data_5G04
# 
_entry.id   5G04 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5G04         
PDBE  EBI-66501    
WWPDB D_1290066501 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB  5G05     unspecified            'CRYO-EM STRUCTURE OF COMBINED APO PHOSPHORYLATED APC' 
EMDB EMD-3385 'associated EM volume' .                                                      
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        5G04 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2016-03-16 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhang, S.'   1 
'Chang, L.'   2 
'Alfieri, C.' 3 
'Zhang, Z.'   4 
'Yang, J.'    5 
'Maslen, S.'  6 
'Skehel, M.'  7 
'Barford, D.' 8 
# 
_citation.id                        primary 
_citation.title                     'Molecular Mechanism of Apc/C Activation by Mitotic Phosphorylation.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            533 
_citation.page_first                260 
_citation.page_last                 ? 
_citation.year                      2016 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   27120157 
_citation.pdbx_database_id_DOI      10.1038/NATURE17973 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Zhang, S.'   1 
primary 'Chang, L.'   2 
primary 'Alfieri, C.' 3 
primary 'Zhang, Z.'   4 
primary 'Yang, J.'    5 
primary 'Maslen, S.'  6 
primary 'Skehel, M.'  7 
primary 'Barford, D.' 8 
# 
_cell.entry_id           5G04 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5G04 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'ANAPHASE-PROMOTING COMPLEX SUBUNIT 1'          216725.469 1 ?        ? ?                  ? 
2  polymer     man 'ANAPHASE-PROMOTING COMPLEX SUBUNIT 11'         9854.647   1 ?        ? ?                  ? 
3  polymer     man 'CELL DIVISION CYCLE PROTEIN 23 HOMOLOG'        68921.031  2 ?        ? ?                  ? 
4  polymer     man 'ANAPHASE-PROMOTING COMPLEX SUBUNIT 15'         14286.727  1 ?        ? ?                  ? 
5  polymer     man 'ANAPHASE-PROMOTING COMPLEX SUBUNIT 16'         11677.995  1 ?        ? ?                  ? 
6  polymer     man 'CELL DIVISION CYCLE PROTEIN 27 HOMOLOG'        91973.125  2 ?        ? ?                  ? 
7  polymer     man 'ANAPHASE-PROMOTING COMPLEX SUBUNIT CDC26'      9793.999   2 ?        ? ?                  ? 
8  polymer     man 'ANAPHASE-PROMOTING COMPLEX SUBUNIT 4'          92219.227  1 ?        ? ?                  ? 
9  polymer     man 'CELL DIVISION CYCLE PROTEIN 16 HOMOLOG'        71747.516  2 ?        ? ?                  ? 
10 polymer     man 'ANAPHASE-PROMOTING COMPLEX SUBUNIT 10'         21124.949  1 ?        ? ?                  ? 
11 polymer     man 'ANAPHASE-PROMOTING COMPLEX SUBUNIT 13'         8528.309   1 ?        ? ?                  ? 
12 polymer     man 'ANAPHASE-PROMOTING COMPLEX SUBUNIT 2'          93938.977  1 ?        ? ?                  ? 
13 polymer     man 'ANAPHASE-PROMOTING COMPLEX SUBUNIT 5'          85179.766  1 ?        ? ?                  ? 
14 polymer     man 'CELL DIVISION CYCLE PROTEIN 20 HOMOLOG'        54796.508  1 ?        ? ?                  ? 
15 polymer     man 'PROBABLE SERINE/THREONINE-PROTEIN KINASE HSL1' 23658.162  1 2.7.11.1 ? 'RESIDUES 667-872' ? 
16 polymer     man 'ANAPHASE-PROMOTING COMPLEX SUBUNIT 7'          66929.367  2 ?        ? ?                  ? 
17 non-polymer syn 'ZINC ION'                                      65.409     3 ?        ? ?                  ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1  'APC1, CYCLOSOME SUBUNIT 1, MITOTIC CHECKPOINT REGULATOR, TESTIS-SPECIFIC GENE 24 PROTEIN, APC1' 
2  'APC11, CYCLOSOME SUBUNIT 11, HEPATOCELLULAR CARCINOMA-ASSOCIATED RING FINGER PROTEIN, APC11'    
3  'ANAPHASE-PROMOTING COMPLEX SUBUNIT 8, APC8, CYCLOSOME SUBUNIT 8, APC8'                          
4  APC15                                                                                            
5  'APC16, CYCLOSOME SUBUNIT 16, APC16'                                                             
6  'ANAPHASE-PROMOTING COMPLEX SUBUNIT 3, APC3, CDC27 HOMOLOG, CDC27HS, H-NUC, APC3'                
7  'ANAPHASE-PROMOTING COMPLEX SUBUNIT 12, APC12, CELL DIVISION CYCLE PROTEIN 26 HOMOLOG, APC12'    
8  'APC4, CYCLOSOME SUBUNIT 4, APC4'                                                                
9  'ANAPHASE-PROMOTING COMPLEX SUBUNIT 6, APC6, CDC16 HOMOLOG, CDC16HS, CYCLOSOME SUBUNIT 6, APC6'  
10 'APC10, CYCLOSOME SUBUNIT 10, APC10'                                                             
11 'APC13, CYCLOSOME SUBUNIT 13, APC13'                                                             
12 'APC2, CYCLOSOME SUBUNIT 2, APC2'                                                                
13 'APC5, CYCLOSOME SUBUNIT 5, APC5'                                                                
14 'P55CDC, CDC20'                                                                                  
15 HSL1                                                                                             
16 'APC7, CYCLOSOME SUBUNIT 7, APC7'                                                                
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)' no no 
;MSNFYEERTTMIAARDLQEFVPFGRDHCKHHPNALNLQLRQLQPASELWSSDGAAGLVGSLQEVTIHEKQKESWQLRKGV
SEIGEDVDYDEELYVAGNMVIWSKGSKSQALAVYKAFTVDSPVQQALWCDFIISQDKSEKAYSSNEVEKCICILQSSCIN
MHSIEGKDYIASLPFQVANVWPTKYGLLFERSASSHEVPPGSPREPLPTMFSMLHPLDEITPLVCKSGSLFGSSRVQYVV
DHAMKIVFLNTDPSIVMTYDAVQNVHSVWTLRRVKSEEENVVLKFSEQGGTPQNVATSSSLTAHLRSLSKGDSPVTSPFQ
NYSSIHSQSRSTSSPSLHSRSPSISNMAALSRAHSPALGVHSFSGVQRFNISSHNQSPKRHSISHSPNSNSNGSFLAPET
EPIVPELCIDHLWTETITNIREKNSQASKVFITSDLCGQKFLCFLVESQLQLRCVKFQESNDKTQLIFGSVTNIPAKDAA
PVEKIDTMLVLEGSGNLVLYTGVVRVGKVFIPGLPAPSLTMSNTMPRPSTPLDGVSTPKPLSKLLGSLDEVVLLSPVPEL
RDSSKLHDSLYNEDCTFQQLGTYIHSIRDPVHNRVTLELSNGSMVRITIPEIATSELVQTCLQAIKFILPKEIAVQMLVK
WYNVHSAPGGPSYHSEWNLFVTCLMNMMGYNTDRLAWTRNFDFEGSLSPVIAPKKARPSETGSDDDWEYLLNSDYHQNVE
SHLLNRSLCLSPSEASQMKDEDFSQNLSLDSSTLLFTHIPAIFFVLHLVYEELKLNTLMGEGICSLVELLVQLARDLKLG
PYVDHYYRDYPTLVRTTGQVCTIDPGQTGFMHHPSFFTSEPPSIYQWVSSCLKGEGMPPYPYLPGICERSRLVVLSIALY
ILGDESLVSDESSQYLTRITIAPQKLQVEQEENRFSFRHSTSVSSLAERLVVWMTNVGFTLRDLETLPFGIALPIRDAIY
HCREQPASDWPEAVCLLIGRQDLSKQACEGNLPKGKSVLSSDVPSGTETEEEDDGMNDMNHEVMSLIWSEDLRVQDVRRL
LQSAHPVRVNVVQYPELSDHEFIEEKENRLLQLCQRTMALPVGRGMFTLFSYHPVPTEPLPIPKLNLTGRAPPRNTTVDL
NSGNIDVPPNMTSWASFHNGVAAGLKIAPASQIDSAWIVYNKPKHAELANEYAGFLMALGLNGHLTKLATLNIHDYLTKG
HEMTSIGLLLGVSAAKLGTMDMSITRLLSIHIPALLPPTSTELDVPHNVQVAAVVGIGLVYQGTAHRHTAEVLLAEIGRP
PGPEMEYCTDRESYSLAAGLALGMVCLGHGSNLIGMSDLNVPEQLYQYMVGGHRRFQTGMHREKHKSPSYQIKEGDTINV
DVTCPGATLALAMIYLKTNNRSIADWLRAPDTMYLLDFVKPEFLLLRTLARCLILWDDILPNSKWVDSNVPQIIRENSIS
LSEIELPCSEDLNLETLSQAHVYIIAGACLSLGFRFAGSENLSAFNCLHKFAKDFMTYLSAPNASVTGPHNLETCLSVVL
LSLAMVMAGSGNLKVLQLCRFLHMKTGGEMNYGFHLAHHMALGLLFLGGGRYSLSTSNSSIAALLCALYPHFPAHSTDNR
YHLQALRHLYVLAAEPRLLVPVDVDTNTPCYALLEVTYKGTQWYEQTKEELMAPTLLPELHLLKQIKVKGPRYWELLIDL
SKGTQHLKSILSKDGVLYVKLRAGQLSYKEDPMGWQSLLAQTVANRNSEARAFKPETISAFTSDPALLSFAEYFCKPTVN
MGQKQEILDLFSSVLYECVTQETPEMLPAYIAMDQAIRRLGRREMSETSELWQIKLVLEFFSSRSHQERLQNHPKRGLFM
NSEFLPVVKCTIDNTLDQWLQVGGDMCVHAYLSGQPLEESQLSMLACFLVYHSVPAPQHLPPIGLEGSTSFAELLFKFKQ
LKMPVRALLRLAPLLLGNPQPMVM
;
;MSNFYEERTTMIAARDLQEFVPFGRDHCKHHPNALNLQLRQLQPASELWSSDGAAGLVGSLQEVTIHEKQKESWQLRKGV
SEIGEDVDYDEELYVAGNMVIWSKGSKSQALAVYKAFTVDSPVQQALWCDFIISQDKSEKAYSSNEVEKCICILQSSCIN
MHSIEGKDYIASLPFQVANVWPTKYGLLFERSASSHEVPPGSPREPLPTMFSMLHPLDEITPLVCKSGSLFGSSRVQYVV
DHAMKIVFLNTDPSIVMTYDAVQNVHSVWTLRRVKSEEENVVLKFSEQGGTPQNVATSSSLTAHLRSLSKGDSPVTSPFQ
NYSSIHSQSRSTSSPSLHSRSPSISNMAALSRAHSPALGVHSFSGVQRFNISSHNQSPKRHSISHSPNSNSNGSFLAPET
EPIVPELCIDHLWTETITNIREKNSQASKVFITSDLCGQKFLCFLVESQLQLRCVKFQESNDKTQLIFGSVTNIPAKDAA
PVEKIDTMLVLEGSGNLVLYTGVVRVGKVFIPGLPAPSLTMSNTMPRPSTPLDGVSTPKPLSKLLGSLDEVVLLSPVPEL
RDSSKLHDSLYNEDCTFQQLGTYIHSIRDPVHNRVTLELSNGSMVRITIPEIATSELVQTCLQAIKFILPKEIAVQMLVK
WYNVHSAPGGPSYHSEWNLFVTCLMNMMGYNTDRLAWTRNFDFEGSLSPVIAPKKARPSETGSDDDWEYLLNSDYHQNVE
SHLLNRSLCLSPSEASQMKDEDFSQNLSLDSSTLLFTHIPAIFFVLHLVYEELKLNTLMGEGICSLVELLVQLARDLKLG
PYVDHYYRDYPTLVRTTGQVCTIDPGQTGFMHHPSFFTSEPPSIYQWVSSCLKGEGMPPYPYLPGICERSRLVVLSIALY
ILGDESLVSDESSQYLTRITIAPQKLQVEQEENRFSFRHSTSVSSLAERLVVWMTNVGFTLRDLETLPFGIALPIRDAIY
HCREQPASDWPEAVCLLIGRQDLSKQACEGNLPKGKSVLSSDVPSGTETEEEDDGMNDMNHEVMSLIWSEDLRVQDVRRL
LQSAHPVRVNVVQYPELSDHEFIEEKENRLLQLCQRTMALPVGRGMFTLFSYHPVPTEPLPIPKLNLTGRAPPRNTTVDL
NSGNIDVPPNMTSWASFHNGVAAGLKIAPASQIDSAWIVYNKPKHAELANEYAGFLMALGLNGHLTKLATLNIHDYLTKG
HEMTSIGLLLGVSAAKLGTMDMSITRLLSIHIPALLPPTSTELDVPHNVQVAAVVGIGLVYQGTAHRHTAEVLLAEIGRP
PGPEMEYCTDRESYSLAAGLALGMVCLGHGSNLIGMSDLNVPEQLYQYMVGGHRRFQTGMHREKHKSPSYQIKEGDTINV
DVTCPGATLALAMIYLKTNNRSIADWLRAPDTMYLLDFVKPEFLLLRTLARCLILWDDILPNSKWVDSNVPQIIRENSIS
LSEIELPCSEDLNLETLSQAHVYIIAGACLSLGFRFAGSENLSAFNCLHKFAKDFMTYLSAPNASVTGPHNLETCLSVVL
LSLAMVMAGSGNLKVLQLCRFLHMKTGGEMNYGFHLAHHMALGLLFLGGGRYSLSTSNSSIAALLCALYPHFPAHSTDNR
YHLQALRHLYVLAAEPRLLVPVDVDTNTPCYALLEVTYKGTQWYEQTKEELMAPTLLPELHLLKQIKVKGPRYWELLIDL
SKGTQHLKSILSKDGVLYVKLRAGQLSYKEDPMGWQSLLAQTVANRNSEARAFKPETISAFTSDPALLSFAEYFCKPTVN
MGQKQEILDLFSSVLYECVTQETPEMLPAYIAMDQAIRRLGRREMSETSELWQIKLVLEFFSSRSHQERLQNHPKRGLFM
NSEFLPVVKCTIDNTLDQWLQVGGDMCVHAYLSGQPLEESQLSMLACFLVYHSVPAPQHLPPIGLEGSTSFAELLFKFKQ
LKMPVRALLRLAPLLLGNPQPMVM
;
A   ? 
2  'polypeptide(L)' no no 
;MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEW
KFKE
;
;MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEW
KFKE
;
B   ? 
3  'polypeptide(L)' no no 
;MAASTSMVPVAVTAAVAPVLSINSDFSDLREIKKQLLLIAGLTRERGLLHSSKWSAELAFSLPALPLAELQPPPPITEED
AQDMDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMYSRYLSGEKKKDDETVDSLGPLEKGQVKNEALRELRVELSK
KHQARELDGFGLYLYGVVLRKLDLVKEAIDVFVEATHVLPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTE
LQLIEEALQKYQNLIDVGFSKSSYIVSQIAVAYHNIRDIDKALSIFNELRKQDPYRIENMDTFSNLLYVRSMKSELSYLA
HNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKLNPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYR
AWYGLGQTYEILKMPFYCLYYYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQL
TESEQAAQCYIKYIQDIYSCGEIVEHLEESTAFRYLAQYYFKCKLWDEASTCAQKCCAFNDTREEGKALLRQILQLRNQG
ETPTTEVPAPFFLPASLSANNTPTRRVSPLNLSSVTP
;
;MAASTSMVPVAVTAAVAPVLSINSDFSDLREIKKQLLLIAGLTRERGLLHSSKWSAELAFSLPALPLAELQPPPPITEED
AQDMDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMYSRYLSGEKKKDDETVDSLGPLEKGQVKNEALRELRVELSK
KHQARELDGFGLYLYGVVLRKLDLVKEAIDVFVEATHVLPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTE
LQLIEEALQKYQNLIDVGFSKSSYIVSQIAVAYHNIRDIDKALSIFNELRKQDPYRIENMDTFSNLLYVRSMKSELSYLA
HNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKLNPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYR
AWYGLGQTYEILKMPFYCLYYYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQL
TESEQAAQCYIKYIQDIYSCGEIVEHLEESTAFRYLAQYYFKCKLWDEASTCAQKCCAFNDTREEGKALLRQILQLRNQG
ETPTTEVPAPFFLPASLSANNTPTRRVSPLNLSSVTP
;
C,P ? 
4  'polypeptide(L)' no no 
;MSTLFPSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEEDDEDDEDSEEDS
EDDEDMQDMDEMNDYNESPDDGEVNEVDMEGNEQDQDQWMI
;
;MSTLFPSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEEDDEDDEDSEEDS
EDDEDMQDMDEMNDYNESPDDGEVNEVDMEGNEQDQDQWMI
;
D   ? 
5  'polypeptide(L)' no no 
;MAASSSSSSAGGVSGSSVTGSGFSVSDLAPPRKALFTYPKGAGEMLEDGSERFLCESVFSYQVASTLKQVKHDQQVARME
KLAGLVEELEADEWRFKPIEQLLGFTPSSG
;
;MAASSSSSSAGGVSGSSVTGSGFSVSDLAPPRKALFTYPKGAGEMLEDGSERFLCESVFSYQVASTLKQVKHDQQVARME
KLAGLVEELEADEWRFKPIEQLLGFTPSSG
;
E   ? 
6  'polypeptide(L)' no no 
;MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKCCV
DLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSLLGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGE
KPDPDQTFKFTSLQNFSNCLPNSCTTQVPNHSLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSAVI
SPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQNYTNTPPVIDVPSTGAPSKKS
VARIGQTGTKSVFSQSGNSREVTPILAQTQSSGPQTSTTPQVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKF
PPKIPNRKTKSKTNKGGITQPNINDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAAEGLMSLLREMGKGYLALCSYN
CKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLT
DMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYG
LGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYK
SALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMGT
DESQESSMTDADDTQLHAAESDEF
;
;MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKCCV
DLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSLLGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGE
KPDPDQTFKFTSLQNFSNCLPNSCTTQVPNHSLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSAVI
SPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQNYTNTPPVIDVPSTGAPSKKS
VARIGQTGTKSVFSQSGNSREVTPILAQTQSSGPQTSTTPQVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKF
PPKIPNRKTKSKTNKGGITQPNINDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAAEGLMSLLREMGKGYLALCSYN
CKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLT
DMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYG
LGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYK
SALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMGT
DESQESSMTDADDTQLHAAESDEF
;
F,H ? 
7  'polypeptide(L)' no no 
;MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQF
GSLEF
;
;MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQF
GSLEF
;
G,W ? 
8  'polypeptide(L)' no no 
;MLRFPTCFPSFRVVGEKQLPQEIIFLVWSPKRDLIALANTAGEVLLHRLASFHRVWSFPPNENTGKEVTCLAWRPDGKLL
AFALADTKKIVLCDVEKPESLHSFSVEAPVSCMHWMEVTVESSVLTSFYNAEDESNLLLPKLPTLPKNYSNTSKIFSEEN
SDEIIKLLGDVRLNILVLGGSSGFIELYAYGMFKIARVTGIAGTCLALCLSSDLKSLSVVTEVSTNGASEVSYFQLETNL
LYSFLPEVTRMARKFTHISALLQYINLSLTCMCEAWEEILMQMDSRLTKFVQEKNTTTSVQDEFMHLLLWGKASAELQTL
LMNQLTVKGLKKLGQSIESSYSSIQKLVISHLQSGSESLLYHLSELKGMASWKQKYEPLGLDAAGIEEAITAVGSFILKA
NELLQVIDSSMKNFKAFFRWLYVAMLRMTEDHVLPELNKMTQKDITFVAEFLTEHFNEAPDLYNRKGKYFNVERVGQYLK
DEDDDLVSPPNTEGNQWYDFLQNSSHLKESPLLFPYYPRKSLHFVKRRMENIIDQCLQKPADVIGKSMNQAICIPLYRDT
RSEDSTRRLFKFPFLWNNKTSNLHYLLFTILEDSLYKMCILRRHTDISQSVSNGLIAIKFGSFTYATTEKVRRSIYSCLD
AQFYDDETVTVVLKDTVGREGRDRLLVQLPLSLVYNSEDSAEYQFTGTYSTRLDEQCSAIPTRTMHFEKHWRLLESMKAQ
YVAGNGFRKVSCVLSSNLRHVRVFEMDIDDEWELDESSDEEEEASNKPVKIKEEVLSESEAENQQAGAAALAPEIVIKVE
KLDPELDS
;
;MLRFPTCFPSFRVVGEKQLPQEIIFLVWSPKRDLIALANTAGEVLLHRLASFHRVWSFPPNENTGKEVTCLAWRPDGKLL
AFALADTKKIVLCDVEKPESLHSFSVEAPVSCMHWMEVTVESSVLTSFYNAEDESNLLLPKLPTLPKNYSNTSKIFSEEN
SDEIIKLLGDVRLNILVLGGSSGFIELYAYGMFKIARVTGIAGTCLALCLSSDLKSLSVVTEVSTNGASEVSYFQLETNL
LYSFLPEVTRMARKFTHISALLQYINLSLTCMCEAWEEILMQMDSRLTKFVQEKNTTTSVQDEFMHLLLWGKASAELQTL
LMNQLTVKGLKKLGQSIESSYSSIQKLVISHLQSGSESLLYHLSELKGMASWKQKYEPLGLDAAGIEEAITAVGSFILKA
NELLQVIDSSMKNFKAFFRWLYVAMLRMTEDHVLPELNKMTQKDITFVAEFLTEHFNEAPDLYNRKGKYFNVERVGQYLK
DEDDDLVSPPNTEGNQWYDFLQNSSHLKESPLLFPYYPRKSLHFVKRRMENIIDQCLQKPADVIGKSMNQAICIPLYRDT
RSEDSTRRLFKFPFLWNNKTSNLHYLLFTILEDSLYKMCILRRHTDISQSVSNGLIAIKFGSFTYATTEKVRRSIYSCLD
AQFYDDETVTVVLKDTVGREGRDRLLVQLPLSLVYNSEDSAEYQFTGTYSTRLDEQCSAIPTRTMHFEKHWRLLESMKAQ
YVAGNGFRKVSCVLSSNLRHVRVFEMDIDDEWELDESSDEEEEASNKPVKIKEEVLSESEAENQQAGAAALAPEIVIKVE
KLDPELDS
;
I   ? 
9  'polypeptide(L)' no no 
;MNLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCH
YAAKEHQQALDVLDMEEPINKRLFEKYLKDESGFKDPSSDWEMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLD
VYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAER
HYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHAR
RYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPE
DPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNAS
TYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKDKLKCYDFDVHTMKTLKNIIS
PPWDFREFEVEKQTAEETGLTPLETSRKTPDSRPSLEETFEIEMNESDMMLETSMSDHST
;
;MNLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCH
YAAKEHQQALDVLDMEEPINKRLFEKYLKDESGFKDPSSDWEMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLD
VYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAER
HYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHAR
RYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPE
DPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNAS
TYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKDKLKCYDFDVHTMKTLKNIIS
PPWDFREFEVEKQTAEETGLTPLETSRKTPDSRPSLEETFEIEMNESDMMLETSMSDHST
;
J,K ? 
10 'polypeptide(L)' no no 
;MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIY
ADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYT
PVEESSIGKFPCTTIDFMMYRSIR
;
;MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIY
ADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYT
PVEESSIGKFPCTTIDFMMYRSIR
;
L   ? 
11 'polypeptide(L)' no no MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDLALQYLHENVPPIGN 
MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDLALQYLHENVPPIGN M   ? 
12 'polypeptide(L)' no no 
;MAAAVVVAEGDSDSRPGQELLVAWNTVSTGLVPPAALGLVSSRTSGAVPPKEEELRAAVEVLRGHGLHSVLEEWFVEVLQ
NDLQANISPEFWNAISQCENSADEPQCLLLLLDAFGLLESRLDPYLRSLELLEKWTRLGLLMGTGAQGLREEVHTMLRGV
LFFSTPRTFQEMIQRLYGCFLRVYMQSKRKGEGGTDPELEGELDSRYARRRYYRLLQSPLCAGCSSDKQQCWCRQALEQF
HQLSQVLHRLSLLERVSAEAVTTTLHQVTRERMEDRCRGEYERSFLREFHKWIERVVGWLGKVFLQDGPARPASPEAGNT
LRRWRCHVQRFFYRIYASLRIEELFSIVRDFPDSRPAIEDLKYCLERTDQRQQLLVSLKAALETRLLHPGVNTCDIITLY
ISAIKALRVLDPSMVILEVACEPIRRYLRTREDTVRQIVAGLTGDSDGTGDLAVELSKTDPASLETGQDSEDDSGEPEDW
VPDPVDADPGKSSSKRRSSDIISLLVSIYGSKDLFINEYRSLLADRLLHQFSFSPEREIRNVELLKLRFGEAPMHFCEVM
LKDMADSRRINANIREEDEKRPAEEQPPFGVYAVILSSEFWPPFKDEKLEVPEDIRAALEAYCKKYEQLKAMRTLSWKHT
LGLVTMDVELADRTLSVAVTPVQAVILLYFQDQASWTLEELSKAVKMPVALLRRRMSVWLQQGVLREEPPGTFSVIEEER
PQDRDNMVLIDSDDESDSGMASQADQKEEELLLFWTYIQAMLTNLESLSLDRIYNMLRMFVVTGPALAEIDLQELQGYLQ
KKVRDQQLVYSAGVYRLPKNCS
;
;MAAAVVVAEGDSDSRPGQELLVAWNTVSTGLVPPAALGLVSSRTSGAVPPKEEELRAAVEVLRGHGLHSVLEEWFVEVLQ
NDLQANISPEFWNAISQCENSADEPQCLLLLLDAFGLLESRLDPYLRSLELLEKWTRLGLLMGTGAQGLREEVHTMLRGV
LFFSTPRTFQEMIQRLYGCFLRVYMQSKRKGEGGTDPELEGELDSRYARRRYYRLLQSPLCAGCSSDKQQCWCRQALEQF
HQLSQVLHRLSLLERVSAEAVTTTLHQVTRERMEDRCRGEYERSFLREFHKWIERVVGWLGKVFLQDGPARPASPEAGNT
LRRWRCHVQRFFYRIYASLRIEELFSIVRDFPDSRPAIEDLKYCLERTDQRQQLLVSLKAALETRLLHPGVNTCDIITLY
ISAIKALRVLDPSMVILEVACEPIRRYLRTREDTVRQIVAGLTGDSDGTGDLAVELSKTDPASLETGQDSEDDSGEPEDW
VPDPVDADPGKSSSKRRSSDIISLLVSIYGSKDLFINEYRSLLADRLLHQFSFSPEREIRNVELLKLRFGEAPMHFCEVM
LKDMADSRRINANIREEDEKRPAEEQPPFGVYAVILSSEFWPPFKDEKLEVPEDIRAALEAYCKKYEQLKAMRTLSWKHT
LGLVTMDVELADRTLSVAVTPVQAVILLYFQDQASWTLEELSKAVKMPVALLRRRMSVWLQQGVLREEPPGTFSVIEEER
PQDRDNMVLIDSDDESDSGMASQADQKEEELLLFWTYIQAMLTNLESLSLDRIYNMLRMFVVTGPALAEIDLQELQGYLQ
KKVRDQQLVYSAGVYRLPKNCS
;
N   ? 
13 'polypeptide(L)' no no 
;MASVHESLYFNPMMTNGVVHANVFGIKDWVTPYKIAVLVLLNEMSRTGEGAVSLMERRRLNQLLLPLLQGPDITLSKLYK
LIEESCPQLANSVQIRIKLMAEGELKDMEQFFDDLSDSFSGTEPEVHKTSVVGLFLRHMILAYSKLSFSQVFKLYTALQQ
YFQNGEKKTVEDADMELTSRDEGERKMEKEELDVSVREEEVSCSGPLSQKQAEFFLSQQASLLKNDETKALTPASLQKEL
NNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFDRLILTGAESKSNGEEGYGRSLRYAALNLAALHCRFGHYQQA
ELALQEAIRIAQESNDHVCLQHCLSWLYVLGQKRSDSYVLLEHSVKKAVHFGLPYLASLGIQSLVQQRAFAGKTANKLMD
ALKDSDLLHWKHSLSELIDISIAQKTAIWRLYGRSTMALQQAQMLLSMNSLEAVNAGVQQNNTESFAVALCHLAELHAEQ
GCFAAASEVLKHLKERFPPNSQHAQLWMLCDQKIQFDRAMNDGKYHLADSLVTGITALNSIEGVYRKAVVLQAQNQMSEA
HKLLQKLLVHCQKLKNTEMVISVLLSVAELYWRSSSPTIALPMLLQALALSKEYRLQYLASETVLNLAFAQLILGIPEQA
LSLLHMAIEPILADGAILDKGRAMFLVAKCQVASAASYDQPKKAEALEAAIENLNEAKNYFAKVDCKERIRDVVYFQARL
YHTLGKTQERNRCAMLFRQLHQELPSHGVPLINHL
;
;MASVHESLYFNPMMTNGVVHANVFGIKDWVTPYKIAVLVLLNEMSRTGEGAVSLMERRRLNQLLLPLLQGPDITLSKLYK
LIEESCPQLANSVQIRIKLMAEGELKDMEQFFDDLSDSFSGTEPEVHKTSVVGLFLRHMILAYSKLSFSQVFKLYTALQQ
YFQNGEKKTVEDADMELTSRDEGERKMEKEELDVSVREEEVSCSGPLSQKQAEFFLSQQASLLKNDETKALTPASLQKEL
NNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFDRLILTGAESKSNGEEGYGRSLRYAALNLAALHCRFGHYQQA
ELALQEAIRIAQESNDHVCLQHCLSWLYVLGQKRSDSYVLLEHSVKKAVHFGLPYLASLGIQSLVQQRAFAGKTANKLMD
ALKDSDLLHWKHSLSELIDISIAQKTAIWRLYGRSTMALQQAQMLLSMNSLEAVNAGVQQNNTESFAVALCHLAELHAEQ
GCFAAASEVLKHLKERFPPNSQHAQLWMLCDQKIQFDRAMNDGKYHLADSLVTGITALNSIEGVYRKAVVLQAQNQMSEA
HKLLQKLLVHCQKLKNTEMVISVLLSVAELYWRSSSPTIALPMLLQALALSKEYRLQYLASETVLNLAFAQLILGIPEQA
LSLLHMAIEPILADGAILDKGRAMFLVAKCQVASAASYDQPKKAEALEAAIENLNEAKNYFAKVDCKERIRDVVYFQARL
YHTLGKTQERNRCAMLFRQLHQELPSHGVPLINHL
;
O   ? 
14 'polypeptide(L)' no no 
;MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYI
PHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGS
SRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNY
LAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPD
GRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHS
QVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARR
REREKASAAKSSLIHQGIR
;
;MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYI
PHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGS
SRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNY
LAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPD
GRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHS
QVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARR
REREKASAAKSSLIHQGIR
;
R   ? 
15 'polypeptide(L)' no no 
;QNSASKRSLYSLQSISKRSLNLNDLLVFDDPLPSKKPASENVNKSEPHSLESDSDFEILCDQILFGNALDRILEEEEDNE
KERDTQRQRQNDTKSSADTFTISGVSTNKENEGPEYPTKIEKNQFNMSYKPSENMSGLSSFPIFEKENTLSSSYLEEQKP
KRAALSDITNSFNKMNKQEGMRIEKKIQREQLQKKNDRPSPLKPIQ
;
;QNSASKRSLYSLQSISKRSLNLNDLLVFDDPLPSKKPASENVNKSEPHSLESDSDFEILCDQILFGNALDRILEEEEDNE
KERDTQRQRQNDTKSSADTFTISGVSTNKENEGPEYPTKIEKNQFNMSYKPSENMSGLSSFPIFEKENTLSSSYLEEQKP
KRAALSDITNSFNKMNKQEGMRIEKKIQREQLQKKNDRPSPLKPIQ
;
S   ? 
16 'polypeptide(L)' no no 
;MDPGDAAILESSLRILYRLFESVLPPLPAALQSRMNVIDHVRDMAAAGLHSNVRLLSSLLLTMSNNNPELFSPPQKYQLL
VYHADSLFHDKEYRNAVSKYTMALQQKKALSKTSKVRPSTGNSASTPQSQCLPSEIEVKYKMAECYTMLKQDKDAIAILD
GIPSRQRTPKINMMLANLYKKAGQERPSVTSYKEVLRQCPLALDAILGLLSLSVKGAEVASMTMNVIQTVPNLDWLSVWI
KAYAFVHTGDNSRAISTICSLEKKSLLRDNVDLLGSLADLYFRAGDNKNSVLKFEQAQMLDPYLIKGMDVYGYLLAREGR
LEDVENLGCRLFNISDQHAEPWVVSGCHSFYSKRYSRALYLGAKAIQLNSNSVQALLLKGAALRNMGRVQEAIIHFREAI
RLAPCRLDCYEGLIECYLASNSIREAMVMANNVYKTLGANAQTLTLLATVCLEDPVTQEKAKTLLDKALTQRPDYIKAVV
KKAELLSREQKYEDGIALLRNALANQSDCVLHRILGDFLVAVNEYQEAMDQYSIALSLDPNDQKSLEGMQKMEKEESPTD
ATQEEDVDDMEGSGEEGDLEGSDSEAAQWADQEQWFGMQ
;
;MDPGDAAILESSLRILYRLFESVLPPLPAALQSRMNVIDHVRDMAAAGLHSNVRLLSSLLLTMSNNNPELFSPPQKYQLL
VYHADSLFHDKEYRNAVSKYTMALQQKKALSKTSKVRPSTGNSASTPQSQCLPSEIEVKYKMAECYTMLKQDKDAIAILD
GIPSRQRTPKINMMLANLYKKAGQERPSVTSYKEVLRQCPLALDAILGLLSLSVKGAEVASMTMNVIQTVPNLDWLSVWI
KAYAFVHTGDNSRAISTICSLEKKSLLRDNVDLLGSLADLYFRAGDNKNSVLKFEQAQMLDPYLIKGMDVYGYLLAREGR
LEDVENLGCRLFNISDQHAEPWVVSGCHSFYSKRYSRALYLGAKAIQLNSNSVQALLLKGAALRNMGRVQEAIIHFREAI
RLAPCRLDCYEGLIECYLASNSIREAMVMANNVYKTLGANAQTLTLLATVCLEDPVTQEKAKTLLDKALTQRPDYIKAVV
KKAELLSREQKYEDGIALLRNALANQSDCVLHRILGDFLVAVNEYQEAMDQYSIALSLDPNDQKSLEGMQKMEKEESPTD
ATQEEDVDDMEGSGEEGDLEGSDSEAAQWADQEQWFGMQ
;
X,Y ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1    MET n 
1  2    SER n 
1  3    ASN n 
1  4    PHE n 
1  5    TYR n 
1  6    GLU n 
1  7    GLU n 
1  8    ARG n 
1  9    THR n 
1  10   THR n 
1  11   MET n 
1  12   ILE n 
1  13   ALA n 
1  14   ALA n 
1  15   ARG n 
1  16   ASP n 
1  17   LEU n 
1  18   GLN n 
1  19   GLU n 
1  20   PHE n 
1  21   VAL n 
1  22   PRO n 
1  23   PHE n 
1  24   GLY n 
1  25   ARG n 
1  26   ASP n 
1  27   HIS n 
1  28   CYS n 
1  29   LYS n 
1  30   HIS n 
1  31   HIS n 
1  32   PRO n 
1  33   ASN n 
1  34   ALA n 
1  35   LEU n 
1  36   ASN n 
1  37   LEU n 
1  38   GLN n 
1  39   LEU n 
1  40   ARG n 
1  41   GLN n 
1  42   LEU n 
1  43   GLN n 
1  44   PRO n 
1  45   ALA n 
1  46   SER n 
1  47   GLU n 
1  48   LEU n 
1  49   TRP n 
1  50   SER n 
1  51   SER n 
1  52   ASP n 
1  53   GLY n 
1  54   ALA n 
1  55   ALA n 
1  56   GLY n 
1  57   LEU n 
1  58   VAL n 
1  59   GLY n 
1  60   SER n 
1  61   LEU n 
1  62   GLN n 
1  63   GLU n 
1  64   VAL n 
1  65   THR n 
1  66   ILE n 
1  67   HIS n 
1  68   GLU n 
1  69   LYS n 
1  70   GLN n 
1  71   LYS n 
1  72   GLU n 
1  73   SER n 
1  74   TRP n 
1  75   GLN n 
1  76   LEU n 
1  77   ARG n 
1  78   LYS n 
1  79   GLY n 
1  80   VAL n 
1  81   SER n 
1  82   GLU n 
1  83   ILE n 
1  84   GLY n 
1  85   GLU n 
1  86   ASP n 
1  87   VAL n 
1  88   ASP n 
1  89   TYR n 
1  90   ASP n 
1  91   GLU n 
1  92   GLU n 
1  93   LEU n 
1  94   TYR n 
1  95   VAL n 
1  96   ALA n 
1  97   GLY n 
1  98   ASN n 
1  99   MET n 
1  100  VAL n 
1  101  ILE n 
1  102  TRP n 
1  103  SER n 
1  104  LYS n 
1  105  GLY n 
1  106  SER n 
1  107  LYS n 
1  108  SER n 
1  109  GLN n 
1  110  ALA n 
1  111  LEU n 
1  112  ALA n 
1  113  VAL n 
1  114  TYR n 
1  115  LYS n 
1  116  ALA n 
1  117  PHE n 
1  118  THR n 
1  119  VAL n 
1  120  ASP n 
1  121  SER n 
1  122  PRO n 
1  123  VAL n 
1  124  GLN n 
1  125  GLN n 
1  126  ALA n 
1  127  LEU n 
1  128  TRP n 
1  129  CYS n 
1  130  ASP n 
1  131  PHE n 
1  132  ILE n 
1  133  ILE n 
1  134  SER n 
1  135  GLN n 
1  136  ASP n 
1  137  LYS n 
1  138  SER n 
1  139  GLU n 
1  140  LYS n 
1  141  ALA n 
1  142  TYR n 
1  143  SER n 
1  144  SER n 
1  145  ASN n 
1  146  GLU n 
1  147  VAL n 
1  148  GLU n 
1  149  LYS n 
1  150  CYS n 
1  151  ILE n 
1  152  CYS n 
1  153  ILE n 
1  154  LEU n 
1  155  GLN n 
1  156  SER n 
1  157  SER n 
1  158  CYS n 
1  159  ILE n 
1  160  ASN n 
1  161  MET n 
1  162  HIS n 
1  163  SER n 
1  164  ILE n 
1  165  GLU n 
1  166  GLY n 
1  167  LYS n 
1  168  ASP n 
1  169  TYR n 
1  170  ILE n 
1  171  ALA n 
1  172  SER n 
1  173  LEU n 
1  174  PRO n 
1  175  PHE n 
1  176  GLN n 
1  177  VAL n 
1  178  ALA n 
1  179  ASN n 
1  180  VAL n 
1  181  TRP n 
1  182  PRO n 
1  183  THR n 
1  184  LYS n 
1  185  TYR n 
1  186  GLY n 
1  187  LEU n 
1  188  LEU n 
1  189  PHE n 
1  190  GLU n 
1  191  ARG n 
1  192  SER n 
1  193  ALA n 
1  194  SER n 
1  195  SER n 
1  196  HIS n 
1  197  GLU n 
1  198  VAL n 
1  199  PRO n 
1  200  PRO n 
1  201  GLY n 
1  202  SER n 
1  203  PRO n 
1  204  ARG n 
1  205  GLU n 
1  206  PRO n 
1  207  LEU n 
1  208  PRO n 
1  209  THR n 
1  210  MET n 
1  211  PHE n 
1  212  SER n 
1  213  MET n 
1  214  LEU n 
1  215  HIS n 
1  216  PRO n 
1  217  LEU n 
1  218  ASP n 
1  219  GLU n 
1  220  ILE n 
1  221  THR n 
1  222  PRO n 
1  223  LEU n 
1  224  VAL n 
1  225  CYS n 
1  226  LYS n 
1  227  SER n 
1  228  GLY n 
1  229  SER n 
1  230  LEU n 
1  231  PHE n 
1  232  GLY n 
1  233  SER n 
1  234  SER n 
1  235  ARG n 
1  236  VAL n 
1  237  GLN n 
1  238  TYR n 
1  239  VAL n 
1  240  VAL n 
1  241  ASP n 
1  242  HIS n 
1  243  ALA n 
1  244  MET n 
1  245  LYS n 
1  246  ILE n 
1  247  VAL n 
1  248  PHE n 
1  249  LEU n 
1  250  ASN n 
1  251  THR n 
1  252  ASP n 
1  253  PRO n 
1  254  SER n 
1  255  ILE n 
1  256  VAL n 
1  257  MET n 
1  258  THR n 
1  259  TYR n 
1  260  ASP n 
1  261  ALA n 
1  262  VAL n 
1  263  GLN n 
1  264  ASN n 
1  265  VAL n 
1  266  HIS n 
1  267  SER n 
1  268  VAL n 
1  269  TRP n 
1  270  THR n 
1  271  LEU n 
1  272  ARG n 
1  273  ARG n 
1  274  VAL n 
1  275  LYS n 
1  276  SER n 
1  277  GLU n 
1  278  GLU n 
1  279  GLU n 
1  280  ASN n 
1  281  VAL n 
1  282  VAL n 
1  283  LEU n 
1  284  LYS n 
1  285  PHE n 
1  286  SER n 
1  287  GLU n 
1  288  GLN n 
1  289  GLY n 
1  290  GLY n 
1  291  THR n 
1  292  PRO n 
1  293  GLN n 
1  294  ASN n 
1  295  VAL n 
1  296  ALA n 
1  297  THR n 
1  298  SER n 
1  299  SER n 
1  300  SER n 
1  301  LEU n 
1  302  THR n 
1  303  ALA n 
1  304  HIS n 
1  305  LEU n 
1  306  ARG n 
1  307  SER n 
1  308  LEU n 
1  309  SER n 
1  310  LYS n 
1  311  GLY n 
1  312  ASP n 
1  313  SER n 
1  314  PRO n 
1  315  VAL n 
1  316  THR n 
1  317  SER n 
1  318  PRO n 
1  319  PHE n 
1  320  GLN n 
1  321  ASN n 
1  322  TYR n 
1  323  SER n 
1  324  SER n 
1  325  ILE n 
1  326  HIS n 
1  327  SER n 
1  328  GLN n 
1  329  SER n 
1  330  ARG n 
1  331  SER n 
1  332  THR n 
1  333  SER n 
1  334  SER n 
1  335  PRO n 
1  336  SER n 
1  337  LEU n 
1  338  HIS n 
1  339  SER n 
1  340  ARG n 
1  341  SER n 
1  342  PRO n 
1  343  SER n 
1  344  ILE n 
1  345  SER n 
1  346  ASN n 
1  347  MET n 
1  348  ALA n 
1  349  ALA n 
1  350  LEU n 
1  351  SER n 
1  352  ARG n 
1  353  ALA n 
1  354  HIS n 
1  355  SER n 
1  356  PRO n 
1  357  ALA n 
1  358  LEU n 
1  359  GLY n 
1  360  VAL n 
1  361  HIS n 
1  362  SER n 
1  363  PHE n 
1  364  SER n 
1  365  GLY n 
1  366  VAL n 
1  367  GLN n 
1  368  ARG n 
1  369  PHE n 
1  370  ASN n 
1  371  ILE n 
1  372  SER n 
1  373  SER n 
1  374  HIS n 
1  375  ASN n 
1  376  GLN n 
1  377  SER n 
1  378  PRO n 
1  379  LYS n 
1  380  ARG n 
1  381  HIS n 
1  382  SER n 
1  383  ILE n 
1  384  SER n 
1  385  HIS n 
1  386  SER n 
1  387  PRO n 
1  388  ASN n 
1  389  SER n 
1  390  ASN n 
1  391  SER n 
1  392  ASN n 
1  393  GLY n 
1  394  SER n 
1  395  PHE n 
1  396  LEU n 
1  397  ALA n 
1  398  PRO n 
1  399  GLU n 
1  400  THR n 
1  401  GLU n 
1  402  PRO n 
1  403  ILE n 
1  404  VAL n 
1  405  PRO n 
1  406  GLU n 
1  407  LEU n 
1  408  CYS n 
1  409  ILE n 
1  410  ASP n 
1  411  HIS n 
1  412  LEU n 
1  413  TRP n 
1  414  THR n 
1  415  GLU n 
1  416  THR n 
1  417  ILE n 
1  418  THR n 
1  419  ASN n 
1  420  ILE n 
1  421  ARG n 
1  422  GLU n 
1  423  LYS n 
1  424  ASN n 
1  425  SER n 
1  426  GLN n 
1  427  ALA n 
1  428  SER n 
1  429  LYS n 
1  430  VAL n 
1  431  PHE n 
1  432  ILE n 
1  433  THR n 
1  434  SER n 
1  435  ASP n 
1  436  LEU n 
1  437  CYS n 
1  438  GLY n 
1  439  GLN n 
1  440  LYS n 
1  441  PHE n 
1  442  LEU n 
1  443  CYS n 
1  444  PHE n 
1  445  LEU n 
1  446  VAL n 
1  447  GLU n 
1  448  SER n 
1  449  GLN n 
1  450  LEU n 
1  451  GLN n 
1  452  LEU n 
1  453  ARG n 
1  454  CYS n 
1  455  VAL n 
1  456  LYS n 
1  457  PHE n 
1  458  GLN n 
1  459  GLU n 
1  460  SER n 
1  461  ASN n 
1  462  ASP n 
1  463  LYS n 
1  464  THR n 
1  465  GLN n 
1  466  LEU n 
1  467  ILE n 
1  468  PHE n 
1  469  GLY n 
1  470  SER n 
1  471  VAL n 
1  472  THR n 
1  473  ASN n 
1  474  ILE n 
1  475  PRO n 
1  476  ALA n 
1  477  LYS n 
1  478  ASP n 
1  479  ALA n 
1  480  ALA n 
1  481  PRO n 
1  482  VAL n 
1  483  GLU n 
1  484  LYS n 
1  485  ILE n 
1  486  ASP n 
1  487  THR n 
1  488  MET n 
1  489  LEU n 
1  490  VAL n 
1  491  LEU n 
1  492  GLU n 
1  493  GLY n 
1  494  SER n 
1  495  GLY n 
1  496  ASN n 
1  497  LEU n 
1  498  VAL n 
1  499  LEU n 
1  500  TYR n 
1  501  THR n 
1  502  GLY n 
1  503  VAL n 
1  504  VAL n 
1  505  ARG n 
1  506  VAL n 
1  507  GLY n 
1  508  LYS n 
1  509  VAL n 
1  510  PHE n 
1  511  ILE n 
1  512  PRO n 
1  513  GLY n 
1  514  LEU n 
1  515  PRO n 
1  516  ALA n 
1  517  PRO n 
1  518  SER n 
1  519  LEU n 
1  520  THR n 
1  521  MET n 
1  522  SER n 
1  523  ASN n 
1  524  THR n 
1  525  MET n 
1  526  PRO n 
1  527  ARG n 
1  528  PRO n 
1  529  SER n 
1  530  THR n 
1  531  PRO n 
1  532  LEU n 
1  533  ASP n 
1  534  GLY n 
1  535  VAL n 
1  536  SER n 
1  537  THR n 
1  538  PRO n 
1  539  LYS n 
1  540  PRO n 
1  541  LEU n 
1  542  SER n 
1  543  LYS n 
1  544  LEU n 
1  545  LEU n 
1  546  GLY n 
1  547  SER n 
1  548  LEU n 
1  549  ASP n 
1  550  GLU n 
1  551  VAL n 
1  552  VAL n 
1  553  LEU n 
1  554  LEU n 
1  555  SER n 
1  556  PRO n 
1  557  VAL n 
1  558  PRO n 
1  559  GLU n 
1  560  LEU n 
1  561  ARG n 
1  562  ASP n 
1  563  SER n 
1  564  SER n 
1  565  LYS n 
1  566  LEU n 
1  567  HIS n 
1  568  ASP n 
1  569  SER n 
1  570  LEU n 
1  571  TYR n 
1  572  ASN n 
1  573  GLU n 
1  574  ASP n 
1  575  CYS n 
1  576  THR n 
1  577  PHE n 
1  578  GLN n 
1  579  GLN n 
1  580  LEU n 
1  581  GLY n 
1  582  THR n 
1  583  TYR n 
1  584  ILE n 
1  585  HIS n 
1  586  SER n 
1  587  ILE n 
1  588  ARG n 
1  589  ASP n 
1  590  PRO n 
1  591  VAL n 
1  592  HIS n 
1  593  ASN n 
1  594  ARG n 
1  595  VAL n 
1  596  THR n 
1  597  LEU n 
1  598  GLU n 
1  599  LEU n 
1  600  SER n 
1  601  ASN n 
1  602  GLY n 
1  603  SER n 
1  604  MET n 
1  605  VAL n 
1  606  ARG n 
1  607  ILE n 
1  608  THR n 
1  609  ILE n 
1  610  PRO n 
1  611  GLU n 
1  612  ILE n 
1  613  ALA n 
1  614  THR n 
1  615  SER n 
1  616  GLU n 
1  617  LEU n 
1  618  VAL n 
1  619  GLN n 
1  620  THR n 
1  621  CYS n 
1  622  LEU n 
1  623  GLN n 
1  624  ALA n 
1  625  ILE n 
1  626  LYS n 
1  627  PHE n 
1  628  ILE n 
1  629  LEU n 
1  630  PRO n 
1  631  LYS n 
1  632  GLU n 
1  633  ILE n 
1  634  ALA n 
1  635  VAL n 
1  636  GLN n 
1  637  MET n 
1  638  LEU n 
1  639  VAL n 
1  640  LYS n 
1  641  TRP n 
1  642  TYR n 
1  643  ASN n 
1  644  VAL n 
1  645  HIS n 
1  646  SER n 
1  647  ALA n 
1  648  PRO n 
1  649  GLY n 
1  650  GLY n 
1  651  PRO n 
1  652  SER n 
1  653  TYR n 
1  654  HIS n 
1  655  SER n 
1  656  GLU n 
1  657  TRP n 
1  658  ASN n 
1  659  LEU n 
1  660  PHE n 
1  661  VAL n 
1  662  THR n 
1  663  CYS n 
1  664  LEU n 
1  665  MET n 
1  666  ASN n 
1  667  MET n 
1  668  MET n 
1  669  GLY n 
1  670  TYR n 
1  671  ASN n 
1  672  THR n 
1  673  ASP n 
1  674  ARG n 
1  675  LEU n 
1  676  ALA n 
1  677  TRP n 
1  678  THR n 
1  679  ARG n 
1  680  ASN n 
1  681  PHE n 
1  682  ASP n 
1  683  PHE n 
1  684  GLU n 
1  685  GLY n 
1  686  SER n 
1  687  LEU n 
1  688  SER n 
1  689  PRO n 
1  690  VAL n 
1  691  ILE n 
1  692  ALA n 
1  693  PRO n 
1  694  LYS n 
1  695  LYS n 
1  696  ALA n 
1  697  ARG n 
1  698  PRO n 
1  699  SER n 
1  700  GLU n 
1  701  THR n 
1  702  GLY n 
1  703  SER n 
1  704  ASP n 
1  705  ASP n 
1  706  ASP n 
1  707  TRP n 
1  708  GLU n 
1  709  TYR n 
1  710  LEU n 
1  711  LEU n 
1  712  ASN n 
1  713  SER n 
1  714  ASP n 
1  715  TYR n 
1  716  HIS n 
1  717  GLN n 
1  718  ASN n 
1  719  VAL n 
1  720  GLU n 
1  721  SER n 
1  722  HIS n 
1  723  LEU n 
1  724  LEU n 
1  725  ASN n 
1  726  ARG n 
1  727  SER n 
1  728  LEU n 
1  729  CYS n 
1  730  LEU n 
1  731  SER n 
1  732  PRO n 
1  733  SER n 
1  734  GLU n 
1  735  ALA n 
1  736  SER n 
1  737  GLN n 
1  738  MET n 
1  739  LYS n 
1  740  ASP n 
1  741  GLU n 
1  742  ASP n 
1  743  PHE n 
1  744  SER n 
1  745  GLN n 
1  746  ASN n 
1  747  LEU n 
1  748  SER n 
1  749  LEU n 
1  750  ASP n 
1  751  SER n 
1  752  SER n 
1  753  THR n 
1  754  LEU n 
1  755  LEU n 
1  756  PHE n 
1  757  THR n 
1  758  HIS n 
1  759  ILE n 
1  760  PRO n 
1  761  ALA n 
1  762  ILE n 
1  763  PHE n 
1  764  PHE n 
1  765  VAL n 
1  766  LEU n 
1  767  HIS n 
1  768  LEU n 
1  769  VAL n 
1  770  TYR n 
1  771  GLU n 
1  772  GLU n 
1  773  LEU n 
1  774  LYS n 
1  775  LEU n 
1  776  ASN n 
1  777  THR n 
1  778  LEU n 
1  779  MET n 
1  780  GLY n 
1  781  GLU n 
1  782  GLY n 
1  783  ILE n 
1  784  CYS n 
1  785  SER n 
1  786  LEU n 
1  787  VAL n 
1  788  GLU n 
1  789  LEU n 
1  790  LEU n 
1  791  VAL n 
1  792  GLN n 
1  793  LEU n 
1  794  ALA n 
1  795  ARG n 
1  796  ASP n 
1  797  LEU n 
1  798  LYS n 
1  799  LEU n 
1  800  GLY n 
1  801  PRO n 
1  802  TYR n 
1  803  VAL n 
1  804  ASP n 
1  805  HIS n 
1  806  TYR n 
1  807  TYR n 
1  808  ARG n 
1  809  ASP n 
1  810  TYR n 
1  811  PRO n 
1  812  THR n 
1  813  LEU n 
1  814  VAL n 
1  815  ARG n 
1  816  THR n 
1  817  THR n 
1  818  GLY n 
1  819  GLN n 
1  820  VAL n 
1  821  CYS n 
1  822  THR n 
1  823  ILE n 
1  824  ASP n 
1  825  PRO n 
1  826  GLY n 
1  827  GLN n 
1  828  THR n 
1  829  GLY n 
1  830  PHE n 
1  831  MET n 
1  832  HIS n 
1  833  HIS n 
1  834  PRO n 
1  835  SER n 
1  836  PHE n 
1  837  PHE n 
1  838  THR n 
1  839  SER n 
1  840  GLU n 
1  841  PRO n 
1  842  PRO n 
1  843  SER n 
1  844  ILE n 
1  845  TYR n 
1  846  GLN n 
1  847  TRP n 
1  848  VAL n 
1  849  SER n 
1  850  SER n 
1  851  CYS n 
1  852  LEU n 
1  853  LYS n 
1  854  GLY n 
1  855  GLU n 
1  856  GLY n 
1  857  MET n 
1  858  PRO n 
1  859  PRO n 
1  860  TYR n 
1  861  PRO n 
1  862  TYR n 
1  863  LEU n 
1  864  PRO n 
1  865  GLY n 
1  866  ILE n 
1  867  CYS n 
1  868  GLU n 
1  869  ARG n 
1  870  SER n 
1  871  ARG n 
1  872  LEU n 
1  873  VAL n 
1  874  VAL n 
1  875  LEU n 
1  876  SER n 
1  877  ILE n 
1  878  ALA n 
1  879  LEU n 
1  880  TYR n 
1  881  ILE n 
1  882  LEU n 
1  883  GLY n 
1  884  ASP n 
1  885  GLU n 
1  886  SER n 
1  887  LEU n 
1  888  VAL n 
1  889  SER n 
1  890  ASP n 
1  891  GLU n 
1  892  SER n 
1  893  SER n 
1  894  GLN n 
1  895  TYR n 
1  896  LEU n 
1  897  THR n 
1  898  ARG n 
1  899  ILE n 
1  900  THR n 
1  901  ILE n 
1  902  ALA n 
1  903  PRO n 
1  904  GLN n 
1  905  LYS n 
1  906  LEU n 
1  907  GLN n 
1  908  VAL n 
1  909  GLU n 
1  910  GLN n 
1  911  GLU n 
1  912  GLU n 
1  913  ASN n 
1  914  ARG n 
1  915  PHE n 
1  916  SER n 
1  917  PHE n 
1  918  ARG n 
1  919  HIS n 
1  920  SER n 
1  921  THR n 
1  922  SER n 
1  923  VAL n 
1  924  SER n 
1  925  SER n 
1  926  LEU n 
1  927  ALA n 
1  928  GLU n 
1  929  ARG n 
1  930  LEU n 
1  931  VAL n 
1  932  VAL n 
1  933  TRP n 
1  934  MET n 
1  935  THR n 
1  936  ASN n 
1  937  VAL n 
1  938  GLY n 
1  939  PHE n 
1  940  THR n 
1  941  LEU n 
1  942  ARG n 
1  943  ASP n 
1  944  LEU n 
1  945  GLU n 
1  946  THR n 
1  947  LEU n 
1  948  PRO n 
1  949  PHE n 
1  950  GLY n 
1  951  ILE n 
1  952  ALA n 
1  953  LEU n 
1  954  PRO n 
1  955  ILE n 
1  956  ARG n 
1  957  ASP n 
1  958  ALA n 
1  959  ILE n 
1  960  TYR n 
1  961  HIS n 
1  962  CYS n 
1  963  ARG n 
1  964  GLU n 
1  965  GLN n 
1  966  PRO n 
1  967  ALA n 
1  968  SER n 
1  969  ASP n 
1  970  TRP n 
1  971  PRO n 
1  972  GLU n 
1  973  ALA n 
1  974  VAL n 
1  975  CYS n 
1  976  LEU n 
1  977  LEU n 
1  978  ILE n 
1  979  GLY n 
1  980  ARG n 
1  981  GLN n 
1  982  ASP n 
1  983  LEU n 
1  984  SER n 
1  985  LYS n 
1  986  GLN n 
1  987  ALA n 
1  988  CYS n 
1  989  GLU n 
1  990  GLY n 
1  991  ASN n 
1  992  LEU n 
1  993  PRO n 
1  994  LYS n 
1  995  GLY n 
1  996  LYS n 
1  997  SER n 
1  998  VAL n 
1  999  LEU n 
1  1000 SER n 
1  1001 SER n 
1  1002 ASP n 
1  1003 VAL n 
1  1004 PRO n 
1  1005 SER n 
1  1006 GLY n 
1  1007 THR n 
1  1008 GLU n 
1  1009 THR n 
1  1010 GLU n 
1  1011 GLU n 
1  1012 GLU n 
1  1013 ASP n 
1  1014 ASP n 
1  1015 GLY n 
1  1016 MET n 
1  1017 ASN n 
1  1018 ASP n 
1  1019 MET n 
1  1020 ASN n 
1  1021 HIS n 
1  1022 GLU n 
1  1023 VAL n 
1  1024 MET n 
1  1025 SER n 
1  1026 LEU n 
1  1027 ILE n 
1  1028 TRP n 
1  1029 SER n 
1  1030 GLU n 
1  1031 ASP n 
1  1032 LEU n 
1  1033 ARG n 
1  1034 VAL n 
1  1035 GLN n 
1  1036 ASP n 
1  1037 VAL n 
1  1038 ARG n 
1  1039 ARG n 
1  1040 LEU n 
1  1041 LEU n 
1  1042 GLN n 
1  1043 SER n 
1  1044 ALA n 
1  1045 HIS n 
1  1046 PRO n 
1  1047 VAL n 
1  1048 ARG n 
1  1049 VAL n 
1  1050 ASN n 
1  1051 VAL n 
1  1052 VAL n 
1  1053 GLN n 
1  1054 TYR n 
1  1055 PRO n 
1  1056 GLU n 
1  1057 LEU n 
1  1058 SER n 
1  1059 ASP n 
1  1060 HIS n 
1  1061 GLU n 
1  1062 PHE n 
1  1063 ILE n 
1  1064 GLU n 
1  1065 GLU n 
1  1066 LYS n 
1  1067 GLU n 
1  1068 ASN n 
1  1069 ARG n 
1  1070 LEU n 
1  1071 LEU n 
1  1072 GLN n 
1  1073 LEU n 
1  1074 CYS n 
1  1075 GLN n 
1  1076 ARG n 
1  1077 THR n 
1  1078 MET n 
1  1079 ALA n 
1  1080 LEU n 
1  1081 PRO n 
1  1082 VAL n 
1  1083 GLY n 
1  1084 ARG n 
1  1085 GLY n 
1  1086 MET n 
1  1087 PHE n 
1  1088 THR n 
1  1089 LEU n 
1  1090 PHE n 
1  1091 SER n 
1  1092 TYR n 
1  1093 HIS n 
1  1094 PRO n 
1  1095 VAL n 
1  1096 PRO n 
1  1097 THR n 
1  1098 GLU n 
1  1099 PRO n 
1  1100 LEU n 
1  1101 PRO n 
1  1102 ILE n 
1  1103 PRO n 
1  1104 LYS n 
1  1105 LEU n 
1  1106 ASN n 
1  1107 LEU n 
1  1108 THR n 
1  1109 GLY n 
1  1110 ARG n 
1  1111 ALA n 
1  1112 PRO n 
1  1113 PRO n 
1  1114 ARG n 
1  1115 ASN n 
1  1116 THR n 
1  1117 THR n 
1  1118 VAL n 
1  1119 ASP n 
1  1120 LEU n 
1  1121 ASN n 
1  1122 SER n 
1  1123 GLY n 
1  1124 ASN n 
1  1125 ILE n 
1  1126 ASP n 
1  1127 VAL n 
1  1128 PRO n 
1  1129 PRO n 
1  1130 ASN n 
1  1131 MET n 
1  1132 THR n 
1  1133 SER n 
1  1134 TRP n 
1  1135 ALA n 
1  1136 SER n 
1  1137 PHE n 
1  1138 HIS n 
1  1139 ASN n 
1  1140 GLY n 
1  1141 VAL n 
1  1142 ALA n 
1  1143 ALA n 
1  1144 GLY n 
1  1145 LEU n 
1  1146 LYS n 
1  1147 ILE n 
1  1148 ALA n 
1  1149 PRO n 
1  1150 ALA n 
1  1151 SER n 
1  1152 GLN n 
1  1153 ILE n 
1  1154 ASP n 
1  1155 SER n 
1  1156 ALA n 
1  1157 TRP n 
1  1158 ILE n 
1  1159 VAL n 
1  1160 TYR n 
1  1161 ASN n 
1  1162 LYS n 
1  1163 PRO n 
1  1164 LYS n 
1  1165 HIS n 
1  1166 ALA n 
1  1167 GLU n 
1  1168 LEU n 
1  1169 ALA n 
1  1170 ASN n 
1  1171 GLU n 
1  1172 TYR n 
1  1173 ALA n 
1  1174 GLY n 
1  1175 PHE n 
1  1176 LEU n 
1  1177 MET n 
1  1178 ALA n 
1  1179 LEU n 
1  1180 GLY n 
1  1181 LEU n 
1  1182 ASN n 
1  1183 GLY n 
1  1184 HIS n 
1  1185 LEU n 
1  1186 THR n 
1  1187 LYS n 
1  1188 LEU n 
1  1189 ALA n 
1  1190 THR n 
1  1191 LEU n 
1  1192 ASN n 
1  1193 ILE n 
1  1194 HIS n 
1  1195 ASP n 
1  1196 TYR n 
1  1197 LEU n 
1  1198 THR n 
1  1199 LYS n 
1  1200 GLY n 
1  1201 HIS n 
1  1202 GLU n 
1  1203 MET n 
1  1204 THR n 
1  1205 SER n 
1  1206 ILE n 
1  1207 GLY n 
1  1208 LEU n 
1  1209 LEU n 
1  1210 LEU n 
1  1211 GLY n 
1  1212 VAL n 
1  1213 SER n 
1  1214 ALA n 
1  1215 ALA n 
1  1216 LYS n 
1  1217 LEU n 
1  1218 GLY n 
1  1219 THR n 
1  1220 MET n 
1  1221 ASP n 
1  1222 MET n 
1  1223 SER n 
1  1224 ILE n 
1  1225 THR n 
1  1226 ARG n 
1  1227 LEU n 
1  1228 LEU n 
1  1229 SER n 
1  1230 ILE n 
1  1231 HIS n 
1  1232 ILE n 
1  1233 PRO n 
1  1234 ALA n 
1  1235 LEU n 
1  1236 LEU n 
1  1237 PRO n 
1  1238 PRO n 
1  1239 THR n 
1  1240 SER n 
1  1241 THR n 
1  1242 GLU n 
1  1243 LEU n 
1  1244 ASP n 
1  1245 VAL n 
1  1246 PRO n 
1  1247 HIS n 
1  1248 ASN n 
1  1249 VAL n 
1  1250 GLN n 
1  1251 VAL n 
1  1252 ALA n 
1  1253 ALA n 
1  1254 VAL n 
1  1255 VAL n 
1  1256 GLY n 
1  1257 ILE n 
1  1258 GLY n 
1  1259 LEU n 
1  1260 VAL n 
1  1261 TYR n 
1  1262 GLN n 
1  1263 GLY n 
1  1264 THR n 
1  1265 ALA n 
1  1266 HIS n 
1  1267 ARG n 
1  1268 HIS n 
1  1269 THR n 
1  1270 ALA n 
1  1271 GLU n 
1  1272 VAL n 
1  1273 LEU n 
1  1274 LEU n 
1  1275 ALA n 
1  1276 GLU n 
1  1277 ILE n 
1  1278 GLY n 
1  1279 ARG n 
1  1280 PRO n 
1  1281 PRO n 
1  1282 GLY n 
1  1283 PRO n 
1  1284 GLU n 
1  1285 MET n 
1  1286 GLU n 
1  1287 TYR n 
1  1288 CYS n 
1  1289 THR n 
1  1290 ASP n 
1  1291 ARG n 
1  1292 GLU n 
1  1293 SER n 
1  1294 TYR n 
1  1295 SER n 
1  1296 LEU n 
1  1297 ALA n 
1  1298 ALA n 
1  1299 GLY n 
1  1300 LEU n 
1  1301 ALA n 
1  1302 LEU n 
1  1303 GLY n 
1  1304 MET n 
1  1305 VAL n 
1  1306 CYS n 
1  1307 LEU n 
1  1308 GLY n 
1  1309 HIS n 
1  1310 GLY n 
1  1311 SER n 
1  1312 ASN n 
1  1313 LEU n 
1  1314 ILE n 
1  1315 GLY n 
1  1316 MET n 
1  1317 SER n 
1  1318 ASP n 
1  1319 LEU n 
1  1320 ASN n 
1  1321 VAL n 
1  1322 PRO n 
1  1323 GLU n 
1  1324 GLN n 
1  1325 LEU n 
1  1326 TYR n 
1  1327 GLN n 
1  1328 TYR n 
1  1329 MET n 
1  1330 VAL n 
1  1331 GLY n 
1  1332 GLY n 
1  1333 HIS n 
1  1334 ARG n 
1  1335 ARG n 
1  1336 PHE n 
1  1337 GLN n 
1  1338 THR n 
1  1339 GLY n 
1  1340 MET n 
1  1341 HIS n 
1  1342 ARG n 
1  1343 GLU n 
1  1344 LYS n 
1  1345 HIS n 
1  1346 LYS n 
1  1347 SER n 
1  1348 PRO n 
1  1349 SER n 
1  1350 TYR n 
1  1351 GLN n 
1  1352 ILE n 
1  1353 LYS n 
1  1354 GLU n 
1  1355 GLY n 
1  1356 ASP n 
1  1357 THR n 
1  1358 ILE n 
1  1359 ASN n 
1  1360 VAL n 
1  1361 ASP n 
1  1362 VAL n 
1  1363 THR n 
1  1364 CYS n 
1  1365 PRO n 
1  1366 GLY n 
1  1367 ALA n 
1  1368 THR n 
1  1369 LEU n 
1  1370 ALA n 
1  1371 LEU n 
1  1372 ALA n 
1  1373 MET n 
1  1374 ILE n 
1  1375 TYR n 
1  1376 LEU n 
1  1377 LYS n 
1  1378 THR n 
1  1379 ASN n 
1  1380 ASN n 
1  1381 ARG n 
1  1382 SER n 
1  1383 ILE n 
1  1384 ALA n 
1  1385 ASP n 
1  1386 TRP n 
1  1387 LEU n 
1  1388 ARG n 
1  1389 ALA n 
1  1390 PRO n 
1  1391 ASP n 
1  1392 THR n 
1  1393 MET n 
1  1394 TYR n 
1  1395 LEU n 
1  1396 LEU n 
1  1397 ASP n 
1  1398 PHE n 
1  1399 VAL n 
1  1400 LYS n 
1  1401 PRO n 
1  1402 GLU n 
1  1403 PHE n 
1  1404 LEU n 
1  1405 LEU n 
1  1406 LEU n 
1  1407 ARG n 
1  1408 THR n 
1  1409 LEU n 
1  1410 ALA n 
1  1411 ARG n 
1  1412 CYS n 
1  1413 LEU n 
1  1414 ILE n 
1  1415 LEU n 
1  1416 TRP n 
1  1417 ASP n 
1  1418 ASP n 
1  1419 ILE n 
1  1420 LEU n 
1  1421 PRO n 
1  1422 ASN n 
1  1423 SER n 
1  1424 LYS n 
1  1425 TRP n 
1  1426 VAL n 
1  1427 ASP n 
1  1428 SER n 
1  1429 ASN n 
1  1430 VAL n 
1  1431 PRO n 
1  1432 GLN n 
1  1433 ILE n 
1  1434 ILE n 
1  1435 ARG n 
1  1436 GLU n 
1  1437 ASN n 
1  1438 SER n 
1  1439 ILE n 
1  1440 SER n 
1  1441 LEU n 
1  1442 SER n 
1  1443 GLU n 
1  1444 ILE n 
1  1445 GLU n 
1  1446 LEU n 
1  1447 PRO n 
1  1448 CYS n 
1  1449 SER n 
1  1450 GLU n 
1  1451 ASP n 
1  1452 LEU n 
1  1453 ASN n 
1  1454 LEU n 
1  1455 GLU n 
1  1456 THR n 
1  1457 LEU n 
1  1458 SER n 
1  1459 GLN n 
1  1460 ALA n 
1  1461 HIS n 
1  1462 VAL n 
1  1463 TYR n 
1  1464 ILE n 
1  1465 ILE n 
1  1466 ALA n 
1  1467 GLY n 
1  1468 ALA n 
1  1469 CYS n 
1  1470 LEU n 
1  1471 SER n 
1  1472 LEU n 
1  1473 GLY n 
1  1474 PHE n 
1  1475 ARG n 
1  1476 PHE n 
1  1477 ALA n 
1  1478 GLY n 
1  1479 SER n 
1  1480 GLU n 
1  1481 ASN n 
1  1482 LEU n 
1  1483 SER n 
1  1484 ALA n 
1  1485 PHE n 
1  1486 ASN n 
1  1487 CYS n 
1  1488 LEU n 
1  1489 HIS n 
1  1490 LYS n 
1  1491 PHE n 
1  1492 ALA n 
1  1493 LYS n 
1  1494 ASP n 
1  1495 PHE n 
1  1496 MET n 
1  1497 THR n 
1  1498 TYR n 
1  1499 LEU n 
1  1500 SER n 
1  1501 ALA n 
1  1502 PRO n 
1  1503 ASN n 
1  1504 ALA n 
1  1505 SER n 
1  1506 VAL n 
1  1507 THR n 
1  1508 GLY n 
1  1509 PRO n 
1  1510 HIS n 
1  1511 ASN n 
1  1512 LEU n 
1  1513 GLU n 
1  1514 THR n 
1  1515 CYS n 
1  1516 LEU n 
1  1517 SER n 
1  1518 VAL n 
1  1519 VAL n 
1  1520 LEU n 
1  1521 LEU n 
1  1522 SER n 
1  1523 LEU n 
1  1524 ALA n 
1  1525 MET n 
1  1526 VAL n 
1  1527 MET n 
1  1528 ALA n 
1  1529 GLY n 
1  1530 SER n 
1  1531 GLY n 
1  1532 ASN n 
1  1533 LEU n 
1  1534 LYS n 
1  1535 VAL n 
1  1536 LEU n 
1  1537 GLN n 
1  1538 LEU n 
1  1539 CYS n 
1  1540 ARG n 
1  1541 PHE n 
1  1542 LEU n 
1  1543 HIS n 
1  1544 MET n 
1  1545 LYS n 
1  1546 THR n 
1  1547 GLY n 
1  1548 GLY n 
1  1549 GLU n 
1  1550 MET n 
1  1551 ASN n 
1  1552 TYR n 
1  1553 GLY n 
1  1554 PHE n 
1  1555 HIS n 
1  1556 LEU n 
1  1557 ALA n 
1  1558 HIS n 
1  1559 HIS n 
1  1560 MET n 
1  1561 ALA n 
1  1562 LEU n 
1  1563 GLY n 
1  1564 LEU n 
1  1565 LEU n 
1  1566 PHE n 
1  1567 LEU n 
1  1568 GLY n 
1  1569 GLY n 
1  1570 GLY n 
1  1571 ARG n 
1  1572 TYR n 
1  1573 SER n 
1  1574 LEU n 
1  1575 SER n 
1  1576 THR n 
1  1577 SER n 
1  1578 ASN n 
1  1579 SER n 
1  1580 SER n 
1  1581 ILE n 
1  1582 ALA n 
1  1583 ALA n 
1  1584 LEU n 
1  1585 LEU n 
1  1586 CYS n 
1  1587 ALA n 
1  1588 LEU n 
1  1589 TYR n 
1  1590 PRO n 
1  1591 HIS n 
1  1592 PHE n 
1  1593 PRO n 
1  1594 ALA n 
1  1595 HIS n 
1  1596 SER n 
1  1597 THR n 
1  1598 ASP n 
1  1599 ASN n 
1  1600 ARG n 
1  1601 TYR n 
1  1602 HIS n 
1  1603 LEU n 
1  1604 GLN n 
1  1605 ALA n 
1  1606 LEU n 
1  1607 ARG n 
1  1608 HIS n 
1  1609 LEU n 
1  1610 TYR n 
1  1611 VAL n 
1  1612 LEU n 
1  1613 ALA n 
1  1614 ALA n 
1  1615 GLU n 
1  1616 PRO n 
1  1617 ARG n 
1  1618 LEU n 
1  1619 LEU n 
1  1620 VAL n 
1  1621 PRO n 
1  1622 VAL n 
1  1623 ASP n 
1  1624 VAL n 
1  1625 ASP n 
1  1626 THR n 
1  1627 ASN n 
1  1628 THR n 
1  1629 PRO n 
1  1630 CYS n 
1  1631 TYR n 
1  1632 ALA n 
1  1633 LEU n 
1  1634 LEU n 
1  1635 GLU n 
1  1636 VAL n 
1  1637 THR n 
1  1638 TYR n 
1  1639 LYS n 
1  1640 GLY n 
1  1641 THR n 
1  1642 GLN n 
1  1643 TRP n 
1  1644 TYR n 
1  1645 GLU n 
1  1646 GLN n 
1  1647 THR n 
1  1648 LYS n 
1  1649 GLU n 
1  1650 GLU n 
1  1651 LEU n 
1  1652 MET n 
1  1653 ALA n 
1  1654 PRO n 
1  1655 THR n 
1  1656 LEU n 
1  1657 LEU n 
1  1658 PRO n 
1  1659 GLU n 
1  1660 LEU n 
1  1661 HIS n 
1  1662 LEU n 
1  1663 LEU n 
1  1664 LYS n 
1  1665 GLN n 
1  1666 ILE n 
1  1667 LYS n 
1  1668 VAL n 
1  1669 LYS n 
1  1670 GLY n 
1  1671 PRO n 
1  1672 ARG n 
1  1673 TYR n 
1  1674 TRP n 
1  1675 GLU n 
1  1676 LEU n 
1  1677 LEU n 
1  1678 ILE n 
1  1679 ASP n 
1  1680 LEU n 
1  1681 SER n 
1  1682 LYS n 
1  1683 GLY n 
1  1684 THR n 
1  1685 GLN n 
1  1686 HIS n 
1  1687 LEU n 
1  1688 LYS n 
1  1689 SER n 
1  1690 ILE n 
1  1691 LEU n 
1  1692 SER n 
1  1693 LYS n 
1  1694 ASP n 
1  1695 GLY n 
1  1696 VAL n 
1  1697 LEU n 
1  1698 TYR n 
1  1699 VAL n 
1  1700 LYS n 
1  1701 LEU n 
1  1702 ARG n 
1  1703 ALA n 
1  1704 GLY n 
1  1705 GLN n 
1  1706 LEU n 
1  1707 SER n 
1  1708 TYR n 
1  1709 LYS n 
1  1710 GLU n 
1  1711 ASP n 
1  1712 PRO n 
1  1713 MET n 
1  1714 GLY n 
1  1715 TRP n 
1  1716 GLN n 
1  1717 SER n 
1  1718 LEU n 
1  1719 LEU n 
1  1720 ALA n 
1  1721 GLN n 
1  1722 THR n 
1  1723 VAL n 
1  1724 ALA n 
1  1725 ASN n 
1  1726 ARG n 
1  1727 ASN n 
1  1728 SER n 
1  1729 GLU n 
1  1730 ALA n 
1  1731 ARG n 
1  1732 ALA n 
1  1733 PHE n 
1  1734 LYS n 
1  1735 PRO n 
1  1736 GLU n 
1  1737 THR n 
1  1738 ILE n 
1  1739 SER n 
1  1740 ALA n 
1  1741 PHE n 
1  1742 THR n 
1  1743 SER n 
1  1744 ASP n 
1  1745 PRO n 
1  1746 ALA n 
1  1747 LEU n 
1  1748 LEU n 
1  1749 SER n 
1  1750 PHE n 
1  1751 ALA n 
1  1752 GLU n 
1  1753 TYR n 
1  1754 PHE n 
1  1755 CYS n 
1  1756 LYS n 
1  1757 PRO n 
1  1758 THR n 
1  1759 VAL n 
1  1760 ASN n 
1  1761 MET n 
1  1762 GLY n 
1  1763 GLN n 
1  1764 LYS n 
1  1765 GLN n 
1  1766 GLU n 
1  1767 ILE n 
1  1768 LEU n 
1  1769 ASP n 
1  1770 LEU n 
1  1771 PHE n 
1  1772 SER n 
1  1773 SER n 
1  1774 VAL n 
1  1775 LEU n 
1  1776 TYR n 
1  1777 GLU n 
1  1778 CYS n 
1  1779 VAL n 
1  1780 THR n 
1  1781 GLN n 
1  1782 GLU n 
1  1783 THR n 
1  1784 PRO n 
1  1785 GLU n 
1  1786 MET n 
1  1787 LEU n 
1  1788 PRO n 
1  1789 ALA n 
1  1790 TYR n 
1  1791 ILE n 
1  1792 ALA n 
1  1793 MET n 
1  1794 ASP n 
1  1795 GLN n 
1  1796 ALA n 
1  1797 ILE n 
1  1798 ARG n 
1  1799 ARG n 
1  1800 LEU n 
1  1801 GLY n 
1  1802 ARG n 
1  1803 ARG n 
1  1804 GLU n 
1  1805 MET n 
1  1806 SER n 
1  1807 GLU n 
1  1808 THR n 
1  1809 SER n 
1  1810 GLU n 
1  1811 LEU n 
1  1812 TRP n 
1  1813 GLN n 
1  1814 ILE n 
1  1815 LYS n 
1  1816 LEU n 
1  1817 VAL n 
1  1818 LEU n 
1  1819 GLU n 
1  1820 PHE n 
1  1821 PHE n 
1  1822 SER n 
1  1823 SER n 
1  1824 ARG n 
1  1825 SER n 
1  1826 HIS n 
1  1827 GLN n 
1  1828 GLU n 
1  1829 ARG n 
1  1830 LEU n 
1  1831 GLN n 
1  1832 ASN n 
1  1833 HIS n 
1  1834 PRO n 
1  1835 LYS n 
1  1836 ARG n 
1  1837 GLY n 
1  1838 LEU n 
1  1839 PHE n 
1  1840 MET n 
1  1841 ASN n 
1  1842 SER n 
1  1843 GLU n 
1  1844 PHE n 
1  1845 LEU n 
1  1846 PRO n 
1  1847 VAL n 
1  1848 VAL n 
1  1849 LYS n 
1  1850 CYS n 
1  1851 THR n 
1  1852 ILE n 
1  1853 ASP n 
1  1854 ASN n 
1  1855 THR n 
1  1856 LEU n 
1  1857 ASP n 
1  1858 GLN n 
1  1859 TRP n 
1  1860 LEU n 
1  1861 GLN n 
1  1862 VAL n 
1  1863 GLY n 
1  1864 GLY n 
1  1865 ASP n 
1  1866 MET n 
1  1867 CYS n 
1  1868 VAL n 
1  1869 HIS n 
1  1870 ALA n 
1  1871 TYR n 
1  1872 LEU n 
1  1873 SER n 
1  1874 GLY n 
1  1875 GLN n 
1  1876 PRO n 
1  1877 LEU n 
1  1878 GLU n 
1  1879 GLU n 
1  1880 SER n 
1  1881 GLN n 
1  1882 LEU n 
1  1883 SER n 
1  1884 MET n 
1  1885 LEU n 
1  1886 ALA n 
1  1887 CYS n 
1  1888 PHE n 
1  1889 LEU n 
1  1890 VAL n 
1  1891 TYR n 
1  1892 HIS n 
1  1893 SER n 
1  1894 VAL n 
1  1895 PRO n 
1  1896 ALA n 
1  1897 PRO n 
1  1898 GLN n 
1  1899 HIS n 
1  1900 LEU n 
1  1901 PRO n 
1  1902 PRO n 
1  1903 ILE n 
1  1904 GLY n 
1  1905 LEU n 
1  1906 GLU n 
1  1907 GLY n 
1  1908 SER n 
1  1909 THR n 
1  1910 SER n 
1  1911 PHE n 
1  1912 ALA n 
1  1913 GLU n 
1  1914 LEU n 
1  1915 LEU n 
1  1916 PHE n 
1  1917 LYS n 
1  1918 PHE n 
1  1919 LYS n 
1  1920 GLN n 
1  1921 LEU n 
1  1922 LYS n 
1  1923 MET n 
1  1924 PRO n 
1  1925 VAL n 
1  1926 ARG n 
1  1927 ALA n 
1  1928 LEU n 
1  1929 LEU n 
1  1930 ARG n 
1  1931 LEU n 
1  1932 ALA n 
1  1933 PRO n 
1  1934 LEU n 
1  1935 LEU n 
1  1936 LEU n 
1  1937 GLY n 
1  1938 ASN n 
1  1939 PRO n 
1  1940 GLN n 
1  1941 PRO n 
1  1942 MET n 
1  1943 VAL n 
1  1944 MET n 
2  1    MET n 
2  2    LYS n 
2  3    VAL n 
2  4    LYS n 
2  5    ILE n 
2  6    LYS n 
2  7    CYS n 
2  8    TRP n 
2  9    ASN n 
2  10   GLY n 
2  11   VAL n 
2  12   ALA n 
2  13   THR n 
2  14   TRP n 
2  15   LEU n 
2  16   TRP n 
2  17   VAL n 
2  18   ALA n 
2  19   ASN n 
2  20   ASP n 
2  21   GLU n 
2  22   ASN n 
2  23   CYS n 
2  24   GLY n 
2  25   ILE n 
2  26   CYS n 
2  27   ARG n 
2  28   MET n 
2  29   ALA n 
2  30   PHE n 
2  31   ASN n 
2  32   GLY n 
2  33   CYS n 
2  34   CYS n 
2  35   PRO n 
2  36   ASP n 
2  37   CYS n 
2  38   LYS n 
2  39   VAL n 
2  40   PRO n 
2  41   GLY n 
2  42   ASP n 
2  43   ASP n 
2  44   CYS n 
2  45   PRO n 
2  46   LEU n 
2  47   VAL n 
2  48   TRP n 
2  49   GLY n 
2  50   GLN n 
2  51   CYS n 
2  52   SER n 
2  53   HIS n 
2  54   CYS n 
2  55   PHE n 
2  56   HIS n 
2  57   MET n 
2  58   HIS n 
2  59   CYS n 
2  60   ILE n 
2  61   LEU n 
2  62   LYS n 
2  63   TRP n 
2  64   LEU n 
2  65   HIS n 
2  66   ALA n 
2  67   GLN n 
2  68   GLN n 
2  69   VAL n 
2  70   GLN n 
2  71   GLN n 
2  72   HIS n 
2  73   CYS n 
2  74   PRO n 
2  75   MET n 
2  76   CYS n 
2  77   ARG n 
2  78   GLN n 
2  79   GLU n 
2  80   TRP n 
2  81   LYS n 
2  82   PHE n 
2  83   LYS n 
2  84   GLU n 
3  1    MET n 
3  2    ALA n 
3  3    ALA n 
3  4    SER n 
3  5    THR n 
3  6    SER n 
3  7    MET n 
3  8    VAL n 
3  9    PRO n 
3  10   VAL n 
3  11   ALA n 
3  12   VAL n 
3  13   THR n 
3  14   ALA n 
3  15   ALA n 
3  16   VAL n 
3  17   ALA n 
3  18   PRO n 
3  19   VAL n 
3  20   LEU n 
3  21   SER n 
3  22   ILE n 
3  23   ASN n 
3  24   SER n 
3  25   ASP n 
3  26   PHE n 
3  27   SER n 
3  28   ASP n 
3  29   LEU n 
3  30   ARG n 
3  31   GLU n 
3  32   ILE n 
3  33   LYS n 
3  34   LYS n 
3  35   GLN n 
3  36   LEU n 
3  37   LEU n 
3  38   LEU n 
3  39   ILE n 
3  40   ALA n 
3  41   GLY n 
3  42   LEU n 
3  43   THR n 
3  44   ARG n 
3  45   GLU n 
3  46   ARG n 
3  47   GLY n 
3  48   LEU n 
3  49   LEU n 
3  50   HIS n 
3  51   SER n 
3  52   SER n 
3  53   LYS n 
3  54   TRP n 
3  55   SER n 
3  56   ALA n 
3  57   GLU n 
3  58   LEU n 
3  59   ALA n 
3  60   PHE n 
3  61   SER n 
3  62   LEU n 
3  63   PRO n 
3  64   ALA n 
3  65   LEU n 
3  66   PRO n 
3  67   LEU n 
3  68   ALA n 
3  69   GLU n 
3  70   LEU n 
3  71   GLN n 
3  72   PRO n 
3  73   PRO n 
3  74   PRO n 
3  75   PRO n 
3  76   ILE n 
3  77   THR n 
3  78   GLU n 
3  79   GLU n 
3  80   ASP n 
3  81   ALA n 
3  82   GLN n 
3  83   ASP n 
3  84   MET n 
3  85   ASP n 
3  86   ALA n 
3  87   TYR n 
3  88   THR n 
3  89   LEU n 
3  90   ALA n 
3  91   LYS n 
3  92   ALA n 
3  93   TYR n 
3  94   PHE n 
3  95   ASP n 
3  96   VAL n 
3  97   LYS n 
3  98   GLU n 
3  99   TYR n 
3  100  ASP n 
3  101  ARG n 
3  102  ALA n 
3  103  ALA n 
3  104  HIS n 
3  105  PHE n 
3  106  LEU n 
3  107  HIS n 
3  108  GLY n 
3  109  CYS n 
3  110  ASN n 
3  111  SER n 
3  112  LYS n 
3  113  LYS n 
3  114  ALA n 
3  115  TYR n 
3  116  PHE n 
3  117  LEU n 
3  118  TYR n 
3  119  MET n 
3  120  TYR n 
3  121  SER n 
3  122  ARG n 
3  123  TYR n 
3  124  LEU n 
3  125  SER n 
3  126  GLY n 
3  127  GLU n 
3  128  LYS n 
3  129  LYS n 
3  130  LYS n 
3  131  ASP n 
3  132  ASP n 
3  133  GLU n 
3  134  THR n 
3  135  VAL n 
3  136  ASP n 
3  137  SER n 
3  138  LEU n 
3  139  GLY n 
3  140  PRO n 
3  141  LEU n 
3  142  GLU n 
3  143  LYS n 
3  144  GLY n 
3  145  GLN n 
3  146  VAL n 
3  147  LYS n 
3  148  ASN n 
3  149  GLU n 
3  150  ALA n 
3  151  LEU n 
3  152  ARG n 
3  153  GLU n 
3  154  LEU n 
3  155  ARG n 
3  156  VAL n 
3  157  GLU n 
3  158  LEU n 
3  159  SER n 
3  160  LYS n 
3  161  LYS n 
3  162  HIS n 
3  163  GLN n 
3  164  ALA n 
3  165  ARG n 
3  166  GLU n 
3  167  LEU n 
3  168  ASP n 
3  169  GLY n 
3  170  PHE n 
3  171  GLY n 
3  172  LEU n 
3  173  TYR n 
3  174  LEU n 
3  175  TYR n 
3  176  GLY n 
3  177  VAL n 
3  178  VAL n 
3  179  LEU n 
3  180  ARG n 
3  181  LYS n 
3  182  LEU n 
3  183  ASP n 
3  184  LEU n 
3  185  VAL n 
3  186  LYS n 
3  187  GLU n 
3  188  ALA n 
3  189  ILE n 
3  190  ASP n 
3  191  VAL n 
3  192  PHE n 
3  193  VAL n 
3  194  GLU n 
3  195  ALA n 
3  196  THR n 
3  197  HIS n 
3  198  VAL n 
3  199  LEU n 
3  200  PRO n 
3  201  LEU n 
3  202  HIS n 
3  203  TRP n 
3  204  GLY n 
3  205  ALA n 
3  206  TRP n 
3  207  LEU n 
3  208  GLU n 
3  209  LEU n 
3  210  CYS n 
3  211  ASN n 
3  212  LEU n 
3  213  ILE n 
3  214  THR n 
3  215  ASP n 
3  216  LYS n 
3  217  GLU n 
3  218  MET n 
3  219  LEU n 
3  220  LYS n 
3  221  PHE n 
3  222  LEU n 
3  223  SER n 
3  224  LEU n 
3  225  PRO n 
3  226  ASP n 
3  227  THR n 
3  228  TRP n 
3  229  MET n 
3  230  LYS n 
3  231  GLU n 
3  232  PHE n 
3  233  PHE n 
3  234  LEU n 
3  235  ALA n 
3  236  HIS n 
3  237  ILE n 
3  238  TYR n 
3  239  THR n 
3  240  GLU n 
3  241  LEU n 
3  242  GLN n 
3  243  LEU n 
3  244  ILE n 
3  245  GLU n 
3  246  GLU n 
3  247  ALA n 
3  248  LEU n 
3  249  GLN n 
3  250  LYS n 
3  251  TYR n 
3  252  GLN n 
3  253  ASN n 
3  254  LEU n 
3  255  ILE n 
3  256  ASP n 
3  257  VAL n 
3  258  GLY n 
3  259  PHE n 
3  260  SER n 
3  261  LYS n 
3  262  SER n 
3  263  SER n 
3  264  TYR n 
3  265  ILE n 
3  266  VAL n 
3  267  SER n 
3  268  GLN n 
3  269  ILE n 
3  270  ALA n 
3  271  VAL n 
3  272  ALA n 
3  273  TYR n 
3  274  HIS n 
3  275  ASN n 
3  276  ILE n 
3  277  ARG n 
3  278  ASP n 
3  279  ILE n 
3  280  ASP n 
3  281  LYS n 
3  282  ALA n 
3  283  LEU n 
3  284  SER n 
3  285  ILE n 
3  286  PHE n 
3  287  ASN n 
3  288  GLU n 
3  289  LEU n 
3  290  ARG n 
3  291  LYS n 
3  292  GLN n 
3  293  ASP n 
3  294  PRO n 
3  295  TYR n 
3  296  ARG n 
3  297  ILE n 
3  298  GLU n 
3  299  ASN n 
3  300  MET n 
3  301  ASP n 
3  302  THR n 
3  303  PHE n 
3  304  SER n 
3  305  ASN n 
3  306  LEU n 
3  307  LEU n 
3  308  TYR n 
3  309  VAL n 
3  310  ARG n 
3  311  SER n 
3  312  MET n 
3  313  LYS n 
3  314  SER n 
3  315  GLU n 
3  316  LEU n 
3  317  SER n 
3  318  TYR n 
3  319  LEU n 
3  320  ALA n 
3  321  HIS n 
3  322  ASN n 
3  323  LEU n 
3  324  CYS n 
3  325  GLU n 
3  326  ILE n 
3  327  ASP n 
3  328  LYS n 
3  329  TYR n 
3  330  ARG n 
3  331  VAL n 
3  332  GLU n 
3  333  THR n 
3  334  CYS n 
3  335  CYS n 
3  336  VAL n 
3  337  ILE n 
3  338  GLY n 
3  339  ASN n 
3  340  TYR n 
3  341  TYR n 
3  342  SER n 
3  343  LEU n 
3  344  ARG n 
3  345  SER n 
3  346  GLN n 
3  347  HIS n 
3  348  GLU n 
3  349  LYS n 
3  350  ALA n 
3  351  ALA n 
3  352  LEU n 
3  353  TYR n 
3  354  PHE n 
3  355  GLN n 
3  356  ARG n 
3  357  ALA n 
3  358  LEU n 
3  359  LYS n 
3  360  LEU n 
3  361  ASN n 
3  362  PRO n 
3  363  ARG n 
3  364  TYR n 
3  365  LEU n 
3  366  GLY n 
3  367  ALA n 
3  368  TRP n 
3  369  THR n 
3  370  LEU n 
3  371  MET n 
3  372  GLY n 
3  373  HIS n 
3  374  GLU n 
3  375  TYR n 
3  376  MET n 
3  377  GLU n 
3  378  MET n 
3  379  LYS n 
3  380  ASN n 
3  381  THR n 
3  382  SER n 
3  383  ALA n 
3  384  ALA n 
3  385  ILE n 
3  386  GLN n 
3  387  ALA n 
3  388  TYR n 
3  389  ARG n 
3  390  HIS n 
3  391  ALA n 
3  392  ILE n 
3  393  GLU n 
3  394  VAL n 
3  395  ASN n 
3  396  LYS n 
3  397  ARG n 
3  398  ASP n 
3  399  TYR n 
3  400  ARG n 
3  401  ALA n 
3  402  TRP n 
3  403  TYR n 
3  404  GLY n 
3  405  LEU n 
3  406  GLY n 
3  407  GLN n 
3  408  THR n 
3  409  TYR n 
3  410  GLU n 
3  411  ILE n 
3  412  LEU n 
3  413  LYS n 
3  414  MET n 
3  415  PRO n 
3  416  PHE n 
3  417  TYR n 
3  418  CYS n 
3  419  LEU n 
3  420  TYR n 
3  421  TYR n 
3  422  TYR n 
3  423  ARG n 
3  424  ARG n 
3  425  ALA n 
3  426  HIS n 
3  427  GLN n 
3  428  LEU n 
3  429  ARG n 
3  430  PRO n 
3  431  ASN n 
3  432  ASP n 
3  433  SER n 
3  434  ARG n 
3  435  MET n 
3  436  LEU n 
3  437  VAL n 
3  438  ALA n 
3  439  LEU n 
3  440  GLY n 
3  441  GLU n 
3  442  CYS n 
3  443  TYR n 
3  444  GLU n 
3  445  LYS n 
3  446  LEU n 
3  447  ASN n 
3  448  GLN n 
3  449  LEU n 
3  450  VAL n 
3  451  GLU n 
3  452  ALA n 
3  453  LYS n 
3  454  LYS n 
3  455  CYS n 
3  456  TYR n 
3  457  TRP n 
3  458  ARG n 
3  459  ALA n 
3  460  TYR n 
3  461  ALA n 
3  462  VAL n 
3  463  GLY n 
3  464  ASP n 
3  465  VAL n 
3  466  GLU n 
3  467  LYS n 
3  468  MET n 
3  469  ALA n 
3  470  LEU n 
3  471  VAL n 
3  472  LYS n 
3  473  LEU n 
3  474  ALA n 
3  475  LYS n 
3  476  LEU n 
3  477  HIS n 
3  478  GLU n 
3  479  GLN n 
3  480  LEU n 
3  481  THR n 
3  482  GLU n 
3  483  SER n 
3  484  GLU n 
3  485  GLN n 
3  486  ALA n 
3  487  ALA n 
3  488  GLN n 
3  489  CYS n 
3  490  TYR n 
3  491  ILE n 
3  492  LYS n 
3  493  TYR n 
3  494  ILE n 
3  495  GLN n 
3  496  ASP n 
3  497  ILE n 
3  498  TYR n 
3  499  SER n 
3  500  CYS n 
3  501  GLY n 
3  502  GLU n 
3  503  ILE n 
3  504  VAL n 
3  505  GLU n 
3  506  HIS n 
3  507  LEU n 
3  508  GLU n 
3  509  GLU n 
3  510  SER n 
3  511  THR n 
3  512  ALA n 
3  513  PHE n 
3  514  ARG n 
3  515  TYR n 
3  516  LEU n 
3  517  ALA n 
3  518  GLN n 
3  519  TYR n 
3  520  TYR n 
3  521  PHE n 
3  522  LYS n 
3  523  CYS n 
3  524  LYS n 
3  525  LEU n 
3  526  TRP n 
3  527  ASP n 
3  528  GLU n 
3  529  ALA n 
3  530  SER n 
3  531  THR n 
3  532  CYS n 
3  533  ALA n 
3  534  GLN n 
3  535  LYS n 
3  536  CYS n 
3  537  CYS n 
3  538  ALA n 
3  539  PHE n 
3  540  ASN n 
3  541  ASP n 
3  542  THR n 
3  543  ARG n 
3  544  GLU n 
3  545  GLU n 
3  546  GLY n 
3  547  LYS n 
3  548  ALA n 
3  549  LEU n 
3  550  LEU n 
3  551  ARG n 
3  552  GLN n 
3  553  ILE n 
3  554  LEU n 
3  555  GLN n 
3  556  LEU n 
3  557  ARG n 
3  558  ASN n 
3  559  GLN n 
3  560  GLY n 
3  561  GLU n 
3  562  THR n 
3  563  PRO n 
3  564  THR n 
3  565  THR n 
3  566  GLU n 
3  567  VAL n 
3  568  PRO n 
3  569  ALA n 
3  570  PRO n 
3  571  PHE n 
3  572  PHE n 
3  573  LEU n 
3  574  PRO n 
3  575  ALA n 
3  576  SER n 
3  577  LEU n 
3  578  SER n 
3  579  ALA n 
3  580  ASN n 
3  581  ASN n 
3  582  THR n 
3  583  PRO n 
3  584  THR n 
3  585  ARG n 
3  586  ARG n 
3  587  VAL n 
3  588  SER n 
3  589  PRO n 
3  590  LEU n 
3  591  ASN n 
3  592  LEU n 
3  593  SER n 
3  594  SER n 
3  595  VAL n 
3  596  THR n 
3  597  PRO n 
4  1    MET n 
4  2    SER n 
4  3    THR n 
4  4    LEU n 
4  5    PHE n 
4  6    PRO n 
4  7    SER n 
4  8    LEU n 
4  9    PHE n 
4  10   PRO n 
4  11   ARG n 
4  12   VAL n 
4  13   THR n 
4  14   GLU n 
4  15   THR n 
4  16   LEU n 
4  17   TRP n 
4  18   PHE n 
4  19   ASN n 
4  20   LEU n 
4  21   ASP n 
4  22   ARG n 
4  23   PRO n 
4  24   CYS n 
4  25   VAL n 
4  26   GLU n 
4  27   GLU n 
4  28   THR n 
4  29   GLU n 
4  30   LEU n 
4  31   GLN n 
4  32   GLN n 
4  33   GLN n 
4  34   GLU n 
4  35   GLN n 
4  36   GLN n 
4  37   HIS n 
4  38   GLN n 
4  39   ALA n 
4  40   TRP n 
4  41   LEU n 
4  42   GLN n 
4  43   SER n 
4  44   ILE n 
4  45   ALA n 
4  46   GLU n 
4  47   LYS n 
4  48   ASP n 
4  49   ASN n 
4  50   ASN n 
4  51   LEU n 
4  52   VAL n 
4  53   PRO n 
4  54   ILE n 
4  55   GLY n 
4  56   LYS n 
4  57   PRO n 
4  58   ALA n 
4  59   SER n 
4  60   GLU n 
4  61   HIS n 
4  62   TYR n 
4  63   ASP n 
4  64   ASP n 
4  65   GLU n 
4  66   GLU n 
4  67   GLU n 
4  68   GLU n 
4  69   ASP n 
4  70   ASP n 
4  71   GLU n 
4  72   ASP n 
4  73   ASP n 
4  74   GLU n 
4  75   ASP n 
4  76   SER n 
4  77   GLU n 
4  78   GLU n 
4  79   ASP n 
4  80   SER n 
4  81   GLU n 
4  82   ASP n 
4  83   ASP n 
4  84   GLU n 
4  85   ASP n 
4  86   MET n 
4  87   GLN n 
4  88   ASP n 
4  89   MET n 
4  90   ASP n 
4  91   GLU n 
4  92   MET n 
4  93   ASN n 
4  94   ASP n 
4  95   TYR n 
4  96   ASN n 
4  97   GLU n 
4  98   SER n 
4  99   PRO n 
4  100  ASP n 
4  101  ASP n 
4  102  GLY n 
4  103  GLU n 
4  104  VAL n 
4  105  ASN n 
4  106  GLU n 
4  107  VAL n 
4  108  ASP n 
4  109  MET n 
4  110  GLU n 
4  111  GLY n 
4  112  ASN n 
4  113  GLU n 
4  114  GLN n 
4  115  ASP n 
4  116  GLN n 
4  117  ASP n 
4  118  GLN n 
4  119  TRP n 
4  120  MET n 
4  121  ILE n 
5  1    MET n 
5  2    ALA n 
5  3    ALA n 
5  4    SER n 
5  5    SER n 
5  6    SER n 
5  7    SER n 
5  8    SER n 
5  9    SER n 
5  10   ALA n 
5  11   GLY n 
5  12   GLY n 
5  13   VAL n 
5  14   SER n 
5  15   GLY n 
5  16   SER n 
5  17   SER n 
5  18   VAL n 
5  19   THR n 
5  20   GLY n 
5  21   SER n 
5  22   GLY n 
5  23   PHE n 
5  24   SER n 
5  25   VAL n 
5  26   SER n 
5  27   ASP n 
5  28   LEU n 
5  29   ALA n 
5  30   PRO n 
5  31   PRO n 
5  32   ARG n 
5  33   LYS n 
5  34   ALA n 
5  35   LEU n 
5  36   PHE n 
5  37   THR n 
5  38   TYR n 
5  39   PRO n 
5  40   LYS n 
5  41   GLY n 
5  42   ALA n 
5  43   GLY n 
5  44   GLU n 
5  45   MET n 
5  46   LEU n 
5  47   GLU n 
5  48   ASP n 
5  49   GLY n 
5  50   SER n 
5  51   GLU n 
5  52   ARG n 
5  53   PHE n 
5  54   LEU n 
5  55   CYS n 
5  56   GLU n 
5  57   SER n 
5  58   VAL n 
5  59   PHE n 
5  60   SER n 
5  61   TYR n 
5  62   GLN n 
5  63   VAL n 
5  64   ALA n 
5  65   SER n 
5  66   THR n 
5  67   LEU n 
5  68   LYS n 
5  69   GLN n 
5  70   VAL n 
5  71   LYS n 
5  72   HIS n 
5  73   ASP n 
5  74   GLN n 
5  75   GLN n 
5  76   VAL n 
5  77   ALA n 
5  78   ARG n 
5  79   MET n 
5  80   GLU n 
5  81   LYS n 
5  82   LEU n 
5  83   ALA n 
5  84   GLY n 
5  85   LEU n 
5  86   VAL n 
5  87   GLU n 
5  88   GLU n 
5  89   LEU n 
5  90   GLU n 
5  91   ALA n 
5  92   ASP n 
5  93   GLU n 
5  94   TRP n 
5  95   ARG n 
5  96   PHE n 
5  97   LYS n 
5  98   PRO n 
5  99   ILE n 
5  100  GLU n 
5  101  GLN n 
5  102  LEU n 
5  103  LEU n 
5  104  GLY n 
5  105  PHE n 
5  106  THR n 
5  107  PRO n 
5  108  SER n 
5  109  SER n 
5  110  GLY n 
6  1    MET n 
6  2    THR n 
6  3    VAL n 
6  4    LEU n 
6  5    GLN n 
6  6    GLU n 
6  7    PRO n 
6  8    VAL n 
6  9    GLN n 
6  10   ALA n 
6  11   ALA n 
6  12   ILE n 
6  13   TRP n 
6  14   GLN n 
6  15   ALA n 
6  16   LEU n 
6  17   ASN n 
6  18   HIS n 
6  19   TYR n 
6  20   ALA n 
6  21   TYR n 
6  22   ARG n 
6  23   ASP n 
6  24   ALA n 
6  25   VAL n 
6  26   PHE n 
6  27   LEU n 
6  28   ALA n 
6  29   GLU n 
6  30   ARG n 
6  31   LEU n 
6  32   TYR n 
6  33   ALA n 
6  34   GLU n 
6  35   VAL n 
6  36   HIS n 
6  37   SER n 
6  38   GLU n 
6  39   GLU n 
6  40   ALA n 
6  41   LEU n 
6  42   PHE n 
6  43   LEU n 
6  44   LEU n 
6  45   ALA n 
6  46   THR n 
6  47   CYS n 
6  48   TYR n 
6  49   TYR n 
6  50   ARG n 
6  51   SER n 
6  52   GLY n 
6  53   LYS n 
6  54   ALA n 
6  55   TYR n 
6  56   LYS n 
6  57   ALA n 
6  58   TYR n 
6  59   ARG n 
6  60   LEU n 
6  61   LEU n 
6  62   LYS n 
6  63   GLY n 
6  64   HIS n 
6  65   SER n 
6  66   CYS n 
6  67   THR n 
6  68   THR n 
6  69   PRO n 
6  70   GLN n 
6  71   CYS n 
6  72   LYS n 
6  73   TYR n 
6  74   LEU n 
6  75   LEU n 
6  76   ALA n 
6  77   LYS n 
6  78   CYS n 
6  79   CYS n 
6  80   VAL n 
6  81   ASP n 
6  82   LEU n 
6  83   SER n 
6  84   LYS n 
6  85   LEU n 
6  86   ALA n 
6  87   GLU n 
6  88   GLY n 
6  89   GLU n 
6  90   GLN n 
6  91   ILE n 
6  92   LEU n 
6  93   SER n 
6  94   GLY n 
6  95   GLY n 
6  96   VAL n 
6  97   PHE n 
6  98   ASN n 
6  99   LYS n 
6  100  GLN n 
6  101  LYS n 
6  102  SER n 
6  103  HIS n 
6  104  ASP n 
6  105  ASP n 
6  106  ILE n 
6  107  VAL n 
6  108  THR n 
6  109  GLU n 
6  110  PHE n 
6  111  GLY n 
6  112  ASP n 
6  113  SER n 
6  114  ALA n 
6  115  CYS n 
6  116  PHE n 
6  117  THR n 
6  118  LEU n 
6  119  SER n 
6  120  LEU n 
6  121  LEU n 
6  122  GLY n 
6  123  HIS n 
6  124  VAL n 
6  125  TYR n 
6  126  CYS n 
6  127  LYS n 
6  128  THR n 
6  129  ASP n 
6  130  ARG n 
6  131  LEU n 
6  132  ALA n 
6  133  LYS n 
6  134  GLY n 
6  135  SER n 
6  136  GLU n 
6  137  CYS n 
6  138  TYR n 
6  139  GLN n 
6  140  LYS n 
6  141  SER n 
6  142  LEU n 
6  143  SER n 
6  144  LEU n 
6  145  ASN n 
6  146  PRO n 
6  147  PHE n 
6  148  LEU n 
6  149  TRP n 
6  150  SER n 
6  151  PRO n 
6  152  PHE n 
6  153  GLU n 
6  154  SER n 
6  155  LEU n 
6  156  CYS n 
6  157  GLU n 
6  158  ILE n 
6  159  GLY n 
6  160  GLU n 
6  161  LYS n 
6  162  PRO n 
6  163  ASP n 
6  164  PRO n 
6  165  ASP n 
6  166  GLN n 
6  167  THR n 
6  168  PHE n 
6  169  LYS n 
6  170  PHE n 
6  171  THR n 
6  172  SER n 
6  173  LEU n 
6  174  GLN n 
6  175  ASN n 
6  176  PHE n 
6  177  SER n 
6  178  ASN n 
6  179  CYS n 
6  180  LEU n 
6  181  PRO n 
6  182  ASN n 
6  183  SER n 
6  184  CYS n 
6  185  THR n 
6  186  THR n 
6  187  GLN n 
6  188  VAL n 
6  189  PRO n 
6  190  ASN n 
6  191  HIS n 
6  192  SER n 
6  193  LEU n 
6  194  SER n 
6  195  HIS n 
6  196  ARG n 
6  197  GLN n 
6  198  PRO n 
6  199  GLU n 
6  200  THR n 
6  201  VAL n 
6  202  LEU n 
6  203  THR n 
6  204  GLU n 
6  205  THR n 
6  206  PRO n 
6  207  GLN n 
6  208  ASP n 
6  209  THR n 
6  210  ILE n 
6  211  GLU n 
6  212  LEU n 
6  213  ASN n 
6  214  ARG n 
6  215  LEU n 
6  216  ASN n 
6  217  LEU n 
6  218  GLU n 
6  219  SER n 
6  220  SER n 
6  221  ASN n 
6  222  SER n 
6  223  LYS n 
6  224  TYR n 
6  225  SER n 
6  226  LEU n 
6  227  ASN n 
6  228  THR n 
6  229  ASP n 
6  230  SER n 
6  231  SER n 
6  232  VAL n 
6  233  SER n 
6  234  TYR n 
6  235  ILE n 
6  236  ASP n 
6  237  SER n 
6  238  ALA n 
6  239  VAL n 
6  240  ILE n 
6  241  SER n 
6  242  PRO n 
6  243  ASP n 
6  244  THR n 
6  245  VAL n 
6  246  PRO n 
6  247  LEU n 
6  248  GLY n 
6  249  THR n 
6  250  GLY n 
6  251  THR n 
6  252  SER n 
6  253  ILE n 
6  254  LEU n 
6  255  SER n 
6  256  LYS n 
6  257  GLN n 
6  258  VAL n 
6  259  GLN n 
6  260  ASN n 
6  261  LYS n 
6  262  PRO n 
6  263  LYS n 
6  264  THR n 
6  265  GLY n 
6  266  ARG n 
6  267  SER n 
6  268  LEU n 
6  269  LEU n 
6  270  GLY n 
6  271  GLY n 
6  272  PRO n 
6  273  ALA n 
6  274  ALA n 
6  275  LEU n 
6  276  SER n 
6  277  PRO n 
6  278  LEU n 
6  279  THR n 
6  280  PRO n 
6  281  SER n 
6  282  PHE n 
6  283  GLY n 
6  284  ILE n 
6  285  LEU n 
6  286  PRO n 
6  287  LEU n 
6  288  GLU n 
6  289  THR n 
6  290  PRO n 
6  291  SER n 
6  292  PRO n 
6  293  GLY n 
6  294  ASP n 
6  295  GLY n 
6  296  SER n 
6  297  TYR n 
6  298  LEU n 
6  299  GLN n 
6  300  ASN n 
6  301  TYR n 
6  302  THR n 
6  303  ASN n 
6  304  THR n 
6  305  PRO n 
6  306  PRO n 
6  307  VAL n 
6  308  ILE n 
6  309  ASP n 
6  310  VAL n 
6  311  PRO n 
6  312  SER n 
6  313  THR n 
6  314  GLY n 
6  315  ALA n 
6  316  PRO n 
6  317  SER n 
6  318  LYS n 
6  319  LYS n 
6  320  SER n 
6  321  VAL n 
6  322  ALA n 
6  323  ARG n 
6  324  ILE n 
6  325  GLY n 
6  326  GLN n 
6  327  THR n 
6  328  GLY n 
6  329  THR n 
6  330  LYS n 
6  331  SER n 
6  332  VAL n 
6  333  PHE n 
6  334  SER n 
6  335  GLN n 
6  336  SER n 
6  337  GLY n 
6  338  ASN n 
6  339  SER n 
6  340  ARG n 
6  341  GLU n 
6  342  VAL n 
6  343  THR n 
6  344  PRO n 
6  345  ILE n 
6  346  LEU n 
6  347  ALA n 
6  348  GLN n 
6  349  THR n 
6  350  GLN n 
6  351  SER n 
6  352  SER n 
6  353  GLY n 
6  354  PRO n 
6  355  GLN n 
6  356  THR n 
6  357  SER n 
6  358  THR n 
6  359  THR n 
6  360  PRO n 
6  361  GLN n 
6  362  VAL n 
6  363  LEU n 
6  364  SER n 
6  365  PRO n 
6  366  THR n 
6  367  ILE n 
6  368  THR n 
6  369  SER n 
6  370  PRO n 
6  371  PRO n 
6  372  ASN n 
6  373  ALA n 
6  374  LEU n 
6  375  PRO n 
6  376  ARG n 
6  377  ARG n 
6  378  SER n 
6  379  SER n 
6  380  ARG n 
6  381  LEU n 
6  382  PHE n 
6  383  THR n 
6  384  SER n 
6  385  ASP n 
6  386  SER n 
6  387  SER n 
6  388  THR n 
6  389  THR n 
6  390  LYS n 
6  391  GLU n 
6  392  ASN n 
6  393  SER n 
6  394  LYS n 
6  395  LYS n 
6  396  LEU n 
6  397  LYS n 
6  398  MET n 
6  399  LYS n 
6  400  PHE n 
6  401  PRO n 
6  402  PRO n 
6  403  LYS n 
6  404  ILE n 
6  405  PRO n 
6  406  ASN n 
6  407  ARG n 
6  408  LYS n 
6  409  THR n 
6  410  LYS n 
6  411  SER n 
6  412  LYS n 
6  413  THR n 
6  414  ASN n 
6  415  LYS n 
6  416  GLY n 
6  417  GLY n 
6  418  ILE n 
6  419  THR n 
6  420  GLN n 
6  421  PRO n 
6  422  ASN n 
6  423  ILE n 
6  424  ASN n 
6  425  ASP n 
6  426  SER n 
6  427  LEU n 
6  428  GLU n 
6  429  ILE n 
6  430  THR n 
6  431  LYS n 
6  432  LEU n 
6  433  ASP n 
6  434  SER n 
6  435  SER n 
6  436  ILE n 
6  437  ILE n 
6  438  SER n 
6  439  GLU n 
6  440  GLY n 
6  441  LYS n 
6  442  ILE n 
6  443  SER n 
6  444  THR n 
6  445  ILE n 
6  446  THR n 
6  447  PRO n 
6  448  GLN n 
6  449  ILE n 
6  450  GLN n 
6  451  ALA n 
6  452  PHE n 
6  453  ASN n 
6  454  LEU n 
6  455  GLN n 
6  456  LYS n 
6  457  ALA n 
6  458  ALA n 
6  459  ALA n 
6  460  GLU n 
6  461  GLY n 
6  462  LEU n 
6  463  MET n 
6  464  SER n 
6  465  LEU n 
6  466  LEU n 
6  467  ARG n 
6  468  GLU n 
6  469  MET n 
6  470  GLY n 
6  471  LYS n 
6  472  GLY n 
6  473  TYR n 
6  474  LEU n 
6  475  ALA n 
6  476  LEU n 
6  477  CYS n 
6  478  SER n 
6  479  TYR n 
6  480  ASN n 
6  481  CYS n 
6  482  LYS n 
6  483  GLU n 
6  484  ALA n 
6  485  ILE n 
6  486  ASN n 
6  487  ILE n 
6  488  LEU n 
6  489  SER n 
6  490  HIS n 
6  491  LEU n 
6  492  PRO n 
6  493  SER n 
6  494  HIS n 
6  495  HIS n 
6  496  TYR n 
6  497  ASN n 
6  498  THR n 
6  499  GLY n 
6  500  TRP n 
6  501  VAL n 
6  502  LEU n 
6  503  CYS n 
6  504  GLN n 
6  505  ILE n 
6  506  GLY n 
6  507  ARG n 
6  508  ALA n 
6  509  TYR n 
6  510  PHE n 
6  511  GLU n 
6  512  LEU n 
6  513  SER n 
6  514  GLU n 
6  515  TYR n 
6  516  MET n 
6  517  GLN n 
6  518  ALA n 
6  519  GLU n 
6  520  ARG n 
6  521  ILE n 
6  522  PHE n 
6  523  SER n 
6  524  GLU n 
6  525  VAL n 
6  526  ARG n 
6  527  ARG n 
6  528  ILE n 
6  529  GLU n 
6  530  ASN n 
6  531  TYR n 
6  532  ARG n 
6  533  VAL n 
6  534  GLU n 
6  535  GLY n 
6  536  MET n 
6  537  GLU n 
6  538  ILE n 
6  539  TYR n 
6  540  SER n 
6  541  THR n 
6  542  THR n 
6  543  LEU n 
6  544  TRP n 
6  545  HIS n 
6  546  LEU n 
6  547  GLN n 
6  548  LYS n 
6  549  ASP n 
6  550  VAL n 
6  551  ALA n 
6  552  LEU n 
6  553  SER n 
6  554  VAL n 
6  555  LEU n 
6  556  SER n 
6  557  LYS n 
6  558  ASP n 
6  559  LEU n 
6  560  THR n 
6  561  ASP n 
6  562  MET n 
6  563  ASP n 
6  564  LYS n 
6  565  ASN n 
6  566  SER n 
6  567  PRO n 
6  568  GLU n 
6  569  ALA n 
6  570  TRP n 
6  571  CYS n 
6  572  ALA n 
6  573  ALA n 
6  574  GLY n 
6  575  ASN n 
6  576  CYS n 
6  577  PHE n 
6  578  SER n 
6  579  LEU n 
6  580  GLN n 
6  581  ARG n 
6  582  GLU n 
6  583  HIS n 
6  584  ASP n 
6  585  ILE n 
6  586  ALA n 
6  587  ILE n 
6  588  LYS n 
6  589  PHE n 
6  590  PHE n 
6  591  GLN n 
6  592  ARG n 
6  593  ALA n 
6  594  ILE n 
6  595  GLN n 
6  596  VAL n 
6  597  ASP n 
6  598  PRO n 
6  599  ASN n 
6  600  TYR n 
6  601  ALA n 
6  602  TYR n 
6  603  ALA n 
6  604  TYR n 
6  605  THR n 
6  606  LEU n 
6  607  LEU n 
6  608  GLY n 
6  609  HIS n 
6  610  GLU n 
6  611  PHE n 
6  612  VAL n 
6  613  LEU n 
6  614  THR n 
6  615  GLU n 
6  616  GLU n 
6  617  LEU n 
6  618  ASP n 
6  619  LYS n 
6  620  ALA n 
6  621  LEU n 
6  622  ALA n 
6  623  CYS n 
6  624  PHE n 
6  625  ARG n 
6  626  ASN n 
6  627  ALA n 
6  628  ILE n 
6  629  ARG n 
6  630  VAL n 
6  631  ASN n 
6  632  PRO n 
6  633  ARG n 
6  634  HIS n 
6  635  TYR n 
6  636  ASN n 
6  637  ALA n 
6  638  TRP n 
6  639  TYR n 
6  640  GLY n 
6  641  LEU n 
6  642  GLY n 
6  643  MET n 
6  644  ILE n 
6  645  TYR n 
6  646  TYR n 
6  647  LYS n 
6  648  GLN n 
6  649  GLU n 
6  650  LYS n 
6  651  PHE n 
6  652  SER n 
6  653  LEU n 
6  654  ALA n 
6  655  GLU n 
6  656  MET n 
6  657  HIS n 
6  658  PHE n 
6  659  GLN n 
6  660  LYS n 
6  661  ALA n 
6  662  LEU n 
6  663  ASP n 
6  664  ILE n 
6  665  ASN n 
6  666  PRO n 
6  667  GLN n 
6  668  SER n 
6  669  SER n 
6  670  VAL n 
6  671  LEU n 
6  672  LEU n 
6  673  CYS n 
6  674  HIS n 
6  675  ILE n 
6  676  GLY n 
6  677  VAL n 
6  678  VAL n 
6  679  GLN n 
6  680  HIS n 
6  681  ALA n 
6  682  LEU n 
6  683  LYS n 
6  684  LYS n 
6  685  SER n 
6  686  GLU n 
6  687  LYS n 
6  688  ALA n 
6  689  LEU n 
6  690  ASP n 
6  691  THR n 
6  692  LEU n 
6  693  ASN n 
6  694  LYS n 
6  695  ALA n 
6  696  ILE n 
6  697  VAL n 
6  698  ILE n 
6  699  ASP n 
6  700  PRO n 
6  701  LYS n 
6  702  ASN n 
6  703  PRO n 
6  704  LEU n 
6  705  CYS n 
6  706  LYS n 
6  707  PHE n 
6  708  HIS n 
6  709  ARG n 
6  710  ALA n 
6  711  SER n 
6  712  VAL n 
6  713  LEU n 
6  714  PHE n 
6  715  ALA n 
6  716  ASN n 
6  717  GLU n 
6  718  LYS n 
6  719  TYR n 
6  720  LYS n 
6  721  SER n 
6  722  ALA n 
6  723  LEU n 
6  724  GLN n 
6  725  GLU n 
6  726  LEU n 
6  727  GLU n 
6  728  GLU n 
6  729  LEU n 
6  730  LYS n 
6  731  GLN n 
6  732  ILE n 
6  733  VAL n 
6  734  PRO n 
6  735  LYS n 
6  736  GLU n 
6  737  SER n 
6  738  LEU n 
6  739  VAL n 
6  740  TYR n 
6  741  PHE n 
6  742  LEU n 
6  743  ILE n 
6  744  GLY n 
6  745  LYS n 
6  746  VAL n 
6  747  TYR n 
6  748  LYS n 
6  749  LYS n 
6  750  LEU n 
6  751  GLY n 
6  752  GLN n 
6  753  THR n 
6  754  HIS n 
6  755  LEU n 
6  756  ALA n 
6  757  LEU n 
6  758  MET n 
6  759  ASN n 
6  760  PHE n 
6  761  SER n 
6  762  TRP n 
6  763  ALA n 
6  764  MET n 
6  765  ASP n 
6  766  LEU n 
6  767  ASP n 
6  768  PRO n 
6  769  LYS n 
6  770  GLY n 
6  771  ALA n 
6  772  ASN n 
6  773  ASN n 
6  774  GLN n 
6  775  ILE n 
6  776  LYS n 
6  777  GLU n 
6  778  ALA n 
6  779  ILE n 
6  780  ASP n 
6  781  LYS n 
6  782  ARG n 
6  783  TYR n 
6  784  LEU n 
6  785  PRO n 
6  786  ASP n 
6  787  ASP n 
6  788  GLU n 
6  789  GLU n 
6  790  PRO n 
6  791  ILE n 
6  792  THR n 
6  793  GLN n 
6  794  GLU n 
6  795  GLU n 
6  796  GLN n 
6  797  ILE n 
6  798  MET n 
6  799  GLY n 
6  800  THR n 
6  801  ASP n 
6  802  GLU n 
6  803  SER n 
6  804  GLN n 
6  805  GLU n 
6  806  SER n 
6  807  SER n 
6  808  MET n 
6  809  THR n 
6  810  ASP n 
6  811  ALA n 
6  812  ASP n 
6  813  ASP n 
6  814  THR n 
6  815  GLN n 
6  816  LEU n 
6  817  HIS n 
6  818  ALA n 
6  819  ALA n 
6  820  GLU n 
6  821  SER n 
6  822  ASP n 
6  823  GLU n 
6  824  PHE n 
7  1    MET n 
7  2    LEU n 
7  3    ARG n 
7  4    ARG n 
7  5    LYS n 
7  6    PRO n 
7  7    THR n 
7  8    ARG n 
7  9    LEU n 
7  10   GLU n 
7  11   LEU n 
7  12   LYS n 
7  13   LEU n 
7  14   ASP n 
7  15   ASP n 
7  16   ILE n 
7  17   GLU n 
7  18   GLU n 
7  19   PHE n 
7  20   GLU n 
7  21   ASN n 
7  22   ILE n 
7  23   ARG n 
7  24   LYS n 
7  25   ASP n 
7  26   LEU n 
7  27   GLU n 
7  28   THR n 
7  29   ARG n 
7  30   LYS n 
7  31   LYS n 
7  32   GLN n 
7  33   LYS n 
7  34   GLU n 
7  35   ASP n 
7  36   VAL n 
7  37   GLU n 
7  38   VAL n 
7  39   VAL n 
7  40   GLY n 
7  41   GLY n 
7  42   SER n 
7  43   ASP n 
7  44   GLY n 
7  45   GLU n 
7  46   GLY n 
7  47   ALA n 
7  48   ILE n 
7  49   GLY n 
7  50   LEU n 
7  51   SER n 
7  52   SER n 
7  53   ASP n 
7  54   PRO n 
7  55   LYS n 
7  56   SER n 
7  57   ARG n 
7  58   GLU n 
7  59   GLN n 
7  60   MET n 
7  61   ILE n 
7  62   ASN n 
7  63   ASP n 
7  64   ARG n 
7  65   ILE n 
7  66   GLY n 
7  67   TYR n 
7  68   LYS n 
7  69   PRO n 
7  70   GLN n 
7  71   PRO n 
7  72   LYS n 
7  73   PRO n 
7  74   ASN n 
7  75   ASN n 
7  76   ARG n 
7  77   SER n 
7  78   SER n 
7  79   GLN n 
7  80   PHE n 
7  81   GLY n 
7  82   SER n 
7  83   LEU n 
7  84   GLU n 
7  85   PHE n 
8  1    MET n 
8  2    LEU n 
8  3    ARG n 
8  4    PHE n 
8  5    PRO n 
8  6    THR n 
8  7    CYS n 
8  8    PHE n 
8  9    PRO n 
8  10   SER n 
8  11   PHE n 
8  12   ARG n 
8  13   VAL n 
8  14   VAL n 
8  15   GLY n 
8  16   GLU n 
8  17   LYS n 
8  18   GLN n 
8  19   LEU n 
8  20   PRO n 
8  21   GLN n 
8  22   GLU n 
8  23   ILE n 
8  24   ILE n 
8  25   PHE n 
8  26   LEU n 
8  27   VAL n 
8  28   TRP n 
8  29   SER n 
8  30   PRO n 
8  31   LYS n 
8  32   ARG n 
8  33   ASP n 
8  34   LEU n 
8  35   ILE n 
8  36   ALA n 
8  37   LEU n 
8  38   ALA n 
8  39   ASN n 
8  40   THR n 
8  41   ALA n 
8  42   GLY n 
8  43   GLU n 
8  44   VAL n 
8  45   LEU n 
8  46   LEU n 
8  47   HIS n 
8  48   ARG n 
8  49   LEU n 
8  50   ALA n 
8  51   SER n 
8  52   PHE n 
8  53   HIS n 
8  54   ARG n 
8  55   VAL n 
8  56   TRP n 
8  57   SER n 
8  58   PHE n 
8  59   PRO n 
8  60   PRO n 
8  61   ASN n 
8  62   GLU n 
8  63   ASN n 
8  64   THR n 
8  65   GLY n 
8  66   LYS n 
8  67   GLU n 
8  68   VAL n 
8  69   THR n 
8  70   CYS n 
8  71   LEU n 
8  72   ALA n 
8  73   TRP n 
8  74   ARG n 
8  75   PRO n 
8  76   ASP n 
8  77   GLY n 
8  78   LYS n 
8  79   LEU n 
8  80   LEU n 
8  81   ALA n 
8  82   PHE n 
8  83   ALA n 
8  84   LEU n 
8  85   ALA n 
8  86   ASP n 
8  87   THR n 
8  88   LYS n 
8  89   LYS n 
8  90   ILE n 
8  91   VAL n 
8  92   LEU n 
8  93   CYS n 
8  94   ASP n 
8  95   VAL n 
8  96   GLU n 
8  97   LYS n 
8  98   PRO n 
8  99   GLU n 
8  100  SER n 
8  101  LEU n 
8  102  HIS n 
8  103  SER n 
8  104  PHE n 
8  105  SER n 
8  106  VAL n 
8  107  GLU n 
8  108  ALA n 
8  109  PRO n 
8  110  VAL n 
8  111  SER n 
8  112  CYS n 
8  113  MET n 
8  114  HIS n 
8  115  TRP n 
8  116  MET n 
8  117  GLU n 
8  118  VAL n 
8  119  THR n 
8  120  VAL n 
8  121  GLU n 
8  122  SER n 
8  123  SER n 
8  124  VAL n 
8  125  LEU n 
8  126  THR n 
8  127  SER n 
8  128  PHE n 
8  129  TYR n 
8  130  ASN n 
8  131  ALA n 
8  132  GLU n 
8  133  ASP n 
8  134  GLU n 
8  135  SER n 
8  136  ASN n 
8  137  LEU n 
8  138  LEU n 
8  139  LEU n 
8  140  PRO n 
8  141  LYS n 
8  142  LEU n 
8  143  PRO n 
8  144  THR n 
8  145  LEU n 
8  146  PRO n 
8  147  LYS n 
8  148  ASN n 
8  149  TYR n 
8  150  SER n 
8  151  ASN n 
8  152  THR n 
8  153  SER n 
8  154  LYS n 
8  155  ILE n 
8  156  PHE n 
8  157  SER n 
8  158  GLU n 
8  159  GLU n 
8  160  ASN n 
8  161  SER n 
8  162  ASP n 
8  163  GLU n 
8  164  ILE n 
8  165  ILE n 
8  166  LYS n 
8  167  LEU n 
8  168  LEU n 
8  169  GLY n 
8  170  ASP n 
8  171  VAL n 
8  172  ARG n 
8  173  LEU n 
8  174  ASN n 
8  175  ILE n 
8  176  LEU n 
8  177  VAL n 
8  178  LEU n 
8  179  GLY n 
8  180  GLY n 
8  181  SER n 
8  182  SER n 
8  183  GLY n 
8  184  PHE n 
8  185  ILE n 
8  186  GLU n 
8  187  LEU n 
8  188  TYR n 
8  189  ALA n 
8  190  TYR n 
8  191  GLY n 
8  192  MET n 
8  193  PHE n 
8  194  LYS n 
8  195  ILE n 
8  196  ALA n 
8  197  ARG n 
8  198  VAL n 
8  199  THR n 
8  200  GLY n 
8  201  ILE n 
8  202  ALA n 
8  203  GLY n 
8  204  THR n 
8  205  CYS n 
8  206  LEU n 
8  207  ALA n 
8  208  LEU n 
8  209  CYS n 
8  210  LEU n 
8  211  SER n 
8  212  SER n 
8  213  ASP n 
8  214  LEU n 
8  215  LYS n 
8  216  SER n 
8  217  LEU n 
8  218  SER n 
8  219  VAL n 
8  220  VAL n 
8  221  THR n 
8  222  GLU n 
8  223  VAL n 
8  224  SER n 
8  225  THR n 
8  226  ASN n 
8  227  GLY n 
8  228  ALA n 
8  229  SER n 
8  230  GLU n 
8  231  VAL n 
8  232  SER n 
8  233  TYR n 
8  234  PHE n 
8  235  GLN n 
8  236  LEU n 
8  237  GLU n 
8  238  THR n 
8  239  ASN n 
8  240  LEU n 
8  241  LEU n 
8  242  TYR n 
8  243  SER n 
8  244  PHE n 
8  245  LEU n 
8  246  PRO n 
8  247  GLU n 
8  248  VAL n 
8  249  THR n 
8  250  ARG n 
8  251  MET n 
8  252  ALA n 
8  253  ARG n 
8  254  LYS n 
8  255  PHE n 
8  256  THR n 
8  257  HIS n 
8  258  ILE n 
8  259  SER n 
8  260  ALA n 
8  261  LEU n 
8  262  LEU n 
8  263  GLN n 
8  264  TYR n 
8  265  ILE n 
8  266  ASN n 
8  267  LEU n 
8  268  SER n 
8  269  LEU n 
8  270  THR n 
8  271  CYS n 
8  272  MET n 
8  273  CYS n 
8  274  GLU n 
8  275  ALA n 
8  276  TRP n 
8  277  GLU n 
8  278  GLU n 
8  279  ILE n 
8  280  LEU n 
8  281  MET n 
8  282  GLN n 
8  283  MET n 
8  284  ASP n 
8  285  SER n 
8  286  ARG n 
8  287  LEU n 
8  288  THR n 
8  289  LYS n 
8  290  PHE n 
8  291  VAL n 
8  292  GLN n 
8  293  GLU n 
8  294  LYS n 
8  295  ASN n 
8  296  THR n 
8  297  THR n 
8  298  THR n 
8  299  SER n 
8  300  VAL n 
8  301  GLN n 
8  302  ASP n 
8  303  GLU n 
8  304  PHE n 
8  305  MET n 
8  306  HIS n 
8  307  LEU n 
8  308  LEU n 
8  309  LEU n 
8  310  TRP n 
8  311  GLY n 
8  312  LYS n 
8  313  ALA n 
8  314  SER n 
8  315  ALA n 
8  316  GLU n 
8  317  LEU n 
8  318  GLN n 
8  319  THR n 
8  320  LEU n 
8  321  LEU n 
8  322  MET n 
8  323  ASN n 
8  324  GLN n 
8  325  LEU n 
8  326  THR n 
8  327  VAL n 
8  328  LYS n 
8  329  GLY n 
8  330  LEU n 
8  331  LYS n 
8  332  LYS n 
8  333  LEU n 
8  334  GLY n 
8  335  GLN n 
8  336  SER n 
8  337  ILE n 
8  338  GLU n 
8  339  SER n 
8  340  SER n 
8  341  TYR n 
8  342  SER n 
8  343  SER n 
8  344  ILE n 
8  345  GLN n 
8  346  LYS n 
8  347  LEU n 
8  348  VAL n 
8  349  ILE n 
8  350  SER n 
8  351  HIS n 
8  352  LEU n 
8  353  GLN n 
8  354  SER n 
8  355  GLY n 
8  356  SER n 
8  357  GLU n 
8  358  SER n 
8  359  LEU n 
8  360  LEU n 
8  361  TYR n 
8  362  HIS n 
8  363  LEU n 
8  364  SER n 
8  365  GLU n 
8  366  LEU n 
8  367  LYS n 
8  368  GLY n 
8  369  MET n 
8  370  ALA n 
8  371  SER n 
8  372  TRP n 
8  373  LYS n 
8  374  GLN n 
8  375  LYS n 
8  376  TYR n 
8  377  GLU n 
8  378  PRO n 
8  379  LEU n 
8  380  GLY n 
8  381  LEU n 
8  382  ASP n 
8  383  ALA n 
8  384  ALA n 
8  385  GLY n 
8  386  ILE n 
8  387  GLU n 
8  388  GLU n 
8  389  ALA n 
8  390  ILE n 
8  391  THR n 
8  392  ALA n 
8  393  VAL n 
8  394  GLY n 
8  395  SER n 
8  396  PHE n 
8  397  ILE n 
8  398  LEU n 
8  399  LYS n 
8  400  ALA n 
8  401  ASN n 
8  402  GLU n 
8  403  LEU n 
8  404  LEU n 
8  405  GLN n 
8  406  VAL n 
8  407  ILE n 
8  408  ASP n 
8  409  SER n 
8  410  SER n 
8  411  MET n 
8  412  LYS n 
8  413  ASN n 
8  414  PHE n 
8  415  LYS n 
8  416  ALA n 
8  417  PHE n 
8  418  PHE n 
8  419  ARG n 
8  420  TRP n 
8  421  LEU n 
8  422  TYR n 
8  423  VAL n 
8  424  ALA n 
8  425  MET n 
8  426  LEU n 
8  427  ARG n 
8  428  MET n 
8  429  THR n 
8  430  GLU n 
8  431  ASP n 
8  432  HIS n 
8  433  VAL n 
8  434  LEU n 
8  435  PRO n 
8  436  GLU n 
8  437  LEU n 
8  438  ASN n 
8  439  LYS n 
8  440  MET n 
8  441  THR n 
8  442  GLN n 
8  443  LYS n 
8  444  ASP n 
8  445  ILE n 
8  446  THR n 
8  447  PHE n 
8  448  VAL n 
8  449  ALA n 
8  450  GLU n 
8  451  PHE n 
8  452  LEU n 
8  453  THR n 
8  454  GLU n 
8  455  HIS n 
8  456  PHE n 
8  457  ASN n 
8  458  GLU n 
8  459  ALA n 
8  460  PRO n 
8  461  ASP n 
8  462  LEU n 
8  463  TYR n 
8  464  ASN n 
8  465  ARG n 
8  466  LYS n 
8  467  GLY n 
8  468  LYS n 
8  469  TYR n 
8  470  PHE n 
8  471  ASN n 
8  472  VAL n 
8  473  GLU n 
8  474  ARG n 
8  475  VAL n 
8  476  GLY n 
8  477  GLN n 
8  478  TYR n 
8  479  LEU n 
8  480  LYS n 
8  481  ASP n 
8  482  GLU n 
8  483  ASP n 
8  484  ASP n 
8  485  ASP n 
8  486  LEU n 
8  487  VAL n 
8  488  SER n 
8  489  PRO n 
8  490  PRO n 
8  491  ASN n 
8  492  THR n 
8  493  GLU n 
8  494  GLY n 
8  495  ASN n 
8  496  GLN n 
8  497  TRP n 
8  498  TYR n 
8  499  ASP n 
8  500  PHE n 
8  501  LEU n 
8  502  GLN n 
8  503  ASN n 
8  504  SER n 
8  505  SER n 
8  506  HIS n 
8  507  LEU n 
8  508  LYS n 
8  509  GLU n 
8  510  SER n 
8  511  PRO n 
8  512  LEU n 
8  513  LEU n 
8  514  PHE n 
8  515  PRO n 
8  516  TYR n 
8  517  TYR n 
8  518  PRO n 
8  519  ARG n 
8  520  LYS n 
8  521  SER n 
8  522  LEU n 
8  523  HIS n 
8  524  PHE n 
8  525  VAL n 
8  526  LYS n 
8  527  ARG n 
8  528  ARG n 
8  529  MET n 
8  530  GLU n 
8  531  ASN n 
8  532  ILE n 
8  533  ILE n 
8  534  ASP n 
8  535  GLN n 
8  536  CYS n 
8  537  LEU n 
8  538  GLN n 
8  539  LYS n 
8  540  PRO n 
8  541  ALA n 
8  542  ASP n 
8  543  VAL n 
8  544  ILE n 
8  545  GLY n 
8  546  LYS n 
8  547  SER n 
8  548  MET n 
8  549  ASN n 
8  550  GLN n 
8  551  ALA n 
8  552  ILE n 
8  553  CYS n 
8  554  ILE n 
8  555  PRO n 
8  556  LEU n 
8  557  TYR n 
8  558  ARG n 
8  559  ASP n 
8  560  THR n 
8  561  ARG n 
8  562  SER n 
8  563  GLU n 
8  564  ASP n 
8  565  SER n 
8  566  THR n 
8  567  ARG n 
8  568  ARG n 
8  569  LEU n 
8  570  PHE n 
8  571  LYS n 
8  572  PHE n 
8  573  PRO n 
8  574  PHE n 
8  575  LEU n 
8  576  TRP n 
8  577  ASN n 
8  578  ASN n 
8  579  LYS n 
8  580  THR n 
8  581  SER n 
8  582  ASN n 
8  583  LEU n 
8  584  HIS n 
8  585  TYR n 
8  586  LEU n 
8  587  LEU n 
8  588  PHE n 
8  589  THR n 
8  590  ILE n 
8  591  LEU n 
8  592  GLU n 
8  593  ASP n 
8  594  SER n 
8  595  LEU n 
8  596  TYR n 
8  597  LYS n 
8  598  MET n 
8  599  CYS n 
8  600  ILE n 
8  601  LEU n 
8  602  ARG n 
8  603  ARG n 
8  604  HIS n 
8  605  THR n 
8  606  ASP n 
8  607  ILE n 
8  608  SER n 
8  609  GLN n 
8  610  SER n 
8  611  VAL n 
8  612  SER n 
8  613  ASN n 
8  614  GLY n 
8  615  LEU n 
8  616  ILE n 
8  617  ALA n 
8  618  ILE n 
8  619  LYS n 
8  620  PHE n 
8  621  GLY n 
8  622  SER n 
8  623  PHE n 
8  624  THR n 
8  625  TYR n 
8  626  ALA n 
8  627  THR n 
8  628  THR n 
8  629  GLU n 
8  630  LYS n 
8  631  VAL n 
8  632  ARG n 
8  633  ARG n 
8  634  SER n 
8  635  ILE n 
8  636  TYR n 
8  637  SER n 
8  638  CYS n 
8  639  LEU n 
8  640  ASP n 
8  641  ALA n 
8  642  GLN n 
8  643  PHE n 
8  644  TYR n 
8  645  ASP n 
8  646  ASP n 
8  647  GLU n 
8  648  THR n 
8  649  VAL n 
8  650  THR n 
8  651  VAL n 
8  652  VAL n 
8  653  LEU n 
8  654  LYS n 
8  655  ASP n 
8  656  THR n 
8  657  VAL n 
8  658  GLY n 
8  659  ARG n 
8  660  GLU n 
8  661  GLY n 
8  662  ARG n 
8  663  ASP n 
8  664  ARG n 
8  665  LEU n 
8  666  LEU n 
8  667  VAL n 
8  668  GLN n 
8  669  LEU n 
8  670  PRO n 
8  671  LEU n 
8  672  SER n 
8  673  LEU n 
8  674  VAL n 
8  675  TYR n 
8  676  ASN n 
8  677  SER n 
8  678  GLU n 
8  679  ASP n 
8  680  SER n 
8  681  ALA n 
8  682  GLU n 
8  683  TYR n 
8  684  GLN n 
8  685  PHE n 
8  686  THR n 
8  687  GLY n 
8  688  THR n 
8  689  TYR n 
8  690  SER n 
8  691  THR n 
8  692  ARG n 
8  693  LEU n 
8  694  ASP n 
8  695  GLU n 
8  696  GLN n 
8  697  CYS n 
8  698  SER n 
8  699  ALA n 
8  700  ILE n 
8  701  PRO n 
8  702  THR n 
8  703  ARG n 
8  704  THR n 
8  705  MET n 
8  706  HIS n 
8  707  PHE n 
8  708  GLU n 
8  709  LYS n 
8  710  HIS n 
8  711  TRP n 
8  712  ARG n 
8  713  LEU n 
8  714  LEU n 
8  715  GLU n 
8  716  SER n 
8  717  MET n 
8  718  LYS n 
8  719  ALA n 
8  720  GLN n 
8  721  TYR n 
8  722  VAL n 
8  723  ALA n 
8  724  GLY n 
8  725  ASN n 
8  726  GLY n 
8  727  PHE n 
8  728  ARG n 
8  729  LYS n 
8  730  VAL n 
8  731  SER n 
8  732  CYS n 
8  733  VAL n 
8  734  LEU n 
8  735  SER n 
8  736  SER n 
8  737  ASN n 
8  738  LEU n 
8  739  ARG n 
8  740  HIS n 
8  741  VAL n 
8  742  ARG n 
8  743  VAL n 
8  744  PHE n 
8  745  GLU n 
8  746  MET n 
8  747  ASP n 
8  748  ILE n 
8  749  ASP n 
8  750  ASP n 
8  751  GLU n 
8  752  TRP n 
8  753  GLU n 
8  754  LEU n 
8  755  ASP n 
8  756  GLU n 
8  757  SER n 
8  758  SER n 
8  759  ASP n 
8  760  GLU n 
8  761  GLU n 
8  762  GLU n 
8  763  GLU n 
8  764  ALA n 
8  765  SER n 
8  766  ASN n 
8  767  LYS n 
8  768  PRO n 
8  769  VAL n 
8  770  LYS n 
8  771  ILE n 
8  772  LYS n 
8  773  GLU n 
8  774  GLU n 
8  775  VAL n 
8  776  LEU n 
8  777  SER n 
8  778  GLU n 
8  779  SER n 
8  780  GLU n 
8  781  ALA n 
8  782  GLU n 
8  783  ASN n 
8  784  GLN n 
8  785  GLN n 
8  786  ALA n 
8  787  GLY n 
8  788  ALA n 
8  789  ALA n 
8  790  ALA n 
8  791  LEU n 
8  792  ALA n 
8  793  PRO n 
8  794  GLU n 
8  795  ILE n 
8  796  VAL n 
8  797  ILE n 
8  798  LYS n 
8  799  VAL n 
8  800  GLU n 
8  801  LYS n 
8  802  LEU n 
8  803  ASP n 
8  804  PRO n 
8  805  GLU n 
8  806  LEU n 
8  807  ASP n 
8  808  SER n 
9  1    MET n 
9  2    ASN n 
9  3    LEU n 
9  4    GLU n 
9  5    ARG n 
9  6    LEU n 
9  7    ARG n 
9  8    LYS n 
9  9    ARG n 
9  10   VAL n 
9  11   ARG n 
9  12   GLN n 
9  13   TYR n 
9  14   LEU n 
9  15   ASP n 
9  16   GLN n 
9  17   GLN n 
9  18   GLN n 
9  19   TYR n 
9  20   GLN n 
9  21   SER n 
9  22   ALA n 
9  23   LEU n 
9  24   PHE n 
9  25   TRP n 
9  26   ALA n 
9  27   ASP n 
9  28   LYS n 
9  29   VAL n 
9  30   ALA n 
9  31   SER n 
9  32   LEU n 
9  33   SER n 
9  34   ARG n 
9  35   GLU n 
9  36   GLU n 
9  37   PRO n 
9  38   GLN n 
9  39   ASP n 
9  40   ILE n 
9  41   TYR n 
9  42   TRP n 
9  43   LEU n 
9  44   ALA n 
9  45   GLN n 
9  46   CYS n 
9  47   LEU n 
9  48   TYR n 
9  49   LEU n 
9  50   THR n 
9  51   ALA n 
9  52   GLN n 
9  53   TYR n 
9  54   HIS n 
9  55   ARG n 
9  56   ALA n 
9  57   ALA n 
9  58   HIS n 
9  59   ALA n 
9  60   LEU n 
9  61   ARG n 
9  62   SER n 
9  63   ARG n 
9  64   LYS n 
9  65   LEU n 
9  66   ASP n 
9  67   LYS n 
9  68   LEU n 
9  69   TYR n 
9  70   GLU n 
9  71   ALA n 
9  72   CYS n 
9  73   ARG n 
9  74   TYR n 
9  75   LEU n 
9  76   ALA n 
9  77   ALA n 
9  78   ARG n 
9  79   CYS n 
9  80   HIS n 
9  81   TYR n 
9  82   ALA n 
9  83   ALA n 
9  84   LYS n 
9  85   GLU n 
9  86   HIS n 
9  87   GLN n 
9  88   GLN n 
9  89   ALA n 
9  90   LEU n 
9  91   ASP n 
9  92   VAL n 
9  93   LEU n 
9  94   ASP n 
9  95   MET n 
9  96   GLU n 
9  97   GLU n 
9  98   PRO n 
9  99   ILE n 
9  100  ASN n 
9  101  LYS n 
9  102  ARG n 
9  103  LEU n 
9  104  PHE n 
9  105  GLU n 
9  106  LYS n 
9  107  TYR n 
9  108  LEU n 
9  109  LYS n 
9  110  ASP n 
9  111  GLU n 
9  112  SER n 
9  113  GLY n 
9  114  PHE n 
9  115  LYS n 
9  116  ASP n 
9  117  PRO n 
9  118  SER n 
9  119  SER n 
9  120  ASP n 
9  121  TRP n 
9  122  GLU n 
9  123  MET n 
9  124  SER n 
9  125  GLN n 
9  126  SER n 
9  127  SER n 
9  128  ILE n 
9  129  LYS n 
9  130  SER n 
9  131  SER n 
9  132  ILE n 
9  133  CYS n 
9  134  LEU n 
9  135  LEU n 
9  136  ARG n 
9  137  GLY n 
9  138  LYS n 
9  139  ILE n 
9  140  TYR n 
9  141  ASP n 
9  142  ALA n 
9  143  LEU n 
9  144  ASP n 
9  145  ASN n 
9  146  ARG n 
9  147  THR n 
9  148  LEU n 
9  149  ALA n 
9  150  THR n 
9  151  TYR n 
9  152  SER n 
9  153  TYR n 
9  154  LYS n 
9  155  GLU n 
9  156  ALA n 
9  157  LEU n 
9  158  LYS n 
9  159  LEU n 
9  160  ASP n 
9  161  VAL n 
9  162  TYR n 
9  163  CYS n 
9  164  PHE n 
9  165  GLU n 
9  166  ALA n 
9  167  PHE n 
9  168  ASP n 
9  169  LEU n 
9  170  LEU n 
9  171  THR n 
9  172  SER n 
9  173  HIS n 
9  174  HIS n 
9  175  MET n 
9  176  LEU n 
9  177  THR n 
9  178  ALA n 
9  179  GLN n 
9  180  GLU n 
9  181  GLU n 
9  182  LYS n 
9  183  GLU n 
9  184  LEU n 
9  185  LEU n 
9  186  GLU n 
9  187  SER n 
9  188  LEU n 
9  189  PRO n 
9  190  LEU n 
9  191  SER n 
9  192  LYS n 
9  193  LEU n 
9  194  CYS n 
9  195  ASN n 
9  196  GLU n 
9  197  GLU n 
9  198  GLN n 
9  199  GLU n 
9  200  LEU n 
9  201  LEU n 
9  202  ARG n 
9  203  PHE n 
9  204  LEU n 
9  205  PHE n 
9  206  GLU n 
9  207  ASN n 
9  208  LYS n 
9  209  LEU n 
9  210  LYS n 
9  211  LYS n 
9  212  TYR n 
9  213  ASN n 
9  214  LYS n 
9  215  PRO n 
9  216  SER n 
9  217  GLU n 
9  218  THR n 
9  219  VAL n 
9  220  ILE n 
9  221  PRO n 
9  222  GLU n 
9  223  SER n 
9  224  VAL n 
9  225  ASP n 
9  226  GLY n 
9  227  LEU n 
9  228  GLN n 
9  229  GLU n 
9  230  ASN n 
9  231  LEU n 
9  232  ASP n 
9  233  VAL n 
9  234  VAL n 
9  235  VAL n 
9  236  SER n 
9  237  LEU n 
9  238  ALA n 
9  239  GLU n 
9  240  ARG n 
9  241  HIS n 
9  242  TYR n 
9  243  TYR n 
9  244  ASN n 
9  245  CYS n 
9  246  ASP n 
9  247  PHE n 
9  248  LYS n 
9  249  MET n 
9  250  CYS n 
9  251  TYR n 
9  252  LYS n 
9  253  LEU n 
9  254  THR n 
9  255  SER n 
9  256  VAL n 
9  257  VAL n 
9  258  MET n 
9  259  GLU n 
9  260  LYS n 
9  261  ASP n 
9  262  PRO n 
9  263  PHE n 
9  264  HIS n 
9  265  ALA n 
9  266  SER n 
9  267  CYS n 
9  268  LEU n 
9  269  PRO n 
9  270  VAL n 
9  271  HIS n 
9  272  ILE n 
9  273  GLY n 
9  274  THR n 
9  275  LEU n 
9  276  VAL n 
9  277  GLU n 
9  278  LEU n 
9  279  ASN n 
9  280  LYS n 
9  281  ALA n 
9  282  ASN n 
9  283  GLU n 
9  284  LEU n 
9  285  PHE n 
9  286  TYR n 
9  287  LEU n 
9  288  SER n 
9  289  HIS n 
9  290  LYS n 
9  291  LEU n 
9  292  VAL n 
9  293  ASP n 
9  294  LEU n 
9  295  TYR n 
9  296  PRO n 
9  297  SER n 
9  298  ASN n 
9  299  PRO n 
9  300  VAL n 
9  301  SER n 
9  302  TRP n 
9  303  PHE n 
9  304  ALA n 
9  305  VAL n 
9  306  GLY n 
9  307  CYS n 
9  308  TYR n 
9  309  TYR n 
9  310  LEU n 
9  311  MET n 
9  312  VAL n 
9  313  GLY n 
9  314  HIS n 
9  315  LYS n 
9  316  ASN n 
9  317  GLU n 
9  318  HIS n 
9  319  ALA n 
9  320  ARG n 
9  321  ARG n 
9  322  TYR n 
9  323  LEU n 
9  324  SER n 
9  325  LYS n 
9  326  ALA n 
9  327  THR n 
9  328  THR n 
9  329  LEU n 
9  330  GLU n 
9  331  LYS n 
9  332  THR n 
9  333  TYR n 
9  334  GLY n 
9  335  PRO n 
9  336  ALA n 
9  337  TRP n 
9  338  ILE n 
9  339  ALA n 
9  340  TYR n 
9  341  GLY n 
9  342  HIS n 
9  343  SER n 
9  344  PHE n 
9  345  ALA n 
9  346  VAL n 
9  347  GLU n 
9  348  SER n 
9  349  GLU n 
9  350  HIS n 
9  351  ASP n 
9  352  GLN n 
9  353  ALA n 
9  354  MET n 
9  355  ALA n 
9  356  ALA n 
9  357  TYR n 
9  358  PHE n 
9  359  THR n 
9  360  ALA n 
9  361  ALA n 
9  362  GLN n 
9  363  LEU n 
9  364  MET n 
9  365  LYS n 
9  366  GLY n 
9  367  CYS n 
9  368  HIS n 
9  369  LEU n 
9  370  PRO n 
9  371  MET n 
9  372  LEU n 
9  373  TYR n 
9  374  ILE n 
9  375  GLY n 
9  376  LEU n 
9  377  GLU n 
9  378  TYR n 
9  379  GLY n 
9  380  LEU n 
9  381  THR n 
9  382  ASN n 
9  383  ASN n 
9  384  SER n 
9  385  LYS n 
9  386  LEU n 
9  387  ALA n 
9  388  GLU n 
9  389  ARG n 
9  390  PHE n 
9  391  PHE n 
9  392  SER n 
9  393  GLN n 
9  394  ALA n 
9  395  LEU n 
9  396  SER n 
9  397  ILE n 
9  398  ALA n 
9  399  PRO n 
9  400  GLU n 
9  401  ASP n 
9  402  PRO n 
9  403  PHE n 
9  404  VAL n 
9  405  MET n 
9  406  HIS n 
9  407  GLU n 
9  408  VAL n 
9  409  GLY n 
9  410  VAL n 
9  411  VAL n 
9  412  ALA n 
9  413  PHE n 
9  414  GLN n 
9  415  ASN n 
9  416  GLY n 
9  417  GLU n 
9  418  TRP n 
9  419  LYS n 
9  420  THR n 
9  421  ALA n 
9  422  GLU n 
9  423  LYS n 
9  424  TRP n 
9  425  PHE n 
9  426  LEU n 
9  427  ASP n 
9  428  ALA n 
9  429  LEU n 
9  430  GLU n 
9  431  LYS n 
9  432  ILE n 
9  433  LYS n 
9  434  ALA n 
9  435  ILE n 
9  436  GLY n 
9  437  ASN n 
9  438  GLU n 
9  439  VAL n 
9  440  THR n 
9  441  VAL n 
9  442  ASP n 
9  443  LYS n 
9  444  TRP n 
9  445  GLU n 
9  446  PRO n 
9  447  LEU n 
9  448  LEU n 
9  449  ASN n 
9  450  ASN n 
9  451  LEU n 
9  452  GLY n 
9  453  HIS n 
9  454  VAL n 
9  455  CYS n 
9  456  ARG n 
9  457  LYS n 
9  458  LEU n 
9  459  LYS n 
9  460  LYS n 
9  461  TYR n 
9  462  ALA n 
9  463  GLU n 
9  464  ALA n 
9  465  LEU n 
9  466  ASP n 
9  467  TYR n 
9  468  HIS n 
9  469  ARG n 
9  470  GLN n 
9  471  ALA n 
9  472  LEU n 
9  473  VAL n 
9  474  LEU n 
9  475  ILE n 
9  476  PRO n 
9  477  GLN n 
9  478  ASN n 
9  479  ALA n 
9  480  SER n 
9  481  THR n 
9  482  TYR n 
9  483  SER n 
9  484  ALA n 
9  485  ILE n 
9  486  GLY n 
9  487  TYR n 
9  488  ILE n 
9  489  HIS n 
9  490  SER n 
9  491  LEU n 
9  492  MET n 
9  493  GLY n 
9  494  ASN n 
9  495  PHE n 
9  496  GLU n 
9  497  ASN n 
9  498  ALA n 
9  499  VAL n 
9  500  ASP n 
9  501  TYR n 
9  502  PHE n 
9  503  HIS n 
9  504  THR n 
9  505  ALA n 
9  506  LEU n 
9  507  GLY n 
9  508  LEU n 
9  509  ARG n 
9  510  ARG n 
9  511  ASP n 
9  512  ASP n 
9  513  THR n 
9  514  PHE n 
9  515  SER n 
9  516  VAL n 
9  517  THR n 
9  518  MET n 
9  519  LEU n 
9  520  GLY n 
9  521  HIS n 
9  522  CYS n 
9  523  ILE n 
9  524  GLU n 
9  525  MET n 
9  526  TYR n 
9  527  ILE n 
9  528  GLY n 
9  529  ASP n 
9  530  SER n 
9  531  GLU n 
9  532  ALA n 
9  533  TYR n 
9  534  ILE n 
9  535  GLY n 
9  536  ALA n 
9  537  ASP n 
9  538  ILE n 
9  539  LYS n 
9  540  ASP n 
9  541  LYS n 
9  542  LEU n 
9  543  LYS n 
9  544  CYS n 
9  545  TYR n 
9  546  ASP n 
9  547  PHE n 
9  548  ASP n 
9  549  VAL n 
9  550  HIS n 
9  551  THR n 
9  552  MET n 
9  553  LYS n 
9  554  THR n 
9  555  LEU n 
9  556  LYS n 
9  557  ASN n 
9  558  ILE n 
9  559  ILE n 
9  560  SER n 
9  561  PRO n 
9  562  PRO n 
9  563  TRP n 
9  564  ASP n 
9  565  PHE n 
9  566  ARG n 
9  567  GLU n 
9  568  PHE n 
9  569  GLU n 
9  570  VAL n 
9  571  GLU n 
9  572  LYS n 
9  573  GLN n 
9  574  THR n 
9  575  ALA n 
9  576  GLU n 
9  577  GLU n 
9  578  THR n 
9  579  GLY n 
9  580  LEU n 
9  581  THR n 
9  582  PRO n 
9  583  LEU n 
9  584  GLU n 
9  585  THR n 
9  586  SER n 
9  587  ARG n 
9  588  LYS n 
9  589  THR n 
9  590  PRO n 
9  591  ASP n 
9  592  SER n 
9  593  ARG n 
9  594  PRO n 
9  595  SER n 
9  596  LEU n 
9  597  GLU n 
9  598  GLU n 
9  599  THR n 
9  600  PHE n 
9  601  GLU n 
9  602  ILE n 
9  603  GLU n 
9  604  MET n 
9  605  ASN n 
9  606  GLU n 
9  607  SER n 
9  608  ASP n 
9  609  MET n 
9  610  MET n 
9  611  LEU n 
9  612  GLU n 
9  613  THR n 
9  614  SER n 
9  615  MET n 
9  616  SER n 
9  617  ASP n 
9  618  HIS n 
9  619  SER n 
9  620  THR n 
10 1    MET n 
10 2    THR n 
10 3    THR n 
10 4    PRO n 
10 5    ASN n 
10 6    LYS n 
10 7    THR n 
10 8    PRO n 
10 9    PRO n 
10 10   GLY n 
10 11   ALA n 
10 12   ASP n 
10 13   PRO n 
10 14   LYS n 
10 15   GLN n 
10 16   LEU n 
10 17   GLU n 
10 18   ARG n 
10 19   THR n 
10 20   GLY n 
10 21   THR n 
10 22   VAL n 
10 23   ARG n 
10 24   GLU n 
10 25   ILE n 
10 26   GLY n 
10 27   SER n 
10 28   GLN n 
10 29   ALA n 
10 30   VAL n 
10 31   TRP n 
10 32   SER n 
10 33   LEU n 
10 34   SER n 
10 35   SER n 
10 36   CYS n 
10 37   LYS n 
10 38   PRO n 
10 39   GLY n 
10 40   PHE n 
10 41   GLY n 
10 42   VAL n 
10 43   ASP n 
10 44   GLN n 
10 45   LEU n 
10 46   ARG n 
10 47   ASP n 
10 48   ASP n 
10 49   ASN n 
10 50   LEU n 
10 51   GLU n 
10 52   THR n 
10 53   TYR n 
10 54   TRP n 
10 55   GLN n 
10 56   SER n 
10 57   ASP n 
10 58   GLY n 
10 59   SER n 
10 60   GLN n 
10 61   PRO n 
10 62   HIS n 
10 63   LEU n 
10 64   VAL n 
10 65   ASN n 
10 66   ILE n 
10 67   GLN n 
10 68   PHE n 
10 69   ARG n 
10 70   ARG n 
10 71   LYS n 
10 72   THR n 
10 73   THR n 
10 74   VAL n 
10 75   LYS n 
10 76   THR n 
10 77   LEU n 
10 78   CYS n 
10 79   ILE n 
10 80   TYR n 
10 81   ALA n 
10 82   ASP n 
10 83   TYR n 
10 84   LYS n 
10 85   SER n 
10 86   ASP n 
10 87   GLU n 
10 88   SER n 
10 89   TYR n 
10 90   THR n 
10 91   PRO n 
10 92   SER n 
10 93   LYS n 
10 94   ILE n 
10 95   SER n 
10 96   VAL n 
10 97   ARG n 
10 98   VAL n 
10 99   GLY n 
10 100  ASN n 
10 101  ASN n 
10 102  PHE n 
10 103  HIS n 
10 104  ASN n 
10 105  LEU n 
10 106  GLN n 
10 107  GLU n 
10 108  ILE n 
10 109  ARG n 
10 110  GLN n 
10 111  LEU n 
10 112  GLU n 
10 113  LEU n 
10 114  VAL n 
10 115  GLU n 
10 116  PRO n 
10 117  SER n 
10 118  GLY n 
10 119  TRP n 
10 120  ILE n 
10 121  HIS n 
10 122  VAL n 
10 123  PRO n 
10 124  LEU n 
10 125  THR n 
10 126  ASP n 
10 127  ASN n 
10 128  HIS n 
10 129  LYS n 
10 130  LYS n 
10 131  PRO n 
10 132  THR n 
10 133  ARG n 
10 134  THR n 
10 135  PHE n 
10 136  MET n 
10 137  ILE n 
10 138  GLN n 
10 139  ILE n 
10 140  ALA n 
10 141  VAL n 
10 142  LEU n 
10 143  ALA n 
10 144  ASN n 
10 145  HIS n 
10 146  GLN n 
10 147  ASN n 
10 148  GLY n 
10 149  ARG n 
10 150  ASP n 
10 151  THR n 
10 152  HIS n 
10 153  MET n 
10 154  ARG n 
10 155  GLN n 
10 156  ILE n 
10 157  LYS n 
10 158  ILE n 
10 159  TYR n 
10 160  THR n 
10 161  PRO n 
10 162  VAL n 
10 163  GLU n 
10 164  GLU n 
10 165  SER n 
10 166  SER n 
10 167  ILE n 
10 168  GLY n 
10 169  LYS n 
10 170  PHE n 
10 171  PRO n 
10 172  CYS n 
10 173  THR n 
10 174  THR n 
10 175  ILE n 
10 176  ASP n 
10 177  PHE n 
10 178  MET n 
10 179  MET n 
10 180  TYR n 
10 181  ARG n 
10 182  SER n 
10 183  ILE n 
10 184  ARG n 
11 1    MET n 
11 2    ASP n 
11 3    SER n 
11 4    GLU n 
11 5    VAL n 
11 6    GLN n 
11 7    ARG n 
11 8    ASP n 
11 9    GLY n 
11 10   ARG n 
11 11   ILE n 
11 12   LEU n 
11 13   ASP n 
11 14   LEU n 
11 15   ILE n 
11 16   ASP n 
11 17   ASP n 
11 18   ALA n 
11 19   TRP n 
11 20   ARG n 
11 21   GLU n 
11 22   ASP n 
11 23   LYS n 
11 24   LEU n 
11 25   PRO n 
11 26   TYR n 
11 27   GLU n 
11 28   ASP n 
11 29   VAL n 
11 30   ALA n 
11 31   ILE n 
11 32   PRO n 
11 33   LEU n 
11 34   ASN n 
11 35   GLU n 
11 36   LEU n 
11 37   PRO n 
11 38   GLU n 
11 39   PRO n 
11 40   GLU n 
11 41   GLN n 
11 42   ASP n 
11 43   ASN n 
11 44   GLY n 
11 45   GLY n 
11 46   THR n 
11 47   THR n 
11 48   GLU n 
11 49   SER n 
11 50   VAL n 
11 51   LYS n 
11 52   GLU n 
11 53   GLN n 
11 54   GLU n 
11 55   MET n 
11 56   LYS n 
11 57   TRP n 
11 58   THR n 
11 59   ASP n 
11 60   LEU n 
11 61   ALA n 
11 62   LEU n 
11 63   GLN n 
11 64   TYR n 
11 65   LEU n 
11 66   HIS n 
11 67   GLU n 
11 68   ASN n 
11 69   VAL n 
11 70   PRO n 
11 71   PRO n 
11 72   ILE n 
11 73   GLY n 
11 74   ASN n 
12 1    MET n 
12 2    ALA n 
12 3    ALA n 
12 4    ALA n 
12 5    VAL n 
12 6    VAL n 
12 7    VAL n 
12 8    ALA n 
12 9    GLU n 
12 10   GLY n 
12 11   ASP n 
12 12   SER n 
12 13   ASP n 
12 14   SER n 
12 15   ARG n 
12 16   PRO n 
12 17   GLY n 
12 18   GLN n 
12 19   GLU n 
12 20   LEU n 
12 21   LEU n 
12 22   VAL n 
12 23   ALA n 
12 24   TRP n 
12 25   ASN n 
12 26   THR n 
12 27   VAL n 
12 28   SER n 
12 29   THR n 
12 30   GLY n 
12 31   LEU n 
12 32   VAL n 
12 33   PRO n 
12 34   PRO n 
12 35   ALA n 
12 36   ALA n 
12 37   LEU n 
12 38   GLY n 
12 39   LEU n 
12 40   VAL n 
12 41   SER n 
12 42   SER n 
12 43   ARG n 
12 44   THR n 
12 45   SER n 
12 46   GLY n 
12 47   ALA n 
12 48   VAL n 
12 49   PRO n 
12 50   PRO n 
12 51   LYS n 
12 52   GLU n 
12 53   GLU n 
12 54   GLU n 
12 55   LEU n 
12 56   ARG n 
12 57   ALA n 
12 58   ALA n 
12 59   VAL n 
12 60   GLU n 
12 61   VAL n 
12 62   LEU n 
12 63   ARG n 
12 64   GLY n 
12 65   HIS n 
12 66   GLY n 
12 67   LEU n 
12 68   HIS n 
12 69   SER n 
12 70   VAL n 
12 71   LEU n 
12 72   GLU n 
12 73   GLU n 
12 74   TRP n 
12 75   PHE n 
12 76   VAL n 
12 77   GLU n 
12 78   VAL n 
12 79   LEU n 
12 80   GLN n 
12 81   ASN n 
12 82   ASP n 
12 83   LEU n 
12 84   GLN n 
12 85   ALA n 
12 86   ASN n 
12 87   ILE n 
12 88   SER n 
12 89   PRO n 
12 90   GLU n 
12 91   PHE n 
12 92   TRP n 
12 93   ASN n 
12 94   ALA n 
12 95   ILE n 
12 96   SER n 
12 97   GLN n 
12 98   CYS n 
12 99   GLU n 
12 100  ASN n 
12 101  SER n 
12 102  ALA n 
12 103  ASP n 
12 104  GLU n 
12 105  PRO n 
12 106  GLN n 
12 107  CYS n 
12 108  LEU n 
12 109  LEU n 
12 110  LEU n 
12 111  LEU n 
12 112  LEU n 
12 113  ASP n 
12 114  ALA n 
12 115  PHE n 
12 116  GLY n 
12 117  LEU n 
12 118  LEU n 
12 119  GLU n 
12 120  SER n 
12 121  ARG n 
12 122  LEU n 
12 123  ASP n 
12 124  PRO n 
12 125  TYR n 
12 126  LEU n 
12 127  ARG n 
12 128  SER n 
12 129  LEU n 
12 130  GLU n 
12 131  LEU n 
12 132  LEU n 
12 133  GLU n 
12 134  LYS n 
12 135  TRP n 
12 136  THR n 
12 137  ARG n 
12 138  LEU n 
12 139  GLY n 
12 140  LEU n 
12 141  LEU n 
12 142  MET n 
12 143  GLY n 
12 144  THR n 
12 145  GLY n 
12 146  ALA n 
12 147  GLN n 
12 148  GLY n 
12 149  LEU n 
12 150  ARG n 
12 151  GLU n 
12 152  GLU n 
12 153  VAL n 
12 154  HIS n 
12 155  THR n 
12 156  MET n 
12 157  LEU n 
12 158  ARG n 
12 159  GLY n 
12 160  VAL n 
12 161  LEU n 
12 162  PHE n 
12 163  PHE n 
12 164  SER n 
12 165  THR n 
12 166  PRO n 
12 167  ARG n 
12 168  THR n 
12 169  PHE n 
12 170  GLN n 
12 171  GLU n 
12 172  MET n 
12 173  ILE n 
12 174  GLN n 
12 175  ARG n 
12 176  LEU n 
12 177  TYR n 
12 178  GLY n 
12 179  CYS n 
12 180  PHE n 
12 181  LEU n 
12 182  ARG n 
12 183  VAL n 
12 184  TYR n 
12 185  MET n 
12 186  GLN n 
12 187  SER n 
12 188  LYS n 
12 189  ARG n 
12 190  LYS n 
12 191  GLY n 
12 192  GLU n 
12 193  GLY n 
12 194  GLY n 
12 195  THR n 
12 196  ASP n 
12 197  PRO n 
12 198  GLU n 
12 199  LEU n 
12 200  GLU n 
12 201  GLY n 
12 202  GLU n 
12 203  LEU n 
12 204  ASP n 
12 205  SER n 
12 206  ARG n 
12 207  TYR n 
12 208  ALA n 
12 209  ARG n 
12 210  ARG n 
12 211  ARG n 
12 212  TYR n 
12 213  TYR n 
12 214  ARG n 
12 215  LEU n 
12 216  LEU n 
12 217  GLN n 
12 218  SER n 
12 219  PRO n 
12 220  LEU n 
12 221  CYS n 
12 222  ALA n 
12 223  GLY n 
12 224  CYS n 
12 225  SER n 
12 226  SER n 
12 227  ASP n 
12 228  LYS n 
12 229  GLN n 
12 230  GLN n 
12 231  CYS n 
12 232  TRP n 
12 233  CYS n 
12 234  ARG n 
12 235  GLN n 
12 236  ALA n 
12 237  LEU n 
12 238  GLU n 
12 239  GLN n 
12 240  PHE n 
12 241  HIS n 
12 242  GLN n 
12 243  LEU n 
12 244  SER n 
12 245  GLN n 
12 246  VAL n 
12 247  LEU n 
12 248  HIS n 
12 249  ARG n 
12 250  LEU n 
12 251  SER n 
12 252  LEU n 
12 253  LEU n 
12 254  GLU n 
12 255  ARG n 
12 256  VAL n 
12 257  SER n 
12 258  ALA n 
12 259  GLU n 
12 260  ALA n 
12 261  VAL n 
12 262  THR n 
12 263  THR n 
12 264  THR n 
12 265  LEU n 
12 266  HIS n 
12 267  GLN n 
12 268  VAL n 
12 269  THR n 
12 270  ARG n 
12 271  GLU n 
12 272  ARG n 
12 273  MET n 
12 274  GLU n 
12 275  ASP n 
12 276  ARG n 
12 277  CYS n 
12 278  ARG n 
12 279  GLY n 
12 280  GLU n 
12 281  TYR n 
12 282  GLU n 
12 283  ARG n 
12 284  SER n 
12 285  PHE n 
12 286  LEU n 
12 287  ARG n 
12 288  GLU n 
12 289  PHE n 
12 290  HIS n 
12 291  LYS n 
12 292  TRP n 
12 293  ILE n 
12 294  GLU n 
12 295  ARG n 
12 296  VAL n 
12 297  VAL n 
12 298  GLY n 
12 299  TRP n 
12 300  LEU n 
12 301  GLY n 
12 302  LYS n 
12 303  VAL n 
12 304  PHE n 
12 305  LEU n 
12 306  GLN n 
12 307  ASP n 
12 308  GLY n 
12 309  PRO n 
12 310  ALA n 
12 311  ARG n 
12 312  PRO n 
12 313  ALA n 
12 314  SER n 
12 315  PRO n 
12 316  GLU n 
12 317  ALA n 
12 318  GLY n 
12 319  ASN n 
12 320  THR n 
12 321  LEU n 
12 322  ARG n 
12 323  ARG n 
12 324  TRP n 
12 325  ARG n 
12 326  CYS n 
12 327  HIS n 
12 328  VAL n 
12 329  GLN n 
12 330  ARG n 
12 331  PHE n 
12 332  PHE n 
12 333  TYR n 
12 334  ARG n 
12 335  ILE n 
12 336  TYR n 
12 337  ALA n 
12 338  SER n 
12 339  LEU n 
12 340  ARG n 
12 341  ILE n 
12 342  GLU n 
12 343  GLU n 
12 344  LEU n 
12 345  PHE n 
12 346  SER n 
12 347  ILE n 
12 348  VAL n 
12 349  ARG n 
12 350  ASP n 
12 351  PHE n 
12 352  PRO n 
12 353  ASP n 
12 354  SER n 
12 355  ARG n 
12 356  PRO n 
12 357  ALA n 
12 358  ILE n 
12 359  GLU n 
12 360  ASP n 
12 361  LEU n 
12 362  LYS n 
12 363  TYR n 
12 364  CYS n 
12 365  LEU n 
12 366  GLU n 
12 367  ARG n 
12 368  THR n 
12 369  ASP n 
12 370  GLN n 
12 371  ARG n 
12 372  GLN n 
12 373  GLN n 
12 374  LEU n 
12 375  LEU n 
12 376  VAL n 
12 377  SER n 
12 378  LEU n 
12 379  LYS n 
12 380  ALA n 
12 381  ALA n 
12 382  LEU n 
12 383  GLU n 
12 384  THR n 
12 385  ARG n 
12 386  LEU n 
12 387  LEU n 
12 388  HIS n 
12 389  PRO n 
12 390  GLY n 
12 391  VAL n 
12 392  ASN n 
12 393  THR n 
12 394  CYS n 
12 395  ASP n 
12 396  ILE n 
12 397  ILE n 
12 398  THR n 
12 399  LEU n 
12 400  TYR n 
12 401  ILE n 
12 402  SER n 
12 403  ALA n 
12 404  ILE n 
12 405  LYS n 
12 406  ALA n 
12 407  LEU n 
12 408  ARG n 
12 409  VAL n 
12 410  LEU n 
12 411  ASP n 
12 412  PRO n 
12 413  SER n 
12 414  MET n 
12 415  VAL n 
12 416  ILE n 
12 417  LEU n 
12 418  GLU n 
12 419  VAL n 
12 420  ALA n 
12 421  CYS n 
12 422  GLU n 
12 423  PRO n 
12 424  ILE n 
12 425  ARG n 
12 426  ARG n 
12 427  TYR n 
12 428  LEU n 
12 429  ARG n 
12 430  THR n 
12 431  ARG n 
12 432  GLU n 
12 433  ASP n 
12 434  THR n 
12 435  VAL n 
12 436  ARG n 
12 437  GLN n 
12 438  ILE n 
12 439  VAL n 
12 440  ALA n 
12 441  GLY n 
12 442  LEU n 
12 443  THR n 
12 444  GLY n 
12 445  ASP n 
12 446  SER n 
12 447  ASP n 
12 448  GLY n 
12 449  THR n 
12 450  GLY n 
12 451  ASP n 
12 452  LEU n 
12 453  ALA n 
12 454  VAL n 
12 455  GLU n 
12 456  LEU n 
12 457  SER n 
12 458  LYS n 
12 459  THR n 
12 460  ASP n 
12 461  PRO n 
12 462  ALA n 
12 463  SER n 
12 464  LEU n 
12 465  GLU n 
12 466  THR n 
12 467  GLY n 
12 468  GLN n 
12 469  ASP n 
12 470  SER n 
12 471  GLU n 
12 472  ASP n 
12 473  ASP n 
12 474  SER n 
12 475  GLY n 
12 476  GLU n 
12 477  PRO n 
12 478  GLU n 
12 479  ASP n 
12 480  TRP n 
12 481  VAL n 
12 482  PRO n 
12 483  ASP n 
12 484  PRO n 
12 485  VAL n 
12 486  ASP n 
12 487  ALA n 
12 488  ASP n 
12 489  PRO n 
12 490  GLY n 
12 491  LYS n 
12 492  SER n 
12 493  SER n 
12 494  SER n 
12 495  LYS n 
12 496  ARG n 
12 497  ARG n 
12 498  SER n 
12 499  SER n 
12 500  ASP n 
12 501  ILE n 
12 502  ILE n 
12 503  SER n 
12 504  LEU n 
12 505  LEU n 
12 506  VAL n 
12 507  SER n 
12 508  ILE n 
12 509  TYR n 
12 510  GLY n 
12 511  SER n 
12 512  LYS n 
12 513  ASP n 
12 514  LEU n 
12 515  PHE n 
12 516  ILE n 
12 517  ASN n 
12 518  GLU n 
12 519  TYR n 
12 520  ARG n 
12 521  SER n 
12 522  LEU n 
12 523  LEU n 
12 524  ALA n 
12 525  ASP n 
12 526  ARG n 
12 527  LEU n 
12 528  LEU n 
12 529  HIS n 
12 530  GLN n 
12 531  PHE n 
12 532  SER n 
12 533  PHE n 
12 534  SER n 
12 535  PRO n 
12 536  GLU n 
12 537  ARG n 
12 538  GLU n 
12 539  ILE n 
12 540  ARG n 
12 541  ASN n 
12 542  VAL n 
12 543  GLU n 
12 544  LEU n 
12 545  LEU n 
12 546  LYS n 
12 547  LEU n 
12 548  ARG n 
12 549  PHE n 
12 550  GLY n 
12 551  GLU n 
12 552  ALA n 
12 553  PRO n 
12 554  MET n 
12 555  HIS n 
12 556  PHE n 
12 557  CYS n 
12 558  GLU n 
12 559  VAL n 
12 560  MET n 
12 561  LEU n 
12 562  LYS n 
12 563  ASP n 
12 564  MET n 
12 565  ALA n 
12 566  ASP n 
12 567  SER n 
12 568  ARG n 
12 569  ARG n 
12 570  ILE n 
12 571  ASN n 
12 572  ALA n 
12 573  ASN n 
12 574  ILE n 
12 575  ARG n 
12 576  GLU n 
12 577  GLU n 
12 578  ASP n 
12 579  GLU n 
12 580  LYS n 
12 581  ARG n 
12 582  PRO n 
12 583  ALA n 
12 584  GLU n 
12 585  GLU n 
12 586  GLN n 
12 587  PRO n 
12 588  PRO n 
12 589  PHE n 
12 590  GLY n 
12 591  VAL n 
12 592  TYR n 
12 593  ALA n 
12 594  VAL n 
12 595  ILE n 
12 596  LEU n 
12 597  SER n 
12 598  SER n 
12 599  GLU n 
12 600  PHE n 
12 601  TRP n 
12 602  PRO n 
12 603  PRO n 
12 604  PHE n 
12 605  LYS n 
12 606  ASP n 
12 607  GLU n 
12 608  LYS n 
12 609  LEU n 
12 610  GLU n 
12 611  VAL n 
12 612  PRO n 
12 613  GLU n 
12 614  ASP n 
12 615  ILE n 
12 616  ARG n 
12 617  ALA n 
12 618  ALA n 
12 619  LEU n 
12 620  GLU n 
12 621  ALA n 
12 622  TYR n 
12 623  CYS n 
12 624  LYS n 
12 625  LYS n 
12 626  TYR n 
12 627  GLU n 
12 628  GLN n 
12 629  LEU n 
12 630  LYS n 
12 631  ALA n 
12 632  MET n 
12 633  ARG n 
12 634  THR n 
12 635  LEU n 
12 636  SER n 
12 637  TRP n 
12 638  LYS n 
12 639  HIS n 
12 640  THR n 
12 641  LEU n 
12 642  GLY n 
12 643  LEU n 
12 644  VAL n 
12 645  THR n 
12 646  MET n 
12 647  ASP n 
12 648  VAL n 
12 649  GLU n 
12 650  LEU n 
12 651  ALA n 
12 652  ASP n 
12 653  ARG n 
12 654  THR n 
12 655  LEU n 
12 656  SER n 
12 657  VAL n 
12 658  ALA n 
12 659  VAL n 
12 660  THR n 
12 661  PRO n 
12 662  VAL n 
12 663  GLN n 
12 664  ALA n 
12 665  VAL n 
12 666  ILE n 
12 667  LEU n 
12 668  LEU n 
12 669  TYR n 
12 670  PHE n 
12 671  GLN n 
12 672  ASP n 
12 673  GLN n 
12 674  ALA n 
12 675  SER n 
12 676  TRP n 
12 677  THR n 
12 678  LEU n 
12 679  GLU n 
12 680  GLU n 
12 681  LEU n 
12 682  SER n 
12 683  LYS n 
12 684  ALA n 
12 685  VAL n 
12 686  LYS n 
12 687  MET n 
12 688  PRO n 
12 689  VAL n 
12 690  ALA n 
12 691  LEU n 
12 692  LEU n 
12 693  ARG n 
12 694  ARG n 
12 695  ARG n 
12 696  MET n 
12 697  SER n 
12 698  VAL n 
12 699  TRP n 
12 700  LEU n 
12 701  GLN n 
12 702  GLN n 
12 703  GLY n 
12 704  VAL n 
12 705  LEU n 
12 706  ARG n 
12 707  GLU n 
12 708  GLU n 
12 709  PRO n 
12 710  PRO n 
12 711  GLY n 
12 712  THR n 
12 713  PHE n 
12 714  SER n 
12 715  VAL n 
12 716  ILE n 
12 717  GLU n 
12 718  GLU n 
12 719  GLU n 
12 720  ARG n 
12 721  PRO n 
12 722  GLN n 
12 723  ASP n 
12 724  ARG n 
12 725  ASP n 
12 726  ASN n 
12 727  MET n 
12 728  VAL n 
12 729  LEU n 
12 730  ILE n 
12 731  ASP n 
12 732  SER n 
12 733  ASP n 
12 734  ASP n 
12 735  GLU n 
12 736  SER n 
12 737  ASP n 
12 738  SER n 
12 739  GLY n 
12 740  MET n 
12 741  ALA n 
12 742  SER n 
12 743  GLN n 
12 744  ALA n 
12 745  ASP n 
12 746  GLN n 
12 747  LYS n 
12 748  GLU n 
12 749  GLU n 
12 750  GLU n 
12 751  LEU n 
12 752  LEU n 
12 753  LEU n 
12 754  PHE n 
12 755  TRP n 
12 756  THR n 
12 757  TYR n 
12 758  ILE n 
12 759  GLN n 
12 760  ALA n 
12 761  MET n 
12 762  LEU n 
12 763  THR n 
12 764  ASN n 
12 765  LEU n 
12 766  GLU n 
12 767  SER n 
12 768  LEU n 
12 769  SER n 
12 770  LEU n 
12 771  ASP n 
12 772  ARG n 
12 773  ILE n 
12 774  TYR n 
12 775  ASN n 
12 776  MET n 
12 777  LEU n 
12 778  ARG n 
12 779  MET n 
12 780  PHE n 
12 781  VAL n 
12 782  VAL n 
12 783  THR n 
12 784  GLY n 
12 785  PRO n 
12 786  ALA n 
12 787  LEU n 
12 788  ALA n 
12 789  GLU n 
12 790  ILE n 
12 791  ASP n 
12 792  LEU n 
12 793  GLN n 
12 794  GLU n 
12 795  LEU n 
12 796  GLN n 
12 797  GLY n 
12 798  TYR n 
12 799  LEU n 
12 800  GLN n 
12 801  LYS n 
12 802  LYS n 
12 803  VAL n 
12 804  ARG n 
12 805  ASP n 
12 806  GLN n 
12 807  GLN n 
12 808  LEU n 
12 809  VAL n 
12 810  TYR n 
12 811  SER n 
12 812  ALA n 
12 813  GLY n 
12 814  VAL n 
12 815  TYR n 
12 816  ARG n 
12 817  LEU n 
12 818  PRO n 
12 819  LYS n 
12 820  ASN n 
12 821  CYS n 
12 822  SER n 
13 1    MET n 
13 2    ALA n 
13 3    SER n 
13 4    VAL n 
13 5    HIS n 
13 6    GLU n 
13 7    SER n 
13 8    LEU n 
13 9    TYR n 
13 10   PHE n 
13 11   ASN n 
13 12   PRO n 
13 13   MET n 
13 14   MET n 
13 15   THR n 
13 16   ASN n 
13 17   GLY n 
13 18   VAL n 
13 19   VAL n 
13 20   HIS n 
13 21   ALA n 
13 22   ASN n 
13 23   VAL n 
13 24   PHE n 
13 25   GLY n 
13 26   ILE n 
13 27   LYS n 
13 28   ASP n 
13 29   TRP n 
13 30   VAL n 
13 31   THR n 
13 32   PRO n 
13 33   TYR n 
13 34   LYS n 
13 35   ILE n 
13 36   ALA n 
13 37   VAL n 
13 38   LEU n 
13 39   VAL n 
13 40   LEU n 
13 41   LEU n 
13 42   ASN n 
13 43   GLU n 
13 44   MET n 
13 45   SER n 
13 46   ARG n 
13 47   THR n 
13 48   GLY n 
13 49   GLU n 
13 50   GLY n 
13 51   ALA n 
13 52   VAL n 
13 53   SER n 
13 54   LEU n 
13 55   MET n 
13 56   GLU n 
13 57   ARG n 
13 58   ARG n 
13 59   ARG n 
13 60   LEU n 
13 61   ASN n 
13 62   GLN n 
13 63   LEU n 
13 64   LEU n 
13 65   LEU n 
13 66   PRO n 
13 67   LEU n 
13 68   LEU n 
13 69   GLN n 
13 70   GLY n 
13 71   PRO n 
13 72   ASP n 
13 73   ILE n 
13 74   THR n 
13 75   LEU n 
13 76   SER n 
13 77   LYS n 
13 78   LEU n 
13 79   TYR n 
13 80   LYS n 
13 81   LEU n 
13 82   ILE n 
13 83   GLU n 
13 84   GLU n 
13 85   SER n 
13 86   CYS n 
13 87   PRO n 
13 88   GLN n 
13 89   LEU n 
13 90   ALA n 
13 91   ASN n 
13 92   SER n 
13 93   VAL n 
13 94   GLN n 
13 95   ILE n 
13 96   ARG n 
13 97   ILE n 
13 98   LYS n 
13 99   LEU n 
13 100  MET n 
13 101  ALA n 
13 102  GLU n 
13 103  GLY n 
13 104  GLU n 
13 105  LEU n 
13 106  LYS n 
13 107  ASP n 
13 108  MET n 
13 109  GLU n 
13 110  GLN n 
13 111  PHE n 
13 112  PHE n 
13 113  ASP n 
13 114  ASP n 
13 115  LEU n 
13 116  SER n 
13 117  ASP n 
13 118  SER n 
13 119  PHE n 
13 120  SER n 
13 121  GLY n 
13 122  THR n 
13 123  GLU n 
13 124  PRO n 
13 125  GLU n 
13 126  VAL n 
13 127  HIS n 
13 128  LYS n 
13 129  THR n 
13 130  SER n 
13 131  VAL n 
13 132  VAL n 
13 133  GLY n 
13 134  LEU n 
13 135  PHE n 
13 136  LEU n 
13 137  ARG n 
13 138  HIS n 
13 139  MET n 
13 140  ILE n 
13 141  LEU n 
13 142  ALA n 
13 143  TYR n 
13 144  SER n 
13 145  LYS n 
13 146  LEU n 
13 147  SER n 
13 148  PHE n 
13 149  SER n 
13 150  GLN n 
13 151  VAL n 
13 152  PHE n 
13 153  LYS n 
13 154  LEU n 
13 155  TYR n 
13 156  THR n 
13 157  ALA n 
13 158  LEU n 
13 159  GLN n 
13 160  GLN n 
13 161  TYR n 
13 162  PHE n 
13 163  GLN n 
13 164  ASN n 
13 165  GLY n 
13 166  GLU n 
13 167  LYS n 
13 168  LYS n 
13 169  THR n 
13 170  VAL n 
13 171  GLU n 
13 172  ASP n 
13 173  ALA n 
13 174  ASP n 
13 175  MET n 
13 176  GLU n 
13 177  LEU n 
13 178  THR n 
13 179  SER n 
13 180  ARG n 
13 181  ASP n 
13 182  GLU n 
13 183  GLY n 
13 184  GLU n 
13 185  ARG n 
13 186  LYS n 
13 187  MET n 
13 188  GLU n 
13 189  LYS n 
13 190  GLU n 
13 191  GLU n 
13 192  LEU n 
13 193  ASP n 
13 194  VAL n 
13 195  SER n 
13 196  VAL n 
13 197  ARG n 
13 198  GLU n 
13 199  GLU n 
13 200  GLU n 
13 201  VAL n 
13 202  SER n 
13 203  CYS n 
13 204  SER n 
13 205  GLY n 
13 206  PRO n 
13 207  LEU n 
13 208  SER n 
13 209  GLN n 
13 210  LYS n 
13 211  GLN n 
13 212  ALA n 
13 213  GLU n 
13 214  PHE n 
13 215  PHE n 
13 216  LEU n 
13 217  SER n 
13 218  GLN n 
13 219  GLN n 
13 220  ALA n 
13 221  SER n 
13 222  LEU n 
13 223  LEU n 
13 224  LYS n 
13 225  ASN n 
13 226  ASP n 
13 227  GLU n 
13 228  THR n 
13 229  LYS n 
13 230  ALA n 
13 231  LEU n 
13 232  THR n 
13 233  PRO n 
13 234  ALA n 
13 235  SER n 
13 236  LEU n 
13 237  GLN n 
13 238  LYS n 
13 239  GLU n 
13 240  LEU n 
13 241  ASN n 
13 242  ASN n 
13 243  LEU n 
13 244  LEU n 
13 245  LYS n 
13 246  PHE n 
13 247  ASN n 
13 248  PRO n 
13 249  ASP n 
13 250  PHE n 
13 251  ALA n 
13 252  GLU n 
13 253  ALA n 
13 254  HIS n 
13 255  TYR n 
13 256  LEU n 
13 257  SER n 
13 258  TYR n 
13 259  LEU n 
13 260  ASN n 
13 261  ASN n 
13 262  LEU n 
13 263  ARG n 
13 264  VAL n 
13 265  GLN n 
13 266  ASP n 
13 267  VAL n 
13 268  PHE n 
13 269  SER n 
13 270  SER n 
13 271  THR n 
13 272  HIS n 
13 273  SER n 
13 274  LEU n 
13 275  LEU n 
13 276  HIS n 
13 277  TYR n 
13 278  PHE n 
13 279  ASP n 
13 280  ARG n 
13 281  LEU n 
13 282  ILE n 
13 283  LEU n 
13 284  THR n 
13 285  GLY n 
13 286  ALA n 
13 287  GLU n 
13 288  SER n 
13 289  LYS n 
13 290  SER n 
13 291  ASN n 
13 292  GLY n 
13 293  GLU n 
13 294  GLU n 
13 295  GLY n 
13 296  TYR n 
13 297  GLY n 
13 298  ARG n 
13 299  SER n 
13 300  LEU n 
13 301  ARG n 
13 302  TYR n 
13 303  ALA n 
13 304  ALA n 
13 305  LEU n 
13 306  ASN n 
13 307  LEU n 
13 308  ALA n 
13 309  ALA n 
13 310  LEU n 
13 311  HIS n 
13 312  CYS n 
13 313  ARG n 
13 314  PHE n 
13 315  GLY n 
13 316  HIS n 
13 317  TYR n 
13 318  GLN n 
13 319  GLN n 
13 320  ALA n 
13 321  GLU n 
13 322  LEU n 
13 323  ALA n 
13 324  LEU n 
13 325  GLN n 
13 326  GLU n 
13 327  ALA n 
13 328  ILE n 
13 329  ARG n 
13 330  ILE n 
13 331  ALA n 
13 332  GLN n 
13 333  GLU n 
13 334  SER n 
13 335  ASN n 
13 336  ASP n 
13 337  HIS n 
13 338  VAL n 
13 339  CYS n 
13 340  LEU n 
13 341  GLN n 
13 342  HIS n 
13 343  CYS n 
13 344  LEU n 
13 345  SER n 
13 346  TRP n 
13 347  LEU n 
13 348  TYR n 
13 349  VAL n 
13 350  LEU n 
13 351  GLY n 
13 352  GLN n 
13 353  LYS n 
13 354  ARG n 
13 355  SER n 
13 356  ASP n 
13 357  SER n 
13 358  TYR n 
13 359  VAL n 
13 360  LEU n 
13 361  LEU n 
13 362  GLU n 
13 363  HIS n 
13 364  SER n 
13 365  VAL n 
13 366  LYS n 
13 367  LYS n 
13 368  ALA n 
13 369  VAL n 
13 370  HIS n 
13 371  PHE n 
13 372  GLY n 
13 373  LEU n 
13 374  PRO n 
13 375  TYR n 
13 376  LEU n 
13 377  ALA n 
13 378  SER n 
13 379  LEU n 
13 380  GLY n 
13 381  ILE n 
13 382  GLN n 
13 383  SER n 
13 384  LEU n 
13 385  VAL n 
13 386  GLN n 
13 387  GLN n 
13 388  ARG n 
13 389  ALA n 
13 390  PHE n 
13 391  ALA n 
13 392  GLY n 
13 393  LYS n 
13 394  THR n 
13 395  ALA n 
13 396  ASN n 
13 397  LYS n 
13 398  LEU n 
13 399  MET n 
13 400  ASP n 
13 401  ALA n 
13 402  LEU n 
13 403  LYS n 
13 404  ASP n 
13 405  SER n 
13 406  ASP n 
13 407  LEU n 
13 408  LEU n 
13 409  HIS n 
13 410  TRP n 
13 411  LYS n 
13 412  HIS n 
13 413  SER n 
13 414  LEU n 
13 415  SER n 
13 416  GLU n 
13 417  LEU n 
13 418  ILE n 
13 419  ASP n 
13 420  ILE n 
13 421  SER n 
13 422  ILE n 
13 423  ALA n 
13 424  GLN n 
13 425  LYS n 
13 426  THR n 
13 427  ALA n 
13 428  ILE n 
13 429  TRP n 
13 430  ARG n 
13 431  LEU n 
13 432  TYR n 
13 433  GLY n 
13 434  ARG n 
13 435  SER n 
13 436  THR n 
13 437  MET n 
13 438  ALA n 
13 439  LEU n 
13 440  GLN n 
13 441  GLN n 
13 442  ALA n 
13 443  GLN n 
13 444  MET n 
13 445  LEU n 
13 446  LEU n 
13 447  SER n 
13 448  MET n 
13 449  ASN n 
13 450  SER n 
13 451  LEU n 
13 452  GLU n 
13 453  ALA n 
13 454  VAL n 
13 455  ASN n 
13 456  ALA n 
13 457  GLY n 
13 458  VAL n 
13 459  GLN n 
13 460  GLN n 
13 461  ASN n 
13 462  ASN n 
13 463  THR n 
13 464  GLU n 
13 465  SER n 
13 466  PHE n 
13 467  ALA n 
13 468  VAL n 
13 469  ALA n 
13 470  LEU n 
13 471  CYS n 
13 472  HIS n 
13 473  LEU n 
13 474  ALA n 
13 475  GLU n 
13 476  LEU n 
13 477  HIS n 
13 478  ALA n 
13 479  GLU n 
13 480  GLN n 
13 481  GLY n 
13 482  CYS n 
13 483  PHE n 
13 484  ALA n 
13 485  ALA n 
13 486  ALA n 
13 487  SER n 
13 488  GLU n 
13 489  VAL n 
13 490  LEU n 
13 491  LYS n 
13 492  HIS n 
13 493  LEU n 
13 494  LYS n 
13 495  GLU n 
13 496  ARG n 
13 497  PHE n 
13 498  PRO n 
13 499  PRO n 
13 500  ASN n 
13 501  SER n 
13 502  GLN n 
13 503  HIS n 
13 504  ALA n 
13 505  GLN n 
13 506  LEU n 
13 507  TRP n 
13 508  MET n 
13 509  LEU n 
13 510  CYS n 
13 511  ASP n 
13 512  GLN n 
13 513  LYS n 
13 514  ILE n 
13 515  GLN n 
13 516  PHE n 
13 517  ASP n 
13 518  ARG n 
13 519  ALA n 
13 520  MET n 
13 521  ASN n 
13 522  ASP n 
13 523  GLY n 
13 524  LYS n 
13 525  TYR n 
13 526  HIS n 
13 527  LEU n 
13 528  ALA n 
13 529  ASP n 
13 530  SER n 
13 531  LEU n 
13 532  VAL n 
13 533  THR n 
13 534  GLY n 
13 535  ILE n 
13 536  THR n 
13 537  ALA n 
13 538  LEU n 
13 539  ASN n 
13 540  SER n 
13 541  ILE n 
13 542  GLU n 
13 543  GLY n 
13 544  VAL n 
13 545  TYR n 
13 546  ARG n 
13 547  LYS n 
13 548  ALA n 
13 549  VAL n 
13 550  VAL n 
13 551  LEU n 
13 552  GLN n 
13 553  ALA n 
13 554  GLN n 
13 555  ASN n 
13 556  GLN n 
13 557  MET n 
13 558  SER n 
13 559  GLU n 
13 560  ALA n 
13 561  HIS n 
13 562  LYS n 
13 563  LEU n 
13 564  LEU n 
13 565  GLN n 
13 566  LYS n 
13 567  LEU n 
13 568  LEU n 
13 569  VAL n 
13 570  HIS n 
13 571  CYS n 
13 572  GLN n 
13 573  LYS n 
13 574  LEU n 
13 575  LYS n 
13 576  ASN n 
13 577  THR n 
13 578  GLU n 
13 579  MET n 
13 580  VAL n 
13 581  ILE n 
13 582  SER n 
13 583  VAL n 
13 584  LEU n 
13 585  LEU n 
13 586  SER n 
13 587  VAL n 
13 588  ALA n 
13 589  GLU n 
13 590  LEU n 
13 591  TYR n 
13 592  TRP n 
13 593  ARG n 
13 594  SER n 
13 595  SER n 
13 596  SER n 
13 597  PRO n 
13 598  THR n 
13 599  ILE n 
13 600  ALA n 
13 601  LEU n 
13 602  PRO n 
13 603  MET n 
13 604  LEU n 
13 605  LEU n 
13 606  GLN n 
13 607  ALA n 
13 608  LEU n 
13 609  ALA n 
13 610  LEU n 
13 611  SER n 
13 612  LYS n 
13 613  GLU n 
13 614  TYR n 
13 615  ARG n 
13 616  LEU n 
13 617  GLN n 
13 618  TYR n 
13 619  LEU n 
13 620  ALA n 
13 621  SER n 
13 622  GLU n 
13 623  THR n 
13 624  VAL n 
13 625  LEU n 
13 626  ASN n 
13 627  LEU n 
13 628  ALA n 
13 629  PHE n 
13 630  ALA n 
13 631  GLN n 
13 632  LEU n 
13 633  ILE n 
13 634  LEU n 
13 635  GLY n 
13 636  ILE n 
13 637  PRO n 
13 638  GLU n 
13 639  GLN n 
13 640  ALA n 
13 641  LEU n 
13 642  SER n 
13 643  LEU n 
13 644  LEU n 
13 645  HIS n 
13 646  MET n 
13 647  ALA n 
13 648  ILE n 
13 649  GLU n 
13 650  PRO n 
13 651  ILE n 
13 652  LEU n 
13 653  ALA n 
13 654  ASP n 
13 655  GLY n 
13 656  ALA n 
13 657  ILE n 
13 658  LEU n 
13 659  ASP n 
13 660  LYS n 
13 661  GLY n 
13 662  ARG n 
13 663  ALA n 
13 664  MET n 
13 665  PHE n 
13 666  LEU n 
13 667  VAL n 
13 668  ALA n 
13 669  LYS n 
13 670  CYS n 
13 671  GLN n 
13 672  VAL n 
13 673  ALA n 
13 674  SER n 
13 675  ALA n 
13 676  ALA n 
13 677  SER n 
13 678  TYR n 
13 679  ASP n 
13 680  GLN n 
13 681  PRO n 
13 682  LYS n 
13 683  LYS n 
13 684  ALA n 
13 685  GLU n 
13 686  ALA n 
13 687  LEU n 
13 688  GLU n 
13 689  ALA n 
13 690  ALA n 
13 691  ILE n 
13 692  GLU n 
13 693  ASN n 
13 694  LEU n 
13 695  ASN n 
13 696  GLU n 
13 697  ALA n 
13 698  LYS n 
13 699  ASN n 
13 700  TYR n 
13 701  PHE n 
13 702  ALA n 
13 703  LYS n 
13 704  VAL n 
13 705  ASP n 
13 706  CYS n 
13 707  LYS n 
13 708  GLU n 
13 709  ARG n 
13 710  ILE n 
13 711  ARG n 
13 712  ASP n 
13 713  VAL n 
13 714  VAL n 
13 715  TYR n 
13 716  PHE n 
13 717  GLN n 
13 718  ALA n 
13 719  ARG n 
13 720  LEU n 
13 721  TYR n 
13 722  HIS n 
13 723  THR n 
13 724  LEU n 
13 725  GLY n 
13 726  LYS n 
13 727  THR n 
13 728  GLN n 
13 729  GLU n 
13 730  ARG n 
13 731  ASN n 
13 732  ARG n 
13 733  CYS n 
13 734  ALA n 
13 735  MET n 
13 736  LEU n 
13 737  PHE n 
13 738  ARG n 
13 739  GLN n 
13 740  LEU n 
13 741  HIS n 
13 742  GLN n 
13 743  GLU n 
13 744  LEU n 
13 745  PRO n 
13 746  SER n 
13 747  HIS n 
13 748  GLY n 
13 749  VAL n 
13 750  PRO n 
13 751  LEU n 
13 752  ILE n 
13 753  ASN n 
13 754  HIS n 
13 755  LEU n 
14 1    MET n 
14 2    ALA n 
14 3    GLN n 
14 4    PHE n 
14 5    ALA n 
14 6    PHE n 
14 7    GLU n 
14 8    SER n 
14 9    ASP n 
14 10   LEU n 
14 11   HIS n 
14 12   SER n 
14 13   LEU n 
14 14   LEU n 
14 15   GLN n 
14 16   LEU n 
14 17   ASP n 
14 18   ALA n 
14 19   PRO n 
14 20   ILE n 
14 21   PRO n 
14 22   ASN n 
14 23   ALA n 
14 24   PRO n 
14 25   PRO n 
14 26   ALA n 
14 27   ARG n 
14 28   TRP n 
14 29   GLN n 
14 30   ARG n 
14 31   LYS n 
14 32   ALA n 
14 33   LYS n 
14 34   GLU n 
14 35   ALA n 
14 36   ALA n 
14 37   GLY n 
14 38   PRO n 
14 39   ALA n 
14 40   PRO n 
14 41   SER n 
14 42   PRO n 
14 43   MET n 
14 44   ARG n 
14 45   ALA n 
14 46   ALA n 
14 47   ASN n 
14 48   ARG n 
14 49   SER n 
14 50   HIS n 
14 51   SER n 
14 52   ALA n 
14 53   GLY n 
14 54   ARG n 
14 55   THR n 
14 56   PRO n 
14 57   GLY n 
14 58   ARG n 
14 59   THR n 
14 60   PRO n 
14 61   GLY n 
14 62   LYS n 
14 63   SER n 
14 64   SER n 
14 65   SER n 
14 66   LYS n 
14 67   VAL n 
14 68   GLN n 
14 69   THR n 
14 70   THR n 
14 71   PRO n 
14 72   SER n 
14 73   LYS n 
14 74   PRO n 
14 75   GLY n 
14 76   GLY n 
14 77   ASP n 
14 78   ARG n 
14 79   TYR n 
14 80   ILE n 
14 81   PRO n 
14 82   HIS n 
14 83   ARG n 
14 84   SER n 
14 85   ALA n 
14 86   ALA n 
14 87   GLN n 
14 88   MET n 
14 89   GLU n 
14 90   VAL n 
14 91   ALA n 
14 92   SER n 
14 93   PHE n 
14 94   LEU n 
14 95   LEU n 
14 96   SER n 
14 97   LYS n 
14 98   GLU n 
14 99   ASN n 
14 100  GLN n 
14 101  PRO n 
14 102  GLU n 
14 103  ASN n 
14 104  SER n 
14 105  GLN n 
14 106  THR n 
14 107  PRO n 
14 108  THR n 
14 109  LYS n 
14 110  LYS n 
14 111  GLU n 
14 112  HIS n 
14 113  GLN n 
14 114  LYS n 
14 115  ALA n 
14 116  TRP n 
14 117  ALA n 
14 118  LEU n 
14 119  ASN n 
14 120  LEU n 
14 121  ASN n 
14 122  GLY n 
14 123  PHE n 
14 124  ASP n 
14 125  VAL n 
14 126  GLU n 
14 127  GLU n 
14 128  ALA n 
14 129  LYS n 
14 130  ILE n 
14 131  LEU n 
14 132  ARG n 
14 133  LEU n 
14 134  SER n 
14 135  GLY n 
14 136  LYS n 
14 137  PRO n 
14 138  GLN n 
14 139  ASN n 
14 140  ALA n 
14 141  PRO n 
14 142  GLU n 
14 143  GLY n 
14 144  TYR n 
14 145  GLN n 
14 146  ASN n 
14 147  ARG n 
14 148  LEU n 
14 149  LYS n 
14 150  VAL n 
14 151  LEU n 
14 152  TYR n 
14 153  SER n 
14 154  GLN n 
14 155  LYS n 
14 156  ALA n 
14 157  THR n 
14 158  PRO n 
14 159  GLY n 
14 160  SER n 
14 161  SER n 
14 162  ARG n 
14 163  LYS n 
14 164  THR n 
14 165  CYS n 
14 166  ARG n 
14 167  TYR n 
14 168  ILE n 
14 169  PRO n 
14 170  SER n 
14 171  LEU n 
14 172  PRO n 
14 173  ASP n 
14 174  ARG n 
14 175  ILE n 
14 176  LEU n 
14 177  ASP n 
14 178  ALA n 
14 179  PRO n 
14 180  GLU n 
14 181  ILE n 
14 182  ARG n 
14 183  ASN n 
14 184  ASP n 
14 185  TYR n 
14 186  TYR n 
14 187  LEU n 
14 188  ASN n 
14 189  LEU n 
14 190  VAL n 
14 191  ASP n 
14 192  TRP n 
14 193  SER n 
14 194  SER n 
14 195  GLY n 
14 196  ASN n 
14 197  VAL n 
14 198  LEU n 
14 199  ALA n 
14 200  VAL n 
14 201  ALA n 
14 202  LEU n 
14 203  ASP n 
14 204  ASN n 
14 205  SER n 
14 206  VAL n 
14 207  TYR n 
14 208  LEU n 
14 209  TRP n 
14 210  SER n 
14 211  ALA n 
14 212  SER n 
14 213  SER n 
14 214  GLY n 
14 215  ASP n 
14 216  ILE n 
14 217  LEU n 
14 218  GLN n 
14 219  LEU n 
14 220  LEU n 
14 221  GLN n 
14 222  MET n 
14 223  GLU n 
14 224  GLN n 
14 225  PRO n 
14 226  GLY n 
14 227  GLU n 
14 228  TYR n 
14 229  ILE n 
14 230  SER n 
14 231  SER n 
14 232  VAL n 
14 233  ALA n 
14 234  TRP n 
14 235  ILE n 
14 236  LYS n 
14 237  GLU n 
14 238  GLY n 
14 239  ASN n 
14 240  TYR n 
14 241  LEU n 
14 242  ALA n 
14 243  VAL n 
14 244  GLY n 
14 245  THR n 
14 246  SER n 
14 247  SER n 
14 248  ALA n 
14 249  GLU n 
14 250  VAL n 
14 251  GLN n 
14 252  LEU n 
14 253  TRP n 
14 254  ASP n 
14 255  VAL n 
14 256  GLN n 
14 257  GLN n 
14 258  GLN n 
14 259  LYS n 
14 260  ARG n 
14 261  LEU n 
14 262  ARG n 
14 263  ASN n 
14 264  MET n 
14 265  THR n 
14 266  SER n 
14 267  HIS n 
14 268  SER n 
14 269  ALA n 
14 270  ARG n 
14 271  VAL n 
14 272  GLY n 
14 273  SER n 
14 274  LEU n 
14 275  SER n 
14 276  TRP n 
14 277  ASN n 
14 278  SER n 
14 279  TYR n 
14 280  ILE n 
14 281  LEU n 
14 282  SER n 
14 283  SER n 
14 284  GLY n 
14 285  SER n 
14 286  ARG n 
14 287  SER n 
14 288  GLY n 
14 289  HIS n 
14 290  ILE n 
14 291  HIS n 
14 292  HIS n 
14 293  HIS n 
14 294  ASP n 
14 295  VAL n 
14 296  ARG n 
14 297  VAL n 
14 298  ALA n 
14 299  GLU n 
14 300  HIS n 
14 301  HIS n 
14 302  VAL n 
14 303  ALA n 
14 304  THR n 
14 305  LEU n 
14 306  SER n 
14 307  GLY n 
14 308  HIS n 
14 309  SER n 
14 310  GLN n 
14 311  GLU n 
14 312  VAL n 
14 313  CYS n 
14 314  GLY n 
14 315  LEU n 
14 316  ARG n 
14 317  TRP n 
14 318  ALA n 
14 319  PRO n 
14 320  ASP n 
14 321  GLY n 
14 322  ARG n 
14 323  HIS n 
14 324  LEU n 
14 325  ALA n 
14 326  SER n 
14 327  GLY n 
14 328  GLY n 
14 329  ASN n 
14 330  ASP n 
14 331  ASN n 
14 332  LEU n 
14 333  VAL n 
14 334  ASN n 
14 335  VAL n 
14 336  TRP n 
14 337  PRO n 
14 338  SER n 
14 339  ALA n 
14 340  PRO n 
14 341  GLY n 
14 342  GLU n 
14 343  GLY n 
14 344  GLY n 
14 345  TRP n 
14 346  VAL n 
14 347  PRO n 
14 348  LEU n 
14 349  GLN n 
14 350  THR n 
14 351  PHE n 
14 352  THR n 
14 353  GLN n 
14 354  HIS n 
14 355  GLN n 
14 356  GLY n 
14 357  ALA n 
14 358  VAL n 
14 359  LYS n 
14 360  ALA n 
14 361  VAL n 
14 362  ALA n 
14 363  TRP n 
14 364  CYS n 
14 365  PRO n 
14 366  TRP n 
14 367  GLN n 
14 368  SER n 
14 369  ASN n 
14 370  VAL n 
14 371  LEU n 
14 372  ALA n 
14 373  THR n 
14 374  GLY n 
14 375  GLY n 
14 376  GLY n 
14 377  THR n 
14 378  SER n 
14 379  ASP n 
14 380  ARG n 
14 381  HIS n 
14 382  ILE n 
14 383  ARG n 
14 384  ILE n 
14 385  TRP n 
14 386  ASN n 
14 387  VAL n 
14 388  CYS n 
14 389  SER n 
14 390  GLY n 
14 391  ALA n 
14 392  CYS n 
14 393  LEU n 
14 394  SER n 
14 395  ALA n 
14 396  VAL n 
14 397  ASP n 
14 398  ALA n 
14 399  HIS n 
14 400  SER n 
14 401  GLN n 
14 402  VAL n 
14 403  CYS n 
14 404  SER n 
14 405  ILE n 
14 406  LEU n 
14 407  TRP n 
14 408  SER n 
14 409  PRO n 
14 410  HIS n 
14 411  TYR n 
14 412  LYS n 
14 413  GLU n 
14 414  LEU n 
14 415  ILE n 
14 416  SER n 
14 417  GLY n 
14 418  HIS n 
14 419  GLY n 
14 420  PHE n 
14 421  ALA n 
14 422  GLN n 
14 423  ASN n 
14 424  GLN n 
14 425  LEU n 
14 426  VAL n 
14 427  ILE n 
14 428  TRP n 
14 429  LYS n 
14 430  TYR n 
14 431  PRO n 
14 432  THR n 
14 433  MET n 
14 434  ALA n 
14 435  LYS n 
14 436  VAL n 
14 437  ALA n 
14 438  GLU n 
14 439  LEU n 
14 440  LYS n 
14 441  GLY n 
14 442  HIS n 
14 443  THR n 
14 444  SER n 
14 445  ARG n 
14 446  VAL n 
14 447  LEU n 
14 448  SER n 
14 449  LEU n 
14 450  THR n 
14 451  MET n 
14 452  SER n 
14 453  PRO n 
14 454  ASP n 
14 455  GLY n 
14 456  ALA n 
14 457  THR n 
14 458  VAL n 
14 459  ALA n 
14 460  SER n 
14 461  ALA n 
14 462  ALA n 
14 463  ALA n 
14 464  ASP n 
14 465  GLU n 
14 466  THR n 
14 467  LEU n 
14 468  ARG n 
14 469  LEU n 
14 470  TRP n 
14 471  ARG n 
14 472  CYS n 
14 473  PHE n 
14 474  GLU n 
14 475  LEU n 
14 476  ASP n 
14 477  PRO n 
14 478  ALA n 
14 479  ARG n 
14 480  ARG n 
14 481  ARG n 
14 482  GLU n 
14 483  ARG n 
14 484  GLU n 
14 485  LYS n 
14 486  ALA n 
14 487  SER n 
14 488  ALA n 
14 489  ALA n 
14 490  LYS n 
14 491  SER n 
14 492  SER n 
14 493  LEU n 
14 494  ILE n 
14 495  HIS n 
14 496  GLN n 
14 497  GLY n 
14 498  ILE n 
14 499  ARG n 
15 1    GLN n 
15 2    ASN n 
15 3    SER n 
15 4    ALA n 
15 5    SER n 
15 6    LYS n 
15 7    ARG n 
15 8    SER n 
15 9    LEU n 
15 10   TYR n 
15 11   SER n 
15 12   LEU n 
15 13   GLN n 
15 14   SER n 
15 15   ILE n 
15 16   SER n 
15 17   LYS n 
15 18   ARG n 
15 19   SER n 
15 20   LEU n 
15 21   ASN n 
15 22   LEU n 
15 23   ASN n 
15 24   ASP n 
15 25   LEU n 
15 26   LEU n 
15 27   VAL n 
15 28   PHE n 
15 29   ASP n 
15 30   ASP n 
15 31   PRO n 
15 32   LEU n 
15 33   PRO n 
15 34   SER n 
15 35   LYS n 
15 36   LYS n 
15 37   PRO n 
15 38   ALA n 
15 39   SER n 
15 40   GLU n 
15 41   ASN n 
15 42   VAL n 
15 43   ASN n 
15 44   LYS n 
15 45   SER n 
15 46   GLU n 
15 47   PRO n 
15 48   HIS n 
15 49   SER n 
15 50   LEU n 
15 51   GLU n 
15 52   SER n 
15 53   ASP n 
15 54   SER n 
15 55   ASP n 
15 56   PHE n 
15 57   GLU n 
15 58   ILE n 
15 59   LEU n 
15 60   CYS n 
15 61   ASP n 
15 62   GLN n 
15 63   ILE n 
15 64   LEU n 
15 65   PHE n 
15 66   GLY n 
15 67   ASN n 
15 68   ALA n 
15 69   LEU n 
15 70   ASP n 
15 71   ARG n 
15 72   ILE n 
15 73   LEU n 
15 74   GLU n 
15 75   GLU n 
15 76   GLU n 
15 77   GLU n 
15 78   ASP n 
15 79   ASN n 
15 80   GLU n 
15 81   LYS n 
15 82   GLU n 
15 83   ARG n 
15 84   ASP n 
15 85   THR n 
15 86   GLN n 
15 87   ARG n 
15 88   GLN n 
15 89   ARG n 
15 90   GLN n 
15 91   ASN n 
15 92   ASP n 
15 93   THR n 
15 94   LYS n 
15 95   SER n 
15 96   SER n 
15 97   ALA n 
15 98   ASP n 
15 99   THR n 
15 100  PHE n 
15 101  THR n 
15 102  ILE n 
15 103  SER n 
15 104  GLY n 
15 105  VAL n 
15 106  SER n 
15 107  THR n 
15 108  ASN n 
15 109  LYS n 
15 110  GLU n 
15 111  ASN n 
15 112  GLU n 
15 113  GLY n 
15 114  PRO n 
15 115  GLU n 
15 116  TYR n 
15 117  PRO n 
15 118  THR n 
15 119  LYS n 
15 120  ILE n 
15 121  GLU n 
15 122  LYS n 
15 123  ASN n 
15 124  GLN n 
15 125  PHE n 
15 126  ASN n 
15 127  MET n 
15 128  SER n 
15 129  TYR n 
15 130  LYS n 
15 131  PRO n 
15 132  SER n 
15 133  GLU n 
15 134  ASN n 
15 135  MET n 
15 136  SER n 
15 137  GLY n 
15 138  LEU n 
15 139  SER n 
15 140  SER n 
15 141  PHE n 
15 142  PRO n 
15 143  ILE n 
15 144  PHE n 
15 145  GLU n 
15 146  LYS n 
15 147  GLU n 
15 148  ASN n 
15 149  THR n 
15 150  LEU n 
15 151  SER n 
15 152  SER n 
15 153  SER n 
15 154  TYR n 
15 155  LEU n 
15 156  GLU n 
15 157  GLU n 
15 158  GLN n 
15 159  LYS n 
15 160  PRO n 
15 161  LYS n 
15 162  ARG n 
15 163  ALA n 
15 164  ALA n 
15 165  LEU n 
15 166  SER n 
15 167  ASP n 
15 168  ILE n 
15 169  THR n 
15 170  ASN n 
15 171  SER n 
15 172  PHE n 
15 173  ASN n 
15 174  LYS n 
15 175  MET n 
15 176  ASN n 
15 177  LYS n 
15 178  GLN n 
15 179  GLU n 
15 180  GLY n 
15 181  MET n 
15 182  ARG n 
15 183  ILE n 
15 184  GLU n 
15 185  LYS n 
15 186  LYS n 
15 187  ILE n 
15 188  GLN n 
15 189  ARG n 
15 190  GLU n 
15 191  GLN n 
15 192  LEU n 
15 193  GLN n 
15 194  LYS n 
15 195  LYS n 
15 196  ASN n 
15 197  ASP n 
15 198  ARG n 
15 199  PRO n 
15 200  SER n 
15 201  PRO n 
15 202  LEU n 
15 203  LYS n 
15 204  PRO n 
15 205  ILE n 
15 206  GLN n 
16 1    MET n 
16 2    ASP n 
16 3    PRO n 
16 4    GLY n 
16 5    ASP n 
16 6    ALA n 
16 7    ALA n 
16 8    ILE n 
16 9    LEU n 
16 10   GLU n 
16 11   SER n 
16 12   SER n 
16 13   LEU n 
16 14   ARG n 
16 15   ILE n 
16 16   LEU n 
16 17   TYR n 
16 18   ARG n 
16 19   LEU n 
16 20   PHE n 
16 21   GLU n 
16 22   SER n 
16 23   VAL n 
16 24   LEU n 
16 25   PRO n 
16 26   PRO n 
16 27   LEU n 
16 28   PRO n 
16 29   ALA n 
16 30   ALA n 
16 31   LEU n 
16 32   GLN n 
16 33   SER n 
16 34   ARG n 
16 35   MET n 
16 36   ASN n 
16 37   VAL n 
16 38   ILE n 
16 39   ASP n 
16 40   HIS n 
16 41   VAL n 
16 42   ARG n 
16 43   ASP n 
16 44   MET n 
16 45   ALA n 
16 46   ALA n 
16 47   ALA n 
16 48   GLY n 
16 49   LEU n 
16 50   HIS n 
16 51   SER n 
16 52   ASN n 
16 53   VAL n 
16 54   ARG n 
16 55   LEU n 
16 56   LEU n 
16 57   SER n 
16 58   SER n 
16 59   LEU n 
16 60   LEU n 
16 61   LEU n 
16 62   THR n 
16 63   MET n 
16 64   SER n 
16 65   ASN n 
16 66   ASN n 
16 67   ASN n 
16 68   PRO n 
16 69   GLU n 
16 70   LEU n 
16 71   PHE n 
16 72   SER n 
16 73   PRO n 
16 74   PRO n 
16 75   GLN n 
16 76   LYS n 
16 77   TYR n 
16 78   GLN n 
16 79   LEU n 
16 80   LEU n 
16 81   VAL n 
16 82   TYR n 
16 83   HIS n 
16 84   ALA n 
16 85   ASP n 
16 86   SER n 
16 87   LEU n 
16 88   PHE n 
16 89   HIS n 
16 90   ASP n 
16 91   LYS n 
16 92   GLU n 
16 93   TYR n 
16 94   ARG n 
16 95   ASN n 
16 96   ALA n 
16 97   VAL n 
16 98   SER n 
16 99   LYS n 
16 100  TYR n 
16 101  THR n 
16 102  MET n 
16 103  ALA n 
16 104  LEU n 
16 105  GLN n 
16 106  GLN n 
16 107  LYS n 
16 108  LYS n 
16 109  ALA n 
16 110  LEU n 
16 111  SER n 
16 112  LYS n 
16 113  THR n 
16 114  SER n 
16 115  LYS n 
16 116  VAL n 
16 117  ARG n 
16 118  PRO n 
16 119  SER n 
16 120  THR n 
16 121  GLY n 
16 122  ASN n 
16 123  SER n 
16 124  ALA n 
16 125  SER n 
16 126  THR n 
16 127  PRO n 
16 128  GLN n 
16 129  SER n 
16 130  GLN n 
16 131  CYS n 
16 132  LEU n 
16 133  PRO n 
16 134  SER n 
16 135  GLU n 
16 136  ILE n 
16 137  GLU n 
16 138  VAL n 
16 139  LYS n 
16 140  TYR n 
16 141  LYS n 
16 142  MET n 
16 143  ALA n 
16 144  GLU n 
16 145  CYS n 
16 146  TYR n 
16 147  THR n 
16 148  MET n 
16 149  LEU n 
16 150  LYS n 
16 151  GLN n 
16 152  ASP n 
16 153  LYS n 
16 154  ASP n 
16 155  ALA n 
16 156  ILE n 
16 157  ALA n 
16 158  ILE n 
16 159  LEU n 
16 160  ASP n 
16 161  GLY n 
16 162  ILE n 
16 163  PRO n 
16 164  SER n 
16 165  ARG n 
16 166  GLN n 
16 167  ARG n 
16 168  THR n 
16 169  PRO n 
16 170  LYS n 
16 171  ILE n 
16 172  ASN n 
16 173  MET n 
16 174  MET n 
16 175  LEU n 
16 176  ALA n 
16 177  ASN n 
16 178  LEU n 
16 179  TYR n 
16 180  LYS n 
16 181  LYS n 
16 182  ALA n 
16 183  GLY n 
16 184  GLN n 
16 185  GLU n 
16 186  ARG n 
16 187  PRO n 
16 188  SER n 
16 189  VAL n 
16 190  THR n 
16 191  SER n 
16 192  TYR n 
16 193  LYS n 
16 194  GLU n 
16 195  VAL n 
16 196  LEU n 
16 197  ARG n 
16 198  GLN n 
16 199  CYS n 
16 200  PRO n 
16 201  LEU n 
16 202  ALA n 
16 203  LEU n 
16 204  ASP n 
16 205  ALA n 
16 206  ILE n 
16 207  LEU n 
16 208  GLY n 
16 209  LEU n 
16 210  LEU n 
16 211  SER n 
16 212  LEU n 
16 213  SER n 
16 214  VAL n 
16 215  LYS n 
16 216  GLY n 
16 217  ALA n 
16 218  GLU n 
16 219  VAL n 
16 220  ALA n 
16 221  SER n 
16 222  MET n 
16 223  THR n 
16 224  MET n 
16 225  ASN n 
16 226  VAL n 
16 227  ILE n 
16 228  GLN n 
16 229  THR n 
16 230  VAL n 
16 231  PRO n 
16 232  ASN n 
16 233  LEU n 
16 234  ASP n 
16 235  TRP n 
16 236  LEU n 
16 237  SER n 
16 238  VAL n 
16 239  TRP n 
16 240  ILE n 
16 241  LYS n 
16 242  ALA n 
16 243  TYR n 
16 244  ALA n 
16 245  PHE n 
16 246  VAL n 
16 247  HIS n 
16 248  THR n 
16 249  GLY n 
16 250  ASP n 
16 251  ASN n 
16 252  SER n 
16 253  ARG n 
16 254  ALA n 
16 255  ILE n 
16 256  SER n 
16 257  THR n 
16 258  ILE n 
16 259  CYS n 
16 260  SER n 
16 261  LEU n 
16 262  GLU n 
16 263  LYS n 
16 264  LYS n 
16 265  SER n 
16 266  LEU n 
16 267  LEU n 
16 268  ARG n 
16 269  ASP n 
16 270  ASN n 
16 271  VAL n 
16 272  ASP n 
16 273  LEU n 
16 274  LEU n 
16 275  GLY n 
16 276  SER n 
16 277  LEU n 
16 278  ALA n 
16 279  ASP n 
16 280  LEU n 
16 281  TYR n 
16 282  PHE n 
16 283  ARG n 
16 284  ALA n 
16 285  GLY n 
16 286  ASP n 
16 287  ASN n 
16 288  LYS n 
16 289  ASN n 
16 290  SER n 
16 291  VAL n 
16 292  LEU n 
16 293  LYS n 
16 294  PHE n 
16 295  GLU n 
16 296  GLN n 
16 297  ALA n 
16 298  GLN n 
16 299  MET n 
16 300  LEU n 
16 301  ASP n 
16 302  PRO n 
16 303  TYR n 
16 304  LEU n 
16 305  ILE n 
16 306  LYS n 
16 307  GLY n 
16 308  MET n 
16 309  ASP n 
16 310  VAL n 
16 311  TYR n 
16 312  GLY n 
16 313  TYR n 
16 314  LEU n 
16 315  LEU n 
16 316  ALA n 
16 317  ARG n 
16 318  GLU n 
16 319  GLY n 
16 320  ARG n 
16 321  LEU n 
16 322  GLU n 
16 323  ASP n 
16 324  VAL n 
16 325  GLU n 
16 326  ASN n 
16 327  LEU n 
16 328  GLY n 
16 329  CYS n 
16 330  ARG n 
16 331  LEU n 
16 332  PHE n 
16 333  ASN n 
16 334  ILE n 
16 335  SER n 
16 336  ASP n 
16 337  GLN n 
16 338  HIS n 
16 339  ALA n 
16 340  GLU n 
16 341  PRO n 
16 342  TRP n 
16 343  VAL n 
16 344  VAL n 
16 345  SER n 
16 346  GLY n 
16 347  CYS n 
16 348  HIS n 
16 349  SER n 
16 350  PHE n 
16 351  TYR n 
16 352  SER n 
16 353  LYS n 
16 354  ARG n 
16 355  TYR n 
16 356  SER n 
16 357  ARG n 
16 358  ALA n 
16 359  LEU n 
16 360  TYR n 
16 361  LEU n 
16 362  GLY n 
16 363  ALA n 
16 364  LYS n 
16 365  ALA n 
16 366  ILE n 
16 367  GLN n 
16 368  LEU n 
16 369  ASN n 
16 370  SER n 
16 371  ASN n 
16 372  SER n 
16 373  VAL n 
16 374  GLN n 
16 375  ALA n 
16 376  LEU n 
16 377  LEU n 
16 378  LEU n 
16 379  LYS n 
16 380  GLY n 
16 381  ALA n 
16 382  ALA n 
16 383  LEU n 
16 384  ARG n 
16 385  ASN n 
16 386  MET n 
16 387  GLY n 
16 388  ARG n 
16 389  VAL n 
16 390  GLN n 
16 391  GLU n 
16 392  ALA n 
16 393  ILE n 
16 394  ILE n 
16 395  HIS n 
16 396  PHE n 
16 397  ARG n 
16 398  GLU n 
16 399  ALA n 
16 400  ILE n 
16 401  ARG n 
16 402  LEU n 
16 403  ALA n 
16 404  PRO n 
16 405  CYS n 
16 406  ARG n 
16 407  LEU n 
16 408  ASP n 
16 409  CYS n 
16 410  TYR n 
16 411  GLU n 
16 412  GLY n 
16 413  LEU n 
16 414  ILE n 
16 415  GLU n 
16 416  CYS n 
16 417  TYR n 
16 418  LEU n 
16 419  ALA n 
16 420  SER n 
16 421  ASN n 
16 422  SER n 
16 423  ILE n 
16 424  ARG n 
16 425  GLU n 
16 426  ALA n 
16 427  MET n 
16 428  VAL n 
16 429  MET n 
16 430  ALA n 
16 431  ASN n 
16 432  ASN n 
16 433  VAL n 
16 434  TYR n 
16 435  LYS n 
16 436  THR n 
16 437  LEU n 
16 438  GLY n 
16 439  ALA n 
16 440  ASN n 
16 441  ALA n 
16 442  GLN n 
16 443  THR n 
16 444  LEU n 
16 445  THR n 
16 446  LEU n 
16 447  LEU n 
16 448  ALA n 
16 449  THR n 
16 450  VAL n 
16 451  CYS n 
16 452  LEU n 
16 453  GLU n 
16 454  ASP n 
16 455  PRO n 
16 456  VAL n 
16 457  THR n 
16 458  GLN n 
16 459  GLU n 
16 460  LYS n 
16 461  ALA n 
16 462  LYS n 
16 463  THR n 
16 464  LEU n 
16 465  LEU n 
16 466  ASP n 
16 467  LYS n 
16 468  ALA n 
16 469  LEU n 
16 470  THR n 
16 471  GLN n 
16 472  ARG n 
16 473  PRO n 
16 474  ASP n 
16 475  TYR n 
16 476  ILE n 
16 477  LYS n 
16 478  ALA n 
16 479  VAL n 
16 480  VAL n 
16 481  LYS n 
16 482  LYS n 
16 483  ALA n 
16 484  GLU n 
16 485  LEU n 
16 486  LEU n 
16 487  SER n 
16 488  ARG n 
16 489  GLU n 
16 490  GLN n 
16 491  LYS n 
16 492  TYR n 
16 493  GLU n 
16 494  ASP n 
16 495  GLY n 
16 496  ILE n 
16 497  ALA n 
16 498  LEU n 
16 499  LEU n 
16 500  ARG n 
16 501  ASN n 
16 502  ALA n 
16 503  LEU n 
16 504  ALA n 
16 505  ASN n 
16 506  GLN n 
16 507  SER n 
16 508  ASP n 
16 509  CYS n 
16 510  VAL n 
16 511  LEU n 
16 512  HIS n 
16 513  ARG n 
16 514  ILE n 
16 515  LEU n 
16 516  GLY n 
16 517  ASP n 
16 518  PHE n 
16 519  LEU n 
16 520  VAL n 
16 521  ALA n 
16 522  VAL n 
16 523  ASN n 
16 524  GLU n 
16 525  TYR n 
16 526  GLN n 
16 527  GLU n 
16 528  ALA n 
16 529  MET n 
16 530  ASP n 
16 531  GLN n 
16 532  TYR n 
16 533  SER n 
16 534  ILE n 
16 535  ALA n 
16 536  LEU n 
16 537  SER n 
16 538  LEU n 
16 539  ASP n 
16 540  PRO n 
16 541  ASN n 
16 542  ASP n 
16 543  GLN n 
16 544  LYS n 
16 545  SER n 
16 546  LEU n 
16 547  GLU n 
16 548  GLY n 
16 549  MET n 
16 550  GLN n 
16 551  LYS n 
16 552  MET n 
16 553  GLU n 
16 554  LYS n 
16 555  GLU n 
16 556  GLU n 
16 557  SER n 
16 558  PRO n 
16 559  THR n 
16 560  ASP n 
16 561  ALA n 
16 562  THR n 
16 563  GLN n 
16 564  GLU n 
16 565  GLU n 
16 566  ASP n 
16 567  VAL n 
16 568  ASP n 
16 569  ASP n 
16 570  MET n 
16 571  GLU n 
16 572  GLY n 
16 573  SER n 
16 574  GLY n 
16 575  GLU n 
16 576  GLU n 
16 577  GLY n 
16 578  ASP n 
16 579  LEU n 
16 580  GLU n 
16 581  GLY n 
16 582  SER n 
16 583  ASP n 
16 584  SER n 
16 585  GLU n 
16 586  ALA n 
16 587  ALA n 
16 588  GLN n 
16 589  TRP n 
16 590  ALA n 
16 591  ASP n 
16 592  GLN n 
16 593  GLU n 
16 594  GLN n 
16 595  TRP n 
16 596  PHE n 
16 597  GLY n 
16 598  MET n 
16 599  GLN n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1  1 sample ? ? ? HUMAN           ? ? ? ? ? ? ? ? 'HOMO SAPIENS'             9606 ? ? ? ? ? ? ? 'FALL ARMYWORM' 
'SPODOPTERA FRUGIPERDA' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? BACULOVIRUS ? ? ? 'PF1, PU1'              ? ? 
2  1 sample ? ? ? HUMAN           ? ? ? ? ? ? ? ? 'HOMO SAPIENS'             9606 ? ? ? ? ? ? ? 'FALL ARMYWORM' 
'SPODOPTERA FRUGIPERDA' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? BACULOVIRUS ? ? ? 'PF1, PU1'              ? ? 
3  1 sample ? ? ? HUMAN           ? ? ? ? ? ? ? ? 'HOMO SAPIENS'             9606 ? ? ? ? ? ? ? 'FALL ARMYWORM' 
'SPODOPTERA FRUGIPERDA' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? BACULOVIRUS ? ? ? 'PF1, PU1'              ? ? 
4  1 sample ? ? ? HUMAN           ? ? ? ? ? ? ? ? 'HOMO SAPIENS'             9606 ? ? ? ? ? ? ? 'FALL ARMYWORM' 
'SPODOPTERA FRUGIPERDA' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? BACULOVIRUS ? ? ? 'PF1, PU1'              ? ? 
5  1 sample ? ? ? HUMAN           ? ? ? ? ? ? ? ? 'HOMO SAPIENS'             9606 ? ? ? ? ? ? ? 'FALL ARMYWORM' 
'SPODOPTERA FRUGIPERDA' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? BACULOVIRUS ? ? ? 'PF1, PU1'              ? ? 
6  1 sample ? ? ? HUMAN           ? ? ? ? ? ? ? ? 'HOMO SAPIENS'             9606 ? ? ? ? ? ? ? 'FALL ARMYWORM' 
'SPODOPTERA FRUGIPERDA' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? BACULOVIRUS ? ? ? 'PF1, PU1'              ? ? 
7  1 sample ? ? ? HUMAN           ? ? ? ? ? ? ? ? 'HOMO SAPIENS'             9606 ? ? ? ? ? ? ? 'FALL ARMYWORM' 
'SPODOPTERA FRUGIPERDA' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? BACULOVIRUS ? ? ? 'PF1, PU1'              ? ? 
8  1 sample ? ? ? HUMAN           ? ? ? ? ? ? ? ? 'HOMO SAPIENS'             9606 ? ? ? ? ? ? ? 'FALL ARMYWORM' 
'SPODOPTERA FRUGIPERDA' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? BACULOVIRUS ? ? ? 'PF1, PU1'              ? ? 
9  1 sample ? ? ? HUMAN           ? ? ? ? ? ? ? ? 'HOMO SAPIENS'             9606 ? ? ? ? ? ? ? 'FALL ARMYWORM' 
'SPODOPTERA FRUGIPERDA' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? BACULOVIRUS ? ? ? 'PF1, PU1'              ? ? 
10 1 sample ? ? ? HUMAN           ? ? ? ? ? ? ? ? 'HOMO SAPIENS'             9606 ? ? ? ? ? ? ? 'FALL ARMYWORM' 
'SPODOPTERA FRUGIPERDA' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? BACULOVIRUS ? ? ? 'PF1, PU1'              ? ? 
11 1 sample ? ? ? HUMAN           ? ? ? ? ? ? ? ? 'HOMO SAPIENS'             9606 ? ? ? ? ? ? ? 'FALL ARMYWORM' 
'SPODOPTERA FRUGIPERDA' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? BACULOVIRUS ? ? ? 'PF1, PU1'              ? ? 
12 1 sample ? ? ? HUMAN           ? ? ? ? ? ? ? ? 'HOMO SAPIENS'             9606 ? ? ? ? ? ? ? 'FALL ARMYWORM' 
'SPODOPTERA FRUGIPERDA' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? BACULOVIRUS ? ? ? 'PF1, PU1'              ? ? 
13 1 sample ? ? ? HUMAN           ? ? ? ? ? ? ? ? 'HOMO SAPIENS'             9606 ? ? ? ? ? ? ? 'FALL ARMYWORM' 
'SPODOPTERA FRUGIPERDA' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? BACULOVIRUS ? ? ? 'PF1, PU1'              ? ? 
14 1 sample ? ? ? HUMAN           ? ? ? ? ? ? ? ? 'HOMO SAPIENS'             9606 ? ? ? ? ? ? ? 'FALL ARMYWORM' 
'SPODOPTERA FRUGIPERDA' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? BACULOVIRUS ? ? ? 'MODIFIED PFASTBAC HTA' ? ? 
15 1 sample ? ? ? 
;BAKER'S YEAST
;
? ? ? ? ? ? ? ? 'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ?               'ESCHERICHIA COLI'      562  ? ? ? ? ? ? ? ? ? ? ? ? 
? ? ?           ? ? ? PET28A                  ? ? 
16 1 sample ? ? ? HUMAN           ? ? ? ? ? ? ? ? 'HOMO SAPIENS'             9606 ? ? ? ? ? ? ? 'FALL ARMYWORM' 
'SPODOPTERA FRUGIPERDA' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? BACULOVIRUS ? ? ? 'PF1, PU1'              ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1  UNP APC1_HUMAN  1  ? ? Q9H1A4 ? 
2  UNP APC11_HUMAN 2  ? ? Q9NYG5 ? 
3  UNP CDC23_HUMAN 3  ? ? Q9UJX2 ? 
4  UNP APC15_HUMAN 4  ? ? P60006 ? 
5  UNP APC16_HUMAN 5  ? ? Q96DE5 ? 
6  UNP CDC27_HUMAN 6  ? ? P30260 ? 
7  UNP CDC26_HUMAN 7  ? ? Q8NHZ8 ? 
8  UNP APC4_HUMAN  8  ? ? Q9UJX5 ? 
9  UNP CDC16_HUMAN 9  ? ? Q13042 ? 
10 UNP APC10_HUMAN 10 ? ? Q9UM13 ? 
11 UNP APC13_HUMAN 11 ? ? Q9BS18 ? 
12 UNP ANC2_HUMAN  12 ? ? Q9UJX6 ? 
13 UNP APC5_HUMAN  13 ? ? Q9UJX4 ? 
14 UNP CDC20_HUMAN 14 ? ? Q12834 ? 
15 UNP HSL1_YEAST  15 ? ? P34244 ? 
16 UNP APC7_HUMAN  16 ? ? Q9UJX3 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  5G04 A 1 ? 1943 ? Q9H1A4 1   ? 1944 ? 1   1944 
2  2  5G04 B 1 ? 84   ? Q9NYG5 1   ? 84   ? 1   84   
3  3  5G04 C 1 ? 597  ? Q9UJX2 1   ? 597  ? 1   597  
4  4  5G04 D 1 ? 121  ? P60006 1   ? 121  ? 1   121  
5  5  5G04 E 1 ? 110  ? Q96DE5 1   ? 110  ? 1   110  
6  6  5G04 F 1 ? 824  ? P30260 1   ? 824  ? 1   824  
7  7  5G04 G 1 ? 85   ? Q8NHZ8 1   ? 85   ? 1   85   
8  6  5G04 H 1 ? 824  ? P30260 1   ? 824  ? 1   824  
9  8  5G04 I 1 ? 808  ? Q9UJX5 1   ? 808  ? 1   808  
10 9  5G04 J 1 ? 620  ? Q13042 1   ? 620  ? 1   620  
11 9  5G04 K 1 ? 620  ? Q13042 1   ? 620  ? 1   620  
12 10 5G04 L 1 ? 184  ? Q9UM13 1   ? 185  ? 1   184  
13 11 5G04 M 1 ? 74   ? Q9BS18 1   ? 74   ? 1   74   
14 12 5G04 N 1 ? 822  ? Q9UJX6 1   ? 822  ? 1   822  
15 13 5G04 O 1 ? 755  ? Q9UJX4 1   ? 755  ? 1   755  
16 3  5G04 P 1 ? 597  ? Q9UJX2 1   ? 597  ? 1   597  
17 14 5G04 R 1 ? 499  ? Q12834 1   ? 499  ? 1   499  
18 15 5G04 S 1 ? 206  ? P34244 667 ? 872  ? 667 872  
19 7  5G04 W 1 ? 85   ? Q8NHZ8 1   ? 85   ? 1   85   
20 16 5G04 X 1 ? 599  ? Q9UJX3 1   ? 599  ? 1   599  
21 16 5G04 Y 1 ? 599  ? Q9UJX3 1   ? 599  ? 1   599  
# 
_struct_ref_seq_dif.align_id                     12 
_struct_ref_seq_dif.pdbx_pdb_id_code             5G04 
_struct_ref_seq_dif.mon_id                       ? 
_struct_ref_seq_dif.pdbx_pdb_strand_id           L 
_struct_ref_seq_dif.seq_num                      ? 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   Q9UM13 
_struct_ref_seq_dif.db_mon_id                    ARG 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          172 
_struct_ref_seq_dif.details                      deletion 
_struct_ref_seq_dif.pdbx_auth_seq_num            ? 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.entry_id          5G04 
_exptl.method            'ELECTRON MICROSCOPY' 
_exptl.crystals_number   ? 
# 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.entry_id                                 5G04 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            4.00 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'ELECTRON MICROSCOPY' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        65459 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         3 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               65462 
_refine_hist.d_res_high                       4.00 
_refine_hist.d_res_low                        . 
# 
_struct.entry_id                  5G04 
_struct.title                     'Structure of the human APC-Cdc20-Hsl1 complex' 
_struct.pdbx_descriptor           
;ANAPHASE-PROMOTING COMPLEX SUBUNIT 1, ANAPHASE-PROMOTING COMPLEX SUBUNIT 11, CELL DIVISION CYCLE PROTEIN 23 HOMOLOG, ANAPHASE-PROMOTING COMPLEX SUBUNIT 15, ANAPHASE-PROMOTING COMPLEX SUBUNIT 16, CELL DIVISION CYCLE PROTEIN 27 HOMOLOG, ANAPHASE-PROMOTING COMPLEX SUBUNIT CDC26, ANAPHASE-PROMOTING COMPLEX SUBUNIT 4, CELL DIVISION CYCLE PROTEIN 16 HOMOLOG, ANAPHASE-PROMOTING COMPLEX SUBUNIT 10, ANAPHASE-PROMOTING COMPLEX SUBUNIT 13, ANAPHASE-PROMOTING COMPLEX SUBUNIT 2, ANAPHASE-PROMOTING COMPLEX SUBUNIT 5, CELL DIVISION CYCLE PROTEIN 20 HOMOLOG, PROBABLE SERINE/THREONINE-PROTEIN KINASE HSL1 (E.C.2.7.11.1), ANAPHASE-PROMOTING COMPLEX SUBUNIT 7
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        5G04 
_struct_keywords.pdbx_keywords   'CELL CYCLE' 
_struct_keywords.text            'CELL CYCLE, PHOSPHORYLATION, MITOSIS, UBIQUITINATION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 5  ? 
F N N 6  ? 
G N N 7  ? 
H N N 6  ? 
I N N 8  ? 
J N N 9  ? 
K N N 9  ? 
L N N 10 ? 
M N N 11 ? 
N N N 12 ? 
O N N 13 ? 
P N N 3  ? 
Q N N 14 ? 
R N N 15 ? 
S N N 7  ? 
T N N 16 ? 
U N N 16 ? 
V N N 17 ? 
W N N 17 ? 
X N N 17 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   PHE A 23   ? CYS A 28   ? PHE A 23   CYS A 28   1 ? 6  
HELX_P HELX_P2   2   SER A 615  ? LEU A 629  ? SER A 615  LEU A 629  1 ? 15 
HELX_P HELX_P3   3   LYS A 631  ? SER A 646  ? LYS A 631  SER A 646  1 ? 16 
HELX_P HELX_P4   4   SER A 655  ? GLY A 669  ? SER A 655  GLY A 669  1 ? 15 
HELX_P HELX_P5   5   HIS A 758  ? LEU A 775  ? HIS A 758  LEU A 775  1 ? 18 
HELX_P HELX_P6   6   GLU A 781  ? LEU A 790  ? GLU A 781  LEU A 790  1 ? 10 
HELX_P HELX_P7   7   GLY A 800  ? TYR A 810  ? GLY A 800  TYR A 810  1 ? 11 
HELX_P HELX_P8   8   SER A 843  ? GLY A 854  ? SER A 843  GLY A 854  1 ? 12 
HELX_P HELX_P9   9   CYS A 867  ? LEU A 882  ? CYS A 867  LEU A 882  1 ? 16 
HELX_P HELX_P10  10  SER A 924  ? VAL A 937  ? SER A 924  VAL A 937  1 ? 14 
HELX_P HELX_P11  11  THR A 940  ? GLU A 945  ? THR A 940  GLU A 945  1 ? 6  
HELX_P HELX_P12  12  PRO A 948  ? GLN A 965  ? PRO A 948  GLN A 965  1 ? 18 
HELX_P HELX_P13  13  PRO A 971  ? ILE A 978  ? PRO A 971  ILE A 978  1 ? 8  
HELX_P HELX_P14  14  ARG A 980  ? LYS A 985  ? ARG A 980  LYS A 985  5 ? 6  
HELX_P HELX_P15  15  ASN A 1020 ? TRP A 1028 ? ASN A 1020 TRP A 1028 1 ? 9  
HELX_P HELX_P16  16  LEU A 1032 ? GLN A 1042 ? LEU A 1032 GLN A 1042 1 ? 11 
HELX_P HELX_P17  17  SER A 1058 ? THR A 1088 ? SER A 1058 THR A 1088 1 ? 31 
HELX_P HELX_P18  18  THR A 1132 ? LYS A 1146 ? THR A 1132 LYS A 1146 1 ? 15 
HELX_P HELX_P19  19  ASP A 1154 ? ASN A 1161 ? ASP A 1154 ASN A 1161 1 ? 8  
HELX_P HELX_P20  20  LEU A 1168 ? GLY A 1183 ? LEU A 1168 GLY A 1183 1 ? 16 
HELX_P HELX_P21  21  HIS A 1184 ? LEU A 1188 ? HIS A 1184 LEU A 1188 5 ? 5  
HELX_P HELX_P22  22  ALA A 1189 ? ILE A 1193 ? ALA A 1189 ILE A 1193 5 ? 5  
HELX_P HELX_P23  23  HIS A 1201 ? LEU A 1217 ? HIS A 1201 LEU A 1217 1 ? 17 
HELX_P HELX_P24  24  ASP A 1221 ? LEU A 1228 ? ASP A 1221 LEU A 1228 1 ? 8  
HELX_P HELX_P25  25  PRO A 1246 ? TYR A 1261 ? PRO A 1246 TYR A 1261 1 ? 16 
HELX_P HELX_P26  26  HIS A 1266 ? GLY A 1278 ? HIS A 1266 GLY A 1278 1 ? 13 
HELX_P HELX_P27  27  ASP A 1290 ? LEU A 1307 ? ASP A 1290 LEU A 1307 1 ? 18 
HELX_P HELX_P28  28  ASN A 1320 ? GLY A 1331 ? ASN A 1320 GLY A 1331 1 ? 12 
HELX_P HELX_P29  29  ASN A 1359 ? TYR A 1375 ? ASN A 1359 TYR A 1375 1 ? 17 
HELX_P HELX_P30  30  ASN A 1380 ? LEU A 1387 ? ASN A 1380 LEU A 1387 1 ? 8  
HELX_P HELX_P31  31  THR A 1392 ? VAL A 1399 ? THR A 1392 VAL A 1399 1 ? 8  
HELX_P HELX_P32  32  LYS A 1400 ? LEU A 1415 ? LYS A 1400 LEU A 1415 1 ? 16 
HELX_P HELX_P33  33  ASN A 1422 ? ASN A 1429 ? ASN A 1422 ASN A 1429 1 ? 8  
HELX_P HELX_P34  34  PRO A 1431 ? ASN A 1437 ? PRO A 1431 ASN A 1437 1 ? 7  
HELX_P HELX_P35  35  ASN A 1453 ? PHE A 1476 ? ASN A 1453 PHE A 1476 1 ? 24 
HELX_P HELX_P36  36  ASN A 1481 ? SER A 1500 ? ASN A 1481 SER A 1500 1 ? 20 
HELX_P HELX_P37  37  ASN A 1503 ? GLY A 1508 ? ASN A 1503 GLY A 1508 1 ? 6  
HELX_P HELX_P38  38  GLY A 1508 ? MET A 1527 ? GLY A 1508 MET A 1527 1 ? 20 
HELX_P HELX_P39  39  ASN A 1532 ? THR A 1546 ? ASN A 1532 THR A 1546 1 ? 15 
HELX_P HELX_P40  40  ASN A 1551 ? PHE A 1566 ? ASN A 1551 PHE A 1566 1 ? 16 
HELX_P HELX_P41  41  LEU A 1567 ? GLY A 1570 ? LEU A 1567 GLY A 1570 5 ? 4  
HELX_P HELX_P42  42  ASN A 1578 ? LEU A 1588 ? ASN A 1578 LEU A 1588 1 ? 11 
HELX_P HELX_P43  43  LEU A 1603 ? HIS A 1608 ? LEU A 1603 HIS A 1608 5 ? 6  
HELX_P HELX_P44  44  LEU A 1609 ? ALA A 1613 ? LEU A 1609 ALA A 1613 1 ? 5  
HELX_P HELX_P45  45  THR A 1684 ? LYS A 1693 ? THR A 1684 LYS A 1693 1 ? 10 
HELX_P HELX_P46  46  ASP A 1744 ? CYS A 1755 ? ASP A 1744 CYS A 1755 1 ? 12 
HELX_P HELX_P47  47  LYS A 1764 ? GLN A 1781 ? LYS A 1764 GLN A 1781 1 ? 18 
HELX_P HELX_P48  48  GLU A 1785 ? ARG A 1803 ? GLU A 1785 ARG A 1803 1 ? 19 
HELX_P HELX_P49  49  THR A 1808 ? SER A 1822 ? THR A 1808 SER A 1822 1 ? 15 
HELX_P HELX_P50  50  PHE A 1844 ? GLY A 1863 ? PHE A 1844 GLY A 1863 1 ? 20 
HELX_P HELX_P51  51  GLY A 1864 ? SER A 1873 ? GLY A 1864 SER A 1873 1 ? 10 
HELX_P HELX_P52  52  GLU A 1878 ? SER A 1893 ? GLU A 1878 SER A 1893 1 ? 16 
HELX_P HELX_P53  53  SER A 1910 ? LYS A 1919 ? SER A 1911 LYS A 1920 1 ? 10 
HELX_P HELX_P54  54  PRO A 1924 ? ARG A 1930 ? PRO A 1925 ARG A 1931 1 ? 7  
HELX_P HELX_P55  55  MET B 57   ? GLN B 68   ? MET B 57   GLN B 68   1 ? 12 
HELX_P HELX_P56  56  LEU C 29   ? GLY C 47   ? LEU C 29   GLY C 47   1 ? 19 
HELX_P HELX_P57  57  LEU C 48   ? LEU C 62   ? LEU C 48   LEU C 62   1 ? 15 
HELX_P HELX_P58  58  THR C 77   ? LYS C 97   ? THR C 77   LYS C 97   1 ? 21 
HELX_P HELX_P59  59  GLU C 98   ? LEU C 106  ? GLU C 98   LEU C 106  1 ? 9  
HELX_P HELX_P60  60  LYS C 112  ? SER C 137  ? LYS C 112  SER C 137  1 ? 26 
HELX_P HELX_P61  61  ALA C 150  ? ARG C 165  ? ALA C 150  ARG C 165  1 ? 16 
HELX_P HELX_P62  62  GLY C 169  ? LEU C 182  ? GLY C 169  LEU C 182  1 ? 14 
HELX_P HELX_P63  63  LEU C 184  ? LEU C 199  ? LEU C 184  LEU C 199  1 ? 16 
HELX_P HELX_P64  64  HIS C 202  ? ILE C 213  ? HIS C 202  ILE C 213  1 ? 12 
HELX_P HELX_P65  65  ASP C 215  ? LEU C 222  ? ASP C 215  LEU C 222  1 ? 8  
HELX_P HELX_P66  66  TRP C 228  ? GLN C 242  ? TRP C 228  GLN C 242  1 ? 15 
HELX_P HELX_P67  67  LEU C 243  ? VAL C 257  ? LEU C 243  VAL C 257  1 ? 15 
HELX_P HELX_P68  68  GLY C 258  ? LYS C 261  ? GLY C 258  LYS C 261  5 ? 4  
HELX_P HELX_P69  69  SER C 262  ? ARG C 277  ? SER C 262  ARG C 277  1 ? 16 
HELX_P HELX_P70  70  ASP C 278  ? ASP C 293  ? ASP C 278  ASP C 293  1 ? 16 
HELX_P HELX_P71  71  ASN C 299  ? ARG C 310  ? ASN C 299  ARG C 310  1 ? 12 
HELX_P HELX_P72  72  MET C 312  ? ASP C 327  ? MET C 312  ASP C 327  1 ? 16 
HELX_P HELX_P73  73  ARG C 330  ? ARG C 344  ? ARG C 330  ARG C 344  1 ? 15 
HELX_P HELX_P74  74  GLN C 346  ? LEU C 360  ? GLN C 346  LEU C 360  1 ? 15 
HELX_P HELX_P75  75  LEU C 365  ? MET C 378  ? LEU C 365  MET C 378  1 ? 14 
HELX_P HELX_P76  76  ASN C 380  ? ASN C 395  ? ASN C 380  ASN C 395  1 ? 16 
HELX_P HELX_P77  77  ASP C 398  ? LEU C 412  ? ASP C 398  LEU C 412  1 ? 15 
HELX_P HELX_P78  78  MET C 414  ? GLN C 427  ? MET C 414  GLN C 427  1 ? 14 
HELX_P HELX_P79  79  ASP C 432  ? LEU C 439  ? ASP C 432  LEU C 439  1 ? 8  
HELX_P HELX_P80  80  GLU C 441  ? ASN C 447  ? GLU C 441  ASN C 447  1 ? 7  
HELX_P HELX_P81  81  GLN C 448  ? GLY C 463  ? GLN C 448  GLY C 463  1 ? 16 
HELX_P HELX_P82  82  MET C 468  ? LEU C 480  ? MET C 468  LEU C 480  1 ? 13 
HELX_P HELX_P83  83  SER C 483  ? CYS C 500  ? SER C 483  CYS C 500  1 ? 18 
HELX_P HELX_P84  84  THR C 511  ? CYS C 523  ? THR C 511  CYS C 523  1 ? 13 
HELX_P HELX_P85  85  LEU C 525  ? ASN C 540  ? LEU C 525  ASN C 540  1 ? 16 
HELX_P HELX_P86  86  ARG C 543  ? ARG C 557  ? ARG C 543  ARG C 557  1 ? 15 
HELX_P HELX_P87  87  VAL D 25   ? GLU D 46   ? VAL D 25   GLU D 46   1 ? 22 
HELX_P HELX_P88  88  ARG E 52   ? ASP E 92   ? ARG E 52   ASP E 92   1 ? 41 
HELX_P HELX_P89  89  GLU E 93   ? PHE E 96   ? GLU E 93   PHE E 96   5 ? 4  
HELX_P HELX_P90  90  PRO E 98   ? LEU E 103  ? PRO E 98   LEU E 103  1 ? 6  
HELX_P HELX_P91  91  GLU F 6    ? HIS F 18   ? GLU F 6    HIS F 18   1 ? 13 
HELX_P HELX_P92  92  ALA F 20   ? HIS F 36   ? ALA F 20   HIS F 36   1 ? 17 
HELX_P HELX_P93  93  SER F 37   ? SER F 51   ? SER F 37   SER F 51   1 ? 15 
HELX_P HELX_P94  94  LYS F 53   ? HIS F 64   ? LYS F 53   HIS F 64   1 ? 12 
HELX_P HELX_P95  95  THR F 68   ? LEU F 82   ? THR F 68   LEU F 82   1 ? 15 
HELX_P HELX_P96  96  LYS F 84   ? GLY F 94   ? LYS F 84   GLY F 94   1 ? 11 
HELX_P HELX_P97  97  HIS F 103  ? GLY F 111  ? HIS F 103  GLY F 111  1 ? 9  
HELX_P HELX_P98  98  SER F 113  ? ASP F 129  ? SER F 113  ASP F 129  1 ? 17 
HELX_P HELX_P99  99  ARG F 130  ? ASN F 145  ? ARG F 130  ASN F 145  1 ? 16 
HELX_P HELX_P100 100 LEU F 148  ? ILE F 158  ? LEU F 148  ILE F 158  1 ? 11 
HELX_P HELX_P101 101 ALA F 451  ? SER F 478  ? ALA F 451  SER F 478  1 ? 28 
HELX_P HELX_P102 102 ASN F 480  ? HIS F 490  ? ASN F 480  HIS F 490  1 ? 11 
HELX_P HELX_P103 103 THR F 498  ? SER F 513  ? THR F 498  SER F 513  1 ? 16 
HELX_P HELX_P104 104 GLU F 514  ? GLU F 529  ? GLU F 514  GLU F 529  1 ? 16 
HELX_P HELX_P105 105 GLY F 535  ? LEU F 546  ? GLY F 535  LEU F 546  1 ? 12 
HELX_P HELX_P106 106 LYS F 548  ? ASP F 563  ? LYS F 548  ASP F 563  1 ? 16 
HELX_P HELX_P107 107 SER F 566  ? GLN F 580  ? SER F 566  GLN F 580  1 ? 15 
HELX_P HELX_P108 108 GLU F 582  ? ASP F 597  ? GLU F 582  ASP F 597  1 ? 16 
HELX_P HELX_P109 109 TYR F 600  ? GLU F 615  ? TYR F 600  GLU F 615  1 ? 16 
HELX_P HELX_P110 110 GLU F 616  ? ASN F 631  ? GLU F 616  ASN F 631  1 ? 16 
HELX_P HELX_P111 111 HIS F 634  ? GLN F 648  ? HIS F 634  GLN F 648  1 ? 15 
HELX_P HELX_P112 112 LYS F 650  ? ASN F 665  ? LYS F 650  ASN F 665  1 ? 16 
HELX_P HELX_P113 113 SER F 668  ? LYS F 683  ? SER F 668  LYS F 683  1 ? 16 
HELX_P HELX_P114 114 LYS F 684  ? ASP F 699  ? LYS F 684  ASP F 699  1 ? 16 
HELX_P HELX_P115 115 ASN F 702  ? ASN F 716  ? ASN F 702  ASN F 716  1 ? 15 
HELX_P HELX_P116 116 LYS F 718  ? VAL F 733  ? LYS F 718  VAL F 733  1 ? 16 
HELX_P HELX_P117 117 GLU F 736  ? GLY F 751  ? GLU F 736  GLY F 751  1 ? 16 
HELX_P HELX_P118 118 GLN F 752  ? ASP F 767  ? GLN F 752  ASP F 767  1 ? 16 
HELX_P HELX_P119 119 LYS F 769  ? ARG F 782  ? LYS F 769  ARG F 782  1 ? 14 
HELX_P HELX_P120 120 LYS G 12   ? ASP G 25   ? LYS G 12   ASP G 25   1 ? 14 
HELX_P HELX_P121 121 GLU H 6    ? HIS H 18   ? GLU H 6    HIS H 18   1 ? 13 
HELX_P HELX_P122 122 ALA H 20   ? HIS H 36   ? ALA H 20   HIS H 36   1 ? 17 
HELX_P HELX_P123 123 SER H 37   ? SER H 51   ? SER H 37   SER H 51   1 ? 15 
HELX_P HELX_P124 124 LYS H 53   ? HIS H 64   ? LYS H 53   HIS H 64   1 ? 12 
HELX_P HELX_P125 125 THR H 68   ? LEU H 82   ? THR H 68   LEU H 82   1 ? 15 
HELX_P HELX_P126 126 LYS H 84   ? GLY H 94   ? LYS H 84   GLY H 94   1 ? 11 
HELX_P HELX_P127 127 HIS H 103  ? GLY H 111  ? HIS H 103  GLY H 111  1 ? 9  
HELX_P HELX_P128 128 SER H 113  ? ASP H 129  ? SER H 113  ASP H 129  1 ? 17 
HELX_P HELX_P129 129 ARG H 130  ? ASN H 145  ? ARG H 130  ASN H 145  1 ? 16 
HELX_P HELX_P130 130 LEU H 148  ? ILE H 158  ? LEU H 148  ILE H 158  1 ? 11 
HELX_P HELX_P131 131 PRO H 164  ? LYS H 169  ? PRO H 164  LYS H 169  1 ? 6  
HELX_P HELX_P132 132 ALA H 451  ? TYR H 479  ? ALA H 451  TYR H 479  1 ? 29 
HELX_P HELX_P133 133 ASN H 480  ? HIS H 490  ? ASN H 480  HIS H 490  1 ? 11 
HELX_P HELX_P134 134 THR H 498  ? SER H 513  ? THR H 498  SER H 513  1 ? 16 
HELX_P HELX_P135 135 GLU H 514  ? GLU H 529  ? GLU H 514  GLU H 529  1 ? 16 
HELX_P HELX_P136 136 GLY H 535  ? LEU H 546  ? GLY H 535  LEU H 546  1 ? 12 
HELX_P HELX_P137 137 LYS H 548  ? ASP H 563  ? LYS H 548  ASP H 563  1 ? 16 
HELX_P HELX_P138 138 SER H 566  ? GLN H 580  ? SER H 566  GLN H 580  1 ? 15 
HELX_P HELX_P139 139 GLU H 582  ? ASP H 597  ? GLU H 582  ASP H 597  1 ? 16 
HELX_P HELX_P140 140 TYR H 600  ? GLU H 615  ? TYR H 600  GLU H 615  1 ? 16 
HELX_P HELX_P141 141 GLU H 616  ? ASN H 631  ? GLU H 616  ASN H 631  1 ? 16 
HELX_P HELX_P142 142 HIS H 634  ? GLN H 648  ? HIS H 634  GLN H 648  1 ? 15 
HELX_P HELX_P143 143 LYS H 650  ? ASN H 665  ? LYS H 650  ASN H 665  1 ? 16 
HELX_P HELX_P144 144 SER H 668  ? LYS H 683  ? SER H 668  LYS H 683  1 ? 16 
HELX_P HELX_P145 145 LYS H 684  ? ASP H 699  ? LYS H 684  ASP H 699  1 ? 16 
HELX_P HELX_P146 146 ASN H 702  ? ASN H 716  ? ASN H 702  ASN H 716  1 ? 15 
HELX_P HELX_P147 147 LYS H 718  ? VAL H 733  ? LYS H 718  VAL H 733  1 ? 16 
HELX_P HELX_P148 148 GLU H 736  ? GLY H 751  ? GLU H 736  GLY H 751  1 ? 16 
HELX_P HELX_P149 149 GLN H 752  ? ASP H 767  ? GLN H 752  ASP H 767  1 ? 16 
HELX_P HELX_P150 150 LEU I 49   ? PHE I 52   ? LEU I 49   PHE I 52   5 ? 4  
HELX_P HELX_P151 151 GLU I 132  ? LEU I 137  ? GLU I 132  LEU I 137  1 ? 6  
HELX_P HELX_P152 152 GLU I 163  ? ASP I 170  ? GLU I 163  ASP I 170  1 ? 8  
HELX_P HELX_P153 153 TYR I 190  ? MET I 192  ? TYR I 190  MET I 192  5 ? 3  
HELX_P HELX_P154 154 THR I 238  ? PHE I 244  ? THR I 238  PHE I 244  1 ? 7  
HELX_P HELX_P155 155 PHE I 244  ? LYS I 294  ? PHE I 244  LYS I 294  1 ? 51 
HELX_P HELX_P156 156 SER I 299  ? TRP I 310  ? SER I 299  TRP I 310  1 ? 12 
HELX_P HELX_P157 157 ALA I 315  ? LEU I 325  ? ALA I 315  LEU I 325  1 ? 11 
HELX_P HELX_P158 158 THR I 326  ? HIS I 351  ? THR I 326  HIS I 351  1 ? 26 
HELX_P HELX_P159 159 HIS I 351  ? TRP I 372  ? HIS I 351  TRP I 372  1 ? 22 
HELX_P HELX_P160 160 TRP I 372  ? GLU I 377  ? TRP I 372  GLU I 377  1 ? 6  
HELX_P HELX_P161 161 ASP I 382  ? THR I 429  ? ASP I 382  THR I 429  1 ? 48 
HELX_P HELX_P162 162 THR I 441  ? PHE I 456  ? THR I 441  PHE I 456  1 ? 16 
HELX_P HELX_P163 163 ARG I 474  ? LYS I 480  ? ARG I 474  LYS I 480  1 ? 7  
HELX_P HELX_P164 164 ASN I 495  ? ASN I 503  ? ASN I 495  ASN I 503  1 ? 9  
HELX_P HELX_P165 165 SER I 521  ? MET I 548  ? SER I 521  MET I 548  1 ? 28 
HELX_P HELX_P166 166 SER I 672  ? VAL I 674  ? SER I 672  VAL I 674  5 ? 3  
HELX_P HELX_P167 167 ASP I 679  ? TYR I 683  ? ASP I 679  TYR I 683  5 ? 5  
HELX_P HELX_P168 168 ASN J 2    ? GLN J 17   ? ASN J 2    GLN J 17   1 ? 16 
HELX_P HELX_P169 169 GLN J 18   ? ARG J 34   ? GLN J 18   ARG J 34   1 ? 17 
HELX_P HELX_P170 170 GLU J 36   ? THR J 50   ? GLU J 36   THR J 50   1 ? 15 
HELX_P HELX_P171 171 GLN J 52   ? ARG J 63   ? GLN J 52   ARG J 63   1 ? 12 
HELX_P HELX_P172 172 LYS J 64   ? GLU J 70   ? LYS J 64   GLU J 70   1 ? 7  
HELX_P HELX_P173 173 GLU J 70   ? LYS J 84   ? GLU J 70   LYS J 84   1 ? 15 
HELX_P HELX_P174 174 GLN J 88   ? ASP J 94   ? GLN J 88   ASP J 94   1 ? 7  
HELX_P HELX_P175 175 SER J 124  ? LEU J 143  ? SER J 124  LEU J 143  1 ? 20 
HELX_P HELX_P176 176 ASN J 145  ? VAL J 161  ? ASN J 145  VAL J 161  1 ? 17 
HELX_P HELX_P177 177 CYS J 163  ? HIS J 173  ? CYS J 163  HIS J 173  1 ? 11 
HELX_P HELX_P178 178 THR J 177  ? LEU J 188  ? THR J 177  LEU J 188  1 ? 12 
HELX_P HELX_P179 179 CYS J 194  ? LYS J 208  ? CYS J 194  LYS J 208  1 ? 15 
HELX_P HELX_P180 180 ASN J 230  ? CYS J 245  ? ASN J 230  CYS J 245  1 ? 16 
HELX_P HELX_P181 181 ASP J 246  ? ASP J 261  ? ASP J 246  ASP J 261  1 ? 16 
HELX_P HELX_P182 182 SER J 266  ? ASN J 279  ? SER J 266  ASN J 279  1 ? 14 
HELX_P HELX_P183 183 LYS J 280  ? TYR J 295  ? LYS J 280  TYR J 295  1 ? 16 
HELX_P HELX_P184 184 ASN J 298  ? GLY J 313  ? ASN J 298  GLY J 313  1 ? 16 
HELX_P HELX_P185 185 LYS J 315  ? GLU J 330  ? LYS J 315  GLU J 330  1 ? 16 
HELX_P HELX_P186 186 TYR J 333  ? SER J 348  ? TYR J 333  SER J 348  1 ? 16 
HELX_P HELX_P187 187 GLU J 349  ? MET J 364  ? GLU J 349  MET J 364  1 ? 16 
HELX_P HELX_P188 188 HIS J 368  ? THR J 381  ? HIS J 368  THR J 381  1 ? 14 
HELX_P HELX_P189 189 ASN J 383  ? ILE J 397  ? ASN J 383  ILE J 397  1 ? 15 
HELX_P HELX_P190 190 ASP J 401  ? GLY J 416  ? ASP J 401  GLY J 416  1 ? 16 
HELX_P HELX_P191 191 TRP J 418  ? ALA J 434  ? TRP J 418  ALA J 434  1 ? 17 
HELX_P HELX_P192 192 TRP J 444  ? LYS J 459  ? TRP J 444  LYS J 459  1 ? 16 
HELX_P HELX_P193 193 LYS J 460  ? ILE J 475  ? LYS J 460  ILE J 475  1 ? 16 
HELX_P HELX_P194 194 ASN J 478  ? MET J 492  ? ASN J 478  MET J 492  1 ? 15 
HELX_P HELX_P195 195 ASN J 494  ? ARG J 509  ? ASN J 494  ARG J 509  1 ? 16 
HELX_P HELX_P196 196 ASP J 512  ? ASP J 529  ? ASP J 512  ASP J 529  1 ? 18 
HELX_P HELX_P197 197 ASN K 2    ? GLN K 17   ? ASN K 2    GLN K 17   1 ? 16 
HELX_P HELX_P198 198 GLN K 18   ? ARG K 34   ? GLN K 18   ARG K 34   1 ? 17 
HELX_P HELX_P199 199 GLU K 36   ? THR K 50   ? GLU K 36   THR K 50   1 ? 15 
HELX_P HELX_P200 200 GLN K 52   ? SER K 62   ? GLN K 52   SER K 62   1 ? 11 
HELX_P HELX_P201 201 LYS K 64   ? TYR K 69   ? LYS K 64   TYR K 69   1 ? 6  
HELX_P HELX_P202 202 TYR K 69   ? LYS K 84   ? TYR K 69   LYS K 84   1 ? 16 
HELX_P HELX_P203 203 GLN K 88   ? LEU K 93   ? GLN K 88   LEU K 93   1 ? 6  
HELX_P HELX_P204 204 SER K 130  ? LEU K 143  ? SER K 130  LEU K 143  1 ? 14 
HELX_P HELX_P205 205 ASN K 145  ? VAL K 161  ? ASN K 145  VAL K 161  1 ? 17 
HELX_P HELX_P206 206 CYS K 163  ? SER K 172  ? CYS K 163  SER K 172  1 ? 10 
HELX_P HELX_P207 207 HIS K 173  ? MET K 175  ? HIS K 173  MET K 175  5 ? 3  
HELX_P HELX_P208 208 ALA K 178  ? LEU K 188  ? ALA K 178  LEU K 188  1 ? 11 
HELX_P HELX_P209 209 CYS K 194  ? LYS K 211  ? CYS K 194  LYS K 211  1 ? 18 
HELX_P HELX_P210 210 THR K 218  ? ASP K 225  ? THR K 218  ASP K 225  1 ? 8  
HELX_P HELX_P211 211 GLY K 226  ? GLU K 229  ? GLY K 226  GLU K 229  5 ? 4  
HELX_P HELX_P212 212 ASN K 230  ? CYS K 245  ? ASN K 230  CYS K 245  1 ? 16 
HELX_P HELX_P213 213 ASP K 246  ? ASP K 261  ? ASP K 246  ASP K 261  1 ? 16 
HELX_P HELX_P214 214 SER K 266  ? ASN K 279  ? SER K 266  ASN K 279  1 ? 14 
HELX_P HELX_P215 215 LYS K 280  ? TYR K 295  ? LYS K 280  TYR K 295  1 ? 16 
HELX_P HELX_P216 216 ASN K 298  ? GLY K 313  ? ASN K 298  GLY K 313  1 ? 16 
HELX_P HELX_P217 217 LYS K 315  ? GLU K 330  ? LYS K 315  GLU K 330  1 ? 16 
HELX_P HELX_P218 218 GLY K 334  ? SER K 348  ? GLY K 334  SER K 348  1 ? 15 
HELX_P HELX_P219 219 GLU K 349  ? MET K 364  ? GLU K 349  MET K 364  1 ? 16 
HELX_P HELX_P220 220 CYS K 367  ? THR K 381  ? CYS K 367  THR K 381  1 ? 15 
HELX_P HELX_P221 221 ASN K 383  ? ALA K 398  ? ASN K 383  ALA K 398  1 ? 16 
HELX_P HELX_P222 222 ASP K 401  ? GLY K 416  ? ASP K 401  GLY K 416  1 ? 16 
HELX_P HELX_P223 223 GLU K 417  ? ILE K 435  ? GLU K 417  ILE K 435  1 ? 19 
HELX_P HELX_P224 224 THR K 440  ? LYS K 459  ? THR K 440  LYS K 459  1 ? 20 
HELX_P HELX_P225 225 LYS K 460  ? ILE K 475  ? LYS K 460  ILE K 475  1 ? 16 
HELX_P HELX_P226 226 ASN K 478  ? MET K 492  ? ASN K 478  MET K 492  1 ? 15 
HELX_P HELX_P227 227 ASN K 494  ? ARG K 509  ? ASN K 494  ARG K 509  1 ? 16 
HELX_P HELX_P228 228 ASP K 512  ? ILE K 527  ? ASP K 512  ILE K 527  1 ? 16 
HELX_P HELX_P229 229 ASP L 12   ? THR L 19   ? ASP L 12   THR L 19   1 ? 8  
HELX_P HELX_P230 230 GLY L 41   ? ARG L 46   ? GLY L 41   ARG L 46   1 ? 6  
HELX_P HELX_P231 231 HIS L 145  ? GLY L 148  ? HIS L 145  GLY L 148  5 ? 4  
HELX_P HELX_P232 232 THR L 174  ? MET L 179  ? THR L 174  MET L 179  1 ? 6  
HELX_P HELX_P233 233 ASP M 8    ? ASP M 16   ? ASP M 8    ASP M 16   1 ? 9  
HELX_P HELX_P234 234 SER M 49   ? MET M 55   ? SER M 49   MET M 55   1 ? 7  
HELX_P HELX_P235 235 ARG N 15   ? THR N 29   ? ARG N 15   THR N 29   1 ? 15 
HELX_P HELX_P236 236 GLU N 53   ? ARG N 63   ? GLU N 53   ARG N 63   1 ? 11 
HELX_P HELX_P237 237 VAL N 78   ? TRP N 92   ? VAL N 78   TRP N 92   1 ? 15 
HELX_P HELX_P238 238 ASN N 93   ? GLU N 99   ? ASN N 93   GLU N 99   1 ? 7  
HELX_P HELX_P239 239 CYS N 107  ? ASP N 123  ? CYS N 107  ASP N 123  1 ? 17 
HELX_P HELX_P240 240 LEU N 126  ? GLY N 139  ? LEU N 126  GLY N 139  1 ? 14 
HELX_P HELX_P241 241 ARG N 150  ? PHE N 162  ? ARG N 150  PHE N 162  1 ? 13 
HELX_P HELX_P242 242 ARG N 167  ? GLY N 191  ? ARG N 167  GLY N 191  1 ? 25 
HELX_P HELX_P243 243 LEU N 203  ? TYR N 213  ? LEU N 203  TYR N 213  1 ? 11 
HELX_P HELX_P244 244 ARG N 234  ? LEU N 250  ? ARG N 234  LEU N 250  1 ? 17 
HELX_P HELX_P245 245 LEU N 252  ? ARG N 278  ? LEU N 252  ARG N 278  1 ? 27 
HELX_P HELX_P246 246 ARG N 287  ? PHE N 304  ? ARG N 287  PHE N 304  1 ? 18 
HELX_P HELX_P247 247 ARG N 322  ? ARG N 349  ? ARG N 322  ARG N 349  1 ? 28 
HELX_P HELX_P248 248 SER N 354  ? ARG N 367  ? SER N 354  ARG N 367  1 ? 14 
HELX_P HELX_P249 249 GLN N 370  ? LEU N 386  ? GLN N 370  LEU N 386  1 ? 17 
HELX_P HELX_P250 250 ASP N 395  ? VAL N 409  ? ASP N 395  VAL N 409  1 ? 15 
HELX_P HELX_P251 251 ILE N 416  ? CYS N 421  ? ILE N 416  CYS N 421  1 ? 6  
HELX_P HELX_P252 252 CYS N 421  ? GLU N 432  ? CYS N 421  GLU N 432  1 ? 12 
HELX_P HELX_P253 253 ASP N 433  ? LEU N 442  ? ASP N 433  LEU N 442  1 ? 10 
HELX_P HELX_P254 254 ASP N 451  ? LYS N 458  ? ASP N 451  LYS N 458  1 ? 8  
HELX_P HELX_P255 255 SER N 499  ? TYR N 509  ? SER N 499  TYR N 509  1 ? 11 
HELX_P HELX_P256 256 LYS N 512  ? GLN N 530  ? LYS N 512  GLN N 530  1 ? 19 
HELX_P HELX_P257 257 GLU N 536  ? PHE N 549  ? GLU N 536  PHE N 549  1 ? 14 
HELX_P HELX_P258 258 MET N 554  ? ASP N 563  ? MET N 554  ASP N 563  1 ? 10 
HELX_P HELX_P259 259 MET N 564  ? LYS N 580  ? MET N 564  LYS N 580  1 ? 17 
HELX_P HELX_P260 260 PRO N 612  ? LYS N 630  ? PRO N 612  LYS N 630  1 ? 19 
HELX_P HELX_P261 261 THR N 660  ? ASP N 672  ? THR N 660  ASP N 672  1 ? 13 
HELX_P HELX_P262 262 THR N 677  ? LYS N 686  ? THR N 677  LYS N 686  1 ? 10 
HELX_P HELX_P263 263 PRO N 688  ? GLY N 703  ? PRO N 688  GLY N 703  1 ? 16 
HELX_P HELX_P264 264 THR O 31   ? SER O 45   ? THR O 31   SER O 45   1 ? 15 
HELX_P HELX_P265 265 SER O 53   ? GLY O 70   ? SER O 53   GLY O 70   1 ? 18 
HELX_P HELX_P266 266 THR O 74   ? CYS O 86   ? THR O 74   CYS O 86   1 ? 13 
HELX_P HELX_P267 267 CYS O 86   ? GLY O 103  ? CYS O 86   GLY O 103  1 ? 18 
HELX_P HELX_P268 268 GLU O 104  ? GLY O 121  ? GLU O 104  GLY O 121  1 ? 18 
HELX_P HELX_P269 269 THR O 129  ? LEU O 146  ? THR O 129  LEU O 146  1 ? 18 
HELX_P HELX_P270 270 SER O 147  ? THR O 169  ? SER O 147  THR O 169  1 ? 23 
HELX_P HELX_P271 271 SER O 208  ? ASP O 226  ? SER O 208  ASP O 226  1 ? 19 
HELX_P HELX_P272 272 THR O 232  ? ASN O 247  ? THR O 232  ASN O 247  1 ? 16 
HELX_P HELX_P273 273 ALA O 251  ? VAL O 264  ? ALA O 251  VAL O 264  1 ? 14 
HELX_P HELX_P274 274 ASP O 266  ? LEU O 281  ? ASP O 266  LEU O 281  1 ? 16 
HELX_P HELX_P275 275 ARG O 298  ? PHE O 314  ? ARG O 298  PHE O 314  1 ? 17 
HELX_P HELX_P276 276 HIS O 316  ? SER O 334  ? HIS O 316  SER O 334  1 ? 19 
HELX_P HELX_P277 277 ASP O 336  ? GLY O 351  ? ASP O 336  GLY O 351  1 ? 16 
HELX_P HELX_P278 278 TYR O 358  ? HIS O 370  ? TYR O 358  HIS O 370  1 ? 13 
HELX_P HELX_P279 279 LEU O 373  ? ARG O 388  ? LEU O 373  ARG O 388  1 ? 16 
HELX_P HELX_P280 280 THR O 394  ? SER O 413  ? THR O 394  SER O 413  1 ? 20 
HELX_P HELX_P281 281 LEU O 414  ? TYR O 432  ? LEU O 414  TYR O 432  1 ? 19 
HELX_P HELX_P282 282 ARG O 434  ? SER O 447  ? ARG O 434  SER O 447  1 ? 14 
HELX_P HELX_P283 283 ASN O 462  ? GLN O 480  ? ASN O 462  GLN O 480  1 ? 19 
HELX_P HELX_P284 284 CYS O 482  ? PHE O 497  ? CYS O 482  PHE O 497  1 ? 16 
HELX_P HELX_P285 285 HIS O 503  ? GLY O 523  ? HIS O 503  GLY O 523  1 ? 21 
HELX_P HELX_P286 286 LYS O 524  ? ASN O 539  ? LYS O 524  ASN O 539  1 ? 16 
HELX_P HELX_P287 287 SER O 540  ? GLN O 554  ? SER O 540  GLN O 554  1 ? 15 
HELX_P HELX_P288 288 GLN O 556  ? LEU O 574  ? GLN O 556  LEU O 574  1 ? 19 
HELX_P HELX_P289 289 ASN O 576  ? TRP O 592  ? ASN O 576  TRP O 592  1 ? 17 
HELX_P HELX_P290 290 SER O 596  ? ILE O 599  ? SER O 596  ILE O 599  5 ? 4  
HELX_P HELX_P291 291 ALA O 600  ? ARG O 615  ? ALA O 600  ARG O 615  1 ? 16 
HELX_P HELX_P292 292 LEU O 616  ? LEU O 634  ? LEU O 616  LEU O 634  1 ? 19 
HELX_P HELX_P293 293 ILE O 636  ? ASP O 654  ? ILE O 636  ASP O 654  1 ? 19 
HELX_P HELX_P294 294 ILE O 657  ? ALA O 676  ? ILE O 657  ALA O 676  1 ? 20 
HELX_P HELX_P295 295 LYS O 682  ? ASP O 705  ? LYS O 682  ASP O 705  1 ? 24 
HELX_P HELX_P296 296 ARG O 709  ? GLY O 725  ? ARG O 709  GLY O 725  1 ? 17 
HELX_P HELX_P297 297 LYS O 726  ? HIS O 741  ? LYS O 726  HIS O 741  1 ? 16 
HELX_P HELX_P298 298 ASP P 28   ? GLY P 47   ? ASP P 28   GLY P 47   1 ? 20 
HELX_P HELX_P299 299 LEU P 48   ? LEU P 62   ? LEU P 48   LEU P 62   1 ? 15 
HELX_P HELX_P300 300 THR P 77   ? LYS P 97   ? THR P 77   LYS P 97   1 ? 21 
HELX_P HELX_P301 301 GLU P 98   ? LEU P 106  ? GLU P 98   LEU P 106  1 ? 9  
HELX_P HELX_P302 302 HIS P 107  ? CYS P 109  ? HIS P 107  CYS P 109  5 ? 3  
HELX_P HELX_P303 303 SER P 111  ? THR P 134  ? SER P 111  THR P 134  1 ? 24 
HELX_P HELX_P304 304 ASN P 148  ? ARG P 165  ? ASN P 148  ARG P 165  1 ? 18 
HELX_P HELX_P305 305 GLY P 169  ? LEU P 182  ? GLY P 169  LEU P 182  1 ? 14 
HELX_P HELX_P306 306 LEU P 184  ? LEU P 199  ? LEU P 184  LEU P 199  1 ? 16 
HELX_P HELX_P307 307 HIS P 202  ? ILE P 213  ? HIS P 202  ILE P 213  1 ? 12 
HELX_P HELX_P308 308 ASP P 215  ? LEU P 222  ? ASP P 215  LEU P 222  1 ? 8  
HELX_P HELX_P309 309 TRP P 228  ? LEU P 241  ? TRP P 228  LEU P 241  1 ? 14 
HELX_P HELX_P310 310 LEU P 243  ? VAL P 257  ? LEU P 243  VAL P 257  1 ? 15 
HELX_P HELX_P311 311 SER P 262  ? ILE P 276  ? SER P 262  ILE P 276  1 ? 15 
HELX_P HELX_P312 312 ASP P 278  ? ASP P 293  ? ASP P 278  ASP P 293  1 ? 16 
HELX_P HELX_P313 313 ASN P 299  ? ARG P 310  ? ASN P 299  ARG P 310  1 ? 12 
HELX_P HELX_P314 314 MET P 312  ? ASP P 327  ? MET P 312  ASP P 327  1 ? 16 
HELX_P HELX_P315 315 ARG P 330  ? ARG P 344  ? ARG P 330  ARG P 344  1 ? 15 
HELX_P HELX_P316 316 GLN P 346  ? LEU P 360  ? GLN P 346  LEU P 360  1 ? 15 
HELX_P HELX_P317 317 LEU P 365  ? MET P 378  ? LEU P 365  MET P 378  1 ? 14 
HELX_P HELX_P318 318 ASN P 380  ? ASN P 395  ? ASN P 380  ASN P 395  1 ? 16 
HELX_P HELX_P319 319 ASP P 398  ? LEU P 412  ? ASP P 398  LEU P 412  1 ? 15 
HELX_P HELX_P320 320 MET P 414  ? GLN P 427  ? MET P 414  GLN P 427  1 ? 14 
HELX_P HELX_P321 321 ASP P 432  ? ASN P 447  ? ASP P 432  ASN P 447  1 ? 16 
HELX_P HELX_P322 322 GLN P 448  ? GLY P 463  ? GLN P 448  GLY P 463  1 ? 16 
HELX_P HELX_P323 323 MET P 468  ? LEU P 480  ? MET P 468  LEU P 480  1 ? 13 
HELX_P HELX_P324 324 SER P 483  ? CYS P 500  ? SER P 483  CYS P 500  1 ? 18 
HELX_P HELX_P325 325 THR P 511  ? CYS P 523  ? THR P 511  CYS P 523  1 ? 13 
HELX_P HELX_P326 326 LEU P 525  ? ALA P 538  ? LEU P 525  ALA P 538  1 ? 14 
HELX_P HELX_P327 327 SER Q 84   ? LYS Q 97   ? SER R 84   LYS R 97   1 ? 14 
HELX_P HELX_P328 328 PRO Q 107  ? ASN Q 121  ? PRO R 107  ASN R 121  1 ? 15 
HELX_P HELX_P329 329 ASP Q 124  ? ALA Q 128  ? ASP R 124  ALA R 128  5 ? 5  
HELX_P HELX_P330 330 LYS S 12   ? ASP S 25   ? LYS W 12   ASP W 25   1 ? 14 
HELX_P HELX_P331 331 ASN T 36   ? GLY T 48   ? ASN X 36   GLY X 48   1 ? 13 
HELX_P HELX_P332 332 LEU T 49   ? ASN T 67   ? LEU X 49   ASN X 67   1 ? 19 
HELX_P HELX_P333 333 SER T 72   ? ASP T 90   ? SER X 72   ASP X 90   1 ? 19 
HELX_P HELX_P334 334 GLU T 92   ? LEU T 110  ? GLU X 92   LEU X 110  1 ? 19 
HELX_P HELX_P335 335 SER T 134  ? LYS T 150  ? SER X 134  LYS X 150  1 ? 17 
HELX_P HELX_P336 336 GLN T 151  ? ILE T 162  ? GLN X 151  ILE X 162  1 ? 12 
HELX_P HELX_P337 337 THR T 168  ? GLY T 183  ? THR X 168  GLY X 183  1 ? 16 
HELX_P HELX_P338 338 GLN T 184  ? CYS T 199  ? GLN X 184  CYS X 199  1 ? 16 
HELX_P HELX_P339 339 ALA T 202  ? SER T 213  ? ALA X 202  SER X 213  1 ? 12 
HELX_P HELX_P340 340 VAL T 214  ? THR T 229  ? VAL X 214  THR X 229  1 ? 16 
HELX_P HELX_P341 341 TRP T 235  ? GLY T 249  ? TRP X 235  GLY X 249  1 ? 15 
HELX_P HELX_P342 342 ASP T 250  ? LYS T 264  ? ASP X 250  LYS X 264  1 ? 15 
HELX_P HELX_P343 343 ASN T 270  ? GLY T 285  ? ASN X 270  GLY X 285  1 ? 16 
HELX_P HELX_P344 344 ASP T 286  ? ASP T 301  ? ASP X 286  ASP X 301  1 ? 16 
HELX_P HELX_P345 345 LEU T 304  ? GLU T 318  ? LEU X 304  GLU X 318  1 ? 15 
HELX_P HELX_P346 346 ARG T 320  ? SER T 335  ? ARG X 320  SER X 335  1 ? 16 
HELX_P HELX_P347 347 HIS T 338  ? LYS T 353  ? HIS X 338  LYS X 353  1 ? 16 
HELX_P HELX_P348 348 ARG T 354  ? ASN T 369  ? ARG X 354  ASN X 369  1 ? 16 
HELX_P HELX_P349 349 SER T 372  ? MET T 386  ? SER X 372  MET X 386  1 ? 15 
HELX_P HELX_P350 350 ARG T 388  ? ALA T 403  ? ARG X 388  ALA X 403  1 ? 16 
HELX_P HELX_P351 351 ARG T 406  ? ASN T 421  ? ARG X 406  ASN X 421  1 ? 16 
HELX_P HELX_P352 352 SER T 422  ? GLY T 438  ? SER X 422  GLY X 438  1 ? 17 
HELX_P HELX_P353 353 ALA T 441  ? ASP T 454  ? ALA X 441  ASP X 454  1 ? 14 
HELX_P HELX_P354 354 THR T 457  ? ARG T 472  ? THR X 457  ARG X 472  1 ? 16 
HELX_P HELX_P355 355 TYR T 475  ? GLN T 490  ? TYR X 475  GLN X 490  1 ? 16 
HELX_P HELX_P356 356 TYR T 492  ? GLN T 506  ? TYR X 492  GLN X 506  1 ? 15 
HELX_P HELX_P357 357 CYS T 509  ? ASN T 523  ? CYS X 509  ASN X 523  1 ? 15 
HELX_P HELX_P358 358 GLU T 524  ? ASP T 539  ? GLU X 524  ASP X 539  1 ? 16 
HELX_P HELX_P359 359 ASN U 36   ? GLY U 48   ? ASN Y 36   GLY Y 48   1 ? 13 
HELX_P HELX_P360 360 LEU U 49   ? ASN U 67   ? LEU Y 49   ASN Y 67   1 ? 19 
HELX_P HELX_P361 361 SER U 72   ? LYS U 91   ? SER Y 72   LYS Y 91   1 ? 20 
HELX_P HELX_P362 362 GLU U 92   ? LEU U 110  ? GLU Y 92   LEU Y 110  1 ? 19 
HELX_P HELX_P363 363 SER U 134  ? LYS U 150  ? SER Y 134  LYS Y 150  1 ? 17 
HELX_P HELX_P364 364 GLN U 151  ? ILE U 162  ? GLN Y 151  ILE Y 162  1 ? 12 
HELX_P HELX_P365 365 THR U 168  ? GLY U 183  ? THR Y 168  GLY Y 183  1 ? 16 
HELX_P HELX_P366 366 GLN U 184  ? CYS U 199  ? GLN Y 184  CYS Y 199  1 ? 16 
HELX_P HELX_P367 367 ALA U 202  ? SER U 213  ? ALA Y 202  SER Y 213  1 ? 12 
HELX_P HELX_P368 368 VAL U 214  ? THR U 229  ? VAL Y 214  THR Y 229  1 ? 16 
HELX_P HELX_P369 369 TRP U 235  ? GLY U 249  ? TRP Y 235  GLY Y 249  1 ? 15 
HELX_P HELX_P370 370 ASP U 250  ? LYS U 264  ? ASP Y 250  LYS Y 264  1 ? 15 
HELX_P HELX_P371 371 ASN U 270  ? GLY U 285  ? ASN Y 270  GLY Y 285  1 ? 16 
HELX_P HELX_P372 372 ASP U 286  ? ASP U 301  ? ASP Y 286  ASP Y 301  1 ? 16 
HELX_P HELX_P373 373 LEU U 304  ? GLY U 319  ? LEU Y 304  GLY Y 319  1 ? 16 
HELX_P HELX_P374 374 ARG U 320  ? SER U 335  ? ARG Y 320  SER Y 335  1 ? 16 
HELX_P HELX_P375 375 HIS U 338  ? LYS U 353  ? HIS Y 338  LYS Y 353  1 ? 16 
HELX_P HELX_P376 376 ARG U 354  ? ASN U 369  ? ARG Y 354  ASN Y 369  1 ? 16 
HELX_P HELX_P377 377 SER U 372  ? GLY U 387  ? SER Y 372  GLY Y 387  1 ? 16 
HELX_P HELX_P378 378 ARG U 388  ? ALA U 403  ? ARG Y 388  ALA Y 403  1 ? 16 
HELX_P HELX_P379 379 ARG U 406  ? ASN U 421  ? ARG Y 406  ASN Y 421  1 ? 16 
HELX_P HELX_P380 380 SER U 422  ? GLY U 438  ? SER Y 422  GLY Y 438  1 ? 17 
HELX_P HELX_P381 381 ALA U 441  ? ASP U 454  ? ALA Y 441  ASP Y 454  1 ? 14 
HELX_P HELX_P382 382 THR U 457  ? ARG U 472  ? THR Y 457  ARG Y 472  1 ? 16 
HELX_P HELX_P383 383 TYR U 475  ? GLN U 490  ? TYR Y 475  GLN Y 490  1 ? 16 
HELX_P HELX_P384 384 TYR U 492  ? GLN U 506  ? TYR Y 492  GLN Y 506  1 ? 15 
HELX_P HELX_P385 385 CYS U 509  ? ASN U 523  ? CYS Y 509  ASN Y 523  1 ? 15 
HELX_P HELX_P386 386 GLU U 524  ? ASP U 539  ? GLU Y 524  ASP Y 539  1 ? 16 
HELX_P HELX_P387 387 ASP U 542  ? MET U 552  ? ASP Y 542  MET Y 552  1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  PRO 44   A . ? PRO 44   A ALA 45   A ? ALA 45   A 1 8.21   
2  VAL 240  A . ? VAL 240  A ASP 241  A ? ASP 241  A 1 -0.54  
3  ASN 264  A . ? ASN 264  A VAL 265  A ? VAL 265  A 1 -9.51  
4  ALA 476  A . ? ALA 476  A LYS 477  A ? LYS 477  A 1 -8.75  
5  THR 582  A . ? THR 582  A TYR 583  A ? TYR 583  A 1 1.39   
6  LEU 755  A . ? LEU 755  A PHE 756  A ? PHE 756  A 1 -0.31  
7  LEU 793  A . ? LEU 793  A ALA 794  A ? ALA 794  A 1 5.14   
8  LEU 1100 A . ? LEU 1100 A PRO 1101 A ? PRO 1101 A 1 -16.92 
9  PRO 1112 A . ? PRO 1112 A PRO 1113 A ? PRO 1113 A 1 -1.72  
10 PRO 1238 A . ? PRO 1238 A THR 1239 A ? THR 1239 A 1 -8.47  
11 THR 1239 A . ? THR 1239 A SER 1240 A ? SER 1240 A 1 -15.28 
12 GLY 1670 A . ? GLY 1670 A PRO 1671 A ? PRO 1671 A 1 -8.10  
13 SER 1739 A . ? SER 1739 A ALA 1740 A ? ALA 1740 A 1 24.66  
14 TRP 14   B . ? TRP 14   B LEU 15   B ? LEU 15   B 1 2.21   
15 GLN 68   B . ? GLN 68   B VAL 69   B ? VAL 69   B 1 -8.85  
16 VAL 96   C . ? VAL 96   C LYS 97   C ? LYS 97   C 1 17.33  
17 ASN 361  C . ? ASN 361  C PRO 362  C ? PRO 362  C 1 -0.14  
18 ASN 145  F . ? ASN 145  F PRO 146  F ? PRO 146  F 1 -2.50  
19 ASN 145  H . ? ASN 145  H PRO 146  H ? PRO 146  H 1 -2.40  
20 PHE 572  I . ? PHE 572  I PRO 573  I ? PRO 573  I 1 -0.36  
21 GLN 60   L . ? GLN 60   L PRO 61   L ? PRO 61   L 1 5.29   
22 THR 125  L . ? THR 125  L ASP 126  L ? ASP 126  L 1 -15.66 
23 PHE 170  L . ? PHE 170  L PRO 171  L ? PRO 171  L 1 -5.49  
24 ARG 63   N . ? ARG 63   N GLY 64   N ? GLY 64   N 1 2.15   
25 TYR 125  N . ? TYR 125  N LEU 126  N ? LEU 126  N 1 4.44   
26 PHE 162  N . ? PHE 162  N PHE 163  N ? PHE 163  N 1 19.59  
27 SER 164  N . ? SER 164  N THR 165  N ? THR 165  N 1 -23.11 
28 THR 165  N . ? THR 165  N PRO 166  N ? PRO 166  N 1 -13.50 
29 PRO 197  N . ? PRO 197  N GLU 198  N ? GLU 198  N 1 4.69   
30 GLU 280  N . ? GLU 280  N TYR 281  N ? TYR 281  N 1 26.54  
31 SER 284  N . ? SER 284  N PHE 285  N ? PHE 285  N 1 -21.96 
32 ASP 350  N . ? ASP 350  N PHE 351  N ? PHE 351  N 1 -10.59 
33 THR 368  N . ? THR 368  N ASP 369  N ? ASP 369  N 1 -10.51 
34 PRO 477  N . ? PRO 477  N GLU 478  N ? GLU 478  N 1 6.46   
35 GLU 478  N . ? GLU 478  N ASP 479  N ? ASP 479  N 1 -0.30  
36 ASP 483  N . ? ASP 483  N PRO 484  N ? PRO 484  N 1 -0.37  
37 PRO 484  N . ? PRO 484  N VAL 485  N ? VAL 485  N 1 3.46   
38 SER 493  N . ? SER 493  N SER 494  N ? SER 494  N 1 4.47   
39 TYR 509  N . ? TYR 509  N GLY 510  N ? GLY 510  N 1 0.04   
40 SER 532  N . ? SER 532  N PHE 533  N ? PHE 533  N 1 -4.60  
41 GLY 550  N . ? GLY 550  N GLU 551  N ? GLU 551  N 1 -13.91 
42 PRO 709  N . ? PRO 709  N PRO 710  N ? PRO 710  N 1 -0.96  
43 GLU 123  O . ? GLU 123  O PRO 124  O ? PRO 124  O 1 -4.08  
44 ASP 356  O . ? ASP 356  O SER 357  O ? SER 357  O 1 6.04   
45 VAL 96   P . ? VAL 96   P LYS 97   P ? LYS 97   P 1 14.82  
46 ASN 361  P . ? ASN 361  P PRO 362  P ? PRO 362  P 1 0.95   
47 PRO 74   Q . ? PRO 74   R GLY 75   Q ? GLY 75   R 1 -4.88  
48 LYS 97   Q . ? LYS 97   R GLU 98   Q ? GLU 98   R 1 -2.76  
49 ASN 99   Q . ? ASN 99   R GLN 100  Q ? GLN 100  R 1 7.83   
50 GLN 100  Q . ? GLN 100  R PRO 101  Q ? PRO 101  R 1 -4.51  
51 ALA 128  Q . ? ALA 128  R LYS 129  Q ? LYS 129  R 1 12.14  
52 PHE 420  Q . ? PHE 420  R ALA 421  Q ? ALA 421  R 1 -1.62  
53 TYR 430  Q . ? TYR 430  R PRO 431  Q ? PRO 431  R 1 -1.82  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 4 ? 
AB ? 4 ? 
AC ? 4 ? 
AD ? 4 ? 
AE ? 4 ? 
AF ? 3 ? 
AG ? 3 ? 
AH ? 2 ? 
AI ? 3 ? 
AJ ? 2 ? 
AK ? 2 ? 
AL ? 2 ? 
AM ? 4 ? 
NA ? 4 ? 
BA ? 2 ? 
IA ? 4 ? 
IB ? 4 ? 
IC ? 2 ? 
ID ? 2 ? 
IE ? 4 ? 
IF ? 2 ? 
IG ? 5 ? 
IH ? 5 ? 
II ? 2 ? 
IJ ? 4 ? 
IK ? 3 ? 
LA ? 4 ? 
LB ? 5 ? 
LC ? 2 ? 
RA ? 4 ? 
RB ? 4 ? 
RC ? 4 ? 
RD ? 4 ? 
RE ? 4 ? 
RF ? 4 ? 
RG ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AD 3 4 ? anti-parallel 
AE 1 2 ? anti-parallel 
AE 2 3 ? parallel      
AE 3 4 ? anti-parallel 
AF 1 2 ? anti-parallel 
AF 2 3 ? anti-parallel 
AG 1 2 ? anti-parallel 
AG 2 3 ? anti-parallel 
AH 1 2 ? anti-parallel 
AI 1 2 ? anti-parallel 
AI 2 3 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AK 1 2 ? anti-parallel 
AL 1 2 ? parallel      
AM 1 2 ? anti-parallel 
AM 2 3 ? anti-parallel 
AM 3 4 ? anti-parallel 
NA 1 2 ? parallel      
NA 2 3 ? anti-parallel 
NA 3 4 ? anti-parallel 
BA 1 2 ? anti-parallel 
IA 1 2 ? anti-parallel 
IA 2 3 ? anti-parallel 
IA 3 4 ? anti-parallel 
IB 1 2 ? anti-parallel 
IB 2 3 ? anti-parallel 
IB 3 4 ? anti-parallel 
IC 1 2 ? anti-parallel 
ID 1 2 ? anti-parallel 
IE 1 2 ? anti-parallel 
IE 2 3 ? anti-parallel 
IE 3 4 ? anti-parallel 
IF 1 2 ? anti-parallel 
IG 1 2 ? anti-parallel 
IG 2 3 ? anti-parallel 
IG 3 4 ? anti-parallel 
IG 4 5 ? anti-parallel 
IH 1 2 ? anti-parallel 
IH 2 3 ? anti-parallel 
IH 3 4 ? anti-parallel 
IH 4 5 ? parallel      
II 1 2 ? anti-parallel 
IJ 1 2 ? anti-parallel 
IJ 2 3 ? anti-parallel 
IJ 3 4 ? anti-parallel 
IK 1 2 ? anti-parallel 
IK 2 3 ? anti-parallel 
LA 1 2 ? anti-parallel 
LA 2 3 ? anti-parallel 
LA 3 4 ? anti-parallel 
LB 1 2 ? anti-parallel 
LB 2 3 ? anti-parallel 
LB 3 4 ? anti-parallel 
LB 4 5 ? anti-parallel 
LC 1 2 ? anti-parallel 
RA 1 2 ? anti-parallel 
RA 2 3 ? anti-parallel 
RA 3 4 ? anti-parallel 
RB 1 2 ? anti-parallel 
RB 2 3 ? anti-parallel 
RB 3 4 ? anti-parallel 
RC 1 2 ? anti-parallel 
RC 2 3 ? anti-parallel 
RC 3 4 ? anti-parallel 
RD 1 2 ? anti-parallel 
RD 2 3 ? anti-parallel 
RD 3 4 ? anti-parallel 
RE 1 2 ? anti-parallel 
RE 2 3 ? anti-parallel 
RE 3 4 ? anti-parallel 
RF 1 2 ? anti-parallel 
RF 2 3 ? anti-parallel 
RF 3 4 ? anti-parallel 
RG 1 2 ? anti-parallel 
RG 2 3 ? anti-parallel 
RG 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 GLN A 18   ? GLU A 19   ? GLN A 18   GLU A 19   
AA 2 MET A 604  ? THR A 608  ? MET A 604  THR A 608  
AA 3 ARG A 594  ? GLU A 598  ? ARG A 594  GLU A 598  
AA 4 SER A 586  ? VAL A 591  ? SER A 586  VAL A 591  
AB 1 SER A 73   ? LYS A 78   ? SER A 73   LYS A 78   
AB 2 ASP A 90   ? VAL A 95   ? ASP A 90   VAL A 95   
AB 3 MET A 99   ? SER A 103  ? MET A 99   SER A 103  
AB 4 VAL A 113  ? THR A 118  ? VAL A 113  THR A 118  
AC 1 LEU A 127  ? ILE A 132  ? LEU A 127  ILE A 132  
AC 2 VAL A 147  ? LEU A 154  ? VAL A 147  LEU A 154  
AC 3 CYS A 158  ? HIS A 162  ? CYS A 158  HIS A 162  
AC 4 ASP A 168  ? SER A 172  ? ASP A 168  SER A 172  
AD 1 VAL A 177  ? VAL A 180  ? VAL A 177  VAL A 180  
AD 2 PHE A 189  ? ARG A 191  ? PHE A 189  ARG A 191  
AD 3 MET A 210  ? SER A 212  ? MET A 210  SER A 212  
AD 4 THR A 221  ? PRO A 222  ? THR A 221  PRO A 222  
AE 1 GLN A 237  ? TYR A 238  ? GLN A 237  TYR A 238  
AE 2 VAL A 224  ? CYS A 225  ? VAL A 224  CYS A 225  
AE 3 CYS A 408  ? ILE A 409  ? CYS A 408  ILE A 409  
AE 4 LEU A 271  ? ARG A 272  ? LEU A 271  ARG A 272  
AF 1 LYS A 245  ? ASN A 250  ? LYS A 245  ASN A 250  
AF 2 ILE A 255  ? TYR A 259  ? ILE A 255  TYR A 259  
AF 3 HIS A 266  ? TRP A 269  ? HIS A 266  TRP A 269  
AG 1 ILE A 432  ? SER A 434  ? ILE A 432  SER A 434  
AG 2 LYS A 440  ? LEU A 445  ? LYS A 440  LEU A 445  
AG 3 LEU A 452  ? CYS A 454  ? LEU A 452  CYS A 454  
AH 1 GLN A 458  ? GLU A 459  ? GLN A 458  GLU A 459  
AH 2 LEU A 466  ? ILE A 467  ? LEU A 466  ILE A 467  
AI 1 MET A 488  ? GLU A 492  ? MET A 488  GLU A 492  
AI 2 ASN A 496  ? TYR A 500  ? ASN A 496  TYR A 500  
AI 3 ARG A 505  ? LYS A 508  ? ARG A 505  LYS A 508  
AJ 1 THR A 1108 ? ALA A 1111 ? THR A 1108 ALA A 1111 
AJ 2 THR A 1116 ? ASP A 1119 ? THR A 1116 ASP A 1119 
AK 1 TYR A 1572 ? LEU A 1574 ? TYR A 1572 LEU A 1574 
AK 2 ALA A 1614 ? PRO A 1616 ? ALA A 1614 PRO A 1616 
AL 1 VAL A 1620 ? VAL A 1622 ? VAL A 1620 VAL A 1622 
AL 2 VAL A 1696 ? TYR A 1698 ? VAL A 1696 TYR A 1698 
AM 1 LYS A 1648 ? GLU A 1649 ? LYS A 1648 GLU A 1649 
AM 2 GLU A 1635 ? TYR A 1638 ? GLU A 1635 TYR A 1638 
AM 3 LEU A 1663 ? VAL A 1668 ? LEU A 1663 VAL A 1668 
AM 4 GLU A 1675 ? ILE A 1678 ? GLU A 1675 ILE A 1678 
NA 1 GLY N 590  ? ALA N 593  ? GLY N 590  ALA N 593  
NA 2 VAL B 3    ? GLY B 10   ? VAL B 3    GLY B 10   
NA 3 LEU N 643  ? VAL N 648  ? LEU N 643  VAL N 648  
NA 4 LEU N 655  ? SER N 656  ? LEU N 655  SER N 656  
BA 1 LEU B 46   ? TRP B 48   ? LEU B 46   TRP B 48   
BA 2 CYS B 54   ? HIS B 56   ? CYS B 54   HIS B 56   
IA 1 ILE I 23   ? TRP I 28   ? ILE I 23   TRP I 28   
IA 2 ILE I 35   ? ASN I 39   ? ILE I 35   ASN I 39   
IA 3 VAL I 44   ? HIS I 47   ? VAL I 44   HIS I 47   
IA 4 ARG I 54   ? PHE I 58   ? ARG I 54   PHE I 58   
IB 1 VAL I 68   ? TRP I 73   ? VAL I 68   TRP I 73   
IB 2 LEU I 79   ? LEU I 84   ? LEU I 79   LEU I 84   
IB 3 ILE I 90   ? ASP I 94   ? ILE I 90   ASP I 94   
IB 4 SER I 103  ? PHE I 104  ? SER I 103  PHE I 104  
IC 1 CYS I 112  ? GLU I 117  ? CYS I 112  GLU I 117  
IC 2 ASN I 174  ? GLY I 179  ? ASN I 174  GLY I 179  
ID 1 PHE I 184  ? ALA I 189  ? PHE I 184  ALA I 189  
ID 2 PHE I 193  ? THR I 199  ? PHE I 193  THR I 199  
IE 1 THR I 204  ? LEU I 210  ? THR I 204  LEU I 210  
IE 2 SER I 216  ? GLU I 222  ? SER I 216  GLU I 222  
IE 3 TYR I 233  ? GLU I 237  ? TYR I 233  GLU I 237  
IE 4 ALA I 551  ? ILE I 554  ? ALA I 551  ILE I 554  
IF 1 SER I 229  ? GLU I 230  ? SER I 229  GLU I 230  
IF 2 ARG I 558  ? ASP I 559  ? ARG I 558  ASP I 559  
IG 1 PHE I 574  ? ASN I 578  ? PHE I 574  ASN I 578  
IG 2 LEU I 583  ? LEU I 591  ? LEU I 583  LEU I 591  
IG 3 TYR I 596  ? HIS I 604  ? TYR I 596  HIS I 604  
IG 4 LEU I 615  ? THR I 624  ? LEU I 615  THR I 624  
IG 5 VAL I 631  ? ARG I 632  ? VAL I 631  ARG I 632  
IH 1 PHE I 574  ? ASN I 578  ? PHE I 574  ASN I 578  
IH 2 LEU I 583  ? LEU I 591  ? LEU I 583  LEU I 591  
IH 3 TYR I 596  ? HIS I 604  ? TYR I 596  HIS I 604  
IH 4 LEU I 615  ? THR I 624  ? LEU I 615  THR I 624  
IH 5 THR I 702  ? PHE I 707  ? THR I 702  PHE I 707  
II 1 VAL I 631  ? ARG I 632  ? VAL I 631  ARG I 632  
II 2 LEU I 615  ? THR I 624  ? LEU I 615  THR I 624  
IJ 1 TYR I 636  ? ASP I 645  ? TYR I 636  ASP I 645  
IJ 2 THR I 648  ? ASP I 655  ? THR I 648  ASP I 655  
IJ 3 ARG I 664  ? PRO I 670  ? ARG I 664  PRO I 670  
IJ 4 TRP I 711  ? LEU I 713  ? TRP I 711  LEU I 713  
IK 1 ALA I 719  ? GLY I 724  ? ALA I 719  GLY I 724  
IK 2 VAL I 730  ? SER I 735  ? VAL I 730  SER I 735  
IK 3 VAL I 741  ? GLU I 745  ? VAL I 741  GLU I 745  
LA 1 VAL L 22   ? GLU L 24   ? VAL L 22   GLU L 24   
LA 2 GLN L 155  ? PRO L 161  ? GLN L 155  PRO L 161  
LA 3 THR L 76   ? TYR L 80   ? THR L 76   TYR L 80   
LA 4 TRP L 119  ? PRO L 123  ? TRP L 119  PRO L 123  
LB 1 VAL L 30   ? LEU L 33   ? VAL L 30   LEU L 33   
LB 2 HIS L 62   ? VAL L 74   ? HIS L 62   VAL L 74   
LB 3 THR L 132  ? VAL L 141  ? THR L 132  VAL L 141  
LB 4 LYS L 93   ? GLY L 99   ? LYS L 93   GLY L 99   
LB 5 GLN L 106  ? GLU L 112  ? GLN L 106  GLU L 112  
LC 1 TRP L 54   ? GLN L 55   ? TRP L 54   GLN L 55   
LC 2 HIS L 152  ? MET L 153  ? HIS L 152  MET L 153  
RA 1 ILE Q 175  ? ASP Q 177  ? ILE R 175  ASP R 177  
RA 2 THR Q 466  ? TRP Q 470  ? THR R 466  TRP R 470  
RA 3 VAL Q 458  ? ALA Q 462  ? VAL R 458  ALA R 462  
RA 4 VAL Q 446  ? MET Q 451  ? VAL R 446  MET R 451  
RB 1 VAL Q 190  ? TRP Q 192  ? VAL R 190  TRP R 192  
RB 2 VAL Q 197  ? LEU Q 202  ? VAL R 197  LEU R 202  
RB 3 SER Q 205  ? SER Q 210  ? SER R 205  SER R 210  
RB 4 ILE Q 216  ? GLN Q 221  ? ILE R 216  GLN R 221  
RC 1 ILE Q 229  ? TRP Q 234  ? ILE R 229  TRP R 234  
RC 2 TYR Q 240  ? THR Q 245  ? TYR R 240  THR R 245  
RC 3 VAL Q 250  ? ASP Q 254  ? VAL R 250  ASP R 254  
RC 4 LYS Q 259  ? MET Q 264  ? LYS R 259  MET R 264  
RD 1 VAL Q 271  ? ASN Q 277  ? VAL R 271  ASN R 277  
RD 2 ILE Q 280  ? SER Q 285  ? ILE R 280  SER R 285  
RD 3 HIS Q 289  ? ASP Q 294  ? HIS R 289  ASP R 294  
RD 4 HIS Q 301  ? SER Q 306  ? HIS R 301  SER R 306  
RE 1 VAL Q 312  ? TRP Q 317  ? VAL R 312  TRP R 317  
RE 2 HIS Q 323  ? GLY Q 328  ? HIS R 323  GLY R 328  
RE 3 VAL Q 333  ? PRO Q 337  ? VAL R 333  PRO R 337  
RE 4 GLN Q 349  ? PHE Q 351  ? GLN R 349  PHE R 351  
RF 1 ALA Q 360  ? TRP Q 363  ? ALA R 360  TRP R 363  
RF 2 VAL Q 370  ? GLY Q 374  ? VAL R 370  GLY R 374  
RF 3 HIS Q 381  ? ASN Q 386  ? HIS R 381  ASN R 386  
RF 4 CYS Q 392  ? ASP Q 397  ? CYS R 392  ASP R 397  
RG 1 VAL Q 402  ? SER Q 408  ? VAL R 402  SER R 408  
RG 2 GLU Q 413  ? HIS Q 418  ? GLU R 413  HIS R 418  
RG 3 LEU Q 425  ? LYS Q 429  ? LEU R 425  LYS R 429  
RG 4 LYS Q 435  ? LEU Q 439  ? LYS R 435  LEU R 439  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N GLN A 18   ? N GLN A 18   O ARG A 606  ? O ARG A 606  
AA 2 3 N ILE A 607  ? N ILE A 607  O VAL A 595  ? O VAL A 595  
AA 3 4 N GLU A 598  ? N GLU A 598  O SER A 586  ? O SER A 586  
AB 1 2 N ARG A 77   ? N ARG A 77   O GLU A 91   ? O GLU A 91   
AB 2 3 N TYR A 94   ? N TYR A 94   O ILE A 101  ? O ILE A 101  
AB 3 4 O TRP A 102  ? O TRP A 102  N TYR A 114  ? N TYR A 114  
AC 1 2 N PHE A 131  ? N PHE A 131  O GLU A 148  ? O GLU A 148  
AC 2 3 N ILE A 153  ? N ILE A 153  O ASN A 160  ? O ASN A 160  
AC 3 4 N MET A 161  ? N MET A 161  O TYR A 169  ? O TYR A 169  
AD 1 2 N ALA A 178  ? N ALA A 178  O GLU A 190  ? O GLU A 190  
AD 2 3 N PHE A 189  ? N PHE A 189  O PHE A 211  ? O PHE A 211  
AD 3 4 N SER A 212  ? N SER A 212  O THR A 221  ? O THR A 221  
AE 1 2 N GLN A 237  ? N GLN A 237  O CYS A 225  ? O CYS A 225  
AE 2 3 O VAL A 224  ? O VAL A 224  N ILE A 409  ? N ILE A 409  
AE 3 4 N CYS A 408  ? N CYS A 408  O ARG A 272  ? O ARG A 272  
AF 1 2 N ASN A 250  ? N ASN A 250  O ILE A 255  ? O ILE A 255  
AF 2 3 N THR A 258  ? N THR A 258  O SER A 267  ? O SER A 267  
AG 1 2 N THR A 433  ? N THR A 433  O PHE A 441  ? O PHE A 441  
AG 2 3 N PHE A 444  ? N PHE A 444  O ARG A 453  ? O ARG A 453  
AH 1 2 N GLN A 458  ? N GLN A 458  O ILE A 467  ? O ILE A 467  
AI 1 2 N GLU A 492  ? N GLU A 492  O ASN A 496  ? O ASN A 496  
AI 2 3 O LEU A 499  ? O LEU A 499  N VAL A 506  ? N VAL A 506  
AJ 1 2 N ALA A 1111 ? N ALA A 1111 O THR A 1116 ? O THR A 1116 
AK 1 2 N SER A 1573 ? N SER A 1573 O GLU A 1615 ? O GLU A 1615 
AL 1 2 N VAL A 1622 ? N VAL A 1622 O LEU A 1697 ? O LEU A 1697 
AM 1 2 N GLU A 1649 ? N GLU A 1649 O VAL A 1636 ? O VAL A 1636 
AM 2 3 O THR A 1637 ? O THR A 1637 N LYS A 1664 ? N LYS A 1664 
AM 3 4 N VAL A 1668 ? N VAL A 1668 O GLU A 1675 ? O GLU A 1675 
NA 1 2 N GLY N 590  ? N GLY N 590  O LYS B 6    ? O LYS B 6    
NA 2 3 N ASN B 9    ? N ASN B 9    O LEU N 643  ? O LEU N 643  
NA 3 4 N VAL N 648  ? N VAL N 648  O LEU N 655  ? O LEU N 655  
BA 1 2 N VAL B 47   ? N VAL B 47   O PHE B 55   ? O PHE B 55   
IA 1 2 N VAL I 27   ? N VAL I 27   O ALA I 36   ? O ALA I 36   
IA 2 3 N LEU I 37   ? N LEU I 37   O LEU I 45   ? O LEU I 45   
IA 3 4 O LEU I 46   ? O LEU I 46   N VAL I 55   ? N VAL I 55   
IB 1 2 N ALA I 72   ? N ALA I 72   O ALA I 81   ? O ALA I 81   
IB 2 3 N PHE I 82   ? N PHE I 82   O VAL I 91   ? O VAL I 91   
IB 3 4 N ILE I 90   ? N ILE I 90   O PHE I 104  ? O PHE I 104  
IC 1 2 N MET I 116  ? N MET I 116  O ILE I 175  ? O ILE I 175  
ID 1 2 N ALA I 189  ? N ALA I 189  O PHE I 193  ? O PHE I 193  
IE 1 2 N CYS I 209  ? N CYS I 209  O SER I 218  ? O SER I 218  
IE 2 3 N VAL I 219  ? N VAL I 219  O PHE I 234  ? O PHE I 234  
IE 3 4 N GLN I 235  ? N GLN I 235  O ILE I 552  ? O ILE I 552  
IF 1 2 N SER I 229  ? N SER I 229  O ASP I 559  ? O ASP I 559  
IG 1 2 N ASN I 578  ? N ASN I 578  O LEU I 583  ? O LEU I 583  
IG 2 3 N ILE I 590  ? N ILE I 590  O LYS I 597  ? O LYS I 597  
IG 3 4 N ILE I 600  ? N ILE I 600  O ILE I 616  ? O ILE I 616  
IG 4 5 N PHE I 623  ? N PHE I 623  O ARG I 632  ? O ARG I 632  
IH 1 2 N ASN I 578  ? N ASN I 578  O LEU I 583  ? O LEU I 583  
IH 2 3 N ILE I 590  ? N ILE I 590  O LYS I 597  ? O LYS I 597  
IH 3 4 N ILE I 600  ? N ILE I 600  O ILE I 616  ? O ILE I 616  
IH 4 5 N LYS I 619  ? N LYS I 619  O ARG I 703  ? O ARG I 703  
II 1 2 N ARG I 632  ? N ARG I 632  O PHE I 623  ? O PHE I 623  
IJ 1 2 N TYR I 644  ? N TYR I 644  O THR I 648  ? O THR I 648  
IJ 2 3 N LEU I 653  ? N LEU I 653  O LEU I 665  ? O LEU I 665  
IJ 3 4 N LEU I 666  ? N LEU I 666  O ARG I 712  ? O ARG I 712  
IK 1 2 N ALA I 723  ? N ALA I 723  O CYS I 732  ? O CYS I 732  
IK 2 3 N VAL I 733  ? N VAL I 733  O ARG I 742  ? O ARG I 742  
LA 1 2 N ARG L 23   ? N ARG L 23   O THR L 160  ? O THR L 160  
LA 2 3 N TYR L 159  ? N TYR L 159  O THR L 76   ? O THR L 76   
LA 3 4 N ILE L 79   ? N ILE L 79   O ILE L 120  ? O ILE L 120  
LB 1 2 N SER L 32   ? N SER L 32   O ASN L 65   ? O ASN L 65   
LB 2 3 N VAL L 74   ? N VAL L 74   O THR L 132  ? O THR L 132  
LB 3 4 N ALA L 140  ? N ALA L 140  O SER L 95   ? O SER L 95   
LB 4 5 N VAL L 98   ? N VAL L 98   O GLN L 106  ? O GLN L 106  
LC 1 2 N TRP L 54   ? N TRP L 54   O MET L 153  ? O MET L 153  
RA 1 2 N LEU Q 176  ? N LEU R 176  O LEU Q 467  ? O LEU R 467  
RA 2 3 N TRP Q 470  ? N TRP R 470  O VAL Q 458  ? O VAL R 458  
RA 3 4 O ALA Q 461  ? O ALA R 461  N LEU Q 447  ? N LEU R 447  
RB 1 2 N ASP Q 191  ? N ASP R 191  O ALA Q 199  ? O ALA R 199  
RB 2 3 N LEU Q 202  ? N LEU R 202  O SER Q 205  ? O SER R 205  
RB 3 4 N LEU Q 208  ? N LEU R 208  O LEU Q 217  ? O LEU R 217  
RC 1 2 N ALA Q 233  ? N ALA R 233  O ALA Q 242  ? O ALA R 242  
RC 2 3 N VAL Q 243  ? N VAL R 243  O GLN Q 251  ? O GLN R 251  
RC 3 4 N ASP Q 254  ? N ASP R 254  O LYS Q 259  ? O LYS R 259  
RD 1 2 N ASN Q 277  ? N ASN R 277  O ILE Q 280  ? O ILE R 280  
RD 2 3 N SER Q 285  ? N SER R 285  O HIS Q 289  ? O HIS R 289  
RD 3 4 O HIS Q 292  ? O HIS R 292  N VAL Q 302  ? N VAL R 302  
RE 1 2 N ARG Q 316  ? N ARG R 316  O ALA Q 325  ? O ALA R 325  
RE 2 3 N SER Q 326  ? N SER R 326  O ASN Q 334  ? O ASN R 334  
RE 3 4 N VAL Q 335  ? N VAL R 335  O GLN Q 349  ? O GLN R 349  
RF 1 2 N ALA Q 362  ? N ALA R 362  O ALA Q 372  ? O ALA R 372  
RF 2 3 N THR Q 373  ? N THR R 373  O ARG Q 383  ? O ARG R 383  
RF 3 4 O ILE Q 384  ? O ILE R 384  N LEU Q 393  ? N LEU R 393  
RG 1 2 N SER Q 408  ? N SER R 408  O GLU Q 413  ? O GLU R 413  
RG 2 3 N SER Q 416  ? N SER R 416  O VAL Q 426  ? O VAL R 426  
RG 3 4 O ILE Q 427  ? O ILE R 427  N VAL Q 436  ? N VAL R 436  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN B 1085' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN B 1086' 
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN B 1087' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS B 23 ? CYS B 23 . ? 1_555 ? 
2  AC1 4 CYS B 26 ? CYS B 26 . ? 1_555 ? 
3  AC1 4 HIS B 56 ? HIS B 56 . ? 1_555 ? 
4  AC1 4 CYS B 59 ? CYS B 59 . ? 1_555 ? 
5  AC2 4 CYS B 51 ? CYS B 51 . ? 1_555 ? 
6  AC2 4 HIS B 53 ? HIS B 53 . ? 1_555 ? 
7  AC2 4 CYS B 73 ? CYS B 73 . ? 1_555 ? 
8  AC2 4 CYS B 76 ? CYS B 76 . ? 1_555 ? 
9  AC3 4 CYS B 34 ? CYS B 34 . ? 1_555 ? 
10 AC3 4 CYS B 37 ? CYS B 37 . ? 1_555 ? 
11 AC3 4 CYS B 44 ? CYS B 44 . ? 1_555 ? 
12 AC3 4 HIS B 58 ? HIS B 58 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          5G04 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    5G04 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . MET A 1  11   ? 268.328 246.513 147.286 1.00 264.29 ?  11   MET A N   1 
ATOM   2     C  CA  . MET A 1  11   ? 266.842 246.492 147.053 1.00 291.97 ?  11   MET A CA  1 
ATOM   3     C  C   . MET A 1  11   ? 266.131 245.321 147.753 1.00 311.45 ?  11   MET A C   1 
ATOM   4     O  O   . MET A 1  11   ? 266.720 244.247 147.886 1.00 314.91 ?  11   MET A O   1 
ATOM   5     C  CB  . MET A 1  11   ? 266.528 246.474 145.546 1.00 271.36 ?  11   MET A CB  1 
ATOM   6     C  CG  . MET A 1  11   ? 267.048 247.677 144.777 1.00 229.62 ?  11   MET A CG  1 
ATOM   7     S  SD  . MET A 1  11   ? 266.328 249.196 145.409 1.00 195.57 ?  11   MET A SD  1 
ATOM   8     C  CE  . MET A 1  11   ? 267.098 250.402 144.323 1.00 218.49 ?  11   MET A CE  1 
ATOM   9     N  N   . ILE A 1  12   ? 264.865 245.542 148.150 1.00 289.31 ?  12   ILE A N   1 
ATOM   10    C  CA  . ILE A 1  12   ? 263.999 244.609 148.935 1.00 222.51 ?  12   ILE A CA  1 
ATOM   11    C  C   . ILE A 1  12   ? 264.027 243.140 148.472 1.00 202.38 ?  12   ILE A C   1 
ATOM   12    O  O   . ILE A 1  12   ? 263.671 242.818 147.335 1.00 176.43 ?  12   ILE A O   1 
ATOM   13    C  CB  . ILE A 1  12   ? 262.525 245.149 149.026 1.00 216.28 ?  12   ILE A CB  1 
ATOM   14    C  CG1 . ILE A 1  12   ? 262.452 246.417 149.899 1.00 221.48 ?  12   ILE A CG1 1 
ATOM   15    C  CG2 . ILE A 1  12   ? 261.542 244.108 149.563 1.00 201.50 ?  12   ILE A CG2 1 
ATOM   16    C  CD1 . ILE A 1  12   ? 261.510 247.495 149.391 1.00 216.29 ?  12   ILE A CD1 1 
ATOM   17    N  N   . ALA A 1  13   ? 264.456 242.259 149.374 1.00 212.28 ?  13   ALA A N   1 
ATOM   18    C  CA  . ALA A 1  13   ? 264.423 240.821 149.139 1.00 240.08 ?  13   ALA A CA  1 
ATOM   19    C  C   . ALA A 1  13   ? 263.371 240.197 150.058 1.00 274.39 ?  13   ALA A C   1 
ATOM   20    O  O   . ALA A 1  13   ? 263.468 240.301 151.289 1.00 326.12 ?  13   ALA A O   1 
ATOM   21    C  CB  . ALA A 1  13   ? 265.796 240.210 149.367 1.00 228.89 ?  13   ALA A CB  1 
ATOM   22    N  N   . ALA A 1  14   ? 262.356 239.583 149.443 1.00 276.84 ?  14   ALA A N   1 
ATOM   23    C  CA  . ALA A 1  14   ? 261.200 239.030 150.148 1.00 253.60 ?  14   ALA A CA  1 
ATOM   24    C  C   . ALA A 1  14   ? 261.625 237.914 151.103 1.00 245.52 ?  14   ALA A C   1 
ATOM   25    O  O   . ALA A 1  14   ? 262.613 237.207 150.852 1.00 233.54 ?  14   ALA A O   1 
ATOM   26    C  CB  . ALA A 1  14   ? 260.167 238.533 149.147 1.00 273.58 ?  14   ALA A CB  1 
ATOM   27    N  N   . ARG A 1  15   ? 260.880 237.779 152.196 1.00 232.99 ?  15   ARG A N   1 
ATOM   28    C  CA  . ARG A 1  15   ? 261.242 236.882 153.306 1.00 232.37 ?  15   ARG A CA  1 
ATOM   29    C  C   . ARG A 1  15   ? 261.298 235.392 152.941 1.00 241.40 ?  15   ARG A C   1 
ATOM   30    O  O   . ARG A 1  15   ? 262.298 234.728 153.232 1.00 258.89 ?  15   ARG A O   1 
ATOM   31    C  CB  . ARG A 1  15   ? 260.339 237.115 154.536 1.00 217.12 ?  15   ARG A CB  1 
ATOM   32    C  CG  . ARG A 1  15   ? 260.316 238.543 155.077 1.00 219.21 ?  15   ARG A CG  1 
ATOM   33    C  CD  . ARG A 1  15   ? 261.629 238.953 155.739 1.00 242.65 ?  15   ARG A CD  1 
ATOM   34    N  NE  . ARG A 1  15   ? 261.652 238.702 157.178 1.00 258.86 ?  15   ARG A NE  1 
ATOM   35    C  CZ  . ARG A 1  15   ? 261.224 239.552 158.113 1.00 264.22 ?  15   ARG A CZ  1 
ATOM   36    N  NH1 . ARG A 1  15   ? 260.710 240.736 157.771 1.00 245.66 ?  15   ARG A NH1 1 
ATOM   37    N  NH2 . ARG A 1  15   ? 261.302 239.212 159.402 1.00 238.71 ?  15   ARG A NH2 1 
ATOM   38    N  N   . ASP A 1  16   ? 260.244 234.878 152.297 1.00 247.72 ?  16   ASP A N   1 
ATOM   39    C  CA  . ASP A 1  16   ? 260.128 233.436 152.006 1.00 259.53 ?  16   ASP A CA  1 
ATOM   40    C  C   . ASP A 1  16   ? 259.765 233.061 150.577 1.00 267.20 ?  16   ASP A C   1 
ATOM   41    O  O   . ASP A 1  16   ? 259.133 233.831 149.849 1.00 278.54 ?  16   ASP A O   1 
ATOM   42    C  CB  . ASP A 1  16   ? 259.135 232.751 152.964 1.00 258.63 ?  16   ASP A CB  1 
ATOM   43    C  CG  . ASP A 1  16   ? 257.693 233.278 152.837 1.00 246.69 ?  16   ASP A CG  1 
ATOM   44    O  OD1 . ASP A 1  16   ? 257.221 233.629 151.731 1.00 185.23 ?  16   ASP A OD1 1 
ATOM   45    O  OD2 . ASP A 1  16   ? 257.008 233.323 153.880 1.00 285.07 -1 16   ASP A OD2 1 
ATOM   46    N  N   . LEU A 1  17   ? 260.160 231.854 150.199 1.00 271.17 ?  17   LEU A N   1 
ATOM   47    C  CA  . LEU A 1  17   ? 259.676 231.265 148.974 1.00 320.41 ?  17   LEU A CA  1 
ATOM   48    C  C   . LEU A 1  17   ? 258.899 230.013 149.319 1.00 356.30 ?  17   LEU A C   1 
ATOM   49    O  O   . LEU A 1  17   ? 259.385 229.151 150.062 1.00 341.36 ?  17   LEU A O   1 
ATOM   50    C  CB  . LEU A 1  17   ? 260.832 230.966 148.015 1.00 337.01 ?  17   LEU A CB  1 
ATOM   51    C  CG  . LEU A 1  17   ? 261.587 232.172 147.431 1.00 362.86 ?  17   LEU A CG  1 
ATOM   52    C  CD1 . LEU A 1  17   ? 262.882 231.728 146.767 1.00 375.08 ?  17   LEU A CD1 1 
ATOM   53    C  CD2 . LEU A 1  17   ? 260.732 232.981 146.458 1.00 374.36 ?  17   LEU A CD2 1 
ATOM   54    N  N   . GLN A 1  18   ? 257.672 229.958 148.809 1.00 435.48 ?  18   GLN A N   1 
ATOM   55    C  CA  . GLN A 1  18   ? 256.792 228.805 148.954 1.00 500.00 ?  18   GLN A CA  1 
ATOM   56    C  C   . GLN A 1  18   ? 256.121 228.549 147.614 1.00 500.00 ?  18   GLN A C   1 
ATOM   57    O  O   . GLN A 1  18   ? 255.404 229.416 147.103 1.00 500.00 ?  18   GLN A O   1 
ATOM   58    C  CB  . GLN A 1  18   ? 255.720 229.064 150.020 1.00 491.09 ?  18   GLN A CB  1 
ATOM   59    C  CG  . GLN A 1  18   ? 256.205 229.020 151.461 1.00 464.44 ?  18   GLN A CG  1 
ATOM   60    C  CD  . GLN A 1  18   ? 255.197 229.579 152.453 1.00 455.11 ?  18   GLN A CD  1 
ATOM   61    O  OE1 . GLN A 1  18   ? 254.024 229.799 152.131 1.00 433.95 ?  18   GLN A OE1 1 
ATOM   62    N  NE2 . GLN A 1  18   ? 255.654 229.806 153.676 1.00 465.13 ?  18   GLN A NE2 1 
ATOM   63    N  N   . GLU A 1  19   ? 256.369 227.375 147.035 1.00 500.00 ?  19   GLU A N   1 
ATOM   64    C  CA  . GLU A 1  19   ? 255.609 226.942 145.864 1.00 500.00 ?  19   GLU A CA  1 
ATOM   65    C  C   . GLU A 1  19   ? 254.181 226.669 146.320 1.00 500.00 ?  19   GLU A C   1 
ATOM   66    O  O   . GLU A 1  19   ? 253.940 225.815 147.180 1.00 500.00 ?  19   GLU A O   1 
ATOM   67    C  CB  . GLU A 1  19   ? 256.241 225.726 145.176 1.00 500.00 ?  19   GLU A CB  1 
ATOM   68    C  CG  . GLU A 1  19   ? 257.219 226.097 144.066 1.00 500.00 ?  19   GLU A CG  1 
ATOM   69    C  CD  . GLU A 1  19   ? 257.430 225.001 143.031 1.00 500.00 ?  19   GLU A CD  1 
ATOM   70    O  OE1 . GLU A 1  19   ? 256.596 224.074 142.925 1.00 497.28 ?  19   GLU A OE1 1 
ATOM   71    O  OE2 . GLU A 1  19   ? 258.444 225.074 142.306 1.00 497.83 -1 19   GLU A OE2 1 
ATOM   72    N  N   . PHE A 1  20   ? 253.255 227.450 145.770 1.00 500.00 ?  20   PHE A N   1 
ATOM   73    C  CA  . PHE A 1  20   ? 251.865 227.457 146.206 1.00 500.00 ?  20   PHE A CA  1 
ATOM   74    C  C   . PHE A 1  20   ? 250.942 226.889 145.130 1.00 500.00 ?  20   PHE A C   1 
ATOM   75    O  O   . PHE A 1  20   ? 250.698 227.516 144.090 1.00 500.00 ?  20   PHE A O   1 
ATOM   76    C  CB  . PHE A 1  20   ? 251.451 228.874 146.654 1.00 500.00 ?  20   PHE A CB  1 
ATOM   77    C  CG  . PHE A 1  20   ? 249.958 229.081 146.786 1.00 500.00 ?  20   PHE A CG  1 
ATOM   78    C  CD1 . PHE A 1  20   ? 249.231 228.467 147.811 1.00 500.00 ?  20   PHE A CD1 1 
ATOM   79    C  CD2 . PHE A 1  20   ? 249.276 229.911 145.889 1.00 500.00 ?  20   PHE A CD2 1 
ATOM   80    C  CE1 . PHE A 1  20   ? 247.856 228.665 147.927 1.00 500.00 ?  20   PHE A CE1 1 
ATOM   81    C  CE2 . PHE A 1  20   ? 247.902 230.114 146.002 1.00 500.00 ?  20   PHE A CE2 1 
ATOM   82    C  CZ  . PHE A 1  20   ? 247.192 229.490 147.022 1.00 500.00 ?  20   PHE A CZ  1 
ATOM   83    N  N   . VAL A 1  21   ? 250.481 225.670 145.391 1.00 500.00 ?  21   VAL A N   1 
ATOM   84    C  CA  . VAL A 1  21   ? 249.406 225.046 144.636 1.00 500.00 ?  21   VAL A CA  1 
ATOM   85    C  C   . VAL A 1  21   ? 248.203 224.951 145.587 1.00 500.00 ?  21   VAL A C   1 
ATOM   86    O  O   . VAL A 1  21   ? 248.367 224.509 146.734 1.00 500.00 ?  21   VAL A O   1 
ATOM   87    C  CB  . VAL A 1  21   ? 249.833 223.682 144.007 1.00 500.00 ?  21   VAL A CB  1 
ATOM   88    C  CG1 . VAL A 1  21   ? 250.264 222.653 145.055 1.00 500.00 ?  21   VAL A CG1 1 
ATOM   89    C  CG2 . VAL A 1  21   ? 248.744 223.125 143.099 1.00 500.00 ?  21   VAL A CG2 1 
ATOM   90    N  N   . PRO A 1  22   ? 247.009 225.420 145.143 1.00 500.00 ?  22   PRO A N   1 
ATOM   91    C  CA  . PRO A 1  22   ? 245.814 225.252 145.982 1.00 480.69 ?  22   PRO A CA  1 
ATOM   92    C  C   . PRO A 1  22   ? 245.594 223.774 146.304 1.00 424.58 ?  22   PRO A C   1 
ATOM   93    O  O   . PRO A 1  22   ? 245.670 222.928 145.406 1.00 416.19 ?  22   PRO A O   1 
ATOM   94    C  CB  . PRO A 1  22   ? 244.672 225.821 145.120 1.00 484.85 ?  22   PRO A CB  1 
ATOM   95    C  CG  . PRO A 1  22   ? 245.241 226.042 143.758 1.00 499.58 ?  22   PRO A CG  1 
ATOM   96    C  CD  . PRO A 1  22   ? 246.720 226.221 143.938 1.00 500.00 ?  22   PRO A CD  1 
ATOM   97    N  N   . PHE A 1  23   ? 245.382 223.481 147.586 1.00 342.01 ?  23   PHE A N   1 
ATOM   98    C  CA  . PHE A 1  23   ? 245.286 222.109 148.095 1.00 241.11 ?  23   PHE A CA  1 
ATOM   99    C  C   . PHE A 1  23   ? 244.180 221.317 147.427 1.00 200.77 ?  23   PHE A C   1 
ATOM   100   O  O   . PHE A 1  23   ? 244.395 220.186 147.036 1.00 179.84 ?  23   PHE A O   1 
ATOM   101   C  CB  . PHE A 1  23   ? 245.080 222.107 149.613 1.00 207.34 ?  23   PHE A CB  1 
ATOM   102   C  CG  . PHE A 1  23   ? 245.096 220.739 150.226 1.00 210.24 ?  23   PHE A CG  1 
ATOM   103   C  CD1 . PHE A 1  23   ? 246.204 219.894 150.076 1.00 214.97 ?  23   PHE A CD1 1 
ATOM   104   C  CD2 . PHE A 1  23   ? 244.000 220.284 150.952 1.00 214.89 ?  23   PHE A CD2 1 
ATOM   105   C  CE1 . PHE A 1  23   ? 246.216 218.629 150.644 1.00 213.53 ?  23   PHE A CE1 1 
ATOM   106   C  CE2 . PHE A 1  23   ? 244.011 219.019 151.520 1.00 215.90 ?  23   PHE A CE2 1 
ATOM   107   C  CZ  . PHE A 1  23   ? 245.115 218.192 151.364 1.00 220.42 ?  23   PHE A CZ  1 
ATOM   108   N  N   . GLY A 1  24   ? 243.004 221.938 147.313 1.00 186.03 ?  24   GLY A N   1 
ATOM   109   C  CA  . GLY A 1  24   ? 241.845 221.370 146.633 1.00 153.45 ?  24   GLY A CA  1 
ATOM   110   C  C   . GLY A 1  24   ? 242.257 220.703 145.341 1.00 152.79 ?  24   GLY A C   1 
ATOM   111   O  O   . GLY A 1  24   ? 241.856 219.580 145.088 1.00 124.60 ?  24   GLY A O   1 
ATOM   112   N  N   . ARG A 1  25   ? 243.100 221.384 144.560 1.00 174.57 ?  25   ARG A N   1 
ATOM   113   C  CA  . ARG A 1  25   ? 243.605 220.878 143.282 1.00 197.32 ?  25   ARG A CA  1 
ATOM   114   C  C   . ARG A 1  25   ? 244.523 219.687 143.490 1.00 165.50 ?  25   ARG A C   1 
ATOM   115   O  O   . ARG A 1  25   ? 244.760 218.913 142.559 1.00 179.88 ?  25   ARG A O   1 
ATOM   116   C  CB  . ARG A 1  25   ? 244.328 221.983 142.498 1.00 271.20 ?  25   ARG A CB  1 
ATOM   117   C  CG  . ARG A 1  25   ? 244.684 221.615 141.063 1.00 334.37 ?  25   ARG A CG  1 
ATOM   118   C  CD  . ARG A 1  25   ? 246.057 222.173 140.739 1.00 372.22 ?  25   ARG A CD  1 
ATOM   119   N  NE  . ARG A 1  25   ? 246.102 223.120 139.614 1.00 401.50 ?  25   ARG A NE  1 
ATOM   120   C  CZ  . ARG A 1  25   ? 245.437 224.276 139.505 1.00 415.32 ?  25   ARG A CZ  1 
ATOM   121   N  NH1 . ARG A 1  25   ? 244.582 224.697 140.436 1.00 422.87 ?  25   ARG A NH1 1 
ATOM   122   N  NH2 . ARG A 1  25   ? 245.617 225.014 138.417 1.00 422.30 ?  25   ARG A NH2 1 
ATOM   123   N  N   . ASP A 1  26   ? 245.034 219.550 144.706 1.00 159.49 ?  26   ASP A N   1 
ATOM   124   C  CA  . ASP A 1  26   ? 245.798 218.362 145.109 1.00 208.12 ?  26   ASP A CA  1 
ATOM   125   C  C   . ASP A 1  26   ? 244.853 217.207 145.523 1.00 204.13 ?  26   ASP A C   1 
ATOM   126   O  O   . ASP A 1  26   ? 245.242 216.045 145.587 1.00 205.28 ?  26   ASP A O   1 
ATOM   127   C  CB  . ASP A 1  26   ? 246.789 218.767 146.226 1.00 231.52 ?  26   ASP A CB  1 
ATOM   128   C  CG  . ASP A 1  26   ? 247.314 217.584 147.045 1.00 264.60 ?  26   ASP A CG  1 
ATOM   129   O  OD1 . ASP A 1  26   ? 246.605 217.120 147.969 1.00 270.65 -1 26   ASP A OD1 1 
ATOM   130   O  OD2 . ASP A 1  26   ? 248.445 217.125 146.771 1.00 289.25 ?  26   ASP A OD2 1 
ATOM   131   N  N   . HIS A 1  27   ? 243.594 217.541 145.745 1.00 200.10 ?  27   HIS A N   1 
ATOM   132   C  CA  . HIS A 1  27   ? 242.703 216.740 146.544 1.00 192.04 ?  27   HIS A CA  1 
ATOM   133   C  C   . HIS A 1  27   ? 241.360 216.637 145.827 1.00 170.84 ?  27   HIS A C   1 
ATOM   134   O  O   . HIS A 1  27   ? 240.546 215.814 146.202 1.00 160.96 ?  27   HIS A O   1 
ATOM   135   C  CB  . HIS A 1  27   ? 242.625 217.446 147.908 1.00 223.51 ?  27   HIS A CB  1 
ATOM   136   C  CG  . HIS A 1  27   ? 241.622 216.897 148.865 1.00 222.74 ?  27   HIS A CG  1 
ATOM   137   N  ND1 . HIS A 1  27   ? 240.266 217.080 148.707 1.00 210.99 ?  27   HIS A ND1 1 
ATOM   138   C  CD2 . HIS A 1  27   ? 241.784 216.257 150.047 1.00 225.89 ?  27   HIS A CD2 1 
ATOM   139   C  CE1 . HIS A 1  27   ? 239.634 216.536 149.731 1.00 231.28 ?  27   HIS A CE1 1 
ATOM   140   N  NE2 . HIS A 1  27   ? 240.531 216.027 150.556 1.00 249.94 ?  27   HIS A NE2 1 
ATOM   141   N  N   . CYS A 1  28   ? 241.143 217.473 144.803 1.00 161.68 ?  28   CYS A N   1 
ATOM   142   C  CA  . CYS A 1  28   ? 240.013 217.338 143.864 1.00 205.89 ?  28   CYS A CA  1 
ATOM   143   C  C   . CYS A 1  28   ? 240.238 216.232 142.828 1.00 295.73 ?  28   CYS A C   1 
ATOM   144   O  O   . CYS A 1  28   ? 239.288 215.539 142.438 1.00 351.17 ?  28   CYS A O   1 
ATOM   145   C  CB  . CYS A 1  28   ? 239.738 218.638 143.118 1.00 171.55 ?  28   CYS A CB  1 
ATOM   146   S  SG  . CYS A 1  28   ? 238.506 219.722 143.875 1.00 212.19 ?  28   CYS A SG  1 
ATOM   147   N  N   . LYS A 1  29   ? 241.491 216.067 142.388 1.00 351.18 ?  29   LYS A N   1 
ATOM   148   C  CA  . LYS A 1  29   ? 241.880 215.067 141.371 1.00 333.59 ?  29   LYS A CA  1 
ATOM   149   C  C   . LYS A 1  29   ? 241.924 213.628 141.957 1.00 269.96 ?  29   LYS A C   1 
ATOM   150   O  O   . LYS A 1  29   ? 242.778 212.807 141.593 1.00 245.35 ?  29   LYS A O   1 
ATOM   151   C  CB  . LYS A 1  29   ? 243.222 215.479 140.726 1.00 351.58 ?  29   LYS A CB  1 
ATOM   152   C  CG  . LYS A 1  29   ? 243.539 214.838 139.373 1.00 331.30 ?  29   LYS A CG  1 
ATOM   153   C  CD  . LYS A 1  29   ? 245.034 214.801 139.058 1.00 315.00 ?  29   LYS A CD  1 
ATOM   154   C  CE  . LYS A 1  29   ? 245.851 213.951 140.031 1.00 313.13 ?  29   LYS A CE  1 
ATOM   155   N  NZ  . LYS A 1  29   ? 246.625 214.796 140.984 1.00 293.14 ?  29   LYS A NZ  1 
ATOM   156   N  N   . HIS A 1  30   ? 240.974 213.334 142.847 1.00 196.94 ?  30   HIS A N   1 
ATOM   157   C  CA  . HIS A 1  30   ? 240.977 212.159 143.694 1.00 177.62 ?  30   HIS A CA  1 
ATOM   158   C  C   . HIS A 1  30   ? 239.631 211.942 144.390 1.00 208.30 ?  30   HIS A C   1 
ATOM   159   O  O   . HIS A 1  30   ? 239.305 210.824 144.794 1.00 229.66 ?  30   HIS A O   1 
ATOM   160   C  CB  . HIS A 1  30   ? 242.037 212.344 144.763 1.00 175.43 ?  30   HIS A CB  1 
ATOM   161   C  CG  . HIS A 1  30   ? 243.416 212.087 144.273 1.00 189.32 ?  30   HIS A CG  1 
ATOM   162   N  ND1 . HIS A 1  30   ? 244.304 213.100 143.987 1.00 186.00 ?  30   HIS A ND1 1 
ATOM   163   C  CD2 . HIS A 1  30   ? 244.052 210.929 143.977 1.00 223.95 ?  30   HIS A CD2 1 
ATOM   164   C  CE1 . HIS A 1  30   ? 245.438 212.575 143.555 1.00 233.36 ?  30   HIS A CE1 1 
ATOM   165   N  NE2 . HIS A 1  30   ? 245.313 211.260 143.545 1.00 253.29 ?  30   HIS A NE2 1 
ATOM   166   N  N   . HIS A 1  31   ? 238.878 213.034 144.543 1.00 217.14 ?  31   HIS A N   1 
ATOM   167   C  CA  . HIS A 1  31   ? 237.638 213.127 145.331 1.00 188.99 ?  31   HIS A CA  1 
ATOM   168   C  C   . HIS A 1  31   ? 236.488 212.399 144.625 1.00 152.56 ?  31   HIS A C   1 
ATOM   169   O  O   . HIS A 1  31   ? 236.507 212.315 143.387 1.00 156.46 ?  31   HIS A O   1 
ATOM   170   C  CB  . HIS A 1  31   ? 237.287 214.615 145.471 1.00 226.08 ?  31   HIS A CB  1 
ATOM   171   C  CG  . HIS A 1  31   ? 236.854 215.034 146.843 1.00 214.90 ?  31   HIS A CG  1 
ATOM   172   N  ND1 . HIS A 1  31   ? 235.596 215.532 147.106 1.00 236.92 ?  31   HIS A ND1 1 
ATOM   173   C  CD2 . HIS A 1  31   ? 237.523 215.072 148.019 1.00 173.67 ?  31   HIS A CD2 1 
ATOM   174   C  CE1 . HIS A 1  31   ? 235.502 215.835 148.387 1.00 229.95 ?  31   HIS A CE1 1 
ATOM   175   N  NE2 . HIS A 1  31   ? 236.659 215.567 148.965 1.00 182.95 ?  31   HIS A NE2 1 
ATOM   176   N  N   . PRO A 1  32   ? 235.488 211.898 145.400 1.00 114.16 ?  32   PRO A N   1 
ATOM   177   C  CA  . PRO A 1  32   ? 234.284 211.200 144.972 1.00 133.89 ?  32   PRO A CA  1 
ATOM   178   C  C   . PRO A 1  32   ? 233.561 211.845 143.799 1.00 176.89 ?  32   PRO A C   1 
ATOM   179   O  O   . PRO A 1  32   ? 233.320 211.157 142.799 1.00 230.11 ?  32   PRO A O   1 
ATOM   180   C  CB  . PRO A 1  32   ? 233.392 211.258 146.210 1.00 113.00 ?  32   PRO A CB  1 
ATOM   181   C  CG  . PRO A 1  32   ? 233.984 212.292 147.060 1.00 116.99 ?  32   PRO A CG  1 
ATOM   182   C  CD  . PRO A 1  32   ? 235.436 212.051 146.848 1.00 108.96 ?  32   PRO A CD  1 
ATOM   183   N  N   . ASN A 1  33   ? 233.206 213.128 143.921 1.00 171.47 ?  33   ASN A N   1 
ATOM   184   C  CA  . ASN A 1  33   ? 232.772 213.933 142.773 1.00 179.90 ?  33   ASN A CA  1 
ATOM   185   C  C   . ASN A 1  33   ? 231.314 213.770 142.368 1.00 183.42 ?  33   ASN A C   1 
ATOM   186   O  O   . ASN A 1  33   ? 230.577 214.749 142.379 1.00 194.47 ?  33   ASN A O   1 
ATOM   187   C  CB  . ASN A 1  33   ? 233.715 213.703 141.560 1.00 202.25 ?  33   ASN A CB  1 
ATOM   188   C  CG  . ASN A 1  33   ? 233.375 214.565 140.359 1.00 199.47 ?  33   ASN A CG  1 
ATOM   189   O  OD1 . ASN A 1  33   ? 233.581 215.774 140.384 1.00 194.79 ?  33   ASN A OD1 1 
ATOM   190   N  ND2 . ASN A 1  33   ? 232.884 213.940 139.283 1.00 181.21 ?  33   ASN A ND2 1 
ATOM   191   N  N   . ALA A 1  34   ? 230.925 212.548 141.992 1.00 204.61 ?  34   ALA A N   1 
ATOM   192   C  CA  . ALA A 1  34   ? 229.625 212.260 141.362 1.00 221.91 ?  34   ALA A CA  1 
ATOM   193   C  C   . ALA A 1  34   ? 228.709 211.486 142.300 1.00 223.80 ?  34   ALA A C   1 
ATOM   194   O  O   . ALA A 1  34   ? 229.099 210.467 142.833 1.00 256.63 ?  34   ALA A O   1 
ATOM   195   C  CB  . ALA A 1  34   ? 229.833 211.478 140.069 1.00 225.00 ?  34   ALA A CB  1 
ATOM   196   N  N   . LEU A 1  35   ? 227.481 211.951 142.486 1.00 215.50 ?  35   LEU A N   1 
ATOM   197   C  CA  . LEU A 1  35   ? 226.614 211.356 143.495 1.00 224.07 ?  35   LEU A CA  1 
ATOM   198   C  C   . LEU A 1  35   ? 225.353 210.801 142.839 1.00 243.23 ?  35   LEU A C   1 
ATOM   199   O  O   . LEU A 1  35   ? 224.635 211.535 142.156 1.00 295.72 ?  35   LEU A O   1 
ATOM   200   C  CB  . LEU A 1  35   ? 226.274 212.389 144.583 1.00 258.79 ?  35   LEU A CB  1 
ATOM   201   C  CG  . LEU A 1  35   ? 227.163 213.631 144.813 1.00 304.24 ?  35   LEU A CG  1 
ATOM   202   C  CD1 . LEU A 1  35   ? 226.408 214.726 145.561 1.00 323.26 ?  35   LEU A CD1 1 
ATOM   203   C  CD2 . LEU A 1  35   ? 228.486 213.308 145.507 1.00 324.68 ?  35   LEU A CD2 1 
ATOM   204   N  N   . ASN A 1  36   ? 225.099 209.506 143.022 1.00 248.81 ?  36   ASN A N   1 
ATOM   205   C  CA  . ASN A 1  36   ? 223.860 208.881 142.512 1.00 265.46 ?  36   ASN A CA  1 
ATOM   206   C  C   . ASN A 1  36   ? 222.705 208.798 143.547 1.00 272.81 ?  36   ASN A C   1 
ATOM   207   O  O   . ASN A 1  36   ? 222.352 207.727 144.055 1.00 242.16 ?  36   ASN A O   1 
ATOM   208   C  CB  . ASN A 1  36   ? 224.141 207.553 141.765 1.00 307.31 ?  36   ASN A CB  1 
ATOM   209   C  CG  . ASN A 1  36   ? 224.550 206.401 142.684 1.00 353.83 ?  36   ASN A CG  1 
ATOM   210   O  OD1 . ASN A 1  36   ? 224.308 205.241 142.356 1.00 377.05 ?  36   ASN A OD1 1 
ATOM   211   N  ND2 . ASN A 1  36   ? 225.168 206.708 143.827 1.00 376.26 ?  36   ASN A ND2 1 
ATOM   212   N  N   . LEU A 1  37   ? 222.145 209.967 143.858 1.00 285.42 ?  37   LEU A N   1 
ATOM   213   C  CA  . LEU A 1  37   ? 220.956 210.118 144.719 1.00 226.00 ?  37   LEU A CA  1 
ATOM   214   C  C   . LEU A 1  37   ? 219.708 209.704 143.937 1.00 196.18 ?  37   LEU A C   1 
ATOM   215   O  O   . LEU A 1  37   ? 218.782 209.104 144.484 1.00 162.64 ?  37   LEU A O   1 
ATOM   216   C  CB  . LEU A 1  37   ? 220.839 211.579 145.169 1.00 210.95 ?  37   LEU A CB  1 
ATOM   217   C  CG  . LEU A 1  37   ? 220.380 211.955 146.570 1.00 208.27 ?  37   LEU A CG  1 
ATOM   218   C  CD1 . LEU A 1  37   ? 221.002 213.304 146.900 1.00 196.03 ?  37   LEU A CD1 1 
ATOM   219   C  CD2 . LEU A 1  37   ? 218.859 212.009 146.670 1.00 218.01 ?  37   LEU A CD2 1 
ATOM   220   N  N   . GLN A 1  38   ? 219.719 210.045 142.647 1.00 189.26 ?  38   GLN A N   1 
ATOM   221   C  CA  . GLN A 1  38   ? 218.704 209.675 141.674 1.00 172.11 ?  38   GLN A CA  1 
ATOM   222   C  C   . GLN A 1  38   ? 219.244 208.523 140.824 1.00 162.07 ?  38   GLN A C   1 
ATOM   223   O  O   . GLN A 1  38   ? 219.400 208.656 139.608 1.00 151.05 ?  38   GLN A O   1 
ATOM   224   C  CB  . GLN A 1  38   ? 218.383 210.880 140.791 1.00 175.94 ?  38   GLN A CB  1 
ATOM   225   C  CG  . GLN A 1  38   ? 216.951 210.888 140.299 1.00 207.75 ?  38   GLN A CG  1 
ATOM   226   C  CD  . GLN A 1  38   ? 216.777 211.568 138.951 1.00 229.55 ?  38   GLN A CD  1 
ATOM   227   O  OE1 . GLN A 1  38   ? 216.585 210.899 137.932 1.00 250.97 ?  38   GLN A OE1 1 
ATOM   228   N  NE2 . GLN A 1  38   ? 216.828 212.904 138.935 1.00 236.33 ?  38   GLN A NE2 1 
ATOM   229   N  N   . LEU A 1  39   ? 219.510 207.395 141.489 1.00 176.03 ?  39   LEU A N   1 
ATOM   230   C  CA  . LEU A 1  39   ? 220.162 206.202 140.904 1.00 193.02 ?  39   LEU A CA  1 
ATOM   231   C  C   . LEU A 1  39   ? 219.496 205.587 139.673 1.00 209.94 ?  39   LEU A C   1 
ATOM   232   O  O   . LEU A 1  39   ? 220.020 205.746 138.571 1.00 249.00 ?  39   LEU A O   1 
ATOM   233   C  CB  . LEU A 1  39   ? 220.425 205.124 141.966 1.00 186.11 ?  39   LEU A CB  1 
ATOM   234   C  CG  . LEU A 1  39   ? 219.586 205.114 143.244 1.00 201.52 ?  39   LEU A CG  1 
ATOM   235   C  CD1 . LEU A 1  39   ? 218.292 204.337 143.093 1.00 192.04 ?  39   LEU A CD1 1 
ATOM   236   C  CD2 . LEU A 1  39   ? 220.424 204.533 144.364 1.00 211.06 ?  39   LEU A CD2 1 
ATOM   237   N  N   . ARG A 1  40   ? 218.371 204.888 139.865 1.00 210.54 ?  40   ARG A N   1 
ATOM   238   C  CA  . ARG A 1  40   ? 217.640 204.220 138.772 1.00 209.77 ?  40   ARG A CA  1 
ATOM   239   C  C   . ARG A 1  40   ? 217.436 205.107 137.528 1.00 221.22 ?  40   ARG A C   1 
ATOM   240   O  O   . ARG A 1  40   ? 216.938 206.240 137.619 1.00 203.82 ?  40   ARG A O   1 
ATOM   241   C  CB  . ARG A 1  40   ? 216.311 203.571 139.242 1.00 182.84 ?  40   ARG A CB  1 
ATOM   242   C  CG  . ARG A 1  40   ? 215.711 204.112 140.541 1.00 187.11 ?  40   ARG A CG  1 
ATOM   243   C  CD  . ARG A 1  40   ? 214.607 203.243 141.105 1.00 180.04 ?  40   ARG A CD  1 
ATOM   244   N  NE  . ARG A 1  40   ? 214.958 202.793 142.452 1.00 191.57 ?  40   ARG A NE  1 
ATOM   245   C  CZ  . ARG A 1  40   ? 215.197 201.524 142.783 1.00 217.90 ?  40   ARG A CZ  1 
ATOM   246   N  NH1 . ARG A 1  40   ? 215.082 200.555 141.882 1.00 239.07 ?  40   ARG A NH1 1 
ATOM   247   N  NH2 . ARG A 1  40   ? 215.521 201.212 144.031 1.00 202.41 ?  40   ARG A NH2 1 
ATOM   248   N  N   . GLN A 1  41   ? 217.933 204.605 136.394 1.00 232.28 ?  41   GLN A N   1 
ATOM   249   C  CA  . GLN A 1  41   ? 217.512 205.063 135.076 1.00 204.07 ?  41   GLN A CA  1 
ATOM   250   C  C   . GLN A 1  41   ? 216.263 204.229 134.823 1.00 196.87 ?  41   GLN A C   1 
ATOM   251   O  O   . GLN A 1  41   ? 216.318 202.988 134.764 1.00 166.89 ?  41   GLN A O   1 
ATOM   252   C  CB  . GLN A 1  41   ? 218.570 204.823 133.972 1.00 202.24 ?  41   GLN A CB  1 
ATOM   253   C  CG  . GLN A 1  41   ? 219.969 205.406 134.212 1.00 223.93 ?  41   GLN A CG  1 
ATOM   254   C  CD  . GLN A 1  41   ? 221.024 204.365 134.627 1.00 235.42 ?  41   GLN A CD  1 
ATOM   255   O  OE1 . GLN A 1  41   ? 221.168 203.315 133.997 1.00 245.04 ?  41   GLN A OE1 1 
ATOM   256   N  NE2 . GLN A 1  41   ? 221.786 204.673 135.679 1.00 214.31 ?  41   GLN A NE2 1 
ATOM   257   N  N   . LEU A 1  42   ? 215.135 204.934 134.780 1.00 203.46 ?  42   LEU A N   1 
ATOM   258   C  CA  . LEU A 1  42   ? 213.833 204.406 134.368 1.00 214.43 ?  42   LEU A CA  1 
ATOM   259   C  C   . LEU A 1  42   ? 213.897 204.000 132.910 1.00 241.71 ?  42   LEU A C   1 
ATOM   260   O  O   . LEU A 1  42   ? 214.503 204.720 132.106 1.00 292.06 ?  42   LEU A O   1 
ATOM   261   C  CB  . LEU A 1  42   ? 212.740 205.470 134.573 1.00 183.24 ?  42   LEU A CB  1 
ATOM   262   C  CG  . LEU A 1  42   ? 213.083 206.972 134.688 1.00 192.62 ?  42   LEU A CG  1 
ATOM   263   C  CD1 . LEU A 1  42   ? 213.554 207.648 133.396 1.00 177.24 ?  42   LEU A CD1 1 
ATOM   264   C  CD2 . LEU A 1  42   ? 211.884 207.720 135.250 1.00 221.58 ?  42   LEU A CD2 1 
ATOM   265   N  N   . GLN A 1  43   ? 213.314 202.840 132.585 1.00 248.90 ?  43   GLN A N   1 
ATOM   266   C  CA  . GLN A 1  43   ? 213.179 202.382 131.188 1.00 293.20 ?  43   GLN A CA  1 
ATOM   267   C  C   . GLN A 1  43   ? 212.476 203.440 130.340 1.00 372.46 ?  43   GLN A C   1 
ATOM   268   O  O   . GLN A 1  43   ? 211.409 203.922 130.733 1.00 396.26 ?  43   GLN A O   1 
ATOM   269   C  CB  . GLN A 1  43   ? 212.422 201.041 131.060 1.00 251.33 ?  43   GLN A CB  1 
ATOM   270   C  CG  . GLN A 1  43   ? 211.377 200.683 132.124 1.00 261.60 ?  43   GLN A CG  1 
ATOM   271   C  CD  . GLN A 1  43   ? 210.343 201.763 132.438 1.00 261.91 ?  43   GLN A CD  1 
ATOM   272   O  OE1 . GLN A 1  43   ? 210.602 202.685 133.221 1.00 235.80 ?  43   GLN A OE1 1 
ATOM   273   N  NE2 . GLN A 1  43   ? 209.154 201.632 131.856 1.00 273.71 ?  43   GLN A NE2 1 
ATOM   274   N  N   . PRO A 1  44   ? 213.073 203.832 129.184 1.00 425.28 ?  44   PRO A N   1 
ATOM   275   C  CA  . PRO A 1  44   ? 212.292 204.734 128.337 1.00 430.92 ?  44   PRO A CA  1 
ATOM   276   C  C   . PRO A 1  44   ? 211.034 203.992 127.818 1.00 442.54 ?  44   PRO A C   1 
ATOM   277   O  O   . PRO A 1  44   ? 211.120 202.771 127.647 1.00 457.84 ?  44   PRO A O   1 
ATOM   278   C  CB  . PRO A 1  44   ? 213.278 205.099 127.217 1.00 394.20 ?  44   PRO A CB  1 
ATOM   279   C  CG  . PRO A 1  44   ? 214.636 204.817 127.766 1.00 388.22 ?  44   PRO A CG  1 
ATOM   280   C  CD  . PRO A 1  44   ? 214.427 203.608 128.631 1.00 423.00 ?  44   PRO A CD  1 
ATOM   281   N  N   . ALA A 1  45   ? 209.864 204.619 127.617 1.00 427.71 ?  45   ALA A N   1 
ATOM   282   C  CA  . ALA A 1  45   ? 209.461 206.050 127.643 1.00 400.77 ?  45   ALA A CA  1 
ATOM   283   C  C   . ALA A 1  45   ? 208.783 206.236 126.297 1.00 368.91 ?  45   ALA A C   1 
ATOM   284   O  O   . ALA A 1  45   ? 209.248 206.996 125.451 1.00 359.12 ?  45   ALA A O   1 
ATOM   285   C  CB  . ALA A 1  45   ? 210.602 207.044 127.819 1.00 421.49 ?  45   ALA A CB  1 
ATOM   286   N  N   . SER A 1  46   ? 207.675 205.525 126.117 1.00 310.88 ?  46   SER A N   1 
ATOM   287   C  CA  . SER A 1  46   ? 207.112 205.236 124.798 1.00 301.86 ?  46   SER A CA  1 
ATOM   288   C  C   . SER A 1  46   ? 206.568 206.470 124.071 1.00 285.39 ?  46   SER A C   1 
ATOM   289   O  O   . SER A 1  46   ? 206.464 207.544 124.665 1.00 311.18 ?  46   SER A O   1 
ATOM   290   C  CB  . SER A 1  46   ? 206.039 204.149 124.944 1.00 309.36 ?  46   SER A CB  1 
ATOM   291   O  OG  . SER A 1  46   ? 206.517 203.069 125.738 1.00 279.32 ?  46   SER A OG  1 
ATOM   292   N  N   . GLU A 1  47   ? 206.282 206.317 122.781 1.00 262.79 ?  47   GLU A N   1 
ATOM   293   C  CA  . GLU A 1  47   ? 205.446 207.241 121.998 1.00 257.28 ?  47   GLU A CA  1 
ATOM   294   C  C   . GLU A 1  47   ? 204.385 208.056 122.800 1.00 265.56 ?  47   GLU A C   1 
ATOM   295   O  O   . GLU A 1  47   ? 204.394 209.292 122.764 1.00 264.96 ?  47   GLU A O   1 
ATOM   296   C  CB  . GLU A 1  47   ? 204.778 206.463 120.851 1.00 269.75 ?  47   GLU A CB  1 
ATOM   297   C  CG  . GLU A 1  47   ? 204.879 204.928 120.918 1.00 265.68 ?  47   GLU A CG  1 
ATOM   298   C  CD  . GLU A 1  47   ? 204.104 204.254 122.062 1.00 274.18 ?  47   GLU A CD  1 
ATOM   299   O  OE1 . GLU A 1  47   ? 203.360 204.912 122.825 1.00 240.85 ?  47   GLU A OE1 1 
ATOM   300   O  OE2 . GLU A 1  47   ? 204.254 203.024 122.211 1.00 277.03 -1 47   GLU A OE2 1 
ATOM   301   N  N   . LEU A 1  48   ? 203.494 207.373 123.505 1.00 250.99 ?  48   LEU A N   1 
ATOM   302   C  CA  . LEU A 1  48   ? 202.446 208.048 124.273 1.00 250.90 ?  48   LEU A CA  1 
ATOM   303   C  C   . LEU A 1  48   ? 202.869 208.668 125.610 1.00 272.50 ?  48   LEU A C   1 
ATOM   304   O  O   . LEU A 1  48   ? 203.517 208.010 126.415 1.00 330.32 ?  48   LEU A O   1 
ATOM   305   C  CB  . LEU A 1  48   ? 201.296 207.072 124.525 1.00 20.00  ?  48   LEU A CB  1 
ATOM   306   C  CG  . LEU A 1  48   ? 200.035 207.598 125.209 1.00 20.00  ?  48   LEU A CG  1 
ATOM   307   C  CD1 . LEU A 1  48   ? 199.921 207.036 126.612 1.00 20.00  ?  48   LEU A CD1 1 
ATOM   308   C  CD2 . LEU A 1  48   ? 199.981 209.115 125.232 1.00 20.00  ?  48   LEU A CD2 1 
ATOM   309   N  N   . TRP A 1  49   ? 202.484 209.925 125.844 1.00 276.63 ?  49   TRP A N   1 
ATOM   310   C  CA  . TRP A 1  49   ? 202.778 210.621 127.105 1.00 279.24 ?  49   TRP A CA  1 
ATOM   311   C  C   . TRP A 1  49   ? 201.866 210.058 128.216 1.00 299.47 ?  49   TRP A C   1 
ATOM   312   O  O   . TRP A 1  49   ? 201.047 210.775 128.815 1.00 278.60 ?  49   TRP A O   1 
ATOM   313   C  CB  . TRP A 1  49   ? 202.583 212.131 126.960 1.00 20.00  ?  49   TRP A CB  1 
ATOM   314   N  N   . SER A 1  50   ? 202.035 208.757 128.468 1.00 317.08 ?  50   SER A N   1 
ATOM   315   C  CA  . SER A 1  50   ? 201.166 207.966 129.342 1.00 320.00 ?  50   SER A CA  1 
ATOM   316   C  C   . SER A 1  50   ? 201.219 208.404 130.807 1.00 345.71 ?  50   SER A C   1 
ATOM   317   O  O   . SER A 1  50   ? 200.215 208.883 131.343 1.00 371.54 ?  50   SER A O   1 
ATOM   318   C  CB  . SER A 1  50   ? 201.486 206.476 129.204 1.00 273.79 ?  50   SER A CB  1 
ATOM   319   N  N   . SER A 1  51   ? 202.393 208.267 131.425 1.00 341.06 ?  51   SER A N   1 
ATOM   320   C  CA  . SER A 1  51   ? 202.576 208.478 132.862 1.00 303.13 ?  51   SER A CA  1 
ATOM   321   C  C   . SER A 1  51   ? 203.183 209.846 133.153 1.00 295.00 ?  51   SER A C   1 
ATOM   322   O  O   . SER A 1  51   ? 204.209 210.209 132.569 1.00 274.08 ?  51   SER A O   1 
ATOM   323   C  CB  . SER A 1  51   ? 203.436 207.371 133.442 1.00 281.49 ?  51   SER A CB  1 
ATOM   324   N  N   . ASP A 1  52   ? 202.544 210.584 134.063 1.00 291.90 ?  52   ASP A N   1 
ATOM   325   C  CA  . ASP A 1  52   ? 202.853 211.996 134.320 1.00 330.54 ?  52   ASP A CA  1 
ATOM   326   C  C   . ASP A 1  52   ? 204.021 212.207 135.293 1.00 373.46 ?  52   ASP A C   1 
ATOM   327   O  O   . ASP A 1  52   ? 203.996 211.710 136.428 1.00 414.90 ?  52   ASP A O   1 
ATOM   328   C  CB  . ASP A 1  52   ? 201.606 212.730 134.802 1.00 284.51 ?  52   ASP A CB  1 
ATOM   329   N  N   . GLY A 1  53   ? 205.033 212.950 134.830 1.00 378.16 ?  53   GLY A N   1 
ATOM   330   C  CA  . GLY A 1  53   ? 206.254 213.239 135.599 1.00 371.38 ?  53   GLY A CA  1 
ATOM   331   C  C   . GLY A 1  53   ? 206.919 214.557 135.184 1.00 363.17 ?  53   GLY A C   1 
ATOM   332   O  O   . GLY A 1  53   ? 206.903 214.925 134.003 1.00 297.32 ?  53   GLY A O   1 
ATOM   333   N  N   . ALA A 1  54   ? 207.495 215.253 136.169 1.00 372.49 ?  54   ALA A N   1 
ATOM   334   C  CA  . ALA A 1  54   ? 208.344 216.429 135.934 1.00 377.50 ?  54   ALA A CA  1 
ATOM   335   C  C   . ALA A 1  54   ? 209.643 216.033 135.211 1.00 430.41 ?  54   ALA A C   1 
ATOM   336   O  O   . ALA A 1  54   ? 210.155 216.798 134.391 1.00 464.39 ?  54   ALA A O   1 
ATOM   337   C  CB  . ALA A 1  54   ? 208.637 217.154 137.242 1.00 287.68 ?  54   ALA A CB  1 
ATOM   338   N  N   . ALA A 1  55   ? 210.153 214.838 135.534 1.00 480.00 ?  55   ALA A N   1 
ATOM   339   C  CA  . ALA A 1  55   ? 211.200 214.114 134.775 1.00 485.20 ?  55   ALA A CA  1 
ATOM   340   C  C   . ALA A 1  55   ? 212.529 214.853 134.529 1.00 500.00 ?  55   ALA A C   1 
ATOM   341   O  O   . ALA A 1  55   ? 212.931 215.082 133.378 1.00 500.00 ?  55   ALA A O   1 
ATOM   342   C  CB  . ALA A 1  55   ? 210.628 213.538 133.475 1.00 480.00 ?  55   ALA A CB  1 
ATOM   343   N  N   . GLY A 1  56   ? 213.208 215.195 135.625 1.00 500.00 ?  56   GLY A N   1 
ATOM   344   C  CA  . GLY A 1  56   ? 214.554 215.797 135.589 1.00 500.00 ?  56   GLY A CA  1 
ATOM   345   C  C   . GLY A 1  56   ? 215.576 214.937 134.828 1.00 500.00 ?  56   GLY A C   1 
ATOM   346   O  O   . GLY A 1  56   ? 216.395 215.470 134.072 1.00 500.00 ?  56   GLY A O   1 
ATOM   347   N  N   . LEU A 1  57   ? 215.502 213.618 135.038 1.00 499.00 ?  57   LEU A N   1 
ATOM   348   C  CA  . LEU A 1  57   ? 216.271 212.593 134.300 1.00 483.19 ?  57   LEU A CA  1 
ATOM   349   C  C   . LEU A 1  57   ? 217.809 212.776 134.282 1.00 480.06 ?  57   LEU A C   1 
ATOM   350   O  O   . LEU A 1  57   ? 218.427 212.911 135.341 1.00 480.00 ?  57   LEU A O   1 
ATOM   351   C  CB  . LEU A 1  57   ? 215.697 212.401 132.893 1.00 484.95 ?  57   LEU A CB  1 
ATOM   352   N  N   . VAL A 1  58   ? 218.411 212.771 133.090 1.00 492.66 ?  58   VAL A N   1 
ATOM   353   C  CA  . VAL A 1  58   ? 219.869 212.856 132.935 1.00 500.00 ?  58   VAL A CA  1 
ATOM   354   C  C   . VAL A 1  58   ? 220.312 214.185 132.325 1.00 500.00 ?  58   VAL A C   1 
ATOM   355   O  O   . VAL A 1  58   ? 219.851 214.579 131.252 1.00 500.00 ?  58   VAL A O   1 
ATOM   356   C  CB  . VAL A 1  58   ? 220.390 211.683 132.112 1.00 500.00 ?  58   VAL A CB  1 
ATOM   357   N  N   . LYS A 1  71   ? 238.081 224.259 134.398 1.00 170.58 ?  71   LYS A N   1 
ATOM   358   C  CA  . LYS A 1  71   ? 237.741 225.698 134.392 1.00 236.94 ?  71   LYS A CA  1 
ATOM   359   C  C   . LYS A 1  71   ? 237.697 226.382 135.782 1.00 240.64 ?  71   LYS A C   1 
ATOM   360   O  O   . LYS A 1  71   ? 237.087 227.457 135.945 1.00 195.65 ?  71   LYS A O   1 
ATOM   361   C  CB  . LYS A 1  71   ? 236.417 225.920 133.647 1.00 262.67 ?  71   LYS A CB  1 
ATOM   362   N  N   . GLU A 1  72   ? 238.394 225.767 136.742 1.00 293.60 ?  72   GLU A N   1 
ATOM   363   C  CA  . GLU A 1  72   ? 238.381 226.105 138.179 1.00 334.12 ?  72   GLU A CA  1 
ATOM   364   C  C   . GLU A 1  72   ? 239.014 227.453 138.575 1.00 334.24 ?  72   GLU A C   1 
ATOM   365   O  O   . GLU A 1  72   ? 239.825 228.010 137.826 1.00 399.59 ?  72   GLU A O   1 
ATOM   366   C  CB  . GLU A 1  72   ? 239.079 224.966 138.962 1.00 393.91 ?  72   GLU A CB  1 
ATOM   367   C  CG  . GLU A 1  72   ? 240.560 225.161 139.310 1.00 439.85 ?  72   GLU A CG  1 
ATOM   368   C  CD  . GLU A 1  72   ? 241.515 225.140 138.125 1.00 471.93 ?  72   GLU A CD  1 
ATOM   369   O  OE1 . GLU A 1  72   ? 241.109 224.813 136.987 1.00 500.00 ?  72   GLU A OE1 1 
ATOM   370   O  OE2 . GLU A 1  72   ? 242.702 225.459 138.343 1.00 462.89 -1 72   GLU A OE2 1 
ATOM   371   N  N   . SER A 1  73   ? 238.647 227.941 139.767 1.00 257.00 ?  73   SER A N   1 
ATOM   372   C  CA  . SER A 1  73   ? 239.346 229.037 140.456 1.00 212.84 ?  73   SER A CA  1 
ATOM   373   C  C   . SER A 1  73   ? 239.267 228.860 141.976 1.00 189.31 ?  73   SER A C   1 
ATOM   374   O  O   . SER A 1  73   ? 238.848 227.797 142.443 1.00 126.99 ?  73   SER A O   1 
ATOM   375   C  CB  . SER A 1  73   ? 238.804 230.407 140.024 1.00 221.30 ?  73   SER A CB  1 
ATOM   376   O  OG  . SER A 1  73   ? 237.428 230.530 140.321 1.00 257.05 ?  73   SER A OG  1 
ATOM   377   N  N   . TRP A 1  74   ? 239.679 229.905 142.713 1.00 235.70 ?  74   TRP A N   1 
ATOM   378   C  CA  . TRP A 1  74   ? 239.779 229.932 144.186 1.00 297.48 ?  74   TRP A CA  1 
ATOM   379   C  C   . TRP A 1  74   ? 239.983 231.365 144.721 1.00 317.38 ?  74   TRP A C   1 
ATOM   380   O  O   . TRP A 1  74   ? 240.439 232.248 143.977 1.00 325.71 ?  74   TRP A O   1 
ATOM   381   C  CB  . TRP A 1  74   ? 240.942 229.046 144.670 1.00 373.56 ?  74   TRP A CB  1 
ATOM   382   C  CG  . TRP A 1  74   ? 242.329 229.511 144.241 1.00 438.73 ?  74   TRP A CG  1 
ATOM   383   C  CD1 . TRP A 1  74   ? 243.178 230.333 144.939 1.00 447.18 ?  74   TRP A CD1 1 
ATOM   384   C  CD2 . TRP A 1  74   ? 243.015 229.168 143.029 1.00 471.28 ?  74   TRP A CD2 1 
ATOM   385   N  NE1 . TRP A 1  74   ? 244.345 230.523 144.238 1.00 464.09 ?  74   TRP A NE1 1 
ATOM   386   C  CE2 . TRP A 1  74   ? 244.275 229.822 143.062 1.00 473.77 ?  74   TRP A CE2 1 
ATOM   387   C  CE3 . TRP A 1  74   ? 242.691 228.372 141.917 1.00 474.81 ?  74   TRP A CE3 1 
ATOM   388   C  CZ2 . TRP A 1  74   ? 245.216 229.707 142.021 1.00 472.52 ?  74   TRP A CZ2 1 
ATOM   389   C  CZ3 . TRP A 1  74   ? 243.631 228.258 140.875 1.00 467.05 ?  74   TRP A CZ3 1 
ATOM   390   C  CH2 . TRP A 1  74   ? 244.877 228.924 140.941 1.00 466.14 ?  74   TRP A CH2 1 
ATOM   391   N  N   . GLN A 1  75   ? 239.691 231.565 146.014 1.00 345.48 ?  75   GLN A N   1 
ATOM   392   C  CA  . GLN A 1  75   ? 239.878 232.862 146.716 1.00 318.83 ?  75   GLN A CA  1 
ATOM   393   C  C   . GLN A 1  75   ? 240.503 232.762 148.130 1.00 243.50 ?  75   GLN A C   1 
ATOM   394   O  O   . GLN A 1  75   ? 240.338 231.759 148.830 1.00 204.96 ?  75   GLN A O   1 
ATOM   395   C  CB  . GLN A 1  75   ? 238.561 233.659 146.760 1.00 382.05 ?  75   GLN A CB  1 
ATOM   396   C  CG  . GLN A 1  75   ? 237.343 232.882 147.248 1.00 405.95 ?  75   GLN A CG  1 
ATOM   397   C  CD  . GLN A 1  75   ? 236.060 233.680 147.156 1.00 404.64 ?  75   GLN A CD  1 
ATOM   398   O  OE1 . GLN A 1  75   ? 235.759 234.494 148.028 1.00 423.22 ?  75   GLN A OE1 1 
ATOM   399   N  NE2 . GLN A 1  75   ? 235.295 233.449 146.097 1.00 376.74 ?  75   GLN A NE2 1 
ATOM   400   N  N   . LEU A 1  76   ? 241.206 233.808 148.553 1.00 169.41 ?  76   LEU A N   1 
ATOM   401   C  CA  . LEU A 1  76   ? 241.832 233.774 149.859 1.00 139.59 ?  76   LEU A CA  1 
ATOM   402   C  C   . LEU A 1  76   ? 241.279 234.765 150.853 1.00 145.42 ?  76   LEU A C   1 
ATOM   403   O  O   . LEU A 1  76   ? 240.826 235.864 150.499 1.00 145.27 ?  76   LEU A O   1 
ATOM   404   C  CB  . LEU A 1  76   ? 243.340 233.885 149.749 1.00 142.09 ?  76   LEU A CB  1 
ATOM   405   C  CG  . LEU A 1  76   ? 244.041 232.533 149.731 1.00 175.27 ?  76   LEU A CG  1 
ATOM   406   C  CD1 . LEU A 1  76   ? 244.194 232.007 148.309 1.00 186.05 ?  76   LEU A CD1 1 
ATOM   407   C  CD2 . LEU A 1  76   ? 245.393 232.631 150.432 1.00 170.66 ?  76   LEU A CD2 1 
ATOM   408   N  N   . ARG A 1  77   ? 241.320 234.338 152.108 1.00 142.40 ?  77   ARG A N   1 
ATOM   409   C  CA  . ARG A 1  77   ? 240.778 235.073 153.234 1.00 146.27 ?  77   ARG A CA  1 
ATOM   410   C  C   . ARG A 1  77   ? 241.875 235.133 154.249 1.00 145.74 ?  77   ARG A C   1 
ATOM   411   O  O   . ARG A 1  77   ? 242.606 234.154 154.436 1.00 151.19 ?  77   ARG A O   1 
ATOM   412   C  CB  . ARG A 1  77   ? 239.604 234.302 153.836 1.00 142.71 ?  77   ARG A CB  1 
ATOM   413   C  CG  . ARG A 1  77   ? 238.817 235.030 154.895 1.00 147.29 ?  77   ARG A CG  1 
ATOM   414   C  CD  . ARG A 1  77   ? 237.464 234.380 155.061 1.00 192.20 ?  77   ARG A CD  1 
ATOM   415   N  NE  . ARG A 1  77   ? 237.434 233.403 156.144 1.00 198.96 ?  77   ARG A NE  1 
ATOM   416   C  CZ  . ARG A 1  77   ? 236.317 232.906 156.688 1.00 231.66 ?  77   ARG A CZ  1 
ATOM   417   N  NH1 . ARG A 1  77   ? 235.104 233.278 156.275 1.00 235.34 ?  77   ARG A NH1 1 
ATOM   418   N  NH2 . ARG A 1  77   ? 236.410 232.026 157.673 1.00 257.02 ?  77   ARG A NH2 1 
ATOM   419   N  N   . LYS A 1  78   ? 242.021 236.298 154.872 1.00 161.29 ?  78   LYS A N   1 
ATOM   420   C  CA  . LYS A 1  78   ? 242.762 236.409 156.113 1.00 180.38 ?  78   LYS A CA  1 
ATOM   421   C  C   . LYS A 1  78   ? 242.011 235.437 157.014 1.00 188.64 ?  78   LYS A C   1 
ATOM   422   O  O   . LYS A 1  78   ? 240.773 235.497 157.110 1.00 176.00 ?  78   LYS A O   1 
ATOM   423   C  CB  . LYS A 1  78   ? 242.726 237.861 156.622 1.00 211.71 ?  78   LYS A CB  1 
ATOM   424   C  CG  . LYS A 1  78   ? 243.074 238.100 158.089 1.00 224.74 ?  78   LYS A CG  1 
ATOM   425   C  CD  . LYS A 1  78   ? 244.564 238.094 158.359 1.00 227.41 ?  78   LYS A CD  1 
ATOM   426   C  CE  . LYS A 1  78   ? 244.867 238.900 159.606 1.00 232.84 ?  78   LYS A CE  1 
ATOM   427   N  NZ  . LYS A 1  78   ? 246.095 238.378 160.254 1.00 256.98 ?  78   LYS A NZ  1 
ATOM   428   N  N   . GLY A 1  79   ? 242.732 234.495 157.610 1.00 212.27 ?  79   GLY A N   1 
ATOM   429   C  CA  . GLY A 1  79   ? 242.049 233.438 158.346 1.00 240.90 ?  79   GLY A CA  1 
ATOM   430   C  C   . GLY A 1  79   ? 241.737 233.819 159.784 1.00 249.35 ?  79   GLY A C   1 
ATOM   431   O  O   . GLY A 1  79   ? 242.314 234.752 160.329 1.00 281.68 ?  79   GLY A O   1 
ATOM   432   N  N   . VAL A 1  80   ? 240.800 233.105 160.383 1.00 216.69 ?  80   VAL A N   1 
ATOM   433   C  CA  . VAL A 1  80   ? 240.242 233.514 161.651 1.00 201.55 ?  80   VAL A CA  1 
ATOM   434   C  C   . VAL A 1  80   ? 240.364 232.405 162.689 1.00 228.77 ?  80   VAL A C   1 
ATOM   435   O  O   . VAL A 1  80   ? 239.803 231.317 162.515 1.00 256.31 ?  80   VAL A O   1 
ATOM   436   C  CB  . VAL A 1  80   ? 238.778 233.980 161.471 1.00 187.83 ?  80   VAL A CB  1 
ATOM   437   C  CG1 . VAL A 1  80   ? 238.720 235.482 161.231 1.00 174.86 ?  80   VAL A CG1 1 
ATOM   438   C  CG2 . VAL A 1  80   ? 238.106 233.228 160.329 1.00 161.82 ?  80   VAL A CG2 1 
ATOM   439   N  N   . SER A 1  81   ? 241.126 232.683 163.750 1.00 232.59 ?  81   SER A N   1 
ATOM   440   C  CA  . SER A 1  81   ? 241.260 231.782 164.908 1.00 220.70 ?  81   SER A CA  1 
ATOM   441   C  C   . SER A 1  81   ? 240.452 232.270 166.118 1.00 220.68 ?  81   SER A C   1 
ATOM   442   O  O   . SER A 1  81   ? 240.751 233.330 166.686 1.00 195.94 ?  81   SER A O   1 
ATOM   443   C  CB  . SER A 1  81   ? 242.733 231.613 165.287 1.00 208.36 ?  81   SER A CB  1 
ATOM   444   O  OG  . SER A 1  81   ? 243.376 232.861 165.469 1.00 192.51 ?  81   SER A OG  1 
ATOM   445   N  N   . GLU A 1  82   ? 239.431 231.493 166.498 1.00 221.68 ?  82   GLU A N   1 
ATOM   446   C  CA  . GLU A 1  82   ? 238.555 231.816 167.633 1.00 237.40 ?  82   GLU A CA  1 
ATOM   447   C  C   . GLU A 1  82   ? 239.364 231.907 168.925 1.00 278.30 ?  82   GLU A C   1 
ATOM   448   O  O   . GLU A 1  82   ? 240.212 231.048 169.202 1.00 314.95 ?  82   GLU A O   1 
ATOM   449   C  CB  . GLU A 1  82   ? 237.413 230.797 167.775 1.00 183.44 ?  82   GLU A CB  1 
ATOM   450   N  N   . ILE A 1  83   ? 239.103 232.972 169.687 1.00 330.18 ?  83   ILE A N   1 
ATOM   451   C  CA  . ILE A 1  83   ? 239.802 233.305 170.950 1.00 344.80 ?  83   ILE A CA  1 
ATOM   452   C  C   . ILE A 1  83   ? 241.335 233.414 170.806 1.00 343.70 ?  83   ILE A C   1 
ATOM   453   O  O   . ILE A 1  83   ? 242.098 233.191 171.758 1.00 374.14 ?  83   ILE A O   1 
ATOM   454   C  CB  . ILE A 1  83   ? 239.377 232.387 172.126 1.00 329.89 ?  83   ILE A CB  1 
ATOM   455   N  N   . GLY A 1  84   ? 241.759 233.764 169.595 1.00 296.03 ?  84   GLY A N   1 
ATOM   456   C  CA  . GLY A 1  84   ? 243.132 234.141 169.318 1.00 325.51 ?  84   GLY A CA  1 
ATOM   457   C  C   . GLY A 1  84   ? 243.124 235.581 168.854 1.00 344.54 ?  84   GLY A C   1 
ATOM   458   O  O   . GLY A 1  84   ? 243.426 236.483 169.635 1.00 392.63 ?  84   GLY A O   1 
ATOM   459   N  N   . GLU A 1  85   ? 242.722 235.783 167.591 1.00 306.34 ?  85   GLU A N   1 
ATOM   460   C  CA  . GLU A 1  85   ? 242.690 237.105 166.898 1.00 276.67 ?  85   GLU A CA  1 
ATOM   461   C  C   . GLU A 1  85   ? 244.087 237.640 166.487 1.00 264.78 ?  85   GLU A C   1 
ATOM   462   O  O   . GLU A 1  85   ? 244.227 238.742 165.924 1.00 219.64 ?  85   GLU A O   1 
ATOM   463   C  CB  . GLU A 1  85   ? 241.879 238.153 167.689 1.00 261.56 ?  85   GLU A CB  1 
ATOM   464   C  CG  . GLU A 1  85   ? 240.439 237.759 167.993 1.00 241.16 ?  85   GLU A CG  1 
ATOM   465   C  CD  . GLU A 1  85   ? 239.550 237.839 166.774 1.00 265.07 ?  85   GLU A CD  1 
ATOM   466   O  OE1 . GLU A 1  85   ? 239.525 238.905 166.118 1.00 276.06 ?  85   GLU A OE1 1 
ATOM   467   O  OE2 . GLU A 1  85   ? 238.876 236.832 166.478 1.00 291.33 -1 85   GLU A OE2 1 
ATOM   468   N  N   . ASP A 1  86   ? 245.107 236.829 166.773 1.00 272.10 ?  86   ASP A N   1 
ATOM   469   C  CA  . ASP A 1  86   ? 246.494 237.091 166.417 1.00 263.02 ?  86   ASP A CA  1 
ATOM   470   C  C   . ASP A 1  86   ? 246.813 236.339 165.141 1.00 236.29 ?  86   ASP A C   1 
ATOM   471   O  O   . ASP A 1  86   ? 247.773 236.683 164.464 1.00 261.85 ?  86   ASP A O   1 
ATOM   472   C  CB  . ASP A 1  86   ? 247.444 236.661 167.541 1.00 323.87 ?  86   ASP A CB  1 
ATOM   473   C  CG  . ASP A 1  86   ? 246.932 237.039 168.933 1.00 389.85 ?  86   ASP A CG  1 
ATOM   474   O  OD1 . ASP A 1  86   ? 246.359 238.138 169.114 1.00 416.85 ?  86   ASP A OD1 1 
ATOM   475   O  OD2 . ASP A 1  86   ? 247.099 236.220 169.857 1.00 430.60 -1 86   ASP A OD2 1 
ATOM   476   N  N   . VAL A 1  87   ? 246.031 235.292 164.852 1.00 208.44 ?  87   VAL A N   1 
ATOM   477   C  CA  . VAL A 1  87   ? 245.837 234.751 163.487 1.00 230.94 ?  87   VAL A CA  1 
ATOM   478   C  C   . VAL A 1  87   ? 247.154 234.530 162.724 1.00 218.47 ?  87   VAL A C   1 
ATOM   479   O  O   . VAL A 1  87   ? 247.965 233.711 163.138 1.00 224.82 ?  87   VAL A O   1 
ATOM   480   C  CB  . VAL A 1  87   ? 244.840 235.633 162.657 1.00 243.86 ?  87   VAL A CB  1 
ATOM   481   C  CG1 . VAL A 1  87   ? 244.653 235.114 161.233 1.00 234.19 ?  87   VAL A CG1 1 
ATOM   482   C  CG2 . VAL A 1  87   ? 243.486 235.742 163.339 1.00 234.11 ?  87   VAL A CG2 1 
ATOM   483   N  N   . ASP A 1  88   ? 247.339 235.334 161.669 1.00 212.92 ?  88   ASP A N   1 
ATOM   484   C  CA  . ASP A 1  88   ? 248.385 235.297 160.622 1.00 218.82 ?  88   ASP A CA  1 
ATOM   485   C  C   . ASP A 1  88   ? 248.374 234.142 159.598 1.00 204.68 ?  88   ASP A C   1 
ATOM   486   O  O   . ASP A 1  88   ? 249.280 234.050 158.766 1.00 185.07 ?  88   ASP A O   1 
ATOM   487   C  CB  . ASP A 1  88   ? 249.802 235.752 161.117 1.00 267.03 ?  88   ASP A CB  1 
ATOM   488   C  CG  . ASP A 1  88   ? 250.635 234.642 161.793 1.00 298.47 ?  88   ASP A CG  1 
ATOM   489   O  OD1 . ASP A 1  88   ? 250.315 233.441 161.696 1.00 346.02 ?  88   ASP A OD1 1 
ATOM   490   O  OD2 . ASP A 1  88   ? 251.660 234.994 162.425 1.00 289.01 -1 88   ASP A OD2 1 
ATOM   491   N  N   . TYR A 1  89   ? 247.340 233.293 159.638 1.00 192.49 ?  89   TYR A N   1 
ATOM   492   C  CA  . TYR A 1  89   ? 247.205 232.179 158.672 1.00 180.33 ?  89   TYR A CA  1 
ATOM   493   C  C   . TYR A 1  89   ? 246.113 232.417 157.620 1.00 185.15 ?  89   TYR A C   1 
ATOM   494   O  O   . TYR A 1  89   ? 245.380 233.410 157.692 1.00 202.08 ?  89   TYR A O   1 
ATOM   495   C  CB  . TYR A 1  89   ? 247.014 230.841 159.391 1.00 160.36 ?  89   TYR A CB  1 
ATOM   496   C  CG  . TYR A 1  89   ? 245.599 230.525 159.794 1.00 166.51 ?  89   TYR A CG  1 
ATOM   497   C  CD1 . TYR A 1  89   ? 245.028 231.096 160.931 1.00 170.67 ?  89   TYR A CD1 1 
ATOM   498   C  CD2 . TYR A 1  89   ? 244.829 229.639 159.038 1.00 175.61 ?  89   TYR A CD2 1 
ATOM   499   C  CE1 . TYR A 1  89   ? 243.728 230.789 161.304 1.00 173.76 ?  89   TYR A CE1 1 
ATOM   500   C  CE2 . TYR A 1  89   ? 243.533 229.320 159.400 1.00 174.25 ?  89   TYR A CE2 1 
ATOM   501   C  CZ  . TYR A 1  89   ? 242.987 229.895 160.531 1.00 177.31 ?  89   TYR A CZ  1 
ATOM   502   O  OH  . TYR A 1  89   ? 241.695 229.576 160.870 1.00 203.43 ?  89   TYR A OH  1 
ATOM   503   N  N   . ASP A 1  90   ? 245.994 231.486 156.672 1.00 170.17 ?  90   ASP A N   1 
ATOM   504   C  CA  . ASP A 1  90   ? 245.252 231.716 155.431 1.00 177.15 ?  90   ASP A CA  1 
ATOM   505   C  C   . ASP A 1  90   ? 244.313 230.600 154.998 1.00 157.65 ?  90   ASP A C   1 
ATOM   506   O  O   . ASP A 1  90   ? 244.751 229.518 154.624 1.00 185.72 ?  90   ASP A O   1 
ATOM   507   C  CB  . ASP A 1  90   ? 246.228 232.045 154.281 1.00 216.55 ?  90   ASP A CB  1 
ATOM   508   C  CG  . ASP A 1  90   ? 247.582 231.335 154.419 1.00 238.36 ?  90   ASP A CG  1 
ATOM   509   O  OD1 . ASP A 1  90   ? 247.621 230.100 154.620 1.00 258.69 ?  90   ASP A OD1 1 
ATOM   510   O  OD2 . ASP A 1  90   ? 248.619 232.026 154.318 1.00 258.44 -1 90   ASP A OD2 1 
ATOM   511   N  N   . GLU A 1  91   ? 243.021 230.881 155.007 1.00 145.00 ?  91   GLU A N   1 
ATOM   512   C  CA  . GLU A 1  91   ? 242.054 229.947 154.445 1.00 167.63 ?  91   GLU A CA  1 
ATOM   513   C  C   . GLU A 1  91   ? 241.915 230.106 152.922 1.00 175.47 ?  91   GLU A C   1 
ATOM   514   O  O   . GLU A 1  91   ? 242.025 231.224 152.367 1.00 188.91 ?  91   GLU A O   1 
ATOM   515   C  CB  . GLU A 1  91   ? 240.680 230.070 155.122 1.00 188.03 ?  91   GLU A CB  1 
ATOM   516   C  CG  . GLU A 1  91   ? 240.541 229.435 156.514 1.00 191.22 ?  91   GLU A CG  1 
ATOM   517   C  CD  . GLU A 1  91   ? 239.115 229.522 157.080 1.00 186.61 ?  91   GLU A CD  1 
ATOM   518   O  OE1 . GLU A 1  91   ? 238.412 230.510 156.798 1.00 198.75 -1 91   GLU A OE1 1 
ATOM   519   O  OE2 . GLU A 1  91   ? 238.669 228.600 157.799 1.00 162.65 ?  91   GLU A OE2 1 
ATOM   520   N  N   . GLU A 1  92   ? 241.681 228.976 152.260 1.00 162.73 ?  92   GLU A N   1 
ATOM   521   C  CA  . GLU A 1  92   ? 241.402 228.946 150.832 1.00 192.14 ?  92   GLU A CA  1 
ATOM   522   C  C   . GLU A 1  92   ? 239.962 228.481 150.614 1.00 204.92 ?  92   GLU A C   1 
ATOM   523   O  O   . GLU A 1  92   ? 239.466 227.629 151.375 1.00 166.95 ?  92   GLU A O   1 
ATOM   524   C  CB  . GLU A 1  92   ? 242.369 227.996 150.104 1.00 222.21 ?  92   GLU A CB  1 
ATOM   525   C  CG  . GLU A 1  92   ? 243.834 228.055 150.550 1.00 256.83 ?  92   GLU A CG  1 
ATOM   526   C  CD  . GLU A 1  92   ? 244.528 226.700 150.513 1.00 283.79 ?  92   GLU A CD  1 
ATOM   527   O  OE1 . GLU A 1  92   ? 244.503 226.037 149.453 1.00 313.94 ?  92   GLU A OE1 1 
ATOM   528   O  OE2 . GLU A 1  92   ? 245.108 226.296 151.544 1.00 276.52 -1 92   GLU A OE2 1 
ATOM   529   N  N   . LEU A 1  93   ? 239.309 229.053 149.584 1.00 254.52 ?  93   LEU A N   1 
ATOM   530   C  CA  . LEU A 1  93   ? 237.991 228.589 149.053 1.00 257.67 ?  93   LEU A CA  1 
ATOM   531   C  C   . LEU A 1  93   ? 237.938 228.184 147.550 1.00 274.89 ?  93   LEU A C   1 
ATOM   532   O  O   . LEU A 1  93   ? 237.689 229.013 146.632 1.00 183.42 ?  93   LEU A O   1 
ATOM   533   C  CB  . LEU A 1  93   ? 236.845 229.544 149.413 1.00 213.85 ?  93   LEU A CB  1 
ATOM   534   C  CG  . LEU A 1  93   ? 235.502 228.840 149.628 1.00 170.09 ?  93   LEU A CG  1 
ATOM   535   C  CD1 . LEU A 1  93   ? 235.674 227.520 150.372 1.00 126.92 ?  93   LEU A CD1 1 
ATOM   536   C  CD2 . LEU A 1  93   ? 234.538 229.777 150.346 1.00 141.30 ?  93   LEU A CD2 1 
ATOM   537   N  N   . TYR A 1  94   ? 238.129 226.878 147.342 1.00 346.28 ?  94   TYR A N   1 
ATOM   538   C  CA  . TYR A 1  94   ? 238.402 226.284 146.029 1.00 372.56 ?  94   TYR A CA  1 
ATOM   539   C  C   . TYR A 1  94   ? 237.128 225.828 145.326 1.00 350.57 ?  94   TYR A C   1 
ATOM   540   O  O   . TYR A 1  94   ? 236.290 225.136 145.921 1.00 374.57 ?  94   TYR A O   1 
ATOM   541   C  CB  . TYR A 1  94   ? 239.387 225.115 146.174 1.00 414.61 ?  94   TYR A CB  1 
ATOM   542   C  CG  . TYR A 1  94   ? 240.023 224.655 144.875 1.00 435.37 ?  94   TYR A CG  1 
ATOM   543   C  CD1 . TYR A 1  94   ? 241.112 225.346 144.318 1.00 442.34 ?  94   TYR A CD1 1 
ATOM   544   C  CD2 . TYR A 1  94   ? 239.549 223.519 144.208 1.00 456.45 ?  94   TYR A CD2 1 
ATOM   545   C  CE1 . TYR A 1  94   ? 241.702 224.922 143.130 1.00 457.27 ?  94   TYR A CE1 1 
ATOM   546   C  CE2 . TYR A 1  94   ? 240.133 223.085 143.018 1.00 464.06 ?  94   TYR A CE2 1 
ATOM   547   C  CZ  . TYR A 1  94   ? 241.208 223.788 142.485 1.00 463.54 ?  94   TYR A CZ  1 
ATOM   548   O  OH  . TYR A 1  94   ? 241.779 223.364 141.306 1.00 465.39 ?  94   TYR A OH  1 
ATOM   549   N  N   . VAL A 1  95   ? 237.008 226.230 144.057 1.00 295.14 ?  95   VAL A N   1 
ATOM   550   C  CA  . VAL A 1  95   ? 235.794 226.043 143.258 1.00 263.74 ?  95   VAL A CA  1 
ATOM   551   C  C   . VAL A 1  95   ? 236.198 225.381 141.929 1.00 302.87 ?  95   VAL A C   1 
ATOM   552   O  O   . VAL A 1  95   ? 236.801 226.029 141.074 1.00 282.76 ?  95   VAL A O   1 
ATOM   553   C  CB  . VAL A 1  95   ? 235.067 227.396 143.006 1.00 196.99 ?  95   VAL A CB  1 
ATOM   554   C  CG1 . VAL A 1  95   ? 233.664 227.181 142.450 1.00 152.88 ?  95   VAL A CG1 1 
ATOM   555   C  CG2 . VAL A 1  95   ? 234.993 228.232 144.275 1.00 182.57 ?  95   VAL A CG2 1 
ATOM   556   N  N   . ALA A 1  96   ? 235.882 224.090 141.770 1.00 319.15 ?  96   ALA A N   1 
ATOM   557   C  CA  . ALA A 1  96   ? 236.281 223.314 140.577 1.00 268.44 ?  96   ALA A CA  1 
ATOM   558   C  C   . ALA A 1  96   ? 235.128 223.082 139.582 1.00 243.76 ?  96   ALA A C   1 
ATOM   559   O  O   . ALA A 1  96   ? 235.256 223.380 138.386 1.00 198.91 ?  96   ALA A O   1 
ATOM   560   C  CB  . ALA A 1  96   ? 236.938 221.999 140.994 1.00 243.55 ?  96   ALA A CB  1 
ATOM   561   N  N   . GLY A 1  97   ? 234.026 222.542 140.113 1.00 254.79 ?  97   GLY A N   1 
ATOM   562   C  CA  . GLY A 1  97   ? 232.740 222.309 139.430 1.00 205.71 ?  97   GLY A CA  1 
ATOM   563   C  C   . GLY A 1  97   ? 231.776 221.975 140.561 1.00 163.94 ?  97   GLY A C   1 
ATOM   564   O  O   . GLY A 1  97   ? 231.580 222.783 141.491 1.00 131.14 ?  97   GLY A O   1 
ATOM   565   N  N   . ASN A 1  98   ? 231.224 220.767 140.535 1.00 134.32 ?  98   ASN A N   1 
ATOM   566   C  CA  . ASN A 1  98   ? 230.377 220.343 141.642 1.00 129.27 ?  98   ASN A CA  1 
ATOM   567   C  C   . ASN A 1  98   ? 230.978 220.410 143.033 1.00 119.60 ?  98   ASN A C   1 
ATOM   568   O  O   . ASN A 1  98   ? 230.226 220.669 143.956 1.00 127.90 ?  98   ASN A O   1 
ATOM   569   C  CB  . ASN A 1  98   ? 229.729 218.980 141.422 1.00 145.76 ?  98   ASN A CB  1 
ATOM   570   C  CG  . ASN A 1  98   ? 230.651 217.991 140.751 1.00 177.04 ?  98   ASN A CG  1 
ATOM   571   O  OD1 . ASN A 1  98   ? 231.880 218.106 140.840 1.00 174.92 ?  98   ASN A OD1 1 
ATOM   572   N  ND2 . ASN A 1  98   ? 230.061 217.007 140.064 1.00 189.39 ?  98   ASN A ND2 1 
ATOM   573   N  N   . MET A 1  99   ? 232.282 220.186 143.221 1.00 117.03 ?  99   MET A N   1 
ATOM   574   C  CA  . MET A 1  99   ? 232.784 220.298 144.602 1.00 132.40 ?  99   MET A CA  1 
ATOM   575   C  C   . MET A 1  99   ? 233.589 221.516 144.859 1.00 131.39 ?  99   MET A C   1 
ATOM   576   O  O   . MET A 1  99   ? 234.386 221.928 144.000 1.00 124.63 ?  99   MET A O   1 
ATOM   577   C  CB  . MET A 1  99   ? 233.460 219.035 145.208 1.00 138.65 ?  99   MET A CB  1 
ATOM   578   C  CG  . MET A 1  99   ? 234.940 218.824 144.925 1.00 150.22 ?  99   MET A CG  1 
ATOM   579   S  SD  . MET A 1  99   ? 235.098 217.874 143.414 1.00 193.48 ?  99   MET A SD  1 
ATOM   580   C  CE  . MET A 1  99   ? 234.551 216.283 144.006 1.00 145.44 ?  99   MET A CE  1 
ATOM   581   N  N   . VAL A 1  100  ? 233.306 222.085 146.043 1.00 141.57 ?  100  VAL A N   1 
ATOM   582   C  CA  . VAL A 1  100  ? 234.036 223.182 146.691 1.00 142.15 ?  100  VAL A CA  1 
ATOM   583   C  C   . VAL A 1  100  ? 234.735 222.718 147.942 1.00 130.79 ?  100  VAL A C   1 
ATOM   584   O  O   . VAL A 1  100  ? 234.111 222.109 148.806 1.00 133.78 ?  100  VAL A O   1 
ATOM   585   C  CB  . VAL A 1  100  ? 233.120 224.369 147.057 1.00 134.41 ?  100  VAL A CB  1 
ATOM   586   C  CG1 . VAL A 1  100  ? 233.771 225.278 148.095 1.00 105.04 ?  100  VAL A CG1 1 
ATOM   587   C  CG2 . VAL A 1  100  ? 232.778 225.153 145.791 1.00 161.63 ?  100  VAL A CG2 1 
ATOM   588   N  N   . ILE A 1  101  ? 236.023 223.036 148.035 1.00 131.95 ?  101  ILE A N   1 
ATOM   589   C  CA  . ILE A 1  101  ? 236.830 222.658 149.190 1.00 143.50 ?  101  ILE A CA  1 
ATOM   590   C  C   . ILE A 1  101  ? 237.308 223.876 149.976 1.00 160.65 ?  101  ILE A C   1 
ATOM   591   O  O   . ILE A 1  101  ? 237.695 224.897 149.403 1.00 200.23 ?  101  ILE A O   1 
ATOM   592   C  CB  . ILE A 1  101  ? 238.009 221.782 148.773 1.00 141.61 ?  101  ILE A CB  1 
ATOM   593   C  CG1 . ILE A 1  101  ? 237.479 220.423 148.348 1.00 159.88 ?  101  ILE A CG1 1 
ATOM   594   C  CG2 . ILE A 1  101  ? 238.997 221.626 149.917 1.00 131.29 ?  101  ILE A CG2 1 
ATOM   595   C  CD1 . ILE A 1  101  ? 238.190 219.846 147.145 1.00 194.02 ?  101  ILE A CD1 1 
ATOM   596   N  N   . TRP A 1  102  ? 237.276 223.735 151.298 1.00 139.42 ?  102  TRP A N   1 
ATOM   597   C  CA  . TRP A 1  102  ? 237.575 224.796 152.234 1.00 128.43 ?  102  TRP A CA  1 
ATOM   598   C  C   . TRP A 1  102  ? 238.817 224.311 152.899 1.00 119.32 ?  102  TRP A C   1 
ATOM   599   O  O   . TRP A 1  102  ? 238.794 223.332 153.624 1.00 99.95  ?  102  TRP A O   1 
ATOM   600   C  CB  . TRP A 1  102  ? 236.444 224.896 153.249 1.00 135.03 ?  102  TRP A CB  1 
ATOM   601   C  CG  . TRP A 1  102  ? 236.519 225.974 154.271 1.00 146.65 ?  102  TRP A CG  1 
ATOM   602   C  CD1 . TRP A 1  102  ? 237.555 226.830 154.523 1.00 156.21 ?  102  TRP A CD1 1 
ATOM   603   C  CD2 . TRP A 1  102  ? 235.509 226.284 155.221 1.00 156.85 ?  102  TRP A CD2 1 
ATOM   604   N  NE1 . TRP A 1  102  ? 237.242 227.667 155.570 1.00 132.16 ?  102  TRP A NE1 1 
ATOM   605   C  CE2 . TRP A 1  102  ? 235.995 227.349 156.022 1.00 143.54 ?  102  TRP A CE2 1 
ATOM   606   C  CE3 . TRP A 1  102  ? 234.226 225.767 155.478 1.00 185.51 ?  102  TRP A CE3 1 
ATOM   607   C  CZ2 . TRP A 1  102  ? 235.252 227.903 157.057 1.00 164.59 ?  102  TRP A CZ2 1 
ATOM   608   C  CZ3 . TRP A 1  102  ? 233.477 226.315 156.521 1.00 190.24 ?  102  TRP A CZ3 1 
ATOM   609   C  CH2 . TRP A 1  102  ? 233.994 227.376 157.294 1.00 191.25 ?  102  TRP A CH2 1 
ATOM   610   N  N   . SER A 1  103  ? 239.899 225.029 152.659 1.00 153.88 ?  103  SER A N   1 
ATOM   611   C  CA  . SER A 1  103  ? 241.238 224.575 153.014 1.00 178.28 ?  103  SER A CA  1 
ATOM   612   C  C   . SER A 1  103  ? 241.929 225.612 153.916 1.00 182.68 ?  103  SER A C   1 
ATOM   613   O  O   . SER A 1  103  ? 241.611 226.799 153.849 1.00 207.08 ?  103  SER A O   1 
ATOM   614   C  CB  . SER A 1  103  ? 242.002 224.328 151.718 1.00 173.48 ?  103  SER A CB  1 
ATOM   615   O  OG  . SER A 1  103  ? 241.073 224.160 150.641 1.00 138.21 ?  103  SER A OG  1 
ATOM   616   N  N   . LYS A 1  104  ? 242.855 225.185 154.767 1.00 160.46 ?  104  LYS A N   1 
ATOM   617   C  CA  . LYS A 1  104  ? 243.266 226.063 155.854 1.00 175.45 ?  104  LYS A CA  1 
ATOM   618   C  C   . LYS A 1  104  ? 244.698 226.611 155.881 1.00 186.16 ?  104  LYS A C   1 
ATOM   619   O  O   . LYS A 1  104  ? 244.905 227.693 156.430 1.00 209.29 ?  104  LYS A O   1 
ATOM   620   C  CB  . LYS A 1  104  ? 242.897 225.446 157.204 1.00 203.53 ?  104  LYS A CB  1 
ATOM   621   C  CG  . LYS A 1  104  ? 241.485 225.766 157.697 1.00 239.79 ?  104  LYS A CG  1 
ATOM   622   C  CD  . LYS A 1  104  ? 241.528 226.218 159.166 1.00 270.69 ?  104  LYS A CD  1 
ATOM   623   C  CE  . LYS A 1  104  ? 240.242 225.973 159.964 1.00 264.86 ?  104  LYS A CE  1 
ATOM   624   N  NZ  . LYS A 1  104  ? 239.269 227.104 160.046 1.00 241.47 ?  104  LYS A NZ  1 
ATOM   625   N  N   . GLY A 1  105  ? 245.677 225.904 155.313 1.00 183.80 ?  105  GLY A N   1 
ATOM   626   C  CA  . GLY A 1  105  ? 247.087 226.324 155.453 1.00 182.33 ?  105  GLY A CA  1 
ATOM   627   C  C   . GLY A 1  105  ? 247.947 226.170 154.220 1.00 186.58 ?  105  GLY A C   1 
ATOM   628   O  O   . GLY A 1  105  ? 248.055 225.087 153.685 1.00 209.65 ?  105  GLY A O   1 
ATOM   629   N  N   . SER A 1  106  ? 248.612 227.241 153.802 1.00 186.36 ?  106  SER A N   1 
ATOM   630   C  CA  . SER A 1  106  ? 249.216 227.287 152.459 1.00 207.19 ?  106  SER A CA  1 
ATOM   631   C  C   . SER A 1  106  ? 250.697 226.813 152.320 1.00 191.01 ?  106  SER A C   1 
ATOM   632   O  O   . SER A 1  106  ? 251.547 227.515 151.757 1.00 198.82 ?  106  SER A O   1 
ATOM   633   C  CB  . SER A 1  106  ? 248.974 228.672 151.829 1.00 251.92 ?  106  SER A CB  1 
ATOM   634   O  OG  . SER A 1  106  ? 247.601 229.053 151.931 1.00 241.32 ?  106  SER A OG  1 
ATOM   635   N  N   . LYS A 1  107  ? 250.992 225.612 152.807 1.00 170.79 ?  107  LYS A N   1 
ATOM   636   C  CA  . LYS A 1  107  ? 252.355 225.064 152.747 1.00 181.16 ?  107  LYS A CA  1 
ATOM   637   C  C   . LYS A 1  107  ? 252.374 223.575 152.359 1.00 187.69 ?  107  LYS A C   1 
ATOM   638   O  O   . LYS A 1  107  ? 251.365 222.898 152.478 1.00 184.89 ?  107  LYS A O   1 
ATOM   639   C  CB  . LYS A 1  107  ? 253.032 225.212 154.110 1.00 200.31 ?  107  LYS A CB  1 
ATOM   640   C  CG  . LYS A 1  107  ? 253.342 226.621 154.579 1.00 236.21 ?  107  LYS A CG  1 
ATOM   641   C  CD  . LYS A 1  107  ? 254.016 226.564 155.947 1.00 259.85 ?  107  LYS A CD  1 
ATOM   642   C  CE  . LYS A 1  107  ? 255.180 227.545 156.105 1.00 259.83 ?  107  LYS A CE  1 
ATOM   643   N  NZ  . LYS A 1  107  ? 256.503 227.044 155.615 1.00 214.82 ?  107  LYS A NZ  1 
ATOM   644   N  N   . SER A 1  108  ? 253.530 223.060 151.929 1.00 208.41 ?  108  SER A N   1 
ATOM   645   C  CA  . SER A 1  108  ? 253.727 221.607 151.738 1.00 217.76 ?  108  SER A CA  1 
ATOM   646   C  C   . SER A 1  108  ? 253.581 220.890 153.075 1.00 214.88 ?  108  SER A C   1 
ATOM   647   O  O   . SER A 1  108  ? 253.006 219.800 153.166 1.00 210.70 ?  108  SER A O   1 
ATOM   648   C  CB  . SER A 1  108  ? 255.119 221.310 151.163 1.00 244.04 ?  108  SER A CB  1 
ATOM   649   O  OG  . SER A 1  108  ? 256.087 221.116 152.193 1.00 246.98 ?  108  SER A OG  1 
ATOM   650   N  N   . GLN A 1  109  ? 254.136 221.531 154.097 1.00 207.88 ?  109  GLN A N   1 
ATOM   651   C  CA  . GLN A 1  109  ? 254.046 221.100 155.474 1.00 221.47 ?  109  GLN A CA  1 
ATOM   652   C  C   . GLN A 1  109  ? 252.639 221.274 156.089 1.00 215.88 ?  109  GLN A C   1 
ATOM   653   O  O   . GLN A 1  109  ? 252.186 220.437 156.866 1.00 190.94 ?  109  GLN A O   1 
ATOM   654   C  CB  . GLN A 1  109  ? 255.096 221.856 156.289 1.00 229.59 ?  109  GLN A CB  1 
ATOM   655   N  N   . ALA A 1  110  ? 251.947 222.350 155.738 1.00 211.77 ?  110  ALA A N   1 
ATOM   656   C  CA  . ALA A 1  110  ? 250.724 222.715 156.454 1.00 191.03 ?  110  ALA A CA  1 
ATOM   657   C  C   . ALA A 1  110  ? 249.417 222.162 155.899 1.00 166.81 ?  110  ALA A C   1 
ATOM   658   O  O   . ALA A 1  110  ? 248.551 221.834 156.684 1.00 150.02 ?  110  ALA A O   1 
ATOM   659   C  CB  . ALA A 1  110  ? 250.626 224.230 156.627 1.00 202.38 ?  110  ALA A CB  1 
ATOM   660   N  N   . LEU A 1  111  ? 249.303 222.039 154.571 1.00 152.18 ?  111  LEU A N   1 
ATOM   661   C  CA  . LEU A 1  111  ? 248.016 221.997 153.834 1.00 158.84 ?  111  LEU A CA  1 
ATOM   662   C  C   . LEU A 1  111  ? 246.943 221.121 154.424 1.00 171.34 ?  111  LEU A C   1 
ATOM   663   O  O   . LEU A 1  111  ? 247.078 219.904 154.433 1.00 201.56 ?  111  LEU A O   1 
ATOM   664   C  CB  . LEU A 1  111  ? 248.222 221.627 152.360 1.00 199.78 ?  111  LEU A CB  1 
ATOM   665   C  CG  . LEU A 1  111  ? 248.578 222.752 151.369 1.00 260.27 ?  111  LEU A CG  1 
ATOM   666   C  CD1 . LEU A 1  111  ? 249.140 222.192 150.063 1.00 286.66 ?  111  LEU A CD1 1 
ATOM   667   C  CD2 . LEU A 1  111  ? 247.453 223.761 151.109 1.00 263.47 ?  111  LEU A CD2 1 
ATOM   668   N  N   . ALA A 1  112  ? 245.879 221.746 154.917 1.00 180.13 ?  112  ALA A N   1 
ATOM   669   C  CA  . ALA A 1  112  ? 244.844 221.024 155.660 1.00 186.62 ?  112  ALA A CA  1 
ATOM   670   C  C   . ALA A 1  112  ? 243.466 221.323 155.120 1.00 175.60 ?  112  ALA A C   1 
ATOM   671   O  O   . ALA A 1  112  ? 243.039 222.480 155.061 1.00 172.60 ?  112  ALA A O   1 
ATOM   672   C  CB  . ALA A 1  112  ? 244.920 221.335 157.156 1.00 189.49 ?  112  ALA A CB  1 
ATOM   673   N  N   . VAL A 1  113  ? 242.783 220.268 154.707 1.00 159.73 ?  113  VAL A N   1 
ATOM   674   C  CA  . VAL A 1  113  ? 241.411 220.400 154.267 1.00 161.65 ?  113  VAL A CA  1 
ATOM   675   C  C   . VAL A 1  113  ? 240.474 220.544 155.509 1.00 166.27 ?  113  VAL A C   1 
ATOM   676   O  O   . VAL A 1  113  ? 240.512 219.749 156.471 1.00 126.41 ?  113  VAL A O   1 
ATOM   677   C  CB  . VAL A 1  113  ? 241.040 219.343 153.165 1.00 146.04 ?  113  VAL A CB  1 
ATOM   678   C  CG1 . VAL A 1  113  ? 241.229 217.910 153.637 1.00 169.39 ?  113  VAL A CG1 1 
ATOM   679   C  CG2 . VAL A 1  113  ? 239.637 219.540 152.631 1.00 152.19 ?  113  VAL A CG2 1 
ATOM   680   N  N   . TYR A 1  114  ? 239.703 221.628 155.498 1.00 179.74 ?  114  TYR A N   1 
ATOM   681   C  CA  . TYR A 1  114  ? 238.713 221.894 156.535 1.00 184.72 ?  114  TYR A CA  1 
ATOM   682   C  C   . TYR A 1  114  ? 237.392 221.120 156.395 1.00 186.88 ?  114  TYR A C   1 
ATOM   683   O  O   . TYR A 1  114  ? 236.920 220.521 157.362 1.00 189.01 ?  114  TYR A O   1 
ATOM   684   C  CB  . TYR A 1  114  ? 238.440 223.389 156.650 1.00 155.88 ?  114  TYR A CB  1 
ATOM   685   C  CG  . TYR A 1  114  ? 237.631 223.703 157.867 1.00 150.36 ?  114  TYR A CG  1 
ATOM   686   C  CD1 . TYR A 1  114  ? 238.098 223.376 159.148 1.00 148.89 ?  114  TYR A CD1 1 
ATOM   687   C  CD2 . TYR A 1  114  ? 236.398 224.292 157.752 1.00 145.90 ?  114  TYR A CD2 1 
ATOM   688   C  CE1 . TYR A 1  114  ? 237.358 223.664 160.275 1.00 147.60 ?  114  TYR A CE1 1 
ATOM   689   C  CE2 . TYR A 1  114  ? 235.641 224.587 158.869 1.00 164.34 ?  114  TYR A CE2 1 
ATOM   690   C  CZ  . TYR A 1  114  ? 236.124 224.271 160.127 1.00 175.95 ?  114  TYR A CZ  1 
ATOM   691   O  OH  . TYR A 1  114  ? 235.364 224.570 161.236 1.00 222.15 ?  114  TYR A OH  1 
ATOM   692   N  N   . LYS A 1  115  ? 236.798 221.166 155.203 1.00 178.21 ?  115  LYS A N   1 
ATOM   693   C  CA  . LYS A 1  115  ? 235.558 220.442 154.845 1.00 180.77 ?  115  LYS A CA  1 
ATOM   694   C  C   . LYS A 1  115  ? 235.350 220.481 153.320 1.00 205.65 ?  115  LYS A C   1 
ATOM   695   O  O   . LYS A 1  115  ? 235.819 221.411 152.655 1.00 237.15 ?  115  LYS A O   1 
ATOM   696   C  CB  . LYS A 1  115  ? 234.337 221.092 155.483 1.00 176.28 ?  115  LYS A CB  1 
ATOM   697   C  CG  . LYS A 1  115  ? 233.987 220.685 156.904 1.00 192.74 ?  115  LYS A CG  1 
ATOM   698   C  CD  . LYS A 1  115  ? 232.867 221.602 157.344 1.00 204.19 ?  115  LYS A CD  1 
ATOM   699   C  CE  . LYS A 1  115  ? 232.757 221.807 158.838 1.00 196.64 ?  115  LYS A CE  1 
ATOM   700   N  NZ  . LYS A 1  115  ? 232.052 223.110 159.058 1.00 191.37 ?  115  LYS A NZ  1 
ATOM   701   N  N   . ALA A 1  116  ? 234.630 219.498 152.769 1.00 199.74 ?  116  ALA A N   1 
ATOM   702   C  CA  . ALA A 1  116  ? 234.406 219.408 151.312 1.00 162.52 ?  116  ALA A CA  1 
ATOM   703   C  C   . ALA A 1  116  ? 232.924 219.478 150.904 1.00 140.11 ?  116  ALA A C   1 
ATOM   704   O  O   . ALA A 1  116  ? 232.076 218.701 151.373 1.00 109.28 ?  116  ALA A O   1 
ATOM   705   C  CB  . ALA A 1  116  ? 235.096 218.179 150.727 1.00 157.41 ?  116  ALA A CB  1 
ATOM   706   N  N   . PHE A 1  117  ? 232.645 220.408 149.996 1.00 143.16 ?  117  PHE A N   1 
ATOM   707   C  CA  . PHE A 1  117  ? 231.280 220.839 149.686 1.00 161.72 ?  117  PHE A CA  1 
ATOM   708   C  C   . PHE A 1  117  ? 230.899 220.491 148.263 1.00 172.34 ?  117  PHE A C   1 
ATOM   709   O  O   . PHE A 1  117  ? 231.195 221.265 147.350 1.00 190.48 ?  117  PHE A O   1 
ATOM   710   C  CB  . PHE A 1  117  ? 231.163 222.342 149.946 1.00 150.93 ?  117  PHE A CB  1 
ATOM   711   C  CG  . PHE A 1  117  ? 231.297 222.688 151.395 1.00 177.82 ?  117  PHE A CG  1 
ATOM   712   C  CD1 . PHE A 1  117  ? 232.551 222.658 152.032 1.00 171.69 ?  117  PHE A CD1 1 
ATOM   713   C  CD2 . PHE A 1  117  ? 230.157 222.961 152.168 1.00 195.79 ?  117  PHE A CD2 1 
ATOM   714   C  CE1 . PHE A 1  117  ? 232.669 222.945 153.389 1.00 162.08 ?  117  PHE A CE1 1 
ATOM   715   C  CE2 . PHE A 1  117  ? 230.273 223.262 153.528 1.00 187.17 ?  117  PHE A CE2 1 
ATOM   716   C  CZ  . PHE A 1  117  ? 231.530 223.253 154.141 1.00 181.27 ?  117  PHE A CZ  1 
ATOM   717   N  N   . THR A 1  118  ? 230.241 219.329 148.103 1.00 173.78 ?  118  THR A N   1 
ATOM   718   C  CA  . THR A 1  118  ? 229.925 218.697 146.797 1.00 170.73 ?  118  THR A CA  1 
ATOM   719   C  C   . THR A 1  118  ? 228.477 218.958 146.417 1.00 157.53 ?  118  THR A C   1 
ATOM   720   O  O   . THR A 1  118  ? 227.559 218.707 147.235 1.00 159.21 ?  118  THR A O   1 
ATOM   721   C  CB  . THR A 1  118  ? 230.075 217.165 146.881 1.00 180.69 ?  118  THR A CB  1 
ATOM   722   O  OG1 . THR A 1  118  ? 230.602 216.810 148.159 1.00 172.86 ?  118  THR A OG1 1 
ATOM   723   C  CG2 . THR A 1  118  ? 230.957 216.593 145.753 1.00 171.60 ?  118  THR A CG2 1 
ATOM   724   N  N   . VAL A 1  119  ? 228.249 219.469 145.203 1.00 123.38 ?  119  VAL A N   1 
ATOM   725   C  CA  . VAL A 1  119  ? 226.894 219.961 144.917 1.00 155.32 ?  119  VAL A CA  1 
ATOM   726   C  C   . VAL A 1  119  ? 226.287 219.519 143.591 1.00 162.42 ?  119  VAL A C   1 
ATOM   727   O  O   . VAL A 1  119  ? 225.335 220.168 143.087 1.00 135.88 ?  119  VAL A O   1 
ATOM   728   C  CB  . VAL A 1  119  ? 226.676 221.497 145.174 1.00 155.01 ?  119  VAL A CB  1 
ATOM   729   C  CG1 . VAL A 1  119  ? 227.042 221.920 146.608 1.00 165.44 ?  119  VAL A CG1 1 
ATOM   730   C  CG2 . VAL A 1  119  ? 227.359 222.358 144.124 1.00 150.14 ?  119  VAL A CG2 1 
ATOM   731   N  N   . ASP A 1  120  ? 226.816 218.415 143.051 1.00 171.77 ?  120  ASP A N   1 
ATOM   732   C  CA  . ASP A 1  120  ? 226.235 217.706 141.883 1.00 216.44 ?  120  ASP A CA  1 
ATOM   733   C  C   . ASP A 1  120  ? 225.957 218.521 140.582 1.00 253.46 ?  120  ASP A C   1 
ATOM   734   O  O   . ASP A 1  120  ? 225.745 217.931 139.521 1.00 300.32 ?  120  ASP A O   1 
ATOM   735   C  CB  . ASP A 1  120  ? 225.006 216.855 142.296 1.00 209.60 ?  120  ASP A CB  1 
ATOM   736   C  CG  . ASP A 1  120  ? 223.807 217.700 142.752 1.00 211.46 ?  120  ASP A CG  1 
ATOM   737   O  OD1 . ASP A 1  120  ? 223.159 218.374 141.915 1.00 209.83 ?  120  ASP A OD1 1 
ATOM   738   O  OD2 . ASP A 1  120  ? 223.506 217.683 143.964 1.00 218.25 -1 120  ASP A OD2 1 
ATOM   739   N  N   . SER A 1  121  ? 225.950 219.854 140.681 1.00 239.74 ?  121  SER A N   1 
ATOM   740   C  CA  . SER A 1  121  ? 225.784 220.782 139.548 1.00 202.91 ?  121  SER A CA  1 
ATOM   741   C  C   . SER A 1  121  ? 226.941 221.786 139.592 1.00 203.15 ?  121  SER A C   1 
ATOM   742   O  O   . SER A 1  121  ? 227.587 221.909 140.630 1.00 245.69 ?  121  SER A O   1 
ATOM   743   C  CB  . SER A 1  121  ? 224.458 221.536 139.666 1.00 183.19 ?  121  SER A CB  1 
ATOM   744   O  OG  . SER A 1  121  ? 223.430 220.713 140.176 1.00 188.80 ?  121  SER A OG  1 
ATOM   745   N  N   . PRO A 1  122  ? 227.212 222.515 138.491 1.00 195.78 ?  122  PRO A N   1 
ATOM   746   C  CA  . PRO A 1  122  ? 228.325 223.468 138.607 1.00 196.25 ?  122  PRO A CA  1 
ATOM   747   C  C   . PRO A 1  122  ? 228.097 224.552 139.691 1.00 204.43 ?  122  PRO A C   1 
ATOM   748   O  O   . PRO A 1  122  ? 226.985 225.085 139.806 1.00 164.42 ?  122  PRO A O   1 
ATOM   749   C  CB  . PRO A 1  122  ? 228.402 224.103 137.210 1.00 208.70 ?  122  PRO A CB  1 
ATOM   750   C  CG  . PRO A 1  122  ? 227.634 223.196 136.314 1.00 212.72 ?  122  PRO A CG  1 
ATOM   751   C  CD  . PRO A 1  122  ? 226.579 222.561 137.161 1.00 197.74 ?  122  PRO A CD  1 
ATOM   752   N  N   . VAL A 1  123  ? 229.151 224.831 140.474 1.00 230.42 ?  123  VAL A N   1 
ATOM   753   C  CA  . VAL A 1  123  ? 229.208 225.943 141.455 1.00 247.10 ?  123  VAL A CA  1 
ATOM   754   C  C   . VAL A 1  123  ? 229.624 227.247 140.762 1.00 285.90 ?  123  VAL A C   1 
ATOM   755   O  O   . VAL A 1  123  ? 230.737 227.337 140.214 1.00 343.81 ?  123  VAL A O   1 
ATOM   756   C  CB  . VAL A 1  123  ? 230.256 225.716 142.585 1.00 208.36 ?  123  VAL A CB  1 
ATOM   757   C  CG1 . VAL A 1  123  ? 230.203 226.851 143.597 1.00 208.32 ?  123  VAL A CG1 1 
ATOM   758   C  CG2 . VAL A 1  123  ? 230.083 224.386 143.287 1.00 162.61 ?  123  VAL A CG2 1 
ATOM   759   N  N   . GLN A 1  124  ? 228.751 228.255 140.814 1.00 262.38 ?  124  GLN A N   1 
ATOM   760   C  CA  . GLN A 1  124  ? 229.058 229.577 140.268 1.00 249.76 ?  124  GLN A CA  1 
ATOM   761   C  C   . GLN A 1  124  ? 230.184 230.240 141.062 1.00 198.73 ?  124  GLN A C   1 
ATOM   762   O  O   . GLN A 1  124  ? 231.211 230.631 140.503 1.00 240.15 ?  124  GLN A O   1 
ATOM   763   C  CB  . GLN A 1  124  ? 227.819 230.500 140.291 1.00 265.45 ?  124  GLN A CB  1 
ATOM   764   C  CG  . GLN A 1  124  ? 226.793 230.358 139.164 1.00 255.61 ?  124  GLN A CG  1 
ATOM   765   C  CD  . GLN A 1  124  ? 226.872 231.450 138.090 1.00 228.81 ?  124  GLN A CD  1 
ATOM   766   O  OE1 . GLN A 1  124  ? 226.504 231.213 136.941 1.00 242.87 ?  124  GLN A OE1 1 
ATOM   767   N  NE2 . GLN A 1  124  ? 227.336 232.643 138.458 1.00 197.06 ?  124  GLN A NE2 1 
ATOM   768   N  N   . GLN A 1  125  ? 230.005 230.337 142.371 1.00 132.41 ?  125  GLN A N   1 
ATOM   769   C  CA  . GLN A 1  125  ? 230.578 231.472 143.062 1.00 143.98 ?  125  GLN A CA  1 
ATOM   770   C  C   . GLN A 1  125  ? 231.394 231.197 144.306 1.00 163.60 ?  125  GLN A C   1 
ATOM   771   O  O   . GLN A 1  125  ? 232.512 231.727 144.462 1.00 153.38 ?  125  GLN A O   1 
ATOM   772   C  CB  . GLN A 1  125  ? 229.449 232.434 143.378 1.00 139.93 ?  125  GLN A CB  1 
ATOM   773   C  CG  . GLN A 1  125  ? 229.170 233.400 142.246 1.00 168.46 ?  125  GLN A CG  1 
ATOM   774   C  CD  . GLN A 1  125  ? 229.825 234.749 142.455 1.00 201.18 ?  125  GLN A CD  1 
ATOM   775   O  OE1 . GLN A 1  125  ? 230.737 234.903 143.265 1.00 245.29 ?  125  GLN A OE1 1 
ATOM   776   N  NE2 . GLN A 1  125  ? 229.349 235.738 141.737 1.00 168.39 ?  125  GLN A NE2 1 
ATOM   777   N  N   . ALA A 1  126  ? 230.794 230.383 145.178 1.00 177.85 ?  126  ALA A N   1 
ATOM   778   C  CA  . ALA A 1  126  ? 231.307 229.968 146.498 1.00 164.45 ?  126  ALA A CA  1 
ATOM   779   C  C   . ALA A 1  126  ? 232.195 230.941 147.325 1.00 149.93 ?  126  ALA A C   1 
ATOM   780   O  O   . ALA A 1  126  ? 233.296 230.617 147.756 1.00 157.30 ?  126  ALA A O   1 
ATOM   781   C  CB  . ALA A 1  126  ? 231.890 228.561 146.428 1.00 124.35 ?  126  ALA A CB  1 
ATOM   782   N  N   . LEU A 1  127  ? 231.687 232.147 147.532 1.00 128.09 ?  127  LEU A N   1 
ATOM   783   C  CA  . LEU A 1  127  ? 232.225 233.043 148.529 1.00 130.78 ?  127  LEU A CA  1 
ATOM   784   C  C   . LEU A 1  127  ? 231.691 232.723 149.932 1.00 131.58 ?  127  LEU A C   1 
ATOM   785   O  O   . LEU A 1  127  ? 230.705 231.989 150.076 1.00 95.39  ?  127  LEU A O   1 
ATOM   786   C  CB  . LEU A 1  127  ? 231.867 234.473 148.173 1.00 141.86 ?  127  LEU A CB  1 
ATOM   787   C  CG  . LEU A 1  127  ? 230.494 234.776 147.586 1.00 142.98 ?  127  LEU A CG  1 
ATOM   788   C  CD1 . LEU A 1  127  ? 229.314 234.464 148.495 1.00 156.70 ?  127  LEU A CD1 1 
ATOM   789   C  CD2 . LEU A 1  127  ? 230.528 236.244 147.273 1.00 156.53 ?  127  LEU A CD2 1 
ATOM   790   N  N   . TRP A 1  128  ? 232.353 233.319 150.936 1.00 149.33 ?  128  TRP A N   1 
ATOM   791   C  CA  . TRP A 1  128  ? 231.999 233.293 152.367 1.00 143.72 ?  128  TRP A CA  1 
ATOM   792   C  C   . TRP A 1  128  ? 231.283 234.565 152.767 1.00 153.33 ?  128  TRP A C   1 
ATOM   793   O  O   . TRP A 1  128  ? 231.597 235.621 152.217 1.00 178.03 ?  128  TRP A O   1 
ATOM   794   C  CB  . TRP A 1  128  ? 233.257 233.384 153.194 1.00 134.07 ?  128  TRP A CB  1 
ATOM   795   C  CG  . TRP A 1  128  ? 234.079 232.210 153.322 1.00 127.36 ?  128  TRP A CG  1 
ATOM   796   C  CD1 . TRP A 1  128  ? 233.789 231.071 154.021 1.00 131.29 ?  128  TRP A CD1 1 
ATOM   797   C  CD2 . TRP A 1  128  ? 235.405 232.070 152.834 1.00 128.23 ?  128  TRP A CD2 1 
ATOM   798   N  NE1 . TRP A 1  128  ? 234.847 230.206 153.958 1.00 140.26 ?  128  TRP A NE1 1 
ATOM   799   C  CE2 . TRP A 1  128  ? 235.860 230.797 153.243 1.00 154.72 ?  128  TRP A CE2 1 
ATOM   800   C  CE3 . TRP A 1  128  ? 236.250 232.886 152.063 1.00 117.57 ?  128  TRP A CE3 1 
ATOM   801   C  CZ2 . TRP A 1  128  ? 237.136 230.313 152.907 1.00 179.58 ?  128  TRP A CZ2 1 
ATOM   802   C  CZ3 . TRP A 1  128  ? 237.511 232.410 151.723 1.00 146.54 ?  128  TRP A CZ3 1 
ATOM   803   C  CH2 . TRP A 1  128  ? 237.951 231.136 152.154 1.00 175.81 ?  128  TRP A CH2 1 
ATOM   804   N  N   . CYS A 1  129  ? 230.400 234.487 153.771 1.00 156.85 ?  129  CYS A N   1 
ATOM   805   C  CA  . CYS A 1  129  ? 229.751 235.691 154.348 1.00 179.00 ?  129  CYS A CA  1 
ATOM   806   C  C   . CYS A 1  129  ? 229.198 235.484 155.759 1.00 180.42 ?  129  CYS A C   1 
ATOM   807   O  O   . CYS A 1  129  ? 229.203 234.366 156.268 1.00 184.73 ?  129  CYS A O   1 
ATOM   808   C  CB  . CYS A 1  129  ? 228.615 236.196 153.447 1.00 193.86 ?  129  CYS A CB  1 
ATOM   809   S  SG  . CYS A 1  129  ? 226.981 235.736 154.054 1.00 168.70 ?  129  CYS A SG  1 
ATOM   810   N  N   . ASP A 1  130  ? 228.696 236.573 156.353 1.00 181.94 ?  130  ASP A N   1 
ATOM   811   C  CA  . ASP A 1  130  ? 228.011 236.561 157.652 1.00 193.49 ?  130  ASP A CA  1 
ATOM   812   C  C   . ASP A 1  130  ? 226.593 237.134 157.618 1.00 174.60 ?  130  ASP A C   1 
ATOM   813   O  O   . ASP A 1  130  ? 226.335 238.107 156.918 1.00 204.78 ?  130  ASP A O   1 
ATOM   814   C  CB  . ASP A 1  130  ? 228.825 237.347 158.681 1.00 219.40 ?  130  ASP A CB  1 
ATOM   815   C  CG  . ASP A 1  130  ? 230.014 236.574 159.214 1.00 239.59 ?  130  ASP A CG  1 
ATOM   816   O  OD1 . ASP A 1  130  ? 230.494 235.647 158.535 1.00 287.17 ?  130  ASP A OD1 1 
ATOM   817   O  OD2 . ASP A 1  130  ? 230.489 236.922 160.314 1.00 207.63 -1 130  ASP A OD2 1 
ATOM   818   N  N   . PHE A 1  131  ? 225.695 236.547 158.406 1.00 150.29 ?  131  PHE A N   1 
ATOM   819   C  CA  . PHE A 1  131  ? 224.332 237.049 158.532 1.00 161.72 ?  131  PHE A CA  1 
ATOM   820   C  C   . PHE A 1  131  ? 223.997 237.402 159.978 1.00 183.79 ?  131  PHE A C   1 
ATOM   821   O  O   . PHE A 1  131  ? 224.139 236.561 160.872 1.00 179.20 ?  131  PHE A O   1 
ATOM   822   C  CB  . PHE A 1  131  ? 223.315 236.006 158.059 1.00 151.05 ?  131  PHE A CB  1 
ATOM   823   C  CG  . PHE A 1  131  ? 223.649 235.356 156.755 1.00 137.61 ?  131  PHE A CG  1 
ATOM   824   C  CD1 . PHE A 1  131  ? 223.264 235.939 155.555 1.00 152.57 ?  131  PHE A CD1 1 
ATOM   825   C  CD2 . PHE A 1  131  ? 224.319 234.141 156.727 1.00 141.95 ?  131  PHE A CD2 1 
ATOM   826   C  CE1 . PHE A 1  131  ? 223.545 235.327 154.345 1.00 166.56 ?  131  PHE A CE1 1 
ATOM   827   C  CE2 . PHE A 1  131  ? 224.613 233.520 155.527 1.00 156.08 ?  131  PHE A CE2 1 
ATOM   828   C  CZ  . PHE A 1  131  ? 224.224 234.116 154.336 1.00 177.11 ?  131  PHE A CZ  1 
ATOM   829   N  N   . ILE A 1  132  ? 223.536 238.635 160.198 1.00 191.02 ?  132  ILE A N   1 
ATOM   830   C  CA  . ILE A 1  132  ? 222.911 239.024 161.474 1.00 205.03 ?  132  ILE A CA  1 
ATOM   831   C  C   . ILE A 1  132  ? 221.500 238.432 161.553 1.00 205.25 ?  132  ILE A C   1 
ATOM   832   O  O   . ILE A 1  132  ? 220.754 238.508 160.578 1.00 246.91 ?  132  ILE A O   1 
ATOM   833   C  CB  . ILE A 1  132  ? 222.798 240.559 161.655 1.00 231.18 ?  132  ILE A CB  1 
ATOM   834   C  CG1 . ILE A 1  132  ? 223.930 241.315 160.934 1.00 257.92 ?  132  ILE A CG1 1 
ATOM   835   C  CG2 . ILE A 1  132  ? 222.734 240.906 163.142 1.00 254.95 ?  132  ILE A CG2 1 
ATOM   836   C  CD1 . ILE A 1  132  ? 223.651 242.790 160.686 1.00 263.58 ?  132  ILE A CD1 1 
ATOM   837   N  N   . ILE A 1  133  ? 221.128 237.866 162.704 1.00 190.62 ?  133  ILE A N   1 
ATOM   838   C  CA  . ILE A 1  133  ? 219.770 237.293 162.899 1.00 184.32 ?  133  ILE A CA  1 
ATOM   839   C  C   . ILE A 1  133  ? 218.924 237.885 164.054 1.00 188.72 ?  133  ILE A C   1 
ATOM   840   O  O   . ILE A 1  133  ? 218.943 237.379 165.182 1.00 194.05 ?  133  ILE A O   1 
ATOM   841   C  CB  . ILE A 1  133  ? 219.772 235.735 162.979 1.00 170.72 ?  133  ILE A CB  1 
ATOM   842   C  CG1 . ILE A 1  133  ? 221.150 235.166 163.358 1.00 180.25 ?  133  ILE A CG1 1 
ATOM   843   C  CG2 . ILE A 1  133  ? 219.282 235.124 161.680 1.00 150.14 ?  133  ILE A CG2 1 
ATOM   844   C  CD1 . ILE A 1  133  ? 221.287 234.748 164.813 1.00 179.76 ?  133  ILE A CD1 1 
ATOM   845   N  N   . SER A 1  134  ? 218.173 238.947 163.758 1.00 201.94 ?  134  SER A N   1 
ATOM   846   C  CA  . SER A 1  134  ? 217.238 239.565 164.719 1.00 242.63 ?  134  SER A CA  1 
ATOM   847   C  C   . SER A 1  134  ? 216.158 240.399 164.015 1.00 272.10 ?  134  SER A C   1 
ATOM   848   O  O   . SER A 1  134  ? 215.078 240.642 164.563 1.00 266.98 ?  134  SER A O   1 
ATOM   849   C  CB  . SER A 1  134  ? 217.982 240.416 165.762 1.00 249.29 ?  134  SER A CB  1 
ATOM   850   O  OG  . SER A 1  134  ? 218.537 241.585 165.187 1.00 255.21 ?  134  SER A OG  1 
ATOM   851   N  N   . GLU A 1  146  ? 223.609 235.960 167.453 1.00 187.70 ?  146  GLU A N   1 
ATOM   852   C  CA  . GLU A 1  146  ? 224.763 236.720 166.950 1.00 213.12 ?  146  GLU A CA  1 
ATOM   853   C  C   . GLU A 1  146  ? 224.860 236.660 165.402 1.00 218.34 ?  146  GLU A C   1 
ATOM   854   O  O   . GLU A 1  146  ? 223.833 236.802 164.725 1.00 190.86 ?  146  GLU A O   1 
ATOM   855   C  CB  . GLU A 1  146  ? 226.061 236.273 167.656 1.00 199.39 ?  146  GLU A CB  1 
ATOM   856   N  N   . VAL A 1  147  ? 226.073 236.465 164.860 1.00 222.28 ?  147  VAL A N   1 
ATOM   857   C  CA  . VAL A 1  147  ? 226.313 236.340 163.396 1.00 188.29 ?  147  VAL A CA  1 
ATOM   858   C  C   . VAL A 1  147  ? 226.913 234.982 162.963 1.00 178.85 ?  147  VAL A C   1 
ATOM   859   O  O   . VAL A 1  147  ? 228.058 234.647 163.313 1.00 173.63 ?  147  VAL A O   1 
ATOM   860   C  CB  . VAL A 1  147  ? 227.141 237.526 162.789 1.00 163.87 ?  147  VAL A CB  1 
ATOM   861   C  CG1 . VAL A 1  147  ? 226.298 238.791 162.684 1.00 130.04 ?  147  VAL A CG1 1 
ATOM   862   C  CG2 . VAL A 1  147  ? 228.442 237.788 163.554 1.00 150.31 ?  147  VAL A CG2 1 
ATOM   863   N  N   . GLU A 1  148  ? 226.124 234.212 162.208 1.00 163.16 ?  148  GLU A N   1 
ATOM   864   C  CA  . GLU A 1  148  ? 226.585 232.946 161.632 1.00 163.93 ?  148  GLU A CA  1 
ATOM   865   C  C   . GLU A 1  148  ? 227.578 233.249 160.498 1.00 173.61 ?  148  GLU A C   1 
ATOM   866   O  O   . GLU A 1  148  ? 227.363 234.186 159.726 1.00 158.94 ?  148  GLU A O   1 
ATOM   867   C  CB  . GLU A 1  148  ? 225.392 232.106 161.145 1.00 133.95 ?  148  GLU A CB  1 
ATOM   868   N  N   . LYS A 1  149  ? 228.672 232.487 160.432 1.00 195.96 ?  149  LYS A N   1 
ATOM   869   C  CA  . LYS A 1  149  ? 229.710 232.664 159.403 1.00 201.03 ?  149  LYS A CA  1 
ATOM   870   C  C   . LYS A 1  149  ? 229.735 231.464 158.456 1.00 191.82 ?  149  LYS A C   1 
ATOM   871   O  O   . LYS A 1  149  ? 230.410 230.470 158.721 1.00 190.47 ?  149  LYS A O   1 
ATOM   872   C  CB  . LYS A 1  149  ? 231.109 232.908 160.012 1.00 209.97 ?  149  LYS A CB  1 
ATOM   873   C  CG  . LYS A 1  149  ? 231.158 233.892 161.170 1.00 230.78 ?  149  LYS A CG  1 
ATOM   874   C  CD  . LYS A 1  149  ? 231.638 233.240 162.453 1.00 260.39 ?  149  LYS A CD  1 
ATOM   875   C  CE  . LYS A 1  149  ? 231.251 234.051 163.685 1.00 288.19 ?  149  LYS A CE  1 
ATOM   876   N  NZ  . LYS A 1  149  ? 231.845 235.416 163.775 1.00 290.70 ?  149  LYS A NZ  1 
ATOM   877   N  N   . CYS A 1  150  ? 228.995 231.575 157.352 1.00 186.26 ?  150  CYS A N   1 
ATOM   878   C  CA  . CYS A 1  150  ? 228.817 230.475 156.404 1.00 169.13 ?  150  CYS A CA  1 
ATOM   879   C  C   . CYS A 1  150  ? 229.631 230.619 155.134 1.00 172.05 ?  150  CYS A C   1 
ATOM   880   O  O   . CYS A 1  150  ? 230.233 231.663 154.856 1.00 182.88 ?  150  CYS A O   1 
ATOM   881   C  CB  . CYS A 1  150  ? 227.351 230.301 156.015 1.00 158.31 ?  150  CYS A CB  1 
ATOM   882   S  SG  . CYS A 1  150  ? 226.215 230.654 157.349 1.00 201.69 ?  150  CYS A SG  1 
ATOM   883   N  N   . ILE A 1  151  ? 229.607 229.532 154.371 1.00 155.04 ?  151  ILE A N   1 
ATOM   884   C  CA  . ILE A 1  151  ? 230.261 229.413 153.085 1.00 152.13 ?  151  ILE A CA  1 
ATOM   885   C  C   . ILE A 1  151  ? 229.117 229.265 152.060 1.00 148.20 ?  151  ILE A C   1 
ATOM   886   O  O   . ILE A 1  151  ? 228.361 228.287 152.104 1.00 149.65 ?  151  ILE A O   1 
ATOM   887   C  CB  . ILE A 1  151  ? 231.283 228.240 153.104 1.00 139.80 ?  151  ILE A CB  1 
ATOM   888   C  CG1 . ILE A 1  151  ? 231.703 227.847 151.695 1.00 155.79 ?  151  ILE A CG1 1 
ATOM   889   C  CG2 . ILE A 1  151  ? 230.729 227.021 153.842 1.00 125.97 ?  151  ILE A CG2 1 
ATOM   890   C  CD1 . ILE A 1  151  ? 232.669 226.691 151.684 1.00 181.70 ?  151  ILE A CD1 1 
ATOM   891   N  N   . CYS A 1  152  ? 228.971 230.263 151.180 1.00 138.28 ?  152  CYS A N   1 
ATOM   892   C  CA  . CYS A 1  152  ? 227.791 230.387 150.312 1.00 132.45 ?  152  CYS A CA  1 
ATOM   893   C  C   . CYS A 1  152  ? 228.121 229.901 148.937 1.00 134.44 ?  152  CYS A C   1 
ATOM   894   O  O   . CYS A 1  152  ? 228.821 230.574 148.199 1.00 169.20 ?  152  CYS A O   1 
ATOM   895   C  CB  . CYS A 1  152  ? 227.281 231.825 150.224 1.00 135.41 ?  152  CYS A CB  1 
ATOM   896   S  SG  . CYS A 1  152  ? 227.455 232.752 151.757 1.00 194.25 ?  152  CYS A SG  1 
ATOM   897   N  N   . ILE A 1  153  ? 227.597 228.728 148.612 1.00 121.83 ?  153  ILE A N   1 
ATOM   898   C  CA  . ILE A 1  153  ? 227.832 228.035 147.360 1.00 113.99 ?  153  ILE A CA  1 
ATOM   899   C  C   . ILE A 1  153  ? 226.648 228.411 146.465 1.00 121.89 ?  153  ILE A C   1 
ATOM   900   O  O   . ILE A 1  153  ? 225.535 227.939 146.696 1.00 142.56 ?  153  ILE A O   1 
ATOM   901   C  CB  . ILE A 1  153  ? 227.810 226.496 147.618 1.00 113.67 ?  153  ILE A CB  1 
ATOM   902   C  CG1 . ILE A 1  153  ? 228.752 226.094 148.798 1.00 131.16 ?  153  ILE A CG1 1 
ATOM   903   C  CG2 . ILE A 1  153  ? 227.972 225.697 146.327 1.00 123.75 ?  153  ILE A CG2 1 
ATOM   904   C  CD1 . ILE A 1  153  ? 230.088 225.394 148.536 1.00 116.21 ?  153  ILE A CD1 1 
ATOM   905   N  N   . LEU A 1  154  ? 226.859 229.278 145.475 1.00 108.46 ?  154  LEU A N   1 
ATOM   906   C  CA  . LEU A 1  154  ? 225.818 229.537 144.485 1.00 103.26 ?  154  LEU A CA  1 
ATOM   907   C  C   . LEU A 1  154  ? 226.022 228.707 143.219 1.00 118.56 ?  154  LEU A C   1 
ATOM   908   O  O   . LEU A 1  154  ? 227.153 228.567 142.748 1.00 123.18 ?  154  LEU A O   1 
ATOM   909   C  CB  . LEU A 1  154  ? 225.794 231.003 144.110 1.00 105.69 ?  154  LEU A CB  1 
ATOM   910   C  CG  . LEU A 1  154  ? 225.134 231.272 142.743 1.00 121.59 ?  154  LEU A CG  1 
ATOM   911   C  CD1 . LEU A 1  154  ? 223.632 231.241 142.842 1.00 122.09 ?  154  LEU A CD1 1 
ATOM   912   C  CD2 . LEU A 1  154  ? 225.557 232.571 142.081 1.00 159.39 ?  154  LEU A CD2 1 
ATOM   913   N  N   . GLN A 1  155  ? 224.929 228.161 142.678 1.00 127.77 ?  155  GLN A N   1 
ATOM   914   C  CA  . GLN A 1  155  ? 224.876 227.631 141.290 1.00 169.69 ?  155  GLN A CA  1 
ATOM   915   C  C   . GLN A 1  155  ? 223.777 228.360 140.467 1.00 250.56 ?  155  GLN A C   1 
ATOM   916   O  O   . GLN A 1  155  ? 222.998 229.124 141.037 1.00 321.27 ?  155  GLN A O   1 
ATOM   917   C  CB  . GLN A 1  155  ? 224.585 226.136 141.291 1.00 128.76 ?  155  GLN A CB  1 
ATOM   918   C  CG  . GLN A 1  155  ? 225.296 225.363 142.367 1.00 135.55 ?  155  GLN A CG  1 
ATOM   919   C  CD  . GLN A 1  155  ? 224.451 224.238 142.881 1.00 149.79 ?  155  GLN A CD  1 
ATOM   920   O  OE1 . GLN A 1  155  ? 223.808 223.530 142.112 1.00 141.13 ?  155  GLN A OE1 1 
ATOM   921   N  NE2 . GLN A 1  155  ? 224.432 224.074 144.195 1.00 167.17 ?  155  GLN A NE2 1 
ATOM   922   N  N   . SER A 1  156  ? 223.691 228.116 139.150 1.00 282.01 ?  156  SER A N   1 
ATOM   923   C  CA  . SER A 1  156  ? 222.636 228.724 138.287 1.00 251.20 ?  156  SER A CA  1 
ATOM   924   C  C   . SER A 1  156  ? 221.185 228.497 138.763 1.00 279.20 ?  156  SER A C   1 
ATOM   925   O  O   . SER A 1  156  ? 220.344 229.391 138.641 1.00 294.65 ?  156  SER A O   1 
ATOM   926   C  CB  . SER A 1  156  ? 222.785 228.281 136.830 1.00 237.53 ?  156  SER A CB  1 
ATOM   927   O  OG  . SER A 1  156  ? 223.824 228.999 136.188 1.00 247.63 ?  156  SER A OG  1 
ATOM   928   N  N   . SER A 1  157  ? 220.913 227.310 139.311 1.00 284.23 ?  157  SER A N   1 
ATOM   929   C  CA  . SER A 1  157  ? 219.603 226.972 139.889 1.00 230.01 ?  157  SER A CA  1 
ATOM   930   C  C   . SER A 1  157  ? 219.352 227.524 141.309 1.00 194.69 ?  157  SER A C   1 
ATOM   931   O  O   . SER A 1  157  ? 218.262 228.006 141.580 1.00 167.19 ?  157  SER A O   1 
ATOM   932   C  CB  . SER A 1  157  ? 219.386 225.458 139.868 1.00 210.77 ?  157  SER A CB  1 
ATOM   933   O  OG  . SER A 1  157  ? 218.065 225.151 140.257 1.00 218.13 ?  157  SER A OG  1 
ATOM   934   N  N   . CYS A 1  158  ? 220.362 227.472 142.187 1.00 182.33 ?  158  CYS A N   1 
ATOM   935   C  CA  . CYS A 1  158  ? 220.187 227.694 143.635 1.00 177.40 ?  158  CYS A CA  1 
ATOM   936   C  C   . CYS A 1  158  ? 221.448 228.071 144.440 1.00 178.18 ?  158  CYS A C   1 
ATOM   937   O  O   . CYS A 1  158  ? 222.582 227.984 143.948 1.00 176.75 ?  158  CYS A O   1 
ATOM   938   C  CB  . CYS A 1  158  ? 219.657 226.402 144.239 1.00 187.40 ?  158  CYS A CB  1 
ATOM   939   S  SG  . CYS A 1  158  ? 220.832 225.068 143.917 1.00 196.03 ?  158  CYS A SG  1 
ATOM   940   N  N   . ILE A 1  159  ? 221.232 228.417 145.709 1.00 149.56 ?  159  ILE A N   1 
ATOM   941   C  CA  . ILE A 1  159  ? 222.303 228.683 146.665 1.00 135.90 ?  159  ILE A CA  1 
ATOM   942   C  C   . ILE A 1  159  ? 222.311 227.674 147.827 1.00 136.73 ?  159  ILE A C   1 
ATOM   943   O  O   . ILE A 1  159  ? 221.252 227.237 148.284 1.00 155.25 ?  159  ILE A O   1 
ATOM   944   C  CB  . ILE A 1  159  ? 222.178 230.117 147.200 1.00 135.99 ?  159  ILE A CB  1 
ATOM   945   C  CG1 . ILE A 1  159  ? 222.832 231.082 146.220 1.00 167.67 ?  159  ILE A CG1 1 
ATOM   946   C  CG2 . ILE A 1  159  ? 222.860 230.287 148.545 1.00 147.53 ?  159  ILE A CG2 1 
ATOM   947   C  CD1 . ILE A 1  159  ? 222.953 232.517 146.694 1.00 191.66 ?  159  ILE A CD1 1 
ATOM   948   N  N   . ASN A 1  160  ? 223.506 227.315 148.299 1.00 140.92 ?  160  ASN A N   1 
ATOM   949   C  CA  . ASN A 1  160  ? 223.677 226.695 149.615 1.00 126.71 ?  160  ASN A CA  1 
ATOM   950   C  C   . ASN A 1  160  ? 224.436 227.545 150.581 1.00 128.50 ?  160  ASN A C   1 
ATOM   951   O  O   . ASN A 1  160  ? 225.338 228.294 150.182 1.00 147.11 ?  160  ASN A O   1 
ATOM   952   C  CB  . ASN A 1  160  ? 224.365 225.365 149.483 1.00 115.40 ?  160  ASN A CB  1 
ATOM   953   C  CG  . ASN A 1  160  ? 223.404 224.328 149.077 1.00 133.26 ?  160  ASN A CG  1 
ATOM   954   O  OD1 . ASN A 1  160  ? 222.338 224.240 149.672 1.00 144.23 ?  160  ASN A OD1 1 
ATOM   955   N  ND2 . ASN A 1  160  ? 223.711 223.590 148.012 1.00 164.44 ?  160  ASN A ND2 1 
ATOM   956   N  N   . MET A 1  161  ? 224.049 227.461 151.849 1.00 110.59 ?  161  MET A N   1 
ATOM   957   C  CA  . MET A 1  161  ? 224.916 227.920 152.925 1.00 115.92 ?  161  MET A CA  1 
ATOM   958   C  C   . MET A 1  161  ? 225.335 226.697 153.704 1.00 125.25 ?  161  MET A C   1 
ATOM   959   O  O   . MET A 1  161  ? 224.707 225.633 153.613 1.00 167.65 ?  161  MET A O   1 
ATOM   960   C  CB  . MET A 1  161  ? 224.191 228.871 153.881 1.00 115.10 ?  161  MET A CB  1 
ATOM   961   C  CG  . MET A 1  161  ? 223.280 229.860 153.223 1.00 116.99 ?  161  MET A CG  1 
ATOM   962   S  SD  . MET A 1  161  ? 224.337 230.917 152.249 1.00 185.19 ?  161  MET A SD  1 
ATOM   963   C  CE  . MET A 1  161  ? 223.113 232.096 151.675 1.00 224.35 ?  161  MET A CE  1 
ATOM   964   N  N   . HIS A 1  162  ? 226.392 226.853 154.479 1.00 112.67 ?  162  HIS A N   1 
ATOM   965   C  CA  . HIS A 1  162  ? 226.646 225.924 155.540 1.00 130.55 ?  162  HIS A CA  1 
ATOM   966   C  C   . HIS A 1  162  ? 227.400 226.699 156.620 1.00 157.18 ?  162  HIS A C   1 
ATOM   967   O  O   . HIS A 1  162  ? 228.491 227.202 156.364 1.00 209.61 ?  162  HIS A O   1 
ATOM   968   C  CB  . HIS A 1  162  ? 227.431 224.721 155.013 1.00 128.83 ?  162  HIS A CB  1 
ATOM   969   C  CG  . HIS A 1  162  ? 227.848 223.777 156.087 1.00 140.99 ?  162  HIS A CG  1 
ATOM   970   N  ND1 . HIS A 1  162  ? 229.027 223.918 156.789 1.00 139.40 ?  162  HIS A ND1 1 
ATOM   971   C  CD2 . HIS A 1  162  ? 227.210 222.713 156.626 1.00 146.20 ?  162  HIS A CD2 1 
ATOM   972   C  CE1 . HIS A 1  162  ? 229.117 222.958 157.691 1.00 142.68 ?  162  HIS A CE1 1 
ATOM   973   N  NE2 . HIS A 1  162  ? 228.024 222.215 157.614 1.00 150.29 ?  162  HIS A NE2 1 
ATOM   974   N  N   . SER A 1  163  ? 226.820 226.805 157.815 1.00 154.73 ?  163  SER A N   1 
ATOM   975   C  CA  . SER A 1  163  ? 227.446 227.541 158.928 1.00 177.82 ?  163  SER A CA  1 
ATOM   976   C  C   . SER A 1  163  ? 228.693 226.836 159.450 1.00 173.76 ?  163  SER A C   1 
ATOM   977   O  O   . SER A 1  163  ? 228.830 225.621 159.303 1.00 174.72 ?  163  SER A O   1 
ATOM   978   C  CB  . SER A 1  163  ? 226.466 227.714 160.098 1.00 198.12 ?  163  SER A CB  1 
ATOM   979   O  OG  . SER A 1  163  ? 225.392 228.585 159.778 1.00 224.62 ?  163  SER A OG  1 
ATOM   980   N  N   . ILE A 1  164  ? 229.600 227.597 160.064 1.00 155.78 ?  164  ILE A N   1 
ATOM   981   C  CA  . ILE A 1  164  ? 230.653 226.996 160.886 1.00 153.64 ?  164  ILE A CA  1 
ATOM   982   C  C   . ILE A 1  164  ? 230.050 226.288 162.094 1.00 151.27 ?  164  ILE A C   1 
ATOM   983   O  O   . ILE A 1  164  ? 230.616 225.307 162.592 1.00 160.65 ?  164  ILE A O   1 
ATOM   984   C  CB  . ILE A 1  164  ? 231.711 228.001 161.373 1.00 160.97 ?  164  ILE A CB  1 
ATOM   985   C  CG1 . ILE A 1  164  ? 231.094 229.168 162.170 1.00 156.10 ?  164  ILE A CG1 1 
ATOM   986   C  CG2 . ILE A 1  164  ? 232.543 228.482 160.201 1.00 176.14 ?  164  ILE A CG2 1 
ATOM   987   C  CD1 . ILE A 1  164  ? 231.879 229.510 163.429 1.00 162.91 ?  164  ILE A CD1 1 
ATOM   988   N  N   . GLU A 1  165  ? 228.901 226.797 162.547 1.00 157.65 ?  165  GLU A N   1 
ATOM   989   C  CA  . GLU A 1  165  ? 228.097 226.166 163.595 1.00 182.77 ?  165  GLU A CA  1 
ATOM   990   C  C   . GLU A 1  165  ? 227.586 224.810 163.123 1.00 178.29 ?  165  GLU A C   1 
ATOM   991   O  O   . GLU A 1  165  ? 227.468 223.882 163.924 1.00 188.10 ?  165  GLU A O   1 
ATOM   992   C  CB  . GLU A 1  165  ? 226.930 227.074 164.014 1.00 213.51 ?  165  GLU A CB  1 
ATOM   993   C  CG  . GLU A 1  165  ? 226.271 226.716 165.350 1.00 242.50 ?  165  GLU A CG  1 
ATOM   994   C  CD  . GLU A 1  165  ? 225.033 225.831 165.212 1.00 253.94 ?  165  GLU A CD  1 
ATOM   995   O  OE1 . GLU A 1  165  ? 224.053 226.257 164.558 1.00 273.30 ?  165  GLU A OE1 1 
ATOM   996   O  OE2 . GLU A 1  165  ? 225.025 224.713 165.779 1.00 236.91 -1 165  GLU A OE2 1 
ATOM   997   N  N   . GLY A 1  166  ? 227.284 224.706 161.833 1.00 155.20 ?  166  GLY A N   1 
ATOM   998   C  CA  . GLY A 1  166  ? 226.885 223.454 161.212 1.00 149.52 ?  166  GLY A CA  1 
ATOM   999   C  C   . GLY A 1  166  ? 225.480 223.528 160.672 1.00 161.79 ?  166  GLY A C   1 
ATOM   1000  O  O   . GLY A 1  166  ? 224.975 222.553 160.104 1.00 176.56 ?  166  GLY A O   1 
ATOM   1001  N  N   . LYS A 1  167  ? 224.841 224.679 160.871 1.00 149.01 ?  167  LYS A N   1 
ATOM   1002  C  CA  . LYS A 1  167  ? 223.530 224.931 160.314 1.00 139.46 ?  167  LYS A CA  1 
ATOM   1003  C  C   . LYS A 1  167  ? 223.686 225.154 158.819 1.00 143.85 ?  167  LYS A C   1 
ATOM   1004  O  O   . LYS A 1  167  ? 224.599 225.846 158.394 1.00 147.01 ?  167  LYS A O   1 
ATOM   1005  C  CB  . LYS A 1  167  ? 222.883 226.131 161.003 1.00 136.50 ?  167  LYS A CB  1 
ATOM   1006  C  CG  . LYS A 1  167  ? 221.904 225.747 162.109 1.00 147.54 ?  167  LYS A CG  1 
ATOM   1007  C  CD  . LYS A 1  167  ? 220.418 225.782 161.706 1.00 164.71 ?  167  LYS A CD  1 
ATOM   1008  C  CE  . LYS A 1  167  ? 220.011 224.994 160.450 1.00 166.22 ?  167  LYS A CE  1 
ATOM   1009  N  NZ  . LYS A 1  167  ? 220.170 223.510 160.504 1.00 153.90 ?  167  LYS A NZ  1 
ATOM   1010  N  N   . ASP A 1  168  ? 222.837 224.519 158.022 1.00 145.83 ?  168  ASP A N   1 
ATOM   1011  C  CA  . ASP A 1  168  ? 222.921 224.651 156.570 1.00 150.69 ?  168  ASP A CA  1 
ATOM   1012  C  C   . ASP A 1  168  ? 221.619 225.137 156.027 1.00 140.31 ?  168  ASP A C   1 
ATOM   1013  O  O   . ASP A 1  168  ? 220.576 224.884 156.588 1.00 145.98 ?  168  ASP A O   1 
ATOM   1014  C  CB  . ASP A 1  168  ? 223.383 223.367 155.855 1.00 170.74 ?  168  ASP A CB  1 
ATOM   1015  C  CG  . ASP A 1  168  ? 223.058 222.092 156.620 1.00 228.66 ?  168  ASP A CG  1 
ATOM   1016  O  OD1 . ASP A 1  168  ? 222.305 222.120 157.621 1.00 261.02 ?  168  ASP A OD1 1 
ATOM   1017  O  OD2 . ASP A 1  168  ? 223.571 221.032 156.205 1.00 273.38 -1 168  ASP A OD2 1 
ATOM   1018  N  N   . TYR A 1  169  ? 221.699 225.840 154.910 1.00 159.10 ?  169  TYR A N   1 
ATOM   1019  C  CA  . TYR A 1  169  ? 220.574 226.585 154.375 1.00 150.02 ?  169  TYR A CA  1 
ATOM   1020  C  C   . TYR A 1  169  ? 220.539 226.542 152.861 1.00 151.07 ?  169  TYR A C   1 
ATOM   1021  O  O   . TYR A 1  169  ? 221.524 226.863 152.151 1.00 131.52 ?  169  TYR A O   1 
ATOM   1022  C  CB  . TYR A 1  169  ? 220.702 228.032 154.787 1.00 134.97 ?  169  TYR A CB  1 
ATOM   1023  C  CG  . TYR A 1  169  ? 220.637 228.285 156.253 1.00 120.02 ?  169  TYR A CG  1 
ATOM   1024  C  CD1 . TYR A 1  169  ? 219.555 227.837 157.010 1.00 128.74 ?  169  TYR A CD1 1 
ATOM   1025  C  CD2 . TYR A 1  169  ? 221.626 229.028 156.875 1.00 114.92 ?  169  TYR A CD2 1 
ATOM   1026  C  CE1 . TYR A 1  169  ? 219.460 228.116 158.360 1.00 128.46 ?  169  TYR A CE1 1 
ATOM   1027  C  CE2 . TYR A 1  169  ? 221.548 229.320 158.220 1.00 141.69 ?  169  TYR A CE2 1 
ATOM   1028  C  CZ  . TYR A 1  169  ? 220.454 228.865 158.950 1.00 147.35 ?  169  TYR A CZ  1 
ATOM   1029  O  OH  . TYR A 1  169  ? 220.358 229.141 160.289 1.00 196.86 ?  169  TYR A OH  1 
ATOM   1030  N  N   . ILE A 1  170  ? 219.392 226.139 152.354 1.00 137.34 ?  170  ILE A N   1 
ATOM   1031  C  CA  . ILE A 1  170  ? 219.270 226.151 150.941 1.00 139.40 ?  170  ILE A CA  1 
ATOM   1032  C  C   . ILE A 1  170  ? 218.268 227.192 150.540 1.00 188.67 ?  170  ILE A C   1 
ATOM   1033  O  O   . ILE A 1  170  ? 217.053 227.008 150.711 1.00 210.51 ?  170  ILE A O   1 
ATOM   1034  C  CB  . ILE A 1  170  ? 218.854 224.820 150.376 1.00 116.39 ?  170  ILE A CB  1 
ATOM   1035  C  CG1 . ILE A 1  170  ? 219.360 223.677 151.266 1.00 145.39 ?  170  ILE A CG1 1 
ATOM   1036  C  CG2 . ILE A 1  170  ? 219.393 224.761 148.961 1.00 117.04 ?  170  ILE A CG2 1 
ATOM   1037  C  CD1 . ILE A 1  170  ? 218.622 222.353 151.135 1.00 164.35 ?  170  ILE A CD1 1 
ATOM   1038  N  N   . ALA A 1  171  ? 218.798 228.294 150.017 1.00 238.16 ?  171  ALA A N   1 
ATOM   1039  C  CA  . ALA A 1  171  ? 218.015 229.205 149.199 1.00 265.72 ?  171  ALA A CA  1 
ATOM   1040  C  C   . ALA A 1  171  ? 217.800 228.541 147.831 1.00 285.55 ?  171  ALA A C   1 
ATOM   1041  O  O   . ALA A 1  171  ? 218.402 227.510 147.518 1.00 313.44 ?  171  ALA A O   1 
ATOM   1042  C  CB  . ALA A 1  171  ? 218.728 230.545 149.057 1.00 259.63 ?  171  ALA A CB  1 
ATOM   1043  N  N   . SER A 1  172  ? 216.902 229.096 147.037 1.00 255.91 ?  172  SER A N   1 
ATOM   1044  C  CA  . SER A 1  172  ? 216.810 228.748 145.630 1.00 214.58 ?  172  SER A CA  1 
ATOM   1045  C  C   . SER A 1  172  ? 216.652 230.101 144.966 1.00 172.86 ?  172  SER A C   1 
ATOM   1046  O  O   . SER A 1  172  ? 216.356 231.072 145.648 1.00 148.72 ?  172  SER A O   1 
ATOM   1047  C  CB  . SER A 1  172  ? 215.624 227.793 145.367 1.00 228.92 ?  172  SER A CB  1 
ATOM   1048  O  OG  . SER A 1  172  ? 215.970 226.410 145.548 1.00 172.19 ?  172  SER A OG  1 
ATOM   1049  N  N   . LEU A 1  173  ? 216.862 230.200 143.666 1.00 161.97 ?  173  LEU A N   1 
ATOM   1050  C  CA  . LEU A 1  173  ? 216.708 231.500 143.039 1.00 239.35 ?  173  LEU A CA  1 
ATOM   1051  C  C   . LEU A 1  173  ? 215.431 231.742 142.189 1.00 321.32 ?  173  LEU A C   1 
ATOM   1052  O  O   . LEU A 1  173  ? 215.023 230.846 141.434 1.00 360.10 ?  173  LEU A O   1 
ATOM   1053  C  CB  . LEU A 1  173  ? 217.986 231.876 142.301 1.00 226.71 ?  173  LEU A CB  1 
ATOM   1054  C  CG  . LEU A 1  173  ? 218.821 232.748 143.223 1.00 214.95 ?  173  LEU A CG  1 
ATOM   1055  C  CD1 . LEU A 1  173  ? 219.860 231.918 143.964 1.00 214.78 ?  173  LEU A CD1 1 
ATOM   1056  C  CD2 . LEU A 1  173  ? 219.449 233.853 142.398 1.00 203.36 ?  173  LEU A CD2 1 
ATOM   1057  N  N   . PRO A 1  174  ? 214.783 232.944 142.336 1.00 347.78 ?  174  PRO A N   1 
ATOM   1058  C  CA  . PRO A 1  174  ? 213.674 233.373 141.432 1.00 316.15 ?  174  PRO A CA  1 
ATOM   1059  C  C   . PRO A 1  174  ? 214.096 233.917 140.035 1.00 280.22 ?  174  PRO A C   1 
ATOM   1060  O  O   . PRO A 1  174  ? 213.236 234.419 139.281 1.00 265.35 ?  174  PRO A O   1 
ATOM   1061  C  CB  . PRO A 1  174  ? 212.924 234.449 142.248 1.00 280.33 ?  174  PRO A CB  1 
ATOM   1062  C  CG  . PRO A 1  174  ? 213.860 234.899 143.309 1.00 267.66 ?  174  PRO A CG  1 
ATOM   1063  C  CD  . PRO A 1  174  ? 214.927 233.852 143.500 1.00 334.31 ?  174  PRO A CD  1 
ATOM   1064  N  N   . PHE A 1  175  ? 215.389 233.787 139.702 1.00 218.14 ?  175  PHE A N   1 
ATOM   1065  C  CA  . PHE A 1  175  ? 215.993 234.372 138.506 1.00 166.55 ?  175  PHE A CA  1 
ATOM   1066  C  C   . PHE A 1  175  ? 217.449 233.958 138.231 1.00 179.97 ?  175  PHE A C   1 
ATOM   1067  O  O   . PHE A 1  175  ? 218.146 233.473 139.132 1.00 148.45 ?  175  PHE A O   1 
ATOM   1068  C  CB  . PHE A 1  175  ? 215.942 235.891 138.628 1.00 168.31 ?  175  PHE A CB  1 
ATOM   1069  C  CG  . PHE A 1  175  ? 216.561 236.436 139.895 1.00 171.44 ?  175  PHE A CG  1 
ATOM   1070  C  CD1 . PHE A 1  175  ? 217.949 236.570 140.020 1.00 184.23 ?  175  PHE A CD1 1 
ATOM   1071  C  CD2 . PHE A 1  175  ? 215.754 236.866 140.944 1.00 179.33 ?  175  PHE A CD2 1 
ATOM   1072  C  CE1 . PHE A 1  175  ? 218.519 237.111 141.159 1.00 194.65 ?  175  PHE A CE1 1 
ATOM   1073  C  CE2 . PHE A 1  175  ? 216.321 237.405 142.094 1.00 202.32 ?  175  PHE A CE2 1 
ATOM   1074  C  CZ  . PHE A 1  175  ? 217.707 237.525 142.200 1.00 198.11 ?  175  PHE A CZ  1 
ATOM   1075  N  N   . GLN A 1  176  ? 217.901 234.225 136.994 1.00 224.57 ?  176  GLN A N   1 
ATOM   1076  C  CA  . GLN A 1  176  ? 219.302 234.021 136.518 1.00 231.92 ?  176  GLN A CA  1 
ATOM   1077  C  C   . GLN A 1  176  ? 220.314 235.091 136.995 1.00 228.49 ?  176  GLN A C   1 
ATOM   1078  O  O   . GLN A 1  176  ? 220.245 236.276 136.615 1.00 209.85 ?  176  GLN A O   1 
ATOM   1079  C  CB  . GLN A 1  176  ? 219.361 233.912 134.982 1.00 228.77 ?  176  GLN A CB  1 
ATOM   1080  C  CG  . GLN A 1  176  ? 218.452 232.860 134.356 1.00 235.21 ?  176  GLN A CG  1 
ATOM   1081  C  CD  . GLN A 1  176  ? 218.795 231.446 134.779 1.00 269.35 ?  176  GLN A CD  1 
ATOM   1082  O  OE1 . GLN A 1  176  ? 217.940 230.712 135.276 1.00 301.17 ?  176  GLN A OE1 1 
ATOM   1083  N  NE2 . GLN A 1  176  ? 220.053 231.059 134.594 1.00 294.46 ?  176  GLN A NE2 1 
ATOM   1084  N  N   . VAL A 1  177  ? 221.282 234.632 137.786 1.00 200.91 ?  177  VAL A N   1 
ATOM   1085  C  CA  . VAL A 1  177  ? 222.137 235.494 138.617 1.00 171.03 ?  177  VAL A CA  1 
ATOM   1086  C  C   . VAL A 1  177  ? 223.630 235.462 138.179 1.00 168.77 ?  177  VAL A C   1 
ATOM   1087  O  O   . VAL A 1  177  ? 224.254 234.398 138.121 1.00 176.98 ?  177  VAL A O   1 
ATOM   1088  C  CB  . VAL A 1  177  ? 221.884 235.159 140.129 1.00 140.61 ?  177  VAL A CB  1 
ATOM   1089  C  CG1 . VAL A 1  177  ? 222.097 233.679 140.416 1.00 148.87 ?  177  VAL A CG1 1 
ATOM   1090  C  CG2 . VAL A 1  177  ? 222.702 236.013 141.082 1.00 126.76 ?  177  VAL A CG2 1 
ATOM   1091  N  N   . ALA A 1  178  ? 224.182 236.631 137.854 1.00 165.80 ?  178  ALA A N   1 
ATOM   1092  C  CA  . ALA A 1  178  ? 225.584 236.753 137.439 1.00 170.01 ?  178  ALA A CA  1 
ATOM   1093  C  C   . ALA A 1  178  ? 226.503 236.631 138.633 1.00 184.58 ?  178  ALA A C   1 
ATOM   1094  O  O   . ALA A 1  178  ? 227.369 235.756 138.651 1.00 213.21 ?  178  ALA A O   1 
ATOM   1095  C  CB  . ALA A 1  178  ? 225.840 238.068 136.718 1.00 178.91 ?  178  ALA A CB  1 
ATOM   1096  N  N   . ASN A 1  179  ? 226.298 237.490 139.631 1.00 185.65 ?  179  ASN A N   1 
ATOM   1097  C  CA  . ASN A 1  179  ? 227.144 237.495 140.813 1.00 217.04 ?  179  ASN A CA  1 
ATOM   1098  C  C   . ASN A 1  179  ? 226.455 237.453 142.148 1.00 247.26 ?  179  ASN A C   1 
ATOM   1099  O  O   . ASN A 1  179  ? 225.320 237.895 142.282 1.00 303.75 ?  179  ASN A O   1 
ATOM   1100  C  CB  . ASN A 1  179  ? 228.060 238.699 140.796 1.00 229.15 ?  179  ASN A CB  1 
ATOM   1101  C  CG  . ASN A 1  179  ? 229.370 238.406 140.125 1.00 251.76 ?  179  ASN A CG  1 
ATOM   1102  O  OD1 . ASN A 1  179  ? 230.385 238.221 140.797 1.00 228.97 ?  179  ASN A OD1 1 
ATOM   1103  N  ND2 . ASN A 1  179  ? 229.357 238.331 138.792 1.00 287.44 ?  179  ASN A ND2 1 
ATOM   1104  N  N   . VAL A 1  180  ? 227.158 236.898 143.128 1.00 252.08 ?  180  VAL A N   1 
ATOM   1105  C  CA  . VAL A 1  180  ? 226.843 237.122 144.533 1.00 300.66 ?  180  VAL A CA  1 
ATOM   1106  C  C   . VAL A 1  180  ? 227.995 237.878 145.158 1.00 324.01 ?  180  VAL A C   1 
ATOM   1107  O  O   . VAL A 1  180  ? 229.161 237.632 144.827 1.00 358.71 ?  180  VAL A O   1 
ATOM   1108  C  CB  . VAL A 1  180  ? 226.516 235.841 145.345 1.00 291.78 ?  180  VAL A CB  1 
ATOM   1109  C  CG1 . VAL A 1  180  ? 225.113 235.364 145.048 1.00 285.51 ?  180  VAL A CG1 1 
ATOM   1110  C  CG2 . VAL A 1  180  ? 227.514 234.726 145.097 1.00 279.38 ?  180  VAL A CG2 1 
ATOM   1111  N  N   . TRP A 1  181  ? 227.655 238.809 146.045 1.00 324.51 ?  181  TRP A N   1 
ATOM   1112  C  CA  . TRP A 1  181  ? 228.648 239.658 146.693 1.00 300.93 ?  181  TRP A CA  1 
ATOM   1113  C  C   . TRP A 1  181  ? 228.650 239.416 148.216 1.00 289.54 ?  181  TRP A C   1 
ATOM   1114  O  O   . TRP A 1  181  ? 227.582 239.440 148.833 1.00 309.52 ?  181  TRP A O   1 
ATOM   1115  C  CB  . TRP A 1  181  ? 228.440 241.123 146.256 1.00 264.12 ?  181  TRP A CB  1 
ATOM   1116  C  CG  . TRP A 1  181  ? 228.728 241.249 144.776 1.00 228.65 ?  181  TRP A CG  1 
ATOM   1117  C  CD1 . TRP A 1  181  ? 227.826 241.218 143.750 1.00 154.89 ?  181  TRP A CD1 1 
ATOM   1118  C  CD2 . TRP A 1  181  ? 230.023 241.323 144.170 1.00 249.69 ?  181  TRP A CD2 1 
ATOM   1119  N  NE1 . TRP A 1  181  ? 228.477 241.306 142.552 1.00 175.39 ?  181  TRP A NE1 1 
ATOM   1120  C  CE2 . TRP A 1  181  ? 229.827 241.373 142.772 1.00 223.65 ?  181  TRP A CE2 1 
ATOM   1121  C  CE3 . TRP A 1  181  ? 231.335 241.368 144.678 1.00 284.91 ?  181  TRP A CE3 1 
ATOM   1122  C  CZ2 . TRP A 1  181  ? 230.897 241.458 141.860 1.00 238.14 ?  181  TRP A CZ2 1 
ATOM   1123  C  CZ3 . TRP A 1  181  ? 232.405 241.465 143.771 1.00 298.98 ?  181  TRP A CZ3 1 
ATOM   1124  C  CH2 . TRP A 1  181  ? 232.174 241.513 142.377 1.00 280.47 ?  181  TRP A CH2 1 
ATOM   1125  N  N   . PRO A 1  182  ? 229.848 239.161 148.816 1.00 252.02 ?  182  PRO A N   1 
ATOM   1126  C  CA  . PRO A 1  182  ? 229.937 238.592 150.173 1.00 230.73 ?  182  PRO A CA  1 
ATOM   1127  C  C   . PRO A 1  182  ? 229.739 239.627 151.305 1.00 261.68 ?  182  PRO A C   1 
ATOM   1128  O  O   . PRO A 1  182  ? 230.432 239.579 152.334 1.00 281.95 ?  182  PRO A O   1 
ATOM   1129  C  CB  . PRO A 1  182  ? 231.361 238.012 150.199 1.00 195.61 ?  182  PRO A CB  1 
ATOM   1130  C  CG  . PRO A 1  182  ? 232.120 238.680 149.087 1.00 186.44 ?  182  PRO A CG  1 
ATOM   1131  C  CD  . PRO A 1  182  ? 231.184 239.577 148.330 1.00 214.56 ?  182  PRO A CD  1 
ATOM   1132  N  N   . THR A 1  183  ? 228.768 240.521 151.121 1.00 294.41 ?  183  THR A N   1 
ATOM   1133  C  CA  . THR A 1  183  ? 228.708 241.816 151.837 1.00 278.71 ?  183  THR A CA  1 
ATOM   1134  C  C   . THR A 1  183  ? 228.645 241.700 153.362 1.00 224.12 ?  183  THR A C   1 
ATOM   1135  O  O   . THR A 1  183  ? 228.001 240.780 153.876 1.00 175.39 ?  183  THR A O   1 
ATOM   1136  C  CB  . THR A 1  183  ? 227.563 242.774 151.323 1.00 298.17 ?  183  THR A CB  1 
ATOM   1137  O  OG1 . THR A 1  183  ? 226.435 242.781 152.210 1.00 243.78 ?  183  THR A OG1 1 
ATOM   1138  C  CG2 . THR A 1  183  ? 227.082 242.441 149.927 1.00 299.06 ?  183  THR A CG2 1 
ATOM   1139  N  N   . LYS A 1  184  ? 229.346 242.621 154.048 1.00 198.40 ?  184  LYS A N   1 
ATOM   1140  C  CA  . LYS A 1  184  ? 229.005 243.070 155.410 1.00 187.69 ?  184  LYS A CA  1 
ATOM   1141  C  C   . LYS A 1  184  ? 227.521 243.350 155.370 1.00 191.95 ?  184  LYS A C   1 
ATOM   1142  O  O   . LYS A 1  184  ? 226.947 243.477 154.283 1.00 167.51 ?  184  LYS A O   1 
ATOM   1143  C  CB  . LYS A 1  184  ? 229.731 244.377 155.770 1.00 161.30 ?  184  LYS A CB  1 
ATOM   1144  N  N   . TYR A 1  185  ? 226.869 243.442 156.519 1.00 193.44 ?  185  TYR A N   1 
ATOM   1145  C  CA  . TYR A 1  185  ? 225.475 243.870 156.501 1.00 207.61 ?  185  TYR A CA  1 
ATOM   1146  C  C   . TYR A 1  185  ? 224.495 242.764 156.020 1.00 180.24 ?  185  TYR A C   1 
ATOM   1147  O  O   . TYR A 1  185  ? 223.545 242.455 156.728 1.00 189.39 ?  185  TYR A O   1 
ATOM   1148  C  CB  . TYR A 1  185  ? 225.332 245.167 155.662 1.00 232.44 ?  185  TYR A CB  1 
ATOM   1149  C  CG  . TYR A 1  185  ? 224.747 246.333 156.398 1.00 237.76 ?  185  TYR A CG  1 
ATOM   1150  C  CD1 . TYR A 1  185  ? 223.733 246.134 157.326 1.00 263.93 ?  185  TYR A CD1 1 
ATOM   1151  C  CD2 . TYR A 1  185  ? 225.188 247.640 156.164 1.00 215.39 ?  185  TYR A CD2 1 
ATOM   1152  C  CE1 . TYR A 1  185  ? 223.182 247.188 158.019 1.00 281.60 ?  185  TYR A CE1 1 
ATOM   1153  C  CE2 . TYR A 1  185  ? 224.622 248.714 156.850 1.00 247.85 ?  185  TYR A CE2 1 
ATOM   1154  C  CZ  . TYR A 1  185  ? 223.614 248.472 157.781 1.00 275.78 ?  185  TYR A CZ  1 
ATOM   1155  O  OH  . TYR A 1  185  ? 223.018 249.483 158.497 1.00 287.87 ?  185  TYR A OH  1 
ATOM   1156  N  N   . GLY A 1  186  ? 224.722 242.170 154.843 1.00 150.49 ?  186  GLY A N   1 
ATOM   1157  C  CA  . GLY A 1  186  ? 223.908 241.032 154.384 1.00 161.10 ?  186  GLY A CA  1 
ATOM   1158  C  C   . GLY A 1  186  ? 224.531 240.150 153.311 1.00 165.38 ?  186  GLY A C   1 
ATOM   1159  O  O   . GLY A 1  186  ? 225.636 239.621 153.454 1.00 127.03 ?  186  GLY A O   1 
ATOM   1160  N  N   . LEU A 1  187  ? 223.788 239.951 152.235 1.00 199.77 ?  187  LEU A N   1 
ATOM   1161  C  CA  . LEU A 1  187  ? 224.367 239.408 151.008 1.00 282.65 ?  187  LEU A CA  1 
ATOM   1162  C  C   . LEU A 1  187  ? 223.996 240.317 149.814 1.00 345.14 ?  187  LEU A C   1 
ATOM   1163  O  O   . LEU A 1  187  ? 223.530 241.450 150.027 1.00 395.47 ?  187  LEU A O   1 
ATOM   1164  C  CB  . LEU A 1  187  ? 223.982 237.927 150.822 1.00 257.30 ?  187  LEU A CB  1 
ATOM   1165  C  CG  . LEU A 1  187  ? 224.949 236.986 150.084 1.00 252.81 ?  187  LEU A CG  1 
ATOM   1166  C  CD1 . LEU A 1  187  ? 226.377 237.094 150.612 1.00 242.72 ?  187  LEU A CD1 1 
ATOM   1167  C  CD2 . LEU A 1  187  ? 224.448 235.549 150.145 1.00 231.71 ?  187  LEU A CD2 1 
ATOM   1168  N  N   . LEU A 1  188  ? 224.236 239.854 148.584 1.00 353.86 ?  188  LEU A N   1 
ATOM   1169  C  CA  . LEU A 1  188  ? 223.898 240.615 147.371 1.00 305.21 ?  188  LEU A CA  1 
ATOM   1170  C  C   . LEU A 1  188  ? 223.797 239.714 146.134 1.00 289.94 ?  188  LEU A C   1 
ATOM   1171  O  O   . LEU A 1  188  ? 224.418 238.643 146.078 1.00 323.87 ?  188  LEU A O   1 
ATOM   1172  C  CB  . LEU A 1  188  ? 224.896 241.773 147.147 1.00 294.48 ?  188  LEU A CB  1 
ATOM   1173  C  CG  . LEU A 1  188  ? 224.579 243.111 146.443 1.00 284.88 ?  188  LEU A CG  1 
ATOM   1174  C  CD1 . LEU A 1  188  ? 223.105 243.476 146.317 1.00 243.05 ?  188  LEU A CD1 1 
ATOM   1175  C  CD2 . LEU A 1  188  ? 225.332 244.243 147.123 1.00 285.34 ?  188  LEU A CD2 1 
ATOM   1176  N  N   . PHE A 1  189  ? 222.978 240.143 145.174 1.00 228.66 ?  189  PHE A N   1 
ATOM   1177  C  CA  . PHE A 1  189  ? 222.858 239.505 143.864 1.00 186.16 ?  189  PHE A CA  1 
ATOM   1178  C  C   . PHE A 1  189  ? 222.843 240.574 142.793 1.00 182.57 ?  189  PHE A C   1 
ATOM   1179  O  O   . PHE A 1  189  ? 222.174 241.598 142.941 1.00 206.40 ?  189  PHE A O   1 
ATOM   1180  C  CB  . PHE A 1  189  ? 221.576 238.687 143.747 1.00 168.09 ?  189  PHE A CB  1 
ATOM   1181  C  CG  . PHE A 1  189  ? 221.410 237.661 144.814 1.00 182.91 ?  189  PHE A CG  1 
ATOM   1182  C  CD1 . PHE A 1  189  ? 221.933 236.389 144.654 1.00 185.37 ?  189  PHE A CD1 1 
ATOM   1183  C  CD2 . PHE A 1  189  ? 220.707 237.960 145.979 1.00 202.93 ?  189  PHE A CD2 1 
ATOM   1184  C  CE1 . PHE A 1  189  ? 221.770 235.434 145.646 1.00 222.20 ?  189  PHE A CE1 1 
ATOM   1185  C  CE2 . PHE A 1  189  ? 220.548 237.014 146.983 1.00 234.12 ?  189  PHE A CE2 1 
ATOM   1186  C  CZ  . PHE A 1  189  ? 221.081 235.743 146.815 1.00 246.77 ?  189  PHE A CZ  1 
ATOM   1187  N  N   . GLU A 1  190  ? 223.593 240.341 141.724 1.00 174.59 ?  190  GLU A N   1 
ATOM   1188  C  CA  . GLU A 1  190  ? 223.446 241.136 140.527 1.00 194.85 ?  190  GLU A CA  1 
ATOM   1189  C  C   . GLU A 1  190  ? 222.868 240.237 139.449 1.00 215.60 ?  190  GLU A C   1 
ATOM   1190  O  O   . GLU A 1  190  ? 223.479 239.228 139.076 1.00 265.36 ?  190  GLU A O   1 
ATOM   1191  C  CB  . GLU A 1  190  ? 224.771 241.725 140.097 1.00 218.90 ?  190  GLU A CB  1 
ATOM   1192  C  CG  . GLU A 1  190  ? 224.585 242.909 139.173 1.00 281.29 ?  190  GLU A CG  1 
ATOM   1193  C  CD  . GLU A 1  190  ? 225.637 242.991 138.095 1.00 325.10 ?  190  GLU A CD  1 
ATOM   1194  O  OE1 . GLU A 1  190  ? 226.738 242.425 138.278 1.00 364.69 -1 190  GLU A OE1 1 
ATOM   1195  O  OE2 . GLU A 1  190  ? 225.350 243.625 137.060 1.00 339.69 ?  190  GLU A OE2 1 
ATOM   1196  N  N   . ARG A 1  191  ? 221.684 240.599 138.962 1.00 200.33 ?  191  ARG A N   1 
ATOM   1197  C  CA  . ARG A 1  191  ? 220.892 239.709 138.113 1.00 190.19 ?  191  ARG A CA  1 
ATOM   1198  C  C   . ARG A 1  191  ? 221.254 239.860 136.618 1.00 200.38 ?  191  ARG A C   1 
ATOM   1199  O  O   . ARG A 1  191  ? 222.026 240.764 136.237 1.00 182.59 ?  191  ARG A O   1 
ATOM   1200  C  CB  . ARG A 1  191  ? 219.396 239.932 138.404 1.00 173.87 ?  191  ARG A CB  1 
ATOM   1201  C  CG  . ARG A 1  191  ? 218.441 238.877 137.864 1.00 171.54 ?  191  ARG A CG  1 
ATOM   1202  C  CD  . ARG A 1  191  ? 217.064 239.457 137.603 1.00 191.07 ?  191  ARG A CD  1 
ATOM   1203  N  NE  . ARG A 1  191  ? 217.096 240.447 136.529 1.00 230.94 ?  191  ARG A NE  1 
ATOM   1204  C  CZ  . ARG A 1  191  ? 216.180 241.391 136.327 1.00 260.21 ?  191  ARG A CZ  1 
ATOM   1205  N  NH1 . ARG A 1  191  ? 215.121 241.498 137.126 1.00 246.62 ?  191  ARG A NH1 1 
ATOM   1206  N  NH2 . ARG A 1  191  ? 216.330 242.234 135.313 1.00 283.50 ?  191  ARG A NH2 1 
ATOM   1207  N  N   . SER A 1  192  ? 220.715 238.942 135.803 1.00 215.09 ?  192  SER A N   1 
ATOM   1208  C  CA  . SER A 1  192  ? 220.802 238.923 134.326 1.00 232.00 ?  192  SER A CA  1 
ATOM   1209  C  C   . SER A 1  192  ? 222.175 238.416 133.897 1.00 203.93 ?  192  SER A C   1 
ATOM   1210  O  O   . SER A 1  192  ? 222.517 237.264 134.168 1.00 179.31 ?  192  SER A O   1 
ATOM   1211  C  CB  . SER A 1  192  ? 220.435 240.283 133.669 1.00 255.83 ?  192  SER A CB  1 
ATOM   1212  O  OG  . SER A 1  192  ? 219.723 240.143 132.437 1.00 231.16 ?  192  SER A OG  1 
ATOM   1213  N  N   . PRO A 1  206  ? 210.867 247.806 133.435 1.00 180.65 ?  206  PRO A N   1 
ATOM   1214  C  CA  . PRO A 1  206  ? 211.946 247.966 134.402 1.00 208.14 ?  206  PRO A CA  1 
ATOM   1215  C  C   . PRO A 1  206  ? 211.728 247.112 135.640 1.00 234.50 ?  206  PRO A C   1 
ATOM   1216  O  O   . PRO A 1  206  ? 210.861 247.408 136.478 1.00 234.14 ?  206  PRO A O   1 
ATOM   1217  C  CB  . PRO A 1  206  ? 211.888 249.452 134.762 1.00 209.36 ?  206  PRO A CB  1 
ATOM   1218  N  N   . LEU A 1  207  ? 212.524 246.047 135.712 1.00 253.71 ?  207  LEU A N   1 
ATOM   1219  C  CA  . LEU A 1  207  ? 212.591 245.114 136.833 1.00 235.81 ?  207  LEU A CA  1 
ATOM   1220  C  C   . LEU A 1  207  ? 213.945 245.375 137.500 1.00 230.14 ?  207  LEU A C   1 
ATOM   1221  O  O   . LEU A 1  207  ? 214.870 245.797 136.806 1.00 252.43 ?  207  LEU A O   1 
ATOM   1222  C  CB  . LEU A 1  207  ? 212.524 243.689 136.281 1.00 229.79 ?  207  LEU A CB  1 
ATOM   1223  C  CG  . LEU A 1  207  ? 211.773 242.562 136.995 1.00 235.90 ?  207  LEU A CG  1 
ATOM   1224  C  CD1 . LEU A 1  207  ? 210.301 242.896 137.223 1.00 237.63 ?  207  LEU A CD1 1 
ATOM   1225  C  CD2 . LEU A 1  207  ? 211.902 241.279 136.182 1.00 220.04 ?  207  LEU A CD2 1 
ATOM   1226  N  N   . PRO A 1  208  ? 214.077 245.148 138.832 1.00 209.39 ?  208  PRO A N   1 
ATOM   1227  C  CA  . PRO A 1  208  ? 215.372 245.501 139.463 1.00 196.31 ?  208  PRO A CA  1 
ATOM   1228  C  C   . PRO A 1  208  ? 216.474 244.448 139.272 1.00 181.04 ?  208  PRO A C   1 
ATOM   1229  O  O   . PRO A 1  208  ? 216.150 243.263 139.269 1.00 183.38 ?  208  PRO A O   1 
ATOM   1230  C  CB  . PRO A 1  208  ? 215.018 245.651 140.949 1.00 177.89 ?  208  PRO A CB  1 
ATOM   1231  C  CG  . PRO A 1  208  ? 213.637 245.115 141.129 1.00 161.19 ?  208  PRO A CG  1 
ATOM   1232  C  CD  . PRO A 1  208  ? 213.110 244.622 139.814 1.00 183.06 ?  208  PRO A CD  1 
ATOM   1233  N  N   . THR A 1  209  ? 217.742 244.869 139.106 1.00 174.00 ?  209  THR A N   1 
ATOM   1234  C  CA  . THR A 1  209  ? 218.890 243.917 138.973 1.00 201.32 ?  209  THR A CA  1 
ATOM   1235  C  C   . THR A 1  209  ? 219.661 243.631 140.275 1.00 190.07 ?  209  THR A C   1 
ATOM   1236  O  O   . THR A 1  209  ? 220.142 242.511 140.488 1.00 173.64 ?  209  THR A O   1 
ATOM   1237  C  CB  . THR A 1  209  ? 219.932 244.296 137.880 1.00 223.84 ?  209  THR A CB  1 
ATOM   1238  O  OG1 . THR A 1  209  ? 220.519 245.569 138.174 1.00 230.10 ?  209  THR A OG1 1 
ATOM   1239  C  CG2 . THR A 1  209  ? 219.336 244.290 136.471 1.00 224.71 ?  209  THR A CG2 1 
ATOM   1240  N  N   . MET A 1  210  ? 219.806 244.641 141.128 1.00 183.11 ?  210  MET A N   1 
ATOM   1241  C  CA  . MET A 1  210  ? 220.376 244.409 142.457 1.00 182.14 ?  210  MET A CA  1 
ATOM   1242  C  C   . MET A 1  210  ? 219.391 243.735 143.420 1.00 167.34 ?  210  MET A C   1 
ATOM   1243  O  O   . MET A 1  210  ? 218.267 244.179 143.631 1.00 138.43 ?  210  MET A O   1 
ATOM   1244  C  CB  . MET A 1  210  ? 220.982 245.684 143.056 1.00 183.28 ?  210  MET A CB  1 
ATOM   1245  C  CG  . MET A 1  210  ? 222.506 245.705 143.163 1.00 188.21 ?  210  MET A CG  1 
ATOM   1246  S  SD  . MET A 1  210  ? 223.394 245.383 141.624 1.00 226.48 ?  210  MET A SD  1 
ATOM   1247  C  CE  . MET A 1  210  ? 224.621 246.691 141.591 1.00 204.72 ?  210  MET A CE  1 
ATOM   1248  N  N   . PHE A 1  211  ? 219.840 242.625 143.976 1.00 183.41 ?  211  PHE A N   1 
ATOM   1249  C  CA  . PHE A 1  211  ? 219.083 241.905 144.971 1.00 185.47 ?  211  PHE A CA  1 
ATOM   1250  C  C   . PHE A 1  211  ? 219.957 241.572 146.165 1.00 196.61 ?  211  PHE A C   1 
ATOM   1251  O  O   . PHE A 1  211  ? 221.178 241.437 146.061 1.00 158.79 ?  211  PHE A O   1 
ATOM   1252  C  CB  . PHE A 1  211  ? 218.492 240.627 144.387 1.00 175.20 ?  211  PHE A CB  1 
ATOM   1253  C  CG  . PHE A 1  211  ? 217.285 240.850 143.549 1.00 170.89 ?  211  PHE A CG  1 
ATOM   1254  C  CD1 . PHE A 1  211  ? 216.014 240.902 144.127 1.00 187.40 ?  211  PHE A CD1 1 
ATOM   1255  C  CD2 . PHE A 1  211  ? 217.408 240.986 142.171 1.00 186.74 ?  211  PHE A CD2 1 
ATOM   1256  C  CE1 . PHE A 1  211  ? 214.879 241.105 143.349 1.00 208.84 ?  211  PHE A CE1 1 
ATOM   1257  C  CE2 . PHE A 1  211  ? 216.277 241.174 141.383 1.00 215.58 ?  211  PHE A CE2 1 
ATOM   1258  C  CZ  . PHE A 1  211  ? 215.011 241.244 141.972 1.00 218.77 ?  211  PHE A CZ  1 
ATOM   1259  N  N   . SER A 1  212  ? 219.320 241.444 147.313 1.00 184.93 ?  212  SER A N   1 
ATOM   1260  C  CA  . SER A 1  212  ? 220.038 241.065 148.496 1.00 166.51 ?  212  SER A CA  1 
ATOM   1261  C  C   . SER A 1  212  ? 219.255 240.008 149.282 1.00 169.02 ?  212  SER A C   1 
ATOM   1262  O  O   . SER A 1  212  ? 218.077 239.738 149.004 1.00 152.08 ?  212  SER A O   1 
ATOM   1263  C  CB  . SER A 1  212  ? 220.349 242.317 149.324 1.00 152.22 ?  212  SER A CB  1 
ATOM   1264  O  OG  . SER A 1  212  ? 219.158 242.972 149.722 1.00 155.24 ?  212  SER A OG  1 
ATOM   1265  N  N   . MET A 1  213  ? 219.959 239.369 150.213 1.00 177.52 ?  213  MET A N   1 
ATOM   1266  C  CA  . MET A 1  213  ? 219.357 238.712 151.360 1.00 174.19 ?  213  MET A CA  1 
ATOM   1267  C  C   . MET A 1  213  ? 220.265 238.999 152.565 1.00 169.92 ?  213  MET A C   1 
ATOM   1268  O  O   . MET A 1  213  ? 221.471 238.714 152.536 1.00 137.29 ?  213  MET A O   1 
ATOM   1269  C  CB  . MET A 1  213  ? 219.147 237.217 151.087 1.00 200.08 ?  213  MET A CB  1 
ATOM   1270  C  CG  . MET A 1  213  ? 220.354 236.306 151.325 1.00 248.50 ?  213  MET A CG  1 
ATOM   1271  S  SD  . MET A 1  213  ? 220.258 234.597 150.740 1.00 307.24 ?  213  MET A SD  1 
ATOM   1272  C  CE  . MET A 1  213  ? 218.518 234.195 150.925 1.00 316.87 ?  213  MET A CE  1 
ATOM   1273  N  N   . LEU A 1  214  ? 219.698 239.630 153.590 1.00 173.30 ?  214  LEU A N   1 
ATOM   1274  C  CA  . LEU A 1  214  ? 220.393 239.800 154.869 1.00 188.88 ?  214  LEU A CA  1 
ATOM   1275  C  C   . LEU A 1  214  ? 220.471 238.454 155.610 1.00 222.72 ?  214  LEU A C   1 
ATOM   1276  O  O   . LEU A 1  214  ? 221.369 238.257 156.437 1.00 242.78 ?  214  LEU A O   1 
ATOM   1277  C  CB  . LEU A 1  214  ? 219.717 240.890 155.722 1.00 192.33 ?  214  LEU A CB  1 
ATOM   1278  C  CG  . LEU A 1  214  ? 219.868 241.163 157.247 1.00 193.26 ?  214  LEU A CG  1 
ATOM   1279  C  CD1 . LEU A 1  214  ? 218.892 240.375 158.132 1.00 165.56 ?  214  LEU A CD1 1 
ATOM   1280  C  CD2 . LEU A 1  214  ? 221.298 241.057 157.777 1.00 181.46 ?  214  LEU A CD2 1 
ATOM   1281  N  N   . HIS A 1  215  ? 219.521 237.552 155.325 1.00 212.75 ?  215  HIS A N   1 
ATOM   1282  C  CA  . HIS A 1  215  ? 219.564 236.161 155.808 1.00 178.65 ?  215  HIS A CA  1 
ATOM   1283  C  C   . HIS A 1  215  ? 219.026 235.186 154.768 1.00 164.55 ?  215  HIS A C   1 
ATOM   1284  O  O   . HIS A 1  215  ? 218.168 235.583 153.965 1.00 147.82 ?  215  HIS A O   1 
ATOM   1285  C  CB  . HIS A 1  215  ? 218.802 235.969 157.120 1.00 159.53 ?  215  HIS A CB  1 
ATOM   1286  C  CG  . HIS A 1  215  ? 219.049 234.631 157.744 1.00 164.94 ?  215  HIS A CG  1 
ATOM   1287  N  ND1 . HIS A 1  215  ? 220.268 234.282 158.289 1.00 173.30 ?  215  HIS A ND1 1 
ATOM   1288  C  CD2 . HIS A 1  215  ? 218.264 233.535 157.848 1.00 163.45 ?  215  HIS A CD2 1 
ATOM   1289  C  CE1 . HIS A 1  215  ? 220.211 233.037 158.730 1.00 173.67 ?  215  HIS A CE1 1 
ATOM   1290  N  NE2 . HIS A 1  215  ? 219.009 232.560 158.467 1.00 165.13 ?  215  HIS A NE2 1 
ATOM   1291  N  N   . PRO A 1  216  ? 219.530 233.919 154.775 1.00 153.84 ?  216  PRO A N   1 
ATOM   1292  C  CA  . PRO A 1  216  ? 219.034 232.844 153.903 1.00 163.88 ?  216  PRO A CA  1 
ATOM   1293  C  C   . PRO A 1  216  ? 217.633 232.269 154.165 1.00 144.23 ?  216  PRO A C   1 
ATOM   1294  O  O   . PRO A 1  216  ? 217.347 231.183 153.690 1.00 145.67 ?  216  PRO A O   1 
ATOM   1295  C  CB  . PRO A 1  216  ? 220.105 231.749 154.050 1.00 171.46 ?  216  PRO A CB  1 
ATOM   1296  C  CG  . PRO A 1  216  ? 220.735 232.030 155.365 1.00 167.25 ?  216  PRO A CG  1 
ATOM   1297  C  CD  . PRO A 1  216  ? 220.818 233.521 155.374 1.00 149.23 ?  216  PRO A CD  1 
ATOM   1298  N  N   . LEU A 1  217  ? 216.766 232.969 154.886 1.00 143.16 ?  217  LEU A N   1 
ATOM   1299  C  CA  . LEU A 1  217  ? 215.361 232.548 154.991 1.00 165.96 ?  217  LEU A CA  1 
ATOM   1300  C  C   . LEU A 1  217  ? 214.371 233.648 154.652 1.00 248.43 ?  217  LEU A C   1 
ATOM   1301  O  O   . LEU A 1  217  ? 213.202 233.369 154.359 1.00 280.77 ?  217  LEU A O   1 
ATOM   1302  C  CB  . LEU A 1  217  ? 215.064 232.016 156.371 1.00 141.79 ?  217  LEU A CB  1 
ATOM   1303  C  CG  . LEU A 1  217  ? 215.639 230.624 156.536 1.00 153.44 ?  217  LEU A CG  1 
ATOM   1304  C  CD1 . LEU A 1  217  ? 217.061 230.716 157.082 1.00 147.44 ?  217  LEU A CD1 1 
ATOM   1305  C  CD2 . LEU A 1  217  ? 214.766 229.761 157.439 1.00 155.79 ?  217  LEU A CD2 1 
ATOM   1306  N  N   . ASP A 1  218  ? 214.852 234.893 154.721 1.00 339.42 ?  218  ASP A N   1 
ATOM   1307  C  CA  . ASP A 1  218  ? 214.120 236.091 154.278 1.00 350.52 ?  218  ASP A CA  1 
ATOM   1308  C  C   . ASP A 1  218  ? 213.927 236.042 152.750 1.00 337.80 ?  218  ASP A C   1 
ATOM   1309  O  O   . ASP A 1  218  ? 214.826 235.565 152.035 1.00 402.78 ?  218  ASP A O   1 
ATOM   1310  C  CB  . ASP A 1  218  ? 214.886 237.374 154.685 1.00 347.23 ?  218  ASP A CB  1 
ATOM   1311  C  CG  . ASP A 1  218  ? 215.259 237.424 156.188 1.00 317.22 ?  218  ASP A CG  1 
ATOM   1312  O  OD1 . ASP A 1  218  ? 214.585 236.784 157.025 1.00 336.86 ?  218  ASP A OD1 1 
ATOM   1313  O  OD2 . ASP A 1  218  ? 216.232 238.130 156.535 1.00 256.31 -1 218  ASP A OD2 1 
ATOM   1314  N  N   . GLU A 1  219  ? 212.767 236.508 152.259 1.00 232.54 ?  219  GLU A N   1 
ATOM   1315  C  CA  . GLU A 1  219  ? 212.488 236.591 150.816 1.00 168.00 ?  219  GLU A CA  1 
ATOM   1316  C  C   . GLU A 1  219  ? 213.498 237.539 150.183 1.00 157.88 ?  219  GLU A C   1 
ATOM   1317  O  O   . GLU A 1  219  ? 213.609 238.691 150.620 1.00 149.75 ?  219  GLU A O   1 
ATOM   1318  C  CB  . GLU A 1  219  ? 211.063 237.085 150.566 1.00 164.39 ?  219  GLU A CB  1 
ATOM   1319  N  N   . ILE A 1  220  ? 214.251 237.045 149.192 1.00 157.47 ?  220  ILE A N   1 
ATOM   1320  C  CA  . ILE A 1  220  ? 215.419 237.783 148.647 1.00 187.94 ?  220  ILE A CA  1 
ATOM   1321  C  C   . ILE A 1  220  ? 214.946 238.994 147.842 1.00 209.72 ?  220  ILE A C   1 
ATOM   1322  O  O   . ILE A 1  220  ? 214.123 238.865 146.936 1.00 267.25 ?  220  ILE A O   1 
ATOM   1323  C  CB  . ILE A 1  220  ? 216.461 236.884 147.905 1.00 199.58 ?  220  ILE A CB  1 
ATOM   1324  C  CG1 . ILE A 1  220  ? 216.200 236.776 146.395 1.00 211.53 ?  220  ILE A CG1 1 
ATOM   1325  C  CG2 . ILE A 1  220  ? 216.505 235.490 148.516 1.00 224.74 ?  220  ILE A CG2 1 
ATOM   1326  C  CD1 . ILE A 1  220  ? 217.359 236.220 145.586 1.00 190.80 ?  220  ILE A CD1 1 
ATOM   1327  N  N   . THR A 1  221  ? 215.448 240.167 148.201 1.00 220.99 ?  221  THR A N   1 
ATOM   1328  C  CA  . THR A 1  221  ? 214.747 241.423 147.898 1.00 250.06 ?  221  THR A CA  1 
ATOM   1329  C  C   . THR A 1  221  ? 215.593 242.396 147.055 1.00 232.54 ?  221  THR A C   1 
ATOM   1330  O  O   . THR A 1  221  ? 216.729 242.062 146.729 1.00 196.10 ?  221  THR A O   1 
ATOM   1331  C  CB  . THR A 1  221  ? 214.200 242.055 149.200 1.00 283.65 ?  221  THR A CB  1 
ATOM   1332  O  OG1 . THR A 1  221  ? 214.945 241.570 150.327 1.00 316.52 ?  221  THR A OG1 1 
ATOM   1333  C  CG2 . THR A 1  221  ? 212.732 241.689 149.387 1.00 261.45 ?  221  THR A CG2 1 
ATOM   1334  N  N   . PRO A 1  222  ? 215.044 243.579 146.670 1.00 217.27 ?  222  PRO A N   1 
ATOM   1335  C  CA  . PRO A 1  222  ? 215.852 244.353 145.734 1.00 195.27 ?  222  PRO A CA  1 
ATOM   1336  C  C   . PRO A 1  222  ? 216.789 245.346 146.410 1.00 171.47 ?  222  PRO A C   1 
ATOM   1337  O  O   . PRO A 1  222  ? 216.733 245.509 147.636 1.00 135.19 ?  222  PRO A O   1 
ATOM   1338  C  CB  . PRO A 1  222  ? 214.796 245.096 144.919 1.00 201.57 ?  222  PRO A CB  1 
ATOM   1339  C  CG  . PRO A 1  222  ? 213.646 245.280 145.858 1.00 200.02 ?  222  PRO A CG  1 
ATOM   1340  C  CD  . PRO A 1  222  ? 213.763 244.260 146.956 1.00 187.45 ?  222  PRO A CD  1 
ATOM   1341  N  N   . LEU A 1  223  ? 217.636 245.991 145.602 1.00 177.68 ?  223  LEU A N   1 
ATOM   1342  C  CA  . LEU A 1  223  ? 218.394 247.169 146.029 1.00 237.41 ?  223  LEU A CA  1 
ATOM   1343  C  C   . LEU A 1  223  ? 217.828 248.476 145.446 1.00 279.50 ?  223  LEU A C   1 
ATOM   1344  O  O   . LEU A 1  223  ? 217.285 248.486 144.333 1.00 268.31 ?  223  LEU A O   1 
ATOM   1345  C  CB  . LEU A 1  223  ? 219.869 247.028 145.669 1.00 233.08 ?  223  LEU A CB  1 
ATOM   1346  C  CG  . LEU A 1  223  ? 220.891 247.435 146.728 1.00 270.32 ?  223  LEU A CG  1 
ATOM   1347  C  CD1 . LEU A 1  223  ? 221.099 246.300 147.720 1.00 300.92 ?  223  LEU A CD1 1 
ATOM   1348  C  CD2 . LEU A 1  223  ? 222.209 247.818 146.085 1.00 284.00 ?  223  LEU A CD2 1 
ATOM   1349  N  N   . VAL A 1  224  ? 217.968 249.560 146.221 1.00 312.61 ?  224  VAL A N   1 
ATOM   1350  C  CA  . VAL A 1  224  ? 217.452 250.910 145.888 1.00 276.49 ?  224  VAL A CA  1 
ATOM   1351  C  C   . VAL A 1  224  ? 218.525 252.010 145.966 1.00 342.63 ?  224  VAL A C   1 
ATOM   1352  O  O   . VAL A 1  224  ? 219.322 252.045 146.910 1.00 374.35 ?  224  VAL A O   1 
ATOM   1353  C  CB  . VAL A 1  224  ? 216.201 251.301 146.728 1.00 191.98 ?  224  VAL A CB  1 
ATOM   1354  C  CG1 . VAL A 1  224  ? 214.993 250.549 146.227 1.00 140.62 ?  224  VAL A CG1 1 
ATOM   1355  C  CG2 . VAL A 1  224  ? 216.391 251.073 148.231 1.00 172.18 ?  224  VAL A CG2 1 
ATOM   1356  N  N   . CYS A 1  225  ? 218.538 252.902 144.971 1.00 392.60 ?  225  CYS A N   1 
ATOM   1357  C  CA  . CYS A 1  225  ? 219.563 253.955 144.871 1.00 411.36 ?  225  CYS A CA  1 
ATOM   1358  C  C   . CYS A 1  225  ? 219.049 255.375 145.131 1.00 421.52 ?  225  CYS A C   1 
ATOM   1359  O  O   . CYS A 1  225  ? 217.910 255.705 144.779 1.00 441.55 ?  225  CYS A O   1 
ATOM   1360  C  CB  . CYS A 1  225  ? 220.307 253.880 143.531 1.00 410.09 ?  225  CYS A CB  1 
ATOM   1361  S  SG  . CYS A 1  225  ? 219.272 254.109 142.065 1.00 405.02 ?  225  CYS A SG  1 
ATOM   1362  N  N   . LYS A 1  226  ? 219.918 256.194 145.739 1.00 405.89 ?  226  LYS A N   1 
ATOM   1363  C  CA  . LYS A 1  226  ? 219.640 257.588 146.151 1.00 390.60 ?  226  LYS A CA  1 
ATOM   1364  C  C   . LYS A 1  226  ? 218.422 257.736 147.069 1.00 387.31 ?  226  LYS A C   1 
ATOM   1365  O  O   . LYS A 1  226  ? 218.443 258.510 148.028 1.00 383.16 ?  226  LYS A O   1 
ATOM   1366  C  CB  . LYS A 1  226  ? 219.528 258.533 144.942 1.00 383.85 ?  226  LYS A CB  1 
ATOM   1367  C  CG  . LYS A 1  226  ? 220.860 258.975 144.342 1.00 374.59 ?  226  LYS A CG  1 
ATOM   1368  C  CD  . LYS A 1  226  ? 220.650 259.813 143.088 1.00 370.87 ?  226  LYS A CD  1 
ATOM   1369  C  CE  . LYS A 1  226  ? 220.601 258.952 141.831 1.00 370.36 ?  226  LYS A CE  1 
ATOM   1370  N  NZ  . LYS A 1  226  ? 220.358 259.765 140.608 1.00 376.79 ?  226  LYS A NZ  1 
ATOM   1371  N  N   . VAL A 1  236  ? 214.086 257.038 146.711 1.00 338.28 ?  236  VAL A N   1 
ATOM   1372  C  CA  . VAL A 1  236  ? 214.888 255.849 146.438 1.00 298.67 ?  236  VAL A CA  1 
ATOM   1373  C  C   . VAL A 1  236  ? 214.151 254.857 145.517 1.00 269.06 ?  236  VAL A C   1 
ATOM   1374  O  O   . VAL A 1  236  ? 213.366 254.025 145.985 1.00 244.96 ?  236  VAL A O   1 
ATOM   1375  C  CB  . VAL A 1  236  ? 215.322 255.190 147.746 1.00 297.37 ?  236  VAL A CB  1 
ATOM   1376  N  N   . GLN A 1  237  ? 214.391 254.993 144.206 1.00 246.09 ?  237  GLN A N   1 
ATOM   1377  C  CA  . GLN A 1  237  ? 213.856 254.091 143.171 1.00 207.30 ?  237  GLN A CA  1 
ATOM   1378  C  C   . GLN A 1  237  ? 214.677 252.836 143.180 1.00 179.17 ?  237  GLN A C   1 
ATOM   1379  O  O   . GLN A 1  237  ? 215.841 252.872 143.565 1.00 173.12 ?  237  GLN A O   1 
ATOM   1380  C  CB  . GLN A 1  237  ? 213.951 254.719 141.767 1.00 216.71 ?  237  GLN A CB  1 
ATOM   1381  C  CG  . GLN A 1  237  ? 213.266 253.922 140.649 1.00 234.23 ?  237  GLN A CG  1 
ATOM   1382  C  CD  . GLN A 1  237  ? 213.588 254.410 139.238 1.00 265.35 ?  237  GLN A CD  1 
ATOM   1383  O  OE1 . GLN A 1  237  ? 213.885 255.586 139.019 1.00 311.95 ?  237  GLN A OE1 1 
ATOM   1384  N  NE2 . GLN A 1  237  ? 213.532 253.495 138.272 1.00 255.33 ?  237  GLN A NE2 1 
ATOM   1385  N  N   . TYR A 1  238  ? 214.063 251.737 142.743 1.00 176.18 ?  238  TYR A N   1 
ATOM   1386  C  CA  . TYR A 1  238  ? 214.755 250.480 142.498 1.00 171.06 ?  238  TYR A CA  1 
ATOM   1387  C  C   . TYR A 1  238  ? 215.787 250.639 141.383 1.00 165.95 ?  238  TYR A C   1 
ATOM   1388  O  O   . TYR A 1  238  ? 215.881 251.703 140.737 1.00 139.76 ?  238  TYR A O   1 
ATOM   1389  C  CB  . TYR A 1  238  ? 213.769 249.370 142.106 1.00 193.43 ?  238  TYR A CB  1 
ATOM   1390  C  CG  . TYR A 1  238  ? 212.586 249.142 143.024 1.00 227.42 ?  238  TYR A CG  1 
ATOM   1391  C  CD1 . TYR A 1  238  ? 212.738 249.093 144.418 1.00 230.67 ?  238  TYR A CD1 1 
ATOM   1392  C  CD2 . TYR A 1  238  ? 211.309 248.924 142.491 1.00 242.48 ?  238  TYR A CD2 1 
ATOM   1393  C  CE1 . TYR A 1  238  ? 211.655 248.866 145.252 1.00 227.94 ?  238  TYR A CE1 1 
ATOM   1394  C  CE2 . TYR A 1  238  ? 210.217 248.692 143.322 1.00 258.19 ?  238  TYR A CE2 1 
ATOM   1395  C  CZ  . TYR A 1  238  ? 210.396 248.665 144.702 1.00 246.01 ?  238  TYR A CZ  1 
ATOM   1396  O  OH  . TYR A 1  238  ? 209.322 248.422 145.531 1.00 253.89 ?  238  TYR A OH  1 
ATOM   1397  N  N   . VAL A 1  239  ? 216.563 249.569 141.184 1.00 174.69 ?  239  VAL A N   1 
ATOM   1398  C  CA  . VAL A 1  239  ? 217.558 249.446 140.102 1.00 177.72 ?  239  VAL A CA  1 
ATOM   1399  C  C   . VAL A 1  239  ? 216.774 249.158 138.808 1.00 172.65 ?  239  VAL A C   1 
ATOM   1400  O  O   . VAL A 1  239  ? 215.590 248.812 138.871 1.00 174.09 ?  239  VAL A O   1 
ATOM   1401  C  CB  . VAL A 1  239  ? 218.641 248.357 140.451 1.00 154.51 ?  239  VAL A CB  1 
ATOM   1402  C  CG1 . VAL A 1  239  ? 219.613 248.105 139.303 1.00 126.86 ?  239  VAL A CG1 1 
ATOM   1403  C  CG2 . VAL A 1  239  ? 219.431 248.739 141.714 1.00 136.53 ?  239  VAL A CG2 1 
ATOM   1404  N  N   . VAL A 1  240  ? 217.384 249.363 137.646 1.00 169.09 ?  240  VAL A N   1 
ATOM   1405  C  CA  . VAL A 1  240  ? 216.776 248.829 136.429 1.00 205.45 ?  240  VAL A CA  1 
ATOM   1406  C  C   . VAL A 1  240  ? 217.561 247.629 135.816 1.00 211.93 ?  240  VAL A C   1 
ATOM   1407  O  O   . VAL A 1  240  ? 217.108 246.506 136.012 1.00 241.62 ?  240  VAL A O   1 
ATOM   1408  C  CB  . VAL A 1  240  ? 216.099 249.893 135.492 1.00 238.99 ?  240  VAL A CB  1 
ATOM   1409  C  CG1 . VAL A 1  240  ? 216.644 251.298 135.734 1.00 247.03 ?  240  VAL A CG1 1 
ATOM   1410  C  CG2 . VAL A 1  240  ? 216.141 249.499 134.012 1.00 263.62 ?  240  VAL A CG2 1 
ATOM   1411  N  N   . ASP A 1  241  ? 218.718 247.760 135.151 1.00 194.14 ?  241  ASP A N   1 
ATOM   1412  C  CA  . ASP A 1  241  ? 219.560 248.912 134.788 1.00 177.74 ?  241  ASP A CA  1 
ATOM   1413  C  C   . ASP A 1  241  ? 220.920 248.231 134.517 1.00 218.45 ?  241  ASP A C   1 
ATOM   1414  O  O   . ASP A 1  241  ? 221.981 248.779 134.852 1.00 316.77 ?  241  ASP A O   1 
ATOM   1415  C  CB  . ASP A 1  241  ? 219.689 249.978 135.890 1.00 120.59 ?  241  ASP A CB  1 
ATOM   1416  N  N   . HIS A 1  242  ? 220.868 247.033 133.917 1.00 195.59 ?  242  HIS A N   1 
ATOM   1417  C  CA  . HIS A 1  242  ? 222.011 246.095 133.713 1.00 204.16 ?  242  HIS A CA  1 
ATOM   1418  C  C   . HIS A 1  242  ? 223.411 246.668 133.422 1.00 214.80 ?  242  HIS A C   1 
ATOM   1419  O  O   . HIS A 1  242  ? 224.415 246.088 133.848 1.00 230.30 ?  242  HIS A O   1 
ATOM   1420  C  CB  . HIS A 1  242  ? 221.660 245.033 132.661 1.00 228.42 ?  242  HIS A CB  1 
ATOM   1421  C  CG  . HIS A 1  242  ? 220.391 245.309 131.914 1.00 265.96 ?  242  HIS A CG  1 
ATOM   1422  N  ND1 . HIS A 1  242  ? 219.290 244.484 131.995 1.00 293.39 ?  242  HIS A ND1 1 
ATOM   1423  C  CD2 . HIS A 1  242  ? 220.042 246.323 131.086 1.00 278.67 ?  242  HIS A CD2 1 
ATOM   1424  C  CE1 . HIS A 1  242  ? 218.320 244.974 131.244 1.00 311.59 ?  242  HIS A CE1 1 
ATOM   1425  N  NE2 . HIS A 1  242  ? 218.750 246.091 130.683 1.00 306.33 ?  242  HIS A NE2 1 
ATOM   1426  N  N   . ALA A 1  243  ? 223.456 247.787 132.692 1.00 225.23 ?  243  ALA A N   1 
ATOM   1427  C  CA  . ALA A 1  243  ? 224.680 248.572 132.430 1.00 192.71 ?  243  ALA A CA  1 
ATOM   1428  C  C   . ALA A 1  243  ? 225.550 248.779 133.655 1.00 187.93 ?  243  ALA A C   1 
ATOM   1429  O  O   . ALA A 1  243  ? 226.751 248.633 133.546 1.00 226.81 ?  243  ALA A O   1 
ATOM   1430  C  CB  . ALA A 1  243  ? 224.342 249.919 131.807 1.00 196.31 ?  243  ALA A CB  1 
ATOM   1431  N  N   . MET A 1  244  ? 224.951 249.099 134.806 1.00 185.28 ?  244  MET A N   1 
ATOM   1432  C  CA  . MET A 1  244  ? 225.691 249.254 136.078 1.00 205.30 ?  244  MET A CA  1 
ATOM   1433  C  C   . MET A 1  244  ? 225.991 247.905 136.722 1.00 197.79 ?  244  MET A C   1 
ATOM   1434  O  O   . MET A 1  244  ? 225.078 247.154 137.074 1.00 183.76 ?  244  MET A O   1 
ATOM   1435  C  CB  . MET A 1  244  ? 224.967 250.166 137.080 1.00 228.94 ?  244  MET A CB  1 
ATOM   1436  C  CG  . MET A 1  244  ? 223.998 251.184 136.486 1.00 261.50 ?  244  MET A CG  1 
ATOM   1437  S  SD  . MET A 1  244  ? 224.556 252.012 134.983 1.00 250.65 ?  244  MET A SD  1 
ATOM   1438  C  CE  . MET A 1  244  ? 222.990 252.571 134.305 1.00 275.18 ?  244  MET A CE  1 
ATOM   1439  N  N   . LYS A 1  245  ? 227.288 247.632 136.856 1.00 201.28 ?  245  LYS A N   1 
ATOM   1440  C  CA  . LYS A 1  245  ? 227.840 246.349 137.272 1.00 210.91 ?  245  LYS A CA  1 
ATOM   1441  C  C   . LYS A 1  245  ? 228.636 246.579 138.535 1.00 230.06 ?  245  LYS A C   1 
ATOM   1442  O  O   . LYS A 1  245  ? 229.486 247.463 138.574 1.00 254.62 ?  245  LYS A O   1 
ATOM   1443  C  CB  . LYS A 1  245  ? 228.803 245.807 136.209 1.00 200.48 ?  245  LYS A CB  1 
ATOM   1444  C  CG  . LYS A 1  245  ? 228.180 245.167 134.974 1.00 231.21 ?  245  LYS A CG  1 
ATOM   1445  C  CD  . LYS A 1  245  ? 227.922 243.667 135.126 1.00 260.93 ?  245  LYS A CD  1 
ATOM   1446  C  CE  . LYS A 1  245  ? 229.170 242.788 135.045 1.00 270.19 ?  245  LYS A CE  1 
ATOM   1447  N  NZ  . LYS A 1  245  ? 229.563 242.454 133.645 1.00 268.03 ?  245  LYS A NZ  1 
ATOM   1448  N  N   . ILE A 1  246  ? 228.369 245.776 139.556 1.00 232.92 ?  246  ILE A N   1 
ATOM   1449  C  CA  . ILE A 1  246  ? 229.091 245.854 140.829 1.00 206.41 ?  246  ILE A CA  1 
ATOM   1450  C  C   . ILE A 1  246  ? 230.442 245.119 140.736 1.00 186.75 ?  246  ILE A C   1 
ATOM   1451  O  O   . ILE A 1  246  ? 230.503 243.889 140.782 1.00 164.07 ?  246  ILE A O   1 
ATOM   1452  C  CB  . ILE A 1  246  ? 228.181 245.427 142.021 1.00 200.79 ?  246  ILE A CB  1 
ATOM   1453  C  CG1 . ILE A 1  246  ? 228.952 245.382 143.344 1.00 179.74 ?  246  ILE A CG1 1 
ATOM   1454  C  CG2 . ILE A 1  246  ? 227.388 244.150 141.712 1.00 202.31 ?  246  ILE A CG2 1 
ATOM   1455  C  CD1 . ILE A 1  246  ? 228.042 245.558 144.536 1.00 205.95 ?  246  ILE A CD1 1 
ATOM   1456  N  N   . VAL A 1  247  ? 231.510 245.895 140.548 1.00 185.03 ?  247  VAL A N   1 
ATOM   1457  C  CA  . VAL A 1  247  ? 232.874 245.352 140.460 1.00 199.94 ?  247  VAL A CA  1 
ATOM   1458  C  C   . VAL A 1  247  ? 233.507 245.210 141.856 1.00 244.87 ?  247  VAL A C   1 
ATOM   1459  O  O   . VAL A 1  247  ? 234.495 244.481 142.010 1.00 306.90 ?  247  VAL A O   1 
ATOM   1460  C  CB  . VAL A 1  247  ? 233.780 246.141 139.452 1.00 172.83 ?  247  VAL A CB  1 
ATOM   1461  C  CG1 . VAL A 1  247  ? 234.180 247.501 139.993 1.00 171.12 ?  247  VAL A CG1 1 
ATOM   1462  C  CG2 . VAL A 1  247  ? 235.024 245.351 139.044 1.00 130.49 ?  247  VAL A CG2 1 
ATOM   1463  N  N   . PHE A 1  248  ? 232.927 245.869 142.870 1.00 244.44 ?  248  PHE A N   1 
ATOM   1464  C  CA  . PHE A 1  248  ? 233.517 245.856 144.226 1.00 207.13 ?  248  PHE A CA  1 
ATOM   1465  C  C   . PHE A 1  248  ? 232.618 245.985 145.467 1.00 216.36 ?  248  PHE A C   1 
ATOM   1466  O  O   . PHE A 1  248  ? 231.817 246.917 145.556 1.00 182.00 ?  248  PHE A O   1 
ATOM   1467  C  CB  . PHE A 1  248  ? 234.598 246.919 144.318 1.00 148.08 ?  248  PHE A CB  1 
ATOM   1468  C  CG  . PHE A 1  248  ? 235.085 247.130 145.675 1.00 133.41 ?  248  PHE A CG  1 
ATOM   1469  C  CD1 . PHE A 1  248  ? 235.995 246.224 146.249 1.00 153.17 ?  248  PHE A CD1 1 
ATOM   1470  C  CD2 . PHE A 1  248  ? 234.593 248.177 146.424 1.00 134.27 ?  248  PHE A CD2 1 
ATOM   1471  C  CE1 . PHE A 1  248  ? 236.451 246.388 147.559 1.00 173.37 ?  248  PHE A CE1 1 
ATOM   1472  C  CE2 . PHE A 1  248  ? 235.049 248.356 147.729 1.00 176.31 ?  248  PHE A CE2 1 
ATOM   1473  C  CZ  . PHE A 1  248  ? 235.987 247.472 148.295 1.00 183.31 ?  248  PHE A CZ  1 
ATOM   1474  N  N   . LEU A 1  249  ? 232.867 245.093 146.445 1.00 263.04 ?  249  LEU A N   1 
ATOM   1475  C  CA  . LEU A 1  249  ? 232.259 245.096 147.804 1.00 285.90 ?  249  LEU A CA  1 
ATOM   1476  C  C   . LEU A 1  249  ? 233.276 245.032 148.989 1.00 286.22 ?  249  LEU A C   1 
ATOM   1477  O  O   . LEU A 1  249  ? 234.313 244.355 148.900 1.00 288.50 ?  249  LEU A O   1 
ATOM   1478  C  CB  . LEU A 1  249  ? 231.240 243.945 147.944 1.00 243.20 ?  249  LEU A CB  1 
ATOM   1479  C  CG  . LEU A 1  249  ? 229.849 244.144 148.585 1.00 213.41 ?  249  LEU A CG  1 
ATOM   1480  C  CD1 . LEU A 1  249  ? 229.782 245.107 149.769 1.00 201.31 ?  249  LEU A CD1 1 
ATOM   1481  C  CD2 . LEU A 1  249  ? 228.857 244.606 147.544 1.00 208.74 ?  249  LEU A CD2 1 
ATOM   1482  N  N   . ASN A 1  250  ? 232.943 245.721 150.089 1.00 230.72 ?  250  ASN A N   1 
ATOM   1483  C  CA  . ASN A 1  250  ? 233.790 245.820 151.278 1.00 168.02 ?  250  ASN A CA  1 
ATOM   1484  C  C   . ASN A 1  250  ? 233.025 245.735 152.578 1.00 179.19 ?  250  ASN A C   1 
ATOM   1485  O  O   . ASN A 1  250  ? 232.005 246.408 152.790 1.00 154.14 ?  250  ASN A O   1 
ATOM   1486  C  CB  . ASN A 1  250  ? 234.562 247.128 151.284 1.00 149.64 ?  250  ASN A CB  1 
ATOM   1487  C  CG  . ASN A 1  250  ? 235.891 247.037 152.006 1.00 167.67 ?  250  ASN A CG  1 
ATOM   1488  O  OD1 . ASN A 1  250  ? 236.722 247.919 151.860 1.00 216.10 ?  250  ASN A OD1 1 
ATOM   1489  N  ND2 . ASN A 1  250  ? 236.107 245.985 152.774 1.00 187.27 ?  250  ASN A ND2 1 
ATOM   1490  N  N   . THR A 1  251  ? 233.585 244.908 153.452 1.00 229.22 ?  251  THR A N   1 
ATOM   1491  C  CA  . THR A 1  251  ? 233.100 244.663 154.803 1.00 259.63 ?  251  THR A CA  1 
ATOM   1492  C  C   . THR A 1  251  ? 233.455 245.788 155.804 1.00 278.48 ?  251  THR A C   1 
ATOM   1493  O  O   . THR A 1  251  ? 232.600 246.187 156.607 1.00 268.06 ?  251  THR A O   1 
ATOM   1494  C  CB  . THR A 1  251  ? 233.565 243.266 155.312 1.00 257.44 ?  251  THR A CB  1 
ATOM   1495  O  OG1 . THR A 1  251  ? 234.959 243.071 155.034 1.00 237.05 ?  251  THR A OG1 1 
ATOM   1496  C  CG2 . THR A 1  251  ? 232.772 242.138 154.626 1.00 247.45 ?  251  THR A CG2 1 
ATOM   1497  N  N   . ASP A 1  252  ? 234.695 246.301 155.720 1.00 293.29 ?  252  ASP A N   1 
ATOM   1498  C  CA  . ASP A 1  252  ? 235.270 247.316 156.647 1.00 275.30 ?  252  ASP A CA  1 
ATOM   1499  C  C   . ASP A 1  252  ? 234.543 248.692 156.654 1.00 241.78 ?  252  ASP A C   1 
ATOM   1500  O  O   . ASP A 1  252  ? 233.888 249.020 157.660 1.00 212.69 ?  252  ASP A O   1 
ATOM   1501  C  CB  . ASP A 1  252  ? 236.799 247.453 156.432 1.00 282.66 ?  252  ASP A CB  1 
ATOM   1502  C  CG  . ASP A 1  252  ? 237.626 246.933 157.607 1.00 292.16 ?  252  ASP A CG  1 
ATOM   1503  O  OD1 . ASP A 1  252  ? 237.369 245.815 158.112 1.00 299.32 ?  252  ASP A OD1 1 
ATOM   1504  O  OD2 . ASP A 1  252  ? 238.563 247.653 158.015 1.00 275.07 -1 252  ASP A OD2 1 
ATOM   1505  N  N   . PRO A 1  253  ? 234.690 249.511 155.575 1.00 212.81 ?  253  PRO A N   1 
ATOM   1506  C  CA  . PRO A 1  253  ? 233.646 250.507 155.301 1.00 203.11 ?  253  PRO A CA  1 
ATOM   1507  C  C   . PRO A 1  253  ? 232.721 250.031 154.175 1.00 209.85 ?  253  PRO A C   1 
ATOM   1508  O  O   . PRO A 1  253  ? 233.184 249.500 153.159 1.00 217.90 ?  253  PRO A O   1 
ATOM   1509  C  CB  . PRO A 1  253  ? 234.430 251.749 154.866 1.00 184.41 ?  253  PRO A CB  1 
ATOM   1510  C  CG  . PRO A 1  253  ? 235.832 251.292 154.621 1.00 191.04 ?  253  PRO A CG  1 
ATOM   1511  C  CD  . PRO A 1  253  ? 235.904 249.805 154.791 1.00 186.74 ?  253  PRO A CD  1 
ATOM   1512  N  N   . SER A 1  254  ? 231.420 250.199 154.375 1.00 202.13 ?  254  SER A N   1 
ATOM   1513  C  CA  . SER A 1  254  ? 230.432 249.724 153.424 1.00 200.87 ?  254  SER A CA  1 
ATOM   1514  C  C   . SER A 1  254  ? 230.548 250.518 152.134 1.00 188.20 ?  254  SER A C   1 
ATOM   1515  O  O   . SER A 1  254  ? 230.281 251.706 152.121 1.00 210.61 ?  254  SER A O   1 
ATOM   1516  C  CB  . SER A 1  254  ? 229.043 249.874 154.021 1.00 242.85 ?  254  SER A CB  1 
ATOM   1517  O  OG  . SER A 1  254  ? 228.065 249.682 153.027 1.00 321.94 ?  254  SER A OG  1 
ATOM   1518  N  N   . ILE A 1  255  ? 230.969 249.859 151.061 1.00 173.86 ?  255  ILE A N   1 
ATOM   1519  C  CA  . ILE A 1  255  ? 231.285 250.524 149.797 1.00 183.34 ?  255  ILE A CA  1 
ATOM   1520  C  C   . ILE A 1  255  ? 230.720 249.680 148.658 1.00 233.71 ?  255  ILE A C   1 
ATOM   1521  O  O   . ILE A 1  255  ? 230.650 248.454 148.779 1.00 282.96 ?  255  ILE A O   1 
ATOM   1522  C  CB  . ILE A 1  255  ? 232.822 250.674 149.615 1.00 172.13 ?  255  ILE A CB  1 
ATOM   1523  C  CG1 . ILE A 1  255  ? 233.438 251.525 150.739 1.00 177.43 ?  255  ILE A CG1 1 
ATOM   1524  C  CG2 . ILE A 1  255  ? 233.166 251.292 148.261 1.00 173.42 ?  255  ILE A CG2 1 
ATOM   1525  C  CD1 . ILE A 1  255  ? 234.924 251.329 150.979 1.00 155.93 ?  255  ILE A CD1 1 
ATOM   1526  N  N   . VAL A 1  256  ? 230.300 250.339 147.573 1.00 305.55 ?  256  VAL A N   1 
ATOM   1527  C  CA  . VAL A 1  256  ? 229.987 249.680 146.275 1.00 341.20 ?  256  VAL A CA  1 
ATOM   1528  C  C   . VAL A 1  256  ? 230.847 250.289 145.142 1.00 366.47 ?  256  VAL A C   1 
ATOM   1529  O  O   . VAL A 1  256  ? 231.239 251.468 145.203 1.00 375.71 ?  256  VAL A O   1 
ATOM   1530  C  CB  . VAL A 1  256  ? 228.445 249.660 145.951 1.00 314.31 ?  256  VAL A CB  1 
ATOM   1531  C  CG1 . VAL A 1  256  ? 228.124 249.260 144.504 1.00 239.05 ?  256  VAL A CG1 1 
ATOM   1532  C  CG2 . VAL A 1  256  ? 227.712 248.713 146.884 1.00 277.30 ?  256  VAL A CG2 1 
ATOM   1533  N  N   . MET A 1  257  ? 231.150 249.473 144.130 1.00 341.18 ?  257  MET A N   1 
ATOM   1534  C  CA  . MET A 1  257  ? 231.933 249.919 142.984 1.00 285.43 ?  257  MET A CA  1 
ATOM   1535  C  C   . MET A 1  257  ? 231.322 249.559 141.619 1.00 281.80 ?  257  MET A C   1 
ATOM   1536  O  O   . MET A 1  257  ? 231.464 248.419 141.162 1.00 216.30 ?  257  MET A O   1 
ATOM   1537  C  CB  . MET A 1  257  ? 233.335 249.350 143.103 1.00 222.90 ?  257  MET A CB  1 
ATOM   1538  C  CG  . MET A 1  257  ? 234.381 250.185 142.446 1.00 211.68 ?  257  MET A CG  1 
ATOM   1539  S  SD  . MET A 1  257  ? 234.570 251.660 143.421 1.00 192.28 ?  257  MET A SD  1 
ATOM   1540  C  CE  . MET A 1  257  ? 234.989 252.755 142.061 1.00 248.63 ?  257  MET A CE  1 
ATOM   1541  N  N   . THR A 1  258  ? 230.658 250.524 140.967 1.00 307.30 ?  258  THR A N   1 
ATOM   1542  C  CA  . THR A 1  258  ? 230.027 250.258 139.653 1.00 270.12 ?  258  THR A CA  1 
ATOM   1543  C  C   . THR A 1  258  ? 230.845 250.631 138.444 1.00 257.01 ?  258  THR A C   1 
ATOM   1544  O  O   . THR A 1  258  ? 231.709 251.516 138.493 1.00 278.81 ?  258  THR A O   1 
ATOM   1545  C  CB  . THR A 1  258  ? 228.560 250.775 139.458 1.00 263.77 ?  258  THR A CB  1 
ATOM   1546  O  OG1 . THR A 1  258  ? 228.505 252.215 139.345 1.00 210.07 ?  258  THR A OG1 1 
ATOM   1547  C  CG2 . THR A 1  258  ? 227.618 250.244 140.547 1.00 276.08 ?  258  THR A CG2 1 
ATOM   1548  N  N   . TYR A 1  259  ? 230.541 249.919 137.367 1.00 255.40 ?  259  TYR A N   1 
ATOM   1549  C  CA  . TYR A 1  259  ? 230.943 250.259 136.027 1.00 272.92 ?  259  TYR A CA  1 
ATOM   1550  C  C   . TYR A 1  259  ? 229.657 250.543 135.267 1.00 224.56 ?  259  TYR A C   1 
ATOM   1551  O  O   . TYR A 1  259  ? 228.880 249.636 135.037 1.00 216.71 ?  259  TYR A O   1 
ATOM   1552  C  CB  . TYR A 1  259  ? 231.697 249.070 135.403 1.00 296.41 ?  259  TYR A CB  1 
ATOM   1553  C  CG  . TYR A 1  259  ? 232.345 249.334 134.052 1.00 312.38 ?  259  TYR A CG  1 
ATOM   1554  C  CD1 . TYR A 1  259  ? 233.437 250.211 133.933 1.00 327.35 ?  259  TYR A CD1 1 
ATOM   1555  C  CD2 . TYR A 1  259  ? 231.887 248.684 132.894 1.00 280.96 ?  259  TYR A CD2 1 
ATOM   1556  C  CE1 . TYR A 1  259  ? 234.031 250.447 132.699 1.00 294.23 ?  259  TYR A CE1 1 
ATOM   1557  C  CE2 . TYR A 1  259  ? 232.483 248.914 131.657 1.00 264.82 ?  259  TYR A CE2 1 
ATOM   1558  C  CZ  . TYR A 1  259  ? 233.547 249.793 131.566 1.00 265.44 ?  259  TYR A CZ  1 
ATOM   1559  O  OH  . TYR A 1  259  ? 234.125 250.024 130.346 1.00 226.00 ?  259  TYR A OH  1 
ATOM   1560  N  N   . ASP A 1  260  ? 229.408 251.804 134.927 1.00 196.21 ?  260  ASP A N   1 
ATOM   1561  C  CA  . ASP A 1  260  ? 228.389 252.126 133.943 1.00 250.46 ?  260  ASP A CA  1 
ATOM   1562  C  C   . ASP A 1  260  ? 228.943 251.916 132.518 1.00 271.15 ?  260  ASP A C   1 
ATOM   1563  O  O   . ASP A 1  260  ? 229.975 252.500 132.147 1.00 321.94 ?  260  ASP A O   1 
ATOM   1564  C  CB  . ASP A 1  260  ? 227.845 253.548 134.170 1.00 313.48 ?  260  ASP A CB  1 
ATOM   1565  C  CG  . ASP A 1  260  ? 227.160 254.147 132.925 1.00 392.02 ?  260  ASP A CG  1 
ATOM   1566  O  OD1 . ASP A 1  260  ? 226.447 253.419 132.197 1.00 442.58 ?  260  ASP A OD1 1 
ATOM   1567  O  OD2 . ASP A 1  260  ? 227.329 255.363 132.683 1.00 420.27 -1 260  ASP A OD2 1 
ATOM   1568  N  N   . ALA A 1  261  ? 228.235 251.090 131.739 1.00 250.99 ?  261  ALA A N   1 
ATOM   1569  C  CA  . ALA A 1  261  ? 228.603 250.749 130.359 1.00 265.49 ?  261  ALA A CA  1 
ATOM   1570  C  C   . ALA A 1  261  ? 228.518 251.911 129.357 1.00 320.89 ?  261  ALA A C   1 
ATOM   1571  O  O   . ALA A 1  261  ? 229.349 251.985 128.446 1.00 349.32 ?  261  ALA A O   1 
ATOM   1572  C  CB  . ALA A 1  261  ? 227.787 249.567 129.862 1.00 215.06 ?  261  ALA A CB  1 
ATOM   1573  N  N   . VAL A 1  262  ? 227.535 252.806 129.522 1.00 381.46 ?  262  VAL A N   1 
ATOM   1574  C  CA  . VAL A 1  262  ? 227.293 253.894 128.536 1.00 400.49 ?  262  VAL A CA  1 
ATOM   1575  C  C   . VAL A 1  262  ? 228.358 255.008 128.517 1.00 415.95 ?  262  VAL A C   1 
ATOM   1576  O  O   . VAL A 1  262  ? 228.678 255.528 127.444 1.00 415.43 ?  262  VAL A O   1 
ATOM   1577  C  CB  . VAL A 1  262  ? 225.830 254.450 128.524 1.00 395.19 ?  262  VAL A CB  1 
ATOM   1578  C  CG1 . VAL A 1  262  ? 224.830 253.353 128.171 1.00 384.87 ?  262  VAL A CG1 1 
ATOM   1579  C  CG2 . VAL A 1  262  ? 225.450 255.134 129.830 1.00 389.08 ?  262  VAL A CG2 1 
ATOM   1580  N  N   . GLN A 1  263  ? 228.883 255.376 129.690 1.00 421.08 ?  263  GLN A N   1 
ATOM   1581  C  CA  . GLN A 1  263  ? 230.097 256.210 129.781 1.00 403.95 ?  263  GLN A CA  1 
ATOM   1582  C  C   . GLN A 1  263  ? 231.301 255.321 130.148 1.00 405.36 ?  263  GLN A C   1 
ATOM   1583  O  O   . GLN A 1  263  ? 231.238 254.100 129.938 1.00 416.50 ?  263  GLN A O   1 
ATOM   1584  C  CB  . GLN A 1  263  ? 229.930 257.383 130.763 1.00 392.31 ?  263  GLN A CB  1 
ATOM   1585  C  CG  . GLN A 1  263  ? 228.916 258.444 130.359 1.00 385.31 ?  263  GLN A CG  1 
ATOM   1586  C  CD  . GLN A 1  263  ? 227.595 258.312 131.096 1.00 380.73 ?  263  GLN A CD  1 
ATOM   1587  O  OE1 . GLN A 1  263  ? 227.553 258.282 132.329 1.00 374.77 ?  263  GLN A OE1 1 
ATOM   1588  N  NE2 . GLN A 1  263  ? 226.507 258.257 130.343 1.00 379.67 ?  263  GLN A NE2 1 
ATOM   1589  N  N   . ASN A 1  264  ? 232.378 255.925 130.671 1.00 403.14 ?  264  ASN A N   1 
ATOM   1590  C  CA  . ASN A 1  264  ? 233.614 255.203 131.045 1.00 399.14 ?  264  ASN A CA  1 
ATOM   1591  C  C   . ASN A 1  264  ? 233.420 253.954 131.954 1.00 395.55 ?  264  ASN A C   1 
ATOM   1592  O  O   . ASN A 1  264  ? 233.571 252.862 131.413 1.00 396.33 ?  264  ASN A O   1 
ATOM   1593  C  CB  . ASN A 1  264  ? 234.733 256.150 131.520 1.00 401.26 ?  264  ASN A CB  1 
ATOM   1594  N  N   . VAL A 1  265  ? 233.085 254.026 133.263 1.00 400.48 ?  265  VAL A N   1 
ATOM   1595  C  CA  . VAL A 1  265  ? 233.002 255.191 134.207 1.00 418.32 ?  265  VAL A CA  1 
ATOM   1596  C  C   . VAL A 1  265  ? 232.775 254.671 135.652 1.00 441.09 ?  265  VAL A C   1 
ATOM   1597  O  O   . VAL A 1  265  ? 231.697 254.153 135.975 1.00 470.02 ?  265  VAL A O   1 
ATOM   1598  C  CB  . VAL A 1  265  ? 231.942 256.280 133.816 1.00 413.91 ?  265  VAL A CB  1 
ATOM   1599  C  CG1 . VAL A 1  265  ? 230.529 255.716 133.725 1.00 419.68 ?  265  VAL A CG1 1 
ATOM   1600  C  CG2 . VAL A 1  265  ? 232.004 257.485 134.753 1.00 399.46 ?  265  VAL A CG2 1 
ATOM   1601  N  N   . HIS A 1  266  ? 233.786 254.800 136.516 1.00 444.93 ?  266  HIS A N   1 
ATOM   1602  C  CA  . HIS A 1  266  ? 233.709 254.232 137.881 1.00 441.30 ?  266  HIS A CA  1 
ATOM   1603  C  C   . HIS A 1  266  ? 232.918 255.087 138.876 1.00 445.55 ?  266  HIS A C   1 
ATOM   1604  O  O   . HIS A 1  266  ? 233.025 256.321 138.859 1.00 444.66 ?  266  HIS A O   1 
ATOM   1605  C  CB  . HIS A 1  266  ? 235.101 253.901 138.444 1.00 415.89 ?  266  HIS A CB  1 
ATOM   1606  C  CG  . HIS A 1  266  ? 235.842 252.848 137.673 1.00 392.43 ?  266  HIS A CG  1 
ATOM   1607  N  ND1 . HIS A 1  266  ? 235.211 251.815 137.010 1.00 374.77 ?  266  HIS A ND1 1 
ATOM   1608  C  CD2 . HIS A 1  266  ? 237.170 252.657 137.486 1.00 387.35 ?  266  HIS A CD2 1 
ATOM   1609  C  CE1 . HIS A 1  266  ? 236.115 251.050 136.427 1.00 370.84 ?  266  HIS A CE1 1 
ATOM   1610  N  NE2 . HIS A 1  266  ? 237.312 251.533 136.708 1.00 375.00 ?  266  HIS A NE2 1 
ATOM   1611  N  N   . SER A 1  267  ? 232.143 254.423 139.743 1.00 445.32 ?  267  SER A N   1 
ATOM   1612  C  CA  . SER A 1  267  ? 231.280 255.098 140.737 1.00 429.89 ?  267  SER A CA  1 
ATOM   1613  C  C   . SER A 1  267  ? 231.353 254.459 142.139 1.00 444.52 ?  267  SER A C   1 
ATOM   1614  O  O   . SER A 1  267  ? 231.210 253.231 142.274 1.00 485.89 ?  267  SER A O   1 
ATOM   1615  C  CB  . SER A 1  267  ? 229.816 255.130 140.261 1.00 401.43 ?  267  SER A CB  1 
ATOM   1616  O  OG  . SER A 1  267  ? 229.699 255.308 138.858 1.00 395.42 ?  267  SER A OG  1 
ATOM   1617  N  N   . VAL A 1  268  ? 231.570 255.294 143.167 1.00 444.44 ?  268  VAL A N   1 
ATOM   1618  C  CA  . VAL A 1  268  ? 231.587 254.843 144.580 1.00 429.52 ?  268  VAL A CA  1 
ATOM   1619  C  C   . VAL A 1  268  ? 230.263 255.164 145.286 1.00 443.30 ?  268  VAL A C   1 
ATOM   1620  O  O   . VAL A 1  268  ? 229.808 256.321 145.291 1.00 478.87 ?  268  VAL A O   1 
ATOM   1621  C  CB  . VAL A 1  268  ? 232.769 255.430 145.410 1.00 408.98 ?  268  VAL A CB  1 
ATOM   1622  C  CG1 . VAL A 1  268  ? 232.765 254.890 146.835 1.00 354.37 ?  268  VAL A CG1 1 
ATOM   1623  C  CG2 . VAL A 1  268  ? 234.113 255.111 144.782 1.00 420.76 ?  268  VAL A CG2 1 
ATOM   1624  N  N   . TRP A 1  269  ? 229.680 254.112 145.878 1.00 410.24 ?  269  TRP A N   1 
ATOM   1625  C  CA  . TRP A 1  269  ? 228.453 254.157 146.692 1.00 350.86 ?  269  TRP A CA  1 
ATOM   1626  C  C   . TRP A 1  269  ? 228.711 253.472 148.068 1.00 287.51 ?  269  TRP A C   1 
ATOM   1627  O  O   . TRP A 1  269  ? 229.821 252.999 148.350 1.00 211.80 ?  269  TRP A O   1 
ATOM   1628  C  CB  . TRP A 1  269  ? 227.244 253.499 145.962 1.00 350.94 ?  269  TRP A CB  1 
ATOM   1629  C  CG  . TRP A 1  269  ? 227.181 253.585 144.411 1.00 351.99 ?  269  TRP A CG  1 
ATOM   1630  C  CD1 . TRP A 1  269  ? 228.146 253.184 143.525 1.00 340.09 ?  269  TRP A CD1 1 
ATOM   1631  C  CD2 . TRP A 1  269  ? 226.070 254.028 143.603 1.00 369.14 ?  269  TRP A CD2 1 
ATOM   1632  N  NE1 . TRP A 1  269  ? 227.730 253.387 142.232 1.00 350.67 ?  269  TRP A NE1 1 
ATOM   1633  C  CE2 . TRP A 1  269  ? 226.463 253.903 142.245 1.00 373.85 ?  269  TRP A CE2 1 
ATOM   1634  C  CE3 . TRP A 1  269  ? 224.795 254.548 143.893 1.00 380.59 ?  269  TRP A CE3 1 
ATOM   1635  C  CZ2 . TRP A 1  269  ? 225.624 254.267 141.177 1.00 386.68 ?  269  TRP A CZ2 1 
ATOM   1636  C  CZ3 . TRP A 1  269  ? 223.956 254.912 142.828 1.00 386.20 ?  269  TRP A CZ3 1 
ATOM   1637  C  CH2 . TRP A 1  269  ? 224.380 254.768 141.487 1.00 391.01 ?  269  TRP A CH2 1 
ATOM   1638  N  N   . THR A 1  270  ? 227.694 253.457 148.930 1.00 256.34 ?  270  THR A N   1 
ATOM   1639  C  CA  . THR A 1  270  ? 227.756 252.766 150.219 1.00 261.09 ?  270  THR A CA  1 
ATOM   1640  C  C   . THR A 1  270  ? 226.411 252.085 150.465 1.00 317.79 ?  270  THR A C   1 
ATOM   1641  O  O   . THR A 1  270  ? 225.363 252.717 150.260 1.00 365.11 ?  270  THR A O   1 
ATOM   1642  C  CB  . THR A 1  270  ? 228.072 253.719 151.418 1.00 243.46 ?  270  THR A CB  1 
ATOM   1643  O  OG1 . THR A 1  270  ? 226.907 254.460 151.800 1.00 239.24 ?  270  THR A OG1 1 
ATOM   1644  C  CG2 . THR A 1  270  ? 229.235 254.698 151.124 1.00 254.13 ?  270  THR A CG2 1 
ATOM   1645  N  N   . LEU A 1  271  ? 226.433 250.812 150.885 1.00 367.20 ?  271  LEU A N   1 
ATOM   1646  C  CA  . LEU A 1  271  ? 225.222 250.129 151.393 1.00 358.68 ?  271  LEU A CA  1 
ATOM   1647  C  C   . LEU A 1  271  ? 224.804 250.688 152.755 1.00 312.43 ?  271  LEU A C   1 
ATOM   1648  O  O   . LEU A 1  271  ? 225.649 251.035 153.591 1.00 347.38 ?  271  LEU A O   1 
ATOM   1649  C  CB  . LEU A 1  271  ? 225.416 248.608 151.542 1.00 383.52 ?  271  LEU A CB  1 
ATOM   1650  C  CG  . LEU A 1  271  ? 225.277 247.522 150.462 1.00 370.35 ?  271  LEU A CG  1 
ATOM   1651  C  CD1 . LEU A 1  271  ? 224.101 247.712 149.507 1.00 366.37 ?  271  LEU A CD1 1 
ATOM   1652  C  CD2 . LEU A 1  271  ? 226.577 247.325 149.710 1.00 347.20 ?  271  LEU A CD2 1 
ATOM   1653  N  N   . ARG A 1  272  ? 223.497 250.760 152.968 1.00 215.48 ?  272  ARG A N   1 
ATOM   1654  C  CA  . ARG A 1  272  ? 222.937 251.206 154.224 1.00 180.68 ?  272  ARG A CA  1 
ATOM   1655  C  C   . ARG A 1  272  ? 221.755 250.328 154.457 1.00 145.01 ?  272  ARG A C   1 
ATOM   1656  O  O   . ARG A 1  272  ? 221.407 249.526 153.591 1.00 108.24 ?  272  ARG A O   1 
ATOM   1657  C  CB  . ARG A 1  272  ? 222.451 252.651 154.132 1.00 239.99 ?  272  ARG A CB  1 
ATOM   1658  C  CG  . ARG A 1  272  ? 223.513 253.744 154.158 1.00 287.98 ?  272  ARG A CG  1 
ATOM   1659  C  CD  . ARG A 1  272  ? 222.882 255.133 154.290 1.00 313.77 ?  272  ARG A CD  1 
ATOM   1660  N  NE  . ARG A 1  272  ? 221.994 255.484 153.172 1.00 347.55 ?  272  ARG A NE  1 
ATOM   1661  C  CZ  . ARG A 1  272  ? 220.659 255.452 153.191 1.00 367.07 ?  272  ARG A CZ  1 
ATOM   1662  N  NH1 . ARG A 1  272  ? 219.992 255.081 154.281 1.00 393.72 ?  272  ARG A NH1 1 
ATOM   1663  N  NH2 . ARG A 1  272  ? 219.979 255.790 152.101 1.00 364.72 ?  272  ARG A NH2 1 
ATOM   1664  N  N   . ARG A 1  273  ? 221.112 250.536 155.604 1.00 136.82 ?  273  ARG A N   1 
ATOM   1665  C  CA  . ARG A 1  273  ? 219.989 249.735 156.015 1.00 162.54 ?  273  ARG A CA  1 
ATOM   1666  C  C   . ARG A 1  273  ? 218.731 250.061 155.252 1.00 228.03 ?  273  ARG A C   1 
ATOM   1667  O  O   . ARG A 1  273  ? 217.902 249.173 155.052 1.00 270.34 ?  273  ARG A O   1 
ATOM   1668  C  CB  . ARG A 1  273  ? 219.743 249.890 157.508 1.00 148.07 ?  273  ARG A CB  1 
ATOM   1669  C  CG  . ARG A 1  273  ? 219.188 248.623 158.167 1.00 185.85 ?  273  ARG A CG  1 
ATOM   1670  C  CD  . ARG A 1  273  ? 219.933 247.365 157.715 1.00 207.17 ?  273  ARG A CD  1 
ATOM   1671  N  NE  . ARG A 1  273  ? 219.543 246.120 158.387 1.00 207.28 ?  273  ARG A NE  1 
ATOM   1672  C  CZ  . ARG A 1  273  ? 220.219 245.539 159.379 1.00 210.25 ?  273  ARG A CZ  1 
ATOM   1673  N  NH1 . ARG A 1  273  ? 221.325 246.081 159.868 1.00 208.61 ?  273  ARG A NH1 1 
ATOM   1674  N  NH2 . ARG A 1  273  ? 219.773 244.408 159.903 1.00 227.13 ?  273  ARG A NH2 1 
ATOM   1675  N  N   . VAL A 1  274  ? 218.639 251.324 154.813 1.00 338.08 ?  274  VAL A N   1 
ATOM   1676  C  CA  . VAL A 1  274  ? 217.452 252.019 154.220 1.00 420.27 ?  274  VAL A CA  1 
ATOM   1677  C  C   . VAL A 1  274  ? 216.974 253.151 155.156 1.00 476.44 ?  274  VAL A C   1 
ATOM   1678  O  O   . VAL A 1  274  ? 216.633 254.244 154.683 1.00 500.00 ?  274  VAL A O   1 
ATOM   1679  C  CB  . VAL A 1  274  ? 216.298 251.077 153.706 1.00 425.15 ?  274  VAL A CB  1 
ATOM   1680  C  CG1 . VAL A 1  274  ? 214.926 251.748 153.701 1.00 392.88 ?  274  VAL A CG1 1 
ATOM   1681  C  CG2 . VAL A 1  274  ? 216.617 250.542 152.313 1.00 417.02 ?  274  VAL A CG2 1 
ATOM   1682  N  N   . LYS A 1  275  ? 216.995 252.879 156.469 1.00 500.00 ?  275  LYS A N   1 
ATOM   1683  C  CA  . LYS A 1  275  ? 216.523 253.787 157.534 1.00 500.00 ?  275  LYS A CA  1 
ATOM   1684  C  C   . LYS A 1  275  ? 215.062 254.233 157.318 1.00 500.00 ?  275  LYS A C   1 
ATOM   1685  O  O   . LYS A 1  275  ? 214.179 253.376 157.212 1.00 500.00 ?  275  LYS A O   1 
ATOM   1686  C  CB  . LYS A 1  275  ? 217.496 254.962 157.754 1.00 500.00 ?  275  LYS A CB  1 
ATOM   1687  N  N   . SER A 1  276  ? 214.816 255.544 157.244 1.00 500.00 ?  276  SER A N   1 
ATOM   1688  C  CA  . SER A 1  276  ? 213.471 256.090 157.027 1.00 500.00 ?  276  SER A CA  1 
ATOM   1689  C  C   . SER A 1  276  ? 213.356 256.870 155.707 1.00 500.00 ?  276  SER A C   1 
ATOM   1690  O  O   . SER A 1  276  ? 213.649 258.072 155.643 1.00 500.00 ?  276  SER A O   1 
ATOM   1691  C  CB  . SER A 1  276  ? 213.038 256.939 158.219 1.00 500.00 ?  276  SER A CB  1 
ATOM   1692  N  N   . GLU A 1  277  ? 212.935 256.159 154.661 1.00 500.00 ?  277  GLU A N   1 
ATOM   1693  C  CA  . GLU A 1  277  ? 212.737 256.726 153.324 1.00 500.00 ?  277  GLU A CA  1 
ATOM   1694  C  C   . GLU A 1  277  ? 211.313 256.495 152.817 1.00 500.00 ?  277  GLU A C   1 
ATOM   1695  O  O   . GLU A 1  277  ? 210.644 255.544 153.235 1.00 500.00 ?  277  GLU A O   1 
ATOM   1696  C  CB  . GLU A 1  277  ? 213.749 256.138 152.338 1.00 500.00 ?  277  GLU A CB  1 
ATOM   1697  N  N   . GLU A 1  278  ? 210.867 257.368 151.911 1.00 500.00 ?  278  GLU A N   1 
ATOM   1698  C  CA  . GLU A 1  278  ? 209.530 257.298 151.305 1.00 500.00 ?  278  GLU A CA  1 
ATOM   1699  C  C   . GLU A 1  278  ? 209.340 256.057 150.423 1.00 500.00 ?  278  GLU A C   1 
ATOM   1700  O  O   . GLU A 1  278  ? 210.320 255.478 149.934 1.00 500.00 ?  278  GLU A O   1 
ATOM   1701  C  CB  . GLU A 1  278  ? 209.244 258.568 150.513 1.00 500.00 ?  278  GLU A CB  1 
ATOM   1702  N  N   . GLU A 1  279  ? 208.076 255.662 150.238 1.00 500.00 ?  279  GLU A N   1 
ATOM   1703  C  CA  . GLU A 1  279  ? 207.694 254.486 149.443 1.00 500.00 ?  279  GLU A CA  1 
ATOM   1704  C  C   . GLU A 1  279  ? 208.368 254.475 148.069 1.00 500.00 ?  279  GLU A C   1 
ATOM   1705  O  O   . GLU A 1  279  ? 208.214 255.418 147.284 1.00 500.00 ?  279  GLU A O   1 
ATOM   1706  C  CB  . GLU A 1  279  ? 206.178 254.399 149.309 1.00 500.00 ?  279  GLU A CB  1 
ATOM   1707  N  N   . ASN A 1  280  ? 209.131 253.410 147.815 1.00 500.00 ?  280  ASN A N   1 
ATOM   1708  C  CA  . ASN A 1  280  ? 209.972 253.268 146.616 1.00 500.00 ?  280  ASN A CA  1 
ATOM   1709  C  C   . ASN A 1  280  ? 209.195 253.251 145.292 1.00 500.00 ?  280  ASN A C   1 
ATOM   1710  O  O   . ASN A 1  280  ? 208.031 252.834 145.253 1.00 500.00 ?  280  ASN A O   1 
ATOM   1711  C  CB  . ASN A 1  280  ? 210.864 252.036 146.736 1.00 500.00 ?  280  ASN A CB  1 
ATOM   1712  N  N   . VAL A 1  281  ? 209.870 253.699 144.225 1.00 500.00 ?  281  VAL A N   1 
ATOM   1713  C  CA  . VAL A 1  281  ? 209.327 253.866 142.859 1.00 500.00 ?  281  VAL A CA  1 
ATOM   1714  C  C   . VAL A 1  281  ? 208.151 254.858 142.769 1.00 500.00 ?  281  VAL A C   1 
ATOM   1715  O  O   . VAL A 1  281  ? 207.022 254.503 142.420 1.00 500.00 ?  281  VAL A O   1 
ATOM   1716  C  CB  . VAL A 1  281  ? 208.999 252.519 142.207 1.00 500.00 ?  281  VAL A CB  1 
ATOM   1717  N  N   . PRO A 1  402  ? 204.313 241.444 150.276 1.00 313.78 ?  402  PRO A N   1 
ATOM   1718  C  CA  . PRO A 1  402  ? 204.652 242.691 149.579 1.00 317.28 ?  402  PRO A CA  1 
ATOM   1719  C  C   . PRO A 1  402  ? 206.171 242.994 149.573 1.00 334.34 ?  402  PRO A C   1 
ATOM   1720  O  O   . PRO A 1  402  ? 206.703 243.429 150.604 1.00 359.17 ?  402  PRO A O   1 
ATOM   1721  C  CB  . PRO A 1  402  ? 203.867 243.760 150.372 1.00 300.35 ?  402  PRO A CB  1 
ATOM   1722  C  CG  . PRO A 1  402  ? 203.490 243.112 151.672 1.00 279.07 ?  402  PRO A CG  1 
ATOM   1723  C  CD  . PRO A 1  402  ? 203.341 241.652 151.366 1.00 293.46 ?  402  PRO A CD  1 
ATOM   1724  N  N   . ILE A 1  403  ? 206.862 242.765 148.441 1.00 317.50 ?  403  ILE A N   1 
ATOM   1725  C  CA  . ILE A 1  403  ? 208.333 243.018 148.371 1.00 262.83 ?  403  ILE A CA  1 
ATOM   1726  C  C   . ILE A 1  403  ? 208.707 244.492 148.509 1.00 224.13 ?  403  ILE A C   1 
ATOM   1727  O  O   . ILE A 1  403  ? 208.370 245.360 147.680 1.00 189.54 ?  403  ILE A O   1 
ATOM   1728  C  CB  . ILE A 1  403  ? 209.114 242.295 147.221 1.00 253.52 ?  403  ILE A CB  1 
ATOM   1729  C  CG1 . ILE A 1  403  ? 209.657 240.943 147.708 1.00 219.87 ?  403  ILE A CG1 1 
ATOM   1730  C  CG2 . ILE A 1  403  ? 210.318 243.115 146.754 1.00 244.27 ?  403  ILE A CG2 1 
ATOM   1731  C  CD1 . ILE A 1  403  ? 210.461 240.175 146.676 1.00 200.14 ?  403  ILE A CD1 1 
ATOM   1732  N  N   . VAL A 1  404  ? 209.401 244.710 149.615 1.00 201.31 ?  404  VAL A N   1 
ATOM   1733  C  CA  . VAL A 1  404  ? 209.965 245.970 150.023 1.00 224.14 ?  404  VAL A CA  1 
ATOM   1734  C  C   . VAL A 1  404  ? 211.501 245.820 149.947 1.00 263.74 ?  404  VAL A C   1 
ATOM   1735  O  O   . VAL A 1  404  ? 212.026 244.768 150.306 1.00 297.12 ?  404  VAL A O   1 
ATOM   1736  C  CB  . VAL A 1  404  ? 209.458 246.371 151.447 1.00 206.05 ?  404  VAL A CB  1 
ATOM   1737  C  CG1 . VAL A 1  404  ? 208.039 246.916 151.373 1.00 198.98 ?  404  VAL A CG1 1 
ATOM   1738  C  CG2 . VAL A 1  404  ? 209.512 245.212 152.456 1.00 176.97 ?  404  VAL A CG2 1 
ATOM   1739  N  N   . PRO A 1  405  ? 212.222 246.846 149.446 1.00 292.31 ?  405  PRO A N   1 
ATOM   1740  C  CA  . PRO A 1  405  ? 213.690 246.770 149.457 1.00 309.13 ?  405  PRO A CA  1 
ATOM   1741  C  C   . PRO A 1  405  ? 214.330 246.941 150.841 1.00 364.56 ?  405  PRO A C   1 
ATOM   1742  O  O   . PRO A 1  405  ? 213.838 247.720 151.666 1.00 409.23 ?  405  PRO A O   1 
ATOM   1743  C  CB  . PRO A 1  405  ? 214.104 247.928 148.549 1.00 315.06 ?  405  PRO A CB  1 
ATOM   1744  C  CG  . PRO A 1  405  ? 212.978 248.900 148.642 1.00 318.05 ?  405  PRO A CG  1 
ATOM   1745  C  CD  . PRO A 1  405  ? 211.749 248.047 148.731 1.00 312.03 ?  405  PRO A CD  1 
ATOM   1746  N  N   . GLU A 1  406  ? 215.404 246.190 151.077 1.00 372.31 ?  406  GLU A N   1 
ATOM   1747  C  CA  . GLU A 1  406  ? 216.326 246.405 152.198 1.00 370.57 ?  406  GLU A CA  1 
ATOM   1748  C  C   . GLU A 1  406  ? 217.690 246.725 151.577 1.00 369.81 ?  406  GLU A C   1 
ATOM   1749  O  O   . GLU A 1  406  ? 218.007 246.192 150.509 1.00 382.90 ?  406  GLU A O   1 
ATOM   1750  C  CB  . GLU A 1  406  ? 216.429 245.158 153.095 1.00 360.11 ?  406  GLU A CB  1 
ATOM   1751  C  CG  . GLU A 1  406  ? 215.117 244.422 153.395 1.00 356.01 ?  406  GLU A CG  1 
ATOM   1752  C  CD  . GLU A 1  406  ? 214.312 244.988 154.562 1.00 349.41 ?  406  GLU A CD  1 
ATOM   1753  O  OE1 . GLU A 1  406  ? 214.896 245.637 155.458 1.00 349.44 ?  406  GLU A OE1 1 
ATOM   1754  O  OE2 . GLU A 1  406  ? 213.078 244.759 154.599 1.00 322.43 -1 406  GLU A OE2 1 
ATOM   1755  N  N   . LEU A 1  407  ? 218.483 247.579 152.238 1.00 349.17 ?  407  LEU A N   1 
ATOM   1756  C  CA  . LEU A 1  407  ? 219.803 248.055 151.746 1.00 322.39 ?  407  LEU A CA  1 
ATOM   1757  C  C   . LEU A 1  407  ? 219.729 249.072 150.588 1.00 334.66 ?  407  LEU A C   1 
ATOM   1758  O  O   . LEU A 1  407  ? 219.364 248.721 149.460 1.00 343.41 ?  407  LEU A O   1 
ATOM   1759  C  CB  . LEU A 1  407  ? 220.773 246.894 151.422 1.00 304.79 ?  407  LEU A CB  1 
ATOM   1760  C  CG  . LEU A 1  407  ? 221.898 246.395 152.344 1.00 298.72 ?  407  LEU A CG  1 
ATOM   1761  C  CD1 . LEU A 1  407  ? 221.518 246.294 153.819 1.00 293.09 ?  407  LEU A CD1 1 
ATOM   1762  C  CD2 . LEU A 1  407  ? 222.394 245.048 151.834 1.00 311.73 ?  407  LEU A CD2 1 
ATOM   1763  N  N   . CYS A 1  408  ? 220.069 250.329 150.887 1.00 340.68 ?  408  CYS A N   1 
ATOM   1764  C  CA  . CYS A 1  408  ? 220.079 251.422 149.896 1.00 342.59 ?  408  CYS A CA  1 
ATOM   1765  C  C   . CYS A 1  408  ? 221.501 251.893 149.562 1.00 350.43 ?  408  CYS A C   1 
ATOM   1766  O  O   . CYS A 1  408  ? 222.406 251.731 150.384 1.00 370.27 ?  408  CYS A O   1 
ATOM   1767  C  CB  . CYS A 1  408  ? 219.229 252.606 150.376 1.00 324.45 ?  408  CYS A CB  1 
ATOM   1768  N  N   . ILE A 1  409  ? 221.687 252.465 148.364 1.00 354.65 ?  409  ILE A N   1 
ATOM   1769  C  CA  . ILE A 1  409  ? 222.999 252.997 147.898 1.00 345.58 ?  409  ILE A CA  1 
ATOM   1770  C  C   . ILE A 1  409  ? 222.955 254.478 147.447 1.00 359.03 ?  409  ILE A C   1 
ATOM   1771  O  O   . ILE A 1  409  ? 222.249 254.823 146.492 1.00 374.71 ?  409  ILE A O   1 
ATOM   1772  C  CB  . ILE A 1  409  ? 223.691 252.097 146.823 1.00 319.64 ?  409  ILE A CB  1 
ATOM   1773  C  CG1 . ILE A 1  409  ? 222.685 251.550 145.790 1.00 287.73 ?  409  ILE A CG1 1 
ATOM   1774  C  CG2 . ILE A 1  409  ? 224.461 250.966 147.498 1.00 309.94 ?  409  ILE A CG2 1 
ATOM   1775  C  CD1 . ILE A 1  409  ? 223.236 251.327 144.395 1.00 236.92 ?  409  ILE A CD1 1 
ATOM   1776  N  N   . ASP A 1  410  ? 223.739 255.327 148.122 1.00 357.19 ?  410  ASP A N   1 
ATOM   1777  C  CA  . ASP A 1  410  ? 223.643 256.809 148.013 1.00 358.73 ?  410  ASP A CA  1 
ATOM   1778  C  C   . ASP A 1  410  ? 224.542 257.516 146.977 1.00 345.39 ?  410  ASP A C   1 
ATOM   1779  O  O   . ASP A 1  410  ? 224.253 258.651 146.577 1.00 355.78 ?  410  ASP A O   1 
ATOM   1780  C  CB  . ASP A 1  410  ? 223.896 257.461 149.383 1.00 366.95 ?  410  ASP A CB  1 
ATOM   1781  C  CG  . ASP A 1  410  ? 223.068 256.846 150.490 1.00 371.44 ?  410  ASP A CG  1 
ATOM   1782  O  OD1 . ASP A 1  410  ? 223.409 255.730 150.935 1.00 347.63 -1 410  ASP A OD1 1 
ATOM   1783  O  OD2 . ASP A 1  410  ? 222.076 257.477 150.909 1.00 390.40 ?  410  ASP A OD2 1 
ATOM   1784  N  N   . HIS A 1  411  ? 225.614 256.834 146.565 1.00 306.45 ?  411  HIS A N   1 
ATOM   1785  C  CA  . HIS A 1  411  ? 226.775 257.383 145.808 1.00 235.79 ?  411  HIS A CA  1 
ATOM   1786  C  C   . HIS A 1  411  ? 227.474 258.643 146.309 1.00 158.46 ?  411  HIS A C   1 
ATOM   1787  O  O   . HIS A 1  411  ? 226.967 259.376 147.156 1.00 124.94 ?  411  HIS A O   1 
ATOM   1788  C  CB  . HIS A 1  411  ? 226.599 257.409 144.271 1.00 284.27 ?  411  HIS A CB  1 
ATOM   1789  C  CG  . HIS A 1  411  ? 225.557 258.359 143.769 1.00 354.73 ?  411  HIS A CG  1 
ATOM   1790  N  ND1 . HIS A 1  411  ? 225.349 259.611 144.310 1.00 372.03 ?  411  HIS A ND1 1 
ATOM   1791  C  CD2 . HIS A 1  411  ? 224.693 258.250 142.732 1.00 390.17 ?  411  HIS A CD2 1 
ATOM   1792  C  CE1 . HIS A 1  411  ? 224.379 260.217 143.649 1.00 407.05 ?  411  HIS A CE1 1 
ATOM   1793  N  NE2 . HIS A 1  411  ? 223.971 259.417 142.681 1.00 410.93 ?  411  HIS A NE2 1 
ATOM   1794  N  N   . LEU A 1  412  ? 228.683 258.815 145.790 1.00 135.41 ?  412  LEU A N   1 
ATOM   1795  C  CA  . LEU A 1  412  ? 229.575 259.907 146.140 1.00 175.70 ?  412  LEU A CA  1 
ATOM   1796  C  C   . LEU A 1  412  ? 230.631 260.143 145.054 1.00 202.40 ?  412  LEU A C   1 
ATOM   1797  O  O   . LEU A 1  412  ? 231.066 261.284 144.866 1.00 220.14 ?  412  LEU A O   1 
ATOM   1798  C  CB  . LEU A 1  412  ? 230.184 259.778 147.560 1.00 170.85 ?  412  LEU A CB  1 
ATOM   1799  C  CG  . LEU A 1  412  ? 230.571 258.500 148.320 1.00 183.59 ?  412  LEU A CG  1 
ATOM   1800  C  CD1 . LEU A 1  412  ? 232.070 258.244 148.388 1.00 177.31 ?  412  LEU A CD1 1 
ATOM   1801  C  CD2 . LEU A 1  412  ? 229.988 258.566 149.724 1.00 196.59 ?  412  LEU A CD2 1 
ATOM   1802  N  N   . TRP A 1  413  ? 231.029 259.078 144.346 1.00 239.95 ?  413  TRP A N   1 
ATOM   1803  C  CA  . TRP A 1  413  ? 231.709 259.140 143.004 1.00 296.64 ?  413  TRP A CA  1 
ATOM   1804  C  C   . TRP A 1  413  ? 233.262 258.941 142.920 1.00 256.20 ?  413  TRP A C   1 
ATOM   1805  O  O   . TRP A 1  413  ? 233.734 257.845 143.216 1.00 268.26 ?  413  TRP A O   1 
ATOM   1806  C  CB  . TRP A 1  413  ? 231.160 260.274 142.091 1.00 379.62 ?  413  TRP A CB  1 
ATOM   1807  C  CG  . TRP A 1  413  ? 229.646 260.192 141.840 1.00 421.71 ?  413  TRP A CG  1 
ATOM   1808  C  CD1 . TRP A 1  413  ? 228.653 260.748 142.606 1.00 425.85 ?  413  TRP A CD1 1 
ATOM   1809  C  CD2 . TRP A 1  413  ? 228.979 259.520 140.756 1.00 429.79 ?  413  TRP A CD2 1 
ATOM   1810  N  NE1 . TRP A 1  413  ? 227.418 260.461 142.074 1.00 433.38 ?  413  TRP A NE1 1 
ATOM   1811  C  CE2 . TRP A 1  413  ? 227.584 259.711 140.940 1.00 433.92 ?  413  TRP A CE2 1 
ATOM   1812  C  CE3 . TRP A 1  413  ? 229.422 258.774 139.650 1.00 422.46 ?  413  TRP A CE3 1 
ATOM   1813  C  CZ2 . TRP A 1  413  ? 226.626 259.185 140.055 1.00 433.54 ?  413  TRP A CZ2 1 
ATOM   1814  C  CZ3 . TRP A 1  413  ? 228.466 258.249 138.767 1.00 426.41 ?  413  TRP A CZ3 1 
ATOM   1815  C  CH2 . TRP A 1  413  ? 227.085 258.459 138.980 1.00 429.16 ?  413  TRP A CH2 1 
ATOM   1816  N  N   . THR A 1  414  ? 234.020 259.991 142.545 1.00 195.63 ?  414  THR A N   1 
ATOM   1817  C  CA  . THR A 1  414  ? 235.453 259.948 142.102 1.00 192.79 ?  414  THR A CA  1 
ATOM   1818  C  C   . THR A 1  414  ? 235.616 260.068 140.601 1.00 224.56 ?  414  THR A C   1 
ATOM   1819  O  O   . THR A 1  414  ? 236.449 260.844 140.140 1.00 252.52 ?  414  THR A O   1 
ATOM   1820  C  CB  . THR A 1  414  ? 236.203 258.708 142.566 1.00 162.54 ?  414  THR A CB  1 
ATOM   1821  N  N   . GLU A 1  415  ? 234.824 259.273 139.866 1.00 300.38 ?  415  GLU A N   1 
ATOM   1822  C  CA  . GLU A 1  415  ? 234.897 259.079 138.402 1.00 353.82 ?  415  GLU A CA  1 
ATOM   1823  C  C   . GLU A 1  415  ? 236.279 258.643 137.907 1.00 379.47 ?  415  GLU A C   1 
ATOM   1824  O  O   . GLU A 1  415  ? 236.945 257.823 138.540 1.00 375.86 ?  415  GLU A O   1 
ATOM   1825  C  CB  . GLU A 1  415  ? 234.389 260.303 137.637 1.00 376.82 ?  415  GLU A CB  1 
ATOM   1826  N  N   . SER A 1  425  ? 236.928 249.264 129.120 1.00 204.71 ?  425  SER A N   1 
ATOM   1827  C  CA  . SER A 1  425  ? 236.604 248.044 129.844 1.00 218.21 ?  425  SER A CA  1 
ATOM   1828  C  C   . SER A 1  425  ? 236.499 248.289 131.352 1.00 235.98 ?  425  SER A C   1 
ATOM   1829  O  O   . SER A 1  425  ? 236.996 249.297 131.858 1.00 231.98 ?  425  SER A O   1 
ATOM   1830  C  CB  . SER A 1  425  ? 237.632 246.964 129.538 1.00 231.55 ?  425  SER A CB  1 
ATOM   1831  N  N   . GLN A 1  426  ? 235.837 247.358 132.044 1.00 280.13 ?  426  GLN A N   1 
ATOM   1832  C  CA  . GLN A 1  426  ? 235.608 247.358 133.506 1.00 352.78 ?  426  GLN A CA  1 
ATOM   1833  C  C   . GLN A 1  426  ? 236.868 247.494 134.408 1.00 407.46 ?  426  GLN A C   1 
ATOM   1834  O  O   . GLN A 1  426  ? 237.995 247.327 133.929 1.00 445.38 ?  426  GLN A O   1 
ATOM   1835  C  CB  . GLN A 1  426  ? 234.851 246.073 133.855 1.00 337.51 ?  426  GLN A CB  1 
ATOM   1836  C  CG  . GLN A 1  426  ? 233.916 246.173 135.047 1.00 318.38 ?  426  GLN A CG  1 
ATOM   1837  C  CD  . GLN A 1  426  ? 232.609 245.441 134.829 1.00 287.93 ?  426  GLN A CD  1 
ATOM   1838  O  OE1 . GLN A 1  426  ? 232.141 245.296 133.698 1.00 252.19 ?  426  GLN A OE1 1 
ATOM   1839  N  NE2 . GLN A 1  426  ? 232.005 244.984 135.920 1.00 296.41 ?  426  GLN A NE2 1 
ATOM   1840  N  N   . ALA A 1  427  ? 236.661 247.797 135.702 1.00 407.60 ?  427  ALA A N   1 
ATOM   1841  C  CA  . ALA A 1  427  ? 237.712 247.720 136.747 1.00 389.82 ?  427  ALA A CA  1 
ATOM   1842  C  C   . ALA A 1  427  ? 238.198 246.276 136.976 1.00 402.86 ?  427  ALA A C   1 
ATOM   1843  O  O   . ALA A 1  427  ? 237.801 245.363 136.241 1.00 417.39 ?  427  ALA A O   1 
ATOM   1844  C  CB  . ALA A 1  427  ? 237.230 248.337 138.060 1.00 354.55 ?  427  ALA A CB  1 
ATOM   1845  N  N   . SER A 1  428  ? 239.050 246.067 137.986 1.00 415.50 ?  428  SER A N   1 
ATOM   1846  C  CA  . SER A 1  428  ? 239.622 244.735 138.237 1.00 422.01 ?  428  SER A CA  1 
ATOM   1847  C  C   . SER A 1  428  ? 239.708 244.264 139.704 1.00 416.80 ?  428  SER A C   1 
ATOM   1848  O  O   . SER A 1  428  ? 239.147 243.216 140.039 1.00 417.45 ?  428  SER A O   1 
ATOM   1849  C  CB  . SER A 1  428  ? 240.976 244.587 137.531 1.00 434.68 ?  428  SER A CB  1 
ATOM   1850  O  OG  . SER A 1  428  ? 240.847 244.744 136.128 1.00 442.74 ?  428  SER A OG  1 
ATOM   1851  N  N   . LYS A 1  429  ? 240.397 245.024 140.561 1.00 403.13 ?  429  LYS A N   1 
ATOM   1852  C  CA  . LYS A 1  429  ? 240.704 244.571 141.938 1.00 363.35 ?  429  LYS A CA  1 
ATOM   1853  C  C   . LYS A 1  429  ? 240.342 245.523 143.101 1.00 323.82 ?  429  LYS A C   1 
ATOM   1854  O  O   . LYS A 1  429  ? 240.585 245.200 144.275 1.00 259.36 ?  429  LYS A O   1 
ATOM   1855  C  CB  . LYS A 1  429  ? 242.160 244.085 142.024 1.00 373.12 ?  429  LYS A CB  1 
ATOM   1856  C  CG  . LYS A 1  429  ? 242.307 242.590 141.763 1.00 382.86 ?  429  LYS A CG  1 
ATOM   1857  C  CD  . LYS A 1  429  ? 243.645 242.206 141.141 1.00 383.98 ?  429  LYS A CD  1 
ATOM   1858  C  CE  . LYS A 1  429  ? 243.554 242.107 139.623 1.00 383.32 ?  429  LYS A CE  1 
ATOM   1859  N  NZ  . LYS A 1  429  ? 244.503 241.112 139.056 1.00 387.64 ?  429  LYS A NZ  1 
ATOM   1860  N  N   . VAL A 1  430  ? 239.750 246.669 142.736 1.00 287.01 ?  430  VAL A N   1 
ATOM   1861  C  CA  . VAL A 1  430  ? 239.208 247.747 143.619 1.00 214.07 ?  430  VAL A CA  1 
ATOM   1862  C  C   . VAL A 1  430  ? 239.242 247.581 145.142 1.00 206.90 ?  430  VAL A C   1 
ATOM   1863  O  O   . VAL A 1  430  ? 238.211 247.467 145.780 1.00 197.52 ?  430  VAL A O   1 
ATOM   1864  C  CB  . VAL A 1  430  ? 237.792 248.205 143.186 1.00 161.72 ?  430  VAL A CB  1 
ATOM   1865  C  CG1 . VAL A 1  430  ? 237.884 249.253 142.096 1.00 164.93 ?  430  VAL A CG1 1 
ATOM   1866  C  CG2 . VAL A 1  430  ? 236.975 247.021 142.702 1.00 165.76 ?  430  VAL A CG2 1 
ATOM   1867  N  N   . PHE A 1  431  ? 240.448 247.640 145.696 1.00 210.59 ?  431  PHE A N   1 
ATOM   1868  C  CA  . PHE A 1  431  ? 240.775 247.319 147.093 1.00 178.60 ?  431  PHE A CA  1 
ATOM   1869  C  C   . PHE A 1  431  ? 241.235 248.556 147.910 1.00 193.98 ?  431  PHE A C   1 
ATOM   1870  O  O   . PHE A 1  431  ? 242.128 249.338 147.469 1.00 168.97 ?  431  PHE A O   1 
ATOM   1871  C  CB  . PHE A 1  431  ? 241.948 246.380 147.035 1.00 138.69 ?  431  PHE A CB  1 
ATOM   1872  C  CG  . PHE A 1  431  ? 243.097 246.946 146.257 1.00 118.91 ?  431  PHE A CG  1 
ATOM   1873  C  CD1 . PHE A 1  431  ? 243.958 247.884 146.839 1.00 94.77  ?  431  PHE A CD1 1 
ATOM   1874  C  CD2 . PHE A 1  431  ? 243.286 246.589 144.928 1.00 138.16 ?  431  PHE A CD2 1 
ATOM   1875  C  CE1 . PHE A 1  431  ? 244.996 248.427 146.127 1.00 124.58 ?  431  PHE A CE1 1 
ATOM   1876  C  CE2 . PHE A 1  431  ? 244.336 247.137 144.200 1.00 186.43 ?  431  PHE A CE2 1 
ATOM   1877  C  CZ  . PHE A 1  431  ? 245.200 248.048 144.808 1.00 180.00 ?  431  PHE A CZ  1 
ATOM   1878  N  N   . ILE A 1  432  ? 240.681 248.701 149.115 1.00 184.60 ?  432  ILE A N   1 
ATOM   1879  C  CA  . ILE A 1  432  ? 241.079 249.801 149.998 1.00 172.94 ?  432  ILE A CA  1 
ATOM   1880  C  C   . ILE A 1  432  ? 242.443 249.501 150.668 1.00 165.60 ?  432  ILE A C   1 
ATOM   1881  O  O   . ILE A 1  432  ? 242.569 248.525 151.401 1.00 173.63 ?  432  ILE A O   1 
ATOM   1882  C  CB  . ILE A 1  432  ? 239.933 250.195 150.986 1.00 166.48 ?  432  ILE A CB  1 
ATOM   1883  C  CG1 . ILE A 1  432  ? 240.085 251.653 151.467 1.00 210.46 ?  432  ILE A CG1 1 
ATOM   1884  C  CG2 . ILE A 1  432  ? 239.788 249.201 152.143 1.00 161.74 ?  432  ILE A CG2 1 
ATOM   1885  C  CD1 . ILE A 1  432  ? 238.799 252.366 151.881 1.00 215.01 ?  432  ILE A CD1 1 
ATOM   1886  N  N   . THR A 1  433  ? 243.473 250.292 150.364 1.00 172.37 ?  433  THR A N   1 
ATOM   1887  C  CA  . THR A 1  433  ? 244.724 250.209 151.136 1.00 201.22 ?  433  THR A CA  1 
ATOM   1888  C  C   . THR A 1  433  ? 245.017 251.501 151.861 1.00 207.05 ?  433  THR A C   1 
ATOM   1889  O  O   . THR A 1  433  ? 244.975 252.592 151.280 1.00 195.60 ?  433  THR A O   1 
ATOM   1890  C  CB  . THR A 1  433  ? 246.004 249.834 150.330 1.00 228.52 ?  433  THR A CB  1 
ATOM   1891  O  OG1 . THR A 1  433  ? 246.772 251.006 150.036 1.00 266.54 ?  433  THR A OG1 1 
ATOM   1892  C  CG2 . THR A 1  433  ? 245.684 249.159 149.069 1.00 220.11 ?  433  THR A CG2 1 
ATOM   1893  N  N   . SER A 1  434  ? 245.327 251.354 153.138 1.00 223.38 ?  434  SER A N   1 
ATOM   1894  C  CA  . SER A 1  434  ? 245.977 252.405 153.877 1.00 230.58 ?  434  SER A CA  1 
ATOM   1895  C  C   . SER A 1  434  ? 247.481 252.339 153.593 1.00 231.54 ?  434  SER A C   1 
ATOM   1896  O  O   . SER A 1  434  ? 248.039 251.269 153.337 1.00 251.16 ?  434  SER A O   1 
ATOM   1897  C  CB  . SER A 1  434  ? 245.679 252.254 155.370 1.00 242.05 ?  434  SER A CB  1 
ATOM   1898  O  OG  . SER A 1  434  ? 245.694 253.507 156.026 1.00 246.54 ?  434  SER A OG  1 
ATOM   1899  N  N   . ASP A 1  435  ? 248.126 253.494 153.601 1.00 216.34 ?  435  ASP A N   1 
ATOM   1900  C  CA  . ASP A 1  435  ? 249.580 253.561 153.647 1.00 242.18 ?  435  ASP A CA  1 
ATOM   1901  C  C   . ASP A 1  435  ? 250.066 253.271 155.089 1.00 250.04 ?  435  ASP A C   1 
ATOM   1902  O  O   . ASP A 1  435  ? 249.278 252.814 155.926 1.00 256.01 ?  435  ASP A O   1 
ATOM   1903  C  CB  . ASP A 1  435  ? 250.074 254.910 153.087 1.00 277.87 ?  435  ASP A CB  1 
ATOM   1904  C  CG  . ASP A 1  435  ? 249.181 256.083 153.462 1.00 302.56 ?  435  ASP A CG  1 
ATOM   1905  O  OD1 . ASP A 1  435  ? 248.140 255.881 154.119 1.00 294.82 ?  435  ASP A OD1 1 
ATOM   1906  O  OD2 . ASP A 1  435  ? 249.514 257.222 153.069 1.00 320.12 -1 435  ASP A OD2 1 
ATOM   1907  N  N   . LEU A 1  436  ? 251.351 253.502 155.369 1.00 270.84 ?  436  LEU A N   1 
ATOM   1908  C  CA  . LEU A 1  436  ? 251.919 253.356 156.730 1.00 265.10 ?  436  LEU A CA  1 
ATOM   1909  C  C   . LEU A 1  436  ? 251.377 254.385 157.747 1.00 312.72 ?  436  LEU A C   1 
ATOM   1910  O  O   . LEU A 1  436  ? 251.301 254.091 158.944 1.00 298.93 ?  436  LEU A O   1 
ATOM   1911  C  CB  . LEU A 1  436  ? 253.458 253.349 156.684 1.00 220.41 ?  436  LEU A CB  1 
ATOM   1912  C  CG  . LEU A 1  436  ? 254.008 252.041 156.105 1.00 218.70 ?  436  LEU A CG  1 
ATOM   1913  C  CD1 . LEU A 1  436  ? 255.306 252.179 155.316 1.00 230.25 ?  436  LEU A CD1 1 
ATOM   1914  C  CD2 . LEU A 1  436  ? 254.169 251.052 157.239 1.00 249.92 ?  436  LEU A CD2 1 
ATOM   1915  N  N   . CYS A 1  437  ? 251.025 255.582 157.252 1.00 340.82 ?  437  CYS A N   1 
ATOM   1916  C  CA  . CYS A 1  437  ? 250.214 256.591 157.971 1.00 266.90 ?  437  CYS A CA  1 
ATOM   1917  C  C   . CYS A 1  437  ? 248.730 256.325 157.738 1.00 226.22 ?  437  CYS A C   1 
ATOM   1918  O  O   . CYS A 1  437  ? 248.362 255.617 156.797 1.00 195.03 ?  437  CYS A O   1 
ATOM   1919  C  CB  . CYS A 1  437  ? 250.549 258.021 157.498 1.00 252.54 ?  437  CYS A CB  1 
ATOM   1920  S  SG  . CYS A 1  437  ? 249.865 258.512 155.886 1.00 188.53 ?  437  CYS A SG  1 
ATOM   1921  N  N   . GLY A 1  438  ? 247.888 256.910 158.583 1.00 218.49 ?  438  GLY A N   1 
ATOM   1922  C  CA  . GLY A 1  438  ? 246.448 256.884 158.375 1.00 244.68 ?  438  GLY A CA  1 
ATOM   1923  C  C   . GLY A 1  438  ? 246.076 257.704 157.151 1.00 278.13 ?  438  GLY A C   1 
ATOM   1924  O  O   . GLY A 1  438  ? 245.969 258.932 157.229 1.00 314.38 ?  438  GLY A O   1 
ATOM   1925  N  N   . GLN A 1  439  ? 245.933 257.018 156.015 1.00 274.89 ?  439  GLN A N   1 
ATOM   1926  C  CA  . GLN A 1  439  ? 245.366 257.581 154.782 1.00 256.59 ?  439  GLN A CA  1 
ATOM   1927  C  C   . GLN A 1  439  ? 244.794 256.428 153.961 1.00 253.70 ?  439  GLN A C   1 
ATOM   1928  O  O   . GLN A 1  439  ? 245.323 255.322 154.005 1.00 252.53 ?  439  GLN A O   1 
ATOM   1929  C  CB  . GLN A 1  439  ? 246.428 258.334 153.971 1.00 232.24 ?  439  GLN A CB  1 
ATOM   1930  C  CG  . GLN A 1  439  ? 246.071 259.776 153.662 1.00 215.90 ?  439  GLN A CG  1 
ATOM   1931  C  CD  . GLN A 1  439  ? 244.868 259.901 152.758 1.00 197.29 ?  439  GLN A CD  1 
ATOM   1932  O  OE1 . GLN A 1  439  ? 244.930 259.560 151.583 1.00 170.86 ?  439  GLN A OE1 1 
ATOM   1933  N  NE2 . GLN A 1  439  ? 243.763 260.391 153.307 1.00 182.87 ?  439  GLN A NE2 1 
ATOM   1934  N  N   . LYS A 1  440  ? 243.709 256.673 153.230 1.00 235.14 ?  440  LYS A N   1 
ATOM   1935  C  CA  . LYS A 1  440  ? 243.039 255.598 152.481 1.00 219.15 ?  440  LYS A CA  1 
ATOM   1936  C  C   . LYS A 1  440  ? 243.202 255.743 150.976 1.00 210.82 ?  440  LYS A C   1 
ATOM   1937  O  O   . LYS A 1  440  ? 243.242 256.854 150.455 1.00 280.06 ?  440  LYS A O   1 
ATOM   1938  C  CB  . LYS A 1  440  ? 241.572 255.457 152.904 1.00 196.71 ?  440  LYS A CB  1 
ATOM   1939  C  CG  . LYS A 1  440  ? 241.390 254.571 154.135 1.00 194.44 ?  440  LYS A CG  1 
ATOM   1940  C  CD  . LYS A 1  440  ? 240.690 255.302 155.269 1.00 215.82 ?  440  LYS A CD  1 
ATOM   1941  C  CE  . LYS A 1  440  ? 241.684 255.895 156.265 1.00 229.59 ?  440  LYS A CE  1 
ATOM   1942  N  NZ  . LYS A 1  440  ? 241.395 257.310 156.645 1.00 206.72 ?  440  LYS A NZ  1 
ATOM   1943  N  N   . PHE A 1  441  ? 243.360 254.613 150.297 1.00 182.43 ?  441  PHE A N   1 
ATOM   1944  C  CA  . PHE A 1  441  ? 243.602 254.588 148.864 1.00 185.51 ?  441  PHE A CA  1 
ATOM   1945  C  C   . PHE A 1  441  ? 242.843 253.426 148.306 1.00 186.14 ?  441  PHE A C   1 
ATOM   1946  O  O   . PHE A 1  441  ? 243.421 252.371 148.030 1.00 196.32 ?  441  PHE A O   1 
ATOM   1947  C  CB  . PHE A 1  441  ? 245.096 254.438 148.519 1.00 192.53 ?  441  PHE A CB  1 
ATOM   1948  C  CG  . PHE A 1  441  ? 245.944 255.572 148.990 1.00 211.01 ?  441  PHE A CG  1 
ATOM   1949  C  CD1 . PHE A 1  441  ? 246.107 256.709 148.200 1.00 213.18 ?  441  PHE A CD1 1 
ATOM   1950  C  CD2 . PHE A 1  441  ? 246.575 255.512 150.233 1.00 213.33 ?  441  PHE A CD2 1 
ATOM   1951  C  CE1 . PHE A 1  441  ? 246.886 257.767 148.645 1.00 216.07 ?  441  PHE A CE1 1 
ATOM   1952  C  CE2 . PHE A 1  441  ? 247.348 256.568 150.684 1.00 226.75 ?  441  PHE A CE2 1 
ATOM   1953  C  CZ  . PHE A 1  441  ? 247.505 257.696 149.888 1.00 221.41 ?  441  PHE A CZ  1 
ATOM   1954  N  N   . LEU A 1  442  ? 241.536 253.602 148.170 1.00 179.34 ?  442  LEU A N   1 
ATOM   1955  C  CA  . LEU A 1  442  ? 240.752 252.671 147.374 1.00 190.24 ?  442  LEU A CA  1 
ATOM   1956  C  C   . LEU A 1  442  ? 241.125 252.906 145.915 1.00 220.25 ?  442  LEU A C   1 
ATOM   1957  O  O   . LEU A 1  442  ? 241.011 254.017 145.398 1.00 215.86 ?  442  LEU A O   1 
ATOM   1958  C  CB  . LEU A 1  442  ? 239.258 252.846 147.647 1.00 174.50 ?  442  LEU A CB  1 
ATOM   1959  C  CG  . LEU A 1  442  ? 238.067 252.231 146.900 1.00 153.12 ?  442  LEU A CG  1 
ATOM   1960  C  CD1 . LEU A 1  442  ? 238.405 251.101 145.936 1.00 151.02 ?  442  LEU A CD1 1 
ATOM   1961  C  CD2 . LEU A 1  442  ? 237.030 251.794 147.931 1.00 123.97 ?  442  LEU A CD2 1 
ATOM   1962  N  N   . CYS A 1  443  ? 241.620 251.848 145.282 1.00 286.39 ?  443  CYS A N   1 
ATOM   1963  C  CA  . CYS A 1  443  ? 242.210 251.941 143.950 1.00 369.46 ?  443  CYS A CA  1 
ATOM   1964  C  C   . CYS A 1  443  ? 241.294 251.327 142.909 1.00 395.75 ?  443  CYS A C   1 
ATOM   1965  O  O   . CYS A 1  443  ? 240.456 250.491 143.241 1.00 410.93 ?  443  CYS A O   1 
ATOM   1966  C  CB  . CYS A 1  443  ? 243.570 251.240 143.913 1.00 402.52 ?  443  CYS A CB  1 
ATOM   1967  S  SG  . CYS A 1  443  ? 244.696 251.654 145.267 1.00 429.73 ?  443  CYS A SG  1 
ATOM   1968  N  N   . PHE A 1  444  ? 241.439 251.774 141.661 1.00 411.82 ?  444  PHE A N   1 
ATOM   1969  C  CA  . PHE A 1  444  ? 240.737 251.173 140.528 1.00 409.16 ?  444  PHE A CA  1 
ATOM   1970  C  C   . PHE A 1  444  ? 241.753 250.879 139.430 1.00 428.34 ?  444  PHE A C   1 
ATOM   1971  O  O   . PHE A 1  444  ? 242.389 251.795 138.896 1.00 449.31 ?  444  PHE A O   1 
ATOM   1972  C  CB  . PHE A 1  444  ? 239.588 252.055 139.982 1.00 384.07 ?  444  PHE A CB  1 
ATOM   1973  C  CG  . PHE A 1  444  ? 239.128 253.160 140.912 1.00 341.70 ?  444  PHE A CG  1 
ATOM   1974  C  CD1 . PHE A 1  444  ? 238.547 252.877 142.155 1.00 311.16 ?  444  PHE A CD1 1 
ATOM   1975  C  CD2 . PHE A 1  444  ? 239.232 254.496 140.516 1.00 319.44 ?  444  PHE A CD2 1 
ATOM   1976  C  CE1 . PHE A 1  444  ? 238.128 253.898 142.994 1.00 269.74 ?  444  PHE A CE1 1 
ATOM   1977  C  CE2 . PHE A 1  444  ? 238.804 255.521 141.354 1.00 281.85 ?  444  PHE A CE2 1 
ATOM   1978  C  CZ  . PHE A 1  444  ? 238.238 255.216 142.582 1.00 261.32 ?  444  PHE A CZ  1 
ATOM   1979  N  N   . LEU A 1  445  ? 241.912 249.593 139.125 1.00 438.52 ?  445  LEU A N   1 
ATOM   1980  C  CA  . LEU A 1  445  ? 242.809 249.125 138.073 1.00 460.94 ?  445  LEU A CA  1 
ATOM   1981  C  C   . LEU A 1  445  ? 242.000 248.787 136.817 1.00 477.42 ?  445  LEU A C   1 
ATOM   1982  O  O   . LEU A 1  445  ? 241.064 247.979 136.867 1.00 493.47 ?  445  LEU A O   1 
ATOM   1983  C  CB  . LEU A 1  445  ? 243.629 247.920 138.574 1.00 453.64 ?  445  LEU A CB  1 
ATOM   1984  C  CG  . LEU A 1  445  ? 244.221 246.846 137.647 1.00 454.98 ?  445  LEU A CG  1 
ATOM   1985  C  CD1 . LEU A 1  445  ? 245.425 247.334 136.855 1.00 454.65 ?  445  LEU A CD1 1 
ATOM   1986  C  CD2 . LEU A 1  445  ? 244.584 245.625 138.472 1.00 450.56 ?  445  LEU A CD2 1 
ATOM   1987  N  N   . VAL A 1  446  ? 242.370 249.422 135.703 1.00 479.34 ?  446  VAL A N   1 
ATOM   1988  C  CA  . VAL A 1  446  ? 241.693 249.238 134.411 1.00 471.98 ?  446  VAL A CA  1 
ATOM   1989  C  C   . VAL A 1  446  ? 242.588 248.457 133.442 1.00 491.18 ?  446  VAL A C   1 
ATOM   1990  O  O   . VAL A 1  446  ? 243.742 248.837 133.204 1.00 500.00 ?  446  VAL A O   1 
ATOM   1991  C  CB  . VAL A 1  446  ? 241.263 250.584 133.760 1.00 447.60 ?  446  VAL A CB  1 
ATOM   1992  C  CG1 . VAL A 1  446  ? 240.222 250.347 132.674 1.00 438.27 ?  446  VAL A CG1 1 
ATOM   1993  C  CG2 . VAL A 1  446  ? 240.714 251.560 134.792 1.00 425.51 ?  446  VAL A CG2 1 
ATOM   1994  N  N   . GLU A 1  447  ? 242.038 247.372 132.895 1.00 496.75 ?  447  GLU A N   1 
ATOM   1995  C  CA  . GLU A 1  447  ? 242.736 246.503 131.941 1.00 500.00 ?  447  GLU A CA  1 
ATOM   1996  C  C   . GLU A 1  447  ? 242.979 247.177 130.585 1.00 500.00 ?  447  GLU A C   1 
ATOM   1997  O  O   . GLU A 1  447  ? 244.077 247.068 130.028 1.00 500.00 ?  447  GLU A O   1 
ATOM   1998  C  CB  . GLU A 1  447  ? 241.974 245.187 131.755 1.00 485.96 ?  447  GLU A CB  1 
ATOM   1999  N  N   . SER A 1  448  ? 241.959 247.873 130.074 1.00 500.00 ?  448  SER A N   1 
ATOM   2000  C  CA  . SER A 1  448  ? 242.023 248.557 128.773 1.00 500.00 ?  448  SER A CA  1 
ATOM   2001  C  C   . SER A 1  448  ? 242.974 249.759 128.795 1.00 500.00 ?  448  SER A C   1 
ATOM   2002  O  O   . SER A 1  448  ? 244.033 249.719 128.158 1.00 500.00 ?  448  SER A O   1 
ATOM   2003  C  CB  . SER A 1  448  ? 240.620 248.944 128.273 1.00 500.00 ?  448  SER A CB  1 
ATOM   2004  O  OG  . SER A 1  448  ? 239.904 249.698 129.238 1.00 500.00 ?  448  SER A OG  1 
ATOM   2005  N  N   . GLN A 1  449  ? 242.608 250.797 129.558 1.00 500.00 ?  449  GLN A N   1 
ATOM   2006  C  CA  . GLN A 1  449  ? 243.431 252.003 129.756 1.00 500.00 ?  449  GLN A CA  1 
ATOM   2007  C  C   . GLN A 1  449  ? 244.813 251.709 130.372 1.00 500.00 ?  449  GLN A C   1 
ATOM   2008  O  O   . GLN A 1  449  ? 245.707 252.566 130.343 1.00 500.00 ?  449  GLN A O   1 
ATOM   2009  C  CB  . GLN A 1  449  ? 242.666 253.020 130.615 1.00 500.00 ?  449  GLN A CB  1 
ATOM   2010  C  CG  . GLN A 1  449  ? 242.905 254.483 130.253 1.00 500.00 ?  449  GLN A CG  1 
ATOM   2011  C  CD  . GLN A 1  449  ? 242.169 254.931 128.997 1.00 499.00 ?  449  GLN A CD  1 
ATOM   2012  O  OE1 . GLN A 1  449  ? 241.035 254.519 128.737 1.00 490.80 ?  449  GLN A OE1 1 
ATOM   2013  N  NE2 . GLN A 1  449  ? 242.811 255.794 128.217 1.00 492.70 ?  449  GLN A NE2 1 
ATOM   2014  N  N   . LEU A 1  450  ? 244.961 250.500 130.927 1.00 500.00 ?  450  LEU A N   1 
ATOM   2015  C  CA  . LEU A 1  450  ? 246.227 249.937 131.456 1.00 500.00 ?  450  LEU A CA  1 
ATOM   2016  C  C   . LEU A 1  450  ? 246.736 250.560 132.774 1.00 500.00 ?  450  LEU A C   1 
ATOM   2017  O  O   . LEU A 1  450  ? 247.580 249.963 133.448 1.00 500.00 ?  450  LEU A O   1 
ATOM   2018  C  CB  . LEU A 1  450  ? 247.342 249.884 130.378 1.00 500.00 ?  450  LEU A CB  1 
ATOM   2019  C  CG  . LEU A 1  450  ? 248.173 248.621 130.051 1.00 500.00 ?  450  LEU A CG  1 
ATOM   2020  C  CD1 . LEU A 1  450  ? 248.870 247.975 131.250 1.00 499.84 ?  450  LEU A CD1 1 
ATOM   2021  C  CD2 . LEU A 1  450  ? 247.346 247.590 129.286 1.00 500.00 ?  450  LEU A CD2 1 
ATOM   2022  N  N   . GLN A 1  451  ? 246.212 251.733 133.145 1.00 500.00 ?  451  GLN A N   1 
ATOM   2023  C  CA  . GLN A 1  451  ? 246.615 252.421 134.385 1.00 500.00 ?  451  GLN A CA  1 
ATOM   2024  C  C   . GLN A 1  451  ? 245.968 251.820 135.652 1.00 500.00 ?  451  GLN A C   1 
ATOM   2025  O  O   . GLN A 1  451  ? 245.391 250.725 135.600 1.00 500.00 ?  451  GLN A O   1 
ATOM   2026  C  CB  . GLN A 1  451  ? 246.438 253.958 134.283 1.00 500.00 ?  451  GLN A CB  1 
ATOM   2027  C  CG  . GLN A 1  451  ? 245.004 254.489 134.233 1.00 500.00 ?  451  GLN A CG  1 
ATOM   2028  C  CD  . GLN A 1  451  ? 244.839 255.861 134.884 1.00 500.00 ?  451  GLN A CD  1 
ATOM   2029  O  OE1 . GLN A 1  451  ? 245.503 256.187 135.874 1.00 500.00 ?  451  GLN A OE1 1 
ATOM   2030  N  NE2 . GLN A 1  451  ? 243.937 256.665 134.335 1.00 500.00 ?  451  GLN A NE2 1 
ATOM   2031  N  N   . LEU A 1  452  ? 246.109 252.516 136.784 1.00 500.00 ?  452  LEU A N   1 
ATOM   2032  C  CA  . LEU A 1  452  ? 245.502 252.119 138.065 1.00 500.00 ?  452  LEU A CA  1 
ATOM   2033  C  C   . LEU A 1  452  ? 245.359 253.318 139.013 1.00 500.00 ?  452  LEU A C   1 
ATOM   2034  O  O   . LEU A 1  452  ? 246.255 253.612 139.818 1.00 500.00 ?  452  LEU A O   1 
ATOM   2035  C  CB  . LEU A 1  452  ? 246.251 250.936 138.716 1.00 500.00 ?  452  LEU A CB  1 
ATOM   2036  C  CG  . LEU A 1  452  ? 247.772 250.840 138.534 1.00 500.00 ?  452  LEU A CG  1 
ATOM   2037  C  CD1 . LEU A 1  452  ? 248.512 251.204 139.809 1.00 500.00 ?  452  LEU A CD1 1 
ATOM   2038  C  CD2 . LEU A 1  452  ? 248.150 249.443 138.092 1.00 500.00 ?  452  LEU A CD2 1 
ATOM   2039  N  N   . ARG A 1  453  ? 244.224 254.012 138.887 1.00 500.00 ?  453  ARG A N   1 
ATOM   2040  C  CA  . ARG A 1  453  ? 243.900 255.202 139.690 1.00 500.00 ?  453  ARG A CA  1 
ATOM   2041  C  C   . ARG A 1  453  ? 244.030 254.943 141.189 1.00 500.00 ?  453  ARG A C   1 
ATOM   2042  O  O   . ARG A 1  453  ? 243.738 253.841 141.659 1.00 500.00 ?  453  ARG A O   1 
ATOM   2043  C  CB  . ARG A 1  453  ? 242.475 255.673 139.391 1.00 488.72 ?  453  ARG A CB  1 
ATOM   2044  C  CG  . ARG A 1  453  ? 242.344 256.809 138.387 1.00 477.57 ?  453  ARG A CG  1 
ATOM   2045  C  CD  . ARG A 1  453  ? 240.922 256.844 137.835 1.00 479.69 ?  453  ARG A CD  1 
ATOM   2046  N  NE  . ARG A 1  453  ? 240.827 256.638 136.382 1.00 478.87 ?  453  ARG A NE  1 
ATOM   2047  C  CZ  . ARG A 1  453  ? 241.116 255.512 135.721 1.00 476.12 ?  453  ARG A CZ  1 
ATOM   2048  N  NH1 . ARG A 1  453  ? 241.562 254.431 136.349 1.00 472.59 ?  453  ARG A NH1 1 
ATOM   2049  N  NH2 . ARG A 1  453  ? 240.969 255.476 134.404 1.00 475.73 ?  453  ARG A NH2 1 
ATOM   2050  N  N   . CYS A 1  454  ? 244.492 255.952 141.926 1.00 496.78 ?  454  CYS A N   1 
ATOM   2051  C  CA  . CYS A 1  454  ? 244.527 255.886 143.387 1.00 454.89 ?  454  CYS A CA  1 
ATOM   2052  C  C   . CYS A 1  454  ? 243.828 257.100 144.001 1.00 406.38 ?  454  CYS A C   1 
ATOM   2053  O  O   . CYS A 1  454  ? 244.451 258.154 144.195 1.00 425.41 ?  454  CYS A O   1 
ATOM   2054  C  CB  . CYS A 1  454  ? 245.967 255.740 143.907 1.00 476.30 ?  454  CYS A CB  1 
ATOM   2055  S  SG  . CYS A 1  454  ? 246.837 254.251 143.355 1.00 500.00 ?  454  CYS A SG  1 
ATOM   2056  N  N   . VAL A 1  455  ? 242.531 256.946 144.295 1.00 317.71 ?  455  VAL A N   1 
ATOM   2057  C  CA  . VAL A 1  455  ? 241.764 257.998 144.994 1.00 237.35 ?  455  VAL A CA  1 
ATOM   2058  C  C   . VAL A 1  455  ? 242.242 258.064 146.449 1.00 204.95 ?  455  VAL A C   1 
ATOM   2059  O  O   . VAL A 1  455  ? 242.924 257.126 146.907 1.00 162.90 ?  455  VAL A O   1 
ATOM   2060  C  CB  . VAL A 1  455  ? 240.218 257.898 144.784 1.00 192.35 ?  455  VAL A CB  1 
ATOM   2061  C  CG1 . VAL A 1  455  ? 239.655 256.603 145.332 1.00 190.59 ?  455  VAL A CG1 1 
ATOM   2062  C  CG2 . VAL A 1  455  ? 239.483 259.104 145.365 1.00 166.06 ?  455  VAL A CG2 1 
ATOM   2063  N  N   . LYS A 1  456  ? 241.924 259.178 147.127 1.00 190.71 ?  456  LYS A N   1 
ATOM   2064  C  CA  . LYS A 1  456  ? 242.541 259.534 148.398 1.00 203.99 ?  456  LYS A CA  1 
ATOM   2065  C  C   . LYS A 1  456  ? 241.531 259.755 149.550 1.00 204.34 ?  456  LYS A C   1 
ATOM   2066  O  O   . LYS A 1  456  ? 241.412 260.861 150.081 1.00 192.66 ?  456  LYS A O   1 
ATOM   2067  C  CB  . LYS A 1  456  ? 243.495 260.723 148.194 1.00 202.44 ?  456  LYS A CB  1 
ATOM   2068  C  CG  . LYS A 1  456  ? 244.818 260.554 148.917 1.00 227.60 ?  456  LYS A CG  1 
ATOM   2069  C  CD  . LYS A 1  456  ? 245.940 261.438 148.390 1.00 241.79 ?  456  LYS A CD  1 
ATOM   2070  C  CE  . LYS A 1  456  ? 246.149 262.693 149.231 1.00 238.43 ?  456  LYS A CE  1 
ATOM   2071  N  NZ  . LYS A 1  456  ? 246.740 262.402 150.570 1.00 237.83 ?  456  LYS A NZ  1 
ATOM   2072  N  N   . PHE A 1  457  ? 240.870 258.660 149.951 1.00 219.39 ?  457  PHE A N   1 
ATOM   2073  C  CA  . PHE A 1  457  ? 239.757 258.621 150.932 1.00 215.53 ?  457  PHE A CA  1 
ATOM   2074  C  C   . PHE A 1  457  ? 239.970 259.117 152.376 1.00 226.50 ?  457  PHE A C   1 
ATOM   2075  O  O   . PHE A 1  457  ? 241.100 259.390 152.801 1.00 230.89 ?  457  PHE A O   1 
ATOM   2076  C  CB  . PHE A 1  457  ? 239.147 257.215 150.965 1.00 204.70 ?  457  PHE A CB  1 
ATOM   2077  C  CG  . PHE A 1  457  ? 238.103 257.006 149.928 1.00 233.48 ?  457  PHE A CG  1 
ATOM   2078  C  CD1 . PHE A 1  457  ? 236.881 257.684 150.003 1.00 251.27 ?  457  PHE A CD1 1 
ATOM   2079  C  CD2 . PHE A 1  457  ? 238.336 256.153 148.857 1.00 256.16 ?  457  PHE A CD2 1 
ATOM   2080  C  CE1 . PHE A 1  457  ? 235.906 257.501 149.032 1.00 266.83 ?  457  PHE A CE1 1 
ATOM   2081  C  CE2 . PHE A 1  457  ? 237.360 255.962 147.881 1.00 265.60 ?  457  PHE A CE2 1 
ATOM   2082  C  CZ  . PHE A 1  457  ? 236.148 256.638 147.967 1.00 264.99 ?  457  PHE A CZ  1 
ATOM   2083  N  N   . GLN A 1  458  ? 238.844 259.221 153.098 1.00 218.88 ?  458  GLN A N   1 
ATOM   2084  C  CA  . GLN A 1  458  ? 238.738 259.717 154.480 1.00 209.55 ?  458  GLN A CA  1 
ATOM   2085  C  C   . GLN A 1  458  ? 237.364 259.338 155.057 1.00 204.94 ?  458  GLN A C   1 
ATOM   2086  O  O   . GLN A 1  458  ? 236.407 259.126 154.307 1.00 204.41 ?  458  GLN A O   1 
ATOM   2087  C  CB  . GLN A 1  458  ? 238.915 261.245 154.514 1.00 212.91 ?  458  GLN A CB  1 
ATOM   2088  C  CG  . GLN A 1  458  ? 239.198 261.855 155.885 1.00 222.94 ?  458  GLN A CG  1 
ATOM   2089  C  CD  . GLN A 1  458  ? 240.642 261.682 156.336 1.00 241.65 ?  458  GLN A CD  1 
ATOM   2090  O  OE1 . GLN A 1  458  ? 241.570 262.177 155.698 1.00 257.06 ?  458  GLN A OE1 1 
ATOM   2091  N  NE2 . GLN A 1  458  ? 240.834 260.991 157.453 1.00 250.74 ?  458  GLN A NE2 1 
ATOM   2092  N  N   . GLU A 1  459  ? 237.280 259.234 156.383 1.00 210.69 ?  459  GLU A N   1 
ATOM   2093  C  CA  . GLU A 1  459  ? 235.997 259.181 157.093 1.00 237.89 ?  459  GLU A CA  1 
ATOM   2094  C  C   . GLU A 1  459  ? 235.691 260.540 157.749 1.00 273.33 ?  459  GLU A C   1 
ATOM   2095  O  O   . GLU A 1  459  ? 236.615 261.309 158.040 1.00 278.98 ?  459  GLU A O   1 
ATOM   2096  C  CB  . GLU A 1  459  ? 235.962 258.022 158.104 1.00 221.02 ?  459  GLU A CB  1 
ATOM   2097  C  CG  . GLU A 1  459  ? 237.110 257.977 159.112 1.00 248.59 ?  459  GLU A CG  1 
ATOM   2098  C  CD  . GLU A 1  459  ? 236.786 258.642 160.447 1.00 302.01 ?  459  GLU A CD  1 
ATOM   2099  O  OE1 . GLU A 1  459  ? 235.608 258.613 160.880 1.00 342.28 -1 459  GLU A OE1 1 
ATOM   2100  O  OE2 . GLU A 1  459  ? 237.719 259.191 161.076 1.00 324.35 ?  459  GLU A OE2 1 
ATOM   2101  N  N   . SER A 1  460  ? 234.405 260.842 157.957 1.00 324.66 ?  460  SER A N   1 
ATOM   2102  C  CA  . SER A 1  460  ? 233.991 262.083 158.643 1.00 349.68 ?  460  SER A CA  1 
ATOM   2103  C  C   . SER A 1  460  ? 232.795 261.901 159.576 1.00 362.75 ?  460  SER A C   1 
ATOM   2104  O  O   . SER A 1  460  ? 232.940 261.449 160.714 1.00 346.10 ?  460  SER A O   1 
ATOM   2105  C  CB  . SER A 1  460  ? 233.717 263.222 157.646 1.00 349.22 ?  460  SER A CB  1 
ATOM   2106  O  OG  . SER A 1  460  ? 232.775 262.858 156.649 1.00 331.27 ?  460  SER A OG  1 
ATOM   2107  N  N   . THR A 1  464  ? 230.086 259.192 161.161 1.00 302.60 ?  464  THR A N   1 
ATOM   2108  C  CA  . THR A 1  464  ? 231.187 258.704 160.330 1.00 286.13 ?  464  THR A CA  1 
ATOM   2109  C  C   . THR A 1  464  ? 230.749 258.588 158.850 1.00 290.72 ?  464  THR A C   1 
ATOM   2110  O  O   . THR A 1  464  ? 230.167 257.579 158.437 1.00 292.49 ?  464  THR A O   1 
ATOM   2111  C  CB  . THR A 1  464  ? 231.811 257.386 160.885 1.00 264.02 ?  464  THR A CB  1 
ATOM   2112  O  OG1 . THR A 1  464  ? 230.801 256.379 161.002 1.00 265.42 ?  464  THR A OG1 1 
ATOM   2113  C  CG2 . THR A 1  464  ? 232.455 257.595 162.266 1.00 224.18 ?  464  THR A CG2 1 
ATOM   2114  N  N   . GLN A 1  465  ? 231.011 259.643 158.074 1.00 298.08 ?  465  GLN A N   1 
ATOM   2115  C  CA  . GLN A 1  465  ? 230.688 259.693 156.630 1.00 298.95 ?  465  GLN A CA  1 
ATOM   2116  C  C   . GLN A 1  465  ? 231.919 259.387 155.745 1.00 293.26 ?  465  GLN A C   1 
ATOM   2117  O  O   . GLN A 1  465  ? 232.854 258.734 156.222 1.00 283.66 ?  465  GLN A O   1 
ATOM   2118  C  CB  . GLN A 1  465  ? 230.049 261.033 156.272 1.00 302.26 ?  465  GLN A CB  1 
ATOM   2119  N  N   . LEU A 1  466  ? 231.909 259.822 154.472 1.00 273.14 ?  466  LEU A N   1 
ATOM   2120  C  CA  . LEU A 1  466  ? 233.035 259.603 153.520 1.00 262.36 ?  466  LEU A CA  1 
ATOM   2121  C  C   . LEU A 1  466  ? 233.318 260.760 152.528 1.00 245.76 ?  466  LEU A C   1 
ATOM   2122  O  O   . LEU A 1  466  ? 232.390 261.386 152.013 1.00 249.51 ?  466  LEU A O   1 
ATOM   2123  C  CB  . LEU A 1  466  ? 232.873 258.278 152.754 1.00 266.25 ?  466  LEU A CB  1 
ATOM   2124  C  CG  . LEU A 1  466  ? 233.281 256.993 153.489 1.00 264.09 ?  466  LEU A CG  1 
ATOM   2125  C  CD1 . LEU A 1  466  ? 232.052 256.255 153.995 1.00 268.57 ?  466  LEU A CD1 1 
ATOM   2126  C  CD2 . LEU A 1  466  ? 234.115 256.072 152.612 1.00 266.05 ?  466  LEU A CD2 1 
ATOM   2127  N  N   . ILE A 1  467  ? 234.609 261.010 152.266 1.00 230.33 ?  467  ILE A N   1 
ATOM   2128  C  CA  . ILE A 1  467  ? 235.102 262.145 151.443 1.00 218.25 ?  467  ILE A CA  1 
ATOM   2129  C  C   . ILE A 1  467  ? 236.265 261.734 150.527 1.00 214.75 ?  467  ILE A C   1 
ATOM   2130  O  O   . ILE A 1  467  ? 237.147 260.991 150.943 1.00 228.28 ?  467  ILE A O   1 
ATOM   2131  C  CB  . ILE A 1  467  ? 235.654 263.306 152.311 1.00 211.55 ?  467  ILE A CB  1 
ATOM   2132  C  CG1 . ILE A 1  467  ? 234.976 263.379 153.685 1.00 192.42 ?  467  ILE A CG1 1 
ATOM   2133  C  CG2 . ILE A 1  467  ? 235.581 264.632 151.555 1.00 223.86 ?  467  ILE A CG2 1 
ATOM   2134  C  CD1 . ILE A 1  467  ? 235.959 263.595 154.813 1.00 197.47 ?  467  ILE A CD1 1 
ATOM   2135  N  N   . PHE A 1  468  ? 236.296 262.254 149.303 1.00 208.33 ?  468  PHE A N   1 
ATOM   2136  C  CA  . PHE A 1  468  ? 237.371 261.921 148.363 1.00 230.15 ?  468  PHE A CA  1 
ATOM   2137  C  C   . PHE A 1  468  ? 238.647 262.694 148.578 1.00 256.56 ?  468  PHE A C   1 
ATOM   2138  O  O   . PHE A 1  468  ? 238.717 263.574 149.442 1.00 281.02 ?  468  PHE A O   1 
ATOM   2139  C  CB  . PHE A 1  468  ? 236.928 262.131 146.922 1.00 260.29 ?  468  PHE A CB  1 
ATOM   2140  C  CG  . PHE A 1  468  ? 235.825 261.238 146.520 1.00 297.97 ?  468  PHE A CG  1 
ATOM   2141  C  CD1 . PHE A 1  468  ? 236.048 259.874 146.326 1.00 304.79 ?  468  PHE A CD1 1 
ATOM   2142  C  CD2 . PHE A 1  468  ? 234.551 261.746 146.374 1.00 306.38 ?  468  PHE A CD2 1 
ATOM   2143  C  CE1 . PHE A 1  468  ? 235.007 259.038 145.972 1.00 295.66 ?  468  PHE A CE1 1 
ATOM   2144  C  CE2 . PHE A 1  468  ? 233.516 260.915 146.027 1.00 291.79 ?  468  PHE A CE2 1 
ATOM   2145  C  CZ  . PHE A 1  468  ? 233.743 259.563 145.834 1.00 274.70 ?  468  PHE A CZ  1 
ATOM   2146  N  N   . GLY A 1  469  ? 239.650 262.317 147.778 1.00 263.81 ?  469  GLY A N   1 
ATOM   2147  C  CA  . GLY A 1  469  ? 240.883 263.074 147.568 1.00 252.59 ?  469  GLY A CA  1 
ATOM   2148  C  C   . GLY A 1  469  ? 241.211 263.081 146.086 1.00 237.31 ?  469  GLY A C   1 
ATOM   2149  O  O   . GLY A 1  469  ? 240.518 262.441 145.287 1.00 230.73 ?  469  GLY A O   1 
ATOM   2150  N  N   . SER A 1  470  ? 242.258 263.808 145.711 1.00 241.52 ?  470  SER A N   1 
ATOM   2151  C  CA  . SER A 1  470  ? 242.643 263.883 144.304 1.00 259.49 ?  470  SER A CA  1 
ATOM   2152  C  C   . SER A 1  470  ? 243.577 262.745 143.895 1.00 272.20 ?  470  SER A C   1 
ATOM   2153  O  O   . SER A 1  470  ? 244.568 262.444 144.575 1.00 208.71 ?  470  SER A O   1 
ATOM   2154  C  CB  . SER A 1  470  ? 243.206 265.255 143.949 1.00 262.15 ?  470  SER A CB  1 
ATOM   2155  O  OG  . SER A 1  470  ? 242.151 266.195 143.846 1.00 248.66 ?  470  SER A OG  1 
ATOM   2156  N  N   . VAL A 1  471  ? 243.231 262.130 142.766 1.00 345.95 ?  471  VAL A N   1 
ATOM   2157  C  CA  . VAL A 1  471  ? 243.843 260.878 142.302 1.00 404.61 ?  471  VAL A CA  1 
ATOM   2158  C  C   . VAL A 1  471  ? 245.278 261.063 141.793 1.00 406.45 ?  471  VAL A C   1 
ATOM   2159  O  O   . VAL A 1  471  ? 245.683 262.170 141.414 1.00 427.34 ?  471  VAL A O   1 
ATOM   2160  C  CB  . VAL A 1  471  ? 242.959 260.129 141.250 1.00 435.92 ?  471  VAL A CB  1 
ATOM   2161  C  CG1 . VAL A 1  471  ? 241.514 260.000 141.729 1.00 458.35 ?  471  VAL A CG1 1 
ATOM   2162  C  CG2 . VAL A 1  471  ? 243.006 260.799 139.878 1.00 427.41 ?  471  VAL A CG2 1 
ATOM   2163  N  N   . THR A 1  472  ? 246.037 259.969 141.807 1.00 396.72 ?  472  THR A N   1 
ATOM   2164  C  CA  . THR A 1  472  ? 247.404 259.945 141.283 1.00 401.54 ?  472  THR A CA  1 
ATOM   2165  C  C   . THR A 1  472  ? 247.608 258.741 140.342 1.00 459.58 ?  472  THR A C   1 
ATOM   2166  O  O   . THR A 1  472  ? 247.449 257.584 140.752 1.00 487.17 ?  472  THR A O   1 
ATOM   2167  C  CB  . THR A 1  472  ? 248.465 260.006 142.413 1.00 341.97 ?  472  THR A CB  1 
ATOM   2168  O  OG1 . THR A 1  472  ? 248.079 259.164 143.507 1.00 279.57 ?  472  THR A OG1 1 
ATOM   2169  C  CG2 . THR A 1  472  ? 248.627 261.434 142.936 1.00 305.18 ?  472  THR A CG2 1 
ATOM   2170  N  N   . ASN A 1  473  ? 247.930 259.037 139.079 1.00 490.69 ?  473  ASN A N   1 
ATOM   2171  C  CA  . ASN A 1  473  ? 248.027 258.033 138.010 1.00 496.92 ?  473  ASN A CA  1 
ATOM   2172  C  C   . ASN A 1  473  ? 249.360 257.284 137.983 1.00 500.00 ?  473  ASN A C   1 
ATOM   2173  O  O   . ASN A 1  473  ? 250.429 257.898 137.899 1.00 500.00 ?  473  ASN A O   1 
ATOM   2174  C  CB  . ASN A 1  473  ? 247.753 258.673 136.637 1.00 485.74 ?  473  ASN A CB  1 
ATOM   2175  C  CG  . ASN A 1  473  ? 246.279 258.971 136.397 1.00 478.92 ?  473  ASN A CG  1 
ATOM   2176  O  OD1 . ASN A 1  473  ? 245.461 258.964 137.318 1.00 469.00 ?  473  ASN A OD1 1 
ATOM   2177  N  ND2 . ASN A 1  473  ? 245.934 259.226 135.140 1.00 479.52 ?  473  ASN A ND2 1 
ATOM   2178  N  N   . ILE A 1  474  ? 249.273 255.958 138.075 1.00 500.00 ?  474  ILE A N   1 
ATOM   2179  C  CA  . ILE A 1  474  ? 250.418 255.052 137.906 1.00 500.00 ?  474  ILE A CA  1 
ATOM   2180  C  C   . ILE A 1  474  ? 250.128 254.192 136.656 1.00 500.00 ?  474  ILE A C   1 
ATOM   2181  O  O   . ILE A 1  474  ? 249.017 253.656 136.537 1.00 500.00 ?  474  ILE A O   1 
ATOM   2182  C  CB  . ILE A 1  474  ? 250.665 254.176 139.171 1.00 500.00 ?  474  ILE A CB  1 
ATOM   2183  C  CG1 . ILE A 1  474  ? 250.735 255.041 140.442 1.00 500.00 ?  474  ILE A CG1 1 
ATOM   2184  C  CG2 . ILE A 1  474  ? 251.946 253.352 139.044 1.00 500.00 ?  474  ILE A CG2 1 
ATOM   2185  C  CD1 . ILE A 1  474  ? 250.268 254.351 141.711 1.00 489.79 ?  474  ILE A CD1 1 
ATOM   2186  N  N   . PRO A 1  475  ? 251.101 254.088 135.711 1.00 500.00 ?  475  PRO A N   1 
ATOM   2187  C  CA  . PRO A 1  475  ? 250.908 253.339 134.448 1.00 500.00 ?  475  PRO A CA  1 
ATOM   2188  C  C   . PRO A 1  475  ? 250.664 251.820 134.603 1.00 500.00 ?  475  PRO A C   1 
ATOM   2189  O  O   . PRO A 1  475  ? 249.527 251.416 134.824 1.00 500.00 ?  475  PRO A O   1 
ATOM   2190  C  CB  . PRO A 1  475  ? 252.190 253.644 133.649 1.00 500.00 ?  475  PRO A CB  1 
ATOM   2191  C  CG  . PRO A 1  475  ? 253.184 254.099 134.662 1.00 500.00 ?  475  PRO A CG  1 
ATOM   2192  C  CD  . PRO A 1  475  ? 252.383 254.821 135.703 1.00 500.00 ?  475  PRO A CD  1 
ATOM   2193  N  N   . ALA A 1  476  ? 251.714 251.004 134.485 1.00 500.00 ?  476  ALA A N   1 
ATOM   2194  C  CA  . ALA A 1  476  ? 251.636 249.537 134.594 1.00 500.00 ?  476  ALA A CA  1 
ATOM   2195  C  C   . ALA A 1  476  ? 251.079 249.073 135.966 1.00 500.00 ?  476  ALA A C   1 
ATOM   2196  O  O   . ALA A 1  476  ? 251.226 249.815 136.941 1.00 500.00 ?  476  ALA A O   1 
ATOM   2197  C  CB  . ALA A 1  476  ? 253.022 248.948 134.345 1.00 500.00 ?  476  ALA A CB  1 
ATOM   2198  N  N   . LYS A 1  477  ? 250.417 247.907 136.095 1.00 500.00 ?  477  LYS A N   1 
ATOM   2199  C  CA  . LYS A 1  477  ? 249.935 246.963 135.052 1.00 500.00 ?  477  LYS A CA  1 
ATOM   2200  C  C   . LYS A 1  477  ? 248.817 246.067 135.634 1.00 500.00 ?  477  LYS A C   1 
ATOM   2201  O  O   . LYS A 1  477  ? 247.789 245.853 134.983 1.00 500.00 ?  477  LYS A O   1 
ATOM   2202  C  CB  . LYS A 1  477  ? 251.096 246.124 134.456 1.00 500.00 ?  477  LYS A CB  1 
ATOM   2203  C  CG  . LYS A 1  477  ? 250.888 244.629 134.226 1.00 500.00 ?  477  LYS A CG  1 
ATOM   2204  C  CD  . LYS A 1  477  ? 250.195 244.300 132.909 1.00 500.00 ?  477  LYS A CD  1 
ATOM   2205  C  CE  . LYS A 1  477  ? 250.051 242.794 132.720 1.00 483.65 ?  477  LYS A CE  1 
ATOM   2206  N  NZ  . LYS A 1  477  ? 249.177 242.146 133.741 1.00 477.76 ?  477  LYS A NZ  1 
ATOM   2207  N  N   . ASP A 1  478  ? 249.044 245.550 136.850 1.00 500.00 ?  478  ASP A N   1 
ATOM   2208  C  CA  . ASP A 1  478  ? 248.119 244.656 137.573 1.00 500.00 ?  478  ASP A CA  1 
ATOM   2209  C  C   . ASP A 1  478  ? 248.450 244.695 139.077 1.00 500.00 ?  478  ASP A C   1 
ATOM   2210  O  O   . ASP A 1  478  ? 249.459 244.136 139.516 1.00 500.00 ?  478  ASP A O   1 
ATOM   2211  C  CB  . ASP A 1  478  ? 248.186 243.223 137.004 1.00 500.00 ?  478  ASP A CB  1 
ATOM   2212  C  CG  . ASP A 1  478  ? 247.078 242.320 137.531 1.00 500.00 ?  478  ASP A CG  1 
ATOM   2213  O  OD1 . ASP A 1  478  ? 247.204 241.807 138.664 1.00 500.00 ?  478  ASP A OD1 1 
ATOM   2214  O  OD2 . ASP A 1  478  ? 246.089 242.099 136.799 1.00 500.00 -1 478  ASP A OD2 1 
ATOM   2215  N  N   . ALA A 1  479  ? 247.585 245.352 139.855 1.00 467.12 ?  479  ALA A N   1 
ATOM   2216  C  CA  . ALA A 1  479  ? 247.880 245.731 141.248 1.00 425.46 ?  479  ALA A CA  1 
ATOM   2217  C  C   . ALA A 1  479  ? 247.122 244.961 142.339 1.00 407.28 ?  479  ALA A C   1 
ATOM   2218  O  O   . ALA A 1  479  ? 246.068 244.372 142.082 1.00 403.24 ?  479  ALA A O   1 
ATOM   2219  C  CB  . ALA A 1  479  ? 247.679 247.233 141.429 1.00 397.46 ?  479  ALA A CB  1 
ATOM   2220  N  N   . ALA A 1  480  ? 247.695 244.973 143.549 1.00 399.91 ?  480  ALA A N   1 
ATOM   2221  C  CA  . ALA A 1  480  ? 247.107 244.405 144.780 1.00 390.57 ?  480  ALA A CA  1 
ATOM   2222  C  C   . ALA A 1  480  ? 247.720 245.089 146.026 1.00 371.66 ?  480  ALA A C   1 
ATOM   2223  O  O   . ALA A 1  480  ? 248.879 245.519 145.965 1.00 448.48 ?  480  ALA A O   1 
ATOM   2224  C  CB  . ALA A 1  480  ? 247.318 242.895 144.838 1.00 377.29 ?  480  ALA A CB  1 
ATOM   2225  N  N   . PRO A 1  481  ? 246.963 245.190 147.156 1.00 294.01 ?  481  PRO A N   1 
ATOM   2226  C  CA  . PRO A 1  481  ? 247.550 245.783 148.366 1.00 218.16 ?  481  PRO A CA  1 
ATOM   2227  C  C   . PRO A 1  481  ? 248.236 244.710 149.199 1.00 192.29 ?  481  PRO A C   1 
ATOM   2228  O  O   . PRO A 1  481  ? 248.211 243.536 148.822 1.00 176.72 ?  481  PRO A O   1 
ATOM   2229  C  CB  . PRO A 1  481  ? 246.320 246.243 149.115 1.00 209.50 ?  481  PRO A CB  1 
ATOM   2230  C  CG  . PRO A 1  481  ? 245.293 245.186 148.818 1.00 243.56 ?  481  PRO A CG  1 
ATOM   2231  C  CD  . PRO A 1  481  ? 245.599 244.674 147.432 1.00 278.37 ?  481  PRO A CD  1 
ATOM   2232  N  N   . VAL A 1  482  ? 248.827 245.107 150.322 1.00 208.58 ?  482  VAL A N   1 
ATOM   2233  C  CA  . VAL A 1  482  ? 249.090 244.160 151.425 1.00 229.65 ?  482  VAL A CA  1 
ATOM   2234  C  C   . VAL A 1  482  ? 248.447 244.679 152.731 1.00 241.40 ?  482  VAL A C   1 
ATOM   2235  O  O   . VAL A 1  482  ? 248.316 245.894 152.910 1.00 275.45 ?  482  VAL A O   1 
ATOM   2236  C  CB  . VAL A 1  482  ? 250.594 243.755 151.531 1.00 211.81 ?  482  VAL A CB  1 
ATOM   2237  C  CG1 . VAL A 1  482  ? 251.403 244.693 152.421 1.00 210.88 ?  482  VAL A CG1 1 
ATOM   2238  C  CG2 . VAL A 1  482  ? 250.716 242.325 152.017 1.00 178.81 ?  482  VAL A CG2 1 
ATOM   2239  N  N   . GLU A 1  483  ? 248.009 243.785 153.620 1.00 226.46 ?  483  GLU A N   1 
ATOM   2240  C  CA  . GLU A 1  483  ? 247.328 244.241 154.840 1.00 236.55 ?  483  GLU A CA  1 
ATOM   2241  C  C   . GLU A 1  483  ? 248.270 244.504 156.031 1.00 241.10 ?  483  GLU A C   1 
ATOM   2242  O  O   . GLU A 1  483  ? 248.091 245.500 156.739 1.00 252.81 ?  483  GLU A O   1 
ATOM   2243  C  CB  . GLU A 1  483  ? 246.174 243.312 155.241 1.00 265.28 ?  483  GLU A CB  1 
ATOM   2244  C  CG  . GLU A 1  483  ? 245.019 244.034 155.937 1.00 283.56 ?  483  GLU A CG  1 
ATOM   2245  C  CD  . GLU A 1  483  ? 244.456 243.272 157.132 1.00 303.28 ?  483  GLU A CD  1 
ATOM   2246  O  OE1 . GLU A 1  483  ? 245.163 243.152 158.160 1.00 295.91 -1 483  GLU A OE1 1 
ATOM   2247  O  OE2 . GLU A 1  483  ? 243.301 242.796 157.050 1.00 297.89 ?  483  GLU A OE2 1 
ATOM   2248  N  N   . LYS A 1  484  ? 249.267 243.637 156.235 1.00 219.10 ?  484  LYS A N   1 
ATOM   2249  C  CA  . LYS A 1  484  ? 250.155 243.720 157.410 1.00 207.32 ?  484  LYS A CA  1 
ATOM   2250  C  C   . LYS A 1  484  ? 251.052 244.957 157.445 1.00 218.89 ?  484  LYS A C   1 
ATOM   2251  O  O   . LYS A 1  484  ? 251.009 245.707 158.422 1.00 258.81 ?  484  LYS A O   1 
ATOM   2252  C  CB  . LYS A 1  484  ? 250.989 242.447 157.581 1.00 208.53 ?  484  LYS A CB  1 
ATOM   2253  N  N   . ILE A 1  485  ? 251.855 245.175 156.400 1.00 201.39 ?  485  ILE A N   1 
ATOM   2254  C  CA  . ILE A 1  485  ? 252.660 246.405 156.291 1.00 191.11 ?  485  ILE A CA  1 
ATOM   2255  C  C   . ILE A 1  485  ? 251.719 247.581 156.052 1.00 217.02 ?  485  ILE A C   1 
ATOM   2256  O  O   . ILE A 1  485  ? 251.875 248.633 156.667 1.00 236.79 ?  485  ILE A O   1 
ATOM   2257  C  CB  . ILE A 1  485  ? 253.710 246.363 155.154 1.00 169.66 ?  485  ILE A CB  1 
ATOM   2258  C  CG1 . ILE A 1  485  ? 254.406 245.008 155.099 1.00 181.30 ?  485  ILE A CG1 1 
ATOM   2259  C  CG2 . ILE A 1  485  ? 254.763 247.450 155.353 1.00 175.98 ?  485  ILE A CG2 1 
ATOM   2260  C  CD1 . ILE A 1  485  ? 254.967 244.666 153.741 1.00 172.64 ?  485  ILE A CD1 1 
ATOM   2261  N  N   . ASP A 1  486  ? 250.714 247.346 155.204 1.00 244.77 ?  486  ASP A N   1 
ATOM   2262  C  CA  . ASP A 1  486  ? 249.789 248.353 154.657 1.00 256.94 ?  486  ASP A CA  1 
ATOM   2263  C  C   . ASP A 1  486  ? 250.465 249.133 153.521 1.00 276.13 ?  486  ASP A C   1 
ATOM   2264  O  O   . ASP A 1  486  ? 250.549 250.364 153.561 1.00 247.26 ?  486  ASP A O   1 
ATOM   2265  C  CB  . ASP A 1  486  ? 249.180 249.261 155.746 1.00 247.44 ?  486  ASP A CB  1 
ATOM   2266  N  N   . THR A 1  487  ? 250.957 248.381 152.525 1.00 333.90 ?  487  THR A N   1 
ATOM   2267  C  CA  . THR A 1  487  ? 251.676 248.908 151.344 1.00 367.21 ?  487  THR A CA  1 
ATOM   2268  C  C   . THR A 1  487  ? 251.308 248.145 150.042 1.00 377.76 ?  487  THR A C   1 
ATOM   2269  O  O   . THR A 1  487  ? 251.500 246.931 149.948 1.00 372.02 ?  487  THR A O   1 
ATOM   2270  C  CB  . THR A 1  487  ? 253.227 248.909 151.536 1.00 374.10 ?  487  THR A CB  1 
ATOM   2271  O  OG1 . THR A 1  487  ? 253.690 247.586 151.833 1.00 364.53 ?  487  THR A OG1 1 
ATOM   2272  C  CG2 . THR A 1  487  ? 253.699 249.879 152.645 1.00 386.01 ?  487  THR A CG2 1 
ATOM   2273  N  N   . MET A 1  488  ? 250.799 248.878 149.049 1.00 390.70 ?  488  MET A N   1 
ATOM   2274  C  CA  . MET A 1  488  ? 250.323 248.331 147.758 1.00 408.45 ?  488  MET A CA  1 
ATOM   2275  C  C   . MET A 1  488  ? 251.446 247.939 146.763 1.00 431.32 ?  488  MET A C   1 
ATOM   2276  O  O   . MET A 1  488  ? 252.396 248.697 146.581 1.00 480.00 ?  488  MET A O   1 
ATOM   2277  C  CB  . MET A 1  488  ? 249.354 249.350 147.117 1.00 404.63 ?  488  MET A CB  1 
ATOM   2278  C  CG  . MET A 1  488  ? 248.875 249.038 145.698 1.00 404.13 ?  488  MET A CG  1 
ATOM   2279  S  SD  . MET A 1  488  ? 248.217 250.422 144.737 1.00 393.37 ?  488  MET A SD  1 
ATOM   2280  C  CE  . MET A 1  488  ? 249.662 251.466 144.522 1.00 370.73 ?  488  MET A CE  1 
ATOM   2281  N  N   . LEU A 1  489  ? 251.317 246.767 146.120 1.00 372.04 ?  489  LEU A N   1 
ATOM   2282  C  CA  . LEU A 1  489  ? 252.208 246.315 145.016 1.00 284.29 ?  489  LEU A CA  1 
ATOM   2283  C  C   . LEU A 1  489  ? 251.646 246.455 143.618 1.00 331.44 ?  489  LEU A C   1 
ATOM   2284  O  O   . LEU A 1  489  ? 250.450 246.218 143.390 1.00 380.62 ?  489  LEU A O   1 
ATOM   2285  C  CB  . LEU A 1  489  ? 252.517 244.837 145.130 1.00 184.38 ?  489  LEU A CB  1 
ATOM   2286  C  CG  . LEU A 1  489  ? 253.458 244.334 146.169 1.00 171.57 ?  489  LEU A CG  1 
ATOM   2287  C  CD1 . LEU A 1  489  ? 253.360 242.829 146.091 1.00 184.10 ?  489  LEU A CD1 1 
ATOM   2288  C  CD2 . LEU A 1  489  ? 254.833 244.826 145.793 1.00 183.33 ?  489  LEU A CD2 1 
ATOM   2289  N  N   . VAL A 1  490  ? 252.538 246.794 142.685 1.00 375.82 ?  490  VAL A N   1 
ATOM   2290  C  CA  . VAL A 1  490  ? 252.269 246.729 141.240 1.00 433.70 ?  490  VAL A CA  1 
ATOM   2291  C  C   . VAL A 1  490  ? 253.486 246.115 140.522 1.00 461.98 ?  490  VAL A C   1 
ATOM   2292  O  O   . VAL A 1  490  ? 254.579 246.051 141.094 1.00 466.46 ?  490  VAL A O   1 
ATOM   2293  C  CB  . VAL A 1  490  ? 251.878 248.111 140.608 1.00 442.64 ?  490  VAL A CB  1 
ATOM   2294  C  CG1 . VAL A 1  490  ? 250.976 248.942 141.517 1.00 441.20 ?  490  VAL A CG1 1 
ATOM   2295  C  CG2 . VAL A 1  490  ? 253.101 248.924 140.203 1.00 440.88 ?  490  VAL A CG2 1 
ATOM   2296  N  N   . LEU A 1  491  ? 253.290 245.670 139.277 1.00 488.83 ?  491  LEU A N   1 
ATOM   2297  C  CA  . LEU A 1  491  ? 254.401 245.264 138.401 1.00 495.64 ?  491  LEU A CA  1 
ATOM   2298  C  C   . LEU A 1  491  ? 254.547 246.217 137.199 1.00 500.00 ?  491  LEU A C   1 
ATOM   2299  O  O   . LEU A 1  491  ? 253.678 246.268 136.320 1.00 500.00 ?  491  LEU A O   1 
ATOM   2300  C  CB  . LEU A 1  491  ? 254.273 243.791 137.963 1.00 471.24 ?  491  LEU A CB  1 
ATOM   2301  C  CG  . LEU A 1  491  ? 253.207 243.347 136.947 1.00 448.40 ?  491  LEU A CG  1 
ATOM   2302  C  CD1 . LEU A 1  491  ? 253.689 242.179 136.105 1.00 430.55 ?  491  LEU A CD1 1 
ATOM   2303  C  CD2 . LEU A 1  491  ? 251.868 243.044 137.599 1.00 442.53 ?  491  LEU A CD2 1 
ATOM   2304  N  N   . GLU A 1  492  ? 255.648 246.971 137.181 1.00 500.00 ?  492  GLU A N   1 
ATOM   2305  C  CA  . GLU A 1  492  ? 255.892 247.988 136.152 1.00 500.00 ?  492  GLU A CA  1 
ATOM   2306  C  C   . GLU A 1  492  ? 256.703 247.452 134.973 1.00 500.00 ?  492  GLU A C   1 
ATOM   2307  O  O   . GLU A 1  492  ? 257.705 246.753 135.168 1.00 500.00 ?  492  GLU A O   1 
ATOM   2308  C  CB  . GLU A 1  492  ? 256.565 249.224 136.754 1.00 500.00 ?  492  GLU A CB  1 
ATOM   2309  N  N   . GLY A 1  493  ? 256.260 247.785 133.758 1.00 500.00 ?  493  GLY A N   1 
ATOM   2310  C  CA  . GLY A 1  493  ? 256.912 247.348 132.520 1.00 500.00 ?  493  GLY A CA  1 
ATOM   2311  C  C   . GLY A 1  493  ? 256.881 245.841 132.341 1.00 500.00 ?  493  GLY A C   1 
ATOM   2312  O  O   . GLY A 1  493  ? 255.816 245.224 132.420 1.00 500.00 ?  493  GLY A O   1 
ATOM   2313  N  N   . SER A 1  494  ? 258.059 245.258 132.117 1.00 500.00 ?  494  SER A N   1 
ATOM   2314  C  CA  . SER A 1  494  ? 258.208 243.810 131.951 1.00 500.00 ?  494  SER A CA  1 
ATOM   2315  C  C   . SER A 1  494  ? 259.006 243.184 133.100 1.00 500.00 ?  494  SER A C   1 
ATOM   2316  O  O   . SER A 1  494  ? 260.213 243.421 133.238 1.00 500.00 ?  494  SER A O   1 
ATOM   2317  C  CB  . SER A 1  494  ? 258.847 243.481 130.596 1.00 500.00 ?  494  SER A CB  1 
ATOM   2318  N  N   . GLY A 1  495  ? 258.305 242.409 133.928 1.00 500.00 ?  495  GLY A N   1 
ATOM   2319  C  CA  . GLY A 1  495  ? 258.902 241.633 135.024 1.00 500.00 ?  495  GLY A CA  1 
ATOM   2320  C  C   . GLY A 1  495  ? 259.615 242.397 136.130 1.00 500.00 ?  495  GLY A C   1 
ATOM   2321  O  O   . GLY A 1  495  ? 260.501 241.844 136.790 1.00 500.00 ?  495  GLY A O   1 
ATOM   2322  N  N   . ASN A 1  496  ? 259.227 243.657 136.335 1.00 500.00 ?  496  ASN A N   1 
ATOM   2323  C  CA  . ASN A 1  496  ? 259.837 244.516 137.355 1.00 500.00 ?  496  ASN A CA  1 
ATOM   2324  C  C   . ASN A 1  496  ? 258.832 244.931 138.440 1.00 500.00 ?  496  ASN A C   1 
ATOM   2325  O  O   . ASN A 1  496  ? 258.264 246.029 138.401 1.00 500.00 ?  496  ASN A O   1 
ATOM   2326  C  CB  . ASN A 1  496  ? 260.526 245.728 136.698 1.00 500.00 ?  496  ASN A CB  1 
ATOM   2327  C  CG  . ASN A 1  496  ? 261.484 246.453 137.637 1.00 500.00 ?  496  ASN A CG  1 
ATOM   2328  O  OD1 . ASN A 1  496  ? 262.135 245.842 138.486 1.00 488.46 ?  496  ASN A OD1 1 
ATOM   2329  N  ND2 . ASN A 1  496  ? 261.586 247.768 137.470 1.00 496.82 ?  496  ASN A ND2 1 
ATOM   2330  N  N   . LEU A 1  497  ? 258.627 244.029 139.401 1.00 500.00 ?  497  LEU A N   1 
ATOM   2331  C  CA  . LEU A 1  497  ? 257.659 244.201 140.492 1.00 500.00 ?  497  LEU A CA  1 
ATOM   2332  C  C   . LEU A 1  497  ? 258.134 245.256 141.495 1.00 500.00 ?  497  LEU A C   1 
ATOM   2333  O  O   . LEU A 1  497  ? 259.273 245.193 141.972 1.00 500.00 ?  497  LEU A O   1 
ATOM   2334  C  CB  . LEU A 1  497  ? 257.444 242.864 141.208 1.00 455.13 ?  497  LEU A CB  1 
ATOM   2335  C  CG  . LEU A 1  497  ? 256.083 242.389 141.731 1.00 414.65 ?  497  LEU A CG  1 
ATOM   2336  C  CD1 . LEU A 1  497  ? 256.303 241.058 142.422 1.00 405.75 ?  497  LEU A CD1 1 
ATOM   2337  C  CD2 . LEU A 1  497  ? 255.386 243.353 142.680 1.00 363.13 ?  497  LEU A CD2 1 
ATOM   2338  N  N   . VAL A 1  498  ? 257.254 246.213 141.803 1.00 500.00 ?  498  VAL A N   1 
ATOM   2339  C  CA  . VAL A 1  498  ? 257.561 247.335 142.718 1.00 486.03 ?  498  VAL A CA  1 
ATOM   2340  C  C   . VAL A 1  498  ? 256.484 247.576 143.789 1.00 462.01 ?  498  VAL A C   1 
ATOM   2341  O  O   . VAL A 1  498  ? 255.317 247.207 143.604 1.00 438.30 ?  498  VAL A O   1 
ATOM   2342  C  CB  . VAL A 1  498  ? 257.881 248.669 141.973 1.00 476.87 ?  498  VAL A CB  1 
ATOM   2343  C  CG1 . VAL A 1  498  ? 259.256 248.617 141.321 1.00 456.23 ?  498  VAL A CG1 1 
ATOM   2344  C  CG2 . VAL A 1  498  ? 256.798 249.047 140.961 1.00 472.66 ?  498  VAL A CG2 1 
ATOM   2345  N  N   . LEU A 1  499  ? 256.900 248.195 144.899 1.00 423.92 ?  499  LEU A N   1 
ATOM   2346  C  CA  . LEU A 1  499  ? 256.023 248.490 146.041 1.00 387.01 ?  499  LEU A CA  1 
ATOM   2347  C  C   . LEU A 1  499  ? 255.783 249.991 146.238 1.00 440.56 ?  499  LEU A C   1 
ATOM   2348  O  O   . LEU A 1  499  ? 256.719 250.796 146.162 1.00 476.60 ?  499  LEU A O   1 
ATOM   2349  C  CB  . LEU A 1  499  ? 256.586 247.866 147.334 1.00 270.49 ?  499  LEU A CB  1 
ATOM   2350  C  CG  . LEU A 1  499  ? 255.834 248.054 148.661 1.00 201.62 ?  499  LEU A CG  1 
ATOM   2351  C  CD1 . LEU A 1  499  ? 254.536 247.266 148.668 1.00 161.43 ?  499  LEU A CD1 1 
ATOM   2352  C  CD2 . LEU A 1  499  ? 256.706 247.625 149.818 1.00 208.78 ?  499  LEU A CD2 1 
ATOM   2353  N  N   . TYR A 1  500  ? 254.522 250.344 146.495 1.00 479.28 ?  500  TYR A N   1 
ATOM   2354  C  CA  . TYR A 1  500  ? 254.119 251.710 146.839 1.00 498.84 ?  500  TYR A CA  1 
ATOM   2355  C  C   . TYR A 1  500  ? 253.448 251.760 148.221 1.00 500.00 ?  500  TYR A C   1 
ATOM   2356  O  O   . TYR A 1  500  ? 252.489 251.019 148.469 1.00 500.00 ?  500  TYR A O   1 
ATOM   2357  C  CB  . TYR A 1  500  ? 253.185 252.303 145.762 1.00 470.40 ?  500  TYR A CB  1 
ATOM   2358  C  CG  . TYR A 1  500  ? 253.739 252.320 144.342 1.00 457.49 ?  500  TYR A CG  1 
ATOM   2359  C  CD1 . TYR A 1  500  ? 254.931 252.993 144.033 1.00 459.83 ?  500  TYR A CD1 1 
ATOM   2360  C  CD2 . TYR A 1  500  ? 253.059 251.683 143.297 1.00 449.49 ?  500  TYR A CD2 1 
ATOM   2361  C  CE1 . TYR A 1  500  ? 255.435 253.015 142.736 1.00 457.74 ?  500  TYR A CE1 1 
ATOM   2362  C  CE2 . TYR A 1  500  ? 253.551 251.711 141.997 1.00 451.14 ?  500  TYR A CE2 1 
ATOM   2363  C  CZ  . TYR A 1  500  ? 254.739 252.369 141.721 1.00 455.09 ?  500  TYR A CZ  1 
ATOM   2364  O  OH  . TYR A 1  500  ? 255.231 252.388 140.435 1.00 455.37 ?  500  TYR A OH  1 
ATOM   2365  N  N   . THR A 1  501  ? 253.962 252.620 149.111 1.00 500.00 ?  501  THR A N   1 
ATOM   2366  C  CA  . THR A 1  501  ? 253.358 252.862 150.441 1.00 500.00 ?  501  THR A CA  1 
ATOM   2367  C  C   . THR A 1  501  ? 251.911 253.357 150.266 1.00 500.00 ?  501  THR A C   1 
ATOM   2368  O  O   . THR A 1  501  ? 250.963 252.752 150.787 1.00 500.00 ?  501  THR A O   1 
ATOM   2369  C  CB  . THR A 1  501  ? 254.211 253.825 151.324 1.00 500.00 ?  501  THR A CB  1 
ATOM   2370  O  OG1 . THR A 1  501  ? 255.471 253.215 151.631 1.00 500.00 ?  501  THR A OG1 1 
ATOM   2371  C  CG2 . THR A 1  501  ? 253.515 254.123 152.657 1.00 500.00 ?  501  THR A CG2 1 
ATOM   2372  N  N   . GLY A 1  502  ? 251.772 254.441 149.506 1.00 500.00 ?  502  GLY A N   1 
ATOM   2373  C  CA  . GLY A 1  502  ? 250.489 254.919 149.011 1.00 500.00 ?  502  GLY A CA  1 
ATOM   2374  C  C   . GLY A 1  502  ? 250.677 255.419 147.591 1.00 500.00 ?  502  GLY A C   1 
ATOM   2375  O  O   . GLY A 1  502  ? 250.419 254.693 146.626 1.00 500.00 ?  502  GLY A O   1 
ATOM   2376  N  N   . VAL A 1  503  ? 251.146 256.660 147.482 1.00 500.00 ?  503  VAL A N   1 
ATOM   2377  C  CA  . VAL A 1  503  ? 251.468 257.301 146.201 1.00 500.00 ?  503  VAL A CA  1 
ATOM   2378  C  C   . VAL A 1  503  ? 252.935 257.034 145.822 1.00 500.00 ?  503  VAL A C   1 
ATOM   2379  O  O   . VAL A 1  503  ? 253.262 256.866 144.642 1.00 500.00 ?  503  VAL A O   1 
ATOM   2380  C  CB  . VAL A 1  503  ? 251.207 258.836 146.249 1.00 500.00 ?  503  VAL A CB  1 
ATOM   2381  C  CG1 . VAL A 1  503  ? 251.322 259.468 144.867 1.00 500.00 ?  503  VAL A CG1 1 
ATOM   2382  C  CG2 . VAL A 1  503  ? 249.840 259.152 146.847 1.00 500.00 ?  503  VAL A CG2 1 
ATOM   2383  N  N   . VAL A 1  504  ? 253.796 256.963 146.838 1.00 500.00 ?  504  VAL A N   1 
ATOM   2384  C  CA  . VAL A 1  504  ? 255.263 257.005 146.666 1.00 500.00 ?  504  VAL A CA  1 
ATOM   2385  C  C   . VAL A 1  504  ? 255.925 255.637 146.458 1.00 500.00 ?  504  VAL A C   1 
ATOM   2386  O  O   . VAL A 1  504  ? 255.365 254.614 146.842 1.00 500.00 ?  504  VAL A O   1 
ATOM   2387  C  CB  . VAL A 1  504  ? 255.948 257.781 147.818 1.00 500.00 ?  504  VAL A CB  1 
ATOM   2388  C  CG1 . VAL A 1  504  ? 255.530 259.243 147.768 1.00 500.00 ?  504  VAL A CG1 1 
ATOM   2389  C  CG2 . VAL A 1  504  ? 255.645 257.151 149.181 1.00 500.00 ?  504  VAL A CG2 1 
ATOM   2390  N  N   . ARG A 1  505  ? 257.125 255.647 145.871 1.00 500.00 ?  505  ARG A N   1 
ATOM   2391  C  CA  . ARG A 1  505  ? 257.821 254.431 145.425 1.00 500.00 ?  505  ARG A CA  1 
ATOM   2392  C  C   . ARG A 1  505  ? 258.852 253.902 146.435 1.00 500.00 ?  505  ARG A C   1 
ATOM   2393  O  O   . ARG A 1  505  ? 259.902 254.517 146.650 1.00 500.00 ?  505  ARG A O   1 
ATOM   2394  C  CB  . ARG A 1  505  ? 258.455 254.675 144.047 1.00 498.17 ?  505  ARG A CB  1 
ATOM   2395  C  CG  . ARG A 1  505  ? 258.975 253.440 143.327 1.00 474.07 ?  505  ARG A CG  1 
ATOM   2396  C  CD  . ARG A 1  505  ? 259.267 253.772 141.872 1.00 465.09 ?  505  ARG A CD  1 
ATOM   2397  N  NE  . ARG A 1  505  ? 259.966 252.695 141.171 1.00 459.54 ?  505  ARG A NE  1 
ATOM   2398  C  CZ  . ARG A 1  505  ? 260.330 252.730 139.888 1.00 461.17 ?  505  ARG A CZ  1 
ATOM   2399  N  NH1 . ARG A 1  505  ? 260.068 253.791 139.132 1.00 461.13 ?  505  ARG A NH1 1 
ATOM   2400  N  NH2 . ARG A 1  505  ? 260.963 251.695 139.355 1.00 462.81 ?  505  ARG A NH2 1 
ATOM   2401  N  N   . VAL A 1  506  ? 258.537 252.751 147.032 1.00 500.00 ?  506  VAL A N   1 
ATOM   2402  C  CA  . VAL A 1  506  ? 259.380 252.123 148.065 1.00 485.62 ?  506  VAL A CA  1 
ATOM   2403  C  C   . VAL A 1  506  ? 260.645 251.485 147.473 1.00 457.74 ?  506  VAL A C   1 
ATOM   2404  O  O   . VAL A 1  506  ? 261.736 251.643 148.028 1.00 409.13 ?  506  VAL A O   1 
ATOM   2405  C  CB  . VAL A 1  506  ? 258.603 251.100 148.941 1.00 485.35 ?  506  VAL A CB  1 
ATOM   2406  C  CG1 . VAL A 1  506  ? 259.439 250.657 150.135 1.00 480.00 ?  506  VAL A CG1 1 
ATOM   2407  C  CG2 . VAL A 1  506  ? 257.289 251.688 149.437 1.00 480.00 ?  506  VAL A CG2 1 
ATOM   2408  N  N   . GLY A 1  507  ? 260.489 250.777 146.355 1.00 455.49 ?  507  GLY A N   1 
ATOM   2409  C  CA  . GLY A 1  507  ? 261.607 250.107 145.685 1.00 441.47 ?  507  GLY A CA  1 
ATOM   2410  C  C   . GLY A 1  507  ? 261.238 248.795 145.018 1.00 430.68 ?  507  GLY A C   1 
ATOM   2411  O  O   . GLY A 1  507  ? 260.132 248.274 145.209 1.00 441.50 ?  507  GLY A O   1 
ATOM   2412  N  N   . LYS A 1  508  ? 262.172 248.260 144.235 1.00 407.47 ?  508  LYS A N   1 
ATOM   2413  C  CA  . LYS A 1  508  ? 261.949 247.008 143.515 1.00 394.00 ?  508  LYS A CA  1 
ATOM   2414  C  C   . LYS A 1  508  ? 262.124 245.781 144.429 1.00 413.28 ?  508  LYS A C   1 
ATOM   2415  O  O   . LYS A 1  508  ? 263.232 245.504 144.912 1.00 452.99 ?  508  LYS A O   1 
ATOM   2416  C  CB  . LYS A 1  508  ? 262.783 246.953 142.209 1.00 361.69 ?  508  LYS A CB  1 
ATOM   2417  C  CG  . LYS A 1  508  ? 264.262 246.587 142.316 1.00 333.07 ?  508  LYS A CG  1 
ATOM   2418  C  CD  . LYS A 1  508  ? 264.483 245.164 141.819 1.00 314.37 ?  508  LYS A CD  1 
ATOM   2419  C  CE  . LYS A 1  508  ? 265.839 244.622 142.232 1.00 297.49 ?  508  LYS A CE  1 
ATOM   2420  N  NZ  . LYS A 1  508  ? 265.972 243.172 141.915 1.00 281.89 ?  508  LYS A NZ  1 
ATOM   2421  N  N   . VAL A 1  509  ? 261.009 245.092 144.696 1.00 390.92 ?  509  VAL A N   1 
ATOM   2422  C  CA  . VAL A 1  509  ? 261.013 243.794 145.403 1.00 344.77 ?  509  VAL A CA  1 
ATOM   2423  C  C   . VAL A 1  509  ? 261.684 242.726 144.523 1.00 399.55 ?  509  VAL A C   1 
ATOM   2424  O  O   . VAL A 1  509  ? 261.499 242.715 143.300 1.00 434.56 ?  509  VAL A O   1 
ATOM   2425  C  CB  . VAL A 1  509  ? 259.598 243.372 145.918 1.00 265.02 ?  509  VAL A CB  1 
ATOM   2426  C  CG1 . VAL A 1  509  ? 258.573 243.258 144.788 1.00 247.49 ?  509  VAL A CG1 1 
ATOM   2427  C  CG2 . VAL A 1  509  ? 259.659 242.084 146.731 1.00 226.84 ?  509  VAL A CG2 1 
ATOM   2428  N  N   . PHE A 1  510  ? 262.476 241.864 145.160 1.00 446.70 ?  510  PHE A N   1 
ATOM   2429  C  CA  . PHE A 1  510  ? 263.302 240.866 144.478 1.00 500.00 ?  510  PHE A CA  1 
ATOM   2430  C  C   . PHE A 1  510  ? 263.028 239.460 145.008 1.00 500.00 ?  510  PHE A C   1 
ATOM   2431  O  O   . PHE A 1  510  ? 262.968 239.243 146.225 1.00 500.00 ?  510  PHE A O   1 
ATOM   2432  C  CB  . PHE A 1  510  ? 264.794 241.245 144.601 1.00 500.00 ?  510  PHE A CB  1 
ATOM   2433  C  CG  . PHE A 1  510  ? 265.759 240.128 144.271 1.00 491.53 ?  510  PHE A CG  1 
ATOM   2434  C  CD1 . PHE A 1  510  ? 265.989 239.738 142.945 1.00 483.06 ?  510  PHE A CD1 1 
ATOM   2435  C  CD2 . PHE A 1  510  ? 266.468 239.482 145.291 1.00 487.41 ?  510  PHE A CD2 1 
ATOM   2436  C  CE1 . PHE A 1  510  ? 266.887 238.715 142.649 1.00 475.18 ?  510  PHE A CE1 1 
ATOM   2437  C  CE2 . PHE A 1  510  ? 267.367 238.460 144.999 1.00 479.72 ?  510  PHE A CE2 1 
ATOM   2438  C  CZ  . PHE A 1  510  ? 267.576 238.076 143.677 1.00 475.24 ?  510  PHE A CZ  1 
ATOM   2439  N  N   . ILE A 1  511  ? 262.858 238.525 144.073 1.00 500.00 ?  511  ILE A N   1 
ATOM   2440  C  CA  . ILE A 1  511  ? 262.684 237.099 144.375 1.00 500.00 ?  511  ILE A CA  1 
ATOM   2441  C  C   . ILE A 1  511  ? 263.978 236.311 144.099 1.00 500.00 ?  511  ILE A C   1 
ATOM   2442  O  O   . ILE A 1  511  ? 264.567 236.456 143.021 1.00 500.00 ?  511  ILE A O   1 
ATOM   2443  C  CB  . ILE A 1  511  ? 261.461 236.470 143.646 1.00 500.00 ?  511  ILE A CB  1 
ATOM   2444  C  CG1 . ILE A 1  511  ? 261.441 236.815 142.144 1.00 500.00 ?  511  ILE A CG1 1 
ATOM   2445  C  CG2 . ILE A 1  511  ? 260.170 236.922 144.313 1.00 500.00 ?  511  ILE A CG2 1 
ATOM   2446  C  CD1 . ILE A 1  511  ? 260.698 235.819 141.273 1.00 500.00 ?  511  ILE A CD1 1 
ATOM   2447  N  N   . PRO A 1  512  ? 264.443 235.508 145.087 1.00 500.00 ?  512  PRO A N   1 
ATOM   2448  C  CA  . PRO A 1  512  ? 265.639 234.661 144.904 1.00 500.00 ?  512  PRO A CA  1 
ATOM   2449  C  C   . PRO A 1  512  ? 265.513 233.554 143.837 1.00 500.00 ?  512  PRO A C   1 
ATOM   2450  O  O   . PRO A 1  512  ? 266.508 233.233 143.178 1.00 500.00 ?  512  PRO A O   1 
ATOM   2451  C  CB  . PRO A 1  512  ? 265.852 234.051 146.295 1.00 500.00 ?  512  PRO A CB  1 
ATOM   2452  C  CG  . PRO A 1  512  ? 265.238 235.035 147.231 1.00 500.00 ?  512  PRO A CG  1 
ATOM   2453  C  CD  . PRO A 1  512  ? 264.029 235.552 146.506 1.00 500.00 ?  512  PRO A CD  1 
ATOM   2454  N  N   . GLY A 1  513  ? 264.311 232.992 143.676 1.00 500.00 ?  513  GLY A N   1 
ATOM   2455  C  CA  . GLY A 1  513  ? 264.049 231.914 142.712 1.00 500.00 ?  513  GLY A CA  1 
ATOM   2456  C  C   . GLY A 1  513  ? 264.081 232.398 141.263 1.00 500.00 ?  513  GLY A C   1 
ATOM   2457  O  O   . GLY A 1  513  ? 263.549 233.459 140.934 1.00 500.00 ?  513  GLY A O   1 
ATOM   2458  N  N   . THR A 1  582  ? 257.984 236.896 130.584 1.00 500.00 ?  582  THR A N   1 
ATOM   2459  C  CA  . THR A 1  582  ? 257.593 238.274 130.904 1.00 500.00 ?  582  THR A CA  1 
ATOM   2460  C  C   . THR A 1  582  ? 258.478 239.045 131.925 1.00 500.00 ?  582  THR A C   1 
ATOM   2461  O  O   . THR A 1  582  ? 258.730 240.229 131.695 1.00 500.00 ?  582  THR A O   1 
ATOM   2462  C  CB  . THR A 1  582  ? 256.090 238.404 131.275 1.00 500.00 ?  582  THR A CB  1 
ATOM   2463  O  OG1 . THR A 1  582  ? 255.718 237.374 132.199 1.00 500.00 ?  582  THR A OG1 1 
ATOM   2464  C  CG2 . THR A 1  582  ? 255.213 238.307 130.029 1.00 500.00 ?  582  THR A CG2 1 
ATOM   2465  N  N   . TYR A 1  583  ? 258.958 238.443 133.026 1.00 500.00 ?  583  TYR A N   1 
ATOM   2466  C  CA  . TYR A 1  583  ? 258.778 237.038 133.432 1.00 500.00 ?  583  TYR A CA  1 
ATOM   2467  C  C   . TYR A 1  583  ? 258.241 236.935 134.870 1.00 500.00 ?  583  TYR A C   1 
ATOM   2468  O  O   . TYR A 1  583  ? 258.986 236.611 135.808 1.00 500.00 ?  583  TYR A O   1 
ATOM   2469  C  CB  . TYR A 1  583  ? 260.097 236.262 133.257 1.00 500.00 ?  583  TYR A CB  1 
ATOM   2470  C  CG  . TYR A 1  583  ? 259.957 234.752 133.282 1.00 500.00 ?  583  TYR A CG  1 
ATOM   2471  C  CD1 . TYR A 1  583  ? 259.553 234.047 132.140 1.00 500.00 ?  583  TYR A CD1 1 
ATOM   2472  C  CD2 . TYR A 1  583  ? 260.244 234.021 134.442 1.00 500.00 ?  583  TYR A CD2 1 
ATOM   2473  C  CE1 . TYR A 1  583  ? 259.427 232.662 132.157 1.00 500.00 ?  583  TYR A CE1 1 
ATOM   2474  C  CE2 . TYR A 1  583  ? 260.121 232.636 134.470 1.00 500.00 ?  583  TYR A CE2 1 
ATOM   2475  C  CZ  . TYR A 1  583  ? 259.713 231.962 133.327 1.00 500.00 ?  583  TYR A CZ  1 
ATOM   2476  O  OH  . TYR A 1  583  ? 259.591 230.592 133.350 1.00 500.00 ?  583  TYR A OH  1 
ATOM   2477  N  N   . ILE A 1  584  ? 256.946 237.234 135.030 1.00 500.00 ?  584  ILE A N   1 
ATOM   2478  C  CA  . ILE A 1  584  ? 256.250 237.178 136.334 1.00 500.00 ?  584  ILE A CA  1 
ATOM   2479  C  C   . ILE A 1  584  ? 254.705 237.144 136.215 1.00 500.00 ?  584  ILE A C   1 
ATOM   2480  O  O   . ILE A 1  584  ? 254.023 236.785 137.174 1.00 500.00 ?  584  ILE A O   1 
ATOM   2481  C  CB  . ILE A 1  584  ? 256.754 238.297 137.307 1.00 500.00 ?  584  ILE A CB  1 
ATOM   2482  C  CG1 . ILE A 1  584  ? 256.817 237.784 138.753 1.00 500.00 ?  584  ILE A CG1 1 
ATOM   2483  C  CG2 . ILE A 1  584  ? 255.962 239.594 137.162 1.00 500.00 ?  584  ILE A CG2 1 
ATOM   2484  C  CD1 . ILE A 1  584  ? 257.915 238.408 139.594 1.00 500.00 ?  584  ILE A CD1 1 
ATOM   2485  N  N   . HIS A 1  585  ? 254.197 237.527 135.036 1.00 500.00 ?  585  HIS A N   1 
ATOM   2486  C  CA  . HIS A 1  585  ? 252.757 237.549 134.642 1.00 500.00 ?  585  HIS A CA  1 
ATOM   2487  C  C   . HIS A 1  585  ? 251.782 238.449 135.445 1.00 500.00 ?  585  HIS A C   1 
ATOM   2488  O  O   . HIS A 1  585  ? 251.362 239.489 134.922 1.00 500.00 ?  585  HIS A O   1 
ATOM   2489  C  CB  . HIS A 1  585  ? 252.198 236.129 134.363 1.00 500.00 ?  585  HIS A CB  1 
ATOM   2490  C  CG  . HIS A 1  585  ? 250.789 236.107 133.839 1.00 500.00 ?  585  HIS A CG  1 
ATOM   2491  N  ND1 . HIS A 1  585  ? 249.867 235.155 134.225 1.00 500.00 ?  585  HIS A ND1 1 
ATOM   2492  C  CD2 . HIS A 1  585  ? 250.148 236.916 132.961 1.00 500.00 ?  585  HIS A CD2 1 
ATOM   2493  C  CE1 . HIS A 1  585  ? 248.720 235.380 133.608 1.00 500.00 ?  585  HIS A CE1 1 
ATOM   2494  N  NE2 . HIS A 1  585  ? 248.864 236.442 132.836 1.00 500.00 ?  585  HIS A NE2 1 
ATOM   2495  N  N   . SER A 1  586  ? 251.408 238.047 136.667 1.00 500.00 ?  586  SER A N   1 
ATOM   2496  C  CA  . SER A 1  586  ? 250.460 238.819 137.505 1.00 500.00 ?  586  SER A CA  1 
ATOM   2497  C  C   . SER A 1  586  ? 250.493 238.499 139.004 1.00 500.00 ?  586  SER A C   1 
ATOM   2498  O  O   . SER A 1  586  ? 250.785 237.366 139.410 1.00 500.00 ?  586  SER A O   1 
ATOM   2499  C  CB  . SER A 1  586  ? 249.014 238.681 136.993 1.00 500.00 ?  586  SER A CB  1 
ATOM   2500  O  OG  . SER A 1  586  ? 248.532 237.358 137.154 1.00 500.00 ?  586  SER A OG  1 
ATOM   2501  N  N   . ILE A 1  587  ? 250.182 239.521 139.802 1.00 500.00 ?  587  ILE A N   1 
ATOM   2502  C  CA  . ILE A 1  587  ? 249.922 239.398 141.242 1.00 500.00 ?  587  ILE A CA  1 
ATOM   2503  C  C   . ILE A 1  587  ? 248.490 238.859 141.435 1.00 500.00 ?  587  ILE A C   1 
ATOM   2504  O  O   . ILE A 1  587  ? 247.618 239.088 140.589 1.00 500.00 ?  587  ILE A O   1 
ATOM   2505  C  CB  . ILE A 1  587  ? 250.130 240.756 141.976 1.00 500.00 ?  587  ILE A CB  1 
ATOM   2506  C  CG1 . ILE A 1  587  ? 251.532 241.331 141.691 1.00 497.87 ?  587  ILE A CG1 1 
ATOM   2507  C  CG2 . ILE A 1  587  ? 249.917 240.604 143.477 1.00 484.18 ?  587  ILE A CG2 1 
ATOM   2508  C  CD1 . ILE A 1  587  ? 251.742 242.788 142.077 1.00 489.67 ?  587  ILE A CD1 1 
ATOM   2509  N  N   . ARG A 1  588  ? 248.268 238.137 142.539 1.00 488.24 ?  588  ARG A N   1 
ATOM   2510  C  CA  . ARG A 1  588  ? 246.978 237.519 142.876 1.00 461.48 ?  588  ARG A CA  1 
ATOM   2511  C  C   . ARG A 1  588  ? 246.848 237.315 144.401 1.00 441.06 ?  588  ARG A C   1 
ATOM   2512  O  O   . ARG A 1  588  ? 247.850 237.390 145.123 1.00 473.74 ?  588  ARG A O   1 
ATOM   2513  C  CB  . ARG A 1  588  ? 246.832 236.179 142.129 1.00 460.26 ?  588  ARG A CB  1 
ATOM   2514  C  CG  . ARG A 1  588  ? 245.398 235.718 141.893 1.00 458.34 ?  588  ARG A CG  1 
ATOM   2515  C  CD  . ARG A 1  588  ? 245.339 234.385 141.159 1.00 449.56 ?  588  ARG A CD  1 
ATOM   2516  N  NE  . ARG A 1  588  ? 244.115 233.650 141.482 1.00 449.45 ?  588  ARG A NE  1 
ATOM   2517  C  CZ  . ARG A 1  588  ? 243.498 232.784 140.676 1.00 446.55 ?  588  ARG A CZ  1 
ATOM   2518  N  NH1 . ARG A 1  588  ? 243.970 232.524 139.460 1.00 436.85 ?  588  ARG A NH1 1 
ATOM   2519  N  NH2 . ARG A 1  588  ? 242.389 232.178 141.093 1.00 456.74 ?  588  ARG A NH2 1 
ATOM   2520  N  N   . ASP A 1  589  ? 245.609 237.102 144.864 1.00 393.94 ?  589  ASP A N   1 
ATOM   2521  C  CA  . ASP A 1  589  ? 245.251 236.610 146.223 1.00 348.43 ?  589  ASP A CA  1 
ATOM   2522  C  C   . ASP A 1  589  ? 246.080 237.130 147.429 1.00 278.22 ?  589  ASP A C   1 
ATOM   2523  O  O   . ASP A 1  589  ? 246.904 236.384 147.995 1.00 280.08 ?  589  ASP A O   1 
ATOM   2524  C  CB  . ASP A 1  589  ? 245.202 235.062 146.256 1.00 401.48 ?  589  ASP A CB  1 
ATOM   2525  C  CG  . ASP A 1  589  ? 244.384 234.445 145.111 1.00 423.70 ?  589  ASP A CG  1 
ATOM   2526  O  OD1 . ASP A 1  589  ? 243.336 235.005 144.710 1.00 438.62 ?  589  ASP A OD1 1 
ATOM   2527  O  OD2 . ASP A 1  589  ? 244.787 233.361 144.629 1.00 420.82 -1 589  ASP A OD2 1 
ATOM   2528  N  N   . PRO A 1  590  ? 245.860 238.402 147.832 1.00 221.87 ?  590  PRO A N   1 
ATOM   2529  C  CA  . PRO A 1  590  ? 246.627 238.931 148.973 1.00 207.40 ?  590  PRO A CA  1 
ATOM   2530  C  C   . PRO A 1  590  ? 246.003 238.596 150.341 1.00 181.92 ?  590  PRO A C   1 
ATOM   2531  O  O   . PRO A 1  590  ? 244.791 238.751 150.482 1.00 206.50 ?  590  PRO A O   1 
ATOM   2532  C  CB  . PRO A 1  590  ? 246.614 240.451 148.725 1.00 229.74 ?  590  PRO A CB  1 
ATOM   2533  C  CG  . PRO A 1  590  ? 245.432 240.724 147.842 1.00 214.83 ?  590  PRO A CG  1 
ATOM   2534  C  CD  . PRO A 1  590  ? 244.996 239.429 147.208 1.00 208.91 ?  590  PRO A CD  1 
ATOM   2535  N  N   . VAL A 1  591  ? 246.799 238.133 151.320 1.00 158.73 ?  591  VAL A N   1 
ATOM   2536  C  CA  . VAL A 1  591  ? 246.339 237.983 152.746 1.00 169.30 ?  591  VAL A CA  1 
ATOM   2537  C  C   . VAL A 1  591  ? 247.398 238.258 153.796 1.00 161.75 ?  591  VAL A C   1 
ATOM   2538  O  O   . VAL A 1  591  ? 248.440 237.614 153.788 1.00 197.31 ?  591  VAL A O   1 
ATOM   2539  C  CB  . VAL A 1  591  ? 245.769 236.581 153.121 1.00 196.32 ?  591  VAL A CB  1 
ATOM   2540  C  CG1 . VAL A 1  591  ? 244.463 236.281 152.398 1.00 260.89 ?  591  VAL A CG1 1 
ATOM   2541  C  CG2 . VAL A 1  591  ? 246.793 235.460 152.926 1.00 188.16 ?  591  VAL A CG2 1 
ATOM   2542  N  N   . HIS A 1  592  ? 247.107 239.163 154.727 1.00 157.95 ?  592  HIS A N   1 
ATOM   2543  C  CA  . HIS A 1  592  ? 248.040 239.557 155.794 1.00 179.51 ?  592  HIS A CA  1 
ATOM   2544  C  C   . HIS A 1  592  ? 249.533 239.324 155.465 1.00 191.12 ?  592  HIS A C   1 
ATOM   2545  O  O   . HIS A 1  592  ? 250.100 238.290 155.848 1.00 224.87 ?  592  HIS A O   1 
ATOM   2546  C  CB  . HIS A 1  592  ? 247.661 238.866 157.117 1.00 193.63 ?  592  HIS A CB  1 
ATOM   2547  C  CG  . HIS A 1  592  ? 248.472 239.323 158.297 1.00 269.57 ?  592  HIS A CG  1 
ATOM   2548  N  ND1 . HIS A 1  592  ? 248.160 240.453 159.022 1.00 305.30 ?  592  HIS A ND1 1 
ATOM   2549  C  CD2 . HIS A 1  592  ? 249.588 238.808 158.869 1.00 285.00 ?  592  HIS A CD2 1 
ATOM   2550  C  CE1 . HIS A 1  592  ? 249.047 240.613 159.990 1.00 318.36 ?  592  HIS A CE1 1 
ATOM   2551  N  NE2 . HIS A 1  592  ? 249.927 239.630 159.916 1.00 294.92 ?  592  HIS A NE2 1 
ATOM   2552  N  N   . ASN A 1  593  ? 250.155 240.259 154.738 1.00 169.81 ?  593  ASN A N   1 
ATOM   2553  C  CA  . ASN A 1  593  ? 251.604 240.199 154.425 1.00 179.58 ?  593  ASN A CA  1 
ATOM   2554  C  C   . ASN A 1  593  ? 251.985 239.326 153.233 1.00 174.92 ?  593  ASN A C   1 
ATOM   2555  O  O   . ASN A 1  593  ? 253.007 239.569 152.590 1.00 158.83 ?  593  ASN A O   1 
ATOM   2556  C  CB  . ASN A 1  593  ? 252.451 239.792 155.649 1.00 195.53 ?  593  ASN A CB  1 
ATOM   2557  C  CG  . ASN A 1  593  ? 253.873 240.307 155.583 1.00 209.47 ?  593  ASN A CG  1 
ATOM   2558  O  OD1 . ASN A 1  593  ? 254.275 240.967 154.623 1.00 232.78 ?  593  ASN A OD1 1 
ATOM   2559  N  ND2 . ASN A 1  593  ? 254.643 240.020 156.623 1.00 212.44 ?  593  ASN A ND2 1 
ATOM   2560  N  N   . ARG A 1  594  ? 251.156 238.323 152.950 1.00 211.55 ?  594  ARG A N   1 
ATOM   2561  C  CA  . ARG A 1  594  ? 251.392 237.355 151.869 1.00 223.96 ?  594  ARG A CA  1 
ATOM   2562  C  C   . ARG A 1  594  ? 250.618 237.639 150.575 1.00 210.46 ?  594  ARG A C   1 
ATOM   2563  O  O   . ARG A 1  594  ? 249.409 237.931 150.563 1.00 189.94 ?  594  ARG A O   1 
ATOM   2564  C  CB  . ARG A 1  594  ? 251.121 235.927 152.343 1.00 221.64 ?  594  ARG A CB  1 
ATOM   2565  C  CG  . ARG A 1  594  ? 252.103 235.416 153.375 1.00 195.40 ?  594  ARG A CG  1 
ATOM   2566  C  CD  . ARG A 1  594  ? 251.703 234.058 153.914 1.00 208.35 ?  594  ARG A CD  1 
ATOM   2567  N  NE  . ARG A 1  594  ? 250.404 234.113 154.583 1.00 211.44 ?  594  ARG A NE  1 
ATOM   2568  C  CZ  . ARG A 1  594  ? 250.197 234.584 155.809 1.00 206.88 ?  594  ARG A CZ  1 
ATOM   2569  N  NH1 . ARG A 1  594  ? 251.200 235.051 156.544 1.00 221.72 ?  594  ARG A NH1 1 
ATOM   2570  N  NH2 . ARG A 1  594  ? 248.970 234.591 156.304 1.00 208.49 ?  594  ARG A NH2 1 
ATOM   2571  N  N   . VAL A 1  595  ? 251.347 237.524 149.479 1.00 162.78 ?  595  VAL A N   1 
ATOM   2572  C  CA  . VAL A 1  595  ? 250.837 237.859 148.188 1.00 196.51 ?  595  VAL A CA  1 
ATOM   2573  C  C   . VAL A 1  595  ? 251.333 236.751 147.264 1.00 257.64 ?  595  VAL A C   1 
ATOM   2574  O  O   . VAL A 1  595  ? 252.468 236.297 147.415 1.00 246.39 ?  595  VAL A O   1 
ATOM   2575  C  CB  . VAL A 1  595  ? 251.322 239.279 147.824 1.00 189.65 ?  595  VAL A CB  1 
ATOM   2576  C  CG1 . VAL A 1  595  ? 251.530 239.472 146.330 1.00 225.78 ?  595  VAL A CG1 1 
ATOM   2577  C  CG2 . VAL A 1  595  ? 250.352 240.314 148.379 1.00 174.57 ?  595  VAL A CG2 1 
ATOM   2578  N  N   . THR A 1  596  ? 250.469 236.279 146.357 1.00 339.74 ?  596  THR A N   1 
ATOM   2579  C  CA  . THR A 1  596  ? 250.846 235.238 145.373 1.00 366.56 ?  596  THR A CA  1 
ATOM   2580  C  C   . THR A 1  596  ? 251.024 235.787 143.942 1.00 394.72 ?  596  THR A C   1 
ATOM   2581  O  O   . THR A 1  596  ? 250.304 236.698 143.503 1.00 402.37 ?  596  THR A O   1 
ATOM   2582  C  CB  . THR A 1  596  ? 249.953 233.953 145.443 1.00 350.80 ?  596  THR A CB  1 
ATOM   2583  O  OG1 . THR A 1  596  ? 250.557 232.894 144.687 1.00 333.73 ?  596  THR A OG1 1 
ATOM   2584  C  CG2 . THR A 1  596  ? 248.526 234.182 144.922 1.00 336.97 ?  596  THR A CG2 1 
ATOM   2585  N  N   . LEU A 1  597  ? 252.019 235.234 143.251 1.00 417.85 ?  597  LEU A N   1 
ATOM   2586  C  CA  . LEU A 1  597  ? 252.390 235.662 141.906 1.00 438.08 ?  597  LEU A CA  1 
ATOM   2587  C  C   . LEU A 1  597  ? 252.303 234.481 140.956 1.00 467.19 ?  597  LEU A C   1 
ATOM   2588  O  O   . LEU A 1  597  ? 252.876 233.419 141.226 1.00 479.78 ?  597  LEU A O   1 
ATOM   2589  C  CB  . LEU A 1  597  ? 253.815 236.236 141.882 1.00 416.43 ?  597  LEU A CB  1 
ATOM   2590  C  CG  . LEU A 1  597  ? 254.352 237.089 143.036 1.00 395.18 ?  597  LEU A CG  1 
ATOM   2591  C  CD1 . LEU A 1  597  ? 255.864 237.205 142.924 1.00 389.42 ?  597  LEU A CD1 1 
ATOM   2592  C  CD2 . LEU A 1  597  ? 253.696 238.462 143.086 1.00 384.23 ?  597  LEU A CD2 1 
ATOM   2593  N  N   . GLU A 1  598  ? 251.572 234.674 139.860 1.00 491.06 ?  598  GLU A N   1 
ATOM   2594  C  CA  . GLU A 1  598  ? 251.485 233.690 138.787 1.00 500.00 ?  598  GLU A CA  1 
ATOM   2595  C  C   . GLU A 1  598  ? 252.514 234.065 137.729 1.00 500.00 ?  598  GLU A C   1 
ATOM   2596  O  O   . GLU A 1  598  ? 252.399 235.115 137.108 1.00 500.00 ?  598  GLU A O   1 
ATOM   2597  C  CB  . GLU A 1  598  ? 250.073 233.669 138.189 1.00 497.86 ?  598  GLU A CB  1 
ATOM   2598  C  CG  . GLU A 1  598  ? 249.853 232.607 137.114 1.00 488.59 ?  598  GLU A CG  1 
ATOM   2599  C  CD  . GLU A 1  598  ? 248.561 232.791 136.330 1.00 484.33 ?  598  GLU A CD  1 
ATOM   2600  O  OE1 . GLU A 1  598  ? 247.611 233.423 136.844 1.00 483.19 ?  598  GLU A OE1 1 
ATOM   2601  O  OE2 . GLU A 1  598  ? 248.494 232.293 135.187 1.00 477.14 -1 598  GLU A OE2 1 
ATOM   2602  N  N   . LEU A 1  599  ? 253.508 233.197 137.545 1.00 500.00 ?  599  LEU A N   1 
ATOM   2603  C  CA  . LEU A 1  599  ? 254.596 233.397 136.580 1.00 500.00 ?  599  LEU A CA  1 
ATOM   2604  C  C   . LEU A 1  599  ? 254.198 232.906 135.180 1.00 500.00 ?  599  LEU A C   1 
ATOM   2605  O  O   . LEU A 1  599  ? 253.219 232.159 135.027 1.00 500.00 ?  599  LEU A O   1 
ATOM   2606  C  CB  . LEU A 1  599  ? 255.863 232.652 137.043 1.00 495.29 ?  599  LEU A CB  1 
ATOM   2607  C  CG  . LEU A 1  599  ? 256.447 232.812 138.456 1.00 471.35 ?  599  LEU A CG  1 
ATOM   2608  C  CD1 . LEU A 1  599  ? 257.254 231.581 138.841 1.00 456.10 ?  599  LEU A CD1 1 
ATOM   2609  C  CD2 . LEU A 1  599  ? 257.302 234.064 138.581 1.00 461.96 ?  599  LEU A CD2 1 
ATOM   2610  N  N   . SER A 1  600  ? 254.969 233.327 134.171 1.00 500.00 ?  600  SER A N   1 
ATOM   2611  C  CA  . SER A 1  600  ? 254.812 232.876 132.778 1.00 500.00 ?  600  SER A CA  1 
ATOM   2612  C  C   . SER A 1  600  ? 254.964 231.357 132.643 1.00 500.00 ?  600  SER A C   1 
ATOM   2613  O  O   . SER A 1  600  ? 254.322 230.737 131.790 1.00 500.00 ?  600  SER A O   1 
ATOM   2614  C  CB  . SER A 1  600  ? 255.813 233.593 131.867 1.00 500.00 ?  600  SER A CB  1 
ATOM   2615  O  OG  . SER A 1  600  ? 255.500 233.398 130.499 1.00 500.00 ?  600  SER A OG  1 
ATOM   2616  N  N   . ASN A 1  601  ? 255.810 230.779 133.501 1.00 500.00 ?  601  ASN A N   1 
ATOM   2617  C  CA  . ASN A 1  601  ? 255.952 229.328 133.676 1.00 500.00 ?  601  ASN A CA  1 
ATOM   2618  C  C   . ASN A 1  601  ? 254.628 228.620 133.995 1.00 500.00 ?  601  ASN A C   1 
ATOM   2619  O  O   . ASN A 1  601  ? 254.415 227.480 133.576 1.00 500.00 ?  601  ASN A O   1 
ATOM   2620  C  CB  . ASN A 1  601  ? 256.984 229.039 134.781 1.00 500.00 ?  601  ASN A CB  1 
ATOM   2621  C  CG  . ASN A 1  601  ? 257.425 227.581 134.828 1.00 500.00 ?  601  ASN A CG  1 
ATOM   2622  O  OD1 . ASN A 1  601  ? 257.443 226.880 133.812 1.00 500.00 ?  601  ASN A OD1 1 
ATOM   2623  N  ND2 . ASN A 1  601  ? 257.800 227.122 136.019 1.00 500.00 ?  601  ASN A ND2 1 
ATOM   2624  N  N   . GLY A 1  602  ? 253.748 229.310 134.720 1.00 500.00 ?  602  GLY A N   1 
ATOM   2625  C  CA  . GLY A 1  602  ? 252.472 228.746 135.158 1.00 500.00 ?  602  GLY A CA  1 
ATOM   2626  C  C   . GLY A 1  602  ? 252.504 228.245 136.591 1.00 500.00 ?  602  GLY A C   1 
ATOM   2627  O  O   . GLY A 1  602  ? 251.481 227.788 137.113 1.00 500.00 ?  602  GLY A O   1 
ATOM   2628  N  N   . SER A 1  603  ? 253.682 228.322 137.215 1.00 500.00 ?  603  SER A N   1 
ATOM   2629  C  CA  . SER A 1  603  ? 253.868 227.989 138.629 1.00 500.00 ?  603  SER A CA  1 
ATOM   2630  C  C   . SER A 1  603  ? 253.615 229.219 139.500 1.00 500.00 ?  603  SER A C   1 
ATOM   2631  O  O   . SER A 1  603  ? 254.056 230.328 139.167 1.00 500.00 ?  603  SER A O   1 
ATOM   2632  C  CB  . SER A 1  603  ? 255.280 227.439 138.873 1.00 500.00 ?  603  SER A CB  1 
ATOM   2633  O  OG  . SER A 1  603  ? 255.454 227.025 140.220 1.00 500.00 ?  603  SER A OG  1 
ATOM   2634  N  N   . MET A 1  604  ? 252.901 229.009 140.607 1.00 494.18 ?  604  MET A N   1 
ATOM   2635  C  CA  . MET A 1  604  ? 252.569 230.080 141.549 1.00 471.28 ?  604  MET A CA  1 
ATOM   2636  C  C   . MET A 1  604  ? 253.429 230.005 142.812 1.00 459.71 ?  604  MET A C   1 
ATOM   2637  O  O   . MET A 1  604  ? 253.549 228.940 143.432 1.00 474.58 ?  604  MET A O   1 
ATOM   2638  C  CB  . MET A 1  604  ? 251.074 230.067 141.904 1.00 463.59 ?  604  MET A CB  1 
ATOM   2639  C  CG  . MET A 1  604  ? 250.143 230.529 140.790 1.00 461.15 ?  604  MET A CG  1 
ATOM   2640  S  SD  . MET A 1  604  ? 248.487 230.923 141.394 1.00 455.12 ?  604  MET A SD  1 
ATOM   2641  C  CE  . MET A 1  604  ? 247.656 231.433 139.888 1.00 456.08 ?  604  MET A CE  1 
ATOM   2642  N  N   . VAL A 1  605  ? 254.033 231.140 143.171 1.00 432.22 ?  605  VAL A N   1 
ATOM   2643  C  CA  . VAL A 1  605  ? 254.855 231.260 144.387 1.00 397.12 ?  605  VAL A CA  1 
ATOM   2644  C  C   . VAL A 1  605  ? 254.402 232.415 145.283 1.00 376.02 ?  605  VAL A C   1 
ATOM   2645  O  O   . VAL A 1  605  ? 254.149 233.524 144.791 1.00 372.61 ?  605  VAL A O   1 
ATOM   2646  C  CB  . VAL A 1  605  ? 256.383 231.367 144.098 1.00 390.33 ?  605  VAL A CB  1 
ATOM   2647  C  CG1 . VAL A 1  605  ? 256.973 229.996 143.792 1.00 383.55 ?  605  VAL A CG1 1 
ATOM   2648  C  CG2 . VAL A 1  605  ? 256.698 232.366 142.984 1.00 389.70 ?  605  VAL A CG2 1 
ATOM   2649  N  N   . ARG A 1  606  ? 254.288 232.136 146.588 1.00 347.20 ?  606  ARG A N   1 
ATOM   2650  C  CA  . ARG A 1  606  ? 253.965 233.158 147.599 1.00 315.41 ?  606  ARG A CA  1 
ATOM   2651  C  C   . ARG A 1  606  ? 255.184 234.000 147.980 1.00 347.00 ?  606  ARG A C   1 
ATOM   2652  O  O   . ARG A 1  606  ? 256.284 233.470 148.271 1.00 389.44 ?  606  ARG A O   1 
ATOM   2653  C  CB  . ARG A 1  606  ? 253.317 232.562 148.868 1.00 234.76 ?  606  ARG A CB  1 
ATOM   2654  C  CG  . ARG A 1  606  ? 251.830 232.276 148.754 1.00 173.65 ?  606  ARG A CG  1 
ATOM   2655  C  CD  . ARG A 1  606  ? 251.137 232.225 150.105 1.00 154.75 ?  606  ARG A CD  1 
ATOM   2656  N  NE  . ARG A 1  606  ? 250.305 233.409 150.401 1.00 173.67 ?  606  ARG A NE  1 
ATOM   2657  C  CZ  . ARG A 1  606  ? 249.073 233.672 149.923 1.00 172.40 ?  606  ARG A CZ  1 
ATOM   2658  N  NH1 . ARG A 1  606  ? 248.462 232.871 149.058 1.00 168.28 ?  606  ARG A NH1 1 
ATOM   2659  N  NH2 . ARG A 1  606  ? 248.446 234.783 150.291 1.00 149.39 ?  606  ARG A NH2 1 
ATOM   2660  N  N   . ILE A 1  607  ? 254.966 235.316 147.943 1.00 319.32 ?  607  ILE A N   1 
ATOM   2661  C  CA  . ILE A 1  607  ? 255.884 236.303 148.503 1.00 252.50 ?  607  ILE A CA  1 
ATOM   2662  C  C   . ILE A 1  607  ? 255.256 236.990 149.708 1.00 188.95 ?  607  ILE A C   1 
ATOM   2663  O  O   . ILE A 1  607  ? 254.047 237.244 149.753 1.00 130.25 ?  607  ILE A O   1 
ATOM   2664  C  CB  . ILE A 1  607  ? 256.390 237.359 147.479 1.00 269.78 ?  607  ILE A CB  1 
ATOM   2665  C  CG1 . ILE A 1  607  ? 255.230 238.136 146.834 1.00 245.78 ?  607  ILE A CG1 1 
ATOM   2666  C  CG2 . ILE A 1  607  ? 257.291 236.703 146.437 1.00 280.44 ?  607  ILE A CG2 1 
ATOM   2667  C  CD1 . ILE A 1  607  ? 255.411 239.637 146.848 1.00 230.75 ?  607  ILE A CD1 1 
ATOM   2668  N  N   . THR A 1  608  ? 256.119 237.228 150.683 1.00 168.85 ?  608  THR A N   1 
ATOM   2669  C  CA  . THR A 1  608  ? 255.852 238.025 151.849 1.00 165.57 ?  608  THR A CA  1 
ATOM   2670  C  C   . THR A 1  608  ? 256.831 239.184 151.808 1.00 177.80 ?  608  THR A C   1 
ATOM   2671  O  O   . THR A 1  608  ? 258.060 239.005 151.689 1.00 194.57 ?  608  THR A O   1 
ATOM   2672  C  CB  . THR A 1  608  ? 256.158 237.231 153.109 1.00 169.25 ?  608  THR A CB  1 
ATOM   2673  O  OG1 . THR A 1  608  ? 257.341 236.451 152.879 1.00 176.76 ?  608  THR A OG1 1 
ATOM   2674  C  CG2 . THR A 1  608  ? 255.026 236.319 153.445 1.00 170.10 ?  608  THR A CG2 1 
ATOM   2675  N  N   . ILE A 1  609  ? 256.291 240.379 151.900 1.00 159.90 ?  609  ILE A N   1 
ATOM   2676  C  CA  . ILE A 1  609  ? 257.134 241.547 151.929 1.00 168.15 ?  609  ILE A CA  1 
ATOM   2677  C  C   . ILE A 1  609  ? 257.446 241.780 153.409 1.00 185.73 ?  609  ILE A C   1 
ATOM   2678  O  O   . ILE A 1  609  ? 256.563 241.581 154.238 1.00 188.46 ?  609  ILE A O   1 
ATOM   2679  C  CB  . ILE A 1  609  ? 256.407 242.730 151.285 1.00 153.82 ?  609  ILE A CB  1 
ATOM   2680  C  CG1 . ILE A 1  609  ? 255.679 242.263 150.018 1.00 136.39 ?  609  ILE A CG1 1 
ATOM   2681  C  CG2 . ILE A 1  609  ? 257.382 243.864 150.989 1.00 166.63 ?  609  ILE A CG2 1 
ATOM   2682  C  CD1 . ILE A 1  609  ? 254.262 242.793 149.891 1.00 152.78 ?  609  ILE A CD1 1 
ATOM   2683  N  N   . PRO A 1  610  ? 258.708 242.142 153.756 1.00 191.08 ?  610  PRO A N   1 
ATOM   2684  C  CA  . PRO A 1  610  ? 259.055 242.421 155.177 1.00 201.00 ?  610  PRO A CA  1 
ATOM   2685  C  C   . PRO A 1  610  ? 258.167 243.501 155.818 1.00 226.29 ?  610  PRO A C   1 
ATOM   2686  O  O   . PRO A 1  610  ? 257.797 244.458 155.136 1.00 236.45 ?  610  PRO A O   1 
ATOM   2687  C  CB  . PRO A 1  610  ? 260.495 242.938 155.107 1.00 174.08 ?  610  PRO A CB  1 
ATOM   2688  C  CG  . PRO A 1  610  ? 261.027 242.451 153.810 1.00 183.58 ?  610  PRO A CG  1 
ATOM   2689  C  CD  . PRO A 1  610  ? 259.898 242.119 152.884 1.00 165.27 ?  610  PRO A CD  1 
ATOM   2690  N  N   . GLU A 1  611  ? 257.823 243.347 157.103 1.00 226.94 ?  611  GLU A N   1 
ATOM   2691  C  CA  . GLU A 1  611  ? 257.125 244.414 157.854 1.00 228.40 ?  611  GLU A CA  1 
ATOM   2692  C  C   . GLU A 1  611  ? 258.134 245.524 158.111 1.00 231.73 ?  611  GLU A C   1 
ATOM   2693  O  O   . GLU A 1  611  ? 259.345 245.288 157.986 1.00 263.37 ?  611  GLU A O   1 
ATOM   2694  C  CB  . GLU A 1  611  ? 256.575 243.947 159.206 1.00 250.05 ?  611  GLU A CB  1 
ATOM   2695  C  CG  . GLU A 1  611  ? 256.534 242.453 159.479 1.00 279.32 ?  611  GLU A CG  1 
ATOM   2696  C  CD  . GLU A 1  611  ? 256.796 242.152 160.945 1.00 294.78 ?  611  GLU A CD  1 
ATOM   2697  O  OE1 . GLU A 1  611  ? 257.975 242.227 161.364 1.00 295.01 ?  611  GLU A OE1 1 
ATOM   2698  O  OE2 . GLU A 1  611  ? 255.826 241.850 161.677 1.00 307.37 -1 611  GLU A OE2 1 
ATOM   2699  N  N   . ILE A 1  612  ? 257.662 246.718 158.481 1.00 208.79 ?  612  ILE A N   1 
ATOM   2700  C  CA  . ILE A 1  612  ? 258.592 247.844 158.681 1.00 185.96 ?  612  ILE A CA  1 
ATOM   2701  C  C   . ILE A 1  612  ? 259.617 247.663 159.799 1.00 188.04 ?  612  ILE A C   1 
ATOM   2702  O  O   . ILE A 1  612  ? 260.764 247.996 159.580 1.00 181.71 ?  612  ILE A O   1 
ATOM   2703  C  CB  . ILE A 1  612  ? 257.930 249.235 158.835 1.00 164.07 ?  612  ILE A CB  1 
ATOM   2704  C  CG1 . ILE A 1  612  ? 256.829 249.210 159.900 1.00 168.03 ?  612  ILE A CG1 1 
ATOM   2705  C  CG2 . ILE A 1  612  ? 257.480 249.776 157.485 1.00 140.90 ?  612  ILE A CG2 1 
ATOM   2706  C  CD1 . ILE A 1  612  ? 256.782 250.480 160.724 1.00 194.11 ?  612  ILE A CD1 1 
ATOM   2707  N  N   . ALA A 1  613  ? 259.228 247.111 160.954 1.00 181.07 ?  613  ALA A N   1 
ATOM   2708  C  CA  . ALA A 1  613  ? 260.065 247.236 162.163 1.00 176.05 ?  613  ALA A CA  1 
ATOM   2709  C  C   . ALA A 1  613  ? 260.734 245.992 162.775 1.00 181.69 ?  613  ALA A C   1 
ATOM   2710  O  O   . ALA A 1  613  ? 261.971 245.934 162.868 1.00 180.96 ?  613  ALA A O   1 
ATOM   2711  C  CB  . ALA A 1  613  ? 259.338 248.041 163.226 1.00 156.62 ?  613  ALA A CB  1 
ATOM   2712  N  N   . THR A 1  614  ? 259.922 245.013 163.185 1.00 188.62 ?  614  THR A N   1 
ATOM   2713  C  CA  . THR A 1  614  ? 260.355 243.805 163.937 1.00 217.63 ?  614  THR A CA  1 
ATOM   2714  C  C   . THR A 1  614  ? 260.486 244.021 165.457 1.00 224.67 ?  614  THR A C   1 
ATOM   2715  O  O   . THR A 1  614  ? 259.899 243.263 166.238 1.00 236.84 ?  614  THR A O   1 
ATOM   2716  C  CB  . THR A 1  614  ? 261.653 243.139 163.387 1.00 234.99 ?  614  THR A CB  1 
ATOM   2717  O  OG1 . THR A 1  614  ? 261.643 243.162 161.956 1.00 255.05 ?  614  THR A OG1 1 
ATOM   2718  C  CG2 . THR A 1  614  ? 261.789 241.688 163.871 1.00 243.16 ?  614  THR A CG2 1 
ATOM   2719  N  N   . SER A 1  615  ? 261.250 245.040 165.863 1.00 216.55 ?  615  SER A N   1 
ATOM   2720  C  CA  . SER A 1  615  ? 261.540 245.277 167.284 1.00 214.95 ?  615  SER A CA  1 
ATOM   2721  C  C   . SER A 1  615  ? 260.764 246.455 167.851 1.00 202.43 ?  615  SER A C   1 
ATOM   2722  O  O   . SER A 1  615  ? 260.488 247.419 167.145 1.00 221.62 ?  615  SER A O   1 
ATOM   2723  C  CB  . SER A 1  615  ? 263.040 245.458 167.500 1.00 227.93 ?  615  SER A CB  1 
ATOM   2724  O  OG  . SER A 1  615  ? 263.743 244.300 167.081 1.00 227.46 ?  615  SER A OG  1 
ATOM   2725  N  N   . GLU A 1  616  ? 260.431 246.378 169.131 1.00 188.18 ?  616  GLU A N   1 
ATOM   2726  C  CA  . GLU A 1  616  ? 259.488 247.314 169.728 1.00 197.74 ?  616  GLU A CA  1 
ATOM   2727  C  C   . GLU A 1  616  ? 259.994 248.755 169.896 1.00 195.67 ?  616  GLU A C   1 
ATOM   2728  O  O   . GLU A 1  616  ? 259.220 249.675 169.655 1.00 228.59 ?  616  GLU A O   1 
ATOM   2729  C  CB  . GLU A 1  616  ? 258.929 246.757 171.028 1.00 224.78 ?  616  GLU A CB  1 
ATOM   2730  C  CG  . GLU A 1  616  ? 257.413 246.599 171.026 1.00 230.41 ?  616  GLU A CG  1 
ATOM   2731  C  CD  . GLU A 1  616  ? 256.936 245.419 171.872 1.00 231.42 ?  616  GLU A CD  1 
ATOM   2732  O  OE1 . GLU A 1  616  ? 257.547 245.124 172.934 1.00 225.55 ?  616  GLU A OE1 1 
ATOM   2733  O  OE2 . GLU A 1  616  ? 255.943 244.769 171.466 1.00 201.21 -1 616  GLU A OE2 1 
ATOM   2734  N  N   . LEU A 1  617  ? 261.268 248.961 170.258 1.00 174.20 ?  617  LEU A N   1 
ATOM   2735  C  CA  . LEU A 1  617  ? 261.850 250.333 170.309 1.00 160.28 ?  617  LEU A CA  1 
ATOM   2736  C  C   . LEU A 1  617  ? 261.925 250.893 168.918 1.00 154.40 ?  617  LEU A C   1 
ATOM   2737  O  O   . LEU A 1  617  ? 261.641 252.067 168.729 1.00 152.69 ?  617  LEU A O   1 
ATOM   2738  C  CB  . LEU A 1  617  ? 263.258 250.391 170.879 1.00 155.38 ?  617  LEU A CB  1 
ATOM   2739  C  CG  . LEU A 1  617  ? 263.741 249.139 171.592 1.00 211.09 ?  617  LEU A CG  1 
ATOM   2740  C  CD1 . LEU A 1  617  ? 265.234 248.921 171.367 1.00 208.96 ?  617  LEU A CD1 1 
ATOM   2741  C  CD2 . LEU A 1  617  ? 263.344 249.203 173.066 1.00 229.23 ?  617  LEU A CD2 1 
ATOM   2742  N  N   . VAL A 1  618  ? 262.298 250.042 167.958 1.00 153.99 ?  618  VAL A N   1 
ATOM   2743  C  CA  . VAL A 1  618  ? 262.343 250.403 166.531 1.00 158.13 ?  618  VAL A CA  1 
ATOM   2744  C  C   . VAL A 1  618  ? 260.957 250.839 166.034 1.00 149.60 ?  618  VAL A C   1 
ATOM   2745  O  O   . VAL A 1  618  ? 260.832 251.914 165.453 1.00 135.44 ?  618  VAL A O   1 
ATOM   2746  C  CB  . VAL A 1  618  ? 262.901 249.257 165.646 1.00 166.21 ?  618  VAL A CB  1 
ATOM   2747  C  CG1 . VAL A 1  618  ? 262.985 249.700 164.192 1.00 174.57 ?  618  VAL A CG1 1 
ATOM   2748  C  CG2 . VAL A 1  618  ? 264.269 248.793 166.137 1.00 175.28 ?  618  VAL A CG2 1 
ATOM   2749  N  N   . GLN A 1  619  ? 259.953 249.986 166.287 1.00 160.99 ?  619  GLN A N   1 
ATOM   2750  C  CA  . GLN A 1  619  ? 258.519 250.193 166.007 1.00 171.03 ?  619  GLN A CA  1 
ATOM   2751  C  C   . GLN A 1  619  ? 257.994 251.522 166.523 1.00 198.66 ?  619  GLN A C   1 
ATOM   2752  O  O   . GLN A 1  619  ? 257.537 252.380 165.746 1.00 207.22 ?  619  GLN A O   1 
ATOM   2753  C  CB  . GLN A 1  619  ? 257.710 249.069 166.667 1.00 153.97 ?  619  GLN A CB  1 
ATOM   2754  C  CG  . GLN A 1  619  ? 256.363 248.803 166.050 1.00 182.89 ?  619  GLN A CG  1 
ATOM   2755  C  CD  . GLN A 1  619  ? 256.462 247.876 164.851 1.00 221.48 ?  619  GLN A CD  1 
ATOM   2756  O  OE1 . GLN A 1  619  ? 256.806 246.697 164.991 1.00 251.48 ?  619  GLN A OE1 1 
ATOM   2757  N  NE2 . GLN A 1  619  ? 256.157 248.399 163.661 1.00 207.10 ?  619  GLN A NE2 1 
ATOM   2758  N  N   . THR A 1  620  ? 258.075 251.668 167.845 1.00 199.97 ?  620  THR A N   1 
ATOM   2759  C  CA  . THR A 1  620  ? 257.603 252.842 168.561 1.00 192.53 ?  620  THR A CA  1 
ATOM   2760  C  C   . THR A 1  620  ? 258.231 254.094 167.956 1.00 174.53 ?  620  THR A C   1 
ATOM   2761  O  O   . THR A 1  620  ? 257.509 255.021 167.606 1.00 159.91 ?  620  THR A O   1 
ATOM   2762  C  CB  . THR A 1  620  ? 257.882 252.724 170.080 1.00 204.58 ?  620  THR A CB  1 
ATOM   2763  O  OG1 . THR A 1  620  ? 257.393 251.463 170.560 1.00 232.01 ?  620  THR A OG1 1 
ATOM   2764  C  CG2 . THR A 1  620  ? 257.213 253.854 170.879 1.00 210.00 ?  620  THR A CG2 1 
ATOM   2765  N  N   . CYS A 1  621  ? 259.555 254.083 167.782 1.00 158.41 ?  621  CYS A N   1 
ATOM   2766  C  CA  . CYS A 1  621  ? 260.268 255.214 167.204 1.00 160.95 ?  621  CYS A CA  1 
ATOM   2767  C  C   . CYS A 1  621  ? 259.717 255.578 165.862 1.00 161.01 ?  621  CYS A C   1 
ATOM   2768  O  O   . CYS A 1  621  ? 259.566 256.757 165.580 1.00 229.45 ?  621  CYS A O   1 
ATOM   2769  C  CB  . CYS A 1  621  ? 261.749 254.935 167.073 1.00 174.46 ?  621  CYS A CB  1 
ATOM   2770  S  SG  . CYS A 1  621  ? 262.562 254.918 168.678 1.00 276.66 ?  621  CYS A SG  1 
ATOM   2771  N  N   . LEU A 1  622  ? 259.382 254.574 165.057 1.00 152.55 ?  622  LEU A N   1 
ATOM   2772  C  CA  . LEU A 1  622  ? 258.859 254.823 163.725 1.00 175.70 ?  622  LEU A CA  1 
ATOM   2773  C  C   . LEU A 1  622  ? 257.517 255.516 163.786 1.00 215.90 ?  622  LEU A C   1 
ATOM   2774  O  O   . LEU A 1  622  ? 257.317 256.525 163.085 1.00 307.92 ?  622  LEU A O   1 
ATOM   2775  C  CB  . LEU A 1  622  ? 258.822 253.564 162.879 1.00 180.79 ?  622  LEU A CB  1 
ATOM   2776  C  CG  . LEU A 1  622  ? 260.242 253.086 162.561 1.00 203.81 ?  622  LEU A CG  1 
ATOM   2777  C  CD1 . LEU A 1  622  ? 260.191 251.663 162.043 1.00 216.73 ?  622  LEU A CD1 1 
ATOM   2778  C  CD2 . LEU A 1  622  ? 261.007 254.010 161.613 1.00 217.81 ?  622  LEU A CD2 1 
ATOM   2779  N  N   . GLN A 1  623  ? 256.638 255.028 164.666 1.00 204.69 ?  623  GLN A N   1 
ATOM   2780  C  CA  . GLN A 1  623  ? 255.346 255.687 164.926 1.00 281.55 ?  623  GLN A CA  1 
ATOM   2781  C  C   . GLN A 1  623  ? 255.507 257.189 165.269 1.00 358.57 ?  623  GLN A C   1 
ATOM   2782  O  O   . GLN A 1  623  ? 254.879 258.051 164.637 1.00 408.65 ?  623  GLN A O   1 
ATOM   2783  C  CB  . GLN A 1  623  ? 254.558 254.962 166.028 1.00 254.36 ?  623  GLN A CB  1 
ATOM   2784  C  CG  . GLN A 1  623  ? 254.533 253.437 165.960 1.00 241.13 ?  623  GLN A CG  1 
ATOM   2785  C  CD  . GLN A 1  623  ? 254.092 252.893 164.615 1.00 248.41 ?  623  GLN A CD  1 
ATOM   2786  O  OE1 . GLN A 1  623  ? 254.882 252.283 163.893 1.00 243.17 ?  623  GLN A OE1 1 
ATOM   2787  N  NE2 . GLN A 1  623  ? 252.828 253.118 164.266 1.00 245.66 ?  623  GLN A NE2 1 
ATOM   2788  N  N   . ALA A 1  624  ? 256.386 257.477 166.233 1.00 411.45 ?  624  ALA A N   1 
ATOM   2789  C  CA  . ALA A 1  624  ? 256.648 258.838 166.726 1.00 425.67 ?  624  ALA A CA  1 
ATOM   2790  C  C   . ALA A 1  624  ? 257.295 259.791 165.709 1.00 444.66 ?  624  ALA A C   1 
ATOM   2791  O  O   . ALA A 1  624  ? 256.888 260.957 165.621 1.00 454.16 ?  624  ALA A O   1 
ATOM   2792  C  CB  . ALA A 1  624  ? 257.475 258.784 168.000 1.00 420.23 ?  624  ALA A CB  1 
ATOM   2793  N  N   . ILE A 1  625  ? 258.287 259.301 164.956 1.00 449.13 ?  625  ILE A N   1 
ATOM   2794  C  CA  . ILE A 1  625  ? 258.992 260.111 163.937 1.00 402.56 ?  625  ILE A CA  1 
ATOM   2795  C  C   . ILE A 1  625  ? 258.026 260.579 162.826 1.00 400.56 ?  625  ILE A C   1 
ATOM   2796  O  O   . ILE A 1  625  ? 258.018 261.770 162.447 1.00 442.51 ?  625  ILE A O   1 
ATOM   2797  C  CB  . ILE A 1  625  ? 260.237 259.383 163.352 1.00 387.43 ?  625  ILE A CB  1 
ATOM   2798  C  CG1 . ILE A 1  625  ? 261.348 259.254 164.412 1.00 366.67 ?  625  ILE A CG1 1 
ATOM   2799  C  CG2 . ILE A 1  625  ? 260.784 260.139 162.146 1.00 365.45 ?  625  ILE A CG2 1 
ATOM   2800  C  CD1 . ILE A 1  625  ? 262.293 258.077 164.216 1.00 333.94 ?  625  ILE A CD1 1 
ATOM   2801  N  N   . LYS A 1  626  ? 257.217 259.633 162.340 1.00 368.60 ?  626  LYS A N   1 
ATOM   2802  C  CA  . LYS A 1  626  ? 256.150 259.859 161.354 1.00 326.32 ?  626  LYS A CA  1 
ATOM   2803  C  C   . LYS A 1  626  ? 255.136 260.929 161.832 1.00 304.20 ?  626  LYS A C   1 
ATOM   2804  O  O   . LYS A 1  626  ? 254.813 261.871 161.085 1.00 290.81 ?  626  LYS A O   1 
ATOM   2805  C  CB  . LYS A 1  626  ? 255.469 258.510 161.052 1.00 324.25 ?  626  LYS A CB  1 
ATOM   2806  C  CG  . LYS A 1  626  ? 254.401 258.486 159.960 1.00 314.71 ?  626  LYS A CG  1 
ATOM   2807  C  CD  . LYS A 1  626  ? 253.696 257.129 159.904 1.00 297.39 ?  626  LYS A CD  1 
ATOM   2808  C  CE  . LYS A 1  626  ? 252.668 256.950 161.019 1.00 269.10 ?  626  LYS A CE  1 
ATOM   2809  N  NZ  . LYS A 1  626  ? 252.402 255.512 161.307 1.00 273.96 ?  626  LYS A NZ  1 
ATOM   2810  N  N   . PHE A 1  627  ? 254.699 260.779 163.090 1.00 258.05 ?  627  PHE A N   1 
ATOM   2811  C  CA  . PHE A 1  627  ? 253.711 261.620 163.782 1.00 197.72 ?  627  PHE A CA  1 
ATOM   2812  C  C   . PHE A 1  627  ? 254.015 263.109 163.730 1.00 161.26 ?  627  PHE A C   1 
ATOM   2813  O  O   . PHE A 1  627  ? 253.168 263.880 163.339 1.00 165.02 ?  627  PHE A O   1 
ATOM   2814  C  CB  . PHE A 1  627  ? 253.620 261.170 165.242 1.00 195.04 ?  627  PHE A CB  1 
ATOM   2815  C  CG  . PHE A 1  627  ? 252.329 261.513 165.918 1.00 206.28 ?  627  PHE A CG  1 
ATOM   2816  C  CD1 . PHE A 1  627  ? 252.033 262.829 166.262 1.00 202.27 ?  627  PHE A CD1 1 
ATOM   2817  C  CD2 . PHE A 1  627  ? 251.412 260.502 166.253 1.00 216.27 ?  627  PHE A CD2 1 
ATOM   2818  C  CE1 . PHE A 1  627  ? 250.839 263.134 166.908 1.00 247.41 ?  627  PHE A CE1 1 
ATOM   2819  C  CE2 . PHE A 1  627  ? 250.214 260.805 166.903 1.00 219.75 ?  627  PHE A CE2 1 
ATOM   2820  C  CZ  . PHE A 1  627  ? 249.929 262.124 167.222 1.00 231.91 ?  627  PHE A CZ  1 
ATOM   2821  N  N   . ILE A 1  628  ? 255.222 263.485 164.135 1.00 165.66 ?  628  ILE A N   1 
ATOM   2822  C  CA  . ILE A 1  628  ? 255.682 264.886 164.221 1.00 195.25 ?  628  ILE A CA  1 
ATOM   2823  C  C   . ILE A 1  628  ? 255.727 265.679 162.908 1.00 194.81 ?  628  ILE A C   1 
ATOM   2824  O  O   . ILE A 1  628  ? 254.987 266.652 162.759 1.00 207.22 ?  628  ILE A O   1 
ATOM   2825  C  CB  . ILE A 1  628  ? 257.047 264.974 164.981 1.00 225.68 ?  628  ILE A CB  1 
ATOM   2826  C  CG1 . ILE A 1  628  ? 256.834 264.937 166.509 1.00 250.07 ?  628  ILE A CG1 1 
ATOM   2827  C  CG2 . ILE A 1  628  ? 257.922 266.163 164.550 1.00 201.14 ?  628  ILE A CG2 1 
ATOM   2828  C  CD1 . ILE A 1  628  ? 255.654 265.705 167.075 1.00 278.99 ?  628  ILE A CD1 1 
ATOM   2829  N  N   . LEU A 1  629  ? 256.607 265.278 161.986 1.00 210.44 ?  629  LEU A N   1 
ATOM   2830  C  CA  . LEU A 1  629  ? 256.829 265.993 160.715 1.00 223.91 ?  629  LEU A CA  1 
ATOM   2831  C  C   . LEU A 1  629  ? 255.629 265.719 159.772 1.00 237.97 ?  629  LEU A C   1 
ATOM   2832  O  O   . LEU A 1  629  ? 254.757 264.915 160.141 1.00 248.48 ?  629  LEU A O   1 
ATOM   2833  C  CB  . LEU A 1  629  ? 258.197 265.606 160.103 1.00 218.97 ?  629  LEU A CB  1 
ATOM   2834  C  CG  . LEU A 1  629  ? 258.539 264.126 159.849 1.00 245.99 ?  629  LEU A CG  1 
ATOM   2835  C  CD1 . LEU A 1  629  ? 257.634 263.474 158.802 1.00 252.05 ?  629  LEU A CD1 1 
ATOM   2836  C  CD2 . LEU A 1  629  ? 260.001 263.957 159.469 1.00 225.34 ?  629  LEU A CD2 1 
ATOM   2837  N  N   . PRO A 1  630  ? 255.576 266.361 158.569 1.00 235.67 ?  630  PRO A N   1 
ATOM   2838  C  CA  . PRO A 1  630  ? 254.334 266.331 157.776 1.00 246.75 ?  630  PRO A CA  1 
ATOM   2839  C  C   . PRO A 1  630  ? 254.014 264.981 157.094 1.00 258.91 ?  630  PRO A C   1 
ATOM   2840  O  O   . PRO A 1  630  ? 253.913 263.949 157.765 1.00 274.79 ?  630  PRO A O   1 
ATOM   2841  C  CB  . PRO A 1  630  ? 254.565 267.446 156.746 1.00 233.28 ?  630  PRO A CB  1 
ATOM   2842  C  CG  . PRO A 1  630  ? 256.035 267.433 156.532 1.00 225.69 ?  630  PRO A CG  1 
ATOM   2843  C  CD  . PRO A 1  630  ? 256.608 267.177 157.893 1.00 224.40 ?  630  PRO A CD  1 
ATOM   2844  N  N   . LYS A 1  631  ? 253.812 265.011 155.779 1.00 259.57 ?  631  LYS A N   1 
ATOM   2845  C  CA  . LYS A 1  631  ? 253.645 263.806 154.971 1.00 251.37 ?  631  LYS A CA  1 
ATOM   2846  C  C   . LYS A 1  631  ? 254.758 263.742 153.912 1.00 260.13 ?  631  LYS A C   1 
ATOM   2847  O  O   . LYS A 1  631  ? 255.213 262.654 153.548 1.00 267.60 ?  631  LYS A O   1 
ATOM   2848  C  CB  . LYS A 1  631  ? 252.240 263.750 154.351 1.00 201.81 ?  631  LYS A CB  1 
ATOM   2849  N  N   . GLU A 1  632  ? 255.201 264.919 153.461 1.00 254.19 ?  632  GLU A N   1 
ATOM   2850  C  CA  . GLU A 1  632  ? 256.288 265.075 152.496 1.00 232.71 ?  632  GLU A CA  1 
ATOM   2851  C  C   . GLU A 1  632  ? 257.604 264.447 152.973 1.00 230.10 ?  632  GLU A C   1 
ATOM   2852  O  O   . GLU A 1  632  ? 258.233 263.664 152.241 1.00 229.14 ?  632  GLU A O   1 
ATOM   2853  C  CB  . GLU A 1  632  ? 256.487 266.563 152.171 1.00 206.81 ?  632  GLU A CB  1 
ATOM   2854  N  N   . ILE A 1  633  ? 258.016 264.778 154.195 1.00 214.62 ?  633  ILE A N   1 
ATOM   2855  C  CA  . ILE A 1  633  ? 259.337 264.359 154.663 1.00 219.83 ?  633  ILE A CA  1 
ATOM   2856  C  C   . ILE A 1  633  ? 259.329 262.879 155.022 1.00 190.51 ?  633  ILE A C   1 
ATOM   2857  O  O   . ILE A 1  633  ? 260.290 262.159 154.724 1.00 141.77 ?  633  ILE A O   1 
ATOM   2858  C  CB  . ILE A 1  633  ? 259.876 265.226 155.824 1.00 260.79 ?  633  ILE A CB  1 
ATOM   2859  C  CG1 . ILE A 1  633  ? 259.625 266.720 155.554 1.00 292.24 ?  633  ILE A CG1 1 
ATOM   2860  C  CG2 . ILE A 1  633  ? 261.361 264.943 156.043 1.00 285.24 ?  633  ILE A CG2 1 
ATOM   2861  C  CD1 . ILE A 1  633  ? 260.043 267.659 156.670 1.00 307.05 ?  633  ILE A CD1 1 
ATOM   2862  N  N   . ALA A 1  634  ? 258.219 262.441 155.624 1.00 232.72 ?  634  ALA A N   1 
ATOM   2863  C  CA  . ALA A 1  634  ? 257.983 261.031 155.985 1.00 289.45 ?  634  ALA A CA  1 
ATOM   2864  C  C   . ALA A 1  634  ? 258.187 260.088 154.799 1.00 290.58 ?  634  ALA A C   1 
ATOM   2865  O  O   . ALA A 1  634  ? 258.651 258.945 154.973 1.00 319.44 ?  634  ALA A O   1 
ATOM   2866  C  CB  . ALA A 1  634  ? 256.584 260.850 156.562 1.00 321.98 ?  634  ALA A CB  1 
ATOM   2867  N  N   . VAL A 1  635  ? 257.826 260.588 153.610 1.00 250.36 ?  635  VAL A N   1 
ATOM   2868  C  CA  . VAL A 1  635  ? 258.093 259.936 152.332 1.00 203.24 ?  635  VAL A CA  1 
ATOM   2869  C  C   . VAL A 1  635  ? 259.582 259.628 152.253 1.00 158.92 ?  635  VAL A C   1 
ATOM   2870  O  O   . VAL A 1  635  ? 259.973 258.499 152.021 1.00 137.34 ?  635  VAL A O   1 
ATOM   2871  C  CB  . VAL A 1  635  ? 257.613 260.811 151.138 1.00 213.21 ?  635  VAL A CB  1 
ATOM   2872  C  CG1 . VAL A 1  635  ? 258.292 260.428 149.822 1.00 226.18 ?  635  VAL A CG1 1 
ATOM   2873  C  CG2 . VAL A 1  635  ? 256.096 260.749 151.006 1.00 198.21 ?  635  VAL A CG2 1 
ATOM   2874  N  N   . GLN A 1  636  ? 260.418 260.613 152.497 1.00 147.14 ?  636  GLN A N   1 
ATOM   2875  C  CA  . GLN A 1  636  ? 261.805 260.403 152.163 1.00 211.67 ?  636  GLN A CA  1 
ATOM   2876  C  C   . GLN A 1  636  ? 262.540 259.673 153.281 1.00 243.22 ?  636  GLN A C   1 
ATOM   2877  O  O   . GLN A 1  636  ? 263.460 258.897 153.010 1.00 256.42 ?  636  GLN A O   1 
ATOM   2878  C  CB  . GLN A 1  636  ? 262.446 261.711 151.722 1.00 251.63 ?  636  GLN A CB  1 
ATOM   2879  C  CG  . GLN A 1  636  ? 261.997 262.102 150.314 1.00 288.39 ?  636  GLN A CG  1 
ATOM   2880  C  CD  . GLN A 1  636  ? 261.327 263.468 150.233 1.00 320.44 ?  636  GLN A CD  1 
ATOM   2881  O  OE1 . GLN A 1  636  ? 260.258 263.608 149.633 1.00 319.26 ?  636  GLN A OE1 1 
ATOM   2882  N  NE2 . GLN A 1  636  ? 261.955 264.482 150.827 1.00 360.75 ?  636  GLN A NE2 1 
ATOM   2883  N  N   . MET A 1  637  ? 262.073 259.883 154.516 1.00 284.74 ?  637  MET A N   1 
ATOM   2884  C  CA  . MET A 1  637  ? 262.578 259.201 155.731 1.00 292.97 ?  637  MET A CA  1 
ATOM   2885  C  C   . MET A 1  637  ? 262.372 257.668 155.788 1.00 277.53 ?  637  MET A C   1 
ATOM   2886  O  O   . MET A 1  637  ? 263.340 256.909 155.968 1.00 182.24 ?  637  MET A O   1 
ATOM   2887  C  CB  . MET A 1  637  ? 262.084 259.947 157.010 1.00 295.74 ?  637  MET A CB  1 
ATOM   2888  C  CG  . MET A 1  637  ? 261.243 259.194 158.056 1.00 269.55 ?  637  MET A CG  1 
ATOM   2889  S  SD  . MET A 1  637  ? 261.995 257.818 158.952 1.00 227.26 ?  637  MET A SD  1 
ATOM   2890  C  CE  . MET A 1  637  ? 263.148 258.686 160.006 1.00 298.06 ?  637  MET A CE  1 
ATOM   2891  N  N   . LEU A 1  638  ? 261.119 257.231 155.635 1.00 325.01 ?  638  LEU A N   1 
ATOM   2892  C  CA  . LEU A 1  638  ? 260.730 255.833 155.878 1.00 296.89 ?  638  LEU A CA  1 
ATOM   2893  C  C   . LEU A 1  638  ? 261.302 254.929 154.785 1.00 241.03 ?  638  LEU A C   1 
ATOM   2894  O  O   . LEU A 1  638  ? 261.918 253.900 155.075 1.00 137.94 ?  638  LEU A O   1 
ATOM   2895  C  CB  . LEU A 1  638  ? 259.195 255.711 155.962 1.00 335.63 ?  638  LEU A CB  1 
ATOM   2896  C  CG  . LEU A 1  638  ? 258.540 254.768 156.985 1.00 342.43 ?  638  LEU A CG  1 
ATOM   2897  C  CD1 . LEU A 1  638  ? 257.064 255.108 157.176 1.00 334.08 ?  638  LEU A CD1 1 
ATOM   2898  C  CD2 . LEU A 1  638  ? 258.711 253.303 156.610 1.00 353.77 ?  638  LEU A CD2 1 
ATOM   2899  N  N   . VAL A 1  639  ? 261.105 255.373 153.539 1.00 267.61 ?  639  VAL A N   1 
ATOM   2900  C  CA  . VAL A 1  639  ? 261.596 254.717 152.330 1.00 256.08 ?  639  VAL A CA  1 
ATOM   2901  C  C   . VAL A 1  639  ? 263.091 254.501 152.435 1.00 214.01 ?  639  VAL A C   1 
ATOM   2902  O  O   . VAL A 1  639  ? 263.582 253.437 152.065 1.00 208.39 ?  639  VAL A O   1 
ATOM   2903  C  CB  . VAL A 1  639  ? 261.219 255.495 151.023 1.00 316.25 ?  639  VAL A CB  1 
ATOM   2904  C  CG1 . VAL A 1  639  ? 262.088 256.734 150.777 1.00 311.10 ?  639  VAL A CG1 1 
ATOM   2905  C  CG2 . VAL A 1  639  ? 261.291 254.577 149.815 1.00 341.30 ?  639  VAL A CG2 1 
ATOM   2906  N  N   . LYS A 1  640  ? 263.783 255.513 152.967 1.00 192.74 ?  640  LYS A N   1 
ATOM   2907  C  CA  . LYS A 1  640  ? 265.219 255.499 153.077 1.00 228.31 ?  640  LYS A CA  1 
ATOM   2908  C  C   . LYS A 1  640  ? 265.590 254.328 153.949 1.00 250.36 ?  640  LYS A C   1 
ATOM   2909  O  O   . LYS A 1  640  ? 266.387 253.478 153.545 1.00 286.55 ?  640  LYS A O   1 
ATOM   2910  C  CB  . LYS A 1  640  ? 265.755 256.817 153.652 1.00 234.70 ?  640  LYS A CB  1 
ATOM   2911  C  CG  . LYS A 1  640  ? 267.271 256.991 153.611 1.00 271.07 ?  640  LYS A CG  1 
ATOM   2912  C  CD  . LYS A 1  640  ? 267.810 257.304 152.215 1.00 300.33 ?  640  LYS A CD  1 
ATOM   2913  C  CE  . LYS A 1  640  ? 268.548 256.122 151.591 1.00 315.59 ?  640  LYS A CE  1 
ATOM   2914  N  NZ  . LYS A 1  640  ? 267.668 255.087 150.974 1.00 327.36 ?  640  LYS A NZ  1 
ATOM   2915  N  N   . TRP A 1  641  ? 264.955 254.259 155.117 1.00 254.42 ?  641  TRP A N   1 
ATOM   2916  C  CA  . TRP A 1  641  ? 265.221 253.182 156.045 1.00 270.69 ?  641  TRP A CA  1 
ATOM   2917  C  C   . TRP A 1  641  ? 264.668 251.840 155.606 1.00 265.56 ?  641  TRP A C   1 
ATOM   2918  O  O   . TRP A 1  641  ? 265.341 250.832 155.786 1.00 277.57 ?  641  TRP A O   1 
ATOM   2919  C  CB  . TRP A 1  641  ? 264.738 253.505 157.452 1.00 264.04 ?  641  TRP A CB  1 
ATOM   2920  C  CG  . TRP A 1  641  ? 265.048 252.386 158.387 1.00 239.07 ?  641  TRP A CG  1 
ATOM   2921  C  CD1 . TRP A 1  641  ? 266.286 251.967 158.795 1.00 243.78 ?  641  TRP A CD1 1 
ATOM   2922  C  CD2 . TRP A 1  641  ? 264.117 251.496 158.968 1.00 206.76 ?  641  TRP A CD2 1 
ATOM   2923  N  NE1 . TRP A 1  641  ? 266.181 250.902 159.640 1.00 223.20 ?  641  TRP A NE1 1 
ATOM   2924  C  CE2 . TRP A 1  641  ? 264.858 250.578 159.757 1.00 220.40 ?  641  TRP A CE2 1 
ATOM   2925  C  CE3 . TRP A 1  641  ? 262.725 251.385 158.914 1.00 177.37 ?  641  TRP A CE3 1 
ATOM   2926  C  CZ2 . TRP A 1  641  ? 264.252 249.568 160.487 1.00 233.30 ?  641  TRP A CZ2 1 
ATOM   2927  C  CZ3 . TRP A 1  641  ? 262.126 250.389 159.630 1.00 195.12 ?  641  TRP A CZ3 1 
ATOM   2928  C  CH2 . TRP A 1  641  ? 262.889 249.487 160.417 1.00 229.74 ?  641  TRP A CH2 1 
ATOM   2929  N  N   . TYR A 1  642  ? 263.460 251.822 155.043 1.00 246.03 ?  642  TYR A N   1 
ATOM   2930  C  CA  . TYR A 1  642  ? 262.834 250.562 154.631 1.00 255.64 ?  642  TYR A CA  1 
ATOM   2931  C  C   . TYR A 1  642  ? 263.739 249.772 153.690 1.00 254.30 ?  642  TYR A C   1 
ATOM   2932  O  O   . TYR A 1  642  ? 263.893 248.556 153.845 1.00 262.03 ?  642  TYR A O   1 
ATOM   2933  C  CB  . TYR A 1  642  ? 261.476 250.796 153.978 1.00 257.05 ?  642  TYR A CB  1 
ATOM   2934  C  CG  . TYR A 1  642  ? 260.627 249.543 153.857 1.00 245.78 ?  642  TYR A CG  1 
ATOM   2935  C  CD1 . TYR A 1  642  ? 260.885 248.589 152.864 1.00 252.23 ?  642  TYR A CD1 1 
ATOM   2936  C  CD2 . TYR A 1  642  ? 259.547 249.322 154.723 1.00 229.71 ?  642  TYR A CD2 1 
ATOM   2937  C  CE1 . TYR A 1  642  ? 260.109 247.446 152.751 1.00 285.00 ?  642  TYR A CE1 1 
ATOM   2938  C  CE2 . TYR A 1  642  ? 258.755 248.185 154.610 1.00 248.88 ?  642  TYR A CE2 1 
ATOM   2939  C  CZ  . TYR A 1  642  ? 259.042 247.252 153.624 1.00 283.49 ?  642  TYR A CZ  1 
ATOM   2940  O  OH  . TYR A 1  642  ? 258.275 246.119 153.492 1.00 295.17 ?  642  TYR A OH  1 
ATOM   2941  N  N   . ASN A 1  643  ? 264.342 250.482 152.739 1.00 256.91 ?  643  ASN A N   1 
ATOM   2942  C  CA  . ASN A 1  643  ? 265.304 249.905 151.811 1.00 255.11 ?  643  ASN A CA  1 
ATOM   2943  C  C   . ASN A 1  643  ? 266.501 249.243 152.513 1.00 238.75 ?  643  ASN A C   1 
ATOM   2944  O  O   . ASN A 1  643  ? 266.900 248.130 152.144 1.00 212.14 ?  643  ASN A O   1 
ATOM   2945  C  CB  . ASN A 1  643  ? 265.766 250.963 150.807 1.00 265.82 ?  643  ASN A CB  1 
ATOM   2946  C  CG  . ASN A 1  643  ? 265.763 250.450 149.381 1.00 285.53 ?  643  ASN A CG  1 
ATOM   2947  O  OD1 . ASN A 1  643  ? 266.064 249.281 149.122 1.00 317.42 ?  643  ASN A OD1 1 
ATOM   2948  N  ND2 . ASN A 1  643  ? 265.418 251.321 148.445 1.00 277.39 ?  643  ASN A ND2 1 
ATOM   2949  N  N   . VAL A 1  644  ? 267.029 249.922 153.538 1.00 238.52 ?  644  VAL A N   1 
ATOM   2950  C  CA  . VAL A 1  644  ? 268.152 249.434 154.364 1.00 247.04 ?  644  VAL A CA  1 
ATOM   2951  C  C   . VAL A 1  644  ? 267.720 248.291 155.296 1.00 249.36 ?  644  VAL A C   1 
ATOM   2952  O  O   . VAL A 1  644  ? 268.461 247.318 155.456 1.00 249.09 ?  644  VAL A O   1 
ATOM   2953  C  CB  . VAL A 1  644  ? 268.813 250.568 155.206 1.00 251.80 ?  644  VAL A CB  1 
ATOM   2954  C  CG1 . VAL A 1  644  ? 270.089 250.081 155.887 1.00 274.00 ?  644  VAL A CG1 1 
ATOM   2955  C  CG2 . VAL A 1  644  ? 269.136 251.788 154.355 1.00 252.46 ?  644  VAL A CG2 1 
ATOM   2956  N  N   . HIS A 1  645  ? 266.535 248.428 155.904 1.00 248.78 ?  645  HIS A N   1 
ATOM   2957  C  CA  . HIS A 1  645  ? 265.966 247.450 156.848 1.00 244.30 ?  645  HIS A CA  1 
ATOM   2958  C  C   . HIS A 1  645  ? 265.922 246.022 156.311 1.00 257.07 ?  645  HIS A C   1 
ATOM   2959  O  O   . HIS A 1  645  ? 266.264 245.088 157.040 1.00 284.30 ?  645  HIS A O   1 
ATOM   2960  C  CB  . HIS A 1  645  ? 264.573 247.891 157.326 1.00 245.48 ?  645  HIS A CB  1 
ATOM   2961  C  CG  . HIS A 1  645  ? 263.695 246.762 157.776 1.00 252.80 ?  645  HIS A CG  1 
ATOM   2962  N  ND1 . HIS A 1  645  ? 263.975 246.001 158.891 1.00 247.06 ?  645  HIS A ND1 1 
ATOM   2963  C  CD2 . HIS A 1  645  ? 262.548 246.260 157.255 1.00 259.58 ?  645  HIS A CD2 1 
ATOM   2964  C  CE1 . HIS A 1  645  ? 263.039 245.081 159.039 1.00 251.92 ?  645  HIS A CE1 1 
ATOM   2965  N  NE2 . HIS A 1  645  ? 262.162 245.215 158.058 1.00 258.75 ?  645  HIS A NE2 1 
ATOM   2966  N  N   . SER A 1  646  ? 265.506 245.860 155.052 1.00 268.18 ?  646  SER A N   1 
ATOM   2967  C  CA  . SER A 1  646  ? 265.508 244.551 154.381 1.00 300.93 ?  646  SER A CA  1 
ATOM   2968  C  C   . SER A 1  646  ? 266.912 243.905 154.362 1.00 359.50 ?  646  SER A C   1 
ATOM   2969  O  O   . SER A 1  646  ? 267.040 242.679 154.437 1.00 377.71 ?  646  SER A O   1 
ATOM   2970  C  CB  . SER A 1  646  ? 264.936 244.674 152.967 1.00 272.28 ?  646  SER A CB  1 
ATOM   2971  O  OG  . SER A 1  646  ? 265.822 245.368 152.109 1.00 273.28 ?  646  SER A OG  1 
ATOM   2972  N  N   . ALA A 1  647  ? 267.939 244.758 154.271 1.00 393.65 ?  647  ALA A N   1 
ATOM   2973  C  CA  . ALA A 1  647  ? 269.371 244.409 154.402 1.00 392.43 ?  647  ALA A CA  1 
ATOM   2974  C  C   . ALA A 1  647  ? 269.900 243.271 153.504 1.00 422.73 ?  647  ALA A C   1 
ATOM   2975  O  O   . ALA A 1  647  ? 270.541 242.338 153.998 1.00 412.32 ?  647  ALA A O   1 
ATOM   2976  C  CB  . ALA A 1  647  ? 269.740 244.184 155.871 1.00 378.37 ?  647  ALA A CB  1 
ATOM   2977  N  N   . PRO A 1  648  ? 269.647 243.345 152.177 1.00 468.55 ?  648  PRO A N   1 
ATOM   2978  C  CA  . PRO A 1  648  ? 270.278 242.359 151.320 1.00 485.77 ?  648  PRO A CA  1 
ATOM   2979  C  C   . PRO A 1  648  ? 271.516 243.000 150.677 1.00 472.86 ?  648  PRO A C   1 
ATOM   2980  O  O   . PRO A 1  648  ? 271.597 243.123 149.447 1.00 450.02 ?  648  PRO A O   1 
ATOM   2981  C  CB  . PRO A 1  648  ? 269.177 242.059 150.286 1.00 500.00 ?  648  PRO A CB  1 
ATOM   2982  C  CG  . PRO A 1  648  ? 268.231 243.231 150.368 1.00 500.00 ?  648  PRO A CG  1 
ATOM   2983  C  CD  . PRO A 1  648  ? 268.779 244.210 151.363 1.00 494.19 ?  648  PRO A CD  1 
ATOM   2984  N  N   . GLY A 1  649  ? 272.452 243.425 151.525 1.00 462.36 ?  649  GLY A N   1 
ATOM   2985  C  CA  . GLY A 1  649  ? 273.645 244.155 151.087 1.00 451.88 ?  649  GLY A CA  1 
ATOM   2986  C  C   . GLY A 1  649  ? 274.893 243.780 151.862 1.00 463.77 ?  649  GLY A C   1 
ATOM   2987  O  O   . GLY A 1  649  ? 274.982 244.020 153.072 1.00 471.84 ?  649  GLY A O   1 
ATOM   2988  N  N   . GLY A 1  650  ? 275.854 243.192 151.151 1.00 467.88 ?  650  GLY A N   1 
ATOM   2989  C  CA  . GLY A 1  650  ? 277.110 242.728 151.741 1.00 455.49 ?  650  GLY A CA  1 
ATOM   2990  C  C   . GLY A 1  650  ? 276.906 241.606 152.741 1.00 437.53 ?  650  GLY A C   1 
ATOM   2991  O  O   . GLY A 1  650  ? 276.156 240.660 152.483 1.00 442.77 ?  650  GLY A O   1 
ATOM   2992  N  N   . PRO A 1  651  ? 277.561 241.734 153.892 1.00 407.88 ?  651  PRO A N   1 
ATOM   2993  C  CA  . PRO A 1  651  ? 277.515 240.715 154.938 1.00 378.54 ?  651  PRO A CA  1 
ATOM   2994  C  C   . PRO A 1  651  ? 276.429 240.955 156.002 1.00 357.62 ?  651  PRO A C   1 
ATOM   2995  O  O   . PRO A 1  651  ? 276.224 240.100 156.871 1.00 382.41 ?  651  PRO A O   1 
ATOM   2996  C  CB  . PRO A 1  651  ? 278.889 240.568 155.584 1.00 373.12 ?  651  PRO A CB  1 
ATOM   2997  N  N   . SER A 1  652  ? 275.719 242.087 155.896 1.00 314.68 ?  652  SER A N   1 
ATOM   2998  C  CA  . SER A 1  652  ? 274.828 242.617 156.955 1.00 303.15 ?  652  SER A CA  1 
ATOM   2999  C  C   . SER A 1  652  ? 275.605 242.808 158.268 1.00 330.21 ?  652  SER A C   1 
ATOM   3000  O  O   . SER A 1  652  ? 276.202 243.869 158.465 1.00 312.62 ?  652  SER A O   1 
ATOM   3001  C  CB  . SER A 1  652  ? 273.546 241.773 157.133 1.00 271.88 ?  652  SER A CB  1 
ATOM   3002  O  OG  . SER A 1  652  ? 272.836 242.116 158.318 1.00 237.36 ?  652  SER A OG  1 
ATOM   3003  N  N   . TYR A 1  653  ? 275.596 241.771 159.120 1.00 393.45 ?  653  TYR A N   1 
ATOM   3004  C  CA  . TYR A 1  653  ? 276.420 241.619 160.352 1.00 442.96 ?  653  TYR A CA  1 
ATOM   3005  C  C   . TYR A 1  653  ? 275.850 242.223 161.654 1.00 432.54 ?  653  TYR A C   1 
ATOM   3006  O  O   . TYR A 1  653  ? 276.274 241.835 162.751 1.00 480.17 ?  653  TYR A O   1 
ATOM   3007  C  CB  . TYR A 1  653  ? 277.898 242.026 160.124 1.00 482.44 ?  653  TYR A CB  1 
ATOM   3008  C  CG  . TYR A 1  653  ? 278.905 241.351 161.038 1.00 485.31 ?  653  TYR A CG  1 
ATOM   3009  C  CD1 . TYR A 1  653  ? 279.294 240.024 160.821 1.00 469.81 ?  653  TYR A CD1 1 
ATOM   3010  C  CD2 . TYR A 1  653  ? 279.487 242.043 162.109 1.00 480.94 ?  653  TYR A CD2 1 
ATOM   3011  C  CE1 . TYR A 1  653  ? 280.218 239.398 161.650 1.00 447.19 ?  653  TYR A CE1 1 
ATOM   3012  C  CE2 . TYR A 1  653  ? 280.414 241.426 162.945 1.00 458.62 ?  653  TYR A CE2 1 
ATOM   3013  C  CZ  . TYR A 1  653  ? 280.776 240.105 162.711 1.00 446.97 ?  653  TYR A CZ  1 
ATOM   3014  O  OH  . TYR A 1  653  ? 281.692 239.488 163.532 1.00 442.56 ?  653  TYR A OH  1 
ATOM   3015  N  N   . HIS A 1  654  ? 274.882 243.135 161.524 1.00 357.63 ?  654  HIS A N   1 
ATOM   3016  C  CA  . HIS A 1  654  ? 274.379 243.935 162.652 1.00 287.36 ?  654  HIS A CA  1 
ATOM   3017  C  C   . HIS A 1  654  ? 272.968 243.501 163.103 1.00 260.86 ?  654  HIS A C   1 
ATOM   3018  O  O   . HIS A 1  654  ? 272.472 242.453 162.662 1.00 232.86 ?  654  HIS A O   1 
ATOM   3019  C  CB  . HIS A 1  654  ? 274.410 245.426 162.283 1.00 266.99 ?  654  HIS A CB  1 
ATOM   3020  C  CG  . HIS A 1  654  ? 275.790 246.013 162.173 1.00 282.80 ?  654  HIS A CG  1 
ATOM   3021  N  ND1 . HIS A 1  654  ? 276.158 247.167 162.829 1.00 317.28 ?  654  HIS A ND1 1 
ATOM   3022  C  CD2 . HIS A 1  654  ? 276.886 245.617 161.481 1.00 269.21 ?  654  HIS A CD2 1 
ATOM   3023  C  CE1 . HIS A 1  654  ? 277.419 247.450 162.553 1.00 313.14 ?  654  HIS A CE1 1 
ATOM   3024  N  NE2 . HIS A 1  654  ? 277.885 246.523 161.737 1.00 277.91 ?  654  HIS A NE2 1 
ATOM   3025  N  N   . SER A 1  655  ? 272.350 244.308 163.977 1.00 243.04 ?  655  SER A N   1 
ATOM   3026  C  CA  . SER A 1  655  ? 270.990 244.078 164.520 1.00 240.32 ?  655  SER A CA  1 
ATOM   3027  C  C   . SER A 1  655  ? 270.028 245.178 164.073 1.00 236.81 ?  655  SER A C   1 
ATOM   3028  O  O   . SER A 1  655  ? 270.470 246.207 163.539 1.00 268.64 ?  655  SER A O   1 
ATOM   3029  C  CB  . SER A 1  655  ? 270.994 244.051 166.054 1.00 236.78 ?  655  SER A CB  1 
ATOM   3030  O  OG  . SER A 1  655  ? 272.295 243.869 166.580 1.00 280.83 ?  655  SER A OG  1 
ATOM   3031  N  N   . GLU A 1  656  ? 268.729 244.976 164.336 1.00 223.95 ?  656  GLU A N   1 
ATOM   3032  C  CA  . GLU A 1  656  ? 267.643 245.872 163.867 1.00 226.96 ?  656  GLU A CA  1 
ATOM   3033  C  C   . GLU A 1  656  ? 267.848 247.337 164.260 1.00 215.92 ?  656  GLU A C   1 
ATOM   3034  O  O   . GLU A 1  656  ? 267.823 248.239 163.397 1.00 210.16 ?  656  GLU A O   1 
ATOM   3035  C  CB  . GLU A 1  656  ? 266.280 245.370 164.339 1.00 231.55 ?  656  GLU A CB  1 
ATOM   3036  N  N   . TRP A 1  657  ? 268.088 247.541 165.558 1.00 189.03 ?  657  TRP A N   1 
ATOM   3037  C  CA  . TRP A 1  657  ? 268.384 248.853 166.124 1.00 189.71 ?  657  TRP A CA  1 
ATOM   3038  C  C   . TRP A 1  657  ? 269.782 249.346 165.774 1.00 206.46 ?  657  TRP A C   1 
ATOM   3039  O  O   . TRP A 1  657  ? 269.961 250.529 165.488 1.00 206.17 ?  657  TRP A O   1 
ATOM   3040  C  CB  . TRP A 1  657  ? 268.248 248.809 167.627 1.00 184.03 ?  657  TRP A CB  1 
ATOM   3041  C  CG  . TRP A 1  657  ? 268.489 250.124 168.271 1.00 193.32 ?  657  TRP A CG  1 
ATOM   3042  C  CD1 . TRP A 1  657  ? 269.660 250.572 168.800 1.00 194.43 ?  657  TRP A CD1 1 
ATOM   3043  C  CD2 . TRP A 1  657  ? 267.531 251.170 168.461 1.00 196.90 ?  657  TRP A CD2 1 
ATOM   3044  N  NE1 . TRP A 1  657  ? 269.490 251.832 169.326 1.00 198.75 ?  657  TRP A NE1 1 
ATOM   3045  C  CE2 . TRP A 1  657  ? 268.193 252.224 169.130 1.00 188.35 ?  657  TRP A CE2 1 
ATOM   3046  C  CE3 . TRP A 1  657  ? 266.171 251.315 168.146 1.00 206.86 ?  657  TRP A CE3 1 
ATOM   3047  C  CZ2 . TRP A 1  657  ? 267.548 253.409 169.483 1.00 184.64 ?  657  TRP A CZ2 1 
ATOM   3048  C  CZ3 . TRP A 1  657  ? 265.526 252.496 168.504 1.00 211.46 ?  657  TRP A CZ3 1 
ATOM   3049  C  CH2 . TRP A 1  657  ? 266.220 253.530 169.160 1.00 198.91 ?  657  TRP A CH2 1 
ATOM   3050  N  N   . ASN A 1  658  ? 270.761 248.440 165.840 1.00 238.93 ?  658  ASN A N   1 
ATOM   3051  C  CA  . ASN A 1  658  ? 272.138 248.677 165.372 1.00 237.59 ?  658  ASN A CA  1 
ATOM   3052  C  C   . ASN A 1  658  ? 272.180 249.166 163.918 1.00 221.70 ?  658  ASN A C   1 
ATOM   3053  O  O   . ASN A 1  658  ? 273.124 249.849 163.498 1.00 204.63 ?  658  ASN A O   1 
ATOM   3054  C  CB  . ASN A 1  658  ? 272.982 247.403 165.527 1.00 246.64 ?  658  ASN A CB  1 
ATOM   3055  C  CG  . ASN A 1  658  ? 273.355 247.105 166.973 1.00 245.95 ?  658  ASN A CG  1 
ATOM   3056  O  OD1 . ASN A 1  658  ? 274.536 246.989 167.299 1.00 250.41 ?  658  ASN A OD1 1 
ATOM   3057  N  ND2 . ASN A 1  658  ? 272.355 246.967 167.842 1.00 244.08 ?  658  ASN A ND2 1 
ATOM   3058  N  N   . LEU A 1  659  ? 271.138 248.810 163.169 1.00 217.12 ?  659  LEU A N   1 
ATOM   3059  C  CA  . LEU A 1  659  ? 270.910 249.360 161.849 1.00 194.83 ?  659  LEU A CA  1 
ATOM   3060  C  C   . LEU A 1  659  ? 270.042 250.615 161.896 1.00 172.87 ?  659  LEU A C   1 
ATOM   3061  O  O   . LEU A 1  659  ? 270.437 251.646 161.352 1.00 177.16 ?  659  LEU A O   1 
ATOM   3062  C  CB  . LEU A 1  659  ? 270.390 248.297 160.874 1.00 211.07 ?  659  LEU A CB  1 
ATOM   3063  C  CG  . LEU A 1  659  ? 271.451 247.383 160.215 1.00 224.71 ?  659  LEU A CG  1 
ATOM   3064  C  CD1 . LEU A 1  659  ? 271.118 247.210 158.737 1.00 226.51 ?  659  LEU A CD1 1 
ATOM   3065  C  CD2 . LEU A 1  659  ? 272.905 247.854 160.366 1.00 219.82 ?  659  LEU A CD2 1 
ATOM   3066  N  N   . PHE A 1  660  ? 268.896 250.545 162.574 1.00 169.11 ?  660  PHE A N   1 
ATOM   3067  C  CA  . PHE A 1  660  ? 268.061 251.729 162.801 1.00 181.85 ?  660  PHE A CA  1 
ATOM   3068  C  C   . PHE A 1  660  ? 268.873 252.970 163.221 1.00 197.36 ?  660  PHE A C   1 
ATOM   3069  O  O   . PHE A 1  660  ? 268.583 254.080 162.777 1.00 217.08 ?  660  PHE A O   1 
ATOM   3070  C  CB  . PHE A 1  660  ? 266.962 251.455 163.830 1.00 173.14 ?  660  PHE A CB  1 
ATOM   3071  C  CG  . PHE A 1  660  ? 266.113 252.656 164.136 1.00 165.59 ?  660  PHE A CG  1 
ATOM   3072  C  CD1 . PHE A 1  660  ? 265.039 252.993 163.305 1.00 183.97 ?  660  PHE A CD1 1 
ATOM   3073  C  CD2 . PHE A 1  660  ? 266.396 253.474 165.231 1.00 159.18 ?  660  PHE A CD2 1 
ATOM   3074  C  CE1 . PHE A 1  660  ? 264.247 254.108 163.568 1.00 195.46 ?  660  PHE A CE1 1 
ATOM   3075  C  CE2 . PHE A 1  660  ? 265.611 254.592 165.494 1.00 188.33 ?  660  PHE A CE2 1 
ATOM   3076  C  CZ  . PHE A 1  660  ? 264.531 254.905 164.668 1.00 195.20 ?  660  PHE A CZ  1 
ATOM   3077  N  N   . VAL A 1  661  ? 269.873 252.788 164.083 1.00 196.56 ?  661  VAL A N   1 
ATOM   3078  C  CA  . VAL A 1  661  ? 270.752 253.902 164.432 1.00 199.56 ?  661  VAL A CA  1 
ATOM   3079  C  C   . VAL A 1  661  ? 271.382 254.482 163.165 1.00 178.28 ?  661  VAL A C   1 
ATOM   3080  O  O   . VAL A 1  661  ? 271.137 255.641 162.839 1.00 179.07 ?  661  VAL A O   1 
ATOM   3081  C  CB  . VAL A 1  661  ? 271.805 253.587 165.540 1.00 225.36 ?  661  VAL A CB  1 
ATOM   3082  C  CG1 . VAL A 1  661  ? 271.131 253.436 166.890 1.00 239.37 ?  661  VAL A CG1 1 
ATOM   3083  C  CG2 . VAL A 1  661  ? 272.677 252.375 165.228 1.00 210.72 ?  661  VAL A CG2 1 
ATOM   3084  N  N   . THR A 1  662  ? 272.110 253.654 162.417 1.00 168.95 ?  662  THR A N   1 
ATOM   3085  C  CA  . THR A 1  662  ? 272.790 254.106 161.203 1.00 178.69 ?  662  THR A CA  1 
ATOM   3086  C  C   . THR A 1  662  ? 271.772 254.676 160.208 1.00 178.31 ?  662  THR A C   1 
ATOM   3087  O  O   . THR A 1  662  ? 272.122 255.456 159.324 1.00 197.10 ?  662  THR A O   1 
ATOM   3088  C  CB  . THR A 1  662  ? 273.716 253.025 160.574 1.00 196.13 ?  662  THR A CB  1 
ATOM   3089  O  OG1 . THR A 1  662  ? 272.940 251.985 159.967 1.00 210.54 ?  662  THR A OG1 1 
ATOM   3090  C  CG2 . THR A 1  662  ? 274.666 252.418 161.628 1.00 204.68 ?  662  THR A CG2 1 
ATOM   3091  N  N   . CYS A 1  663  ? 270.509 254.304 160.397 1.00 196.61 ?  663  CYS A N   1 
ATOM   3092  C  CA  . CYS A 1  663  ? 269.396 254.859 159.632 1.00 223.47 ?  663  CYS A CA  1 
ATOM   3093  C  C   . CYS A 1  663  ? 269.077 256.302 160.015 1.00 210.04 ?  663  CYS A C   1 
ATOM   3094  O  O   . CYS A 1  663  ? 268.799 257.126 159.149 1.00 201.06 ?  663  CYS A O   1 
ATOM   3095  C  CB  . CYS A 1  663  ? 268.168 253.962 159.787 1.00 260.90 ?  663  CYS A CB  1 
ATOM   3096  S  SG  . CYS A 1  663  ? 266.663 254.722 160.459 1.00 299.59 ?  663  CYS A SG  1 
ATOM   3097  N  N   . LEU A 1  664  ? 269.091 256.586 161.312 1.00 205.36 ?  664  LEU A N   1 
ATOM   3098  C  CA  . LEU A 1  664  ? 268.864 257.935 161.799 1.00 197.02 ?  664  LEU A CA  1 
ATOM   3099  C  C   . LEU A 1  664  ? 270.131 258.770 161.794 1.00 210.74 ?  664  LEU A C   1 
ATOM   3100  O  O   . LEU A 1  664  ? 270.057 259.987 161.692 1.00 190.81 ?  664  LEU A O   1 
ATOM   3101  C  CB  . LEU A 1  664  ? 268.235 257.916 163.191 1.00 192.38 ?  664  LEU A CB  1 
ATOM   3102  C  CG  . LEU A 1  664  ? 266.733 258.204 163.318 1.00 192.20 ?  664  LEU A CG  1 
ATOM   3103  C  CD1 . LEU A 1  664  ? 266.385 259.607 162.847 1.00 216.06 ?  664  LEU A CD1 1 
ATOM   3104  C  CD2 . LEU A 1  664  ? 265.870 257.190 162.596 1.00 183.08 ?  664  LEU A CD2 1 
ATOM   3105  N  N   . MET A 1  665  ? 271.282 258.101 161.915 1.00 231.50 ?  665  MET A N   1 
ATOM   3106  C  CA  . MET A 1  665  ? 272.603 258.709 161.749 1.00 237.20 ?  665  MET A CA  1 
ATOM   3107  C  C   . MET A 1  665  ? 272.582 259.546 160.464 1.00 245.35 ?  665  MET A C   1 
ATOM   3108  O  O   . MET A 1  665  ? 272.672 260.773 160.534 1.00 268.12 ?  665  MET A O   1 
ATOM   3109  C  CB  . MET A 1  665  ? 273.693 257.614 161.732 1.00 244.42 ?  665  MET A CB  1 
ATOM   3110  C  CG  . MET A 1  665  ? 275.081 258.003 161.214 1.00 264.06 ?  665  MET A CG  1 
ATOM   3111  S  SD  . MET A 1  665  ? 275.796 256.722 160.151 1.00 265.35 ?  665  MET A SD  1 
ATOM   3112  C  CE  . MET A 1  665  ? 277.444 257.331 159.840 1.00 204.13 ?  665  MET A CE  1 
ATOM   3113  N  N   . ASN A 1  666  ? 272.386 258.884 159.319 1.00 216.78 ?  666  ASN A N   1 
ATOM   3114  C  CA  . ASN A 1  666  ? 272.329 259.543 158.012 1.00 213.79 ?  666  ASN A CA  1 
ATOM   3115  C  C   . ASN A 1  666  ? 271.126 260.446 157.814 1.00 240.57 ?  666  ASN A C   1 
ATOM   3116  O  O   . ASN A 1  666  ? 271.122 261.272 156.897 1.00 256.53 ?  666  ASN A O   1 
ATOM   3117  C  CB  . ASN A 1  666  ? 272.378 258.512 156.889 1.00 199.14 ?  666  ASN A CB  1 
ATOM   3118  C  CG  . ASN A 1  666  ? 273.668 257.716 156.882 1.00 226.28 ?  666  ASN A CG  1 
ATOM   3119  O  OD1 . ASN A 1  666  ? 273.661 256.532 156.566 1.00 260.86 ?  666  ASN A OD1 1 
ATOM   3120  N  ND2 . ASN A 1  666  ? 274.780 258.357 157.240 1.00 232.78 ?  666  ASN A ND2 1 
ATOM   3121  N  N   . MET A 1  667  ? 270.124 260.297 158.682 1.00 274.23 ?  667  MET A N   1 
ATOM   3122  C  CA  . MET A 1  667  ? 268.853 261.011 158.548 1.00 289.40 ?  667  MET A CA  1 
ATOM   3123  C  C   . MET A 1  667  ? 269.020 262.526 158.537 1.00 294.72 ?  667  MET A C   1 
ATOM   3124  O  O   . MET A 1  667  ? 268.370 263.188 157.776 1.00 312.73 ?  667  MET A O   1 
ATOM   3125  C  CB  . MET A 1  667  ? 267.839 260.566 159.608 1.00 268.27 ?  667  MET A CB  1 
ATOM   3126  C  CG  . MET A 1  667  ? 266.406 260.475 159.107 1.00 277.11 ?  667  MET A CG  1 
ATOM   3127  S  SD  . MET A 1  667  ? 266.237 259.602 157.531 1.00 287.83 ?  667  MET A SD  1 
ATOM   3128  C  CE  . MET A 1  667  ? 266.090 257.906 158.062 1.00 276.27 ?  667  MET A CE  1 
ATOM   3129  N  N   . MET A 1  668  ? 269.904 263.046 159.376 1.00 287.42 ?  668  MET A N   1 
ATOM   3130  C  CA  . MET A 1  668  ? 270.297 264.450 159.343 1.00 274.38 ?  668  MET A CA  1 
ATOM   3131  C  C   . MET A 1  668  ? 271.744 264.498 158.865 1.00 280.51 ?  668  MET A C   1 
ATOM   3132  O  O   . MET A 1  668  ? 272.040 265.159 157.869 1.00 287.58 ?  668  MET A O   1 
ATOM   3133  C  CB  . MET A 1  668  ? 270.179 265.104 160.730 1.00 263.01 ?  668  MET A CB  1 
ATOM   3134  C  CG  . MET A 1  668  ? 269.194 264.441 161.690 1.00 259.19 ?  668  MET A CG  1 
ATOM   3135  S  SD  . MET A 1  668  ? 269.620 262.749 162.172 1.00 249.45 ?  668  MET A SD  1 
ATOM   3136  C  CE  . MET A 1  668  ? 271.082 262.968 163.193 1.00 258.31 ?  668  MET A CE  1 
ATOM   3137  N  N   . GLY A 1  669  ? 272.628 263.781 159.574 1.00 280.37 ?  669  GLY A N   1 
ATOM   3138  C  CA  . GLY A 1  669  ? 274.065 263.725 159.270 1.00 263.57 ?  669  GLY A CA  1 
ATOM   3139  C  C   . GLY A 1  669  ? 275.002 263.139 160.330 1.00 249.91 ?  669  GLY A C   1 
ATOM   3140  O  O   . GLY A 1  669  ? 274.779 263.302 161.537 1.00 237.25 ?  669  GLY A O   1 
ATOM   3141  N  N   . TYR A 1  670  ? 276.027 262.435 159.829 1.00 231.84 ?  670  TYR A N   1 
ATOM   3142  C  CA  . TYR A 1  670  ? 277.244 261.932 160.521 1.00 205.02 ?  670  TYR A CA  1 
ATOM   3143  C  C   . TYR A 1  670  ? 277.973 261.022 159.514 1.00 215.46 ?  670  TYR A C   1 
ATOM   3144  O  O   . TYR A 1  670  ? 277.406 260.694 158.465 1.00 209.08 ?  670  TYR A O   1 
ATOM   3145  C  CB  . TYR A 1  670  ? 276.950 261.184 161.829 1.00 178.43 ?  670  TYR A CB  1 
ATOM   3146  N  N   . ASN A 1  671  ? 279.211 260.620 159.818 1.00 242.86 ?  671  ASN A N   1 
ATOM   3147  C  CA  . ASN A 1  671  ? 280.050 259.848 158.868 1.00 253.56 ?  671  ASN A CA  1 
ATOM   3148  C  C   . ASN A 1  671  ? 280.733 258.571 159.428 1.00 269.25 ?  671  ASN A C   1 
ATOM   3149  O  O   . ASN A 1  671  ? 281.423 257.860 158.683 1.00 264.06 ?  671  ASN A O   1 
ATOM   3150  C  CB  . ASN A 1  671  ? 281.069 260.768 158.194 1.00 232.49 ?  671  ASN A CB  1 
ATOM   3151  N  N   . THR A 1  672  ? 280.511 258.305 160.725 1.00 276.10 ?  672  THR A N   1 
ATOM   3152  C  CA  . THR A 1  672  ? 280.980 257.122 161.512 1.00 249.80 ?  672  THR A CA  1 
ATOM   3153  C  C   . THR A 1  672  ? 282.065 257.424 162.563 1.00 230.65 ?  672  THR A C   1 
ATOM   3154  O  O   . THR A 1  672  ? 283.240 257.656 162.229 1.00 189.79 ?  672  THR A O   1 
ATOM   3155  C  CB  . THR A 1  672  ? 281.357 255.915 160.642 1.00 242.93 ?  672  THR A CB  1 
ATOM   3156  N  N   . ASP A 1  673  ? 281.625 257.425 163.829 1.00 240.10 ?  673  ASP A N   1 
ATOM   3157  C  CA  . ASP A 1  673  ? 282.450 257.683 165.023 1.00 246.18 ?  673  ASP A CA  1 
ATOM   3158  C  C   . ASP A 1  673  ? 281.702 257.285 166.310 1.00 234.70 ?  673  ASP A C   1 
ATOM   3159  O  O   . ASP A 1  673  ? 282.062 256.328 167.008 1.00 207.38 ?  673  ASP A O   1 
ATOM   3160  C  CB  . ASP A 1  673  ? 282.869 259.151 165.084 1.00 246.13 ?  673  ASP A CB  1 
ATOM   3161  N  N   . SER A 1  752  ? 275.951 267.424 156.109 1.00 258.04 ?  752  SER A N   1 
ATOM   3162  C  CA  . SER A 1  752  ? 275.719 268.256 157.288 1.00 278.73 ?  752  SER A CA  1 
ATOM   3163  C  C   . SER A 1  752  ? 274.332 268.919 157.289 1.00 296.02 ?  752  SER A C   1 
ATOM   3164  O  O   . SER A 1  752  ? 273.652 268.921 158.320 1.00 320.69 ?  752  SER A O   1 
ATOM   3165  C  CB  . SER A 1  752  ? 276.824 269.296 157.438 1.00 278.76 ?  752  SER A CB  1 
ATOM   3166  N  N   . THR A 1  753  ? 273.927 269.472 156.141 1.00 293.58 ?  753  THR A N   1 
ATOM   3167  C  CA  . THR A 1  753  ? 272.593 270.066 155.958 1.00 273.73 ?  753  THR A CA  1 
ATOM   3168  C  C   . THR A 1  753  ? 271.946 269.634 154.629 1.00 273.22 ?  753  THR A C   1 
ATOM   3169  O  O   . THR A 1  753  ? 271.823 270.436 153.690 1.00 265.84 ?  753  THR A O   1 
ATOM   3170  C  CB  . THR A 1  753  ? 272.654 271.587 156.086 1.00 245.77 ?  753  THR A CB  1 
ATOM   3171  N  N   . LEU A 1  754  ? 271.533 268.362 154.570 1.00 266.39 ?  754  LEU A N   1 
ATOM   3172  C  CA  . LEU A 1  754  ? 271.001 267.746 153.344 1.00 260.31 ?  754  LEU A CA  1 
ATOM   3173  C  C   . LEU A 1  754  ? 269.531 267.302 153.452 1.00 253.39 ?  754  LEU A C   1 
ATOM   3174  O  O   . LEU A 1  754  ? 268.678 267.842 152.743 1.00 283.27 ?  754  LEU A O   1 
ATOM   3175  C  CB  . LEU A 1  754  ? 271.901 266.604 152.876 1.00 250.75 ?  754  LEU A CB  1 
ATOM   3176  N  N   . LEU A 1  755  ? 269.253 266.319 154.315 1.00 230.21 ?  755  LEU A N   1 
ATOM   3177  C  CA  . LEU A 1  755  ? 267.891 265.856 154.649 1.00 224.94 ?  755  LEU A CA  1 
ATOM   3178  C  C   . LEU A 1  755  ? 267.986 264.871 155.801 1.00 232.54 ?  755  LEU A C   1 
ATOM   3179  O  O   . LEU A 1  755  ? 268.748 263.909 155.704 1.00 220.53 ?  755  LEU A O   1 
ATOM   3180  C  CB  . LEU A 1  755  ? 267.205 265.198 153.456 1.00 207.32 ?  755  LEU A CB  1 
ATOM   3181  N  N   . PHE A 1  756  ? 267.250 265.086 156.900 1.00 254.97 ?  756  PHE A N   1 
ATOM   3182  C  CA  . PHE A 1  756  ? 266.338 266.224 157.100 1.00 252.13 ?  756  PHE A CA  1 
ATOM   3183  C  C   . PHE A 1  756  ? 266.597 266.935 158.445 1.00 252.74 ?  756  PHE A C   1 
ATOM   3184  O  O   . PHE A 1  756  ? 266.227 266.440 159.528 1.00 237.47 ?  756  PHE A O   1 
ATOM   3185  C  CB  . PHE A 1  756  ? 264.888 265.776 156.970 1.00 220.09 ?  756  PHE A CB  1 
ATOM   3186  N  N   . THR A 1  757  ? 267.234 268.106 158.342 1.00 250.45 ?  757  THR A N   1 
ATOM   3187  C  CA  . THR A 1  757  ? 267.729 268.912 159.480 1.00 239.85 ?  757  THR A CA  1 
ATOM   3188  C  C   . THR A 1  757  ? 266.663 269.303 160.497 1.00 226.85 ?  757  THR A C   1 
ATOM   3189  O  O   . THR A 1  757  ? 266.932 270.025 161.465 1.00 255.43 ?  757  THR A O   1 
ATOM   3190  C  CB  . THR A 1  757  ? 268.418 270.200 158.999 1.00 243.99 ?  757  THR A CB  1 
ATOM   3191  O  OG1 . THR A 1  757  ? 267.582 270.845 158.033 1.00 260.41 ?  757  THR A OG1 1 
ATOM   3192  C  CG2 . THR A 1  757  ? 269.774 269.895 158.390 1.00 231.35 ?  757  THR A CG2 1 
ATOM   3193  N  N   . HIS A 1  758  ? 265.456 268.808 160.272 1.00 209.27 ?  758  HIS A N   1 
ATOM   3194  C  CA  . HIS A 1  758  ? 264.393 268.790 161.272 1.00 236.59 ?  758  HIS A CA  1 
ATOM   3195  C  C   . HIS A 1  758  ? 264.763 268.388 162.726 1.00 228.72 ?  758  HIS A C   1 
ATOM   3196  O  O   . HIS A 1  758  ? 263.947 268.587 163.614 1.00 213.56 ?  758  HIS A O   1 
ATOM   3197  C  CB  . HIS A 1  758  ? 263.236 267.923 160.762 1.00 257.64 ?  758  HIS A CB  1 
ATOM   3198  C  CG  . HIS A 1  758  ? 262.048 268.707 160.295 1.00 263.23 ?  758  HIS A CG  1 
ATOM   3199  N  ND1 . HIS A 1  758  ? 262.149 269.985 159.785 1.00 252.00 ?  758  HIS A ND1 1 
ATOM   3200  C  CD2 . HIS A 1  758  ? 260.733 268.381 160.241 1.00 262.26 ?  758  HIS A CD2 1 
ATOM   3201  C  CE1 . HIS A 1  758  ? 260.947 270.421 159.458 1.00 270.40 ?  758  HIS A CE1 1 
ATOM   3202  N  NE2 . HIS A 1  758  ? 260.072 269.464 159.717 1.00 274.47 ?  758  HIS A NE2 1 
ATOM   3203  N  N   . ILE A 1  759  ? 265.976 267.871 162.959 1.00 199.28 ?  759  ILE A N   1 
ATOM   3204  C  CA  . ILE A 1  759  ? 266.508 267.441 164.299 1.00 182.80 ?  759  ILE A CA  1 
ATOM   3205  C  C   . ILE A 1  759  ? 265.927 267.958 165.642 1.00 187.15 ?  759  ILE A C   1 
ATOM   3206  O  O   . ILE A 1  759  ? 265.689 267.146 166.531 1.00 225.21 ?  759  ILE A O   1 
ATOM   3207  C  CB  . ILE A 1  759  ? 268.042 267.560 164.415 1.00 183.10 ?  759  ILE A CB  1 
ATOM   3208  C  CG1 . ILE A 1  759  ? 268.715 267.638 163.033 1.00 224.43 ?  759  ILE A CG1 1 
ATOM   3209  C  CG2 . ILE A 1  759  ? 268.547 266.411 165.264 1.00 160.98 ?  759  ILE A CG2 1 
ATOM   3210  C  CD1 . ILE A 1  759  ? 270.059 268.348 162.995 1.00 244.46 ?  759  ILE A CD1 1 
ATOM   3211  N  N   . PRO A 1  760  ? 265.746 269.291 165.816 1.00 194.10 ?  760  PRO A N   1 
ATOM   3212  C  CA  . PRO A 1  760  ? 264.937 269.805 166.930 1.00 204.33 ?  760  PRO A CA  1 
ATOM   3213  C  C   . PRO A 1  760  ? 263.570 269.145 167.059 1.00 236.04 ?  760  PRO A C   1 
ATOM   3214  O  O   . PRO A 1  760  ? 263.160 268.874 168.180 1.00 262.87 ?  760  PRO A O   1 
ATOM   3215  C  CB  . PRO A 1  760  ? 264.744 271.287 166.578 1.00 243.77 ?  760  PRO A CB  1 
ATOM   3216  C  CG  . PRO A 1  760  ? 265.273 271.449 165.186 1.00 281.21 ?  760  PRO A CG  1 
ATOM   3217  C  CD  . PRO A 1  760  ? 266.346 270.413 165.076 1.00 249.22 ?  760  PRO A CD  1 
ATOM   3218  N  N   . ALA A 1  761  ? 262.892 268.883 165.929 1.00 263.82 ?  761  ALA A N   1 
ATOM   3219  C  CA  . ALA A 1  761  ? 261.626 268.101 165.875 1.00 306.58 ?  761  ALA A CA  1 
ATOM   3220  C  C   . ALA A 1  761  ? 261.772 266.640 166.349 1.00 354.96 ?  761  ALA A C   1 
ATOM   3221  O  O   . ALA A 1  761  ? 261.010 266.189 167.220 1.00 397.01 ?  761  ALA A O   1 
ATOM   3222  C  CB  . ALA A 1  761  ? 260.999 268.145 164.472 1.00 223.75 ?  761  ALA A CB  1 
ATOM   3223  N  N   . ILE A 1  762  ? 262.756 265.926 165.785 1.00 362.67 ?  762  ILE A N   1 
ATOM   3224  C  CA  . ILE A 1  762  ? 262.919 264.460 165.957 1.00 283.71 ?  762  ILE A CA  1 
ATOM   3225  C  C   . ILE A 1  762  ? 263.290 264.070 167.386 1.00 210.84 ?  762  ILE A C   1 
ATOM   3226  O  O   . ILE A 1  762  ? 262.561 263.329 168.036 1.00 149.29 ?  762  ILE A O   1 
ATOM   3227  C  CB  . ILE A 1  762  ? 263.954 263.857 164.949 1.00 302.13 ?  762  ILE A CB  1 
ATOM   3228  C  CG1 . ILE A 1  762  ? 263.564 264.134 163.475 1.00 343.55 ?  762  ILE A CG1 1 
ATOM   3229  C  CG2 . ILE A 1  762  ? 264.208 262.367 165.208 1.00 268.12 ?  762  ILE A CG2 1 
ATOM   3230  C  CD1 . ILE A 1  762  ? 262.212 263.611 163.009 1.00 365.86 ?  762  ILE A CD1 1 
ATOM   3231  N  N   . PHE A 1  763  ? 264.418 264.596 167.852 1.00 194.58 ?  763  PHE A N   1 
ATOM   3232  C  CA  . PHE A 1  763  ? 265.005 264.253 169.133 1.00 202.11 ?  763  PHE A CA  1 
ATOM   3233  C  C   . PHE A 1  763  ? 264.048 264.378 170.333 1.00 211.23 ?  763  PHE A C   1 
ATOM   3234  O  O   . PHE A 1  763  ? 264.071 263.516 171.212 1.00 175.74 ?  763  PHE A O   1 
ATOM   3235  C  CB  . PHE A 1  763  ? 266.286 265.064 169.343 1.00 209.29 ?  763  PHE A CB  1 
ATOM   3236  C  CG  . PHE A 1  763  ? 266.926 264.840 170.675 1.00 275.81 ?  763  PHE A CG  1 
ATOM   3237  C  CD1 . PHE A 1  763  ? 267.816 263.790 170.864 1.00 268.78 ?  763  PHE A CD1 1 
ATOM   3238  C  CD2 . PHE A 1  763  ? 266.621 265.674 171.761 1.00 340.15 ?  763  PHE A CD2 1 
ATOM   3239  C  CE1 . PHE A 1  763  ? 268.399 263.587 172.108 1.00 291.45 ?  763  PHE A CE1 1 
ATOM   3240  C  CE2 . PHE A 1  763  ? 267.200 265.467 173.009 1.00 357.83 ?  763  PHE A CE2 1 
ATOM   3241  C  CZ  . PHE A 1  763  ? 268.093 264.422 173.181 1.00 331.80 ?  763  PHE A CZ  1 
ATOM   3242  N  N   . PHE A 1  764  ? 263.237 265.443 170.366 1.00 285.76 ?  764  PHE A N   1 
ATOM   3243  C  CA  . PHE A 1  764  ? 262.279 265.720 171.467 1.00 357.48 ?  764  PHE A CA  1 
ATOM   3244  C  C   . PHE A 1  764  ? 261.166 264.666 171.528 1.00 374.19 ?  764  PHE A C   1 
ATOM   3245  O  O   . PHE A 1  764  ? 260.888 264.101 172.600 1.00 403.70 ?  764  PHE A O   1 
ATOM   3246  C  CB  . PHE A 1  764  ? 261.722 267.165 171.362 1.00 381.01 ?  764  PHE A CB  1 
ATOM   3247  C  CG  . PHE A 1  764  ? 260.494 267.434 172.205 1.00 386.45 ?  764  PHE A CG  1 
ATOM   3248  C  CD1 . PHE A 1  764  ? 260.594 267.597 173.596 1.00 399.27 ?  764  PHE A CD1 1 
ATOM   3249  C  CD2 . PHE A 1  764  ? 259.233 267.544 171.605 1.00 359.52 ?  764  PHE A CD2 1 
ATOM   3250  C  CE1 . PHE A 1  764  ? 259.460 267.844 174.369 1.00 404.68 ?  764  PHE A CE1 1 
ATOM   3251  C  CE2 . PHE A 1  764  ? 258.098 267.793 172.373 1.00 365.89 ?  764  PHE A CE2 1 
ATOM   3252  C  CZ  . PHE A 1  764  ? 258.213 267.946 173.754 1.00 394.22 ?  764  PHE A CZ  1 
ATOM   3253  N  N   . VAL A 1  765  ? 260.555 264.399 170.370 1.00 339.74 ?  765  VAL A N   1 
ATOM   3254  C  CA  . VAL A 1  765  ? 259.632 263.275 170.227 1.00 280.84 ?  765  VAL A CA  1 
ATOM   3255  C  C   . VAL A 1  765  ? 260.355 261.963 170.551 1.00 229.95 ?  765  VAL A C   1 
ATOM   3256  O  O   . VAL A 1  765  ? 259.773 261.085 171.189 1.00 271.44 ?  765  VAL A O   1 
ATOM   3257  C  CB  . VAL A 1  765  ? 258.895 263.253 168.856 1.00 275.48 ?  765  VAL A CB  1 
ATOM   3258  C  CG1 . VAL A 1  765  ? 259.773 262.748 167.713 1.00 249.70 ?  765  VAL A CG1 1 
ATOM   3259  C  CG2 . VAL A 1  765  ? 257.620 262.425 168.950 1.00 287.64 ?  765  VAL A CG2 1 
ATOM   3260  N  N   . LEU A 1  766  ? 261.630 261.860 170.176 1.00 165.41 ?  766  LEU A N   1 
ATOM   3261  C  CA  . LEU A 1  766  ? 262.370 260.647 170.483 1.00 172.84 ?  766  LEU A CA  1 
ATOM   3262  C  C   . LEU A 1  766  ? 262.746 260.576 171.942 1.00 154.54 ?  766  LEU A C   1 
ATOM   3263  O  O   . LEU A 1  766  ? 262.783 259.474 172.489 1.00 166.48 ?  766  LEU A O   1 
ATOM   3264  C  CB  . LEU A 1  766  ? 263.584 260.424 169.580 1.00 196.60 ?  766  LEU A CB  1 
ATOM   3265  C  CG  . LEU A 1  766  ? 263.779 258.958 169.132 1.00 194.53 ?  766  LEU A CG  1 
ATOM   3266  C  CD1 . LEU A 1  766  ? 264.368 258.887 167.728 1.00 191.23 ?  766  LEU A CD1 1 
ATOM   3267  C  CD2 . LEU A 1  766  ? 264.586 258.100 170.109 1.00 173.22 ?  766  LEU A CD2 1 
ATOM   3268  N  N   . HIS A 1  767  ? 262.989 261.725 172.576 1.00 163.98 ?  767  HIS A N   1 
ATOM   3269  C  CA  . HIS A 1  767  ? 263.089 261.785 174.048 1.00 263.67 ?  767  HIS A CA  1 
ATOM   3270  C  C   . HIS A 1  767  ? 261.775 261.326 174.721 1.00 337.38 ?  767  HIS A C   1 
ATOM   3271  O  O   . HIS A 1  767  ? 261.795 260.519 175.671 1.00 414.88 ?  767  HIS A O   1 
ATOM   3272  C  CB  . HIS A 1  767  ? 263.510 263.184 174.532 1.00 275.02 ?  767  HIS A CB  1 
ATOM   3273  C  CG  . HIS A 1  767  ? 263.364 263.388 176.013 1.00 297.94 ?  767  HIS A CG  1 
ATOM   3274  N  ND1 . HIS A 1  767  ? 264.406 263.222 176.901 1.00 299.53 ?  767  HIS A ND1 1 
ATOM   3275  C  CD2 . HIS A 1  767  ? 262.291 263.744 176.759 1.00 310.60 ?  767  HIS A CD2 1 
ATOM   3276  C  CE1 . HIS A 1  767  ? 263.984 263.474 178.127 1.00 308.55 ?  767  HIS A CE1 1 
ATOM   3277  N  NE2 . HIS A 1  767  ? 262.702 263.786 178.069 1.00 325.23 ?  767  HIS A NE2 1 
ATOM   3278  N  N   . LEU A 1  768  ? 260.647 261.838 174.219 1.00 376.97 ?  768  LEU A N   1 
ATOM   3279  C  CA  . LEU A 1  768  ? 259.312 261.445 174.707 1.00 377.82 ?  768  LEU A CA  1 
ATOM   3280  C  C   . LEU A 1  768  ? 259.048 259.932 174.631 1.00 379.95 ?  768  LEU A C   1 
ATOM   3281  O  O   . LEU A 1  768  ? 258.404 259.368 175.522 1.00 347.34 ?  768  LEU A O   1 
ATOM   3282  C  CB  . LEU A 1  768  ? 258.200 262.239 174.004 1.00 387.76 ?  768  LEU A CB  1 
ATOM   3283  C  CG  . LEU A 1  768  ? 257.774 263.574 174.636 1.00 383.37 ?  768  LEU A CG  1 
ATOM   3284  C  CD1 . LEU A 1  768  ? 256.742 264.271 173.761 1.00 386.01 ?  768  LEU A CD1 1 
ATOM   3285  C  CD2 . LEU A 1  768  ? 257.252 263.403 176.059 1.00 377.06 ?  768  LEU A CD2 1 
ATOM   3286  N  N   . VAL A 1  769  ? 259.579 259.294 173.581 1.00 377.52 ?  769  VAL A N   1 
ATOM   3287  C  CA  . VAL A 1  769  ? 259.603 257.826 173.430 1.00 313.19 ?  769  VAL A CA  1 
ATOM   3288  C  C   . VAL A 1  769  ? 260.354 257.142 174.598 1.00 298.16 ?  769  VAL A C   1 
ATOM   3289  O  O   . VAL A 1  769  ? 259.838 256.189 175.190 1.00 272.70 ?  769  VAL A O   1 
ATOM   3290  C  CB  . VAL A 1  769  ? 260.130 257.413 172.020 1.00 267.74 ?  769  VAL A CB  1 
ATOM   3291  C  CG1 . VAL A 1  769  ? 260.602 255.969 171.975 1.00 263.85 ?  769  VAL A CG1 1 
ATOM   3292  C  CG2 . VAL A 1  769  ? 259.048 257.616 170.973 1.00 238.94 ?  769  VAL A CG2 1 
ATOM   3293  N  N   . TYR A 1  770  ? 261.539 257.656 174.942 1.00 267.91 ?  770  TYR A N   1 
ATOM   3294  C  CA  . TYR A 1  770  ? 262.311 257.197 176.107 1.00 189.07 ?  770  TYR A CA  1 
ATOM   3295  C  C   . TYR A 1  770  ? 261.528 257.327 177.411 1.00 158.36 ?  770  TYR A C   1 
ATOM   3296  O  O   . TYR A 1  770  ? 261.637 256.499 178.271 1.00 141.64 ?  770  TYR A O   1 
ATOM   3297  C  CB  . TYR A 1  770  ? 263.622 257.975 176.201 1.00 194.46 ?  770  TYR A CB  1 
ATOM   3298  C  CG  . TYR A 1  770  ? 264.271 257.967 177.557 1.00 210.36 ?  770  TYR A CG  1 
ATOM   3299  C  CD1 . TYR A 1  770  ? 264.929 256.833 178.013 1.00 215.31 ?  770  TYR A CD1 1 
ATOM   3300  C  CD2 . TYR A 1  770  ? 264.246 259.102 178.382 1.00 239.60 ?  770  TYR A CD2 1 
ATOM   3301  C  CE1 . TYR A 1  770  ? 265.526 256.800 179.257 1.00 231.55 ?  770  TYR A CE1 1 
ATOM   3302  C  CE2 . TYR A 1  770  ? 264.849 259.086 179.633 1.00 271.27 ?  770  TYR A CE2 1 
ATOM   3303  C  CZ  . TYR A 1  770  ? 265.491 257.928 180.058 1.00 264.57 ?  770  TYR A CZ  1 
ATOM   3304  O  OH  . TYR A 1  770  ? 266.098 257.879 181.288 1.00 287.82 ?  770  TYR A OH  1 
ATOM   3305  N  N   . GLU A 1  771  ? 260.740 258.376 177.559 1.00 191.09 ?  771  GLU A N   1 
ATOM   3306  C  CA  . GLU A 1  771  ? 259.905 258.513 178.745 1.00 250.56 ?  771  GLU A CA  1 
ATOM   3307  C  C   . GLU A 1  771  ? 258.726 257.535 178.736 1.00 231.58 ?  771  GLU A C   1 
ATOM   3308  O  O   . GLU A 1  771  ? 258.386 256.943 179.775 1.00 262.49 ?  771  GLU A O   1 
ATOM   3309  C  CB  . GLU A 1  771  ? 259.445 259.968 178.943 1.00 334.47 ?  771  GLU A CB  1 
ATOM   3310  C  CG  . GLU A 1  771  ? 260.567 261.018 178.945 1.00 391.85 ?  771  GLU A CG  1 
ATOM   3311  C  CD  . GLU A 1  771  ? 261.574 260.916 180.100 1.00 429.15 ?  771  GLU A CD  1 
ATOM   3312  O  OE1 . GLU A 1  771  ? 261.414 260.087 181.027 1.00 451.74 ?  771  GLU A OE1 1 
ATOM   3313  O  OE2 . GLU A 1  771  ? 262.552 261.692 180.082 1.00 444.53 -1 771  GLU A OE2 1 
ATOM   3314  N  N   . GLU A 1  772  ? 258.125 257.341 177.566 1.00 172.41 ?  772  GLU A N   1 
ATOM   3315  C  CA  . GLU A 1  772  ? 257.095 256.335 177.423 1.00 192.13 ?  772  GLU A CA  1 
ATOM   3316  C  C   . GLU A 1  772  ? 257.613 254.926 177.779 1.00 204.55 ?  772  GLU A C   1 
ATOM   3317  O  O   . GLU A 1  772  ? 256.945 254.195 178.529 1.00 198.77 ?  772  GLU A O   1 
ATOM   3318  C  CB  . GLU A 1  772  ? 256.575 256.349 176.002 1.00 222.16 ?  772  GLU A CB  1 
ATOM   3319  C  CG  . GLU A 1  772  ? 255.064 256.340 175.919 1.00 287.25 ?  772  GLU A CG  1 
ATOM   3320  C  CD  . GLU A 1  772  ? 254.399 255.003 176.237 1.00 317.77 ?  772  GLU A CD  1 
ATOM   3321  O  OE1 . GLU A 1  772  ? 255.052 253.934 176.158 1.00 328.49 ?  772  GLU A OE1 1 
ATOM   3322  O  OE2 . GLU A 1  772  ? 253.190 255.028 176.549 1.00 354.95 -1 772  GLU A OE2 1 
ATOM   3323  N  N   . LEU A 1  773  ? 258.797 254.574 177.247 1.00 211.88 ?  773  LEU A N   1 
ATOM   3324  C  CA  . LEU A 1  773  ? 259.434 253.242 177.417 1.00 201.88 ?  773  LEU A CA  1 
ATOM   3325  C  C   . LEU A 1  773  ? 259.894 252.980 178.842 1.00 195.66 ?  773  LEU A C   1 
ATOM   3326  O  O   . LEU A 1  773  ? 259.902 251.836 179.314 1.00 192.04 ?  773  LEU A O   1 
ATOM   3327  C  CB  . LEU A 1  773  ? 260.661 253.077 176.511 1.00 203.04 ?  773  LEU A CB  1 
ATOM   3328  C  CG  . LEU A 1  773  ? 260.692 253.054 174.983 1.00 229.65 ?  773  LEU A CG  1 
ATOM   3329  C  CD1 . LEU A 1  773  ? 262.061 252.581 174.504 1.00 228.73 ?  773  LEU A CD1 1 
ATOM   3330  C  CD2 . LEU A 1  773  ? 259.591 252.182 174.394 1.00 264.37 ?  773  LEU A CD2 1 
ATOM   3331  N  N   . LYS A 1  774  ? 260.317 254.059 179.493 1.00 208.41 ?  774  LYS A N   1 
ATOM   3332  C  CA  . LYS A 1  774  ? 260.673 254.085 180.896 1.00 198.15 ?  774  LYS A CA  1 
ATOM   3333  C  C   . LYS A 1  774  ? 259.571 253.428 181.692 1.00 183.86 ?  774  LYS A C   1 
ATOM   3334  O  O   . LYS A 1  774  ? 259.841 252.700 182.643 1.00 203.99 ?  774  LYS A O   1 
ATOM   3335  C  CB  . LYS A 1  774  ? 260.860 255.544 181.316 1.00 220.48 ?  774  LYS A CB  1 
ATOM   3336  C  CG  . LYS A 1  774  ? 261.216 255.798 182.768 1.00 252.11 ?  774  LYS A CG  1 
ATOM   3337  C  CD  . LYS A 1  774  ? 262.204 256.951 182.850 1.00 261.85 ?  774  LYS A CD  1 
ATOM   3338  C  CE  . LYS A 1  774  ? 263.613 256.427 183.064 1.00 254.79 ?  774  LYS A CE  1 
ATOM   3339  N  NZ  . LYS A 1  774  ? 264.213 255.702 181.911 1.00 222.35 ?  774  LYS A NZ  1 
ATOM   3340  N  N   . LEU A 1  775  ? 258.338 253.660 181.254 1.00 178.44 ?  775  LEU A N   1 
ATOM   3341  C  CA  . LEU A 1  775  ? 257.148 253.173 181.937 1.00 225.97 ?  775  LEU A CA  1 
ATOM   3342  C  C   . LEU A 1  775  ? 256.690 251.738 181.589 1.00 210.48 ?  775  LEU A C   1 
ATOM   3343  O  O   . LEU A 1  775  ? 255.836 251.163 182.296 1.00 166.99 ?  775  LEU A O   1 
ATOM   3344  C  CB  . LEU A 1  775  ? 256.016 254.175 181.708 1.00 292.86 ?  775  LEU A CB  1 
ATOM   3345  C  CG  . LEU A 1  775  ? 254.628 253.868 182.274 1.00 344.40 ?  775  LEU A CG  1 
ATOM   3346  C  CD1 . LEU A 1  775  ? 254.578 253.986 183.791 1.00 363.99 ?  775  LEU A CD1 1 
ATOM   3347  C  CD2 . LEU A 1  775  ? 253.625 254.781 181.611 1.00 363.43 ?  775  LEU A CD2 1 
ATOM   3348  N  N   . ASN A 1  776  ? 257.249 251.164 180.520 1.00 225.92 ?  776  ASN A N   1 
ATOM   3349  C  CA  . ASN A 1  776  ? 256.864 249.808 180.058 1.00 211.59 ?  776  ASN A CA  1 
ATOM   3350  C  C   . ASN A 1  776  ? 257.459 248.620 180.833 1.00 167.69 ?  776  ASN A C   1 
ATOM   3351  O  O   . ASN A 1  776  ? 256.747 247.653 181.144 1.00 154.02 ?  776  ASN A O   1 
ATOM   3352  C  CB  . ASN A 1  776  ? 257.103 249.641 178.547 1.00 246.01 ?  776  ASN A CB  1 
ATOM   3353  C  CG  . ASN A 1  776  ? 256.627 248.293 178.021 1.00 253.16 ?  776  ASN A CG  1 
ATOM   3354  O  OD1 . ASN A 1  776  ? 255.549 247.822 178.371 1.00 248.53 ?  776  ASN A OD1 1 
ATOM   3355  N  ND2 . ASN A 1  776  ? 257.432 247.669 177.180 1.00 241.51 ?  776  ASN A ND2 1 
ATOM   3356  N  N   . THR A 1  777  ? 258.757 248.697 181.119 1.00 127.46 ?  777  THR A N   1 
ATOM   3357  C  CA  . THR A 1  777  ? 259.481 247.704 181.936 1.00 154.77 ?  777  THR A CA  1 
ATOM   3358  C  C   . THR A 1  777  ? 260.057 246.648 181.017 1.00 161.02 ?  777  THR A C   1 
ATOM   3359  O  O   . THR A 1  777  ? 261.197 246.197 181.197 1.00 183.40 ?  777  THR A O   1 
ATOM   3360  C  CB  . THR A 1  777  ? 258.623 247.071 183.096 1.00 147.11 ?  777  THR A CB  1 
ATOM   3361  O  OG1 . THR A 1  777  ? 258.348 248.058 184.094 1.00 163.13 ?  777  THR A OG1 1 
ATOM   3362  C  CG2 . THR A 1  777  ? 259.301 245.887 183.807 1.00 143.00 ?  777  THR A CG2 1 
ATOM   3363  N  N   . LEU A 1  778  ? 259.279 246.253 180.024 1.00 164.63 ?  778  LEU A N   1 
ATOM   3364  C  CA  . LEU A 1  778  ? 259.701 245.133 179.231 1.00 186.77 ?  778  LEU A CA  1 
ATOM   3365  C  C   . LEU A 1  778  ? 260.789 245.616 178.327 1.00 165.69 ?  778  LEU A C   1 
ATOM   3366  O  O   . LEU A 1  778  ? 261.589 244.808 177.874 1.00 188.56 ?  778  LEU A O   1 
ATOM   3367  C  CB  . LEU A 1  778  ? 258.538 244.446 178.485 1.00 239.26 ?  778  LEU A CB  1 
ATOM   3368  C  CG  . LEU A 1  778  ? 257.843 243.247 179.184 1.00 244.51 ?  778  LEU A CG  1 
ATOM   3369  C  CD1 . LEU A 1  778  ? 256.435 242.981 178.654 1.00 230.01 ?  778  LEU A CD1 1 
ATOM   3370  C  CD2 . LEU A 1  778  ? 258.678 241.972 179.109 1.00 224.45 ?  778  LEU A CD2 1 
ATOM   3371  N  N   . MET A 1  779  ? 260.867 246.929 178.123 1.00 144.14 ?  779  MET A N   1 
ATOM   3372  C  CA  . MET A 1  779  ? 261.928 247.466 177.290 1.00 199.57 ?  779  MET A CA  1 
ATOM   3373  C  C   . MET A 1  779  ? 263.232 247.497 178.074 1.00 226.58 ?  779  MET A C   1 
ATOM   3374  O  O   . MET A 1  779  ? 263.889 248.516 178.128 1.00 243.44 ?  779  MET A O   1 
ATOM   3375  C  CB  . MET A 1  779  ? 261.572 248.850 176.761 1.00 222.54 ?  779  MET A CB  1 
ATOM   3376  C  CG  . MET A 1  779  ? 260.220 248.951 176.072 1.00 266.27 ?  779  MET A CG  1 
ATOM   3377  S  SD  . MET A 1  779  ? 259.806 247.705 174.826 1.00 305.15 ?  779  MET A SD  1 
ATOM   3378  C  CE  . MET A 1  779  ? 258.291 248.390 174.147 1.00 255.82 ?  779  MET A CE  1 
ATOM   3379  N  N   . GLY A 1  780  ? 263.582 246.373 178.699 1.00 255.64 ?  780  GLY A N   1 
ATOM   3380  C  CA  . GLY A 1  780  ? 264.813 246.238 179.473 1.00 282.75 ?  780  GLY A CA  1 
ATOM   3381  C  C   . GLY A 1  780  ? 265.977 246.058 178.527 1.00 308.65 ?  780  GLY A C   1 
ATOM   3382  O  O   . GLY A 1  780  ? 265.923 245.217 177.620 1.00 327.26 ?  780  GLY A O   1 
ATOM   3383  N  N   . GLU A 1  781  ? 267.027 246.852 178.751 1.00 308.28 ?  781  GLU A N   1 
ATOM   3384  C  CA  . GLU A 1  781  ? 268.215 246.957 177.873 1.00 319.74 ?  781  GLU A CA  1 
ATOM   3385  C  C   . GLU A 1  781  ? 267.906 247.657 176.548 1.00 300.71 ?  781  GLU A C   1 
ATOM   3386  O  O   . GLU A 1  781  ? 268.816 248.189 175.909 1.00 329.64 ?  781  GLU A O   1 
ATOM   3387  C  CB  . GLU A 1  781  ? 268.891 245.603 177.582 1.00 359.90 ?  781  GLU A CB  1 
ATOM   3388  C  CG  . GLU A 1  781  ? 269.088 244.674 178.769 1.00 399.75 ?  781  GLU A CG  1 
ATOM   3389  C  CD  . GLU A 1  781  ? 268.558 243.279 178.488 1.00 427.72 ?  781  GLU A CD  1 
ATOM   3390  O  OE1 . GLU A 1  781  ? 268.877 242.709 177.419 1.00 429.34 ?  781  GLU A OE1 1 
ATOM   3391  O  OE2 . GLU A 1  781  ? 267.821 242.744 179.342 1.00 461.67 -1 781  GLU A OE2 1 
ATOM   3392  N  N   . GLY A 1  782  ? 266.641 247.629 176.129 1.00 258.03 ?  782  GLY A N   1 
ATOM   3393  C  CA  . GLY A 1  782  ? 266.208 248.297 174.908 1.00 250.75 ?  782  GLY A CA  1 
ATOM   3394  C  C   . GLY A 1  782  ? 266.204 249.797 175.105 1.00 237.56 ?  782  GLY A C   1 
ATOM   3395  O  O   . GLY A 1  782  ? 266.666 250.556 174.242 1.00 252.56 ?  782  GLY A O   1 
ATOM   3396  N  N   . ILE A 1  783  ? 265.681 250.211 176.257 1.00 211.33 ?  783  ILE A N   1 
ATOM   3397  C  CA  . ILE A 1  783  ? 265.702 251.603 176.684 1.00 203.70 ?  783  ILE A CA  1 
ATOM   3398  C  C   . ILE A 1  783  ? 267.140 252.098 176.728 1.00 185.53 ?  783  ILE A C   1 
ATOM   3399  O  O   . ILE A 1  783  ? 267.417 253.198 176.266 1.00 175.94 ?  783  ILE A O   1 
ATOM   3400  C  CB  . ILE A 1  783  ? 264.989 251.801 178.050 1.00 217.13 ?  783  ILE A CB  1 
ATOM   3401  C  CG1 . ILE A 1  783  ? 264.861 253.279 178.401 1.00 226.66 ?  783  ILE A CG1 1 
ATOM   3402  C  CG2 . ILE A 1  783  ? 265.694 251.068 179.189 1.00 263.29 ?  783  ILE A CG2 1 
ATOM   3403  C  CD1 . ILE A 1  783  ? 263.532 253.865 178.020 1.00 254.55 ?  783  ILE A CD1 1 
ATOM   3404  N  N   . CYS A 1  784  ? 268.029 251.250 177.250 1.00 180.94 ?  784  CYS A N   1 
ATOM   3405  C  CA  . CYS A 1  784  ? 269.446 251.545 177.438 1.00 226.49 ?  784  CYS A CA  1 
ATOM   3406  C  C   . CYS A 1  784  ? 270.180 251.818 176.110 1.00 230.24 ?  784  CYS A C   1 
ATOM   3407  O  O   . CYS A 1  784  ? 271.035 252.707 176.036 1.00 245.05 ?  784  CYS A O   1 
ATOM   3408  C  CB  . CYS A 1  784  ? 270.096 250.390 178.208 1.00 264.73 ?  784  CYS A CB  1 
ATOM   3409  S  SG  . CYS A 1  784  ? 271.637 250.768 179.068 1.00 317.42 ?  784  CYS A SG  1 
ATOM   3410  N  N   . SER A 1  785  ? 269.832 251.067 175.067 1.00 208.86 ?  785  SER A N   1 
ATOM   3411  C  CA  . SER A 1  785  ? 270.372 251.322 173.740 1.00 199.90 ?  785  SER A CA  1 
ATOM   3412  C  C   . SER A 1  785  ? 269.795 252.601 173.117 1.00 182.00 ?  785  SER A C   1 
ATOM   3413  O  O   . SER A 1  785  ? 270.532 253.329 172.462 1.00 193.55 ?  785  SER A O   1 
ATOM   3414  C  CB  . SER A 1  785  ? 270.178 250.125 172.816 1.00 226.43 ?  785  SER A CB  1 
ATOM   3415  O  OG  . SER A 1  785  ? 270.947 250.287 171.637 1.00 267.28 ?  785  SER A OG  1 
ATOM   3416  N  N   . LEU A 1  786  ? 268.504 252.881 173.332 1.00 147.96 ?  786  LEU A N   1 
ATOM   3417  C  CA  . LEU A 1  786  ? 267.903 254.155 172.891 1.00 151.08 ?  786  LEU A CA  1 
ATOM   3418  C  C   . LEU A 1  786  ? 268.604 255.356 173.501 1.00 162.28 ?  786  LEU A C   1 
ATOM   3419  O  O   . LEU A 1  786  ? 268.793 256.368 172.827 1.00 146.20 ?  786  LEU A O   1 
ATOM   3420  C  CB  . LEU A 1  786  ? 266.407 254.230 173.221 1.00 172.72 ?  786  LEU A CB  1 
ATOM   3421  C  CG  . LEU A 1  786  ? 265.531 255.345 172.595 1.00 170.18 ?  786  LEU A CG  1 
ATOM   3422  C  CD1 . LEU A 1  786  ? 264.142 254.813 172.297 1.00 188.03 ?  786  LEU A CD1 1 
ATOM   3423  C  CD2 . LEU A 1  786  ? 265.406 256.583 173.455 1.00 130.32 ?  786  LEU A CD2 1 
ATOM   3424  N  N   . VAL A 1  787  ? 268.957 255.225 174.782 1.00 202.89 ?  787  VAL A N   1 
ATOM   3425  C  CA  . VAL A 1  787  ? 269.685 256.237 175.571 1.00 218.11 ?  787  VAL A CA  1 
ATOM   3426  C  C   . VAL A 1  787  ? 271.049 256.567 174.977 1.00 186.42 ?  787  VAL A C   1 
ATOM   3427  O  O   . VAL A 1  787  ? 271.426 257.741 174.960 1.00 184.28 ?  787  VAL A O   1 
ATOM   3428  C  CB  . VAL A 1  787  ? 269.782 255.833 177.071 1.00 269.01 ?  787  VAL A CB  1 
ATOM   3429  C  CG1 . VAL A 1  787  ? 271.016 256.402 177.770 1.00 298.64 ?  787  VAL A CG1 1 
ATOM   3430  C  CG2 . VAL A 1  787  ? 268.528 256.262 177.808 1.00 279.17 ?  787  VAL A CG2 1 
ATOM   3431  N  N   . GLU A 1  788  ? 271.771 255.546 174.510 1.00 167.10 ?  788  GLU A N   1 
ATOM   3432  C  CA  . GLU A 1  788  ? 272.911 255.753 173.619 1.00 236.30 ?  788  GLU A CA  1 
ATOM   3433  C  C   . GLU A 1  788  ? 272.584 256.678 172.378 1.00 321.64 ?  788  GLU A C   1 
ATOM   3434  O  O   . GLU A 1  788  ? 273.298 257.663 172.154 1.00 378.05 ?  788  GLU A O   1 
ATOM   3435  C  CB  . GLU A 1  788  ? 273.543 254.403 173.233 1.00 207.84 ?  788  GLU A CB  1 
ATOM   3436  C  CG  . GLU A 1  788  ? 274.685 254.473 172.221 1.00 237.20 ?  788  GLU A CG  1 
ATOM   3437  C  CD  . GLU A 1  788  ? 276.009 254.951 172.808 1.00 248.97 ?  788  GLU A CD  1 
ATOM   3438  O  OE1 . GLU A 1  788  ? 276.482 254.346 173.790 1.00 266.13 ?  788  GLU A OE1 1 
ATOM   3439  O  OE2 . GLU A 1  788  ? 276.597 255.919 172.269 1.00 257.39 -1 788  GLU A OE2 1 
ATOM   3440  N  N   . LEU A 1  789  ? 271.511 256.383 171.621 1.00 321.84 ?  789  LEU A N   1 
ATOM   3441  C  CA  . LEU A 1  789  ? 271.056 257.215 170.450 1.00 241.32 ?  789  LEU A CA  1 
ATOM   3442  C  C   . LEU A 1  789  ? 270.735 258.671 170.822 1.00 177.72 ?  789  LEU A C   1 
ATOM   3443  O  O   . LEU A 1  789  ? 271.163 259.607 170.167 1.00 161.29 ?  789  LEU A O   1 
ATOM   3444  C  CB  . LEU A 1  789  ? 269.847 256.580 169.734 1.00 244.91 ?  789  LEU A CB  1 
ATOM   3445  C  CG  . LEU A 1  789  ? 269.261 257.288 168.495 1.00 254.66 ?  789  LEU A CG  1 
ATOM   3446  C  CD1 . LEU A 1  789  ? 268.683 256.299 167.486 1.00 234.91 ?  789  LEU A CD1 1 
ATOM   3447  C  CD2 . LEU A 1  789  ? 268.240 258.368 168.859 1.00 254.94 ?  789  LEU A CD2 1 
ATOM   3448  N  N   . LEU A 1  790  ? 269.962 258.831 171.878 1.00 130.14 ?  790  LEU A N   1 
ATOM   3449  C  CA  . LEU A 1  790  ? 269.836 260.102 172.554 1.00 157.73 ?  790  LEU A CA  1 
ATOM   3450  C  C   . LEU A 1  790  ? 271.113 260.753 173.194 1.00 215.87 ?  790  LEU A C   1 
ATOM   3451  O  O   . LEU A 1  790  ? 270.958 261.711 173.962 1.00 292.79 ?  790  LEU A O   1 
ATOM   3452  C  CB  . LEU A 1  790  ? 268.756 259.960 173.622 1.00 131.45 ?  790  LEU A CB  1 
ATOM   3453  C  CG  . LEU A 1  790  ? 267.375 259.574 173.143 1.00 134.30 ?  790  LEU A CG  1 
ATOM   3454  C  CD1 . LEU A 1  790  ? 266.426 259.820 174.290 1.00 134.63 ?  790  LEU A CD1 1 
ATOM   3455  C  CD2 . LEU A 1  790  ? 266.959 260.385 171.930 1.00 161.24 ?  790  LEU A CD2 1 
ATOM   3456  N  N   . VAL A 1  791  ? 272.342 260.270 172.933 1.00 191.11 ?  791  VAL A N   1 
ATOM   3457  C  CA  . VAL A 1  791  ? 273.548 261.066 173.316 1.00 139.42 ?  791  VAL A CA  1 
ATOM   3458  C  C   . VAL A 1  791  ? 274.474 261.398 172.176 1.00 146.86 ?  791  VAL A C   1 
ATOM   3459  O  O   . VAL A 1  791  ? 274.933 262.543 172.087 1.00 166.79 ?  791  VAL A O   1 
ATOM   3460  C  CB  . VAL A 1  791  ? 274.365 260.595 174.545 1.00 127.77 ?  791  VAL A CB  1 
ATOM   3461  C  CG1 . VAL A 1  791  ? 273.618 260.860 175.856 1.00 113.45 ?  791  VAL A CG1 1 
ATOM   3462  C  CG2 . VAL A 1  791  ? 274.900 259.174 174.391 1.00 142.36 ?  791  VAL A CG2 1 
ATOM   3463  N  N   . GLN A 1  792  ? 274.741 260.447 171.291 1.00 159.76 ?  792  GLN A N   1 
ATOM   3464  C  CA  . GLN A 1  792  ? 275.522 260.789 170.112 1.00 232.35 ?  792  GLN A CA  1 
ATOM   3465  C  C   . GLN A 1  792  ? 274.687 261.754 169.211 1.00 266.07 ?  792  GLN A C   1 
ATOM   3466  O  O   . GLN A 1  792  ? 274.452 261.461 168.038 1.00 324.54 ?  792  GLN A O   1 
ATOM   3467  C  CB  . GLN A 1  792  ? 275.984 259.506 169.406 1.00 258.05 ?  792  GLN A CB  1 
ATOM   3468  C  CG  . GLN A 1  792  ? 277.488 259.486 169.148 1.00 309.05 ?  792  GLN A CG  1 
ATOM   3469  C  CD  . GLN A 1  792  ? 278.060 258.090 168.950 1.00 334.87 ?  792  GLN A CD  1 
ATOM   3470  O  OE1 . GLN A 1  792  ? 278.065 257.557 167.839 1.00 354.44 ?  792  GLN A OE1 1 
ATOM   3471  N  NE2 . GLN A 1  792  ? 278.572 257.503 170.028 1.00 337.67 ?  792  GLN A NE2 1 
ATOM   3472  N  N   . LEU A 1  793  ? 274.306 262.917 169.781 1.00 256.69 ?  793  LEU A N   1 
ATOM   3473  C  CA  . LEU A 1  793  ? 273.108 263.763 169.429 1.00 237.01 ?  793  LEU A CA  1 
ATOM   3474  C  C   . LEU A 1  793  ? 271.809 263.435 170.274 1.00 190.16 ?  793  LEU A C   1 
ATOM   3475  O  O   . LEU A 1  793  ? 271.412 262.276 170.382 1.00 159.87 ?  793  LEU A O   1 
ATOM   3476  C  CB  . LEU A 1  793  ? 272.825 263.778 167.906 1.00 276.05 ?  793  LEU A CB  1 
ATOM   3477  C  CG  . LEU A 1  793  ? 271.674 264.488 167.166 1.00 305.45 ?  793  LEU A CG  1 
ATOM   3478  C  CD1 . LEU A 1  793  ? 270.269 264.030 167.580 1.00 332.03 ?  793  LEU A CD1 1 
ATOM   3479  C  CD2 . LEU A 1  793  ? 271.814 266.003 167.233 1.00 320.52 ?  793  LEU A CD2 1 
ATOM   3480  N  N   . ALA A 1  794  ? 271.112 264.423 170.848 1.00 153.60 ?  794  ALA A N   1 
ATOM   3481  C  CA  . ALA A 1  794  ? 271.356 265.861 170.704 1.00 207.64 ?  794  ALA A CA  1 
ATOM   3482  C  C   . ALA A 1  794  ? 272.414 266.545 171.606 1.00 286.94 ?  794  ALA A C   1 
ATOM   3483  O  O   . ALA A 1  794  ? 272.485 267.780 171.617 1.00 353.10 ?  794  ALA A O   1 
ATOM   3484  C  CB  . ALA A 1  794  ? 270.041 266.601 170.814 1.00 163.24 ?  794  ALA A CB  1 
ATOM   3485  N  N   . ARG A 1  795  ? 273.242 265.788 172.340 1.00 321.72 ?  795  ARG A N   1 
ATOM   3486  C  CA  . ARG A 1  795  ? 274.308 266.415 173.167 1.00 262.31 ?  795  ARG A CA  1 
ATOM   3487  C  C   . ARG A 1  795  ? 275.285 267.237 172.317 1.00 233.99 ?  795  ARG A C   1 
ATOM   3488  O  O   . ARG A 1  795  ? 275.863 268.203 172.820 1.00 205.70 ?  795  ARG A O   1 
ATOM   3489  C  CB  . ARG A 1  795  ? 275.025 265.410 174.078 1.00 248.36 ?  795  ARG A CB  1 
ATOM   3490  C  CG  . ARG A 1  795  ? 276.086 266.027 174.971 1.00 240.82 ?  795  ARG A CG  1 
ATOM   3491  C  CD  . ARG A 1  795  ? 277.461 265.454 174.678 1.00 286.50 ?  795  ARG A CD  1 
ATOM   3492  N  NE  . ARG A 1  795  ? 277.792 264.377 175.618 1.00 324.47 ?  795  ARG A NE  1 
ATOM   3493  C  CZ  . ARG A 1  795  ? 277.580 263.074 175.417 1.00 317.58 ?  795  ARG A CZ  1 
ATOM   3494  N  NH1 . ARG A 1  795  ? 277.044 262.635 174.286 1.00 320.46 ?  795  ARG A NH1 1 
ATOM   3495  N  NH2 . ARG A 1  795  ? 277.919 262.198 176.355 1.00 293.03 ?  795  ARG A NH2 1 
ATOM   3496  N  N   . ASP A 1  796  ? 275.417 266.873 171.033 1.00 232.00 ?  796  ASP A N   1 
ATOM   3497  C  CA  . ASP A 1  796  ? 276.107 267.710 170.041 1.00 263.38 ?  796  ASP A CA  1 
ATOM   3498  C  C   . ASP A 1  796  ? 275.255 268.889 169.488 1.00 245.18 ?  796  ASP A C   1 
ATOM   3499  O  O   . ASP A 1  796  ? 275.829 269.898 169.056 1.00 278.11 ?  796  ASP A O   1 
ATOM   3500  C  CB  . ASP A 1  796  ? 276.719 266.869 168.901 1.00 298.70 ?  796  ASP A CB  1 
ATOM   3501  C  CG  . ASP A 1  796  ? 278.186 267.252 168.599 1.00 315.19 ?  796  ASP A CG  1 
ATOM   3502  O  OD1 . ASP A 1  796  ? 279.082 266.801 169.350 1.00 324.79 ?  796  ASP A OD1 1 
ATOM   3503  O  OD2 . ASP A 1  796  ? 278.450 267.985 167.611 1.00 287.38 -1 796  ASP A OD2 1 
ATOM   3504  N  N   . LEU A 1  797  ? 273.917 268.761 169.500 1.00 190.00 ?  797  LEU A N   1 
ATOM   3505  C  CA  . LEU A 1  797  ? 272.984 269.879 169.182 1.00 194.71 ?  797  LEU A CA  1 
ATOM   3506  C  C   . LEU A 1  797  ? 273.082 271.040 170.212 1.00 229.57 ?  797  LEU A C   1 
ATOM   3507  O  O   . LEU A 1  797  ? 272.789 272.205 169.897 1.00 210.45 ?  797  LEU A O   1 
ATOM   3508  C  CB  . LEU A 1  797  ? 271.540 269.352 169.065 1.00 176.49 ?  797  LEU A CB  1 
ATOM   3509  C  CG  . LEU A 1  797  ? 270.307 270.121 168.538 1.00 207.80 ?  797  LEU A CG  1 
ATOM   3510  C  CD1 . LEU A 1  797  ? 270.480 270.637 167.110 1.00 215.68 ?  797  LEU A CD1 1 
ATOM   3511  C  CD2 . LEU A 1  797  ? 269.035 269.271 168.612 1.00 204.70 ?  797  LEU A CD2 1 
ATOM   3512  N  N   . LYS A 1  798  ? 273.502 270.673 171.431 1.00 286.62 ?  798  LYS A N   1 
ATOM   3513  C  CA  . LYS A 1  798  ? 273.840 271.535 172.607 1.00 271.25 ?  798  LYS A CA  1 
ATOM   3514  C  C   . LYS A 1  798  ? 272.702 272.247 173.373 1.00 254.45 ?  798  LYS A C   1 
ATOM   3515  O  O   . LYS A 1  798  ? 272.657 273.481 173.501 1.00 196.64 ?  798  LYS A O   1 
ATOM   3516  C  CB  . LYS A 1  798  ? 275.074 272.431 172.389 1.00 253.13 ?  798  LYS A CB  1 
ATOM   3517  C  CG  . LYS A 1  798  ? 276.078 272.240 173.518 1.00 246.53 ?  798  LYS A CG  1 
ATOM   3518  C  CD  . LYS A 1  798  ? 276.635 273.540 174.067 1.00 272.53 ?  798  LYS A CD  1 
ATOM   3519  C  CE  . LYS A 1  798  ? 277.105 273.347 175.502 1.00 273.02 ?  798  LYS A CE  1 
ATOM   3520  N  NZ  . LYS A 1  798  ? 277.466 274.633 176.163 1.00 278.18 ?  798  LYS A NZ  1 
ATOM   3521  N  N   . LEU A 1  799  ? 271.804 271.420 173.901 1.00 268.59 ?  799  LEU A N   1 
ATOM   3522  C  CA  . LEU A 1  799  ? 270.732 271.872 174.764 1.00 253.91 ?  799  LEU A CA  1 
ATOM   3523  C  C   . LEU A 1  799  ? 271.232 271.955 176.196 1.00 222.84 ?  799  LEU A C   1 
ATOM   3524  O  O   . LEU A 1  799  ? 271.076 272.993 176.815 1.00 208.33 ?  799  LEU A O   1 
ATOM   3525  C  CB  . LEU A 1  799  ? 269.478 270.991 174.630 1.00 295.93 ?  799  LEU A CB  1 
ATOM   3526  C  CG  . LEU A 1  799  ? 268.705 271.113 173.304 1.00 326.07 ?  799  LEU A CG  1 
ATOM   3527  C  CD1 . LEU A 1  799  ? 269.062 269.991 172.338 1.00 330.84 ?  799  LEU A CD1 1 
ATOM   3528  C  CD2 . LEU A 1  799  ? 267.201 271.150 173.528 1.00 337.20 ?  799  LEU A CD2 1 
ATOM   3529  N  N   . GLY A 1  800  ? 271.848 270.886 176.707 1.00 237.19 ?  800  GLY A N   1 
ATOM   3530  C  CA  . GLY A 1  800  ? 272.433 270.886 178.061 1.00 319.18 ?  800  GLY A CA  1 
ATOM   3531  C  C   . GLY A 1  800  ? 271.661 270.152 179.163 1.00 405.55 ?  800  GLY A C   1 
ATOM   3532  O  O   . GLY A 1  800  ? 272.103 269.077 179.593 1.00 453.60 ?  800  GLY A O   1 
ATOM   3533  N  N   . PRO A 1  801  ? 270.531 270.736 179.657 1.00 450.74 ?  801  PRO A N   1 
ATOM   3534  C  CA  . PRO A 1  801  ? 269.634 270.113 180.652 1.00 462.42 ?  801  PRO A CA  1 
ATOM   3535  C  C   . PRO A 1  801  ? 269.181 268.682 180.347 1.00 468.79 ?  801  PRO A C   1 
ATOM   3536  O  O   . PRO A 1  801  ? 269.015 267.890 181.282 1.00 476.73 ?  801  PRO A O   1 
ATOM   3537  C  CB  . PRO A 1  801  ? 268.421 271.065 180.691 1.00 466.90 ?  801  PRO A CB  1 
ATOM   3538  C  CG  . PRO A 1  801  ? 268.650 272.068 179.606 1.00 462.90 ?  801  PRO A CG  1 
ATOM   3539  C  CD  . PRO A 1  801  ? 270.136 272.140 179.467 1.00 460.07 ?  801  PRO A CD  1 
ATOM   3540  N  N   . TYR A 1  802  ? 268.989 268.364 179.064 1.00 460.18 ?  802  TYR A N   1 
ATOM   3541  C  CA  . TYR A 1  802  ? 268.707 266.991 178.608 1.00 433.20 ?  802  TYR A CA  1 
ATOM   3542  C  C   . TYR A 1  802  ? 269.862 266.018 178.910 1.00 427.35 ?  802  TYR A C   1 
ATOM   3543  O  O   . TYR A 1  802  ? 269.624 264.913 179.412 1.00 446.00 ?  802  TYR A O   1 
ATOM   3544  C  CB  . TYR A 1  802  ? 268.378 266.967 177.107 1.00 424.56 ?  802  TYR A CB  1 
ATOM   3545  C  CG  . TYR A 1  802  ? 267.010 267.506 176.739 1.00 428.26 ?  802  TYR A CG  1 
ATOM   3546  C  CD1 . TYR A 1  802  ? 266.822 268.864 176.458 1.00 437.70 ?  802  TYR A CD1 1 
ATOM   3547  C  CD2 . TYR A 1  802  ? 265.903 266.655 176.648 1.00 430.42 ?  802  TYR A CD2 1 
ATOM   3548  C  CE1 . TYR A 1  802  ? 265.568 269.360 176.112 1.00 449.23 ?  802  TYR A CE1 1 
ATOM   3549  C  CE2 . TYR A 1  802  ? 264.645 267.143 176.300 1.00 443.20 ?  802  TYR A CE2 1 
ATOM   3550  C  CZ  . TYR A 1  802  ? 264.484 268.493 176.032 1.00 451.53 ?  802  TYR A CZ  1 
ATOM   3551  O  OH  . TYR A 1  802  ? 263.243 268.979 175.688 1.00 457.87 ?  802  TYR A OH  1 
ATOM   3552  N  N   . VAL A 1  803  ? 271.097 266.451 178.616 1.00 386.79 ?  803  VAL A N   1 
ATOM   3553  C  CA  . VAL A 1  803  ? 272.330 265.645 178.781 1.00 303.22 ?  803  VAL A CA  1 
ATOM   3554  C  C   . VAL A 1  803  ? 272.481 265.103 180.213 1.00 258.16 ?  803  VAL A C   1 
ATOM   3555  O  O   . VAL A 1  803  ? 272.551 263.889 180.414 1.00 139.19 ?  803  VAL A O   1 
ATOM   3556  C  CB  . VAL A 1  803  ? 273.618 266.427 178.372 1.00 291.88 ?  803  VAL A CB  1 
ATOM   3557  C  CG1 . VAL A 1  803  ? 274.815 265.491 178.320 1.00 290.02 ?  803  VAL A CG1 1 
ATOM   3558  C  CG2 . VAL A 1  803  ? 273.448 267.171 177.044 1.00 277.26 ?  803  VAL A CG2 1 
ATOM   3559  N  N   . ASP A 1  804  ? 272.499 266.011 181.192 1.00 344.99 ?  804  ASP A N   1 
ATOM   3560  C  CA  . ASP A 1  804  ? 272.670 265.652 182.613 1.00 419.55 ?  804  ASP A CA  1 
ATOM   3561  C  C   . ASP A 1  804  ? 271.515 264.835 183.200 1.00 422.70 ?  804  ASP A C   1 
ATOM   3562  O  O   . ASP A 1  804  ? 271.737 264.048 184.120 1.00 390.05 ?  804  ASP A O   1 
ATOM   3563  C  CB  . ASP A 1  804  ? 272.984 266.884 183.491 1.00 482.68 ?  804  ASP A CB  1 
ATOM   3564  C  CG  . ASP A 1  804  ? 271.957 268.013 183.343 1.00 500.00 ?  804  ASP A CG  1 
ATOM   3565  O  OD1 . ASP A 1  804  ? 271.700 268.448 182.207 1.00 500.00 ?  804  ASP A OD1 1 
ATOM   3566  O  OD2 . ASP A 1  804  ? 271.439 268.488 184.381 1.00 500.00 -1 804  ASP A OD2 1 
ATOM   3567  N  N   . HIS A 1  805  ? 270.301 265.008 182.665 1.00 424.98 ?  805  HIS A N   1 
ATOM   3568  C  CA  . HIS A 1  805  ? 269.153 264.165 183.037 1.00 366.39 ?  805  HIS A CA  1 
ATOM   3569  C  C   . HIS A 1  805  ? 269.396 262.687 182.703 1.00 277.21 ?  805  HIS A C   1 
ATOM   3570  O  O   . HIS A 1  805  ? 269.136 261.811 183.540 1.00 240.70 ?  805  HIS A O   1 
ATOM   3571  C  CB  . HIS A 1  805  ? 267.848 264.662 182.394 1.00 427.85 ?  805  HIS A CB  1 
ATOM   3572  C  CG  . HIS A 1  805  ? 266.680 263.748 182.611 1.00 451.23 ?  805  HIS A CG  1 
ATOM   3573  N  ND1 . HIS A 1  805  ? 266.261 262.839 181.663 1.00 454.63 ?  805  HIS A ND1 1 
ATOM   3574  C  CD2 . HIS A 1  805  ? 265.856 263.589 183.674 1.00 457.49 ?  805  HIS A CD2 1 
ATOM   3575  C  CE1 . HIS A 1  805  ? 265.224 262.166 182.129 1.00 452.80 ?  805  HIS A CE1 1 
ATOM   3576  N  NE2 . HIS A 1  805  ? 264.959 262.602 183.347 1.00 454.20 ?  805  HIS A NE2 1 
ATOM   3577  N  N   . TYR A 1  806  ? 269.897 262.413 181.497 1.00 191.04 ?  806  TYR A N   1 
ATOM   3578  C  CA  . TYR A 1  806  ? 270.220 261.048 181.140 1.00 204.30 ?  806  TYR A CA  1 
ATOM   3579  C  C   . TYR A 1  806  ? 271.360 260.548 182.016 1.00 227.01 ?  806  TYR A C   1 
ATOM   3580  O  O   . TYR A 1  806  ? 271.375 259.370 182.381 1.00 243.67 ?  806  TYR A O   1 
ATOM   3581  C  CB  . TYR A 1  806  ? 270.578 260.897 179.663 1.00 221.83 ?  806  TYR A CB  1 
ATOM   3582  C  CG  . TYR A 1  806  ? 269.531 261.358 178.687 1.00 238.62 ?  806  TYR A CG  1 
ATOM   3583  C  CD1 . TYR A 1  806  ? 268.201 260.913 178.772 1.00 268.26 ?  806  TYR A CD1 1 
ATOM   3584  C  CD2 . TYR A 1  806  ? 269.877 262.221 177.646 1.00 274.66 ?  806  TYR A CD2 1 
ATOM   3585  C  CE1 . TYR A 1  806  ? 267.239 261.348 177.859 1.00 312.99 ?  806  TYR A CE1 1 
ATOM   3586  C  CE2 . TYR A 1  806  ? 268.931 262.660 176.727 1.00 314.62 ?  806  TYR A CE2 1 
ATOM   3587  C  CZ  . TYR A 1  806  ? 267.618 262.226 176.831 1.00 325.89 ?  806  TYR A CZ  1 
ATOM   3588  O  OH  . TYR A 1  806  ? 266.704 262.680 175.903 1.00 339.74 ?  806  TYR A OH  1 
ATOM   3589  N  N   . TYR A 1  807  ? 272.298 261.440 182.365 1.00 238.83 ?  807  TYR A N   1 
ATOM   3590  C  CA  . TYR A 1  807  ? 273.365 261.096 183.310 1.00 238.30 ?  807  TYR A CA  1 
ATOM   3591  C  C   . TYR A 1  807  ? 272.767 260.599 184.626 1.00 238.70 ?  807  TYR A C   1 
ATOM   3592  O  O   . TYR A 1  807  ? 273.235 259.597 185.192 1.00 216.88 ?  807  TYR A O   1 
ATOM   3593  C  CB  . TYR A 1  807  ? 274.342 262.258 183.583 1.00 235.33 ?  807  TYR A CB  1 
ATOM   3594  C  CG  . TYR A 1  807  ? 275.208 261.957 184.789 1.00 252.23 ?  807  TYR A CG  1 
ATOM   3595  C  CD1 . TYR A 1  807  ? 276.342 261.146 184.673 1.00 265.24 ?  807  TYR A CD1 1 
ATOM   3596  C  CD2 . TYR A 1  807  ? 274.851 262.412 186.066 1.00 273.10 ?  807  TYR A CD2 1 
ATOM   3597  C  CE1 . TYR A 1  807  ? 277.119 260.826 185.785 1.00 275.21 ?  807  TYR A CE1 1 
ATOM   3598  C  CE2 . TYR A 1  807  ? 275.619 262.094 187.185 1.00 285.90 ?  807  TYR A CE2 1 
ATOM   3599  C  CZ  . TYR A 1  807  ? 276.754 261.302 187.041 1.00 274.24 ?  807  TYR A CZ  1 
ATOM   3600  O  OH  . TYR A 1  807  ? 277.530 260.987 188.140 1.00 253.01 ?  807  TYR A OH  1 
ATOM   3601  N  N   . ARG A 1  808  ? 271.742 261.321 185.088 1.00 250.71 ?  808  ARG A N   1 
ATOM   3602  C  CA  . ARG A 1  808  ? 271.041 261.039 186.338 1.00 262.15 ?  808  ARG A CA  1 
ATOM   3603  C  C   . ARG A 1  808  ? 270.524 259.604 186.362 1.00 250.92 ?  808  ARG A C   1 
ATOM   3604  O  O   . ARG A 1  808  ? 270.826 258.850 187.291 1.00 264.21 ?  808  ARG A O   1 
ATOM   3605  C  CB  . ARG A 1  808  ? 269.896 262.040 186.554 1.00 267.68 ?  808  ARG A CB  1 
ATOM   3606  C  CG  . ARG A 1  808  ? 269.821 262.636 187.953 1.00 291.13 ?  808  ARG A CG  1 
ATOM   3607  C  CD  . ARG A 1  808  ? 270.615 263.937 188.084 1.00 286.42 ?  808  ARG A CD  1 
ATOM   3608  N  NE  . ARG A 1  808  ? 270.204 264.701 189.262 1.00 285.88 ?  808  ARG A NE  1 
ATOM   3609  C  CZ  . ARG A 1  808  ? 269.133 265.493 189.325 1.00 286.95 ?  808  ARG A CZ  1 
ATOM   3610  N  NH1 . ARG A 1  808  ? 268.334 265.655 188.271 1.00 291.23 ?  808  ARG A NH1 1 
ATOM   3611  N  NH2 . ARG A 1  808  ? 268.854 266.127 190.454 1.00 274.08 ?  808  ARG A NH2 1 
ATOM   3612  N  N   . ASP A 1  809  ? 269.798 259.206 185.323 1.00 233.91 ?  809  ASP A N   1 
ATOM   3613  C  CA  . ASP A 1  809  ? 269.269 257.848 185.291 1.00 238.20 ?  809  ASP A CA  1 
ATOM   3614  C  C   . ASP A 1  809  ? 270.278 256.795 184.838 1.00 232.65 ?  809  ASP A C   1 
ATOM   3615  O  O   . ASP A 1  809  ? 270.355 255.720 185.419 1.00 206.55 ?  809  ASP A O   1 
ATOM   3616  C  CB  . ASP A 1  809  ? 268.003 257.773 184.451 1.00 240.66 ?  809  ASP A CB  1 
ATOM   3617  C  CG  . ASP A 1  809  ? 266.911 256.983 185.131 1.00 237.78 ?  809  ASP A CG  1 
ATOM   3618  O  OD1 . ASP A 1  809  ? 267.213 256.061 185.909 1.00 202.17 ?  809  ASP A OD1 1 
ATOM   3619  O  OD2 . ASP A 1  809  ? 265.739 257.303 184.903 1.00 280.29 -1 809  ASP A OD2 1 
ATOM   3620  N  N   . TYR A 1  810  ? 271.032 257.094 183.788 1.00 244.97 ?  810  TYR A N   1 
ATOM   3621  C  CA  . TYR A 1  810  ? 272.052 256.168 183.319 1.00 234.97 ?  810  TYR A CA  1 
ATOM   3622  C  C   . TYR A 1  810  ? 273.421 256.790 183.475 1.00 234.05 ?  810  TYR A C   1 
ATOM   3623  O  O   . TYR A 1  810  ? 273.836 257.617 182.649 1.00 224.55 ?  810  TYR A O   1 
ATOM   3624  C  CB  . TYR A 1  810  ? 271.752 255.647 181.911 1.00 214.53 ?  810  TYR A CB  1 
ATOM   3625  C  CG  . TYR A 1  810  ? 270.559 254.742 181.941 1.00 210.12 ?  810  TYR A CG  1 
ATOM   3626  C  CD1 . TYR A 1  810  ? 269.259 255.272 182.012 1.00 209.70 ?  810  TYR A CD1 1 
ATOM   3627  C  CD2 . TYR A 1  810  ? 270.715 253.361 181.961 1.00 217.34 ?  810  TYR A CD2 1 
ATOM   3628  C  CE1 . TYR A 1  810  ? 268.150 254.451 182.074 1.00 210.50 ?  810  TYR A CE1 1 
ATOM   3629  C  CE2 . TYR A 1  810  ? 269.607 252.528 182.020 1.00 235.35 ?  810  TYR A CE2 1 
ATOM   3630  C  CZ  . TYR A 1  810  ? 268.330 253.080 182.074 1.00 223.04 ?  810  TYR A CZ  1 
ATOM   3631  O  OH  . TYR A 1  810  ? 267.230 252.264 182.132 1.00 216.03 ?  810  TYR A OH  1 
ATOM   3632  N  N   . PRO A 1  811  ? 274.108 256.400 184.568 1.00 219.04 ?  811  PRO A N   1 
ATOM   3633  C  CA  . PRO A 1  811  ? 275.423 256.862 184.995 1.00 238.37 ?  811  PRO A CA  1 
ATOM   3634  C  C   . PRO A 1  811  ? 276.428 256.727 183.841 1.00 264.45 ?  811  PRO A C   1 
ATOM   3635  O  O   . PRO A 1  811  ? 276.743 257.728 183.191 1.00 299.63 ?  811  PRO A O   1 
ATOM   3636  C  CB  . PRO A 1  811  ? 275.758 255.913 186.156 1.00 228.41 ?  811  PRO A CB  1 
ATOM   3637  C  CG  . PRO A 1  811  ? 274.971 254.680 185.856 1.00 216.38 ?  811  PRO A CG  1 
ATOM   3638  C  CD  . PRO A 1  811  ? 273.676 255.234 185.358 1.00 200.71 ?  811  PRO A CD  1 
ATOM   3639  N  N   . THR A 1  812  ? 276.876 255.501 183.563 1.00 244.69 ?  812  THR A N   1 
ATOM   3640  C  CA  . THR A 1  812  ? 277.648 255.176 182.364 1.00 223.99 ?  812  THR A CA  1 
ATOM   3641  C  C   . THR A 1  812  ? 276.789 255.547 181.148 1.00 231.90 ?  812  THR A C   1 
ATOM   3642  O  O   . THR A 1  812  ? 275.574 255.725 181.284 1.00 245.15 ?  812  THR A O   1 
ATOM   3643  C  CB  . THR A 1  812  ? 278.056 253.679 182.334 1.00 224.86 ?  812  THR A CB  1 
ATOM   3644  O  OG1 . THR A 1  812  ? 277.021 252.892 181.728 1.00 218.15 ?  812  THR A OG1 1 
ATOM   3645  C  CG2 . THR A 1  812  ? 278.348 253.141 183.752 1.00 214.13 ?  812  THR A CG2 1 
ATOM   3646  N  N   . LEU A 1  813  ? 277.412 255.659 179.972 1.00 251.23 ?  813  LEU A N   1 
ATOM   3647  C  CA  . LEU A 1  813  ? 276.782 256.233 178.751 1.00 260.08 ?  813  LEU A CA  1 
ATOM   3648  C  C   . LEU A 1  813  ? 276.499 257.740 178.960 1.00 254.20 ?  813  LEU A C   1 
ATOM   3649  O  O   . LEU A 1  813  ? 275.521 258.301 178.427 1.00 223.46 ?  813  LEU A O   1 
ATOM   3650  C  CB  . LEU A 1  813  ? 275.517 255.458 178.289 1.00 264.85 ?  813  LEU A CB  1 
ATOM   3651  C  CG  . LEU A 1  813  ? 275.330 253.939 178.495 1.00 260.51 ?  813  LEU A CG  1 
ATOM   3652  C  CD1 . LEU A 1  813  ? 273.923 253.648 179.003 1.00 243.77 ?  813  LEU A CD1 1 
ATOM   3653  C  CD2 . LEU A 1  813  ? 275.656 253.106 177.264 1.00 244.94 ?  813  LEU A CD2 1 
ATOM   3654  N  N   . VAL A 1  814  ? 277.379 258.364 179.756 1.00 265.38 ?  814  VAL A N   1 
ATOM   3655  C  CA  . VAL A 1  814  ? 277.387 259.803 180.051 1.00 273.63 ?  814  VAL A CA  1 
ATOM   3656  C  C   . VAL A 1  814  ? 278.704 260.211 180.721 1.00 263.85 ?  814  VAL A C   1 
ATOM   3657  O  O   . VAL A 1  814  ? 279.731 260.381 180.064 1.00 258.39 ?  814  VAL A O   1 
ATOM   3658  C  CB  . VAL A 1  814  ? 276.208 260.185 180.936 1.00 268.13 ?  814  VAL A CB  1 
ATOM   3659  N  N   . PHE A 1  837  ? 258.828 273.907 167.347 1.00 146.62 ?  837  PHE A N   1 
ATOM   3660  C  CA  . PHE A 1  837  ? 259.314 274.356 168.655 1.00 195.41 ?  837  PHE A CA  1 
ATOM   3661  C  C   . PHE A 1  837  ? 259.511 273.154 169.549 1.00 248.09 ?  837  PHE A C   1 
ATOM   3662  O  O   . PHE A 1  837  ? 258.906 272.108 169.312 1.00 290.41 ?  837  PHE A O   1 
ATOM   3663  C  CB  . PHE A 1  837  ? 258.320 275.311 169.302 1.00 166.59 ?  837  PHE A CB  1 
ATOM   3664  N  N   . THR A 1  838  ? 260.355 273.305 170.573 1.00 357.11 ?  838  THR A N   1 
ATOM   3665  C  CA  . THR A 1  838  ? 260.510 272.297 171.646 1.00 443.40 ?  838  THR A CA  1 
ATOM   3666  C  C   . THR A 1  838  ? 260.602 272.925 173.052 1.00 495.34 ?  838  THR A C   1 
ATOM   3667  O  O   . THR A 1  838  ? 260.842 274.133 173.185 1.00 500.00 ?  838  THR A O   1 
ATOM   3668  C  CB  . THR A 1  838  ? 261.695 271.367 171.369 1.00 461.10 ?  838  THR A CB  1 
ATOM   3669  N  N   . SER A 1  839  ? 260.407 272.103 174.088 1.00 500.00 ?  839  SER A N   1 
ATOM   3670  C  CA  . SER A 1  839  ? 260.316 272.573 175.482 1.00 500.00 ?  839  SER A CA  1 
ATOM   3671  C  C   . SER A 1  839  ? 261.552 272.245 176.348 1.00 500.00 ?  839  SER A C   1 
ATOM   3672  O  O   . SER A 1  839  ? 262.599 271.849 175.822 1.00 500.00 ?  839  SER A O   1 
ATOM   3673  C  CB  . SER A 1  839  ? 259.027 272.039 176.127 1.00 499.44 ?  839  SER A CB  1 
ATOM   3674  N  N   . GLU A 1  840  ? 261.417 272.453 177.663 1.00 500.00 ?  840  GLU A N   1 
ATOM   3675  C  CA  . GLU A 1  840  ? 262.426 272.097 178.672 1.00 500.00 ?  840  GLU A CA  1 
ATOM   3676  C  C   . GLU A 1  840  ? 262.197 270.649 179.152 1.00 500.00 ?  840  GLU A C   1 
ATOM   3677  O  O   . GLU A 1  840  ? 261.037 270.248 179.298 1.00 500.00 ?  840  GLU A O   1 
ATOM   3678  C  CB  . GLU A 1  840  ? 262.349 273.074 179.849 1.00 500.00 ?  840  GLU A CB  1 
ATOM   3679  N  N   . PRO A 1  841  ? 263.288 269.882 179.438 1.00 500.00 ?  841  PRO A N   1 
ATOM   3680  C  CA  . PRO A 1  841  ? 263.211 268.404 179.476 1.00 500.00 ?  841  PRO A CA  1 
ATOM   3681  C  C   . PRO A 1  841  ? 262.073 267.823 180.335 1.00 500.00 ?  841  PRO A C   1 
ATOM   3682  O  O   . PRO A 1  841  ? 262.007 268.117 181.534 1.00 500.00 ?  841  PRO A O   1 
ATOM   3683  C  CB  . PRO A 1  841  ? 264.587 267.982 180.019 1.00 500.00 ?  841  PRO A CB  1 
ATOM   3684  C  CG  . PRO A 1  841  ? 265.096 269.176 180.746 1.00 500.00 ?  841  PRO A CG  1 
ATOM   3685  C  CD  . PRO A 1  841  ? 264.586 270.354 179.966 1.00 500.00 ?  841  PRO A CD  1 
ATOM   3686  N  N   . PRO A 1  842  ? 261.165 267.030 179.713 1.00 500.00 ?  842  PRO A N   1 
ATOM   3687  C  CA  . PRO A 1  842  ? 260.053 266.409 180.434 1.00 500.00 ?  842  PRO A CA  1 
ATOM   3688  C  C   . PRO A 1  842  ? 260.380 265.006 180.965 1.00 500.00 ?  842  PRO A C   1 
ATOM   3689  O  O   . PRO A 1  842  ? 260.634 264.086 180.180 1.00 500.00 ?  842  PRO A O   1 
ATOM   3690  C  CB  . PRO A 1  842  ? 258.932 266.362 179.382 1.00 500.00 ?  842  PRO A CB  1 
ATOM   3691  C  CG  . PRO A 1  842  ? 259.604 266.510 178.047 1.00 500.00 ?  842  PRO A CG  1 
ATOM   3692  C  CD  . PRO A 1  842  ? 261.067 266.781 178.261 1.00 500.00 ?  842  PRO A CD  1 
ATOM   3693  N  N   . SER A 1  843  ? 260.389 264.870 182.290 1.00 500.00 ?  843  SER A N   1 
ATOM   3694  C  CA  . SER A 1  843  ? 260.593 263.584 182.957 1.00 500.00 ?  843  SER A CA  1 
ATOM   3695  C  C   . SER A 1  843  ? 259.322 263.200 183.706 1.00 500.00 ?  843  SER A C   1 
ATOM   3696  O  O   . SER A 1  843  ? 258.850 263.955 184.568 1.00 500.00 ?  843  SER A O   1 
ATOM   3697  C  CB  . SER A 1  843  ? 261.782 263.652 183.925 1.00 500.00 ?  843  SER A CB  1 
ATOM   3698  O  OG  . SER A 1  843  ? 261.945 262.431 184.631 1.00 500.00 ?  843  SER A OG  1 
ATOM   3699  N  N   . ILE A 1  844  ? 258.780 262.027 183.364 1.00 500.00 ?  844  ILE A N   1 
ATOM   3700  C  CA  . ILE A 1  844  ? 257.578 261.477 184.013 1.00 500.00 ?  844  ILE A CA  1 
ATOM   3701  C  C   . ILE A 1  844  ? 257.812 261.221 185.515 1.00 500.00 ?  844  ILE A C   1 
ATOM   3702  O  O   . ILE A 1  844  ? 256.928 261.487 186.333 1.00 500.00 ?  844  ILE A O   1 
ATOM   3703  C  CB  . ILE A 1  844  ? 256.988 260.249 183.246 1.00 500.00 ?  844  ILE A CB  1 
ATOM   3704  C  CG1 . ILE A 1  844  ? 255.530 259.990 183.659 1.00 500.00 ?  844  ILE A CG1 1 
ATOM   3705  C  CG2 . ILE A 1  844  ? 257.868 259.003 183.369 1.00 500.00 ?  844  ILE A CG2 1 
ATOM   3706  C  CD1 . ILE A 1  844  ? 254.609 259.647 182.506 1.00 500.00 ?  844  ILE A CD1 1 
ATOM   3707  N  N   . TYR A 1  845  ? 259.016 260.752 185.853 1.00 471.87 ?  845  TYR A N   1 
ATOM   3708  C  CA  . TYR A 1  845  ? 259.459 260.576 187.237 1.00 427.32 ?  845  TYR A CA  1 
ATOM   3709  C  C   . TYR A 1  845  ? 259.420 261.876 188.051 1.00 470.77 ?  845  TYR A C   1 
ATOM   3710  O  O   . TYR A 1  845  ? 258.759 261.944 189.106 1.00 488.59 ?  845  TYR A O   1 
ATOM   3711  C  CB  . TYR A 1  845  ? 260.861 259.947 187.265 1.00 320.73 ?  845  TYR A CB  1 
ATOM   3712  C  CG  . TYR A 1  845  ? 260.873 258.454 187.042 1.00 246.16 ?  845  TYR A CG  1 
ATOM   3713  C  CD1 . TYR A 1  845  ? 259.784 257.662 187.420 1.00 263.83 ?  845  TYR A CD1 1 
ATOM   3714  C  CD2 . TYR A 1  845  ? 261.986 257.824 186.509 1.00 210.92 ?  845  TYR A CD2 1 
ATOM   3715  C  CE1 . TYR A 1  845  ? 259.792 256.290 187.240 1.00 263.09 ?  845  TYR A CE1 1 
ATOM   3716  C  CE2 . TYR A 1  845  ? 262.005 256.450 186.331 1.00 235.93 ?  845  TYR A CE2 1 
ATOM   3717  C  CZ  . TYR A 1  845  ? 260.906 255.692 186.689 1.00 252.55 ?  845  TYR A CZ  1 
ATOM   3718  O  OH  . TYR A 1  845  ? 260.923 254.334 186.505 1.00 276.13 ?  845  TYR A OH  1 
ATOM   3719  N  N   . GLN A 1  846  ? 260.100 262.901 187.528 1.00 498.05 ?  846  GLN A N   1 
ATOM   3720  C  CA  . GLN A 1  846  ? 260.140 264.239 188.126 1.00 498.62 ?  846  GLN A CA  1 
ATOM   3721  C  C   . GLN A 1  846  ? 258.742 264.857 188.245 1.00 500.00 ?  846  GLN A C   1 
ATOM   3722  O  O   . GLN A 1  846  ? 258.437 265.506 189.252 1.00 500.00 ?  846  GLN A O   1 
ATOM   3723  C  CB  . GLN A 1  846  ? 261.095 265.157 187.341 1.00 445.14 ?  846  GLN A CB  1 
ATOM   3724  C  CG  . GLN A 1  846  ? 261.366 266.528 187.970 1.00 383.77 ?  846  GLN A CG  1 
ATOM   3725  C  CD  . GLN A 1  846  ? 261.754 266.473 189.443 1.00 345.92 ?  846  GLN A CD  1 
ATOM   3726  O  OE1 . GLN A 1  846  ? 261.048 267.005 190.298 1.00 282.20 ?  846  GLN A OE1 1 
ATOM   3727  N  NE2 . GLN A 1  846  ? 262.875 265.824 189.745 1.00 358.02 ?  846  GLN A NE2 1 
ATOM   3728  N  N   . TRP A 1  847  ? 257.909 264.625 187.226 1.00 500.00 ?  847  TRP A N   1 
ATOM   3729  C  CA  . TRP A 1  847  ? 256.504 265.054 187.211 1.00 500.00 ?  847  TRP A CA  1 
ATOM   3730  C  C   . TRP A 1  847  ? 255.700 264.491 188.389 1.00 500.00 ?  847  TRP A C   1 
ATOM   3731  O  O   . TRP A 1  847  ? 254.978 265.244 189.047 1.00 500.00 ?  847  TRP A O   1 
ATOM   3732  C  CB  . TRP A 1  847  ? 255.844 264.672 185.881 1.00 500.00 ?  847  TRP A CB  1 
ATOM   3733  C  CG  . TRP A 1  847  ? 254.474 265.247 185.665 1.00 500.00 ?  847  TRP A CG  1 
ATOM   3734  C  CD1 . TRP A 1  847  ? 254.175 266.435 185.068 1.00 500.00 ?  847  TRP A CD1 1 
ATOM   3735  C  CD2 . TRP A 1  847  ? 253.219 264.649 186.021 1.00 500.00 ?  847  TRP A CD2 1 
ATOM   3736  N  NE1 . TRP A 1  847  ? 252.815 266.627 185.041 1.00 500.00 ?  847  TRP A NE1 1 
ATOM   3737  C  CE2 . TRP A 1  847  ? 252.200 265.545 185.614 1.00 500.00 ?  847  TRP A CE2 1 
ATOM   3738  C  CE3 . TRP A 1  847  ? 252.854 263.445 186.648 1.00 500.00 ?  847  TRP A CE3 1 
ATOM   3739  C  CZ2 . TRP A 1  847  ? 250.834 265.278 185.812 1.00 500.00 ?  847  TRP A CZ2 1 
ATOM   3740  C  CZ3 . TRP A 1  847  ? 251.491 263.176 186.845 1.00 500.00 ?  847  TRP A CZ3 1 
ATOM   3741  C  CH2 . TRP A 1  847  ? 250.500 264.093 186.425 1.00 500.00 ?  847  TRP A CH2 1 
ATOM   3742  N  N   . VAL A 1  848  ? 255.848 263.187 188.651 1.00 500.00 ?  848  VAL A N   1 
ATOM   3743  C  CA  . VAL A 1  848  ? 255.087 262.486 189.705 1.00 500.00 ?  848  VAL A CA  1 
ATOM   3744  C  C   . VAL A 1  848  ? 255.498 262.952 191.117 1.00 500.00 ?  848  VAL A C   1 
ATOM   3745  O  O   . VAL A 1  848  ? 254.631 263.304 191.930 1.00 500.00 ?  848  VAL A O   1 
ATOM   3746  C  CB  . VAL A 1  848  ? 255.151 260.933 189.559 1.00 500.00 ?  848  VAL A CB  1 
ATOM   3747  C  CG1 . VAL A 1  848  ? 254.376 260.231 190.670 1.00 500.00 ?  848  VAL A CG1 1 
ATOM   3748  C  CG2 . VAL A 1  848  ? 254.585 260.486 188.220 1.00 500.00 ?  848  VAL A CG2 1 
ATOM   3749  N  N   . SER A 1  849  ? 256.809 262.970 191.381 1.00 500.00 ?  849  SER A N   1 
ATOM   3750  C  CA  . SER A 1  849  ? 257.379 263.425 192.663 1.00 500.00 ?  849  SER A CA  1 
ATOM   3751  C  C   . SER A 1  849  ? 256.962 264.857 193.038 1.00 500.00 ?  849  SER A C   1 
ATOM   3752  O  O   . SER A 1  849  ? 256.448 265.094 194.145 1.00 485.06 ?  849  SER A O   1 
ATOM   3753  C  CB  . SER A 1  849  ? 258.908 263.287 192.648 1.00 500.00 ?  849  SER A CB  1 
ATOM   3754  O  OG  . SER A 1  849  ? 259.496 264.137 191.683 1.00 500.00 ?  849  SER A OG  1 
ATOM   3755  N  N   . SER A 1  850  ? 257.171 265.788 192.101 1.00 500.00 ?  850  SER A N   1 
ATOM   3756  C  CA  . SER A 1  850  ? 256.764 267.189 192.253 1.00 453.95 ?  850  SER A CA  1 
ATOM   3757  C  C   . SER A 1  850  ? 255.261 267.315 192.481 1.00 434.12 ?  850  SER A C   1 
ATOM   3758  O  O   . SER A 1  850  ? 254.844 268.037 193.388 1.00 386.22 ?  850  SER A O   1 
ATOM   3759  C  CB  . SER A 1  850  ? 257.184 268.024 191.038 1.00 453.00 ?  850  SER A CB  1 
ATOM   3760  O  OG  . SER A 1  850  ? 258.590 268.007 190.866 1.00 463.14 ?  850  SER A OG  1 
ATOM   3761  N  N   . CYS A 1  851  ? 254.480 266.587 191.670 1.00 463.19 ?  851  CYS A N   1 
ATOM   3762  C  CA  . CYS A 1  851  ? 253.005 266.540 191.729 1.00 466.98 ?  851  CYS A CA  1 
ATOM   3763  C  C   . CYS A 1  851  ? 252.477 266.187 193.122 1.00 467.68 ?  851  CYS A C   1 
ATOM   3764  O  O   . CYS A 1  851  ? 251.644 266.920 193.670 1.00 500.00 ?  851  CYS A O   1 
ATOM   3765  C  CB  . CYS A 1  851  ? 252.447 265.563 190.668 1.00 448.29 ?  851  CYS A CB  1 
ATOM   3766  S  SG  . CYS A 1  851  ? 250.658 265.249 190.642 1.00 385.16 ?  851  CYS A SG  1 
ATOM   3767  N  N   . LEU A 1  852  ? 252.975 265.084 193.689 1.00 380.44 ?  852  LEU A N   1 
ATOM   3768  C  CA  . LEU A 1  852  ? 252.494 264.591 194.987 1.00 288.88 ?  852  LEU A CA  1 
ATOM   3769  C  C   . LEU A 1  852  ? 252.873 265.492 196.157 1.00 262.09 ?  852  LEU A C   1 
ATOM   3770  O  O   . LEU A 1  852  ? 252.108 265.622 197.118 1.00 241.16 ?  852  LEU A O   1 
ATOM   3771  C  CB  . LEU A 1  852  ? 252.904 263.130 195.234 1.00 211.59 ?  852  LEU A CB  1 
ATOM   3772  C  CG  . LEU A 1  852  ? 254.349 262.678 195.340 1.00 152.86 ?  852  LEU A CG  1 
ATOM   3773  C  CD1 . LEU A 1  852  ? 254.859 262.964 196.728 1.00 140.41 ?  852  LEU A CD1 1 
ATOM   3774  C  CD2 . LEU A 1  852  ? 254.371 261.185 195.094 1.00 154.21 ?  852  LEU A CD2 1 
ATOM   3775  N  N   . LYS A 1  853  ? 254.036 266.129 196.063 1.00 232.12 ?  853  LYS A N   1 
ATOM   3776  C  CA  . LYS A 1  853  ? 254.426 267.086 197.084 1.00 253.70 ?  853  LYS A CA  1 
ATOM   3777  C  C   . LYS A 1  853  ? 253.722 268.452 196.927 1.00 247.83 ?  853  LYS A C   1 
ATOM   3778  O  O   . LYS A 1  853  ? 253.069 268.928 197.862 1.00 237.85 ?  853  LYS A O   1 
ATOM   3779  C  CB  . LYS A 1  853  ? 255.953 267.189 197.184 1.00 262.22 ?  853  LYS A CB  1 
ATOM   3780  C  CG  . LYS A 1  853  ? 256.581 265.980 197.877 1.00 249.18 ?  853  LYS A CG  1 
ATOM   3781  C  CD  . LYS A 1  853  ? 257.997 266.225 198.381 1.00 249.04 ?  853  LYS A CD  1 
ATOM   3782  C  CE  . LYS A 1  853  ? 259.024 266.163 197.262 1.00 272.62 ?  853  LYS A CE  1 
ATOM   3783  N  NZ  . LYS A 1  853  ? 260.408 266.224 197.799 1.00 285.01 ?  853  LYS A NZ  1 
ATOM   3784  N  N   . GLY A 1  854  ? 253.830 269.059 195.746 1.00 235.74 ?  854  GLY A N   1 
ATOM   3785  C  CA  . GLY A 1  854  ? 253.261 270.387 195.491 1.00 223.14 ?  854  GLY A CA  1 
ATOM   3786  C  C   . GLY A 1  854  ? 252.381 270.365 194.265 1.00 242.84 ?  854  GLY A C   1 
ATOM   3787  O  O   . GLY A 1  854  ? 252.767 269.797 193.246 1.00 278.55 ?  854  GLY A O   1 
ATOM   3788  N  N   . GLU A 1  855  ? 251.208 270.992 194.369 1.00 294.69 ?  855  GLU A N   1 
ATOM   3789  C  CA  . GLU A 1  855  ? 250.136 270.890 193.360 1.00 365.41 ?  855  GLU A CA  1 
ATOM   3790  C  C   . GLU A 1  855  ? 250.511 271.385 191.958 1.00 425.14 ?  855  GLU A C   1 
ATOM   3791  O  O   . GLU A 1  855  ? 251.188 272.406 191.813 1.00 464.42 ?  855  GLU A O   1 
ATOM   3792  C  CB  . GLU A 1  855  ? 248.872 271.608 193.848 1.00 355.40 ?  855  GLU A CB  1 
ATOM   3793  N  N   . GLY A 1  856  ? 250.074 270.639 190.941 1.00 467.72 ?  856  GLY A N   1 
ATOM   3794  C  CA  . GLY A 1  856  ? 250.226 271.023 189.531 1.00 500.00 ?  856  GLY A CA  1 
ATOM   3795  C  C   . GLY A 1  856  ? 251.625 270.900 188.950 1.00 500.00 ?  856  GLY A C   1 
ATOM   3796  O  O   . GLY A 1  856  ? 252.110 269.788 188.724 1.00 500.00 ?  856  GLY A O   1 
ATOM   3797  N  N   . MET A 1  857  ? 252.248 272.061 188.716 1.00 500.00 ?  857  MET A N   1 
ATOM   3798  C  CA  . MET A 1  857  ? 253.580 272.254 188.089 1.00 500.00 ?  857  MET A CA  1 
ATOM   3799  C  C   . MET A 1  857  ? 253.619 272.193 186.527 1.00 500.00 ?  857  MET A C   1 
ATOM   3800  O  O   . MET A 1  857  ? 253.441 273.243 185.899 1.00 500.00 ?  857  MET A O   1 
ATOM   3801  C  CB  . MET A 1  857  ? 254.701 271.468 188.791 1.00 500.00 ?  857  MET A CB  1 
ATOM   3802  N  N   . PRO A 1  858  ? 253.853 271.007 185.895 1.00 500.00 ?  858  PRO A N   1 
ATOM   3803  C  CA  . PRO A 1  858  ? 253.602 271.010 184.446 1.00 500.00 ?  858  PRO A CA  1 
ATOM   3804  C  C   . PRO A 1  858  ? 252.285 270.317 184.031 1.00 500.00 ?  858  PRO A C   1 
ATOM   3805  O  O   . PRO A 1  858  ? 251.922 269.297 184.630 1.00 500.00 ?  858  PRO A O   1 
ATOM   3806  C  CB  . PRO A 1  858  ? 254.818 270.256 183.872 1.00 500.00 ?  858  PRO A CB  1 
ATOM   3807  C  CG  . PRO A 1  858  ? 255.624 269.790 185.052 1.00 500.00 ?  858  PRO A CG  1 
ATOM   3808  C  CD  . PRO A 1  858  ? 254.719 269.867 186.244 1.00 500.00 ?  858  PRO A CD  1 
ATOM   3809  N  N   . PRO A 1  859  ? 251.573 270.868 183.013 1.00 500.00 ?  859  PRO A N   1 
ATOM   3810  C  CA  . PRO A 1  859  ? 250.337 270.239 182.511 1.00 500.00 ?  859  PRO A CA  1 
ATOM   3811  C  C   . PRO A 1  859  ? 250.579 268.936 181.733 1.00 500.00 ?  859  PRO A C   1 
ATOM   3812  O  O   . PRO A 1  859  ? 249.699 268.067 181.715 1.00 500.00 ?  859  PRO A O   1 
ATOM   3813  C  CB  . PRO A 1  859  ? 249.735 271.313 181.597 1.00 500.00 ?  859  PRO A CB  1 
ATOM   3814  C  CG  . PRO A 1  859  ? 250.891 272.150 181.173 1.00 500.00 ?  859  PRO A CG  1 
ATOM   3815  C  CD  . PRO A 1  859  ? 251.852 272.146 182.326 1.00 500.00 ?  859  PRO A CD  1 
ATOM   3816  N  N   . TYR A 1  860  ? 251.758 268.844 181.102 1.00 500.00 ?  860  TYR A N   1 
ATOM   3817  C  CA  . TYR A 1  860  ? 252.312 267.668 180.371 1.00 500.00 ?  860  TYR A CA  1 
ATOM   3818  C  C   . TYR A 1  860  ? 251.982 267.556 178.866 1.00 500.00 ?  860  TYR A C   1 
ATOM   3819  O  O   . TYR A 1  860  ? 250.856 267.854 178.450 1.00 500.00 ?  860  TYR A O   1 
ATOM   3820  C  CB  . TYR A 1  860  ? 252.070 266.325 181.092 1.00 500.00 ?  860  TYR A CB  1 
ATOM   3821  C  CG  . TYR A 1  860  ? 253.219 265.348 180.943 1.00 500.00 ?  860  TYR A CG  1 
ATOM   3822  C  CD1 . TYR A 1  860  ? 254.373 265.477 181.728 1.00 500.00 ?  860  TYR A CD1 1 
ATOM   3823  C  CD2 . TYR A 1  860  ? 253.163 264.302 180.011 1.00 500.00 ?  860  TYR A CD2 1 
ATOM   3824  C  CE1 . TYR A 1  860  ? 255.434 264.590 181.597 1.00 500.00 ?  860  TYR A CE1 1 
ATOM   3825  C  CE2 . TYR A 1  860  ? 254.222 263.411 179.868 1.00 500.00 ?  860  TYR A CE2 1 
ATOM   3826  C  CZ  . TYR A 1  860  ? 255.353 263.558 180.662 1.00 500.00 ?  860  TYR A CZ  1 
ATOM   3827  O  OH  . TYR A 1  860  ? 256.400 262.678 180.522 1.00 500.00 ?  860  TYR A OH  1 
ATOM   3828  N  N   . PRO A 1  861  ? 252.980 267.140 178.049 1.00 500.00 ?  861  PRO A N   1 
ATOM   3829  C  CA  . PRO A 1  861  ? 252.722 266.774 176.657 1.00 500.00 ?  861  PRO A CA  1 
ATOM   3830  C  C   . PRO A 1  861  ? 252.643 265.253 176.426 1.00 500.00 ?  861  PRO A C   1 
ATOM   3831  O  O   . PRO A 1  861  ? 253.646 264.544 176.571 1.00 500.00 ?  861  PRO A O   1 
ATOM   3832  C  CB  . PRO A 1  861  ? 253.916 267.389 175.908 1.00 500.00 ?  861  PRO A CB  1 
ATOM   3833  C  CG  . PRO A 1  861  ? 254.980 267.617 176.943 1.00 500.00 ?  861  PRO A CG  1 
ATOM   3834  C  CD  . PRO A 1  861  ? 254.430 267.266 178.298 1.00 500.00 ?  861  PRO A CD  1 
ATOM   3835  N  N   . TYR A 1  862  ? 251.446 264.767 176.100 1.00 500.00 ?  862  TYR A N   1 
ATOM   3836  C  CA  . TYR A 1  862  ? 251.241 263.374 175.686 1.00 500.00 ?  862  TYR A CA  1 
ATOM   3837  C  C   . TYR A 1  862  ? 250.859 263.324 174.208 1.00 500.00 ?  862  TYR A C   1 
ATOM   3838  O  O   . TYR A 1  862  ? 250.201 264.238 173.703 1.00 500.00 ?  862  TYR A O   1 
ATOM   3839  C  CB  . TYR A 1  862  ? 250.187 262.669 176.563 1.00 500.00 ?  862  TYR A CB  1 
ATOM   3840  C  CG  . TYR A 1  862  ? 248.736 263.021 176.271 1.00 500.00 ?  862  TYR A CG  1 
ATOM   3841  C  CD1 . TYR A 1  862  ? 248.174 264.215 176.742 1.00 485.27 ?  862  TYR A CD1 1 
ATOM   3842  C  CD2 . TYR A 1  862  ? 247.920 262.151 175.536 1.00 480.92 ?  862  TYR A CD2 1 
ATOM   3843  C  CE1 . TYR A 1  862  ? 246.845 264.535 176.481 1.00 463.98 ?  862  TYR A CE1 1 
ATOM   3844  C  CE2 . TYR A 1  862  ? 246.589 262.460 175.271 1.00 466.18 ?  862  TYR A CE2 1 
ATOM   3845  C  CZ  . TYR A 1  862  ? 246.059 263.653 175.744 1.00 459.68 ?  862  TYR A CZ  1 
ATOM   3846  O  OH  . TYR A 1  862  ? 244.745 263.965 175.484 1.00 456.89 ?  862  TYR A OH  1 
ATOM   3847  N  N   . LEU A 1  863  ? 251.285 262.267 173.519 1.00 500.00 ?  863  LEU A N   1 
ATOM   3848  C  CA  . LEU A 1  863  ? 250.922 262.053 172.115 1.00 500.00 ?  863  LEU A CA  1 
ATOM   3849  C  C   . LEU A 1  863  ? 249.924 260.891 172.006 1.00 500.00 ?  863  LEU A C   1 
ATOM   3850  O  O   . LEU A 1  863  ? 250.246 259.770 172.422 1.00 500.00 ?  863  LEU A O   1 
ATOM   3851  C  CB  . LEU A 1  863  ? 252.170 261.834 171.243 1.00 500.00 ?  863  LEU A CB  1 
ATOM   3852  C  CG  . LEU A 1  863  ? 252.864 263.020 170.554 1.00 500.00 ?  863  LEU A CG  1 
ATOM   3853  C  CD1 . LEU A 1  863  ? 253.437 264.053 171.520 1.00 500.00 ?  863  LEU A CD1 1 
ATOM   3854  C  CD2 . LEU A 1  863  ? 253.961 262.492 169.646 1.00 500.00 ?  863  LEU A CD2 1 
ATOM   3855  N  N   . PRO A 1  864  ? 248.719 261.154 171.434 1.00 500.00 ?  864  PRO A N   1 
ATOM   3856  C  CA  . PRO A 1  864  ? 247.535 260.284 171.587 1.00 500.00 ?  864  PRO A CA  1 
ATOM   3857  C  C   . PRO A 1  864  ? 247.732 258.812 171.204 1.00 500.00 ?  864  PRO A C   1 
ATOM   3858  O  O   . PRO A 1  864  ? 247.379 257.931 171.992 1.00 500.00 ?  864  PRO A O   1 
ATOM   3859  C  CB  . PRO A 1  864  ? 246.478 260.952 170.689 1.00 500.00 ?  864  PRO A CB  1 
ATOM   3860  C  CG  . PRO A 1  864  ? 247.255 261.751 169.708 1.00 500.00 ?  864  PRO A CG  1 
ATOM   3861  C  CD  . PRO A 1  864  ? 248.464 262.232 170.456 1.00 500.00 ?  864  PRO A CD  1 
ATOM   3862  N  N   . GLY A 1  865  ? 248.305 258.557 170.028 1.00 451.57 ?  865  GLY A N   1 
ATOM   3863  C  CA  . GLY A 1  865  ? 248.466 257.197 169.512 1.00 346.54 ?  865  GLY A CA  1 
ATOM   3864  C  C   . GLY A 1  865  ? 249.445 256.327 170.280 1.00 272.50 ?  865  GLY A C   1 
ATOM   3865  O  O   . GLY A 1  865  ? 249.072 255.284 170.814 1.00 166.25 ?  865  GLY A O   1 
ATOM   3866  N  N   . ILE A 1  866  ? 250.694 256.774 170.348 1.00 329.56 ?  866  ILE A N   1 
ATOM   3867  C  CA  . ILE A 1  866  ? 251.803 255.917 170.801 1.00 420.43 ?  866  ILE A CA  1 
ATOM   3868  C  C   . ILE A 1  866  ? 252.148 256.020 172.296 1.00 456.29 ?  866  ILE A C   1 
ATOM   3869  O  O   . ILE A 1  866  ? 252.660 255.060 172.888 1.00 480.00 ?  866  ILE A O   1 
ATOM   3870  C  CB  . ILE A 1  866  ? 253.059 256.052 169.885 1.00 449.52 ?  866  ILE A CB  1 
ATOM   3871  C  CG1 . ILE A 1  866  ? 254.038 254.880 170.082 1.00 461.66 ?  866  ILE A CG1 1 
ATOM   3872  C  CG2 . ILE A 1  866  ? 253.770 257.392 170.080 1.00 442.63 ?  866  ILE A CG2 1 
ATOM   3873  C  CD1 . ILE A 1  866  ? 253.514 253.498 169.728 1.00 464.40 ?  866  ILE A CD1 1 
ATOM   3874  N  N   . CYS A 1  867  ? 251.852 257.170 172.899 1.00 470.70 ?  867  CYS A N   1 
ATOM   3875  C  CA  . CYS A 1  867  ? 252.054 257.352 174.333 1.00 442.35 ?  867  CYS A CA  1 
ATOM   3876  C  C   . CYS A 1  867  ? 250.853 256.837 175.146 1.00 383.45 ?  867  CYS A C   1 
ATOM   3877  O  O   . CYS A 1  867  ? 250.549 257.365 176.217 1.00 410.25 ?  867  CYS A O   1 
ATOM   3878  C  CB  . CYS A 1  867  ? 252.384 258.819 174.659 1.00 473.14 ?  867  CYS A CB  1 
ATOM   3879  S  SG  . CYS A 1  867  ? 253.701 259.550 173.653 1.00 480.82 ?  867  CYS A SG  1 
ATOM   3880  N  N   . GLU A 1  868  ? 250.191 255.792 174.644 1.00 285.10 ?  868  GLU A N   1 
ATOM   3881  C  CA  . GLU A 1  868  ? 248.979 255.285 175.267 1.00 236.67 ?  868  GLU A CA  1 
ATOM   3882  C  C   . GLU A 1  868  ? 249.180 254.640 176.622 1.00 193.79 ?  868  GLU A C   1 
ATOM   3883  O  O   . GLU A 1  868  ? 248.323 254.816 177.487 1.00 203.79 ?  868  GLU A O   1 
ATOM   3884  C  CB  . GLU A 1  868  ? 248.179 254.386 174.337 1.00 272.49 ?  868  GLU A CB  1 
ATOM   3885  C  CG  . GLU A 1  868  ? 246.892 255.046 173.862 1.00 301.37 ?  868  GLU A CG  1 
ATOM   3886  C  CD  . GLU A 1  868  ? 246.204 254.314 172.722 1.00 330.80 ?  868  GLU A CD  1 
ATOM   3887  O  OE1 . GLU A 1  868  ? 246.713 253.275 172.243 1.00 363.76 ?  868  GLU A OE1 1 
ATOM   3888  O  OE2 . GLU A 1  868  ? 245.129 254.791 172.301 1.00 343.85 -1 868  GLU A OE2 1 
ATOM   3889  N  N   . ARG A 1  869  ? 250.289 253.927 176.822 1.00 166.72 ?  869  ARG A N   1 
ATOM   3890  C  CA  . ARG A 1  869  ? 250.655 253.453 178.173 1.00 258.11 ?  869  ARG A CA  1 
ATOM   3891  C  C   . ARG A 1  869  ? 250.926 254.653 179.123 1.00 332.13 ?  869  ARG A C   1 
ATOM   3892  O  O   . ARG A 1  869  ? 250.518 254.634 180.298 1.00 368.32 ?  869  ARG A O   1 
ATOM   3893  C  CB  . ARG A 1  869  ? 251.852 252.477 178.127 1.00 271.34 ?  869  ARG A CB  1 
ATOM   3894  C  CG  . ARG A 1  869  ? 252.066 251.612 179.381 1.00 265.89 ?  869  ARG A CG  1 
ATOM   3895  C  CD  . ARG A 1  869  ? 253.433 250.914 179.379 1.00 204.38 ?  869  ARG A CD  1 
ATOM   3896  N  NE  . ARG A 1  869  ? 253.590 249.868 180.405 1.00 146.25 ?  869  ARG A NE  1 
ATOM   3897  C  CZ  . ARG A 1  869  ? 253.174 248.606 180.281 1.00 182.42 ?  869  ARG A CZ  1 
ATOM   3898  N  NH1 . ARG A 1  869  ? 252.558 248.199 179.178 1.00 232.83 ?  869  ARG A NH1 1 
ATOM   3899  N  NH2 . ARG A 1  869  ? 253.379 247.735 181.256 1.00 157.05 ?  869  ARG A NH2 1 
ATOM   3900  N  N   . SER A 1  870  ? 251.587 255.690 178.593 1.00 403.74 ?  870  SER A N   1 
ATOM   3901  C  CA  . SER A 1  870  ? 251.894 256.933 179.329 1.00 439.39 ?  870  SER A CA  1 
ATOM   3902  C  C   . SER A 1  870  ? 250.663 257.796 179.635 1.00 468.31 ?  870  SER A C   1 
ATOM   3903  O  O   . SER A 1  870  ? 250.554 258.333 180.739 1.00 480.00 ?  870  SER A O   1 
ATOM   3904  C  CB  . SER A 1  870  ? 252.965 257.756 178.598 1.00 440.86 ?  870  SER A CB  1 
ATOM   3905  O  OG  . SER A 1  870  ? 253.331 258.905 179.345 1.00 429.75 ?  870  SER A OG  1 
ATOM   3906  N  N   . ARG A 1  871  ? 249.754 257.930 178.661 1.00 469.80 ?  871  ARG A N   1 
ATOM   3907  C  CA  . ARG A 1  871  ? 248.477 258.646 178.849 1.00 458.31 ?  871  ARG A CA  1 
ATOM   3908  C  C   . ARG A 1  871  ? 247.690 258.045 180.017 1.00 500.00 ?  871  ARG A C   1 
ATOM   3909  O  O   . ARG A 1  871  ? 247.137 258.783 180.840 1.00 500.00 ?  871  ARG A O   1 
ATOM   3910  C  CB  . ARG A 1  871  ? 247.637 258.715 177.546 1.00 380.28 ?  871  ARG A CB  1 
ATOM   3911  C  CG  . ARG A 1  871  ? 246.490 257.714 177.382 1.00 299.93 ?  871  ARG A CG  1 
ATOM   3912  C  CD  . ARG A 1  871  ? 245.181 258.425 177.107 1.00 279.44 ?  871  ARG A CD  1 
ATOM   3913  N  NE  . ARG A 1  871  ? 244.936 258.637 175.684 1.00 269.55 ?  871  ARG A NE  1 
ATOM   3914  C  CZ  . ARG A 1  871  ? 243.858 258.206 175.032 1.00 271.48 ?  871  ARG A CZ  1 
ATOM   3915  N  NH1 . ARG A 1  871  ? 242.900 257.543 175.671 1.00 266.27 ?  871  ARG A NH1 1 
ATOM   3916  N  NH2 . ARG A 1  871  ? 243.725 258.452 173.734 1.00 266.77 ?  871  ARG A NH2 1 
ATOM   3917  N  N   . LEU A 1  872  ? 247.690 256.709 180.080 1.00 500.00 ?  872  LEU A N   1 
ATOM   3918  C  CA  . LEU A 1  872  ? 247.060 255.938 181.147 1.00 500.00 ?  872  LEU A CA  1 
ATOM   3919  C  C   . LEU A 1  872  ? 247.526 256.397 182.533 1.00 500.00 ?  872  LEU A C   1 
ATOM   3920  O  O   . LEU A 1  872  ? 246.692 256.759 183.366 1.00 500.00 ?  872  LEU A O   1 
ATOM   3921  C  CB  . LEU A 1  872  ? 247.287 254.430 180.927 1.00 500.00 ?  872  LEU A CB  1 
ATOM   3922  C  CG  . LEU A 1  872  ? 246.815 253.390 181.951 1.00 500.00 ?  872  LEU A CG  1 
ATOM   3923  C  CD1 . LEU A 1  872  ? 246.258 252.165 181.244 1.00 500.00 ?  872  LEU A CD1 1 
ATOM   3924  C  CD2 . LEU A 1  872  ? 247.936 253.002 182.909 1.00 500.00 ?  872  LEU A CD2 1 
ATOM   3925  N  N   . VAL A 1  873  ? 248.845 256.414 182.752 1.00 500.00 ?  873  VAL A N   1 
ATOM   3926  C  CA  . VAL A 1  873  ? 249.416 256.787 184.059 1.00 500.00 ?  873  VAL A CA  1 
ATOM   3927  C  C   . VAL A 1  873  ? 249.162 258.246 184.467 1.00 500.00 ?  873  VAL A C   1 
ATOM   3928  O  O   . VAL A 1  873  ? 248.782 258.501 185.615 1.00 500.00 ?  873  VAL A O   1 
ATOM   3929  C  CB  . VAL A 1  873  ? 250.904 256.355 184.230 1.00 500.00 ?  873  VAL A CB  1 
ATOM   3930  C  CG1 . VAL A 1  873  ? 251.856 257.190 183.380 1.00 500.00 ?  873  VAL A CG1 1 
ATOM   3931  C  CG2 . VAL A 1  873  ? 251.315 256.406 185.695 1.00 500.00 ?  873  VAL A CG2 1 
ATOM   3932  N  N   . VAL A 1  874  ? 249.346 259.181 183.529 1.00 500.00 ?  874  VAL A N   1 
ATOM   3933  C  CA  . VAL A 1  874  ? 249.149 260.619 183.785 1.00 500.00 ?  874  VAL A CA  1 
ATOM   3934  C  C   . VAL A 1  874  ? 247.703 260.890 184.231 1.00 500.00 ?  874  VAL A C   1 
ATOM   3935  O  O   . VAL A 1  874  ? 247.486 261.497 185.289 1.00 500.00 ?  874  VAL A O   1 
ATOM   3936  C  CB  . VAL A 1  874  ? 249.584 261.504 182.579 1.00 500.00 ?  874  VAL A CB  1 
ATOM   3937  C  CG1 . VAL A 1  874  ? 249.149 262.955 182.760 1.00 500.00 ?  874  VAL A CG1 1 
ATOM   3938  C  CG2 . VAL A 1  874  ? 251.095 261.449 182.388 1.00 500.00 ?  874  VAL A CG2 1 
ATOM   3939  N  N   . LEU A 1  875  ? 246.740 260.402 183.444 1.00 500.00 ?  875  LEU A N   1 
ATOM   3940  C  CA  . LEU A 1  875  ? 245.311 260.492 183.775 1.00 500.00 ?  875  LEU A CA  1 
ATOM   3941  C  C   . LEU A 1  875  ? 244.928 259.728 185.049 1.00 500.00 ?  875  LEU A C   1 
ATOM   3942  O  O   . LEU A 1  875  ? 244.098 260.210 185.824 1.00 500.00 ?  875  LEU A O   1 
ATOM   3943  C  CB  . LEU A 1  875  ? 244.431 260.054 182.591 1.00 500.00 ?  875  LEU A CB  1 
ATOM   3944  C  CG  . LEU A 1  875  ? 244.122 261.105 181.514 1.00 500.00 ?  875  LEU A CG  1 
ATOM   3945  C  CD1 . LEU A 1  875  ? 243.807 260.443 180.182 1.00 500.00 ?  875  LEU A CD1 1 
ATOM   3946  C  CD2 . LEU A 1  875  ? 242.986 262.035 181.927 1.00 500.00 ?  875  LEU A CD2 1 
ATOM   3947  N  N   . SER A 1  876  ? 245.539 258.558 185.261 1.00 500.00 ?  876  SER A N   1 
ATOM   3948  C  CA  . SER A 1  876  ? 245.307 257.756 186.473 1.00 500.00 ?  876  SER A CA  1 
ATOM   3949  C  C   . SER A 1  876  ? 245.731 258.466 187.768 1.00 500.00 ?  876  SER A C   1 
ATOM   3950  O  O   . SER A 1  876  ? 245.000 258.419 188.762 1.00 500.00 ?  876  SER A O   1 
ATOM   3951  C  CB  . SER A 1  876  ? 245.957 256.367 186.368 1.00 500.00 ?  876  SER A CB  1 
ATOM   3952  O  OG  . SER A 1  876  ? 247.354 256.420 186.606 1.00 500.00 ?  876  SER A OG  1 
ATOM   3953  N  N   . ILE A 1  877  ? 246.896 259.124 187.735 1.00 500.00 ?  877  ILE A N   1 
ATOM   3954  C  CA  . ILE A 1  877  ? 247.390 259.961 188.849 1.00 500.00 ?  877  ILE A CA  1 
ATOM   3955  C  C   . ILE A 1  877  ? 246.487 261.188 189.059 1.00 500.00 ?  877  ILE A C   1 
ATOM   3956  O  O   . ILE A 1  877  ? 246.150 261.523 190.204 1.00 500.00 ?  877  ILE A O   1 
ATOM   3957  C  CB  . ILE A 1  877  ? 248.900 260.326 188.688 1.00 500.00 ?  877  ILE A CB  1 
ATOM   3958  C  CG1 . ILE A 1  877  ? 249.773 259.148 189.149 1.00 500.00 ?  877  ILE A CG1 1 
ATOM   3959  C  CG2 . ILE A 1  877  ? 249.285 261.592 189.466 1.00 500.00 ?  877  ILE A CG2 1 
ATOM   3960  C  CD1 . ILE A 1  877  ? 251.145 259.067 188.505 1.00 500.00 ?  877  ILE A CD1 1 
ATOM   3961  N  N   . ALA A 1  878  ? 246.086 261.825 187.954 1.00 500.00 ?  878  ALA A N   1 
ATOM   3962  C  CA  . ALA A 1  878  ? 245.181 262.983 187.977 1.00 500.00 ?  878  ALA A CA  1 
ATOM   3963  C  C   . ALA A 1  878  ? 243.819 262.666 188.609 1.00 500.00 ?  878  ALA A C   1 
ATOM   3964  O  O   . ALA A 1  878  ? 243.331 263.443 189.424 1.00 500.00 ?  878  ALA A O   1 
ATOM   3965  C  CB  . ALA A 1  878  ? 245.010 263.568 186.581 1.00 500.00 ?  878  ALA A CB  1 
ATOM   3966  N  N   . LEU A 1  879  ? 243.226 261.525 188.241 1.00 500.00 ?  879  LEU A N   1 
ATOM   3967  C  CA  . LEU A 1  879  ? 241.967 261.060 188.848 1.00 500.00 ?  879  LEU A CA  1 
ATOM   3968  C  C   . LEU A 1  879  ? 242.119 260.838 190.362 1.00 500.00 ?  879  LEU A C   1 
ATOM   3969  O  O   . LEU A 1  879  ? 241.357 261.401 191.157 1.00 500.00 ?  879  LEU A O   1 
ATOM   3970  C  CB  . LEU A 1  879  ? 241.436 259.788 188.149 1.00 500.00 ?  879  LEU A CB  1 
ATOM   3971  C  CG  . LEU A 1  879  ? 240.640 259.885 186.834 1.00 500.00 ?  879  LEU A CG  1 
ATOM   3972  C  CD1 . LEU A 1  879  ? 240.605 258.551 186.090 1.00 500.00 ?  879  LEU A CD1 1 
ATOM   3973  C  CD2 . LEU A 1  879  ? 239.224 260.406 187.056 1.00 500.00 ?  879  LEU A CD2 1 
ATOM   3974  N  N   . TYR A 1  880  ? 243.139 260.063 190.738 1.00 500.00 ?  880  TYR A N   1 
ATOM   3975  C  CA  . TYR A 1  880  ? 243.386 259.642 192.122 1.00 500.00 ?  880  TYR A CA  1 
ATOM   3976  C  C   . TYR A 1  880  ? 243.823 260.763 193.073 1.00 500.00 ?  880  TYR A C   1 
ATOM   3977  O  O   . TYR A 1  880  ? 243.383 260.797 194.226 1.00 500.00 ?  880  TYR A O   1 
ATOM   3978  C  CB  . TYR A 1  880  ? 244.416 258.500 192.140 1.00 500.00 ?  880  TYR A CB  1 
ATOM   3979  C  CG  . TYR A 1  880  ? 244.464 257.684 193.419 1.00 500.00 ?  880  TYR A CG  1 
ATOM   3980  C  CD1 . TYR A 1  880  ? 243.362 256.921 193.830 1.00 500.00 ?  880  TYR A CD1 1 
ATOM   3981  C  CD2 . TYR A 1  880  ? 245.625 257.648 194.206 1.00 500.00 ?  880  TYR A CD2 1 
ATOM   3982  C  CE1 . TYR A 1  880  ? 243.404 256.170 194.997 1.00 500.00 ?  880  TYR A CE1 1 
ATOM   3983  C  CE2 . TYR A 1  880  ? 245.680 256.893 195.374 1.00 500.00 ?  880  TYR A CE2 1 
ATOM   3984  C  CZ  . TYR A 1  880  ? 244.566 256.156 195.763 1.00 500.00 ?  880  TYR A CZ  1 
ATOM   3985  O  OH  . TYR A 1  880  ? 244.600 255.405 196.914 1.00 500.00 ?  880  TYR A OH  1 
ATOM   3986  N  N   . ILE A 1  881  ? 244.677 261.670 192.592 1.00 500.00 ?  881  ILE A N   1 
ATOM   3987  C  CA  . ILE A 1  881  ? 245.291 262.706 193.451 1.00 500.00 ?  881  ILE A CA  1 
ATOM   3988  C  C   . ILE A 1  881  ? 244.781 264.134 193.140 1.00 500.00 ?  881  ILE A C   1 
ATOM   3989  O  O   . ILE A 1  881  ? 245.080 265.079 193.881 1.00 500.00 ?  881  ILE A O   1 
ATOM   3990  C  CB  . ILE A 1  881  ? 246.854 262.607 193.469 1.00 500.00 ?  881  ILE A CB  1 
ATOM   3991  C  CG1 . ILE A 1  881  ? 247.312 261.148 193.634 1.00 500.00 ?  881  ILE A CG1 1 
ATOM   3992  C  CG2 . ILE A 1  881  ? 247.457 263.428 194.610 1.00 500.00 ?  881  ILE A CG2 1 
ATOM   3993  C  CD1 . ILE A 1  881  ? 248.704 260.846 193.115 1.00 500.00 ?  881  ILE A CD1 1 
ATOM   3994  N  N   . LEU A 1  882  ? 243.994 264.291 192.072 1.00 500.00 ?  882  LEU A N   1 
ATOM   3995  C  CA  . LEU A 1  882  ? 243.436 265.608 191.715 1.00 500.00 ?  882  LEU A CA  1 
ATOM   3996  C  C   . LEU A 1  882  ? 241.975 265.525 191.259 1.00 500.00 ?  882  LEU A C   1 
ATOM   3997  O  O   . LEU A 1  882  ? 241.141 264.893 191.908 1.00 500.00 ?  882  LEU A O   1 
ATOM   3998  C  CB  . LEU A 1  882  ? 244.295 266.300 190.641 1.00 500.00 ?  882  LEU A CB  1 
ATOM   3999  C  CG  . LEU A 1  882  ? 245.687 266.858 190.985 1.00 500.00 ?  882  LEU A CG  1 
ATOM   4000  C  CD1 . LEU A 1  882  ? 246.786 265.821 190.782 1.00 500.00 ?  882  LEU A CD1 1 
ATOM   4001  C  CD2 . LEU A 1  882  ? 245.982 268.094 190.147 1.00 496.21 ?  882  LEU A CD2 1 
ATOM   4002  N  N   . SER A 1  924  ? 235.308 256.569 199.101 1.00 500.00 ?  924  SER A N   1 
ATOM   4003  C  CA  . SER A 1  924  ? 235.229 255.350 198.301 1.00 500.00 ?  924  SER A CA  1 
ATOM   4004  C  C   . SER A 1  924  ? 235.017 255.629 196.810 1.00 500.00 ?  924  SER A C   1 
ATOM   4005  O  O   . SER A 1  924  ? 235.544 254.900 195.966 1.00 500.00 ?  924  SER A O   1 
ATOM   4006  C  CB  . SER A 1  924  ? 234.128 254.426 198.831 1.00 500.00 ?  924  SER A CB  1 
ATOM   4007  O  OG  . SER A 1  924  ? 232.853 255.037 198.730 1.00 500.00 ?  924  SER A OG  1 
ATOM   4008  N  N   . SER A 1  925  ? 234.250 256.681 196.506 1.00 500.00 ?  925  SER A N   1 
ATOM   4009  C  CA  . SER A 1  925  ? 233.908 257.081 195.129 1.00 500.00 ?  925  SER A CA  1 
ATOM   4010  C  C   . SER A 1  925  ? 235.135 257.393 194.257 1.00 500.00 ?  925  SER A C   1 
ATOM   4011  O  O   . SER A 1  925  ? 235.167 257.035 193.072 1.00 500.00 ?  925  SER A O   1 
ATOM   4012  C  CB  . SER A 1  925  ? 232.947 258.277 195.151 1.00 500.00 ?  925  SER A CB  1 
ATOM   4013  O  OG  . SER A 1  925  ? 232.258 258.416 193.919 1.00 500.00 ?  925  SER A OG  1 
ATOM   4014  N  N   . LEU A 1  926  ? 236.133 258.042 194.863 1.00 500.00 ?  926  LEU A N   1 
ATOM   4015  C  CA  . LEU A 1  926  ? 237.398 258.405 194.210 1.00 500.00 ?  926  LEU A CA  1 
ATOM   4016  C  C   . LEU A 1  926  ? 238.183 257.167 193.746 1.00 500.00 ?  926  LEU A C   1 
ATOM   4017  O  O   . LEU A 1  926  ? 238.608 257.098 192.587 1.00 500.00 ?  926  LEU A O   1 
ATOM   4018  C  CB  . LEU A 1  926  ? 238.235 259.298 195.147 1.00 500.00 ?  926  LEU A CB  1 
ATOM   4019  C  CG  . LEU A 1  926  ? 239.612 259.848 194.751 1.00 500.00 ?  926  LEU A CG  1 
ATOM   4020  C  CD1 . LEU A 1  926  ? 239.779 261.282 195.232 1.00 484.09 ?  926  LEU A CD1 1 
ATOM   4021  C  CD2 . LEU A 1  926  ? 240.729 258.966 195.291 1.00 497.71 ?  926  LEU A CD2 1 
ATOM   4022  N  N   . ALA A 1  927  ? 238.355 256.204 194.656 1.00 500.00 ?  927  ALA A N   1 
ATOM   4023  C  CA  . ALA A 1  927  ? 239.031 254.932 194.373 1.00 500.00 ?  927  ALA A CA  1 
ATOM   4024  C  C   . ALA A 1  927  ? 238.307 254.095 193.308 1.00 500.00 ?  927  ALA A C   1 
ATOM   4025  O  O   . ALA A 1  927  ? 238.948 253.565 192.396 1.00 500.00 ?  927  ALA A O   1 
ATOM   4026  C  CB  . ALA A 1  927  ? 239.216 254.135 195.657 1.00 500.00 ?  927  ALA A CB  1 
ATOM   4027  N  N   . GLU A 1  928  ? 236.978 254.005 193.424 1.00 500.00 ?  928  GLU A N   1 
ATOM   4028  C  CA  . GLU A 1  928  ? 236.124 253.264 192.480 1.00 500.00 ?  928  GLU A CA  1 
ATOM   4029  C  C   . GLU A 1  928  ? 236.109 253.882 191.073 1.00 500.00 ?  928  GLU A C   1 
ATOM   4030  O  O   . GLU A 1  928  ? 236.016 253.152 190.081 1.00 500.00 ?  928  GLU A O   1 
ATOM   4031  C  CB  . GLU A 1  928  ? 234.693 253.147 193.023 1.00 500.00 ?  928  GLU A CB  1 
ATOM   4032  C  CG  . GLU A 1  928  ? 233.851 252.041 192.391 1.00 500.00 ?  928  GLU A CG  1 
ATOM   4033  C  CD  . GLU A 1  928  ? 232.384 252.112 192.782 1.00 500.00 ?  928  GLU A CD  1 
ATOM   4034  O  OE1 . GLU A 1  928  ? 232.083 252.286 193.983 1.00 489.26 -1 928  GLU A OE1 1 
ATOM   4035  O  OE2 . GLU A 1  928  ? 231.527 251.996 191.881 1.00 500.00 ?  928  GLU A OE2 1 
ATOM   4036  N  N   . ARG A 1  929  ? 236.194 255.214 190.997 1.00 500.00 ?  929  ARG A N   1 
ATOM   4037  C  CA  . ARG A 1  929  ? 236.274 255.927 189.711 1.00 500.00 ?  929  ARG A CA  1 
ATOM   4038  C  C   . ARG A 1  929  ? 237.512 255.559 188.882 1.00 500.00 ?  929  ARG A C   1 
ATOM   4039  O  O   . ARG A 1  929  ? 237.420 255.405 187.654 1.00 500.00 ?  929  ARG A O   1 
ATOM   4040  C  CB  . ARG A 1  929  ? 236.183 257.452 189.897 1.00 500.00 ?  929  ARG A CB  1 
ATOM   4041  C  CG  . ARG A 1  929  ? 234.774 258.035 189.798 1.00 500.00 ?  929  ARG A CG  1 
ATOM   4042  C  CD  . ARG A 1  929  ? 234.203 257.997 188.381 1.00 496.81 ?  929  ARG A CD  1 
ATOM   4043  N  NE  . ARG A 1  929  ? 234.871 258.924 187.462 1.00 478.59 ?  929  ARG A NE  1 
ATOM   4044  C  CZ  . ARG A 1  929  ? 234.832 258.843 186.131 1.00 460.10 ?  929  ARG A CZ  1 
ATOM   4045  N  NH1 . ARG A 1  929  ? 234.160 257.871 185.523 1.00 440.20 ?  929  ARG A NH1 1 
ATOM   4046  N  NH2 . ARG A 1  929  ? 235.477 259.742 185.401 1.00 453.06 ?  929  ARG A NH2 1 
ATOM   4047  N  N   . LEU A 1  930  ? 238.652 255.405 189.558 1.00 500.00 ?  930  LEU A N   1 
ATOM   4048  C  CA  . LEU A 1  930  ? 239.904 255.018 188.904 1.00 500.00 ?  930  LEU A CA  1 
ATOM   4049  C  C   . LEU A 1  930  ? 239.861 253.597 188.328 1.00 500.00 ?  930  LEU A C   1 
ATOM   4050  O  O   . LEU A 1  930  ? 240.294 253.383 187.191 1.00 500.00 ?  930  LEU A O   1 
ATOM   4051  C  CB  . LEU A 1  930  ? 241.109 255.208 189.842 1.00 500.00 ?  930  LEU A CB  1 
ATOM   4052  C  CG  . LEU A 1  930  ? 242.524 254.938 189.301 1.00 500.00 ?  930  LEU A CG  1 
ATOM   4053  C  CD1 . LEU A 1  930  ? 242.781 255.639 187.977 1.00 487.76 ?  930  LEU A CD1 1 
ATOM   4054  C  CD2 . LEU A 1  930  ? 243.585 255.336 190.312 1.00 496.16 ?  930  LEU A CD2 1 
ATOM   4055  N  N   . VAL A 1  931  ? 239.336 252.649 189.111 1.00 500.00 ?  931  VAL A N   1 
ATOM   4056  C  CA  . VAL A 1  931  ? 239.166 251.249 188.683 1.00 500.00 ?  931  VAL A CA  1 
ATOM   4057  C  C   . VAL A 1  931  ? 238.241 251.154 187.451 1.00 500.00 ?  931  VAL A C   1 
ATOM   4058  O  O   . VAL A 1  931  ? 238.609 250.529 186.449 1.00 500.00 ?  931  VAL A O   1 
ATOM   4059  C  CB  . VAL A 1  931  ? 238.691 250.328 189.850 1.00 500.00 ?  931  VAL A CB  1 
ATOM   4060  C  CG1 . VAL A 1  931  ? 238.365 248.923 189.360 1.00 500.00 ?  931  VAL A CG1 1 
ATOM   4061  C  CG2 . VAL A 1  931  ? 239.740 250.247 190.958 1.00 500.00 ?  931  VAL A CG2 1 
ATOM   4062  N  N   . VAL A 1  932  ? 237.074 251.804 187.520 1.00 500.00 ?  932  VAL A N   1 
ATOM   4063  C  CA  . VAL A 1  932  ? 236.078 251.779 186.428 1.00 500.00 ?  932  VAL A CA  1 
ATOM   4064  C  C   . VAL A 1  932  ? 236.568 252.420 185.107 1.00 500.00 ?  932  VAL A C   1 
ATOM   4065  O  O   . VAL A 1  932  ? 236.192 251.958 184.017 1.00 500.00 ?  932  VAL A O   1 
ATOM   4066  C  CB  . VAL A 1  932  ? 234.665 252.261 186.897 1.00 494.84 ?  932  VAL A CB  1 
ATOM   4067  C  CG1 . VAL A 1  932  ? 234.556 253.781 186.964 1.00 480.41 ?  932  VAL A CG1 1 
ATOM   4068  C  CG2 . VAL A 1  932  ? 233.561 251.676 186.023 1.00 474.57 ?  932  VAL A CG2 1 
ATOM   4069  N  N   . TRP A 1  933  ? 237.415 253.454 185.205 1.00 500.00 ?  933  TRP A N   1 
ATOM   4070  C  CA  . TRP A 1  933  ? 238.067 254.029 184.013 1.00 477.18 ?  933  TRP A CA  1 
ATOM   4071  C  C   . TRP A 1  933  ? 239.120 253.093 183.408 1.00 496.75 ?  933  TRP A C   1 
ATOM   4072  O  O   . TRP A 1  933  ? 239.222 253.018 182.186 1.00 485.50 ?  933  TRP A O   1 
ATOM   4073  C  CB  . TRP A 1  933  ? 238.647 255.438 184.241 1.00 410.47 ?  933  TRP A CB  1 
ATOM   4074  C  CG  . TRP A 1  933  ? 239.474 255.941 183.041 1.00 343.23 ?  933  TRP A CG  1 
ATOM   4075  C  CD1 . TRP A 1  933  ? 238.998 256.425 181.843 1.00 287.26 ?  933  TRP A CD1 1 
ATOM   4076  C  CD2 . TRP A 1  933  ? 240.903 255.955 182.933 1.00 318.74 ?  933  TRP A CD2 1 
ATOM   4077  N  NE1 . TRP A 1  933  ? 240.043 256.752 181.010 1.00 228.25 ?  933  TRP A NE1 1 
ATOM   4078  C  CE2 . TRP A 1  933  ? 241.223 256.476 181.650 1.00 263.11 ?  933  TRP A CE2 1 
ATOM   4079  C  CE3 . TRP A 1  933  ? 241.950 255.580 183.798 1.00 349.85 ?  933  TRP A CE3 1 
ATOM   4080  C  CZ2 . TRP A 1  933  ? 242.547 256.642 181.214 1.00 264.07 ?  933  TRP A CZ2 1 
ATOM   4081  C  CZ3 . TRP A 1  933  ? 243.277 255.753 183.365 1.00 339.43 ?  933  TRP A CZ3 1 
ATOM   4082  C  CH2 . TRP A 1  933  ? 243.557 256.272 182.077 1.00 303.86 ?  933  TRP A CH2 1 
ATOM   4083  N  N   . MET A 1  934  ? 239.886 252.393 184.250 1.00 500.00 ?  934  MET A N   1 
ATOM   4084  C  CA  . MET A 1  934  ? 240.892 251.414 183.780 1.00 500.00 ?  934  MET A CA  1 
ATOM   4085  C  C   . MET A 1  934  ? 240.320 250.201 183.023 1.00 500.00 ?  934  MET A C   1 
ATOM   4086  O  O   . MET A 1  934  ? 241.038 249.559 182.243 1.00 495.76 ?  934  MET A O   1 
ATOM   4087  C  CB  . MET A 1  934  ? 241.821 250.969 184.913 1.00 500.00 ?  934  MET A CB  1 
ATOM   4088  C  CG  . MET A 1  934  ? 243.138 251.733 184.977 1.00 500.00 ?  934  MET A CG  1 
ATOM   4089  S  SD  . MET A 1  934  ? 244.270 251.123 186.250 1.00 500.00 ?  934  MET A SD  1 
ATOM   4090  C  CE  . MET A 1  934  ? 243.444 251.637 187.755 1.00 500.00 ?  934  MET A CE  1 
ATOM   4091  N  N   . THR A 1  935  ? 239.041 249.896 183.263 1.00 500.00 ?  935  THR A N   1 
ATOM   4092  C  CA  . THR A 1  935  ? 238.280 248.918 182.467 1.00 489.86 ?  935  THR A CA  1 
ATOM   4093  C  C   . THR A 1  935  ? 238.005 249.458 181.037 1.00 477.75 ?  935  THR A C   1 
ATOM   4094  O  O   . THR A 1  935  ? 238.092 248.700 180.063 1.00 500.00 ?  935  THR A O   1 
ATOM   4095  C  CB  . THR A 1  935  ? 236.999 248.438 183.219 1.00 486.16 ?  935  THR A CB  1 
ATOM   4096  O  OG1 . THR A 1  935  ? 237.375 247.586 184.312 1.00 479.63 ?  935  THR A OG1 1 
ATOM   4097  C  CG2 . THR A 1  935  ? 236.049 247.647 182.313 1.00 472.27 ?  935  THR A CG2 1 
ATOM   4098  N  N   . ASN A 1  936  ? 237.707 250.759 180.926 1.00 413.51 ?  936  ASN A N   1 
ATOM   4099  C  CA  . ASN A 1  936  ? 237.508 251.448 179.626 1.00 308.85 ?  936  ASN A CA  1 
ATOM   4100  C  C   . ASN A 1  936  ? 238.774 251.541 178.767 1.00 236.81 ?  936  ASN A C   1 
ATOM   4101  O  O   . ASN A 1  936  ? 238.695 251.432 177.544 1.00 198.43 ?  936  ASN A O   1 
ATOM   4102  C  CB  . ASN A 1  936  ? 236.884 252.841 179.812 1.00 329.05 ?  936  ASN A CB  1 
ATOM   4103  C  CG  . ASN A 1  936  ? 235.625 252.817 180.668 1.00 357.92 ?  936  ASN A CG  1 
ATOM   4104  O  OD1 . ASN A 1  936  ? 234.743 251.973 180.489 1.00 342.42 ?  936  ASN A OD1 1 
ATOM   4105  N  ND2 . ASN A 1  936  ? 235.538 253.754 181.607 1.00 386.73 ?  936  ASN A ND2 1 
ATOM   4106  N  N   . VAL A 1  937  ? 239.923 251.755 179.412 1.00 195.38 ?  937  VAL A N   1 
ATOM   4107  C  CA  . VAL A 1  937  ? 241.236 251.554 178.778 1.00 231.29 ?  937  VAL A CA  1 
ATOM   4108  C  C   . VAL A 1  937  ? 241.482 250.047 178.543 1.00 327.18 ?  937  VAL A C   1 
ATOM   4109  O  O   . VAL A 1  937  ? 240.971 249.212 179.299 1.00 411.53 ?  937  VAL A O   1 
ATOM   4110  C  CB  . VAL A 1  937  ? 242.396 252.075 179.652 1.00 189.33 ?  937  VAL A CB  1 
ATOM   4111  C  CG1 . VAL A 1  937  ? 243.512 252.619 178.762 1.00 193.09 ?  937  VAL A CG1 1 
ATOM   4112  C  CG2 . VAL A 1  937  ? 241.923 253.111 180.657 1.00 137.31 ?  937  VAL A CG2 1 
ATOM   4113  N  N   . GLY A 1  938  ? 242.288 249.697 177.534 1.00 363.94 ?  938  GLY A N   1 
ATOM   4114  C  CA  . GLY A 1  938  ? 242.629 248.280 177.229 1.00 362.79 ?  938  GLY A CA  1 
ATOM   4115  C  C   . GLY A 1  938  ? 243.389 247.489 178.300 1.00 355.76 ?  938  GLY A C   1 
ATOM   4116  O  O   . GLY A 1  938  ? 243.755 246.325 178.092 1.00 300.88 ?  938  GLY A O   1 
ATOM   4117  N  N   . PHE A 1  939  ? 243.590 248.134 179.449 1.00 383.13 ?  939  PHE A N   1 
ATOM   4118  C  CA  . PHE A 1  939  ? 244.387 247.665 180.588 1.00 366.06 ?  939  PHE A CA  1 
ATOM   4119  C  C   . PHE A 1  939  ? 243.777 246.454 181.314 1.00 344.58 ?  939  PHE A C   1 
ATOM   4120  O  O   . PHE A 1  939  ? 242.580 246.462 181.631 1.00 339.97 ?  939  PHE A O   1 
ATOM   4121  C  CB  . PHE A 1  939  ? 244.546 248.856 181.545 1.00 386.14 ?  939  PHE A CB  1 
ATOM   4122  C  CG  . PHE A 1  939  ? 245.564 248.662 182.630 1.00 382.66 ?  939  PHE A CG  1 
ATOM   4123  C  CD1 . PHE A 1  939  ? 246.938 248.780 182.366 1.00 364.47 ?  939  PHE A CD1 1 
ATOM   4124  C  CD2 . PHE A 1  939  ? 245.148 248.409 183.937 1.00 386.54 ?  939  PHE A CD2 1 
ATOM   4125  C  CE1 . PHE A 1  939  ? 247.870 248.615 183.383 1.00 352.57 ?  939  PHE A CE1 1 
ATOM   4126  C  CE2 . PHE A 1  939  ? 246.077 248.252 184.958 1.00 380.46 ?  939  PHE A CE2 1 
ATOM   4127  C  CZ  . PHE A 1  939  ? 247.435 248.366 184.678 1.00 370.29 ?  939  PHE A CZ  1 
ATOM   4128  N  N   . THR A 1  940  ? 244.611 245.429 181.558 1.00 311.50 ?  940  THR A N   1 
ATOM   4129  C  CA  . THR A 1  940  ? 244.225 244.170 182.264 1.00 254.65 ?  940  THR A CA  1 
ATOM   4130  C  C   . THR A 1  940  ? 245.130 243.846 183.488 1.00 208.00 ?  940  THR A C   1 
ATOM   4131  O  O   . THR A 1  940  ? 246.266 244.333 183.566 1.00 218.56 ?  940  THR A O   1 
ATOM   4132  C  CB  . THR A 1  940  ? 244.250 242.987 181.279 1.00 20.00  ?  940  THR A CB  1 
ATOM   4133  O  OG1 . THR A 1  940  ? 245.568 242.838 180.740 1.00 20.00  ?  940  THR A OG1 1 
ATOM   4134  C  CG2 . THR A 1  940  ? 243.402 243.294 180.054 1.00 20.00  ?  940  THR A CG2 1 
ATOM   4135  N  N   . LEU A 1  941  ? 244.630 243.048 184.438 1.00 163.63 ?  941  LEU A N   1 
ATOM   4136  C  CA  . LEU A 1  941  ? 245.345 242.830 185.695 1.00 166.40 ?  941  LEU A CA  1 
ATOM   4137  C  C   . LEU A 1  941  ? 246.686 242.137 185.488 1.00 162.56 ?  941  LEU A C   1 
ATOM   4138  O  O   . LEU A 1  941  ? 247.641 242.404 186.225 1.00 165.52 ?  941  LEU A O   1 
ATOM   4139  C  CB  . LEU A 1  941  ? 244.498 242.068 186.735 1.00 232.83 ?  941  LEU A CB  1 
ATOM   4140  C  CG  . LEU A 1  941  ? 245.172 241.769 188.109 1.00 302.95 ?  941  LEU A CG  1 
ATOM   4141  C  CD1 . LEU A 1  941  ? 244.261 241.919 189.315 1.00 335.75 ?  941  LEU A CD1 1 
ATOM   4142  C  CD2 . LEU A 1  941  ? 245.852 240.407 188.178 1.00 308.97 ?  941  LEU A CD2 1 
ATOM   4143  N  N   . ARG A 1  942  ? 246.763 241.241 184.509 1.00 172.36 ?  942  ARG A N   1 
ATOM   4144  C  CA  . ARG A 1  942  ? 248.003 240.511 184.280 1.00 201.94 ?  942  ARG A CA  1 
ATOM   4145  C  C   . ARG A 1  942  ? 249.101 241.458 183.829 1.00 227.68 ?  942  ARG A C   1 
ATOM   4146  O  O   . ARG A 1  942  ? 250.242 241.321 184.278 1.00 182.92 ?  942  ARG A O   1 
ATOM   4147  C  CB  . ARG A 1  942  ? 247.812 239.379 183.276 1.00 206.96 ?  942  ARG A CB  1 
ATOM   4148  C  CG  . ARG A 1  942  ? 248.888 238.313 183.364 1.00 235.45 ?  942  ARG A CG  1 
ATOM   4149  C  CD  . ARG A 1  942  ? 248.391 237.067 184.082 1.00 285.85 ?  942  ARG A CD  1 
ATOM   4150  N  NE  . ARG A 1  942  ? 248.454 237.164 185.543 1.00 307.20 ?  942  ARG A NE  1 
ATOM   4151  C  CZ  . ARG A 1  942  ? 247.398 237.108 186.355 1.00 291.58 ?  942  ARG A CZ  1 
ATOM   4152  N  NH1 . ARG A 1  942  ? 246.173 236.957 185.862 1.00 277.97 ?  942  ARG A NH1 1 
ATOM   4153  N  NH2 . ARG A 1  942  ? 247.565 237.206 187.668 1.00 265.48 ?  942  ARG A NH2 1 
ATOM   4154  N  N   . ASP A 1  943  ? 248.711 242.410 182.961 1.00 310.93 ?  943  ASP A N   1 
ATOM   4155  C  CA  . ASP A 1  943  ? 249.555 243.488 182.387 1.00 365.16 ?  943  ASP A CA  1 
ATOM   4156  C  C   . ASP A 1  943  ? 250.044 244.482 183.437 1.00 398.72 ?  943  ASP A C   1 
ATOM   4157  O  O   . ASP A 1  943  ? 251.188 244.938 183.364 1.00 414.89 ?  943  ASP A O   1 
ATOM   4158  C  CB  . ASP A 1  943  ? 248.792 244.240 181.273 1.00 354.80 ?  943  ASP A CB  1 
ATOM   4159  C  CG  . ASP A 1  943  ? 249.703 245.109 180.390 1.00 333.70 ?  943  ASP A CG  1 
ATOM   4160  O  OD1 . ASP A 1  943  ? 250.193 246.172 180.850 1.00 343.36 ?  943  ASP A OD1 1 
ATOM   4161  O  OD2 . ASP A 1  943  ? 249.899 244.736 179.211 1.00 315.88 -1 943  ASP A OD2 1 
ATOM   4162  N  N   . LEU A 1  944  ? 249.169 244.821 184.390 1.00 419.49 ?  944  LEU A N   1 
ATOM   4163  C  CA  . LEU A 1  944  ? 249.499 245.661 185.559 1.00 392.30 ?  944  LEU A CA  1 
ATOM   4164  C  C   . LEU A 1  944  ? 250.787 245.234 186.287 1.00 358.55 ?  944  LEU A C   1 
ATOM   4165  O  O   . LEU A 1  944  ? 251.486 246.072 186.867 1.00 290.20 ?  944  LEU A O   1 
ATOM   4166  C  CB  . LEU A 1  944  ? 248.306 245.699 186.530 1.00 405.28 ?  944  LEU A CB  1 
ATOM   4167  C  CG  . LEU A 1  944  ? 248.309 246.427 187.887 1.00 387.50 ?  944  LEU A CG  1 
ATOM   4168  C  CD1 . LEU A 1  944  ? 248.856 247.853 187.879 1.00 382.96 ?  944  LEU A CD1 1 
ATOM   4169  C  CD2 . LEU A 1  944  ? 246.904 246.405 188.464 1.00 378.54 ?  944  LEU A CD2 1 
ATOM   4170  N  N   . GLU A 1  945  ? 251.077 243.931 186.231 1.00 363.38 ?  945  GLU A N   1 
ATOM   4171  C  CA  . GLU A 1  945  ? 252.341 243.341 186.685 1.00 363.54 ?  945  GLU A CA  1 
ATOM   4172  C  C   . GLU A 1  945  ? 253.599 244.053 186.150 1.00 347.93 ?  945  GLU A C   1 
ATOM   4173  O  O   . GLU A 1  945  ? 254.461 244.405 186.952 1.00 266.94 ?  945  GLU A O   1 
ATOM   4174  C  CB  . GLU A 1  945  ? 252.375 241.848 186.330 1.00 390.05 ?  945  GLU A CB  1 
ATOM   4175  C  CG  . GLU A 1  945  ? 253.476 241.032 186.988 1.00 412.56 ?  945  GLU A CG  1 
ATOM   4176  C  CD  . GLU A 1  945  ? 253.107 240.536 188.371 1.00 426.74 ?  945  GLU A CD  1 
ATOM   4177  O  OE1 . GLU A 1  945  ? 253.102 241.350 189.316 1.00 450.84 ?  945  GLU A OE1 1 
ATOM   4178  O  OE2 . GLU A 1  945  ? 252.834 239.325 188.512 1.00 417.12 -1 945  GLU A OE2 1 
ATOM   4179  N  N   . THR A 1  946  ? 253.686 244.276 184.827 1.00 383.90 ?  946  THR A N   1 
ATOM   4180  C  CA  . THR A 1  946  ? 254.887 244.893 184.194 1.00 387.19 ?  946  THR A CA  1 
ATOM   4181  C  C   . THR A 1  946  ? 255.189 246.343 184.581 1.00 411.61 ?  946  THR A C   1 
ATOM   4182  O  O   . THR A 1  946  ? 256.355 246.674 184.741 1.00 415.45 ?  946  THR A O   1 
ATOM   4183  C  CB  . THR A 1  946  ? 254.968 244.773 182.640 1.00 356.05 ?  946  THR A CB  1 
ATOM   4184  O  OG1 . THR A 1  946  ? 253.712 245.095 182.031 1.00 342.05 ?  946  THR A OG1 1 
ATOM   4185  C  CG2 . THR A 1  946  ? 255.413 243.390 182.220 1.00 318.53 ?  946  THR A CG2 1 
ATOM   4186  N  N   . LEU A 1  947  ? 254.164 247.195 184.728 1.00 403.47 ?  947  LEU A N   1 
ATOM   4187  C  CA  . LEU A 1  947  ? 254.344 248.595 185.172 1.00 334.11 ?  947  LEU A CA  1 
ATOM   4188  C  C   . LEU A 1  947  ? 255.353 248.683 186.322 1.00 279.14 ?  947  LEU A C   1 
ATOM   4189  O  O   . LEU A 1  947  ? 255.314 247.843 187.230 1.00 327.50 ?  947  LEU A O   1 
ATOM   4190  C  CB  . LEU A 1  947  ? 252.999 249.225 185.581 1.00 356.95 ?  947  LEU A CB  1 
ATOM   4191  C  CG  . LEU A 1  947  ? 252.345 250.308 184.707 1.00 364.71 ?  947  LEU A CG  1 
ATOM   4192  C  CD1 . LEU A 1  947  ? 251.812 249.757 183.395 1.00 374.17 ?  947  LEU A CD1 1 
ATOM   4193  C  CD2 . LEU A 1  947  ? 251.232 251.008 185.473 1.00 371.42 ?  947  LEU A CD2 1 
ATOM   4194  N  N   . PRO A 1  948  ? 256.271 249.671 186.279 1.00 215.63 ?  948  PRO A N   1 
ATOM   4195  C  CA  . PRO A 1  948  ? 257.328 249.727 187.313 1.00 229.29 ?  948  PRO A CA  1 
ATOM   4196  C  C   . PRO A 1  948  ? 256.720 249.918 188.726 1.00 262.43 ?  948  PRO A C   1 
ATOM   4197  O  O   . PRO A 1  948  ? 255.909 250.830 188.901 1.00 362.83 ?  948  PRO A O   1 
ATOM   4198  C  CB  . PRO A 1  948  ? 258.177 250.938 186.885 1.00 226.39 ?  948  PRO A CB  1 
ATOM   4199  C  CG  . PRO A 1  948  ? 257.663 251.362 185.537 1.00 196.27 ?  948  PRO A CG  1 
ATOM   4200  C  CD  . PRO A 1  948  ? 256.259 250.877 185.431 1.00 169.21 ?  948  PRO A CD  1 
ATOM   4201  N  N   . PHE A 1  949  ? 257.082 249.074 189.705 1.00 199.81 ?  949  PHE A N   1 
ATOM   4202  C  CA  . PHE A 1  949  ? 256.319 248.966 190.978 1.00 173.52 ?  949  PHE A CA  1 
ATOM   4203  C  C   . PHE A 1  949  ? 256.064 250.256 191.780 1.00 162.69 ?  949  PHE A C   1 
ATOM   4204  O  O   . PHE A 1  949  ? 254.983 250.393 192.402 1.00 131.83 ?  949  PHE A O   1 
ATOM   4205  C  CB  . PHE A 1  949  ? 256.894 247.867 191.884 1.00 189.08 ?  949  PHE A CB  1 
ATOM   4206  C  CG  . PHE A 1  949  ? 258.270 248.160 192.407 1.00 198.13 ?  949  PHE A CG  1 
ATOM   4207  C  CD1 . PHE A 1  949  ? 258.456 248.934 193.564 1.00 188.97 ?  949  PHE A CD1 1 
ATOM   4208  C  CD2 . PHE A 1  949  ? 259.384 247.648 191.761 1.00 206.16 ?  949  PHE A CD2 1 
ATOM   4209  C  CE1 . PHE A 1  949  ? 259.726 249.211 194.045 1.00 185.42 ?  949  PHE A CE1 1 
ATOM   4210  C  CE2 . PHE A 1  949  ? 260.661 247.923 192.235 1.00 222.20 ?  949  PHE A CE2 1 
ATOM   4211  C  CZ  . PHE A 1  949  ? 260.830 248.698 193.379 1.00 214.10 ?  949  PHE A CZ  1 
ATOM   4212  N  N   . GLY A 1  950  ? 257.055 251.169 191.748 1.00 143.97 ?  950  GLY A N   1 
ATOM   4213  C  CA  . GLY A 1  950  ? 257.013 252.491 192.378 1.00 179.17 ?  950  GLY A CA  1 
ATOM   4214  C  C   . GLY A 1  950  ? 255.978 253.422 191.782 1.00 263.26 ?  950  GLY A C   1 
ATOM   4215  O  O   . GLY A 1  950  ? 255.337 254.192 192.508 1.00 288.60 ?  950  GLY A O   1 
ATOM   4216  N  N   . ILE A 1  951  ? 255.841 253.361 190.455 1.00 359.42 ?  951  ILE A N   1 
ATOM   4217  C  CA  . ILE A 1  951  ? 254.730 253.973 189.701 1.00 416.74 ?  951  ILE A CA  1 
ATOM   4218  C  C   . ILE A 1  951  ? 253.416 253.183 189.917 1.00 463.24 ?  951  ILE A C   1 
ATOM   4219  O  O   . ILE A 1  951  ? 252.327 253.776 189.987 1.00 489.96 ?  951  ILE A O   1 
ATOM   4220  C  CB  . ILE A 1  951  ? 255.071 254.073 188.178 1.00 415.59 ?  951  ILE A CB  1 
ATOM   4221  C  CG1 . ILE A 1  951  ? 256.323 254.944 187.917 1.00 401.89 ?  951  ILE A CG1 1 
ATOM   4222  C  CG2 . ILE A 1  951  ? 253.869 254.515 187.344 1.00 401.62 ?  951  ILE A CG2 1 
ATOM   4223  C  CD1 . ILE A 1  951  ? 256.129 256.449 187.992 1.00 396.05 ?  951  ILE A CD1 1 
ATOM   4224  N  N   . ALA A 1  952  ? 253.533 251.854 190.018 1.00 470.30 ?  952  ALA A N   1 
ATOM   4225  C  CA  . ALA A 1  952  ? 252.383 250.955 190.205 1.00 426.64 ?  952  ALA A CA  1 
ATOM   4226  C  C   . ALA A 1  952  ? 251.691 251.116 191.558 1.00 428.56 ?  952  ALA A C   1 
ATOM   4227  O  O   . ALA A 1  952  ? 250.477 250.925 191.642 1.00 466.57 ?  952  ALA A O   1 
ATOM   4228  C  CB  . ALA A 1  952  ? 252.784 249.503 189.987 1.00 379.82 ?  952  ALA A CB  1 
ATOM   4229  N  N   . LEU A 1  953  ? 252.459 251.460 192.598 1.00 393.66 ?  953  LEU A N   1 
ATOM   4230  C  CA  . LEU A 1  953  ? 251.917 251.694 193.951 1.00 372.75 ?  953  LEU A CA  1 
ATOM   4231  C  C   . LEU A 1  953  ? 250.682 252.627 194.035 1.00 427.80 ?  953  LEU A C   1 
ATOM   4232  O  O   . LEU A 1  953  ? 249.679 252.211 194.618 1.00 449.90 ?  953  LEU A O   1 
ATOM   4233  C  CB  . LEU A 1  953  ? 253.007 252.105 194.959 1.00 285.48 ?  953  LEU A CB  1 
ATOM   4234  C  CG  . LEU A 1  953  ? 253.847 251.094 195.744 1.00 262.08 ?  953  LEU A CG  1 
ATOM   4235  C  CD1 . LEU A 1  953  ? 254.050 251.644 197.145 1.00 265.06 ?  953  LEU A CD1 1 
ATOM   4236  C  CD2 . LEU A 1  953  ? 253.226 249.709 195.834 1.00 251.47 ?  953  LEU A CD2 1 
ATOM   4237  N  N   . PRO A 1  954  ? 250.744 253.867 193.457 1.00 468.16 ?  954  PRO A N   1 
ATOM   4238  C  CA  . PRO A 1  954  ? 249.534 254.718 193.346 1.00 481.10 ?  954  PRO A CA  1 
ATOM   4239  C  C   . PRO A 1  954  ? 248.304 254.013 192.748 1.00 500.00 ?  954  PRO A C   1 
ATOM   4240  O  O   . PRO A 1  954  ? 247.195 254.155 193.279 1.00 500.00 ?  954  PRO A O   1 
ATOM   4241  C  CB  . PRO A 1  954  ? 249.976 255.852 192.411 1.00 476.42 ?  954  PRO A CB  1 
ATOM   4242  C  CG  . PRO A 1  954  ? 251.456 255.906 192.508 1.00 474.12 ?  954  PRO A CG  1 
ATOM   4243  C  CD  . PRO A 1  954  ? 251.965 254.640 193.135 1.00 476.67 ?  954  PRO A CD  1 
ATOM   4244  N  N   . ILE A 1  955  ? 248.520 253.268 191.661 1.00 500.00 ?  955  ILE A N   1 
ATOM   4245  C  CA  . ILE A 1  955  ? 247.473 252.503 190.963 1.00 498.94 ?  955  ILE A CA  1 
ATOM   4246  C  C   . ILE A 1  955  ? 246.985 251.311 191.809 1.00 494.80 ?  955  ILE A C   1 
ATOM   4247  O  O   . ILE A 1  955  ? 245.771 251.086 191.938 1.00 498.92 ?  955  ILE A O   1 
ATOM   4248  C  CB  . ILE A 1  955  ? 247.955 252.074 189.545 1.00 486.22 ?  955  ILE A CB  1 
ATOM   4249  C  CG1 . ILE A 1  955  ? 248.143 253.310 188.653 1.00 471.50 ?  955  ILE A CG1 1 
ATOM   4250  C  CG2 . ILE A 1  955  ? 246.985 251.100 188.877 1.00 482.85 ?  955  ILE A CG2 1 
ATOM   4251  C  CD1 . ILE A 1  955  ? 249.390 253.290 187.793 1.00 453.97 ?  955  ILE A CD1 1 
ATOM   4252  N  N   . ARG A 1  956  ? 247.931 250.570 192.392 1.00 476.97 ?  956  ARG A N   1 
ATOM   4253  C  CA  . ARG A 1  956  ? 247.607 249.401 193.223 1.00 444.11 ?  956  ARG A CA  1 
ATOM   4254  C  C   . ARG A 1  956  ? 246.985 249.732 194.582 1.00 455.91 ?  956  ARG A C   1 
ATOM   4255  O  O   . ARG A 1  956  ? 246.214 248.928 195.111 1.00 450.44 ?  956  ARG A O   1 
ATOM   4256  C  CB  . ARG A 1  956  ? 248.796 248.438 193.367 1.00 403.79 ?  956  ARG A CB  1 
ATOM   4257  C  CG  . ARG A 1  956  ? 248.679 247.227 192.447 1.00 373.64 ?  956  ARG A CG  1 
ATOM   4258  C  CD  . ARG A 1  956  ? 249.401 245.983 192.962 1.00 326.79 ?  956  ARG A CD  1 
ATOM   4259  N  NE  . ARG A 1  956  ? 250.665 245.706 192.267 1.00 262.34 ?  956  ARG A NE  1 
ATOM   4260  C  CZ  . ARG A 1  956  ? 250.780 245.122 191.073 1.00 221.49 ?  956  ARG A CZ  1 
ATOM   4261  N  NH1 . ARG A 1  956  ? 249.715 244.740 190.383 1.00 197.95 ?  956  ARG A NH1 1 
ATOM   4262  N  NH2 . ARG A 1  956  ? 251.977 244.927 190.555 1.00 195.54 ?  956  ARG A NH2 1 
ATOM   4263  N  N   . ASP A 1  957  ? 247.311 250.913 195.121 1.00 480.00 ?  957  ASP A N   1 
ATOM   4264  C  CA  . ASP A 1  957  ? 246.654 251.477 196.314 1.00 483.00 ?  957  ASP A CA  1 
ATOM   4265  C  C   . ASP A 1  957  ? 245.144 251.620 196.104 1.00 500.00 ?  957  ASP A C   1 
ATOM   4266  O  O   . ASP A 1  957  ? 244.361 251.232 196.976 1.00 500.00 ?  957  ASP A O   1 
ATOM   4267  C  CB  . ASP A 1  957  ? 247.287 252.826 196.703 1.00 451.97 ?  957  ASP A CB  1 
ATOM   4268  C  CG  . ASP A 1  957  ? 246.901 253.296 198.108 1.00 410.76 ?  957  ASP A CG  1 
ATOM   4269  O  OD1 . ASP A 1  957  ? 246.970 252.506 199.071 1.00 400.25 ?  957  ASP A OD1 1 
ATOM   4270  O  OD2 . ASP A 1  957  ? 246.553 254.485 198.260 1.00 371.57 -1 957  ASP A OD2 1 
ATOM   4271  N  N   . ALA A 1  958  ? 244.753 252.146 194.938 1.00 500.00 ?  958  ALA A N   1 
ATOM   4272  C  CA  . ALA A 1  958  ? 243.345 252.239 194.530 1.00 500.00 ?  958  ALA A CA  1 
ATOM   4273  C  C   . ALA A 1  958  ? 242.657 250.871 194.512 1.00 500.00 ?  958  ALA A C   1 
ATOM   4274  O  O   . ALA A 1  958  ? 241.519 250.743 194.969 1.00 500.00 ?  958  ALA A O   1 
ATOM   4275  C  CB  . ALA A 1  958  ? 243.224 252.920 193.175 1.00 500.00 ?  958  ALA A CB  1 
ATOM   4276  N  N   . ILE A 1  959  ? 243.364 249.857 194.010 1.00 500.00 ?  959  ILE A N   1 
ATOM   4277  C  CA  . ILE A 1  959  ? 242.862 248.478 193.984 1.00 500.00 ?  959  ILE A CA  1 
ATOM   4278  C  C   . ILE A 1  959  ? 242.730 247.882 195.403 1.00 500.00 ?  959  ILE A C   1 
ATOM   4279  O  O   . ILE A 1  959  ? 241.689 247.291 195.718 1.00 500.00 ?  959  ILE A O   1 
ATOM   4280  C  CB  . ILE A 1  959  ? 243.642 247.610 192.957 1.00 497.85 ?  959  ILE A CB  1 
ATOM   4281  C  CG1 . ILE A 1  959  ? 243.114 247.919 191.547 1.00 487.25 ?  959  ILE A CG1 1 
ATOM   4282  C  CG2 . ILE A 1  959  ? 243.523 246.114 193.251 1.00 489.23 ?  959  ILE A CG2 1 
ATOM   4283  C  CD1 . ILE A 1  959  ? 244.109 247.719 190.425 1.00 470.78 ?  959  ILE A CD1 1 
ATOM   4284  N  N   . TYR A 1  960  ? 243.754 248.074 196.247 1.00 480.32 ?  960  TYR A N   1 
ATOM   4285  C  CA  . TYR A 1  960  ? 243.692 247.770 197.699 1.00 458.60 ?  960  TYR A CA  1 
ATOM   4286  C  C   . TYR A 1  960  ? 242.451 248.414 198.332 1.00 496.21 ?  960  TYR A C   1 
ATOM   4287  O  O   . TYR A 1  960  ? 241.663 247.727 198.994 1.00 500.00 ?  960  TYR A O   1 
ATOM   4288  C  CB  . TYR A 1  960  ? 244.989 248.219 198.418 1.00 399.75 ?  960  TYR A CB  1 
ATOM   4289  C  CG  . TYR A 1  960  ? 245.043 248.056 199.945 1.00 343.37 ?  960  TYR A CG  1 
ATOM   4290  C  CD1 . TYR A 1  960  ? 244.456 249.003 200.800 1.00 284.45 ?  960  TYR A CD1 1 
ATOM   4291  C  CD2 . TYR A 1  960  ? 245.722 246.979 200.533 1.00 345.92 ?  960  TYR A CD2 1 
ATOM   4292  C  CE1 . TYR A 1  960  ? 244.518 248.865 202.185 1.00 258.80 ?  960  TYR A CE1 1 
ATOM   4293  C  CE2 . TYR A 1  960  ? 245.788 246.838 201.920 1.00 323.99 ?  960  TYR A CE2 1 
ATOM   4294  C  CZ  . TYR A 1  960  ? 245.183 247.785 202.738 1.00 292.08 ?  960  TYR A CZ  1 
ATOM   4295  O  OH  . TYR A 1  960  ? 245.240 247.662 204.108 1.00 287.92 ?  960  TYR A OH  1 
ATOM   4296  N  N   . HIS A 1  961  ? 242.280 249.719 198.100 1.00 499.89 ?  961  HIS A N   1 
ATOM   4297  C  CA  . HIS A 1  961  ? 241.149 250.469 198.648 1.00 479.55 ?  961  HIS A CA  1 
ATOM   4298  C  C   . HIS A 1  961  ? 239.781 250.083 198.040 1.00 493.19 ?  961  HIS A C   1 
ATOM   4299  O  O   . HIS A 1  961  ? 238.770 250.130 198.740 1.00 482.81 ?  961  HIS A O   1 
ATOM   4300  C  CB  . HIS A 1  961  ? 241.402 251.992 198.636 1.00 429.62 ?  961  HIS A CB  1 
ATOM   4301  C  CG  . HIS A 1  961  ? 242.369 252.470 199.689 1.00 368.15 ?  961  HIS A CG  1 
ATOM   4302  N  ND1 . HIS A 1  961  ? 242.439 251.924 200.954 1.00 325.41 ?  961  HIS A ND1 1 
ATOM   4303  C  CD2 . HIS A 1  961  ? 243.280 253.473 199.671 1.00 333.19 ?  961  HIS A CD2 1 
ATOM   4304  C  CE1 . HIS A 1  961  ? 243.360 252.554 201.661 1.00 289.52 ?  961  HIS A CE1 1 
ATOM   4305  N  NE2 . HIS A 1  961  ? 243.891 253.494 200.902 1.00 303.48 ?  961  HIS A NE2 1 
ATOM   4306  N  N   . CYS A 1  962  ? 239.752 249.675 196.767 1.00 500.00 ?  962  CYS A N   1 
ATOM   4307  C  CA  . CYS A 1  962  ? 238.514 249.143 196.166 1.00 500.00 ?  962  CYS A CA  1 
ATOM   4308  C  C   . CYS A 1  962  ? 238.176 247.722 196.659 1.00 500.00 ?  962  CYS A C   1 
ATOM   4309  O  O   . CYS A 1  962  ? 237.010 247.330 196.647 1.00 500.00 ?  962  CYS A O   1 
ATOM   4310  C  CB  . CYS A 1  962  ? 238.532 249.206 194.626 1.00 495.33 ?  962  CYS A CB  1 
ATOM   4311  S  SG  . CYS A 1  962  ? 236.889 249.415 193.881 1.00 477.32 ?  962  CYS A SG  1 
ATOM   4312  N  N   . ARG A 1  963  ? 239.187 246.971 197.103 1.00 492.09 ?  963  ARG A N   1 
ATOM   4313  C  CA  . ARG A 1  963  ? 238.999 245.595 197.605 1.00 426.22 ?  963  ARG A CA  1 
ATOM   4314  C  C   . ARG A 1  963  ? 238.404 245.536 199.026 1.00 342.18 ?  963  ARG A C   1 
ATOM   4315  O  O   . ARG A 1  963  ? 237.626 244.629 199.343 1.00 338.37 ?  963  ARG A O   1 
ATOM   4316  C  CB  . ARG A 1  963  ? 240.314 244.809 197.520 1.00 458.69 ?  963  ARG A CB  1 
ATOM   4317  C  CG  . ARG A 1  963  ? 240.211 243.311 197.801 1.00 463.90 ?  963  ARG A CG  1 
ATOM   4318  C  CD  . ARG A 1  963  ? 241.561 242.621 197.654 1.00 466.23 ?  963  ARG A CD  1 
ATOM   4319  N  NE  . ARG A 1  963  ? 242.615 243.267 198.441 1.00 457.48 ?  963  ARG A NE  1 
ATOM   4320  C  CZ  . ARG A 1  963  ? 243.856 243.508 198.014 1.00 447.88 ?  963  ARG A CZ  1 
ATOM   4321  N  NH1 . ARG A 1  963  ? 244.240 243.173 196.785 1.00 446.44 ?  963  ARG A NH1 1 
ATOM   4322  N  NH2 . ARG A 1  963  ? 244.722 244.099 198.827 1.00 437.32 ?  963  ARG A NH2 1 
ATOM   4323  N  N   . GLU A 1  964  ? 238.769 246.495 199.872 1.00 229.10 ?  964  GLU A N   1 
ATOM   4324  C  CA  . GLU A 1  964  ? 238.165 246.606 201.190 1.00 215.72 ?  964  GLU A CA  1 
ATOM   4325  C  C   . GLU A 1  964  ? 236.687 246.998 201.131 1.00 213.55 ?  964  GLU A C   1 
ATOM   4326  O  O   . GLU A 1  964  ? 235.897 246.526 201.947 1.00 206.89 ?  964  GLU A O   1 
ATOM   4327  C  CB  . GLU A 1  964  ? 238.933 247.582 202.072 1.00 238.82 ?  964  GLU A CB  1 
ATOM   4328  C  CG  . GLU A 1  964  ? 239.656 248.671 201.309 1.00 272.48 ?  964  GLU A CG  1 
ATOM   4329  C  CD  . GLU A 1  964  ? 239.692 250.011 202.014 1.00 320.99 ?  964  GLU A CD  1 
ATOM   4330  O  OE1 . GLU A 1  964  ? 238.617 250.555 202.345 1.00 356.99 ?  964  GLU A OE1 1 
ATOM   4331  O  OE2 . GLU A 1  964  ? 240.805 250.541 202.209 1.00 348.09 -1 964  GLU A OE2 1 
ATOM   4332  N  N   . GLN A 1  965  ? 236.309 247.832 200.160 1.00 247.99 ?  965  GLN A N   1 
ATOM   4333  C  CA  . GLN A 1  965  ? 234.900 248.256 199.993 1.00 332.74 ?  965  GLN A CA  1 
ATOM   4334  C  C   . GLN A 1  965  ? 234.209 247.846 198.651 1.00 402.87 ?  965  GLN A C   1 
ATOM   4335  O  O   . GLN A 1  965  ? 233.966 248.717 197.800 1.00 437.94 ?  965  GLN A O   1 
ATOM   4336  C  CB  . GLN A 1  965  ? 234.749 249.781 200.221 1.00 317.15 ?  965  GLN A CB  1 
ATOM   4337  C  CG  . GLN A 1  965  ? 235.376 250.370 201.485 1.00 276.97 ?  965  GLN A CG  1 
ATOM   4338  C  CD  . GLN A 1  965  ? 234.958 249.672 202.766 1.00 257.63 ?  965  GLN A CD  1 
ATOM   4339  O  OE1 . GLN A 1  965  ? 233.778 249.441 203.013 1.00 232.67 ?  965  GLN A OE1 1 
ATOM   4340  N  NE2 . GLN A 1  965  ? 235.933 249.341 203.591 1.00 281.52 ?  965  GLN A NE2 1 
ATOM   4341  N  N   . PRO A 1  966  ? 233.879 246.537 198.456 1.00 440.28 ?  966  PRO A N   1 
ATOM   4342  C  CA  . PRO A 1  966  ? 233.053 246.227 197.271 1.00 445.71 ?  966  PRO A CA  1 
ATOM   4343  C  C   . PRO A 1  966  ? 231.624 246.747 197.470 1.00 466.10 ?  966  PRO A C   1 
ATOM   4344  O  O   . PRO A 1  966  ? 231.056 246.581 198.554 1.00 473.12 ?  966  PRO A O   1 
ATOM   4345  C  CB  . PRO A 1  966  ? 233.094 244.692 197.190 1.00 435.73 ?  966  PRO A CB  1 
ATOM   4346  C  CG  . PRO A 1  966  ? 233.381 244.244 198.584 1.00 439.50 ?  966  PRO A CG  1 
ATOM   4347  C  CD  . PRO A 1  966  ? 234.252 245.311 199.194 1.00 446.59 ?  966  PRO A CD  1 
ATOM   4348  N  N   . ALA A 1  967  ? 231.072 247.400 196.447 1.00 481.89 ?  967  ALA A N   1 
ATOM   4349  C  CA  . ALA A 1  967  ? 229.774 248.082 196.576 1.00 493.53 ?  967  ALA A CA  1 
ATOM   4350  C  C   . ALA A 1  967  ? 228.598 247.410 195.848 1.00 500.00 ?  967  ALA A C   1 
ATOM   4351  O  O   . ALA A 1  967  ? 227.654 246.947 196.495 1.00 500.00 ?  967  ALA A O   1 
ATOM   4352  C  CB  . ALA A 1  967  ? 229.898 249.551 196.182 1.00 479.95 ?  967  ALA A CB  1 
ATOM   4353  N  N   . SER A 1  968  ? 228.662 247.366 194.516 1.00 500.00 ?  968  SER A N   1 
ATOM   4354  C  CA  . SER A 1  968  ? 227.580 246.834 193.681 1.00 500.00 ?  968  SER A CA  1 
ATOM   4355  C  C   . SER A 1  968  ? 228.132 245.950 192.563 1.00 500.00 ?  968  SER A C   1 
ATOM   4356  O  O   . SER A 1  968  ? 229.316 246.047 192.222 1.00 500.00 ?  968  SER A O   1 
ATOM   4357  C  CB  . SER A 1  968  ? 226.754 247.985 193.096 1.00 490.94 ?  968  SER A CB  1 
ATOM   4358  O  OG  . SER A 1  968  ? 225.718 247.509 192.253 1.00 482.64 ?  968  SER A OG  1 
ATOM   4359  N  N   . ASP A 1  969  ? 227.272 245.094 192.002 1.00 500.00 ?  969  ASP A N   1 
ATOM   4360  C  CA  . ASP A 1  969  ? 227.653 244.233 190.878 1.00 500.00 ?  969  ASP A CA  1 
ATOM   4361  C  C   . ASP A 1  969  ? 228.187 245.069 189.722 1.00 496.21 ?  969  ASP A C   1 
ATOM   4362  O  O   . ASP A 1  969  ? 227.478 245.914 189.163 1.00 500.00 ?  969  ASP A O   1 
ATOM   4363  C  CB  . ASP A 1  969  ? 226.494 243.345 190.403 1.00 500.00 ?  969  ASP A CB  1 
ATOM   4364  C  CG  . ASP A 1  969  ? 226.854 242.526 189.163 1.00 499.44 ?  969  ASP A CG  1 
ATOM   4365  O  OD1 . ASP A 1  969  ? 227.547 241.494 189.301 1.00 494.61 ?  969  ASP A OD1 1 
ATOM   4366  O  OD2 . ASP A 1  969  ? 226.451 242.923 188.049 1.00 495.20 -1 969  ASP A OD2 1 
ATOM   4367  N  N   . TRP A 1  970  ? 229.461 244.845 189.422 1.00 449.74 ?  970  TRP A N   1 
ATOM   4368  C  CA  . TRP A 1  970  ? 230.122 245.422 188.263 1.00 383.11 ?  970  TRP A CA  1 
ATOM   4369  C  C   . TRP A 1  970  ? 230.026 244.412 187.090 1.00 292.28 ?  970  TRP A C   1 
ATOM   4370  O  O   . TRP A 1  970  ? 229.685 243.236 187.312 1.00 227.79 ?  970  TRP A O   1 
ATOM   4371  C  CB  . TRP A 1  970  ? 231.599 245.734 188.593 1.00 445.80 ?  970  TRP A CB  1 
ATOM   4372  C  CG  . TRP A 1  970  ? 231.886 246.907 189.559 1.00 465.39 ?  970  TRP A CG  1 
ATOM   4373  C  CD1 . TRP A 1  970  ? 231.704 248.245 189.311 1.00 462.06 ?  970  TRP A CD1 1 
ATOM   4374  C  CD2 . TRP A 1  970  ? 232.458 246.824 190.881 1.00 473.29 ?  970  TRP A CD2 1 
ATOM   4375  N  NE1 . TRP A 1  970  ? 232.100 248.992 190.401 1.00 469.18 ?  970  TRP A NE1 1 
ATOM   4376  C  CE2 . TRP A 1  970  ? 232.565 248.150 191.377 1.00 480.12 ?  970  TRP A CE2 1 
ATOM   4377  C  CE3 . TRP A 1  970  ? 232.871 245.758 191.701 1.00 468.29 ?  970  TRP A CE3 1 
ATOM   4378  C  CZ2 . TRP A 1  970  ? 233.076 248.441 192.661 1.00 488.08 ?  970  TRP A CZ2 1 
ATOM   4379  C  CZ3 . TRP A 1  970  ? 233.378 246.047 192.983 1.00 470.51 ?  970  TRP A CZ3 1 
ATOM   4380  C  CH2 . TRP A 1  970  ? 233.470 247.381 193.447 1.00 481.58 ?  970  TRP A CH2 1 
ATOM   4381  N  N   . PRO A 1  971  ? 230.288 244.876 185.840 1.00 262.50 ?  971  PRO A N   1 
ATOM   4382  C  CA  . PRO A 1  971  ? 230.693 244.005 184.722 1.00 272.57 ?  971  PRO A CA  1 
ATOM   4383  C  C   . PRO A 1  971  ? 231.864 243.101 185.086 1.00 248.69 ?  971  PRO A C   1 
ATOM   4384  O  O   . PRO A 1  971  ? 232.724 243.513 185.856 1.00 253.46 ?  971  PRO A O   1 
ATOM   4385  C  CB  . PRO A 1  971  ? 231.149 245.003 183.639 1.00 270.98 ?  971  PRO A CB  1 
ATOM   4386  C  CG  . PRO A 1  971  ? 230.898 246.374 184.190 1.00 269.24 ?  971  PRO A CG  1 
ATOM   4387  C  CD  . PRO A 1  971  ? 229.948 246.218 185.339 1.00 251.74 ?  971  PRO A CD  1 
ATOM   4388  N  N   . GLU A 1  972  ? 231.894 241.894 184.521 1.00 279.19 ?  972  GLU A N   1 
ATOM   4389  C  CA  . GLU A 1  972  ? 232.899 240.868 184.847 1.00 375.03 ?  972  GLU A CA  1 
ATOM   4390  C  C   . GLU A 1  972  ? 234.360 241.371 184.862 1.00 437.67 ?  972  GLU A C   1 
ATOM   4391  O  O   . GLU A 1  972  ? 235.122 241.023 185.773 1.00 480.07 ?  972  GLU A O   1 
ATOM   4392  C  CB  . GLU A 1  972  ? 232.749 239.663 183.908 1.00 395.26 ?  972  GLU A CB  1 
ATOM   4393  C  CG  . GLU A 1  972  ? 233.382 238.371 184.427 1.00 415.26 ?  972  GLU A CG  1 
ATOM   4394  C  CD  . GLU A 1  972  ? 233.055 237.139 183.588 1.00 422.68 ?  972  GLU A CD  1 
ATOM   4395  O  OE1 . GLU A 1  972  ? 231.939 237.053 183.026 1.00 430.01 ?  972  GLU A OE1 1 
ATOM   4396  O  OE2 . GLU A 1  972  ? 233.919 236.237 183.502 1.00 410.26 -1 972  GLU A OE2 1 
ATOM   4397  N  N   . ALA A 1  973  ? 234.721 242.195 183.871 1.00 486.99 ?  973  ALA A N   1 
ATOM   4398  C  CA  . ALA A 1  973  ? 236.078 242.760 183.725 1.00 500.00 ?  973  ALA A CA  1 
ATOM   4399  C  C   . ALA A 1  973  ? 236.583 243.522 184.962 1.00 500.00 ?  973  ALA A C   1 
ATOM   4400  O  O   . ALA A 1  973  ? 237.725 243.316 185.402 1.00 500.00 ?  973  ALA A O   1 
ATOM   4401  C  CB  . ALA A 1  973  ? 236.152 243.644 182.485 1.00 500.00 ?  973  ALA A CB  1 
ATOM   4402  N  N   . VAL A 1  974  ? 235.713 244.372 185.516 1.00 500.00 ?  974  VAL A N   1 
ATOM   4403  C  CA  . VAL A 1  974  ? 236.007 245.200 186.701 1.00 500.00 ?  974  VAL A CA  1 
ATOM   4404  C  C   . VAL A 1  974  ? 236.327 244.328 187.932 1.00 500.00 ?  974  VAL A C   1 
ATOM   4405  O  O   . VAL A 1  974  ? 237.290 244.605 188.664 1.00 500.00 ?  974  VAL A O   1 
ATOM   4406  C  CB  . VAL A 1  974  ? 234.847 246.189 187.015 1.00 500.00 ?  974  VAL A CB  1 
ATOM   4407  C  CG1 . VAL A 1  974  ? 235.234 247.175 188.110 1.00 500.00 ?  974  VAL A CG1 1 
ATOM   4408  C  CG2 . VAL A 1  974  ? 234.395 246.945 185.767 1.00 500.00 ?  974  VAL A CG2 1 
ATOM   4409  N  N   . CYS A 1  975  ? 235.522 243.280 188.137 1.00 500.00 ?  975  CYS A N   1 
ATOM   4410  C  CA  . CYS A 1  975  ? 235.731 242.302 189.212 1.00 500.00 ?  975  CYS A CA  1 
ATOM   4411  C  C   . CYS A 1  975  ? 237.101 241.623 189.126 1.00 500.00 ?  975  CYS A C   1 
ATOM   4412  O  O   . CYS A 1  975  ? 237.781 241.488 190.145 1.00 500.00 ?  975  CYS A O   1 
ATOM   4413  C  CB  . CYS A 1  975  ? 234.614 241.254 189.225 1.00 500.00 ?  975  CYS A CB  1 
ATOM   4414  S  SG  . CYS A 1  975  ? 232.965 241.929 189.525 1.00 500.00 ?  975  CYS A SG  1 
ATOM   4415  N  N   . LEU A 1  976  ? 237.499 241.228 187.912 1.00 500.00 ?  976  LEU A N   1 
ATOM   4416  C  CA  . LEU A 1  976  ? 238.810 240.607 187.662 1.00 500.00 ?  976  LEU A CA  1 
ATOM   4417  C  C   . LEU A 1  976  ? 240.006 241.533 187.880 1.00 500.00 ?  976  LEU A C   1 
ATOM   4418  O  O   . LEU A 1  976  ? 241.069 241.067 188.294 1.00 500.00 ?  976  LEU A O   1 
ATOM   4419  C  CB  . LEU A 1  976  ? 238.881 239.994 186.259 1.00 483.54 ?  976  LEU A CB  1 
ATOM   4420  C  CG  . LEU A 1  976  ? 238.692 238.478 186.176 1.00 451.38 ?  976  LEU A CG  1 
ATOM   4421  C  CD1 . LEU A 1  976  ? 237.231 238.110 185.953 1.00 446.33 ?  976  LEU A CD1 1 
ATOM   4422  C  CD2 . LEU A 1  976  ? 239.561 237.914 185.064 1.00 433.79 ?  976  LEU A CD2 1 
ATOM   4423  N  N   . LEU A 1  977  ? 239.830 242.825 187.595 1.00 500.00 ?  977  LEU A N   1 
ATOM   4424  C  CA  . LEU A 1  977  ? 240.886 243.826 187.799 1.00 500.00 ?  977  LEU A CA  1 
ATOM   4425  C  C   . LEU A 1  977  ? 241.185 244.089 189.285 1.00 500.00 ?  977  LEU A C   1 
ATOM   4426  O  O   . LEU A 1  977  ? 242.339 244.298 189.653 1.00 500.00 ?  977  LEU A O   1 
ATOM   4427  C  CB  . LEU A 1  977  ? 240.576 245.125 187.040 1.00 500.00 ?  977  LEU A CB  1 
ATOM   4428  C  CG  . LEU A 1  977  ? 241.589 246.276 186.941 1.00 500.00 ?  977  LEU A CG  1 
ATOM   4429  C  CD1 . LEU A 1  977  ? 243.013 245.832 186.624 1.00 500.00 ?  977  LEU A CD1 1 
ATOM   4430  C  CD2 . LEU A 1  977  ? 241.099 247.253 185.889 1.00 500.00 ?  977  LEU A CD2 1 
ATOM   4431  N  N   . ILE A 1  978  ? 240.148 244.084 190.123 1.00 500.00 ?  978  ILE A N   1 
ATOM   4432  C  CA  . ILE A 1  978  ? 240.319 244.008 191.586 1.00 500.00 ?  978  ILE A CA  1 
ATOM   4433  C  C   . ILE A 1  978  ? 240.694 242.558 191.938 1.00 500.00 ?  978  ILE A C   1 
ATOM   4434  O  O   . ILE A 1  978  ? 240.350 241.628 191.201 1.00 500.00 ?  978  ILE A O   1 
ATOM   4435  C  CB  . ILE A 1  978  ? 239.047 244.486 192.349 1.00 500.00 ?  978  ILE A CB  1 
ATOM   4436  C  CG1 . ILE A 1  978  ? 238.737 245.949 191.999 1.00 500.00 ?  978  ILE A CG1 1 
ATOM   4437  C  CG2 . ILE A 1  978  ? 239.201 244.360 193.873 1.00 500.00 ?  978  ILE A CG2 1 
ATOM   4438  C  CD1 . ILE A 1  978  ? 237.269 246.312 192.034 1.00 500.00 ?  978  ILE A CD1 1 
ATOM   4439  N  N   . GLY A 1  979  ? 241.421 242.376 193.043 1.00 500.00 ?  979  GLY A N   1 
ATOM   4440  C  CA  . GLY A 1  979  ? 241.708 241.045 193.593 1.00 500.00 ?  979  GLY A CA  1 
ATOM   4441  C  C   . GLY A 1  979  ? 240.530 240.440 194.345 1.00 500.00 ?  979  GLY A C   1 
ATOM   4442  O  O   . GLY A 1  979  ? 240.691 239.935 195.459 1.00 500.00 ?  979  GLY A O   1 
ATOM   4443  N  N   . ARG A 1  980  ? 239.349 240.497 193.725 1.00 500.00 ?  980  ARG A N   1 
ATOM   4444  C  CA  . ARG A 1  980  ? 238.103 239.968 194.285 1.00 479.52 ?  980  ARG A CA  1 
ATOM   4445  C  C   . ARG A 1  980  ? 237.238 239.374 193.157 1.00 467.06 ?  980  ARG A C   1 
ATOM   4446  O  O   . ARG A 1  980  ? 236.208 239.938 192.740 1.00 451.41 ?  980  ARG A O   1 
ATOM   4447  C  CB  . ARG A 1  980  ? 237.374 241.041 195.112 1.00 461.28 ?  980  ARG A CB  1 
ATOM   4448  C  CG  . ARG A 1  980  ? 236.249 240.495 195.978 1.00 444.00 ?  980  ARG A CG  1 
ATOM   4449  C  CD  . ARG A 1  980  ? 236.043 241.296 197.254 1.00 431.34 ?  980  ARG A CD  1 
ATOM   4450  N  NE  . ARG A 1  980  ? 234.643 241.308 197.698 1.00 421.69 ?  980  ARG A NE  1 
ATOM   4451  C  CZ  . ARG A 1  980  ? 234.000 240.304 198.297 1.00 406.41 ?  980  ARG A CZ  1 
ATOM   4452  N  NH1 . ARG A 1  980  ? 234.602 239.143 198.538 1.00 402.28 ?  980  ARG A NH1 1 
ATOM   4453  N  NH2 . ARG A 1  980  ? 232.730 240.462 198.654 1.00 392.73 ?  980  ARG A NH2 1 
ATOM   4454  N  N   . GLN A 1  981  ? 237.693 238.214 192.683 1.00 458.29 ?  981  GLN A N   1 
ATOM   4455  C  CA  . GLN A 1  981  ? 237.119 237.504 191.538 1.00 425.26 ?  981  GLN A CA  1 
ATOM   4456  C  C   . GLN A 1  981  ? 235.741 236.913 191.832 1.00 385.86 ?  981  GLN A C   1 
ATOM   4457  O  O   . GLN A 1  981  ? 234.950 236.695 190.907 1.00 417.39 ?  981  GLN A O   1 
ATOM   4458  C  CB  . GLN A 1  981  ? 238.069 236.387 191.084 1.00 444.15 ?  981  GLN A CB  1 
ATOM   4459  C  CG  . GLN A 1  981  ? 239.412 236.865 190.540 1.00 440.15 ?  981  GLN A CG  1 
ATOM   4460  C  CD  . GLN A 1  981  ? 240.556 235.911 190.847 1.00 436.41 ?  981  GLN A CD  1 
ATOM   4461  O  OE1 . GLN A 1  981  ? 240.428 234.691 190.707 1.00 428.70 ?  981  GLN A OE1 1 
ATOM   4462  N  NE2 . GLN A 1  981  ? 241.691 236.467 191.258 1.00 437.90 ?  981  GLN A NE2 1 
ATOM   4463  N  N   . ASP A 1  982  ? 235.463 236.672 193.117 1.00 292.51 ?  982  ASP A N   1 
ATOM   4464  C  CA  . ASP A 1  982  ? 234.257 235.972 193.563 1.00 216.09 ?  982  ASP A CA  1 
ATOM   4465  C  C   . ASP A 1  982  ? 232.961 236.674 193.196 1.00 189.67 ?  982  ASP A C   1 
ATOM   4466  O  O   . ASP A 1  982  ? 231.948 236.023 192.978 1.00 218.97 ?  982  ASP A O   1 
ATOM   4467  C  CB  . ASP A 1  982  ? 234.295 235.729 195.076 1.00 195.82 ?  982  ASP A CB  1 
ATOM   4468  C  CG  . ASP A 1  982  ? 234.111 237.009 195.902 1.00 194.19 ?  982  ASP A CG  1 
ATOM   4469  O  OD1 . ASP A 1  982  ? 234.114 238.139 195.338 1.00 152.12 ?  982  ASP A OD1 1 
ATOM   4470  O  OD2 . ASP A 1  982  ? 233.967 236.858 197.139 1.00 189.78 -1 982  ASP A OD2 1 
ATOM   4471  N  N   . LEU A 1  983  ? 232.988 237.997 193.154 1.00 160.00 ?  983  LEU A N   1 
ATOM   4472  C  CA  . LEU A 1  983  ? 231.783 238.748 192.862 1.00 206.62 ?  983  LEU A CA  1 
ATOM   4473  C  C   . LEU A 1  983  ? 231.119 238.326 191.523 1.00 273.03 ?  983  LEU A C   1 
ATOM   4474  O  O   . LEU A 1  983  ? 229.899 238.136 191.485 1.00 282.09 ?  983  LEU A O   1 
ATOM   4475  C  CB  . LEU A 1  983  ? 232.097 240.237 192.899 1.00 223.89 ?  983  LEU A CB  1 
ATOM   4476  C  CG  . LEU A 1  983  ? 232.578 240.788 194.238 1.00 227.33 ?  983  LEU A CG  1 
ATOM   4477  C  CD1 . LEU A 1  983  ? 233.481 241.998 194.032 1.00 272.34 ?  983  LEU A CD1 1 
ATOM   4478  C  CD2 . LEU A 1  983  ? 231.378 241.151 195.097 1.00 247.77 ?  983  LEU A CD2 1 
ATOM   4479  N  N   . SER A 1  984  ? 231.927 238.144 190.463 1.00 354.21 ?  984  SER A N   1 
ATOM   4480  C  CA  . SER A 1  984  ? 231.458 237.746 189.102 1.00 378.02 ?  984  SER A CA  1 
ATOM   4481  C  C   . SER A 1  984  ? 231.848 236.315 188.609 1.00 397.30 ?  984  SER A C   1 
ATOM   4482  O  O   . SER A 1  984  ? 231.891 236.060 187.393 1.00 426.88 ?  984  SER A O   1 
ATOM   4483  C  CB  . SER A 1  984  ? 231.890 238.795 188.051 1.00 377.12 ?  984  SER A CB  1 
ATOM   4484  O  OG  . SER A 1  984  ? 231.026 239.924 188.005 1.00 345.26 ?  984  SER A OG  1 
ATOM   4485  N  N   . LYS A 1  985  ? 232.085 235.379 189.535 1.00 374.91 ?  985  LYS A N   1 
ATOM   4486  C  CA  . LYS A 1  985  ? 232.533 234.002 189.193 1.00 314.67 ?  985  LYS A CA  1 
ATOM   4487  C  C   . LYS A 1  985  ? 231.551 233.124 188.374 1.00 312.71 ?  985  LYS A C   1 
ATOM   4488  O  O   . LYS A 1  985  ? 231.902 232.000 188.009 1.00 294.99 ?  985  LYS A O   1 
ATOM   4489  C  CB  . LYS A 1  985  ? 232.992 233.266 190.445 1.00 277.93 ?  985  LYS A CB  1 
ATOM   4490  N  N   . GLN A 1  986  ? 230.348 233.651 188.101 1.00 311.48 ?  986  GLN A N   1 
ATOM   4491  C  CA  . GLN A 1  986  ? 229.310 233.067 187.208 1.00 260.35 ?  986  GLN A CA  1 
ATOM   4492  C  C   . GLN A 1  986  ? 228.787 231.706 187.651 1.00 236.52 ?  986  GLN A C   1 
ATOM   4493  O  O   . GLN A 1  986  ? 228.339 231.553 188.785 1.00 197.13 ?  986  GLN A O   1 
ATOM   4494  C  CB  . GLN A 1  986  ? 229.764 233.037 185.746 1.00 223.57 ?  986  GLN A CB  1 
ATOM   4495  N  N   . ASP A 1  1013 ? 220.289 200.096 194.145 1.00 408.80 ?  1013 ASP A N   1 
ATOM   4496  C  CA  . ASP A 1  1013 ? 219.883 199.371 195.343 1.00 420.59 ?  1013 ASP A CA  1 
ATOM   4497  C  C   . ASP A 1  1013 ? 219.682 200.337 196.514 1.00 425.68 ?  1013 ASP A C   1 
ATOM   4498  O  O   . ASP A 1  1013 ? 220.582 201.126 196.829 1.00 456.00 ?  1013 ASP A O   1 
ATOM   4499  C  CB  . ASP A 1  1013 ? 220.925 198.297 195.694 1.00 425.61 ?  1013 ASP A CB  1 
ATOM   4500  C  CG  . ASP A 1  1013 ? 220.355 197.169 196.551 1.00 433.94 ?  1013 ASP A CG  1 
ATOM   4501  O  OD1 . ASP A 1  1013 ? 219.233 196.694 196.267 1.00 443.61 ?  1013 ASP A OD1 1 
ATOM   4502  O  OD2 . ASP A 1  1013 ? 221.046 196.741 197.501 1.00 433.50 -1 1013 ASP A OD2 1 
ATOM   4503  N  N   . ASP A 1  1014 ? 218.490 200.265 197.125 1.00 402.35 ?  1014 ASP A N   1 
ATOM   4504  C  CA  . ASP A 1  1014 ? 218.037 201.082 198.292 1.00 371.88 ?  1014 ASP A CA  1 
ATOM   4505  C  C   . ASP A 1  1014 ? 217.557 202.514 197.977 1.00 399.43 ?  1014 ASP A C   1 
ATOM   4506  O  O   . ASP A 1  1014 ? 216.760 203.092 198.731 1.00 435.29 ?  1014 ASP A O   1 
ATOM   4507  C  CB  . ASP A 1  1014 ? 219.074 201.082 199.451 1.00 309.39 ?  1014 ASP A CB  1 
ATOM   4508  C  CG  . ASP A 1  1014 ? 218.562 201.768 200.719 1.00 259.62 ?  1014 ASP A CG  1 
ATOM   4509  O  OD1 . ASP A 1  1014 ? 217.371 201.609 201.045 1.00 246.90 ?  1014 ASP A OD1 1 
ATOM   4510  O  OD2 . ASP A 1  1014 ? 219.352 202.471 201.380 1.00 231.54 -1 1014 ASP A OD2 1 
ATOM   4511  N  N   . GLY A 1  1015 ? 218.030 203.074 196.864 1.00 388.56 ?  1015 GLY A N   1 
ATOM   4512  C  CA  . GLY A 1  1015 ? 217.987 204.518 196.650 1.00 297.13 ?  1015 GLY A CA  1 
ATOM   4513  C  C   . GLY A 1  1015 ? 218.909 205.189 197.656 1.00 213.89 ?  1015 GLY A C   1 
ATOM   4514  O  O   . GLY A 1  1015 ? 219.731 204.538 198.328 1.00 177.15 ?  1015 GLY A O   1 
ATOM   4515  N  N   . MET A 1  1016 ? 218.769 206.499 197.785 1.00 165.05 ?  1016 MET A N   1 
ATOM   4516  C  CA  . MET A 1  1016 ? 219.620 207.247 198.690 1.00 173.37 ?  1016 MET A CA  1 
ATOM   4517  C  C   . MET A 1  1016 ? 221.060 207.254 198.158 1.00 180.12 ?  1016 MET A C   1 
ATOM   4518  O  O   . MET A 1  1016 ? 221.995 207.672 198.843 1.00 197.53 ?  1016 MET A O   1 
ATOM   4519  C  CB  . MET A 1  1016 ? 219.512 206.679 200.113 1.00 166.84 ?  1016 MET A CB  1 
ATOM   4520  C  CG  . MET A 1  1016 ? 218.076 206.377 200.526 1.00 213.71 ?  1016 MET A CG  1 
ATOM   4521  S  SD  . MET A 1  1016 ? 217.729 206.381 202.290 1.00 301.98 ?  1016 MET A SD  1 
ATOM   4522  C  CE  . MET A 1  1016 ? 216.845 204.830 202.386 1.00 284.67 ?  1016 MET A CE  1 
ATOM   4523  N  N   . ASN A 1  1017 ? 221.217 206.825 196.910 1.00 202.20 ?  1017 ASN A N   1 
ATOM   4524  C  CA  . ASN A 1  1017 ? 222.522 206.761 196.270 1.00 254.20 ?  1017 ASN A CA  1 
ATOM   4525  C  C   . ASN A 1  1017 ? 223.044 208.112 195.825 1.00 220.41 ?  1017 ASN A C   1 
ATOM   4526  O  O   . ASN A 1  1017 ? 224.195 208.445 196.096 1.00 222.98 ?  1017 ASN A O   1 
ATOM   4527  C  CB  . ASN A 1  1017 ? 222.526 205.751 195.118 1.00 330.99 ?  1017 ASN A CB  1 
ATOM   4528  C  CG  . ASN A 1  1017 ? 222.799 204.328 195.590 1.00 386.14 ?  1017 ASN A CG  1 
ATOM   4529  O  OD1 . ASN A 1  1017 ? 223.391 204.108 196.655 1.00 417.70 ?  1017 ASN A OD1 1 
ATOM   4530  N  ND2 . ASN A 1  1017 ? 222.374 203.350 194.792 1.00 399.85 ?  1017 ASN A ND2 1 
ATOM   4531  N  N   . ASP A 1  1018 ? 222.216 208.895 195.149 1.00 196.05 ?  1018 ASP A N   1 
ATOM   4532  C  CA  . ASP A 1  1018 ? 222.632 210.250 194.886 1.00 217.64 ?  1018 ASP A CA  1 
ATOM   4533  C  C   . ASP A 1  1018 ? 222.219 211.162 196.035 1.00 210.14 ?  1018 ASP A C   1 
ATOM   4534  O  O   . ASP A 1  1018 ? 221.056 211.553 196.139 1.00 222.27 ?  1018 ASP A O   1 
ATOM   4535  C  CB  . ASP A 1  1018 ? 222.130 210.767 193.543 1.00 248.02 ?  1018 ASP A CB  1 
ATOM   4536  C  CG  . ASP A 1  1018 ? 222.887 212.015 193.087 1.00 299.20 ?  1018 ASP A CG  1 
ATOM   4537  O  OD1 . ASP A 1  1018 ? 222.788 213.067 193.760 1.00 327.56 ?  1018 ASP A OD1 1 
ATOM   4538  O  OD2 . ASP A 1  1018 ? 223.593 211.945 192.057 1.00 322.38 -1 1018 ASP A OD2 1 
ATOM   4539  N  N   . MET A 1  1019 ? 223.186 211.505 196.885 1.00 196.91 ?  1019 MET A N   1 
ATOM   4540  C  CA  . MET A 1  1019 ? 222.929 212.408 197.999 1.00 202.37 ?  1019 MET A CA  1 
ATOM   4541  C  C   . MET A 1  1019 ? 223.624 213.769 197.926 1.00 207.82 ?  1019 MET A C   1 
ATOM   4542  O  O   . MET A 1  1019 ? 223.084 214.760 198.438 1.00 221.15 ?  1019 MET A O   1 
ATOM   4543  C  CB  . MET A 1  1019 ? 223.237 211.726 199.329 1.00 199.63 ?  1019 MET A CB  1 
ATOM   4544  C  CG  . MET A 1  1019 ? 222.161 210.775 199.858 1.00 193.05 ?  1019 MET A CG  1 
ATOM   4545  S  SD  . MET A 1  1019 ? 220.398 211.211 199.731 1.00 193.28 ?  1019 MET A SD  1 
ATOM   4546  C  CE  . MET A 1  1019 ? 220.189 212.687 200.722 1.00 191.82 ?  1019 MET A CE  1 
ATOM   4547  N  N   . ASN A 1  1020 ? 224.783 213.824 197.263 1.00 196.84 ?  1020 ASN A N   1 
ATOM   4548  C  CA  . ASN A 1  1020 ? 225.690 214.988 197.311 1.00 212.60 ?  1020 ASN A CA  1 
ATOM   4549  C  C   . ASN A 1  1020 ? 226.141 215.192 198.744 1.00 224.55 ?  1020 ASN A C   1 
ATOM   4550  O  O   . ASN A 1  1020 ? 225.913 216.249 199.372 1.00 179.68 ?  1020 ASN A O   1 
ATOM   4551  C  CB  . ASN A 1  1020 ? 225.095 216.274 196.689 1.00 227.81 ?  1020 ASN A CB  1 
ATOM   4552  C  CG  . ASN A 1  1020 ? 226.068 217.466 196.703 1.00 233.13 ?  1020 ASN A CG  1 
ATOM   4553  O  OD1 . ASN A 1  1020 ? 227.261 217.338 196.999 1.00 194.13 ?  1020 ASN A OD1 1 
ATOM   4554  N  ND2 . ASN A 1  1020 ? 225.546 218.640 196.371 1.00 269.88 ?  1020 ASN A ND2 1 
ATOM   4555  N  N   . HIS A 1  1021 ? 226.776 214.128 199.229 1.00 294.17 ?  1021 HIS A N   1 
ATOM   4556  C  CA  . HIS A 1  1021 ? 227.405 214.047 200.545 1.00 373.97 ?  1021 HIS A CA  1 
ATOM   4557  C  C   . HIS A 1  1021 ? 228.431 215.144 200.888 1.00 427.98 ?  1021 HIS A C   1 
ATOM   4558  O  O   . HIS A 1  1021 ? 228.523 215.508 202.045 1.00 471.11 ?  1021 HIS A O   1 
ATOM   4559  C  CB  . HIS A 1  1021 ? 228.023 212.657 200.750 1.00 370.40 ?  1021 HIS A CB  1 
ATOM   4560  C  CG  . HIS A 1  1021 ? 227.016 211.561 200.928 1.00 351.62 ?  1021 HIS A CG  1 
ATOM   4561  N  ND1 . HIS A 1  1021 ? 226.603 210.750 199.891 1.00 349.36 ?  1021 HIS A ND1 1 
ATOM   4562  C  CD2 . HIS A 1  1021 ? 226.360 211.124 202.028 1.00 338.94 ?  1021 HIS A CD2 1 
ATOM   4563  C  CE1 . HIS A 1  1021 ? 225.733 209.865 200.346 1.00 333.47 ?  1021 HIS A CE1 1 
ATOM   4564  N  NE2 . HIS A 1  1021 ? 225.563 210.075 201.638 1.00 321.14 ?  1021 HIS A NE2 1 
ATOM   4565  N  N   . GLU A 1  1022 ? 229.174 215.671 199.906 1.00 410.01 ?  1022 GLU A N   1 
ATOM   4566  C  CA  . GLU A 1  1022 ? 230.153 216.781 200.110 1.00 323.47 ?  1022 GLU A CA  1 
ATOM   4567  C  C   . GLU A 1  1022 ? 229.529 217.968 200.878 1.00 266.47 ?  1022 GLU A C   1 
ATOM   4568  O  O   . GLU A 1  1022 ? 229.990 218.343 201.976 1.00 242.92 ?  1022 GLU A O   1 
ATOM   4569  C  CB  . GLU A 1  1022 ? 230.721 217.275 198.764 1.00 323.17 ?  1022 GLU A CB  1 
ATOM   4570  C  CG  . GLU A 1  1022 ? 231.162 216.189 197.781 1.00 331.15 ?  1022 GLU A CG  1 
ATOM   4571  C  CD  . GLU A 1  1022 ? 230.995 216.589 196.316 1.00 343.12 ?  1022 GLU A CD  1 
ATOM   4572  O  OE1 . GLU A 1  1022 ? 231.194 217.778 195.976 1.00 375.98 ?  1022 GLU A OE1 1 
ATOM   4573  O  OE2 . GLU A 1  1022 ? 230.671 215.706 195.491 1.00 319.85 -1 1022 GLU A OE2 1 
ATOM   4574  N  N   . VAL A 1  1023 ? 228.461 218.511 200.285 1.00 194.00 ?  1023 VAL A N   1 
ATOM   4575  C  CA  . VAL A 1  1023 ? 227.594 219.521 200.884 1.00 146.15 ?  1023 VAL A CA  1 
ATOM   4576  C  C   . VAL A 1  1023 ? 226.909 219.001 202.146 1.00 134.12 ?  1023 VAL A C   1 
ATOM   4577  O  O   . VAL A 1  1023 ? 226.971 219.656 203.177 1.00 149.14 ?  1023 VAL A O   1 
ATOM   4578  C  CB  . VAL A 1  1023 ? 226.526 219.982 199.881 1.00 138.34 ?  1023 VAL A CB  1 
ATOM   4579  C  CG1 . VAL A 1  1023 ? 225.553 220.938 200.536 1.00 136.85 ?  1023 VAL A CG1 1 
ATOM   4580  C  CG2 . VAL A 1  1023 ? 227.173 220.661 198.686 1.00 157.26 ?  1023 VAL A CG2 1 
ATOM   4581  N  N   . MET A 1  1024 ? 226.249 217.845 202.043 1.00 123.38 ?  1024 MET A N   1 
ATOM   4582  C  CA  . MET A 1  1024 ? 225.614 217.150 203.182 1.00 130.90 ?  1024 MET A CA  1 
ATOM   4583  C  C   . MET A 1  1024 ? 226.529 216.832 204.391 1.00 132.78 ?  1024 MET A C   1 
ATOM   4584  O  O   . MET A 1  1024 ? 226.090 216.947 205.537 1.00 142.02 ?  1024 MET A O   1 
ATOM   4585  C  CB  . MET A 1  1024 ? 224.885 215.879 202.711 1.00 132.95 ?  1024 MET A CB  1 
ATOM   4586  C  CG  . MET A 1  1024 ? 223.737 215.475 203.629 1.00 166.87 ?  1024 MET A CG  1 
ATOM   4587  S  SD  . MET A 1  1024 ? 222.430 214.358 203.064 1.00 167.06 ?  1024 MET A SD  1 
ATOM   4588  C  CE  . MET A 1  1024 ? 223.418 212.911 202.714 1.00 190.31 ?  1024 MET A CE  1 
ATOM   4589  N  N   . SER A 1  1025 ? 227.780 216.448 204.149 1.00 133.11 ?  1025 SER A N   1 
ATOM   4590  C  CA  . SER A 1  1025 ? 228.743 216.215 205.226 1.00 151.33 ?  1025 SER A CA  1 
ATOM   4591  C  C   . SER A 1  1025 ? 229.082 217.509 205.966 1.00 172.11 ?  1025 SER A C   1 
ATOM   4592  O  O   . SER A 1  1025 ? 229.315 217.488 207.181 1.00 217.80 ?  1025 SER A O   1 
ATOM   4593  C  CB  . SER A 1  1025 ? 230.018 215.550 204.708 1.00 156.28 ?  1025 SER A CB  1 
ATOM   4594  O  OG  . SER A 1  1025 ? 230.740 214.969 205.783 1.00 168.51 ?  1025 SER A OG  1 
ATOM   4595  N  N   . LEU A 1  1026 ? 229.101 218.623 205.233 1.00 172.76 ?  1026 LEU A N   1 
ATOM   4596  C  CA  . LEU A 1  1026 ? 229.249 219.950 205.830 1.00 173.80 ?  1026 LEU A CA  1 
ATOM   4597  C  C   . LEU A 1  1026 ? 228.173 220.277 206.853 1.00 165.43 ?  1026 LEU A C   1 
ATOM   4598  O  O   . LEU A 1  1026 ? 228.475 220.841 207.910 1.00 174.89 ?  1026 LEU A O   1 
ATOM   4599  C  CB  . LEU A 1  1026 ? 229.261 221.022 204.748 1.00 180.40 ?  1026 LEU A CB  1 
ATOM   4600  C  CG  . LEU A 1  1026 ? 230.603 221.556 204.269 1.00 224.17 ?  1026 LEU A CG  1 
ATOM   4601  C  CD1 . LEU A 1  1026 ? 231.719 220.512 204.157 1.00 242.07 ?  1026 LEU A CD1 1 
ATOM   4602  C  CD2 . LEU A 1  1026 ? 230.337 222.232 202.940 1.00 249.27 ?  1026 LEU A CD2 1 
ATOM   4603  N  N   . ILE A 1  1027 ? 226.927 219.916 206.540 1.00 142.96 ?  1027 ILE A N   1 
ATOM   4604  C  CA  . ILE A 1  1027 ? 225.815 220.199 207.432 1.00 131.31 ?  1027 ILE A CA  1 
ATOM   4605  C  C   . ILE A 1  1027 ? 226.035 219.431 208.723 1.00 126.04 ?  1027 ILE A C   1 
ATOM   4606  O  O   . ILE A 1  1027 ? 226.047 220.034 209.784 1.00 157.34 ?  1027 ILE A O   1 
ATOM   4607  C  CB  . ILE A 1  1027 ? 224.402 219.939 206.828 1.00 134.94 ?  1027 ILE A CB  1 
ATOM   4608  C  CG1 . ILE A 1  1027 ? 224.294 220.469 205.384 1.00 145.66 ?  1027 ILE A CG1 1 
ATOM   4609  C  CG2 . ILE A 1  1027 ? 223.332 220.608 207.697 1.00 149.94 ?  1027 ILE A CG2 1 
ATOM   4610  C  CD1 . ILE A 1  1027 ? 223.074 220.010 204.598 1.00 136.32 ?  1027 ILE A CD1 1 
ATOM   4611  N  N   . TRP A 1  1028 ? 226.273 218.129 208.636 1.00 128.38 ?  1028 TRP A N   1 
ATOM   4612  C  CA  . TRP A 1  1028 ? 226.294 217.290 209.843 1.00 163.82 ?  1028 TRP A CA  1 
ATOM   4613  C  C   . TRP A 1  1028 ? 227.656 216.654 210.071 1.00 186.34 ?  1028 TRP A C   1 
ATOM   4614  O  O   . TRP A 1  1028 ? 227.810 215.442 209.888 1.00 207.55 ?  1028 TRP A O   1 
ATOM   4615  C  CB  . TRP A 1  1028 ? 225.162 216.228 209.808 1.00 162.38 ?  1028 TRP A CB  1 
ATOM   4616  C  CG  . TRP A 1  1028 ? 223.792 216.820 209.558 1.00 175.75 ?  1028 TRP A CG  1 
ATOM   4617  C  CD1 . TRP A 1  1028 ? 223.124 217.685 210.367 1.00 196.66 ?  1028 TRP A CD1 1 
ATOM   4618  C  CD2 . TRP A 1  1028 ? 222.941 216.614 208.416 1.00 172.43 ?  1028 TRP A CD2 1 
ATOM   4619  N  NE1 . TRP A 1  1028 ? 221.910 218.031 209.816 1.00 191.57 ?  1028 TRP A NE1 1 
ATOM   4620  C  CE2 . TRP A 1  1028 ? 221.774 217.390 208.616 1.00 174.26 ?  1028 TRP A CE2 1 
ATOM   4621  C  CE3 . TRP A 1  1028 ? 223.048 215.860 207.247 1.00 165.37 ?  1028 TRP A CE3 1 
ATOM   4622  C  CZ2 . TRP A 1  1028 ? 220.730 217.432 207.692 1.00 160.07 ?  1028 TRP A CZ2 1 
ATOM   4623  C  CZ3 . TRP A 1  1028 ? 221.986 215.891 206.336 1.00 149.40 ?  1028 TRP A CZ3 1 
ATOM   4624  C  CH2 . TRP A 1  1028 ? 220.858 216.676 206.560 1.00 143.56 ?  1028 TRP A CH2 1 
ATOM   4625  N  N   . SER A 1  1029 ? 228.643 217.459 210.475 1.00 190.71 ?  1029 SER A N   1 
ATOM   4626  C  CA  . SER A 1  1029 ? 229.972 216.913 210.757 1.00 244.15 ?  1029 SER A CA  1 
ATOM   4627  C  C   . SER A 1  1029 ? 229.973 216.220 212.129 1.00 282.85 ?  1029 SER A C   1 
ATOM   4628  O  O   . SER A 1  1029 ? 228.907 216.089 212.756 1.00 298.52 ?  1029 SER A O   1 
ATOM   4629  C  CB  . SER A 1  1029 ? 231.068 217.978 210.623 1.00 253.57 ?  1029 SER A CB  1 
ATOM   4630  O  OG  . SER A 1  1029 ? 231.314 218.627 211.853 1.00 301.87 ?  1029 SER A OG  1 
ATOM   4631  N  N   . GLU A 1  1030 ? 231.161 215.788 212.576 1.00 317.45 ?  1030 GLU A N   1 
ATOM   4632  C  CA  . GLU A 1  1030 ? 231.349 214.937 213.768 1.00 329.77 ?  1030 GLU A CA  1 
ATOM   4633  C  C   . GLU A 1  1030 ? 230.580 213.627 213.554 1.00 321.87 ?  1030 GLU A C   1 
ATOM   4634  O  O   . GLU A 1  1030 ? 230.996 212.808 212.735 1.00 319.09 ?  1030 GLU A O   1 
ATOM   4635  C  CB  . GLU A 1  1030 ? 230.945 215.649 215.079 1.00 366.02 ?  1030 GLU A CB  1 
ATOM   4636  C  CG  . GLU A 1  1030 ? 231.544 217.041 215.283 1.00 404.59 ?  1030 GLU A CG  1 
ATOM   4637  C  CD  . GLU A 1  1030 ? 230.622 218.003 216.028 1.00 417.57 ?  1030 GLU A CD  1 
ATOM   4638  O  OE1 . GLU A 1  1030 ? 229.418 217.703 216.199 1.00 426.47 ?  1030 GLU A OE1 1 
ATOM   4639  O  OE2 . GLU A 1  1030 ? 231.105 219.082 216.441 1.00 418.36 -1 1030 GLU A OE2 1 
ATOM   4640  N  N   . ASP A 1  1031 ? 229.451 213.471 214.252 1.00 303.50 ?  1031 ASP A N   1 
ATOM   4641  C  CA  . ASP A 1  1031 ? 228.533 212.340 214.094 1.00 295.79 ?  1031 ASP A CA  1 
ATOM   4642  C  C   . ASP A 1  1031 ? 227.892 212.222 212.704 1.00 275.07 ?  1031 ASP A C   1 
ATOM   4643  O  O   . ASP A 1  1031 ? 227.463 213.227 212.128 1.00 272.28 ?  1031 ASP A O   1 
ATOM   4644  C  CB  . ASP A 1  1031 ? 227.402 212.450 215.123 1.00 312.50 ?  1031 ASP A CB  1 
ATOM   4645  C  CG  . ASP A 1  1031 ? 226.226 211.550 214.788 1.00 324.10 ?  1031 ASP A CG  1 
ATOM   4646  O  OD1 . ASP A 1  1031 ? 226.404 210.320 214.855 1.00 318.99 ?  1031 ASP A OD1 1 
ATOM   4647  O  OD2 . ASP A 1  1031 ? 225.145 212.057 214.420 1.00 329.59 -1 1031 ASP A OD2 1 
ATOM   4648  N  N   . LEU A 1  1032 ? 227.791 210.988 212.201 1.00 230.84 ?  1032 LEU A N   1 
ATOM   4649  C  CA  . LEU A 1  1032 ? 226.957 210.709 211.024 1.00 196.12 ?  1032 LEU A CA  1 
ATOM   4650  C  C   . LEU A 1  1032 ? 225.487 210.338 211.332 1.00 174.04 ?  1032 LEU A C   1 
ATOM   4651  O  O   . LEU A 1  1032 ? 225.124 209.181 211.628 1.00 122.05 ?  1032 LEU A O   1 
ATOM   4652  C  CB  . LEU A 1  1032 ? 227.631 209.776 210.001 1.00 190.36 ?  1032 LEU A CB  1 
ATOM   4653  C  CG  . LEU A 1  1032 ? 228.140 208.374 210.294 1.00 189.11 ?  1032 LEU A CG  1 
ATOM   4654  C  CD1 . LEU A 1  1032 ? 228.378 207.693 208.957 1.00 173.90 ?  1032 LEU A CD1 1 
ATOM   4655  C  CD2 . LEU A 1  1032 ? 229.428 208.417 211.101 1.00 220.57 ?  1032 LEU A CD2 1 
ATOM   4656  N  N   . ARG A 1  1033 ? 224.661 211.377 211.260 1.00 184.08 ?  1033 ARG A N   1 
ATOM   4657  C  CA  . ARG A 1  1033 ? 223.203 211.275 211.249 1.00 194.20 ?  1033 ARG A CA  1 
ATOM   4658  C  C   . ARG A 1  1033 ? 222.680 210.504 210.029 1.00 241.64 ?  1033 ARG A C   1 
ATOM   4659  O  O   . ARG A 1  1033 ? 221.815 209.638 210.181 1.00 280.73 ?  1033 ARG A O   1 
ATOM   4660  C  CB  . ARG A 1  1033 ? 222.593 212.677 211.272 1.00 180.01 ?  1033 ARG A CB  1 
ATOM   4661  C  CG  . ARG A 1  1033 ? 222.658 213.351 212.627 1.00 182.99 ?  1033 ARG A CG  1 
ATOM   4662  C  CD  . ARG A 1  1033 ? 222.985 214.820 212.510 1.00 167.16 ?  1033 ARG A CD  1 
ATOM   4663  N  NE  . ARG A 1  1033 ? 223.036 215.406 213.835 1.00 169.54 ?  1033 ARG A NE  1 
ATOM   4664  C  CZ  . ARG A 1  1033 ? 222.721 216.664 214.117 1.00 209.41 ?  1033 ARG A CZ  1 
ATOM   4665  N  NH1 . ARG A 1  1033 ? 222.327 217.498 213.170 1.00 237.60 ?  1033 ARG A NH1 1 
ATOM   4666  N  NH2 . ARG A 1  1033 ? 222.786 217.095 215.363 1.00 252.06 ?  1033 ARG A NH2 1 
ATOM   4667  N  N   . VAL A 1  1034 ? 223.224 210.810 208.842 1.00 263.11 ?  1034 VAL A N   1 
ATOM   4668  C  CA  . VAL A 1  1034 ? 222.754 210.272 207.529 1.00 228.93 ?  1034 VAL A CA  1 
ATOM   4669  C  C   . VAL A 1  1034 ? 222.903 208.772 207.287 1.00 293.85 ?  1034 VAL A C   1 
ATOM   4670  O  O   . VAL A 1  1034 ? 222.067 208.186 206.589 1.00 289.53 ?  1034 VAL A O   1 
ATOM   4671  C  CB  . VAL A 1  1034 ? 223.379 211.007 206.338 1.00 158.91 ?  1034 VAL A CB  1 
ATOM   4672  C  CG1 . VAL A 1  1034 ? 222.838 212.419 206.302 1.00 154.34 ?  1034 VAL A CG1 1 
ATOM   4673  C  CG2 . VAL A 1  1034 ? 224.904 211.007 206.414 1.00 147.71 ?  1034 VAL A CG2 1 
ATOM   4674  N  N   . GLN A 1  1035 ? 223.968 208.178 207.840 1.00 378.01 ?  1035 GLN A N   1 
ATOM   4675  C  CA  . GLN A 1  1035 ? 224.147 206.718 207.879 1.00 420.34 ?  1035 GLN A CA  1 
ATOM   4676  C  C   . GLN A 1  1035 ? 223.002 206.077 208.652 1.00 461.50 ?  1035 GLN A C   1 
ATOM   4677  O  O   . GLN A 1  1035 ? 222.422 205.103 208.174 1.00 490.80 ?  1035 GLN A O   1 
ATOM   4678  C  CB  . GLN A 1  1035 ? 225.527 206.336 208.450 1.00 403.06 ?  1035 GLN A CB  1 
ATOM   4679  C  CG  . GLN A 1  1035 ? 225.638 205.081 209.326 1.00 386.12 ?  1035 GLN A CG  1 
ATOM   4680  C  CD  . GLN A 1  1035 ? 225.332 203.776 208.603 1.00 388.85 ?  1035 GLN A CD  1 
ATOM   4681  O  OE1 . GLN A 1  1035 ? 225.682 203.592 207.435 1.00 393.48 ?  1035 GLN A OE1 1 
ATOM   4682  N  NE2 . GLN A 1  1035 ? 224.673 202.858 209.305 1.00 387.89 ?  1035 GLN A NE2 1 
ATOM   4683  N  N   . ASP A 1  1036 ? 222.676 206.645 209.820 1.00 472.19 ?  1036 ASP A N   1 
ATOM   4684  C  CA  . ASP A 1  1036 ? 221.525 206.208 210.616 1.00 458.33 ?  1036 ASP A CA  1 
ATOM   4685  C  C   . ASP A 1  1036 ? 220.223 206.371 209.830 1.00 466.68 ?  1036 ASP A C   1 
ATOM   4686  O  O   . ASP A 1  1036 ? 219.431 205.437 209.783 1.00 480.00 ?  1036 ASP A O   1 
ATOM   4687  C  CB  . ASP A 1  1036 ? 221.454 206.940 211.965 1.00 461.53 ?  1036 ASP A CB  1 
ATOM   4688  C  CG  . ASP A 1  1036 ? 222.681 206.700 212.832 1.00 473.40 ?  1036 ASP A CG  1 
ATOM   4689  O  OD1 . ASP A 1  1036 ? 223.052 205.528 213.053 1.00 500.00 ?  1036 ASP A OD1 1 
ATOM   4690  O  OD2 . ASP A 1  1036 ? 223.272 207.691 213.303 1.00 463.04 -1 1036 ASP A OD2 1 
ATOM   4691  N  N   . VAL A 1  1037 ? 220.044 207.532 209.185 1.00 442.19 ?  1037 VAL A N   1 
ATOM   4692  C  CA  . VAL A 1  1037 ? 218.862 207.846 208.348 1.00 370.21 ?  1037 VAL A CA  1 
ATOM   4693  C  C   . VAL A 1  1037 ? 218.648 206.828 207.195 1.00 356.46 ?  1037 VAL A C   1 
ATOM   4694  O  O   . VAL A 1  1037 ? 217.564 206.238 207.096 1.00 409.35 ?  1037 VAL A O   1 
ATOM   4695  C  CB  . VAL A 1  1037 ? 218.870 209.327 207.861 1.00 321.13 ?  1037 VAL A CB  1 
ATOM   4696  C  CG1 . VAL A 1  1037 ? 217.673 209.625 206.982 1.00 304.06 ?  1037 VAL A CG1 1 
ATOM   4697  C  CG2 . VAL A 1  1037 ? 218.843 210.282 209.046 1.00 275.47 ?  1037 VAL A CG2 1 
ATOM   4698  N  N   . ARG A 1  1038 ? 219.676 206.615 206.364 1.00 275.82 ?  1038 ARG A N   1 
ATOM   4699  C  CA  . ARG A 1  1038 ? 219.684 205.561 205.323 1.00 215.93 ?  1038 ARG A CA  1 
ATOM   4700  C  C   . ARG A 1  1038 ? 219.331 204.149 205.819 1.00 230.93 ?  1038 ARG A C   1 
ATOM   4701  O  O   . ARG A 1  1038 ? 218.701 203.384 205.089 1.00 171.04 ?  1038 ARG A O   1 
ATOM   4702  C  CB  . ARG A 1  1038 ? 221.023 205.521 204.592 1.00 187.43 ?  1038 ARG A CB  1 
ATOM   4703  C  CG  . ARG A 1  1038 ? 221.316 206.759 203.766 1.00 197.43 ?  1038 ARG A CG  1 
ATOM   4704  C  CD  . ARG A 1  1038 ? 222.613 206.612 202.983 1.00 229.79 ?  1038 ARG A CD  1 
ATOM   4705  N  NE  . ARG A 1  1038 ? 222.432 205.916 201.707 1.00 252.27 ?  1038 ARG A NE  1 
ATOM   4706  C  CZ  . ARG A 1  1038 ? 222.691 204.630 201.489 1.00 250.42 ?  1038 ARG A CZ  1 
ATOM   4707  N  NH1 . ARG A 1  1038 ? 223.153 203.858 202.465 1.00 258.07 ?  1038 ARG A NH1 1 
ATOM   4708  N  NH2 . ARG A 1  1038 ? 222.485 204.114 200.283 1.00 243.49 ?  1038 ARG A NH2 1 
ATOM   4709  N  N   . ARG A 1  1039 ? 219.752 203.823 207.049 1.00 322.68 ?  1039 ARG A N   1 
ATOM   4710  C  CA  . ARG A 1  1039 ? 219.377 202.581 207.767 1.00 402.16 ?  1039 ARG A CA  1 
ATOM   4711  C  C   . ARG A 1  1039 ? 217.918 202.598 208.247 1.00 449.77 ?  1039 ARG A C   1 
ATOM   4712  O  O   . ARG A 1  1039 ? 217.222 201.581 208.163 1.00 486.11 ?  1039 ARG A O   1 
ATOM   4713  C  CB  . ARG A 1  1039 ? 220.320 202.322 208.963 1.00 408.75 ?  1039 ARG A CB  1 
ATOM   4714  C  CG  . ARG A 1  1039 ? 220.123 200.985 209.683 1.00 405.04 ?  1039 ARG A CG  1 
ATOM   4715  C  CD  . ARG A 1  1039 ? 220.826 200.914 211.038 1.00 399.77 ?  1039 ARG A CD  1 
ATOM   4716  N  NE  . ARG A 1  1039 ? 222.288 200.867 210.918 1.00 399.09 ?  1039 ARG A NE  1 
ATOM   4717  C  CZ  . ARG A 1  1039 ? 223.133 200.411 211.846 1.00 373.99 ?  1039 ARG A CZ  1 
ATOM   4718  N  NH1 . ARG A 1  1039 ? 222.694 199.924 213.004 1.00 343.76 ?  1039 ARG A NH1 1 
ATOM   4719  N  NH2 . ARG A 1  1039 ? 224.438 200.432 211.606 1.00 368.09 ?  1039 ARG A NH2 1 
ATOM   4720  N  N   . LEU A 1  1040 ? 217.474 203.743 208.770 1.00 457.81 ?  1040 LEU A N   1 
ATOM   4721  C  CA  . LEU A 1  1040 ? 216.101 203.911 209.256 1.00 437.66 ?  1040 LEU A CA  1 
ATOM   4722  C  C   . LEU A 1  1040 ? 215.067 203.787 208.131 1.00 464.36 ?  1040 LEU A C   1 
ATOM   4723  O  O   . LEU A 1  1040 ? 214.043 203.128 208.313 1.00 464.77 ?  1040 LEU A O   1 
ATOM   4724  C  CB  . LEU A 1  1040 ? 215.943 205.241 210.017 1.00 387.89 ?  1040 LEU A CB  1 
ATOM   4725  C  CG  . LEU A 1  1040 ? 216.077 205.241 211.552 1.00 351.80 ?  1040 LEU A CG  1 
ATOM   4726  C  CD1 . LEU A 1  1040 ? 217.497 205.021 212.068 1.00 329.27 ?  1040 LEU A CD1 1 
ATOM   4727  C  CD2 . LEU A 1  1040 ? 215.497 206.517 212.137 1.00 346.06 ?  1040 LEU A CD2 1 
ATOM   4728  N  N   . LEU A 1  1041 ? 215.376 204.371 206.969 1.00 479.84 ?  1041 LEU A N   1 
ATOM   4729  C  CA  . LEU A 1  1041 ? 214.445 204.451 205.830 1.00 468.75 ?  1041 LEU A CA  1 
ATOM   4730  C  C   . LEU A 1  1041 ? 214.624 203.378 204.737 1.00 481.45 ?  1041 LEU A C   1 
ATOM   4731  O  O   . LEU A 1  1041 ? 213.841 203.353 203.776 1.00 490.84 ?  1041 LEU A O   1 
ATOM   4732  C  CB  . LEU A 1  1041 ? 214.492 205.854 205.190 1.00 442.88 ?  1041 LEU A CB  1 
ATOM   4733  C  CG  . LEU A 1  1041 ? 214.133 207.114 205.990 1.00 416.34 ?  1041 LEU A CG  1 
ATOM   4734  C  CD1 . LEU A 1  1041 ? 214.637 208.371 205.286 1.00 413.53 ?  1041 LEU A CD1 1 
ATOM   4735  C  CD2 . LEU A 1  1041 ? 212.641 207.215 206.278 1.00 388.08 ?  1041 LEU A CD2 1 
ATOM   4736  N  N   . GLN A 1  1042 ? 215.639 202.515 204.868 1.00 480.90 ?  1042 GLN A N   1 
ATOM   4737  C  CA  . GLN A 1  1042 ? 215.934 201.497 203.835 1.00 481.76 ?  1042 GLN A CA  1 
ATOM   4738  C  C   . GLN A 1  1042 ? 214.810 200.485 203.637 1.00 500.00 ?  1042 GLN A C   1 
ATOM   4739  O  O   . GLN A 1  1042 ? 214.389 199.814 204.582 1.00 500.00 ?  1042 GLN A O   1 
ATOM   4740  C  CB  . GLN A 1  1042 ? 217.316 200.826 204.007 1.00 453.03 ?  1042 GLN A CB  1 
ATOM   4741  C  CG  . GLN A 1  1042 ? 217.636 200.229 205.373 1.00 442.28 ?  1042 GLN A CG  1 
ATOM   4742  C  CD  . GLN A 1  1042 ? 217.274 198.762 205.512 1.00 439.00 ?  1042 GLN A CD  1 
ATOM   4743  O  OE1 . GLN A 1  1042 ? 217.172 198.032 204.529 1.00 446.62 ?  1042 GLN A OE1 1 
ATOM   4744  N  NE2 . GLN A 1  1042 ? 217.093 198.318 206.751 1.00 429.98 ?  1042 GLN A NE2 1 
ATOM   4745  N  N   . SER A 1  1043 ? 214.315 200.419 202.400 1.00 500.00 ?  1043 SER A N   1 
ATOM   4746  C  CA  . SER A 1  1043 ? 213.193 199.552 202.028 1.00 500.00 ?  1043 SER A CA  1 
ATOM   4747  C  C   . SER A 1  1043 ? 213.649 198.295 201.281 1.00 500.00 ?  1043 SER A C   1 
ATOM   4748  O  O   . SER A 1  1043 ? 212.945 197.278 201.278 1.00 500.00 ?  1043 SER A O   1 
ATOM   4749  C  CB  . SER A 1  1043 ? 212.166 200.329 201.203 1.00 495.25 ?  1043 SER A CB  1 
ATOM   4750  O  OG  . SER A 1  1043 ? 210.875 199.768 201.355 1.00 478.90 ?  1043 SER A OG  1 
ATOM   4751  N  N   . ALA A 1  1044 ? 214.825 198.377 200.653 1.00 500.00 ?  1044 ALA A N   1 
ATOM   4752  C  CA  . ALA A 1  1044 ? 215.519 197.208 200.102 1.00 500.00 ?  1044 ALA A CA  1 
ATOM   4753  C  C   . ALA A 1  1044 ? 216.170 196.398 201.234 1.00 500.00 ?  1044 ALA A C   1 
ATOM   4754  O  O   . ALA A 1  1044 ? 216.038 196.763 202.404 1.00 500.00 ?  1044 ALA A O   1 
ATOM   4755  C  CB  . ALA A 1  1044 ? 216.550 197.639 199.071 1.00 500.00 ?  1044 ALA A CB  1 
ATOM   4756  N  N   . HIS A 1  1045 ? 216.860 195.305 200.879 1.00 500.00 ?  1045 HIS A N   1 
ATOM   4757  C  CA  . HIS A 1  1045 ? 217.413 194.315 201.835 1.00 500.00 ?  1045 HIS A CA  1 
ATOM   4758  C  C   . HIS A 1  1045 ? 216.296 193.548 202.581 1.00 500.00 ?  1045 HIS A C   1 
ATOM   4759  O  O   . HIS A 1  1045 ? 215.139 193.990 202.584 1.00 500.00 ?  1045 HIS A O   1 
ATOM   4760  C  CB  . HIS A 1  1045 ? 218.402 194.947 202.844 1.00 500.00 ?  1045 HIS A CB  1 
ATOM   4761  C  CG  . HIS A 1  1045 ? 219.458 195.808 202.221 1.00 500.00 ?  1045 HIS A CG  1 
ATOM   4762  N  ND1 . HIS A 1  1045 ? 219.564 197.158 202.482 1.00 500.00 ?  1045 HIS A ND1 1 
ATOM   4763  C  CD2 . HIS A 1  1045 ? 220.464 195.511 201.364 1.00 497.07 ?  1045 HIS A CD2 1 
ATOM   4764  C  CE1 . HIS A 1  1045 ? 220.585 197.656 201.807 1.00 491.58 ?  1045 HIS A CE1 1 
ATOM   4765  N  NE2 . HIS A 1  1045 ? 221.148 196.678 201.121 1.00 484.49 ?  1045 HIS A NE2 1 
ATOM   4766  N  N   . PRO A 1  1046 ? 216.625 192.383 203.192 1.00 500.00 ?  1046 PRO A N   1 
ATOM   4767  C  CA  . PRO A 1  1046 ? 215.627 191.805 204.097 1.00 500.00 ?  1046 PRO A CA  1 
ATOM   4768  C  C   . PRO A 1  1046 ? 215.715 192.375 205.512 1.00 500.00 ?  1046 PRO A C   1 
ATOM   4769  O  O   . PRO A 1  1046 ? 216.798 192.771 205.957 1.00 500.00 ?  1046 PRO A O   1 
ATOM   4770  C  CB  . PRO A 1  1046 ? 215.969 190.305 204.110 1.00 500.00 ?  1046 PRO A CB  1 
ATOM   4771  C  CG  . PRO A 1  1046 ? 217.072 190.110 203.118 1.00 500.00 ?  1046 PRO A CG  1 
ATOM   4772  C  CD  . PRO A 1  1046 ? 217.732 191.442 202.944 1.00 500.00 ?  1046 PRO A CD  1 
ATOM   4773  N  N   . VAL A 1  1047 ? 214.567 192.427 206.188 1.00 500.00 ?  1047 VAL A N   1 
ATOM   4774  C  CA  . VAL A 1  1047 ? 214.473 192.722 207.622 1.00 500.00 ?  1047 VAL A CA  1 
ATOM   4775  C  C   . VAL A 1  1047 ? 214.938 191.453 208.344 1.00 500.00 ?  1047 VAL A C   1 
ATOM   4776  O  O   . VAL A 1  1047 ? 214.647 190.344 207.891 1.00 500.00 ?  1047 VAL A O   1 
ATOM   4777  C  CB  . VAL A 1  1047 ? 213.014 193.034 208.055 1.00 500.00 ?  1047 VAL A CB  1 
ATOM   4778  C  CG1 . VAL A 1  1047 ? 212.982 193.902 209.309 1.00 500.00 ?  1047 VAL A CG1 1 
ATOM   4779  C  CG2 . VAL A 1  1047 ? 212.226 193.703 206.933 1.00 500.00 ?  1047 VAL A CG2 1 
ATOM   4780  N  N   . ARG A 1  1048 ? 215.678 191.604 209.440 1.00 500.00 ?  1048 ARG A N   1 
ATOM   4781  C  CA  . ARG A 1  1048 ? 216.055 190.429 210.227 1.00 500.00 ?  1048 ARG A CA  1 
ATOM   4782  C  C   . ARG A 1  1048 ? 215.084 190.184 211.390 1.00 500.00 ?  1048 ARG A C   1 
ATOM   4783  O  O   . ARG A 1  1048 ? 214.883 191.051 212.248 1.00 500.00 ?  1048 ARG A O   1 
ATOM   4784  C  CB  . ARG A 1  1048 ? 217.543 190.426 210.634 1.00 500.00 ?  1048 ARG A CB  1 
ATOM   4785  C  CG  . ARG A 1  1048 ? 217.974 191.378 211.739 1.00 500.00 ?  1048 ARG A CG  1 
ATOM   4786  C  CD  . ARG A 1  1048 ? 219.152 190.776 212.488 1.00 500.00 ?  1048 ARG A CD  1 
ATOM   4787  N  NE  . ARG A 1  1048 ? 219.326 191.354 213.821 1.00 500.00 ?  1048 ARG A NE  1 
ATOM   4788  C  CZ  . ARG A 1  1048 ? 219.931 190.749 214.843 1.00 500.00 ?  1048 ARG A CZ  1 
ATOM   4789  N  NH1 . ARG A 1  1048 ? 220.428 189.522 214.717 1.00 500.00 ?  1048 ARG A NH1 1 
ATOM   4790  N  NH2 . ARG A 1  1048 ? 220.030 191.376 216.007 1.00 500.00 ?  1048 ARG A NH2 1 
ATOM   4791  N  N   . VAL A 1  1049 ? 214.463 189.006 211.372 1.00 500.00 ?  1049 VAL A N   1 
ATOM   4792  C  CA  . VAL A 1  1049 ? 213.432 188.628 212.344 1.00 500.00 ?  1049 VAL A CA  1 
ATOM   4793  C  C   . VAL A 1  1049 ? 213.973 187.659 213.412 1.00 500.00 ?  1049 VAL A C   1 
ATOM   4794  O  O   . VAL A 1  1049 ? 214.285 186.499 213.122 1.00 500.00 ?  1049 VAL A O   1 
ATOM   4795  C  CB  . VAL A 1  1049 ? 212.117 188.139 211.651 1.00 500.00 ?  1049 VAL A CB  1 
ATOM   4796  C  CG1 . VAL A 1  1049 ? 212.374 187.077 210.576 1.00 500.00 ?  1049 VAL A CG1 1 
ATOM   4797  C  CG2 . VAL A 1  1049 ? 211.095 187.662 212.674 1.00 500.00 ?  1049 VAL A CG2 1 
ATOM   4798  N  N   . ASN A 1  1050 ? 214.084 188.160 214.643 1.00 500.00 ?  1050 ASN A N   1 
ATOM   4799  C  CA  . ASN A 1  1050 ? 214.619 187.382 215.767 1.00 500.00 ?  1050 ASN A CA  1 
ATOM   4800  C  C   . ASN A 1  1050 ? 213.581 187.013 216.838 1.00 500.00 ?  1050 ASN A C   1 
ATOM   4801  O  O   . ASN A 1  1050 ? 213.068 187.879 217.557 1.00 500.00 ?  1050 ASN A O   1 
ATOM   4802  C  CB  . ASN A 1  1050 ? 215.878 188.048 216.378 1.00 500.00 ?  1050 ASN A CB  1 
ATOM   4803  C  CG  . ASN A 1  1050 ? 215.679 189.522 216.740 1.00 500.00 ?  1050 ASN A CG  1 
ATOM   4804  O  OD1 . ASN A 1  1050 ? 214.691 190.157 216.364 1.00 500.00 ?  1050 ASN A OD1 1 
ATOM   4805  N  ND2 . ASN A 1  1050 ? 216.640 190.074 217.476 1.00 500.00 ?  1050 ASN A ND2 1 
ATOM   4806  N  N   . VAL A 1  1051 ? 213.264 185.719 216.908 1.00 500.00 ?  1051 VAL A N   1 
ATOM   4807  C  CA  . VAL A 1  1051 ? 212.373 185.163 217.940 1.00 500.00 ?  1051 VAL A CA  1 
ATOM   4808  C  C   . VAL A 1  1051 ? 212.967 183.900 218.581 1.00 500.00 ?  1051 VAL A C   1 
ATOM   4809  O  O   . VAL A 1  1051 ? 213.265 182.919 217.889 1.00 500.00 ?  1051 VAL A O   1 
ATOM   4810  C  CB  . VAL A 1  1051 ? 210.914 184.912 217.441 1.00 500.00 ?  1051 VAL A CB  1 
ATOM   4811  C  CG1 . VAL A 1  1051 ? 210.131 186.218 217.351 1.00 500.00 ?  1051 VAL A CG1 1 
ATOM   4812  C  CG2 . VAL A 1  1051 ? 210.871 184.156 216.113 1.00 500.00 ?  1051 VAL A CG2 1 
ATOM   4813  N  N   . VAL A 1  1052 ? 213.159 183.951 219.899 1.00 500.00 ?  1052 VAL A N   1 
ATOM   4814  C  CA  . VAL A 1  1052 ? 213.637 182.798 220.675 1.00 500.00 ?  1052 VAL A CA  1 
ATOM   4815  C  C   . VAL A 1  1052 ? 212.460 181.850 220.961 1.00 500.00 ?  1052 VAL A C   1 
ATOM   4816  O  O   . VAL A 1  1052 ? 211.357 182.301 221.295 1.00 500.00 ?  1052 VAL A O   1 
ATOM   4817  C  CB  . VAL A 1  1052 ? 214.430 183.234 221.950 1.00 500.00 ?  1052 VAL A CB  1 
ATOM   4818  C  CG1 . VAL A 1  1052 ? 213.543 183.913 222.993 1.00 500.00 ?  1052 VAL A CG1 1 
ATOM   4819  C  CG2 . VAL A 1  1052 ? 215.206 182.071 222.557 1.00 500.00 ?  1052 VAL A CG2 1 
ATOM   4820  N  N   . GLN A 1  1053 ? 212.694 180.547 220.796 1.00 500.00 ?  1053 GLN A N   1 
ATOM   4821  C  CA  . GLN A 1  1053 ? 211.633 179.543 220.937 1.00 500.00 ?  1053 GLN A CA  1 
ATOM   4822  C  C   . GLN A 1  1053 ? 211.835 178.598 222.128 1.00 500.00 ?  1053 GLN A C   1 
ATOM   4823  O  O   . GLN A 1  1053 ? 212.908 178.010 222.303 1.00 500.00 ?  1053 GLN A O   1 
ATOM   4824  C  CB  . GLN A 1  1053 ? 211.392 178.780 219.612 1.00 500.00 ?  1053 GLN A CB  1 
ATOM   4825  C  CG  . GLN A 1  1053 ? 212.493 177.820 219.150 1.00 500.00 ?  1053 GLN A CG  1 
ATOM   4826  C  CD  . GLN A 1  1053 ? 213.640 178.481 218.394 1.00 500.00 ?  1053 GLN A CD  1 
ATOM   4827  O  OE1 . GLN A 1  1053 ? 213.908 179.676 218.535 1.00 500.00 ?  1053 GLN A OE1 1 
ATOM   4828  N  NE2 . GLN A 1  1053 ? 214.331 177.688 217.583 1.00 500.00 ?  1053 GLN A NE2 1 
ATOM   4829  N  N   . TYR A 1  1054 ? 210.793 178.494 222.952 1.00 500.00 ?  1054 TYR A N   1 
ATOM   4830  C  CA  . TYR A 1  1054 ? 210.753 177.566 224.080 1.00 500.00 ?  1054 TYR A CA  1 
ATOM   4831  C  C   . TYR A 1  1054 ? 210.290 176.185 223.597 1.00 500.00 ?  1054 TYR A C   1 
ATOM   4832  O  O   . TYR A 1  1054 ? 209.420 176.115 222.718 1.00 500.00 ?  1054 TYR A O   1 
ATOM   4833  C  CB  . TYR A 1  1054 ? 209.815 178.094 225.170 1.00 500.00 ?  1054 TYR A CB  1 
ATOM   4834  N  N   . PRO A 1  1055 ? 210.871 175.088 224.151 1.00 500.00 ?  1055 PRO A N   1 
ATOM   4835  C  CA  . PRO A 1  1055 ? 210.472 173.705 223.811 1.00 500.00 ?  1055 PRO A CA  1 
ATOM   4836  C  C   . PRO A 1  1055 ? 208.968 173.425 224.008 1.00 500.00 ?  1055 PRO A C   1 
ATOM   4837  O  O   . PRO A 1  1055 ? 208.555 172.819 225.008 1.00 500.00 ?  1055 PRO A O   1 
ATOM   4838  C  CB  . PRO A 1  1055 ? 211.338 172.851 224.746 1.00 500.00 ?  1055 PRO A CB  1 
ATOM   4839  C  CG  . PRO A 1  1055 ? 212.550 173.682 224.980 1.00 500.00 ?  1055 PRO A CG  1 
ATOM   4840  C  CD  . PRO A 1  1055 ? 212.050 175.097 225.044 1.00 500.00 ?  1055 PRO A CD  1 
ATOM   4841  N  N   . GLU A 1  1056 ? 208.179 173.876 223.030 1.00 500.00 ?  1056 GLU A N   1 
ATOM   4842  C  CA  . GLU A 1  1056 ? 206.712 173.839 223.047 1.00 500.00 ?  1056 GLU A CA  1 
ATOM   4843  C  C   . GLU A 1  1056 ? 206.129 174.015 221.637 1.00 500.00 ?  1056 GLU A C   1 
ATOM   4844  O  O   . GLU A 1  1056 ? 204.905 173.960 221.451 1.00 500.00 ?  1056 GLU A O   1 
ATOM   4845  C  CB  . GLU A 1  1056 ? 206.159 174.929 223.976 1.00 500.00 ?  1056 GLU A CB  1 
ATOM   4846  N  N   . LEU A 1  1057 ? 207.006 174.219 220.652 1.00 500.00 ?  1057 LEU A N   1 
ATOM   4847  C  CA  . LEU A 1  1057 ? 206.587 174.479 219.271 1.00 500.00 ?  1057 LEU A CA  1 
ATOM   4848  C  C   . LEU A 1  1057 ? 207.288 173.581 218.247 1.00 500.00 ?  1057 LEU A C   1 
ATOM   4849  O  O   . LEU A 1  1057 ? 208.514 173.422 218.277 1.00 500.00 ?  1057 LEU A O   1 
ATOM   4850  C  CB  . LEU A 1  1057 ? 206.788 175.962 218.897 1.00 500.00 ?  1057 LEU A CB  1 
ATOM   4851  C  CG  . LEU A 1  1057 ? 206.186 177.180 219.638 1.00 500.00 ?  1057 LEU A CG  1 
ATOM   4852  C  CD1 . LEU A 1  1057 ? 204.693 177.066 219.939 1.00 500.00 ?  1057 LEU A CD1 1 
ATOM   4853  C  CD2 . LEU A 1  1057 ? 206.954 177.556 220.902 1.00 500.00 ?  1057 LEU A CD2 1 
ATOM   4854  N  N   . SER A 1  1058 ? 206.491 173.004 217.346 1.00 500.00 ?  1058 SER A N   1 
ATOM   4855  C  CA  . SER A 1  1058 ? 206.982 172.256 216.180 1.00 500.00 ?  1058 SER A CA  1 
ATOM   4856  C  C   . SER A 1  1058 ? 207.679 173.184 215.182 1.00 500.00 ?  1058 SER A C   1 
ATOM   4857  O  O   . SER A 1  1058 ? 207.481 174.399 215.226 1.00 500.00 ?  1058 SER A O   1 
ATOM   4858  C  CB  . SER A 1  1058 ? 205.815 171.557 215.475 1.00 500.00 ?  1058 SER A CB  1 
ATOM   4859  O  OG  . SER A 1  1058 ? 205.126 170.673 216.342 1.00 500.00 ?  1058 SER A OG  1 
ATOM   4860  N  N   . ASP A 1  1059 ? 208.480 172.606 214.282 1.00 500.00 ?  1059 ASP A N   1 
ATOM   4861  C  CA  . ASP A 1  1059 ? 209.106 173.346 213.172 1.00 500.00 ?  1059 ASP A CA  1 
ATOM   4862  C  C   . ASP A 1  1059 ? 208.075 174.136 212.347 1.00 500.00 ?  1059 ASP A C   1 
ATOM   4863  O  O   . ASP A 1  1059 ? 208.295 175.314 212.030 1.00 500.00 ?  1059 ASP A O   1 
ATOM   4864  C  CB  . ASP A 1  1059 ? 209.873 172.384 212.262 1.00 20.00  ?  1059 ASP A CB  1 
ATOM   4865  C  CG  . ASP A 1  1059 ? 211.125 171.836 212.918 1.00 20.00  ?  1059 ASP A CG  1 
ATOM   4866  O  OD1 . ASP A 1  1059 ? 211.556 172.401 213.945 1.00 20.00  ?  1059 ASP A OD1 1 
ATOM   4867  O  OD2 . ASP A 1  1059 ? 211.745 170.845 212.478 1.00 20.00  ?  1059 ASP A OD2 1 
ATOM   4868  N  N   . HIS A 1  1060 ? 206.949 173.486 212.039 1.00 500.00 ?  1060 HIS A N   1 
ATOM   4869  C  CA  . HIS A 1  1060 ? 205.810 174.124 211.363 1.00 500.00 ?  1060 HIS A CA  1 
ATOM   4870  C  C   . HIS A 1  1060 ? 205.082 175.141 212.251 1.00 500.00 ?  1060 HIS A C   1 
ATOM   4871  O  O   . HIS A 1  1060 ? 204.518 176.116 211.752 1.00 500.00 ?  1060 HIS A O   1 
ATOM   4872  C  CB  . HIS A 1  1060 ? 204.827 173.076 210.803 1.00 500.00 ?  1060 HIS A CB  1 
ATOM   4873  C  CG  . HIS A 1  1060 ? 204.158 172.228 211.847 1.00 500.00 ?  1060 HIS A CG  1 
ATOM   4874  N  ND1 . HIS A 1  1060 ? 204.492 170.907 212.057 1.00 500.00 ?  1060 HIS A ND1 1 
ATOM   4875  C  CD2 . HIS A 1  1060 ? 203.157 172.504 212.717 1.00 500.00 ?  1060 HIS A CD2 1 
ATOM   4876  C  CE1 . HIS A 1  1060 ? 203.734 170.409 213.018 1.00 500.00 ?  1060 HIS A CE1 1 
ATOM   4877  N  NE2 . HIS A 1  1060 ? 202.920 171.360 213.440 1.00 500.00 ?  1060 HIS A NE2 1 
ATOM   4878  N  N   . GLU A 1  1061 ? 205.085 174.891 213.561 1.00 500.00 ?  1061 GLU A N   1 
ATOM   4879  C  CA  . GLU A 1  1061 ? 204.472 175.789 214.538 1.00 500.00 ?  1061 GLU A CA  1 
ATOM   4880  C  C   . GLU A 1  1061 ? 205.350 177.034 214.734 1.00 500.00 ?  1061 GLU A C   1 
ATOM   4881  O  O   . GLU A 1  1061 ? 204.831 178.148 214.852 1.00 500.00 ?  1061 GLU A O   1 
ATOM   4882  C  CB  . GLU A 1  1061 ? 204.250 175.048 215.861 1.00 500.00 ?  1061 GLU A CB  1 
ATOM   4883  C  CG  . GLU A 1  1061 ? 203.137 175.596 216.746 1.00 500.00 ?  1061 GLU A CG  1 
ATOM   4884  C  CD  . GLU A 1  1061 ? 202.859 174.732 217.973 1.00 500.00 ?  1061 GLU A CD  1 
ATOM   4885  O  OE1 . GLU A 1  1061 ? 203.559 173.716 218.191 1.00 500.00 ?  1061 GLU A OE1 1 
ATOM   4886  O  OE2 . GLU A 1  1061 ? 201.929 175.076 218.732 1.00 500.00 -1 1061 GLU A OE2 1 
ATOM   4887  N  N   . PHE A 1  1062 ? 206.671 176.825 214.739 1.00 500.00 ?  1062 PHE A N   1 
ATOM   4888  C  CA  . PHE A 1  1062 ? 207.676 177.888 214.880 1.00 500.00 ?  1062 PHE A CA  1 
ATOM   4889  C  C   . PHE A 1  1062 ? 207.715 178.855 213.691 1.00 500.00 ?  1062 PHE A C   1 
ATOM   4890  O  O   . PHE A 1  1062 ? 207.840 180.067 213.900 1.00 500.00 ?  1062 PHE A O   1 
ATOM   4891  C  CB  . PHE A 1  1062 ? 209.075 177.294 215.159 1.00 500.00 ?  1062 PHE A CB  1 
ATOM   4892  C  CG  . PHE A 1  1062 ? 210.206 178.290 215.049 1.00 500.00 ?  1062 PHE A CG  1 
ATOM   4893  C  CD1 . PHE A 1  1062 ? 210.363 179.310 215.996 1.00 500.00 ?  1062 PHE A CD1 1 
ATOM   4894  C  CD2 . PHE A 1  1062 ? 211.125 178.205 213.998 1.00 500.00 ?  1062 PHE A CD2 1 
ATOM   4895  C  CE1 . PHE A 1  1062 ? 211.403 180.230 215.886 1.00 500.00 ?  1062 PHE A CE1 1 
ATOM   4896  C  CE2 . PHE A 1  1062 ? 212.168 179.121 213.886 1.00 500.00 ?  1062 PHE A CE2 1 
ATOM   4897  C  CZ  . PHE A 1  1062 ? 212.308 180.132 214.833 1.00 500.00 ?  1062 PHE A CZ  1 
ATOM   4898  N  N   . ILE A 1  1063 ? 207.609 178.326 212.466 1.00 500.00 ?  1063 ILE A N   1 
ATOM   4899  C  CA  . ILE A 1  1063 ? 207.616 179.159 211.240 1.00 500.00 ?  1063 ILE A CA  1 
ATOM   4900  C  C   . ILE A 1  1063 ? 206.496 180.228 211.252 1.00 500.00 ?  1063 ILE A C   1 
ATOM   4901  O  O   . ILE A 1  1063 ? 206.723 181.380 210.856 1.00 500.00 ?  1063 ILE A O   1 
ATOM   4902  C  CB  . ILE A 1  1063 ? 207.677 178.318 209.919 1.00 500.00 ?  1063 ILE A CB  1 
ATOM   4903  C  CG1 . ILE A 1  1063 ? 208.104 179.196 208.727 1.00 500.00 ?  1063 ILE A CG1 1 
ATOM   4904  C  CG2 . ILE A 1  1063 ? 206.372 177.571 209.639 1.00 500.00 ?  1063 ILE A CG2 1 
ATOM   4905  C  CD1 . ILE A 1  1063 ? 208.626 178.438 207.520 1.00 500.00 ?  1063 ILE A CD1 1 
ATOM   4906  N  N   . GLU A 1  1064 ? 205.322 179.832 211.753 1.00 500.00 ?  1064 GLU A N   1 
ATOM   4907  C  CA  . GLU A 1  1064 ? 204.174 180.719 211.978 1.00 500.00 ?  1064 GLU A CA  1 
ATOM   4908  C  C   . GLU A 1  1064 ? 204.517 181.894 212.908 1.00 500.00 ?  1064 GLU A C   1 
ATOM   4909  O  O   . GLU A 1  1064 ? 204.139 183.037 212.626 1.00 500.00 ?  1064 GLU A O   1 
ATOM   4910  C  CB  . GLU A 1  1064 ? 202.982 179.904 212.515 1.00 500.00 ?  1064 GLU A CB  1 
ATOM   4911  C  CG  . GLU A 1  1064 ? 201.756 180.707 212.939 1.00 490.52 ?  1064 GLU A CG  1 
ATOM   4912  C  CD  . GLU A 1  1064 ? 200.447 179.970 212.714 1.00 469.80 ?  1064 GLU A CD  1 
ATOM   4913  O  OE1 . GLU A 1  1064 ? 200.221 179.464 211.593 1.00 448.60 -1 1064 GLU A OE1 1 
ATOM   4914  O  OE2 . GLU A 1  1064 ? 199.636 179.901 213.661 1.00 464.33 ?  1064 GLU A OE2 1 
ATOM   4915  N  N   . GLU A 1  1065 ? 205.243 181.598 213.990 1.00 500.00 ?  1065 GLU A N   1 
ATOM   4916  C  CA  . GLU A 1  1065 ? 205.650 182.592 214.998 1.00 500.00 ?  1065 GLU A CA  1 
ATOM   4917  C  C   . GLU A 1  1065 ? 206.580 183.679 214.451 1.00 500.00 ?  1065 GLU A C   1 
ATOM   4918  O  O   . GLU A 1  1065 ? 206.380 184.863 214.747 1.00 500.00 ?  1065 GLU A O   1 
ATOM   4919  C  CB  . GLU A 1  1065 ? 206.291 181.915 216.218 1.00 500.00 ?  1065 GLU A CB  1 
ATOM   4920  C  CG  . GLU A 1  1065 ? 205.309 181.228 217.160 1.00 500.00 ?  1065 GLU A CG  1 
ATOM   4921  C  CD  . GLU A 1  1065 ? 205.978 180.599 218.373 1.00 500.00 ?  1065 GLU A CD  1 
ATOM   4922  O  OE1 . GLU A 1  1065 ? 207.154 180.180 218.279 1.00 500.00 -1 1065 GLU A OE1 1 
ATOM   4923  O  OE2 . GLU A 1  1065 ? 205.321 180.520 219.432 1.00 500.00 ?  1065 GLU A OE2 1 
ATOM   4924  N  N   . LYS A 1  1066 ? 207.584 183.282 213.662 1.00 500.00 ?  1066 LYS A N   1 
ATOM   4925  C  CA  . LYS A 1  1066 ? 208.509 184.253 213.056 1.00 500.00 ?  1066 LYS A CA  1 
ATOM   4926  C  C   . LYS A 1  1066 ? 207.853 185.115 211.969 1.00 500.00 ?  1066 LYS A C   1 
ATOM   4927  O  O   . LYS A 1  1066 ? 208.123 186.316 211.890 1.00 500.00 ?  1066 LYS A O   1 
ATOM   4928  C  CB  . LYS A 1  1066 ? 209.839 183.622 212.589 1.00 500.00 ?  1066 LYS A CB  1 
ATOM   4929  C  CG  . LYS A 1  1066 ? 209.761 182.466 211.602 1.00 500.00 ?  1066 LYS A CG  1 
ATOM   4930  C  CD  . LYS A 1  1066 ? 211.161 182.024 211.204 1.00 500.00 ?  1066 LYS A CD  1 
ATOM   4931  C  CE  . LYS A 1  1066 ? 211.160 180.639 210.580 1.00 500.00 ?  1066 LYS A CE  1 
ATOM   4932  N  NZ  . LYS A 1  1066 ? 212.512 180.253 210.093 1.00 500.00 ?  1066 LYS A NZ  1 
ATOM   4933  N  N   . GLU A 1  1067 ? 206.976 184.507 211.167 1.00 500.00 ?  1067 GLU A N   1 
ATOM   4934  C  CA  . GLU A 1  1067 ? 206.219 185.230 210.137 1.00 500.00 ?  1067 GLU A CA  1 
ATOM   4935  C  C   . GLU A 1  1067 ? 205.265 186.289 210.719 1.00 500.00 ?  1067 GLU A C   1 
ATOM   4936  O  O   . GLU A 1  1067 ? 205.135 187.379 210.148 1.00 500.00 ?  1067 GLU A O   1 
ATOM   4937  C  CB  . GLU A 1  1067 ? 205.480 184.265 209.205 1.00 497.91 ?  1067 GLU A CB  1 
ATOM   4938  C  CG  . GLU A 1  1067 ? 206.344 183.681 208.090 1.00 454.86 ?  1067 GLU A CG  1 
ATOM   4939  C  CD  . GLU A 1  1067 ? 205.568 183.329 206.823 1.00 427.14 ?  1067 GLU A CD  1 
ATOM   4940  O  OE1 . GLU A 1  1067 ? 204.445 183.842 206.617 1.00 412.86 ?  1067 GLU A OE1 1 
ATOM   4941  O  OE2 . GLU A 1  1067 ? 206.099 182.540 206.008 1.00 410.46 -1 1067 GLU A OE2 1 
ATOM   4942  N  N   . ASN A 1  1068 ? 204.625 185.968 211.850 1.00 500.00 ?  1068 ASN A N   1 
ATOM   4943  C  CA  . ASN A 1  1068 ? 203.807 186.929 212.611 1.00 500.00 ?  1068 ASN A CA  1 
ATOM   4944  C  C   . ASN A 1  1068 ? 204.614 188.140 213.087 1.00 500.00 ?  1068 ASN A C   1 
ATOM   4945  O  O   . ASN A 1  1068 ? 204.161 189.284 212.955 1.00 500.00 ?  1068 ASN A O   1 
ATOM   4946  C  CB  . ASN A 1  1068 ? 203.107 186.251 213.801 1.00 500.00 ?  1068 ASN A CB  1 
ATOM   4947  C  CG  . ASN A 1  1068 ? 201.819 185.540 213.411 1.00 500.00 ?  1068 ASN A CG  1 
ATOM   4948  O  OD1 . ASN A 1  1068 ? 201.118 185.940 212.477 1.00 500.00 ?  1068 ASN A OD1 1 
ATOM   4949  N  ND2 . ASN A 1  1068 ? 201.491 184.483 214.145 1.00 500.00 ?  1068 ASN A ND2 1 
ATOM   4950  N  N   . ARG A 1  1069 ? 205.808 187.874 213.626 1.00 500.00 ?  1069 ARG A N   1 
ATOM   4951  C  CA  . ARG A 1  1069 ? 206.772 188.920 213.981 1.00 500.00 ?  1069 ARG A CA  1 
ATOM   4952  C  C   . ARG A 1  1069 ? 207.218 189.697 212.733 1.00 500.00 ?  1069 ARG A C   1 
ATOM   4953  O  O   . ARG A 1  1069 ? 207.386 190.917 212.799 1.00 500.00 ?  1069 ARG A O   1 
ATOM   4954  C  CB  . ARG A 1  1069 ? 207.969 188.331 214.757 1.00 500.00 ?  1069 ARG A CB  1 
ATOM   4955  C  CG  . ARG A 1  1069 ? 209.011 189.337 215.255 1.00 500.00 ?  1069 ARG A CG  1 
ATOM   4956  C  CD  . ARG A 1  1069 ? 208.572 190.131 216.480 1.00 500.00 ?  1069 ARG A CD  1 
ATOM   4957  N  NE  . ARG A 1  1069 ? 209.337 191.375 216.607 1.00 500.00 ?  1069 ARG A NE  1 
ATOM   4958  C  CZ  . ARG A 1  1069 ? 208.954 192.563 216.138 1.00 500.00 ?  1069 ARG A CZ  1 
ATOM   4959  N  NH1 . ARG A 1  1069 ? 207.794 192.708 215.507 1.00 500.00 ?  1069 ARG A NH1 1 
ATOM   4960  N  NH2 . ARG A 1  1069 ? 209.736 193.621 216.307 1.00 498.19 ?  1069 ARG A NH2 1 
ATOM   4961  N  N   . LEU A 1  1070 ? 207.375 188.996 211.604 1.00 500.00 ?  1070 LEU A N   1 
ATOM   4962  C  CA  . LEU A 1  1070 ? 207.715 189.635 210.324 1.00 500.00 ?  1070 LEU A CA  1 
ATOM   4963  C  C   . LEU A 1  1070 ? 206.611 190.565 209.795 1.00 500.00 ?  1070 LEU A C   1 
ATOM   4964  O  O   . LEU A 1  1070 ? 206.922 191.655 209.306 1.00 500.00 ?  1070 LEU A O   1 
ATOM   4965  C  CB  . LEU A 1  1070 ? 208.138 188.608 209.255 1.00 500.00 ?  1070 LEU A CB  1 
ATOM   4966  C  CG  . LEU A 1  1070 ? 208.455 189.081 207.823 1.00 500.00 ?  1070 LEU A CG  1 
ATOM   4967  C  CD1 . LEU A 1  1070 ? 209.644 190.035 207.767 1.00 500.00 ?  1070 LEU A CD1 1 
ATOM   4968  C  CD2 . LEU A 1  1070 ? 208.675 187.895 206.896 1.00 500.00 ?  1070 LEU A CD2 1 
ATOM   4969  N  N   . LEU A 1  1071 ? 205.347 190.136 209.897 1.00 500.00 ?  1071 LEU A N   1 
ATOM   4970  C  CA  . LEU A 1  1071 ? 204.194 190.952 209.474 1.00 500.00 ?  1071 LEU A CA  1 
ATOM   4971  C  C   . LEU A 1  1071 ? 204.159 192.313 210.186 1.00 500.00 ?  1071 LEU A C   1 
ATOM   4972  O  O   . LEU A 1  1071 ? 203.891 193.333 209.550 1.00 500.00 ?  1071 LEU A O   1 
ATOM   4973  C  CB  . LEU A 1  1071 ? 202.863 190.198 209.654 1.00 500.00 ?  1071 LEU A CB  1 
ATOM   4974  C  CG  . LEU A 1  1071 ? 201.673 190.559 208.743 1.00 500.00 ?  1071 LEU A CG  1 
ATOM   4975  C  CD1 . LEU A 1  1071 ? 200.740 189.371 208.579 1.00 500.00 ?  1071 LEU A CD1 1 
ATOM   4976  C  CD2 . LEU A 1  1071 ? 200.884 191.773 209.224 1.00 500.00 ?  1071 LEU A CD2 1 
ATOM   4977  N  N   . GLN A 1  1072 ? 204.449 192.317 211.490 1.00 500.00 ?  1072 GLN A N   1 
ATOM   4978  C  CA  . GLN A 1  1072 ? 204.576 193.553 212.279 1.00 500.00 ?  1072 GLN A CA  1 
ATOM   4979  C  C   . GLN A 1  1072 ? 205.700 194.465 211.763 1.00 500.00 ?  1072 GLN A C   1 
ATOM   4980  O  O   . GLN A 1  1072 ? 205.511 195.684 211.663 1.00 500.00 ?  1072 GLN A O   1 
ATOM   4981  C  CB  . GLN A 1  1072 ? 204.766 193.231 213.765 1.00 500.00 ?  1072 GLN A CB  1 
ATOM   4982  C  CG  . GLN A 1  1072 ? 203.493 192.782 214.474 1.00 500.00 ?  1072 GLN A CG  1 
ATOM   4983  C  CD  . GLN A 1  1072 ? 203.747 191.949 215.722 1.00 500.00 ?  1072 GLN A CD  1 
ATOM   4984  O  OE1 . GLN A 1  1072 ? 204.825 191.999 216.322 1.00 500.00 ?  1072 GLN A OE1 1 
ATOM   4985  N  NE2 . GLN A 1  1072 ? 202.741 191.182 216.127 1.00 500.00 ?  1072 GLN A NE2 1 
ATOM   4986  N  N   . LEU A 1  1073 ? 206.847 193.865 211.422 1.00 500.00 ?  1073 LEU A N   1 
ATOM   4987  C  CA  . LEU A 1  1073 ? 207.981 194.580 210.804 1.00 500.00 ?  1073 LEU A CA  1 
ATOM   4988  C  C   . LEU A 1  1073 ? 207.626 195.131 209.418 1.00 500.00 ?  1073 LEU A C   1 
ATOM   4989  O  O   . LEU A 1  1073 ? 208.118 196.194 209.031 1.00 500.00 ?  1073 LEU A O   1 
ATOM   4990  C  CB  . LEU A 1  1073 ? 209.234 193.687 210.703 1.00 500.00 ?  1073 LEU A CB  1 
ATOM   4991  C  CG  . LEU A 1  1073 ? 209.863 193.014 211.933 1.00 500.00 ?  1073 LEU A CG  1 
ATOM   4992  C  CD1 . LEU A 1  1073 ? 210.695 191.808 211.517 1.00 500.00 ?  1073 LEU A CD1 1 
ATOM   4993  C  CD2 . LEU A 1  1073 ? 210.692 193.965 212.786 1.00 500.00 ?  1073 LEU A CD2 1 
ATOM   4994  N  N   . CYS A 1  1074 ? 206.780 194.400 208.686 1.00 500.00 ?  1074 CYS A N   1 
ATOM   4995  C  CA  . CYS A 1  1074 ? 206.301 194.816 207.360 1.00 500.00 ?  1074 CYS A CA  1 
ATOM   4996  C  C   . CYS A 1  1074 ? 205.444 196.081 207.396 1.00 500.00 ?  1074 CYS A C   1 
ATOM   4997  O  O   . CYS A 1  1074 ? 205.582 196.931 206.518 1.00 500.00 ?  1074 CYS A O   1 
ATOM   4998  C  CB  . CYS A 1  1074 ? 205.567 193.677 206.648 1.00 500.00 ?  1074 CYS A CB  1 
ATOM   4999  S  SG  . CYS A 1  1074 ? 206.680 192.408 205.999 1.00 500.00 ?  1074 CYS A SG  1 
ATOM   5000  N  N   . GLN A 1  1075 ? 204.588 196.207 208.413 1.00 500.00 ?  1075 GLN A N   1 
ATOM   5001  C  CA  . GLN A 1  1075 ? 203.808 197.432 208.654 1.00 500.00 ?  1075 GLN A CA  1 
ATOM   5002  C  C   . GLN A 1  1075 ? 204.687 198.690 208.676 1.00 500.00 ?  1075 GLN A C   1 
ATOM   5003  O  O   . GLN A 1  1075 ? 204.317 199.722 208.104 1.00 500.00 ?  1075 GLN A O   1 
ATOM   5004  C  CB  . GLN A 1  1075 ? 202.976 197.286 209.937 1.00 500.00 ?  1075 GLN A CB  1 
ATOM   5005  C  CG  . GLN A 1  1075 ? 201.537 196.787 209.754 1.00 500.00 ?  1075 GLN A CG  1 
ATOM   5006  C  CD  . GLN A 1  1075 ? 201.285 195.977 208.484 1.00 500.00 ?  1075 GLN A CD  1 
ATOM   5007  O  OE1 . GLN A 1  1075 ? 201.916 194.944 208.240 1.00 500.00 ?  1075 GLN A OE1 1 
ATOM   5008  N  NE2 . GLN A 1  1075 ? 200.344 196.446 207.673 1.00 500.00 ?  1075 GLN A NE2 1 
ATOM   5009  N  N   . ARG A 1  1076 ? 205.860 198.568 209.302 1.00 500.00 ?  1076 ARG A N   1 
ATOM   5010  C  CA  . ARG A 1  1076 ? 206.909 199.586 209.251 1.00 500.00 ?  1076 ARG A CA  1 
ATOM   5011  C  C   . ARG A 1  1076 ? 207.457 199.813 207.829 1.00 500.00 ?  1076 ARG A C   1 
ATOM   5012  O  O   . ARG A 1  1076 ? 207.580 200.967 207.410 1.00 500.00 ?  1076 ARG A O   1 
ATOM   5013  C  CB  . ARG A 1  1076 ? 208.043 199.239 210.226 1.00 500.00 ?  1076 ARG A CB  1 
ATOM   5014  C  CG  . ARG A 1  1076 ? 208.926 200.409 210.632 1.00 500.00 ?  1076 ARG A CG  1 
ATOM   5015  C  CD  . ARG A 1  1076 ? 209.650 200.110 211.934 1.00 500.00 ?  1076 ARG A CD  1 
ATOM   5016  N  NE  . ARG A 1  1076 ? 211.002 199.589 211.721 1.00 500.00 ?  1076 ARG A NE  1 
ATOM   5017  C  CZ  . ARG A 1  1076 ? 211.344 198.302 211.702 1.00 499.73 ?  1076 ARG A CZ  1 
ATOM   5018  N  NH1 . ARG A 1  1076 ? 210.439 197.348 211.883 1.00 480.58 ?  1076 ARG A NH1 1 
ATOM   5019  N  NH2 . ARG A 1  1076 ? 212.610 197.967 211.497 1.00 481.23 ?  1076 ARG A NH2 1 
ATOM   5020  N  N   . THR A 1  1077 ? 207.754 198.731 207.092 1.00 500.00 ?  1077 THR A N   1 
ATOM   5021  C  CA  . THR A 1  1077 ? 208.414 198.845 205.765 1.00 500.00 ?  1077 THR A CA  1 
ATOM   5022  C  C   . THR A 1  1077 ? 207.612 199.634 204.710 1.00 500.00 ?  1077 THR A C   1 
ATOM   5023  O  O   . THR A 1  1077 ? 208.200 200.427 203.972 1.00 500.00 ?  1077 THR A O   1 
ATOM   5024  C  CB  . THR A 1  1077 ? 208.965 197.510 205.174 1.00 500.00 ?  1077 THR A CB  1 
ATOM   5025  O  OG1 . THR A 1  1077 ? 207.896 196.670 204.722 1.00 500.00 ?  1077 THR A OG1 1 
ATOM   5026  C  CG2 . THR A 1  1077 ? 209.846 196.760 206.180 1.00 500.00 ?  1077 THR A CG2 1 
ATOM   5027  N  N   . MET A 1  1078 ? 206.290 199.416 204.669 1.00 500.00 ?  1078 MET A N   1 
ATOM   5028  C  CA  . MET A 1  1078 ? 205.362 200.127 203.758 1.00 500.00 ?  1078 MET A CA  1 
ATOM   5029  C  C   . MET A 1  1078 ? 205.445 201.638 203.950 1.00 500.00 ?  1078 MET A C   1 
ATOM   5030  O  O   . MET A 1  1078 ? 205.487 202.407 202.982 1.00 500.00 ?  1078 MET A O   1 
ATOM   5031  C  CB  . MET A 1  1078 ? 203.892 199.725 203.989 1.00 500.00 ?  1078 MET A CB  1 
ATOM   5032  C  CG  . MET A 1  1078 ? 203.590 198.334 204.515 1.00 500.00 ?  1078 MET A CG  1 
ATOM   5033  S  SD  . MET A 1  1078 ? 203.983 197.003 203.369 1.00 500.00 ?  1078 MET A SD  1 
ATOM   5034  C  CE  . MET A 1  1078 ? 202.907 195.717 203.992 1.00 500.00 ?  1078 MET A CE  1 
ATOM   5035  N  N   . ALA A 1  1079 ? 205.454 202.030 205.223 1.00 500.00 ?  1079 ALA A N   1 
ATOM   5036  C  CA  . ALA A 1  1079 ? 205.507 203.413 205.667 1.00 500.00 ?  1079 ALA A CA  1 
ATOM   5037  C  C   . ALA A 1  1079 ? 206.799 204.125 205.272 1.00 499.98 ?  1079 ALA A C   1 
ATOM   5038  O  O   . ALA A 1  1079 ? 206.775 205.324 204.975 1.00 489.04 ?  1079 ALA A O   1 
ATOM   5039  C  CB  . ALA A 1  1079 ? 205.331 203.450 207.171 1.00 489.46 ?  1079 ALA A CB  1 
ATOM   5040  N  N   . LEU A 1  1080 ? 207.908 203.380 205.268 1.00 498.50 ?  1080 LEU A N   1 
ATOM   5041  C  CA  . LEU A 1  1080 ? 209.251 203.928 205.014 1.00 493.16 ?  1080 LEU A CA  1 
ATOM   5042  C  C   . LEU A 1  1080 ? 209.391 204.767 203.720 1.00 500.00 ?  1080 LEU A C   1 
ATOM   5043  O  O   . LEU A 1  1080 ? 209.932 205.872 203.797 1.00 500.00 ?  1080 LEU A O   1 
ATOM   5044  C  CB  . LEU A 1  1080 ? 210.350 202.848 205.117 1.00 463.57 ?  1080 LEU A CB  1 
ATOM   5045  C  CG  . LEU A 1  1080 ? 210.439 201.902 206.326 1.00 439.28 ?  1080 LEU A CG  1 
ATOM   5046  C  CD1 . LEU A 1  1080 ? 211.543 200.873 206.140 1.00 422.87 ?  1080 LEU A CD1 1 
ATOM   5047  C  CD2 . LEU A 1  1080 ? 210.611 202.620 207.655 1.00 430.66 ?  1080 LEU A CD2 1 
ATOM   5048  N  N   . PRO A 1  1081 ? 208.904 204.262 202.550 1.00 500.00 ?  1081 PRO A N   1 
ATOM   5049  C  CA  . PRO A 1  1081 ? 208.864 205.062 201.316 1.00 500.00 ?  1081 PRO A CA  1 
ATOM   5050  C  C   . PRO A 1  1081 ? 208.409 206.531 201.414 1.00 500.00 ?  1081 PRO A C   1 
ATOM   5051  O  O   . PRO A 1  1081 ? 209.065 207.393 200.826 1.00 500.00 ?  1081 PRO A O   1 
ATOM   5052  C  CB  . PRO A 1  1081 ? 207.905 204.265 200.441 1.00 500.00 ?  1081 PRO A CB  1 
ATOM   5053  C  CG  . PRO A 1  1081 ? 208.229 202.856 200.773 1.00 500.00 ?  1081 PRO A CG  1 
ATOM   5054  C  CD  . PRO A 1  1081 ? 208.640 202.842 202.225 1.00 500.00 ?  1081 PRO A CD  1 
ATOM   5055  N  N   . VAL A 1  1082 ? 207.325 206.812 202.143 1.00 487.54 ?  1082 VAL A N   1 
ATOM   5056  C  CA  . VAL A 1  1082 ? 206.799 208.190 202.258 1.00 444.01 ?  1082 VAL A CA  1 
ATOM   5057  C  C   . VAL A 1  1082 ? 207.831 209.122 202.908 1.00 430.11 ?  1082 VAL A C   1 
ATOM   5058  O  O   . VAL A 1  1082 ? 208.129 210.191 202.366 1.00 422.19 ?  1082 VAL A O   1 
ATOM   5059  C  CB  . VAL A 1  1082 ? 205.436 208.267 202.998 1.00 424.83 ?  1082 VAL A CB  1 
ATOM   5060  C  CG1 . VAL A 1  1082 ? 204.799 209.639 202.806 1.00 384.62 ?  1082 VAL A CG1 1 
ATOM   5061  C  CG2 . VAL A 1  1082 ? 204.484 207.183 202.511 1.00 430.53 ?  1082 VAL A CG2 1 
ATOM   5062  N  N   . GLY A 1  1083 ? 208.382 208.690 204.045 1.00 418.11 ?  1083 GLY A N   1 
ATOM   5063  C  CA  . GLY A 1  1083 ? 209.470 209.397 204.728 1.00 405.70 ?  1083 GLY A CA  1 
ATOM   5064  C  C   . GLY A 1  1083 ? 210.743 209.470 203.897 1.00 412.72 ?  1083 GLY A C   1 
ATOM   5065  O  O   . GLY A 1  1083 ? 211.410 210.512 203.870 1.00 388.97 ?  1083 GLY A O   1 
ATOM   5066  N  N   . ARG A 1  1084 ? 211.061 208.365 203.214 1.00 436.26 ?  1084 ARG A N   1 
ATOM   5067  C  CA  . ARG A 1  1084 ? 212.253 208.242 202.356 1.00 434.73 ?  1084 ARG A CA  1 
ATOM   5068  C  C   . ARG A 1  1084 ? 212.299 209.285 201.236 1.00 425.67 ?  1084 ARG A C   1 
ATOM   5069  O  O   . ARG A 1  1084 ? 213.358 209.847 200.967 1.00 440.68 ?  1084 ARG A O   1 
ATOM   5070  C  CB  . ARG A 1  1084 ? 212.360 206.833 201.758 1.00 434.15 ?  1084 ARG A CB  1 
ATOM   5071  C  CG  . ARG A 1  1084 ? 213.723 206.490 201.170 1.00 422.74 ?  1084 ARG A CG  1 
ATOM   5072  C  CD  . ARG A 1  1084 ? 213.600 205.945 199.755 1.00 419.29 ?  1084 ARG A CD  1 
ATOM   5073  N  NE  . ARG A 1  1084 ? 212.893 204.664 199.708 1.00 418.49 ?  1084 ARG A NE  1 
ATOM   5074  C  CZ  . ARG A 1  1084 ? 212.283 204.163 198.636 1.00 416.68 ?  1084 ARG A CZ  1 
ATOM   5075  N  NH1 . ARG A 1  1084 ? 212.270 204.819 197.479 1.00 407.60 ?  1084 ARG A NH1 1 
ATOM   5076  N  NH2 . ARG A 1  1084 ? 211.677 202.988 198.728 1.00 418.80 ?  1084 ARG A NH2 1 
ATOM   5077  N  N   . GLY A 1  1085 ? 211.150 209.531 200.601 1.00 378.16 ?  1085 GLY A N   1 
ATOM   5078  C  CA  . GLY A 1  1085 ? 211.013 210.537 199.541 1.00 269.84 ?  1085 GLY A CA  1 
ATOM   5079  C  C   . GLY A 1  1085 ? 211.467 211.910 199.996 1.00 198.11 ?  1085 GLY A C   1 
ATOM   5080  O  O   . GLY A 1  1085 ? 212.278 212.548 199.330 1.00 187.77 ?  1085 GLY A O   1 
ATOM   5081  N  N   . MET A 1  1086 ? 210.965 212.334 201.156 1.00 145.06 ?  1086 MET A N   1 
ATOM   5082  C  CA  . MET A 1  1086 ? 211.304 213.614 201.757 1.00 144.44 ?  1086 MET A CA  1 
ATOM   5083  C  C   . MET A 1  1086 ? 212.802 213.792 201.750 1.00 141.85 ?  1086 MET A C   1 
ATOM   5084  O  O   . MET A 1  1086 ? 213.332 214.794 201.278 1.00 154.58 ?  1086 MET A O   1 
ATOM   5085  C  CB  . MET A 1  1086 ? 210.769 213.694 203.189 1.00 155.67 ?  1086 MET A CB  1 
ATOM   5086  C  CG  . MET A 1  1086 ? 209.259 213.783 203.272 1.00 190.21 ?  1086 MET A CG  1 
ATOM   5087  S  SD  . MET A 1  1086 ? 208.571 213.646 204.926 1.00 227.88 ?  1086 MET A SD  1 
ATOM   5088  C  CE  . MET A 1  1086 ? 206.820 213.959 204.658 1.00 211.43 ?  1086 MET A CE  1 
ATOM   5089  N  N   . PHE A 1  1087 ? 213.475 212.768 202.239 1.00 143.97 ?  1087 PHE A N   1 
ATOM   5090  C  CA  . PHE A 1  1087 ? 214.897 212.798 202.493 1.00 149.63 ?  1087 PHE A CA  1 
ATOM   5091  C  C   . PHE A 1  1087 ? 215.662 213.044 201.216 1.00 129.96 ?  1087 PHE A C   1 
ATOM   5092  O  O   . PHE A 1  1087 ? 216.465 213.951 201.087 1.00 118.69 ?  1087 PHE A O   1 
ATOM   5093  C  CB  . PHE A 1  1087 ? 215.278 211.449 203.096 1.00 163.49 ?  1087 PHE A CB  1 
ATOM   5094  C  CG  . PHE A 1  1087 ? 216.734 211.265 203.354 1.00 142.52 ?  1087 PHE A CG  1 
ATOM   5095  C  CD1 . PHE A 1  1087 ? 217.443 212.184 204.121 1.00 138.74 ?  1087 PHE A CD1 1 
ATOM   5096  C  CD2 . PHE A 1  1087 ? 217.377 210.136 202.877 1.00 128.07 ?  1087 PHE A CD2 1 
ATOM   5097  C  CE1 . PHE A 1  1087 ? 218.781 212.000 204.386 1.00 147.75 ?  1087 PHE A CE1 1 
ATOM   5098  C  CE2 . PHE A 1  1087 ? 218.713 209.935 203.142 1.00 152.13 ?  1087 PHE A CE2 1 
ATOM   5099  C  CZ  . PHE A 1  1087 ? 219.417 210.868 203.897 1.00 163.98 ?  1087 PHE A CZ  1 
ATOM   5100  N  N   . THR A 1  1088 ? 215.387 212.214 200.254 1.00 122.02 ?  1088 THR A N   1 
ATOM   5101  C  CA  . THR A 1  1088 ? 216.186 212.237 199.097 1.00 152.09 ?  1088 THR A CA  1 
ATOM   5102  C  C   . THR A 1  1088 ? 215.221 212.781 198.057 1.00 221.68 ?  1088 THR A C   1 
ATOM   5103  O  O   . THR A 1  1088 ? 214.707 212.035 197.225 1.00 296.40 ?  1088 THR A O   1 
ATOM   5104  C  CB  . THR A 1  1088 ? 216.799 210.842 198.839 1.00 141.77 ?  1088 THR A CB  1 
ATOM   5105  O  OG1 . THR A 1  1088 ? 217.022 210.668 197.444 1.00 154.04 ?  1088 THR A OG1 1 
ATOM   5106  C  CG2 . THR A 1  1088 ? 215.905 209.709 199.331 1.00 137.58 ?  1088 THR A CG2 1 
ATOM   5107  N  N   . LEU A 1  1089 ? 214.939 214.086 198.172 1.00 229.60 ?  1089 LEU A N   1 
ATOM   5108  C  CA  . LEU A 1  1089 ? 213.950 214.800 197.343 1.00 216.21 ?  1089 LEU A CA  1 
ATOM   5109  C  C   . LEU A 1  1089 ? 214.634 215.799 196.425 1.00 226.74 ?  1089 LEU A C   1 
ATOM   5110  O  O   . LEU A 1  1089 ? 215.511 216.554 196.879 1.00 273.52 ?  1089 LEU A O   1 
ATOM   5111  C  CB  . LEU A 1  1089 ? 212.944 215.564 198.211 1.00 150.24 ?  1089 LEU A CB  1 
ATOM   5112  C  CG  . LEU A 1  1089 ? 211.815 216.300 197.511 1.00 104.74 ?  1089 LEU A CG  1 
ATOM   5113  C  CD1 . LEU A 1  1089 ? 210.619 215.427 197.732 1.00 91.08  ?  1089 LEU A CD1 1 
ATOM   5114  C  CD2 . LEU A 1  1089 ? 211.605 217.664 198.124 1.00 82.79  ?  1089 LEU A CD2 1 
ATOM   5115  N  N   . PHE A 1  1090 ? 214.233 215.802 195.147 1.00 149.61 ?  1090 PHE A N   1 
ATOM   5116  C  CA  . PHE A 1  1090 ? 214.724 216.775 194.189 1.00 126.16 ?  1090 PHE A CA  1 
ATOM   5117  C  C   . PHE A 1  1090 ? 216.255 216.846 194.002 1.00 140.15 ?  1090 PHE A C   1 
ATOM   5118  O  O   . PHE A 1  1090 ? 216.775 217.852 193.538 1.00 140.41 ?  1090 PHE A O   1 
ATOM   5119  C  CB  . PHE A 1  1090 ? 214.237 218.112 194.671 1.00 113.53 ?  1090 PHE A CB  1 
ATOM   5120  C  CG  . PHE A 1  1090 ? 212.796 218.306 194.512 1.00 120.29 ?  1090 PHE A CG  1 
ATOM   5121  C  CD1 . PHE A 1  1090 ? 212.083 217.556 193.593 1.00 134.87 ?  1090 PHE A CD1 1 
ATOM   5122  C  CD2 . PHE A 1  1090 ? 212.153 219.316 195.217 1.00 134.73 ?  1090 PHE A CD2 1 
ATOM   5123  C  CE1 . PHE A 1  1090 ? 210.726 217.790 193.398 1.00 176.12 ?  1090 PHE A CE1 1 
ATOM   5124  C  CE2 . PHE A 1  1090 ? 210.796 219.561 195.035 1.00 146.95 ?  1090 PHE A CE2 1 
ATOM   5125  C  CZ  . PHE A 1  1090 ? 210.080 218.800 194.117 1.00 163.93 ?  1090 PHE A CZ  1 
ATOM   5126  N  N   . SER A 1  1091 ? 216.966 215.781 194.364 1.00 142.79 ?  1091 SER A N   1 
ATOM   5127  C  CA  . SER A 1  1091 ? 218.412 215.845 194.596 1.00 156.19 ?  1091 SER A CA  1 
ATOM   5128  C  C   . SER A 1  1091 ? 219.208 215.308 193.433 1.00 161.52 ?  1091 SER A C   1 
ATOM   5129  O  O   . SER A 1  1091 ? 220.449 215.353 193.440 1.00 184.34 ?  1091 SER A O   1 
ATOM   5130  C  CB  . SER A 1  1091 ? 218.821 215.157 195.928 1.00 160.33 ?  1091 SER A CB  1 
ATOM   5131  O  OG  . SER A 1  1091 ? 218.265 213.864 196.096 1.00 153.29 ?  1091 SER A OG  1 
ATOM   5132  N  N   . TYR A 1  1092 ? 218.483 214.854 192.418 1.00 169.45 ?  1092 TYR A N   1 
ATOM   5133  C  CA  . TYR A 1  1092 ? 219.073 214.082 191.334 1.00 243.55 ?  1092 TYR A CA  1 
ATOM   5134  C  C   . TYR A 1  1092 ? 218.476 214.483 189.997 1.00 222.45 ?  1092 TYR A C   1 
ATOM   5135  O  O   . TYR A 1  1092 ? 217.282 214.392 189.785 1.00 245.80 ?  1092 TYR A O   1 
ATOM   5136  C  CB  . TYR A 1  1092 ? 218.894 212.570 191.616 1.00 297.58 ?  1092 TYR A CB  1 
ATOM   5137  C  CG  . TYR A 1  1092 ? 219.420 211.589 190.574 1.00 296.46 ?  1092 TYR A CG  1 
ATOM   5138  C  CD1 . TYR A 1  1092 ? 220.785 211.523 190.259 1.00 308.95 ?  1092 TYR A CD1 1 
ATOM   5139  C  CD2 . TYR A 1  1092 ? 218.557 210.690 189.941 1.00 266.75 ?  1092 TYR A CD2 1 
ATOM   5140  C  CE1 . TYR A 1  1092 ? 221.263 210.623 189.313 1.00 296.07 ?  1092 TYR A CE1 1 
ATOM   5141  C  CE2 . TYR A 1  1092 ? 219.031 209.779 189.007 1.00 246.53 ?  1092 TYR A CE2 1 
ATOM   5142  C  CZ  . TYR A 1  1092 ? 220.381 209.755 188.694 1.00 272.41 ?  1092 TYR A CZ  1 
ATOM   5143  O  OH  . TYR A 1  1092 ? 220.859 208.860 187.770 1.00 299.81 ?  1092 TYR A OH  1 
ATOM   5144  N  N   . HIS A 1  1093 ? 219.323 214.959 189.107 1.00 172.39 ?  1093 HIS A N   1 
ATOM   5145  C  CA  . HIS A 1  1093 ? 218.963 215.080 187.729 1.00 158.54 ?  1093 HIS A CA  1 
ATOM   5146  C  C   . HIS A 1  1093 ? 219.354 213.731 187.126 1.00 168.12 ?  1093 HIS A C   1 
ATOM   5147  O  O   . HIS A 1  1093 ? 220.497 213.281 187.250 1.00 170.86 ?  1093 HIS A O   1 
ATOM   5148  C  CB  . HIS A 1  1093 ? 219.718 216.227 187.103 1.00 168.56 ?  1093 HIS A CB  1 
ATOM   5149  C  CG  . HIS A 1  1093 ? 219.676 217.483 187.913 1.00 202.62 ?  1093 HIS A CG  1 
ATOM   5150  N  ND1 . HIS A 1  1093 ? 219.201 218.672 187.410 1.00 251.84 ?  1093 HIS A ND1 1 
ATOM   5151  C  CD2 . HIS A 1  1093 ? 220.052 217.740 189.188 1.00 236.42 ?  1093 HIS A CD2 1 
ATOM   5152  C  CE1 . HIS A 1  1093 ? 219.279 219.607 188.338 1.00 286.07 ?  1093 HIS A CE1 1 
ATOM   5153  N  NE2 . HIS A 1  1093 ? 219.796 219.068 189.428 1.00 281.98 ?  1093 HIS A NE2 1 
ATOM   5154  N  N   . PRO A 1  1094 ? 218.389 213.038 186.531 1.00 161.80 ?  1094 PRO A N   1 
ATOM   5155  C  CA  . PRO A 1  1094 ? 218.609 211.736 185.933 1.00 169.66 ?  1094 PRO A CA  1 
ATOM   5156  C  C   . PRO A 1  1094 ? 219.106 211.813 184.494 1.00 194.93 ?  1094 PRO A C   1 
ATOM   5157  O  O   . PRO A 1  1094 ? 218.571 212.607 183.701 1.00 204.94 ?  1094 PRO A O   1 
ATOM   5158  C  CB  . PRO A 1  1094 ? 217.218 211.109 185.971 1.00 167.21 ?  1094 PRO A CB  1 
ATOM   5159  C  CG  . PRO A 1  1094 ? 216.457 211.954 186.942 1.00 160.72 ?  1094 PRO A CG  1 
ATOM   5160  C  CD  . PRO A 1  1094 ? 216.961 213.312 186.662 1.00 158.81 ?  1094 PRO A CD  1 
ATOM   5161  N  N   . VAL A 1  1095 ? 220.117 210.982 184.193 1.00 191.03 ?  1095 VAL A N   1 
ATOM   5162  C  CA  . VAL A 1  1095 ? 220.757 210.827 182.866 1.00 171.40 ?  1095 VAL A CA  1 
ATOM   5163  C  C   . VAL A 1  1095 ? 219.717 210.550 181.781 1.00 183.45 ?  1095 VAL A C   1 
ATOM   5164  O  O   . VAL A 1  1095 ? 218.923 209.629 181.945 1.00 200.32 ?  1095 VAL A O   1 
ATOM   5165  C  CB  . VAL A 1  1095 ? 221.713 209.604 182.819 1.00 160.97 ?  1095 VAL A CB  1 
ATOM   5166  C  CG1 . VAL A 1  1095 ? 222.836 209.856 181.823 1.00 167.16 ?  1095 VAL A CG1 1 
ATOM   5167  C  CG2 . VAL A 1  1095 ? 222.250 209.198 184.198 1.00 141.84 ?  1095 VAL A CG2 1 
ATOM   5168  N  N   . PRO A 1  1096 ? 219.720 211.323 180.665 1.00 219.26 ?  1096 PRO A N   1 
ATOM   5169  C  CA  . PRO A 1  1096 ? 218.726 211.106 179.587 1.00 287.89 ?  1096 PRO A CA  1 
ATOM   5170  C  C   . PRO A 1  1096 ? 218.756 209.720 178.891 1.00 356.76 ?  1096 PRO A C   1 
ATOM   5171  O  O   . PRO A 1  1096 ? 217.807 209.378 178.172 1.00 390.02 ?  1096 PRO A O   1 
ATOM   5172  C  CB  . PRO A 1  1096 ? 219.036 212.234 178.585 1.00 264.68 ?  1096 PRO A CB  1 
ATOM   5173  C  CG  . PRO A 1  1096 ? 219.705 213.285 179.399 1.00 233.61 ?  1096 PRO A CG  1 
ATOM   5174  C  CD  . PRO A 1  1096 ? 220.543 212.514 180.387 1.00 229.85 ?  1096 PRO A CD  1 
ATOM   5175  N  N   . THR A 1  1097 ? 219.819 208.943 179.115 1.00 402.37 ?  1097 THR A N   1 
ATOM   5176  C  CA  . THR A 1  1097 ? 219.943 207.573 178.591 1.00 418.78 ?  1097 THR A CA  1 
ATOM   5177  C  C   . THR A 1  1097 ? 219.303 206.533 179.532 1.00 440.83 ?  1097 THR A C   1 
ATOM   5178  O  O   . THR A 1  1097 ? 218.405 205.791 179.116 1.00 445.04 ?  1097 THR A O   1 
ATOM   5179  C  CB  . THR A 1  1097 ? 221.422 207.232 178.257 1.00 415.51 ?  1097 THR A CB  1 
ATOM   5180  O  OG1 . THR A 1  1097 ? 221.810 207.923 177.065 1.00 399.43 ?  1097 THR A OG1 1 
ATOM   5181  C  CG2 . THR A 1  1097 ? 221.637 205.729 178.044 1.00 420.34 ?  1097 THR A CG2 1 
ATOM   5182  N  N   . GLU A 1  1098 ? 219.767 206.506 180.786 1.00 452.77 ?  1098 GLU A N   1 
ATOM   5183  C  CA  . GLU A 1  1098 ? 219.356 205.534 181.814 1.00 453.37 ?  1098 GLU A CA  1 
ATOM   5184  C  C   . GLU A 1  1098 ? 217.867 205.648 182.216 1.00 458.39 ?  1098 GLU A C   1 
ATOM   5185  O  O   . GLU A 1  1098 ? 217.218 206.642 181.872 1.00 472.03 ?  1098 GLU A O   1 
ATOM   5186  C  CB  . GLU A 1  1098 ? 220.259 205.690 183.046 1.00 436.66 ?  1098 GLU A CB  1 
ATOM   5187  N  N   . PRO A 1  1099 ? 217.311 204.624 182.916 1.00 446.61 ?  1099 PRO A N   1 
ATOM   5188  C  CA  . PRO A 1  1099 ? 215.942 204.780 183.440 1.00 411.43 ?  1099 PRO A CA  1 
ATOM   5189  C  C   . PRO A 1  1099 ? 215.841 205.695 184.685 1.00 360.38 ?  1099 PRO A C   1 
ATOM   5190  O  O   . PRO A 1  1099 ? 215.518 206.888 184.557 1.00 226.21 ?  1099 PRO A O   1 
ATOM   5191  C  CB  . PRO A 1  1099 ? 215.512 203.332 183.751 1.00 432.25 ?  1099 PRO A CB  1 
ATOM   5192  C  CG  . PRO A 1  1099 ? 216.465 202.461 183.000 1.00 433.32 ?  1099 PRO A CG  1 
ATOM   5193  C  CD  . PRO A 1  1099 ? 217.757 203.219 183.004 1.00 442.76 ?  1099 PRO A CD  1 
ATOM   5194  N  N   . LEU A 1  1100 ? 216.106 205.147 185.872 1.00 382.42 ?  1100 LEU A N   1 
ATOM   5195  C  CA  . LEU A 1  1100 ? 216.019 205.934 187.104 1.00 399.39 ?  1100 LEU A CA  1 
ATOM   5196  C  C   . LEU A 1  1100 ? 217.115 205.686 188.173 1.00 433.03 ?  1100 LEU A C   1 
ATOM   5197  O  O   . LEU A 1  1100 ? 217.823 206.640 188.493 1.00 426.91 ?  1100 LEU A O   1 
ATOM   5198  C  CB  . LEU A 1  1100 ? 214.600 205.909 187.691 1.00 381.29 ?  1100 LEU A CB  1 
ATOM   5199  C  CG  . LEU A 1  1100 ? 213.875 207.221 187.988 1.00 359.15 ?  1100 LEU A CG  1 
ATOM   5200  C  CD1 . LEU A 1  1100 ? 212.876 206.927 189.089 1.00 365.60 ?  1100 LEU A CD1 1 
ATOM   5201  C  CD2 . LEU A 1  1100 ? 214.803 208.359 188.392 1.00 346.03 ?  1100 LEU A CD2 1 
ATOM   5202  N  N   . PRO A 1  1101 ? 217.250 204.486 188.771 1.00 476.79 ?  1101 PRO A N   1 
ATOM   5203  C  CA  . PRO A 1  1101 ? 216.245 203.406 188.795 1.00 500.00 ?  1101 PRO A CA  1 
ATOM   5204  C  C   . PRO A 1  1101 ? 215.515 203.356 190.146 1.00 500.00 ?  1101 PRO A C   1 
ATOM   5205  O  O   . PRO A 1  1101 ? 216.049 203.850 191.147 1.00 500.00 ?  1101 PRO A O   1 
ATOM   5206  C  CB  . PRO A 1  1101 ? 217.080 202.140 188.578 1.00 489.84 ?  1101 PRO A CB  1 
ATOM   5207  C  CG  . PRO A 1  1101 ? 218.445 202.482 189.072 1.00 476.91 ?  1101 PRO A CG  1 
ATOM   5208  C  CD  . PRO A 1  1101 ? 218.623 203.971 188.960 1.00 478.73 ?  1101 PRO A CD  1 
ATOM   5209  N  N   . ILE A 1  1102 ? 214.308 202.781 190.164 1.00 500.00 ?  1102 ILE A N   1 
ATOM   5210  C  CA  . ILE A 1  1102 ? 213.520 202.622 191.401 1.00 500.00 ?  1102 ILE A CA  1 
ATOM   5211  C  C   . ILE A 1  1102 ? 214.061 201.434 192.223 1.00 500.00 ?  1102 ILE A C   1 
ATOM   5212  O  O   . ILE A 1  1102 ? 214.222 200.337 191.672 1.00 500.00 ?  1102 ILE A O   1 
ATOM   5213  C  CB  . ILE A 1  1102 ? 211.991 202.444 191.135 1.00 477.44 ?  1102 ILE A CB  1 
ATOM   5214  C  CG1 . ILE A 1  1102 ? 211.401 203.617 190.341 1.00 431.88 ?  1102 ILE A CG1 1 
ATOM   5215  C  CG2 . ILE A 1  1102 ? 211.215 202.301 192.439 1.00 470.54 ?  1102 ILE A CG2 1 
ATOM   5216  C  CD1 . ILE A 1  1102 ? 211.064 203.288 188.902 1.00 397.63 ?  1102 ILE A CD1 1 
ATOM   5217  N  N   . PRO A 1  1103 ? 214.347 201.647 193.535 1.00 500.00 ?  1103 PRO A N   1 
ATOM   5218  C  CA  . PRO A 1  1103 ? 214.750 200.537 194.414 1.00 500.00 ?  1103 PRO A CA  1 
ATOM   5219  C  C   . PRO A 1  1103 ? 213.647 199.493 194.593 1.00 500.00 ?  1103 PRO A C   1 
ATOM   5220  O  O   . PRO A 1  1103 ? 212.463 199.819 194.473 1.00 500.00 ?  1103 PRO A O   1 
ATOM   5221  C  CB  . PRO A 1  1103 ? 215.037 201.229 195.750 1.00 500.00 ?  1103 PRO A CB  1 
ATOM   5222  C  CG  . PRO A 1  1103 ? 214.285 202.515 195.693 1.00 500.00 ?  1103 PRO A CG  1 
ATOM   5223  C  CD  . PRO A 1  1103 ? 214.368 202.935 194.259 1.00 500.00 ?  1103 PRO A CD  1 
ATOM   5224  N  N   . LYS A 1  1104 ? 214.048 198.255 194.874 1.00 500.00 ?  1104 LYS A N   1 
ATOM   5225  C  CA  . LYS A 1  1104 ? 213.118 197.137 195.029 1.00 500.00 ?  1104 LYS A CA  1 
ATOM   5226  C  C   . LYS A 1  1104 ? 212.440 197.169 196.402 1.00 500.00 ?  1104 LYS A C   1 
ATOM   5227  O  O   . LYS A 1  1104 ? 213.116 197.178 197.436 1.00 500.00 ?  1104 LYS A O   1 
ATOM   5228  C  CB  . LYS A 1  1104 ? 213.853 195.806 194.808 1.00 500.00 ?  1104 LYS A CB  1 
ATOM   5229  C  CG  . LYS A 1  1104 ? 212.951 194.597 194.583 1.00 500.00 ?  1104 LYS A CG  1 
ATOM   5230  C  CD  . LYS A 1  1104 ? 213.751 193.313 194.392 1.00 481.78 ?  1104 LYS A CD  1 
ATOM   5231  C  CE  . LYS A 1  1104 ? 214.149 192.675 195.717 1.00 469.50 ?  1104 LYS A CE  1 
ATOM   5232  N  NZ  . LYS A 1  1104 ? 214.963 191.446 195.514 1.00 463.70 ?  1104 LYS A NZ  1 
ATOM   5233  N  N   . LEU A 1  1105 ? 211.106 197.210 196.394 1.00 500.00 ?  1105 LEU A N   1 
ATOM   5234  C  CA  . LEU A 1  1105 ? 210.301 197.079 197.611 1.00 500.00 ?  1105 LEU A CA  1 
ATOM   5235  C  C   . LEU A 1  1105 ? 210.069 195.590 197.900 1.00 500.00 ?  1105 LEU A C   1 
ATOM   5236  O  O   . LEU A 1  1105 ? 209.222 194.949 197.264 1.00 500.00 ?  1105 LEU A O   1 
ATOM   5237  C  CB  . LEU A 1  1105 ? 208.969 197.847 197.482 1.00 500.00 ?  1105 LEU A CB  1 
ATOM   5238  C  CG  . LEU A 1  1105 ? 207.938 197.735 198.621 1.00 500.00 ?  1105 LEU A CG  1 
ATOM   5239  C  CD1 . LEU A 1  1105 ? 208.152 198.803 199.680 1.00 494.86 ?  1105 LEU A CD1 1 
ATOM   5240  C  CD2 . LEU A 1  1105 ? 206.515 197.808 198.092 1.00 500.00 ?  1105 LEU A CD2 1 
ATOM   5241  N  N   . ASN A 1  1106 ? 210.839 195.047 198.844 1.00 500.00 ?  1106 ASN A N   1 
ATOM   5242  C  CA  . ASN A 1  1106 ? 210.730 193.630 199.218 1.00 500.00 ?  1106 ASN A CA  1 
ATOM   5243  C  C   . ASN A 1  1106 ? 210.352 193.384 200.684 1.00 500.00 ?  1106 ASN A C   1 
ATOM   5244  O  O   . ASN A 1  1106 ? 210.762 194.134 201.579 1.00 500.00 ?  1106 ASN A O   1 
ATOM   5245  C  CB  . ASN A 1  1106 ? 211.987 192.834 198.801 1.00 500.00 ?  1106 ASN A CB  1 
ATOM   5246  C  CG  . ASN A 1  1106 ? 213.238 193.201 199.597 1.00 500.00 ?  1106 ASN A CG  1 
ATOM   5247  O  OD1 . ASN A 1  1106 ? 213.438 194.350 200.005 1.00 500.00 ?  1106 ASN A OD1 1 
ATOM   5248  N  ND2 . ASN A 1  1106 ? 214.103 192.212 199.802 1.00 500.00 ?  1106 ASN A ND2 1 
ATOM   5249  N  N   . LEU A 1  1107 ? 209.559 192.337 200.906 1.00 500.00 ?  1107 LEU A N   1 
ATOM   5250  C  CA  . LEU A 1  1107 ? 209.049 191.999 202.238 1.00 500.00 ?  1107 LEU A CA  1 
ATOM   5251  C  C   . LEU A 1  1107 ? 209.479 190.582 202.623 1.00 500.00 ?  1107 LEU A C   1 
ATOM   5252  O  O   . LEU A 1  1107 ? 208.664 189.653 202.664 1.00 500.00 ?  1107 LEU A O   1 
ATOM   5253  C  CB  . LEU A 1  1107 ? 207.520 192.168 202.321 1.00 500.00 ?  1107 LEU A CB  1 
ATOM   5254  C  CG  . LEU A 1  1107 ? 206.845 193.214 201.430 1.00 500.00 ?  1107 LEU A CG  1 
ATOM   5255  C  CD1 . LEU A 1  1107 ? 206.103 192.545 200.282 1.00 500.00 ?  1107 LEU A CD1 1 
ATOM   5256  C  CD2 . LEU A 1  1107 ? 205.903 194.083 202.239 1.00 500.00 ?  1107 LEU A CD2 1 
ATOM   5257  N  N   . THR A 1  1108 ? 210.777 190.435 202.883 1.00 500.00 ?  1108 THR A N   1 
ATOM   5258  C  CA  . THR A 1  1108 ? 211.375 189.160 203.302 1.00 500.00 ?  1108 THR A CA  1 
ATOM   5259  C  C   . THR A 1  1108 ? 212.133 189.322 204.622 1.00 500.00 ?  1108 THR A C   1 
ATOM   5260  O  O   . THR A 1  1108 ? 212.585 190.424 204.955 1.00 500.00 ?  1108 THR A O   1 
ATOM   5261  C  CB  . THR A 1  1108 ? 212.313 188.567 202.223 1.00 500.00 ?  1108 THR A CB  1 
ATOM   5262  O  OG1 . THR A 1  1108 ? 213.231 189.571 201.768 1.00 500.00 ?  1108 THR A OG1 1 
ATOM   5263  C  CG2 . THR A 1  1108 ? 211.514 188.030 201.035 1.00 500.00 ?  1108 THR A CG2 1 
ATOM   5264  N  N   . GLY A 1  1109 ? 212.255 188.220 205.365 1.00 500.00 ?  1109 GLY A N   1 
ATOM   5265  C  CA  . GLY A 1  1109 ? 212.898 188.210 206.681 1.00 500.00 ?  1109 GLY A CA  1 
ATOM   5266  C  C   . GLY A 1  1109 ? 213.980 187.156 206.827 1.00 500.00 ?  1109 GLY A C   1 
ATOM   5267  O  O   . GLY A 1  1109 ? 213.756 185.990 206.501 1.00 500.00 ?  1109 GLY A O   1 
ATOM   5268  N  N   . ARG A 1  1110 ? 215.150 187.566 207.320 1.00 500.00 ?  1110 ARG A N   1 
ATOM   5269  C  CA  . ARG A 1  1110 ? 216.279 186.644 207.512 1.00 500.00 ?  1110 ARG A CA  1 
ATOM   5270  C  C   . ARG A 1  1110 ? 216.552 186.345 208.989 1.00 500.00 ?  1110 ARG A C   1 
ATOM   5271  O  O   . ARG A 1  1110 ? 217.069 187.194 209.725 1.00 500.00 ?  1110 ARG A O   1 
ATOM   5272  C  CB  . ARG A 1  1110 ? 217.538 187.134 206.784 1.00 500.00 ?  1110 ARG A CB  1 
ATOM   5273  C  CG  . ARG A 1  1110 ? 217.457 186.983 205.273 1.00 500.00 ?  1110 ARG A CG  1 
ATOM   5274  C  CD  . ARG A 1  1110 ? 218.821 187.064 204.611 1.00 500.00 ?  1110 ARG A CD  1 
ATOM   5275  N  NE  . ARG A 1  1110 ? 218.745 186.733 203.187 1.00 500.00 ?  1110 ARG A NE  1 
ATOM   5276  C  CZ  . ARG A 1  1110 ? 219.577 187.184 202.250 1.00 500.00 ?  1110 ARG A CZ  1 
ATOM   5277  N  NH1 . ARG A 1  1110 ? 220.571 188.011 202.556 1.00 500.00 ?  1110 ARG A NH1 1 
ATOM   5278  N  NH2 . ARG A 1  1110 ? 219.407 186.812 200.989 1.00 500.00 ?  1110 ARG A NH2 1 
ATOM   5279  N  N   . ALA A 1  1111 ? 216.208 185.121 209.398 1.00 500.00 ?  1111 ALA A N   1 
ATOM   5280  C  CA  . ALA A 1  1111 ? 216.191 184.716 210.811 1.00 500.00 ?  1111 ALA A CA  1 
ATOM   5281  C  C   . ALA A 1  1111 ? 217.500 184.069 211.312 1.00 500.00 ?  1111 ALA A C   1 
ATOM   5282  O  O   . ALA A 1  1111 ? 217.943 183.069 210.739 1.00 500.00 ?  1111 ALA A O   1 
ATOM   5283  C  CB  . ALA A 1  1111 ? 215.002 183.799 211.078 1.00 500.00 ?  1111 ALA A CB  1 
ATOM   5284  N  N   . PRO A 1  1112 ? 218.113 184.640 212.384 1.00 500.00 ?  1112 PRO A N   1 
ATOM   5285  C  CA  . PRO A 1  1112 ? 219.303 184.057 213.038 1.00 500.00 ?  1112 PRO A CA  1 
ATOM   5286  C  C   . PRO A 1  1112 ? 219.018 182.708 213.738 1.00 500.00 ?  1112 PRO A C   1 
ATOM   5287  O  O   . PRO A 1  1112 ? 217.873 182.485 214.150 1.00 500.00 ?  1112 PRO A O   1 
ATOM   5288  C  CB  . PRO A 1  1112 ? 219.702 185.127 214.068 1.00 500.00 ?  1112 PRO A CB  1 
ATOM   5289  C  CG  . PRO A 1  1112 ? 218.474 185.940 214.290 1.00 500.00 ?  1112 PRO A CG  1 
ATOM   5290  C  CD  . PRO A 1  1112 ? 217.773 185.955 212.965 1.00 500.00 ?  1112 PRO A CD  1 
ATOM   5291  N  N   . PRO A 1  1113 ? 220.013 181.814 213.868 1.00 500.00 ?  1113 PRO A N   1 
ATOM   5292  C  CA  . PRO A 1  1113 ? 221.383 182.002 213.354 1.00 500.00 ?  1113 PRO A CA  1 
ATOM   5293  C  C   . PRO A 1  1113 ? 221.649 181.355 211.984 1.00 500.00 ?  1113 PRO A C   1 
ATOM   5294  O  O   . PRO A 1  1113 ? 222.716 181.575 211.398 1.00 500.00 ?  1113 PRO A O   1 
ATOM   5295  C  CB  . PRO A 1  1113 ? 222.247 181.346 214.435 1.00 500.00 ?  1113 PRO A CB  1 
ATOM   5296  C  CG  . PRO A 1  1113 ? 221.378 180.284 215.018 1.00 500.00 ?  1113 PRO A CG  1 
ATOM   5297  C  CD  . PRO A 1  1113 ? 219.950 180.742 214.884 1.00 500.00 ?  1113 PRO A CD  1 
ATOM   5298  N  N   . ARG A 1  1114 ? 220.684 180.576 211.491 1.00 500.00 ?  1114 ARG A N   1 
ATOM   5299  C  CA  . ARG A 1  1114 ? 220.775 179.894 210.190 1.00 500.00 ?  1114 ARG A CA  1 
ATOM   5300  C  C   . ARG A 1  1114 ? 220.756 180.849 208.984 1.00 500.00 ?  1114 ARG A C   1 
ATOM   5301  O  O   . ARG A 1  1114 ? 221.203 180.476 207.894 1.00 500.00 ?  1114 ARG A O   1 
ATOM   5302  C  CB  . ARG A 1  1114 ? 219.657 178.844 210.044 1.00 500.00 ?  1114 ARG A CB  1 
ATOM   5303  C  CG  . ARG A 1  1114 ? 219.562 177.798 211.159 1.00 500.00 ?  1114 ARG A CG  1 
ATOM   5304  C  CD  . ARG A 1  1114 ? 220.842 176.993 211.365 1.00 500.00 ?  1114 ARG A CD  1 
ATOM   5305  N  NE  . ARG A 1  1114 ? 221.260 176.273 210.160 1.00 495.06 ?  1114 ARG A NE  1 
ATOM   5306  C  CZ  . ARG A 1  1114 ? 222.369 175.543 210.050 1.00 486.20 ?  1114 ARG A CZ  1 
ATOM   5307  N  NH1 . ARG A 1  1114 ? 223.210 175.414 211.072 1.00 480.90 ?  1114 ARG A NH1 1 
ATOM   5308  N  NH2 . ARG A 1  1114 ? 222.642 174.934 208.904 1.00 482.48 ?  1114 ARG A NH2 1 
ATOM   5309  N  N   . ASN A 1  1115 ? 220.245 182.067 209.204 1.00 500.00 ?  1115 ASN A N   1 
ATOM   5310  C  CA  . ASN A 1  1115 ? 220.073 183.126 208.184 1.00 500.00 ?  1115 ASN A CA  1 
ATOM   5311  C  C   . ASN A 1  1115 ? 219.062 182.761 207.072 1.00 500.00 ?  1115 ASN A C   1 
ATOM   5312  O  O   . ASN A 1  1115 ? 219.199 183.181 205.914 1.00 500.00 ?  1115 ASN A O   1 
ATOM   5313  C  CB  . ASN A 1  1115 ? 221.436 183.603 207.625 1.00 500.00 ?  1115 ASN A CB  1 
ATOM   5314  C  CG  . ASN A 1  1115 ? 221.520 185.117 207.466 1.00 500.00 ?  1115 ASN A CG  1 
ATOM   5315  O  OD1 . ASN A 1  1115 ? 220.965 185.880 208.261 1.00 500.00 ?  1115 ASN A OD1 1 
ATOM   5316  N  ND2 . ASN A 1  1115 ? 222.244 185.557 206.442 1.00 500.00 ?  1115 ASN A ND2 1 
ATOM   5317  N  N   . THR A 1  1116 ? 218.040 181.992 207.458 1.00 500.00 ?  1116 THR A N   1 
ATOM   5318  C  CA  . THR A 1  1116 ? 216.992 181.505 206.547 1.00 500.00 ?  1116 THR A CA  1 
ATOM   5319  C  C   . THR A 1  1116 ? 215.952 182.587 206.244 1.00 500.00 ?  1116 THR A C   1 
ATOM   5320  O  O   . THR A 1  1116 ? 215.690 183.457 207.085 1.00 500.00 ?  1116 THR A O   1 
ATOM   5321  C  CB  . THR A 1  1116 ? 216.277 180.254 207.109 1.00 500.00 ?  1116 THR A CB  1 
ATOM   5322  O  OG1 . THR A 1  1116 ? 215.864 180.499 208.459 1.00 500.00 ?  1116 THR A OG1 1 
ATOM   5323  C  CG2 . THR A 1  1116 ? 217.195 179.031 207.072 1.00 500.00 ?  1116 THR A CG2 1 
ATOM   5324  N  N   . THR A 1  1117 ? 215.362 182.508 205.048 1.00 500.00 ?  1117 THR A N   1 
ATOM   5325  C  CA  . THR A 1  1117 ? 214.423 183.520 204.541 1.00 500.00 ?  1117 THR A CA  1 
ATOM   5326  C  C   . THR A 1  1117 ? 212.958 183.088 204.666 1.00 500.00 ?  1117 THR A C   1 
ATOM   5327  O  O   . THR A 1  1117 ? 212.602 181.964 204.294 1.00 500.00 ?  1117 THR A O   1 
ATOM   5328  C  CB  . THR A 1  1117 ? 214.709 183.900 203.066 1.00 500.00 ?  1117 THR A CB  1 
ATOM   5329  O  OG1 . THR A 1  1117 ? 214.602 182.736 202.236 1.00 500.00 ?  1117 THR A OG1 1 
ATOM   5330  C  CG2 . THR A 1  1117 ? 216.099 184.511 202.904 1.00 500.00 ?  1117 THR A CG2 1 
ATOM   5331  N  N   . VAL A 1  1118 ? 212.125 183.989 205.192 1.00 500.00 ?  1118 VAL A N   1 
ATOM   5332  C  CA  . VAL A 1  1118 ? 210.666 183.783 205.274 1.00 500.00 ?  1118 VAL A CA  1 
ATOM   5333  C  C   . VAL A 1  1118 ? 209.879 184.794 204.432 1.00 500.00 ?  1118 VAL A C   1 
ATOM   5334  O  O   . VAL A 1  1118 ? 210.130 186.002 204.493 1.00 500.00 ?  1118 VAL A O   1 
ATOM   5335  C  CB  . VAL A 1  1118 ? 210.116 183.731 206.730 1.00 500.00 ?  1118 VAL A CB  1 
ATOM   5336  C  CG1 . VAL A 1  1118 ? 210.208 182.318 207.286 1.00 500.00 ?  1118 VAL A CG1 1 
ATOM   5337  C  CG2 . VAL A 1  1118 ? 210.807 184.727 207.658 1.00 500.00 ?  1118 VAL A CG2 1 
ATOM   5338  N  N   . ASP A 1  1119 ? 208.934 184.273 203.649 1.00 500.00 ?  1119 ASP A N   1 
ATOM   5339  C  CA  . ASP A 1  1119 ? 208.120 185.060 202.719 1.00 500.00 ?  1119 ASP A CA  1 
ATOM   5340  C  C   . ASP A 1  1119 ? 206.633 184.934 203.066 1.00 500.00 ?  1119 ASP A C   1 
ATOM   5341  O  O   . ASP A 1  1119 ? 206.115 183.825 203.217 1.00 500.00 ?  1119 ASP A O   1 
ATOM   5342  C  CB  . ASP A 1  1119 ? 208.391 184.595 201.274 1.00 500.00 ?  1119 ASP A CB  1 
ATOM   5343  C  CG  . ASP A 1  1119 ? 207.683 185.446 200.211 1.00 500.00 ?  1119 ASP A CG  1 
ATOM   5344  O  OD1 . ASP A 1  1119 ? 206.991 186.436 200.537 1.00 500.00 ?  1119 ASP A OD1 1 
ATOM   5345  O  OD2 . ASP A 1  1119 ? 207.829 185.109 199.017 1.00 500.00 -1 1119 ASP A OD2 1 
ATOM   5346  N  N   . LEU A 1  1120 ? 205.958 186.080 203.179 1.00 500.00 ?  1120 LEU A N   1 
ATOM   5347  C  CA  . LEU A 1  1120 ? 204.516 186.128 203.480 1.00 459.33 ?  1120 LEU A CA  1 
ATOM   5348  C  C   . LEU A 1  1120 ? 203.654 185.802 202.250 1.00 421.69 ?  1120 LEU A C   1 
ATOM   5349  O  O   . LEU A 1  1120 ? 202.493 185.401 202.387 1.00 426.72 ?  1120 LEU A O   1 
ATOM   5350  C  CB  . LEU A 1  1120 ? 204.105 187.480 204.096 1.00 447.61 ?  1120 LEU A CB  1 
ATOM   5351  C  CG  . LEU A 1  1120 ? 204.966 188.108 205.203 1.00 440.14 ?  1120 LEU A CG  1 
ATOM   5352  C  CD1 . LEU A 1  1120 ? 205.858 189.181 204.598 1.00 439.41 ?  1120 LEU A CD1 1 
ATOM   5353  C  CD2 . LEU A 1  1120 ? 204.123 188.695 206.329 1.00 428.25 ?  1120 LEU A CD2 1 
ATOM   5354  N  N   . ASN A 1  1121 ? 204.232 185.970 201.058 1.00 362.27 ?  1121 ASN A N   1 
ATOM   5355  C  CA  . ASN A 1  1121 ? 203.578 185.612 199.792 1.00 312.86 ?  1121 ASN A CA  1 
ATOM   5356  C  C   . ASN A 1  1121 ? 203.570 184.105 199.473 1.00 286.38 ?  1121 ASN A C   1 
ATOM   5357  O  O   . ASN A 1  1121 ? 202.873 183.660 198.557 1.00 241.69 ?  1121 ASN A O   1 
ATOM   5358  C  CB  . ASN A 1  1121 ? 204.162 186.430 198.639 1.00 307.30 ?  1121 ASN A CB  1 
ATOM   5359  C  CG  . ASN A 1  1121 ? 203.863 187.913 198.770 1.00 306.61 ?  1121 ASN A CG  1 
ATOM   5360  O  OD1 . ASN A 1  1121 ? 204.278 188.565 199.733 1.00 278.46 ?  1121 ASN A OD1 1 
ATOM   5361  N  ND2 . ASN A 1  1121 ? 203.138 188.455 197.798 1.00 323.58 ?  1121 ASN A ND2 1 
ATOM   5362  N  N   . SER A 1  1122 ? 204.351 183.331 200.227 1.00 292.19 ?  1122 SER A N   1 
ATOM   5363  C  CA  . SER A 1  1122 ? 204.164 181.878 200.305 1.00 329.69 ?  1122 SER A CA  1 
ATOM   5364  C  C   . SER A 1  1122 ? 202.992 181.546 201.260 1.00 388.91 ?  1122 SER A C   1 
ATOM   5365  O  O   . SER A 1  1122 ? 202.454 182.443 201.920 1.00 448.23 ?  1122 SER A O   1 
ATOM   5366  C  CB  . SER A 1  1122 ? 205.465 181.182 200.730 1.00 318.05 ?  1122 SER A CB  1 
ATOM   5367  O  OG  . SER A 1  1122 ? 205.891 181.595 202.018 1.00 320.25 ?  1122 SER A OG  1 
ATOM   5368  N  N   . GLY A 1  1123 ? 202.611 180.265 201.325 1.00 416.38 ?  1123 GLY A N   1 
ATOM   5369  C  CA  . GLY A 1  1123 ? 201.429 179.780 202.069 1.00 433.17 ?  1123 GLY A CA  1 
ATOM   5370  C  C   . GLY A 1  1123 ? 201.071 180.347 203.442 1.00 449.19 ?  1123 GLY A C   1 
ATOM   5371  O  O   . GLY A 1  1123 ? 199.926 180.763 203.661 1.00 442.20 ?  1123 GLY A O   1 
ATOM   5372  N  N   . ASN A 1  1124 ? 202.048 180.366 204.354 1.00 453.17 ?  1124 ASN A N   1 
ATOM   5373  C  CA  . ASN A 1  1124 ? 201.830 180.722 205.770 1.00 436.35 ?  1124 ASN A CA  1 
ATOM   5374  C  C   . ASN A 1  1124 ? 201.310 182.143 206.036 1.00 412.23 ?  1124 ASN A C   1 
ATOM   5375  O  O   . ASN A 1  1124 ? 201.688 183.090 205.338 1.00 430.88 ?  1124 ASN A O   1 
ATOM   5376  C  CB  . ASN A 1  1124 ? 203.108 180.480 206.597 1.00 439.70 ?  1124 ASN A CB  1 
ATOM   5377  C  CG  . ASN A 1  1124 ? 203.527 179.017 206.643 1.00 435.06 ?  1124 ASN A CG  1 
ATOM   5378  O  OD1 . ASN A 1  1124 ? 204.652 178.677 206.276 1.00 427.83 ?  1124 ASN A OD1 1 
ATOM   5379  N  ND2 . ASN A 1  1124 ? 202.632 178.149 207.109 1.00 439.19 ?  1124 ASN A ND2 1 
ATOM   5380  N  N   . ILE A 1  1125 ? 200.448 182.252 207.058 1.00 358.74 ?  1125 ILE A N   1 
ATOM   5381  C  CA  . ILE A 1  1125 ? 199.894 183.514 207.628 1.00 290.63 ?  1125 ILE A CA  1 
ATOM   5382  C  C   . ILE A 1  1125 ? 198.887 184.212 206.720 1.00 214.65 ?  1125 ILE A C   1 
ATOM   5383  O  O   . ILE A 1  1125 ? 198.990 184.148 205.499 1.00 172.36 ?  1125 ILE A O   1 
ATOM   5384  C  CB  . ILE A 1  1125 ? 200.982 184.516 208.155 1.00 336.33 ?  1125 ILE A CB  1 
ATOM   5385  C  CG1 . ILE A 1  1125 ? 202.087 183.805 208.968 1.00 378.44 ?  1125 ILE A CG1 1 
ATOM   5386  C  CG2 . ILE A 1  1125 ? 200.368 185.680 208.943 1.00 322.53 ?  1125 ILE A CG2 1 
ATOM   5387  C  CD1 . ILE A 1  1125 ? 201.671 183.076 210.237 1.00 392.08 ?  1125 ILE A CD1 1 
ATOM   5388  N  N   . ASP A 1  1126 ? 197.915 184.864 207.356 1.00 219.79 ?  1126 ASP A N   1 
ATOM   5389  C  CA  . ASP A 1  1126 ? 196.820 185.560 206.684 1.00 250.57 ?  1126 ASP A CA  1 
ATOM   5390  C  C   . ASP A 1  1126 ? 197.139 187.032 206.398 1.00 248.66 ?  1126 ASP A C   1 
ATOM   5391  O  O   . ASP A 1  1126 ? 197.659 187.746 207.267 1.00 249.17 ?  1126 ASP A O   1 
ATOM   5392  C  CB  . ASP A 1  1126 ? 195.533 185.450 207.515 1.00 239.81 ?  1126 ASP A CB  1 
ATOM   5393  N  N   . VAL A 1  1127 ? 196.835 187.454 205.166 1.00 230.98 ?  1127 VAL A N   1 
ATOM   5394  C  CA  . VAL A 1  1127 ? 196.893 188.859 204.722 1.00 203.91 ?  1127 VAL A CA  1 
ATOM   5395  C  C   . VAL A 1  1127 ? 195.561 189.256 204.066 1.00 235.76 ?  1127 VAL A C   1 
ATOM   5396  O  O   . VAL A 1  1127 ? 194.895 188.399 203.471 1.00 232.51 ?  1127 VAL A O   1 
ATOM   5397  C  CB  . VAL A 1  1127 ? 198.063 189.145 203.727 1.00 175.99 ?  1127 VAL A CB  1 
ATOM   5398  C  CG1 . VAL A 1  1127 ? 199.405 188.795 204.348 1.00 213.51 ?  1127 VAL A CG1 1 
ATOM   5399  C  CG2 . VAL A 1  1127 ? 197.911 188.406 202.400 1.00 155.08 ?  1127 VAL A CG2 1 
ATOM   5400  N  N   . PRO A 1  1128 ? 195.151 190.543 204.187 1.00 268.34 ?  1128 PRO A N   1 
ATOM   5401  C  CA  . PRO A 1  1128 ? 194.168 191.041 203.213 1.00 278.72 ?  1128 PRO A CA  1 
ATOM   5402  C  C   . PRO A 1  1128 ? 194.851 191.117 201.842 1.00 279.02 ?  1128 PRO A C   1 
ATOM   5403  O  O   . PRO A 1  1128 ? 195.989 191.595 201.773 1.00 270.08 ?  1128 PRO A O   1 
ATOM   5404  C  CB  . PRO A 1  1128 ? 193.805 192.438 203.735 1.00 263.97 ?  1128 PRO A CB  1 
ATOM   5405  C  CG  . PRO A 1  1128 ? 194.895 192.811 204.680 1.00 271.73 ?  1128 PRO A CG  1 
ATOM   5406  C  CD  . PRO A 1  1128 ? 195.401 191.523 205.261 1.00 285.89 ?  1128 PRO A CD  1 
ATOM   5407  N  N   . PRO A 1  1129 ? 194.179 190.628 200.771 1.00 281.67 ?  1129 PRO A N   1 
ATOM   5408  C  CA  . PRO A 1  1129 ? 194.872 190.305 199.513 1.00 272.39 ?  1129 PRO A CA  1 
ATOM   5409  C  C   . PRO A 1  1129 ? 195.665 191.468 198.927 1.00 262.34 ?  1129 PRO A C   1 
ATOM   5410  O  O   . PRO A 1  1129 ? 196.815 191.282 198.526 1.00 275.38 ?  1129 PRO A O   1 
ATOM   5411  C  CB  . PRO A 1  1129 ? 193.733 189.887 198.569 1.00 276.02 ?  1129 PRO A CB  1 
ATOM   5412  C  CG  . PRO A 1  1129 ? 192.502 190.487 199.155 1.00 298.04 ?  1129 PRO A CG  1 
ATOM   5413  C  CD  . PRO A 1  1129 ? 192.717 190.472 200.640 1.00 292.65 ?  1129 PRO A CD  1 
ATOM   5414  N  N   . ASN A 1  1130 ? 195.069 192.657 198.937 1.00 239.93 ?  1130 ASN A N   1 
ATOM   5415  C  CA  . ASN A 1  1130 ? 195.632 193.811 198.251 1.00 222.57 ?  1130 ASN A CA  1 
ATOM   5416  C  C   . ASN A 1  1130 ? 196.782 194.529 198.958 1.00 213.01 ?  1130 ASN A C   1 
ATOM   5417  O  O   . ASN A 1  1130 ? 197.388 195.413 198.359 1.00 241.43 ?  1130 ASN A O   1 
ATOM   5418  C  CB  . ASN A 1  1130 ? 194.530 194.783 197.821 1.00 237.04 ?  1130 ASN A CB  1 
ATOM   5419  C  CG  . ASN A 1  1130 ? 194.099 194.572 196.378 1.00 240.58 ?  1130 ASN A CG  1 
ATOM   5420  O  OD1 . ASN A 1  1130 ? 193.298 193.681 196.070 1.00 248.94 ?  1130 ASN A OD1 1 
ATOM   5421  N  ND2 . ASN A 1  1130 ? 194.634 195.400 195.482 1.00 213.55 ?  1130 ASN A ND2 1 
ATOM   5422  N  N   . MET A 1  1131 ? 197.093 194.151 200.204 1.00 205.64 ?  1131 MET A N   1 
ATOM   5423  C  CA  . MET A 1  1131 ? 198.308 194.615 200.920 1.00 231.49 ?  1131 MET A CA  1 
ATOM   5424  C  C   . MET A 1  1131 ? 199.505 194.775 199.977 1.00 256.47 ?  1131 MET A C   1 
ATOM   5425  O  O   . MET A 1  1131 ? 199.734 193.899 199.130 1.00 305.07 ?  1131 MET A O   1 
ATOM   5426  C  CB  . MET A 1  1131 ? 198.667 193.610 202.022 1.00 247.85 ?  1131 MET A CB  1 
ATOM   5427  C  CG  . MET A 1  1131 ? 200.133 193.584 202.455 1.00 260.40 ?  1131 MET A CG  1 
ATOM   5428  S  SD  . MET A 1  1131 ? 200.810 191.910 202.439 1.00 298.33 ?  1131 MET A SD  1 
ATOM   5429  C  CE  . MET A 1  1131 ? 202.505 192.184 202.954 1.00 256.90 ?  1131 MET A CE  1 
ATOM   5430  N  N   . THR A 1  1132 ? 200.259 195.870 200.126 1.00 239.40 ?  1132 THR A N   1 
ATOM   5431  C  CA  . THR A 1  1132 ? 201.455 196.174 199.284 1.00 239.85 ?  1132 THR A CA  1 
ATOM   5432  C  C   . THR A 1  1132 ? 201.111 196.910 197.976 1.00 217.55 ?  1132 THR A C   1 
ATOM   5433  O  O   . THR A 1  1132 ? 202.001 197.464 197.323 1.00 241.66 ?  1132 THR A O   1 
ATOM   5434  C  CB  . THR A 1  1132 ? 202.389 194.940 199.040 1.00 244.87 ?  1132 THR A CB  1 
ATOM   5435  O  OG1 . THR A 1  1132 ? 202.821 194.419 200.303 1.00 267.32 ?  1132 THR A OG1 1 
ATOM   5436  C  CG2 . THR A 1  1132 ? 203.631 195.274 198.174 1.00 201.27 ?  1132 THR A CG2 1 
ATOM   5437  N  N   . SER A 1  1133 ? 199.832 196.941 197.608 1.00 181.79 ?  1133 SER A N   1 
ATOM   5438  C  CA  . SER A 1  1133 ? 199.413 197.779 196.501 1.00 157.91 ?  1133 SER A CA  1 
ATOM   5439  C  C   . SER A 1  1133 ? 199.584 199.220 196.919 1.00 150.21 ?  1133 SER A C   1 
ATOM   5440  O  O   . SER A 1  1133 ? 200.031 200.032 196.113 1.00 144.69 ?  1133 SER A O   1 
ATOM   5441  C  CB  . SER A 1  1133 ? 197.969 197.565 196.124 1.00 157.31 ?  1133 SER A CB  1 
ATOM   5442  O  OG  . SER A 1  1133 ? 197.199 198.584 196.722 1.00 179.90 ?  1133 SER A OG  1 
ATOM   5443  N  N   . TRP A 1  1134 ? 199.262 199.535 198.175 1.00 168.72 ?  1134 TRP A N   1 
ATOM   5444  C  CA  . TRP A 1  1134 ? 199.513 200.898 198.653 1.00 263.04 ?  1134 TRP A CA  1 
ATOM   5445  C  C   . TRP A 1  1134 ? 201.007 201.285 198.880 1.00 326.29 ?  1134 TRP A C   1 
ATOM   5446  O  O   . TRP A 1  1134 ? 201.468 202.344 198.403 1.00 337.15 ?  1134 TRP A O   1 
ATOM   5447  C  CB  . TRP A 1  1134 ? 198.557 201.291 199.792 1.00 284.21 ?  1134 TRP A CB  1 
ATOM   5448  C  CG  . TRP A 1  1134 ? 197.298 201.944 199.227 1.00 303.29 ?  1134 TRP A CG  1 
ATOM   5449  C  CD1 . TRP A 1  1134 ? 196.014 201.454 199.269 1.00 256.78 ?  1134 TRP A CD1 1 
ATOM   5450  C  CD2 . TRP A 1  1134 ? 197.228 203.187 198.500 1.00 321.36 ?  1134 TRP A CD2 1 
ATOM   5451  N  NE1 . TRP A 1  1134 ? 195.153 202.324 198.632 1.00 237.05 ?  1134 TRP A NE1 1 
ATOM   5452  C  CE2 . TRP A 1  1134 ? 195.869 203.394 198.153 1.00 300.27 ?  1134 TRP A CE2 1 
ATOM   5453  C  CE3 . TRP A 1  1134 ? 198.185 204.152 198.112 1.00 306.49 ?  1134 TRP A CE3 1 
ATOM   5454  C  CZ2 . TRP A 1  1134 ? 195.444 204.526 197.426 1.00 302.11 ?  1134 TRP A CZ2 1 
ATOM   5455  C  CZ3 . TRP A 1  1134 ? 197.760 205.283 197.395 1.00 267.15 ?  1134 TRP A CZ3 1 
ATOM   5456  C  CH2 . TRP A 1  1134 ? 196.401 205.455 197.062 1.00 286.93 ?  1134 TRP A CH2 1 
ATOM   5457  N  N   . ALA A 1  1135 ? 201.750 200.395 199.545 1.00 386.41 ?  1135 ALA A N   1 
ATOM   5458  C  CA  . ALA A 1  1135 ? 203.208 200.525 199.770 1.00 388.12 ?  1135 ALA A CA  1 
ATOM   5459  C  C   . ALA A 1  1135 ? 204.038 200.770 198.502 1.00 394.10 ?  1135 ALA A C   1 
ATOM   5460  O  O   . ALA A 1  1135 ? 204.929 201.642 198.486 1.00 391.50 ?  1135 ALA A O   1 
ATOM   5461  C  CB  . ALA A 1  1135 ? 203.732 199.290 200.483 1.00 402.20 ?  1135 ALA A CB  1 
ATOM   5462  N  N   . SER A 1  1136 ? 203.735 199.986 197.461 1.00 389.83 ?  1136 SER A N   1 
ATOM   5463  C  CA  . SER A 1  1136 ? 204.424 200.044 196.167 1.00 347.74 ?  1136 SER A CA  1 
ATOM   5464  C  C   . SER A 1  1136 ? 204.251 201.424 195.547 1.00 334.44 ?  1136 SER A C   1 
ATOM   5465  O  O   . SER A 1  1136 ? 205.235 202.030 195.096 1.00 340.02 ?  1136 SER A O   1 
ATOM   5466  C  CB  . SER A 1  1136 ? 203.905 198.948 195.227 1.00 325.37 ?  1136 SER A CB  1 
ATOM   5467  O  OG  . SER A 1  1136 ? 204.963 198.347 194.497 1.00 289.51 ?  1136 SER A OG  1 
ATOM   5468  N  N   . PHE A 1  1137 ? 203.010 201.928 195.573 1.00 311.43 ?  1137 PHE A N   1 
ATOM   5469  C  CA  . PHE A 1  1137 ? 202.702 203.273 195.084 1.00 303.87 ?  1137 PHE A CA  1 
ATOM   5470  C  C   . PHE A 1  1137 ? 203.649 204.306 195.697 1.00 351.79 ?  1137 PHE A C   1 
ATOM   5471  O  O   . PHE A 1  1137 ? 204.333 205.040 194.971 1.00 374.63 ?  1137 PHE A O   1 
ATOM   5472  C  CB  . PHE A 1  1137 ? 201.234 203.683 195.326 1.00 227.53 ?  1137 PHE A CB  1 
ATOM   5473  C  CG  . PHE A 1  1137 ? 200.914 205.059 194.795 1.00 172.34 ?  1137 PHE A CG  1 
ATOM   5474  C  CD1 . PHE A 1  1137 ? 200.507 205.222 193.477 1.00 129.71 ?  1137 PHE A CD1 1 
ATOM   5475  C  CD2 . PHE A 1  1137 ? 201.088 206.203 195.592 1.00 167.12 ?  1137 PHE A CD2 1 
ATOM   5476  C  CE1 . PHE A 1  1137 ? 200.247 206.484 192.974 1.00 117.40 ?  1137 PHE A CE1 1 
ATOM   5477  C  CE2 . PHE A 1  1137 ? 200.833 207.473 195.088 1.00 135.32 ?  1137 PHE A CE2 1 
ATOM   5478  C  CZ  . PHE A 1  1137 ? 200.418 207.610 193.774 1.00 122.12 ?  1137 PHE A CZ  1 
ATOM   5479  N  N   . HIS A 1  1138 ? 203.686 204.337 197.028 1.00 381.10 ?  1138 HIS A N   1 
ATOM   5480  C  CA  . HIS A 1  1138 ? 204.538 205.260 197.773 1.00 383.36 ?  1138 HIS A CA  1 
ATOM   5481  C  C   . HIS A 1  1138 ? 206.016 205.118 197.363 1.00 392.42 ?  1138 HIS A C   1 
ATOM   5482  O  O   . HIS A 1  1138 ? 206.694 206.122 197.085 1.00 407.99 ?  1138 HIS A O   1 
ATOM   5483  C  CB  . HIS A 1  1138 ? 204.306 205.086 199.281 1.00 376.00 ?  1138 HIS A CB  1 
ATOM   5484  C  CG  . HIS A 1  1138 ? 202.904 205.405 199.710 1.00 370.77 ?  1138 HIS A CG  1 
ATOM   5485  N  ND1 . HIS A 1  1138 ? 201.978 204.432 200.022 1.00 362.13 ?  1138 HIS A ND1 1 
ATOM   5486  C  CD2 . HIS A 1  1138 ? 202.264 206.591 199.853 1.00 372.98 ?  1138 HIS A CD2 1 
ATOM   5487  C  CE1 . HIS A 1  1138 ? 200.833 205.006 200.348 1.00 362.99 ?  1138 HIS A CE1 1 
ATOM   5488  N  NE2 . HIS A 1  1138 ? 200.981 206.315 200.257 1.00 368.74 ?  1138 HIS A NE2 1 
ATOM   5489  N  N   . ASN A 1  1139 ? 206.462 203.862 197.269 1.00 394.24 ?  1139 ASN A N   1 
ATOM   5490  C  CA  . ASN A 1  1139 ? 207.802 203.485 196.798 1.00 380.71 ?  1139 ASN A CA  1 
ATOM   5491  C  C   . ASN A 1  1139 ? 208.224 204.163 195.469 1.00 364.65 ?  1139 ASN A C   1 
ATOM   5492  O  O   . ASN A 1  1139 ? 209.325 204.728 195.373 1.00 377.11 ?  1139 ASN A O   1 
ATOM   5493  C  CB  . ASN A 1  1139 ? 207.893 201.947 196.733 1.00 393.63 ?  1139 ASN A CB  1 
ATOM   5494  C  CG  . ASN A 1  1139 ? 209.241 201.444 196.246 1.00 396.50 ?  1139 ASN A CG  1 
ATOM   5495  O  OD1 . ASN A 1  1139 ? 210.284 201.747 196.824 1.00 410.82 ?  1139 ASN A OD1 1 
ATOM   5496  N  ND2 . ASN A 1  1139 ? 209.219 200.645 195.190 1.00 390.85 ?  1139 ASN A ND2 1 
ATOM   5497  N  N   . GLY A 1  1140 ? 207.331 204.137 194.477 1.00 326.65 ?  1140 GLY A N   1 
ATOM   5498  C  CA  . GLY A 1  1140 ? 207.560 204.769 193.163 1.00 267.22 ?  1140 GLY A CA  1 
ATOM   5499  C  C   . GLY A 1  1140 ? 207.610 206.295 193.095 1.00 216.25 ?  1140 GLY A C   1 
ATOM   5500  O  O   . GLY A 1  1140 ? 208.499 206.865 192.437 1.00 212.69 ?  1140 GLY A O   1 
ATOM   5501  N  N   . VAL A 1  1141 ? 206.637 206.948 193.735 1.00 138.70 ?  1141 VAL A N   1 
ATOM   5502  C  CA  . VAL A 1  1141 ? 206.654 208.386 193.962 1.00 124.86 ?  1141 VAL A CA  1 
ATOM   5503  C  C   . VAL A 1  1141 ? 207.932 208.829 194.685 1.00 209.55 ?  1141 VAL A C   1 
ATOM   5504  O  O   . VAL A 1  1141 ? 208.492 209.861 194.331 1.00 243.84 ?  1141 VAL A O   1 
ATOM   5505  C  CB  . VAL A 1  1141 ? 205.546 208.805 194.913 1.00 113.66 ?  1141 VAL A CB  1 
ATOM   5506  C  CG1 . VAL A 1  1141 ? 205.333 210.310 194.857 1.00 120.69 ?  1141 VAL A CG1 1 
ATOM   5507  C  CG2 . VAL A 1  1141 ? 204.269 208.046 194.663 1.00 104.93 ?  1141 VAL A CG2 1 
ATOM   5508  N  N   . ALA A 1  1142 ? 208.359 208.076 195.715 1.00 287.16 ?  1142 ALA A N   1 
ATOM   5509  C  CA  . ALA A 1  1142 ? 209.595 208.359 196.490 1.00 287.18 ?  1142 ALA A CA  1 
ATOM   5510  C  C   . ALA A 1  1142 ? 210.844 208.487 195.597 1.00 300.62 ?  1142 ALA A C   1 
ATOM   5511  O  O   . ALA A 1  1142 ? 211.609 209.458 195.717 1.00 238.90 ?  1142 ALA A O   1 
ATOM   5512  C  CB  . ALA A 1  1142 ? 209.810 207.302 197.574 1.00 276.93 ?  1142 ALA A CB  1 
ATOM   5513  N  N   . ALA A 1  1143 ? 211.008 207.514 194.693 1.00 329.42 ?  1143 ALA A N   1 
ATOM   5514  C  CA  . ALA A 1  1143 ? 212.069 207.501 193.675 1.00 314.13 ?  1143 ALA A CA  1 
ATOM   5515  C  C   . ALA A 1  1143 ? 211.947 208.663 192.665 1.00 314.51 ?  1143 ALA A C   1 
ATOM   5516  O  O   . ALA A 1  1143 ? 212.940 209.329 192.365 1.00 273.64 ?  1143 ALA A O   1 
ATOM   5517  C  CB  . ALA A 1  1143 ? 212.098 206.151 192.965 1.00 294.00 ?  1143 ALA A CB  1 
ATOM   5518  N  N   . GLY A 1  1144 ? 210.733 208.903 192.160 1.00 328.13 ?  1144 GLY A N   1 
ATOM   5519  C  CA  . GLY A 1  1144 ? 210.437 210.038 191.267 1.00 294.08 ?  1144 GLY A CA  1 
ATOM   5520  C  C   . GLY A 1  1144 ? 210.497 211.438 191.885 1.00 286.00 ?  1144 GLY A C   1 
ATOM   5521  O  O   . GLY A 1  1144 ? 210.536 212.441 191.156 1.00 219.63 ?  1144 GLY A O   1 
ATOM   5522  N  N   . LEU A 1  1145 ? 210.475 211.511 193.223 1.00 297.05 ?  1145 LEU A N   1 
ATOM   5523  C  CA  . LEU A 1  1145 ? 210.658 212.778 193.966 1.00 254.26 ?  1145 LEU A CA  1 
ATOM   5524  C  C   . LEU A 1  1145 ? 212.114 213.245 193.994 1.00 251.24 ?  1145 LEU A C   1 
ATOM   5525  O  O   . LEU A 1  1145 ? 212.377 214.460 194.075 1.00 161.39 ?  1145 LEU A O   1 
ATOM   5526  C  CB  . LEU A 1  1145 ? 210.064 212.708 195.392 1.00 190.45 ?  1145 LEU A CB  1 
ATOM   5527  C  CG  . LEU A 1  1145 ? 208.542 212.930 195.426 1.00 145.39 ?  1145 LEU A CG  1 
ATOM   5528  C  CD1 . LEU A 1  1145 ? 207.973 212.736 196.803 1.00 104.23 ?  1145 LEU A CD1 1 
ATOM   5529  C  CD2 . LEU A 1  1145 ? 208.105 214.268 194.843 1.00 125.92 ?  1145 LEU A CD2 1 
ATOM   5530  N  N   . LYS A 1  1146 ? 213.043 212.280 193.900 1.00 272.34 ?  1146 LYS A N   1 
ATOM   5531  C  CA  . LYS A 1  1146 ? 214.490 212.568 193.860 1.00 269.74 ?  1146 LYS A CA  1 
ATOM   5532  C  C   . LYS A 1  1146 ? 214.951 213.291 192.571 1.00 294.33 ?  1146 LYS A C   1 
ATOM   5533  O  O   . LYS A 1  1146 ? 215.963 213.989 192.587 1.00 304.20 ?  1146 LYS A O   1 
ATOM   5534  C  CB  . LYS A 1  1146 ? 215.364 211.346 194.284 1.00 226.53 ?  1146 LYS A CB  1 
ATOM   5535  C  CG  . LYS A 1  1146 ? 215.961 210.438 193.217 1.00 233.86 ?  1146 LYS A CG  1 
ATOM   5536  C  CD  . LYS A 1  1146 ? 217.331 209.905 193.660 1.00 233.85 ?  1146 LYS A CD  1 
ATOM   5537  C  CE  . LYS A 1  1146 ? 217.327 208.440 194.098 1.00 256.50 ?  1146 LYS A CE  1 
ATOM   5538  N  NZ  . LYS A 1  1146 ? 217.029 208.193 195.542 1.00 220.87 ?  1146 LYS A NZ  1 
ATOM   5539  N  N   . ILE A 1  1147 ? 214.178 213.159 191.490 1.00 280.10 ?  1147 ILE A N   1 
ATOM   5540  C  CA  . ILE A 1  1147 ? 214.387 213.917 190.242 1.00 195.42 ?  1147 ILE A CA  1 
ATOM   5541  C  C   . ILE A 1  1147 ? 214.254 215.417 190.531 1.00 162.48 ?  1147 ILE A C   1 
ATOM   5542  O  O   . ILE A 1  1147 ? 213.257 215.851 191.091 1.00 138.21 ?  1147 ILE A O   1 
ATOM   5543  C  CB  . ILE A 1  1147 ? 213.407 213.449 189.144 1.00 188.72 ?  1147 ILE A CB  1 
ATOM   5544  C  CG1 . ILE A 1  1147 ? 213.585 211.937 188.895 1.00 185.54 ?  1147 ILE A CG1 1 
ATOM   5545  C  CG2 . ILE A 1  1147 ? 213.558 214.295 187.884 1.00 172.82 ?  1147 ILE A CG2 1 
ATOM   5546  C  CD1 . ILE A 1  1147 ? 212.380 211.229 188.306 1.00 199.56 ?  1147 ILE A CD1 1 
ATOM   5547  N  N   . ALA A 1  1148 ? 215.285 216.184 190.199 1.00 153.87 ?  1148 ALA A N   1 
ATOM   5548  C  CA  . ALA A 1  1148 ? 215.304 217.621 190.494 1.00 163.45 ?  1148 ALA A CA  1 
ATOM   5549  C  C   . ALA A 1  1148 ? 214.402 218.453 189.528 1.00 155.94 ?  1148 ALA A C   1 
ATOM   5550  O  O   . ALA A 1  1148 ? 214.272 218.104 188.346 1.00 143.02 ?  1148 ALA A O   1 
ATOM   5551  C  CB  . ALA A 1  1148 ? 216.741 218.128 190.532 1.00 144.51 ?  1148 ALA A CB  1 
ATOM   5552  N  N   . PRO A 1  1149 ? 213.761 219.538 190.031 1.00 146.21 ?  1149 PRO A N   1 
ATOM   5553  C  CA  . PRO A 1  1149 ? 212.786 220.242 189.195 1.00 155.31 ?  1149 PRO A CA  1 
ATOM   5554  C  C   . PRO A 1  1149 ? 213.415 221.065 188.101 1.00 158.17 ?  1149 PRO A C   1 
ATOM   5555  O  O   . PRO A 1  1149 ? 212.755 221.364 187.108 1.00 175.50 ?  1149 PRO A O   1 
ATOM   5556  C  CB  . PRO A 1  1149 ? 212.058 221.163 190.185 1.00 161.26 ?  1149 PRO A CB  1 
ATOM   5557  C  CG  . PRO A 1  1149 ? 212.346 220.591 191.525 1.00 157.56 ?  1149 PRO A CG  1 
ATOM   5558  C  CD  . PRO A 1  1149 ? 213.756 220.088 191.394 1.00 155.36 ?  1149 PRO A CD  1 
ATOM   5559  N  N   . ALA A 1  1150 ? 214.674 221.433 188.291 1.00 164.64 ?  1150 ALA A N   1 
ATOM   5560  C  CA  . ALA A 1  1150 ? 215.409 222.157 187.270 1.00 213.58 ?  1150 ALA A CA  1 
ATOM   5561  C  C   . ALA A 1  1150 ? 215.595 221.363 185.951 1.00 223.80 ?  1150 ALA A C   1 
ATOM   5562  O  O   . ALA A 1  1150 ? 215.346 221.914 184.870 1.00 227.76 ?  1150 ALA A O   1 
ATOM   5563  C  CB  . ALA A 1  1150 ? 216.744 222.640 187.826 1.00 245.25 ?  1150 ALA A CB  1 
ATOM   5564  N  N   . SER A 1  1151 ? 215.985 220.081 186.047 1.00 219.08 ?  1151 SER A N   1 
ATOM   5565  C  CA  . SER A 1  1151 ? 216.450 219.305 184.873 1.00 212.57 ?  1151 SER A CA  1 
ATOM   5566  C  C   . SER A 1  1151 ? 215.361 218.933 183.880 1.00 218.62 ?  1151 SER A C   1 
ATOM   5567  O  O   . SER A 1  1151 ? 214.184 218.779 184.239 1.00 204.96 ?  1151 SER A O   1 
ATOM   5568  C  CB  . SER A 1  1151 ? 217.270 218.061 185.255 1.00 199.86 ?  1151 SER A CB  1 
ATOM   5569  O  OG  . SER A 1  1151 ? 216.462 216.966 185.638 1.00 183.99 ?  1151 SER A OG  1 
ATOM   5570  N  N   . GLN A 1  1152 ? 215.805 218.769 182.634 1.00 215.70 ?  1152 GLN A N   1 
ATOM   5571  C  CA  . GLN A 1  1152 ? 214.959 218.458 181.493 1.00 187.95 ?  1152 GLN A CA  1 
ATOM   5572  C  C   . GLN A 1  1152 ? 214.649 216.985 181.459 1.00 178.69 ?  1152 GLN A C   1 
ATOM   5573  O  O   . GLN A 1  1152 ? 215.532 216.139 181.618 1.00 168.69 ?  1152 GLN A O   1 
ATOM   5574  C  CB  . GLN A 1  1152 ? 215.646 218.876 180.183 1.00 166.39 ?  1152 GLN A CB  1 
ATOM   5575  C  CG  . GLN A 1  1152 ? 215.222 220.237 179.636 1.00 181.80 ?  1152 GLN A CG  1 
ATOM   5576  C  CD  . GLN A 1  1152 ? 215.636 221.428 180.506 1.00 197.34 ?  1152 GLN A CD  1 
ATOM   5577  O  OE1 . GLN A 1  1152 ? 216.809 221.592 180.847 1.00 222.97 ?  1152 GLN A OE1 1 
ATOM   5578  N  NE2 . GLN A 1  1152 ? 214.667 222.277 180.853 1.00 196.01 ?  1152 GLN A NE2 1 
ATOM   5579  N  N   . ILE A 1  1153 ? 213.376 216.684 181.295 1.00 210.83 ?  1153 ILE A N   1 
ATOM   5580  C  CA  . ILE A 1  1153 ? 212.981 215.356 180.863 1.00 311.80 ?  1153 ILE A CA  1 
ATOM   5581  C  C   . ILE A 1  1153 ? 212.027 215.482 179.673 1.00 374.94 ?  1153 ILE A C   1 
ATOM   5582  O  O   . ILE A 1  1153 ? 211.128 216.333 179.670 1.00 406.14 ?  1153 ILE A O   1 
ATOM   5583  C  CB  . ILE A 1  1153 ? 212.432 214.454 182.010 1.00 324.15 ?  1153 ILE A CB  1 
ATOM   5584  C  CG1 . ILE A 1  1153 ? 211.218 215.077 182.714 1.00 323.45 ?  1153 ILE A CG1 1 
ATOM   5585  C  CG2 . ILE A 1  1153 ? 213.539 214.090 183.004 1.00 307.41 ?  1153 ILE A CG2 1 
ATOM   5586  C  CD1 . ILE A 1  1153 ? 210.283 214.050 183.322 1.00 318.40 ?  1153 ILE A CD1 1 
ATOM   5587  N  N   . ASP A 1  1154 ? 212.274 214.669 178.646 1.00 428.28 ?  1154 ASP A N   1 
ATOM   5588  C  CA  . ASP A 1  1154 ? 211.398 214.596 177.475 1.00 441.51 ?  1154 ASP A CA  1 
ATOM   5589  C  C   . ASP A 1  1154 ? 210.278 213.572 177.692 1.00 460.32 ?  1154 ASP A C   1 
ATOM   5590  O  O   . ASP A 1  1154 ? 210.378 212.710 178.576 1.00 468.55 ?  1154 ASP A O   1 
ATOM   5591  C  CB  . ASP A 1  1154 ? 212.199 214.338 176.178 1.00 433.37 ?  1154 ASP A CB  1 
ATOM   5592  C  CG  . ASP A 1  1154 ? 212.954 213.003 176.178 1.00 424.69 ?  1154 ASP A CG  1 
ATOM   5593  O  OD1 . ASP A 1  1154 ? 213.518 212.598 177.218 1.00 418.80 ?  1154 ASP A OD1 1 
ATOM   5594  O  OD2 . ASP A 1  1154 ? 213.005 212.364 175.106 1.00 416.60 -1 1154 ASP A OD2 1 
ATOM   5595  N  N   . SER A 1  1155 ? 209.212 213.696 176.898 1.00 468.01 ?  1155 SER A N   1 
ATOM   5596  C  CA  . SER A 1  1155 ? 208.015 212.845 176.986 1.00 475.07 ?  1155 SER A CA  1 
ATOM   5597  C  C   . SER A 1  1155 ? 208.329 211.334 176.965 1.00 481.55 ?  1155 SER A C   1 
ATOM   5598  O  O   . SER A 1  1155 ? 207.832 210.573 177.811 1.00 499.72 ?  1155 SER A O   1 
ATOM   5599  C  CB  . SER A 1  1155 ? 207.029 213.234 175.874 1.00 475.59 ?  1155 SER A CB  1 
ATOM   5600  O  OG  . SER A 1  1155 ? 205.966 212.306 175.751 1.00 472.86 ?  1155 SER A OG  1 
ATOM   5601  N  N   . ALA A 1  1156 ? 209.182 210.932 176.019 1.00 480.00 ?  1156 ALA A N   1 
ATOM   5602  C  CA  . ALA A 1  1156 ? 209.595 209.535 175.826 1.00 476.02 ?  1156 ALA A CA  1 
ATOM   5603  C  C   . ALA A 1  1156 ? 210.305 208.891 177.029 1.00 480.00 ?  1156 ALA A C   1 
ATOM   5604  O  O   . ALA A 1  1156 ? 210.254 207.667 177.186 1.00 480.00 ?  1156 ALA A O   1 
ATOM   5605  C  CB  . ALA A 1  1156 ? 210.452 209.412 174.575 1.00 461.65 ?  1156 ALA A CB  1 
ATOM   5606  N  N   . TRP A 1  1157 ? 210.956 209.714 177.859 1.00 478.19 ?  1157 TRP A N   1 
ATOM   5607  C  CA  . TRP A 1  1157 ? 211.641 209.252 179.081 1.00 469.19 ?  1157 TRP A CA  1 
ATOM   5608  C  C   . TRP A 1  1157 ? 210.668 208.766 180.154 1.00 488.25 ?  1157 TRP A C   1 
ATOM   5609  O  O   . TRP A 1  1157 ? 210.935 207.760 180.812 1.00 500.00 ?  1157 TRP A O   1 
ATOM   5610  C  CB  . TRP A 1  1157 ? 212.563 210.336 179.655 1.00 426.69 ?  1157 TRP A CB  1 
ATOM   5611  C  CG  . TRP A 1  1157 ? 213.424 209.867 180.816 1.00 388.43 ?  1157 TRP A CG  1 
ATOM   5612  C  CD1 . TRP A 1  1157 ? 214.599 209.173 180.734 1.00 376.23 ?  1157 TRP A CD1 1 
ATOM   5613  C  CD2 . TRP A 1  1157 ? 213.176 210.067 182.218 1.00 351.86 ?  1157 TRP A CD2 1 
ATOM   5614  N  NE1 . TRP A 1  1157 ? 215.099 208.928 181.994 1.00 341.45 ?  1157 TRP A NE1 1 
ATOM   5615  C  CE2 . TRP A 1  1157 ? 214.250 209.466 182.923 1.00 323.99 ?  1157 TRP A CE2 1 
ATOM   5616  C  CE3 . TRP A 1  1157 ? 212.154 210.696 182.950 1.00 321.23 ?  1157 TRP A CE3 1 
ATOM   5617  C  CZ2 . TRP A 1  1157 ? 214.331 209.473 184.322 1.00 274.74 ?  1157 TRP A CZ2 1 
ATOM   5618  C  CZ3 . TRP A 1  1157 ? 212.238 210.706 184.347 1.00 280.87 ?  1157 TRP A CZ3 1 
ATOM   5619  C  CH2 . TRP A 1  1157 ? 213.322 210.091 185.015 1.00 276.37 ?  1157 TRP A CH2 1 
ATOM   5620  N  N   . ILE A 1  1158 ? 209.557 209.488 180.327 1.00 489.61 ?  1158 ILE A N   1 
ATOM   5621  C  CA  . ILE A 1  1158 ? 208.452 209.058 181.202 1.00 469.73 ?  1158 ILE A CA  1 
ATOM   5622  C  C   . ILE A 1  1158 ? 207.929 207.686 180.738 1.00 500.00 ?  1158 ILE A C   1 
ATOM   5623  O  O   . ILE A 1  1158 ? 207.775 206.774 181.559 1.00 500.00 ?  1158 ILE A O   1 
ATOM   5624  C  CB  . ILE A 1  1158 ? 207.331 210.134 181.302 1.00 428.00 ?  1158 ILE A CB  1 
ATOM   5625  C  CG1 . ILE A 1  1158 ? 207.883 211.413 181.946 1.00 386.06 ?  1158 ILE A CG1 1 
ATOM   5626  C  CG2 . ILE A 1  1158 ? 206.140 209.634 182.118 1.00 408.64 ?  1158 ILE A CG2 1 
ATOM   5627  C  CD1 . ILE A 1  1158 ? 207.289 212.701 181.413 1.00 359.53 ?  1158 ILE A CD1 1 
ATOM   5628  N  N   . VAL A 1  1159 ? 207.722 207.543 179.424 1.00 500.00 ?  1159 VAL A N   1 
ATOM   5629  C  CA  . VAL A 1  1159 ? 207.325 206.270 178.785 1.00 500.00 ?  1159 VAL A CA  1 
ATOM   5630  C  C   . VAL A 1  1159 ? 208.371 205.160 179.025 1.00 500.00 ?  1159 VAL A C   1 
ATOM   5631  O  O   . VAL A 1  1159 ? 208.009 204.008 179.289 1.00 500.00 ?  1159 VAL A O   1 
ATOM   5632  C  CB  . VAL A 1  1159 ? 207.036 206.445 177.262 1.00 500.00 ?  1159 VAL A CB  1 
ATOM   5633  C  CG1 . VAL A 1  1159 ? 206.463 205.171 176.649 1.00 481.35 ?  1159 VAL A CG1 1 
ATOM   5634  C  CG2 . VAL A 1  1159 ? 206.075 207.602 177.010 1.00 493.60 ?  1159 VAL A CG2 1 
ATOM   5635  N  N   . TYR A 1  1160 ? 209.652 205.531 178.960 1.00 500.00 ?  1160 TYR A N   1 
ATOM   5636  C  CA  . TYR A 1  1160 ? 210.790 204.615 179.155 1.00 500.00 ?  1160 TYR A CA  1 
ATOM   5637  C  C   . TYR A 1  1160 ? 210.892 204.004 180.569 1.00 500.00 ?  1160 TYR A C   1 
ATOM   5638  O  O   . TYR A 1  1160 ? 211.468 202.922 180.736 1.00 500.00 ?  1160 TYR A O   1 
ATOM   5639  C  CB  . TYR A 1  1160 ? 212.099 205.325 178.756 1.00 492.69 ?  1160 TYR A CB  1 
ATOM   5640  C  CG  . TYR A 1  1160 ? 213.368 204.490 178.833 1.00 480.00 ?  1160 TYR A CG  1 
ATOM   5641  C  CD1 . TYR A 1  1160 ? 213.568 203.391 177.984 1.00 475.57 ?  1160 TYR A CD1 1 
ATOM   5642  C  CD2 . TYR A 1  1160 ? 214.382 204.816 179.743 1.00 474.67 ?  1160 TYR A CD2 1 
ATOM   5643  C  CE1 . TYR A 1  1160 ? 214.730 202.630 178.057 1.00 470.07 ?  1160 TYR A CE1 1 
ATOM   5644  C  CE2 . TYR A 1  1160 ? 215.550 204.066 179.818 1.00 471.23 ?  1160 TYR A CE2 1 
ATOM   5645  C  CZ  . TYR A 1  1160 ? 215.719 202.976 178.976 1.00 469.80 ?  1160 TYR A CZ  1 
ATOM   5646  O  OH  . TYR A 1  1160 ? 216.875 202.235 179.050 1.00 470.90 ?  1160 TYR A OH  1 
ATOM   5647  N  N   . ASN A 1  1161 ? 210.328 204.689 181.566 1.00 500.00 ?  1161 ASN A N   1 
ATOM   5648  C  CA  . ASN A 1  1161 ? 210.354 204.226 182.964 1.00 500.00 ?  1161 ASN A CA  1 
ATOM   5649  C  C   . ASN A 1  1161 ? 209.229 203.242 183.351 1.00 500.00 ?  1161 ASN A C   1 
ATOM   5650  O  O   . ASN A 1  1161 ? 209.300 202.607 184.412 1.00 500.00 ?  1161 ASN A O   1 
ATOM   5651  C  CB  . ASN A 1  1161 ? 210.396 205.415 183.934 1.00 497.51 ?  1161 ASN A CB  1 
ATOM   5652  C  CG  . ASN A 1  1161 ? 211.764 206.089 183.993 1.00 499.70 ?  1161 ASN A CG  1 
ATOM   5653  O  OD1 . ASN A 1  1161 ? 212.106 206.908 183.140 1.00 500.00 ?  1161 ASN A OD1 1 
ATOM   5654  N  ND2 . ASN A 1  1161 ? 212.538 205.770 185.026 1.00 493.94 ?  1161 ASN A ND2 1 
ATOM   5655  N  N   . LYS A 1  1162 ? 208.210 203.127 182.490 1.00 500.00 ?  1162 LYS A N   1 
ATOM   5656  C  CA  . LYS A 1  1162 ? 207.144 202.112 182.600 1.00 500.00 ?  1162 LYS A CA  1 
ATOM   5657  C  C   . LYS A 1  1162 ? 207.757 200.699 182.656 1.00 500.00 ?  1162 LYS A C   1 
ATOM   5658  O  O   . LYS A 1  1162 ? 208.541 200.339 181.772 1.00 500.00 ?  1162 LYS A O   1 
ATOM   5659  C  CB  . LYS A 1  1162 ? 206.156 202.264 181.430 1.00 500.00 ?  1162 LYS A CB  1 
ATOM   5660  C  CG  . LYS A 1  1162 ? 204.941 201.338 181.435 1.00 480.05 ?  1162 LYS A CG  1 
ATOM   5661  C  CD  . LYS A 1  1162 ? 203.762 201.933 180.674 1.00 464.28 ?  1162 LYS A CD  1 
ATOM   5662  C  CE  . LYS A 1  1162 ? 203.903 201.803 179.163 1.00 449.99 ?  1162 LYS A CE  1 
ATOM   5663  N  NZ  . LYS A 1  1162 ? 202.980 202.731 178.452 1.00 442.27 ?  1162 LYS A NZ  1 
ATOM   5664  N  N   . PRO A 1  1163 ? 207.405 199.902 183.695 1.00 500.00 ?  1163 PRO A N   1 
ATOM   5665  C  CA  . PRO A 1  1163 ? 208.175 198.693 184.023 1.00 498.73 ?  1163 PRO A CA  1 
ATOM   5666  C  C   . PRO A 1  1163 ? 207.983 197.483 183.090 1.00 497.21 ?  1163 PRO A C   1 
ATOM   5667  O  O   . PRO A 1  1163 ? 208.815 196.570 183.116 1.00 500.00 ?  1163 PRO A O   1 
ATOM   5668  C  CB  . PRO A 1  1163 ? 207.703 198.356 185.442 1.00 486.28 ?  1163 PRO A CB  1 
ATOM   5669  C  CG  . PRO A 1  1163 ? 206.304 198.870 185.506 1.00 482.15 ?  1163 PRO A CG  1 
ATOM   5670  C  CD  . PRO A 1  1163 ? 206.200 200.024 184.545 1.00 492.10 ?  1163 PRO A CD  1 
ATOM   5671  N  N   . LYS A 1  1164 ? 206.907 197.490 182.291 1.00 481.71 ?  1164 LYS A N   1 
ATOM   5672  C  CA  . LYS A 1  1164 ? 206.478 196.380 181.391 1.00 454.14 ?  1164 LYS A CA  1 
ATOM   5673  C  C   . LYS A 1  1164 ? 206.298 194.980 182.035 1.00 447.01 ?  1164 LYS A C   1 
ATOM   5674  O  O   . LYS A 1  1164 ? 205.950 194.008 181.352 1.00 466.58 ?  1164 LYS A O   1 
ATOM   5675  C  CB  . LYS A 1  1164 ? 207.294 196.342 180.073 1.00 438.48 ?  1164 LYS A CB  1 
ATOM   5676  C  CG  . LYS A 1  1164 ? 208.664 195.676 180.123 1.00 428.65 ?  1164 LYS A CG  1 
ATOM   5677  C  CD  . LYS A 1  1164 ? 209.421 195.872 178.817 1.00 417.39 ?  1164 LYS A CD  1 
ATOM   5678  C  CE  . LYS A 1  1164 ? 210.878 195.447 178.934 1.00 411.04 ?  1164 LYS A CE  1 
ATOM   5679  N  NZ  . LYS A 1  1164 ? 211.055 193.968 178.982 1.00 409.21 ?  1164 LYS A NZ  1 
ATOM   5680  N  N   . HIS A 1  1165 ? 206.513 194.911 183.349 1.00 405.24 ?  1165 HIS A N   1 
ATOM   5681  C  CA  . HIS A 1  1165 ? 206.350 193.699 184.164 1.00 328.95 ?  1165 HIS A CA  1 
ATOM   5682  C  C   . HIS A 1  1165 ? 204.871 193.375 184.430 1.00 244.39 ?  1165 HIS A C   1 
ATOM   5683  O  O   . HIS A 1  1165 ? 204.528 192.215 184.697 1.00 152.89 ?  1165 HIS A O   1 
ATOM   5684  C  CB  . HIS A 1  1165 ? 207.114 193.885 185.482 1.00 386.54 ?  1165 HIS A CB  1 
ATOM   5685  C  CG  . HIS A 1  1165 ? 207.181 192.659 186.339 1.00 420.20 ?  1165 HIS A CG  1 
ATOM   5686  N  ND1 . HIS A 1  1165 ? 208.235 191.770 186.290 1.00 429.06 ?  1165 HIS A ND1 1 
ATOM   5687  C  CD2 . HIS A 1  1165 ? 206.336 192.187 187.285 1.00 428.64 ?  1165 HIS A CD2 1 
ATOM   5688  C  CE1 . HIS A 1  1165 ? 208.027 190.796 187.158 1.00 432.92 ?  1165 HIS A CE1 1 
ATOM   5689  N  NE2 . HIS A 1  1165 ? 206.883 191.026 187.776 1.00 434.08 ?  1165 HIS A NE2 1 
ATOM   5690  N  N   . ALA A 1  1166 ? 204.031 194.420 184.361 1.00 234.12 ?  1166 ALA A N   1 
ATOM   5691  C  CA  . ALA A 1  1166 ? 202.551 194.403 184.525 1.00 269.90 ?  1166 ALA A CA  1 
ATOM   5692  C  C   . ALA A 1  1166 ? 202.047 194.159 185.958 1.00 287.29 ?  1166 ALA A C   1 
ATOM   5693  O  O   . ALA A 1  1166 ? 200.921 194.563 186.300 1.00 305.24 ?  1166 ALA A O   1 
ATOM   5694  C  CB  . ALA A 1  1166 ? 201.859 193.486 183.509 1.00 273.68 ?  1166 ALA A CB  1 
ATOM   5695  N  N   . GLU A 1  1167 ? 202.875 193.478 186.758 1.00 266.50 ?  1167 GLU A N   1 
ATOM   5696  C  CA  . GLU A 1  1167 ? 202.793 193.474 188.219 1.00 225.50 ?  1167 GLU A CA  1 
ATOM   5697  C  C   . GLU A 1  1167 ? 203.724 194.585 188.555 1.00 186.60 ?  1167 GLU A C   1 
ATOM   5698  O  O   . GLU A 1  1167 ? 204.624 194.875 187.773 1.00 168.37 ?  1167 GLU A O   1 
ATOM   5699  C  CB  . GLU A 1  1167 ? 203.329 192.172 188.814 1.00 205.24 ?  1167 GLU A CB  1 
ATOM   5700  C  CG  . GLU A 1  1167 ? 202.581 190.936 188.333 1.00 253.65 ?  1167 GLU A CG  1 
ATOM   5701  C  CD  . GLU A 1  1167 ? 203.444 189.691 188.237 1.00 270.51 ?  1167 GLU A CD  1 
ATOM   5702  O  OE1 . GLU A 1  1167 ? 204.104 189.339 189.237 1.00 318.96 ?  1167 GLU A OE1 1 
ATOM   5703  O  OE2 . GLU A 1  1167 ? 203.444 189.049 187.160 1.00 264.95 -1 1167 GLU A OE2 1 
ATOM   5704  N  N   . LEU A 1  1168 ? 203.521 195.221 189.699 1.00 214.72 ?  1168 LEU A N   1 
ATOM   5705  C  CA  . LEU A 1  1168 ? 204.388 196.332 190.103 1.00 284.16 ?  1168 LEU A CA  1 
ATOM   5706  C  C   . LEU A 1  1168 ? 204.303 197.488 189.073 1.00 285.75 ?  1168 LEU A C   1 
ATOM   5707  O  O   . LEU A 1  1168 ? 205.109 198.429 189.085 1.00 324.64 ?  1168 LEU A O   1 
ATOM   5708  C  CB  . LEU A 1  1168 ? 205.825 195.813 190.417 1.00 341.72 ?  1168 LEU A CB  1 
ATOM   5709  C  CG  . LEU A 1  1168 ? 207.190 196.501 190.224 1.00 354.45 ?  1168 LEU A CG  1 
ATOM   5710  C  CD1 . LEU A 1  1168 ? 208.211 196.011 191.246 1.00 334.92 ?  1168 LEU A CD1 1 
ATOM   5711  C  CD2 . LEU A 1  1168 ? 207.721 196.325 188.806 1.00 363.34 ?  1168 LEU A CD2 1 
ATOM   5712  N  N   . ALA A 1  1169 ? 203.290 197.408 188.202 1.00 260.74 ?  1169 ALA A N   1 
ATOM   5713  C  CA  . ALA A 1  1169 ? 202.793 198.564 187.455 1.00 313.10 ?  1169 ALA A CA  1 
ATOM   5714  C  C   . ALA A 1  1169 ? 202.235 199.582 188.462 1.00 348.26 ?  1169 ALA A C   1 
ATOM   5715  O  O   . ALA A 1  1169 ? 202.184 200.788 188.188 1.00 393.82 ?  1169 ALA A O   1 
ATOM   5716  C  CB  . ALA A 1  1169 ? 201.720 198.135 186.471 1.00 315.35 ?  1169 ALA A CB  1 
ATOM   5717  N  N   . ASN A 1  1170 ? 201.832 199.059 189.624 1.00 314.34 ?  1170 ASN A N   1 
ATOM   5718  C  CA  . ASN A 1  1170 ? 201.452 199.825 190.812 1.00 270.01 ?  1170 ASN A CA  1 
ATOM   5719  C  C   . ASN A 1  1170 ? 202.528 200.827 191.330 1.00 292.44 ?  1170 ASN A C   1 
ATOM   5720  O  O   . ASN A 1  1170 ? 202.219 202.004 191.576 1.00 233.81 ?  1170 ASN A O   1 
ATOM   5721  C  CB  . ASN A 1  1170 ? 201.002 198.851 191.911 1.00 184.51 ?  1170 ASN A CB  1 
ATOM   5722  C  CG  . ASN A 1  1170 ? 199.785 199.343 192.648 1.00 155.56 ?  1170 ASN A CG  1 
ATOM   5723  O  OD1 . ASN A 1  1170 ? 198.693 198.880 192.411 1.00 135.80 ?  1170 ASN A OD1 1 
ATOM   5724  N  ND2 . ASN A 1  1170 ? 199.968 200.311 193.521 1.00 167.84 ?  1170 ASN A ND2 1 
ATOM   5725  N  N   . GLU A 1  1171 ? 203.783 200.381 191.466 1.00 332.89 ?  1171 GLU A N   1 
ATOM   5726  C  CA  . GLU A 1  1171 ? 204.884 201.284 191.881 1.00 328.84 ?  1171 GLU A CA  1 
ATOM   5727  C  C   . GLU A 1  1171 ? 205.205 202.358 190.834 1.00 324.91 ?  1171 GLU A C   1 
ATOM   5728  O  O   . GLU A 1  1171 ? 205.573 203.483 191.185 1.00 342.66 ?  1171 GLU A O   1 
ATOM   5729  C  CB  . GLU A 1  1171 ? 206.147 200.528 192.372 1.00 340.96 ?  1171 GLU A CB  1 
ATOM   5730  C  CG  . GLU A 1  1171 ? 207.101 199.951 191.321 1.00 352.96 ?  1171 GLU A CG  1 
ATOM   5731  C  CD  . GLU A 1  1171 ? 208.178 200.917 190.820 1.00 364.30 ?  1171 GLU A CD  1 
ATOM   5732  O  OE1 . GLU A 1  1171 ? 208.338 202.026 191.375 1.00 364.41 -1 1171 GLU A OE1 1 
ATOM   5733  O  OE2 . GLU A 1  1171 ? 208.875 200.559 189.846 1.00 366.40 ?  1171 GLU A OE2 1 
ATOM   5734  N  N   . TYR A 1  1172 ? 205.051 202.010 189.556 1.00 318.86 ?  1172 TYR A N   1 
ATOM   5735  C  CA  . TYR A 1  1172 ? 205.163 202.991 188.483 1.00 281.82 ?  1172 TYR A CA  1 
ATOM   5736  C  C   . TYR A 1  1172 ? 204.056 204.020 188.662 1.00 203.74 ?  1172 TYR A C   1 
ATOM   5737  O  O   . TYR A 1  1172 ? 204.268 205.221 188.427 1.00 145.21 ?  1172 TYR A O   1 
ATOM   5738  C  CB  . TYR A 1  1172 ? 205.095 202.325 187.101 1.00 347.51 ?  1172 TYR A CB  1 
ATOM   5739  C  CG  . TYR A 1  1172 ? 204.997 203.289 185.928 1.00 384.90 ?  1172 TYR A CG  1 
ATOM   5740  C  CD1 . TYR A 1  1172 ? 206.079 204.111 185.566 1.00 388.95 ?  1172 TYR A CD1 1 
ATOM   5741  C  CD2 . TYR A 1  1172 ? 203.820 203.377 185.174 1.00 392.57 ?  1172 TYR A CD2 1 
ATOM   5742  C  CE1 . TYR A 1  1172 ? 205.985 204.994 184.492 1.00 389.19 ?  1172 TYR A CE1 1 
ATOM   5743  C  CE2 . TYR A 1  1172 ? 203.718 204.254 184.095 1.00 393.15 ?  1172 TYR A CE2 1 
ATOM   5744  C  CZ  . TYR A 1  1172 ? 204.800 205.059 183.757 1.00 390.29 ?  1172 TYR A CZ  1 
ATOM   5745  O  OH  . TYR A 1  1172 ? 204.698 205.930 182.692 1.00 380.55 ?  1172 TYR A OH  1 
ATOM   5746  N  N   . ALA A 1  1173 ? 202.901 203.550 189.137 1.00 149.01 ?  1173 ALA A N   1 
ATOM   5747  C  CA  . ALA A 1  1173 ? 201.756 204.411 189.315 1.00 188.78 ?  1173 ALA A CA  1 
ATOM   5748  C  C   . ALA A 1  1173 ? 202.248 205.582 190.105 1.00 189.02 ?  1173 ALA A C   1 
ATOM   5749  O  O   . ALA A 1  1173 ? 202.037 206.751 189.726 1.00 202.52 ?  1173 ALA A O   1 
ATOM   5750  C  CB  . ALA A 1  1173 ? 200.656 203.691 190.060 1.00 197.50 ?  1173 ALA A CB  1 
ATOM   5751  N  N   . GLY A 1  1174 ? 202.960 205.239 191.174 1.00 164.55 ?  1174 GLY A N   1 
ATOM   5752  C  CA  . GLY A 1  1174 ? 203.604 206.229 192.012 1.00 189.49 ?  1174 GLY A CA  1 
ATOM   5753  C  C   . GLY A 1  1174 ? 204.587 207.113 191.275 1.00 164.57 ?  1174 GLY A C   1 
ATOM   5754  O  O   . GLY A 1  1174 ? 204.657 208.318 191.498 1.00 152.55 ?  1174 GLY A O   1 
ATOM   5755  N  N   . PHE A 1  1175 ? 205.352 206.514 190.384 1.00 145.66 ?  1175 PHE A N   1 
ATOM   5756  C  CA  . PHE A 1  1175 ? 206.416 207.252 189.768 1.00 151.93 ?  1175 PHE A CA  1 
ATOM   5757  C  C   . PHE A 1  1175 ? 205.805 208.332 188.921 1.00 132.66 ?  1175 PHE A C   1 
ATOM   5758  O  O   . PHE A 1  1175 ? 206.281 209.460 188.911 1.00 155.13 ?  1175 PHE A O   1 
ATOM   5759  C  CB  . PHE A 1  1175 ? 207.284 206.338 188.930 1.00 169.56 ?  1175 PHE A CB  1 
ATOM   5760  C  CG  . PHE A 1  1175 ? 208.137 207.065 187.965 1.00 186.62 ?  1175 PHE A CG  1 
ATOM   5761  C  CD1 . PHE A 1  1175 ? 209.310 207.688 188.389 1.00 208.86 ?  1175 PHE A CD1 1 
ATOM   5762  C  CD2 . PHE A 1  1175 ? 207.757 207.152 186.625 1.00 217.85 ?  1175 PHE A CD2 1 
ATOM   5763  C  CE1 . PHE A 1  1175 ? 210.106 208.370 187.479 1.00 255.78 ?  1175 PHE A CE1 1 
ATOM   5764  C  CE2 . PHE A 1  1175 ? 208.542 207.835 185.709 1.00 257.93 ?  1175 PHE A CE2 1 
ATOM   5765  C  CZ  . PHE A 1  1175 ? 209.726 208.436 186.136 1.00 277.93 ?  1175 PHE A CZ  1 
ATOM   5766  N  N   . LEU A 1  1176 ? 204.722 207.974 188.249 1.00 131.25 ?  1176 LEU A N   1 
ATOM   5767  C  CA  . LEU A 1  1176 ? 204.043 208.855 187.302 1.00 161.37 ?  1176 LEU A CA  1 
ATOM   5768  C  C   . LEU A 1  1176 ? 203.672 210.175 187.942 1.00 144.34 ?  1176 LEU A C   1 
ATOM   5769  O  O   . LEU A 1  1176 ? 203.920 211.255 187.403 1.00 135.66 ?  1176 LEU A O   1 
ATOM   5770  C  CB  . LEU A 1  1176 ? 202.775 208.154 186.809 1.00 201.84 ?  1176 LEU A CB  1 
ATOM   5771  C  CG  . LEU A 1  1176 ? 202.011 208.552 185.542 1.00 219.52 ?  1176 LEU A CG  1 
ATOM   5772  C  CD1 . LEU A 1  1176 ? 202.724 209.537 184.614 1.00 198.06 ?  1176 LEU A CD1 1 
ATOM   5773  C  CD2 . LEU A 1  1176 ? 201.644 207.267 184.803 1.00 243.15 ?  1176 LEU A CD2 1 
ATOM   5774  N  N   . MET A 1  1177 ? 203.093 210.024 189.122 1.00 149.72 ?  1177 MET A N   1 
ATOM   5775  C  CA  . MET A 1  1177 ? 202.541 211.064 189.969 1.00 146.54 ?  1177 MET A CA  1 
ATOM   5776  C  C   . MET A 1  1177 ? 203.606 211.989 190.531 1.00 131.02 ?  1177 MET A C   1 
ATOM   5777  O  O   . MET A 1  1177 ? 203.417 213.201 190.634 1.00 109.48 ?  1177 MET A O   1 
ATOM   5778  C  CB  . MET A 1  1177 ? 201.833 210.307 191.086 1.00 161.34 ?  1177 MET A CB  1 
ATOM   5779  C  CG  . MET A 1  1177 ? 201.842 210.884 192.469 1.00 162.64 ?  1177 MET A CG  1 
ATOM   5780  S  SD  . MET A 1  1177 ? 200.615 212.155 192.627 1.00 145.74 ?  1177 MET A SD  1 
ATOM   5781  C  CE  . MET A 1  1177 ? 200.447 212.085 194.413 1.00 186.52 ?  1177 MET A CE  1 
ATOM   5782  N  N   . ALA A 1  1178 ? 204.722 211.380 190.897 1.00 132.39 ?  1178 ALA A N   1 
ATOM   5783  C  CA  . ALA A 1  1178 ? 205.835 212.062 191.493 1.00 152.33 ?  1178 ALA A CA  1 
ATOM   5784  C  C   . ALA A 1  1178 ? 206.286 213.178 190.578 1.00 162.99 ?  1178 ALA A C   1 
ATOM   5785  O  O   . ALA A 1  1178 ? 206.609 214.265 191.055 1.00 174.99 ?  1178 ALA A O   1 
ATOM   5786  C  CB  . ALA A 1  1178 ? 206.962 211.077 191.725 1.00 165.52 ?  1178 ALA A CB  1 
ATOM   5787  N  N   . LEU A 1  1179 ? 206.272 212.906 189.270 1.00 163.00 ?  1179 LEU A N   1 
ATOM   5788  C  CA  . LEU A 1  1179 ? 206.717 213.871 188.282 1.00 174.86 ?  1179 LEU A CA  1 
ATOM   5789  C  C   . LEU A 1  1179 ? 205.833 215.084 188.182 1.00 159.59 ?  1179 LEU A C   1 
ATOM   5790  O  O   . LEU A 1  1179 ? 206.337 216.179 187.997 1.00 173.20 ?  1179 LEU A O   1 
ATOM   5791  C  CB  . LEU A 1  1179 ? 206.901 213.255 186.900 1.00 213.88 ?  1179 LEU A CB  1 
ATOM   5792  C  CG  . LEU A 1  1179 ? 208.317 212.851 186.464 1.00 246.33 ?  1179 LEU A CG  1 
ATOM   5793  C  CD1 . LEU A 1  1179 ? 209.448 213.504 187.253 1.00 229.45 ?  1179 LEU A CD1 1 
ATOM   5794  C  CD2 . LEU A 1  1179 ? 208.423 211.353 186.569 1.00 275.36 ?  1179 LEU A CD2 1 
ATOM   5795  N  N   . GLY A 1  1180 ? 204.529 214.904 188.321 1.00 139.11 ?  1180 GLY A N   1 
ATOM   5796  C  CA  . GLY A 1  1180 ? 203.625 216.053 188.304 1.00 139.12 ?  1180 GLY A CA  1 
ATOM   5797  C  C   . GLY A 1  1180 ? 203.740 216.983 189.506 1.00 127.94 ?  1180 GLY A C   1 
ATOM   5798  O  O   . GLY A 1  1180 ? 203.555 218.209 189.376 1.00 106.23 ?  1180 GLY A O   1 
ATOM   5799  N  N   . LEU A 1  1181 ? 204.028 216.375 190.661 1.00 127.99 ?  1181 LEU A N   1 
ATOM   5800  C  CA  . LEU A 1  1181 ? 204.290 217.055 191.920 1.00 132.10 ?  1181 LEU A CA  1 
ATOM   5801  C  C   . LEU A 1  1181 ? 205.583 217.846 191.827 1.00 158.89 ?  1181 LEU A C   1 
ATOM   5802  O  O   . LEU A 1  1181 ? 205.641 218.990 192.277 1.00 174.22 ?  1181 LEU A O   1 
ATOM   5803  C  CB  . LEU A 1  1181 ? 204.391 216.017 193.019 1.00 123.24 ?  1181 LEU A CB  1 
ATOM   5804  C  CG  . LEU A 1  1181 ? 203.202 215.653 193.924 1.00 141.00 ?  1181 LEU A CG  1 
ATOM   5805  C  CD1 . LEU A 1  1181 ? 201.803 215.619 193.284 1.00 129.08 ?  1181 LEU A CD1 1 
ATOM   5806  C  CD2 . LEU A 1  1181 ? 203.535 214.335 194.636 1.00 144.90 ?  1181 LEU A CD2 1 
ATOM   5807  N  N   . ASN A 1  1182 ? 206.602 217.207 191.245 1.00 177.47 ?  1182 ASN A N   1 
ATOM   5808  C  CA  . ASN A 1  1182 ? 207.841 217.819 190.769 1.00 205.55 ?  1182 ASN A CA  1 
ATOM   5809  C  C   . ASN A 1  1182 ? 207.625 219.027 189.840 1.00 261.91 ?  1182 ASN A C   1 
ATOM   5810  O  O   . ASN A 1  1182 ? 208.312 220.043 189.989 1.00 273.50 ?  1182 ASN A O   1 
ATOM   5811  C  CB  . ASN A 1  1182 ? 208.645 216.741 190.034 1.00 203.92 ?  1182 ASN A CB  1 
ATOM   5812  C  CG  . ASN A 1  1182 ? 210.101 217.087 189.863 1.00 219.25 ?  1182 ASN A CG  1 
ATOM   5813  O  OD1 . ASN A 1  1182 ? 210.523 218.217 190.071 1.00 231.87 ?  1182 ASN A OD1 1 
ATOM   5814  N  ND2 . ASN A 1  1182 ? 210.887 216.093 189.491 1.00 241.95 ?  1182 ASN A ND2 1 
ATOM   5815  N  N   . GLY A 1  1183 ? 206.679 218.899 188.897 1.00 327.61 ?  1183 GLY A N   1 
ATOM   5816  C  CA  . GLY A 1  1183 ? 206.370 219.921 187.869 1.00 350.44 ?  1183 GLY A CA  1 
ATOM   5817  C  C   . GLY A 1  1183 ? 206.523 219.465 186.415 1.00 357.25 ?  1183 GLY A C   1 
ATOM   5818  O  O   . GLY A 1  1183 ? 206.043 220.135 185.488 1.00 333.26 ?  1183 GLY A O   1 
ATOM   5819  N  N   . HIS A 1  1184 ? 207.162 218.305 186.241 1.00 333.28 ?  1184 HIS A N   1 
ATOM   5820  C  CA  . HIS A 1  1184 ? 207.649 217.759 184.956 1.00 274.62 ?  1184 HIS A CA  1 
ATOM   5821  C  C   . HIS A 1  1184 ? 206.598 217.189 183.984 1.00 240.37 ?  1184 HIS A C   1 
ATOM   5822  O  O   . HIS A 1  1184 ? 206.851 217.074 182.770 1.00 213.41 ?  1184 HIS A O   1 
ATOM   5823  C  CB  . HIS A 1  1184 ? 208.690 216.667 185.269 1.00 230.99 ?  1184 HIS A CB  1 
ATOM   5824  C  CG  . HIS A 1  1184 ? 210.053 217.192 185.568 1.00 166.03 ?  1184 HIS A CG  1 
ATOM   5825  N  ND1 . HIS A 1  1184 ? 210.309 218.531 185.743 1.00 158.25 ?  1184 HIS A ND1 1 
ATOM   5826  C  CD2 . HIS A 1  1184 ? 211.235 216.559 185.732 1.00 174.03 ?  1184 HIS A CD2 1 
ATOM   5827  C  CE1 . HIS A 1  1184 ? 211.593 218.705 185.988 1.00 178.95 ?  1184 HIS A CE1 1 
ATOM   5828  N  NE2 . HIS A 1  1184 ? 212.179 217.523 185.982 1.00 190.63 ?  1184 HIS A NE2 1 
ATOM   5829  N  N   . LEU A 1  1185 ? 205.430 216.836 184.514 1.00 172.34 ?  1185 LEU A N   1 
ATOM   5830  C  CA  . LEU A 1  1185 ? 204.484 216.056 183.767 1.00 152.19 ?  1185 LEU A CA  1 
ATOM   5831  C  C   . LEU A 1  1185 ? 203.917 216.894 182.647 1.00 158.31 ?  1185 LEU A C   1 
ATOM   5832  O  O   . LEU A 1  1185 ? 203.328 216.361 181.725 1.00 181.23 ?  1185 LEU A O   1 
ATOM   5833  C  CB  . LEU A 1  1185 ? 203.387 215.541 184.700 1.00 173.36 ?  1185 LEU A CB  1 
ATOM   5834  C  CG  . LEU A 1  1185 ? 202.795 214.141 184.459 1.00 192.33 ?  1185 LEU A CG  1 
ATOM   5835  C  CD1 . LEU A 1  1185 ? 203.892 213.085 184.460 1.00 224.27 ?  1185 LEU A CD1 1 
ATOM   5836  C  CD2 . LEU A 1  1185 ? 201.711 213.757 185.470 1.00 159.44 ?  1185 LEU A CD2 1 
ATOM   5837  N  N   . THR A 1  1186 ? 204.117 218.206 182.737 1.00 175.25 ?  1186 THR A N   1 
ATOM   5838  C  CA  . THR A 1  1186 ? 203.723 219.156 181.690 1.00 224.69 ?  1186 THR A CA  1 
ATOM   5839  C  C   . THR A 1  1186 ? 204.358 218.862 180.324 1.00 241.39 ?  1186 THR A C   1 
ATOM   5840  O  O   . THR A 1  1186 ? 203.690 218.980 179.296 1.00 265.90 ?  1186 THR A O   1 
ATOM   5841  C  CB  . THR A 1  1186 ? 204.044 220.618 182.079 1.00 243.20 ?  1186 THR A CB  1 
ATOM   5842  O  OG1 . THR A 1  1186 ? 205.324 220.684 182.725 1.00 226.79 ?  1186 THR A OG1 1 
ATOM   5843  C  CG2 . THR A 1  1186 ? 202.967 221.186 183.001 1.00 262.48 ?  1186 THR A CG2 1 
ATOM   5844  N  N   . LYS A 1  1187 ? 205.629 218.463 180.319 1.00 233.87 ?  1187 LYS A N   1 
ATOM   5845  C  CA  . LYS A 1  1187 ? 206.368 218.234 179.069 1.00 252.04 ?  1187 LYS A CA  1 
ATOM   5846  C  C   . LYS A 1  1187 ? 206.000 216.924 178.369 1.00 291.53 ?  1187 LYS A C   1 
ATOM   5847  O  O   . LYS A 1  1187 ? 206.442 216.676 177.239 1.00 298.66 ?  1187 LYS A O   1 
ATOM   5848  C  CB  . LYS A 1  1187 ? 207.877 218.310 179.304 1.00 274.73 ?  1187 LYS A CB  1 
ATOM   5849  C  CG  . LYS A 1  1187 ? 208.396 219.699 179.660 1.00 293.65 ?  1187 LYS A CG  1 
ATOM   5850  C  CD  . LYS A 1  1187 ? 209.889 219.701 179.982 1.00 301.69 ?  1187 LYS A CD  1 
ATOM   5851  C  CE  . LYS A 1  1187 ? 210.206 219.150 181.372 1.00 313.48 ?  1187 LYS A CE  1 
ATOM   5852  N  NZ  . LYS A 1  1187 ? 209.740 220.024 182.488 1.00 306.01 ?  1187 LYS A NZ  1 
ATOM   5853  N  N   . LEU A 1  1188 ? 205.210 216.086 179.051 1.00 371.58 ?  1188 LEU A N   1 
ATOM   5854  C  CA  . LEU A 1  1188 ? 204.552 214.920 178.437 1.00 445.91 ?  1188 LEU A CA  1 
ATOM   5855  C  C   . LEU A 1  1188 ? 203.502 215.419 177.431 1.00 496.84 ?  1188 LEU A C   1 
ATOM   5856  O  O   . LEU A 1  1188 ? 203.008 216.549 177.556 1.00 500.00 ?  1188 LEU A O   1 
ATOM   5857  C  CB  . LEU A 1  1188 ? 203.936 214.015 179.523 1.00 444.79 ?  1188 LEU A CB  1 
ATOM   5858  C  CG  . LEU A 1  1188 ? 203.304 212.622 179.324 1.00 425.02 ?  1188 LEU A CG  1 
ATOM   5859  C  CD1 . LEU A 1  1188 ? 204.022 211.737 178.315 1.00 413.29 ?  1188 LEU A CD1 1 
ATOM   5860  C  CD2 . LEU A 1  1188 ? 203.219 211.907 180.667 1.00 415.91 ?  1188 LEU A CD2 1 
ATOM   5861  N  N   . ALA A 1  1189 ? 203.170 214.580 176.446 1.00 500.00 ?  1189 ALA A N   1 
ATOM   5862  C  CA  . ALA A 1  1189 ? 202.457 215.008 175.227 1.00 500.00 ?  1189 ALA A CA  1 
ATOM   5863  C  C   . ALA A 1  1189 ? 200.919 215.092 175.329 1.00 500.00 ?  1189 ALA A C   1 
ATOM   5864  O  O   . ALA A 1  1189 ? 200.209 214.626 174.428 1.00 500.00 ?  1189 ALA A O   1 
ATOM   5865  C  CB  . ALA A 1  1189 ? 202.883 214.136 174.047 1.00 500.00 ?  1189 ALA A CB  1 
ATOM   5866  N  N   . THR A 1  1190 ? 200.433 215.734 176.400 1.00 500.00 ?  1190 THR A N   1 
ATOM   5867  C  CA  . THR A 1  1190 ? 198.993 215.840 176.775 1.00 500.00 ?  1190 THR A CA  1 
ATOM   5868  C  C   . THR A 1  1190 ? 198.116 214.614 176.446 1.00 500.00 ?  1190 THR A C   1 
ATOM   5869  O  O   . THR A 1  1190 ? 197.748 213.864 177.351 1.00 500.00 ?  1190 THR A O   1 
ATOM   5870  C  CB  . THR A 1  1190 ? 198.334 217.209 176.390 1.00 500.00 ?  1190 THR A CB  1 
ATOM   5871  O  OG1 . THR A 1  1190 ? 196.932 217.182 176.697 1.00 500.00 ?  1190 THR A OG1 1 
ATOM   5872  C  CG2 . THR A 1  1190 ? 198.528 217.575 174.909 1.00 500.00 ?  1190 THR A CG2 1 
ATOM   5873  N  N   . LEU A 1  1191 ? 197.825 214.400 175.160 1.00 500.00 ?  1191 LEU A N   1 
ATOM   5874  C  CA  . LEU A 1  1191 ? 197.136 213.201 174.662 1.00 500.00 ?  1191 LEU A CA  1 
ATOM   5875  C  C   . LEU A 1  1191 ? 197.817 211.883 175.089 1.00 500.00 ?  1191 LEU A C   1 
ATOM   5876  O  O   . LEU A 1  1191 ? 197.198 210.814 175.032 1.00 500.00 ?  1191 LEU A O   1 
ATOM   5877  C  CB  . LEU A 1  1191 ? 197.010 213.274 173.137 1.00 493.16 ?  1191 LEU A CB  1 
ATOM   5878  C  CG  . LEU A 1  1191 ? 195.641 212.927 172.541 1.00 466.72 ?  1191 LEU A CG  1 
ATOM   5879  C  CD1 . LEU A 1  1191 ? 195.329 213.838 171.366 1.00 437.57 ?  1191 LEU A CD1 1 
ATOM   5880  C  CD2 . LEU A 1  1191 ? 195.540 211.462 172.139 1.00 454.80 ?  1191 LEU A CD2 1 
ATOM   5881  N  N   . ASN A 1  1192 ? 199.080 211.980 175.519 1.00 500.00 ?  1192 ASN A N   1 
ATOM   5882  C  CA  . ASN A 1  1192 ? 199.820 210.870 176.144 1.00 500.00 ?  1192 ASN A CA  1 
ATOM   5883  C  C   . ASN A 1  1192 ? 199.647 210.732 177.675 1.00 500.00 ?  1192 ASN A C   1 
ATOM   5884  O  O   . ASN A 1  1192 ? 200.368 209.967 178.332 1.00 500.00 ?  1192 ASN A O   1 
ATOM   5885  C  CB  . ASN A 1  1192 ? 201.307 210.910 175.751 1.00 500.00 ?  1192 ASN A CB  1 
ATOM   5886  C  CG  . ASN A 1  1192 ? 201.652 209.912 174.657 1.00 493.89 ?  1192 ASN A CG  1 
ATOM   5887  O  OD1 . ASN A 1  1192 ? 201.502 208.699 174.830 1.00 491.15 ?  1192 ASN A OD1 1 
ATOM   5888  N  ND2 . ASN A 1  1192 ? 202.132 210.419 173.528 1.00 473.71 ?  1192 ASN A ND2 1 
ATOM   5889  N  N   . ILE A 1  1193 ? 198.680 211.473 178.219 1.00 490.94 ?  1193 ILE A N   1 
ATOM   5890  C  CA  . ILE A 1  1193 ? 198.249 211.373 179.620 1.00 447.67 ?  1193 ILE A CA  1 
ATOM   5891  C  C   . ILE A 1  1193 ? 196.921 210.600 179.635 1.00 468.41 ?  1193 ILE A C   1 
ATOM   5892  O  O   . ILE A 1  1193 ? 196.781 209.583 180.336 1.00 481.11 ?  1193 ILE A O   1 
ATOM   5893  C  CB  . ILE A 1  1193 ? 198.145 212.785 180.269 1.00 399.68 ?  1193 ILE A CB  1 
ATOM   5894  C  CG1 . ILE A 1  1193 ? 199.544 213.331 180.579 1.00 360.06 ?  1193 ILE A CG1 1 
ATOM   5895  C  CG2 . ILE A 1  1193 ? 197.275 212.795 181.523 1.00 389.87 ?  1193 ILE A CG2 1 
ATOM   5896  C  CD1 . ILE A 1  1193 ? 199.654 214.842 180.521 1.00 334.05 ?  1193 ILE A CD1 1 
ATOM   5897  N  N   . HIS A 1  1194 ? 195.980 211.076 178.814 1.00 483.22 ?  1194 HIS A N   1 
ATOM   5898  C  CA  . HIS A 1  1194 ? 194.680 210.437 178.583 1.00 482.98 ?  1194 HIS A CA  1 
ATOM   5899  C  C   . HIS A 1  1194 ? 194.802 208.968 178.151 1.00 485.31 ?  1194 HIS A C   1 
ATOM   5900  O  O   . HIS A 1  1194 ? 193.845 208.205 178.283 1.00 485.67 ?  1194 HIS A O   1 
ATOM   5901  C  CB  . HIS A 1  1194 ? 193.857 211.231 177.550 1.00 477.86 ?  1194 HIS A CB  1 
ATOM   5902  C  CG  . HIS A 1  1194 ? 193.817 212.713 177.798 1.00 476.40 ?  1194 HIS A CG  1 
ATOM   5903  N  ND1 . HIS A 1  1194 ? 193.891 213.640 176.779 1.00 474.00 ?  1194 HIS A ND1 1 
ATOM   5904  C  CD2 . HIS A 1  1194 ? 193.715 213.426 178.946 1.00 471.47 ?  1194 HIS A CD2 1 
ATOM   5905  C  CE1 . HIS A 1  1194 ? 193.840 214.858 177.288 1.00 469.75 ?  1194 HIS A CE1 1 
ATOM   5906  N  NE2 . HIS A 1  1194 ? 193.730 214.757 178.601 1.00 467.29 ?  1194 HIS A NE2 1 
ATOM   5907  N  N   . ASP A 1  1195 ? 195.981 208.581 177.656 1.00 487.32 ?  1195 ASP A N   1 
ATOM   5908  C  CA  . ASP A 1  1195 ? 196.268 207.179 177.305 1.00 482.43 ?  1195 ASP A CA  1 
ATOM   5909  C  C   . ASP A 1  1195 ? 196.742 206.303 178.496 1.00 475.42 ?  1195 ASP A C   1 
ATOM   5910  O  O   . ASP A 1  1195 ? 197.083 205.126 178.316 1.00 477.85 ?  1195 ASP A O   1 
ATOM   5911  C  CB  . ASP A 1  1195 ? 197.158 207.074 176.032 1.00 484.03 ?  1195 ASP A CB  1 
ATOM   5912  C  CG  . ASP A 1  1195 ? 198.633 206.792 176.327 1.00 487.62 ?  1195 ASP A CG  1 
ATOM   5913  O  OD1 . ASP A 1  1195 ? 199.378 207.722 176.695 1.00 499.67 -1 1195 ASP A OD1 1 
ATOM   5914  O  OD2 . ASP A 1  1195 ? 199.050 205.624 176.170 1.00 482.12 ?  1195 ASP A OD2 1 
ATOM   5915  N  N   . TYR A 1  1196 ? 196.725 206.870 179.706 1.00 457.08 ?  1196 TYR A N   1 
ATOM   5916  C  CA  . TYR A 1  1196 ? 196.990 206.110 180.942 1.00 404.58 ?  1196 TYR A CA  1 
ATOM   5917  C  C   . TYR A 1  1196 ? 195.779 206.053 181.885 1.00 352.28 ?  1196 TYR A C   1 
ATOM   5918  O  O   . TYR A 1  1196 ? 195.558 205.048 182.574 1.00 305.75 ?  1196 TYR A O   1 
ATOM   5919  C  CB  . TYR A 1  1196 ? 198.198 206.670 181.693 1.00 425.17 ?  1196 TYR A CB  1 
ATOM   5920  C  CG  . TYR A 1  1196 ? 199.553 206.460 181.059 1.00 429.80 ?  1196 TYR A CG  1 
ATOM   5921  C  CD1 . TYR A 1  1196 ? 200.101 205.176 180.934 1.00 433.13 ?  1196 TYR A CD1 1 
ATOM   5922  C  CD2 . TYR A 1  1196 ? 200.314 207.553 180.620 1.00 433.07 ?  1196 TYR A CD2 1 
ATOM   5923  C  CE1 . TYR A 1  1196 ? 201.352 204.983 180.362 1.00 442.64 ?  1196 TYR A CE1 1 
ATOM   5924  C  CE2 . TYR A 1  1196 ? 201.570 207.371 180.048 1.00 440.37 ?  1196 TYR A CE2 1 
ATOM   5925  C  CZ  . TYR A 1  1196 ? 202.083 206.085 179.923 1.00 446.33 ?  1196 TYR A CZ  1 
ATOM   5926  O  OH  . TYR A 1  1196 ? 203.323 205.894 179.362 1.00 450.58 ?  1196 TYR A OH  1 
ATOM   5927  N  N   . LEU A 1  1197 ? 194.994 207.132 181.901 1.00 320.20 ?  1197 LEU A N   1 
ATOM   5928  C  CA  . LEU A 1  1197 ? 193.729 207.187 182.638 1.00 249.30 ?  1197 LEU A CA  1 
ATOM   5929  C  C   . LEU A 1  1197 ? 192.687 206.442 181.830 1.00 178.48 ?  1197 LEU A C   1 
ATOM   5930  O  O   . LEU A 1  1197 ? 191.639 206.994 181.471 1.00 140.98 ?  1197 LEU A O   1 
ATOM   5931  C  CB  . LEU A 1  1197 ? 193.288 208.635 182.830 1.00 295.91 ?  1197 LEU A CB  1 
ATOM   5932  C  CG  . LEU A 1  1197 ? 194.262 209.571 183.526 1.00 321.57 ?  1197 LEU A CG  1 
ATOM   5933  C  CD1 . LEU A 1  1197 ? 194.623 210.710 182.587 1.00 319.93 ?  1197 LEU A CD1 1 
ATOM   5934  C  CD2 . LEU A 1  1197 ? 193.656 210.045 184.834 1.00 318.79 ?  1197 LEU A CD2 1 
ATOM   5935  N  N   . THR A 1  1198 ? 193.014 205.201 181.490 1.00 129.88 ?  1198 THR A N   1 
ATOM   5936  C  CA  . THR A 1  1198 ? 192.099 204.330 180.801 1.00 144.35 ?  1198 THR A CA  1 
ATOM   5937  C  C   . THR A 1  1198 ? 192.550 202.948 181.088 1.00 167.98 ?  1198 THR A C   1 
ATOM   5938  O  O   . THR A 1  1198 ? 191.711 202.067 181.248 1.00 219.82 ?  1198 THR A O   1 
ATOM   5939  C  CB  . THR A 1  1198 ? 192.168 204.440 179.282 1.00 145.89 ?  1198 THR A CB  1 
ATOM   5940  O  OG1 . THR A 1  1198 ? 193.533 204.295 178.867 1.00 169.76 ?  1198 THR A OG1 1 
ATOM   5941  C  CG2 . THR A 1  1198 ? 191.596 205.731 178.791 1.00 150.37 ?  1198 THR A CG2 1 
ATOM   5942  N  N   . LYS A 1  1199 ? 193.875 202.754 181.100 1.00 186.93 ?  1199 LYS A N   1 
ATOM   5943  C  CA  . LYS A 1  1199 ? 194.508 201.462 181.392 1.00 239.85 ?  1199 LYS A CA  1 
ATOM   5944  C  C   . LYS A 1  1199 ? 193.694 200.665 182.404 1.00 242.02 ?  1199 LYS A C   1 
ATOM   5945  O  O   . LYS A 1  1199 ? 193.665 199.431 182.366 1.00 254.27 ?  1199 LYS A O   1 
ATOM   5946  C  CB  . LYS A 1  1199 ? 195.945 201.668 181.890 1.00 290.08 ?  1199 LYS A CB  1 
ATOM   5947  C  CG  . LYS A 1  1199 ? 197.048 201.122 180.981 1.00 317.75 ?  1199 LYS A CG  1 
ATOM   5948  C  CD  . LYS A 1  1199 ? 197.290 201.932 179.709 1.00 323.60 ?  1199 LYS A CD  1 
ATOM   5949  C  CE  . LYS A 1  1199 ? 198.488 201.373 178.952 1.00 318.64 ?  1199 LYS A CE  1 
ATOM   5950  N  NZ  . LYS A 1  1199 ? 198.490 201.710 177.501 1.00 322.27 ?  1199 LYS A NZ  1 
ATOM   5951  N  N   . GLY A 1  1200 ? 193.018 201.401 183.286 1.00 228.15 ?  1200 GLY A N   1 
ATOM   5952  C  CA  . GLY A 1  1200 ? 191.963 200.858 184.111 1.00 224.54 ?  1200 GLY A CA  1 
ATOM   5953  C  C   . GLY A 1  1200 ? 192.481 200.629 185.494 1.00 234.46 ?  1200 GLY A C   1 
ATOM   5954  O  O   . GLY A 1  1200 ? 191.702 200.557 186.442 1.00 276.15 ?  1200 GLY A O   1 
ATOM   5955  N  N   . HIS A 1  1201 ? 193.802 200.513 185.596 1.00 219.75 ?  1201 HIS A N   1 
ATOM   5956  C  CA  . HIS A 1  1201 ? 194.459 200.333 186.864 1.00 202.67 ?  1201 HIS A CA  1 
ATOM   5957  C  C   . HIS A 1  1201 ? 194.279 201.578 187.732 1.00 183.21 ?  1201 HIS A C   1 
ATOM   5958  O  O   . HIS A 1  1201 ? 194.660 202.697 187.364 1.00 158.54 ?  1201 HIS A O   1 
ATOM   5959  C  CB  . HIS A 1  1201 ? 195.917 199.973 186.674 1.00 208.65 ?  1201 HIS A CB  1 
ATOM   5960  C  CG  . HIS A 1  1201 ? 196.557 199.478 187.923 1.00 238.23 ?  1201 HIS A CG  1 
ATOM   5961  N  ND1 . HIS A 1  1201 ? 197.034 200.327 188.899 1.00 233.58 ?  1201 HIS A ND1 1 
ATOM   5962  C  CD2 . HIS A 1  1201 ? 196.762 198.222 188.378 1.00 262.24 ?  1201 HIS A CD2 1 
ATOM   5963  C  CE1 . HIS A 1  1201 ? 197.537 199.612 189.887 1.00 233.09 ?  1201 HIS A CE1 1 
ATOM   5964  N  NE2 . HIS A 1  1201 ? 197.379 198.333 189.600 1.00 263.82 ?  1201 HIS A NE2 1 
ATOM   5965  N  N   . GLU A 1  1202 ? 193.662 201.362 188.884 1.00 181.17 ?  1202 GLU A N   1 
ATOM   5966  C  CA  . GLU A 1  1202 ? 193.054 202.445 189.634 1.00 177.28 ?  1202 GLU A CA  1 
ATOM   5967  C  C   . GLU A 1  1202 ? 194.106 203.313 190.319 1.00 160.53 ?  1202 GLU A C   1 
ATOM   5968  O  O   . GLU A 1  1202 ? 193.930 204.516 190.453 1.00 144.81 ?  1202 GLU A O   1 
ATOM   5969  C  CB  . GLU A 1  1202 ? 191.964 201.890 190.567 1.00 200.83 ?  1202 GLU A CB  1 
ATOM   5970  C  CG  . GLU A 1  1202 ? 192.408 201.400 191.932 1.00 259.34 ?  1202 GLU A CG  1 
ATOM   5971  C  CD  . GLU A 1  1202 ? 192.267 202.477 192.986 1.00 312.05 ?  1202 GLU A CD  1 
ATOM   5972  O  OE1 . GLU A 1  1202 ? 191.854 203.600 192.632 1.00 334.57 ?  1202 GLU A OE1 1 
ATOM   5973  O  OE2 . GLU A 1  1202 ? 192.558 202.199 194.169 1.00 354.01 -1 1202 GLU A OE2 1 
ATOM   5974  N  N   . MET A 1  1203 ? 195.225 202.685 190.665 1.00 152.83 ?  1203 MET A N   1 
ATOM   5975  C  CA  . MET A 1  1203 ? 196.313 203.313 191.383 1.00 142.86 ?  1203 MET A CA  1 
ATOM   5976  C  C   . MET A 1  1203 ? 197.011 204.360 190.555 1.00 143.32 ?  1203 MET A C   1 
ATOM   5977  O  O   . MET A 1  1203 ? 197.346 205.415 191.092 1.00 108.28 ?  1203 MET A O   1 
ATOM   5978  C  CB  . MET A 1  1203 ? 197.329 202.252 191.784 1.00 156.85 ?  1203 MET A CB  1 
ATOM   5979  C  CG  . MET A 1  1203 ? 196.915 201.429 192.970 1.00 167.37 ?  1203 MET A CG  1 
ATOM   5980  S  SD  . MET A 1  1203 ? 197.191 202.402 194.448 1.00 221.09 ?  1203 MET A SD  1 
ATOM   5981  C  CE  . MET A 1  1203 ? 196.290 201.372 195.594 1.00 240.27 ?  1203 MET A CE  1 
ATOM   5982  N  N   . THR A 1  1204 ? 197.256 204.027 189.274 1.00 185.25 ?  1204 THR A N   1 
ATOM   5983  C  CA  . THR A 1  1204 ? 197.880 204.909 188.251 1.00 237.44 ?  1204 THR A CA  1 
ATOM   5984  C  C   . THR A 1  1204 ? 197.000 206.101 187.969 1.00 243.95 ?  1204 THR A C   1 
ATOM   5985  O  O   . THR A 1  1204 ? 197.499 207.208 187.741 1.00 311.84 ?  1204 THR A O   1 
ATOM   5986  C  CB  . THR A 1  1204 ? 198.113 204.220 186.873 1.00 286.27 ?  1204 THR A CB  1 
ATOM   5987  O  OG1 . THR A 1  1204 ? 197.230 203.102 186.718 1.00 352.79 ?  1204 THR A OG1 1 
ATOM   5988  C  CG2 . THR A 1  1204 ? 199.562 203.771 186.665 1.00 261.94 ?  1204 THR A CG2 1 
ATOM   5989  N  N   . SER A 1  1205 ? 195.691 205.856 187.958 1.00 180.49 ?  1205 SER A N   1 
ATOM   5990  C  CA  . SER A 1  1205 ? 194.711 206.913 187.917 1.00 169.92 ?  1205 SER A CA  1 
ATOM   5991  C  C   . SER A 1  1205 ? 194.836 207.868 189.121 1.00 229.61 ?  1205 SER A C   1 
ATOM   5992  O  O   . SER A 1  1205 ? 194.683 209.075 188.939 1.00 278.73 ?  1205 SER A O   1 
ATOM   5993  C  CB  . SER A 1  1205 ? 193.361 206.287 187.835 1.00 163.64 ?  1205 SER A CB  1 
ATOM   5994  O  OG  . SER A 1  1205 ? 193.437 205.315 186.814 1.00 205.75 ?  1205 SER A OG  1 
ATOM   5995  N  N   . ILE A 1  1206 ? 195.182 207.342 190.312 1.00 223.91 ?  1206 ILE A N   1 
ATOM   5996  C  CA  . ILE A 1  1206 ? 195.533 208.155 191.530 1.00 171.85 ?  1206 ILE A CA  1 
ATOM   5997  C  C   . ILE A 1  1206 ? 196.903 208.924 191.456 1.00 136.21 ?  1206 ILE A C   1 
ATOM   5998  O  O   . ILE A 1  1206 ? 196.980 210.120 191.823 1.00 96.95  ?  1206 ILE A O   1 
ATOM   5999  C  CB  . ILE A 1  1206 ? 195.388 207.314 192.827 1.00 166.57 ?  1206 ILE A CB  1 
ATOM   6000  C  CG1 . ILE A 1  1206 ? 193.952 206.803 192.967 1.00 174.45 ?  1206 ILE A CG1 1 
ATOM   6001  C  CG2 . ILE A 1  1206 ? 195.722 208.157 194.045 1.00 197.93 ?  1206 ILE A CG2 1 
ATOM   6002  C  CD1 . ILE A 1  1206 ? 193.742 205.774 194.056 1.00 205.18 ?  1206 ILE A CD1 1 
ATOM   6003  N  N   . GLY A 1  1207 ? 197.955 208.224 190.998 1.00 121.79 ?  1207 GLY A N   1 
ATOM   6004  C  CA  . GLY A 1  1207 ? 199.198 208.823 190.485 1.00 117.56 ?  1207 GLY A CA  1 
ATOM   6005  C  C   . GLY A 1  1207 ? 199.015 209.992 189.518 1.00 145.04 ?  1207 GLY A C   1 
ATOM   6006  O  O   . GLY A 1  1207 ? 199.228 211.151 189.892 1.00 153.48 ?  1207 GLY A O   1 
ATOM   6007  N  N   . LEU A 1  1208 ? 198.622 209.689 188.280 1.00 167.99 ?  1208 LEU A N   1 
ATOM   6008  C  CA  . LEU A 1  1208 ? 198.396 210.703 187.221 1.00 173.88 ?  1208 LEU A CA  1 
ATOM   6009  C  C   . LEU A 1  1208 ? 197.571 211.903 187.596 1.00 142.92 ?  1208 LEU A C   1 
ATOM   6010  O  O   . LEU A 1  1208 ? 197.933 213.004 187.236 1.00 152.90 ?  1208 LEU A O   1 
ATOM   6011  C  CB  . LEU A 1  1208 ? 197.753 210.103 185.977 1.00 221.05 ?  1208 LEU A CB  1 
ATOM   6012  C  CG  . LEU A 1  1208 ? 198.697 209.768 184.827 1.00 271.06 ?  1208 LEU A CG  1 
ATOM   6013  C  CD1 . LEU A 1  1208 ? 198.017 208.744 183.946 1.00 288.44 ?  1208 LEU A CD1 1 
ATOM   6014  C  CD2 . LEU A 1  1208 ? 199.145 210.980 184.014 1.00 269.00 ?  1208 LEU A CD2 1 
ATOM   6015  N  N   . LEU A 1  1209 ? 196.472 211.696 188.308 1.00 138.35 ?  1209 LEU A N   1 
ATOM   6016  C  CA  . LEU A 1  1209 ? 195.592 212.813 188.619 1.00 183.22 ?  1209 LEU A CA  1 
ATOM   6017  C  C   . LEU A 1  1209 ? 196.203 213.862 189.532 1.00 154.43 ?  1209 LEU A C   1 
ATOM   6018  O  O   . LEU A 1  1209 ? 196.237 215.035 189.175 1.00 137.28 ?  1209 LEU A O   1 
ATOM   6019  C  CB  . LEU A 1  1209 ? 194.204 212.356 189.100 1.00 262.62 ?  1209 LEU A CB  1 
ATOM   6020  C  CG  . LEU A 1  1209 ? 193.305 211.902 187.933 1.00 306.09 ?  1209 LEU A CG  1 
ATOM   6021  C  CD1 . LEU A 1  1209 ? 191.888 211.521 188.348 1.00 310.13 ?  1209 LEU A CD1 1 
ATOM   6022  C  CD2 . LEU A 1  1209 ? 193.277 212.930 186.807 1.00 321.80 ?  1209 LEU A CD2 1 
ATOM   6023  N  N   . LEU A 1  1210 ? 196.707 213.443 190.684 1.00 156.43 ?  1210 LEU A N   1 
ATOM   6024  C  CA  . LEU A 1  1210 ? 197.368 214.387 191.586 1.00 187.88 ?  1210 LEU A CA  1 
ATOM   6025  C  C   . LEU A 1  1210 ? 198.697 214.891 191.007 1.00 160.80 ?  1210 LEU A C   1 
ATOM   6026  O  O   . LEU A 1  1210 ? 199.121 216.004 191.315 1.00 142.77 ?  1210 LEU A O   1 
ATOM   6027  C  CB  . LEU A 1  1210 ? 197.530 213.803 192.997 1.00 249.21 ?  1210 LEU A CB  1 
ATOM   6028  C  CG  . LEU A 1  1210 ? 196.294 213.617 193.895 1.00 288.86 ?  1210 LEU A CG  1 
ATOM   6029  C  CD1 . LEU A 1  1210 ? 196.520 212.574 194.985 1.00 290.95 ?  1210 LEU A CD1 1 
ATOM   6030  C  CD2 . LEU A 1  1210 ? 195.840 214.942 194.499 1.00 295.79 ?  1210 LEU A CD2 1 
ATOM   6031  N  N   . GLY A 1  1211 ? 199.324 214.073 190.159 1.00 149.82 ?  1211 GLY A N   1 
ATOM   6032  C  CA  . GLY A 1  1211 ? 200.460 214.494 189.349 1.00 173.72 ?  1211 GLY A CA  1 
ATOM   6033  C  C   . GLY A 1  1211 ? 200.111 215.661 188.433 1.00 192.60 ?  1211 GLY A C   1 
ATOM   6034  O  O   . GLY A 1  1211 ? 200.632 216.774 188.600 1.00 233.07 ?  1211 GLY A O   1 
ATOM   6035  N  N   . VAL A 1  1212 ? 199.216 215.405 187.479 1.00 181.61 ?  1212 VAL A N   1 
ATOM   6036  C  CA  . VAL A 1  1212 ? 198.718 216.413 186.534 1.00 165.19 ?  1212 VAL A CA  1 
ATOM   6037  C  C   . VAL A 1  1212 ? 198.337 217.710 187.229 1.00 148.89 ?  1212 VAL A C   1 
ATOM   6038  O  O   . VAL A 1  1212 ? 198.709 218.777 186.747 1.00 133.17 ?  1212 VAL A O   1 
ATOM   6039  C  CB  . VAL A 1  1212 ? 197.497 215.881 185.753 1.00 207.95 ?  1212 VAL A CB  1 
ATOM   6040  C  CG1 . VAL A 1  1212 ? 196.735 217.000 185.054 1.00 224.07 ?  1212 VAL A CG1 1 
ATOM   6041  C  CG2 . VAL A 1  1212 ? 197.934 214.828 184.745 1.00 272.54 ?  1212 VAL A CG2 1 
ATOM   6042  N  N   . SER A 1  1213 ? 197.616 217.575 188.360 1.00 150.95 ?  1213 SER A N   1 
ATOM   6043  C  CA  . SER A 1  1213 ? 197.031 218.677 189.161 1.00 139.22 ?  1213 SER A CA  1 
ATOM   6044  C  C   . SER A 1  1213 ? 198.052 219.583 189.785 1.00 135.09 ?  1213 SER A C   1 
ATOM   6045  O  O   . SER A 1  1213 ? 197.903 220.803 189.719 1.00 138.91 ?  1213 SER A O   1 
ATOM   6046  C  CB  . SER A 1  1213 ? 196.169 218.133 190.290 1.00 130.38 ?  1213 SER A CB  1 
ATOM   6047  O  OG  . SER A 1  1213 ? 195.193 217.245 189.784 1.00 183.96 ?  1213 SER A OG  1 
ATOM   6048  N  N   . ALA A 1  1214 ? 199.068 218.974 190.400 1.00 145.86 ?  1214 ALA A N   1 
ATOM   6049  C  CA  . ALA A 1  1214 ? 200.189 219.682 191.039 1.00 153.96 ?  1214 ALA A CA  1 
ATOM   6050  C  C   . ALA A 1  1214 ? 201.004 220.531 190.067 1.00 156.05 ?  1214 ALA A C   1 
ATOM   6051  O  O   . ALA A 1  1214 ? 201.492 221.604 190.437 1.00 147.06 ?  1214 ALA A O   1 
ATOM   6052  C  CB  . ALA A 1  1214 ? 201.098 218.694 191.737 1.00 156.09 ?  1214 ALA A CB  1 
ATOM   6053  N  N   . ALA A 1  1215 ? 201.154 220.037 188.836 1.00 168.95 ?  1215 ALA A N   1 
ATOM   6054  C  CA  . ALA A 1  1215 ? 201.720 220.807 187.731 1.00 182.65 ?  1215 ALA A CA  1 
ATOM   6055  C  C   . ALA A 1  1215 ? 200.883 222.067 187.385 1.00 174.00 ?  1215 ALA A C   1 
ATOM   6056  O  O   . ALA A 1  1215 ? 201.442 223.161 187.218 1.00 166.62 ?  1215 ALA A O   1 
ATOM   6057  C  CB  . ALA A 1  1215 ? 201.901 219.911 186.514 1.00 202.08 ?  1215 ALA A CB  1 
ATOM   6058  N  N   . LYS A 1  1216 ? 199.559 221.913 187.311 1.00 164.52 ?  1216 LYS A N   1 
ATOM   6059  C  CA  . LYS A 1  1216 ? 198.670 223.050 187.082 1.00 175.99 ?  1216 LYS A CA  1 
ATOM   6060  C  C   . LYS A 1  1216 ? 198.483 223.977 188.268 1.00 170.07 ?  1216 LYS A C   1 
ATOM   6061  O  O   . LYS A 1  1216 ? 198.260 225.156 188.064 1.00 177.37 ?  1216 LYS A O   1 
ATOM   6062  C  CB  . LYS A 1  1216 ? 197.331 222.628 186.471 1.00 217.36 ?  1216 LYS A CB  1 
ATOM   6063  C  CG  . LYS A 1  1216 ? 197.199 223.029 185.002 1.00 257.62 ?  1216 LYS A CG  1 
ATOM   6064  C  CD  . LYS A 1  1216 ? 198.434 222.624 184.206 1.00 277.68 ?  1216 LYS A CD  1 
ATOM   6065  C  CE  . LYS A 1  1216 ? 198.844 223.698 183.218 1.00 281.79 ?  1216 LYS A CE  1 
ATOM   6066  N  NZ  . LYS A 1  1216 ? 198.491 223.278 181.841 1.00 308.32 ?  1216 LYS A NZ  1 
ATOM   6067  N  N   . LEU A 1  1217 ? 198.610 223.449 189.486 1.00 180.57 ?  1217 LEU A N   1 
ATOM   6068  C  CA  . LEU A 1  1217 ? 198.587 224.229 190.746 1.00 188.28 ?  1217 LEU A CA  1 
ATOM   6069  C  C   . LEU A 1  1217 ? 197.993 225.642 190.642 1.00 182.45 ?  1217 LEU A C   1 
ATOM   6070  O  O   . LEU A 1  1217 ? 198.700 226.658 190.754 1.00 165.78 ?  1217 LEU A O   1 
ATOM   6071  C  CB  . LEU A 1  1217 ? 199.975 224.276 191.417 1.00 186.38 ?  1217 LEU A CB  1 
ATOM   6072  C  CG  . LEU A 1  1217 ? 200.141 224.191 192.952 1.00 170.98 ?  1217 LEU A CG  1 
ATOM   6073  C  CD1 . LEU A 1  1217 ? 200.937 225.379 193.478 1.00 169.08 ?  1217 LEU A CD1 1 
ATOM   6074  C  CD2 . LEU A 1  1217 ? 198.837 224.109 193.717 1.00 157.28 ?  1217 LEU A CD2 1 
ATOM   6075  N  N   . GLY A 1  1218 ? 196.687 225.680 190.400 1.00 163.76 ?  1218 GLY A N   1 
ATOM   6076  C  CA  . GLY A 1  1218 ? 195.915 226.910 190.500 1.00 212.76 ?  1218 GLY A CA  1 
ATOM   6077  C  C   . GLY A 1  1218 ? 195.981 227.773 189.264 1.00 243.80 ?  1218 GLY A C   1 
ATOM   6078  O  O   . GLY A 1  1218 ? 195.576 228.930 189.306 1.00 280.72 ?  1218 GLY A O   1 
ATOM   6079  N  N   . THR A 1  1219 ? 196.497 227.210 188.170 1.00 265.06 ?  1219 THR A N   1 
ATOM   6080  C  CA  . THR A 1  1219 ? 196.648 227.921 186.890 1.00 295.94 ?  1219 THR A CA  1 
ATOM   6081  C  C   . THR A 1  1219 ? 195.376 227.863 186.019 1.00 369.65 ?  1219 THR A C   1 
ATOM   6082  O  O   . THR A 1  1219 ? 195.205 228.684 185.107 1.00 415.39 ?  1219 THR A O   1 
ATOM   6083  C  CB  . THR A 1  1219 ? 197.926 227.445 186.165 1.00 228.76 ?  1219 THR A CB  1 
ATOM   6084  O  OG1 . THR A 1  1219 ? 199.045 227.762 187.001 1.00 199.36 ?  1219 THR A OG1 1 
ATOM   6085  C  CG2 . THR A 1  1219 ? 198.124 228.099 184.792 1.00 218.04 ?  1219 THR A CG2 1 
ATOM   6086  N  N   . MET A 1  1220 ? 194.475 226.931 186.355 1.00 430.35 ?  1220 MET A N   1 
ATOM   6087  C  CA  . MET A 1  1220 ? 193.197 226.679 185.637 1.00 455.12 ?  1220 MET A CA  1 
ATOM   6088  C  C   . MET A 1  1220 ? 193.368 226.445 184.128 1.00 492.32 ?  1220 MET A C   1 
ATOM   6089  O  O   . MET A 1  1220 ? 193.012 227.308 183.313 1.00 500.00 ?  1220 MET A O   1 
ATOM   6090  C  CB  . MET A 1  1220 ? 192.137 227.787 185.861 1.00 434.42 ?  1220 MET A CB  1 
ATOM   6091  C  CG  . MET A 1  1220 ? 192.257 228.632 187.117 1.00 415.65 ?  1220 MET A CG  1 
ATOM   6092  S  SD  . MET A 1  1220 ? 191.476 230.247 186.933 1.00 388.07 ?  1220 MET A SD  1 
ATOM   6093  C  CE  . MET A 1  1220 ? 189.801 229.851 187.405 1.00 386.74 ?  1220 MET A CE  1 
ATOM   6094  N  N   . ASP A 1  1221 ? 193.915 225.291 183.755 1.00 500.00 ?  1221 ASP A N   1 
ATOM   6095  C  CA  . ASP A 1  1221 ? 194.003 224.937 182.344 1.00 500.00 ?  1221 ASP A CA  1 
ATOM   6096  C  C   . ASP A 1  1221 ? 192.718 224.251 181.905 1.00 500.00 ?  1221 ASP A C   1 
ATOM   6097  O  O   . ASP A 1  1221 ? 192.162 223.437 182.644 1.00 500.00 ?  1221 ASP A O   1 
ATOM   6098  C  CB  . ASP A 1  1221 ? 195.209 224.044 182.068 1.00 500.00 ?  1221 ASP A CB  1 
ATOM   6099  C  CG  . ASP A 1  1221 ? 195.579 223.994 180.591 1.00 500.00 ?  1221 ASP A CG  1 
ATOM   6100  O  OD1 . ASP A 1  1221 ? 194.817 223.411 179.784 1.00 500.00 ?  1221 ASP A OD1 1 
ATOM   6101  O  OD2 . ASP A 1  1221 ? 196.651 224.533 180.241 1.00 500.00 -1 1221 ASP A OD2 1 
ATOM   6102  N  N   . MET A 1  1222 ? 192.267 224.591 180.697 1.00 500.00 ?  1222 MET A N   1 
ATOM   6103  C  CA  . MET A 1  1222 ? 191.060 224.018 180.084 1.00 500.00 ?  1222 MET A CA  1 
ATOM   6104  C  C   . MET A 1  1222 ? 191.158 222.501 179.862 1.00 500.00 ?  1222 MET A C   1 
ATOM   6105  O  O   . MET A 1  1222 ? 190.197 221.768 180.141 1.00 500.00 ?  1222 MET A O   1 
ATOM   6106  C  CB  . MET A 1  1222 ? 190.733 224.748 178.769 1.00 500.00 ?  1222 MET A CB  1 
ATOM   6107  C  CG  . MET A 1  1222 ? 189.472 224.281 178.045 1.00 500.00 ?  1222 MET A CG  1 
ATOM   6108  S  SD  . MET A 1  1222 ? 187.964 224.328 179.038 1.00 499.62 ?  1222 MET A SD  1 
ATOM   6109  C  CE  . MET A 1  1222 ? 187.593 226.082 179.045 1.00 488.11 ?  1222 MET A CE  1 
ATOM   6110  N  N   . SER A 1  1223 ? 192.321 222.054 179.376 1.00 500.00 ?  1223 SER A N   1 
ATOM   6111  C  CA  . SER A 1  1223 ? 192.597 220.641 179.072 1.00 500.00 ?  1223 SER A CA  1 
ATOM   6112  C  C   . SER A 1  1223 ? 192.641 219.751 180.320 1.00 500.00 ?  1223 SER A C   1 
ATOM   6113  O  O   . SER A 1  1223 ? 192.218 218.592 180.276 1.00 500.00 ?  1223 SER A O   1 
ATOM   6114  C  CB  . SER A 1  1223 ? 193.910 220.505 178.291 1.00 500.00 ?  1223 SER A CB  1 
ATOM   6115  O  OG  . SER A 1  1223 ? 193.925 221.342 177.147 1.00 500.00 ?  1223 SER A OG  1 
ATOM   6116  N  N   . ILE A 1  1224 ? 193.153 220.310 181.416 1.00 500.00 ?  1224 ILE A N   1 
ATOM   6117  C  CA  . ILE A 1  1224 ? 193.280 219.619 182.706 1.00 500.00 ?  1224 ILE A CA  1 
ATOM   6118  C  C   . ILE A 1  1224 ? 191.914 219.562 183.411 1.00 500.00 ?  1224 ILE A C   1 
ATOM   6119  O  O   . ILE A 1  1224 ? 191.514 218.504 183.930 1.00 500.00 ?  1224 ILE A O   1 
ATOM   6120  C  CB  . ILE A 1  1224 ? 194.378 220.290 183.592 1.00 486.37 ?  1224 ILE A CB  1 
ATOM   6121  C  CG1 . ILE A 1  1224 ? 195.775 220.284 182.916 1.00 441.69 ?  1224 ILE A CG1 1 
ATOM   6122  C  CG2 . ILE A 1  1224 ? 194.421 219.713 185.005 1.00 467.44 ?  1224 ILE A CG2 1 
ATOM   6123  C  CD1 . ILE A 1  1224 ? 196.178 219.039 182.142 1.00 426.89 ?  1224 ILE A CD1 1 
ATOM   6124  N  N   . THR A 1  1225 ? 191.214 220.703 183.404 1.00 500.00 ?  1225 THR A N   1 
ATOM   6125  C  CA  . THR A 1  1225 ? 189.856 220.835 183.953 1.00 500.00 ?  1225 THR A CA  1 
ATOM   6126  C  C   . THR A 1  1225 ? 188.916 219.764 183.404 1.00 500.00 ?  1225 THR A C   1 
ATOM   6127  O  O   . THR A 1  1225 ? 188.234 219.116 184.194 1.00 500.00 ?  1225 THR A O   1 
ATOM   6128  C  CB  . THR A 1  1225 ? 189.274 222.262 183.753 1.00 500.00 ?  1225 THR A CB  1 
ATOM   6129  O  OG1 . THR A 1  1225 ? 189.880 223.158 184.696 1.00 500.00 ?  1225 THR A OG1 1 
ATOM   6130  C  CG2 . THR A 1  1225 ? 187.739 222.293 183.940 1.00 500.00 ?  1225 THR A CG2 1 
ATOM   6131  N  N   . ARG A 1  1226 ? 188.923 219.575 182.077 1.00 500.00 ?  1226 ARG A N   1 
ATOM   6132  C  CA  . ARG A 1  1226 ? 188.108 218.566 181.373 1.00 500.00 ?  1226 ARG A CA  1 
ATOM   6133  C  C   . ARG A 1  1226 ? 188.473 217.122 181.759 1.00 500.00 ?  1226 ARG A C   1 
ATOM   6134  O  O   . ARG A 1  1226 ? 187.588 216.263 181.892 1.00 500.00 ?  1226 ARG A O   1 
ATOM   6135  C  CB  . ARG A 1  1226 ? 188.204 218.753 179.852 1.00 500.00 ?  1226 ARG A CB  1 
ATOM   6136  C  CG  . ARG A 1  1226 ? 187.045 218.146 179.068 1.00 500.00 ?  1226 ARG A CG  1 
ATOM   6137  C  CD  . ARG A 1  1226 ? 187.326 218.078 177.571 1.00 500.00 ?  1226 ARG A CD  1 
ATOM   6138  N  NE  . ARG A 1  1226 ? 187.318 219.396 176.928 1.00 500.00 ?  1226 ARG A NE  1 
ATOM   6139  C  CZ  . ARG A 1  1226 ? 188.383 220.003 176.403 1.00 500.00 ?  1226 ARG A CZ  1 
ATOM   6140  N  NH1 . ARG A 1  1226 ? 189.581 219.426 176.416 1.00 500.00 ?  1226 ARG A NH1 1 
ATOM   6141  N  NH2 . ARG A 1  1226 ? 188.246 221.200 175.849 1.00 500.00 ?  1226 ARG A NH2 1 
ATOM   6142  N  N   . LEU A 1  1227 ? 189.774 216.882 181.936 1.00 500.00 ?  1227 LEU A N   1 
ATOM   6143  C  CA  . LEU A 1  1227 ? 190.316 215.596 182.388 1.00 500.00 ?  1227 LEU A CA  1 
ATOM   6144  C  C   . LEU A 1  1227 ? 189.826 215.222 183.796 1.00 500.00 ?  1227 LEU A C   1 
ATOM   6145  O  O   . LEU A 1  1227 ? 189.339 214.104 184.013 1.00 500.00 ?  1227 LEU A O   1 
ATOM   6146  C  CB  . LEU A 1  1227 ? 191.858 215.608 182.278 1.00 482.92 ?  1227 LEU A CB  1 
ATOM   6147  C  CG  . LEU A 1  1227 ? 192.867 214.923 183.215 1.00 456.04 ?  1227 LEU A CG  1 
ATOM   6148  C  CD1 . LEU A 1  1227 ? 192.709 213.413 183.262 1.00 441.47 ?  1227 LEU A CD1 1 
ATOM   6149  C  CD2 . LEU A 1  1227 ? 194.277 215.280 182.772 1.00 442.84 ?  1227 LEU A CD2 1 
ATOM   6150  N  N   . LEU A 1  1228 ? 189.948 216.166 184.731 1.00 486.01 ?  1228 LEU A N   1 
ATOM   6151  C  CA  . LEU A 1  1228 ? 189.515 215.965 186.116 1.00 446.72 ?  1228 LEU A CA  1 
ATOM   6152  C  C   . LEU A 1  1228 ? 187.997 215.810 186.211 1.00 460.17 ?  1228 LEU A C   1 
ATOM   6153  O  O   . LEU A 1  1228 ? 187.478 215.011 186.985 1.00 470.86 ?  1228 LEU A O   1 
ATOM   6154  C  CB  . LEU A 1  1228 ? 190.015 217.105 187.021 1.00 394.81 ?  1228 LEU A CB  1 
ATOM   6155  C  CG  . LEU A 1  1228 ? 191.532 217.266 187.271 1.00 352.66 ?  1228 LEU A CG  1 
ATOM   6156  C  CD1 . LEU A 1  1228 ? 191.818 218.323 188.318 1.00 336.24 ?  1228 LEU A CD1 1 
ATOM   6157  C  CD2 . LEU A 1  1228 ? 192.212 215.984 187.711 1.00 324.70 ?  1228 LEU A CD2 1 
ATOM   6158  N  N   . SER A 1  1229 ? 186.900 217.689 184.313 1.00 500.00 ?  1229 SER A N   1 
ATOM   6159  C  CA  . SER A 1  1229 ? 185.467 217.553 184.263 1.00 500.00 ?  1229 SER A CA  1 
ATOM   6160  C  C   . SER A 1  1229 ? 185.100 216.107 184.535 1.00 500.00 ?  1229 SER A C   1 
ATOM   6161  O  O   . SER A 1  1229 ? 184.329 215.830 185.457 1.00 500.00 ?  1229 SER A O   1 
ATOM   6162  C  CB  . SER A 1  1229 ? 184.913 218.093 182.946 1.00 500.00 ?  1229 SER A CB  1 
ATOM   6163  O  OG  . SER A 1  1229 ? 185.055 219.504 182.908 1.00 500.00 ?  1229 SER A OG  1 
ATOM   6164  N  N   . ILE A 1  1230 ? 185.777 215.208 183.815 1.00 500.00 ?  1230 ILE A N   1 
ATOM   6165  C  CA  . ILE A 1  1230 ? 185.310 213.847 183.531 1.00 500.00 ?  1230 ILE A CA  1 
ATOM   6166  C  C   . ILE A 1  1230 ? 185.286 212.825 184.693 1.00 500.00 ?  1230 ILE A C   1 
ATOM   6167  O  O   . ILE A 1  1230 ? 184.464 211.904 184.664 1.00 500.00 ?  1230 ILE A O   1 
ATOM   6168  C  CB  . ILE A 1  1230 ? 186.007 213.296 182.236 1.00 500.00 ?  1230 ILE A CB  1 
ATOM   6169  C  CG1 . ILE A 1  1230 ? 184.979 212.814 181.188 1.00 500.00 ?  1230 ILE A CG1 1 
ATOM   6170  C  CG2 . ILE A 1  1230 ? 187.159 212.326 182.527 1.00 500.00 ?  1230 ILE A CG2 1 
ATOM   6171  C  CD1 . ILE A 1  1230 ? 184.249 211.521 181.491 1.00 500.00 ?  1230 ILE A CD1 1 
ATOM   6172  N  N   . HIS A 1  1231 ? 186.157 212.979 185.697 1.00 500.00 ?  1231 HIS A N   1 
ATOM   6173  C  CA  . HIS A 1  1231 ? 186.214 212.006 186.807 1.00 500.00 ?  1231 HIS A CA  1 
ATOM   6174  C  C   . HIS A 1  1231 ? 185.186 212.271 187.913 1.00 500.00 ?  1231 HIS A C   1 
ATOM   6175  O  O   . HIS A 1  1231 ? 184.319 211.426 188.160 1.00 500.00 ?  1231 HIS A O   1 
ATOM   6176  C  CB  . HIS A 1  1231 ? 187.632 211.868 187.381 1.00 480.01 ?  1231 HIS A CB  1 
ATOM   6177  C  CG  . HIS A 1  1231 ? 188.574 211.120 186.491 1.00 458.80 ?  1231 HIS A CG  1 
ATOM   6178  N  ND1 . HIS A 1  1231 ? 189.445 211.753 185.631 1.00 460.83 ?  1231 HIS A ND1 1 
ATOM   6179  C  CD2 . HIS A 1  1231 ? 188.781 209.791 186.327 1.00 434.40 ?  1231 HIS A CD2 1 
ATOM   6180  C  CE1 . HIS A 1  1231 ? 190.149 210.847 184.975 1.00 443.17 ?  1231 HIS A CE1 1 
ATOM   6181  N  NE2 . HIS A 1  1231 ? 189.766 209.648 185.379 1.00 423.21 ?  1231 HIS A NE2 1 
ATOM   6182  N  N   . ILE A 1  1232 ? 185.275 213.435 188.565 1.00 500.00 ?  1232 ILE A N   1 
ATOM   6183  C  CA  . ILE A 1  1232 ? 184.324 213.789 189.634 1.00 500.00 ?  1232 ILE A CA  1 
ATOM   6184  C  C   . ILE A 1  1232 ? 182.924 214.029 189.025 1.00 500.00 ?  1232 ILE A C   1 
ATOM   6185  O  O   . ILE A 1  1232 ? 182.768 214.895 188.153 1.00 500.00 ?  1232 ILE A O   1 
ATOM   6186  C  CB  . ILE A 1  1232 ? 184.837 214.912 190.607 1.00 500.00 ?  1232 ILE A CB  1 
ATOM   6187  C  CG1 . ILE A 1  1232 ? 184.571 216.339 190.107 1.00 500.00 ?  1232 ILE A CG1 1 
ATOM   6188  C  CG2 . ILE A 1  1232 ? 186.322 214.743 190.910 1.00 494.36 ?  1232 ILE A CG2 1 
ATOM   6189  C  CD1 . ILE A 1  1232 ? 183.364 217.025 190.719 1.00 500.00 ?  1232 ILE A CD1 1 
ATOM   6190  N  N   . PRO A 1  1233 ? 181.919 213.229 189.455 1.00 500.00 ?  1233 PRO A N   1 
ATOM   6191  C  CA  . PRO A 1  1233 ? 180.564 213.193 188.859 1.00 500.00 ?  1233 PRO A CA  1 
ATOM   6192  C  C   . PRO A 1  1233 ? 179.824 214.527 188.677 1.00 500.00 ?  1233 PRO A C   1 
ATOM   6193  O  O   . PRO A 1  1233 ? 178.802 214.562 187.984 1.00 500.00 ?  1233 PRO A O   1 
ATOM   6194  C  CB  . PRO A 1  1233 ? 179.776 212.265 189.801 1.00 500.00 ?  1233 PRO A CB  1 
ATOM   6195  C  CG  . PRO A 1  1233 ? 180.640 212.064 190.996 1.00 500.00 ?  1233 PRO A CG  1 
ATOM   6196  C  CD  . PRO A 1  1233 ? 182.048 212.223 190.526 1.00 500.00 ?  1233 PRO A CD  1 
ATOM   6197  N  N   . ALA A 1  1234 ? 180.340 215.600 189.277 1.00 500.00 ?  1234 ALA A N   1 
ATOM   6198  C  CA  . ALA A 1  1234 ? 179.735 216.931 189.163 1.00 500.00 ?  1234 ALA A CA  1 
ATOM   6199  C  C   . ALA A 1  1234 ? 180.469 217.913 188.229 1.00 500.00 ?  1234 ALA A C   1 
ATOM   6200  O  O   . ALA A 1  1234 ? 179.913 218.958 187.874 1.00 500.00 ?  1234 ALA A O   1 
ATOM   6201  C  CB  . ALA A 1  1234 ? 179.536 217.542 190.545 1.00 500.00 ?  1234 ALA A CB  1 
ATOM   6202  N  N   . LEU A 1  1235 ? 181.691 217.577 187.811 1.00 500.00 ?  1235 LEU A N   1 
ATOM   6203  C  CA  . LEU A 1  1235 ? 182.492 218.504 186.997 1.00 495.68 ?  1235 LEU A CA  1 
ATOM   6204  C  C   . LEU A 1  1235 ? 182.306 218.360 185.466 1.00 493.47 ?  1235 LEU A C   1 
ATOM   6205  O  O   . LEU A 1  1235 ? 182.409 219.352 184.745 1.00 500.00 ?  1235 LEU A O   1 
ATOM   6206  C  CB  . LEU A 1  1235 ? 183.951 218.519 187.493 1.00 476.23 ?  1235 LEU A CB  1 
ATOM   6207  C  CG  . LEU A 1  1235 ? 185.296 218.902 186.869 1.00 458.50 ?  1235 LEU A CG  1 
ATOM   6208  C  CD1 . LEU A 1  1235 ? 185.701 220.371 186.924 1.00 438.73 ?  1235 LEU A CD1 1 
ATOM   6209  C  CD2 . LEU A 1  1235 ? 186.333 218.064 187.588 1.00 452.49 ?  1235 LEU A CD2 1 
ATOM   6210  N  N   . LEU A 1  1236 ? 181.984 217.149 184.994 1.00 459.75 ?  1236 LEU A N   1 
ATOM   6211  C  CA  . LEU A 1  1236 ? 181.648 216.894 183.572 1.00 406.35 ?  1236 LEU A CA  1 
ATOM   6212  C  C   . LEU A 1  1236 ? 180.224 217.342 183.177 1.00 389.69 ?  1236 LEU A C   1 
ATOM   6213  O  O   . LEU A 1  1236 ? 179.248 216.803 183.712 1.00 350.59 ?  1236 LEU A O   1 
ATOM   6214  C  CB  . LEU A 1  1236 ? 181.895 215.421 183.170 1.00 370.10 ?  1236 LEU A CB  1 
ATOM   6215  C  CG  . LEU A 1  1236 ? 181.193 214.221 183.826 1.00 339.78 ?  1236 LEU A CG  1 
ATOM   6216  C  CD1 . LEU A 1  1236 ? 181.260 213.009 182.915 1.00 338.52 ?  1236 LEU A CD1 1 
ATOM   6217  C  CD2 . LEU A 1  1236 ? 181.779 213.873 185.183 1.00 368.53 ?  1236 LEU A CD2 1 
ATOM   6218  N  N   . PRO A 1  1237 ? 180.103 218.333 182.253 1.00 391.62 ?  1237 PRO A N   1 
ATOM   6219  C  CA  . PRO A 1  1237 ? 178.800 218.751 181.737 1.00 362.95 ?  1237 PRO A CA  1 
ATOM   6220  C  C   . PRO A 1  1237 ? 178.517 218.236 180.292 1.00 343.55 ?  1237 PRO A C   1 
ATOM   6221  O  O   . PRO A 1  1237 ? 177.886 217.183 180.173 1.00 350.25 ?  1237 PRO A O   1 
ATOM   6222  C  CB  . PRO A 1  1237 ? 178.852 220.288 181.880 1.00 358.74 ?  1237 PRO A CB  1 
ATOM   6223  C  CG  . PRO A 1  1237 ? 180.304 220.626 182.151 1.00 388.68 ?  1237 PRO A CG  1 
ATOM   6224  C  CD  . PRO A 1  1237 ? 181.099 219.367 181.933 1.00 402.66 ?  1237 PRO A CD  1 
ATOM   6225  N  N   . PRO A 1  1238 ? 178.946 218.948 179.212 1.00 335.09 ?  1238 PRO A N   1 
ATOM   6226  C  CA  . PRO A 1  1238 ? 178.845 218.210 177.952 1.00 329.78 ?  1238 PRO A CA  1 
ATOM   6227  C  C   . PRO A 1  1238 ? 180.178 217.934 177.194 1.00 309.61 ?  1238 PRO A C   1 
ATOM   6228  O  O   . PRO A 1  1238 ? 180.740 218.874 176.630 1.00 342.85 ?  1238 PRO A O   1 
ATOM   6229  C  CB  . PRO A 1  1238 ? 177.909 219.101 177.115 1.00 354.57 ?  1238 PRO A CB  1 
ATOM   6230  C  CG  . PRO A 1  1238 ? 178.003 220.473 177.731 1.00 361.16 ?  1238 PRO A CG  1 
ATOM   6231  C  CD  . PRO A 1  1238 ? 178.908 220.395 178.931 1.00 340.29 ?  1238 PRO A CD  1 
ATOM   6232  N  N   . THR A 1  1239 ? 180.718 216.702 177.163 1.00 281.05 ?  1239 THR A N   1 
ATOM   6233  C  CA  . THR A 1  1239 ? 180.310 215.490 177.920 1.00 281.65 ?  1239 THR A CA  1 
ATOM   6234  C  C   . THR A 1  1239 ? 178.791 215.142 177.789 1.00 270.61 ?  1239 THR A C   1 
ATOM   6235  O  O   . THR A 1  1239 ? 178.214 215.501 176.759 1.00 224.48 ?  1239 THR A O   1 
ATOM   6236  C  CB  . THR A 1  1239 ? 180.933 215.476 179.350 1.00 303.60 ?  1239 THR A CB  1 
ATOM   6237  O  OG1 . THR A 1  1239 ? 181.399 216.785 179.704 1.00 300.50 ?  1239 THR A OG1 1 
ATOM   6238  C  CG2 . THR A 1  1239 ? 182.120 214.520 179.399 1.00 300.09 ?  1239 THR A CG2 1 
ATOM   6239  N  N   . SER A 1  1240 ? 178.127 214.424 178.711 1.00 295.51 ?  1240 SER A N   1 
ATOM   6240  C  CA  . SER A 1  1240 ? 178.672 213.592 179.792 1.00 299.91 ?  1240 SER A CA  1 
ATOM   6241  C  C   . SER A 1  1240 ? 178.380 212.145 179.471 1.00 301.42 ?  1240 SER A C   1 
ATOM   6242  O  O   . SER A 1  1240 ? 177.259 211.798 179.087 1.00 344.67 ?  1240 SER A O   1 
ATOM   6243  C  CB  . SER A 1  1240 ? 178.030 213.932 181.141 1.00 312.53 ?  1240 SER A CB  1 
ATOM   6244  O  OG  . SER A 1  1240 ? 178.599 215.086 181.725 1.00 304.87 ?  1240 SER A OG  1 
ATOM   6245  N  N   . THR A 1  1241 ? 179.379 211.296 179.639 1.00 294.83 ?  1241 THR A N   1 
ATOM   6246  C  CA  . THR A 1  1241 ? 179.204 209.870 179.371 1.00 350.26 ?  1241 THR A CA  1 
ATOM   6247  C  C   . THR A 1  1241 ? 179.079 209.035 180.667 1.00 363.78 ?  1241 THR A C   1 
ATOM   6248  O  O   . THR A 1  1241 ? 179.323 209.555 181.761 1.00 413.41 ?  1241 THR A O   1 
ATOM   6249  C  CB  . THR A 1  1241 ? 180.287 209.358 178.397 1.00 359.48 ?  1241 THR A CB  1 
ATOM   6250  O  OG1 . THR A 1  1241 ? 181.320 210.347 178.265 1.00 335.38 ?  1241 THR A OG1 1 
ATOM   6251  C  CG2 . THR A 1  1241 ? 179.685 209.123 177.021 1.00 362.12 ?  1241 THR A CG2 1 
ATOM   6252  N  N   . GLU A 1  1242 ? 178.662 207.769 180.532 1.00 318.89 ?  1242 GLU A N   1 
ATOM   6253  C  CA  . GLU A 1  1242 ? 178.508 206.811 181.653 1.00 267.91 ?  1242 GLU A CA  1 
ATOM   6254  C  C   . GLU A 1  1242 ? 179.835 206.638 182.415 1.00 256.23 ?  1242 GLU A C   1 
ATOM   6255  O  O   . GLU A 1  1242 ? 180.652 205.760 182.118 1.00 222.59 ?  1242 GLU A O   1 
ATOM   6256  C  CB  . GLU A 1  1242 ? 177.996 205.458 181.143 1.00 279.61 ?  1242 GLU A CB  1 
ATOM   6257  C  CG  . GLU A 1  1242 ? 176.961 205.528 180.025 1.00 306.07 ?  1242 GLU A CG  1 
ATOM   6258  C  CD  . GLU A 1  1242 ? 177.116 204.413 178.999 1.00 330.38 ?  1242 GLU A CD  1 
ATOM   6259  O  OE1 . GLU A 1  1242 ? 178.262 204.114 178.590 1.00 318.84 -1 1242 GLU A OE1 1 
ATOM   6260  O  OE2 . GLU A 1  1242 ? 176.087 203.833 178.594 1.00 361.89 ?  1242 GLU A OE2 1 
ATOM   6261  N  N   . LEU A 1  1243 ? 180.023 207.502 183.407 1.00 267.66 ?  1243 LEU A N   1 
ATOM   6262  C  CA  . LEU A 1  1243 ? 181.330 207.768 184.016 1.00 265.67 ?  1243 LEU A CA  1 
ATOM   6263  C  C   . LEU A 1  1243 ? 181.659 206.813 185.173 1.00 236.67 ?  1243 LEU A C   1 
ATOM   6264  O  O   . LEU A 1  1243 ? 182.026 207.251 186.267 1.00 268.07 ?  1243 LEU A O   1 
ATOM   6265  C  CB  . LEU A 1  1243 ? 181.397 209.249 184.466 1.00 314.37 ?  1243 LEU A CB  1 
ATOM   6266  C  CG  . LEU A 1  1243 ? 180.382 209.775 185.508 1.00 341.63 ?  1243 LEU A CG  1 
ATOM   6267  C  CD1 . LEU A 1  1243 ? 181.078 210.609 186.573 1.00 341.19 ?  1243 LEU A CD1 1 
ATOM   6268  C  CD2 . LEU A 1  1243 ? 179.201 210.528 184.905 1.00 344.19 ?  1243 LEU A CD2 1 
ATOM   6269  N  N   . ASP A 1  1244 ? 181.547 205.514 184.925 1.00 186.87 ?  1244 ASP A N   1 
ATOM   6270  C  CA  . ASP A 1  1244 ? 181.609 204.491 185.986 1.00 209.80 ?  1244 ASP A CA  1 
ATOM   6271  C  C   . ASP A 1  1244 ? 182.954 204.413 186.760 1.00 204.56 ?  1244 ASP A C   1 
ATOM   6272  O  O   . ASP A 1  1244 ? 183.589 203.351 186.837 1.00 217.52 ?  1244 ASP A O   1 
ATOM   6273  C  CB  . ASP A 1  1244 ? 181.218 203.130 185.394 1.00 259.45 ?  1244 ASP A CB  1 
ATOM   6274  C  CG  . ASP A 1  1244 ? 182.002 202.793 184.124 1.00 294.28 ?  1244 ASP A CG  1 
ATOM   6275  O  OD1 . ASP A 1  1244 ? 182.047 203.636 183.199 1.00 294.93 ?  1244 ASP A OD1 1 
ATOM   6276  O  OD2 . ASP A 1  1244 ? 182.579 201.685 184.052 1.00 316.91 -1 1244 ASP A OD2 1 
ATOM   6277  N  N   . VAL A 1  1245 ? 183.342 205.551 187.347 1.00 178.86 ?  1245 VAL A N   1 
ATOM   6278  C  CA  . VAL A 1  1245 ? 184.647 205.803 187.989 1.00 158.47 ?  1245 VAL A CA  1 
ATOM   6279  C  C   . VAL A 1  1245 ? 184.734 205.088 189.339 1.00 170.24 ?  1245 VAL A C   1 
ATOM   6280  O  O   . VAL A 1  1245 ? 183.736 205.073 190.064 1.00 198.10 ?  1245 VAL A O   1 
ATOM   6281  C  CB  . VAL A 1  1245 ? 184.845 207.333 188.191 1.00 153.31 ?  1245 VAL A CB  1 
ATOM   6282  C  CG1 . VAL A 1  1245 ? 185.896 207.661 189.248 1.00 153.32 ?  1245 VAL A CG1 1 
ATOM   6283  C  CG2 . VAL A 1  1245 ? 185.175 208.033 186.876 1.00 143.67 ?  1245 VAL A CG2 1 
ATOM   6284  N  N   . PRO A 1  1246 ? 185.910 204.490 189.676 1.00 184.56 ?  1246 PRO A N   1 
ATOM   6285  C  CA  . PRO A 1  1246 ? 186.093 203.928 191.023 1.00 209.09 ?  1246 PRO A CA  1 
ATOM   6286  C  C   . PRO A 1  1246 ? 186.255 205.006 192.091 1.00 205.41 ?  1246 PRO A C   1 
ATOM   6287  O  O   . PRO A 1  1246 ? 187.066 205.927 191.917 1.00 145.46 ?  1246 PRO A O   1 
ATOM   6288  C  CB  . PRO A 1  1246 ? 187.374 203.073 190.897 1.00 204.22 ?  1246 PRO A CB  1 
ATOM   6289  C  CG  . PRO A 1  1246 ? 187.535 202.834 189.435 1.00 193.01 ?  1246 PRO A CG  1 
ATOM   6290  C  CD  . PRO A 1  1246 ? 187.016 204.088 188.786 1.00 194.08 ?  1246 PRO A CD  1 
ATOM   6291  N  N   . HIS A 1  1247 ? 185.484 204.867 193.180 1.00 245.72 ?  1247 HIS A N   1 
ATOM   6292  C  CA  . HIS A 1  1247 ? 185.454 205.839 194.282 1.00 267.16 ?  1247 HIS A CA  1 
ATOM   6293  C  C   . HIS A 1  1247 ? 186.876 206.260 194.625 1.00 249.32 ?  1247 HIS A C   1 
ATOM   6294  O  O   . HIS A 1  1247 ? 187.219 207.453 194.518 1.00 278.43 ?  1247 HIS A O   1 
ATOM   6295  C  CB  . HIS A 1  1247 ? 184.689 205.321 195.526 1.00 294.07 ?  1247 HIS A CB  1 
ATOM   6296  C  CG  . HIS A 1  1247 ? 184.329 206.401 196.511 1.00 328.52 ?  1247 HIS A CG  1 
ATOM   6297  N  ND1 . HIS A 1  1247 ? 184.940 206.531 197.742 1.00 343.28 ?  1247 HIS A ND1 1 
ATOM   6298  C  CD2 . HIS A 1  1247 ? 183.436 207.418 196.433 1.00 337.19 ?  1247 HIS A CD2 1 
ATOM   6299  C  CE1 . HIS A 1  1247 ? 184.436 207.575 198.379 1.00 348.93 ?  1247 HIS A CE1 1 
ATOM   6300  N  NE2 . HIS A 1  1247 ? 183.519 208.128 197.608 1.00 340.24 ?  1247 HIS A NE2 1 
ATOM   6301  N  N   . ASN A 1  1248 ? 187.724 205.283 194.946 1.00 180.60 ?  1248 ASN A N   1 
ATOM   6302  C  CA  . ASN A 1  1248 ? 189.082 205.606 195.303 1.00 150.47 ?  1248 ASN A CA  1 
ATOM   6303  C  C   . ASN A 1  1248 ? 189.758 206.581 194.338 1.00 114.82 ?  1248 ASN A C   1 
ATOM   6304  O  O   . ASN A 1  1248 ? 190.630 207.299 194.747 1.00 96.35  ?  1248 ASN A O   1 
ATOM   6305  C  CB  . ASN A 1  1248 ? 189.921 204.348 195.510 1.00 190.07 ?  1248 ASN A CB  1 
ATOM   6306  C  CG  . ASN A 1  1248 ? 190.940 204.494 196.648 1.00 225.78 ?  1248 ASN A CG  1 
ATOM   6307  O  OD1 . ASN A 1  1248 ? 191.093 205.569 197.246 1.00 232.30 ?  1248 ASN A OD1 1 
ATOM   6308  N  ND2 . ASN A 1  1248 ? 191.643 203.402 196.953 1.00 235.35 ?  1248 ASN A ND2 1 
ATOM   6309  N  N   . VAL A 1  1249 ? 189.338 206.636 193.082 1.00 124.14 ?  1249 VAL A N   1 
ATOM   6310  C  CA  . VAL A 1  1249 ? 189.952 207.573 192.122 1.00 191.49 ?  1249 VAL A CA  1 
ATOM   6311  C  C   . VAL A 1  1249 ? 189.477 209.038 192.337 1.00 261.05 ?  1249 VAL A C   1 
ATOM   6312  O  O   . VAL A 1  1249 ? 190.308 209.978 192.368 1.00 303.33 ?  1249 VAL A O   1 
ATOM   6313  C  CB  . VAL A 1  1249 ? 189.789 207.102 190.637 1.00 179.19 ?  1249 VAL A CB  1 
ATOM   6314  C  CG1 . VAL A 1  1249 ? 190.449 208.065 189.650 1.00 202.70 ?  1249 VAL A CG1 1 
ATOM   6315  C  CG2 . VAL A 1  1249 ? 190.390 205.728 190.431 1.00 137.08 ?  1249 VAL A CG2 1 
ATOM   6316  N  N   . GLN A 1  1250 ? 188.158 209.211 192.505 1.00 316.11 ?  1250 GLN A N   1 
ATOM   6317  C  CA  . GLN A 1  1250 ? 187.506 210.546 192.519 1.00 350.65 ?  1250 GLN A CA  1 
ATOM   6318  C  C   . GLN A 1  1250 ? 188.010 211.520 193.595 1.00 381.12 ?  1250 GLN A C   1 
ATOM   6319  O  O   . GLN A 1  1250 ? 188.285 212.683 193.283 1.00 422.34 ?  1250 GLN A O   1 
ATOM   6320  C  CB  . GLN A 1  1250 ? 185.954 210.490 192.486 1.00 351.22 ?  1250 GLN A CB  1 
ATOM   6321  C  CG  . GLN A 1  1250 ? 185.288 209.118 192.552 1.00 340.39 ?  1250 GLN A CG  1 
ATOM   6322  C  CD  . GLN A 1  1250 ? 183.772 209.173 192.435 1.00 320.76 ?  1250 GLN A CD  1 
ATOM   6323  O  OE1 . GLN A 1  1250 ? 183.070 209.373 193.425 1.00 270.98 ?  1250 GLN A OE1 1 
ATOM   6324  N  NE2 . GLN A 1  1250 ? 183.259 208.978 191.226 1.00 324.68 ?  1250 GLN A NE2 1 
ATOM   6325  N  N   . VAL A 1  1251 ? 188.152 211.026 194.830 1.00 393.45 ?  1251 VAL A N   1 
ATOM   6326  C  CA  . VAL A 1  1251 ? 188.731 211.779 195.970 1.00 397.03 ?  1251 VAL A CA  1 
ATOM   6327  C  C   . VAL A 1  1251 ? 189.997 212.572 195.600 1.00 419.09 ?  1251 VAL A C   1 
ATOM   6328  O  O   . VAL A 1  1251 ? 190.113 213.753 195.939 1.00 463.45 ?  1251 VAL A O   1 
ATOM   6329  C  CB  . VAL A 1  1251 ? 189.009 210.865 197.204 1.00 394.47 ?  1251 VAL A CB  1 
ATOM   6330  C  CG1 . VAL A 1  1251 ? 187.733 210.205 197.687 1.00 398.22 ?  1251 VAL A CG1 1 
ATOM   6331  C  CG2 . VAL A 1  1251 ? 190.035 209.779 196.898 1.00 402.67 ?  1251 VAL A CG2 1 
ATOM   6332  N  N   . ALA A 1  1252 ? 190.908 211.908 194.878 1.00 405.64 ?  1252 ALA A N   1 
ATOM   6333  C  CA  . ALA A 1  1252 ? 192.179 212.480 194.432 1.00 377.76 ?  1252 ALA A CA  1 
ATOM   6334  C  C   . ALA A 1  1252 ? 191.967 213.637 193.452 1.00 390.06 ?  1252 ALA A C   1 
ATOM   6335  O  O   . ALA A 1  1252 ? 192.547 214.701 193.635 1.00 414.68 ?  1252 ALA A O   1 
ATOM   6336  C  CB  . ALA A 1  1252 ? 193.065 211.399 193.821 1.00 323.45 ?  1252 ALA A CB  1 
ATOM   6337  N  N   . ALA A 1  1253 ? 191.135 213.413 192.428 1.00 366.68 ?  1253 ALA A N   1 
ATOM   6338  C  CA  . ALA A 1  1253 ? 190.729 214.453 191.466 1.00 308.10 ?  1253 ALA A CA  1 
ATOM   6339  C  C   . ALA A 1  1253 ? 189.960 215.573 192.167 1.00 256.69 ?  1253 ALA A C   1 
ATOM   6340  O  O   . ALA A 1  1253 ? 190.229 216.753 191.958 1.00 153.76 ?  1253 ALA A O   1 
ATOM   6341  C  CB  . ALA A 1  1253 ? 189.896 213.847 190.342 1.00 314.56 ?  1253 ALA A CB  1 
ATOM   6342  N  N   . VAL A 1  1254 ? 189.029 215.204 193.041 1.00 280.24 ?  1254 VAL A N   1 
ATOM   6343  C  CA  . VAL A 1  1254 ? 188.446 216.198 193.926 1.00 286.04 ?  1254 VAL A CA  1 
ATOM   6344  C  C   . VAL A 1  1254 ? 189.614 217.057 194.480 1.00 245.08 ?  1254 VAL A C   1 
ATOM   6345  O  O   . VAL A 1  1254 ? 189.614 218.264 194.264 1.00 174.96 ?  1254 VAL A O   1 
ATOM   6346  C  CB  . VAL A 1  1254 ? 187.518 215.615 195.036 1.00 336.15 ?  1254 VAL A CB  1 
ATOM   6347  C  CG1 . VAL A 1  1254 ? 186.869 216.750 195.806 1.00 351.07 ?  1254 VAL A CG1 1 
ATOM   6348  C  CG2 . VAL A 1  1254 ? 186.396 214.743 194.468 1.00 341.46 ?  1254 VAL A CG2 1 
ATOM   6349  N  N   . VAL A 1  1255 ? 190.635 216.436 195.097 1.00 249.54 ?  1255 VAL A N   1 
ATOM   6350  C  CA  . VAL A 1  1255 ? 191.795 217.196 195.639 1.00 202.95 ?  1255 VAL A CA  1 
ATOM   6351  C  C   . VAL A 1  1255 ? 192.591 217.770 194.494 1.00 147.78 ?  1255 VAL A C   1 
ATOM   6352  O  O   . VAL A 1  1255 ? 193.214 218.819 194.625 1.00 136.76 ?  1255 VAL A O   1 
ATOM   6353  C  CB  . VAL A 1  1255 ? 192.803 216.375 196.489 1.00 239.42 ?  1255 VAL A CB  1 
ATOM   6354  C  CG1 . VAL A 1  1255 ? 193.697 217.323 197.272 1.00 238.58 ?  1255 VAL A CG1 1 
ATOM   6355  C  CG2 . VAL A 1  1255 ? 192.127 215.412 197.448 1.00 267.12 ?  1255 VAL A CG2 1 
ATOM   6356  N  N   . GLY A 1  1256 ? 192.580 217.050 193.382 1.00 124.16 ?  1256 GLY A N   1 
ATOM   6357  C  CA  . GLY A 1  1256 ? 193.162 217.545 192.168 1.00 161.66 ?  1256 GLY A CA  1 
ATOM   6358  C  C   . GLY A 1  1256 ? 192.539 218.883 191.847 1.00 163.31 ?  1256 GLY A C   1 
ATOM   6359  O  O   . GLY A 1  1256 ? 193.252 219.862 191.594 1.00 180.20 ?  1256 GLY A O   1 
ATOM   6360  N  N   . ILE A 1  1257 ? 191.210 218.941 191.911 1.00 124.07 ?  1257 ILE A N   1 
ATOM   6361  C  CA  . ILE A 1  1257 ? 190.506 220.125 191.503 1.00 129.92 ?  1257 ILE A CA  1 
ATOM   6362  C  C   . ILE A 1  1257 ? 190.973 221.293 192.335 1.00 124.01 ?  1257 ILE A C   1 
ATOM   6363  O  O   . ILE A 1  1257 ? 191.114 222.406 191.826 1.00 140.89 ?  1257 ILE A O   1 
ATOM   6364  C  CB  . ILE A 1  1257 ? 188.971 219.898 191.478 1.00 169.78 ?  1257 ILE A CB  1 
ATOM   6365  C  CG1 . ILE A 1  1257 ? 188.533 219.467 190.066 1.00 211.55 ?  1257 ILE A CG1 1 
ATOM   6366  C  CG2 . ILE A 1  1257 ? 188.155 221.099 191.986 1.00 216.79 ?  1257 ILE A CG2 1 
ATOM   6367  C  CD1 . ILE A 1  1257 ? 189.008 220.346 188.912 1.00 201.88 ?  1257 ILE A CD1 1 
ATOM   6368  N  N   . GLY A 1  1258 ? 191.260 221.019 193.601 1.00 130.56 ?  1258 GLY A N   1 
ATOM   6369  C  CA  . GLY A 1  1258 ? 191.652 222.057 194.563 1.00 151.66 ?  1258 GLY A CA  1 
ATOM   6370  C  C   . GLY A 1  1258 ? 192.937 222.742 194.152 1.00 137.20 ?  1258 GLY A C   1 
ATOM   6371  O  O   . GLY A 1  1258 ? 193.040 223.970 194.161 1.00 144.33 ?  1258 GLY A O   1 
ATOM   6372  N  N   . LEU A 1  1259 ? 193.899 221.917 193.769 1.00 129.27 ?  1259 LEU A N   1 
ATOM   6373  C  CA  . LEU A 1  1259 ? 195.167 222.374 193.264 1.00 139.13 ?  1259 LEU A CA  1 
ATOM   6374  C  C   . LEU A 1  1259 ? 194.981 223.218 191.999 1.00 147.62 ?  1259 LEU A C   1 
ATOM   6375  O  O   . LEU A 1  1259 ? 195.591 224.263 191.874 1.00 143.69 ?  1259 LEU A O   1 
ATOM   6376  C  CB  . LEU A 1  1259 ? 196.068 221.167 192.997 1.00 149.91 ?  1259 LEU A CB  1 
ATOM   6377  C  CG  . LEU A 1  1259 ? 196.381 220.267 194.190 1.00 143.26 ?  1259 LEU A CG  1 
ATOM   6378  C  CD1 . LEU A 1  1259 ? 196.552 218.818 193.745 1.00 137.76 ?  1259 LEU A CD1 1 
ATOM   6379  C  CD2 . LEU A 1  1259 ? 197.607 220.794 194.919 1.00 132.50 ?  1259 LEU A CD2 1 
ATOM   6380  N  N   . VAL A 1  1260 ? 194.094 222.773 191.104 1.00 151.95 ?  1260 VAL A N   1 
ATOM   6381  C  CA  . VAL A 1  1260 ? 193.856 223.384 189.778 1.00 141.82 ?  1260 VAL A CA  1 
ATOM   6382  C  C   . VAL A 1  1260 ? 193.185 224.742 189.899 1.00 105.87 ?  1260 VAL A C   1 
ATOM   6383  O  O   . VAL A 1  1260 ? 193.357 225.618 189.073 1.00 104.42 ?  1260 VAL A O   1 
ATOM   6384  C  CB  . VAL A 1  1260 ? 193.034 222.420 188.865 1.00 189.53 ?  1260 VAL A CB  1 
ATOM   6385  C  CG1 . VAL A 1  1260 ? 192.425 223.114 187.645 1.00 198.82 ?  1260 VAL A CG1 1 
ATOM   6386  C  CG2 . VAL A 1  1260 ? 193.895 221.240 188.420 1.00 216.20 ?  1260 VAL A CG2 1 
ATOM   6387  N  N   . TYR A 1  1261 ? 192.423 224.915 190.946 1.00 108.33 ?  1261 TYR A N   1 
ATOM   6388  C  CA  . TYR A 1  1261 ? 191.826 226.186 191.166 1.00 137.66 ?  1261 TYR A CA  1 
ATOM   6389  C  C   . TYR A 1  1261 ? 192.418 226.969 192.360 1.00 144.66 ?  1261 TYR A C   1 
ATOM   6390  O  O   . TYR A 1  1261 ? 191.878 227.987 192.760 1.00 172.88 ?  1261 TYR A O   1 
ATOM   6391  C  CB  . TYR A 1  1261 ? 190.317 225.984 191.220 1.00 172.02 ?  1261 TYR A CB  1 
ATOM   6392  C  CG  . TYR A 1  1261 ? 189.757 225.597 189.865 1.00 223.02 ?  1261 TYR A CG  1 
ATOM   6393  C  CD1 . TYR A 1  1261 ? 189.805 226.498 188.792 1.00 269.56 ?  1261 TYR A CD1 1 
ATOM   6394  C  CD2 . TYR A 1  1261 ? 189.186 224.339 189.645 1.00 261.99 ?  1261 TYR A CD2 1 
ATOM   6395  C  CE1 . TYR A 1  1261 ? 189.303 226.159 187.540 1.00 322.04 ?  1261 TYR A CE1 1 
ATOM   6396  C  CE2 . TYR A 1  1261 ? 188.677 223.991 188.392 1.00 311.62 ?  1261 TYR A CE2 1 
ATOM   6397  C  CZ  . TYR A 1  1261 ? 188.739 224.904 187.346 1.00 337.35 ?  1261 TYR A CZ  1 
ATOM   6398  O  OH  . TYR A 1  1261 ? 188.236 224.575 186.112 1.00 365.08 ?  1261 TYR A OH  1 
ATOM   6399  N  N   . GLN A 1  1262 ? 193.555 226.523 192.892 1.00 138.17 ?  1262 GLN A N   1 
ATOM   6400  C  CA  . GLN A 1  1262 ? 194.146 227.117 194.111 1.00 138.54 ?  1262 GLN A CA  1 
ATOM   6401  C  C   . GLN A 1  1262 ? 194.503 228.591 194.032 1.00 141.89 ?  1262 GLN A C   1 
ATOM   6402  O  O   . GLN A 1  1262 ? 195.272 229.021 193.181 1.00 157.00 ?  1262 GLN A O   1 
ATOM   6403  C  CB  . GLN A 1  1262 ? 195.365 226.334 194.555 1.00 145.73 ?  1262 GLN A CB  1 
ATOM   6404  C  CG  . GLN A 1  1262 ? 195.813 226.664 195.963 1.00 159.13 ?  1262 GLN A CG  1 
ATOM   6405  C  CD  . GLN A 1  1262 ? 196.199 225.427 196.763 1.00 178.39 ?  1262 GLN A CD  1 
ATOM   6406  O  OE1 . GLN A 1  1262 ? 196.265 224.300 196.243 1.00 163.46 ?  1262 GLN A OE1 1 
ATOM   6407  N  NE2 . GLN A 1  1262 ? 196.436 225.632 198.048 1.00 181.34 ?  1262 GLN A NE2 1 
ATOM   6408  N  N   . GLY A 1  1263 ? 193.928 229.355 194.948 1.00 166.77 ?  1263 GLY A N   1 
ATOM   6409  C  CA  . GLY A 1  1263 ? 194.089 230.799 194.962 1.00 180.24 ?  1263 GLY A CA  1 
ATOM   6410  C  C   . GLY A 1  1263 ? 193.063 231.563 194.144 1.00 185.60 ?  1263 GLY A C   1 
ATOM   6411  O  O   . GLY A 1  1263 ? 192.871 232.750 194.388 1.00 203.48 ?  1263 GLY A O   1 
ATOM   6412  N  N   . THR A 1  1264 ? 192.396 230.886 193.201 1.00 189.66 ?  1264 THR A N   1 
ATOM   6413  C  CA  . THR A 1  1264 ? 191.548 231.541 192.180 1.00 197.31 ?  1264 THR A CA  1 
ATOM   6414  C  C   . THR A 1  1264 ? 190.220 232.078 192.697 1.00 202.71 ?  1264 THR A C   1 
ATOM   6415  O  O   . THR A 1  1264 ? 189.721 233.088 192.184 1.00 194.02 ?  1264 THR A O   1 
ATOM   6416  C  CB  . THR A 1  1264 ? 191.283 230.640 190.945 1.00 196.99 ?  1264 THR A CB  1 
ATOM   6417  O  OG1 . THR A 1  1264 ? 190.530 229.483 191.325 1.00 217.47 ?  1264 THR A OG1 1 
ATOM   6418  C  CG2 . THR A 1  1264 ? 192.589 230.188 190.338 1.00 203.74 ?  1264 THR A CG2 1 
ATOM   6419  N  N   . ALA A 1  1265 ? 189.687 231.412 193.725 1.00 221.99 ?  1265 ALA A N   1 
ATOM   6420  C  CA  . ALA A 1  1265 ? 188.317 231.600 194.226 1.00 294.52 ?  1265 ALA A CA  1 
ATOM   6421  C  C   . ALA A 1  1265 ? 187.230 231.504 193.124 1.00 374.15 ?  1265 ALA A C   1 
ATOM   6422  O  O   . ALA A 1  1265 ? 186.313 232.334 193.056 1.00 434.20 ?  1265 ALA A O   1 
ATOM   6423  C  CB  . ALA A 1  1265 ? 188.202 232.884 195.053 1.00 258.41 ?  1265 ALA A CB  1 
ATOM   6424  N  N   . HIS A 1  1266 ? 187.349 230.474 192.276 1.00 417.17 ?  1266 HIS A N   1 
ATOM   6425  C  CA  . HIS A 1  1266 ? 186.406 230.214 191.167 1.00 444.40 ?  1266 HIS A CA  1 
ATOM   6426  C  C   . HIS A 1  1266 ? 184.962 229.985 191.628 1.00 470.43 ?  1266 HIS A C   1 
ATOM   6427  O  O   . HIS A 1  1266 ? 184.696 229.144 192.497 1.00 476.48 ?  1266 HIS A O   1 
ATOM   6428  C  CB  . HIS A 1  1266 ? 186.882 229.045 190.286 1.00 436.93 ?  1266 HIS A CB  1 
ATOM   6429  C  CG  . HIS A 1  1266 ? 186.085 228.863 189.027 1.00 433.30 ?  1266 HIS A CG  1 
ATOM   6430  N  ND1 . HIS A 1  1266 ? 186.383 229.523 187.853 1.00 428.50 ?  1266 HIS A ND1 1 
ATOM   6431  C  CD2 . HIS A 1  1266 ? 185.005 228.091 188.758 1.00 430.95 ?  1266 HIS A CD2 1 
ATOM   6432  C  CE1 . HIS A 1  1266 ? 185.521 229.167 186.917 1.00 420.28 ?  1266 HIS A CE1 1 
ATOM   6433  N  NE2 . HIS A 1  1266 ? 184.675 228.299 187.440 1.00 422.11 ?  1266 HIS A NE2 1 
ATOM   6434  N  N   . ARG A 1  1267 ? 184.059 230.751 191.013 1.00 482.64 ?  1267 ARG A N   1 
ATOM   6435  C  CA  . ARG A 1  1267 ? 182.608 230.742 191.258 1.00 485.12 ?  1267 ARG A CA  1 
ATOM   6436  C  C   . ARG A 1  1267 ? 181.958 229.348 191.290 1.00 500.00 ?  1267 ARG A C   1 
ATOM   6437  O  O   . ARG A 1  1267 ? 181.438 228.923 192.331 1.00 500.00 ?  1267 ARG A O   1 
ATOM   6438  C  CB  . ARG A 1  1267 ? 181.919 231.636 190.206 1.00 426.47 ?  1267 ARG A CB  1 
ATOM   6439  C  CG  . ARG A 1  1267 ? 180.407 231.766 190.322 1.00 366.45 ?  1267 ARG A CG  1 
ATOM   6440  C  CD  . ARG A 1  1267 ? 180.023 232.864 191.297 1.00 327.18 ?  1267 ARG A CD  1 
ATOM   6441  N  NE  . ARG A 1  1267 ? 178.577 233.065 191.342 1.00 287.77 ?  1267 ARG A NE  1 
ATOM   6442  C  CZ  . ARG A 1  1267 ? 177.759 232.543 192.253 1.00 271.01 ?  1267 ARG A CZ  1 
ATOM   6443  N  NH1 . ARG A 1  1267 ? 178.218 231.773 193.232 1.00 240.07 ?  1267 ARG A NH1 1 
ATOM   6444  N  NH2 . ARG A 1  1267 ? 176.464 232.796 192.180 1.00 286.66 ?  1267 ARG A NH2 1 
ATOM   6445  N  N   . HIS A 1  1268 ? 182.016 228.648 190.155 1.00 500.00 ?  1268 HIS A N   1 
ATOM   6446  C  CA  . HIS A 1  1268 ? 181.312 227.373 189.947 1.00 500.00 ?  1268 HIS A CA  1 
ATOM   6447  C  C   . HIS A 1  1268 ? 181.869 226.212 190.780 1.00 500.00 ?  1268 HIS A C   1 
ATOM   6448  O  O   . HIS A 1  1268 ? 181.101 225.355 191.234 1.00 500.00 ?  1268 HIS A O   1 
ATOM   6449  C  CB  . HIS A 1  1268 ? 181.307 227.006 188.457 1.00 500.00 ?  1268 HIS A CB  1 
ATOM   6450  C  CG  . HIS A 1  1268 ? 180.175 226.108 188.056 1.00 500.00 ?  1268 HIS A CG  1 
ATOM   6451  N  ND1 . HIS A 1  1268 ? 180.321 224.746 187.906 1.00 500.00 ?  1268 HIS A ND1 1 
ATOM   6452  C  CD2 . HIS A 1  1268 ? 178.881 226.382 187.766 1.00 500.00 ?  1268 HIS A CD2 1 
ATOM   6453  C  CE1 . HIS A 1  1268 ? 179.164 224.218 187.546 1.00 500.00 ?  1268 HIS A CE1 1 
ATOM   6454  N  NE2 . HIS A 1  1268 ? 178.274 225.189 187.454 1.00 500.00 ?  1268 HIS A NE2 1 
ATOM   6455  N  N   . THR A 1  1269 ? 183.192 226.204 190.975 1.00 500.00 ?  1269 THR A N   1 
ATOM   6456  C  CA  . THR A 1  1269 ? 183.907 225.146 191.714 1.00 500.00 ?  1269 THR A CA  1 
ATOM   6457  C  C   . THR A 1  1269 ? 183.480 225.065 193.187 1.00 500.00 ?  1269 THR A C   1 
ATOM   6458  O  O   . THR A 1  1269 ? 183.160 223.975 193.682 1.00 500.00 ?  1269 THR A O   1 
ATOM   6459  C  CB  . THR A 1  1269 ? 185.443 225.276 191.537 1.00 500.00 ?  1269 THR A CB  1 
ATOM   6460  O  OG1 . THR A 1  1269 ? 185.794 224.848 190.218 1.00 500.00 ?  1269 THR A OG1 1 
ATOM   6461  C  CG2 . THR A 1  1269 ? 186.226 224.423 192.540 1.00 500.00 ?  1269 THR A CG2 1 
ATOM   6462  N  N   . ALA A 1  1270 ? 183.460 226.221 193.858 1.00 500.00 ?  1270 ALA A N   1 
ATOM   6463  C  CA  . ALA A 1  1270 ? 182.950 226.347 195.230 1.00 500.00 ?  1270 ALA A CA  1 
ATOM   6464  C  C   . ALA A 1  1270 ? 181.573 225.686 195.380 1.00 500.00 ?  1270 ALA A C   1 
ATOM   6465  O  O   . ALA A 1  1270 ? 181.373 224.865 196.282 1.00 500.00 ?  1270 ALA A O   1 
ATOM   6466  C  CB  . ALA A 1  1270 ? 182.903 227.811 195.651 1.00 500.00 ?  1270 ALA A CB  1 
ATOM   6467  N  N   . GLU A 1  1271 ? 180.664 226.020 194.458 1.00 500.00 ?  1271 GLU A N   1 
ATOM   6468  C  CA  . GLU A 1  1271 ? 179.305 225.465 194.388 1.00 500.00 ?  1271 GLU A CA  1 
ATOM   6469  C  C   . GLU A 1  1271 ? 179.247 223.925 194.387 1.00 500.00 ?  1271 GLU A C   1 
ATOM   6470  O  O   . GLU A 1  1271 ? 178.519 223.337 195.198 1.00 500.00 ?  1271 GLU A O   1 
ATOM   6471  C  CB  . GLU A 1  1271 ? 178.527 226.111 193.212 1.00 500.00 ?  1271 GLU A CB  1 
ATOM   6472  C  CG  . GLU A 1  1271 ? 177.615 225.220 192.359 1.00 500.00 ?  1271 GLU A CG  1 
ATOM   6473  C  CD  . GLU A 1  1271 ? 176.405 224.654 193.096 1.00 500.00 ?  1271 GLU A CD  1 
ATOM   6474  O  OE1 . GLU A 1  1271 ? 175.958 225.243 194.105 1.00 500.00 ?  1271 GLU A OE1 1 
ATOM   6475  O  OE2 . GLU A 1  1271 ? 175.894 223.603 192.655 1.00 500.00 -1 1271 GLU A OE2 1 
ATOM   6476  N  N   . VAL A 1  1272 ? 180.020 223.287 193.503 1.00 500.00 ?  1272 VAL A N   1 
ATOM   6477  C  CA  . VAL A 1  1272 ? 180.000 221.816 193.386 1.00 500.00 ?  1272 VAL A CA  1 
ATOM   6478  C  C   . VAL A 1  1272 ? 180.703 221.119 194.562 1.00 500.00 ?  1272 VAL A C   1 
ATOM   6479  O  O   . VAL A 1  1272 ? 180.248 220.064 195.021 1.00 500.00 ?  1272 VAL A O   1 
ATOM   6480  C  CB  . VAL A 1  1272 ? 180.468 221.280 191.995 1.00 500.00 ?  1272 VAL A CB  1 
ATOM   6481  C  CG1 . VAL A 1  1272 ? 179.610 221.854 190.872 1.00 500.00 ?  1272 VAL A CG1 1 
ATOM   6482  C  CG2 . VAL A 1  1272 ? 181.952 221.522 191.730 1.00 500.00 ?  1272 VAL A CG2 1 
ATOM   6483  N  N   . LEU A 1  1273 ? 181.786 221.726 195.054 1.00 500.00 ?  1273 LEU A N   1 
ATOM   6484  C  CA  . LEU A 1  1273 ? 182.515 221.211 196.218 1.00 500.00 ?  1273 LEU A CA  1 
ATOM   6485  C  C   . LEU A 1  1273 ? 181.693 221.301 197.514 1.00 500.00 ?  1273 LEU A C   1 
ATOM   6486  O  O   . LEU A 1  1273 ? 181.780 220.407 198.362 1.00 500.00 ?  1273 LEU A O   1 
ATOM   6487  C  CB  . LEU A 1  1273 ? 183.897 221.877 196.348 1.00 500.00 ?  1273 LEU A CB  1 
ATOM   6488  C  CG  . LEU A 1  1273 ? 185.158 221.199 195.764 1.00 500.00 ?  1273 LEU A CG  1 
ATOM   6489  C  CD1 . LEU A 1  1273 ? 184.943 220.395 194.481 1.00 500.00 ?  1273 LEU A CD1 1 
ATOM   6490  C  CD2 . LEU A 1  1273 ? 186.252 222.234 195.545 1.00 500.00 ?  1273 LEU A CD2 1 
ATOM   6491  N  N   . LEU A 1  1274 ? 180.883 222.357 197.642 1.00 500.00 ?  1274 LEU A N   1 
ATOM   6492  C  CA  . LEU A 1  1274 ? 179.919 222.475 198.748 1.00 500.00 ?  1274 LEU A CA  1 
ATOM   6493  C  C   . LEU A 1  1274 ? 178.821 221.410 198.697 1.00 500.00 ?  1274 LEU A C   1 
ATOM   6494  O  O   . LEU A 1  1274 ? 178.439 220.861 199.735 1.00 500.00 ?  1274 LEU A O   1 
ATOM   6495  C  CB  . LEU A 1  1274 ? 179.310 223.884 198.835 1.00 500.00 ?  1274 LEU A CB  1 
ATOM   6496  C  CG  . LEU A 1  1274 ? 180.014 224.915 199.731 1.00 500.00 ?  1274 LEU A CG  1 
ATOM   6497  C  CD1 . LEU A 1  1274 ? 179.337 226.274 199.645 1.00 500.00 ?  1274 LEU A CD1 1 
ATOM   6498  C  CD2 . LEU A 1  1274 ? 180.103 224.461 201.183 1.00 500.00 ?  1274 LEU A CD2 1 
ATOM   6499  N  N   . ALA A 1  1275 ? 178.325 221.115 197.493 1.00 500.00 ?  1275 ALA A N   1 
ATOM   6500  C  CA  . ALA A 1  1275 ? 177.415 219.987 197.282 1.00 500.00 ?  1275 ALA A CA  1 
ATOM   6501  C  C   . ALA A 1  1275 ? 178.089 218.663 197.671 1.00 500.00 ?  1275 ALA A C   1 
ATOM   6502  O  O   . ALA A 1  1275 ? 177.482 217.827 198.349 1.00 500.00 ?  1275 ALA A O   1 
ATOM   6503  C  CB  . ALA A 1  1275 ? 176.925 219.950 195.840 1.00 500.00 ?  1275 ALA A CB  1 
ATOM   6504  N  N   . GLU A 1  1276 ? 179.356 218.511 197.276 1.00 500.00 ?  1276 GLU A N   1 
ATOM   6505  C  CA  . GLU A 1  1276 ? 180.131 217.290 197.534 1.00 500.00 ?  1276 GLU A CA  1 
ATOM   6506  C  C   . GLU A 1  1276 ? 180.546 217.073 198.993 1.00 500.00 ?  1276 GLU A C   1 
ATOM   6507  O  O   . GLU A 1  1276 ? 180.626 215.921 199.434 1.00 500.00 ?  1276 GLU A O   1 
ATOM   6508  C  CB  . GLU A 1  1276 ? 181.352 217.200 196.611 1.00 500.00 ?  1276 GLU A CB  1 
ATOM   6509  C  CG  . GLU A 1  1276 ? 181.002 216.770 195.194 1.00 500.00 ?  1276 GLU A CG  1 
ATOM   6510  C  CD  . GLU A 1  1276 ? 182.195 216.358 194.351 1.00 500.00 ?  1276 GLU A CD  1 
ATOM   6511  O  OE1 . GLU A 1  1276 ? 183.365 216.582 194.742 1.00 500.00 ?  1276 GLU A OE1 1 
ATOM   6512  O  OE2 . GLU A 1  1276 ? 181.949 215.775 193.278 1.00 500.00 -1 1276 GLU A OE2 1 
ATOM   6513  N  N   . ILE A 1  1277 ? 180.799 218.162 199.731 1.00 500.00 ?  1277 ILE A N   1 
ATOM   6514  C  CA  . ILE A 1  1277 ? 181.212 218.073 201.151 1.00 500.00 ?  1277 ILE A CA  1 
ATOM   6515  C  C   . ILE A 1  1277 ? 180.162 217.335 202.003 1.00 500.00 ?  1277 ILE A C   1 
ATOM   6516  O  O   . ILE A 1  1277 ? 180.517 216.485 202.825 1.00 500.00 ?  1277 ILE A O   1 
ATOM   6517  C  CB  . ILE A 1  1277 ? 181.679 219.443 201.759 1.00 500.00 ?  1277 ILE A CB  1 
ATOM   6518  C  CG1 . ILE A 1  1277 ? 182.429 219.229 203.090 1.00 500.00 ?  1277 ILE A CG1 1 
ATOM   6519  C  CG2 . ILE A 1  1277 ? 180.534 220.446 201.899 1.00 500.00 ?  1277 ILE A CG2 1 
ATOM   6520  C  CD1 . ILE A 1  1277 ? 183.044 220.472 203.708 1.00 500.00 ?  1277 ILE A CD1 1 
ATOM   6521  N  N   . GLY A 1  1278 ? 178.885 217.631 201.755 1.00 500.00 ?  1278 GLY A N   1 
ATOM   6522  C  CA  . GLY A 1  1278 ? 177.770 216.904 202.355 1.00 500.00 ?  1278 GLY A CA  1 
ATOM   6523  C  C   . GLY A 1  1278 ? 176.903 216.254 201.300 1.00 500.00 ?  1278 GLY A C   1 
ATOM   6524  O  O   . GLY A 1  1278 ? 176.025 216.899 200.717 1.00 500.00 ?  1278 GLY A O   1 
ATOM   6525  N  N   . ARG A 1  1279 ? 177.158 214.970 201.069 1.00 500.00 ?  1279 ARG A N   1 
ATOM   6526  C  CA  . ARG A 1  1279 ? 176.491 214.193 200.032 1.00 500.00 ?  1279 ARG A CA  1 
ATOM   6527  C  C   . ARG A 1  1279 ? 175.621 213.087 200.646 1.00 500.00 ?  1279 ARG A C   1 
ATOM   6528  O  O   . ARG A 1  1279 ? 175.970 212.544 201.706 1.00 500.00 ?  1279 ARG A O   1 
ATOM   6529  C  CB  . ARG A 1  1279 ? 177.543 213.562 199.118 1.00 500.00 ?  1279 ARG A CB  1 
ATOM   6530  C  CG  . ARG A 1  1279 ? 177.083 213.238 197.706 1.00 500.00 ?  1279 ARG A CG  1 
ATOM   6531  C  CD  . ARG A 1  1279 ? 177.687 211.917 197.268 1.00 500.00 ?  1279 ARG A CD  1 
ATOM   6532  N  NE  . ARG A 1  1279 ? 178.098 211.893 195.865 1.00 500.00 ?  1279 ARG A NE  1 
ATOM   6533  C  CZ  . ARG A 1  1279 ? 179.281 212.300 195.402 1.00 500.00 ?  1279 ARG A CZ  1 
ATOM   6534  N  NH1 . ARG A 1  1279 ? 180.213 212.777 196.217 1.00 500.00 ?  1279 ARG A NH1 1 
ATOM   6535  N  NH2 . ARG A 1  1279 ? 179.535 212.223 194.107 1.00 500.00 ?  1279 ARG A NH2 1 
ATOM   6536  N  N   . PRO A 1  1280 ? 174.482 212.755 199.990 1.00 500.00 ?  1280 PRO A N   1 
ATOM   6537  C  CA  . PRO A 1  1280 ? 173.771 211.505 200.278 1.00 500.00 ?  1280 PRO A CA  1 
ATOM   6538  C  C   . PRO A 1  1280 ? 174.705 210.282 200.186 1.00 500.00 ?  1280 PRO A C   1 
ATOM   6539  O  O   . PRO A 1  1280 ? 175.664 210.320 199.400 1.00 500.00 ?  1280 PRO A O   1 
ATOM   6540  C  CB  . PRO A 1  1280 ? 172.692 211.443 199.179 1.00 500.00 ?  1280 PRO A CB  1 
ATOM   6541  C  CG  . PRO A 1  1280 ? 172.896 212.644 198.308 1.00 500.00 ?  1280 PRO A CG  1 
ATOM   6542  C  CD  . PRO A 1  1280 ? 173.676 213.629 199.119 1.00 500.00 ?  1280 PRO A CD  1 
ATOM   6543  N  N   . PRO A 1  1281 ? 174.450 209.222 200.997 1.00 500.00 ?  1281 PRO A N   1 
ATOM   6544  C  CA  . PRO A 1  1281 ? 175.226 207.964 200.977 1.00 500.00 ?  1281 PRO A CA  1 
ATOM   6545  C  C   . PRO A 1  1281 ? 175.495 207.372 199.582 1.00 500.00 ?  1281 PRO A C   1 
ATOM   6546  O  O   . PRO A 1  1281 ? 176.443 206.598 199.420 1.00 500.00 ?  1281 PRO A O   1 
ATOM   6547  C  CB  . PRO A 1  1281 ? 174.359 207.011 201.800 1.00 500.00 ?  1281 PRO A CB  1 
ATOM   6548  C  CG  . PRO A 1  1281 ? 173.701 207.901 202.793 1.00 500.00 ?  1281 PRO A CG  1 
ATOM   6549  C  CD  . PRO A 1  1281 ? 173.465 209.217 202.101 1.00 500.00 ?  1281 PRO A CD  1 
ATOM   6550  N  N   . GLY A 1  1282 ? 174.659 207.727 198.605 1.00 500.00 ?  1282 GLY A N   1 
ATOM   6551  C  CA  . GLY A 1  1282 ? 174.906 207.423 197.193 1.00 500.00 ?  1282 GLY A CA  1 
ATOM   6552  C  C   . GLY A 1  1282 ? 173.662 207.076 196.390 1.00 500.00 ?  1282 GLY A C   1 
ATOM   6553  O  O   . GLY A 1  1282 ? 172.565 207.535 196.722 1.00 500.00 ?  1282 GLY A O   1 
ATOM   6554  N  N   . PRO A 1  1283 ? 173.842 206.333 195.278 1.00 462.87 ?  1283 PRO A N   1 
ATOM   6555  C  CA  . PRO A 1  1283 ? 172.774 205.538 194.674 1.00 406.67 ?  1283 PRO A CA  1 
ATOM   6556  C  C   . PRO A 1  1283 ? 172.978 204.038 194.920 1.00 325.01 ?  1283 PRO A C   1 
ATOM   6557  O  O   . PRO A 1  1283 ? 174.106 203.548 194.817 1.00 247.17 ?  1283 PRO A O   1 
ATOM   6558  C  CB  . PRO A 1  1283 ? 172.889 205.866 193.177 1.00 439.01 ?  1283 PRO A CB  1 
ATOM   6559  C  CG  . PRO A 1  1283 ? 174.245 206.476 192.984 1.00 448.33 ?  1283 PRO A CG  1 
ATOM   6560  C  CD  . PRO A 1  1283 ? 174.934 206.574 194.314 1.00 457.62 ?  1283 PRO A CD  1 
ATOM   6561  N  N   . GLU A 1  1284 ? 171.886 203.332 195.237 1.00 287.99 ?  1284 GLU A N   1 
ATOM   6562  C  CA  . GLU A 1  1284 ? 171.870 201.874 195.516 1.00 243.32 ?  1284 GLU A CA  1 
ATOM   6563  C  C   . GLU A 1  1284 ? 173.097 201.403 196.292 1.00 189.50 ?  1284 GLU A C   1 
ATOM   6564  O  O   . GLU A 1  1284 ? 173.599 202.155 197.125 1.00 169.01 ?  1284 GLU A O   1 
ATOM   6565  C  CB  . GLU A 1  1284 ? 171.584 201.030 194.244 1.00 293.87 ?  1284 GLU A CB  1 
ATOM   6566  C  CG  . GLU A 1  1284 ? 172.612 201.067 193.101 1.00 347.66 ?  1284 GLU A CG  1 
ATOM   6567  C  CD  . GLU A 1  1284 ? 172.511 202.284 192.182 1.00 382.05 ?  1284 GLU A CD  1 
ATOM   6568  O  OE1 . GLU A 1  1284 ? 171.434 202.918 192.097 1.00 416.89 ?  1284 GLU A OE1 1 
ATOM   6569  O  OE2 . GLU A 1  1284 ? 173.525 202.611 191.527 1.00 383.49 -1 1284 GLU A OE2 1 
ATOM   6570  N  N   . MET A 1  1285 ? 173.576 200.188 196.009 1.00 188.04 ?  1285 MET A N   1 
ATOM   6571  C  CA  . MET A 1  1285 ? 174.788 199.624 196.633 1.00 211.22 ?  1285 MET A CA  1 
ATOM   6572  C  C   . MET A 1  1285 ? 176.098 200.391 196.321 1.00 234.09 ?  1285 MET A C   1 
ATOM   6573  O  O   . MET A 1  1285 ? 177.114 200.187 196.994 1.00 238.91 ?  1285 MET A O   1 
ATOM   6574  C  CB  . MET A 1  1285 ? 174.923 198.119 196.313 1.00 156.82 ?  1285 MET A CB  1 
ATOM   6575  N  N   . GLU A 1  1286 ? 176.060 201.285 195.327 1.00 256.12 ?  1286 GLU A N   1 
ATOM   6576  C  CA  . GLU A 1  1286 ? 177.232 202.072 194.908 1.00 249.84 ?  1286 GLU A CA  1 
ATOM   6577  C  C   . GLU A 1  1286 ? 177.486 203.336 195.742 1.00 240.33 ?  1286 GLU A C   1 
ATOM   6578  O  O   . GLU A 1  1286 ? 176.542 203.949 196.275 1.00 186.17 ?  1286 GLU A O   1 
ATOM   6579  C  CB  . GLU A 1  1286 ? 177.142 202.432 193.420 1.00 245.32 ?  1286 GLU A CB  1 
ATOM   6580  N  N   . TYR A 1  1287 ? 178.781 203.681 195.831 1.00 266.92 ?  1287 TYR A N   1 
ATOM   6581  C  CA  . TYR A 1  1287 ? 179.358 204.876 196.502 1.00 288.01 ?  1287 TYR A CA  1 
ATOM   6582  C  C   . TYR A 1  1287 ? 179.604 204.762 198.029 1.00 312.80 ?  1287 TYR A C   1 
ATOM   6583  O  O   . TYR A 1  1287 ? 180.459 205.483 198.576 1.00 245.25 ?  1287 TYR A O   1 
ATOM   6584  C  CB  . TYR A 1  1287 ? 178.582 206.163 196.144 1.00 305.99 ?  1287 TYR A CB  1 
ATOM   6585  C  CG  . TYR A 1  1287 ? 179.180 207.442 196.683 1.00 326.92 ?  1287 TYR A CG  1 
ATOM   6586  C  CD1 . TYR A 1  1287 ? 178.886 207.884 197.980 1.00 338.94 ?  1287 TYR A CD1 1 
ATOM   6587  C  CD2 . TYR A 1  1287 ? 180.025 208.220 195.896 1.00 339.88 ?  1287 TYR A CD2 1 
ATOM   6588  C  CE1 . TYR A 1  1287 ? 179.437 209.045 198.486 1.00 362.81 ?  1287 TYR A CE1 1 
ATOM   6589  C  CE2 . TYR A 1  1287 ? 180.578 209.393 196.390 1.00 370.21 ?  1287 TYR A CE2 1 
ATOM   6590  C  CZ  . TYR A 1  1287 ? 180.281 209.797 197.683 1.00 388.10 ?  1287 TYR A CZ  1 
ATOM   6591  O  OH  . TYR A 1  1287 ? 180.812 210.956 198.184 1.00 424.45 ?  1287 TYR A OH  1 
ATOM   6592  N  N   . CYS A 1  1288 ? 178.885 203.837 198.682 1.00 366.12 ?  1288 CYS A N   1 
ATOM   6593  C  CA  . CYS A 1  1288 ? 178.761 203.743 200.158 1.00 367.70 ?  1288 CYS A CA  1 
ATOM   6594  C  C   . CYS A 1  1288 ? 179.898 202.994 200.907 1.00 347.97 ?  1288 CYS A C   1 
ATOM   6595  O  O   . CYS A 1  1288 ? 179.657 202.128 201.762 1.00 299.11 ?  1288 CYS A O   1 
ATOM   6596  C  CB  . CYS A 1  1288 ? 177.386 203.177 200.522 1.00 336.17 ?  1288 CYS A CB  1 
ATOM   6597  N  N   . THR A 1  1289 ? 181.135 203.360 200.585 1.00 316.73 ?  1289 THR A N   1 
ATOM   6598  C  CA  . THR A 1  1289 ? 182.341 202.772 201.171 1.00 243.71 ?  1289 THR A CA  1 
ATOM   6599  C  C   . THR A 1  1289 ? 183.329 203.931 201.343 1.00 217.52 ?  1289 THR A C   1 
ATOM   6600  O  O   . THR A 1  1289 ? 183.559 204.684 200.396 1.00 228.16 ?  1289 THR A O   1 
ATOM   6601  C  CB  . THR A 1  1289 ? 182.910 201.661 200.240 1.00 227.40 ?  1289 THR A CB  1 
ATOM   6602  O  OG1 . THR A 1  1289 ? 181.909 200.654 200.016 1.00 199.01 ?  1289 THR A OG1 1 
ATOM   6603  C  CG2 . THR A 1  1289 ? 184.168 201.001 200.811 1.00 220.86 ?  1289 THR A CG2 1 
ATOM   6604  N  N   . ASP A 1  1290 ? 183.874 204.092 202.552 1.00 200.94 ?  1290 ASP A N   1 
ATOM   6605  C  CA  . ASP A 1  1290 ? 184.911 205.104 202.857 1.00 237.09 ?  1290 ASP A CA  1 
ATOM   6606  C  C   . ASP A 1  1290 ? 184.521 206.553 202.485 1.00 246.62 ?  1290 ASP A C   1 
ATOM   6607  O  O   . ASP A 1  1290 ? 185.374 207.359 202.071 1.00 174.98 ?  1290 ASP A O   1 
ATOM   6608  C  CB  . ASP A 1  1290 ? 186.259 204.721 202.201 1.00 298.87 ?  1290 ASP A CB  1 
ATOM   6609  C  CG  . ASP A 1  1290 ? 186.825 203.391 202.707 1.00 334.62 ?  1290 ASP A CG  1 
ATOM   6610  O  OD1 . ASP A 1  1290 ? 186.059 202.518 203.158 1.00 370.80 ?  1290 ASP A OD1 1 
ATOM   6611  O  OD2 . ASP A 1  1290 ? 188.058 203.206 202.632 1.00 343.23 -1 1290 ASP A OD2 1 
ATOM   6612  N  N   . ARG A 1  1291 ? 183.236 206.876 202.645 1.00 330.81 ?  1291 ARG A N   1 
ATOM   6613  C  CA  . ARG A 1  1291 ? 182.680 208.182 202.241 1.00 395.53 ?  1291 ARG A CA  1 
ATOM   6614  C  C   . ARG A 1  1291 ? 183.222 209.386 203.037 1.00 426.13 ?  1291 ARG A C   1 
ATOM   6615  O  O   . ARG A 1  1291 ? 183.198 210.517 202.538 1.00 442.53 ?  1291 ARG A O   1 
ATOM   6616  C  CB  . ARG A 1  1291 ? 181.136 208.154 202.212 1.00 403.35 ?  1291 ARG A CB  1 
ATOM   6617  C  CG  . ARG A 1  1291 ? 180.436 208.115 203.566 1.00 402.30 ?  1291 ARG A CG  1 
ATOM   6618  C  CD  . ARG A 1  1291 ? 178.952 207.825 203.409 1.00 395.59 ?  1291 ARG A CD  1 
ATOM   6619  N  NE  . ARG A 1  1291 ? 178.185 208.231 204.587 1.00 408.56 ?  1291 ARG A NE  1 
ATOM   6620  C  CZ  . ARG A 1  1291 ? 177.411 209.313 204.664 1.00 418.12 ?  1291 ARG A CZ  1 
ATOM   6621  N  NH1 . ARG A 1  1291 ? 177.274 210.135 203.626 1.00 429.64 ?  1291 ARG A NH1 1 
ATOM   6622  N  NH2 . ARG A 1  1291 ? 176.762 209.576 205.791 1.00 416.32 ?  1291 ARG A NH2 1 
ATOM   6623  N  N   . GLU A 1  1292 ? 183.710 209.133 204.257 1.00 432.30 ?  1292 GLU A N   1 
ATOM   6624  C  CA  . GLU A 1  1292 ? 184.397 210.153 205.071 1.00 401.67 ?  1292 GLU A CA  1 
ATOM   6625  C  C   . GLU A 1  1292 ? 185.685 210.699 204.432 1.00 407.85 ?  1292 GLU A C   1 
ATOM   6626  O  O   . GLU A 1  1292 ? 186.004 211.878 204.626 1.00 402.95 ?  1292 GLU A O   1 
ATOM   6627  C  CB  . GLU A 1  1292 ? 184.652 209.690 206.521 1.00 369.69 ?  1292 GLU A CB  1 
ATOM   6628  C  CG  . GLU A 1  1292 ? 184.960 208.208 206.727 1.00 353.97 ?  1292 GLU A CG  1 
ATOM   6629  C  CD  . GLU A 1  1292 ? 183.753 207.393 207.182 1.00 329.11 ?  1292 GLU A CD  1 
ATOM   6630  O  OE1 . GLU A 1  1292 ? 182.928 207.911 207.969 1.00 301.30 ?  1292 GLU A OE1 1 
ATOM   6631  O  OE2 . GLU A 1  1292 ? 183.638 206.216 206.770 1.00 304.51 -1 1292 GLU A OE2 1 
ATOM   6632  N  N   . SER A 1  1293 ? 186.399 209.858 203.671 1.00 397.10 ?  1293 SER A N   1 
ATOM   6633  C  CA  . SER A 1  1293 ? 187.588 210.300 202.914 1.00 394.87 ?  1293 SER A CA  1 
ATOM   6634  C  C   . SER A 1  1293 ? 187.217 211.282 201.804 1.00 453.97 ?  1293 SER A C   1 
ATOM   6635  O  O   . SER A 1  1293 ? 187.883 212.308 201.646 1.00 497.71 ?  1293 SER A O   1 
ATOM   6636  C  CB  . SER A 1  1293 ? 188.415 209.126 202.354 1.00 311.53 ?  1293 SER A CB  1 
ATOM   6637  O  OG  . SER A 1  1293 ? 187.821 208.548 201.205 1.00 227.80 ?  1293 SER A OG  1 
ATOM   6638  N  N   . TYR A 1  1294 ? 186.150 210.964 201.062 1.00 499.14 ?  1294 TYR A N   1 
ATOM   6639  C  CA  . TYR A 1  1294 ? 185.631 211.821 199.986 1.00 500.00 ?  1294 TYR A CA  1 
ATOM   6640  C  C   . TYR A 1  1294 ? 185.292 213.234 200.467 1.00 500.00 ?  1294 TYR A C   1 
ATOM   6641  O  O   . TYR A 1  1294 ? 185.664 214.222 199.821 1.00 500.00 ?  1294 TYR A O   1 
ATOM   6642  C  CB  . TYR A 1  1294 ? 184.413 211.179 199.292 1.00 500.00 ?  1294 TYR A CB  1 
ATOM   6643  C  CG  . TYR A 1  1294 ? 184.041 211.851 197.978 1.00 500.00 ?  1294 TYR A CG  1 
ATOM   6644  C  CD1 . TYR A 1  1294 ? 183.510 213.154 197.948 1.00 500.00 ?  1294 TYR A CD1 1 
ATOM   6645  C  CD2 . TYR A 1  1294 ? 184.216 211.186 196.763 1.00 499.41 ?  1294 TYR A CD2 1 
ATOM   6646  C  CE1 . TYR A 1  1294 ? 183.190 213.776 196.750 1.00 500.00 ?  1294 TYR A CE1 1 
ATOM   6647  C  CE2 . TYR A 1  1294 ? 183.882 211.796 195.560 1.00 492.19 ?  1294 TYR A CE2 1 
ATOM   6648  C  CZ  . TYR A 1  1294 ? 183.369 213.083 195.558 1.00 497.64 ?  1294 TYR A CZ  1 
ATOM   6649  O  OH  . TYR A 1  1294 ? 183.047 213.667 194.361 1.00 497.94 ?  1294 TYR A OH  1 
ATOM   6650  N  N   . SER A 1  1295 ? 184.583 213.308 201.593 1.00 500.00 ?  1295 SER A N   1 
ATOM   6651  C  CA  . SER A 1  1295 ? 184.180 214.572 202.209 1.00 500.00 ?  1295 SER A CA  1 
ATOM   6652  C  C   . SER A 1  1295 ? 185.371 215.441 202.626 1.00 500.00 ?  1295 SER A C   1 
ATOM   6653  O  O   . SER A 1  1295 ? 185.362 216.655 202.387 1.00 500.00 ?  1295 SER A O   1 
ATOM   6654  C  CB  . SER A 1  1295 ? 183.263 214.308 203.399 1.00 500.00 ?  1295 SER A CB  1 
ATOM   6655  O  OG  . SER A 1  1295 ? 183.000 215.501 204.105 1.00 500.00 ?  1295 SER A OG  1 
ATOM   6656  N  N   . LEU A 1  1296 ? 186.379 214.818 203.245 1.00 500.00 ?  1296 LEU A N   1 
ATOM   6657  C  CA  . LEU A 1  1296 ? 187.632 215.503 203.572 1.00 500.00 ?  1296 LEU A CA  1 
ATOM   6658  C  C   . LEU A 1  1296 ? 188.262 216.103 202.314 1.00 500.00 ?  1296 LEU A C   1 
ATOM   6659  O  O   . LEU A 1  1296 ? 188.531 217.304 202.284 1.00 500.00 ?  1296 LEU A O   1 
ATOM   6660  C  CB  . LEU A 1  1296 ? 188.623 214.579 204.302 1.00 500.00 ?  1296 LEU A CB  1 
ATOM   6661  C  CG  . LEU A 1  1296 ? 190.081 215.054 204.457 1.00 500.00 ?  1296 LEU A CG  1 
ATOM   6662  C  CD1 . LEU A 1  1296 ? 190.188 216.368 205.216 1.00 500.00 ?  1296 LEU A CD1 1 
ATOM   6663  C  CD2 . LEU A 1  1296 ? 190.940 214.001 205.127 1.00 500.00 ?  1296 LEU A CD2 1 
ATOM   6664  N  N   . ALA A 1  1297 ? 188.465 215.261 201.295 1.00 500.00 ?  1297 ALA A N   1 
ATOM   6665  C  CA  . ALA A 1  1297 ? 189.011 215.664 199.992 1.00 500.00 ?  1297 ALA A CA  1 
ATOM   6666  C  C   . ALA A 1  1297 ? 188.315 216.913 199.441 1.00 500.00 ?  1297 ALA A C   1 
ATOM   6667  O  O   . ALA A 1  1297 ? 188.985 217.896 199.116 1.00 500.00 ?  1297 ALA A O   1 
ATOM   6668  C  CB  . ALA A 1  1297 ? 188.938 214.507 198.994 1.00 500.00 ?  1297 ALA A CB  1 
ATOM   6669  N  N   . ALA A 1  1298 ? 186.979 216.871 199.388 1.00 500.00 ?  1298 ALA A N   1 
ATOM   6670  C  CA  . ALA A 1  1298 ? 186.142 217.980 198.910 1.00 500.00 ?  1298 ALA A CA  1 
ATOM   6671  C  C   . ALA A 1  1298 ? 186.261 219.254 199.748 1.00 500.00 ?  1298 ALA A C   1 
ATOM   6672  O  O   . ALA A 1  1298 ? 186.408 220.349 199.192 1.00 500.00 ?  1298 ALA A O   1 
ATOM   6673  C  CB  . ALA A 1  1298 ? 184.689 217.537 198.795 1.00 500.00 ?  1298 ALA A CB  1 
ATOM   6674  N  N   . GLY A 1  1299 ? 186.201 219.097 201.073 1.00 500.00 ?  1299 GLY A N   1 
ATOM   6675  C  CA  . GLY A 1  1299 ? 186.356 220.209 202.017 1.00 500.00 ?  1299 GLY A CA  1 
ATOM   6676  C  C   . GLY A 1  1299 ? 187.707 220.888 201.878 1.00 500.00 ?  1299 GLY A C   1 
ATOM   6677  O  O   . GLY A 1  1299 ? 187.784 222.108 201.690 1.00 500.00 ?  1299 GLY A O   1 
ATOM   6678  N  N   . LEU A 1  1300 ? 188.759 220.071 201.939 1.00 500.00 ?  1300 LEU A N   1 
ATOM   6679  C  CA  . LEU A 1  1300 ? 190.154 220.496 201.785 1.00 492.88 ?  1300 LEU A CA  1 
ATOM   6680  C  C   . LEU A 1  1300 ? 190.404 221.214 200.453 1.00 500.00 ?  1300 LEU A C   1 
ATOM   6681  O  O   . LEU A 1  1300 ? 191.064 222.260 200.426 1.00 500.00 ?  1300 LEU A O   1 
ATOM   6682  C  CB  . LEU A 1  1300 ? 191.072 219.273 201.928 1.00 448.93 ?  1300 LEU A CB  1 
ATOM   6683  C  CG  . LEU A 1  1300 ? 192.580 219.345 202.169 1.00 410.64 ?  1300 LEU A CG  1 
ATOM   6684  C  CD1 . LEU A 1  1300 ? 192.942 220.174 203.391 1.00 393.23 ?  1300 LEU A CD1 1 
ATOM   6685  C  CD2 . LEU A 1  1300 ? 193.112 217.928 202.319 1.00 403.26 ?  1300 LEU A CD2 1 
ATOM   6686  N  N   . ALA A 1  1301 ? 189.853 220.650 199.373 1.00 500.00 ?  1301 ALA A N   1 
ATOM   6687  C  CA  . ALA A 1  1301 ? 189.915 221.221 198.019 1.00 500.00 ?  1301 ALA A CA  1 
ATOM   6688  C  C   . ALA A 1  1301 ? 189.267 222.605 197.924 1.00 500.00 ?  1301 ALA A C   1 
ATOM   6689  O  O   . ALA A 1  1301 ? 189.838 223.518 197.314 1.00 500.00 ?  1301 ALA A O   1 
ATOM   6690  C  CB  . ALA A 1  1301 ? 189.286 220.271 197.009 1.00 500.00 ?  1301 ALA A CB  1 
ATOM   6691  N  N   . LEU A 1  1302 ? 188.085 222.742 198.533 1.00 497.22 ?  1302 LEU A N   1 
ATOM   6692  C  CA  . LEU A 1  1302 ? 187.346 224.009 198.615 1.00 457.35 ?  1302 LEU A CA  1 
ATOM   6693  C  C   . LEU A 1  1302 ? 188.191 225.096 199.288 1.00 424.87 ?  1302 LEU A C   1 
ATOM   6694  O  O   . LEU A 1  1302 ? 188.268 226.231 198.795 1.00 442.17 ?  1302 LEU A O   1 
ATOM   6695  C  CB  . LEU A 1  1302 ? 186.030 223.795 199.376 1.00 461.84 ?  1302 LEU A CB  1 
ATOM   6696  C  CG  . LEU A 1  1302 ? 184.826 224.729 199.208 1.00 457.81 ?  1302 LEU A CG  1 
ATOM   6697  C  CD1 . LEU A 1  1302 ? 183.604 224.039 199.792 1.00 459.24 ?  1302 LEU A CD1 1 
ATOM   6698  C  CD2 . LEU A 1  1302 ? 185.010 226.097 199.850 1.00 448.83 ?  1302 LEU A CD2 1 
ATOM   6699  N  N   . GLY A 1  1303 ? 188.816 224.727 200.407 1.00 367.49 ?  1303 GLY A N   1 
ATOM   6700  C  CA  . GLY A 1  1303 ? 189.753 225.584 201.134 1.00 280.62 ?  1303 GLY A CA  1 
ATOM   6701  C  C   . GLY A 1  1303 ? 190.883 226.154 200.288 1.00 218.67 ?  1303 GLY A C   1 
ATOM   6702  O  O   . GLY A 1  1303 ? 191.179 227.348 200.365 1.00 192.07 ?  1303 GLY A O   1 
ATOM   6703  N  N   . MET A 1  1304 ? 191.491 225.294 199.471 1.00 167.56 ?  1304 MET A N   1 
ATOM   6704  C  CA  . MET A 1  1304 ? 192.596 225.664 198.610 1.00 139.01 ?  1304 MET A CA  1 
ATOM   6705  C  C   . MET A 1  1304 ? 192.181 226.734 197.626 1.00 135.12 ?  1304 MET A C   1 
ATOM   6706  O  O   . MET A 1  1304 ? 192.875 227.731 197.475 1.00 137.13 ?  1304 MET A O   1 
ATOM   6707  C  CB  . MET A 1  1304 ? 193.084 224.448 197.847 1.00 136.68 ?  1304 MET A CB  1 
ATOM   6708  C  CG  . MET A 1  1304 ? 193.755 223.402 198.712 1.00 163.20 ?  1304 MET A CG  1 
ATOM   6709  S  SD  . MET A 1  1304 ? 194.212 221.958 197.744 1.00 193.56 ?  1304 MET A SD  1 
ATOM   6710  C  CE  . MET A 1  1304 ? 193.936 220.667 198.942 1.00 181.77 ?  1304 MET A CE  1 
ATOM   6711  N  N   . VAL A 1  1305 ? 191.043 226.498 196.970 1.00 150.30 ?  1305 VAL A N   1 
ATOM   6712  C  CA  . VAL A 1  1305 ? 190.442 227.393 195.964 1.00 165.53 ?  1305 VAL A CA  1 
ATOM   6713  C  C   . VAL A 1  1305 ? 190.281 228.839 196.474 1.00 202.13 ?  1305 VAL A C   1 
ATOM   6714  O  O   . VAL A 1  1305 ? 190.663 229.787 195.785 1.00 181.04 ?  1305 VAL A O   1 
ATOM   6715  C  CB  . VAL A 1  1305 ? 189.097 226.812 195.441 1.00 164.03 ?  1305 VAL A CB  1 
ATOM   6716  C  CG1 . VAL A 1  1305 ? 188.310 227.827 194.623 1.00 171.40 ?  1305 VAL A CG1 1 
ATOM   6717  C  CG2 . VAL A 1  1305 ? 189.324 225.536 194.630 1.00 151.77 ?  1305 VAL A CG2 1 
ATOM   6718  N  N   . CYS A 1  1306 ? 189.735 228.997 197.680 1.00 276.18 ?  1306 CYS A N   1 
ATOM   6719  C  CA  . CYS A 1  1306 ? 189.579 230.324 198.306 1.00 297.23 ?  1306 CYS A CA  1 
ATOM   6720  C  C   . CYS A 1  1306 ? 190.826 230.806 199.080 1.00 256.26 ?  1306 CYS A C   1 
ATOM   6721  O  O   . CYS A 1  1306 ? 191.050 232.013 199.208 1.00 233.17 ?  1306 CYS A O   1 
ATOM   6722  C  CB  . CYS A 1  1306 ? 188.331 230.368 199.203 1.00 351.11 ?  1306 CYS A CB  1 
ATOM   6723  S  SG  . CYS A 1  1306 ? 186.731 230.423 198.347 1.00 362.92 ?  1306 CYS A SG  1 
ATOM   6724  N  N   . LEU A 1  1307 ? 191.612 229.857 199.590 1.00 200.73 ?  1307 LEU A N   1 
ATOM   6725  C  CA  . LEU A 1  1307 ? 192.853 230.113 200.338 1.00 195.29 ?  1307 LEU A CA  1 
ATOM   6726  C  C   . LEU A 1  1307 ? 193.055 231.535 200.914 1.00 193.51 ?  1307 LEU A C   1 
ATOM   6727  O  O   . LEU A 1  1307 ? 193.862 232.332 200.422 1.00 209.33 ?  1307 LEU A O   1 
ATOM   6728  C  CB  . LEU A 1  1307 ? 194.057 229.641 199.514 1.00 195.46 ?  1307 LEU A CB  1 
ATOM   6729  C  CG  . LEU A 1  1307 ? 195.458 229.443 200.087 1.00 184.01 ?  1307 LEU A CG  1 
ATOM   6730  C  CD1 . LEU A 1  1307 ? 195.567 228.190 200.943 1.00 182.01 ?  1307 LEU A CD1 1 
ATOM   6731  C  CD2 . LEU A 1  1307 ? 196.387 229.362 198.894 1.00 191.44 ?  1307 LEU A CD2 1 
ATOM   6732  N  N   . GLY A 1  1308 ? 192.278 231.845 201.945 1.00 190.49 ?  1308 GLY A N   1 
ATOM   6733  C  CA  . GLY A 1  1308 ? 192.517 233.015 202.791 1.00 186.18 ?  1308 GLY A CA  1 
ATOM   6734  C  C   . GLY A 1  1308 ? 192.211 234.340 202.143 1.00 197.59 ?  1308 GLY A C   1 
ATOM   6735  O  O   . GLY A 1  1308 ? 192.742 235.365 202.564 1.00 157.14 ?  1308 GLY A O   1 
ATOM   6736  N  N   . HIS A 1  1309 ? 191.370 234.310 201.108 1.00 269.69 ?  1309 HIS A N   1 
ATOM   6737  C  CA  . HIS A 1  1309 ? 190.808 235.525 200.501 1.00 335.57 ?  1309 HIS A CA  1 
ATOM   6738  C  C   . HIS A 1  1309 ? 190.130 236.408 201.563 1.00 382.97 ?  1309 HIS A C   1 
ATOM   6739  O  O   . HIS A 1  1309 ? 190.391 237.616 201.635 1.00 397.84 ?  1309 HIS A O   1 
ATOM   6740  C  CB  . HIS A 1  1309 ? 189.811 235.177 199.383 1.00 329.29 ?  1309 HIS A CB  1 
ATOM   6741  C  CG  . HIS A 1  1309 ? 190.432 235.040 198.026 1.00 295.72 ?  1309 HIS A CG  1 
ATOM   6742  N  ND1 . HIS A 1  1309 ? 190.967 236.108 197.339 1.00 289.28 ?  1309 HIS A ND1 1 
ATOM   6743  C  CD2 . HIS A 1  1309 ? 190.576 233.965 197.218 1.00 272.63 ?  1309 HIS A CD2 1 
ATOM   6744  C  CE1 . HIS A 1  1309 ? 191.427 235.691 196.174 1.00 303.78 ?  1309 HIS A CE1 1 
ATOM   6745  N  NE2 . HIS A 1  1309 ? 191.200 234.394 196.075 1.00 290.70 ?  1309 HIS A NE2 1 
ATOM   6746  N  N   . GLY A 1  1310 ? 189.291 235.782 202.393 1.00 408.61 ?  1310 GLY A N   1 
ATOM   6747  C  CA  . GLY A 1  1310 ? 188.577 236.462 203.475 1.00 394.63 ?  1310 GLY A CA  1 
ATOM   6748  C  C   . GLY A 1  1310 ? 187.085 236.181 203.496 1.00 372.76 ?  1310 GLY A C   1 
ATOM   6749  O  O   . GLY A 1  1310 ? 186.607 235.256 202.831 1.00 334.94 ?  1310 GLY A O   1 
ATOM   6750  N  N   . SER A 1  1311 ? 186.356 236.999 204.256 1.00 388.31 ?  1311 SER A N   1 
ATOM   6751  C  CA  . SER A 1  1311 ? 184.910 236.837 204.461 1.00 406.07 ?  1311 SER A CA  1 
ATOM   6752  C  C   . SER A 1  1311 ? 184.017 237.296 203.290 1.00 421.01 ?  1311 SER A C   1 
ATOM   6753  O  O   . SER A 1  1311 ? 183.113 236.554 202.893 1.00 444.25 ?  1311 SER A O   1 
ATOM   6754  C  CB  . SER A 1  1311 ? 184.479 237.467 205.798 1.00 402.84 ?  1311 SER A CB  1 
ATOM   6755  O  OG  . SER A 1  1311 ? 184.842 238.836 205.861 1.00 401.69 ?  1311 SER A OG  1 
ATOM   6756  N  N   . ASN A 1  1312 ? 184.272 238.491 202.743 1.00 403.52 ?  1312 ASN A N   1 
ATOM   6757  C  CA  . ASN A 1  1312 ? 183.479 239.045 201.611 1.00 347.40 ?  1312 ASN A CA  1 
ATOM   6758  C  C   . ASN A 1  1312 ? 184.209 239.030 200.252 1.00 317.58 ?  1312 ASN A C   1 
ATOM   6759  O  O   . ASN A 1  1312 ? 185.032 239.908 199.965 1.00 307.44 ?  1312 ASN A O   1 
ATOM   6760  C  CB  . ASN A 1  1312 ? 182.883 240.440 201.935 1.00 312.38 ?  1312 ASN A CB  1 
ATOM   6761  C  CG  . ASN A 1  1312 ? 183.847 241.355 202.691 1.00 272.50 ?  1312 ASN A CG  1 
ATOM   6762  O  OD1 . ASN A 1  1312 ? 183.551 241.795 203.803 1.00 238.43 ?  1312 ASN A OD1 1 
ATOM   6763  N  ND2 . ASN A 1  1312 ? 184.990 241.661 202.083 1.00 258.15 ?  1312 ASN A ND2 1 
ATOM   6764  N  N   . LEU A 1  1313 ? 183.878 238.045 199.417 1.00 285.97 ?  1313 LEU A N   1 
ATOM   6765  C  CA  . LEU A 1  1313 ? 184.713 237.702 198.261 1.00 278.35 ?  1313 LEU A CA  1 
ATOM   6766  C  C   . LEU A 1  1313 ? 184.045 237.799 196.897 1.00 246.63 ?  1313 LEU A C   1 
ATOM   6767  O  O   . LEU A 1  1313 ? 183.043 237.121 196.641 1.00 178.73 ?  1313 LEU A O   1 
ATOM   6768  C  CB  . LEU A 1  1313 ? 185.410 236.330 198.434 1.00 334.74 ?  1313 LEU A CB  1 
ATOM   6769  C  CG  . LEU A 1  1313 ? 185.106 235.234 199.477 1.00 354.70 ?  1313 LEU A CG  1 
ATOM   6770  C  CD1 . LEU A 1  1313 ? 183.682 234.693 199.428 1.00 368.87 ?  1313 LEU A CD1 1 
ATOM   6771  C  CD2 . LEU A 1  1313 ? 186.105 234.089 199.330 1.00 332.49 ?  1313 LEU A CD2 1 
ATOM   6772  N  N   . ILE A 1  1314 ? 184.652 238.629 196.042 1.00 253.53 ?  1314 ILE A N   1 
ATOM   6773  C  CA  . ILE A 1  1314 ? 184.307 238.814 194.620 1.00 270.54 ?  1314 ILE A CA  1 
ATOM   6774  C  C   . ILE A 1  1314 ? 182.794 238.826 194.387 1.00 281.90 ?  1314 ILE A C   1 
ATOM   6775  O  O   . ILE A 1  1314 ? 182.148 239.836 194.648 1.00 327.07 ?  1314 ILE A O   1 
ATOM   6776  C  CB  . ILE A 1  1314 ? 185.042 237.824 193.669 1.00 288.65 ?  1314 ILE A CB  1 
ATOM   6777  C  CG1 . ILE A 1  1314 ? 186.459 237.503 194.169 1.00 313.07 ?  1314 ILE A CG1 1 
ATOM   6778  C  CG2 . ILE A 1  1314 ? 185.097 238.393 192.252 1.00 299.69 ?  1314 ILE A CG2 1 
ATOM   6779  C  CD1 . ILE A 1  1314 ? 187.033 236.201 193.643 1.00 314.52 ?  1314 ILE A CD1 1 
ATOM   6780  N  N   . GLY A 1  1315 ? 182.238 237.699 193.937 1.00 264.13 ?  1315 GLY A N   1 
ATOM   6781  C  CA  . GLY A 1  1315 ? 180.800 237.572 193.707 1.00 282.04 ?  1315 GLY A CA  1 
ATOM   6782  C  C   . GLY A 1  1315 ? 180.228 236.300 194.295 1.00 305.34 ?  1315 GLY A C   1 
ATOM   6783  O  O   . GLY A 1  1315 ? 179.356 235.675 193.689 1.00 331.21 ?  1315 GLY A O   1 
ATOM   6784  N  N   . MET A 1  1316 ? 180.713 235.928 195.481 1.00 300.30 ?  1316 MET A N   1 
ATOM   6785  C  CA  . MET A 1  1316 ? 180.364 234.651 196.118 1.00 323.89 ?  1316 MET A CA  1 
ATOM   6786  C  C   . MET A 1  1316 ? 179.322 234.805 197.219 1.00 283.98 ?  1316 MET A C   1 
ATOM   6787  O  O   . MET A 1  1316 ? 178.885 233.818 197.811 1.00 279.07 ?  1316 MET A O   1 
ATOM   6788  C  CB  . MET A 1  1316 ? 181.620 233.947 196.661 1.00 366.24 ?  1316 MET A CB  1 
ATOM   6789  C  CG  . MET A 1  1316 ? 182.832 233.955 195.738 1.00 388.56 ?  1316 MET A CG  1 
ATOM   6790  S  SD  . MET A 1  1316 ? 182.442 233.301 194.105 1.00 456.80 ?  1316 MET A SD  1 
ATOM   6791  C  CE  . MET A 1  1316 ? 183.549 234.245 193.064 1.00 410.84 ?  1316 MET A CE  1 
ATOM   6792  N  N   . SER A 1  1317 ? 178.928 236.050 197.472 1.00 258.26 ?  1317 SER A N   1 
ATOM   6793  C  CA  . SER A 1  1317 ? 177.930 236.372 198.488 1.00 277.92 ?  1317 SER A CA  1 
ATOM   6794  C  C   . SER A 1  1317 ? 176.526 235.819 198.196 1.00 284.66 ?  1317 SER A C   1 
ATOM   6795  O  O   . SER A 1  1317 ? 175.743 235.623 199.123 1.00 302.32 ?  1317 SER A O   1 
ATOM   6796  C  CB  . SER A 1  1317 ? 177.895 237.879 198.748 1.00 281.74 ?  1317 SER A CB  1 
ATOM   6797  O  OG  . SER A 1  1317 ? 179.124 238.309 199.314 1.00 281.30 ?  1317 SER A OG  1 
ATOM   6798  N  N   . ASP A 1  1318 ? 176.218 235.551 196.925 1.00 277.78 ?  1318 ASP A N   1 
ATOM   6799  C  CA  . ASP A 1  1318 ? 175.005 234.812 196.566 1.00 257.07 ?  1318 ASP A CA  1 
ATOM   6800  C  C   . ASP A 1  1318 ? 175.036 233.448 197.246 1.00 235.48 ?  1318 ASP A C   1 
ATOM   6801  O  O   . ASP A 1  1318 ? 174.100 233.092 197.964 1.00 210.35 ?  1318 ASP A O   1 
ATOM   6802  C  CB  . ASP A 1  1318 ? 174.873 234.675 195.058 1.00 256.43 ?  1318 ASP A CB  1 
ATOM   6803  N  N   . LEU A 1  1319 ? 176.139 232.721 197.058 1.00 247.83 ?  1319 LEU A N   1 
ATOM   6804  C  CA  . LEU A 1  1319 ? 176.398 231.487 197.799 1.00 338.35 ?  1319 LEU A CA  1 
ATOM   6805  C  C   . LEU A 1  1319 ? 176.742 231.841 199.253 1.00 394.98 ?  1319 LEU A C   1 
ATOM   6806  O  O   . LEU A 1  1319 ? 176.983 233.009 199.577 1.00 427.62 ?  1319 LEU A O   1 
ATOM   6807  C  CB  . LEU A 1  1319 ? 177.550 230.703 197.157 1.00 360.02 ?  1319 LEU A CB  1 
ATOM   6808  C  CG  . LEU A 1  1319 ? 177.425 229.224 196.746 1.00 374.60 ?  1319 LEU A CG  1 
ATOM   6809  C  CD1 . LEU A 1  1319 ? 178.801 228.707 196.356 1.00 368.94 ?  1319 LEU A CD1 1 
ATOM   6810  C  CD2 . LEU A 1  1319 ? 176.800 228.315 197.801 1.00 377.39 ?  1319 LEU A CD2 1 
ATOM   6811  N  N   . ASN A 1  1320 ? 176.753 230.843 200.134 1.00 453.76 ?  1320 ASN A N   1 
ATOM   6812  C  CA  . ASN A 1  1320 ? 177.020 231.112 201.545 1.00 492.21 ?  1320 ASN A CA  1 
ATOM   6813  C  C   . ASN A 1  1320 ? 178.000 230.136 202.204 1.00 500.00 ?  1320 ASN A C   1 
ATOM   6814  O  O   . ASN A 1  1320 ? 177.604 229.168 202.879 1.00 500.00 ?  1320 ASN A O   1 
ATOM   6815  C  CB  . ASN A 1  1320 ? 175.704 231.264 202.322 1.00 479.72 ?  1320 ASN A CB  1 
ATOM   6816  C  CG  . ASN A 1  1320 ? 175.701 232.470 203.250 1.00 467.18 ?  1320 ASN A CG  1 
ATOM   6817  O  OD1 . ASN A 1  1320 ? 176.749 232.954 203.682 1.00 453.70 ?  1320 ASN A OD1 1 
ATOM   6818  N  ND2 . ASN A 1  1320 ? 174.508 232.959 203.568 1.00 468.38 ?  1320 ASN A ND2 1 
ATOM   6819  N  N   . VAL A 1  1321 ? 179.286 230.417 201.988 1.00 500.00 ?  1321 VAL A N   1 
ATOM   6820  C  CA  . VAL A 1  1321 ? 180.393 229.599 202.513 1.00 500.00 ?  1321 VAL A CA  1 
ATOM   6821  C  C   . VAL A 1  1321 ? 180.536 229.533 204.052 1.00 500.00 ?  1321 VAL A C   1 
ATOM   6822  O  O   . VAL A 1  1321 ? 180.754 228.435 204.567 1.00 500.00 ?  1321 VAL A O   1 
ATOM   6823  C  CB  . VAL A 1  1321 ? 181.763 229.855 201.809 1.00 500.00 ?  1321 VAL A CB  1 
ATOM   6824  C  CG1 . VAL A 1  1321 ? 181.847 229.068 200.508 1.00 500.00 ?  1321 VAL A CG1 1 
ATOM   6825  C  CG2 . VAL A 1  1321 ? 182.031 231.337 201.562 1.00 500.00 ?  1321 VAL A CG2 1 
ATOM   6826  N  N   . PRO A 1  1322 ? 180.400 230.676 204.789 1.00 500.00 ?  1322 PRO A N   1 
ATOM   6827  C  CA  . PRO A 1  1322 ? 180.501 230.530 206.256 1.00 500.00 ?  1322 PRO A CA  1 
ATOM   6828  C  C   . PRO A 1  1322 ? 179.255 229.925 206.921 1.00 500.00 ?  1322 PRO A C   1 
ATOM   6829  O  O   . PRO A 1  1322 ? 179.374 229.319 207.993 1.00 500.00 ?  1322 PRO A O   1 
ATOM   6830  C  CB  . PRO A 1  1322 ? 180.736 231.966 206.758 1.00 500.00 ?  1322 PRO A CB  1 
ATOM   6831  C  CG  . PRO A 1  1322 ? 180.655 232.859 205.568 1.00 500.00 ?  1322 PRO A CG  1 
ATOM   6832  C  CD  . PRO A 1  1322 ? 180.113 232.076 204.417 1.00 500.00 ?  1322 PRO A CD  1 
ATOM   6833  N  N   . GLU A 1  1323 ? 178.088 230.096 206.289 1.00 500.00 ?  1323 GLU A N   1 
ATOM   6834  C  CA  . GLU A 1  1323 ? 176.832 229.472 206.727 1.00 500.00 ?  1323 GLU A CA  1 
ATOM   6835  C  C   . GLU A 1  1323 ? 176.940 227.949 206.600 1.00 500.00 ?  1323 GLU A C   1 
ATOM   6836  O  O   . GLU A 1  1323 ? 176.718 227.222 207.577 1.00 500.00 ?  1323 GLU A O   1 
ATOM   6837  C  CB  . GLU A 1  1323 ? 175.620 230.048 205.946 1.00 500.00 ?  1323 GLU A CB  1 
ATOM   6838  C  CG  . GLU A 1  1323 ? 174.910 229.125 204.946 1.00 500.00 ?  1323 GLU A CG  1 
ATOM   6839  C  CD  . GLU A 1  1323 ? 173.459 228.839 205.289 1.00 500.00 ?  1323 GLU A CD  1 
ATOM   6840  O  OE1 . GLU A 1  1323 ? 172.602 229.709 205.026 1.00 500.00 ?  1323 GLU A OE1 1 
ATOM   6841  O  OE2 . GLU A 1  1323 ? 173.166 227.738 205.801 1.00 500.00 -1 1323 GLU A OE2 1 
ATOM   6842  N  N   . GLN A 1  1324 ? 177.327 227.493 205.405 1.00 500.00 ?  1324 GLN A N   1 
ATOM   6843  C  CA  . GLN A 1  1324 ? 177.326 226.077 205.053 1.00 500.00 ?  1324 GLN A CA  1 
ATOM   6844  C  C   . GLN A 1  1324 ? 178.357 225.292 205.853 1.00 500.00 ?  1324 GLN A C   1 
ATOM   6845  O  O   . GLN A 1  1324 ? 178.034 224.231 206.399 1.00 500.00 ?  1324 GLN A O   1 
ATOM   6846  C  CB  . GLN A 1  1324 ? 177.528 225.883 203.547 1.00 500.00 ?  1324 GLN A CB  1 
ATOM   6847  C  CG  . GLN A 1  1324 ? 176.251 225.978 202.721 1.00 476.57 ?  1324 GLN A CG  1 
ATOM   6848  C  CD  . GLN A 1  1324 ? 175.483 224.665 202.645 1.00 454.83 ?  1324 GLN A CD  1 
ATOM   6849  O  OE1 . GLN A 1  1324 ? 175.095 224.087 203.665 1.00 430.64 ?  1324 GLN A OE1 1 
ATOM   6850  N  NE2 . GLN A 1  1324 ? 175.249 224.193 201.426 1.00 449.88 ?  1324 GLN A NE2 1 
ATOM   6851  N  N   . LEU A 1  1325 ? 179.571 225.845 205.945 1.00 500.00 ?  1325 LEU A N   1 
ATOM   6852  C  CA  . LEU A 1  1325 ? 180.671 225.254 206.718 1.00 500.00 ?  1325 LEU A CA  1 
ATOM   6853  C  C   . LEU A 1  1325 ? 180.332 225.144 208.207 1.00 500.00 ?  1325 LEU A C   1 
ATOM   6854  O  O   . LEU A 1  1325 ? 180.554 224.085 208.804 1.00 500.00 ?  1325 LEU A O   1 
ATOM   6855  C  CB  . LEU A 1  1325 ? 182.002 225.999 206.474 1.00 465.41 ?  1325 LEU A CB  1 
ATOM   6856  C  CG  . LEU A 1  1325 ? 182.998 225.510 205.395 1.00 443.99 ?  1325 LEU A CG  1 
ATOM   6857  C  CD1 . LEU A 1  1325 ? 182.364 224.860 204.166 1.00 420.89 ?  1325 LEU A CD1 1 
ATOM   6858  C  CD2 . LEU A 1  1325 ? 183.918 226.640 204.953 1.00 436.57 ?  1325 LEU A CD2 1 
ATOM   6859  N  N   . TYR A 1  1326 ? 179.768 226.213 208.785 1.00 500.00 ?  1326 TYR A N   1 
ATOM   6860  C  CA  . TYR A 1  1326 ? 179.262 226.168 210.164 1.00 500.00 ?  1326 TYR A CA  1 
ATOM   6861  C  C   . TYR A 1  1326 ? 178.332 224.969 210.369 1.00 500.00 ?  1326 TYR A C   1 
ATOM   6862  O  O   . TYR A 1  1326 ? 178.622 224.118 211.208 1.00 500.00 ?  1326 TYR A O   1 
ATOM   6863  C  CB  . TYR A 1  1326 ? 178.584 227.485 210.592 1.00 488.66 ?  1326 TYR A CB  1 
ATOM   6864  C  CG  . TYR A 1  1326 ? 177.987 227.450 211.992 1.00 481.61 ?  1326 TYR A CG  1 
ATOM   6865  C  CD1 . TYR A 1  1326 ? 178.807 227.522 213.121 1.00 485.17 ?  1326 TYR A CD1 1 
ATOM   6866  C  CD2 . TYR A 1  1326 ? 176.602 227.332 212.190 1.00 465.09 ?  1326 TYR A CD2 1 
ATOM   6867  C  CE1 . TYR A 1  1326 ? 178.278 227.485 214.405 1.00 471.50 ?  1326 TYR A CE1 1 
ATOM   6868  C  CE2 . TYR A 1  1326 ? 176.059 227.294 213.472 1.00 460.95 ?  1326 TYR A CE2 1 
ATOM   6869  C  CZ  . TYR A 1  1326 ? 176.900 227.373 214.575 1.00 464.99 ?  1326 TYR A CZ  1 
ATOM   6870  O  OH  . TYR A 1  1326 ? 176.372 227.337 215.846 1.00 459.60 ?  1326 TYR A OH  1 
ATOM   6871  N  N   . GLN A 1  1327 ? 177.273 224.881 209.554 1.00 466.19 ?  1327 GLN A N   1 
ATOM   6872  C  CA  . GLN A 1  1327 ? 176.253 223.816 209.655 1.00 408.47 ?  1327 GLN A CA  1 
ATOM   6873  C  C   . GLN A 1  1327 ? 176.833 222.397 209.483 1.00 366.41 ?  1327 GLN A C   1 
ATOM   6874  O  O   . GLN A 1  1327 ? 176.439 221.474 210.203 1.00 320.91 ?  1327 GLN A O   1 
ATOM   6875  C  CB  . GLN A 1  1327 ? 175.086 224.070 208.677 1.00 397.50 ?  1327 GLN A CB  1 
ATOM   6876  C  CG  . GLN A 1  1327 ? 173.715 223.574 209.161 1.00 371.50 ?  1327 GLN A CG  1 
ATOM   6877  C  CD  . GLN A 1  1327 ? 172.559 223.888 208.205 1.00 335.07 ?  1327 GLN A CD  1 
ATOM   6878  O  OE1 . GLN A 1  1327 ? 172.733 223.918 206.983 1.00 343.93 ?  1327 GLN A OE1 1 
ATOM   6879  N  NE2 . GLN A 1  1327 ? 171.365 224.106 208.762 1.00 239.83 ?  1327 GLN A NE2 1 
ATOM   6880  N  N   . TYR A 1  1328 ? 177.777 222.237 208.553 1.00 339.24 ?  1328 TYR A N   1 
ATOM   6881  C  CA  . TYR A 1  1328 ? 178.412 220.935 208.318 1.00 283.19 ?  1328 TYR A CA  1 
ATOM   6882  C  C   . TYR A 1  1328 ? 179.267 220.481 209.482 1.00 206.17 ?  1328 TYR A C   1 
ATOM   6883  O  O   . TYR A 1  1328 ? 179.154 219.337 209.903 1.00 208.40 ?  1328 TYR A O   1 
ATOM   6884  C  CB  . TYR A 1  1328 ? 179.230 220.909 207.016 1.00 363.49 ?  1328 TYR A CB  1 
ATOM   6885  C  CG  . TYR A 1  1328 ? 178.392 220.720 205.765 1.00 405.90 ?  1328 TYR A CG  1 
ATOM   6886  C  CD1 . TYR A 1  1328 ? 177.634 219.553 205.566 1.00 415.05 ?  1328 TYR A CD1 1 
ATOM   6887  C  CD2 . TYR A 1  1328 ? 178.368 221.704 204.769 1.00 422.45 ?  1328 TYR A CD2 1 
ATOM   6888  C  CE1 . TYR A 1  1328 ? 176.858 219.394 204.423 1.00 429.96 ?  1328 TYR A CE1 1 
ATOM   6889  C  CE2 . TYR A 1  1328 ? 177.600 221.552 203.623 1.00 432.08 ?  1328 TYR A CE2 1 
ATOM   6890  C  CZ  . TYR A 1  1328 ? 176.856 220.396 203.447 1.00 436.87 ?  1328 TYR A CZ  1 
ATOM   6891  O  OH  . TYR A 1  1328 ? 176.102 220.251 202.304 1.00 445.09 ?  1328 TYR A OH  1 
ATOM   6892  N  N   . MET A 1  1329 ? 180.113 221.374 209.986 1.00 150.75 ?  1329 MET A N   1 
ATOM   6893  C  CA  . MET A 1  1329 ? 180.999 221.060 211.086 1.00 178.56 ?  1329 MET A CA  1 
ATOM   6894  C  C   . MET A 1  1329 ? 180.246 220.930 212.409 1.00 196.60 ?  1329 MET A C   1 
ATOM   6895  O  O   . MET A 1  1329 ? 180.574 220.074 213.236 1.00 240.04 ?  1329 MET A O   1 
ATOM   6896  C  CB  . MET A 1  1329 ? 182.080 222.122 211.192 1.00 183.81 ?  1329 MET A CB  1 
ATOM   6897  C  CG  . MET A 1  1329 ? 182.668 222.318 212.579 1.00 232.43 ?  1329 MET A CG  1 
ATOM   6898  S  SD  . MET A 1  1329 ? 182.948 224.055 212.950 1.00 308.30 ?  1329 MET A SD  1 
ATOM   6899  C  CE  . MET A 1  1329 ? 184.171 224.451 211.703 1.00 279.93 ?  1329 MET A CE  1 
ATOM   6900  N  N   . VAL A 1  1330 ? 179.247 221.777 212.618 1.00 191.79 ?  1330 VAL A N   1 
ATOM   6901  C  CA  . VAL A 1  1330 ? 178.598 221.824 213.920 1.00 212.54 ?  1330 VAL A CA  1 
ATOM   6902  C  C   . VAL A 1  1330 ? 177.373 220.890 214.025 1.00 226.65 ?  1330 VAL A C   1 
ATOM   6903  O  O   . VAL A 1  1330 ? 177.031 220.460 215.128 1.00 240.62 ?  1330 VAL A O   1 
ATOM   6904  C  CB  . VAL A 1  1330 ? 178.327 223.293 214.367 1.00 229.69 ?  1330 VAL A CB  1 
ATOM   6905  C  CG1 . VAL A 1  1330 ? 176.916 223.761 214.000 1.00 281.85 ?  1330 VAL A CG1 1 
ATOM   6906  C  CG2 . VAL A 1  1330 ? 178.597 223.471 215.852 1.00 225.56 ?  1330 VAL A CG2 1 
ATOM   6907  N  N   . GLY A 1  1331 ? 176.736 220.569 212.893 1.00 254.79 ?  1331 GLY A N   1 
ATOM   6908  C  CA  . GLY A 1  1331 ? 175.551 219.692 212.871 1.00 325.06 ?  1331 GLY A CA  1 
ATOM   6909  C  C   . GLY A 1  1331 ? 174.208 220.403 212.757 1.00 383.79 ?  1331 GLY A C   1 
ATOM   6910  O  O   . GLY A 1  1331 ? 174.056 221.546 213.212 1.00 405.50 ?  1331 GLY A O   1 
ATOM   6911  N  N   . GLY A 1  1332 ? 173.234 219.705 212.167 1.00 412.75 ?  1332 GLY A N   1 
ATOM   6912  C  CA  . GLY A 1  1332 ? 171.917 220.264 211.836 1.00 424.61 ?  1332 GLY A CA  1 
ATOM   6913  C  C   . GLY A 1  1332 ? 171.549 219.963 210.391 1.00 447.50 ?  1332 GLY A C   1 
ATOM   6914  O  O   . GLY A 1  1332 ? 172.345 219.380 209.657 1.00 471.18 ?  1332 GLY A O   1 
ATOM   6915  N  N   . HIS A 1  1333 ? 170.347 220.368 209.980 1.00 449.01 ?  1333 HIS A N   1 
ATOM   6916  C  CA  . HIS A 1  1333 ? 169.890 220.197 208.593 1.00 452.94 ?  1333 HIS A CA  1 
ATOM   6917  C  C   . HIS A 1  1333 ? 168.951 221.323 208.163 1.00 465.70 ?  1333 HIS A C   1 
ATOM   6918  O  O   . HIS A 1  1333 ? 168.693 221.518 206.972 1.00 474.45 ?  1333 HIS A O   1 
ATOM   6919  C  CB  . HIS A 1  1333 ? 169.208 218.834 208.406 1.00 444.01 ?  1333 HIS A CB  1 
ATOM   6920  C  CG  . HIS A 1  1333 ? 169.433 218.223 207.057 1.00 432.81 ?  1333 HIS A CG  1 
ATOM   6921  N  ND1 . HIS A 1  1333 ? 170.290 217.163 206.856 1.00 425.16 ?  1333 HIS A ND1 1 
ATOM   6922  C  CD2 . HIS A 1  1333 ? 168.918 218.526 205.842 1.00 432.75 ?  1333 HIS A CD2 1 
ATOM   6923  C  CE1 . HIS A 1  1333 ? 170.293 216.837 205.575 1.00 414.96 ?  1333 HIS A CE1 1 
ATOM   6924  N  NE2 . HIS A 1  1333 ? 169.468 217.648 204.938 1.00 420.61 ?  1333 HIS A NE2 1 
ATOM   6925  N  N   . SER A 1  1347 ? 165.747 203.885 195.546 1.00 419.74 ?  1347 SER A N   1 
ATOM   6926  C  CA  . SER A 1  1347 ? 166.346 203.817 196.875 1.00 427.39 ?  1347 SER A CA  1 
ATOM   6927  C  C   . SER A 1  1347 ? 167.539 204.776 197.020 1.00 429.64 ?  1347 SER A C   1 
ATOM   6928  O  O   . SER A 1  1347 ? 168.248 205.025 196.035 1.00 418.85 ?  1347 SER A O   1 
ATOM   6929  C  CB  . SER A 1  1347 ? 166.778 202.380 197.194 1.00 436.57 ?  1347 SER A CB  1 
ATOM   6930  O  OG  . SER A 1  1347 ? 167.837 201.951 196.350 1.00 464.19 ?  1347 SER A OG  1 
ATOM   6931  N  N   . PRO A 1  1348 ? 167.759 205.326 198.242 1.00 439.68 ?  1348 PRO A N   1 
ATOM   6932  C  CA  . PRO A 1  1348 ? 168.971 206.118 198.494 1.00 446.76 ?  1348 PRO A CA  1 
ATOM   6933  C  C   . PRO A 1  1348 ? 170.229 205.238 198.518 1.00 460.37 ?  1348 PRO A C   1 
ATOM   6934  O  O   . PRO A 1  1348 ? 171.123 205.431 197.689 1.00 480.00 ?  1348 PRO A O   1 
ATOM   6935  C  CB  . PRO A 1  1348 ? 168.708 206.758 199.869 1.00 438.66 ?  1348 PRO A CB  1 
ATOM   6936  C  CG  . PRO A 1  1348 ? 167.239 206.627 200.095 1.00 434.25 ?  1348 PRO A CG  1 
ATOM   6937  C  CD  . PRO A 1  1348 ? 166.851 205.356 199.405 1.00 435.91 ?  1348 PRO A CD  1 
ATOM   6938  N  N   . SER A 1  1349 ? 170.276 204.281 199.448 1.00 445.56 ?  1349 SER A N   1 
ATOM   6939  C  CA  . SER A 1  1349 ? 171.374 203.309 199.566 1.00 386.69 ?  1349 SER A CA  1 
ATOM   6940  C  C   . SER A 1  1349 ? 170.899 202.004 200.220 1.00 312.75 ?  1349 SER A C   1 
ATOM   6941  O  O   . SER A 1  1349 ? 169.726 201.873 200.588 1.00 308.92 ?  1349 SER A O   1 
ATOM   6942  C  CB  . SER A 1  1349 ? 172.562 203.914 200.339 1.00 421.54 ?  1349 SER A CB  1 
ATOM   6943  O  OG  . SER A 1  1349 ? 172.164 204.405 201.607 1.00 450.40 ?  1349 SER A OG  1 
ATOM   6944  N  N   . TYR A 1  1350 ? 171.805 201.037 200.337 1.00 228.49 ?  1350 TYR A N   1 
ATOM   6945  C  CA  . TYR A 1  1350 ? 171.542 199.813 201.084 1.00 204.26 ?  1350 TYR A CA  1 
ATOM   6946  C  C   . TYR A 1  1350 ? 172.577 199.530 202.195 1.00 217.70 ?  1350 TYR A C   1 
ATOM   6947  O  O   . TYR A 1  1350 ? 172.479 198.514 202.905 1.00 209.43 ?  1350 TYR A O   1 
ATOM   6948  C  CB  . TYR A 1  1350 ? 171.492 198.641 200.124 1.00 191.83 ?  1350 TYR A CB  1 
ATOM   6949  C  CG  . TYR A 1  1350 ? 170.447 198.732 199.064 1.00 179.22 ?  1350 TYR A CG  1 
ATOM   6950  C  CD1 . TYR A 1  1350 ? 169.112 198.510 199.373 1.00 200.64 ?  1350 TYR A CD1 1 
ATOM   6951  C  CD2 . TYR A 1  1350 ? 170.793 198.998 197.737 1.00 194.00 ?  1350 TYR A CD2 1 
ATOM   6952  C  CE1 . TYR A 1  1350 ? 168.135 198.572 198.395 1.00 256.19 ?  1350 TYR A CE1 1 
ATOM   6953  C  CE2 . TYR A 1  1350 ? 169.824 199.054 196.747 1.00 245.59 ?  1350 TYR A CE2 1 
ATOM   6954  C  CZ  . TYR A 1  1350 ? 168.499 198.842 197.080 1.00 281.06 ?  1350 TYR A CZ  1 
ATOM   6955  O  OH  . TYR A 1  1350 ? 167.536 198.901 196.098 1.00 327.31 ?  1350 TYR A OH  1 
ATOM   6956  N  N   . GLN A 1  1351 ? 173.551 200.434 202.348 1.00 208.76 ?  1351 GLN A N   1 
ATOM   6957  C  CA  . GLN A 1  1351 ? 174.676 200.244 203.269 1.00 180.80 ?  1351 GLN A CA  1 
ATOM   6958  C  C   . GLN A 1  1351 ? 174.731 201.228 204.432 1.00 156.47 ?  1351 GLN A C   1 
ATOM   6959  O  O   . GLN A 1  1351 ? 174.769 200.798 205.576 1.00 147.44 ?  1351 GLN A O   1 
ATOM   6960  C  CB  . GLN A 1  1351 ? 175.990 200.275 202.507 1.00 210.50 ?  1351 GLN A CB  1 
ATOM   6961  C  CG  . GLN A 1  1351 ? 176.410 198.927 201.966 1.00 211.99 ?  1351 GLN A CG  1 
ATOM   6962  C  CD  . GLN A 1  1351 ? 177.552 199.014 200.960 1.00 226.12 ?  1351 GLN A CD  1 
ATOM   6963  O  OE1 . GLN A 1  1351 ? 178.483 198.212 201.014 1.00 264.80 ?  1351 GLN A OE1 1 
ATOM   6964  N  NE2 . GLN A 1  1351 ? 177.486 199.978 200.034 1.00 174.81 ?  1351 GLN A NE2 1 
ATOM   6965  N  N   . ILE A 1  1352 ? 174.768 202.529 204.144 1.00 133.32 ?  1352 ILE A N   1 
ATOM   6966  C  CA  . ILE A 1  1352 ? 174.771 203.543 205.190 1.00 187.25 ?  1352 ILE A CA  1 
ATOM   6967  C  C   . ILE A 1  1352 ? 173.341 204.082 205.294 1.00 251.74 ?  1352 ILE A C   1 
ATOM   6968  O  O   . ILE A 1  1352 ? 172.537 203.849 204.390 1.00 296.70 ?  1352 ILE A O   1 
ATOM   6969  C  CB  . ILE A 1  1352 ? 175.787 204.687 204.902 1.00 227.51 ?  1352 ILE A CB  1 
ATOM   6970  C  CG1 . ILE A 1  1352 ? 177.038 204.193 204.127 1.00 258.31 ?  1352 ILE A CG1 1 
ATOM   6971  C  CG2 . ILE A 1  1352 ? 176.145 205.442 206.187 1.00 262.36 ?  1352 ILE A CG2 1 
ATOM   6972  C  CD1 . ILE A 1  1352 ? 178.120 203.454 204.909 1.00 255.24 ?  1352 ILE A CD1 1 
ATOM   6973  N  N   . LYS A 1  1353 ? 173.018 204.772 206.393 1.00 336.25 ?  1353 LYS A N   1 
ATOM   6974  C  CA  . LYS A 1  1353 ? 171.682 205.354 206.617 1.00 390.06 ?  1353 LYS A CA  1 
ATOM   6975  C  C   . LYS A 1  1353 ? 171.744 206.617 207.493 1.00 425.28 ?  1353 LYS A C   1 
ATOM   6976  O  O   . LYS A 1  1353 ? 171.988 206.537 208.705 1.00 439.46 ?  1353 LYS A O   1 
ATOM   6977  C  CB  . LYS A 1  1353 ? 170.731 204.304 207.227 1.00 399.02 ?  1353 LYS A CB  1 
ATOM   6978  C  CG  . LYS A 1  1353 ? 169.245 204.643 207.180 1.00 396.36 ?  1353 LYS A CG  1 
ATOM   6979  C  CD  . LYS A 1  1353 ? 168.422 203.608 207.936 1.00 396.24 ?  1353 LYS A CD  1 
ATOM   6980  C  CE  . LYS A 1  1353 ? 166.968 204.029 208.094 1.00 402.41 ?  1353 LYS A CE  1 
ATOM   6981  N  NZ  . LYS A 1  1353 ? 166.781 205.079 209.136 1.00 404.44 ?  1353 LYS A NZ  1 
ATOM   6982  N  N   . GLU A 1  1354 ? 171.535 207.776 206.868 1.00 446.67 ?  1354 GLU A N   1 
ATOM   6983  C  CA  . GLU A 1  1354 ? 171.409 209.042 207.591 1.00 461.73 ?  1354 GLU A CA  1 
ATOM   6984  C  C   . GLU A 1  1354 ? 169.982 209.197 208.122 1.00 479.38 ?  1354 GLU A C   1 
ATOM   6985  O  O   . GLU A 1  1354 ? 169.013 208.995 207.385 1.00 486.62 ?  1354 GLU A O   1 
ATOM   6986  C  CB  . GLU A 1  1354 ? 171.794 210.228 206.699 1.00 454.88 ?  1354 GLU A CB  1 
ATOM   6987  C  CG  . GLU A 1  1354 ? 171.895 211.563 207.433 1.00 443.15 ?  1354 GLU A CG  1 
ATOM   6988  C  CD  . GLU A 1  1354 ? 172.132 212.742 206.505 1.00 433.99 ?  1354 GLU A CD  1 
ATOM   6989  O  OE1 . GLU A 1  1354 ? 173.196 212.794 205.851 1.00 424.55 ?  1354 GLU A OE1 1 
ATOM   6990  O  OE2 . GLU A 1  1354 ? 171.254 213.630 206.442 1.00 432.17 -1 1354 GLU A OE2 1 
ATOM   6991  N  N   . GLY A 1  1355 ? 169.872 209.542 209.404 1.00 488.89 ?  1355 GLY A N   1 
ATOM   6992  C  CA  . GLY A 1  1355 ? 168.578 209.767 210.051 1.00 499.12 ?  1355 GLY A CA  1 
ATOM   6993  C  C   . GLY A 1  1355 ? 168.261 211.236 210.263 1.00 500.00 ?  1355 GLY A C   1 
ATOM   6994  O  O   . GLY A 1  1355 ? 167.760 211.614 211.328 1.00 500.00 ?  1355 GLY A O   1 
ATOM   6995  N  N   . ASP A 1  1356 ? 168.558 212.051 209.243 1.00 500.00 ?  1356 ASP A N   1 
ATOM   6996  C  CA  . ASP A 1  1356 ? 168.336 213.517 209.229 1.00 500.00 ?  1356 ASP A CA  1 
ATOM   6997  C  C   . ASP A 1  1356 ? 169.147 214.303 210.280 1.00 500.00 ?  1356 ASP A C   1 
ATOM   6998  O  O   . ASP A 1  1356 ? 169.914 213.712 211.054 1.00 500.00 ?  1356 ASP A O   1 
ATOM   6999  C  CB  . ASP A 1  1356 ? 166.833 213.863 209.287 1.00 500.00 ?  1356 ASP A CB  1 
ATOM   7000  N  N   . THR A 1  1357 ? 168.991 215.635 210.267 1.00 500.00 ?  1357 THR A N   1 
ATOM   7001  C  CA  . THR A 1  1357 ? 169.730 216.585 211.135 1.00 500.00 ?  1357 THR A CA  1 
ATOM   7002  C  C   . THR A 1  1357 ? 171.267 216.513 210.985 1.00 500.00 ?  1357 THR A C   1 
ATOM   7003  O  O   . THR A 1  1357 ? 172.009 217.046 211.820 1.00 500.00 ?  1357 THR A O   1 
ATOM   7004  C  CB  . THR A 1  1357 ? 169.296 216.490 212.621 1.00 500.00 ?  1357 THR A CB  1 
ATOM   7005  N  N   . ILE A 1  1358 ? 171.710 215.849 209.908 1.00 488.72 ?  1358 ILE A N   1 
ATOM   7006  C  CA  . ILE A 1  1358 ? 173.127 215.594 209.557 1.00 440.38 ?  1358 ILE A CA  1 
ATOM   7007  C  C   . ILE A 1  1358 ? 173.910 214.677 210.522 1.00 417.93 ?  1358 ILE A C   1 
ATOM   7008  O  O   . ILE A 1  1358 ? 173.593 214.590 211.716 1.00 414.14 ?  1358 ILE A O   1 
ATOM   7009  C  CB  . ILE A 1  1358 ? 173.870 216.939 209.439 1.00 20.00  ?  1358 ILE A CB  1 
ATOM   7010  C  CG1 . ILE A 1  1358 ? 173.294 217.767 208.290 1.00 20.00  ?  1358 ILE A CG1 1 
ATOM   7011  C  CG2 . ILE A 1  1358 ? 175.360 216.708 209.242 1.00 20.00  ?  1358 ILE A CG2 1 
ATOM   7012  C  CD1 . ILE A 1  1358 ? 173.780 219.199 208.266 1.00 20.00  ?  1358 ILE A CD1 1 
ATOM   7013  N  N   . ASN A 1  1359 ? 174.901 213.968 209.969 1.00 380.57 ?  1359 ASN A N   1 
ATOM   7014  C  CA  . ASN A 1  1359 ? 175.987 213.360 210.755 1.00 302.98 ?  1359 ASN A CA  1 
ATOM   7015  C  C   . ASN A 1  1359 ? 177.321 214.012 210.405 1.00 200.90 ?  1359 ASN A C   1 
ATOM   7016  O  O   . ASN A 1  1359 ? 177.673 214.183 209.238 1.00 185.55 ?  1359 ASN A O   1 
ATOM   7017  C  CB  . ASN A 1  1359 ? 176.048 211.831 210.606 1.00 361.25 ?  1359 ASN A CB  1 
ATOM   7018  C  CG  . ASN A 1  1359 ? 176.911 211.373 209.437 1.00 390.15 ?  1359 ASN A CG  1 
ATOM   7019  O  OD1 . ASN A 1  1359 ? 178.004 210.834 209.632 1.00 394.13 ?  1359 ASN A OD1 1 
ATOM   7020  N  ND2 . ASN A 1  1359 ? 176.432 211.600 208.217 1.00 409.78 ?  1359 ASN A ND2 1 
ATOM   7021  N  N   . VAL A 1  1360 ? 178.048 214.400 211.431 1.00 131.86 ?  1360 VAL A N   1 
ATOM   7022  C  CA  . VAL A 1  1360 ? 179.185 215.241 211.210 1.00 135.36 ?  1360 VAL A CA  1 
ATOM   7023  C  C   . VAL A 1  1360 ? 180.364 214.355 210.994 1.00 141.88 ?  1360 VAL A C   1 
ATOM   7024  O  O   . VAL A 1  1360 ? 181.407 214.816 210.534 1.00 143.14 ?  1360 VAL A O   1 
ATOM   7025  C  CB  . VAL A 1  1360 ? 179.467 216.234 212.366 1.00 142.48 ?  1360 VAL A CB  1 
ATOM   7026  C  CG1 . VAL A 1  1360 ? 178.353 217.277 212.498 1.00 160.65 ?  1360 VAL A CG1 1 
ATOM   7027  C  CG2 . VAL A 1  1360 ? 179.760 215.526 213.686 1.00 158.45 ?  1360 VAL A CG2 1 
ATOM   7028  N  N   . ASP A 1  1361 ? 180.194 213.076 211.305 1.00 152.79 ?  1361 ASP A N   1 
ATOM   7029  C  CA  . ASP A 1  1361 ? 181.340 212.190 211.362 1.00 203.02 ?  1361 ASP A CA  1 
ATOM   7030  C  C   . ASP A 1  1361 ? 182.034 212.179 210.004 1.00 214.88 ?  1361 ASP A C   1 
ATOM   7031  O  O   . ASP A 1  1361 ? 183.250 212.339 209.936 1.00 193.83 ?  1361 ASP A O   1 
ATOM   7032  C  CB  . ASP A 1  1361 ? 180.952 210.801 211.885 1.00 237.82 ?  1361 ASP A CB  1 
ATOM   7033  C  CG  . ASP A 1  1361 ? 180.521 210.830 213.359 1.00 256.89 ?  1361 ASP A CG  1 
ATOM   7034  O  OD1 . ASP A 1  1361 ? 179.421 211.350 213.648 1.00 282.03 ?  1361 ASP A OD1 1 
ATOM   7035  O  OD2 . ASP A 1  1361 ? 181.279 210.335 214.230 1.00 242.98 -1 1361 ASP A OD2 1 
ATOM   7036  N  N   . VAL A 1  1362 ? 181.230 212.079 208.943 1.00 274.49 ?  1362 VAL A N   1 
ATOM   7037  C  CA  . VAL A 1  1362 ? 181.657 212.264 207.544 1.00 331.02 ?  1362 VAL A CA  1 
ATOM   7038  C  C   . VAL A 1  1362 ? 182.085 213.724 207.224 1.00 338.85 ?  1362 VAL A C   1 
ATOM   7039  O  O   . VAL A 1  1362 ? 183.206 213.953 206.754 1.00 344.77 ?  1362 VAL A O   1 
ATOM   7040  C  CB  . VAL A 1  1362 ? 180.550 211.757 206.557 1.00 348.14 ?  1362 VAL A CB  1 
ATOM   7041  C  CG1 . VAL A 1  1362 ? 180.858 212.107 205.103 1.00 334.37 ?  1362 VAL A CG1 1 
ATOM   7042  C  CG2 . VAL A 1  1362 ? 180.336 210.252 206.693 1.00 343.54 ?  1362 VAL A CG2 1 
ATOM   7043  N  N   . THR A 1  1363 ? 181.205 214.690 207.510 1.00 319.83 ?  1363 THR A N   1 
ATOM   7044  C  CA  . THR A 1  1363 ? 181.299 216.072 206.973 1.00 265.98 ?  1363 THR A CA  1 
ATOM   7045  C  C   . THR A 1  1363 ? 182.178 217.045 207.760 1.00 179.15 ?  1363 THR A C   1 
ATOM   7046  O  O   . THR A 1  1363 ? 182.769 217.976 207.187 1.00 176.59 ?  1363 THR A O   1 
ATOM   7047  C  CB  . THR A 1  1363 ? 179.900 216.731 206.824 1.00 330.11 ?  1363 THR A CB  1 
ATOM   7048  O  OG1 . THR A 1  1363 ? 179.215 216.711 208.083 1.00 387.45 ?  1363 THR A OG1 1 
ATOM   7049  C  CG2 . THR A 1  1363 ? 179.050 216.021 205.761 1.00 334.77 ?  1363 THR A CG2 1 
ATOM   7050  N  N   . CYS A 1  1364 ? 182.250 216.835 209.067 1.00 128.09 ?  1364 CYS A N   1 
ATOM   7051  C  CA  . CYS A 1  1364 ? 182.861 217.806 209.966 1.00 161.39 ?  1364 CYS A CA  1 
ATOM   7052  C  C   . CYS A 1  1364 ? 184.356 218.066 209.745 1.00 179.40 ?  1364 CYS A C   1 
ATOM   7053  O  O   . CYS A 1  1364 ? 184.764 219.231 209.861 1.00 184.98 ?  1364 CYS A O   1 
ATOM   7054  C  CB  . CYS A 1  1364 ? 182.631 217.411 211.423 1.00 192.05 ?  1364 CYS A CB  1 
ATOM   7055  S  SG  . CYS A 1  1364 ? 183.455 218.439 212.662 1.00 273.52 ?  1364 CYS A SG  1 
ATOM   7056  N  N   . PRO A 1  1365 ? 185.174 217.009 209.443 1.00 174.63 ?  1365 PRO A N   1 
ATOM   7057  C  CA  . PRO A 1  1365 ? 186.633 217.233 209.405 1.00 148.38 ?  1365 PRO A CA  1 
ATOM   7058  C  C   . PRO A 1  1365 ? 187.050 218.156 208.259 1.00 169.11 ?  1365 PRO A C   1 
ATOM   7059  O  O   . PRO A 1  1365 ? 187.859 219.065 208.470 1.00 146.63 ?  1365 PRO A O   1 
ATOM   7060  C  CB  . PRO A 1  1365 ? 187.196 215.829 209.182 1.00 134.26 ?  1365 PRO A CB  1 
ATOM   7061  C  CG  . PRO A 1  1365 ? 186.127 215.118 208.422 1.00 153.51 ?  1365 PRO A CG  1 
ATOM   7062  C  CD  . PRO A 1  1365 ? 184.844 215.624 209.026 1.00 159.03 ?  1365 PRO A CD  1 
ATOM   7063  N  N   . GLY A 1  1366 ? 186.473 217.911 207.073 1.00 193.66 ?  1366 GLY A N   1 
ATOM   7064  C  CA  . GLY A 1  1366 ? 186.644 218.736 205.883 1.00 184.43 ?  1366 GLY A CA  1 
ATOM   7065  C  C   . GLY A 1  1366 ? 186.196 220.160 206.135 1.00 171.90 ?  1366 GLY A C   1 
ATOM   7066  O  O   . GLY A 1  1366 ? 186.951 221.105 205.895 1.00 178.64 ?  1366 GLY A O   1 
ATOM   7067  N  N   . ALA A 1  1367 ? 184.978 220.306 206.643 1.00 148.28 ?  1367 ALA A N   1 
ATOM   7068  C  CA  . ALA A 1  1367 ? 184.420 221.604 206.974 1.00 162.45 ?  1367 ALA A CA  1 
ATOM   7069  C  C   . ALA A 1  1367 ? 185.375 222.514 207.791 1.00 175.33 ?  1367 ALA A C   1 
ATOM   7070  O  O   . ALA A 1  1367 ? 185.633 223.658 207.388 1.00 170.97 ?  1367 ALA A O   1 
ATOM   7071  C  CB  . ALA A 1  1367 ? 183.072 221.423 207.659 1.00 170.76 ?  1367 ALA A CB  1 
ATOM   7072  N  N   . THR A 1  1368 ? 185.917 222.000 208.902 1.00 188.35 ?  1368 THR A N   1 
ATOM   7073  C  CA  . THR A 1  1368 ? 186.868 222.756 209.743 1.00 182.47 ?  1368 THR A CA  1 
ATOM   7074  C  C   . THR A 1  1368 ? 188.083 223.159 208.942 1.00 171.03 ?  1368 THR A C   1 
ATOM   7075  O  O   . THR A 1  1368 ? 188.577 224.271 209.095 1.00 163.33 ?  1368 THR A O   1 
ATOM   7076  C  CB  . THR A 1  1368 ? 187.401 221.968 210.962 1.00 194.18 ?  1368 THR A CB  1 
ATOM   7077  O  OG1 . THR A 1  1368 ? 188.221 220.878 210.516 1.00 197.36 ?  1368 THR A OG1 1 
ATOM   7078  C  CG2 . THR A 1  1368 ? 186.279 221.454 211.844 1.00 223.82 ?  1368 THR A CG2 1 
ATOM   7079  N  N   . LEU A 1  1369 ? 188.556 222.238 208.104 1.00 176.46 ?  1369 LEU A N   1 
ATOM   7080  C  CA  . LEU A 1  1369 ? 189.740 222.468 207.287 1.00 239.72 ?  1369 LEU A CA  1 
ATOM   7081  C  C   . LEU A 1  1369 ? 189.552 223.568 206.243 1.00 276.77 ?  1369 LEU A C   1 
ATOM   7082  O  O   . LEU A 1  1369 ? 190.470 224.370 206.020 1.00 344.36 ?  1369 LEU A O   1 
ATOM   7083  C  CB  . LEU A 1  1369 ? 190.239 221.167 206.648 1.00 241.78 ?  1369 LEU A CB  1 
ATOM   7084  C  CG  . LEU A 1  1369 ? 191.445 220.512 207.332 1.00 243.64 ?  1369 LEU A CG  1 
ATOM   7085  C  CD1 . LEU A 1  1369 ? 191.606 219.078 206.872 1.00 208.65 ?  1369 LEU A CD1 1 
ATOM   7086  C  CD2 . LEU A 1  1369 ? 192.734 221.290 207.089 1.00 258.84 ?  1369 LEU A CD2 1 
ATOM   7087  N  N   . ALA A 1  1370 ? 188.363 223.614 205.634 1.00 283.07 ?  1370 ALA A N   1 
ATOM   7088  C  CA  . ALA A 1  1370 ? 187.996 224.678 204.690 1.00 320.94 ?  1370 ALA A CA  1 
ATOM   7089  C  C   . ALA A 1  1370 ? 188.013 226.063 205.354 1.00 364.28 ?  1370 ALA A C   1 
ATOM   7090  O  O   . ALA A 1  1370 ? 188.584 227.005 204.794 1.00 389.57 ?  1370 ALA A O   1 
ATOM   7091  C  CB  . ALA A 1  1370 ? 186.648 224.389 204.045 1.00 317.72 ?  1370 ALA A CB  1 
ATOM   7092  N  N   . LEU A 1  1371 ? 187.428 226.165 206.553 1.00 392.46 ?  1371 LEU A N   1 
ATOM   7093  C  CA  . LEU A 1  1371 ? 187.463 227.404 207.353 1.00 377.07 ?  1371 LEU A CA  1 
ATOM   7094  C  C   . LEU A 1  1371 ? 188.881 227.879 207.748 1.00 361.45 ?  1371 LEU A C   1 
ATOM   7095  O  O   . LEU A 1  1371 ? 189.113 229.086 207.801 1.00 362.23 ?  1371 LEU A O   1 
ATOM   7096  C  CB  . LEU A 1  1371 ? 186.533 227.324 208.581 1.00 374.91 ?  1371 LEU A CB  1 
ATOM   7097  C  CG  . LEU A 1  1371 ? 185.007 227.425 208.385 1.00 369.95 ?  1371 LEU A CG  1 
ATOM   7098  C  CD1 . LEU A 1  1371 ? 184.273 227.109 209.670 1.00 344.77 ?  1371 LEU A CD1 1 
ATOM   7099  C  CD2 . LEU A 1  1371 ? 184.543 228.785 207.891 1.00 367.82 ?  1371 LEU A CD2 1 
ATOM   7100  N  N   . ALA A 1  1372 ? 189.804 226.938 207.999 1.00 326.32 ?  1372 ALA A N   1 
ATOM   7101  C  CA  . ALA A 1  1372 ? 191.238 227.236 208.237 1.00 256.31 ?  1372 ALA A CA  1 
ATOM   7102  C  C   . ALA A 1  1372 ? 191.911 227.954 207.048 1.00 237.78 ?  1372 ALA A C   1 
ATOM   7103  O  O   . ALA A 1  1372 ? 192.520 229.006 207.229 1.00 222.20 ?  1372 ALA A O   1 
ATOM   7104  C  CB  . ALA A 1  1372 ? 192.004 225.971 208.614 1.00 224.05 ?  1372 ALA A CB  1 
ATOM   7105  N  N   . MET A 1  1373 ? 191.758 227.395 205.846 1.00 209.68 ?  1373 MET A N   1 
ATOM   7106  C  CA  . MET A 1  1373 ? 192.282 227.957 204.602 1.00 182.56 ?  1373 MET A CA  1 
ATOM   7107  C  C   . MET A 1  1373 ? 191.583 229.224 204.101 1.00 249.34 ?  1373 MET A C   1 
ATOM   7108  O  O   . MET A 1  1373 ? 192.279 230.150 203.733 1.00 289.10 ?  1373 MET A O   1 
ATOM   7109  C  CB  . MET A 1  1373 ? 192.205 226.938 203.493 1.00 172.29 ?  1373 MET A CB  1 
ATOM   7110  C  CG  . MET A 1  1373 ? 192.634 225.549 203.866 1.00 194.67 ?  1373 MET A CG  1 
ATOM   7111  S  SD  . MET A 1  1373 ? 194.311 225.317 203.316 1.00 258.90 ?  1373 MET A SD  1 
ATOM   7112  C  CE  . MET A 1  1373 ? 194.168 223.614 202.777 1.00 265.31 ?  1373 MET A CE  1 
ATOM   7113  N  N   . ILE A 1  1374 ? 190.238 229.257 204.054 1.00 306.01 ?  1374 ILE A N   1 
ATOM   7114  C  CA  . ILE A 1  1374 ? 189.448 230.424 203.516 1.00 329.50 ?  1374 ILE A CA  1 
ATOM   7115  C  C   . ILE A 1  1374 ? 189.645 231.710 204.350 1.00 359.03 ?  1374 ILE A C   1 
ATOM   7116  O  O   . ILE A 1  1374 ? 189.492 232.844 203.851 1.00 360.38 ?  1374 ILE A O   1 
ATOM   7117  C  CB  . ILE A 1  1374 ? 187.913 230.120 203.374 1.00 321.17 ?  1374 ILE A CB  1 
ATOM   7118  C  CG1 . ILE A 1  1374 ? 187.649 228.912 202.463 1.00 299.61 ?  1374 ILE A CG1 1 
ATOM   7119  C  CG2 . ILE A 1  1374 ? 187.135 231.332 202.841 1.00 322.61 ?  1374 ILE A CG2 1 
ATOM   7120  C  CD1 . ILE A 1  1374 ? 186.218 228.402 202.465 1.00 289.35 ?  1374 ILE A CD1 1 
ATOM   7121  N  N   . TYR A 1  1375 ? 189.987 231.512 205.620 1.00 376.34 ?  1375 TYR A N   1 
ATOM   7122  C  CA  . TYR A 1  1375 ? 190.160 232.589 206.580 1.00 339.05 ?  1375 TYR A CA  1 
ATOM   7123  C  C   . TYR A 1  1375 ? 191.518 232.404 207.248 1.00 292.54 ?  1375 TYR A C   1 
ATOM   7124  O  O   . TYR A 1  1375 ? 191.624 232.264 208.471 1.00 335.99 ?  1375 TYR A O   1 
ATOM   7125  C  CB  . TYR A 1  1375 ? 189.018 232.550 207.606 1.00 381.81 ?  1375 TYR A CB  1 
ATOM   7126  C  CG  . TYR A 1  1375 ? 187.645 232.674 206.996 1.00 392.42 ?  1375 TYR A CG  1 
ATOM   7127  C  CD1 . TYR A 1  1375 ? 187.111 233.929 206.683 1.00 406.13 ?  1375 TYR A CD1 1 
ATOM   7128  C  CD2 . TYR A 1  1375 ? 186.878 231.536 206.721 1.00 392.59 ?  1375 TYR A CD2 1 
ATOM   7129  C  CE1 . TYR A 1  1375 ? 185.847 234.043 206.121 1.00 415.50 ?  1375 TYR A CE1 1 
ATOM   7130  C  CE2 . TYR A 1  1375 ? 185.615 231.643 206.154 1.00 406.39 ?  1375 TYR A CE2 1 
ATOM   7131  C  CZ  . TYR A 1  1375 ? 185.104 232.896 205.860 1.00 416.61 ?  1375 TYR A CZ  1 
ATOM   7132  O  OH  . TYR A 1  1375 ? 183.855 233.005 205.299 1.00 423.54 ?  1375 TYR A OH  1 
ATOM   7133  N  N   . LEU A 1  1376 ? 192.562 232.405 206.432 1.00 193.41 ?  1376 LEU A N   1 
ATOM   7134  C  CA  . LEU A 1  1376 ? 193.853 231.979 206.908 1.00 171.80 ?  1376 LEU A CA  1 
ATOM   7135  C  C   . LEU A 1  1376 ? 194.589 233.225 207.199 1.00 165.43 ?  1376 LEU A C   1 
ATOM   7136  O  O   . LEU A 1  1376 ? 194.839 234.009 206.292 1.00 210.43 ?  1376 LEU A O   1 
ATOM   7137  C  CB  . LEU A 1  1376 ? 194.580 231.196 205.828 1.00 170.73 ?  1376 LEU A CB  1 
ATOM   7138  C  CG  . LEU A 1  1376 ? 195.457 230.016 206.222 1.00 179.23 ?  1376 LEU A CG  1 
ATOM   7139  C  CD1 . LEU A 1  1376 ? 195.594 229.098 205.020 1.00 182.28 ?  1376 LEU A CD1 1 
ATOM   7140  C  CD2 . LEU A 1  1376 ? 196.820 230.449 206.729 1.00 175.31 ?  1376 LEU A CD2 1 
ATOM   7141  N  N   . LYS A 1  1377 ? 194.931 233.414 208.469 1.00 170.17 ?  1377 LYS A N   1 
ATOM   7142  C  CA  . LYS A 1  1377 ? 195.676 234.596 208.933 1.00 198.20 ?  1377 LYS A CA  1 
ATOM   7143  C  C   . LYS A 1  1377 ? 194.843 235.880 208.749 1.00 209.73 ?  1377 LYS A C   1 
ATOM   7144  O  O   . LYS A 1  1377 ? 195.352 237.004 208.895 1.00 227.77 ?  1377 LYS A O   1 
ATOM   7145  C  CB  . LYS A 1  1377 ? 197.055 234.716 208.238 1.00 191.05 ?  1377 LYS A CB  1 
ATOM   7146  C  CG  . LYS A 1  1377 ? 197.886 233.442 208.171 1.00 161.77 ?  1377 LYS A CG  1 
ATOM   7147  C  CD  . LYS A 1  1377 ? 198.858 233.528 207.017 1.00 190.28 ?  1377 LYS A CD  1 
ATOM   7148  C  CE  . LYS A 1  1377 ? 199.984 232.520 207.156 1.00 201.28 ?  1377 LYS A CE  1 
ATOM   7149  N  NZ  . LYS A 1  1377 ? 201.216 232.905 206.402 1.00 212.37 ?  1377 LYS A NZ  1 
ATOM   7150  N  N   . THR A 1  1378 ? 193.562 235.690 208.429 1.00 208.88 ?  1378 THR A N   1 
ATOM   7151  C  CA  . THR A 1  1378 ? 192.611 236.782 208.261 1.00 237.67 ?  1378 THR A CA  1 
ATOM   7152  C  C   . THR A 1  1378 ? 192.370 237.449 209.613 1.00 234.42 ?  1378 THR A C   1 
ATOM   7153  O  O   . THR A 1  1378 ? 192.098 238.650 209.687 1.00 248.46 ?  1378 THR A O   1 
ATOM   7154  C  CB  . THR A 1  1378 ? 191.288 236.282 207.627 1.00 267.25 ?  1378 THR A CB  1 
ATOM   7155  O  OG1 . THR A 1  1378 ? 190.497 237.399 207.198 1.00 296.86 ?  1378 THR A OG1 1 
ATOM   7156  C  CG2 . THR A 1  1378 ? 190.479 235.453 208.609 1.00 279.83 ?  1378 THR A CG2 1 
ATOM   7157  N  N   . ASN A 1  1379 ? 192.515 236.642 210.666 1.00 226.51 ?  1379 ASN A N   1 
ATOM   7158  C  CA  . ASN A 1  1379 ? 192.275 237.022 212.053 1.00 222.23 ?  1379 ASN A CA  1 
ATOM   7159  C  C   . ASN A 1  1379 ? 190.809 237.332 212.329 1.00 195.76 ?  1379 ASN A C   1 
ATOM   7160  O  O   . ASN A 1  1379 ? 190.460 238.244 213.099 1.00 196.57 ?  1379 ASN A O   1 
ATOM   7161  C  CB  . ASN A 1  1379 ? 193.258 238.112 212.528 1.00 230.50 ?  1379 ASN A CB  1 
ATOM   7162  C  CG  . ASN A 1  1379 ? 194.680 237.594 212.641 1.00 205.11 ?  1379 ASN A CG  1 
ATOM   7163  O  OD1 . ASN A 1  1379 ? 195.221 237.008 211.703 1.00 182.01 ?  1379 ASN A OD1 1 
ATOM   7164  N  ND2 . ASN A 1  1379 ? 195.288 237.800 213.802 1.00 190.18 ?  1379 ASN A ND2 1 
ATOM   7165  N  N   . ASN A 1  1380 ? 189.951 236.545 211.691 1.00 163.76 ?  1380 ASN A N   1 
ATOM   7166  C  CA  . ASN A 1  1380 ? 188.570 236.506 212.105 1.00 237.90 ?  1380 ASN A CA  1 
ATOM   7167  C  C   . ASN A 1  1380 ? 188.412 235.858 213.517 1.00 262.70 ?  1380 ASN A C   1 
ATOM   7168  O  O   . ASN A 1  1380 ? 188.523 234.641 213.673 1.00 258.78 ?  1380 ASN A O   1 
ATOM   7169  C  CB  . ASN A 1  1380 ? 187.680 235.873 211.009 1.00 255.41 ?  1380 ASN A CB  1 
ATOM   7170  C  CG  . ASN A 1  1380 ? 187.425 236.821 209.827 1.00 287.67 ?  1380 ASN A CG  1 
ATOM   7171  O  OD1 . ASN A 1  1380 ? 188.045 237.882 209.711 1.00 317.49 ?  1380 ASN A OD1 1 
ATOM   7172  N  ND2 . ASN A 1  1380 ? 186.498 236.435 208.941 1.00 311.57 ?  1380 ASN A ND2 1 
ATOM   7173  N  N   . ARG A 1  1381 ? 188.207 236.699 214.539 1.00 260.42 ?  1381 ARG A N   1 
ATOM   7174  C  CA  . ARG A 1  1381 ? 187.730 236.269 215.865 1.00 228.56 ?  1381 ARG A CA  1 
ATOM   7175  C  C   . ARG A 1  1381 ? 186.320 235.639 215.772 1.00 315.62 ?  1381 ARG A C   1 
ATOM   7176  O  O   . ARG A 1  1381 ? 186.026 234.728 216.528 1.00 365.09 ?  1381 ARG A O   1 
ATOM   7177  C  CB  . ARG A 1  1381 ? 187.647 237.445 216.847 1.00 193.31 ?  1381 ARG A CB  1 
ATOM   7178  C  CG  . ARG A 1  1381 ? 188.803 238.418 216.878 1.00 180.36 ?  1381 ARG A CG  1 
ATOM   7179  C  CD  . ARG A 1  1381 ? 189.653 238.130 218.095 1.00 223.48 ?  1381 ARG A CD  1 
ATOM   7180  N  NE  . ARG A 1  1381 ? 190.904 238.897 218.098 1.00 264.64 ?  1381 ARG A NE  1 
ATOM   7181  C  CZ  . ARG A 1  1381 ? 192.016 238.558 218.759 1.00 267.30 ?  1381 ARG A CZ  1 
ATOM   7182  N  NH1 . ARG A 1  1381 ? 192.073 237.448 219.491 1.00 272.04 ?  1381 ARG A NH1 1 
ATOM   7183  N  NH2 . ARG A 1  1381 ? 193.092 239.332 218.679 1.00 249.83 ?  1381 ARG A NH2 1 
ATOM   7184  N  N   . SER A 1  1382 ? 185.461 236.142 214.869 1.00 368.65 ?  1382 SER A N   1 
ATOM   7185  C  CA  . SER A 1  1382 ? 184.086 235.622 214.627 1.00 345.72 ?  1382 SER A CA  1 
ATOM   7186  C  C   . SER A 1  1382 ? 184.039 234.118 214.302 1.00 352.04 ?  1382 SER A C   1 
ATOM   7187  O  O   . SER A 1  1382 ? 183.307 233.353 214.947 1.00 377.94 ?  1382 SER A O   1 
ATOM   7188  C  CB  . SER A 1  1382 ? 183.379 236.427 213.516 1.00 316.10 ?  1382 SER A CB  1 
ATOM   7189  O  OG  . SER A 1  1382 ? 182.282 235.707 212.956 1.00 318.52 ?  1382 SER A OG  1 
ATOM   7190  N  N   . ILE A 1  1383 ? 184.839 233.716 213.313 1.00 307.06 ?  1383 ILE A N   1 
ATOM   7191  C  CA  . ILE A 1  1383 ? 184.945 232.312 212.885 1.00 237.58 ?  1383 ILE A CA  1 
ATOM   7192  C  C   . ILE A 1  1383 ? 185.742 231.506 213.926 1.00 183.78 ?  1383 ILE A C   1 
ATOM   7193  O  O   . ILE A 1  1383 ? 185.298 230.401 214.309 1.00 130.52 ?  1383 ILE A O   1 
ATOM   7194  C  CB  . ILE A 1  1383 ? 185.450 232.209 211.414 1.00 254.49 ?  1383 ILE A CB  1 
ATOM   7195  C  CG1 . ILE A 1  1383 ? 184.328 232.670 210.478 1.00 278.21 ?  1383 ILE A CG1 1 
ATOM   7196  C  CG2 . ILE A 1  1383 ? 185.830 230.781 211.021 1.00 251.06 ?  1383 ILE A CG2 1 
ATOM   7197  C  CD1 . ILE A 1  1383 ? 184.727 233.691 209.445 1.00 285.77 ?  1383 ILE A CD1 1 
ATOM   7198  N  N   . ALA A 1  1384 ? 186.859 232.095 214.396 1.00 156.13 ?  1384 ALA A N   1 
ATOM   7199  C  CA  . ALA A 1  1384 ? 187.691 231.579 215.500 1.00 168.83 ?  1384 ALA A CA  1 
ATOM   7200  C  C   . ALA A 1  1384 ? 186.926 231.241 216.805 1.00 219.00 ?  1384 ALA A C   1 
ATOM   7201  O  O   . ALA A 1  1384 ? 187.207 230.196 217.397 1.00 202.18 ?  1384 ALA A O   1 
ATOM   7202  C  CB  . ALA A 1  1384 ? 188.843 232.526 215.781 1.00 124.20 ?  1384 ALA A CB  1 
ATOM   7203  N  N   . ASP A 1  1385 ? 185.981 232.117 217.221 1.00 293.05 ?  1385 ASP A N   1 
ATOM   7204  C  CA  . ASP A 1  1385 ? 185.022 231.939 218.370 1.00 291.57 ?  1385 ASP A CA  1 
ATOM   7205  C  C   . ASP A 1  1385 ? 184.206 230.663 218.325 1.00 319.98 ?  1385 ASP A C   1 
ATOM   7206  O  O   . ASP A 1  1385 ? 184.073 229.976 219.339 1.00 267.65 ?  1385 ASP A O   1 
ATOM   7207  C  CB  . ASP A 1  1385 ? 183.960 233.058 218.410 1.00 262.56 ?  1385 ASP A CB  1 
ATOM   7208  C  CG  . ASP A 1  1385 ? 184.376 234.263 219.206 1.00 270.47 ?  1385 ASP A CG  1 
ATOM   7209  O  OD1 . ASP A 1  1385 ? 185.589 234.495 219.398 1.00 324.37 ?  1385 ASP A OD1 1 
ATOM   7210  O  OD2 . ASP A 1  1385 ? 183.459 235.004 219.616 1.00 236.85 -1 1385 ASP A OD2 1 
ATOM   7211  N  N   . TRP A 1  1386 ? 183.578 230.412 217.175 1.00 379.53 ?  1386 TRP A N   1 
ATOM   7212  C  CA  . TRP A 1  1386 ? 182.762 229.208 217.015 1.00 382.01 ?  1386 TRP A CA  1 
ATOM   7213  C  C   . TRP A 1  1386 ? 183.615 227.960 216.708 1.00 339.76 ?  1386 TRP A C   1 
ATOM   7214  O  O   . TRP A 1  1386 ? 183.225 226.839 217.029 1.00 358.27 ?  1386 TRP A O   1 
ATOM   7215  C  CB  . TRP A 1  1386 ? 181.531 229.447 216.105 1.00 398.64 ?  1386 TRP A CB  1 
ATOM   7216  C  CG  . TRP A 1  1386 ? 181.639 229.251 214.600 1.00 398.00 ?  1386 TRP A CG  1 
ATOM   7217  C  CD1 . TRP A 1  1386 ? 181.976 228.100 213.944 1.00 400.77 ?  1386 TRP A CD1 1 
ATOM   7218  C  CD2 . TRP A 1  1386 ? 181.306 230.211 213.576 1.00 398.34 ?  1386 TRP A CD2 1 
ATOM   7219  N  NE1 . TRP A 1  1386 ? 181.912 228.287 212.584 1.00 402.61 ?  1386 TRP A NE1 1 
ATOM   7220  C  CE2 . TRP A 1  1386 ? 181.502 229.568 212.325 1.00 398.17 ?  1386 TRP A CE2 1 
ATOM   7221  C  CE3 . TRP A 1  1386 ? 180.882 231.554 213.591 1.00 392.32 ?  1386 TRP A CE3 1 
ATOM   7222  C  CZ2 . TRP A 1  1386 ? 181.288 230.219 211.096 1.00 390.54 ?  1386 TRP A CZ2 1 
ATOM   7223  C  CZ3 . TRP A 1  1386 ? 180.671 232.211 212.360 1.00 389.66 ?  1386 TRP A CZ3 1 
ATOM   7224  C  CH2 . TRP A 1  1386 ? 180.875 231.533 211.132 1.00 387.75 ?  1386 TRP A CH2 1 
ATOM   7225  N  N   . LEU A 1  1387 ? 184.804 228.184 216.148 1.00 261.75 ?  1387 LEU A N   1 
ATOM   7226  C  CA  . LEU A 1  1387 ? 185.842 227.162 216.050 1.00 223.68 ?  1387 LEU A CA  1 
ATOM   7227  C  C   . LEU A 1  1387 ? 186.571 226.900 217.377 1.00 229.55 ?  1387 LEU A C   1 
ATOM   7228  O  O   . LEU A 1  1387 ? 187.436 226.027 217.444 1.00 251.63 ?  1387 LEU A O   1 
ATOM   7229  C  CB  . LEU A 1  1387 ? 186.850 227.578 214.990 1.00 241.16 ?  1387 LEU A CB  1 
ATOM   7230  C  CG  . LEU A 1  1387 ? 187.659 226.529 214.230 1.00 270.65 ?  1387 LEU A CG  1 
ATOM   7231  C  CD1 . LEU A 1  1387 ? 186.901 225.233 213.987 1.00 302.63 ?  1387 LEU A CD1 1 
ATOM   7232  C  CD2 . LEU A 1  1387 ? 188.068 227.135 212.904 1.00 298.94 ?  1387 LEU A CD2 1 
ATOM   7233  N  N   . ARG A 1  1388 ? 186.226 227.675 218.413 1.00 222.12 ?  1388 ARG A N   1 
ATOM   7234  C  CA  . ARG A 1  1388 ? 186.684 227.515 219.804 1.00 200.61 ?  1388 ARG A CA  1 
ATOM   7235  C  C   . ARG A 1  1388 ? 186.244 226.158 220.375 1.00 209.16 ?  1388 ARG A C   1 
ATOM   7236  O  O   . ARG A 1  1388 ? 185.188 225.632 219.990 1.00 221.31 ?  1388 ARG A O   1 
ATOM   7237  C  CB  . ARG A 1  1388 ? 186.096 228.657 220.644 1.00 172.59 ?  1388 ARG A CB  1 
ATOM   7238  C  CG  . ARG A 1  1388 ? 186.584 228.814 222.068 1.00 198.36 ?  1388 ARG A CG  1 
ATOM   7239  C  CD  . ARG A 1  1388 ? 186.050 230.115 222.650 1.00 228.43 ?  1388 ARG A CD  1 
ATOM   7240  N  NE  . ARG A 1  1388 ? 186.947 231.256 222.400 1.00 253.47 ?  1388 ARG A NE  1 
ATOM   7241  C  CZ  . ARG A 1  1388 ? 187.629 231.928 223.338 1.00 238.29 ?  1388 ARG A CZ  1 
ATOM   7242  N  NH1 . ARG A 1  1388 ? 187.525 231.602 224.624 1.00 240.24 ?  1388 ARG A NH1 1 
ATOM   7243  N  NH2 . ARG A 1  1388 ? 188.417 232.945 222.990 1.00 205.56 ?  1388 ARG A NH2 1 
ATOM   7244  N  N   . ALA A 1  1389 ? 187.063 225.599 221.273 1.00 203.09 ?  1389 ALA A N   1 
ATOM   7245  C  CA  . ALA A 1  1389 ? 186.687 224.434 222.088 1.00 209.76 ?  1389 ALA A CA  1 
ATOM   7246  C  C   . ALA A 1  1389 ? 185.434 224.780 222.947 1.00 227.14 ?  1389 ALA A C   1 
ATOM   7247  O  O   . ALA A 1  1389 ? 185.209 225.960 223.239 1.00 266.85 ?  1389 ALA A O   1 
ATOM   7248  C  CB  . ALA A 1  1389 ? 187.868 224.001 222.946 1.00 184.00 ?  1389 ALA A CB  1 
ATOM   7249  N  N   . PRO A 1  1390 ? 184.609 223.772 223.338 1.00 213.48 ?  1390 PRO A N   1 
ATOM   7250  C  CA  . PRO A 1  1390 ? 183.251 224.099 223.822 1.00 211.70 ?  1390 PRO A CA  1 
ATOM   7251  C  C   . PRO A 1  1390 ? 183.138 224.763 225.216 1.00 244.99 ?  1390 PRO A C   1 
ATOM   7252  O  O   . PRO A 1  1390 ? 182.266 225.622 225.393 1.00 245.80 ?  1390 PRO A O   1 
ATOM   7253  C  CB  . PRO A 1  1390 ? 182.520 222.749 223.791 1.00 169.69 ?  1390 PRO A CB  1 
ATOM   7254  C  CG  . PRO A 1  1390 ? 183.498 221.745 223.311 1.00 176.94 ?  1390 PRO A CG  1 
ATOM   7255  C  CD  . PRO A 1  1390 ? 184.866 222.329 223.467 1.00 202.02 ?  1390 PRO A CD  1 
ATOM   7256  N  N   . ASP A 1  1391 ? 184.001 224.374 226.168 1.00 268.49 ?  1391 ASP A N   1 
ATOM   7257  C  CA  . ASP A 1  1391 ? 184.102 224.978 227.533 1.00 263.19 ?  1391 ASP A CA  1 
ATOM   7258  C  C   . ASP A 1  1391 ? 182.887 224.795 228.479 1.00 251.37 ?  1391 ASP A C   1 
ATOM   7259  O  O   . ASP A 1  1391 ? 182.687 225.595 229.399 1.00 258.92 ?  1391 ASP A O   1 
ATOM   7260  C  CB  . ASP A 1  1391 ? 184.491 226.479 227.477 1.00 311.35 ?  1391 ASP A CB  1 
ATOM   7261  C  CG  . ASP A 1  1391 ? 185.871 226.729 226.875 1.00 335.08 ?  1391 ASP A CG  1 
ATOM   7262  O  OD1 . ASP A 1  1391 ? 186.242 226.064 225.884 1.00 378.40 ?  1391 ASP A OD1 1 
ATOM   7263  O  OD2 . ASP A 1  1391 ? 186.589 227.618 227.393 1.00 309.04 -1 1391 ASP A OD2 1 
ATOM   7264  N  N   . THR A 1  1392 ? 182.082 223.758 228.247 1.00 247.88 ?  1392 THR A N   1 
ATOM   7265  C  CA  . THR A 1  1392 ? 180.997 223.345 229.161 1.00 215.35 ?  1392 THR A CA  1 
ATOM   7266  C  C   . THR A 1  1392 ? 180.914 221.825 229.086 1.00 170.32 ?  1392 THR A C   1 
ATOM   7267  O  O   . THR A 1  1392 ? 181.037 221.252 227.990 1.00 149.86 ?  1392 THR A O   1 
ATOM   7268  C  CB  . THR A 1  1392 ? 179.588 223.889 228.771 1.00 264.36 ?  1392 THR A CB  1 
ATOM   7269  O  OG1 . THR A 1  1392 ? 178.946 222.988 227.847 1.00 303.82 ?  1392 THR A OG1 1 
ATOM   7270  C  CG2 . THR A 1  1392 ? 179.616 225.331 228.188 1.00 245.94 ?  1392 THR A CG2 1 
ATOM   7271  N  N   . MET A 1  1393 ? 180.656 221.174 230.217 1.00 152.30 ?  1393 MET A N   1 
ATOM   7272  C  CA  . MET A 1  1393 ? 180.581 219.701 230.244 1.00 187.30 ?  1393 MET A CA  1 
ATOM   7273  C  C   . MET A 1  1393 ? 179.620 219.102 229.191 1.00 209.69 ?  1393 MET A C   1 
ATOM   7274  O  O   . MET A 1  1393 ? 179.873 218.012 228.673 1.00 207.55 ?  1393 MET A O   1 
ATOM   7275  C  CB  . MET A 1  1393 ? 180.267 219.173 231.650 1.00 173.69 ?  1393 MET A CB  1 
ATOM   7276  N  N   . TYR A 1  1394 ? 178.554 219.832 228.852 1.00 232.09 ?  1394 TYR A N   1 
ATOM   7277  C  CA  . TYR A 1  1394 ? 177.552 219.363 227.884 1.00 231.78 ?  1394 TYR A CA  1 
ATOM   7278  C  C   . TYR A 1  1394 ? 178.001 219.475 226.441 1.00 173.92 ?  1394 TYR A C   1 
ATOM   7279  O  O   . TYR A 1  1394 ? 177.697 218.616 225.623 1.00 160.26 ?  1394 TYR A O   1 
ATOM   7280  C  CB  . TYR A 1  1394 ? 176.218 220.102 228.057 1.00 318.54 ?  1394 TYR A CB  1 
ATOM   7281  C  CG  . TYR A 1  1394 ? 175.120 219.639 227.107 1.00 382.05 ?  1394 TYR A CG  1 
ATOM   7282  C  CD1 . TYR A 1  1394 ? 174.348 218.500 227.392 1.00 402.84 ?  1394 TYR A CD1 1 
ATOM   7283  C  CD2 . TYR A 1  1394 ? 174.860 220.332 225.915 1.00 401.32 ?  1394 TYR A CD2 1 
ATOM   7284  C  CE1 . TYR A 1  1394 ? 173.348 218.070 226.522 1.00 416.64 ?  1394 TYR A CE1 1 
ATOM   7285  C  CE2 . TYR A 1  1394 ? 173.862 219.910 225.041 1.00 425.45 ?  1394 TYR A CE2 1 
ATOM   7286  C  CZ  . TYR A 1  1394 ? 173.107 218.779 225.351 1.00 428.84 ?  1394 TYR A CZ  1 
ATOM   7287  O  OH  . TYR A 1  1394 ? 172.119 218.360 224.486 1.00 420.57 ?  1394 TYR A OH  1 
ATOM   7288  N  N   . LEU A 1  1395 ? 178.684 220.552 226.110 1.00 150.11 ?  1395 LEU A N   1 
ATOM   7289  C  CA  . LEU A 1  1395 ? 179.053 220.745 224.719 1.00 202.12 ?  1395 LEU A CA  1 
ATOM   7290  C  C   . LEU A 1  1395 ? 180.205 219.836 224.251 1.00 210.72 ?  1395 LEU A C   1 
ATOM   7291  O  O   . LEU A 1  1395 ? 180.178 219.354 223.112 1.00 230.28 ?  1395 LEU A O   1 
ATOM   7292  C  CB  . LEU A 1  1395 ? 179.271 222.225 224.403 1.00 260.81 ?  1395 LEU A CB  1 
ATOM   7293  C  CG  . LEU A 1  1395 ? 178.020 223.124 224.509 1.00 309.50 ?  1395 LEU A CG  1 
ATOM   7294  C  CD1 . LEU A 1  1395 ? 178.393 224.602 224.566 1.00 327.69 ?  1395 LEU A CD1 1 
ATOM   7295  C  CD2 . LEU A 1  1395 ? 176.999 222.863 223.401 1.00 323.21 ?  1395 LEU A CD2 1 
ATOM   7296  N  N   . LEU A 1  1396 ? 181.172 219.576 225.142 1.00 199.98 ?  1396 LEU A N   1 
ATOM   7297  C  CA  . LEU A 1  1396 ? 182.289 218.613 224.913 1.00 187.68 ?  1396 LEU A CA  1 
ATOM   7298  C  C   . LEU A 1  1396 ? 181.896 217.164 224.555 1.00 183.23 ?  1396 LEU A C   1 
ATOM   7299  O  O   . LEU A 1  1396 ? 182.636 216.468 223.845 1.00 146.40 ?  1396 LEU A O   1 
ATOM   7300  C  CB  . LEU A 1  1396 ? 183.201 218.583 226.135 1.00 177.48 ?  1396 LEU A CB  1 
ATOM   7301  C  CG  . LEU A 1  1396 ? 184.579 219.218 226.034 1.00 178.67 ?  1396 LEU A CG  1 
ATOM   7302  C  CD1 . LEU A 1  1396 ? 184.950 220.004 227.296 1.00 191.66 ?  1396 LEU A CD1 1 
ATOM   7303  C  CD2 . LEU A 1  1396 ? 185.562 218.092 225.759 1.00 154.81 ?  1396 LEU A CD2 1 
ATOM   7304  N  N   . ASP A 1  1397 ? 180.747 216.734 225.084 1.00 199.73 ?  1397 ASP A N   1 
ATOM   7305  C  CA  . ASP A 1  1397 ? 180.067 215.495 224.706 1.00 212.07 ?  1397 ASP A CA  1 
ATOM   7306  C  C   . ASP A 1  1397 ? 179.856 215.359 223.198 1.00 205.31 ?  1397 ASP A C   1 
ATOM   7307  O  O   . ASP A 1  1397 ? 180.147 214.311 222.625 1.00 209.17 ?  1397 ASP A O   1 
ATOM   7308  C  CB  . ASP A 1  1397 ? 178.686 215.433 225.374 1.00 263.01 ?  1397 ASP A CB  1 
ATOM   7309  C  CG  . ASP A 1  1397 ? 178.748 215.179 226.870 1.00 287.34 ?  1397 ASP A CG  1 
ATOM   7310  O  OD1 . ASP A 1  1397 ? 179.833 215.319 227.479 1.00 286.73 ?  1397 ASP A OD1 1 
ATOM   7311  O  OD2 . ASP A 1  1397 ? 177.678 214.846 227.433 1.00 318.82 -1 1397 ASP A OD2 1 
ATOM   7312  N  N   . PHE A 1  1398 ? 179.332 216.414 222.574 1.00 198.76 ?  1398 PHE A N   1 
ATOM   7313  C  CA  . PHE A 1  1398 ? 179.006 216.397 221.152 1.00 223.35 ?  1398 PHE A CA  1 
ATOM   7314  C  C   . PHE A 1  1398 ? 180.214 216.231 220.239 1.00 243.40 ?  1398 PHE A C   1 
ATOM   7315  O  O   . PHE A 1  1398 ? 180.111 215.574 219.199 1.00 257.33 ?  1398 PHE A O   1 
ATOM   7316  C  CB  . PHE A 1  1398 ? 178.231 217.652 220.776 1.00 244.51 ?  1398 PHE A CB  1 
ATOM   7317  C  CG  . PHE A 1  1398 ? 176.783 217.564 221.099 1.00 282.04 ?  1398 PHE A CG  1 
ATOM   7318  C  CD1 . PHE A 1  1398 ? 176.332 217.794 222.400 1.00 307.12 ?  1398 PHE A CD1 1 
ATOM   7319  C  CD2 . PHE A 1  1398 ? 175.859 217.229 220.109 1.00 303.69 ?  1398 PHE A CD2 1 
ATOM   7320  C  CE1 . PHE A 1  1398 ? 174.981 217.696 222.706 1.00 351.81 ?  1398 PHE A CE1 1 
ATOM   7321  C  CE2 . PHE A 1  1398 ? 174.503 217.136 220.408 1.00 342.87 ?  1398 PHE A CE2 1 
ATOM   7322  C  CZ  . PHE A 1  1398 ? 174.062 217.369 221.710 1.00 357.33 ?  1398 PHE A CZ  1 
ATOM   7323  N  N   . VAL A 1  1399 ? 181.344 216.822 220.642 1.00 246.51 ?  1399 VAL A N   1 
ATOM   7324  C  CA  . VAL A 1  1399 ? 182.569 216.867 219.822 1.00 212.69 ?  1399 VAL A CA  1 
ATOM   7325  C  C   . VAL A 1  1399 ? 183.409 215.605 220.010 1.00 188.32 ?  1399 VAL A C   1 
ATOM   7326  O  O   . VAL A 1  1399 ? 183.822 215.284 221.133 1.00 184.34 ?  1399 VAL A O   1 
ATOM   7327  C  CB  . VAL A 1  1399 ? 183.425 218.148 220.076 1.00 202.19 ?  1399 VAL A CB  1 
ATOM   7328  C  CG1 . VAL A 1  1399 ? 184.692 218.138 219.237 1.00 176.04 ?  1399 VAL A CG1 1 
ATOM   7329  C  CG2 . VAL A 1  1399 ? 182.638 219.414 219.747 1.00 223.92 ?  1399 VAL A CG2 1 
ATOM   7330  N  N   . LYS A 1  1400 ? 183.625 214.899 218.896 1.00 166.17 ?  1400 LYS A N   1 
ATOM   7331  C  CA  . LYS A 1  1400 ? 184.569 213.793 218.805 1.00 166.58 ?  1400 LYS A CA  1 
ATOM   7332  C  C   . LYS A 1  1400 ? 185.937 214.314 219.195 1.00 180.02 ?  1400 LYS A C   1 
ATOM   7333  O  O   . LYS A 1  1400 ? 186.331 215.391 218.725 1.00 185.89 ?  1400 LYS A O   1 
ATOM   7334  C  CB  . LYS A 1  1400 ? 184.598 213.254 217.382 1.00 166.84 ?  1400 LYS A CB  1 
ATOM   7335  C  CG  . LYS A 1  1400 ? 185.192 211.866 217.224 1.00 170.21 ?  1400 LYS A CG  1 
ATOM   7336  C  CD  . LYS A 1  1400 ? 184.283 211.055 216.307 1.00 208.11 ?  1400 LYS A CD  1 
ATOM   7337  C  CE  . LYS A 1  1400 ? 185.005 209.891 215.649 1.00 231.62 ?  1400 LYS A CE  1 
ATOM   7338  N  NZ  . LYS A 1  1400 ? 184.047 208.970 214.968 1.00 233.28 ?  1400 LYS A NZ  1 
ATOM   7339  N  N   . PRO A 1  1401 ? 186.652 213.583 220.081 1.00 189.21 ?  1401 PRO A N   1 
ATOM   7340  C  CA  . PRO A 1  1401 ? 187.944 214.069 220.573 1.00 207.29 ?  1401 PRO A CA  1 
ATOM   7341  C  C   . PRO A 1  1401 ? 188.981 214.190 219.444 1.00 222.92 ?  1401 PRO A C   1 
ATOM   7342  O  O   . PRO A 1  1401 ? 189.831 215.087 219.483 1.00 240.60 ?  1401 PRO A O   1 
ATOM   7343  C  CB  . PRO A 1  1401 ? 188.346 213.013 221.615 1.00 190.42 ?  1401 PRO A CB  1 
ATOM   7344  C  CG  . PRO A 1  1401 ? 187.071 212.341 221.985 1.00 176.67 ?  1401 PRO A CG  1 
ATOM   7345  C  CD  . PRO A 1  1401 ? 186.325 212.284 220.688 1.00 179.58 ?  1401 PRO A CD  1 
ATOM   7346  N  N   . GLU A 1  1402 ? 188.878 213.311 218.445 1.00 205.04 ?  1402 GLU A N   1 
ATOM   7347  C  CA  . GLU A 1  1402 ? 189.645 213.424 217.208 1.00 181.35 ?  1402 GLU A CA  1 
ATOM   7348  C  C   . GLU A 1  1402 ? 189.500 214.819 216.541 1.00 194.24 ?  1402 GLU A C   1 
ATOM   7349  O  O   . GLU A 1  1402 ? 190.519 215.501 216.383 1.00 186.86 ?  1402 GLU A O   1 
ATOM   7350  C  CB  . GLU A 1  1402 ? 189.288 212.281 216.255 1.00 165.87 ?  1402 GLU A CB  1 
ATOM   7351  N  N   . PHE A 1  1403 ? 188.264 215.255 216.211 1.00 191.89 ?  1403 PHE A N   1 
ATOM   7352  C  CA  . PHE A 1  1403 ? 188.010 216.583 215.550 1.00 160.32 ?  1403 PHE A CA  1 
ATOM   7353  C  C   . PHE A 1  1403 ? 188.332 217.775 216.426 1.00 142.61 ?  1403 PHE A C   1 
ATOM   7354  O  O   . PHE A 1  1403 ? 188.466 218.887 215.920 1.00 133.47 ?  1403 PHE A O   1 
ATOM   7355  C  CB  . PHE A 1  1403 ? 186.576 216.771 215.002 1.00 144.46 ?  1403 PHE A CB  1 
ATOM   7356  C  CG  . PHE A 1  1403 ? 186.121 215.693 214.073 1.00 162.33 ?  1403 PHE A CG  1 
ATOM   7357  C  CD1 . PHE A 1  1403 ? 187.012 215.068 213.195 1.00 174.04 ?  1403 PHE A CD1 1 
ATOM   7358  C  CD2 . PHE A 1  1403 ? 184.781 215.297 214.068 1.00 191.20 ?  1403 PHE A CD2 1 
ATOM   7359  C  CE1 . PHE A 1  1403 ? 186.587 214.050 212.346 1.00 205.40 ?  1403 PHE A CE1 1 
ATOM   7360  C  CE2 . PHE A 1  1403 ? 184.341 214.287 213.210 1.00 220.98 ?  1403 PHE A CE2 1 
ATOM   7361  C  CZ  . PHE A 1  1403 ? 185.246 213.665 212.348 1.00 227.84 ?  1403 PHE A CZ  1 
ATOM   7362  N  N   . LEU A 1  1404 ? 188.440 217.549 217.730 1.00 145.59 ?  1404 LEU A N   1 
ATOM   7363  C  CA  . LEU A 1  1404 ? 188.908 218.594 218.625 1.00 182.16 ?  1404 LEU A CA  1 
ATOM   7364  C  C   . LEU A 1  1404 ? 190.356 218.980 218.338 1.00 190.28 ?  1404 LEU A C   1 
ATOM   7365  O  O   . LEU A 1  1404 ? 190.721 220.142 218.495 1.00 219.57 ?  1404 LEU A O   1 
ATOM   7366  C  CB  . LEU A 1  1404 ? 188.685 218.257 220.107 1.00 194.42 ?  1404 LEU A CB  1 
ATOM   7367  C  CG  . LEU A 1  1404 ? 187.651 219.148 220.827 1.00 188.89 ?  1404 LEU A CG  1 
ATOM   7368  C  CD1 . LEU A 1  1404 ? 187.380 218.668 222.245 1.00 179.64 ?  1404 LEU A CD1 1 
ATOM   7369  C  CD2 . LEU A 1  1404 ? 187.999 220.638 220.821 1.00 188.56 ?  1404 LEU A CD2 1 
ATOM   7370  N  N   . LEU A 1  1405 ? 191.155 218.014 217.882 1.00 171.92 ?  1405 LEU A N   1 
ATOM   7371  C  CA  . LEU A 1  1405 ? 192.492 218.296 217.364 1.00 164.66 ?  1405 LEU A CA  1 
ATOM   7372  C  C   . LEU A 1  1405 ? 192.475 219.190 216.102 1.00 174.25 ?  1405 LEU A C   1 
ATOM   7373  O  O   . LEU A 1  1405 ? 193.145 220.238 216.072 1.00 156.71 ?  1405 LEU A O   1 
ATOM   7374  C  CB  . LEU A 1  1405 ? 193.256 216.993 217.155 1.00 148.16 ?  1405 LEU A CB  1 
ATOM   7375  C  CG  . LEU A 1  1405 ? 194.402 216.727 216.179 1.00 164.07 ?  1405 LEU A CG  1 
ATOM   7376  C  CD1 . LEU A 1  1405 ? 195.174 217.929 215.655 1.00 164.32 ?  1405 LEU A CD1 1 
ATOM   7377  C  CD2 . LEU A 1  1405 ? 195.363 215.744 216.836 1.00 188.72 ?  1405 LEU A CD2 1 
ATOM   7378  N  N   . LEU A 1  1406 ? 191.719 218.772 215.080 1.00 173.41 ?  1406 LEU A N   1 
ATOM   7379  C  CA  . LEU A 1  1406 ? 191.487 219.587 213.870 1.00 159.82 ?  1406 LEU A CA  1 
ATOM   7380  C  C   . LEU A 1  1406 ? 191.056 220.987 214.213 1.00 146.38 ?  1406 LEU A C   1 
ATOM   7381  O  O   . LEU A 1  1406 ? 191.658 221.960 213.759 1.00 147.89 ?  1406 LEU A O   1 
ATOM   7382  C  CB  . LEU A 1  1406 ? 190.382 218.993 213.016 1.00 158.96 ?  1406 LEU A CB  1 
ATOM   7383  C  CG  . LEU A 1  1406 ? 190.763 218.047 211.901 1.00 202.74 ?  1406 LEU A CG  1 
ATOM   7384  C  CD1 . LEU A 1  1406 ? 189.463 217.445 211.423 1.00 221.89 ?  1406 LEU A CD1 1 
ATOM   7385  C  CD2 . LEU A 1  1406 ? 191.501 218.745 210.765 1.00 223.12 ?  1406 LEU A CD2 1 
ATOM   7386  N  N   . ARG A 1  1407 ? 190.006 221.043 215.029 1.00 133.13 ?  1407 ARG A N   1 
ATOM   7387  C  CA  . ARG A 1  1407 ? 189.412 222.249 215.545 1.00 128.67 ?  1407 ARG A CA  1 
ATOM   7388  C  C   . ARG A 1  1407 ? 190.471 223.185 216.131 1.00 133.53 ?  1407 ARG A C   1 
ATOM   7389  O  O   . ARG A 1  1407 ? 190.504 224.376 215.790 1.00 149.68 ?  1407 ARG A O   1 
ATOM   7390  C  CB  . ARG A 1  1407 ? 188.390 221.857 216.601 1.00 135.90 ?  1407 ARG A CB  1 
ATOM   7391  C  CG  . ARG A 1  1407 ? 187.241 222.821 216.743 1.00 164.09 ?  1407 ARG A CG  1 
ATOM   7392  C  CD  . ARG A 1  1407 ? 186.160 222.215 217.611 1.00 181.49 ?  1407 ARG A CD  1 
ATOM   7393  N  NE  . ARG A 1  1407 ? 185.184 221.468 216.822 1.00 208.37 ?  1407 ARG A NE  1 
ATOM   7394  C  CZ  . ARG A 1  1407 ? 183.879 221.733 216.783 1.00 246.20 ?  1407 ARG A CZ  1 
ATOM   7395  N  NH1 . ARG A 1  1407 ? 183.364 222.728 217.500 1.00 265.87 ?  1407 ARG A NH1 1 
ATOM   7396  N  NH2 . ARG A 1  1407 ? 183.075 220.992 216.030 1.00 260.68 ?  1407 ARG A NH2 1 
ATOM   7397  N  N   . THR A 1  1408 ? 191.347 222.642 216.982 1.00 135.57 ?  1408 THR A N   1 
ATOM   7398  C  CA  . THR A 1  1408 ? 192.395 223.443 217.645 1.00 143.30 ?  1408 THR A CA  1 
ATOM   7399  C  C   . THR A 1  1408 ? 193.406 223.989 216.652 1.00 139.99 ?  1408 THR A C   1 
ATOM   7400  O  O   . THR A 1  1408 ? 193.769 225.159 216.739 1.00 143.64 ?  1408 THR A O   1 
ATOM   7401  C  CB  . THR A 1  1408 ? 193.158 222.706 218.774 1.00 143.63 ?  1408 THR A CB  1 
ATOM   7402  O  OG1 . THR A 1  1408 ? 192.285 221.823 219.497 1.00 155.69 ?  1408 THR A OG1 1 
ATOM   7403  C  CG2 . THR A 1  1408 ? 193.770 223.728 219.743 1.00 117.09 ?  1408 THR A CG2 1 
ATOM   7404  N  N   . LEU A 1  1409 ? 193.828 223.150 215.708 1.00 124.92 ?  1409 LEU A N   1 
ATOM   7405  C  CA  . LEU A 1  1409 ? 194.738 223.592 214.654 1.00 144.14 ?  1409 LEU A CA  1 
ATOM   7406  C  C   . LEU A 1  1409 ? 194.103 224.712 213.813 1.00 145.55 ?  1409 LEU A C   1 
ATOM   7407  O  O   . LEU A 1  1409 ? 194.652 225.825 213.687 1.00 122.19 ?  1409 LEU A O   1 
ATOM   7408  C  CB  . LEU A 1  1409 ? 195.134 222.409 213.764 1.00 150.27 ?  1409 LEU A CB  1 
ATOM   7409  C  CG  . LEU A 1  1409 ? 196.311 222.291 212.761 1.00 152.13 ?  1409 LEU A CG  1 
ATOM   7410  C  CD1 . LEU A 1  1409 ? 195.714 221.672 211.507 1.00 170.59 ?  1409 LEU A CD1 1 
ATOM   7411  C  CD2 . LEU A 1  1409 ? 197.159 223.504 212.372 1.00 108.07 ?  1409 LEU A CD2 1 
ATOM   7412  N  N   . ALA A 1  1410 ? 192.931 224.421 213.263 1.00 158.76 ?  1410 ALA A N   1 
ATOM   7413  C  CA  . ALA A 1  1410 ? 192.264 225.345 212.360 1.00 179.23 ?  1410 ALA A CA  1 
ATOM   7414  C  C   . ALA A 1  1410 ? 192.216 226.720 212.996 1.00 168.90 ?  1410 ALA A C   1 
ATOM   7415  O  O   . ALA A 1  1410 ? 192.683 227.688 212.403 1.00 194.39 ?  1410 ALA A O   1 
ATOM   7416  C  CB  . ALA A 1  1410 ? 190.870 224.847 212.010 1.00 217.14 ?  1410 ALA A CB  1 
ATOM   7417  N  N   . ARG A 1  1411 ? 191.711 226.777 214.226 1.00 147.50 ?  1411 ARG A N   1 
ATOM   7418  C  CA  . ARG A 1  1411 ? 191.558 228.020 214.947 1.00 153.13 ?  1411 ARG A CA  1 
ATOM   7419  C  C   . ARG A 1  1411 ? 192.869 228.866 214.932 1.00 140.27 ?  1411 ARG A C   1 
ATOM   7420  O  O   . ARG A 1  1411 ? 192.852 230.077 214.598 1.00 113.48 ?  1411 ARG A O   1 
ATOM   7421  C  CB  . ARG A 1  1411 ? 191.033 227.727 216.366 1.00 153.84 ?  1411 ARG A CB  1 
ATOM   7422  C  CG  . ARG A 1  1411 ? 190.164 228.838 216.936 1.00 164.91 ?  1411 ARG A CG  1 
ATOM   7423  C  CD  . ARG A 1  1411 ? 190.101 228.807 218.453 1.00 174.60 ?  1411 ARG A CD  1 
ATOM   7424  N  NE  . ARG A 1  1411 ? 190.310 230.145 219.027 1.00 191.56 ?  1411 ARG A NE  1 
ATOM   7425  C  CZ  . ARG A 1  1411 ? 191.155 230.447 220.021 1.00 197.04 ?  1411 ARG A CZ  1 
ATOM   7426  N  NH1 . ARG A 1  1411 ? 191.888 229.510 220.619 1.00 198.87 ?  1411 ARG A NH1 1 
ATOM   7427  N  NH2 . ARG A 1  1411 ? 191.247 231.704 220.444 1.00 185.01 ?  1411 ARG A NH2 1 
ATOM   7428  N  N   . CYS A 1  1412 ? 194.003 228.225 215.232 1.00 126.87 ?  1412 CYS A N   1 
ATOM   7429  C  CA  . CYS A 1  1412 ? 195.232 228.991 215.455 1.00 145.08 ?  1412 CYS A CA  1 
ATOM   7430  C  C   . CYS A 1  1412 ? 195.769 229.471 214.141 1.00 144.55 ?  1412 CYS A C   1 
ATOM   7431  O  O   . CYS A 1  1412 ? 196.392 230.525 214.097 1.00 181.27 ?  1412 CYS A O   1 
ATOM   7432  C  CB  . CYS A 1  1412 ? 196.328 228.224 216.202 1.00 155.83 ?  1412 CYS A CB  1 
ATOM   7433  S  SG  . CYS A 1  1412 ? 195.823 227.228 217.613 1.00 231.67 ?  1412 CYS A SG  1 
ATOM   7434  N  N   . LEU A 1  1413 ? 195.522 228.714 213.072 1.00 131.62 ?  1413 LEU A N   1 
ATOM   7435  C  CA  . LEU A 1  1413 ? 195.939 229.148 211.741 1.00 138.26 ?  1413 LEU A CA  1 
ATOM   7436  C  C   . LEU A 1  1413 ? 195.202 230.418 211.336 1.00 157.78 ?  1413 LEU A C   1 
ATOM   7437  O  O   . LEU A 1  1413 ? 195.773 231.281 210.675 1.00 201.74 ?  1413 LEU A O   1 
ATOM   7438  C  CB  . LEU A 1  1413 ? 195.735 228.059 210.693 1.00 133.13 ?  1413 LEU A CB  1 
ATOM   7439  C  CG  . LEU A 1  1413 ? 196.549 226.769 210.750 1.00 134.80 ?  1413 LEU A CG  1 
ATOM   7440  C  CD1 . LEU A 1  1413 ? 196.495 226.095 209.389 1.00 150.33 ?  1413 LEU A CD1 1 
ATOM   7441  C  CD2 . LEU A 1  1413 ? 197.995 226.990 211.166 1.00 137.16 ?  1413 LEU A CD2 1 
ATOM   7442  N  N   . ILE A 1  1414 ? 193.948 230.526 211.776 1.00 140.03 ?  1414 ILE A N   1 
ATOM   7443  C  CA  . ILE A 1  1414 ? 193.118 231.704 211.586 1.00 122.73 ?  1414 ILE A CA  1 
ATOM   7444  C  C   . ILE A 1  1414 ? 193.616 232.890 212.442 1.00 152.37 ?  1414 ILE A C   1 
ATOM   7445  O  O   . ILE A 1  1414 ? 193.736 234.001 211.911 1.00 170.62 ?  1414 ILE A O   1 
ATOM   7446  C  CB  . ILE A 1  1414 ? 191.634 231.345 211.795 1.00 107.80 ?  1414 ILE A CB  1 
ATOM   7447  C  CG1 . ILE A 1  1414 ? 191.252 230.229 210.792 1.00 106.33 ?  1414 ILE A CG1 1 
ATOM   7448  C  CG2 . ILE A 1  1414 ? 190.760 232.579 211.644 1.00 129.18 ?  1414 ILE A CG2 1 
ATOM   7449  C  CD1 . ILE A 1  1414 ? 189.852 229.646 210.858 1.00 98.23  ?  1414 ILE A CD1 1 
ATOM   7450  N  N   . LEU A 1  1415 ? 193.938 232.661 213.727 1.00 167.07 ?  1415 LEU A N   1 
ATOM   7451  C  CA  . LEU A 1  1415 ? 194.626 233.685 214.567 1.00 175.70 ?  1415 LEU A CA  1 
ATOM   7452  C  C   . LEU A 1  1415 ? 196.155 233.615 214.455 1.00 172.10 ?  1415 LEU A C   1 
ATOM   7453  O  O   . LEU A 1  1415 ? 196.820 233.240 215.430 1.00 193.18 ?  1415 LEU A O   1 
ATOM   7454  C  CB  . LEU A 1  1415 ? 194.309 233.528 216.059 1.00 198.14 ?  1415 LEU A CB  1 
ATOM   7455  C  CG  . LEU A 1  1415 ? 193.149 232.852 216.773 1.00 224.49 ?  1415 LEU A CG  1 
ATOM   7456  C  CD1 . LEU A 1  1415 ? 193.659 232.440 218.146 1.00 235.28 ?  1415 LEU A CD1 1 
ATOM   7457  C  CD2 . LEU A 1  1415 ? 191.978 233.808 216.906 1.00 256.88 ?  1415 LEU A CD2 1 
ATOM   7458  N  N   . TRP A 1  1416 ? 196.720 233.959 213.297 1.00 164.01 ?  1416 TRP A N   1 
ATOM   7459  C  CA  . TRP A 1  1416 ? 198.150 233.693 213.028 1.00 178.00 ?  1416 TRP A CA  1 
ATOM   7460  C  C   . TRP A 1  1416 ? 199.033 234.429 214.014 1.00 187.86 ?  1416 TRP A C   1 
ATOM   7461  O  O   . TRP A 1  1416 ? 199.976 233.866 214.602 1.00 168.16 ?  1416 TRP A O   1 
ATOM   7462  C  CB  . TRP A 1  1416 ? 198.536 234.116 211.606 1.00 184.04 ?  1416 TRP A CB  1 
ATOM   7463  C  CG  . TRP A 1  1416 ? 199.828 233.483 211.071 1.00 180.74 ?  1416 TRP A CG  1 
ATOM   7464  C  CD1 . TRP A 1  1416 ? 201.040 234.107 210.823 1.00 168.72 ?  1416 TRP A CD1 1 
ATOM   7465  C  CD2 . TRP A 1  1416 ? 200.007 232.120 210.707 1.00 167.87 ?  1416 TRP A CD2 1 
ATOM   7466  N  NE1 . TRP A 1  1416 ? 201.948 233.207 210.335 1.00 131.95 ?  1416 TRP A NE1 1 
ATOM   7467  C  CE2 . TRP A 1  1416 ? 201.342 231.979 210.253 1.00 154.67 ?  1416 TRP A CE2 1 
ATOM   7468  C  CE3 . TRP A 1  1416 ? 199.167 230.992 210.720 1.00 163.93 ?  1416 TRP A CE3 1 
ATOM   7469  C  CZ2 . TRP A 1  1416 ? 201.849 230.755 209.815 1.00 157.94 ?  1416 TRP A CZ2 1 
ATOM   7470  C  CZ3 . TRP A 1  1416 ? 199.674 229.782 210.284 1.00 164.64 ?  1416 TRP A CZ3 1 
ATOM   7471  C  CH2 . TRP A 1  1416 ? 201.003 229.669 209.845 1.00 158.24 ?  1416 TRP A CH2 1 
ATOM   7472  N  N   . ASP A 1  1417 ? 198.687 235.697 214.188 1.00 199.49 ?  1417 ASP A N   1 
ATOM   7473  C  CA  . ASP A 1  1417 ? 199.465 236.640 214.952 1.00 216.26 ?  1417 ASP A CA  1 
ATOM   7474  C  C   . ASP A 1  1417 ? 199.509 236.188 216.400 1.00 215.94 ?  1417 ASP A C   1 
ATOM   7475  O  O   . ASP A 1  1417 ? 200.571 236.203 217.030 1.00 175.25 ?  1417 ASP A O   1 
ATOM   7476  C  CB  . ASP A 1  1417 ? 198.853 238.042 214.814 1.00 239.56 ?  1417 ASP A CB  1 
ATOM   7477  C  CG  . ASP A 1  1417 ? 198.372 238.351 213.385 1.00 244.24 ?  1417 ASP A CG  1 
ATOM   7478  O  OD1 . ASP A 1  1417 ? 198.784 237.671 212.418 1.00 230.87 ?  1417 ASP A OD1 1 
ATOM   7479  O  OD2 . ASP A 1  1417 ? 197.557 239.283 213.231 1.00 278.61 -1 1417 ASP A OD2 1 
ATOM   7480  N  N   . ASP A 1  1418 ? 198.353 235.731 216.885 1.00 240.49 ?  1418 ASP A N   1 
ATOM   7481  C  CA  . ASP A 1  1418 ? 198.163 235.317 218.271 1.00 251.16 ?  1418 ASP A CA  1 
ATOM   7482  C  C   . ASP A 1  1418 ? 199.140 234.236 218.770 1.00 247.08 ?  1418 ASP A C   1 
ATOM   7483  O  O   . ASP A 1  1418 ? 199.382 234.165 219.977 1.00 283.42 ?  1418 ASP A O   1 
ATOM   7484  C  CB  . ASP A 1  1418 ? 196.698 234.906 218.516 1.00 232.06 ?  1418 ASP A CB  1 
ATOM   7485  N  N   . ILE A 1  1419 ? 199.708 233.423 217.870 1.00 202.78 ?  1419 ILE A N   1 
ATOM   7486  C  CA  . ILE A 1  1419 ? 200.506 232.248 218.285 1.00 180.39 ?  1419 ILE A CA  1 
ATOM   7487  C  C   . ILE A 1  1419 ? 201.820 232.658 218.940 1.00 160.62 ?  1419 ILE A C   1 
ATOM   7488  O  O   . ILE A 1  1419 ? 202.528 233.494 218.414 1.00 146.60 ?  1419 ILE A O   1 
ATOM   7489  C  CB  . ILE A 1  1419 ? 200.738 231.218 217.144 1.00 172.72 ?  1419 ILE A CB  1 
ATOM   7490  C  CG1 . ILE A 1  1419 ? 199.393 230.735 216.549 1.00 194.32 ?  1419 ILE A CG1 1 
ATOM   7491  C  CG2 . ILE A 1  1419 ? 201.503 230.005 217.673 1.00 140.79 ?  1419 ILE A CG2 1 
ATOM   7492  C  CD1 . ILE A 1  1419 ? 199.450 230.289 215.097 1.00 183.90 ?  1419 ILE A CD1 1 
ATOM   7493  N  N   . LEU A 1  1420 ? 202.090 232.086 220.115 1.00 175.71 ?  1420 LEU A N   1 
ATOM   7494  C  CA  . LEU A 1  1420 ? 203.338 232.287 220.842 1.00 182.45 ?  1420 LEU A CA  1 
ATOM   7495  C  C   . LEU A 1  1420 ? 203.977 230.951 221.199 1.00 197.17 ?  1420 LEU A C   1 
ATOM   7496  O  O   . LEU A 1  1420 ? 203.304 230.054 221.739 1.00 165.89 ?  1420 LEU A O   1 
ATOM   7497  C  CB  . LEU A 1  1420 ? 203.104 233.059 222.130 1.00 200.34 ?  1420 LEU A CB  1 
ATOM   7498  C  CG  . LEU A 1  1420 ? 203.166 234.581 222.133 1.00 231.66 ?  1420 LEU A CG  1 
ATOM   7499  C  CD1 . LEU A 1  1420 ? 201.850 235.229 221.721 1.00 222.37 ?  1420 LEU A CD1 1 
ATOM   7500  C  CD2 . LEU A 1  1420 ? 203.555 235.026 223.533 1.00 276.17 ?  1420 LEU A CD2 1 
ATOM   7501  N  N   . PRO A 1  1421 ? 205.294 230.820 220.920 1.00 206.59 ?  1421 PRO A N   1 
ATOM   7502  C  CA  . PRO A 1  1421 ? 206.108 229.628 221.215 1.00 199.23 ?  1421 PRO A CA  1 
ATOM   7503  C  C   . PRO A 1  1421 ? 206.235 229.258 222.702 1.00 200.82 ?  1421 PRO A C   1 
ATOM   7504  O  O   . PRO A 1  1421 ? 206.633 228.128 223.002 1.00 167.15 ?  1421 PRO A O   1 
ATOM   7505  C  CB  . PRO A 1  1421 ? 207.480 229.999 220.653 1.00 176.37 ?  1421 PRO A CB  1 
ATOM   7506  C  CG  . PRO A 1  1421 ? 207.195 230.973 219.583 1.00 186.08 ?  1421 PRO A CG  1 
ATOM   7507  C  CD  . PRO A 1  1421 ? 206.064 231.800 220.129 1.00 201.25 ?  1421 PRO A CD  1 
ATOM   7508  N  N   . ASN A 1  1422 ? 205.922 230.201 223.605 1.00 218.32 ?  1422 ASN A N   1 
ATOM   7509  C  CA  . ASN A 1  1422 ? 205.872 229.962 225.058 1.00 199.65 ?  1422 ASN A CA  1 
ATOM   7510  C  C   . ASN A 1  1422 ? 204.980 228.763 225.354 1.00 207.52 ?  1422 ASN A C   1 
ATOM   7511  O  O   . ASN A 1  1422 ? 203.930 228.625 224.723 1.00 181.11 ?  1422 ASN A O   1 
ATOM   7512  C  CB  . ASN A 1  1422 ? 205.357 231.206 225.803 1.00 163.57 ?  1422 ASN A CB  1 
ATOM   7513  N  N   . SER A 1  1423 ? 205.417 227.899 226.280 1.00 222.68 ?  1423 SER A N   1 
ATOM   7514  C  CA  . SER A 1  1423 ? 204.664 226.700 226.704 1.00 210.51 ?  1423 SER A CA  1 
ATOM   7515  C  C   . SER A 1  1423 ? 203.298 227.084 227.222 1.00 199.96 ?  1423 SER A C   1 
ATOM   7516  O  O   . SER A 1  1423 ? 202.327 226.410 226.919 1.00 170.42 ?  1423 SER A O   1 
ATOM   7517  C  CB  . SER A 1  1423 ? 205.396 225.930 227.805 1.00 237.24 ?  1423 SER A CB  1 
ATOM   7518  O  OG  . SER A 1  1423 ? 206.751 225.695 227.474 1.00 318.74 ?  1423 SER A OG  1 
ATOM   7519  N  N   . LYS A 1  1424 ? 203.259 228.180 227.985 1.00 229.27 ?  1424 LYS A N   1 
ATOM   7520  C  CA  . LYS A 1  1424 ? 202.051 228.814 228.530 1.00 260.15 ?  1424 LYS A CA  1 
ATOM   7521  C  C   . LYS A 1  1424 ? 200.884 228.979 227.525 1.00 270.67 ?  1424 LYS A C   1 
ATOM   7522  O  O   . LYS A 1  1424 ? 199.737 228.626 227.844 1.00 281.77 ?  1424 LYS A O   1 
ATOM   7523  C  CB  . LYS A 1  1424 ? 202.438 230.160 229.182 1.00 264.04 ?  1424 LYS A CB  1 
ATOM   7524  C  CG  . LYS A 1  1424 ? 201.306 230.935 229.845 1.00 269.22 ?  1424 LYS A CG  1 
ATOM   7525  C  CD  . LYS A 1  1424 ? 200.829 230.263 231.122 1.00 284.15 ?  1424 LYS A CD  1 
ATOM   7526  C  CE  . LYS A 1  1424 ? 199.330 229.997 231.074 1.00 307.05 ?  1424 LYS A CE  1 
ATOM   7527  N  NZ  . LYS A 1  1424 ? 198.498 231.234 231.069 1.00 325.90 ?  1424 LYS A NZ  1 
ATOM   7528  N  N   . TRP A 1  1425 ? 201.194 229.504 226.332 1.00 243.75 ?  1425 TRP A N   1 
ATOM   7529  C  CA  . TRP A 1  1425 ? 200.228 229.676 225.231 1.00 207.19 ?  1425 TRP A CA  1 
ATOM   7530  C  C   . TRP A 1  1425 ? 199.497 228.374 224.854 1.00 195.19 ?  1425 TRP A C   1 
ATOM   7531  O  O   . TRP A 1  1425 ? 198.281 228.376 224.621 1.00 155.47 ?  1425 TRP A O   1 
ATOM   7532  C  CB  . TRP A 1  1425 ? 200.932 230.248 223.991 1.00 171.45 ?  1425 TRP A CB  1 
ATOM   7533  C  CG  . TRP A 1  1425 ? 199.992 230.537 222.863 1.00 151.60 ?  1425 TRP A CG  1 
ATOM   7534  C  CD1 . TRP A 1  1425 ? 199.410 231.724 222.603 1.00 142.64 ?  1425 TRP A CD1 1 
ATOM   7535  C  CD2 . TRP A 1  1425 ? 199.503 229.616 221.856 1.00 164.63 ?  1425 TRP A CD2 1 
ATOM   7536  N  NE1 . TRP A 1  1425 ? 198.592 231.626 221.497 1.00 173.06 ?  1425 TRP A NE1 1 
ATOM   7537  C  CE2 . TRP A 1  1425 ? 198.628 230.344 221.018 1.00 164.19 ?  1425 TRP A CE2 1 
ATOM   7538  C  CE3 . TRP A 1  1425 ? 199.724 228.252 221.582 1.00 173.19 ?  1425 TRP A CE3 1 
ATOM   7539  C  CZ2 . TRP A 1  1425 ? 197.966 229.762 219.916 1.00 152.02 ?  1425 TRP A CZ2 1 
ATOM   7540  C  CZ3 . TRP A 1  1425 ? 199.074 227.672 220.491 1.00 165.55 ?  1425 TRP A CZ3 1 
ATOM   7541  C  CH2 . TRP A 1  1425 ? 198.207 228.434 219.670 1.00 164.27 ?  1425 TRP A CH2 1 
ATOM   7542  N  N   . VAL A 1  1426 ? 200.260 227.284 224.762 1.00 183.07 ?  1426 VAL A N   1 
ATOM   7543  C  CA  . VAL A 1  1426 ? 199.729 225.977 224.394 1.00 198.34 ?  1426 VAL A CA  1 
ATOM   7544  C  C   . VAL A 1  1426 ? 198.786 225.481 225.505 1.00 237.99 ?  1426 VAL A C   1 
ATOM   7545  O  O   . VAL A 1  1426 ? 197.685 224.994 225.219 1.00 265.10 ?  1426 VAL A O   1 
ATOM   7546  C  CB  . VAL A 1  1426 ? 200.847 224.941 224.089 1.00 180.18 ?  1426 VAL A CB  1 
ATOM   7547  C  CG1 . VAL A 1  1426 ? 200.360 223.918 223.080 1.00 197.68 ?  1426 VAL A CG1 1 
ATOM   7548  C  CG2 . VAL A 1  1426 ? 202.087 225.595 223.521 1.00 175.16 ?  1426 VAL A CG2 1 
ATOM   7549  N  N   . ASP A 1  1427 ? 199.216 225.653 226.760 1.00 259.00 ?  1427 ASP A N   1 
ATOM   7550  C  CA  . ASP A 1  1427 ? 198.428 225.303 227.949 1.00 260.66 ?  1427 ASP A CA  1 
ATOM   7551  C  C   . ASP A 1  1427 ? 197.119 226.077 227.991 1.00 269.86 ?  1427 ASP A C   1 
ATOM   7552  O  O   . ASP A 1  1427 ? 196.093 225.527 228.380 1.00 297.43 ?  1427 ASP A O   1 
ATOM   7553  C  CB  . ASP A 1  1427 ? 199.213 225.584 229.240 1.00 295.45 ?  1427 ASP A CB  1 
ATOM   7554  C  CG  . ASP A 1  1427 ? 200.670 225.132 229.170 1.00 353.02 ?  1427 ASP A CG  1 
ATOM   7555  O  OD1 . ASP A 1  1427 ? 200.966 224.115 228.504 1.00 391.38 ?  1427 ASP A OD1 1 
ATOM   7556  O  OD2 . ASP A 1  1427 ? 201.526 225.798 229.792 1.00 379.84 -1 1427 ASP A OD2 1 
ATOM   7557  N  N   . SER A 1  1428 ? 197.170 227.344 227.568 1.00 253.13 ?  1428 SER A N   1 
ATOM   7558  C  CA  . SER A 1  1428 ? 196.019 228.257 227.592 1.00 232.98 ?  1428 SER A CA  1 
ATOM   7559  C  C   . SER A 1  1428 ? 194.812 227.810 226.750 1.00 234.98 ?  1428 SER A C   1 
ATOM   7560  O  O   . SER A 1  1428 ? 193.668 228.128 227.095 1.00 262.60 ?  1428 SER A O   1 
ATOM   7561  C  CB  . SER A 1  1428 ? 196.448 229.653 227.150 1.00 194.75 ?  1428 SER A CB  1 
ATOM   7562  O  OG  . SER A 1  1428 ? 196.387 229.764 225.741 1.00 168.30 ?  1428 SER A OG  1 
ATOM   7563  N  N   . ASN A 1  1429 ? 195.074 227.087 225.660 1.00 207.86 ?  1429 ASN A N   1 
ATOM   7564  C  CA  . ASN A 1  1429 ? 194.038 226.718 224.696 1.00 201.19 ?  1429 ASN A CA  1 
ATOM   7565  C  C   . ASN A 1  1429 ? 192.977 225.757 225.178 1.00 214.04 ?  1429 ASN A C   1 
ATOM   7566  O  O   . ASN A 1  1429 ? 191.828 225.827 224.711 1.00 192.74 ?  1429 ASN A O   1 
ATOM   7567  C  CB  . ASN A 1  1429 ? 194.670 226.204 223.427 1.00 214.68 ?  1429 ASN A CB  1 
ATOM   7568  C  CG  . ASN A 1  1429 ? 195.335 227.307 222.654 1.00 249.31 ?  1429 ASN A CG  1 
ATOM   7569  O  OD1 . ASN A 1  1429 ? 194.712 228.334 222.356 1.00 277.83 ?  1429 ASN A OD1 1 
ATOM   7570  N  ND2 . ASN A 1  1429 ? 196.612 227.123 222.341 1.00 234.03 ?  1429 ASN A ND2 1 
ATOM   7571  N  N   . VAL A 1  1430 ? 193.378 224.876 226.102 1.00 236.55 ?  1430 VAL A N   1 
ATOM   7572  C  CA  . VAL A 1  1430 ? 192.482 223.915 226.778 1.00 249.78 ?  1430 VAL A CA  1 
ATOM   7573  C  C   . VAL A 1  1430 ? 191.503 224.604 227.780 1.00 226.05 ?  1430 VAL A C   1 
ATOM   7574  O  O   . VAL A 1  1430 ? 191.942 225.439 228.592 1.00 207.21 ?  1430 VAL A O   1 
ATOM   7575  C  CB  . VAL A 1  1430 ? 193.282 222.699 227.370 1.00 239.72 ?  1430 VAL A CB  1 
ATOM   7576  C  CG1 . VAL A 1  1430 ? 194.084 223.069 228.613 1.00 252.65 ?  1430 VAL A CG1 1 
ATOM   7577  C  CG2 . VAL A 1  1430 ? 192.373 221.511 227.654 1.00 221.44 ?  1430 VAL A CG2 1 
ATOM   7578  N  N   . PRO A 1  1431 ? 190.177 224.294 227.682 1.00 194.89 ?  1431 PRO A N   1 
ATOM   7579  C  CA  . PRO A 1  1431 ? 189.155 224.888 228.557 1.00 211.93 ?  1431 PRO A CA  1 
ATOM   7580  C  C   . PRO A 1  1431 ? 189.327 224.632 230.049 1.00 236.50 ?  1431 PRO A C   1 
ATOM   7581  O  O   . PRO A 1  1431 ? 190.027 223.690 230.436 1.00 217.15 ?  1431 PRO A O   1 
ATOM   7582  C  CB  . PRO A 1  1431 ? 187.837 224.247 228.089 1.00 197.06 ?  1431 PRO A CB  1 
ATOM   7583  C  CG  . PRO A 1  1431 ? 188.166 223.323 226.990 1.00 165.76 ?  1431 PRO A CG  1 
ATOM   7584  C  CD  . PRO A 1  1431 ? 189.552 223.622 226.528 1.00 187.92 ?  1431 PRO A CD  1 
ATOM   7585  N  N   . GLN A 1  1432 ? 188.661 225.482 230.845 1.00 253.04 ?  1432 GLN A N   1 
ATOM   7586  C  CA  . GLN A 1  1432 ? 188.617 225.449 232.316 1.00 236.26 ?  1432 GLN A CA  1 
ATOM   7587  C  C   . GLN A 1  1432 ? 188.281 224.074 232.842 1.00 236.04 ?  1432 GLN A C   1 
ATOM   7588  O  O   . GLN A 1  1432 ? 189.047 223.493 233.610 1.00 264.08 ?  1432 GLN A O   1 
ATOM   7589  C  CB  . GLN A 1  1432 ? 187.569 226.442 232.846 1.00 236.02 ?  1432 GLN A CB  1 
ATOM   7590  C  CG  . GLN A 1  1432 ? 187.900 227.916 232.642 1.00 244.89 ?  1432 GLN A CG  1 
ATOM   7591  C  CD  . GLN A 1  1432 ? 189.241 228.325 233.232 1.00 236.91 ?  1432 GLN A CD  1 
ATOM   7592  O  OE1 . GLN A 1  1432 ? 190.082 228.889 232.534 1.00 211.16 ?  1432 GLN A OE1 1 
ATOM   7593  N  NE2 . GLN A 1  1432 ? 189.449 228.036 234.518 1.00 255.68 ?  1432 GLN A NE2 1 
ATOM   7594  N  N   . ILE A 1  1433 ? 187.136 223.569 232.385 1.00 220.05 ?  1433 ILE A N   1 
ATOM   7595  C  CA  . ILE A 1  1433 ? 186.603 222.230 232.679 1.00 220.67 ?  1433 ILE A CA  1 
ATOM   7596  C  C   . ILE A 1  1433 ? 187.681 221.151 232.664 1.00 234.13 ?  1433 ILE A C   1 
ATOM   7597  O  O   . ILE A 1  1433 ? 187.602 220.183 233.424 1.00 243.14 ?  1433 ILE A O   1 
ATOM   7598  C  CB  . ILE A 1  1433 ? 185.504 221.797 231.659 1.00 204.46 ?  1433 ILE A CB  1 
ATOM   7599  C  CG1 . ILE A 1  1433 ? 185.031 222.955 230.729 1.00 214.14 ?  1433 ILE A CG1 1 
ATOM   7600  C  CG2 . ILE A 1  1433 ? 184.380 221.048 232.367 1.00 174.54 ?  1433 ILE A CG2 1 
ATOM   7601  C  CD1 . ILE A 1  1433 ? 184.720 224.299 231.386 1.00 209.32 ?  1433 ILE A CD1 1 
ATOM   7602  N  N   . ILE A 1  1434 ? 188.685 221.352 231.803 1.00 225.97 ?  1434 ILE A N   1 
ATOM   7603  C  CA  . ILE A 1  1434 ? 189.753 220.385 231.542 1.00 211.51 ?  1434 ILE A CA  1 
ATOM   7604  C  C   . ILE A 1  1434 ? 191.087 220.774 232.195 1.00 219.58 ?  1434 ILE A C   1 
ATOM   7605  O  O   . ILE A 1  1434 ? 191.822 219.902 232.681 1.00 214.63 ?  1434 ILE A O   1 
ATOM   7606  C  CB  . ILE A 1  1434 ? 189.931 220.136 230.031 1.00 185.00 ?  1434 ILE A CB  1 
ATOM   7607  C  CG1 . ILE A 1  1434 ? 188.567 220.176 229.323 1.00 184.69 ?  1434 ILE A CG1 1 
ATOM   7608  C  CG2 . ILE A 1  1434 ? 190.628 218.796 229.805 1.00 182.48 ?  1434 ILE A CG2 1 
ATOM   7609  C  CD1 . ILE A 1  1434 ? 188.634 220.141 227.815 1.00 206.41 ?  1434 ILE A CD1 1 
ATOM   7610  N  N   . ARG A 1  1435 ? 191.394 222.074 232.198 1.00 219.12 ?  1435 ARG A N   1 
ATOM   7611  C  CA  . ARG A 1  1435 ? 192.497 222.607 233.002 1.00 204.76 ?  1435 ARG A CA  1 
ATOM   7612  C  C   . ARG A 1  1435 ? 192.293 222.198 234.475 1.00 202.86 ?  1435 ARG A C   1 
ATOM   7613  O  O   . ARG A 1  1435 ? 193.219 221.693 235.108 1.00 186.48 ?  1435 ARG A O   1 
ATOM   7614  C  CB  . ARG A 1  1435 ? 192.628 224.133 232.830 1.00 183.80 ?  1435 ARG A CB  1 
ATOM   7615  N  N   . GLU A 1  1436 ? 191.063 222.360 234.978 1.00 218.05 ?  1436 GLU A N   1 
ATOM   7616  C  CA  . GLU A 1  1436 ? 190.698 222.027 236.363 1.00 225.84 ?  1436 GLU A CA  1 
ATOM   7617  C  C   . GLU A 1  1436 ? 190.772 220.531 236.686 1.00 232.06 ?  1436 GLU A C   1 
ATOM   7618  O  O   . GLU A 1  1436 ? 191.393 220.150 237.683 1.00 251.63 ?  1436 GLU A O   1 
ATOM   7619  C  CB  . GLU A 1  1436 ? 189.319 222.596 236.721 1.00 216.38 ?  1436 GLU A CB  1 
ATOM   7620  N  N   . ASN A 1  1437 ? 190.155 219.693 235.850 1.00 215.44 ?  1437 ASN A N   1 
ATOM   7621  C  CA  . ASN A 1  1437 ? 190.213 218.238 236.027 1.00 229.47 ?  1437 ASN A CA  1 
ATOM   7622  C  C   . ASN A 1  1437 ? 191.152 217.550 235.027 1.00 238.58 ?  1437 ASN A C   1 
ATOM   7623  O  O   . ASN A 1  1437 ? 192.260 217.118 235.374 1.00 241.08 ?  1437 ASN A O   1 
ATOM   7624  C  CB  . ASN A 1  1437 ? 188.808 217.628 235.966 1.00 212.86 ?  1437 ASN A CB  1 
ATOM   7625  N  N   . LEU A 1  1452 ? 183.349 215.175 234.956 1.00 287.49 ?  1452 LEU A N   1 
ATOM   7626  C  CA  . LEU A 1  1452 ? 182.570 214.031 235.432 1.00 295.16 ?  1452 LEU A CA  1 
ATOM   7627  C  C   . LEU A 1  1452 ? 182.873 212.746 234.643 1.00 278.38 ?  1452 LEU A C   1 
ATOM   7628  O  O   . LEU A 1  1452 ? 182.977 211.655 235.225 1.00 287.88 ?  1452 LEU A O   1 
ATOM   7629  C  CB  . LEU A 1  1452 ? 181.070 214.355 235.407 1.00 304.71 ?  1452 LEU A CB  1 
ATOM   7630  N  N   . ASN A 1  1453 ? 183.003 212.883 233.323 1.00 229.20 ?  1453 ASN A N   1 
ATOM   7631  C  CA  . ASN A 1  1453 ? 183.456 211.794 232.473 1.00 198.77 ?  1453 ASN A CA  1 
ATOM   7632  C  C   . ASN A 1  1453 ? 184.889 212.017 232.084 1.00 180.65 ?  1453 ASN A C   1 
ATOM   7633  O  O   . ASN A 1  1453 ? 185.189 212.833 231.210 1.00 181.64 ?  1453 ASN A O   1 
ATOM   7634  C  CB  . ASN A 1  1453 ? 182.567 211.629 231.237 1.00 199.24 ?  1453 ASN A CB  1 
ATOM   7635  C  CG  . ASN A 1  1453 ? 181.750 210.348 231.267 1.00 220.63 ?  1453 ASN A CG  1 
ATOM   7636  O  OD1 . ASN A 1  1453 ? 181.622 209.692 232.306 1.00 251.00 ?  1453 ASN A OD1 1 
ATOM   7637  N  ND2 . ASN A 1  1453 ? 181.198 209.980 230.115 1.00 177.98 ?  1453 ASN A ND2 1 
ATOM   7638  N  N   . LEU A 1  1454 ? 185.772 211.294 232.764 1.00 182.82 ?  1454 LEU A N   1 
ATOM   7639  C  CA  . LEU A 1  1454 ? 187.207 211.437 232.560 1.00 199.59 ?  1454 LEU A CA  1 
ATOM   7640  C  C   . LEU A 1  1454 ? 187.638 210.974 231.181 1.00 180.86 ?  1454 LEU A C   1 
ATOM   7641  O  O   . LEU A 1  1454 ? 188.518 211.569 230.602 1.00 160.82 ?  1454 LEU A O   1 
ATOM   7642  C  CB  . LEU A 1  1454 ? 188.016 210.737 233.667 1.00 239.95 ?  1454 LEU A CB  1 
ATOM   7643  C  CG  . LEU A 1  1454 ? 188.667 211.521 234.832 1.00 246.74 ?  1454 LEU A CG  1 
ATOM   7644  C  CD1 . LEU A 1  1454 ? 189.944 212.244 234.403 1.00 248.91 ?  1454 LEU A CD1 1 
ATOM   7645  C  CD2 . LEU A 1  1454 ? 187.713 212.476 235.550 1.00 239.22 ?  1454 LEU A CD2 1 
ATOM   7646  N  N   . GLU A 1  1455 ? 186.997 209.935 230.658 1.00 190.11 ?  1455 GLU A N   1 
ATOM   7647  C  CA  . GLU A 1  1455 ? 187.207 209.492 229.270 1.00 216.05 ?  1455 GLU A CA  1 
ATOM   7648  C  C   . GLU A 1  1455 ? 187.041 210.631 228.240 1.00 196.53 ?  1455 GLU A C   1 
ATOM   7649  O  O   . GLU A 1  1455 ? 187.957 210.910 227.456 1.00 184.77 ?  1455 GLU A O   1 
ATOM   7650  C  CB  . GLU A 1  1455 ? 186.306 208.284 228.940 1.00 263.42 ?  1455 GLU A CB  1 
ATOM   7651  C  CG  . GLU A 1  1455 ? 184.854 208.403 229.403 1.00 299.80 ?  1455 GLU A CG  1 
ATOM   7652  C  CD  . GLU A 1  1455 ? 184.200 207.068 229.727 1.00 314.16 ?  1455 GLU A CD  1 
ATOM   7653  O  OE1 . GLU A 1  1455 ? 183.897 206.294 228.791 1.00 307.70 ?  1455 GLU A OE1 1 
ATOM   7654  O  OE2 . GLU A 1  1455 ? 183.967 206.802 230.928 1.00 323.33 -1 1455 GLU A OE2 1 
ATOM   7655  N  N   . THR A 1  1456 ? 185.883 211.290 228.283 1.00 203.28 ?  1456 THR A N   1 
ATOM   7656  C  CA  . THR A 1  1456 ? 185.575 212.467 227.472 1.00 202.75 ?  1456 THR A CA  1 
ATOM   7657  C  C   . THR A 1  1456 ? 186.609 213.555 227.713 1.00 195.58 ?  1456 THR A C   1 
ATOM   7658  O  O   . THR A 1  1456 ? 187.157 214.107 226.770 1.00 211.47 ?  1456 THR A O   1 
ATOM   7659  C  CB  . THR A 1  1456 ? 184.176 213.047 227.819 1.00 214.48 ?  1456 THR A CB  1 
ATOM   7660  O  OG1 . THR A 1  1456 ? 183.204 211.993 227.893 1.00 203.53 ?  1456 THR A OG1 1 
ATOM   7661  C  CG2 . THR A 1  1456 ? 183.725 214.103 226.792 1.00 212.79 ?  1456 THR A CG2 1 
ATOM   7662  N  N   . LEU A 1  1457 ? 186.874 213.831 228.987 1.00 195.55 ?  1457 LEU A N   1 
ATOM   7663  C  CA  . LEU A 1  1457 ? 187.717 214.939 229.402 1.00 202.19 ?  1457 LEU A CA  1 
ATOM   7664  C  C   . LEU A 1  1457 ? 189.199 214.649 229.153 1.00 198.18 ?  1457 LEU A C   1 
ATOM   7665  O  O   . LEU A 1  1457 ? 189.927 215.504 228.637 1.00 180.54 ?  1457 LEU A O   1 
ATOM   7666  C  CB  . LEU A 1  1457 ? 187.451 215.244 230.876 1.00 226.21 ?  1457 LEU A CB  1 
ATOM   7667  C  CG  . LEU A 1  1457 ? 187.160 216.677 231.337 1.00 269.00 ?  1457 LEU A CG  1 
ATOM   7668  C  CD1 . LEU A 1  1457 ? 185.992 217.327 230.594 1.00 280.81 ?  1457 LEU A CD1 1 
ATOM   7669  C  CD2 . LEU A 1  1457 ? 186.900 216.667 232.839 1.00 297.45 ?  1457 LEU A CD2 1 
ATOM   7670  N  N   . SER A 1  1458 ? 189.623 213.432 229.492 1.00 196.01 ?  1458 SER A N   1 
ATOM   7671  C  CA  . SER A 1  1458 ? 191.012 212.996 229.345 1.00 208.97 ?  1458 SER A CA  1 
ATOM   7672  C  C   . SER A 1  1458 ? 191.450 212.981 227.891 1.00 183.11 ?  1458 SER A C   1 
ATOM   7673  O  O   . SER A 1  1458 ? 192.499 213.540 227.546 1.00 179.44 ?  1458 SER A O   1 
ATOM   7674  C  CB  . SER A 1  1458 ? 191.206 211.604 229.959 1.00 241.36 ?  1458 SER A CB  1 
ATOM   7675  O  OG  . SER A 1  1458 ? 192.557 211.372 230.304 1.00 296.77 ?  1458 SER A OG  1 
ATOM   7676  N  N   . GLN A 1  1459 ? 190.642 212.353 227.043 1.00 158.40 ?  1459 GLN A N   1 
ATOM   7677  C  CA  . GLN A 1  1459 ? 190.949 212.286 225.627 1.00 155.57 ?  1459 GLN A CA  1 
ATOM   7678  C  C   . GLN A 1  1459 ? 191.025 213.655 224.998 1.00 157.36 ?  1459 GLN A C   1 
ATOM   7679  O  O   . GLN A 1  1459 ? 192.002 213.966 224.325 1.00 173.44 ?  1459 GLN A O   1 
ATOM   7680  C  CB  . GLN A 1  1459 ? 189.937 211.445 224.884 1.00 153.47 ?  1459 GLN A CB  1 
ATOM   7681  C  CG  . GLN A 1  1459 ? 190.470 210.063 224.608 1.00 162.70 ?  1459 GLN A CG  1 
ATOM   7682  C  CD  . GLN A 1  1459 ? 189.388 209.077 224.252 1.00 184.33 ?  1459 GLN A CD  1 
ATOM   7683  O  OE1 . GLN A 1  1459 ? 188.289 209.464 223.842 1.00 223.82 ?  1459 GLN A OE1 1 
ATOM   7684  N  NE2 . GLN A 1  1459 ? 189.692 207.783 224.396 1.00 169.60 ?  1459 GLN A NE2 1 
ATOM   7685  N  N   . ALA A 1  1460 ? 190.003 214.471 225.233 1.00 147.45 ?  1460 ALA A N   1 
ATOM   7686  C  CA  . ALA A 1  1460 ? 189.940 215.804 224.657 1.00 134.64 ?  1460 ALA A CA  1 
ATOM   7687  C  C   . ALA A 1  1460 ? 191.077 216.714 225.113 1.00 138.72 ?  1460 ALA A C   1 
ATOM   7688  O  O   . ALA A 1  1460 ? 191.510 217.581 224.331 1.00 133.05 ?  1460 ALA A O   1 
ATOM   7689  C  CB  . ALA A 1  1460 ? 188.607 216.441 224.952 1.00 138.53 ?  1460 ALA A CB  1 
ATOM   7690  N  N   . HIS A 1  1461 ? 191.566 216.521 226.349 1.00 132.16 ?  1461 HIS A N   1 
ATOM   7691  C  CA  . HIS A 1  1461 ? 192.696 217.313 226.832 1.00 144.57 ?  1461 HIS A CA  1 
ATOM   7692  C  C   . HIS A 1  1461 ? 193.925 217.131 225.949 1.00 137.66 ?  1461 HIS A C   1 
ATOM   7693  O  O   . HIS A 1  1461 ? 194.515 218.111 225.460 1.00 112.93 ?  1461 HIS A O   1 
ATOM   7694  C  CB  . HIS A 1  1461 ? 193.112 216.992 228.267 1.00 144.09 ?  1461 HIS A CB  1 
ATOM   7695  C  CG  . HIS A 1  1461 ? 194.441 217.594 228.602 1.00 170.96 ?  1461 HIS A CG  1 
ATOM   7696  N  ND1 . HIS A 1  1461 ? 194.637 218.960 228.663 1.00 172.69 ?  1461 HIS A ND1 1 
ATOM   7697  C  CD2 . HIS A 1  1461 ? 195.665 217.033 228.763 1.00 188.01 ?  1461 HIS A CD2 1 
ATOM   7698  C  CE1 . HIS A 1  1461 ? 195.910 219.210 228.918 1.00 177.59 ?  1461 HIS A CE1 1 
ATOM   7699  N  NE2 . HIS A 1  1461 ? 196.558 218.058 228.972 1.00 192.59 ?  1461 HIS A NE2 1 
ATOM   7700  N  N   . VAL A 1  1462 ? 194.314 215.866 225.794 1.00 159.53 ?  1462 VAL A N   1 
ATOM   7701  C  CA  . VAL A 1  1462 ? 195.488 215.503 225.003 1.00 204.52 ?  1462 VAL A CA  1 
ATOM   7702  C  C   . VAL A 1  1462 ? 195.369 216.039 223.547 1.00 234.85 ?  1462 VAL A C   1 
ATOM   7703  O  O   . VAL A 1  1462 ? 196.279 216.748 223.066 1.00 156.98 ?  1462 VAL A O   1 
ATOM   7704  C  CB  . VAL A 1  1462 ? 195.892 213.988 225.157 1.00 214.73 ?  1462 VAL A CB  1 
ATOM   7705  C  CG1 . VAL A 1  1462 ? 196.408 213.705 226.568 1.00 209.30 ?  1462 VAL A CG1 1 
ATOM   7706  C  CG2 . VAL A 1  1462 ? 194.761 213.014 224.821 1.00 178.35 ?  1462 VAL A CG2 1 
ATOM   7707  N  N   . TYR A 1  1463 ? 194.218 215.762 222.906 1.00 298.92 ?  1463 TYR A N   1 
ATOM   7708  C  CA  . TYR A 1  1463 ? 193.897 216.181 221.515 1.00 308.79 ?  1463 TYR A CA  1 
ATOM   7709  C  C   . TYR A 1  1463 ? 193.835 217.688 221.287 1.00 301.19 ?  1463 TYR A C   1 
ATOM   7710  O  O   . TYR A 1  1463 ? 194.309 218.178 220.253 1.00 322.02 ?  1463 TYR A O   1 
ATOM   7711  C  CB  . TYR A 1  1463 ? 192.589 215.545 221.010 1.00 272.44 ?  1463 TYR A CB  1 
ATOM   7712  C  CG  . TYR A 1  1463 ? 192.721 214.124 220.505 1.00 241.38 ?  1463 TYR A CG  1 
ATOM   7713  C  CD1 . TYR A 1  1463 ? 193.628 213.795 219.492 1.00 253.73 ?  1463 TYR A CD1 1 
ATOM   7714  C  CD2 . TYR A 1  1463 ? 191.930 213.112 221.030 1.00 234.93 ?  1463 TYR A CD2 1 
ATOM   7715  C  CE1 . TYR A 1  1463 ? 193.753 212.495 219.035 1.00 250.93 ?  1463 TYR A CE1 1 
ATOM   7716  C  CE2 . TYR A 1  1463 ? 192.034 211.813 220.570 1.00 252.31 ?  1463 TYR A CE2 1 
ATOM   7717  C  CZ  . TYR A 1  1463 ? 192.947 211.511 219.575 1.00 257.32 ?  1463 TYR A CZ  1 
ATOM   7718  O  OH  . TYR A 1  1463 ? 193.061 210.222 219.117 1.00 274.27 ?  1463 TYR A OH  1 
ATOM   7719  N  N   . ILE A 1  1464 ? 193.237 218.409 222.233 1.00 265.01 ?  1464 ILE A N   1 
ATOM   7720  C  CA  . ILE A 1  1464 ? 193.299 219.864 222.225 1.00 270.31 ?  1464 ILE A CA  1 
ATOM   7721  C  C   . ILE A 1  1464 ? 194.758 220.381 222.230 1.00 271.16 ?  1464 ILE A C   1 
ATOM   7722  O  O   . ILE A 1  1464 ? 195.098 221.228 221.402 1.00 294.25 ?  1464 ILE A O   1 
ATOM   7723  C  CB  . ILE A 1  1464 ? 192.411 220.490 223.323 1.00 269.85 ?  1464 ILE A CB  1 
ATOM   7724  C  CG1 . ILE A 1  1464 ? 190.941 220.326 222.928 1.00 256.06 ?  1464 ILE A CG1 1 
ATOM   7725  C  CG2 . ILE A 1  1464 ? 192.751 221.966 223.543 1.00 321.89 ?  1464 ILE A CG2 1 
ATOM   7726  C  CD1 . ILE A 1  1464 ? 189.958 220.552 224.062 1.00 294.18 ?  1464 ILE A CD1 1 
ATOM   7727  N  N   . ILE A 1  1465 ? 195.631 219.868 223.104 1.00 206.12 ?  1465 ILE A N   1 
ATOM   7728  C  CA  . ILE A 1  1465 ? 197.023 220.324 223.031 1.00 144.43 ?  1465 ILE A CA  1 
ATOM   7729  C  C   . ILE A 1  1465 ? 197.672 219.886 221.754 1.00 120.78 ?  1465 ILE A C   1 
ATOM   7730  O  O   . ILE A 1  1465 ? 198.342 220.685 221.119 1.00 114.16 ?  1465 ILE A O   1 
ATOM   7731  C  CB  . ILE A 1  1465 ? 197.894 219.977 224.231 1.00 159.51 ?  1465 ILE A CB  1 
ATOM   7732  C  CG1 . ILE A 1  1465 ? 197.911 218.464 224.507 1.00 178.07 ?  1465 ILE A CG1 1 
ATOM   7733  C  CG2 . ILE A 1  1465 ? 197.459 220.850 225.404 1.00 198.37 ?  1465 ILE A CG2 1 
ATOM   7734  C  CD1 . ILE A 1  1465 ? 199.008 217.989 225.446 1.00 210.96 ?  1465 ILE A CD1 1 
ATOM   7735  N  N   . ALA A 1  1466 ? 197.409 218.645 221.351 1.00 128.97 ?  1466 ALA A N   1 
ATOM   7736  C  CA  . ALA A 1  1466 ? 197.948 218.114 220.095 1.00 156.94 ?  1466 ALA A CA  1 
ATOM   7737  C  C   . ALA A 1  1466 ? 197.699 219.050 218.905 1.00 139.23 ?  1466 ALA A C   1 
ATOM   7738  O  O   . ALA A 1  1466 ? 198.645 219.558 218.308 1.00 167.17 ?  1466 ALA A O   1 
ATOM   7739  C  CB  . ALA A 1  1466 ? 197.425 216.714 219.817 1.00 148.80 ?  1466 ALA A CB  1 
ATOM   7740  N  N   . GLY A 1  1467 ? 196.442 219.301 218.577 1.00 138.74 ?  1467 GLY A N   1 
ATOM   7741  C  CA  . GLY A 1  1467 ? 196.110 220.289 217.552 1.00 154.76 ?  1467 GLY A CA  1 
ATOM   7742  C  C   . GLY A 1  1467 ? 196.789 221.636 217.728 1.00 166.52 ?  1467 GLY A C   1 
ATOM   7743  O  O   . GLY A 1  1467 ? 197.241 222.217 216.745 1.00 158.34 ?  1467 GLY A O   1 
ATOM   7744  N  N   . ALA A 1  1468 ? 196.873 222.107 218.977 1.00 159.24 ?  1468 ALA A N   1 
ATOM   7745  C  CA  . ALA A 1  1468 ? 197.437 223.417 219.300 1.00 164.52 ?  1468 ALA A CA  1 
ATOM   7746  C  C   . ALA A 1  1468 ? 198.944 223.471 219.072 1.00 161.69 ?  1468 ALA A C   1 
ATOM   7747  O  O   . ALA A 1  1468 ? 199.452 224.418 218.467 1.00 194.99 ?  1468 ALA A O   1 
ATOM   7748  C  CB  . ALA A 1  1468 ? 197.100 223.814 220.731 1.00 172.59 ?  1468 ALA A CB  1 
ATOM   7749  N  N   . CYS A 1  1469 ? 199.655 222.458 219.551 1.00 133.80 ?  1469 CYS A N   1 
ATOM   7750  C  CA  . CYS A 1  1469 ? 201.082 222.369 219.313 1.00 140.11 ?  1469 CYS A CA  1 
ATOM   7751  C  C   . CYS A 1  1469 ? 201.362 222.115 217.804 1.00 139.58 ?  1469 CYS A C   1 
ATOM   7752  O  O   . CYS A 1  1469 ? 202.313 222.669 217.227 1.00 115.04 ?  1469 CYS A O   1 
ATOM   7753  C  CB  . CYS A 1  1469 ? 201.694 221.305 220.234 1.00 158.32 ?  1469 CYS A CB  1 
ATOM   7754  S  SG  . CYS A 1  1469 ? 201.762 219.619 219.570 1.00 187.84 ?  1469 CYS A SG  1 
ATOM   7755  N  N   . LEU A 1  1470 ? 200.507 221.298 217.174 1.00 155.44 ?  1470 LEU A N   1 
ATOM   7756  C  CA  . LEU A 1  1470 ? 200.581 221.044 215.724 1.00 147.34 ?  1470 LEU A CA  1 
ATOM   7757  C  C   . LEU A 1  1470 ? 200.387 222.308 214.932 1.00 137.65 ?  1470 LEU A C   1 
ATOM   7758  O  O   . LEU A 1  1470 ? 201.105 222.557 213.972 1.00 167.63 ?  1470 LEU A O   1 
ATOM   7759  C  CB  . LEU A 1  1470 ? 199.639 219.925 215.237 1.00 150.58 ?  1470 LEU A CB  1 
ATOM   7760  C  CG  . LEU A 1  1470 ? 199.817 219.519 213.752 1.00 160.97 ?  1470 LEU A CG  1 
ATOM   7761  C  CD1 . LEU A 1  1470 ? 200.377 218.120 213.435 1.00 142.60 ?  1470 LEU A CD1 1 
ATOM   7762  C  CD2 . LEU A 1  1470 ? 198.518 219.812 213.018 1.00 160.08 ?  1470 LEU A CD2 1 
ATOM   7763  N  N   . SER A 1  1471 ? 199.429 223.112 215.349 1.00 131.45 ?  1471 SER A N   1 
ATOM   7764  C  CA  . SER A 1  1471 ? 199.284 224.422 214.782 1.00 136.50 ?  1471 SER A CA  1 
ATOM   7765  C  C   . SER A 1  1471 ? 200.496 225.314 215.042 1.00 141.70 ?  1471 SER A C   1 
ATOM   7766  O  O   . SER A 1  1471 ? 200.787 226.196 214.233 1.00 149.29 ?  1471 SER A O   1 
ATOM   7767  C  CB  . SER A 1  1471 ? 198.044 225.091 215.314 1.00 150.04 ?  1471 SER A CB  1 
ATOM   7768  O  OG  . SER A 1  1471 ? 197.753 226.172 214.464 1.00 191.36 ?  1471 SER A OG  1 
ATOM   7769  N  N   . LEU A 1  1472 ? 201.191 225.099 216.159 1.00 143.80 ?  1472 LEU A N   1 
ATOM   7770  C  CA  . LEU A 1  1472 ? 202.417 225.832 216.421 1.00 138.50 ?  1472 LEU A CA  1 
ATOM   7771  C  C   . LEU A 1  1472 ? 203.464 225.406 215.394 1.00 145.88 ?  1472 LEU A C   1 
ATOM   7772  O  O   . LEU A 1  1472 ? 204.102 226.276 214.774 1.00 134.09 ?  1472 LEU A O   1 
ATOM   7773  C  CB  . LEU A 1  1472 ? 202.919 225.619 217.847 1.00 135.54 ?  1472 LEU A CB  1 
ATOM   7774  C  CG  . LEU A 1  1472 ? 204.206 226.405 218.063 1.00 148.96 ?  1472 LEU A CG  1 
ATOM   7775  C  CD1 . LEU A 1  1472 ? 203.859 227.844 218.378 1.00 157.58 ?  1472 LEU A CD1 1 
ATOM   7776  C  CD2 . LEU A 1  1472 ? 205.101 225.817 219.138 1.00 164.23 ?  1472 LEU A CD2 1 
ATOM   7777  N  N   . GLY A 1  1473 ? 203.602 224.082 215.209 1.00 138.45 ?  1473 GLY A N   1 
ATOM   7778  C  CA  . GLY A 1  1473 ? 204.381 223.470 214.105 1.00 127.41 ?  1473 GLY A CA  1 
ATOM   7779  C  C   . GLY A 1  1473 ? 204.168 224.039 212.698 1.00 108.68 ?  1473 GLY A C   1 
ATOM   7780  O  O   . GLY A 1  1473 ? 205.129 224.406 212.022 1.00 90.25  ?  1473 GLY A O   1 
ATOM   7781  N  N   . PHE A 1  1474 ? 202.903 224.100 212.275 1.00 125.74 ?  1474 PHE A N   1 
ATOM   7782  C  CA  . PHE A 1  1474 ? 202.446 224.823 211.073 1.00 137.58 ?  1474 PHE A CA  1 
ATOM   7783  C  C   . PHE A 1  1474 ? 202.793 226.305 210.984 1.00 146.72 ?  1474 PHE A C   1 
ATOM   7784  O  O   . PHE A 1  1474 ? 202.814 226.867 209.872 1.00 150.67 ?  1474 PHE A O   1 
ATOM   7785  C  CB  . PHE A 1  1474 ? 200.936 224.744 210.979 1.00 145.59 ?  1474 PHE A CB  1 
ATOM   7786  C  CG  . PHE A 1  1474 ? 200.465 223.667 210.119 1.00 148.80 ?  1474 PHE A CG  1 
ATOM   7787  C  CD1 . PHE A 1  1474 ? 200.351 223.867 208.747 1.00 176.72 ?  1474 PHE A CD1 1 
ATOM   7788  C  CD2 . PHE A 1  1474 ? 200.142 222.442 210.666 1.00 163.03 ?  1474 PHE A CD2 1 
ATOM   7789  C  CE1 . PHE A 1  1474 ? 199.909 222.849 207.927 1.00 215.16 ?  1474 PHE A CE1 1 
ATOM   7790  C  CE2 . PHE A 1  1474 ? 199.699 221.412 209.853 1.00 220.59 ?  1474 PHE A CE2 1 
ATOM   7791  C  CZ  . PHE A 1  1474 ? 199.593 221.614 208.482 1.00 232.34 ?  1474 PHE A CZ  1 
ATOM   7792  N  N   . ARG A 1  1475 ? 202.981 226.945 212.143 1.00 122.53 ?  1475 ARG A N   1 
ATOM   7793  C  CA  . ARG A 1  1475 ? 203.397 228.327 212.193 1.00 120.71 ?  1475 ARG A CA  1 
ATOM   7794  C  C   . ARG A 1  1475 ? 204.886 228.401 212.019 1.00 121.03 ?  1475 ARG A C   1 
ATOM   7795  O  O   . ARG A 1  1475 ? 205.398 229.272 211.317 1.00 137.67 ?  1475 ARG A O   1 
ATOM   7796  C  CB  . ARG A 1  1475 ? 203.014 228.963 213.510 1.00 121.17 ?  1475 ARG A CB  1 
ATOM   7797  C  CG  . ARG A 1  1475 ? 203.759 230.252 213.779 1.00 124.36 ?  1475 ARG A CG  1 
ATOM   7798  C  CD  . ARG A 1  1475 ? 203.090 231.488 213.231 1.00 140.78 ?  1475 ARG A CD  1 
ATOM   7799  N  NE  . ARG A 1  1475 ? 203.966 232.588 213.553 1.00 167.48 ?  1475 ARG A NE  1 
ATOM   7800  C  CZ  . ARG A 1  1475 ? 204.789 233.163 212.693 1.00 197.98 ?  1475 ARG A CZ  1 
ATOM   7801  N  NH1 . ARG A 1  1475 ? 204.819 232.760 211.430 1.00 200.85 ?  1475 ARG A NH1 1 
ATOM   7802  N  NH2 . ARG A 1  1475 ? 205.572 234.152 213.103 1.00 233.14 ?  1475 ARG A NH2 1 
ATOM   7803  N  N   . PHE A 1  1476 ? 205.588 227.484 212.660 1.00 124.61 ?  1476 PHE A N   1 
ATOM   7804  C  CA  . PHE A 1  1476 ? 207.029 227.578 212.629 1.00 138.28 ?  1476 PHE A CA  1 
ATOM   7805  C  C   . PHE A 1  1476 ? 207.730 226.641 211.678 1.00 133.55 ?  1476 PHE A C   1 
ATOM   7806  O  O   . PHE A 1  1476 ? 208.930 226.387 211.833 1.00 136.14 ?  1476 PHE A O   1 
ATOM   7807  C  CB  . PHE A 1  1476 ? 207.589 227.606 214.042 1.00 141.47 ?  1476 PHE A CB  1 
ATOM   7808  C  CG  . PHE A 1  1476 ? 207.256 228.869 214.730 1.00 153.70 ?  1476 PHE A CG  1 
ATOM   7809  C  CD1 . PHE A 1  1476 ? 207.946 230.041 214.400 1.00 177.06 ?  1476 PHE A CD1 1 
ATOM   7810  C  CD2 . PHE A 1  1476 ? 206.193 228.928 215.610 1.00 144.75 ?  1476 PHE A CD2 1 
ATOM   7811  C  CE1 . PHE A 1  1476 ? 207.622 231.244 214.993 1.00 194.14 ?  1476 PHE A CE1 1 
ATOM   7812  C  CE2 . PHE A 1  1476 ? 205.862 230.126 216.211 1.00 178.60 ?  1476 PHE A CE2 1 
ATOM   7813  C  CZ  . PHE A 1  1476 ? 206.571 231.289 215.900 1.00 205.93 ?  1476 PHE A CZ  1 
ATOM   7814  N  N   . ALA A 1  1477 ? 206.976 226.202 210.661 1.00 133.45 ?  1477 ALA A N   1 
ATOM   7815  C  CA  . ALA A 1  1477 ? 207.473 225.322 209.607 1.00 145.13 ?  1477 ALA A CA  1 
ATOM   7816  C  C   . ALA A 1  1477 ? 208.780 225.882 209.057 1.00 153.75 ?  1477 ALA A C   1 
ATOM   7817  O  O   . ALA A 1  1477 ? 208.792 226.990 208.504 1.00 174.55 ?  1477 ALA A O   1 
ATOM   7818  C  CB  . ALA A 1  1477 ? 206.442 225.164 208.499 1.00 123.75 ?  1477 ALA A CB  1 
ATOM   7819  N  N   . GLY A 1  1478 ? 209.869 225.142 209.295 1.00 146.41 ?  1478 GLY A N   1 
ATOM   7820  C  CA  . GLY A 1  1478 ? 211.194 225.463 208.763 1.00 175.19 ?  1478 GLY A CA  1 
ATOM   7821  C  C   . GLY A 1  1478 ? 211.862 226.771 209.186 1.00 202.52 ?  1478 GLY A C   1 
ATOM   7822  O  O   . GLY A 1  1478 ? 212.818 227.223 208.546 1.00 230.66 ?  1478 GLY A O   1 
ATOM   7823  N  N   . SER A 1  1479 ? 211.379 227.404 210.246 1.00 198.22 ?  1479 SER A N   1 
ATOM   7824  C  CA  . SER A 1  1479 ? 212.170 228.468 210.842 1.00 186.22 ?  1479 SER A CA  1 
ATOM   7825  C  C   . SER A 1  1479 ? 213.107 227.925 211.928 1.00 177.64 ?  1479 SER A C   1 
ATOM   7826  O  O   . SER A 1  1479 ? 213.915 228.666 212.457 1.00 191.00 ?  1479 SER A O   1 
ATOM   7827  C  CB  . SER A 1  1479 ? 211.311 229.649 211.301 1.00 186.20 ?  1479 SER A CB  1 
ATOM   7828  O  OG  . SER A 1  1479 ? 211.207 230.595 210.243 1.00 187.78 ?  1479 SER A OG  1 
ATOM   7829  N  N   . GLU A 1  1480 ? 213.006 226.622 212.215 1.00 183.15 ?  1480 GLU A N   1 
ATOM   7830  C  CA  . GLU A 1  1480 ? 213.944 225.860 213.073 1.00 198.21 ?  1480 GLU A CA  1 
ATOM   7831  C  C   . GLU A 1  1480 ? 214.027 226.417 214.492 1.00 214.84 ?  1480 GLU A C   1 
ATOM   7832  O  O   . GLU A 1  1480 ? 215.047 226.287 215.183 1.00 239.46 ?  1480 GLU A O   1 
ATOM   7833  C  CB  . GLU A 1  1480 ? 215.325 225.709 212.401 1.00 238.36 ?  1480 GLU A CB  1 
ATOM   7834  C  CG  . GLU A 1  1480 ? 215.261 225.131 210.984 1.00 263.15 ?  1480 GLU A CG  1 
ATOM   7835  C  CD  . GLU A 1  1480 ? 216.574 225.172 210.197 1.00 266.45 ?  1480 GLU A CD  1 
ATOM   7836  O  OE1 . GLU A 1  1480 ? 217.499 225.958 210.527 1.00 259.64 -1 1480 GLU A OE1 1 
ATOM   7837  O  OE2 . GLU A 1  1480 ? 216.668 224.396 209.218 1.00 252.47 ?  1480 GLU A OE2 1 
ATOM   7838  N  N   . ASN A 1  1481 ? 212.891 226.973 214.915 1.00 224.11 ?  1481 ASN A N   1 
ATOM   7839  C  CA  . ASN A 1  1481 ? 212.771 227.963 215.987 1.00 233.81 ?  1481 ASN A CA  1 
ATOM   7840  C  C   . ASN A 1  1481 ? 213.164 227.524 217.408 1.00 249.17 ?  1481 ASN A C   1 
ATOM   7841  O  O   . ASN A 1  1481 ? 212.694 226.490 217.874 1.00 294.49 ?  1481 ASN A O   1 
ATOM   7842  C  CB  . ASN A 1  1481 ? 211.338 228.485 215.979 1.00 207.02 ?  1481 ASN A CB  1 
ATOM   7843  C  CG  . ASN A 1  1481 ? 211.191 229.763 216.750 1.00 200.52 ?  1481 ASN A CG  1 
ATOM   7844  O  OD1 . ASN A 1  1481 ? 211.420 229.803 217.968 1.00 187.57 ?  1481 ASN A OD1 1 
ATOM   7845  N  ND2 . ASN A 1  1481 ? 210.810 230.825 216.047 1.00 195.84 ?  1481 ASN A ND2 1 
ATOM   7846  N  N   . LEU A 1  1482 ? 213.979 228.334 218.100 1.00 219.64 ?  1482 LEU A N   1 
ATOM   7847  C  CA  . LEU A 1  1482 ? 214.566 227.926 219.390 1.00 186.01 ?  1482 LEU A CA  1 
ATOM   7848  C  C   . LEU A 1  1482 ? 213.530 227.644 220.452 1.00 151.36 ?  1482 LEU A C   1 
ATOM   7849  O  O   . LEU A 1  1482 ? 213.475 226.538 220.971 1.00 137.76 ?  1482 LEU A O   1 
ATOM   7850  C  CB  . LEU A 1  1482 ? 215.581 228.949 219.933 1.00 220.14 ?  1482 LEU A CB  1 
ATOM   7851  C  CG  . LEU A 1  1482 ? 216.728 228.550 220.909 1.00 236.04 ?  1482 LEU A CG  1 
ATOM   7852  C  CD1 . LEU A 1  1482 ? 217.295 229.796 221.588 1.00 256.33 ?  1482 LEU A CD1 1 
ATOM   7853  C  CD2 . LEU A 1  1482 ? 216.424 227.490 221.974 1.00 165.90 ?  1482 LEU A CD2 1 
ATOM   7854  N  N   . SER A 1  1483 ? 212.719 228.641 220.779 1.00 165.46 ?  1483 SER A N   1 
ATOM   7855  C  CA  . SER A 1  1483 ? 211.795 228.520 221.908 1.00 196.24 ?  1483 SER A CA  1 
ATOM   7856  C  C   . SER A 1  1483 ? 210.594 227.632 221.582 1.00 186.53 ?  1483 SER A C   1 
ATOM   7857  O  O   . SER A 1  1483 ? 210.127 226.865 222.446 1.00 157.12 ?  1483 SER A O   1 
ATOM   7858  C  CB  . SER A 1  1483 ? 211.380 229.896 222.471 1.00 226.32 ?  1483 SER A CB  1 
ATOM   7859  O  OG  . SER A 1  1483 ? 210.848 230.759 221.478 1.00 258.31 ?  1483 SER A OG  1 
ATOM   7860  N  N   . ALA A 1  1484 ? 210.125 227.719 220.332 1.00 172.34 ?  1484 ALA A N   1 
ATOM   7861  C  CA  . ALA A 1  1484 ? 209.054 226.867 219.857 1.00 145.49 ?  1484 ALA A CA  1 
ATOM   7862  C  C   . ALA A 1  1484 ? 209.517 225.428 219.971 1.00 140.07 ?  1484 ALA A C   1 
ATOM   7863  O  O   . ALA A 1  1484 ? 208.706 224.590 220.315 1.00 178.58 ?  1484 ALA A O   1 
ATOM   7864  C  CB  . ALA A 1  1484 ? 208.634 227.211 218.434 1.00 124.65 ?  1484 ALA A CB  1 
ATOM   7865  N  N   . PHE A 1  1485 ? 210.808 225.154 219.740 1.00 121.21 ?  1485 PHE A N   1 
ATOM   7866  C  CA  . PHE A 1  1485 ? 211.369 223.792 219.909 1.00 139.42 ?  1485 PHE A CA  1 
ATOM   7867  C  C   . PHE A 1  1485 ? 211.500 223.350 221.381 1.00 160.40 ?  1485 PHE A C   1 
ATOM   7868  O  O   . PHE A 1  1485 ? 211.314 222.162 221.683 1.00 159.63 ?  1485 PHE A O   1 
ATOM   7869  C  CB  . PHE A 1  1485 ? 212.694 223.617 219.138 1.00 143.04 ?  1485 PHE A CB  1 
ATOM   7870  C  CG  . PHE A 1  1485 ? 213.553 222.474 219.621 1.00 160.04 ?  1485 PHE A CG  1 
ATOM   7871  C  CD1 . PHE A 1  1485 ? 213.280 221.169 219.234 1.00 149.71 ?  1485 PHE A CD1 1 
ATOM   7872  C  CD2 . PHE A 1  1485 ? 214.658 222.708 220.458 1.00 198.19 ?  1485 PHE A CD2 1 
ATOM   7873  C  CE1 . PHE A 1  1485 ? 214.073 220.112 219.681 1.00 168.69 ?  1485 PHE A CE1 1 
ATOM   7874  C  CE2 . PHE A 1  1485 ? 215.449 221.653 220.915 1.00 208.61 ?  1485 PHE A CE2 1 
ATOM   7875  C  CZ  . PHE A 1  1485 ? 215.157 220.352 220.521 1.00 183.95 ?  1485 PHE A CZ  1 
ATOM   7876  N  N   . ASN A 1  1486 ? 211.811 224.293 222.277 1.00 158.41 ?  1486 ASN A N   1 
ATOM   7877  C  CA  . ASN A 1  1486 ? 211.877 224.019 223.714 1.00 179.04 ?  1486 ASN A CA  1 
ATOM   7878  C  C   . ASN A 1  1486 ? 210.563 223.537 224.314 1.00 208.37 ?  1486 ASN A C   1 
ATOM   7879  O  O   . ASN A 1  1486 ? 210.540 222.550 225.059 1.00 228.60 ?  1486 ASN A O   1 
ATOM   7880  C  CB  . ASN A 1  1486 ? 212.374 225.245 224.466 1.00 189.74 ?  1486 ASN A CB  1 
ATOM   7881  C  CG  . ASN A 1  1486 ? 213.850 225.498 224.242 1.00 239.42 ?  1486 ASN A CG  1 
ATOM   7882  O  OD1 . ASN A 1  1486 ? 214.627 224.570 223.991 1.00 258.42 ?  1486 ASN A OD1 1 
ATOM   7883  N  ND2 . ASN A 1  1486 ? 214.250 226.759 224.339 1.00 263.13 ?  1486 ASN A ND2 1 
ATOM   7884  N  N   . CYS A 1  1487 ? 209.473 224.217 223.956 1.00 242.44 ?  1487 CYS A N   1 
ATOM   7885  C  CA  . CYS A 1  1487 ? 208.130 223.862 224.435 1.00 237.17 ?  1487 CYS A CA  1 
ATOM   7886  C  C   . CYS A 1  1487 ? 207.576 222.564 223.824 1.00 224.19 ?  1487 CYS A C   1 
ATOM   7887  O  O   . CYS A 1  1487 ? 207.022 221.751 224.568 1.00 172.24 ?  1487 CYS A O   1 
ATOM   7888  C  CB  . CYS A 1  1487 ? 207.147 225.036 224.272 1.00 245.16 ?  1487 CYS A CB  1 
ATOM   7889  S  SG  . CYS A 1  1487 ? 206.186 225.101 222.742 1.00 209.85 ?  1487 CYS A SG  1 
ATOM   7890  N  N   . LEU A 1  1488 ? 207.732 222.400 222.494 1.00 234.13 ?  1488 LEU A N   1 
ATOM   7891  C  CA  . LEU A 1  1488 ? 207.337 221.183 221.728 1.00 193.78 ?  1488 LEU A CA  1 
ATOM   7892  C  C   . LEU A 1  1488 ? 208.182 219.974 222.105 1.00 172.32 ?  1488 LEU A C   1 
ATOM   7893  O  O   . LEU A 1  1488 ? 207.633 218.872 222.227 1.00 180.79 ?  1488 LEU A O   1 
ATOM   7894  C  CB  . LEU A 1  1488 ? 207.318 221.387 220.180 1.00 154.26 ?  1488 LEU A CB  1 
ATOM   7895  C  CG  . LEU A 1  1488 ? 206.328 222.387 219.524 1.00 138.64 ?  1488 LEU A CG  1 
ATOM   7896  C  CD1 . LEU A 1  1488 ? 206.257 222.358 217.994 1.00 112.33 ?  1488 LEU A CD1 1 
ATOM   7897  C  CD2 . LEU A 1  1488 ? 204.930 222.249 220.099 1.00 145.38 ?  1488 LEU A CD2 1 
ATOM   7898  N  N   . HIS A 1  1489 ? 209.489 220.173 222.312 1.00 133.00 ?  1489 HIS A N   1 
ATOM   7899  C  CA  . HIS A 1  1489 ? 210.311 219.085 222.822 1.00 154.11 ?  1489 HIS A CA  1 
ATOM   7900  C  C   . HIS A 1  1489 ? 209.727 218.573 224.133 1.00 159.57 ?  1489 HIS A C   1 
ATOM   7901  O  O   . HIS A 1  1489 ? 209.527 217.357 224.294 1.00 150.24 ?  1489 HIS A O   1 
ATOM   7902  C  CB  . HIS A 1  1489 ? 211.804 219.433 222.978 1.00 171.09 ?  1489 HIS A CB  1 
ATOM   7903  C  CG  . HIS A 1  1489 ? 212.685 218.220 222.934 1.00 190.86 ?  1489 HIS A CG  1 
ATOM   7904  N  ND1 . HIS A 1  1489 ? 213.384 217.845 221.806 1.00 188.58 ?  1489 HIS A ND1 1 
ATOM   7905  C  CD2 . HIS A 1  1489 ? 212.909 217.247 223.850 1.00 204.82 ?  1489 HIS A CD2 1 
ATOM   7906  C  CE1 . HIS A 1  1489 ? 214.023 216.712 222.037 1.00 189.73 ?  1489 HIS A CE1 1 
ATOM   7907  N  NE2 . HIS A 1  1489 ? 213.752 216.328 223.271 1.00 212.26 ?  1489 HIS A NE2 1 
ATOM   7908  N  N   . LYS A 1  1490 ? 209.411 219.512 225.031 1.00 174.08 ?  1490 LYS A N   1 
ATOM   7909  C  CA  . LYS A 1  1490 ? 208.855 219.180 226.344 1.00 199.20 ?  1490 LYS A CA  1 
ATOM   7910  C  C   . LYS A 1  1490 ? 207.531 218.424 226.210 1.00 188.75 ?  1490 LYS A C   1 
ATOM   7911  O  O   . LYS A 1  1490 ? 207.350 217.373 226.828 1.00 173.85 ?  1490 LYS A O   1 
ATOM   7912  C  CB  . LYS A 1  1490 ? 208.700 220.423 227.230 1.00 214.84 ?  1490 LYS A CB  1 
ATOM   7913  C  CG  . LYS A 1  1490 ? 208.615 220.092 228.721 1.00 238.13 ?  1490 LYS A CG  1 
ATOM   7914  C  CD  . LYS A 1  1490 ? 207.880 221.159 229.519 1.00 253.08 ?  1490 LYS A CD  1 
ATOM   7915  C  CE  . LYS A 1  1490 ? 208.789 222.323 229.886 1.00 288.74 ?  1490 LYS A CE  1 
ATOM   7916  N  NZ  . LYS A 1  1490 ? 208.013 223.579 230.086 1.00 335.40 ?  1490 LYS A NZ  1 
ATOM   7917  N  N   . PHE A 1  1491 ? 206.633 218.944 225.376 1.00 171.90 ?  1491 PHE A N   1 
ATOM   7918  C  CA  . PHE A 1  1491 ? 205.373 218.285 225.089 1.00 156.98 ?  1491 PHE A CA  1 
ATOM   7919  C  C   . PHE A 1  1491 ? 205.571 216.853 224.645 1.00 153.73 ?  1491 PHE A C   1 
ATOM   7920  O  O   . PHE A 1  1491 ? 204.857 215.979 225.101 1.00 183.48 ?  1491 PHE A O   1 
ATOM   7921  C  CB  . PHE A 1  1491 ? 204.583 219.058 224.037 1.00 171.37 ?  1491 PHE A CB  1 
ATOM   7922  C  CG  . PHE A 1  1491 ? 203.554 219.981 224.612 1.00 195.27 ?  1491 PHE A CG  1 
ATOM   7923  C  CD1 . PHE A 1  1491 ? 203.942 221.070 225.400 1.00 219.84 ?  1491 PHE A CD1 1 
ATOM   7924  C  CD2 . PHE A 1  1491 ? 202.189 219.762 224.376 1.00 178.41 ?  1491 PHE A CD2 1 
ATOM   7925  C  CE1 . PHE A 1  1491 ? 202.989 221.922 225.939 1.00 234.78 ?  1491 PHE A CE1 1 
ATOM   7926  C  CE2 . PHE A 1  1491 ? 201.239 220.617 224.912 1.00 172.96 ?  1491 PHE A CE2 1 
ATOM   7927  C  CZ  . PHE A 1  1491 ? 201.637 221.692 225.698 1.00 215.98 ?  1491 PHE A CZ  1 
ATOM   7928  N  N   . ALA A 1  1492 ? 206.547 216.613 223.777 1.00 153.60 ?  1492 ALA A N   1 
ATOM   7929  C  CA  . ALA A 1  1492 ? 206.790 215.269 223.258 1.00 170.91 ?  1492 ALA A CA  1 
ATOM   7930  C  C   . ALA A 1  1492 ? 207.308 214.305 224.338 1.00 161.86 ?  1492 ALA A C   1 
ATOM   7931  O  O   . ALA A 1  1492 ? 206.854 213.159 224.440 1.00 127.52 ?  1492 ALA A O   1 
ATOM   7932  C  CB  . ALA A 1  1492 ? 207.725 215.329 222.062 1.00 203.79 ?  1492 ALA A CB  1 
ATOM   7933  N  N   . LYS A 1  1493 ? 208.234 214.782 225.156 1.00 152.42 ?  1493 LYS A N   1 
ATOM   7934  C  CA  . LYS A 1  1493 ? 208.614 214.045 226.334 1.00 202.95 ?  1493 LYS A CA  1 
ATOM   7935  C  C   . LYS A 1  1493 ? 207.412 213.852 227.291 1.00 273.43 ?  1493 LYS A C   1 
ATOM   7936  O  O   . LYS A 1  1493 ? 207.259 212.765 227.852 1.00 352.59 ?  1493 LYS A O   1 
ATOM   7937  C  CB  . LYS A 1  1493 ? 209.785 214.727 227.020 1.00 200.01 ?  1493 LYS A CB  1 
ATOM   7938  C  CG  . LYS A 1  1493 ? 211.071 214.603 226.239 1.00 182.40 ?  1493 LYS A CG  1 
ATOM   7939  C  CD  . LYS A 1  1493 ? 212.116 215.477 226.882 1.00 194.32 ?  1493 LYS A CD  1 
ATOM   7940  C  CE  . LYS A 1  1493 ? 213.487 214.922 226.569 1.00 259.69 ?  1493 LYS A CE  1 
ATOM   7941  N  NZ  . LYS A 1  1493 ? 214.551 215.645 227.314 1.00 320.30 ?  1493 LYS A NZ  1 
ATOM   7942  N  N   . ASP A 1  1494 ? 206.553 214.878 227.431 1.00 287.20 ?  1494 ASP A N   1 
ATOM   7943  C  CA  . ASP A 1  1494 ? 205.322 214.828 228.277 1.00 284.06 ?  1494 ASP A CA  1 
ATOM   7944  C  C   . ASP A 1  1494 ? 204.255 213.818 227.806 1.00 292.65 ?  1494 ASP A C   1 
ATOM   7945  O  O   . ASP A 1  1494 ? 203.636 213.129 228.638 1.00 265.07 ?  1494 ASP A O   1 
ATOM   7946  C  CB  . ASP A 1  1494 ? 204.674 216.218 228.421 1.00 261.86 ?  1494 ASP A CB  1 
ATOM   7947  C  CG  . ASP A 1  1494 ? 205.561 217.229 229.154 1.00 281.23 ?  1494 ASP A CG  1 
ATOM   7948  O  OD1 . ASP A 1  1494 ? 206.286 216.857 230.108 1.00 290.89 ?  1494 ASP A OD1 1 
ATOM   7949  O  OD2 . ASP A 1  1494 ? 205.517 218.421 228.775 1.00 276.73 -1 1494 ASP A OD2 1 
ATOM   7950  N  N   . PHE A 1  1495 ? 204.048 213.751 226.482 1.00 334.45 ?  1495 PHE A N   1 
ATOM   7951  C  CA  . PHE A 1  1495 ? 203.137 212.784 225.830 1.00 335.68 ?  1495 PHE A CA  1 
ATOM   7952  C  C   . PHE A 1  1495 ? 203.574 211.331 226.098 1.00 337.34 ?  1495 PHE A C   1 
ATOM   7953  O  O   . PHE A 1  1495 ? 202.743 210.485 226.470 1.00 339.97 ?  1495 PHE A O   1 
ATOM   7954  C  CB  . PHE A 1  1495 ? 203.038 213.040 224.307 1.00 323.54 ?  1495 PHE A CB  1 
ATOM   7955  C  CG  . PHE A 1  1495 ? 201.908 213.972 223.882 1.00 292.48 ?  1495 PHE A CG  1 
ATOM   7956  C  CD1 . PHE A 1  1495 ? 200.586 213.519 223.807 1.00 269.80 ?  1495 PHE A CD1 1 
ATOM   7957  C  CD2 . PHE A 1  1495 ? 202.172 215.296 223.498 1.00 261.57 ?  1495 PHE A CD2 1 
ATOM   7958  C  CE1 . PHE A 1  1495 ? 199.564 214.377 223.398 1.00 227.09 ?  1495 PHE A CE1 1 
ATOM   7959  C  CE2 . PHE A 1  1495 ? 201.144 216.153 223.084 1.00 199.35 ?  1495 PHE A CE2 1 
ATOM   7960  C  CZ  . PHE A 1  1495 ? 199.843 215.687 223.026 1.00 186.66 ?  1495 PHE A CZ  1 
ATOM   7961  N  N   . MET A 1  1496 ? 204.877 211.068 225.925 1.00 335.70 ?  1496 MET A N   1 
ATOM   7962  C  CA  . MET A 1  1496 ? 205.499 209.745 226.162 1.00 323.56 ?  1496 MET A CA  1 
ATOM   7963  C  C   . MET A 1  1496 ? 205.252 209.219 227.590 1.00 336.46 ?  1496 MET A C   1 
ATOM   7964  O  O   . MET A 1  1496 ? 204.917 208.043 227.764 1.00 362.61 ?  1496 MET A O   1 
ATOM   7965  C  CB  . MET A 1  1496 ? 207.011 209.741 225.815 1.00 315.71 ?  1496 MET A CB  1 
ATOM   7966  C  CG  . MET A 1  1496 ? 207.397 210.621 224.627 1.00 289.35 ?  1496 MET A CG  1 
ATOM   7967  S  SD  . MET A 1  1496 ? 209.000 210.481 223.804 1.00 269.79 ?  1496 MET A SD  1 
ATOM   7968  C  CE  . MET A 1  1496 ? 208.498 209.556 222.348 1.00 312.57 ?  1496 MET A CE  1 
ATOM   7969  N  N   . THR A 1  1497 ? 205.378 210.100 228.591 1.00 339.72 ?  1497 THR A N   1 
ATOM   7970  C  CA  . THR A 1  1497 ? 205.160 209.745 230.015 1.00 322.46 ?  1497 THR A CA  1 
ATOM   7971  C  C   . THR A 1  1497 ? 203.687 209.441 230.397 1.00 319.35 ?  1497 THR A C   1 
ATOM   7972  O  O   . THR A 1  1497 ? 203.435 208.655 231.324 1.00 271.31 ?  1497 THR A O   1 
ATOM   7973  C  CB  . THR A 1  1497 ? 205.779 210.777 231.003 1.00 303.07 ?  1497 THR A CB  1 
ATOM   7974  O  OG1 . THR A 1  1497 ? 205.231 212.082 230.774 1.00 301.51 ?  1497 THR A OG1 1 
ATOM   7975  C  CG2 . THR A 1  1497 ? 207.310 210.819 230.883 1.00 266.52 ?  1497 THR A CG2 1 
ATOM   7976  N  N   . TYR A 1  1498 ? 202.733 210.053 229.689 1.00 315.73 ?  1498 TYR A N   1 
ATOM   7977  C  CA  . TYR A 1  1498 ? 201.297 209.741 229.843 1.00 272.79 ?  1498 TYR A CA  1 
ATOM   7978  C  C   . TYR A 1  1498 ? 200.963 208.274 229.543 1.00 260.97 ?  1498 TYR A C   1 
ATOM   7979  O  O   . TYR A 1  1498 ? 200.197 207.671 230.291 1.00 209.04 ?  1498 TYR A O   1 
ATOM   7980  C  CB  . TYR A 1  1498 ? 200.440 210.658 228.958 1.00 321.32 ?  1498 TYR A CB  1 
ATOM   7981  C  CG  . TYR A 1  1498 ? 199.668 211.735 229.691 1.00 347.84 ?  1498 TYR A CG  1 
ATOM   7982  C  CD1 . TYR A 1  1498 ? 198.394 211.472 230.218 1.00 324.82 ?  1498 TYR A CD1 1 
ATOM   7983  C  CD2 . TYR A 1  1498 ? 200.197 213.028 229.840 1.00 368.17 ?  1498 TYR A CD2 1 
ATOM   7984  C  CE1 . TYR A 1  1498 ? 197.677 212.458 230.885 1.00 322.10 ?  1498 TYR A CE1 1 
ATOM   7985  C  CE2 . TYR A 1  1498 ? 199.486 214.021 230.507 1.00 356.68 ?  1498 TYR A CE2 1 
ATOM   7986  C  CZ  . TYR A 1  1498 ? 198.227 213.727 231.027 1.00 337.46 ?  1498 TYR A CZ  1 
ATOM   7987  O  OH  . TYR A 1  1498 ? 197.522 214.702 231.689 1.00 322.23 ?  1498 TYR A OH  1 
ATOM   7988  N  N   . LEU A 1  1499 ? 201.531 207.733 228.447 1.00 312.26 ?  1499 LEU A N   1 
ATOM   7989  C  CA  . LEU A 1  1499 ? 201.372 206.317 228.011 1.00 302.76 ?  1499 LEU A CA  1 
ATOM   7990  C  C   . LEU A 1  1499 ? 201.939 205.330 229.020 1.00 339.00 ?  1499 LEU A C   1 
ATOM   7991  O  O   . LEU A 1  1499 ? 201.342 204.283 229.261 1.00 350.60 ?  1499 LEU A O   1 
ATOM   7992  C  CB  . LEU A 1  1499 ? 202.083 206.036 226.677 1.00 260.21 ?  1499 LEU A CB  1 
ATOM   7993  C  CG  . LEU A 1  1499 ? 201.498 206.221 225.282 1.00 252.90 ?  1499 LEU A CG  1 
ATOM   7994  C  CD1 . LEU A 1  1499 ? 201.644 207.673 224.852 1.00 275.64 ?  1499 LEU A CD1 1 
ATOM   7995  C  CD2 . LEU A 1  1499 ? 202.246 205.325 224.303 1.00 277.20 ?  1499 LEU A CD2 1 
ATOM   7996  N  N   . SER A 1  1500 ? 203.117 205.655 229.562 1.00 373.16 ?  1500 SER A N   1 
ATOM   7997  C  CA  . SER A 1  1500 ? 203.788 204.852 230.586 1.00 357.25 ?  1500 SER A CA  1 
ATOM   7998  C  C   . SER A 1  1500 ? 203.379 205.371 231.966 1.00 325.21 ?  1500 SER A C   1 
ATOM   7999  O  O   . SER A 1  1500 ? 204.199 205.894 232.733 1.00 351.62 ?  1500 SER A O   1 
ATOM   8000  C  CB  . SER A 1  1500 ? 205.313 204.872 230.386 1.00 374.57 ?  1500 SER A CB  1 
ATOM   8001  O  OG  . SER A 1  1500 ? 205.980 204.111 231.380 1.00 379.77 ?  1500 SER A OG  1 
ATOM   8002  N  N   . ALA A 1  1501 ? 202.085 205.223 232.249 1.00 260.09 ?  1501 ALA A N   1 
ATOM   8003  C  CA  . ALA A 1  1501 ? 201.463 205.668 233.487 1.00 241.36 ?  1501 ALA A CA  1 
ATOM   8004  C  C   . ALA A 1  1501 ? 200.137 204.919 233.715 1.00 234.42 ?  1501 ALA A C   1 
ATOM   8005  O  O   . ALA A 1  1501 ? 199.554 204.382 232.772 1.00 192.24 ?  1501 ALA A O   1 
ATOM   8006  C  CB  . ALA A 1  1501 ? 201.233 207.177 233.446 1.00 228.18 ?  1501 ALA A CB  1 
ATOM   8007  N  N   . PRO A 1  1502 ? 199.667 204.848 234.979 1.00 267.02 ?  1502 PRO A N   1 
ATOM   8008  C  CA  . PRO A 1  1502 ? 198.230 204.599 235.139 1.00 280.07 ?  1502 PRO A CA  1 
ATOM   8009  C  C   . PRO A 1  1502 ? 197.485 205.847 234.666 1.00 270.92 ?  1502 PRO A C   1 
ATOM   8010  O  O   . PRO A 1  1502 ? 198.047 206.943 234.739 1.00 268.48 ?  1502 PRO A O   1 
ATOM   8011  C  CB  . PRO A 1  1502 ? 198.063 204.390 236.650 1.00 299.15 ?  1502 PRO A CB  1 
ATOM   8012  C  CG  . PRO A 1  1502 ? 199.292 204.964 237.275 1.00 309.70 ?  1502 PRO A CG  1 
ATOM   8013  C  CD  . PRO A 1  1502 ? 200.387 204.797 236.266 1.00 294.84 ?  1502 PRO A CD  1 
ATOM   8014  N  N   . ASN A 1  1503 ? 196.250 205.676 234.193 1.00 272.08 ?  1503 ASN A N   1 
ATOM   8015  C  CA  . ASN A 1  1503 ? 195.487 206.718 233.476 1.00 268.50 ?  1503 ASN A CA  1 
ATOM   8016  C  C   . ASN A 1  1503 ? 195.620 206.522 231.962 1.00 249.28 ?  1503 ASN A C   1 
ATOM   8017  O  O   . ASN A 1  1503 ? 194.802 207.030 231.197 1.00 241.37 ?  1503 ASN A O   1 
ATOM   8018  C  CB  . ASN A 1  1503 ? 195.868 208.153 233.934 1.00 300.57 ?  1503 ASN A CB  1 
ATOM   8019  C  CG  . ASN A 1  1503 ? 195.076 209.249 233.237 1.00 333.26 ?  1503 ASN A CG  1 
ATOM   8020  O  OD1 . ASN A 1  1503 ? 195.453 209.712 232.161 1.00 339.06 ?  1503 ASN A OD1 1 
ATOM   8021  N  ND2 . ASN A 1  1503 ? 194.000 209.701 233.872 1.00 349.71 ?  1503 ASN A ND2 1 
ATOM   8022  N  N   . ALA A 1  1504 ? 196.635 205.763 231.542 1.00 225.79 ?  1504 ALA A N   1 
ATOM   8023  C  CA  . ALA A 1  1504 ? 196.837 205.437 230.129 1.00 231.35 ?  1504 ALA A CA  1 
ATOM   8024  C  C   . ALA A 1  1504 ? 195.638 204.683 229.585 1.00 233.14 ?  1504 ALA A C   1 
ATOM   8025  O  O   . ALA A 1  1504 ? 195.093 205.028 228.530 1.00 253.60 ?  1504 ALA A O   1 
ATOM   8026  C  CB  . ALA A 1  1504 ? 198.092 204.611 229.951 1.00 241.87 ?  1504 ALA A CB  1 
ATOM   8027  N  N   . SER A 1  1505 ? 195.241 203.658 230.330 1.00 227.43 ?  1505 SER A N   1 
ATOM   8028  C  CA  . SER A 1  1505 ? 194.015 202.913 230.100 1.00 240.52 ?  1505 SER A CA  1 
ATOM   8029  C  C   . SER A 1  1505 ? 192.815 203.797 229.720 1.00 226.83 ?  1505 SER A C   1 
ATOM   8030  O  O   . SER A 1  1505 ? 192.244 203.624 228.637 1.00 203.19 ?  1505 SER A O   1 
ATOM   8031  C  CB  . SER A 1  1505 ? 193.698 202.079 231.344 1.00 274.39 ?  1505 SER A CB  1 
ATOM   8032  O  OG  . SER A 1  1505 ? 193.972 202.816 232.528 1.00 292.85 ?  1505 SER A OG  1 
ATOM   8033  N  N   . VAL A 1  1506 ? 192.477 204.759 230.586 1.00 225.29 ?  1506 VAL A N   1 
ATOM   8034  C  CA  . VAL A 1  1506 ? 191.216 205.533 230.476 1.00 233.65 ?  1506 VAL A CA  1 
ATOM   8035  C  C   . VAL A 1  1506 ? 191.173 206.599 229.381 1.00 210.30 ?  1506 VAL A C   1 
ATOM   8036  O  O   . VAL A 1  1506 ? 190.084 207.015 228.967 1.00 177.84 ?  1506 VAL A O   1 
ATOM   8037  C  CB  . VAL A 1  1506 ? 190.749 206.151 231.823 1.00 258.62 ?  1506 VAL A CB  1 
ATOM   8038  C  CG1 . VAL A 1  1506 ? 190.180 205.076 232.742 1.00 289.87 ?  1506 VAL A CG1 1 
ATOM   8039  C  CG2 . VAL A 1  1506 ? 191.861 206.936 232.507 1.00 251.90 ?  1506 VAL A CG2 1 
ATOM   8040  N  N   . THR A 1  1507 ? 192.348 207.042 228.938 1.00 202.42 ?  1507 THR A N   1 
ATOM   8041  C  CA  . THR A 1  1507 ? 192.461 207.944 227.776 1.00 202.13 ?  1507 THR A CA  1 
ATOM   8042  C  C   . THR A 1  1507 ? 192.715 207.200 226.442 1.00 203.69 ?  1507 THR A C   1 
ATOM   8043  O  O   . THR A 1  1507 ? 192.668 207.803 225.364 1.00 194.41 ?  1507 THR A O   1 
ATOM   8044  C  CB  . THR A 1  1507 ? 193.467 209.103 228.020 1.00 187.57 ?  1507 THR A CB  1 
ATOM   8045  O  OG1 . THR A 1  1507 ? 193.499 209.975 226.881 1.00 171.61 ?  1507 THR A OG1 1 
ATOM   8046  C  CG2 . THR A 1  1507 ? 194.869 208.587 228.316 1.00 194.65 ?  1507 THR A CG2 1 
ATOM   8047  N  N   . GLY A 1  1508 ? 192.960 205.894 226.523 1.00 208.22 ?  1508 GLY A N   1 
ATOM   8048  C  CA  . GLY A 1  1508 ? 193.098 205.046 225.335 1.00 211.09 ?  1508 GLY A CA  1 
ATOM   8049  C  C   . GLY A 1  1508 ? 194.479 205.124 224.703 1.00 218.53 ?  1508 GLY A C   1 
ATOM   8050  O  O   . GLY A 1  1508 ? 194.862 206.204 224.213 1.00 160.19 ?  1508 GLY A O   1 
ATOM   8051  N  N   . PRO A 1  1509 ? 195.236 203.984 224.707 1.00 244.21 ?  1509 PRO A N   1 
ATOM   8052  C  CA  . PRO A 1  1509 ? 196.583 203.906 224.126 1.00 216.41 ?  1509 PRO A CA  1 
ATOM   8053  C  C   . PRO A 1  1509 ? 196.599 204.309 222.668 1.00 189.19 ?  1509 PRO A C   1 
ATOM   8054  O  O   . PRO A 1  1509 ? 197.575 204.916 222.241 1.00 168.91 ?  1509 PRO A O   1 
ATOM   8055  C  CB  . PRO A 1  1509 ? 196.956 202.422 224.268 1.00 215.84 ?  1509 PRO A CB  1 
ATOM   8056  C  CG  . PRO A 1  1509 ? 196.167 201.954 225.435 1.00 225.43 ?  1509 PRO A CG  1 
ATOM   8057  C  CD  . PRO A 1  1509 ? 194.852 202.681 225.294 1.00 259.34 ?  1509 PRO A CD  1 
ATOM   8058  N  N   . HIS A 1  1510 ? 195.537 203.986 221.922 1.00 183.12 ?  1510 HIS A N   1 
ATOM   8059  C  CA  . HIS A 1  1510 ? 195.433 204.455 220.549 1.00 199.08 ?  1510 HIS A CA  1 
ATOM   8060  C  C   . HIS A 1  1510 ? 195.237 205.956 220.500 1.00 220.79 ?  1510 HIS A C   1 
ATOM   8061  O  O   . HIS A 1  1510 ? 195.879 206.620 219.680 1.00 305.48 ?  1510 HIS A O   1 
ATOM   8062  C  CB  . HIS A 1  1510 ? 194.339 203.778 219.726 1.00 194.93 ?  1510 HIS A CB  1 
ATOM   8063  C  CG  . HIS A 1  1510 ? 194.347 204.195 218.281 1.00 202.02 ?  1510 HIS A CG  1 
ATOM   8064  N  ND1 . HIS A 1  1510 ? 193.900 205.431 217.853 1.00 180.67 ?  1510 HIS A ND1 1 
ATOM   8065  C  CD2 . HIS A 1  1510 ? 194.788 203.554 217.173 1.00 203.22 ?  1510 HIS A CD2 1 
ATOM   8066  C  CE1 . HIS A 1  1510 ? 194.045 205.524 216.544 1.00 178.00 ?  1510 HIS A CE1 1 
ATOM   8067  N  NE2 . HIS A 1  1510 ? 194.577 204.396 216.106 1.00 207.92 ?  1510 HIS A NE2 1 
ATOM   8068  N  N   . ASN A 1  1511 ? 194.376 206.501 221.357 1.00 170.43 ?  1511 ASN A N   1 
ATOM   8069  C  CA  . ASN A 1  1511 ? 194.129 207.933 221.291 1.00 157.58 ?  1511 ASN A CA  1 
ATOM   8070  C  C   . ASN A 1  1511 ? 195.282 208.829 221.707 1.00 168.79 ?  1511 ASN A C   1 
ATOM   8071  O  O   . ASN A 1  1511 ? 195.396 209.967 221.205 1.00 124.12 ?  1511 ASN A O   1 
ATOM   8072  C  CB  . ASN A 1  1511 ? 192.866 208.281 222.009 1.00 161.40 ?  1511 ASN A CB  1 
ATOM   8073  C  CG  . ASN A 1  1511 ? 191.656 208.098 221.134 1.00 183.83 ?  1511 ASN A CG  1 
ATOM   8074  O  OD1 . ASN A 1  1511 ? 190.535 208.378 221.550 1.00 214.09 ?  1511 ASN A OD1 1 
ATOM   8075  N  ND2 . ASN A 1  1511 ? 191.873 207.637 219.904 1.00 182.14 ?  1511 ASN A ND2 1 
ATOM   8076  N  N   . LEU A 1  1512 ? 196.132 208.277 222.583 1.00 213.80 ?  1512 LEU A N   1 
ATOM   8077  C  CA  . LEU A 1  1512 ? 197.453 208.828 222.919 1.00 280.22 ?  1512 LEU A CA  1 
ATOM   8078  C  C   . LEU A 1  1512 ? 198.551 208.756 221.826 1.00 368.86 ?  1512 LEU A C   1 
ATOM   8079  O  O   . LEU A 1  1512 ? 199.364 209.684 221.727 1.00 416.18 ?  1512 LEU A O   1 
ATOM   8080  C  CB  . LEU A 1  1512 ? 197.974 208.232 224.231 1.00 225.96 ?  1512 LEU A CB  1 
ATOM   8081  C  CG  . LEU A 1  1512 ? 197.685 209.017 225.512 1.00 207.50 ?  1512 LEU A CG  1 
ATOM   8082  C  CD1 . LEU A 1  1512 ? 198.134 208.175 226.696 1.00 241.78 ?  1512 LEU A CD1 1 
ATOM   8083  C  CD2 . LEU A 1  1512 ? 198.345 210.400 225.550 1.00 162.40 ?  1512 LEU A CD2 1 
ATOM   8084  N  N   . GLU A 1  1513 ? 198.593 207.675 221.034 1.00 432.70 ?  1513 GLU A N   1 
ATOM   8085  C  CA  . GLU A 1  1513 ? 199.574 207.559 219.923 1.00 415.40 ?  1513 GLU A CA  1 
ATOM   8086  C  C   . GLU A 1  1513 ? 199.339 208.613 218.825 1.00 425.36 ?  1513 GLU A C   1 
ATOM   8087  O  O   . GLU A 1  1513 ? 200.306 209.179 218.280 1.00 412.06 ?  1513 GLU A O   1 
ATOM   8088  C  CB  . GLU A 1  1513 ? 199.605 206.151 219.289 1.00 405.28 ?  1513 GLU A CB  1 
ATOM   8089  C  CG  . GLU A 1  1513 ? 199.829 204.955 220.215 1.00 395.18 ?  1513 GLU A CG  1 
ATOM   8090  C  CD  . GLU A 1  1513 ? 201.268 204.737 220.666 1.00 400.06 ?  1513 GLU A CD  1 
ATOM   8091  O  OE1 . GLU A 1  1513 ? 202.017 205.714 220.883 1.00 402.84 ?  1513 GLU A OE1 1 
ATOM   8092  O  OE2 . GLU A 1  1513 ? 201.644 203.559 220.835 1.00 401.41 -1 1513 GLU A OE2 1 
ATOM   8093  N  N   . THR A 1  1514 ? 198.057 208.866 218.525 1.00 429.99 ?  1514 THR A N   1 
ATOM   8094  C  CA  . THR A 1  1514 ? 197.625 209.839 217.508 1.00 377.70 ?  1514 THR A CA  1 
ATOM   8095  C  C   . THR A 1  1514 ? 198.160 211.233 217.841 1.00 380.61 ?  1514 THR A C   1 
ATOM   8096  O  O   . THR A 1  1514 ? 198.828 211.863 217.012 1.00 401.19 ?  1514 THR A O   1 
ATOM   8097  C  CB  . THR A 1  1514 ? 196.082 209.869 217.357 1.00 332.24 ?  1514 THR A CB  1 
ATOM   8098  O  OG1 . THR A 1  1514 ? 195.599 208.563 217.018 1.00 322.76 ?  1514 THR A OG1 1 
ATOM   8099  C  CG2 . THR A 1  1514 ? 195.654 210.848 216.265 1.00 320.21 ?  1514 THR A CG2 1 
ATOM   8100  N  N   . CYS A 1  1515 ? 197.884 211.685 219.064 1.00 380.88 ?  1515 CYS A N   1 
ATOM   8101  C  CA  . CYS A 1  1515 ? 198.373 212.977 219.537 1.00 388.25 ?  1515 CYS A CA  1 
ATOM   8102  C  C   . CYS A 1  1515 ? 199.901 213.059 219.776 1.00 416.72 ?  1515 CYS A C   1 
ATOM   8103  O  O   . CYS A 1  1515 ? 200.468 214.150 219.678 1.00 405.30 ?  1515 CYS A O   1 
ATOM   8104  C  CB  . CYS A 1  1515 ? 197.558 213.472 220.739 1.00 364.02 ?  1515 CYS A CB  1 
ATOM   8105  S  SG  . CYS A 1  1515 ? 197.235 212.301 222.071 1.00 375.31 ?  1515 CYS A SG  1 
ATOM   8106  N  N   . LEU A 1  1516 ? 200.554 211.923 220.065 1.00 426.68 ?  1516 LEU A N   1 
ATOM   8107  C  CA  . LEU A 1  1516 ? 202.037 211.848 220.159 1.00 413.42 ?  1516 LEU A CA  1 
ATOM   8108  C  C   . LEU A 1  1516 ? 202.731 212.035 218.797 1.00 414.96 ?  1516 LEU A C   1 
ATOM   8109  O  O   . LEU A 1  1516 ? 203.745 212.748 218.692 1.00 411.43 ?  1516 LEU A O   1 
ATOM   8110  C  CB  . LEU A 1  1516 ? 202.505 210.540 220.839 1.00 393.33 ?  1516 LEU A CB  1 
ATOM   8111  C  CG  . LEU A 1  1516 ? 203.970 210.056 220.727 1.00 373.18 ?  1516 LEU A CG  1 
ATOM   8112  C  CD1 . LEU A 1  1516 ? 204.974 210.994 221.391 1.00 343.52 ?  1516 LEU A CD1 1 
ATOM   8113  C  CD2 . LEU A 1  1516 ? 204.127 208.647 221.278 1.00 364.90 ?  1516 LEU A CD2 1 
ATOM   8114  N  N   . SER A 1  1517 ? 202.186 211.385 217.767 1.00 405.77 ?  1517 SER A N   1 
ATOM   8115  C  CA  . SER A 1  1517 ? 202.643 211.577 216.387 1.00 361.67 ?  1517 SER A CA  1 
ATOM   8116  C  C   . SER A 1  1517 ? 202.493 213.054 215.938 1.00 337.86 ?  1517 SER A C   1 
ATOM   8117  O  O   . SER A 1  1517 ? 203.378 213.591 215.279 1.00 367.78 ?  1517 SER A O   1 
ATOM   8118  C  CB  . SER A 1  1517 ? 201.930 210.599 215.442 1.00 348.16 ?  1517 SER A CB  1 
ATOM   8119  O  OG  . SER A 1  1517 ? 202.237 209.247 215.777 1.00 332.60 ?  1517 SER A OG  1 
ATOM   8120  N  N   . VAL A 1  1518 ? 201.409 213.703 216.375 1.00 274.55 ?  1518 VAL A N   1 
ATOM   8121  C  CA  . VAL A 1  1518 ? 201.063 215.110 216.063 1.00 181.54 ?  1518 VAL A CA  1 
ATOM   8122  C  C   . VAL A 1  1518 ? 201.871 216.229 216.813 1.00 154.85 ?  1518 VAL A C   1 
ATOM   8123  O  O   . VAL A 1  1518 ? 202.229 217.231 216.204 1.00 121.64 ?  1518 VAL A O   1 
ATOM   8124  C  CB  . VAL A 1  1518 ? 199.534 215.272 216.145 1.00 162.39 ?  1518 VAL A CB  1 
ATOM   8125  C  CG1 . VAL A 1  1518 ? 199.151 216.661 216.594 1.00 161.51 ?  1518 VAL A CG1 1 
ATOM   8126  C  CG2 . VAL A 1  1518 ? 198.890 214.885 214.811 1.00 154.80 ?  1518 VAL A CG2 1 
ATOM   8127  N  N   . VAL A 1  1519 ? 202.168 216.060 218.104 1.00 137.20 ?  1519 VAL A N   1 
ATOM   8128  C  CA  . VAL A 1  1519 ? 203.287 216.795 218.753 1.00 153.88 ?  1519 VAL A CA  1 
ATOM   8129  C  C   . VAL A 1  1519 ? 204.665 216.756 218.053 1.00 161.31 ?  1519 VAL A C   1 
ATOM   8130  O  O   . VAL A 1  1519 ? 205.254 217.811 217.767 1.00 150.97 ?  1519 VAL A O   1 
ATOM   8131  C  CB  . VAL A 1  1519 ? 203.509 216.372 220.229 1.00 191.49 ?  1519 VAL A CB  1 
ATOM   8132  C  CG1 . VAL A 1  1519 ? 204.221 215.012 220.378 1.00 152.41 ?  1519 VAL A CG1 1 
ATOM   8133  C  CG2 . VAL A 1  1519 ? 204.308 217.457 220.931 1.00 222.43 ?  1519 VAL A CG2 1 
ATOM   8134  N  N   . LEU A 1  1520 ? 205.172 215.534 217.857 1.00 162.02 ?  1520 LEU A N   1 
ATOM   8135  C  CA  . LEU A 1  1520 ? 206.449 215.240 217.204 1.00 155.03 ?  1520 LEU A CA  1 
ATOM   8136  C  C   . LEU A 1  1520 ? 206.582 215.733 215.729 1.00 164.10 ?  1520 LEU A C   1 
ATOM   8137  O  O   . LEU A 1  1520 ? 207.640 216.227 215.347 1.00 110.44 ?  1520 LEU A O   1 
ATOM   8138  C  CB  . LEU A 1  1520 ? 206.705 213.742 217.288 1.00 130.26 ?  1520 LEU A CB  1 
ATOM   8139  C  CG  . LEU A 1  1520 ? 207.586 213.240 216.158 1.00 119.89 ?  1520 LEU A CG  1 
ATOM   8140  C  CD1 . LEU A 1  1520 ? 209.032 213.197 216.637 1.00 115.86 ?  1520 LEU A CD1 1 
ATOM   8141  C  CD2 . LEU A 1  1520 ? 207.041 211.919 215.643 1.00 129.46 ?  1520 LEU A CD2 1 
ATOM   8142  N  N   . LEU A 1  1521 ? 205.523 215.568 214.918 1.00 230.30 ?  1521 LEU A N   1 
ATOM   8143  C  CA  . LEU A 1  1521 ? 205.458 216.095 213.523 1.00 221.98 ?  1521 LEU A CA  1 
ATOM   8144  C  C   . LEU A 1  1521 ? 205.594 217.615 213.504 1.00 156.83 ?  1521 LEU A C   1 
ATOM   8145  O  O   . LEU A 1  1521 ? 206.289 218.178 212.672 1.00 128.93 ?  1521 LEU A O   1 
ATOM   8146  C  CB  . LEU A 1  1521 ? 204.139 215.705 212.810 1.00 270.95 ?  1521 LEU A CB  1 
ATOM   8147  C  CG  . LEU A 1  1521 ? 203.948 214.398 212.010 1.00 281.59 ?  1521 LEU A CG  1 
ATOM   8148  C  CD1 . LEU A 1  1521 ? 202.479 214.228 211.623 1.00 268.00 ?  1521 LEU A CD1 1 
ATOM   8149  C  CD2 . LEU A 1  1521 ? 204.852 214.285 210.778 1.00 285.72 ?  1521 LEU A CD2 1 
ATOM   8150  N  N   . SER A 1  1522 ? 204.906 218.255 214.443 1.00 135.84 ?  1522 SER A N   1 
ATOM   8151  C  CA  . SER A 1  1522 ? 205.034 219.663 214.683 1.00 138.25 ?  1522 SER A CA  1 
ATOM   8152  C  C   . SER A 1  1522 ? 206.494 219.904 214.876 1.00 117.56 ?  1522 SER A C   1 
ATOM   8153  O  O   . SER A 1  1522 ? 207.054 220.802 214.264 1.00 126.52 ?  1522 SER A O   1 
ATOM   8154  C  CB  . SER A 1  1522 ? 204.285 220.070 215.958 1.00 161.95 ?  1522 SER A CB  1 
ATOM   8155  O  OG  . SER A 1  1522 ? 202.954 219.603 215.944 1.00 194.33 ?  1522 SER A OG  1 
ATOM   8156  N  N   . LEU A 1  1523 ? 207.106 219.055 215.696 1.00 114.58 ?  1523 LEU A N   1 
ATOM   8157  C  CA  . LEU A 1  1523 ? 208.475 219.239 216.139 1.00 147.94 ?  1523 LEU A CA  1 
ATOM   8158  C  C   . LEU A 1  1523 ? 209.443 219.110 214.972 1.00 156.20 ?  1523 LEU A C   1 
ATOM   8159  O  O   . LEU A 1  1523 ? 210.388 219.912 214.844 1.00 162.12 ?  1523 LEU A O   1 
ATOM   8160  C  CB  . LEU A 1  1523 ? 208.813 218.233 217.234 1.00 159.23 ?  1523 LEU A CB  1 
ATOM   8161  C  CG  . LEU A 1  1523 ? 209.590 218.681 218.462 1.00 171.90 ?  1523 LEU A CG  1 
ATOM   8162  C  CD1 . LEU A 1  1523 ? 209.726 217.478 219.375 1.00 193.21 ?  1523 LEU A CD1 1 
ATOM   8163  C  CD2 . LEU A 1  1523 ? 210.953 219.228 218.093 1.00 185.43 ?  1523 LEU A CD2 1 
ATOM   8164  N  N   . ALA A 1  1524 ? 209.207 218.107 214.126 1.00 157.91 ?  1524 ALA A N   1 
ATOM   8165  C  CA  . ALA A 1  1524 ? 209.980 217.963 212.903 1.00 158.37 ?  1524 ALA A CA  1 
ATOM   8166  C  C   . ALA A 1  1524 ? 209.725 219.210 212.070 1.00 153.90 ?  1524 ALA A C   1 
ATOM   8167  O  O   . ALA A 1  1524 ? 210.645 219.981 211.826 1.00 166.69 ?  1524 ALA A O   1 
ATOM   8168  C  CB  . ALA A 1  1524 ? 209.615 216.692 212.153 1.00 137.29 ?  1524 ALA A CB  1 
ATOM   8169  N  N   . MET A 1  1525 ? 208.463 219.448 211.730 1.00 140.10 ?  1525 MET A N   1 
ATOM   8170  C  CA  . MET A 1  1525 ? 208.066 220.608 210.953 1.00 149.09 ?  1525 MET A CA  1 
ATOM   8171  C  C   . MET A 1  1525 ? 208.729 221.917 211.389 1.00 151.42 ?  1525 MET A C   1 
ATOM   8172  O  O   . MET A 1  1525 ? 209.172 222.670 210.526 1.00 162.67 ?  1525 MET A O   1 
ATOM   8173  C  CB  . MET A 1  1525 ? 206.561 220.778 211.013 1.00 167.15 ?  1525 MET A CB  1 
ATOM   8174  C  CG  . MET A 1  1525 ? 205.885 221.053 209.686 1.00 168.44 ?  1525 MET A CG  1 
ATOM   8175  S  SD  . MET A 1  1525 ? 204.127 221.383 209.938 1.00 199.11 ?  1525 MET A SD  1 
ATOM   8176  C  CE  . MET A 1  1525 ? 203.581 220.108 211.102 1.00 175.39 ?  1525 MET A CE  1 
ATOM   8177  N  N   . VAL A 1  1526 ? 208.811 222.199 212.696 1.00 152.16 ?  1526 VAL A N   1 
ATOM   8178  C  CA  . VAL A 1  1526 ? 209.385 223.489 213.116 1.00 165.98 ?  1526 VAL A CA  1 
ATOM   8179  C  C   . VAL A 1  1526 ? 210.851 223.536 212.775 1.00 148.20 ?  1526 VAL A C   1 
ATOM   8180  O  O   . VAL A 1  1526 ? 211.322 224.528 212.236 1.00 159.75 ?  1526 VAL A O   1 
ATOM   8181  C  CB  . VAL A 1  1526 ? 209.154 223.928 214.597 1.00 194.71 ?  1526 VAL A CB  1 
ATOM   8182  C  CG1 . VAL A 1  1526 ? 207.676 224.025 214.941 1.00 217.18 ?  1526 VAL A CG1 1 
ATOM   8183  C  CG2 . VAL A 1  1526 ? 209.907 223.061 215.598 1.00 236.05 ?  1526 VAL A CG2 1 
ATOM   8184  N  N   . MET A 1  1527 ? 211.557 222.453 213.066 1.00 135.15 ?  1527 MET A N   1 
ATOM   8185  C  CA  . MET A 1  1527 ? 212.951 222.398 212.705 1.00 166.06 ?  1527 MET A CA  1 
ATOM   8186  C  C   . MET A 1  1527 ? 213.191 221.326 211.662 1.00 174.19 ?  1527 MET A C   1 
ATOM   8187  O  O   . MET A 1  1527 ? 213.859 220.296 211.897 1.00 141.77 ?  1527 MET A O   1 
ATOM   8188  C  CB  . MET A 1  1527 ? 213.853 222.307 213.919 1.00 176.02 ?  1527 MET A CB  1 
ATOM   8189  C  CG  . MET A 1  1527 ? 213.436 221.318 214.975 1.00 195.27 ?  1527 MET A CG  1 
ATOM   8190  S  SD  . MET A 1  1527 ? 214.969 220.855 215.774 1.00 262.61 ?  1527 MET A SD  1 
ATOM   8191  C  CE  . MET A 1  1527 ? 215.496 222.405 216.524 1.00 261.17 ?  1527 MET A CE  1 
ATOM   8192  N  N   . ALA A 1  1528 ? 212.592 221.614 210.503 1.00 176.12 ?  1528 ALA A N   1 
ATOM   8193  C  CA  . ALA A 1  1528 ? 212.602 220.761 209.331 1.00 166.47 ?  1528 ALA A CA  1 
ATOM   8194  C  C   . ALA A 1  1528 ? 213.763 221.107 208.438 1.00 150.88 ?  1528 ALA A C   1 
ATOM   8195  O  O   . ALA A 1  1528 ? 214.142 222.285 208.284 1.00 139.00 ?  1528 ALA A O   1 
ATOM   8196  C  CB  . ALA A 1  1528 ? 211.291 220.875 208.563 1.00 140.54 ?  1528 ALA A CB  1 
ATOM   8197  N  N   . GLY A 1  1529 ? 214.324 220.055 207.855 1.00 122.20 ?  1529 GLY A N   1 
ATOM   8198  C  CA  . GLY A 1  1529 ? 215.370 220.201 206.887 1.00 120.14 ?  1529 GLY A CA  1 
ATOM   8199  C  C   . GLY A 1  1529 ? 216.671 220.210 207.622 1.00 138.04 ?  1529 GLY A C   1 
ATOM   8200  O  O   . GLY A 1  1529 ? 217.669 219.765 207.076 1.00 165.89 ?  1529 GLY A O   1 
ATOM   8201  N  N   . SER A 1  1530 ? 216.671 220.710 208.859 1.00 145.97 ?  1530 SER A N   1 
ATOM   8202  C  CA  . SER A 1  1530 ? 217.850 220.575 209.717 1.00 177.11 ?  1530 SER A CA  1 
ATOM   8203  C  C   . SER A 1  1530 ? 217.702 219.356 210.621 1.00 172.78 ?  1530 SER A C   1 
ATOM   8204  O  O   . SER A 1  1530 ? 216.794 219.290 211.480 1.00 175.24 ?  1530 SER A O   1 
ATOM   8205  C  CB  . SER A 1  1530 ? 218.114 221.846 210.518 1.00 196.25 ?  1530 SER A CB  1 
ATOM   8206  O  OG  . SER A 1  1530 ? 216.944 222.246 211.201 1.00 203.34 ?  1530 SER A OG  1 
ATOM   8207  N  N   . GLY A 1  1531 ? 218.577 218.378 210.377 1.00 146.32 ?  1531 GLY A N   1 
ATOM   8208  C  CA  . GLY A 1  1531 ? 218.592 217.147 211.133 1.00 139.16 ?  1531 GLY A CA  1 
ATOM   8209  C  C   . GLY A 1  1531 ? 218.998 217.547 212.521 1.00 164.62 ?  1531 GLY A C   1 
ATOM   8210  O  O   . GLY A 1  1531 ? 219.866 218.402 212.691 1.00 198.55 ?  1531 GLY A O   1 
ATOM   8211  N  N   . ASN A 1  1532 ? 218.333 216.977 213.511 1.00 169.45 ?  1532 ASN A N   1 
ATOM   8212  C  CA  . ASN A 1  1532 ? 218.625 217.309 214.883 1.00 174.50 ?  1532 ASN A CA  1 
ATOM   8213  C  C   . ASN A 1  1532 ? 218.721 216.059 215.724 1.00 180.16 ?  1532 ASN A C   1 
ATOM   8214  O  O   . ASN A 1  1532 ? 217.714 215.362 215.896 1.00 198.95 ?  1532 ASN A O   1 
ATOM   8215  C  CB  . ASN A 1  1532 ? 217.553 218.244 215.436 1.00 168.00 ?  1532 ASN A CB  1 
ATOM   8216  C  CG  . ASN A 1  1532 ? 217.983 218.903 216.726 1.00 210.31 ?  1532 ASN A CG  1 
ATOM   8217  O  OD1 . ASN A 1  1532 ? 219.179 218.986 217.036 1.00 228.30 ?  1532 ASN A OD1 1 
ATOM   8218  N  ND2 . ASN A 1  1532 ? 217.013 219.373 217.494 1.00 245.85 ?  1532 ASN A ND2 1 
ATOM   8219  N  N   . LEU A 1  1533 ? 219.919 215.780 216.254 1.00 160.67 ?  1533 LEU A N   1 
ATOM   8220  C  CA  . LEU A 1  1533 ? 220.108 214.619 217.125 1.00 169.33 ?  1533 LEU A CA  1 
ATOM   8221  C  C   . LEU A 1  1533 ? 218.997 214.490 218.171 1.00 179.37 ?  1533 LEU A C   1 
ATOM   8222  O  O   . LEU A 1  1533 ? 218.563 213.383 218.456 1.00 180.40 ?  1533 LEU A O   1 
ATOM   8223  C  CB  . LEU A 1  1533 ? 221.495 214.578 217.779 1.00 178.12 ?  1533 LEU A CB  1 
ATOM   8224  C  CG  . LEU A 1  1533 ? 222.129 215.663 218.672 1.00 228.62 ?  1533 LEU A CG  1 
ATOM   8225  C  CD1 . LEU A 1  1533 ? 221.434 215.949 219.999 1.00 241.90 ?  1533 LEU A CD1 1 
ATOM   8226  C  CD2 . LEU A 1  1533 ? 223.570 215.258 218.958 1.00 254.32 ?  1533 LEU A CD2 1 
ATOM   8227  N  N   . LYS A 1  1534 ? 218.534 215.632 218.698 1.00 180.13 ?  1534 LYS A N   1 
ATOM   8228  C  CA  . LYS A 1  1534 ? 217.419 215.717 219.660 1.00 172.53 ?  1534 LYS A CA  1 
ATOM   8229  C  C   . LYS A 1  1534 ? 216.149 215.056 219.130 1.00 148.56 ?  1534 LYS A C   1 
ATOM   8230  O  O   . LYS A 1  1534 ? 215.560 214.168 219.774 1.00 119.00 ?  1534 LYS A O   1 
ATOM   8231  C  CB  . LYS A 1  1534 ? 217.097 217.189 219.994 1.00 171.65 ?  1534 LYS A CB  1 
ATOM   8232  C  CG  . LYS A 1  1534 ? 218.054 217.891 220.938 1.00 168.38 ?  1534 LYS A CG  1 
ATOM   8233  C  CD  . LYS A 1  1534 ? 217.563 217.824 222.375 1.00 177.52 ?  1534 LYS A CD  1 
ATOM   8234  C  CE  . LYS A 1  1534 ? 218.669 218.186 223.347 1.00 197.57 ?  1534 LYS A CE  1 
ATOM   8235  N  NZ  . LYS A 1  1534 ? 219.884 217.340 223.150 1.00 218.68 ?  1534 LYS A NZ  1 
ATOM   8236  N  N   . VAL A 1  1535 ? 215.732 215.511 217.953 1.00 141.12 ?  1535 VAL A N   1 
ATOM   8237  C  CA  . VAL A 1  1535 ? 214.445 215.095 217.412 1.00 155.92 ?  1535 VAL A CA  1 
ATOM   8238  C  C   . VAL A 1  1535 ? 214.644 213.760 216.737 1.00 152.57 ?  1535 VAL A C   1 
ATOM   8239  O  O   . VAL A 1  1535 ? 213.755 212.910 216.761 1.00 168.69 ?  1535 VAL A O   1 
ATOM   8240  C  CB  . VAL A 1  1535 ? 213.814 216.115 216.427 1.00 149.49 ?  1535 VAL A CB  1 
ATOM   8241  C  CG1 . VAL A 1  1535 ? 212.295 215.884 216.290 1.00 120.59 ?  1535 VAL A CG1 1 
ATOM   8242  C  CG2 . VAL A 1  1535 ? 214.127 217.553 216.847 1.00 133.32 ?  1535 VAL A CG2 1 
ATOM   8243  N  N   . LEU A 1  1536 ? 215.820 213.581 216.153 1.00 147.45 ?  1536 LEU A N   1 
ATOM   8244  C  CA  . LEU A 1  1536 ? 216.127 212.338 215.504 1.00 150.03 ?  1536 LEU A CA  1 
ATOM   8245  C  C   . LEU A 1  1536 ? 216.179 211.246 216.563 1.00 164.26 ?  1536 LEU A C   1 
ATOM   8246  O  O   . LEU A 1  1536 ? 215.599 210.178 216.337 1.00 172.24 ?  1536 LEU A O   1 
ATOM   8247  C  CB  . LEU A 1  1536 ? 217.404 212.436 214.665 1.00 127.34 ?  1536 LEU A CB  1 
ATOM   8248  C  CG  . LEU A 1  1536 ? 217.878 211.360 213.680 1.00 124.19 ?  1536 LEU A CG  1 
ATOM   8249  C  CD1 . LEU A 1  1536 ? 219.228 210.815 214.134 1.00 136.67 ?  1536 LEU A CD1 1 
ATOM   8250  C  CD2 . LEU A 1  1536 ? 216.921 210.206 213.414 1.00 134.61 ?  1536 LEU A CD2 1 
ATOM   8251  N  N   . GLN A 1  1537 ? 216.820 211.487 217.714 1.00 142.83 ?  1537 GLN A N   1 
ATOM   8252  C  CA  . GLN A 1  1537 ? 216.917 210.379 218.670 1.00 170.64 ?  1537 GLN A CA  1 
ATOM   8253  C  C   . GLN A 1  1537 ? 215.529 210.014 219.185 1.00 185.61 ?  1537 GLN A C   1 
ATOM   8254  O  O   . GLN A 1  1537 ? 215.236 208.836 219.409 1.00 211.43 ?  1537 GLN A O   1 
ATOM   8255  C  CB  . GLN A 1  1537 ? 217.984 210.543 219.764 1.00 161.08 ?  1537 GLN A CB  1 
ATOM   8256  C  CG  . GLN A 1  1537 ? 217.808 211.691 220.747 1.00 195.97 ?  1537 GLN A CG  1 
ATOM   8257  C  CD  . GLN A 1  1537 ? 219.086 211.968 221.532 1.00 203.50 ?  1537 GLN A CD  1 
ATOM   8258  O  OE1 . GLN A 1  1537 ? 219.966 211.114 221.600 1.00 214.44 ?  1537 GLN A OE1 1 
ATOM   8259  N  NE2 . GLN A 1  1537 ? 219.191 213.162 222.133 1.00 185.33 ?  1537 GLN A NE2 1 
ATOM   8260  N  N   . LEU A 1  1538 ? 214.675 211.034 219.280 1.00 177.40 ?  1538 LEU A N   1 
ATOM   8261  C  CA  . LEU A 1  1538 ? 213.264 210.899 219.628 1.00 175.52 ?  1538 LEU A CA  1 
ATOM   8262  C  C   . LEU A 1  1538 ? 212.495 210.064 218.595 1.00 162.95 ?  1538 LEU A C   1 
ATOM   8263  O  O   . LEU A 1  1538 ? 211.693 209.193 218.969 1.00 157.74 ?  1538 LEU A O   1 
ATOM   8264  C  CB  . LEU A 1  1538 ? 212.691 212.300 219.727 1.00 182.58 ?  1538 LEU A CB  1 
ATOM   8265  C  CG  . LEU A 1  1538 ? 211.387 212.708 220.380 1.00 194.96 ?  1538 LEU A CG  1 
ATOM   8266  C  CD1 . LEU A 1  1538 ? 211.138 214.127 219.881 1.00 188.71 ?  1538 LEU A CD1 1 
ATOM   8267  C  CD2 . LEU A 1  1538 ? 210.216 211.785 220.051 1.00 185.02 ?  1538 LEU A CD2 1 
ATOM   8268  N  N   . CYS A 1  1539 ? 212.753 210.357 217.314 1.00 173.19 ?  1539 CYS A N   1 
ATOM   8269  C  CA  . CYS A 1  1539 ? 212.227 209.616 216.163 1.00 173.57 ?  1539 CYS A CA  1 
ATOM   8270  C  C   . CYS A 1  1539 ? 212.737 208.203 216.118 1.00 179.99 ?  1539 CYS A C   1 
ATOM   8271  O  O   . CYS A 1  1539 ? 211.961 207.301 215.824 1.00 201.77 ?  1539 CYS A O   1 
ATOM   8272  C  CB  . CYS A 1  1539 ? 212.649 210.268 214.849 1.00 186.95 ?  1539 CYS A CB  1 
ATOM   8273  S  SG  . CYS A 1  1539 ? 211.416 211.281 214.032 1.00 211.29 ?  1539 CYS A SG  1 
ATOM   8274  N  N   . ARG A 1  1540 ? 214.040 208.031 216.368 1.00 147.38 ?  1540 ARG A N   1 
ATOM   8275  C  CA  . ARG A 1  1540 ? 214.704 206.731 216.324 1.00 164.75 ?  1540 ARG A CA  1 
ATOM   8276  C  C   . ARG A 1  1540 ? 214.094 205.784 217.364 1.00 178.18 ?  1540 ARG A C   1 
ATOM   8277  O  O   . ARG A 1  1540 ? 213.662 204.683 217.015 1.00 199.33 ?  1540 ARG A O   1 
ATOM   8278  C  CB  . ARG A 1  1540 ? 216.218 206.900 216.485 1.00 193.51 ?  1540 ARG A CB  1 
ATOM   8279  C  CG  . ARG A 1  1540 ? 217.068 205.632 216.423 1.00 255.31 ?  1540 ARG A CG  1 
ATOM   8280  C  CD  . ARG A 1  1540 ? 217.767 205.370 217.754 1.00 250.55 ?  1540 ARG A CD  1 
ATOM   8281  N  NE  . ARG A 1  1540 ? 219.162 204.914 217.629 1.00 217.60 ?  1540 ARG A NE  1 
ATOM   8282  C  CZ  . ARG A 1  1540 ? 220.219 205.685 217.339 1.00 212.45 ?  1540 ARG A CZ  1 
ATOM   8283  N  NH1 . ARG A 1  1540 ? 220.109 206.998 217.105 1.00 172.71 ?  1540 ARG A NH1 1 
ATOM   8284  N  NH2 . ARG A 1  1540 ? 221.422 205.134 217.297 1.00 219.67 ?  1540 ARG A NH2 1 
ATOM   8285  N  N   . PHE A 1  1541 ? 214.029 206.236 218.616 1.00 186.55 ?  1541 PHE A N   1 
ATOM   8286  C  CA  . PHE A 1  1541 ? 213.244 205.588 219.686 1.00 226.47 ?  1541 PHE A CA  1 
ATOM   8287  C  C   . PHE A 1  1541 ? 211.856 205.031 219.294 1.00 224.78 ?  1541 PHE A C   1 
ATOM   8288  O  O   . PHE A 1  1541 ? 211.543 203.879 219.594 1.00 243.77 ?  1541 PHE A O   1 
ATOM   8289  C  CB  . PHE A 1  1541 ? 213.074 206.557 220.861 1.00 244.42 ?  1541 PHE A CB  1 
ATOM   8290  C  CG  . PHE A 1  1541 ? 212.060 206.110 221.866 1.00 236.06 ?  1541 PHE A CG  1 
ATOM   8291  C  CD1 . PHE A 1  1541 ? 212.361 205.072 222.757 1.00 251.12 ?  1541 PHE A CD1 1 
ATOM   8292  C  CD2 . PHE A 1  1541 ? 210.802 206.711 221.917 1.00 216.18 ?  1541 PHE A CD2 1 
ATOM   8293  C  CE1 . PHE A 1  1541 ? 211.424 204.645 223.684 1.00 280.44 ?  1541 PHE A CE1 1 
ATOM   8294  C  CE2 . PHE A 1  1541 ? 209.862 206.284 222.839 1.00 265.64 ?  1541 PHE A CE2 1 
ATOM   8295  C  CZ  . PHE A 1  1541 ? 210.171 205.253 223.725 1.00 290.19 ?  1541 PHE A CZ  1 
ATOM   8296  N  N   . LEU A 1  1542 ? 211.032 205.867 218.667 1.00 194.38 ?  1542 LEU A N   1 
ATOM   8297  C  CA  . LEU A 1  1542 ? 209.721 205.464 218.180 1.00 187.84 ?  1542 LEU A CA  1 
ATOM   8298  C  C   . LEU A 1  1542 ? 209.785 204.417 217.062 1.00 192.96 ?  1542 LEU A C   1 
ATOM   8299  O  O   . LEU A 1  1542 ? 209.065 203.418 217.101 1.00 189.46 ?  1542 LEU A O   1 
ATOM   8300  C  CB  . LEU A 1  1542 ? 208.966 206.689 217.690 1.00 199.56 ?  1542 LEU A CB  1 
ATOM   8301  C  CG  . LEU A 1  1542 ? 208.553 207.748 218.703 1.00 231.68 ?  1542 LEU A CG  1 
ATOM   8302  C  CD1 . LEU A 1  1542 ? 208.280 209.024 217.932 1.00 246.48 ?  1542 LEU A CD1 1 
ATOM   8303  C  CD2 . LEU A 1  1542 ? 207.323 207.311 219.492 1.00 253.68 ?  1542 LEU A CD2 1 
ATOM   8304  N  N   . HIS A 1  1543 ? 210.643 204.662 216.070 1.00 193.97 ?  1543 HIS A N   1 
ATOM   8305  C  CA  . HIS A 1  1543 ? 210.866 203.752 214.946 1.00 190.06 ?  1543 HIS A CA  1 
ATOM   8306  C  C   . HIS A 1  1543 ? 211.262 202.366 215.452 1.00 192.60 ?  1543 HIS A C   1 
ATOM   8307  O  O   . HIS A 1  1543 ? 210.744 201.369 214.948 1.00 250.40 ?  1543 HIS A O   1 
ATOM   8308  C  CB  . HIS A 1  1543 ? 211.899 204.357 213.973 1.00 228.41 ?  1543 HIS A CB  1 
ATOM   8309  C  CG  . HIS A 1  1543 ? 212.625 203.357 213.118 1.00 293.90 ?  1543 HIS A CG  1 
ATOM   8310  N  ND1 . HIS A 1  1543 ? 213.992 203.189 213.170 1.00 330.68 ?  1543 HIS A ND1 1 
ATOM   8311  C  CD2 . HIS A 1  1543 ? 212.178 202.485 212.184 1.00 339.24 ?  1543 HIS A CD2 1 
ATOM   8312  C  CE1 . HIS A 1  1543 ? 214.354 202.255 212.307 1.00 362.64 ?  1543 HIS A CE1 1 
ATOM   8313  N  NE2 . HIS A 1  1543 ? 213.272 201.812 211.695 1.00 373.19 ?  1543 HIS A NE2 1 
ATOM   8314  N  N   . MET A 1  1544 ? 212.146 202.306 216.452 1.00 166.76 ?  1544 MET A N   1 
ATOM   8315  C  CA  . MET A 1  1544 ? 212.523 201.042 217.080 1.00 160.84 ?  1544 MET A CA  1 
ATOM   8316  C  C   . MET A 1  1544 ? 211.355 200.372 217.803 1.00 186.58 ?  1544 MET A C   1 
ATOM   8317  O  O   . MET A 1  1544 ? 211.362 199.154 217.907 1.00 236.28 ?  1544 MET A O   1 
ATOM   8318  C  CB  . MET A 1  1544 ? 213.644 201.226 218.090 1.00 166.56 ?  1544 MET A CB  1 
ATOM   8319  C  CG  . MET A 1  1544 ? 214.918 201.833 217.560 1.00 196.53 ?  1544 MET A CG  1 
ATOM   8320  S  SD  . MET A 1  1544 ? 215.976 200.657 216.717 1.00 246.46 ?  1544 MET A SD  1 
ATOM   8321  C  CE  . MET A 1  1544 ? 217.587 201.433 216.977 1.00 217.97 ?  1544 MET A CE  1 
ATOM   8322  N  N   . LYS A 1  1545 ? 210.372 201.143 218.291 1.00 183.90 ?  1545 LYS A N   1 
ATOM   8323  C  CA  . LYS A 1  1545 ? 209.266 200.619 219.123 1.00 225.98 ?  1545 LYS A CA  1 
ATOM   8324  C  C   . LYS A 1  1545 ? 208.445 199.440 218.544 1.00 313.66 ?  1545 LYS A C   1 
ATOM   8325  O  O   . LYS A 1  1545 ? 208.355 198.391 219.192 1.00 383.82 ?  1545 LYS A O   1 
ATOM   8326  C  CB  . LYS A 1  1545 ? 208.332 201.746 219.567 1.00 199.51 ?  1545 LYS A CB  1 
ATOM   8327  C  CG  . LYS A 1  1545 ? 208.848 202.593 220.716 1.00 214.88 ?  1545 LYS A CG  1 
ATOM   8328  C  CD  . LYS A 1  1545 ? 207.873 203.721 221.042 1.00 266.83 ?  1545 LYS A CD  1 
ATOM   8329  C  CE  . LYS A 1  1545 ? 206.924 203.380 222.192 1.00 305.37 ?  1545 LYS A CE  1 
ATOM   8330  N  NZ  . LYS A 1  1545 ? 205.828 204.379 222.413 1.00 305.42 ?  1545 LYS A NZ  1 
ATOM   8331  N  N   . THR A 1  1546 ? 207.867 199.610 217.348 1.00 370.46 ?  1546 THR A N   1 
ATOM   8332  C  CA  . THR A 1  1546 ? 207.035 198.575 216.658 1.00 397.52 ?  1546 THR A CA  1 
ATOM   8333  C  C   . THR A 1  1546 ? 206.018 197.862 217.592 1.00 410.83 ?  1546 THR A C   1 
ATOM   8334  O  O   . THR A 1  1546 ? 205.366 198.514 218.411 1.00 412.45 ?  1546 THR A O   1 
ATOM   8335  C  CB  . THR A 1  1546 ? 207.880 197.546 215.831 1.00 406.04 ?  1546 THR A CB  1 
ATOM   8336  O  OG1 . THR A 1  1546 ? 208.385 196.503 216.679 1.00 409.48 ?  1546 THR A OG1 1 
ATOM   8337  C  CG2 . THR A 1  1546 ? 209.043 198.212 215.096 1.00 413.65 ?  1546 THR A CG2 1 
ATOM   8338  N  N   . GLY A 1  1547 ? 205.899 196.538 217.462 1.00 416.96 ?  1547 GLY A N   1 
ATOM   8339  C  CA  . GLY A 1  1547 ? 205.068 195.703 218.342 1.00 424.14 ?  1547 GLY A CA  1 
ATOM   8340  C  C   . GLY A 1  1547 ? 203.572 195.768 218.084 1.00 433.15 ?  1547 GLY A C   1 
ATOM   8341  O  O   . GLY A 1  1547 ? 203.138 195.964 216.943 1.00 459.14 ?  1547 GLY A O   1 
ATOM   8342  N  N   . GLY A 1  1548 ? 202.792 195.581 219.154 1.00 408.73 ?  1548 GLY A N   1 
ATOM   8343  C  CA  . GLY A 1  1548 ? 201.323 195.709 219.136 1.00 343.65 ?  1548 GLY A CA  1 
ATOM   8344  C  C   . GLY A 1  1548 ? 200.870 197.107 219.533 1.00 316.78 ?  1548 GLY A C   1 
ATOM   8345  O  O   . GLY A 1  1548 ? 201.578 197.807 220.268 1.00 361.58 ?  1548 GLY A O   1 
ATOM   8346  N  N   . GLU A 1  1549 ? 199.693 197.509 219.045 1.00 245.80 ?  1549 GLU A N   1 
ATOM   8347  C  CA  . GLU A 1  1549 ? 199.158 198.884 219.185 1.00 189.89 ?  1549 GLU A CA  1 
ATOM   8348  C  C   . GLU A 1  1549 ? 199.987 199.951 218.465 1.00 149.95 ?  1549 GLU A C   1 
ATOM   8349  O  O   . GLU A 1  1549 ? 199.867 201.135 218.736 1.00 172.41 ?  1549 GLU A O   1 
ATOM   8350  C  CB  . GLU A 1  1549 ? 198.922 199.270 220.660 1.00 197.34 ?  1549 GLU A CB  1 
ATOM   8351  N  N   . MET A 1  1550 ? 200.821 199.529 217.540 1.00 143.19 ?  1550 MET A N   1 
ATOM   8352  C  CA  . MET A 1  1550 ? 201.557 200.459 216.727 1.00 217.19 ?  1550 MET A CA  1 
ATOM   8353  C  C   . MET A 1  1550 ? 201.279 200.053 215.287 1.00 280.21 ?  1550 MET A C   1 
ATOM   8354  O  O   . MET A 1  1550 ? 202.066 199.325 214.666 1.00 323.90 ?  1550 MET A O   1 
ATOM   8355  C  CB  . MET A 1  1550 ? 203.045 200.403 217.081 1.00 246.16 ?  1550 MET A CB  1 
ATOM   8356  C  CG  . MET A 1  1550 ? 203.807 201.698 216.838 1.00 298.98 ?  1550 MET A CG  1 
ATOM   8357  S  SD  . MET A 1  1550 ? 203.497 202.988 218.070 1.00 359.31 ?  1550 MET A SD  1 
ATOM   8358  C  CE  . MET A 1  1550 ? 204.528 202.444 219.432 1.00 350.68 ?  1550 MET A CE  1 
ATOM   8359  N  N   . ASN A 1  1551 ? 200.133 200.506 214.774 1.00 347.23 ?  1551 ASN A N   1 
ATOM   8360  C  CA  . ASN A 1  1551 ? 199.666 200.143 213.424 1.00 397.54 ?  1551 ASN A CA  1 
ATOM   8361  C  C   . ASN A 1  1551 ? 200.462 200.791 212.275 1.00 417.90 ?  1551 ASN A C   1 
ATOM   8362  O  O   . ASN A 1  1551 ? 201.351 201.621 212.518 1.00 450.60 ?  1551 ASN A O   1 
ATOM   8363  C  CB  . ASN A 1  1551 ? 198.140 200.365 213.282 1.00 422.76 ?  1551 ASN A CB  1 
ATOM   8364  C  CG  . ASN A 1  1551 ? 197.738 201.839 213.242 1.00 437.15 ?  1551 ASN A CG  1 
ATOM   8365  O  OD1 . ASN A 1  1551 ? 198.411 202.712 213.794 1.00 445.42 ?  1551 ASN A OD1 1 
ATOM   8366  N  ND2 . ASN A 1  1551 ? 196.612 202.114 212.590 1.00 448.54 ?  1551 ASN A ND2 1 
ATOM   8367  N  N   . TYR A 1  1552 ? 200.142 200.400 211.037 1.00 407.92 ?  1552 TYR A N   1 
ATOM   8368  C  CA  . TYR A 1  1552 ? 200.764 200.963 209.831 1.00 408.24 ?  1552 TYR A CA  1 
ATOM   8369  C  C   . TYR A 1  1552 ? 200.749 202.502 209.800 1.00 421.19 ?  1552 TYR A C   1 
ATOM   8370  O  O   . TYR A 1  1552 ? 201.761 203.122 209.455 1.00 437.71 ?  1552 TYR A O   1 
ATOM   8371  C  CB  . TYR A 1  1552 ? 200.125 200.382 208.553 1.00 393.72 ?  1552 TYR A CB  1 
ATOM   8372  C  CG  . TYR A 1  1552 ? 200.386 201.215 207.313 1.00 392.33 ?  1552 TYR A CG  1 
ATOM   8373  C  CD1 . TYR A 1  1552 ? 201.616 201.145 206.644 1.00 399.33 ?  1552 TYR A CD1 1 
ATOM   8374  C  CD2 . TYR A 1  1552 ? 199.412 202.099 206.824 1.00 387.76 ?  1552 TYR A CD2 1 
ATOM   8375  C  CE1 . TYR A 1  1552 ? 201.861 201.923 205.522 1.00 402.72 ?  1552 TYR A CE1 1 
ATOM   8376  C  CE2 . TYR A 1  1552 ? 199.650 202.878 205.699 1.00 388.38 ?  1552 TYR A CE2 1 
ATOM   8377  C  CZ  . TYR A 1  1552 ? 200.874 202.784 205.053 1.00 396.98 ?  1552 TYR A CZ  1 
ATOM   8378  O  OH  . TYR A 1  1552 ? 201.122 203.553 203.942 1.00 393.73 ?  1552 TYR A OH  1 
ATOM   8379  N  N   . GLY A 1  1553 ? 199.604 203.091 210.159 1.00 422.61 ?  1553 GLY A N   1 
ATOM   8380  C  CA  . GLY A 1  1553 ? 199.407 204.546 210.183 1.00 419.09 ?  1553 GLY A CA  1 
ATOM   8381  C  C   . GLY A 1  1553 ? 200.416 205.310 211.022 1.00 425.57 ?  1553 GLY A C   1 
ATOM   8382  O  O   . GLY A 1  1553 ? 201.004 206.294 210.549 1.00 420.83 ?  1553 GLY A O   1 
ATOM   8383  N  N   . PHE A 1  1554 ? 200.630 204.849 212.256 1.00 443.82 ?  1554 PHE A N   1 
ATOM   8384  C  CA  . PHE A 1  1554 ? 201.597 205.482 213.163 1.00 453.49 ?  1554 PHE A CA  1 
ATOM   8385  C  C   . PHE A 1  1554 ? 203.034 205.378 212.657 1.00 471.53 ?  1554 PHE A C   1 
ATOM   8386  O  O   . PHE A 1  1554 ? 203.772 206.369 212.715 1.00 491.65 ?  1554 PHE A O   1 
ATOM   8387  C  CB  . PHE A 1  1554 ? 201.466 204.965 214.606 1.00 434.20 ?  1554 PHE A CB  1 
ATOM   8388  C  CG  . PHE A 1  1554 ? 200.095 205.159 215.201 1.00 405.48 ?  1554 PHE A CG  1 
ATOM   8389  C  CD1 . PHE A 1  1554 ? 199.353 206.314 214.924 1.00 402.96 ?  1554 PHE A CD1 1 
ATOM   8390  C  CD2 . PHE A 1  1554 ? 199.551 204.198 216.061 1.00 375.21 ?  1554 PHE A CD2 1 
ATOM   8391  C  CE1 . PHE A 1  1554 ? 198.089 206.486 215.462 1.00 398.31 ?  1554 PHE A CE1 1 
ATOM   8392  C  CE2 . PHE A 1  1554 ? 198.282 204.366 216.601 1.00 349.15 ?  1554 PHE A CE2 1 
ATOM   8393  C  CZ  . PHE A 1  1554 ? 197.559 205.517 216.308 1.00 377.04 ?  1554 PHE A CZ  1 
ATOM   8394  N  N   . HIS A 1  1555 ? 203.415 204.205 212.139 1.00 471.67 ?  1555 HIS A N   1 
ATOM   8395  C  CA  . HIS A 1  1555 ? 204.738 204.030 211.524 1.00 463.94 ?  1555 HIS A CA  1 
ATOM   8396  C  C   . HIS A 1  1555 ? 204.960 205.064 210.412 1.00 483.16 ?  1555 HIS A C   1 
ATOM   8397  O  O   . HIS A 1  1555 ? 206.000 205.727 210.385 1.00 491.38 ?  1555 HIS A O   1 
ATOM   8398  C  CB  . HIS A 1  1555 ? 204.962 202.588 211.037 1.00 458.05 ?  1555 HIS A CB  1 
ATOM   8399  C  CG  . HIS A 1  1555 ? 205.423 201.647 212.112 1.00 447.58 ?  1555 HIS A CG  1 
ATOM   8400  N  ND1 . HIS A 1  1555 ? 204.901 200.381 212.269 1.00 447.93 ?  1555 HIS A ND1 1 
ATOM   8401  C  CD2 . HIS A 1  1555 ? 206.360 201.788 213.082 1.00 430.80 ?  1555 HIS A CD2 1 
ATOM   8402  C  CE1 . HIS A 1  1555 ? 205.494 199.783 213.288 1.00 438.68 ?  1555 HIS A CE1 1 
ATOM   8403  N  NE2 . HIS A 1  1555 ? 206.378 200.618 213.803 1.00 436.63 ?  1555 HIS A NE2 1 
ATOM   8404  N  N   . LEU A 1  1556 ? 203.949 205.237 209.554 1.00 479.71 ?  1556 LEU A N   1 
ATOM   8405  C  CA  . LEU A 1  1556 ? 203.947 206.252 208.487 1.00 440.11 ?  1556 LEU A CA  1 
ATOM   8406  C  C   . LEU A 1  1556 ? 204.241 207.659 209.019 1.00 415.71 ?  1556 LEU A C   1 
ATOM   8407  O  O   . LEU A 1  1556 ? 205.088 208.358 208.464 1.00 413.42 ?  1556 LEU A O   1 
ATOM   8408  C  CB  . LEU A 1  1556 ? 202.643 206.164 207.659 1.00 426.23 ?  1556 LEU A CB  1 
ATOM   8409  C  CG  . LEU A 1  1556 ? 201.995 207.219 206.741 1.00 412.97 ?  1556 LEU A CG  1 
ATOM   8410  C  CD1 . LEU A 1  1556 ? 202.969 207.948 205.826 1.00 407.46 ?  1556 LEU A CD1 1 
ATOM   8411  C  CD2 . LEU A 1  1556 ? 200.898 206.557 205.917 1.00 407.82 ?  1556 LEU A CD2 1 
ATOM   8412  N  N   . ALA A 1  1557 ? 203.575 208.035 210.112 1.00 369.65 ?  1557 ALA A N   1 
ATOM   8413  C  CA  . ALA A 1  1557 ? 203.774 209.329 210.783 1.00 272.98 ?  1557 ALA A CA  1 
ATOM   8414  C  C   . ALA A 1  1557 ? 205.182 209.498 211.371 1.00 174.58 ?  1557 ALA A C   1 
ATOM   8415  O  O   . ALA A 1  1557 ? 205.806 210.545 211.258 1.00 121.12 ?  1557 ALA A O   1 
ATOM   8416  C  CB  . ALA A 1  1557 ? 202.721 209.513 211.866 1.00 328.66 ?  1557 ALA A CB  1 
ATOM   8417  N  N   . HIS A 1  1558 ? 205.679 208.452 211.997 1.00 123.86 ?  1558 HIS A N   1 
ATOM   8418  C  CA  . HIS A 1  1558 ? 206.963 208.516 212.575 1.00 131.43 ?  1558 HIS A CA  1 
ATOM   8419  C  C   . HIS A 1  1558 ? 207.940 208.849 211.469 1.00 137.66 ?  1558 HIS A C   1 
ATOM   8420  O  O   . HIS A 1  1558 ? 208.784 209.745 211.575 1.00 147.07 ?  1558 HIS A O   1 
ATOM   8421  C  CB  . HIS A 1  1558 ? 207.273 207.169 213.191 1.00 140.84 ?  1558 HIS A CB  1 
ATOM   8422  C  CG  . HIS A 1  1558 ? 206.361 206.810 214.309 1.00 170.51 ?  1558 HIS A CG  1 
ATOM   8423  N  ND1 . HIS A 1  1558 ? 205.917 205.525 214.520 1.00 189.52 ?  1558 HIS A ND1 1 
ATOM   8424  C  CD2 . HIS A 1  1558 ? 205.788 207.573 215.271 1.00 217.52 ?  1558 HIS A CD2 1 
ATOM   8425  C  CE1 . HIS A 1  1558 ? 205.122 205.507 215.576 1.00 244.22 ?  1558 HIS A CE1 1 
ATOM   8426  N  NE2 . HIS A 1  1558 ? 205.024 206.738 216.049 1.00 258.02 ?  1558 HIS A NE2 1 
ATOM   8427  N  N   . HIS A 1  1559 ? 207.814 208.137 210.376 1.00 136.41 ?  1559 HIS A N   1 
ATOM   8428  C  CA  . HIS A 1  1559 ? 208.873 208.211 209.449 1.00 162.58 ?  1559 HIS A CA  1 
ATOM   8429  C  C   . HIS A 1  1559 ? 208.704 209.482 208.729 1.00 155.91 ?  1559 HIS A C   1 
ATOM   8430  O  O   . HIS A 1  1559 ? 209.685 210.159 208.533 1.00 181.78 ?  1559 HIS A O   1 
ATOM   8431  C  CB  . HIS A 1  1559 ? 208.981 206.960 208.608 1.00 243.37 ?  1559 HIS A CB  1 
ATOM   8432  C  CG  . HIS A 1  1559 ? 209.507 205.808 209.400 1.00 327.11 ?  1559 HIS A CG  1 
ATOM   8433  N  ND1 . HIS A 1  1559 ? 210.845 205.666 209.695 1.00 339.60 ?  1559 HIS A ND1 1 
ATOM   8434  C  CD2 . HIS A 1  1559 ? 208.868 204.804 210.047 1.00 371.23 ?  1559 HIS A CD2 1 
ATOM   8435  C  CE1 . HIS A 1  1559 ? 211.011 204.600 210.455 1.00 360.86 ?  1559 HIS A CE1 1 
ATOM   8436  N  NE2 . HIS A 1  1559 ? 209.829 204.055 210.680 1.00 375.93 ?  1559 HIS A NE2 1 
ATOM   8437  N  N   . MET A 1  1560 ? 207.458 209.865 208.463 1.00 184.88 ?  1560 MET A N   1 
ATOM   8438  C  CA  . MET A 1  1560 ? 207.168 211.209 207.937 1.00 279.47 ?  1560 MET A CA  1 
ATOM   8439  C  C   . MET A 1  1560 ? 207.863 212.293 208.763 1.00 297.22 ?  1560 MET A C   1 
ATOM   8440  O  O   . MET A 1  1560 ? 208.406 213.241 208.191 1.00 373.58 ?  1560 MET A O   1 
ATOM   8441  C  CB  . MET A 1  1560 ? 205.666 211.507 207.851 1.00 323.94 ?  1560 MET A CB  1 
ATOM   8442  C  CG  . MET A 1  1560 ? 205.006 211.186 206.514 1.00 343.65 ?  1560 MET A CG  1 
ATOM   8443  S  SD  . MET A 1  1560 ? 203.492 212.140 206.259 1.00 343.10 ?  1560 MET A SD  1 
ATOM   8444  C  CE  . MET A 1  1560 ? 202.382 211.404 207.463 1.00 316.29 ?  1560 MET A CE  1 
ATOM   8445  N  N   . ALA A 1  1561 ? 207.873 212.133 210.091 1.00 235.68 ?  1561 ALA A N   1 
ATOM   8446  C  CA  . ALA A 1  1561 ? 208.579 213.063 210.977 1.00 187.68 ?  1561 ALA A CA  1 
ATOM   8447  C  C   . ALA A 1  1561 ? 210.101 213.003 210.780 1.00 142.24 ?  1561 ALA A C   1 
ATOM   8448  O  O   . ALA A 1  1561 ? 210.758 214.057 210.597 1.00 117.06 ?  1561 ALA A O   1 
ATOM   8449  C  CB  . ALA A 1  1561 ? 208.194 212.818 212.425 1.00 194.48 ?  1561 ALA A CB  1 
ATOM   8450  N  N   . LEU A 1  1562 ? 210.641 211.781 210.777 1.00 104.17 ?  1562 LEU A N   1 
ATOM   8451  C  CA  . LEU A 1  1562 ? 212.063 211.600 210.533 1.00 117.84 ?  1562 LEU A CA  1 
ATOM   8452  C  C   . LEU A 1  1562 ? 212.540 212.296 209.226 1.00 118.22 ?  1562 LEU A C   1 
ATOM   8453  O  O   . LEU A 1  1562 ? 213.485 213.081 209.231 1.00 106.02 ?  1562 LEU A O   1 
ATOM   8454  C  CB  . LEU A 1  1562 ? 212.435 210.111 210.584 1.00 132.85 ?  1562 LEU A CB  1 
ATOM   8455  C  CG  . LEU A 1  1562 ? 213.902 209.601 210.509 1.00 175.45 ?  1562 LEU A CG  1 
ATOM   8456  C  CD1 . LEU A 1  1562 ? 214.256 208.917 209.187 1.00 171.42 ?  1562 LEU A CD1 1 
ATOM   8457  C  CD2 . LEU A 1  1562 ? 214.972 210.632 210.880 1.00 184.22 ?  1562 LEU A CD2 1 
ATOM   8458  N  N   . GLY A 1  1563 ? 211.861 212.019 208.119 1.00 131.35 ?  1563 GLY A N   1 
ATOM   8459  C  CA  . GLY A 1  1563 ? 212.225 212.543 206.809 1.00 113.92 ?  1563 GLY A CA  1 
ATOM   8460  C  C   . GLY A 1  1563 ? 212.116 214.051 206.731 1.00 103.99 ?  1563 GLY A C   1 
ATOM   8461  O  O   . GLY A 1  1563 ? 212.836 214.671 205.959 1.00 119.10 ?  1563 GLY A O   1 
ATOM   8462  N  N   . LEU A 1  1564 ? 211.240 214.656 207.524 1.00 88.07  ?  1564 LEU A N   1 
ATOM   8463  C  CA  . LEU A 1  1564 ? 211.134 216.099 207.470 1.00 121.95 ?  1564 LEU A CA  1 
ATOM   8464  C  C   . LEU A 1  1564 ? 212.329 216.751 208.145 1.00 143.99 ?  1564 LEU A C   1 
ATOM   8465  O  O   . LEU A 1  1564 ? 212.767 217.835 207.710 1.00 150.06 ?  1564 LEU A O   1 
ATOM   8466  C  CB  . LEU A 1  1564 ? 209.798 216.607 208.012 1.00 135.03 ?  1564 LEU A CB  1 
ATOM   8467  C  CG  . LEU A 1  1564 ? 208.634 216.851 207.019 1.00 152.41 ?  1564 LEU A CG  1 
ATOM   8468  C  CD1 . LEU A 1  1564 ? 208.872 216.614 205.498 1.00 106.84 ?  1564 LEU A CD1 1 
ATOM   8469  C  CD2 . LEU A 1  1564 ? 207.373 216.143 207.554 1.00 155.17 ?  1564 LEU A CD2 1 
ATOM   8470  N  N   . LEU A 1  1565 ? 212.881 216.071 209.167 1.00 139.22 ?  1565 LEU A N   1 
ATOM   8471  C  CA  . LEU A 1  1565 ? 214.131 216.508 209.813 1.00 126.26 ?  1565 LEU A CA  1 
ATOM   8472  C  C   . LEU A 1  1565 ? 215.204 216.652 208.791 1.00 119.27 ?  1565 LEU A C   1 
ATOM   8473  O  O   . LEU A 1  1565 ? 215.949 217.604 208.825 1.00 134.20 ?  1565 LEU A O   1 
ATOM   8474  C  CB  . LEU A 1  1565 ? 214.622 215.522 210.852 1.00 118.39 ?  1565 LEU A CB  1 
ATOM   8475  C  CG  . LEU A 1  1565 ? 213.833 215.398 212.135 1.00 140.32 ?  1565 LEU A CG  1 
ATOM   8476  C  CD1 . LEU A 1  1565 ? 214.535 214.367 212.999 1.00 144.08 ?  1565 LEU A CD1 1 
ATOM   8477  C  CD2 . LEU A 1  1565 ? 213.739 216.756 212.817 1.00 155.86 ?  1565 LEU A CD2 1 
ATOM   8478  N  N   . PHE A 1  1566 ? 215.226 215.705 207.864 1.00 129.33 ?  1566 PHE A N   1 
ATOM   8479  C  CA  . PHE A 1  1566 ? 216.214 215.630 206.804 1.00 138.20 ?  1566 PHE A CA  1 
ATOM   8480  C  C   . PHE A 1  1566 ? 215.601 215.866 205.414 1.00 126.54 ?  1566 PHE A C   1 
ATOM   8481  O  O   . PHE A 1  1566 ? 215.958 215.186 204.429 1.00 101.47 ?  1566 PHE A O   1 
ATOM   8482  C  CB  . PHE A 1  1566 ? 216.932 214.283 206.902 1.00 142.17 ?  1566 PHE A CB  1 
ATOM   8483  C  CG  . PHE A 1  1566 ? 217.590 214.067 208.216 1.00 140.02 ?  1566 PHE A CG  1 
ATOM   8484  C  CD1 . PHE A 1  1566 ? 216.880 213.516 209.273 1.00 149.44 ?  1566 PHE A CD1 1 
ATOM   8485  C  CD2 . PHE A 1  1566 ? 218.921 214.440 208.404 1.00 151.20 ?  1566 PHE A CD2 1 
ATOM   8486  C  CE1 . PHE A 1  1566 ? 217.484 213.333 210.505 1.00 198.40 ?  1566 PHE A CE1 1 
ATOM   8487  C  CE2 . PHE A 1  1566 ? 219.545 214.252 209.622 1.00 178.45 ?  1566 PHE A CE2 1 
ATOM   8488  C  CZ  . PHE A 1  1566 ? 218.823 213.694 210.677 1.00 215.45 ?  1566 PHE A CZ  1 
ATOM   8489  N  N   . LEU A 1  1567 ? 214.685 216.835 205.349 1.00 106.52 ?  1567 LEU A N   1 
ATOM   8490  C  CA  . LEU A 1  1567 ? 214.030 217.156 204.109 1.00 106.24 ?  1567 LEU A CA  1 
ATOM   8491  C  C   . LEU A 1  1567 ? 215.033 217.665 203.085 1.00 113.81 ?  1567 LEU A C   1 
ATOM   8492  O  O   . LEU A 1  1567 ? 215.781 218.606 203.346 1.00 106.65 ?  1567 LEU A O   1 
ATOM   8493  C  CB  . LEU A 1  1567 ? 212.931 218.176 204.326 1.00 120.22 ?  1567 LEU A CB  1 
ATOM   8494  C  CG  . LEU A 1  1567 ? 212.227 218.600 203.036 1.00 129.53 ?  1567 LEU A CG  1 
ATOM   8495  C  CD1 . LEU A 1  1567 ? 211.264 217.496 202.620 1.00 163.41 ?  1567 LEU A CD1 1 
ATOM   8496  C  CD2 . LEU A 1  1567 ? 211.508 219.933 203.180 1.00 134.15 ?  1567 LEU A CD2 1 
ATOM   8497  N  N   . GLY A 1  1568 ? 215.043 217.003 201.934 1.00 139.57 ?  1568 GLY A N   1 
ATOM   8498  C  CA  . GLY A 1  1568 ? 215.972 217.291 200.846 1.00 144.90 ?  1568 GLY A CA  1 
ATOM   8499  C  C   . GLY A 1  1568 ? 217.418 217.018 201.195 1.00 153.09 ?  1568 GLY A C   1 
ATOM   8500  O  O   . GLY A 1  1568 ? 218.317 217.630 200.627 1.00 155.98 ?  1568 GLY A O   1 
ATOM   8501  N  N   . GLY A 1  1569 ? 217.633 216.092 202.131 1.00 166.54 ?  1569 GLY A N   1 
ATOM   8502  C  CA  . GLY A 1  1569 ? 218.957 215.794 202.700 1.00 165.33 ?  1569 GLY A CA  1 
ATOM   8503  C  C   . GLY A 1  1569 ? 219.632 217.029 203.259 1.00 160.16 ?  1569 GLY A C   1 
ATOM   8504  O  O   . GLY A 1  1569 ? 220.829 217.243 203.058 1.00 170.11 ?  1569 GLY A O   1 
ATOM   8505  N  N   . GLY A 1  1570 ? 218.856 217.855 203.949 1.00 138.83 ?  1570 GLY A N   1 
ATOM   8506  C  CA  . GLY A 1  1570 ? 219.351 219.133 204.426 1.00 132.01 ?  1570 GLY A CA  1 
ATOM   8507  C  C   . GLY A 1  1570 ? 219.333 220.236 203.374 1.00 143.40 ?  1570 GLY A C   1 
ATOM   8508  O  O   . GLY A 1  1570 ? 219.864 221.323 203.631 1.00 142.40 ?  1570 GLY A O   1 
ATOM   8509  N  N   . ARG A 1  1571 ? 218.729 219.981 202.207 1.00 128.64 ?  1571 ARG A N   1 
ATOM   8510  C  CA  . ARG A 1  1571 ? 218.626 221.000 201.160 1.00 144.85 ?  1571 ARG A CA  1 
ATOM   8511  C  C   . ARG A 1  1571 ? 217.331 221.822 201.286 1.00 140.93 ?  1571 ARG A C   1 
ATOM   8512  O  O   . ARG A 1  1571 ? 217.338 223.060 201.309 1.00 126.03 ?  1571 ARG A O   1 
ATOM   8513  C  CB  . ARG A 1  1571 ? 218.763 220.356 199.768 1.00 178.39 ?  1571 ARG A CB  1 
ATOM   8514  C  CG  . ARG A 1  1571 ? 218.637 221.285 198.552 1.00 220.07 ?  1571 ARG A CG  1 
ATOM   8515  C  CD  . ARG A 1  1571 ? 219.977 221.762 198.010 1.00 227.83 ?  1571 ARG A CD  1 
ATOM   8516  N  NE  . ARG A 1  1571 ? 220.946 220.670 197.926 1.00 236.15 ?  1571 ARG A NE  1 
ATOM   8517  C  CZ  . ARG A 1  1571 ? 222.251 220.817 197.713 1.00 267.54 ?  1571 ARG A CZ  1 
ATOM   8518  N  NH1 . ARG A 1  1571 ? 222.805 222.021 197.540 1.00 275.95 ?  1571 ARG A NH1 1 
ATOM   8519  N  NH2 . ARG A 1  1571 ? 223.011 219.734 197.671 1.00 285.12 ?  1571 ARG A NH2 1 
ATOM   8520  N  N   . TYR A 1  1572 ? 216.218 221.119 201.373 1.00 146.27 ?  1572 TYR A N   1 
ATOM   8521  C  CA  . TYR A 1  1572 ? 214.930 221.776 201.385 1.00 160.19 ?  1572 TYR A CA  1 
ATOM   8522  C  C   . TYR A 1  1572 ? 214.394 221.915 202.809 1.00 177.41 ?  1572 TYR A C   1 
ATOM   8523  O  O   . TYR A 1  1572 ? 214.519 220.989 203.619 1.00 157.52 ?  1572 TYR A O   1 
ATOM   8524  C  CB  . TYR A 1  1572 ? 213.961 221.001 200.497 1.00 153.95 ?  1572 TYR A CB  1 
ATOM   8525  C  CG  . TYR A 1  1572 ? 214.314 221.112 199.044 1.00 139.95 ?  1572 TYR A CG  1 
ATOM   8526  C  CD1 . TYR A 1  1572 ? 215.199 220.213 198.447 1.00 153.57 ?  1572 TYR A CD1 1 
ATOM   8527  C  CD2 . TYR A 1  1572 ? 213.773 222.121 198.266 1.00 141.34 ?  1572 TYR A CD2 1 
ATOM   8528  C  CE1 . TYR A 1  1572 ? 215.535 220.326 197.107 1.00 175.14 ?  1572 TYR A CE1 1 
ATOM   8529  C  CE2 . TYR A 1  1572 ? 214.088 222.239 196.927 1.00 169.20 ?  1572 TYR A CE2 1 
ATOM   8530  C  CZ  . TYR A 1  1572 ? 214.978 221.347 196.356 1.00 196.18 ?  1572 TYR A CZ  1 
ATOM   8531  O  OH  . TYR A 1  1572 ? 215.295 221.474 195.026 1.00 241.74 ?  1572 TYR A OH  1 
ATOM   8532  N  N   . SER A 1  1573 ? 213.844 223.093 203.122 1.00 192.26 ?  1573 SER A N   1 
ATOM   8533  C  CA  . SER A 1  1573 ? 213.045 223.291 204.344 1.00 159.97 ?  1573 SER A CA  1 
ATOM   8534  C  C   . SER A 1  1573 ? 211.695 223.903 203.973 1.00 136.34 ?  1573 SER A C   1 
ATOM   8535  O  O   . SER A 1  1573 ? 211.599 224.956 203.289 1.00 104.57 ?  1573 SER A O   1 
ATOM   8536  C  CB  . SER A 1  1573 ? 213.751 224.131 205.428 1.00 178.37 ?  1573 SER A CB  1 
ATOM   8537  O  OG  . SER A 1  1573 ? 215.072 224.535 205.105 1.00 158.19 ?  1573 SER A OG  1 
ATOM   8538  N  N   . LEU A 1  1574 ? 210.657 223.217 204.428 1.00 115.20 ?  1574 LEU A N   1 
ATOM   8539  C  CA  . LEU A 1  1574 ? 209.305 223.510 204.004 1.00 147.60 ?  1574 LEU A CA  1 
ATOM   8540  C  C   . LEU A 1  1574 ? 208.822 224.804 204.609 1.00 165.93 ?  1574 LEU A C   1 
ATOM   8541  O  O   . LEU A 1  1574 ? 208.861 224.975 205.825 1.00 172.50 ?  1574 LEU A O   1 
ATOM   8542  C  CB  . LEU A 1  1574 ? 208.374 222.357 204.337 1.00 139.72 ?  1574 LEU A CB  1 
ATOM   8543  C  CG  . LEU A 1  1574 ? 208.671 221.758 205.701 1.00 152.15 ?  1574 LEU A CG  1 
ATOM   8544  C  CD1 . LEU A 1  1574 ? 207.503 222.039 206.644 1.00 157.49 ?  1574 LEU A CD1 1 
ATOM   8545  C  CD2 . LEU A 1  1574 ? 208.953 220.278 205.540 1.00 138.14 ?  1574 LEU A CD2 1 
ATOM   8546  N  N   . SER A 1  1575 ? 208.394 225.717 203.738 1.00 194.68 ?  1575 SER A N   1 
ATOM   8547  C  CA  . SER A 1  1575 ? 208.038 227.075 204.127 1.00 233.52 ?  1575 SER A CA  1 
ATOM   8548  C  C   . SER A 1  1575 ? 206.542 227.215 204.195 1.00 255.23 ?  1575 SER A C   1 
ATOM   8549  O  O   . SER A 1  1575 ? 205.824 226.519 203.489 1.00 295.36 ?  1575 SER A O   1 
ATOM   8550  C  CB  . SER A 1  1575 ? 208.579 228.079 203.119 1.00 245.81 ?  1575 SER A CB  1 
ATOM   8551  O  OG  . SER A 1  1575 ? 207.872 227.996 201.889 1.00 246.91 ?  1575 SER A OG  1 
ATOM   8552  N  N   . THR A 1  1576 ? 206.091 228.149 205.022 1.00 248.64 ?  1576 THR A N   1 
ATOM   8553  C  CA  . THR A 1  1576 ? 204.670 228.401 205.239 1.00 242.79 ?  1576 THR A CA  1 
ATOM   8554  C  C   . THR A 1  1576 ? 203.960 228.981 204.010 1.00 241.26 ?  1576 THR A C   1 
ATOM   8555  O  O   . THR A 1  1576 ? 202.939 228.434 203.546 1.00 223.10 ?  1576 THR A O   1 
ATOM   8556  C  CB  . THR A 1  1576 ? 204.497 229.380 206.401 1.00 238.89 ?  1576 THR A CB  1 
ATOM   8557  O  OG1 . THR A 1  1576 ? 205.197 230.595 206.087 1.00 218.17 ?  1576 THR A OG1 1 
ATOM   8558  C  CG2 . THR A 1  1576 ? 205.056 228.766 207.694 1.00 244.70 ?  1576 THR A CG2 1 
ATOM   8559  N  N   . SER A 1  1577 ? 204.531 230.078 203.493 1.00 242.69 ?  1577 SER A N   1 
ATOM   8560  C  CA  . SER A 1  1577 ? 203.873 231.006 202.559 1.00 241.44 ?  1577 SER A CA  1 
ATOM   8561  C  C   . SER A 1  1577 ? 202.409 231.180 202.971 1.00 224.09 ?  1577 SER A C   1 
ATOM   8562  O  O   . SER A 1  1577 ? 202.124 231.371 204.156 1.00 217.22 ?  1577 SER A O   1 
ATOM   8563  C  CB  . SER A 1  1577 ? 204.063 230.583 201.081 1.00 250.06 ?  1577 SER A CB  1 
ATOM   8564  O  OG  . SER A 1  1577 ? 203.188 229.539 200.679 1.00 227.07 ?  1577 SER A OG  1 
ATOM   8565  N  N   . ASN A 1  1578 ? 201.500 231.115 202.006 1.00 216.77 ?  1578 ASN A N   1 
ATOM   8566  C  CA  . ASN A 1  1578 ? 200.103 230.892 202.296 1.00 213.55 ?  1578 ASN A CA  1 
ATOM   8567  C  C   . ASN A 1  1578 ? 199.681 229.569 201.662 1.00 214.35 ?  1578 ASN A C   1 
ATOM   8568  O  O   . ASN A 1  1578 ? 199.164 228.675 202.353 1.00 184.77 ?  1578 ASN A O   1 
ATOM   8569  C  CB  . ASN A 1  1578 ? 199.258 232.058 201.790 1.00 223.48 ?  1578 ASN A CB  1 
ATOM   8570  C  CG  . ASN A 1  1578 ? 197.938 232.177 202.523 1.00 235.65 ?  1578 ASN A CG  1 
ATOM   8571  O  OD1 . ASN A 1  1578 ? 197.155 231.221 202.588 1.00 243.73 ?  1578 ASN A OD1 1 
ATOM   8572  N  ND2 . ASN A 1  1578 ? 197.682 233.358 203.082 1.00 229.38 ?  1578 ASN A ND2 1 
ATOM   8573  N  N   . SER A 1  1579 ? 199.952 229.460 200.355 1.00 225.33 ?  1579 SER A N   1 
ATOM   8574  C  CA  . SER A 1  1579 ? 199.621 228.299 199.511 1.00 211.55 ?  1579 SER A CA  1 
ATOM   8575  C  C   . SER A 1  1579 ? 200.317 227.023 199.956 1.00 191.32 ?  1579 SER A C   1 
ATOM   8576  O  O   . SER A 1  1579 ? 199.802 225.914 199.766 1.00 145.12 ?  1579 SER A O   1 
ATOM   8577  C  CB  . SER A 1  1579 ? 199.975 228.591 198.044 1.00 212.08 ?  1579 SER A CB  1 
ATOM   8578  O  OG  . SER A 1  1579 ? 199.374 227.657 197.157 1.00 196.24 ?  1579 SER A OG  1 
ATOM   8579  N  N   . SER A 1  1580 ? 201.497 227.190 200.542 1.00 193.81 ?  1580 SER A N   1 
ATOM   8580  C  CA  . SER A 1  1580 ? 202.276 226.055 200.982 1.00 198.81 ?  1580 SER A CA  1 
ATOM   8581  C  C   . SER A 1  1580 ? 201.689 225.410 202.255 1.00 166.47 ?  1580 SER A C   1 
ATOM   8582  O  O   . SER A 1  1580 ? 201.791 224.188 202.421 1.00 145.91 ?  1580 SER A O   1 
ATOM   8583  C  CB  . SER A 1  1580 ? 203.761 226.429 201.076 1.00 226.04 ?  1580 SER A CB  1 
ATOM   8584  O  OG  . SER A 1  1580 ? 204.494 225.493 201.827 1.00 259.83 ?  1580 SER A OG  1 
ATOM   8585  N  N   . ILE A 1  1581 ? 201.046 226.205 203.119 1.00 151.16 ?  1581 ILE A N   1 
ATOM   8586  C  CA  . ILE A 1  1581 ? 200.280 225.621 204.243 1.00 157.57 ?  1581 ILE A CA  1 
ATOM   8587  C  C   . ILE A 1  1581 ? 199.190 224.691 203.744 1.00 147.28 ?  1581 ILE A C   1 
ATOM   8588  O  O   . ILE A 1  1581 ? 198.948 223.650 204.359 1.00 142.46 ?  1581 ILE A O   1 
ATOM   8589  C  CB  . ILE A 1  1581 ? 199.719 226.657 205.241 1.00 164.12 ?  1581 ILE A CB  1 
ATOM   8590  C  CG1 . ILE A 1  1581 ? 200.820 227.004 206.251 1.00 186.07 ?  1581 ILE A CG1 1 
ATOM   8591  C  CG2 . ILE A 1  1581 ? 198.492 226.110 205.990 1.00 118.19 ?  1581 ILE A CG2 1 
ATOM   8592  C  CD1 . ILE A 1  1581 ? 200.789 228.434 206.739 1.00 218.27 ?  1581 ILE A CD1 1 
ATOM   8593  N  N   . ALA A 1  1582 ? 198.571 225.057 202.623 1.00 145.50 ?  1582 ALA A N   1 
ATOM   8594  C  CA  . ALA A 1  1582 ? 197.668 224.154 201.915 1.00 160.68 ?  1582 ALA A CA  1 
ATOM   8595  C  C   . ALA A 1  1582 ? 198.282 222.779 201.668 1.00 176.50 ?  1582 ALA A C   1 
ATOM   8596  O  O   . ALA A 1  1582 ? 197.701 221.777 202.074 1.00 188.56 ?  1582 ALA A O   1 
ATOM   8597  C  CB  . ALA A 1  1582 ? 197.177 224.764 200.621 1.00 143.24 ?  1582 ALA A CB  1 
ATOM   8598  N  N   . ALA A 1  1583 ? 199.467 222.741 201.056 1.00 193.07 ?  1583 ALA A N   1 
ATOM   8599  C  CA  . ALA A 1  1583 ? 200.141 221.472 200.733 1.00 204.14 ?  1583 ALA A CA  1 
ATOM   8600  C  C   . ALA A 1  1583 ? 200.563 220.660 201.974 1.00 199.32 ?  1583 ALA A C   1 
ATOM   8601  O  O   . ALA A 1  1583 ? 200.465 219.426 201.981 1.00 205.78 ?  1583 ALA A O   1 
ATOM   8602  C  CB  . ALA A 1  1583 ? 201.318 221.710 199.798 1.00 186.12 ?  1583 ALA A CB  1 
ATOM   8603  N  N   . LEU A 1  1584 ? 201.013 221.353 203.016 1.00 171.89 ?  1584 LEU A N   1 
ATOM   8604  C  CA  . LEU A 1  1584 ? 201.315 220.712 204.284 1.00 163.65 ?  1584 LEU A CA  1 
ATOM   8605  C  C   . LEU A 1  1584 ? 200.104 220.043 204.938 1.00 160.83 ?  1584 LEU A C   1 
ATOM   8606  O  O   . LEU A 1  1584 ? 200.202 218.894 205.383 1.00 140.32 ?  1584 LEU A O   1 
ATOM   8607  C  CB  . LEU A 1  1584 ? 201.908 221.725 205.252 1.00 158.45 ?  1584 LEU A CB  1 
ATOM   8608  C  CG  . LEU A 1  1584 ? 203.399 222.002 205.221 1.00 154.19 ?  1584 LEU A CG  1 
ATOM   8609  C  CD1 . LEU A 1  1584 ? 203.775 222.801 206.456 1.00 164.30 ?  1584 LEU A CD1 1 
ATOM   8610  C  CD2 . LEU A 1  1584 ? 204.187 220.711 205.177 1.00 151.32 ?  1584 LEU A CD2 1 
ATOM   8611  N  N   . LEU A 1  1585 ? 198.983 220.775 204.975 1.00 152.76 ?  1585 LEU A N   1 
ATOM   8612  C  CA  . LEU A 1  1585 ? 197.758 220.371 205.656 1.00 156.87 ?  1585 LEU A CA  1 
ATOM   8613  C  C   . LEU A 1  1585 ? 197.189 219.092 205.120 1.00 180.02 ?  1585 LEU A C   1 
ATOM   8614  O  O   . LEU A 1  1585 ? 196.692 218.283 205.897 1.00 219.68 ?  1585 LEU A O   1 
ATOM   8615  C  CB  . LEU A 1  1585 ? 196.692 221.460 205.560 1.00 170.76 ?  1585 LEU A CB  1 
ATOM   8616  C  CG  . LEU A 1  1585 ? 196.633 222.532 206.649 1.00 176.84 ?  1585 LEU A CG  1 
ATOM   8617  C  CD1 . LEU A 1  1585 ? 195.653 223.642 206.306 1.00 168.09 ?  1585 LEU A CD1 1 
ATOM   8618  C  CD2 . LEU A 1  1585 ? 196.246 221.899 207.973 1.00 203.62 ?  1585 LEU A CD2 1 
ATOM   8619  N  N   . CYS A 1  1586 ? 197.265 218.921 203.799 1.00 205.73 ?  1586 CYS A N   1 
ATOM   8620  C  CA  . CYS A 1  1586 ? 196.877 217.679 203.125 1.00 260.78 ?  1586 CYS A CA  1 
ATOM   8621  C  C   . CYS A 1  1586 ? 197.785 216.514 203.533 1.00 328.90 ?  1586 CYS A C   1 
ATOM   8622  O  O   . CYS A 1  1586 ? 197.288 215.449 203.908 1.00 386.62 ?  1586 CYS A O   1 
ATOM   8623  C  CB  . CYS A 1  1586 ? 196.896 217.867 201.613 1.00 231.08 ?  1586 CYS A CB  1 
ATOM   8624  S  SG  . CYS A 1  1586 ? 196.303 219.498 201.133 1.00 226.44 ?  1586 CYS A SG  1 
ATOM   8625  N  N   . ALA A 1  1587 ? 199.104 216.736 203.483 1.00 329.30 ?  1587 ALA A N   1 
ATOM   8626  C  CA  . ALA A 1  1587 ? 200.110 215.743 203.891 1.00 307.14 ?  1587 ALA A CA  1 
ATOM   8627  C  C   . ALA A 1  1587 ? 200.014 215.382 205.384 1.00 327.23 ?  1587 ALA A C   1 
ATOM   8628  O  O   . ALA A 1  1587 ? 199.994 214.197 205.743 1.00 361.41 ?  1587 ALA A O   1 
ATOM   8629  C  CB  . ALA A 1  1587 ? 201.513 216.231 203.539 1.00 239.94 ?  1587 ALA A CB  1 
ATOM   8630  N  N   . LEU A 1  1588 ? 199.897 216.414 206.225 1.00 326.30 ?  1588 LEU A N   1 
ATOM   8631  C  CA  . LEU A 1  1588 ? 200.019 216.308 207.688 1.00 330.15 ?  1588 LEU A CA  1 
ATOM   8632  C  C   . LEU A 1  1588 ? 198.688 216.253 208.472 1.00 391.25 ?  1588 LEU A C   1 
ATOM   8633  O  O   . LEU A 1  1588 ? 198.671 216.486 209.692 1.00 408.40 ?  1588 LEU A O   1 
ATOM   8634  C  CB  . LEU A 1  1588 ? 200.888 217.465 208.206 1.00 249.22 ?  1588 LEU A CB  1 
ATOM   8635  C  CG  . LEU A 1  1588 ? 202.408 217.559 208.025 1.00 202.57 ?  1588 LEU A CG  1 
ATOM   8636  C  CD1 . LEU A 1  1588 ? 203.028 216.720 206.915 1.00 228.75 ?  1588 LEU A CD1 1 
ATOM   8637  C  CD2 . LEU A 1  1588 ? 202.730 219.008 207.785 1.00 146.37 ?  1588 LEU A CD2 1 
ATOM   8638  N  N   . TYR A 1  1589 ? 197.592 215.943 207.771 1.00 440.45 ?  1589 TYR A N   1 
ATOM   8639  C  CA  . TYR A 1  1589 ? 196.267 215.734 208.382 1.00 444.91 ?  1589 TYR A CA  1 
ATOM   8640  C  C   . TYR A 1  1589 ? 196.370 214.701 209.529 1.00 448.92 ?  1589 TYR A C   1 
ATOM   8641  O  O   . TYR A 1  1589 ? 196.920 213.617 209.318 1.00 480.99 ?  1589 TYR A O   1 
ATOM   8642  C  CB  . TYR A 1  1589 ? 195.247 215.320 207.300 1.00 437.41 ?  1589 TYR A CB  1 
ATOM   8643  C  CG  . TYR A 1  1589 ? 193.848 214.965 207.788 1.00 424.37 ?  1589 TYR A CG  1 
ATOM   8644  C  CD1 . TYR A 1  1589 ? 192.889 215.957 208.039 1.00 393.67 ?  1589 TYR A CD1 1 
ATOM   8645  C  CD2 . TYR A 1  1589 ? 193.474 213.632 207.974 1.00 433.45 ?  1589 TYR A CD2 1 
ATOM   8646  C  CE1 . TYR A 1  1589 ? 191.609 215.627 208.483 1.00 377.60 ?  1589 TYR A CE1 1 
ATOM   8647  C  CE2 . TYR A 1  1589 ? 192.196 213.295 208.410 1.00 413.11 ?  1589 TYR A CE2 1 
ATOM   8648  C  CZ  . TYR A 1  1589 ? 191.268 214.292 208.666 1.00 383.29 ?  1589 TYR A CZ  1 
ATOM   8649  O  OH  . TYR A 1  1589 ? 190.008 213.944 209.097 1.00 342.86 ?  1589 TYR A OH  1 
ATOM   8650  N  N   . PRO A 1  1590 ? 195.890 215.061 210.750 1.00 415.00 ?  1590 PRO A N   1 
ATOM   8651  C  CA  . PRO A 1  1590 ? 196.013 214.275 212.001 1.00 407.22 ?  1590 PRO A CA  1 
ATOM   8652  C  C   . PRO A 1  1590 ? 195.637 212.782 211.989 1.00 449.00 ?  1590 PRO A C   1 
ATOM   8653  O  O   . PRO A 1  1590 ? 196.347 211.993 212.620 1.00 467.00 ?  1590 PRO A O   1 
ATOM   8654  C  CB  . PRO A 1  1590 ? 195.109 215.030 212.985 1.00 350.38 ?  1590 PRO A CB  1 
ATOM   8655  C  CG  . PRO A 1  1590 ? 194.425 216.105 212.201 1.00 338.27 ?  1590 PRO A CG  1 
ATOM   8656  C  CD  . PRO A 1  1590 ? 195.318 216.389 211.038 1.00 369.50 ?  1590 PRO A CD  1 
ATOM   8657  N  N   . HIS A 1  1591 ? 194.542 212.400 211.320 1.00 481.84 ?  1591 HIS A N   1 
ATOM   8658  C  CA  . HIS A 1  1591 ? 194.141 210.982 211.213 1.00 484.53 ?  1591 HIS A CA  1 
ATOM   8659  C  C   . HIS A 1  1591 ? 195.148 210.191 210.378 1.00 499.25 ?  1591 HIS A C   1 
ATOM   8660  O  O   . HIS A 1  1591 ? 195.647 210.690 209.364 1.00 500.00 ?  1591 HIS A O   1 
ATOM   8661  C  CB  . HIS A 1  1591 ? 192.755 210.825 210.578 1.00 465.20 ?  1591 HIS A CB  1 
ATOM   8662  C  CG  . HIS A 1  1591 ? 191.627 211.381 211.393 1.00 449.78 ?  1591 HIS A CG  1 
ATOM   8663  N  ND1 . HIS A 1  1591 ? 190.605 210.593 211.874 1.00 452.93 ?  1591 HIS A ND1 1 
ATOM   8664  C  CD2 . HIS A 1  1591 ? 191.341 212.647 211.782 1.00 431.04 ?  1591 HIS A CD2 1 
ATOM   8665  C  CE1 . HIS A 1  1591 ? 189.745 211.346 212.536 1.00 440.86 ?  1591 HIS A CE1 1 
ATOM   8666  N  NE2 . HIS A 1  1591 ? 190.170 212.596 212.498 1.00 430.02 ?  1591 HIS A NE2 1 
ATOM   8667  N  N   . PHE A 1  1592 ? 195.436 208.964 210.807 1.00 491.19 ?  1592 PHE A N   1 
ATOM   8668  C  CA  . PHE A 1  1592 ? 196.354 208.076 210.085 1.00 482.60 ?  1592 PHE A CA  1 
ATOM   8669  C  C   . PHE A 1  1592 ? 195.655 206.759 209.689 1.00 487.62 ?  1592 PHE A C   1 
ATOM   8670  O  O   . PHE A 1  1592 ? 194.789 206.287 210.435 1.00 500.00 ?  1592 PHE A O   1 
ATOM   8671  C  CB  . PHE A 1  1592 ? 197.638 207.836 210.904 1.00 470.74 ?  1592 PHE A CB  1 
ATOM   8672  C  CG  . PHE A 1  1592 ? 198.407 209.098 211.232 1.00 446.56 ?  1592 PHE A CG  1 
ATOM   8673  C  CD1 . PHE A 1  1592 ? 199.028 209.853 210.223 1.00 433.41 ?  1592 PHE A CD1 1 
ATOM   8674  C  CD2 . PHE A 1  1592 ? 198.528 209.526 212.557 1.00 431.45 ?  1592 PHE A CD2 1 
ATOM   8675  C  CE1 . PHE A 1  1592 ? 199.728 211.017 210.531 1.00 415.28 ?  1592 PHE A CE1 1 
ATOM   8676  C  CE2 . PHE A 1  1592 ? 199.239 210.685 212.870 1.00 419.47 ?  1592 PHE A CE2 1 
ATOM   8677  C  CZ  . PHE A 1  1592 ? 199.833 211.434 211.857 1.00 414.01 ?  1592 PHE A CZ  1 
ATOM   8678  N  N   . PRO A 1  1593 ? 196.013 206.178 208.509 1.00 480.00 ?  1593 PRO A N   1 
ATOM   8679  C  CA  . PRO A 1  1593 ? 195.358 204.969 207.967 1.00 468.80 ?  1593 PRO A CA  1 
ATOM   8680  C  C   . PRO A 1  1593 ? 195.330 203.789 208.940 1.00 449.78 ?  1593 PRO A C   1 
ATOM   8681  O  O   . PRO A 1  1593 ? 196.322 203.549 209.639 1.00 480.00 ?  1593 PRO A O   1 
ATOM   8682  C  CB  . PRO A 1  1593 ? 196.223 204.622 206.748 1.00 468.73 ?  1593 PRO A CB  1 
ATOM   8683  C  CG  . PRO A 1  1593 ? 196.786 205.925 206.316 1.00 472.66 ?  1593 PRO A CG  1 
ATOM   8684  C  CD  . PRO A 1  1593 ? 197.072 206.655 207.595 1.00 480.00 ?  1593 PRO A CD  1 
ATOM   8685  N  N   . ALA A 1  1594 ? 194.198 203.077 208.974 1.00 384.49 ?  1594 ALA A N   1 
ATOM   8686  C  CA  . ALA A 1  1594 ? 193.974 201.915 209.856 1.00 347.36 ?  1594 ALA A CA  1 
ATOM   8687  C  C   . ALA A 1  1594 ? 195.011 200.808 209.681 1.00 343.20 ?  1594 ALA A C   1 
ATOM   8688  O  O   . ALA A 1  1594 ? 195.481 200.230 210.672 1.00 355.62 ?  1594 ALA A O   1 
ATOM   8689  C  CB  . ALA A 1  1594 ? 192.576 201.357 209.646 1.00 331.58 ?  1594 ALA A CB  1 
ATOM   8690  N  N   . HIS A 1  1595 ? 195.343 200.531 208.416 1.00 344.90 ?  1595 HIS A N   1 
ATOM   8691  C  CA  . HIS A 1  1595 ? 196.380 199.575 207.995 1.00 380.67 ?  1595 HIS A CA  1 
ATOM   8692  C  C   . HIS A 1  1595 ? 196.691 199.815 206.513 1.00 449.74 ?  1595 HIS A C   1 
ATOM   8693  O  O   . HIS A 1  1595 ? 195.864 200.405 205.818 1.00 480.00 ?  1595 HIS A O   1 
ATOM   8694  C  CB  . HIS A 1  1595 ? 195.870 198.147 208.163 1.00 297.89 ?  1595 HIS A CB  1 
ATOM   8695  C  CG  . HIS A 1  1595 ? 194.638 197.862 207.370 1.00 219.47 ?  1595 HIS A CG  1 
ATOM   8696  N  ND1 . HIS A 1  1595 ? 193.376 197.990 207.899 1.00 204.38 ?  1595 HIS A ND1 1 
ATOM   8697  C  CD2 . HIS A 1  1595 ? 194.475 197.484 206.081 1.00 181.63 ?  1595 HIS A CD2 1 
ATOM   8698  C  CE1 . HIS A 1  1595 ? 192.486 197.670 206.977 1.00 218.67 ?  1595 HIS A CE1 1 
ATOM   8699  N  NE2 . HIS A 1  1595 ? 193.128 197.373 205.861 1.00 185.83 ?  1595 HIS A NE2 1 
ATOM   8700  N  N   . SER A 1  1596 ? 197.843 199.333 206.024 1.00 480.00 ?  1596 SER A N   1 
ATOM   8701  C  CA  . SER A 1  1596 ? 198.189 199.415 204.586 1.00 465.28 ?  1596 SER A CA  1 
ATOM   8702  C  C   . SER A 1  1596 ? 197.153 198.670 203.732 1.00 453.03 ?  1596 SER A C   1 
ATOM   8703  O  O   . SER A 1  1596 ? 196.756 197.555 204.076 1.00 469.29 ?  1596 SER A O   1 
ATOM   8704  C  CB  . SER A 1  1596 ? 199.609 198.896 204.309 1.00 448.58 ?  1596 SER A CB  1 
ATOM   8705  O  OG  . SER A 1  1596 ? 199.955 199.017 202.932 1.00 409.53 ?  1596 SER A OG  1 
ATOM   8706  N  N   . THR A 1  1597 ? 196.739 199.319 202.638 1.00 391.32 ?  1597 THR A N   1 
ATOM   8707  C  CA  . THR A 1  1597 ? 195.581 198.967 201.773 1.00 306.97 ?  1597 THR A CA  1 
ATOM   8708  C  C   . THR A 1  1597 ? 194.209 199.517 202.266 1.00 235.02 ?  1597 THR A C   1 
ATOM   8709  O  O   . THR A 1  1597 ? 193.215 199.409 201.549 1.00 199.49 ?  1597 THR A O   1 
ATOM   8710  C  CB  . THR A 1  1597 ? 195.574 197.483 201.269 1.00 336.56 ?  1597 THR A CB  1 
ATOM   8711  O  OG1 . THR A 1  1597 ? 195.277 197.455 199.868 1.00 375.29 ?  1597 THR A OG1 1 
ATOM   8712  C  CG2 . THR A 1  1597 ? 194.581 196.583 202.026 1.00 350.99 ?  1597 THR A CG2 1 
ATOM   8713  N  N   . ASP A 1  1598 ? 194.180 200.116 203.462 1.00 220.07 ?  1598 ASP A N   1 
ATOM   8714  C  CA  . ASP A 1  1598 ? 192.994 200.828 203.974 1.00 241.78 ?  1598 ASP A CA  1 
ATOM   8715  C  C   . ASP A 1  1598 ? 193.165 202.316 204.252 1.00 211.09 ?  1598 ASP A C   1 
ATOM   8716  O  O   . ASP A 1  1598 ? 193.987 202.743 205.082 1.00 148.41 ?  1598 ASP A O   1 
ATOM   8717  C  CB  . ASP A 1  1598 ? 192.450 200.185 205.239 1.00 301.97 ?  1598 ASP A CB  1 
ATOM   8718  C  CG  . ASP A 1  1598 ? 191.084 200.732 205.636 1.00 376.19 ?  1598 ASP A CG  1 
ATOM   8719  O  OD1 . ASP A 1  1598 ? 191.022 201.817 206.258 1.00 400.51 ?  1598 ASP A OD1 1 
ATOM   8720  O  OD2 . ASP A 1  1598 ? 190.071 200.068 205.334 1.00 411.12 -1 1598 ASP A OD2 1 
ATOM   8721  N  N   . ASN A 1  1599 ? 192.280 203.079 203.621 1.00 225.52 ?  1599 ASN A N   1 
ATOM   8722  C  CA  . ASN A 1  1599 ? 192.295 204.533 203.678 1.00 255.44 ?  1599 ASN A CA  1 
ATOM   8723  C  C   . ASN A 1  1599 ? 190.880 205.108 203.710 1.00 218.58 ?  1599 ASN A C   1 
ATOM   8724  O  O   . ASN A 1  1599 ? 190.467 205.924 202.857 1.00 196.53 ?  1599 ASN A O   1 
ATOM   8725  C  CB  . ASN A 1  1599 ? 193.116 205.100 202.514 1.00 329.30 ?  1599 ASN A CB  1 
ATOM   8726  C  CG  . ASN A 1  1599 ? 192.809 204.424 201.183 1.00 365.30 ?  1599 ASN A CG  1 
ATOM   8727  O  OD1 . ASN A 1  1599 ? 191.809 203.717 201.025 1.00 381.87 ?  1599 ASN A OD1 1 
ATOM   8728  N  ND2 . ASN A 1  1599 ? 193.681 204.642 200.215 1.00 374.35 ?  1599 ASN A ND2 1 
ATOM   8729  N  N   . ARG A 1  1600 ? 190.147 204.672 204.726 1.00 183.42 ?  1600 ARG A N   1 
ATOM   8730  C  CA  . ARG A 1  1600 ? 188.802 205.