data_5GGR
# 
_entry.id   5GGR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5GGR         
WWPDB D_1300000746 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 5GGV unspecified 
PDB . 5GGU unspecified 
PDB . 5GGT unspecified 
PDB . 5GGS unspecified 
PDB . 5GGQ unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5GGR 
_pdbx_database_status.recvd_initial_deposition_date   2016-06-16 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_audit_author.name           'Heo, Y.S.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            7 
_citation.language                  ? 
_citation.page_first                13354 
_citation.page_last                 13354 
_citation.title                     'Structural basis of checkpoint blockade by monoclonal antibodies in cancer immunotherapy' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/ncomms13354 
_citation.pdbx_database_id_PubMed   27796306 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lee, J.Y.'   1  
primary 'Lee, H.T.'   2  
primary 'Shin, W.'    3  
primary 'Chae, J.'    4  
primary 'Choi, J.'    5  
primary 'Kim, S.H.'   6  
primary 'Lim, H.'     7  
primary 'Won Heo, T.' 8  
primary 'Park, K.Y.'  9  
primary 'Lee, Y.J.'   10 
primary 'Ryu, S.E.'   11 
primary 'Son, J.Y.'   12 
primary 'Lee, J.U.'   13 
primary 'Heo, Y.S.'   14 
# 
_cell.entry_id           5GGR 
_cell.length_a           91.290 
_cell.length_b           48.612 
_cell.length_c           134.904 
_cell.angle_alpha        90.00 
_cell.angle_beta         102.12 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5GGR 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn 'heavy chain'                     24275.162 2 ? ?    ?                     ? 
2 polymer syn 'light chain'                     23395.904 2 ? ?    ?                     ? 
3 polymer man 'Programmed cell death protein 1' 14083.601 2 ? C93S 'UNP residues 26-150' ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        hPD-1 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;QVQLVESGGGVVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSKRYYADSVKGRFTISRDNSKNTLF
LQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALT
SGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHHHHHH
;
;QVQLVESGGGVVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSKRYYADSVKGRFTISRDNSKNTLF
LQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALT
SGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHHHHHH
;
A,H ? 
2 'polypeptide(L)' no no 
;EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEP
EDFAVYYCQQSSNWPRTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
;
;EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEP
EDFAVYYCQQSSNWPRTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
;
B,L ? 
3 'polypeptide(L)' no no 
;DSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDSRFRVTQLPNGRD
FHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAE
;
;DSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDSRFRVTQLPNGRD
FHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAE
;
Y,Z ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLN n 
1 2   VAL n 
1 3   GLN n 
1 4   LEU n 
1 5   VAL n 
1 6   GLU n 
1 7   SER n 
1 8   GLY n 
1 9   GLY n 
1 10  GLY n 
1 11  VAL n 
1 12  VAL n 
1 13  GLN n 
1 14  PRO n 
1 15  GLY n 
1 16  ARG n 
1 17  SER n 
1 18  LEU n 
1 19  ARG n 
1 20  LEU n 
1 21  ASP n 
1 22  CYS n 
1 23  LYS n 
1 24  ALA n 
1 25  SER n 
1 26  GLY n 
1 27  ILE n 
1 28  THR n 
1 29  PHE n 
1 30  SER n 
1 31  ASN n 
1 32  SER n 
1 33  GLY n 
1 34  MET n 
1 35  HIS n 
1 36  TRP n 
1 37  VAL n 
1 38  ARG n 
1 39  GLN n 
1 40  ALA n 
1 41  PRO n 
1 42  GLY n 
1 43  LYS n 
1 44  GLY n 
1 45  LEU n 
1 46  GLU n 
1 47  TRP n 
1 48  VAL n 
1 49  ALA n 
1 50  VAL n 
1 51  ILE n 
1 52  TRP n 
1 53  TYR n 
1 54  ASP n 
1 55  GLY n 
1 56  SER n 
1 57  LYS n 
1 58  ARG n 
1 59  TYR n 
1 60  TYR n 
1 61  ALA n 
1 62  ASP n 
1 63  SER n 
1 64  VAL n 
1 65  LYS n 
1 66  GLY n 
1 67  ARG n 
1 68  PHE n 
1 69  THR n 
1 70  ILE n 
1 71  SER n 
1 72  ARG n 
1 73  ASP n 
1 74  ASN n 
1 75  SER n 
1 76  LYS n 
1 77  ASN n 
1 78  THR n 
1 79  LEU n 
1 80  PHE n 
1 81  LEU n 
1 82  GLN n 
1 83  MET n 
1 84  ASN n 
1 85  SER n 
1 86  LEU n 
1 87  ARG n 
1 88  ALA n 
1 89  GLU n 
1 90  ASP n 
1 91  THR n 
1 92  ALA n 
1 93  VAL n 
1 94  TYR n 
1 95  TYR n 
1 96  CYS n 
1 97  ALA n 
1 98  THR n 
1 99  ASN n 
1 100 ASP n 
1 101 ASP n 
1 102 TYR n 
1 103 TRP n 
1 104 GLY n 
1 105 GLN n 
1 106 GLY n 
1 107 THR n 
1 108 LEU n 
1 109 VAL n 
1 110 THR n 
1 111 VAL n 
1 112 SER n 
1 113 SER n 
1 114 ALA n 
1 115 SER n 
1 116 THR n 
1 117 LYS n 
1 118 GLY n 
1 119 PRO n 
1 120 SER n 
1 121 VAL n 
1 122 PHE n 
1 123 PRO n 
1 124 LEU n 
1 125 ALA n 
1 126 PRO n 
1 127 SER n 
1 128 SER n 
1 129 LYS n 
1 130 SER n 
1 131 THR n 
1 132 SER n 
1 133 GLY n 
1 134 GLY n 
1 135 THR n 
1 136 ALA n 
1 137 ALA n 
1 138 LEU n 
1 139 GLY n 
1 140 CYS n 
1 141 LEU n 
1 142 VAL n 
1 143 LYS n 
1 144 ASP n 
1 145 TYR n 
1 146 PHE n 
1 147 PRO n 
1 148 GLU n 
1 149 PRO n 
1 150 VAL n 
1 151 THR n 
1 152 VAL n 
1 153 SER n 
1 154 TRP n 
1 155 ASN n 
1 156 SER n 
1 157 GLY n 
1 158 ALA n 
1 159 LEU n 
1 160 THR n 
1 161 SER n 
1 162 GLY n 
1 163 VAL n 
1 164 HIS n 
1 165 THR n 
1 166 PHE n 
1 167 PRO n 
1 168 ALA n 
1 169 VAL n 
1 170 LEU n 
1 171 GLN n 
1 172 SER n 
1 173 SER n 
1 174 GLY n 
1 175 LEU n 
1 176 TYR n 
1 177 SER n 
1 178 LEU n 
1 179 SER n 
1 180 SER n 
1 181 VAL n 
1 182 VAL n 
1 183 THR n 
1 184 VAL n 
1 185 PRO n 
1 186 SER n 
1 187 SER n 
1 188 SER n 
1 189 LEU n 
1 190 GLY n 
1 191 THR n 
1 192 GLN n 
1 193 THR n 
1 194 TYR n 
1 195 ILE n 
1 196 CYS n 
1 197 ASN n 
1 198 VAL n 
1 199 ASN n 
1 200 HIS n 
1 201 LYS n 
1 202 PRO n 
1 203 SER n 
1 204 ASN n 
1 205 THR n 
1 206 LYS n 
1 207 VAL n 
1 208 ASP n 
1 209 LYS n 
1 210 LYS n 
1 211 VAL n 
1 212 GLU n 
1 213 PRO n 
1 214 LYS n 
1 215 SER n 
1 216 CYS n 
1 217 ASP n 
1 218 LYS n 
1 219 THR n 
1 220 HIS n 
1 221 HIS n 
1 222 HIS n 
1 223 HIS n 
1 224 HIS n 
1 225 HIS n 
2 1   GLU n 
2 2   ILE n 
2 3   VAL n 
2 4   LEU n 
2 5   THR n 
2 6   GLN n 
2 7   SER n 
2 8   PRO n 
2 9   ALA n 
2 10  THR n 
2 11  LEU n 
2 12  SER n 
2 13  LEU n 
2 14  SER n 
2 15  PRO n 
2 16  GLY n 
2 17  GLU n 
2 18  ARG n 
2 19  ALA n 
2 20  THR n 
2 21  LEU n 
2 22  SER n 
2 23  CYS n 
2 24  ARG n 
2 25  ALA n 
2 26  SER n 
2 27  GLN n 
2 28  SER n 
2 29  VAL n 
2 30  SER n 
2 31  SER n 
2 32  TYR n 
2 33  LEU n 
2 34  ALA n 
2 35  TRP n 
2 36  TYR n 
2 37  GLN n 
2 38  GLN n 
2 39  LYS n 
2 40  PRO n 
2 41  GLY n 
2 42  GLN n 
2 43  ALA n 
2 44  PRO n 
2 45  ARG n 
2 46  LEU n 
2 47  LEU n 
2 48  ILE n 
2 49  TYR n 
2 50  ASP n 
2 51  ALA n 
2 52  SER n 
2 53  ASN n 
2 54  ARG n 
2 55  ALA n 
2 56  THR n 
2 57  GLY n 
2 58  ILE n 
2 59  PRO n 
2 60  ALA n 
2 61  ARG n 
2 62  PHE n 
2 63  SER n 
2 64  GLY n 
2 65  SER n 
2 66  GLY n 
2 67  SER n 
2 68  GLY n 
2 69  THR n 
2 70  ASP n 
2 71  PHE n 
2 72  THR n 
2 73  LEU n 
2 74  THR n 
2 75  ILE n 
2 76  SER n 
2 77  SER n 
2 78  LEU n 
2 79  GLU n 
2 80  PRO n 
2 81  GLU n 
2 82  ASP n 
2 83  PHE n 
2 84  ALA n 
2 85  VAL n 
2 86  TYR n 
2 87  TYR n 
2 88  CYS n 
2 89  GLN n 
2 90  GLN n 
2 91  SER n 
2 92  SER n 
2 93  ASN n 
2 94  TRP n 
2 95  PRO n 
2 96  ARG n 
2 97  THR n 
2 98  PHE n 
2 99  GLY n 
2 100 GLN n 
2 101 GLY n 
2 102 THR n 
2 103 LYS n 
2 104 VAL n 
2 105 GLU n 
2 106 ILE n 
2 107 LYS n 
2 108 ARG n 
2 109 THR n 
2 110 VAL n 
2 111 ALA n 
2 112 ALA n 
2 113 PRO n 
2 114 SER n 
2 115 VAL n 
2 116 PHE n 
2 117 ILE n 
2 118 PHE n 
2 119 PRO n 
2 120 PRO n 
2 121 SER n 
2 122 ASP n 
2 123 GLU n 
2 124 GLN n 
2 125 LEU n 
2 126 LYS n 
2 127 SER n 
2 128 GLY n 
2 129 THR n 
2 130 ALA n 
2 131 SER n 
2 132 VAL n 
2 133 VAL n 
2 134 CYS n 
2 135 LEU n 
2 136 LEU n 
2 137 ASN n 
2 138 ASN n 
2 139 PHE n 
2 140 TYR n 
2 141 PRO n 
2 142 ARG n 
2 143 GLU n 
2 144 ALA n 
2 145 LYS n 
2 146 VAL n 
2 147 GLN n 
2 148 TRP n 
2 149 LYS n 
2 150 VAL n 
2 151 ASP n 
2 152 ASN n 
2 153 ALA n 
2 154 LEU n 
2 155 GLN n 
2 156 SER n 
2 157 GLY n 
2 158 ASN n 
2 159 SER n 
2 160 GLN n 
2 161 GLU n 
2 162 SER n 
2 163 VAL n 
2 164 THR n 
2 165 GLU n 
2 166 GLN n 
2 167 ASP n 
2 168 SER n 
2 169 LYS n 
2 170 ASP n 
2 171 SER n 
2 172 THR n 
2 173 TYR n 
2 174 SER n 
2 175 LEU n 
2 176 SER n 
2 177 SER n 
2 178 THR n 
2 179 LEU n 
2 180 THR n 
2 181 LEU n 
2 182 SER n 
2 183 LYS n 
2 184 ALA n 
2 185 ASP n 
2 186 TYR n 
2 187 GLU n 
2 188 LYS n 
2 189 HIS n 
2 190 LYS n 
2 191 VAL n 
2 192 TYR n 
2 193 ALA n 
2 194 CYS n 
2 195 GLU n 
2 196 VAL n 
2 197 THR n 
2 198 HIS n 
2 199 GLN n 
2 200 GLY n 
2 201 LEU n 
2 202 SER n 
2 203 SER n 
2 204 PRO n 
2 205 VAL n 
2 206 THR n 
2 207 LYS n 
2 208 SER n 
2 209 PHE n 
2 210 ASN n 
2 211 ARG n 
2 212 GLY n 
2 213 GLU n 
2 214 CYS n 
3 1   ASP n 
3 2   SER n 
3 3   PRO n 
3 4   ASP n 
3 5   ARG n 
3 6   PRO n 
3 7   TRP n 
3 8   ASN n 
3 9   PRO n 
3 10  PRO n 
3 11  THR n 
3 12  PHE n 
3 13  SER n 
3 14  PRO n 
3 15  ALA n 
3 16  LEU n 
3 17  LEU n 
3 18  VAL n 
3 19  VAL n 
3 20  THR n 
3 21  GLU n 
3 22  GLY n 
3 23  ASP n 
3 24  ASN n 
3 25  ALA n 
3 26  THR n 
3 27  PHE n 
3 28  THR n 
3 29  CYS n 
3 30  SER n 
3 31  PHE n 
3 32  SER n 
3 33  ASN n 
3 34  THR n 
3 35  SER n 
3 36  GLU n 
3 37  SER n 
3 38  PHE n 
3 39  VAL n 
3 40  LEU n 
3 41  ASN n 
3 42  TRP n 
3 43  TYR n 
3 44  ARG n 
3 45  MET n 
3 46  SER n 
3 47  PRO n 
3 48  SER n 
3 49  ASN n 
3 50  GLN n 
3 51  THR n 
3 52  ASP n 
3 53  LYS n 
3 54  LEU n 
3 55  ALA n 
3 56  ALA n 
3 57  PHE n 
3 58  PRO n 
3 59  GLU n 
3 60  ASP n 
3 61  ARG n 
3 62  SER n 
3 63  GLN n 
3 64  PRO n 
3 65  GLY n 
3 66  GLN n 
3 67  ASP n 
3 68  SER n 
3 69  ARG n 
3 70  PHE n 
3 71  ARG n 
3 72  VAL n 
3 73  THR n 
3 74  GLN n 
3 75  LEU n 
3 76  PRO n 
3 77  ASN n 
3 78  GLY n 
3 79  ARG n 
3 80  ASP n 
3 81  PHE n 
3 82  HIS n 
3 83  MET n 
3 84  SER n 
3 85  VAL n 
3 86  VAL n 
3 87  ARG n 
3 88  ALA n 
3 89  ARG n 
3 90  ARG n 
3 91  ASN n 
3 92  ASP n 
3 93  SER n 
3 94  GLY n 
3 95  THR n 
3 96  TYR n 
3 97  LEU n 
3 98  CYS n 
3 99  GLY n 
3 100 ALA n 
3 101 ILE n 
3 102 SER n 
3 103 LEU n 
3 104 ALA n 
3 105 PRO n 
3 106 LYS n 
3 107 ALA n 
3 108 GLN n 
3 109 ILE n 
3 110 LYS n 
3 111 GLU n 
3 112 SER n 
3 113 LEU n 
3 114 ARG n 
3 115 ALA n 
3 116 GLU n 
3 117 LEU n 
3 118 ARG n 
3 119 VAL n 
3 120 THR n 
3 121 GLU n 
3 122 ARG n 
3 123 ARG n 
3 124 ALA n 
3 125 GLU n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   125 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'PDCD1, PD1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli-Pichia pastoris shuttle vector pPpARG4' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     1182032 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
1 1 sample 1 225 'Homo sapiens' ? 9606 ? 
2 1 sample 1 214 'Homo sapiens' ? 9606 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 PDB 5GGR        5GGR   ? 1 ? 1  
2 PDB 5GGR        5GGR   ? 2 ? 1  
3 UNP PDCD1_HUMAN Q15116 ? 3 
;DSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRD
FHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAE
;
26 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5GGR A 1 ? 225 ? 5GGR   1  ? 225 ? 1  225 
2 2 5GGR B 1 ? 214 ? 5GGR   1  ? 214 ? 1  214 
3 1 5GGR H 1 ? 225 ? 5GGR   1  ? 225 ? 1  225 
4 2 5GGR L 1 ? 214 ? 5GGR   1  ? 214 ? 1  214 
5 3 5GGR Y 1 ? 125 ? Q15116 26 ? 150 ? 26 150 
6 3 5GGR Z 1 ? 125 ? Q15116 26 ? 150 ? 26 150 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
5 5GGR SER Y 68 ? UNP Q15116 CYS 93 'engineered mutation' 93 1 
6 5GGR SER Z 68 ? UNP Q15116 CYS 93 'engineered mutation' 93 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5GGR 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.37 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         48.09 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '100 mM MES, pH 6.5, 12% PEG500 MME, 6% PEG20,000, 50 mM ammonium acetate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 270' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-06-05 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'PAL/PLS BEAMLINE 7A (6B, 6C1)' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   '7A (6B, 6C1)' 
_diffrn_source.pdbx_synchrotron_site       PAL/PLS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5GGR 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.3 
_reflns.d_resolution_low                 50 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       17556 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.0 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.4 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            6.9 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  . 
_reflns_shell.d_res_low                   ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5GGR 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     17553 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.33 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.752 
_refine.ls_d_res_high                            3.300 
_refine.ls_percent_reflns_obs                    98.08 
_refine.ls_R_factor_obs                          0.2239 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2215 
_refine.ls_R_factor_R_free                       0.2679 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.11 
_refine.ls_number_reflns_R_free                  897 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.25 
_refine.pdbx_overall_phase_error                 35.27 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8256 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               8256 
_refine_hist.d_res_high                       3.300 
_refine_hist.d_res_low                        29.752 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.007  ? ? 8452  'X-RAY DIFFRACTION' ? 
f_angle_d          1.286  ? ? 11491 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 15.873 ? ? 3058  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.049  ? ? 1282  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.007  ? ? 1495  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 3.3001 3.5066  2786 0.2351 100.00 0.3019 . . 153 . . 
'X-RAY DIFFRACTION' . 3.5066 3.7768  2768 0.2350 99.00  0.3489 . . 147 . . 
'X-RAY DIFFRACTION' . 3.7768 4.1560  2761 0.2272 99.00  0.2384 . . 148 . . 
'X-RAY DIFFRACTION' . 4.1560 4.7553  2765 0.1981 98.00  0.2735 . . 139 . . 
'X-RAY DIFFRACTION' . 4.7553 5.9831  2785 0.2096 99.00  0.2218 . . 167 . . 
'X-RAY DIFFRACTION' . 5.9831 29.7528 2791 0.2288 95.00  0.2376 . . 143 . . 
# 
_struct.entry_id                     5GGR 
_struct.title                        'PD-1 in complex with nivolumab Fab' 
_struct.pdbx_descriptor              'heavy chain, light chain, Programmed cell death protein 1' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5GGR 
_struct_keywords.text            'antibody, IMMUNE SYSTEM' 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 62  ? LYS A 65  ? ASP A 62  LYS A 65  5 ? 4 
HELX_P HELX_P2  AA2 ARG A 87  ? THR A 91  ? ARG A 87  THR A 91  5 ? 5 
HELX_P HELX_P3  AA3 SER A 187 ? LEU A 189 ? SER A 187 LEU A 189 5 ? 3 
HELX_P HELX_P4  AA4 GLU B 79  ? PHE B 83  ? GLU B 79  PHE B 83  5 ? 5 
HELX_P HELX_P5  AA5 SER B 121 ? GLY B 128 ? SER B 121 GLY B 128 1 ? 8 
HELX_P HELX_P6  AA6 LYS B 183 ? LYS B 188 ? LYS B 183 LYS B 188 1 ? 6 
HELX_P HELX_P7  AA7 ARG C 87  ? THR C 91  ? ARG H 87  THR H 91  5 ? 5 
HELX_P HELX_P8  AA8 SER C 187 ? GLY C 190 ? SER H 187 GLY H 190 5 ? 4 
HELX_P HELX_P9  AA9 GLU D 79  ? PHE D 83  ? GLU L 79  PHE L 83  5 ? 5 
HELX_P HELX_P10 AB1 GLU D 123 ? GLY D 128 ? GLU L 123 GLY L 128 5 ? 6 
HELX_P HELX_P11 AB2 SER D 182 ? GLU D 187 ? SER L 182 GLU L 187 1 ? 6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 22  SG ? ? ? 1_555 A CYS 96  SG ? ? A CYS 22  A CYS 96  1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf2 disulf ? ? B CYS 23  SG ? ? ? 1_555 B CYS 88  SG ? ? B CYS 23  B CYS 88  1_555 ? ? ? ? ? ? ? 2.061 ? 
disulf3 disulf ? ? B CYS 134 SG ? ? ? 1_555 B CYS 194 SG ? ? B CYS 134 B CYS 194 1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf4 disulf ? ? C CYS 22  SG ? ? ? 1_555 C CYS 96  SG ? ? H CYS 22  H CYS 96  1_555 ? ? ? ? ? ? ? 2.028 ? 
disulf5 disulf ? ? C CYS 140 SG ? ? ? 1_555 C CYS 196 SG ? ? H CYS 140 H CYS 196 1_555 ? ? ? ? ? ? ? 2.028 ? 
disulf6 disulf ? ? D CYS 23  SG ? ? ? 1_555 D CYS 88  SG ? ? L CYS 23  L CYS 88  1_555 ? ? ? ? ? ? ? 2.036 ? 
disulf7 disulf ? ? F CYS 29  SG ? ? ? 1_555 F CYS 98  SG ? ? Z CYS 54  Z CYS 123 1_555 ? ? ? ? ? ? ? 2.071 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  PHE 146 A . ? PHE 146 A PRO 147 A ? PRO 147 A 1 -8.70  
2  GLU 148 A . ? GLU 148 A PRO 149 A ? PRO 149 A 1 -14.42 
3  SER 7   B . ? SER 7   B PRO 8   B ? PRO 8   B 1 -3.65  
4  TRP 94  B . ? TRP 94  B PRO 95  B ? PRO 95  B 1 -5.69  
5  TYR 140 B . ? TYR 140 B PRO 141 B ? PRO 141 B 1 1.00   
6  PHE 146 C . ? PHE 146 H PRO 147 C ? PRO 147 H 1 -8.92  
7  GLU 148 C . ? GLU 148 H PRO 149 C ? PRO 149 H 1 -6.80  
8  SER 7   D . ? SER 7   L PRO 8   D ? PRO 8   L 1 2.56   
9  TRP 94  D . ? TRP 94  L PRO 95  D ? PRO 95  L 1 -8.39  
10 TYR 140 D . ? TYR 140 L PRO 141 D ? PRO 141 L 1 -0.24  
11 SER 13  E . ? SER 38  Y PRO 14  E ? PRO 39  Y 1 0.05   
12 PHE 57  E . ? PHE 82  Y PRO 58  E ? PRO 83  Y 1 -7.62  
13 SER 13  F . ? SER 38  Z PRO 14  F ? PRO 39  Z 1 4.73   
14 PHE 57  F . ? PHE 82  Z PRO 58  F ? PRO 83  Z 1 -1.34  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 6 ? 
AA3 ? 4 ? 
AA4 ? 4 ? 
AA5 ? 3 ? 
AA6 ? 4 ? 
AA7 ? 5 ? 
AA8 ? 4 ? 
AA9 ? 3 ? 
AB1 ? 3 ? 
AB2 ? 4 ? 
AB3 ? 6 ? 
AB4 ? 4 ? 
AB5 ? 4 ? 
AB6 ? 3 ? 
AB7 ? 4 ? 
AB8 ? 5 ? 
AB9 ? 4 ? 
AC1 ? 3 ? 
AC2 ? 5 ? 
AC3 ? 4 ? 
AC4 ? 3 ? 
AC5 ? 4 ? 
AC6 ? 5 ? 
AC7 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? parallel      
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? parallel      
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA7 4 5 ? anti-parallel 
AA8 1 2 ? parallel      
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB2 3 4 ? anti-parallel 
AB3 1 2 ? parallel      
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
AB3 4 5 ? anti-parallel 
AB3 5 6 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB5 3 4 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB7 3 4 ? anti-parallel 
AB8 1 2 ? parallel      
AB8 2 3 ? anti-parallel 
AB8 3 4 ? anti-parallel 
AB8 4 5 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AB9 3 4 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC2 1 2 ? parallel      
AC2 2 3 ? anti-parallel 
AC2 3 4 ? anti-parallel 
AC2 4 5 ? anti-parallel 
AC3 1 2 ? parallel      
AC3 2 3 ? anti-parallel 
AC3 3 4 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC4 2 3 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC5 2 3 ? anti-parallel 
AC5 3 4 ? anti-parallel 
AC6 1 2 ? parallel      
AC6 2 3 ? anti-parallel 
AC6 3 4 ? anti-parallel 
AC6 4 5 ? anti-parallel 
AC7 1 2 ? parallel      
AC7 2 3 ? anti-parallel 
AC7 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLN A 3   ? GLU A 6   ? GLN A 3   GLU A 6   
AA1 2 LEU A 18  ? SER A 25  ? LEU A 18  SER A 25  
AA1 3 THR A 78  ? MET A 83  ? THR A 78  MET A 83  
AA1 4 PHE A 68  ? ASP A 73  ? PHE A 68  ASP A 73  
AA2 1 GLY A 10  ? VAL A 12  ? GLY A 10  VAL A 12  
AA2 2 THR A 107 ? VAL A 111 ? THR A 107 VAL A 111 
AA2 3 ALA A 92  ? THR A 98  ? ALA A 92  THR A 98  
AA2 4 MET A 34  ? GLN A 39  ? MET A 34  GLN A 39  
AA2 5 LEU A 45  ? ILE A 51  ? LEU A 45  ILE A 51  
AA2 6 ARG A 58  ? TYR A 60  ? ARG A 58  TYR A 60  
AA3 1 SER A 120 ? LEU A 124 ? SER A 120 LEU A 124 
AA3 2 THR A 135 ? TYR A 145 ? THR A 135 TYR A 145 
AA3 3 TYR A 176 ? PRO A 185 ? TYR A 176 PRO A 185 
AA3 4 VAL A 163 ? THR A 165 ? VAL A 163 THR A 165 
AA4 1 SER A 120 ? LEU A 124 ? SER A 120 LEU A 124 
AA4 2 THR A 135 ? TYR A 145 ? THR A 135 TYR A 145 
AA4 3 TYR A 176 ? PRO A 185 ? TYR A 176 PRO A 185 
AA4 4 VAL A 169 ? LEU A 170 ? VAL A 169 LEU A 170 
AA5 1 THR A 151 ? TRP A 154 ? THR A 151 TRP A 154 
AA5 2 TYR A 194 ? HIS A 200 ? TYR A 194 HIS A 200 
AA5 3 THR A 205 ? VAL A 211 ? THR A 205 VAL A 211 
AA6 1 LEU B 4   ? SER B 7   ? LEU B 4   SER B 7   
AA6 2 ALA B 19  ? ALA B 25  ? ALA B 19  ALA B 25  
AA6 3 ASP B 70  ? ILE B 75  ? ASP B 70  ILE B 75  
AA6 4 PHE B 62  ? SER B 67  ? PHE B 62  SER B 67  
AA7 1 THR B 10  ? LEU B 13  ? THR B 10  LEU B 13  
AA7 2 THR B 102 ? ILE B 106 ? THR B 102 ILE B 106 
AA7 3 VAL B 85  ? GLN B 90  ? VAL B 85  GLN B 90  
AA7 4 LEU B 33  ? GLN B 38  ? LEU B 33  GLN B 38  
AA7 5 ARG B 45  ? TYR B 49  ? ARG B 45  TYR B 49  
AA8 1 THR B 10  ? LEU B 13  ? THR B 10  LEU B 13  
AA8 2 THR B 102 ? ILE B 106 ? THR B 102 ILE B 106 
AA8 3 VAL B 85  ? GLN B 90  ? VAL B 85  GLN B 90  
AA8 4 THR B 97  ? PHE B 98  ? THR B 97  PHE B 98  
AA9 1 SER B 114 ? PHE B 118 ? SER B 114 PHE B 118 
AA9 2 THR B 129 ? PHE B 139 ? THR B 129 PHE B 139 
AA9 3 TYR B 173 ? SER B 182 ? TYR B 173 SER B 182 
AB1 1 ALA B 144 ? VAL B 150 ? ALA B 144 VAL B 150 
AB1 2 VAL B 191 ? HIS B 198 ? VAL B 191 HIS B 198 
AB1 3 VAL B 205 ? ASN B 210 ? VAL B 205 ASN B 210 
AB2 1 GLN C 3   ? SER C 7   ? GLN H 3   SER H 7   
AB2 2 SER C 17  ? SER C 25  ? SER H 17  SER H 25  
AB2 3 THR C 78  ? ASN C 84  ? THR H 78  ASN H 84  
AB2 4 THR C 69  ? ASP C 73  ? THR H 69  ASP H 73  
AB3 1 VAL C 11  ? VAL C 12  ? VAL H 11  VAL H 12  
AB3 2 THR C 107 ? VAL C 111 ? THR H 107 VAL H 111 
AB3 3 ALA C 92  ? TYR C 95  ? ALA H 92  TYR H 95  
AB3 4 HIS C 35  ? GLN C 39  ? HIS H 35  GLN H 39  
AB3 5 LEU C 45  ? TRP C 52  ? LEU H 45  TRP H 52  
AB3 6 GLY C 55  ? TYR C 60  ? GLY H 55  TYR H 60  
AB4 1 SER C 120 ? LEU C 124 ? SER H 120 LEU H 124 
AB4 2 THR C 135 ? TYR C 145 ? THR H 135 TYR H 145 
AB4 3 TYR C 176 ? PRO C 185 ? TYR H 176 PRO H 185 
AB4 4 VAL C 163 ? THR C 165 ? VAL H 163 THR H 165 
AB5 1 SER C 120 ? LEU C 124 ? SER H 120 LEU H 124 
AB5 2 THR C 135 ? TYR C 145 ? THR H 135 TYR H 145 
AB5 3 TYR C 176 ? PRO C 185 ? TYR H 176 PRO H 185 
AB5 4 VAL C 169 ? LEU C 170 ? VAL H 169 LEU H 170 
AB6 1 THR C 151 ? TRP C 154 ? THR H 151 TRP H 154 
AB6 2 TYR C 194 ? HIS C 200 ? TYR H 194 HIS H 200 
AB6 3 THR C 205 ? VAL C 211 ? THR H 205 VAL H 211 
AB7 1 LEU D 4   ? SER D 7   ? LEU L 4   SER L 7   
AB7 2 ALA D 19  ? ALA D 25  ? ALA L 19  ALA L 25  
AB7 3 ASP D 70  ? ILE D 75  ? ASP L 70  ILE L 75  
AB7 4 PHE D 62  ? SER D 67  ? PHE L 62  SER L 67  
AB8 1 THR D 10  ? LEU D 13  ? THR L 10  LEU L 13  
AB8 2 THR D 102 ? ILE D 106 ? THR L 102 ILE L 106 
AB8 3 VAL D 85  ? GLN D 89  ? VAL L 85  GLN L 89  
AB8 4 ALA D 34  ? GLN D 38  ? ALA L 34  GLN L 38  
AB8 5 ARG D 45  ? TYR D 49  ? ARG L 45  TYR L 49  
AB9 1 SER D 114 ? PHE D 118 ? SER L 114 PHE L 118 
AB9 2 VAL D 132 ? PHE D 139 ? VAL L 132 PHE L 139 
AB9 3 TYR D 173 ? LEU D 179 ? TYR L 173 LEU L 179 
AB9 4 SER D 159 ? VAL D 163 ? SER L 159 VAL L 163 
AC1 1 LYS D 145 ? VAL D 150 ? LYS L 145 VAL L 150 
AC1 2 TYR D 192 ? THR D 197 ? TYR L 192 THR L 197 
AC1 3 VAL D 205 ? LYS D 207 ? VAL L 205 LYS L 207 
AC2 1 LEU E 16  ? THR E 20  ? LEU Y 41  THR Y 45  
AC2 2 ALA E 115 ? THR E 120 ? ALA Y 140 THR Y 145 
AC2 3 GLY E 94  ? SER E 102 ? GLY Y 119 SER Y 127 
AC2 4 PHE E 38  ? ARG E 44  ? PHE Y 63  ARG Y 69  
AC2 5 ASP E 52  ? PHE E 57  ? ASP Y 77  PHE Y 82  
AC3 1 LEU E 16  ? THR E 20  ? LEU Y 41  THR Y 45  
AC3 2 ALA E 115 ? THR E 120 ? ALA Y 140 THR Y 145 
AC3 3 GLY E 94  ? SER E 102 ? GLY Y 119 SER Y 127 
AC3 4 ILE E 109 ? GLU E 111 ? ILE Y 134 GLU Y 136 
AC4 1 ALA E 25  ? SER E 30  ? ALA Y 50  SER Y 55  
AC4 2 ASP E 80  ? VAL E 85  ? ASP Y 105 VAL Y 110 
AC4 3 ARG E 71  ? GLN E 74  ? ARG Y 96  GLN Y 99  
AC5 1 THR F 11  ? SER F 13  ? THR Z 36  SER Z 38  
AC5 2 ALA F 25  ? SER F 30  ? ALA Z 50  SER Z 55  
AC5 3 ASP F 80  ? VAL F 85  ? ASP Z 105 VAL Z 110 
AC5 4 PHE F 70  ? GLN F 74  ? PHE Z 95  GLN Z 99  
AC6 1 LEU F 16  ? THR F 20  ? LEU Z 41  THR Z 45  
AC6 2 ALA F 115 ? THR F 120 ? ALA Z 140 THR Z 145 
AC6 3 THR F 95  ? SER F 102 ? THR Z 120 SER Z 127 
AC6 4 PHE F 38  ? ARG F 44  ? PHE Z 63  ARG Z 69  
AC6 5 ASP F 52  ? PHE F 57  ? ASP Z 77  PHE Z 82  
AC7 1 LEU F 16  ? THR F 20  ? LEU Z 41  THR Z 45  
AC7 2 ALA F 115 ? THR F 120 ? ALA Z 140 THR Z 145 
AC7 3 THR F 95  ? SER F 102 ? THR Z 120 SER Z 127 
AC7 4 ILE F 109 ? GLU F 111 ? ILE Z 134 GLU Z 136 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N VAL A 5   ? N VAL A 5   O LYS A 23  ? O LYS A 23  
AA1 2 3 N CYS A 22  ? N CYS A 22  O LEU A 79  ? O LEU A 79  
AA1 3 4 O GLN A 82  ? O GLN A 82  N THR A 69  ? N THR A 69  
AA2 1 2 N GLY A 10  ? N GLY A 10  O LEU A 108 ? O LEU A 108 
AA2 2 3 O THR A 107 ? O THR A 107 N TYR A 94  ? N TYR A 94  
AA2 3 4 O TYR A 95  ? O TYR A 95  N VAL A 37  ? N VAL A 37  
AA2 4 5 N ARG A 38  ? N ARG A 38  O GLU A 46  ? O GLU A 46  
AA2 5 6 N VAL A 50  ? N VAL A 50  O TYR A 59  ? O TYR A 59  
AA3 1 2 N PHE A 122 ? N PHE A 122 O LEU A 141 ? O LEU A 141 
AA3 2 3 N ALA A 136 ? N ALA A 136 O VAL A 184 ? O VAL A 184 
AA3 3 4 O VAL A 181 ? O VAL A 181 N HIS A 164 ? N HIS A 164 
AA4 1 2 N PHE A 122 ? N PHE A 122 O LEU A 141 ? O LEU A 141 
AA4 2 3 N ALA A 136 ? N ALA A 136 O VAL A 184 ? O VAL A 184 
AA4 3 4 O SER A 177 ? O SER A 177 N VAL A 169 ? N VAL A 169 
AA5 1 2 N SER A 153 ? N SER A 153 O ASN A 197 ? O ASN A 197 
AA5 2 3 N VAL A 198 ? N VAL A 198 O VAL A 207 ? O VAL A 207 
AA6 1 2 N THR B 5   ? N THR B 5   O ARG B 24  ? O ARG B 24  
AA6 2 3 N LEU B 21  ? N LEU B 21  O LEU B 73  ? O LEU B 73  
AA6 3 4 O THR B 74  ? O THR B 74  N SER B 63  ? N SER B 63  
AA7 1 2 N LEU B 11  ? N LEU B 11  O GLU B 105 ? O GLU B 105 
AA7 2 3 O THR B 102 ? O THR B 102 N TYR B 86  ? N TYR B 86  
AA7 3 4 O GLN B 89  ? O GLN B 89  N ALA B 34  ? N ALA B 34  
AA7 4 5 N GLN B 37  ? N GLN B 37  O ARG B 45  ? O ARG B 45  
AA8 1 2 N LEU B 11  ? N LEU B 11  O GLU B 105 ? O GLU B 105 
AA8 2 3 O THR B 102 ? O THR B 102 N TYR B 86  ? N TYR B 86  
AA8 3 4 N GLN B 90  ? N GLN B 90  O THR B 97  ? O THR B 97  
AA9 1 2 N PHE B 116 ? N PHE B 116 O LEU B 135 ? O LEU B 135 
AA9 2 3 N VAL B 132 ? N VAL B 132 O LEU B 179 ? O LEU B 179 
AB1 1 2 N GLN B 147 ? N GLN B 147 O GLU B 195 ? O GLU B 195 
AB1 2 3 N CYS B 194 ? N CYS B 194 O LYS B 207 ? O LYS B 207 
AB2 1 2 N VAL C 5   ? N VAL H 5   O LYS C 23  ? O LYS H 23  
AB2 2 3 N CYS C 22  ? N CYS H 22  O LEU C 79  ? O LEU H 79  
AB2 3 4 O PHE C 80  ? O PHE H 80  N SER C 71  ? N SER H 71  
AB3 1 2 N VAL C 12  ? N VAL H 12  O THR C 110 ? O THR H 110 
AB3 2 3 O VAL C 109 ? O VAL H 109 N ALA C 92  ? N ALA H 92  
AB3 3 4 O TYR C 95  ? O TYR H 95  N VAL C 37  ? N VAL H 37  
AB3 4 5 N TRP C 36  ? N TRP H 36  O VAL C 48  ? O VAL H 48  
AB3 5 6 N VAL C 50  ? N VAL H 50  O TYR C 59  ? O TYR H 59  
AB4 1 2 N PHE C 122 ? N PHE H 122 O LEU C 141 ? O LEU H 141 
AB4 2 3 N CYS C 140 ? N CYS H 140 O SER C 180 ? O SER H 180 
AB4 3 4 O VAL C 181 ? O VAL H 181 N HIS C 164 ? N HIS H 164 
AB5 1 2 N PHE C 122 ? N PHE H 122 O LEU C 141 ? O LEU H 141 
AB5 2 3 N CYS C 140 ? N CYS H 140 O SER C 180 ? O SER H 180 
AB5 3 4 O SER C 177 ? O SER H 177 N VAL C 169 ? N VAL H 169 
AB6 1 2 N SER C 153 ? N SER H 153 O ASN C 197 ? O ASN H 197 
AB6 2 3 N HIS C 200 ? N HIS H 200 O THR C 205 ? O THR H 205 
AB7 1 2 N THR D 5   ? N THR L 5   O ARG D 24  ? O ARG L 24  
AB7 2 3 N LEU D 21  ? N LEU L 21  O LEU D 73  ? O LEU L 73  
AB7 3 4 O THR D 74  ? O THR L 74  N SER D 63  ? N SER L 63  
AB8 1 2 N LEU D 11  ? N LEU L 11  O LYS D 103 ? O LYS L 103 
AB8 2 3 O THR D 102 ? O THR L 102 N TYR D 86  ? N TYR L 86  
AB8 3 4 O VAL D 85  ? O VAL L 85  N GLN D 38  ? N GLN L 38  
AB8 4 5 N TRP D 35  ? N TRP L 35  O LEU D 47  ? O LEU L 47  
AB9 1 2 N PHE D 118 ? N PHE L 118 O VAL D 133 ? O VAL L 133 
AB9 2 3 N CYS D 134 ? N CYS L 134 O SER D 177 ? O SER L 177 
AB9 3 4 O SER D 176 ? O SER L 176 N SER D 162 ? N SER L 162 
AC1 1 2 N LYS D 145 ? N LYS L 145 O THR D 197 ? O THR L 197 
AC1 2 3 N VAL D 196 ? N VAL L 196 O VAL D 205 ? O VAL L 205 
AC2 1 2 N LEU E 17  ? N LEU Y 42  O ARG E 118 ? O ARG Y 143 
AC2 2 3 O ALA E 115 ? O ALA Y 140 N TYR E 96  ? N TYR Y 121 
AC2 3 4 O ILE E 101 ? O ILE Y 126 N VAL E 39  ? N VAL Y 64  
AC2 4 5 N TRP E 42  ? N TRP Y 67  O LEU E 54  ? O LEU Y 79  
AC3 1 2 N LEU E 17  ? N LEU Y 42  O ARG E 118 ? O ARG Y 143 
AC3 2 3 O ALA E 115 ? O ALA Y 140 N TYR E 96  ? N TYR Y 121 
AC3 3 4 N ALA E 100 ? N ALA Y 125 O LYS E 110 ? O LYS Y 135 
AC4 1 2 N PHE E 27  ? N PHE Y 52  O MET E 83  ? O MET Y 108 
AC4 2 3 O HIS E 82  ? O HIS Y 107 N THR E 73  ? N THR Y 98  
AC5 1 2 N SER F 13  ? N SER Z 38  O THR F 28  ? O THR Z 53  
AC5 2 3 N PHE F 27  ? N PHE Z 52  O MET F 83  ? O MET Z 108 
AC5 3 4 O HIS F 82  ? O HIS Z 107 N THR F 73  ? N THR Z 98  
AC6 1 2 N LEU F 17  ? N LEU Z 42  O ARG F 118 ? O ARG Z 143 
AC6 2 3 O ALA F 115 ? O ALA Z 140 N TYR F 96  ? N TYR Z 121 
AC6 3 4 O LEU F 97  ? O LEU Z 122 N TYR F 43  ? N TYR Z 68  
AC6 4 5 N LEU F 40  ? N LEU Z 65  O PHE F 57  ? O PHE Z 82  
AC7 1 2 N LEU F 17  ? N LEU Z 42  O ARG F 118 ? O ARG Z 143 
AC7 2 3 O ALA F 115 ? O ALA Z 140 N TYR F 96  ? N TYR Z 121 
AC7 3 4 N ALA F 100 ? N ALA Z 125 O LYS F 110 ? O LYS Z 135 
# 
_atom_sites.entry_id                    5GGR 
_atom_sites.fract_transf_matrix[1][1]   0.010954 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002353 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.020571 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007582 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . VAL A 1 2   ? 55.489  8.815   14.233  1.00 52.91  ? 2   VAL A N   1 
ATOM 2    C CA  . VAL A 1 2   ? 54.872  7.810   15.088  1.00 56.01  ? 2   VAL A CA  1 
ATOM 3    C C   . VAL A 1 2   ? 53.410  7.572   14.696  1.00 55.51  ? 2   VAL A C   1 
ATOM 4    O O   . VAL A 1 2   ? 52.511  7.667   15.526  1.00 39.57  ? 2   VAL A O   1 
ATOM 5    C CB  . VAL A 1 2   ? 54.965  8.221   16.575  1.00 55.67  ? 2   VAL A CB  1 
ATOM 6    C CG1 . VAL A 1 2   ? 54.747  7.023   17.484  1.00 60.47  ? 2   VAL A CG1 1 
ATOM 7    C CG2 . VAL A 1 2   ? 56.322  8.845   16.870  1.00 44.17  ? 2   VAL A CG2 1 
ATOM 8    N N   . GLN A 1 3   ? 53.171  7.281   13.418  1.00 48.33  ? 3   GLN A N   1 
ATOM 9    C CA  . GLN A 1 3   ? 51.805  7.180   12.904  1.00 47.75  ? 3   GLN A CA  1 
ATOM 10   C C   . GLN A 1 3   ? 51.639  6.120   11.813  1.00 52.06  ? 3   GLN A C   1 
ATOM 11   O O   . GLN A 1 3   ? 52.612  5.511   11.365  1.00 37.27  ? 3   GLN A O   1 
ATOM 12   C CB  . GLN A 1 3   ? 51.361  8.535   12.340  1.00 47.17  ? 3   GLN A CB  1 
ATOM 13   C CG  . GLN A 1 3   ? 51.623  9.727   13.237  1.00 50.68  ? 3   GLN A CG  1 
ATOM 14   C CD  . GLN A 1 3   ? 51.198  11.017  12.601  1.00 59.18  ? 3   GLN A CD  1 
ATOM 15   O OE1 . GLN A 1 3   ? 50.017  11.220  12.338  1.00 59.91  ? 3   GLN A OE1 1 
ATOM 16   N NE2 . GLN A 1 3   ? 52.157  11.897  12.333  1.00 63.93  ? 3   GLN A NE2 1 
ATOM 17   N N   . LEU A 1 4   ? 50.391  5.906   11.402  1.00 45.96  ? 4   LEU A N   1 
ATOM 18   C CA  . LEU A 1 4   ? 50.084  5.131   10.211  1.00 31.56  ? 4   LEU A CA  1 
ATOM 19   C C   . LEU A 1 4   ? 49.009  5.881   9.428   1.00 37.38  ? 4   LEU A C   1 
ATOM 20   O O   . LEU A 1 4   ? 47.871  5.979   9.892   1.00 38.99  ? 4   LEU A O   1 
ATOM 21   C CB  . LEU A 1 4   ? 49.603  3.722   10.584  1.00 30.31  ? 4   LEU A CB  1 
ATOM 22   C CG  . LEU A 1 4   ? 50.544  2.735   11.288  1.00 30.58  ? 4   LEU A CG  1 
ATOM 23   C CD1 . LEU A 1 4   ? 50.560  2.986   12.784  1.00 31.50  ? 4   LEU A CD1 1 
ATOM 24   C CD2 . LEU A 1 4   ? 50.119  1.305   11.015  1.00 29.10  ? 4   LEU A CD2 1 
ATOM 25   N N   . VAL A 1 5   ? 49.339  6.378   8.237   1.00 38.80  ? 5   VAL A N   1 
ATOM 26   C CA  . VAL A 1 5   ? 48.360  7.143   7.464   1.00 39.13  ? 5   VAL A CA  1 
ATOM 27   C C   . VAL A 1 5   ? 47.831  6.324   6.299   1.00 44.64  ? 5   VAL A C   1 
ATOM 28   O O   . VAL A 1 5   ? 48.600  5.772   5.507   1.00 48.23  ? 5   VAL A O   1 
ATOM 29   C CB  . VAL A 1 5   ? 48.941  8.467   6.930   1.00 32.02  ? 5   VAL A CB  1 
ATOM 30   C CG1 . VAL A 1 5   ? 47.905  9.195   6.081   1.00 31.54  ? 5   VAL A CG1 1 
ATOM 31   C CG2 . VAL A 1 5   ? 49.388  9.346   8.079   1.00 33.50  ? 5   VAL A CG2 1 
ATOM 32   N N   . GLU A 1 6   ? 46.511  6.243   6.196   1.00 29.03  ? 6   GLU A N   1 
ATOM 33   C CA  . GLU A 1 6   ? 45.920  5.437   5.151   1.00 43.80  ? 6   GLU A CA  1 
ATOM 34   C C   . GLU A 1 6   ? 45.405  6.311   4.022   1.00 48.04  ? 6   GLU A C   1 
ATOM 35   O O   . GLU A 1 6   ? 45.431  7.537   4.105   1.00 57.23  ? 6   GLU A O   1 
ATOM 36   C CB  . GLU A 1 6   ? 44.810  4.575   5.733   1.00 26.41  ? 6   GLU A CB  1 
ATOM 37   C CG  . GLU A 1 6   ? 45.284  3.788   6.929   1.00 46.49  ? 6   GLU A CG  1 
ATOM 38   C CD  . GLU A 1 6   ? 44.258  3.760   8.032   1.00 50.10  ? 6   GLU A CD  1 
ATOM 39   O OE1 . GLU A 1 6   ? 43.090  3.463   7.718   1.00 57.41  ? 6   GLU A OE1 1 
ATOM 40   O OE2 . GLU A 1 6   ? 44.608  4.048   9.199   1.00 27.29  ? 6   GLU A OE2 1 
ATOM 41   N N   . SER A 1 7   ? 44.920  5.665   2.971   1.00 40.58  ? 7   SER A N   1 
ATOM 42   C CA  . SER A 1 7   ? 44.598  6.344   1.727   1.00 39.35  ? 7   SER A CA  1 
ATOM 43   C C   . SER A 1 7   ? 43.629  5.507   0.900   1.00 37.78  ? 7   SER A C   1 
ATOM 44   O O   . SER A 1 7   ? 43.141  4.470   1.352   1.00 44.44  ? 7   SER A O   1 
ATOM 45   C CB  . SER A 1 7   ? 45.866  6.615   0.907   1.00 37.26  ? 7   SER A CB  1 
ATOM 46   O OG  . SER A 1 7   ? 46.964  7.000   1.715   1.00 28.31  ? 7   SER A OG  1 
ATOM 47   N N   . GLY A 1 8   ? 43.362  5.972   -0.315  1.00 35.43  ? 8   GLY A N   1 
ATOM 48   C CA  . GLY A 1 8   ? 42.671  5.186   -1.322  1.00 34.04  ? 8   GLY A CA  1 
ATOM 49   C C   . GLY A 1 8   ? 41.277  4.684   -0.998  1.00 32.76  ? 8   GLY A C   1 
ATOM 50   O O   . GLY A 1 8   ? 40.918  3.577   -1.390  1.00 23.70  ? 8   GLY A O   1 
ATOM 51   N N   . GLY A 1 9   ? 40.488  5.495   -0.298  1.00 24.87  ? 9   GLY A N   1 
ATOM 52   C CA  . GLY A 1 9   ? 39.130  5.120   0.064   1.00 23.81  ? 9   GLY A CA  1 
ATOM 53   C C   . GLY A 1 9   ? 38.031  5.774   -0.762  1.00 45.14  ? 9   GLY A C   1 
ATOM 54   O O   . GLY A 1 9   ? 38.281  6.276   -1.861  1.00 49.05  ? 9   GLY A O   1 
ATOM 55   N N   . GLY A 1 10  ? 36.818  5.795   -0.215  1.00 42.76  ? 10  GLY A N   1 
ATOM 56   C CA  . GLY A 1 10  ? 35.669  6.374   -0.890  1.00 38.83  ? 10  GLY A CA  1 
ATOM 57   C C   . GLY A 1 10  ? 34.746  5.402   -1.616  1.00 34.12  ? 10  GLY A C   1 
ATOM 58   O O   . GLY A 1 10  ? 34.753  4.202   -1.331  1.00 29.40  ? 10  GLY A O   1 
ATOM 59   N N   . VAL A 1 11  ? 33.942  5.928   -2.543  1.00 40.07  ? 11  VAL A N   1 
ATOM 60   C CA  . VAL A 1 11  ? 32.861  5.176   -3.193  1.00 38.34  ? 11  VAL A CA  1 
ATOM 61   C C   . VAL A 1 11  ? 33.248  4.498   -4.519  1.00 36.23  ? 11  VAL A C   1 
ATOM 62   O O   . VAL A 1 11  ? 33.877  5.103   -5.390  1.00 30.25  ? 11  VAL A O   1 
ATOM 63   C CB  . VAL A 1 11  ? 31.637  6.105   -3.441  1.00 25.09  ? 11  VAL A CB  1 
ATOM 64   C CG1 . VAL A 1 11  ? 30.697  5.536   -4.498  1.00 28.16  ? 11  VAL A CG1 1 
ATOM 65   C CG2 . VAL A 1 11  ? 30.884  6.357   -2.141  1.00 37.72  ? 11  VAL A CG2 1 
ATOM 66   N N   . VAL A 1 12  ? 32.846  3.235   -4.657  1.00 23.99  ? 12  VAL A N   1 
ATOM 67   C CA  . VAL A 1 12  ? 33.110  2.445   -5.856  1.00 28.23  ? 12  VAL A CA  1 
ATOM 68   C C   . VAL A 1 12  ? 31.925  1.514   -6.160  1.00 26.22  ? 12  VAL A C   1 
ATOM 69   O O   . VAL A 1 12  ? 31.317  0.953   -5.248  1.00 32.65  ? 12  VAL A O   1 
ATOM 70   C CB  . VAL A 1 12  ? 34.421  1.627   -5.701  1.00 59.02  ? 12  VAL A CB  1 
ATOM 71   C CG1 . VAL A 1 12  ? 34.421  0.841   -4.392  1.00 23.25  ? 12  VAL A CG1 1 
ATOM 72   C CG2 . VAL A 1 12  ? 34.644  0.706   -6.891  1.00 60.82  ? 12  VAL A CG2 1 
ATOM 73   N N   . GLN A 1 13  ? 31.587  1.376   -7.440  1.00 27.96  ? 13  GLN A N   1 
ATOM 74   C CA  . GLN A 1 13  ? 30.487  0.512   -7.870  1.00 27.56  ? 13  GLN A CA  1 
ATOM 75   C C   . GLN A 1 13  ? 30.839  -0.967  -7.676  1.00 28.79  ? 13  GLN A C   1 
ATOM 76   O O   . GLN A 1 13  ? 32.013  -1.303  -7.537  1.00 37.32  ? 13  GLN A O   1 
ATOM 77   C CB  . GLN A 1 13  ? 30.133  0.793   -9.335  1.00 33.82  ? 13  GLN A CB  1 
ATOM 78   C CG  . GLN A 1 13  ? 29.432  2.120   -9.565  1.00 47.32  ? 13  GLN A CG  1 
ATOM 79   C CD  . GLN A 1 13  ? 28.056  1.943   -10.179 1.00 65.88  ? 13  GLN A CD  1 
ATOM 80   O OE1 . GLN A 1 13  ? 27.498  0.845   -10.166 1.00 71.40  ? 13  GLN A OE1 1 
ATOM 81   N NE2 . GLN A 1 13  ? 27.494  3.027   -10.703 1.00 71.75  ? 13  GLN A NE2 1 
ATOM 82   N N   . PRO A 1 14  ? 29.828  -1.859  -7.659  1.00 30.95  ? 14  PRO A N   1 
ATOM 83   C CA  . PRO A 1 14  ? 30.138  -3.280  -7.439  1.00 21.51  ? 14  PRO A CA  1 
ATOM 84   C C   . PRO A 1 14  ? 30.989  -3.918  -8.537  1.00 43.74  ? 14  PRO A C   1 
ATOM 85   O O   . PRO A 1 14  ? 30.838  -3.595  -9.714  1.00 41.18  ? 14  PRO A O   1 
ATOM 86   C CB  . PRO A 1 14  ? 28.759  -3.947  -7.411  1.00 22.00  ? 14  PRO A CB  1 
ATOM 87   C CG  . PRO A 1 14  ? 27.801  -2.864  -7.129  1.00 30.64  ? 14  PRO A CG  1 
ATOM 88   C CD  . PRO A 1 14  ? 28.375  -1.625  -7.741  1.00 23.23  ? 14  PRO A CD  1 
ATOM 89   N N   . GLY A 1 15  ? 31.877  -4.824  -8.137  1.00 33.26  ? 15  GLY A N   1 
ATOM 90   C CA  . GLY A 1 15  ? 32.693  -5.587  -9.068  1.00 28.73  ? 15  GLY A CA  1 
ATOM 91   C C   . GLY A 1 15  ? 33.906  -4.811  -9.536  1.00 32.03  ? 15  GLY A C   1 
ATOM 92   O O   . GLY A 1 15  ? 34.886  -5.382  -10.022 1.00 25.77  ? 15  GLY A O   1 
ATOM 93   N N   . ARG A 1 16  ? 33.834  -3.497  -9.367  1.00 26.49  ? 16  ARG A N   1 
ATOM 94   C CA  . ARG A 1 16  ? 34.938  -2.618  -9.688  1.00 40.04  ? 16  ARG A CA  1 
ATOM 95   C C   . ARG A 1 16  ? 35.923  -2.684  -8.538  1.00 32.93  ? 16  ARG A C   1 
ATOM 96   O O   . ARG A 1 16  ? 35.530  -2.730  -7.372  1.00 45.18  ? 16  ARG A O   1 
ATOM 97   C CB  . ARG A 1 16  ? 34.452  -1.187  -9.915  1.00 35.18  ? 16  ARG A CB  1 
ATOM 98   C CG  . ARG A 1 16  ? 33.482  -1.011  -11.080 1.00 41.86  ? 16  ARG A CG  1 
ATOM 99   C CD  . ARG A 1 16  ? 34.185  -0.942  -12.435 1.00 41.83  ? 16  ARG A CD  1 
ATOM 100  N NE  . ARG A 1 16  ? 33.230  -0.983  -13.544 1.00 42.04  ? 16  ARG A NE  1 
ATOM 101  C CZ  . ARG A 1 16  ? 33.520  -0.684  -14.809 1.00 41.13  ? 16  ARG A CZ  1 
ATOM 102  N NH1 . ARG A 1 16  ? 34.747  -0.313  -15.153 1.00 36.06  ? 16  ARG A NH1 1 
ATOM 103  N NH2 . ARG A 1 16  ? 32.577  -0.754  -15.737 1.00 36.45  ? 16  ARG A NH2 1 
ATOM 104  N N   . SER A 1 17  ? 37.205  -2.703  -8.867  1.00 38.22  ? 17  SER A N   1 
ATOM 105  C CA  . SER A 1 17  ? 38.234  -2.836  -7.851  1.00 30.61  ? 17  SER A CA  1 
ATOM 106  C C   . SER A 1 17  ? 38.497  -1.537  -7.098  1.00 38.68  ? 17  SER A C   1 
ATOM 107  O O   . SER A 1 17  ? 37.817  -0.530  -7.311  1.00 46.25  ? 17  SER A O   1 
ATOM 108  C CB  . SER A 1 17  ? 39.527  -3.331  -8.492  1.00 28.52  ? 17  SER A CB  1 
ATOM 109  O OG  . SER A 1 17  ? 40.660  -2.805  -7.827  1.00 27.48  ? 17  SER A OG  1 
ATOM 110  N N   . LEU A 1 18  ? 39.508  -1.586  -6.234  1.00 35.12  ? 18  LEU A N   1 
ATOM 111  C CA  . LEU A 1 18  ? 40.025  -0.429  -5.512  1.00 32.34  ? 18  LEU A CA  1 
ATOM 112  C C   . LEU A 1 18  ? 41.222  -0.902  -4.694  1.00 28.86  ? 18  LEU A C   1 
ATOM 113  O O   . LEU A 1 18  ? 41.303  -2.078  -4.345  1.00 32.16  ? 18  LEU A O   1 
ATOM 114  C CB  . LEU A 1 18  ? 38.946  0.180   -4.605  1.00 19.73  ? 18  LEU A CB  1 
ATOM 115  C CG  . LEU A 1 18  ? 39.302  1.354   -3.688  1.00 33.28  ? 18  LEU A CG  1 
ATOM 116  C CD1 . LEU A 1 18  ? 39.789  2.547   -4.493  1.00 28.96  ? 18  LEU A CD1 1 
ATOM 117  C CD2 . LEU A 1 18  ? 38.112  1.744   -2.820  1.00 37.03  ? 18  LEU A CD2 1 
ATOM 118  N N   . ARG A 1 19  ? 42.134  0.005   -4.356  1.00 22.53  ? 19  ARG A N   1 
ATOM 119  C CA  . ARG A 1 19  ? 43.339  -0.399  -3.634  1.00 36.44  ? 19  ARG A CA  1 
ATOM 120  C C   . ARG A 1 19  ? 43.746  0.581   -2.539  1.00 32.73  ? 19  ARG A C   1 
ATOM 121  O O   . ARG A 1 19  ? 44.031  1.749   -2.807  1.00 22.63  ? 19  ARG A O   1 
ATOM 122  C CB  . ARG A 1 19  ? 44.509  -0.596  -4.602  1.00 22.97  ? 19  ARG A CB  1 
ATOM 123  C CG  . ARG A 1 19  ? 45.609  -1.458  -4.013  1.00 30.82  ? 19  ARG A CG  1 
ATOM 124  C CD  . ARG A 1 19  ? 46.877  -1.437  -4.832  1.00 40.97  ? 19  ARG A CD  1 
ATOM 125  N NE  . ARG A 1 19  ? 47.494  -0.117  -4.829  1.00 51.88  ? 19  ARG A NE  1 
ATOM 126  C CZ  . ARG A 1 19  ? 48.797  0.097   -4.975  1.00 57.11  ? 19  ARG A CZ  1 
ATOM 127  N NH1 . ARG A 1 19  ? 49.627  -0.928  -5.122  1.00 53.46  ? 19  ARG A NH1 1 
ATOM 128  N NH2 . ARG A 1 19  ? 49.269  1.336   -4.964  1.00 51.40  ? 19  ARG A NH2 1 
ATOM 129  N N   . LEU A 1 20  ? 43.787  0.085   -1.306  1.00 34.24  ? 20  LEU A N   1 
ATOM 130  C CA  . LEU A 1 20  ? 44.191  0.885   -0.155  1.00 33.09  ? 20  LEU A CA  1 
ATOM 131  C C   . LEU A 1 20  ? 45.703  0.991   -0.007  1.00 41.82  ? 20  LEU A C   1 
ATOM 132  O O   . LEU A 1 20  ? 46.441  0.074   -0.362  1.00 47.93  ? 20  LEU A O   1 
ATOM 133  C CB  . LEU A 1 20  ? 43.604  0.303   1.127   1.00 28.42  ? 20  LEU A CB  1 
ATOM 134  C CG  . LEU A 1 20  ? 42.084  0.233   1.213   1.00 25.97  ? 20  LEU A CG  1 
ATOM 135  C CD1 . LEU A 1 20  ? 41.682  -0.373  2.536   1.00 23.09  ? 20  LEU A CD1 1 
ATOM 136  C CD2 . LEU A 1 20  ? 41.477  1.619   1.052   1.00 27.08  ? 20  LEU A CD2 1 
ATOM 137  N N   . ASP A 1 21  ? 46.154  2.117   0.534   1.00 33.70  ? 21  ASP A N   1 
ATOM 138  C CA  . ASP A 1 21  ? 47.568  2.325   0.805   1.00 35.16  ? 21  ASP A CA  1 
ATOM 139  C C   . ASP A 1 21  ? 47.728  2.786   2.242   1.00 28.66  ? 21  ASP A C   1 
ATOM 140  O O   . ASP A 1 21  ? 47.047  3.713   2.672   1.00 28.35  ? 21  ASP A O   1 
ATOM 141  C CB  . ASP A 1 21  ? 48.164  3.357   -0.155  1.00 42.05  ? 21  ASP A CB  1 
ATOM 142  C CG  . ASP A 1 21  ? 47.609  3.234   -1.560  1.00 48.41  ? 21  ASP A CG  1 
ATOM 143  O OD1 . ASP A 1 21  ? 48.128  2.405   -2.338  1.00 40.37  ? 21  ASP A OD1 1 
ATOM 144  O OD2 . ASP A 1 21  ? 46.649  3.967   -1.880  1.00 52.95  ? 21  ASP A OD2 1 
ATOM 145  N N   . CYS A 1 22  ? 48.619  2.143   2.988   1.00 27.36  ? 22  CYS A N   1 
ATOM 146  C CA  . CYS A 1 22  ? 48.866  2.555   4.361   1.00 26.78  ? 22  CYS A CA  1 
ATOM 147  C C   . CYS A 1 22  ? 50.348  2.839   4.564   1.00 44.13  ? 22  CYS A C   1 
ATOM 148  O O   . CYS A 1 22  ? 51.172  1.927   4.535   1.00 21.86  ? 22  CYS A O   1 
ATOM 149  C CB  . CYS A 1 22  ? 48.386  1.481   5.343   1.00 25.39  ? 22  CYS A CB  1 
ATOM 150  S SG  . CYS A 1 22  ? 48.928  1.722   7.052   1.00 46.34  ? 22  CYS A SG  1 
ATOM 151  N N   . LYS A 1 23  ? 50.679  4.107   4.785   1.00 39.97  ? 23  LYS A N   1 
ATOM 152  C CA  . LYS A 1 23  ? 52.071  4.507   4.953   1.00 39.54  ? 23  LYS A CA  1 
ATOM 153  C C   . LYS A 1 23  ? 52.381  4.863   6.403   1.00 31.90  ? 23  LYS A C   1 
ATOM 154  O O   . LYS A 1 23  ? 51.914  5.880   6.920   1.00 34.71  ? 23  LYS A O   1 
ATOM 155  C CB  . LYS A 1 23  ? 52.402  5.686   4.037   1.00 32.84  ? 23  LYS A CB  1 
ATOM 156  C CG  . LYS A 1 23  ? 53.742  6.341   4.330   1.00 31.98  ? 23  LYS A CG  1 
ATOM 157  C CD  . LYS A 1 23  ? 54.494  6.685   3.056   1.00 40.10  ? 23  LYS A CD  1 
ATOM 158  C CE  . LYS A 1 23  ? 55.923  7.116   3.364   1.00 53.72  ? 23  LYS A CE  1 
ATOM 159  N NZ  . LYS A 1 23  ? 56.755  7.224   2.132   1.00 59.95  ? 23  LYS A NZ  1 
ATOM 160  N N   . ALA A 1 24  ? 53.166  4.007   7.051   1.00 28.75  ? 24  ALA A N   1 
ATOM 161  C CA  . ALA A 1 24  ? 53.573  4.204   8.441   1.00 34.86  ? 24  ALA A CA  1 
ATOM 162  C C   . ALA A 1 24  ? 54.711  5.215   8.556   1.00 32.84  ? 24  ALA A C   1 
ATOM 163  O O   . ALA A 1 24  ? 55.448  5.440   7.596   1.00 33.72  ? 24  ALA A O   1 
ATOM 164  C CB  . ALA A 1 24  ? 53.979  2.877   9.063   1.00 24.55  ? 24  ALA A CB  1 
ATOM 165  N N   . SER A 1 25  ? 54.853  5.820   9.733   1.00 37.58  ? 25  SER A N   1 
ATOM 166  C CA  . SER A 1 25  ? 55.901  6.813   9.960   1.00 35.88  ? 25  SER A CA  1 
ATOM 167  C C   . SER A 1 25  ? 56.350  6.869   11.416  1.00 42.68  ? 25  SER A C   1 
ATOM 168  O O   . SER A 1 25  ? 55.571  6.570   12.312  1.00 50.08  ? 25  SER A O   1 
ATOM 169  C CB  . SER A 1 25  ? 55.419  8.197   9.520   1.00 40.57  ? 25  SER A CB  1 
ATOM 170  O OG  . SER A 1 25  ? 56.266  9.215   10.025  1.00 48.30  ? 25  SER A OG  1 
ATOM 171  N N   . GLY A 1 26  ? 57.604  7.259   11.641  1.00 43.57  ? 26  GLY A N   1 
ATOM 172  C CA  . GLY A 1 26  ? 58.129  7.477   12.985  1.00 56.33  ? 26  GLY A CA  1 
ATOM 173  C C   . GLY A 1 26  ? 58.113  6.255   13.893  1.00 70.50  ? 26  GLY A C   1 
ATOM 174  O O   . GLY A 1 26  ? 57.951  6.357   15.106  1.00 75.95  ? 26  GLY A O   1 
ATOM 175  N N   . ILE A 1 27  ? 58.303  5.096   13.273  1.00 78.54  ? 27  ILE A N   1 
ATOM 176  C CA  . ILE A 1 27  ? 58.288  3.777   13.897  1.00 73.63  ? 27  ILE A CA  1 
ATOM 177  C C   . ILE A 1 27  ? 59.377  3.019   13.150  1.00 61.49  ? 27  ILE A C   1 
ATOM 178  O O   . ILE A 1 27  ? 60.179  3.633   12.431  1.00 54.87  ? 27  ILE A O   1 
ATOM 179  C CB  . ILE A 1 27  ? 56.923  3.029   13.746  1.00 74.81  ? 27  ILE A CB  1 
ATOM 180  C CG1 . ILE A 1 27  ? 55.735  3.963   13.911  1.00 66.17  ? 27  ILE A CG1 1 
ATOM 181  C CG2 . ILE A 1 27  ? 56.789  1.891   14.777  1.00 77.56  ? 27  ILE A CG2 1 
ATOM 182  C CD1 . ILE A 1 27  ? 55.415  4.271   15.354  1.00 62.00  ? 27  ILE A CD1 1 
ATOM 183  N N   . THR A 1 28  ? 59.474  1.711   13.361  1.00 63.24  ? 28  THR A N   1 
ATOM 184  C CA  . THR A 1 28  ? 60.125  0.887   12.358  1.00 63.83  ? 28  THR A CA  1 
ATOM 185  C C   . THR A 1 28  ? 59.083  -0.045  11.712  1.00 60.62  ? 28  THR A C   1 
ATOM 186  O O   . THR A 1 28  ? 58.729  -1.088  12.268  1.00 61.10  ? 28  THR A O   1 
ATOM 187  C CB  . THR A 1 28  ? 61.321  0.104   12.977  1.00 74.99  ? 28  THR A CB  1 
ATOM 188  O OG1 . THR A 1 28  ? 61.754  -0.925  12.079  1.00 79.59  ? 28  THR A OG1 1 
ATOM 189  C CG2 . THR A 1 28  ? 60.971  -0.486  14.351  1.00 69.29  ? 28  THR A CG2 1 
ATOM 190  N N   . PHE A 1 29  ? 58.638  0.327   10.505  1.00 51.77  ? 29  PHE A N   1 
ATOM 191  C CA  . PHE A 1 29  ? 57.580  -0.403  9.787   1.00 41.17  ? 29  PHE A CA  1 
ATOM 192  C C   . PHE A 1 29  ? 58.129  -1.704  9.309   1.00 44.13  ? 29  PHE A C   1 
ATOM 193  O O   . PHE A 1 29  ? 57.483  -2.743  9.395   1.00 38.22  ? 29  PHE A O   1 
ATOM 194  C CB  . PHE A 1 29  ? 57.034  0.375   8.569   1.00 38.85  ? 29  PHE A CB  1 
ATOM 195  C CG  . PHE A 1 29  ? 56.261  -0.497  7.561   1.00 25.59  ? 29  PHE A CG  1 
ATOM 196  C CD1 . PHE A 1 29  ? 56.889  -1.002  6.420   1.00 36.77  ? 29  PHE A CD1 1 
ATOM 197  C CD2 . PHE A 1 29  ? 54.915  -0.794  7.743   1.00 24.48  ? 29  PHE A CD2 1 
ATOM 198  C CE1 . PHE A 1 29  ? 56.196  -1.789  5.495   1.00 42.13  ? 29  PHE A CE1 1 
ATOM 199  C CE2 . PHE A 1 29  ? 54.219  -1.583  6.811   1.00 24.03  ? 29  PHE A CE2 1 
ATOM 200  C CZ  . PHE A 1 29  ? 54.864  -2.079  5.693   1.00 47.03  ? 29  PHE A CZ  1 
ATOM 201  N N   . SER A 1 30  ? 59.336  -1.617  8.777   1.00 46.88  ? 30  SER A N   1 
ATOM 202  C CA  . SER A 1 30  ? 59.924  -2.709  8.042   1.00 50.20  ? 30  SER A CA  1 
ATOM 203  C C   . SER A 1 30  ? 60.087  -3.961  8.886   1.00 42.91  ? 30  SER A C   1 
ATOM 204  O O   . SER A 1 30  ? 60.083  -5.082  8.364   1.00 42.10  ? 30  SER A O   1 
ATOM 205  C CB  . SER A 1 30  ? 61.271  -2.286  7.481   1.00 59.05  ? 30  SER A CB  1 
ATOM 206  O OG  . SER A 1 30  ? 61.578  -3.125  6.395   1.00 70.49  ? 30  SER A OG  1 
ATOM 207  N N   . ASN A 1 31  ? 60.295  -3.758  10.183  1.00 35.22  ? 31  ASN A N   1 
ATOM 208  C CA  . ASN A 1 31  ? 60.449  -4.873  11.110  1.00 36.67  ? 31  ASN A CA  1 
ATOM 209  C C   . ASN A 1 31  ? 59.191  -5.287  11.896  1.00 38.25  ? 31  ASN A C   1 
ATOM 210  O O   . ASN A 1 31  ? 59.183  -6.343  12.521  1.00 40.64  ? 31  ASN A O   1 
ATOM 211  C CB  . ASN A 1 31  ? 61.580  -4.532  12.079  1.00 41.65  ? 31  ASN A CB  1 
ATOM 212  C CG  . ASN A 1 31  ? 62.920  -4.442  11.379  1.00 50.05  ? 31  ASN A CG  1 
ATOM 213  O OD1 . ASN A 1 31  ? 63.906  -4.079  11.991  1.00 49.98  ? 31  ASN A OD1 1 
ATOM 214  N ND2 . ASN A 1 31  ? 62.963  -4.806  10.090  1.00 55.25  ? 31  ASN A ND2 1 
ATOM 215  N N   . SER A 1 32  ? 58.155  -4.448  11.910  1.00 44.36  ? 32  SER A N   1 
ATOM 216  C CA  . SER A 1 32  ? 56.876  -4.818  12.525  1.00 42.99  ? 32  SER A CA  1 
ATOM 217  C C   . SER A 1 32  ? 56.005  -5.601  11.542  1.00 45.55  ? 32  SER A C   1 
ATOM 218  O O   . SER A 1 32  ? 56.134  -5.445  10.327  1.00 58.31  ? 32  SER A O   1 
ATOM 219  C CB  . SER A 1 32  ? 56.117  -3.580  13.019  1.00 39.89  ? 32  SER A CB  1 
ATOM 220  O OG  . SER A 1 32  ? 56.771  -2.935  14.102  1.00 44.62  ? 32  SER A OG  1 
ATOM 221  N N   . GLY A 1 33  ? 55.110  -6.431  12.065  1.00 40.41  ? 33  GLY A N   1 
ATOM 222  C CA  . GLY A 1 33  ? 54.124  -7.093  11.229  1.00 27.17  ? 33  GLY A CA  1 
ATOM 223  C C   . GLY A 1 33  ? 52.928  -6.184  11.022  1.00 33.24  ? 33  GLY A C   1 
ATOM 224  O O   . GLY A 1 33  ? 52.728  -5.257  11.800  1.00 37.98  ? 33  GLY A O   1 
ATOM 225  N N   . MET A 1 34  ? 52.128  -6.438  9.988   1.00 26.51  ? 34  MET A N   1 
ATOM 226  C CA  . MET A 1 34  ? 50.986  -5.568  9.694   1.00 26.23  ? 34  MET A CA  1 
ATOM 227  C C   . MET A 1 34  ? 49.647  -6.289  9.598   1.00 25.93  ? 34  MET A C   1 
ATOM 228  O O   . MET A 1 34  ? 49.576  -7.462  9.234   1.00 25.94  ? 34  MET A O   1 
ATOM 229  C CB  . MET A 1 34  ? 51.226  -4.795  8.398   1.00 44.09  ? 34  MET A CB  1 
ATOM 230  C CG  . MET A 1 34  ? 52.343  -3.790  8.511   1.00 41.34  ? 34  MET A CG  1 
ATOM 231  S SD  . MET A 1 34  ? 52.081  -2.683  9.911   1.00 37.80  ? 34  MET A SD  1 
ATOM 232  C CE  . MET A 1 34  ? 50.566  -1.869  9.414   1.00 26.55  ? 34  MET A CE  1 
ATOM 233  N N   . HIS A 1 35  ? 48.584  -5.558  9.918   1.00 43.64  ? 35  HIS A N   1 
ATOM 234  C CA  . HIS A 1 35  ? 47.234  -6.102  9.915   1.00 31.52  ? 35  HIS A CA  1 
ATOM 235  C C   . HIS A 1 35  ? 46.269  -5.219  9.125   1.00 31.52  ? 35  HIS A C   1 
ATOM 236  O O   . HIS A 1 35  ? 46.570  -4.064  8.828   1.00 23.13  ? 35  HIS A O   1 
ATOM 237  C CB  . HIS A 1 35  ? 46.734  -6.270  11.351  1.00 37.79  ? 35  HIS A CB  1 
ATOM 238  C CG  . HIS A 1 35  ? 47.053  -7.603  11.949  1.00 23.43  ? 35  HIS A CG  1 
ATOM 239  N ND1 . HIS A 1 35  ? 46.196  -8.676  11.859  1.00 23.36  ? 35  HIS A ND1 1 
ATOM 240  C CD2 . HIS A 1 35  ? 48.127  -8.040  12.646  1.00 23.69  ? 35  HIS A CD2 1 
ATOM 241  C CE1 . HIS A 1 35  ? 46.723  -9.716  12.473  1.00 23.58  ? 35  HIS A CE1 1 
ATOM 242  N NE2 . HIS A 1 35  ? 47.901  -9.356  12.962  1.00 23.78  ? 35  HIS A NE2 1 
ATOM 243  N N   . TRP A 1 36  ? 45.117  -5.779  8.774   1.00 24.42  ? 36  TRP A N   1 
ATOM 244  C CA  . TRP A 1 36  ? 44.022  -5.007  8.200   1.00 29.10  ? 36  TRP A CA  1 
ATOM 245  C C   . TRP A 1 36  ? 42.738  -5.340  8.944   1.00 29.70  ? 36  TRP A C   1 
ATOM 246  O O   . TRP A 1 36  ? 42.370  -6.505  9.058   1.00 29.36  ? 36  TRP A O   1 
ATOM 247  C CB  . TRP A 1 36  ? 43.856  -5.295  6.705   1.00 31.53  ? 36  TRP A CB  1 
ATOM 248  C CG  . TRP A 1 36  ? 44.700  -4.436  5.827   1.00 37.35  ? 36  TRP A CG  1 
ATOM 249  C CD1 . TRP A 1 36  ? 45.707  -4.846  5.001   1.00 43.34  ? 36  TRP A CD1 1 
ATOM 250  C CD2 . TRP A 1 36  ? 44.628  -3.004  5.682   1.00 20.26  ? 36  TRP A CD2 1 
ATOM 251  N NE1 . TRP A 1 36  ? 46.262  -3.765  4.356   1.00 46.42  ? 36  TRP A NE1 1 
ATOM 252  C CE2 . TRP A 1 36  ? 45.618  -2.638  4.756   1.00 35.13  ? 36  TRP A CE2 1 
ATOM 253  C CE3 . TRP A 1 36  ? 43.815  -2.025  6.252   1.00 39.85  ? 36  TRP A CE3 1 
ATOM 254  C CZ2 . TRP A 1 36  ? 45.817  -1.300  4.385   1.00 29.04  ? 36  TRP A CZ2 1 
ATOM 255  C CZ3 . TRP A 1 36  ? 44.021  -0.704  5.876   1.00 36.60  ? 36  TRP A CZ3 1 
ATOM 256  C CH2 . TRP A 1 36  ? 45.011  -0.356  4.954   1.00 29.42  ? 36  TRP A CH2 1 
ATOM 257  N N   . VAL A 1 37  ? 42.064  -4.324  9.467   1.00 20.22  ? 37  VAL A N   1 
ATOM 258  C CA  . VAL A 1 37  ? 40.806  -4.548  10.162  1.00 20.12  ? 37  VAL A CA  1 
ATOM 259  C C   . VAL A 1 37  ? 39.733  -3.584  9.692   1.00 19.98  ? 37  VAL A C   1 
ATOM 260  O O   . VAL A 1 37  ? 39.906  -2.375  9.767   1.00 24.64  ? 37  VAL A O   1 
ATOM 261  C CB  . VAL A 1 37  ? 40.954  -4.398  11.676  1.00 21.62  ? 37  VAL A CB  1 
ATOM 262  C CG1 . VAL A 1 37  ? 39.663  -4.783  12.345  1.00 20.26  ? 37  VAL A CG1 1 
ATOM 263  C CG2 . VAL A 1 37  ? 42.098  -5.255  12.194  1.00 20.46  ? 37  VAL A CG2 1 
ATOM 264  N N   . ARG A 1 38  ? 38.617  -4.114  9.205   1.00 32.10  ? 38  ARG A N   1 
ATOM 265  C CA  . ARG A 1 38  ? 37.522  -3.246  8.787   1.00 28.73  ? 38  ARG A CA  1 
ATOM 266  C C   . ARG A 1 38  ? 36.405  -3.253  9.816   1.00 33.20  ? 38  ARG A C   1 
ATOM 267  O O   . ARG A 1 38  ? 36.415  -4.055  10.753  1.00 22.81  ? 38  ARG A O   1 
ATOM 268  C CB  . ARG A 1 38  ? 36.961  -3.695  7.438   1.00 28.82  ? 38  ARG A CB  1 
ATOM 269  C CG  . ARG A 1 38  ? 36.301  -5.061  7.518   1.00 22.61  ? 38  ARG A CG  1 
ATOM 270  C CD  . ARG A 1 38  ? 35.783  -5.517  6.164   1.00 26.41  ? 38  ARG A CD  1 
ATOM 271  N NE  . ARG A 1 38  ? 35.526  -6.956  6.136   1.00 24.40  ? 38  ARG A NE  1 
ATOM 272  C CZ  . ARG A 1 38  ? 34.985  -7.607  5.108   1.00 22.68  ? 38  ARG A CZ  1 
ATOM 273  N NH1 . ARG A 1 38  ? 34.630  -6.952  4.011   1.00 22.71  ? 38  ARG A NH1 1 
ATOM 274  N NH2 . ARG A 1 38  ? 34.800  -8.919  5.173   1.00 22.77  ? 38  ARG A NH2 1 
ATOM 275  N N   . GLN A 1 39  ? 35.440  -2.358  9.634   1.00 31.67  ? 39  GLN A N   1 
ATOM 276  C CA  . GLN A 1 39  ? 34.217  -2.385  10.415  1.00 22.87  ? 39  GLN A CA  1 
ATOM 277  C C   . GLN A 1 39  ? 33.045  -1.845  9.599   1.00 22.79  ? 39  GLN A C   1 
ATOM 278  O O   . GLN A 1 39  ? 33.123  -0.730  9.079   1.00 22.79  ? 39  GLN A O   1 
ATOM 279  C CB  . GLN A 1 39  ? 34.442  -1.587  11.696  1.00 23.02  ? 39  GLN A CB  1 
ATOM 280  C CG  . GLN A 1 39  ? 33.236  -1.246  12.501  1.00 23.15  ? 39  GLN A CG  1 
ATOM 281  C CD  . GLN A 1 39  ? 33.624  -0.481  13.749  1.00 27.29  ? 39  GLN A CD  1 
ATOM 282  O OE1 . GLN A 1 39  ? 34.496  0.387   13.702  1.00 27.84  ? 39  GLN A OE1 1 
ATOM 283  N NE2 . GLN A 1 39  ? 32.999  -0.809  14.873  1.00 23.65  ? 39  GLN A NE2 1 
ATOM 284  N N   . ALA A 1 40  ? 31.948  -2.596  9.529   1.00 17.39  ? 40  ALA A N   1 
ATOM 285  C CA  . ALA A 1 40  ? 30.765  -2.114  8.831   1.00 34.84  ? 40  ALA A CA  1 
ATOM 286  C C   . ALA A 1 40  ? 30.171  -1.000  9.673   1.00 42.77  ? 40  ALA A C   1 
ATOM 287  O O   . ALA A 1 40  ? 30.315  -1.025  10.892  1.00 54.81  ? 40  ALA A O   1 
ATOM 288  C CB  . ALA A 1 40  ? 29.766  -3.239  8.611   1.00 31.98  ? 40  ALA A CB  1 
ATOM 289  N N   . PRO A 1 41  ? 29.515  -0.014  9.039   1.00 27.05  ? 41  PRO A N   1 
ATOM 290  C CA  . PRO A 1 41  ? 28.992  1.088   9.856   1.00 33.02  ? 41  PRO A CA  1 
ATOM 291  C C   . PRO A 1 41  ? 27.974  0.607   10.885  1.00 27.32  ? 41  PRO A C   1 
ATOM 292  O O   . PRO A 1 41  ? 27.091  -0.175  10.540  1.00 27.32  ? 41  PRO A O   1 
ATOM 293  C CB  . PRO A 1 41  ? 28.323  2.010   8.830   1.00 35.47  ? 41  PRO A CB  1 
ATOM 294  C CG  . PRO A 1 41  ? 28.910  1.636   7.518   1.00 27.24  ? 41  PRO A CG  1 
ATOM 295  C CD  . PRO A 1 41  ? 29.233  0.174   7.606   1.00 27.07  ? 41  PRO A CD  1 
ATOM 296  N N   . GLY A 1 42  ? 28.109  1.052   12.130  1.00 38.55  ? 42  GLY A N   1 
ATOM 297  C CA  . GLY A 1 42  ? 27.166  0.690   13.174  1.00 35.35  ? 42  GLY A CA  1 
ATOM 298  C C   . GLY A 1 42  ? 27.328  -0.717  13.724  1.00 35.48  ? 42  GLY A C   1 
ATOM 299  O O   . GLY A 1 42  ? 26.594  -1.124  14.620  1.00 35.03  ? 42  GLY A O   1 
ATOM 300  N N   . LYS A 1 43  ? 28.299  -1.455  13.197  1.00 33.26  ? 43  LYS A N   1 
ATOM 301  C CA  . LYS A 1 43  ? 28.545  -2.833  13.617  1.00 35.65  ? 43  LYS A CA  1 
ATOM 302  C C   . LYS A 1 43  ? 29.975  -2.987  14.115  1.00 35.04  ? 43  LYS A C   1 
ATOM 303  O O   . LYS A 1 43  ? 30.791  -2.094  13.935  1.00 43.53  ? 43  LYS A O   1 
ATOM 304  C CB  . LYS A 1 43  ? 28.267  -3.813  12.474  1.00 36.05  ? 43  LYS A CB  1 
ATOM 305  C CG  . LYS A 1 43  ? 26.809  -3.855  12.054  1.00 39.38  ? 43  LYS A CG  1 
ATOM 306  C CD  . LYS A 1 43  ? 26.580  -4.837  10.921  1.00 23.60  ? 43  LYS A CD  1 
ATOM 307  C CE  . LYS A 1 43  ? 25.121  -4.852  10.487  1.00 24.96  ? 43  LYS A CE  1 
ATOM 308  N NZ  . LYS A 1 43  ? 24.227  -5.497  11.490  1.00 82.08  ? 43  LYS A NZ  1 
ATOM 309  N N   . GLY A 1 44  ? 30.260  -4.101  14.783  1.00 39.63  ? 44  GLY A N   1 
ATOM 310  C CA  . GLY A 1 44  ? 31.561  -4.324  15.391  1.00 36.22  ? 44  GLY A CA  1 
ATOM 311  C C   . GLY A 1 44  ? 32.710  -4.511  14.417  1.00 34.36  ? 44  GLY A C   1 
ATOM 312  O O   . GLY A 1 44  ? 32.517  -4.507  13.200  1.00 26.17  ? 44  GLY A O   1 
ATOM 313  N N   . LEU A 1 45  ? 33.913  -4.673  14.962  1.00 37.02  ? 45  LEU A N   1 
ATOM 314  C CA  . LEU A 1 45  ? 35.103  -4.889  14.144  1.00 22.94  ? 45  LEU A CA  1 
ATOM 315  C C   . LEU A 1 45  ? 35.194  -6.307  13.610  1.00 22.95  ? 45  LEU A C   1 
ATOM 316  O O   . LEU A 1 45  ? 34.742  -7.256  14.248  1.00 42.68  ? 45  LEU A O   1 
ATOM 317  C CB  . LEU A 1 45  ? 36.373  -4.575  14.930  1.00 23.07  ? 45  LEU A CB  1 
ATOM 318  C CG  . LEU A 1 45  ? 36.715  -3.100  15.098  1.00 32.77  ? 45  LEU A CG  1 
ATOM 319  C CD1 . LEU A 1 45  ? 36.323  -2.605  16.478  1.00 23.34  ? 45  LEU A CD1 1 
ATOM 320  C CD2 . LEU A 1 45  ? 38.185  -2.918  14.850  1.00 33.69  ? 45  LEU A CD2 1 
ATOM 321  N N   . GLU A 1 46  ? 35.800  -6.434  12.436  1.00 26.28  ? 46  GLU A N   1 
ATOM 322  C CA  . GLU A 1 46  ? 36.040  -7.731  11.824  1.00 32.91  ? 46  GLU A CA  1 
ATOM 323  C C   . GLU A 1 46  ? 37.451  -7.780  11.252  1.00 30.11  ? 46  GLU A C   1 
ATOM 324  O O   . GLU A 1 46  ? 37.812  -6.946  10.423  1.00 31.38  ? 46  GLU A O   1 
ATOM 325  C CB  . GLU A 1 46  ? 35.010  -7.993  10.725  1.00 37.22  ? 46  GLU A CB  1 
ATOM 326  C CG  . GLU A 1 46  ? 35.089  -9.370  10.102  1.00 44.91  ? 46  GLU A CG  1 
ATOM 327  C CD  . GLU A 1 46  ? 34.552  -9.387  8.686   1.00 50.78  ? 46  GLU A CD  1 
ATOM 328  O OE1 . GLU A 1 46  ? 33.663  -8.563  8.383   1.00 51.34  ? 46  GLU A OE1 1 
ATOM 329  O OE2 . GLU A 1 46  ? 35.013  -10.223 7.879   1.00 48.51  ? 46  GLU A OE2 1 
ATOM 330  N N   . TRP A 1 47  ? 38.247  -8.754  11.689  1.00 35.70  ? 47  TRP A N   1 
ATOM 331  C CA  . TRP A 1 47  ? 39.598  -8.914  11.156  1.00 32.09  ? 47  TRP A CA  1 
ATOM 332  C C   . TRP A 1 47  ? 39.527  -9.204  9.667   1.00 45.45  ? 47  TRP A C   1 
ATOM 333  O O   . TRP A 1 47  ? 38.597  -9.868  9.205   1.00 48.47  ? 47  TRP A O   1 
ATOM 334  C CB  . TRP A 1 47  ? 40.352  -10.037 11.863  1.00 31.47  ? 47  TRP A CB  1 
ATOM 335  C CG  . TRP A 1 47  ? 41.758  -10.239 11.360  1.00 30.82  ? 47  TRP A CG  1 
ATOM 336  C CD1 . TRP A 1 47  ? 42.846  -9.474  11.654  1.00 34.09  ? 47  TRP A CD1 1 
ATOM 337  C CD2 . TRP A 1 47  ? 42.219  -11.263 10.464  1.00 34.19  ? 47  TRP A CD2 1 
ATOM 338  N NE1 . TRP A 1 47  ? 43.954  -9.961  11.009  1.00 22.84  ? 47  TRP A NE1 1 
ATOM 339  C CE2 . TRP A 1 47  ? 43.598  -11.056 10.272  1.00 31.60  ? 47  TRP A CE2 1 
ATOM 340  C CE3 . TRP A 1 47  ? 41.601  -12.332 9.811   1.00 30.31  ? 47  TRP A CE3 1 
ATOM 341  C CZ2 . TRP A 1 47  ? 44.372  -11.877 9.457   1.00 35.87  ? 47  TRP A CZ2 1 
ATOM 342  C CZ3 . TRP A 1 47  ? 42.374  -13.147 9.000   1.00 32.38  ? 47  TRP A CZ3 1 
ATOM 343  C CH2 . TRP A 1 47  ? 43.744  -12.913 8.830   1.00 32.88  ? 47  TRP A CH2 1 
ATOM 344  N N   . VAL A 1 48  ? 40.514  -8.719  8.920   1.00 25.24  ? 48  VAL A N   1 
ATOM 345  C CA  . VAL A 1 48  ? 40.514  -8.881  7.471   1.00 30.08  ? 48  VAL A CA  1 
ATOM 346  C C   . VAL A 1 48  ? 41.712  -9.685  6.971   1.00 25.38  ? 48  VAL A C   1 
ATOM 347  O O   . VAL A 1 48  ? 41.545  -10.774 6.423   1.00 25.47  ? 48  VAL A O   1 
ATOM 348  C CB  . VAL A 1 48  ? 40.497  -7.518  6.758   1.00 25.09  ? 48  VAL A CB  1 
ATOM 349  C CG1 . VAL A 1 48  ? 40.238  -7.698  5.273   1.00 25.12  ? 48  VAL A CG1 1 
ATOM 350  C CG2 . VAL A 1 48  ? 39.446  -6.623  7.373   1.00 24.95  ? 48  VAL A CG2 1 
ATOM 351  N N   . ALA A 1 49  ? 42.918  -9.151  7.147   1.00 23.13  ? 49  ALA A N   1 
ATOM 352  C CA  . ALA A 1 49  ? 44.114  -9.823  6.637   1.00 28.80  ? 49  ALA A CA  1 
ATOM 353  C C   . ALA A 1 49  ? 45.384  -9.460  7.409   1.00 33.53  ? 49  ALA A C   1 
ATOM 354  O O   . ALA A 1 49  ? 45.423  -8.470  8.136   1.00 23.75  ? 49  ALA A O   1 
ATOM 355  C CB  . ALA A 1 49  ? 44.296  -9.510  5.162   1.00 38.11  ? 49  ALA A CB  1 
ATOM 356  N N   . VAL A 1 50  ? 46.421  -10.276 7.240   1.00 28.39  ? 50  VAL A N   1 
ATOM 357  C CA  . VAL A 1 50  ? 47.698  -10.059 7.911   1.00 33.30  ? 50  VAL A CA  1 
ATOM 358  C C   . VAL A 1 50  ? 48.852  -10.431 6.982   1.00 35.52  ? 50  VAL A C   1 
ATOM 359  O O   . VAL A 1 50  ? 48.734  -11.357 6.177   1.00 46.53  ? 50  VAL A O   1 
ATOM 360  C CB  . VAL A 1 50  ? 47.796  -10.880 9.225   1.00 26.43  ? 50  VAL A CB  1 
ATOM 361  C CG1 . VAL A 1 50  ? 47.747  -12.380 8.940   1.00 26.58  ? 50  VAL A CG1 1 
ATOM 362  C CG2 . VAL A 1 50  ? 49.058  -10.521 9.996   1.00 26.66  ? 50  VAL A CG2 1 
ATOM 363  N N   . ILE A 1 51  ? 49.953  -9.689  7.070   1.00 35.25  ? 51  ILE A N   1 
ATOM 364  C CA  . ILE A 1 51  ? 51.176  -10.060 6.364   1.00 41.41  ? 51  ILE A CA  1 
ATOM 365  C C   . ILE A 1 51  ? 52.381  -9.998  7.303   1.00 43.37  ? 51  ILE A C   1 
ATOM 366  O O   . ILE A 1 51  ? 52.571  -9.023  8.035   1.00 50.71  ? 51  ILE A O   1 
ATOM 367  C CB  . ILE A 1 51  ? 51.431  -9.166  5.114   1.00 36.00  ? 51  ILE A CB  1 
ATOM 368  C CG1 . ILE A 1 51  ? 52.724  -9.588  4.410   1.00 27.10  ? 51  ILE A CG1 1 
ATOM 369  C CG2 . ILE A 1 51  ? 51.473  -7.684  5.478   1.00 32.34  ? 51  ILE A CG2 1 
ATOM 370  C CD1 . ILE A 1 51  ? 52.951  -8.910  3.083   1.00 27.31  ? 51  ILE A CD1 1 
ATOM 371  N N   . TRP A 1 52  ? 53.178  -11.063 7.298   1.00 44.50  ? 52  TRP A N   1 
ATOM 372  C CA  . TRP A 1 52  ? 54.401  -11.103 8.090   1.00 39.72  ? 52  TRP A CA  1 
ATOM 373  C C   . TRP A 1 52  ? 55.350  -10.030 7.585   1.00 46.95  ? 52  TRP A C   1 
ATOM 374  O O   . TRP A 1 52  ? 55.276  -9.629  6.423   1.00 45.63  ? 52  TRP A O   1 
ATOM 375  C CB  . TRP A 1 52  ? 55.060  -12.480 8.028   1.00 39.11  ? 52  TRP A CB  1 
ATOM 376  C CG  . TRP A 1 52  ? 54.395  -13.503 8.894   1.00 46.16  ? 52  TRP A CG  1 
ATOM 377  C CD1 . TRP A 1 52  ? 53.079  -13.540 9.260   1.00 43.14  ? 52  TRP A CD1 1 
ATOM 378  C CD2 . TRP A 1 52  ? 55.017  -14.637 9.519   1.00 49.91  ? 52  TRP A CD2 1 
ATOM 379  N NE1 . TRP A 1 52  ? 52.841  -14.631 10.064  1.00 44.21  ? 52  TRP A NE1 1 
ATOM 380  C CE2 . TRP A 1 52  ? 54.007  -15.314 10.236  1.00 57.31  ? 52  TRP A CE2 1 
ATOM 381  C CE3 . TRP A 1 52  ? 56.320  -15.137 9.531   1.00 59.56  ? 52  TRP A CE3 1 
ATOM 382  C CZ2 . TRP A 1 52  ? 54.274  -16.477 10.964  1.00 62.64  ? 52  TRP A CZ2 1 
ATOM 383  C CZ3 . TRP A 1 52  ? 56.576  -16.289 10.255  1.00 67.19  ? 52  TRP A CZ3 1 
ATOM 384  C CH2 . TRP A 1 52  ? 55.557  -16.946 10.962  1.00 68.70  ? 52  TRP A CH2 1 
ATOM 385  N N   . TYR A 1 53  ? 56.230  -9.561  8.463   1.00 47.31  ? 53  TYR A N   1 
ATOM 386  C CA  . TYR A 1 53  ? 57.028  -8.369  8.190   1.00 33.95  ? 53  TYR A CA  1 
ATOM 387  C C   . TYR A 1 53  ? 57.855  -8.444  6.911   1.00 33.53  ? 53  TYR A C   1 
ATOM 388  O O   . TYR A 1 53  ? 57.926  -7.466  6.174   1.00 63.55  ? 53  TYR A O   1 
ATOM 389  C CB  . TYR A 1 53  ? 57.937  -8.067  9.381   1.00 35.04  ? 53  TYR A CB  1 
ATOM 390  C CG  . TYR A 1 53  ? 59.169  -8.937  9.470   1.00 35.65  ? 53  TYR A CG  1 
ATOM 391  C CD1 . TYR A 1 53  ? 60.433  -8.419  9.219   1.00 47.04  ? 53  TYR A CD1 1 
ATOM 392  C CD2 . TYR A 1 53  ? 59.067  -10.282 9.799   1.00 35.99  ? 53  TYR A CD2 1 
ATOM 393  C CE1 . TYR A 1 53  ? 61.563  -9.221  9.302   1.00 46.57  ? 53  TYR A CE1 1 
ATOM 394  C CE2 . TYR A 1 53  ? 60.185  -11.088 9.884   1.00 36.63  ? 53  TYR A CE2 1 
ATOM 395  C CZ  . TYR A 1 53  ? 61.429  -10.555 9.635   1.00 36.93  ? 53  TYR A CZ  1 
ATOM 396  O OH  . TYR A 1 53  ? 62.542  -11.359 9.721   1.00 37.65  ? 53  TYR A OH  1 
ATOM 397  N N   . ASP A 1 54  ? 58.473  -9.591  6.640   1.00 32.95  ? 54  ASP A N   1 
ATOM 398  C CA  . ASP A 1 54  ? 59.230  -9.771  5.399   1.00 32.76  ? 54  ASP A CA  1 
ATOM 399  C C   . ASP A 1 54  ? 58.333  -10.133 4.210   1.00 44.28  ? 54  ASP A C   1 
ATOM 400  O O   . ASP A 1 54  ? 58.644  -9.815  3.068   1.00 41.94  ? 54  ASP A O   1 
ATOM 401  C CB  . ASP A 1 54  ? 60.315  -10.835 5.581   1.00 33.60  ? 54  ASP A CB  1 
ATOM 402  C CG  . ASP A 1 54  ? 59.778  -12.133 6.149   1.00 40.52  ? 54  ASP A CG  1 
ATOM 403  O OD1 . ASP A 1 54  ? 58.542  -12.304 6.224   1.00 44.23  ? 54  ASP A OD1 1 
ATOM 404  O OD2 . ASP A 1 54  ? 60.604  -12.988 6.528   1.00 34.70  ? 54  ASP A OD2 1 
ATOM 405  N N   . GLY A 1 55  ? 57.214  -10.788 4.496   1.00 45.05  ? 55  GLY A N   1 
ATOM 406  C CA  . GLY A 1 55  ? 56.316  -11.265 3.460   1.00 31.25  ? 55  GLY A CA  1 
ATOM 407  C C   . GLY A 1 55  ? 56.389  -12.763 3.263   1.00 40.36  ? 55  GLY A C   1 
ATOM 408  O O   . GLY A 1 55  ? 55.717  -13.308 2.391   1.00 37.39  ? 55  GLY A O   1 
ATOM 409  N N   . SER A 1 56  ? 57.168  -13.428 4.112   1.00 34.20  ? 56  SER A N   1 
ATOM 410  C CA  . SER A 1 56  ? 57.296  -14.882 4.085   1.00 41.84  ? 56  SER A CA  1 
ATOM 411  C C   . SER A 1 56  ? 55.945  -15.587 4.153   1.00 43.69  ? 56  SER A C   1 
ATOM 412  O O   . SER A 1 56  ? 55.749  -16.617 3.529   1.00 47.88  ? 56  SER A O   1 
ATOM 413  C CB  . SER A 1 56  ? 58.183  -15.360 5.231   1.00 41.15  ? 56  SER A CB  1 
ATOM 414  O OG  . SER A 1 56  ? 57.707  -14.867 6.467   1.00 35.69  ? 56  SER A OG  1 
ATOM 415  N N   . LYS A 1 57  ? 55.010  -15.040 4.917   1.00 33.33  ? 57  LYS A N   1 
ATOM 416  C CA  . LYS A 1 57  ? 53.661  -15.598 4.939   1.00 33.00  ? 57  LYS A CA  1 
ATOM 417  C C   . LYS A 1 57  ? 52.574  -14.558 5.181   1.00 32.30  ? 57  LYS A C   1 
ATOM 418  O O   . LYS A 1 57  ? 52.829  -13.477 5.732   1.00 32.28  ? 57  LYS A O   1 
ATOM 419  C CB  . LYS A 1 57  ? 53.547  -16.698 5.987   1.00 52.66  ? 57  LYS A CB  1 
ATOM 420  C CG  . LYS A 1 57  ? 53.129  -18.019 5.373   1.00 70.26  ? 57  LYS A CG  1 
ATOM 421  C CD  . LYS A 1 57  ? 52.752  -19.025 6.425   1.00 77.20  ? 57  LYS A CD  1 
ATOM 422  C CE  . LYS A 1 57  ? 53.852  -19.207 7.467   1.00 77.50  ? 57  LYS A CE  1 
ATOM 423  N NZ  . LYS A 1 57  ? 53.542  -20.373 8.353   1.00 75.30  ? 57  LYS A NZ  1 
ATOM 424  N N   . ARG A 1 58  ? 51.365  -14.901 4.742   1.00 59.94  ? 58  ARG A N   1 
ATOM 425  C CA  . ARG A 1 58  ? 50.218  -14.024 4.855   1.00 52.24  ? 58  ARG A CA  1 
ATOM 426  C C   . ARG A 1 58  ? 48.935  -14.837 5.006   1.00 45.42  ? 58  ARG A C   1 
ATOM 427  O O   . ARG A 1 58  ? 48.788  -15.887 4.382   1.00 38.93  ? 58  ARG A O   1 
ATOM 428  C CB  . ARG A 1 58  ? 50.166  -13.111 3.631   1.00 32.17  ? 58  ARG A CB  1 
ATOM 429  C CG  . ARG A 1 58  ? 50.259  -13.862 2.320   1.00 57.06  ? 58  ARG A CG  1 
ATOM 430  C CD  . ARG A 1 58  ? 50.770  -12.979 1.197   1.00 31.71  ? 58  ARG A CD  1 
ATOM 431  N NE  . ARG A 1 58  ? 52.115  -12.474 1.466   1.00 59.25  ? 58  ARG A NE  1 
ATOM 432  C CZ  . ARG A 1 58  ? 52.745  -11.596 0.692   1.00 68.30  ? 58  ARG A CZ  1 
ATOM 433  N NH1 . ARG A 1 58  ? 52.148  -11.137 -0.397  1.00 70.31  ? 58  ARG A NH1 1 
ATOM 434  N NH2 . ARG A 1 58  ? 53.968  -11.180 0.999   1.00 68.68  ? 58  ARG A NH2 1 
ATOM 435  N N   . TYR A 1 59  ? 48.006  -14.338 5.819   1.00 41.65  ? 59  TYR A N   1 
ATOM 436  C CA  . TYR A 1 59  ? 46.728  -15.011 6.037   1.00 42.72  ? 59  TYR A CA  1 
ATOM 437  C C   . TYR A 1 59  ? 45.582  -14.029 5.820   1.00 31.29  ? 59  TYR A C   1 
ATOM 438  O O   . TYR A 1 59  ? 45.725  -12.833 6.072   1.00 37.75  ? 59  TYR A O   1 
ATOM 439  C CB  . TYR A 1 59  ? 46.655  -15.618 7.446   1.00 32.94  ? 59  TYR A CB  1 
ATOM 440  C CG  . TYR A 1 59  ? 47.654  -16.726 7.712   1.00 33.65  ? 59  TYR A CG  1 
ATOM 441  C CD1 . TYR A 1 59  ? 47.938  -17.685 6.747   1.00 59.23  ? 59  TYR A CD1 1 
ATOM 442  C CD2 . TYR A 1 59  ? 48.306  -16.819 8.935   1.00 46.97  ? 59  TYR A CD2 1 
ATOM 443  C CE1 . TYR A 1 59  ? 48.850  -18.701 6.992   1.00 60.88  ? 59  TYR A CE1 1 
ATOM 444  C CE2 . TYR A 1 59  ? 49.217  -17.830 9.188   1.00 34.89  ? 59  TYR A CE2 1 
ATOM 445  C CZ  . TYR A 1 59  ? 49.485  -18.766 8.216   1.00 35.28  ? 59  TYR A CZ  1 
ATOM 446  O OH  . TYR A 1 59  ? 50.395  -19.764 8.475   1.00 38.66  ? 59  TYR A OH  1 
ATOM 447  N N   . TYR A 1 60  ? 44.452  -14.535 5.333   1.00 30.53  ? 60  TYR A N   1 
ATOM 448  C CA  . TYR A 1 60  ? 43.307  -13.684 5.029   1.00 30.42  ? 60  TYR A CA  1 
ATOM 449  C C   . TYR A 1 60  ? 42.078  -14.100 5.822   1.00 46.79  ? 60  TYR A C   1 
ATOM 450  O O   . TYR A 1 60  ? 42.083  -15.119 6.513   1.00 51.16  ? 60  TYR A O   1 
ATOM 451  C CB  . TYR A 1 60  ? 42.975  -13.734 3.534   1.00 30.20  ? 60  TYR A CB  1 
ATOM 452  C CG  . TYR A 1 60  ? 43.995  -13.088 2.623   1.00 28.70  ? 60  TYR A CG  1 
ATOM 453  C CD1 . TYR A 1 60  ? 43.605  -12.168 1.663   1.00 31.44  ? 60  TYR A CD1 1 
ATOM 454  C CD2 . TYR A 1 60  ? 45.342  -13.413 2.706   1.00 42.66  ? 60  TYR A CD2 1 
ATOM 455  C CE1 . TYR A 1 60  ? 44.532  -11.578 0.825   1.00 26.85  ? 60  TYR A CE1 1 
ATOM 456  C CE2 . TYR A 1 60  ? 46.272  -12.834 1.878   1.00 40.36  ? 60  TYR A CE2 1 
ATOM 457  C CZ  . TYR A 1 60  ? 45.864  -11.918 0.937   1.00 26.28  ? 60  TYR A CZ  1 
ATOM 458  O OH  . TYR A 1 60  ? 46.799  -11.342 0.111   1.00 44.95  ? 60  TYR A OH  1 
ATOM 459  N N   . ALA A 1 61  ? 41.016  -13.312 5.701   1.00 32.08  ? 61  ALA A N   1 
ATOM 460  C CA  . ALA A 1 61  ? 39.715  -13.716 6.202   1.00 43.97  ? 61  ALA A CA  1 
ATOM 461  C C   . ALA A 1 61  ? 39.008  -14.480 5.097   1.00 45.91  ? 61  ALA A C   1 
ATOM 462  O O   . ALA A 1 61  ? 39.190  -14.174 3.922   1.00 47.93  ? 61  ALA A O   1 
ATOM 463  C CB  . ALA A 1 61  ? 38.896  -12.513 6.648   1.00 33.59  ? 61  ALA A CB  1 
ATOM 464  N N   . ASP A 1 62  ? 38.227  -15.487 5.469   1.00 50.52  ? 62  ASP A N   1 
ATOM 465  C CA  . ASP A 1 62  ? 37.477  -16.270 4.490   1.00 49.30  ? 62  ASP A CA  1 
ATOM 466  C C   . ASP A 1 62  ? 36.625  -15.384 3.587   1.00 46.88  ? 62  ASP A C   1 
ATOM 467  O O   . ASP A 1 62  ? 36.492  -15.634 2.387   1.00 41.69  ? 62  ASP A O   1 
ATOM 468  C CB  . ASP A 1 62  ? 36.592  -17.298 5.198   1.00 53.83  ? 62  ASP A CB  1 
ATOM 469  C CG  . ASP A 1 62  ? 37.396  -18.401 5.860   1.00 55.87  ? 62  ASP A CG  1 
ATOM 470  O OD1 . ASP A 1 62  ? 38.193  -19.056 5.154   1.00 57.79  ? 62  ASP A OD1 1 
ATOM 471  O OD2 . ASP A 1 62  ? 37.226  -18.621 7.080   1.00 54.10  ? 62  ASP A OD2 1 
ATOM 472  N N   . SER A 1 63  ? 36.070  -14.336 4.180   1.00 38.41  ? 63  SER A N   1 
ATOM 473  C CA  . SER A 1 63  ? 35.207  -13.411 3.468   1.00 36.30  ? 63  SER A CA  1 
ATOM 474  C C   . SER A 1 63  ? 35.943  -12.707 2.324   1.00 34.70  ? 63  SER A C   1 
ATOM 475  O O   . SER A 1 63  ? 35.324  -12.327 1.324   1.00 51.26  ? 63  SER A O   1 
ATOM 476  C CB  . SER A 1 63  ? 34.628  -12.387 4.453   1.00 36.37  ? 63  SER A CB  1 
ATOM 477  O OG  . SER A 1 63  ? 34.009  -13.034 5.556   1.00 37.98  ? 63  SER A OG  1 
ATOM 478  N N   . VAL A 1 64  ? 37.244  -12.479 2.500   1.00 45.77  ? 64  VAL A N   1 
ATOM 479  C CA  . VAL A 1 64  ? 38.045  -11.825 1.468   1.00 41.26  ? 64  VAL A CA  1 
ATOM 480  C C   . VAL A 1 64  ? 38.934  -12.715 0.569   1.00 39.98  ? 64  VAL A C   1 
ATOM 481  O O   . VAL A 1 64  ? 39.613  -12.190 -0.309  1.00 38.73  ? 64  VAL A O   1 
ATOM 482  C CB  . VAL A 1 64  ? 38.941  -10.726 2.100   1.00 34.18  ? 64  VAL A CB  1 
ATOM 483  C CG1 . VAL A 1 64  ? 38.077  -9.637  2.729   1.00 34.34  ? 64  VAL A CG1 1 
ATOM 484  C CG2 . VAL A 1 64  ? 39.923  -11.297 3.094   1.00 34.03  ? 64  VAL A CG2 1 
ATOM 485  N N   . LYS A 1 65  ? 38.958  -14.031 0.779   1.00 37.79  ? 65  LYS A N   1 
ATOM 486  C CA  . LYS A 1 65  ? 39.846  -14.907 -0.007  1.00 40.75  ? 65  LYS A CA  1 
ATOM 487  C C   . LYS A 1 65  ? 39.623  -14.823 -1.523  1.00 46.23  ? 65  LYS A C   1 
ATOM 488  O O   . LYS A 1 65  ? 38.489  -14.773 -1.991  1.00 48.17  ? 65  LYS A O   1 
ATOM 489  C CB  . LYS A 1 65  ? 39.696  -16.371 0.426   1.00 46.54  ? 65  LYS A CB  1 
ATOM 490  C CG  . LYS A 1 65  ? 40.371  -16.722 1.742   1.00 54.32  ? 65  LYS A CG  1 
ATOM 491  C CD  . LYS A 1 65  ? 41.273  -17.943 1.607   1.00 59.63  ? 65  LYS A CD  1 
ATOM 492  C CE  . LYS A 1 65  ? 42.088  -18.158 2.874   1.00 58.55  ? 65  LYS A CE  1 
ATOM 493  N NZ  . LYS A 1 65  ? 43.109  -17.087 3.071   1.00 52.88  ? 65  LYS A NZ  1 
ATOM 494  N N   . GLY A 1 66  ? 40.719  -14.801 -2.279  1.00 48.61  ? 66  GLY A N   1 
ATOM 495  C CA  . GLY A 1 66  ? 40.683  -14.846 -3.735  1.00 45.93  ? 66  GLY A CA  1 
ATOM 496  C C   . GLY A 1 66  ? 40.378  -13.494 -4.350  1.00 41.81  ? 66  GLY A C   1 
ATOM 497  O O   . GLY A 1 66  ? 40.611  -13.259 -5.542  1.00 37.27  ? 66  GLY A O   1 
ATOM 498  N N   . ARG A 1 67  ? 39.873  -12.600 -3.507  1.00 34.08  ? 67  ARG A N   1 
ATOM 499  C CA  . ARG A 1 67  ? 39.429  -11.277 -3.918  1.00 33.51  ? 67  ARG A CA  1 
ATOM 500  C C   . ARG A 1 67  ? 40.434  -10.218 -3.483  1.00 34.30  ? 67  ARG A C   1 
ATOM 501  O O   . ARG A 1 67  ? 41.039  -9.535  -4.304  1.00 31.25  ? 67  ARG A O   1 
ATOM 502  C CB  . ARG A 1 67  ? 38.039  -10.985 -3.331  1.00 34.31  ? 67  ARG A CB  1 
ATOM 503  C CG  . ARG A 1 67  ? 36.922  -11.820 -3.941  1.00 35.92  ? 67  ARG A CG  1 
ATOM 504  C CD  . ARG A 1 67  ? 35.669  -11.709 -3.089  1.00 42.39  ? 67  ARG A CD  1 
ATOM 505  N NE  . ARG A 1 67  ? 35.305  -10.316 -2.860  1.00 43.08  ? 67  ARG A NE  1 
ATOM 506  C CZ  . ARG A 1 67  ? 34.950  -9.823  -1.680  1.00 36.12  ? 67  ARG A CZ  1 
ATOM 507  N NH1 . ARG A 1 67  ? 34.904  -10.608 -0.611  1.00 36.68  ? 67  ARG A NH1 1 
ATOM 508  N NH2 . ARG A 1 67  ? 34.645  -8.543  -1.571  1.00 47.25  ? 67  ARG A NH2 1 
ATOM 509  N N   . PHE A 1 68  ? 40.591  -10.087 -2.175  1.00 29.48  ? 68  PHE A N   1 
ATOM 510  C CA  . PHE A 1 68  ? 41.522  -9.133  -1.597  1.00 28.17  ? 68  PHE A CA  1 
ATOM 511  C C   . PHE A 1 68  ? 42.948  -9.648  -1.777  1.00 36.23  ? 68  PHE A C   1 
ATOM 512  O O   . PHE A 1 68  ? 43.158  -10.848 -1.976  1.00 36.42  ? 68  PHE A O   1 
ATOM 513  C CB  . PHE A 1 68  ? 41.220  -8.911  -0.105  1.00 28.26  ? 68  PHE A CB  1 
ATOM 514  C CG  . PHE A 1 68  ? 39.926  -8.180  0.158   1.00 41.18  ? 68  PHE A CG  1 
ATOM 515  C CD1 . PHE A 1 68  ? 38.784  -8.482  -0.566  1.00 47.53  ? 68  PHE A CD1 1 
ATOM 516  C CD2 . PHE A 1 68  ? 39.860  -7.171  1.104   1.00 39.24  ? 68  PHE A CD2 1 
ATOM 517  C CE1 . PHE A 1 68  ? 37.609  -7.814  -0.353  1.00 30.56  ? 68  PHE A CE1 1 
ATOM 518  C CE2 . PHE A 1 68  ? 38.675  -6.493  1.324   1.00 40.03  ? 68  PHE A CE2 1 
ATOM 519  C CZ  . PHE A 1 68  ? 37.548  -6.820  0.589   1.00 30.23  ? 68  PHE A CZ  1 
ATOM 520  N N   . THR A 1 69  ? 43.926  -8.749  -1.728  1.00 37.09  ? 69  THR A N   1 
ATOM 521  C CA  . THR A 1 69  ? 45.318  -9.175  -1.649  1.00 27.19  ? 69  THR A CA  1 
ATOM 522  C C   . THR A 1 69  ? 46.093  -8.246  -0.717  1.00 27.36  ? 69  THR A C   1 
ATOM 523  O O   . THR A 1 69  ? 46.031  -7.025  -0.864  1.00 38.77  ? 69  THR A O   1 
ATOM 524  C CB  . THR A 1 69  ? 45.991  -9.217  -3.040  1.00 27.24  ? 69  THR A CB  1 
ATOM 525  O OG1 . THR A 1 69  ? 45.136  -9.898  -3.970  1.00 28.07  ? 69  THR A OG1 1 
ATOM 526  C CG2 . THR A 1 69  ? 47.309  -9.968  -2.940  1.00 39.57  ? 69  THR A CG2 1 
ATOM 527  N N   . ILE A 1 70  ? 46.825  -8.820  0.239   1.00 26.91  ? 70  ILE A N   1 
ATOM 528  C CA  . ILE A 1 70  ? 47.611  -7.996  1.153   1.00 27.26  ? 70  ILE A CA  1 
ATOM 529  C C   . ILE A 1 70  ? 49.107  -8.165  0.882   1.00 55.05  ? 70  ILE A C   1 
ATOM 530  O O   . ILE A 1 70  ? 49.608  -9.282  0.727   1.00 64.27  ? 70  ILE A O   1 
ATOM 531  C CB  . ILE A 1 70  ? 47.295  -8.309  2.656   1.00 37.39  ? 70  ILE A CB  1 
ATOM 532  C CG1 . ILE A 1 70  ? 48.153  -7.443  3.590   1.00 30.61  ? 70  ILE A CG1 1 
ATOM 533  C CG2 . ILE A 1 70  ? 47.503  -9.779  2.973   1.00 37.32  ? 70  ILE A CG2 1 
ATOM 534  C CD1 . ILE A 1 70  ? 47.892  -7.679  5.073   1.00 29.22  ? 70  ILE A CD1 1 
ATOM 535  N N   . SER A 1 71  ? 49.812  -7.040  0.801   1.00 48.94  ? 71  SER A N   1 
ATOM 536  C CA  . SER A 1 71  ? 51.254  -7.054  0.604   1.00 45.33  ? 71  SER A CA  1 
ATOM 537  C C   . SER A 1 71  ? 51.895  -5.807  1.195   1.00 28.39  ? 71  SER A C   1 
ATOM 538  O O   . SER A 1 71  ? 51.207  -4.921  1.701   1.00 28.28  ? 71  SER A O   1 
ATOM 539  C CB  . SER A 1 71  ? 51.596  -7.175  -0.882  1.00 29.85  ? 71  SER A CB  1 
ATOM 540  O OG  . SER A 1 71  ? 51.277  -5.988  -1.585  1.00 27.43  ? 71  SER A OG  1 
ATOM 541  N N   . ARG A 1 72  ? 53.220  -5.745  1.131   1.00 37.35  ? 72  ARG A N   1 
ATOM 542  C CA  . ARG A 1 72  ? 53.952  -4.613  1.678   1.00 29.57  ? 72  ARG A CA  1 
ATOM 543  C C   . ARG A 1 72  ? 55.219  -4.336  0.891   1.00 35.48  ? 72  ARG A C   1 
ATOM 544  O O   . ARG A 1 72  ? 55.914  -5.249  0.446   1.00 37.24  ? 72  ARG A O   1 
ATOM 545  C CB  . ARG A 1 72  ? 54.304  -4.848  3.147   1.00 30.33  ? 72  ARG A CB  1 
ATOM 546  C CG  . ARG A 1 72  ? 55.046  -6.144  3.418   1.00 30.84  ? 72  ARG A CG  1 
ATOM 547  C CD  . ARG A 1 72  ? 55.069  -6.391  4.910   1.00 31.58  ? 72  ARG A CD  1 
ATOM 548  N NE  . ARG A 1 72  ? 55.846  -5.372  5.609   1.00 32.16  ? 72  ARG A NE  1 
ATOM 549  C CZ  . ARG A 1 72  ? 55.801  -5.166  6.921   1.00 32.94  ? 72  ARG A CZ  1 
ATOM 550  N NH1 . ARG A 1 72  ? 54.965  -5.867  7.673   1.00 33.17  ? 72  ARG A NH1 1 
ATOM 551  N NH2 . ARG A 1 72  ? 56.557  -4.227  7.474   1.00 43.29  ? 72  ARG A NH2 1 
ATOM 552  N N   . ASP A 1 73  ? 55.517  -3.056  0.736   1.00 41.62  ? 73  ASP A N   1 
ATOM 553  C CA  . ASP A 1 73  ? 56.758  -2.631  0.133   1.00 39.22  ? 73  ASP A CA  1 
ATOM 554  C C   . ASP A 1 73  ? 57.547  -1.982  1.265   1.00 40.11  ? 73  ASP A C   1 
ATOM 555  O O   . ASP A 1 73  ? 57.249  -0.856  1.665   1.00 33.05  ? 73  ASP A O   1 
ATOM 556  C CB  . ASP A 1 73  ? 56.462  -1.673  -1.037  1.00 49.81  ? 73  ASP A CB  1 
ATOM 557  C CG  . ASP A 1 73  ? 57.696  -1.288  -1.824  1.00 56.59  ? 73  ASP A CG  1 
ATOM 558  O OD1 . ASP A 1 73  ? 58.739  -1.015  -1.201  1.00 51.91  ? 73  ASP A OD1 1 
ATOM 559  O OD2 . ASP A 1 73  ? 57.628  -1.272  -3.073  1.00 68.34  ? 73  ASP A OD2 1 
ATOM 560  N N   . ASN A 1 74  ? 58.563  -2.687  1.761   1.00 44.14  ? 74  ASN A N   1 
ATOM 561  C CA  . ASN A 1 74  ? 59.263  -2.272  2.979   1.00 45.23  ? 74  ASN A CA  1 
ATOM 562  C C   . ASN A 1 74  ? 60.210  -1.120  2.706   1.00 45.34  ? 74  ASN A C   1 
ATOM 563  O O   . ASN A 1 74  ? 60.553  -0.346  3.603   1.00 49.78  ? 74  ASN A O   1 
ATOM 564  C CB  . ASN A 1 74  ? 60.024  -3.445  3.599   1.00 40.48  ? 74  ASN A CB  1 
ATOM 565  C CG  . ASN A 1 74  ? 59.200  -4.200  4.632   1.00 34.35  ? 74  ASN A CG  1 
ATOM 566  O OD1 . ASN A 1 74  ? 57.974  -4.267  4.543   1.00 33.82  ? 74  ASN A OD1 1 
ATOM 567  N ND2 . ASN A 1 74  ? 59.879  -4.787  5.613   1.00 37.09  ? 74  ASN A ND2 1 
ATOM 568  N N   . SER A 1 75  ? 60.614  -1.012  1.448   1.00 43.32  ? 75  SER A N   1 
ATOM 569  C CA  . SER A 1 75  ? 61.379  0.125   0.972   1.00 41.56  ? 75  SER A CA  1 
ATOM 570  C C   . SER A 1 75  ? 60.650  1.430   1.286   1.00 41.99  ? 75  SER A C   1 
ATOM 571  O O   . SER A 1 75  ? 61.131  2.249   2.070   1.00 40.39  ? 75  SER A O   1 
ATOM 572  C CB  . SER A 1 75  ? 61.631  -0.008  -0.532  1.00 43.42  ? 75  SER A CB  1 
ATOM 573  O OG  . SER A 1 75  ? 62.097  1.208   -1.084  1.00 46.30  ? 75  SER A OG  1 
ATOM 574  N N   . LYS A 1 76  ? 59.479  1.607   0.686   1.00 45.35  ? 76  LYS A N   1 
ATOM 575  C CA  . LYS A 1 76  ? 58.720  2.844   0.831   1.00 32.85  ? 76  LYS A CA  1 
ATOM 576  C C   . LYS A 1 76  ? 57.994  2.937   2.170   1.00 41.93  ? 76  LYS A C   1 
ATOM 577  O O   . LYS A 1 76  ? 57.355  3.951   2.457   1.00 31.07  ? 76  LYS A O   1 
ATOM 578  C CB  . LYS A 1 76  ? 57.726  2.989   -0.323  1.00 33.08  ? 76  LYS A CB  1 
ATOM 579  C CG  . LYS A 1 76  ? 58.372  2.832   -1.693  1.00 42.81  ? 76  LYS A CG  1 
ATOM 580  C CD  . LYS A 1 76  ? 57.526  3.467   -2.786  1.00 45.47  ? 76  LYS A CD  1 
ATOM 581  C CE  . LYS A 1 76  ? 56.241  2.692   -3.020  1.00 46.02  ? 76  LYS A CE  1 
ATOM 582  N NZ  . LYS A 1 76  ? 56.505  1.307   -3.501  1.00 46.92  ? 76  LYS A NZ  1 
ATOM 583  N N   . ASN A 1 77  ? 58.093  1.877   2.972   1.00 39.62  ? 77  ASN A N   1 
ATOM 584  C CA  . ASN A 1 77  ? 57.394  1.775   4.255   1.00 45.16  ? 77  ASN A CA  1 
ATOM 585  C C   . ASN A 1 77  ? 55.896  1.921   4.063   1.00 36.49  ? 77  ASN A C   1 
ATOM 586  O O   . ASN A 1 77  ? 55.222  2.649   4.793   1.00 25.61  ? 77  ASN A O   1 
ATOM 587  C CB  . ASN A 1 77  ? 57.907  2.816   5.254   1.00 41.87  ? 77  ASN A CB  1 
ATOM 588  C CG  . ASN A 1 77  ? 59.318  2.529   5.716   1.00 33.95  ? 77  ASN A CG  1 
ATOM 589  O OD1 . ASN A 1 77  ? 60.198  2.235   4.907   1.00 28.17  ? 77  ASN A OD1 1 
ATOM 590  N ND2 . ASN A 1 77  ? 59.543  2.609   7.021   1.00 27.04  ? 77  ASN A ND2 1 
ATOM 591  N N   . THR A 1 78  ? 55.383  1.220   3.063   1.00 34.43  ? 78  THR A N   1 
ATOM 592  C CA  . THR A 1 78  ? 53.973  1.294   2.737   1.00 24.88  ? 78  THR A CA  1 
ATOM 593  C C   . THR A 1 78  ? 53.345  -0.085  2.797   1.00 25.02  ? 78  THR A C   1 
ATOM 594  O O   . THR A 1 78  ? 53.865  -1.041  2.230   1.00 25.78  ? 78  THR A O   1 
ATOM 595  C CB  . THR A 1 78  ? 53.743  1.886   1.337   1.00 42.73  ? 78  THR A CB  1 
ATOM 596  O OG1 . THR A 1 78  ? 54.285  3.211   1.279   1.00 44.63  ? 78  THR A OG1 1 
ATOM 597  C CG2 . THR A 1 78  ? 52.255  1.945   1.032   1.00 44.01  ? 78  THR A CG2 1 
ATOM 598  N N   . LEU A 1 79  ? 52.234  -0.187  3.510   1.00 31.05  ? 79  LEU A N   1 
ATOM 599  C CA  . LEU A 1 79  ? 51.415  -1.384  3.461   1.00 27.28  ? 79  LEU A CA  1 
ATOM 600  C C   . LEU A 1 79  ? 50.418  -1.214  2.324   1.00 33.27  ? 79  LEU A C   1 
ATOM 601  O O   . LEU A 1 79  ? 49.895  -0.122  2.118   1.00 38.94  ? 79  LEU A O   1 
ATOM 602  C CB  . LEU A 1 79  ? 50.707  -1.612  4.799   1.00 21.98  ? 79  LEU A CB  1 
ATOM 603  C CG  . LEU A 1 79  ? 49.645  -2.707  4.883   1.00 22.17  ? 79  LEU A CG  1 
ATOM 604  C CD1 . LEU A 1 79  ? 50.305  -4.069  4.957   1.00 22.98  ? 79  LEU A CD1 1 
ATOM 605  C CD2 . LEU A 1 79  ? 48.777  -2.472  6.103   1.00 21.50  ? 79  LEU A CD2 1 
ATOM 606  N N   . PHE A 1 80  ? 50.164  -2.283  1.579   1.00 31.33  ? 80  PHE A N   1 
ATOM 607  C CA  . PHE A 1 80  ? 49.207  -2.220  0.481   1.00 30.70  ? 80  PHE A CA  1 
ATOM 608  C C   . PHE A 1 80  ? 48.049  -3.185  0.688   1.00 25.03  ? 80  PHE A C   1 
ATOM 609  O O   . PHE A 1 80  ? 48.235  -4.280  1.218   1.00 25.35  ? 80  PHE A O   1 
ATOM 610  C CB  . PHE A 1 80  ? 49.897  -2.527  -0.847  1.00 25.93  ? 80  PHE A CB  1 
ATOM 611  C CG  . PHE A 1 80  ? 50.862  -1.473  -1.282  1.00 37.72  ? 80  PHE A CG  1 
ATOM 612  C CD1 . PHE A 1 80  ? 50.418  -0.362  -1.973  1.00 38.00  ? 80  PHE A CD1 1 
ATOM 613  C CD2 . PHE A 1 80  ? 52.212  -1.589  -1.001  1.00 40.74  ? 80  PHE A CD2 1 
ATOM 614  C CE1 . PHE A 1 80  ? 51.299  0.614   -2.380  1.00 41.15  ? 80  PHE A CE1 1 
ATOM 615  C CE2 . PHE A 1 80  ? 53.099  -0.615  -1.406  1.00 26.49  ? 80  PHE A CE2 1 
ATOM 616  C CZ  . PHE A 1 80  ? 52.642  0.487   -2.098  1.00 40.63  ? 80  PHE A CZ  1 
ATOM 617  N N   . LEU A 1 81  ? 46.852  -2.775  0.282   1.00 25.49  ? 81  LEU A N   1 
ATOM 618  C CA  . LEU A 1 81  ? 45.723  -3.695  0.245   1.00 25.82  ? 81  LEU A CA  1 
ATOM 619  C C   . LEU A 1 81  ? 45.006  -3.602  -1.088  1.00 26.41  ? 81  LEU A C   1 
ATOM 620  O O   . LEU A 1 81  ? 44.415  -2.575  -1.405  1.00 26.05  ? 81  LEU A O   1 
ATOM 621  C CB  . LEU A 1 81  ? 44.737  -3.418  1.381   1.00 31.54  ? 81  LEU A CB  1 
ATOM 622  C CG  . LEU A 1 81  ? 43.492  -4.310  1.324   1.00 31.71  ? 81  LEU A CG  1 
ATOM 623  C CD1 . LEU A 1 81  ? 43.864  -5.769  1.540   1.00 26.25  ? 81  LEU A CD1 1 
ATOM 624  C CD2 . LEU A 1 81  ? 42.458  -3.885  2.351   1.00 33.74  ? 81  LEU A CD2 1 
ATOM 625  N N   . GLN A 1 82  ? 45.038  -4.686  -1.854  1.00 26.77  ? 82  GLN A N   1 
ATOM 626  C CA  . GLN A 1 82  ? 44.328  -4.730  -3.123  1.00 27.51  ? 82  GLN A CA  1 
ATOM 627  C C   . GLN A 1 82  ? 42.967  -5.372  -2.905  1.00 27.68  ? 82  GLN A C   1 
ATOM 628  O O   . GLN A 1 82  ? 42.879  -6.542  -2.550  1.00 30.56  ? 82  GLN A O   1 
ATOM 629  C CB  . GLN A 1 82  ? 45.146  -5.491  -4.173  1.00 28.67  ? 82  GLN A CB  1 
ATOM 630  C CG  . GLN A 1 82  ? 44.624  -5.427  -5.606  1.00 47.37  ? 82  GLN A CG  1 
ATOM 631  C CD  . GLN A 1 82  ? 44.154  -4.046  -6.034  1.00 39.95  ? 82  GLN A CD  1 
ATOM 632  O OE1 . GLN A 1 82  ? 43.037  -3.635  -5.723  1.00 37.47  ? 82  GLN A OE1 1 
ATOM 633  N NE2 . GLN A 1 82  ? 45.003  -3.328  -6.763  1.00 29.44  ? 82  GLN A NE2 1 
ATOM 634  N N   . MET A 1 83  ? 41.907  -4.592  -3.090  1.00 29.02  ? 83  MET A N   1 
ATOM 635  C CA  . MET A 1 83  ? 40.555  -5.102  -2.921  1.00 29.25  ? 83  MET A CA  1 
ATOM 636  C C   . MET A 1 83  ? 39.880  -5.237  -4.279  1.00 40.19  ? 83  MET A C   1 
ATOM 637  O O   . MET A 1 83  ? 39.521  -4.235  -4.902  1.00 34.62  ? 83  MET A O   1 
ATOM 638  C CB  . MET A 1 83  ? 39.735  -4.178  -2.020  1.00 28.22  ? 83  MET A CB  1 
ATOM 639  C CG  . MET A 1 83  ? 40.465  -3.683  -0.788  1.00 27.21  ? 83  MET A CG  1 
ATOM 640  S SD  . MET A 1 83  ? 39.446  -2.498  0.104   1.00 26.17  ? 83  MET A SD  1 
ATOM 641  C CE  . MET A 1 83  ? 39.593  -1.099  -0.999  1.00 53.24  ? 83  MET A CE  1 
ATOM 642  N N   . ASN A 1 84  ? 39.686  -6.475  -4.727  1.00 36.67  ? 84  ASN A N   1 
ATOM 643  C CA  . ASN A 1 84  ? 39.059  -6.721  -6.022  1.00 42.62  ? 84  ASN A CA  1 
ATOM 644  C C   . ASN A 1 84  ? 37.739  -7.453  -5.875  1.00 35.28  ? 84  ASN A C   1 
ATOM 645  O O   . ASN A 1 84  ? 37.514  -8.160  -4.887  1.00 32.26  ? 84  ASN A O   1 
ATOM 646  C CB  . ASN A 1 84  ? 39.982  -7.524  -6.940  1.00 47.13  ? 84  ASN A CB  1 
ATOM 647  C CG  . ASN A 1 84  ? 41.342  -6.882  -7.108  1.00 57.10  ? 84  ASN A CG  1 
ATOM 648  O OD1 . ASN A 1 84  ? 42.269  -7.180  -6.358  1.00 65.19  ? 84  ASN A OD1 1 
ATOM 649  N ND2 . ASN A 1 84  ? 41.468  -5.992  -8.089  1.00 56.01  ? 84  ASN A ND2 1 
ATOM 650  N N   . SER A 1 85  ? 36.882  -7.280  -6.876  1.00 33.83  ? 85  SER A N   1 
ATOM 651  C CA  . SER A 1 85  ? 35.526  -7.810  -6.850  1.00 37.86  ? 85  SER A CA  1 
ATOM 652  C C   . SER A 1 85  ? 34.846  -7.380  -5.561  1.00 41.75  ? 85  SER A C   1 
ATOM 653  O O   . SER A 1 85  ? 34.502  -8.207  -4.717  1.00 45.39  ? 85  SER A O   1 
ATOM 654  C CB  . SER A 1 85  ? 35.533  -9.335  -6.985  1.00 31.85  ? 85  SER A CB  1 
ATOM 655  O OG  . SER A 1 85  ? 35.769  -9.719  -8.330  1.00 33.13  ? 85  SER A OG  1 
ATOM 656  N N   . LEU A 1 86  ? 34.675  -6.071  -5.413  1.00 30.66  ? 86  LEU A N   1 
ATOM 657  C CA  . LEU A 1 86  ? 34.052  -5.521  -4.221  1.00 29.64  ? 86  LEU A CA  1 
ATOM 658  C C   . LEU A 1 86  ? 32.543  -5.685  -4.275  1.00 30.20  ? 86  LEU A C   1 
ATOM 659  O O   . LEU A 1 86  ? 31.911  -5.469  -5.310  1.00 30.96  ? 86  LEU A O   1 
ATOM 660  C CB  . LEU A 1 86  ? 34.425  -4.046  -4.042  1.00 28.52  ? 86  LEU A CB  1 
ATOM 661  C CG  . LEU A 1 86  ? 35.878  -3.810  -3.620  1.00 28.89  ? 86  LEU A CG  1 
ATOM 662  C CD1 . LEU A 1 86  ? 36.296  -2.359  -3.827  1.00 27.10  ? 86  LEU A CD1 1 
ATOM 663  C CD2 . LEU A 1 86  ? 36.079  -4.233  -2.170  1.00 29.94  ? 86  LEU A CD2 1 
ATOM 664  N N   . ARG A 1 87  ? 31.976  -6.082  -3.145  1.00 35.85  ? 87  ARG A N   1 
ATOM 665  C CA  . ARG A 1 87  ? 30.543  -6.270  -3.025  1.00 34.56  ? 87  ARG A CA  1 
ATOM 666  C C   . ARG A 1 87  ? 30.010  -5.242  -2.040  1.00 34.15  ? 87  ARG A C   1 
ATOM 667  O O   . ARG A 1 87  ? 30.764  -4.737  -1.209  1.00 36.66  ? 87  ARG A O   1 
ATOM 668  C CB  . ARG A 1 87  ? 30.224  -7.693  -2.573  1.00 34.25  ? 87  ARG A CB  1 
ATOM 669  C CG  . ARG A 1 87  ? 30.891  -8.753  -3.433  1.00 50.63  ? 87  ARG A CG  1 
ATOM 670  C CD  . ARG A 1 87  ? 30.603  -10.151 -2.919  1.00 51.14  ? 87  ARG A CD  1 
ATOM 671  N NE  . ARG A 1 87  ? 31.262  -11.177 -3.721  1.00 55.61  ? 87  ARG A NE  1 
ATOM 672  C CZ  . ARG A 1 87  ? 32.188  -12.010 -3.258  1.00 59.51  ? 87  ARG A CZ  1 
ATOM 673  N NH1 . ARG A 1 87  ? 32.566  -11.944 -1.989  1.00 65.88  ? 87  ARG A NH1 1 
ATOM 674  N NH2 . ARG A 1 87  ? 32.728  -12.915 -4.062  1.00 55.30  ? 87  ARG A NH2 1 
ATOM 675  N N   . ALA A 1 88  ? 28.725  -4.918  -2.147  1.00 38.90  ? 88  ALA A N   1 
ATOM 676  C CA  . ALA A 1 88  ? 28.119  -3.887  -1.307  1.00 39.21  ? 88  ALA A CA  1 
ATOM 677  C C   . ALA A 1 88  ? 28.330  -4.183  0.177   1.00 41.59  ? 88  ALA A C   1 
ATOM 678  O O   . ALA A 1 88  ? 28.407  -3.271  1.001   1.00 47.49  ? 88  ALA A O   1 
ATOM 679  C CB  . ALA A 1 88  ? 26.638  -3.756  -1.618  1.00 41.47  ? 88  ALA A CB  1 
ATOM 680  N N   . GLU A 1 89  ? 28.442  -5.468  0.499   1.00 41.29  ? 89  GLU A N   1 
ATOM 681  C CA  . GLU A 1 89  ? 28.705  -5.917  1.859   1.00 37.01  ? 89  GLU A CA  1 
ATOM 682  C C   . GLU A 1 89  ? 30.091  -5.519  2.366   1.00 29.10  ? 89  GLU A C   1 
ATOM 683  O O   . GLU A 1 89  ? 30.319  -5.460  3.573   1.00 62.09  ? 89  GLU A O   1 
ATOM 684  C CB  . GLU A 1 89  ? 28.545  -7.436  1.942   1.00 46.30  ? 89  GLU A CB  1 
ATOM 685  C CG  . GLU A 1 89  ? 27.152  -7.924  1.597   1.00 53.87  ? 89  GLU A CG  1 
ATOM 686  C CD  . GLU A 1 89  ? 27.057  -9.436  1.547   1.00 67.00  ? 89  GLU A CD  1 
ATOM 687  O OE1 . GLU A 1 89  ? 27.661  -10.047 0.638   1.00 73.32  ? 89  GLU A OE1 1 
ATOM 688  O OE2 . GLU A 1 89  ? 26.377  -10.013 2.422   1.00 67.03  ? 89  GLU A OE2 1 
ATOM 689  N N   . ASP A 1 90  ? 31.014  -5.253  1.447   1.00 29.14  ? 90  ASP A N   1 
ATOM 690  C CA  . ASP A 1 90  ? 32.389  -4.920  1.815   1.00 28.31  ? 90  ASP A CA  1 
ATOM 691  C C   . ASP A 1 90  ? 32.530  -3.487  2.313   1.00 27.13  ? 90  ASP A C   1 
ATOM 692  O O   . ASP A 1 90  ? 33.622  -3.075  2.719   1.00 26.42  ? 90  ASP A O   1 
ATOM 693  C CB  . ASP A 1 90  ? 33.334  -5.159  0.640   1.00 28.73  ? 90  ASP A CB  1 
ATOM 694  C CG  . ASP A 1 90  ? 33.495  -6.625  0.320   1.00 32.49  ? 90  ASP A CG  1 
ATOM 695  O OD1 . ASP A 1 90  ? 34.059  -7.358  1.160   1.00 39.84  ? 90  ASP A OD1 1 
ATOM 696  O OD2 . ASP A 1 90  ? 33.070  -7.046  -0.778  1.00 36.10  ? 90  ASP A OD2 1 
ATOM 697  N N   . THR A 1 91  ? 31.430  -2.735  2.261   1.00 42.39  ? 91  THR A N   1 
ATOM 698  C CA  . THR A 1 91  ? 31.370  -1.410  2.869   1.00 25.19  ? 91  THR A CA  1 
ATOM 699  C C   . THR A 1 91  ? 31.806  -1.512  4.330   1.00 44.20  ? 91  THR A C   1 
ATOM 700  O O   . THR A 1 91  ? 31.276  -2.322  5.094   1.00 47.40  ? 91  THR A O   1 
ATOM 701  C CB  . THR A 1 91  ? 29.957  -0.800  2.779   1.00 29.05  ? 91  THR A CB  1 
ATOM 702  O OG1 . THR A 1 91  ? 29.667  -0.494  1.410   1.00 25.91  ? 91  THR A OG1 1 
ATOM 703  C CG2 . THR A 1 91  ? 29.884  0.488   3.597   1.00 26.98  ? 91  THR A CG2 1 
ATOM 704  N N   . ALA A 1 92  ? 32.763  -0.664  4.700   1.00 22.52  ? 92  ALA A N   1 
ATOM 705  C CA  . ALA A 1 92  ? 33.450  -0.735  5.981   1.00 21.98  ? 92  ALA A CA  1 
ATOM 706  C C   . ALA A 1 92  ? 34.449  0.418   6.133   1.00 21.15  ? 92  ALA A C   1 
ATOM 707  O O   . ALA A 1 92  ? 34.687  1.167   5.194   1.00 50.43  ? 92  ALA A O   1 
ATOM 708  C CB  . ALA A 1 92  ? 34.169  -2.058  6.111   1.00 68.17  ? 92  ALA A CB  1 
ATOM 709  N N   . VAL A 1 93  ? 35.044  0.546   7.317   1.00 28.17  ? 93  VAL A N   1 
ATOM 710  C CA  . VAL A 1 93  ? 36.200  1.428   7.520   1.00 36.23  ? 93  VAL A CA  1 
ATOM 711  C C   . VAL A 1 93  ? 37.434  0.567   7.727   1.00 40.56  ? 93  VAL A C   1 
ATOM 712  O O   . VAL A 1 93  ? 37.483  -0.210  8.672   1.00 25.21  ? 93  VAL A O   1 
ATOM 713  C CB  . VAL A 1 93  ? 36.056  2.357   8.748   1.00 24.25  ? 93  VAL A CB  1 
ATOM 714  C CG1 . VAL A 1 93  ? 37.363  3.096   8.999   1.00 23.77  ? 93  VAL A CG1 1 
ATOM 715  C CG2 . VAL A 1 93  ? 34.918  3.344   8.561   1.00 24.08  ? 93  VAL A CG2 1 
ATOM 716  N N   . TYR A 1 94  ? 38.439  0.710   6.870   1.00 38.38  ? 94  TYR A N   1 
ATOM 717  C CA  . TYR A 1 94  ? 39.612  -0.161  6.956   1.00 43.56  ? 94  TYR A CA  1 
ATOM 718  C C   . TYR A 1 94  ? 40.805  0.493   7.661   1.00 43.52  ? 94  TYR A C   1 
ATOM 719  O O   . TYR A 1 94  ? 41.432  1.402   7.132   1.00 49.29  ? 94  TYR A O   1 
ATOM 720  C CB  . TYR A 1 94  ? 40.030  -0.629  5.557   1.00 21.07  ? 94  TYR A CB  1 
ATOM 721  C CG  . TYR A 1 94  ? 39.033  -1.556  4.890   1.00 35.80  ? 94  TYR A CG  1 
ATOM 722  C CD1 . TYR A 1 94  ? 37.800  -1.088  4.453   1.00 32.68  ? 94  TYR A CD1 1 
ATOM 723  C CD2 . TYR A 1 94  ? 39.326  -2.901  4.695   1.00 37.71  ? 94  TYR A CD2 1 
ATOM 724  C CE1 . TYR A 1 94  ? 36.886  -1.932  3.845   1.00 22.60  ? 94  TYR A CE1 1 
ATOM 725  C CE2 . TYR A 1 94  ? 38.415  -3.755  4.086   1.00 38.31  ? 94  TYR A CE2 1 
ATOM 726  C CZ  . TYR A 1 94  ? 37.197  -3.263  3.664   1.00 36.78  ? 94  TYR A CZ  1 
ATOM 727  O OH  . TYR A 1 94  ? 36.280  -4.094  3.059   1.00 24.24  ? 94  TYR A OH  1 
ATOM 728  N N   . TYR A 1 95  ? 41.123  -0.003  8.854   1.00 44.11  ? 95  TYR A N   1 
ATOM 729  C CA  . TYR A 1 95  ? 42.289  0.451   9.612   1.00 21.58  ? 95  TYR A CA  1 
ATOM 730  C C   . TYR A 1 95  ? 43.496  -0.452  9.357   1.00 22.08  ? 95  TYR A C   1 
ATOM 731  O O   . TYR A 1 95  ? 43.341  -1.667  9.257   1.00 22.67  ? 95  TYR A O   1 
ATOM 732  C CB  . TYR A 1 95  ? 42.014  0.442   11.121  1.00 21.38  ? 95  TYR A CB  1 
ATOM 733  C CG  . TYR A 1 95  ? 40.724  1.075   11.590  1.00 26.17  ? 95  TYR A CG  1 
ATOM 734  C CD1 . TYR A 1 95  ? 39.505  0.429   11.419  1.00 21.39  ? 95  TYR A CD1 1 
ATOM 735  C CD2 . TYR A 1 95  ? 40.727  2.299   12.243  1.00 29.92  ? 95  TYR A CD2 1 
ATOM 736  C CE1 . TYR A 1 95  ? 38.326  0.995   11.857  1.00 21.18  ? 95  TYR A CE1 1 
ATOM 737  C CE2 . TYR A 1 95  ? 39.550  2.873   12.688  1.00 39.21  ? 95  TYR A CE2 1 
ATOM 738  C CZ  . TYR A 1 95  ? 38.352  2.214   12.492  1.00 51.43  ? 95  TYR A CZ  1 
ATOM 739  O OH  . TYR A 1 95  ? 37.171  2.767   12.929  1.00 56.62  ? 95  TYR A OH  1 
ATOM 740  N N   . CYS A 1 96  ? 44.697  0.117   9.287   1.00 24.68  ? 96  CYS A N   1 
ATOM 741  C CA  . CYS A 1 96  ? 45.894  -0.721  9.369   1.00 25.17  ? 96  CYS A CA  1 
ATOM 742  C C   . CYS A 1 96  ? 46.457  -0.651  10.780  1.00 25.03  ? 96  CYS A C   1 
ATOM 743  O O   . CYS A 1 96  ? 46.426  0.403   11.414  1.00 36.07  ? 96  CYS A O   1 
ATOM 744  C CB  . CYS A 1 96  ? 46.970  -0.306  8.360   1.00 39.83  ? 96  CYS A CB  1 
ATOM 745  S SG  . CYS A 1 96  ? 47.375  1.448   8.333   1.00 52.70  ? 96  CYS A SG  1 
ATOM 746  N N   . ALA A 1 97  ? 46.966  -1.781  11.262  1.00 38.53  ? 97  ALA A N   1 
ATOM 747  C CA  . ALA A 1 97  ? 47.614  -1.850  12.565  1.00 41.86  ? 97  ALA A CA  1 
ATOM 748  C C   . ALA A 1 97  ? 48.811  -2.800  12.563  1.00 43.90  ? 97  ALA A C   1 
ATOM 749  O O   . ALA A 1 97  ? 48.768  -3.864  11.950  1.00 25.40  ? 97  ALA A O   1 
ATOM 750  C CB  . ALA A 1 97  ? 46.615  -2.275  13.627  1.00 24.15  ? 97  ALA A CB  1 
ATOM 751  N N   . THR A 1 98  ? 49.877  -2.407  13.252  1.00 39.96  ? 98  THR A N   1 
ATOM 752  C CA  . THR A 1 98  ? 51.023  -3.286  13.458  1.00 37.23  ? 98  THR A CA  1 
ATOM 753  C C   . THR A 1 98  ? 50.631  -4.356  14.472  1.00 41.66  ? 98  THR A C   1 
ATOM 754  O O   . THR A 1 98  ? 49.668  -4.174  15.217  1.00 41.59  ? 98  THR A O   1 
ATOM 755  C CB  . THR A 1 98  ? 52.270  -2.528  13.976  1.00 36.85  ? 98  THR A CB  1 
ATOM 756  O OG1 . THR A 1 98  ? 52.062  -2.127  15.337  1.00 39.25  ? 98  THR A OG1 1 
ATOM 757  C CG2 . THR A 1 98  ? 52.546  -1.292  13.127  1.00 27.10  ? 98  THR A CG2 1 
ATOM 758  N N   . ASN A 1 99  ? 51.363  -5.467  14.505  1.00 30.94  ? 99  ASN A N   1 
ATOM 759  C CA  . ASN A 1 99  ? 51.065  -6.534  15.460  1.00 35.64  ? 99  ASN A CA  1 
ATOM 760  C C   . ASN A 1 99  ? 51.240  -6.061  16.899  1.00 46.12  ? 99  ASN A C   1 
ATOM 761  O O   . ASN A 1 99  ? 50.607  -6.580  17.808  1.00 31.98  ? 99  ASN A O   1 
ATOM 762  C CB  . ASN A 1 99  ? 51.945  -7.758  15.198  1.00 35.78  ? 99  ASN A CB  1 
ATOM 763  C CG  . ASN A 1 99  ? 51.393  -9.028  15.835  1.00 34.18  ? 99  ASN A CG  1 
ATOM 764  O OD1 . ASN A 1 99  ? 51.206  -9.102  17.050  1.00 35.04  ? 99  ASN A OD1 1 
ATOM 765  N ND2 . ASN A 1 99  ? 51.127  -10.033 15.011  1.00 37.22  ? 99  ASN A ND2 1 
ATOM 766  N N   . ASP A 1 100 ? 52.068  -5.038  17.080  1.00 35.61  ? 100 ASP A N   1 
ATOM 767  C CA  . ASP A 1 100 ? 52.332  -4.442  18.388  1.00 39.83  ? 100 ASP A CA  1 
ATOM 768  C C   . ASP A 1 100 ? 51.238  -3.438  18.741  1.00 39.54  ? 100 ASP A C   1 
ATOM 769  O O   . ASP A 1 100 ? 51.362  -2.688  19.711  1.00 38.76  ? 100 ASP A O   1 
ATOM 770  C CB  . ASP A 1 100 ? 53.702  -3.760  18.428  1.00 48.90  ? 100 ASP A CB  1 
ATOM 771  C CG  . ASP A 1 100 ? 54.778  -4.544  17.710  1.00 66.99  ? 100 ASP A CG  1 
ATOM 772  O OD1 . ASP A 1 100 ? 54.751  -5.791  17.771  1.00 73.66  ? 100 ASP A OD1 1 
ATOM 773  O OD2 . ASP A 1 100 ? 55.672  -3.902  17.113  1.00 63.20  ? 100 ASP A OD2 1 
ATOM 774  N N   . ASP A 1 101 ? 50.204  -3.411  17.901  1.00 43.81  ? 101 ASP A N   1 
ATOM 775  C CA  . ASP A 1 101 ? 48.988  -2.605  18.075  1.00 24.06  ? 101 ASP A CA  1 
ATOM 776  C C   . ASP A 1 101 ? 49.129  -1.075  17.991  1.00 25.47  ? 101 ASP A C   1 
ATOM 777  O O   . ASP A 1 101 ? 48.609  -0.352  18.841  1.00 24.70  ? 101 ASP A O   1 
ATOM 778  C CB  . ASP A 1 101 ? 48.327  -2.963  19.416  1.00 24.44  ? 101 ASP A CB  1 
ATOM 779  C CG  . ASP A 1 101 ? 47.269  -4.038  19.277  1.00 62.83  ? 101 ASP A CG  1 
ATOM 780  O OD1 . ASP A 1 101 ? 46.220  -3.747  18.671  1.00 51.38  ? 101 ASP A OD1 1 
ATOM 781  O OD2 . ASP A 1 101 ? 47.474  -5.164  19.779  1.00 52.24  ? 101 ASP A OD2 1 
ATOM 782  N N   . TYR A 1 102 ? 49.799  -0.588  16.949  1.00 22.60  ? 102 TYR A N   1 
ATOM 783  C CA  . TYR A 1 102 ? 49.679  0.816   16.545  1.00 21.91  ? 102 TYR A CA  1 
ATOM 784  C C   . TYR A 1 102 ? 48.617  0.932   15.447  1.00 30.18  ? 102 TYR A C   1 
ATOM 785  O O   . TYR A 1 102 ? 48.792  0.370   14.374  1.00 34.11  ? 102 TYR A O   1 
ATOM 786  C CB  . TYR A 1 102 ? 51.012  1.361   16.024  1.00 36.38  ? 102 TYR A CB  1 
ATOM 787  C CG  . TYR A 1 102 ? 52.007  1.765   17.088  1.00 38.08  ? 102 TYR A CG  1 
ATOM 788  C CD1 . TYR A 1 102 ? 51.614  2.493   18.202  1.00 42.68  ? 102 TYR A CD1 1 
ATOM 789  C CD2 . TYR A 1 102 ? 53.339  1.385   16.989  1.00 32.80  ? 102 TYR A CD2 1 
ATOM 790  C CE1 . TYR A 1 102 ? 52.529  2.852   19.180  1.00 43.04  ? 102 TYR A CE1 1 
ATOM 791  C CE2 . TYR A 1 102 ? 54.259  1.733   17.960  1.00 31.67  ? 102 TYR A CE2 1 
ATOM 792  C CZ  . TYR A 1 102 ? 53.850  2.465   19.054  1.00 37.23  ? 102 TYR A CZ  1 
ATOM 793  O OH  . TYR A 1 102 ? 54.768  2.809   20.020  1.00 38.55  ? 102 TYR A OH  1 
ATOM 794  N N   . TRP A 1 103 ? 47.538  1.673   15.698  1.00 19.07  ? 103 TRP A N   1 
ATOM 795  C CA  . TRP A 1 103 ? 46.434  1.803   14.731  1.00 31.70  ? 103 TRP A CA  1 
ATOM 796  C C   . TRP A 1 103 ? 46.359  3.195   14.093  1.00 18.27  ? 103 TRP A C   1 
ATOM 797  O O   . TRP A 1 103 ? 46.791  4.185   14.684  1.00 18.06  ? 103 TRP A O   1 
ATOM 798  C CB  . TRP A 1 103 ? 45.080  1.492   15.389  1.00 35.54  ? 103 TRP A CB  1 
ATOM 799  C CG  . TRP A 1 103 ? 44.900  0.080   15.862  1.00 19.37  ? 103 TRP A CG  1 
ATOM 800  C CD1 . TRP A 1 103 ? 45.619  -0.558  16.831  1.00 24.07  ? 103 TRP A CD1 1 
ATOM 801  C CD2 . TRP A 1 103 ? 43.921  -0.864  15.403  1.00 19.71  ? 103 TRP A CD2 1 
ATOM 802  N NE1 . TRP A 1 103 ? 45.156  -1.841  16.997  1.00 20.51  ? 103 TRP A NE1 1 
ATOM 803  C CE2 . TRP A 1 103 ? 44.115  -2.053  16.133  1.00 20.43  ? 103 TRP A CE2 1 
ATOM 804  C CE3 . TRP A 1 103 ? 42.906  -0.819  14.444  1.00 27.07  ? 103 TRP A CE3 1 
ATOM 805  C CZ2 . TRP A 1 103 ? 43.330  -3.188  15.933  1.00 21.04  ? 103 TRP A CZ2 1 
ATOM 806  C CZ3 . TRP A 1 103 ? 42.129  -1.948  14.248  1.00 25.49  ? 103 TRP A CZ3 1 
ATOM 807  C CH2 . TRP A 1 103 ? 42.345  -3.114  14.989  1.00 20.89  ? 103 TRP A CH2 1 
ATOM 808  N N   . GLY A 1 104 ? 45.814  3.260   12.880  1.00 17.27  ? 104 GLY A N   1 
ATOM 809  C CA  . GLY A 1 104 ? 45.643  4.522   12.181  1.00 28.66  ? 104 GLY A CA  1 
ATOM 810  C C   . GLY A 1 104 ? 44.281  5.162   12.392  1.00 34.60  ? 104 GLY A C   1 
ATOM 811  O O   . GLY A 1 104 ? 43.537  4.780   13.293  1.00 31.96  ? 104 GLY A O   1 
ATOM 812  N N   . GLN A 1 105 ? 43.957  6.142   11.553  1.00 38.28  ? 105 GLN A N   1 
ATOM 813  C CA  . GLN A 1 105 ? 42.694  6.873   11.661  1.00 37.55  ? 105 GLN A CA  1 
ATOM 814  C C   . GLN A 1 105 ? 41.520  6.027   11.170  1.00 31.18  ? 105 GLN A C   1 
ATOM 815  O O   . GLN A 1 105 ? 40.413  6.096   11.687  1.00 26.25  ? 105 GLN A O   1 
ATOM 816  C CB  . GLN A 1 105 ? 42.772  8.170   10.856  1.00 54.36  ? 105 GLN A CB  1 
ATOM 817  C CG  . GLN A 1 105 ? 41.483  8.963   10.808  1.00 61.06  ? 105 GLN A CG  1 
ATOM 818  C CD  . GLN A 1 105 ? 41.457  9.924   9.642   1.00 65.82  ? 105 GLN A CD  1 
ATOM 819  O OE1 . GLN A 1 105 ? 42.426  10.020  8.888   1.00 68.74  ? 105 GLN A OE1 1 
ATOM 820  N NE2 . GLN A 1 105 ? 40.339  10.622  9.469   1.00 57.74  ? 105 GLN A NE2 1 
ATOM 821  N N   . GLY A 1 106 ? 41.804  5.216   10.161  1.00 31.00  ? 106 GLY A N   1 
ATOM 822  C CA  . GLY A 1 106 ? 40.831  4.402   9.452   1.00 34.92  ? 106 GLY A CA  1 
ATOM 823  C C   . GLY A 1 106 ? 40.454  5.100   8.157   1.00 36.49  ? 106 GLY A C   1 
ATOM 824  O O   . GLY A 1 106 ? 40.300  6.323   8.126   1.00 27.39  ? 106 GLY A O   1 
ATOM 825  N N   . THR A 1 107 ? 40.253  4.321   7.098   1.00 36.10  ? 107 THR A N   1 
ATOM 826  C CA  . THR A 1 107 ? 39.893  4.875   5.798   1.00 39.54  ? 107 THR A CA  1 
ATOM 827  C C   . THR A 1 107 ? 38.516  4.338   5.418   1.00 40.12  ? 107 THR A C   1 
ATOM 828  O O   . THR A 1 107 ? 38.196  3.180   5.677   1.00 27.69  ? 107 THR A O   1 
ATOM 829  C CB  . THR A 1 107 ? 40.957  4.543   4.701   1.00 42.52  ? 107 THR A CB  1 
ATOM 830  O OG1 . THR A 1 107 ? 40.563  5.114   3.447   1.00 39.41  ? 107 THR A OG1 1 
ATOM 831  C CG2 . THR A 1 107 ? 41.146  3.043   4.529   1.00 44.22  ? 107 THR A CG2 1 
ATOM 832  N N   . LEU A 1 108 ? 37.685  5.189   4.832   1.00 36.66  ? 108 LEU A N   1 
ATOM 833  C CA  . LEU A 1 108 ? 36.304  4.807   4.571   1.00 33.55  ? 108 LEU A CA  1 
ATOM 834  C C   . LEU A 1 108 ? 36.125  4.372   3.118   1.00 35.18  ? 108 LEU A C   1 
ATOM 835  O O   . LEU A 1 108 ? 36.513  5.076   2.189   1.00 43.24  ? 108 LEU A O   1 
ATOM 836  C CB  . LEU A 1 108 ? 35.360  5.963   4.930   1.00 35.84  ? 108 LEU A CB  1 
ATOM 837  C CG  . LEU A 1 108 ? 33.837  5.779   4.908   1.00 34.71  ? 108 LEU A CG  1 
ATOM 838  C CD1 . LEU A 1 108 ? 33.395  4.320   5.189   1.00 25.99  ? 108 LEU A CD1 1 
ATOM 839  C CD2 . LEU A 1 108 ? 33.186  6.764   5.884   1.00 41.03  ? 108 LEU A CD2 1 
ATOM 840  N N   . VAL A 1 109 ? 35.560  3.181   2.947   1.00 29.43  ? 109 VAL A N   1 
ATOM 841  C CA  . VAL A 1 109 ? 35.255  2.622   1.637   1.00 26.75  ? 109 VAL A CA  1 
ATOM 842  C C   . VAL A 1 109 ? 33.766  2.302   1.573   1.00 26.16  ? 109 VAL A C   1 
ATOM 843  O O   . VAL A 1 109 ? 33.275  1.488   2.349   1.00 26.00  ? 109 VAL A O   1 
ATOM 844  C CB  . VAL A 1 109 ? 36.067  1.338   1.353   1.00 25.88  ? 109 VAL A CB  1 
ATOM 845  C CG1 . VAL A 1 109 ? 35.635  0.716   0.040   1.00 25.84  ? 109 VAL A CG1 1 
ATOM 846  C CG2 . VAL A 1 109 ? 37.559  1.632   1.333   1.00 34.89  ? 109 VAL A CG2 1 
ATOM 847  N N   . THR A 1 110 ? 33.045  2.956   0.669   1.00 44.91  ? 110 THR A N   1 
ATOM 848  C CA  . THR A 1 110 ? 31.622  2.684   0.492   1.00 49.28  ? 110 THR A CA  1 
ATOM 849  C C   . THR A 1 110 ? 31.361  2.028   -0.859  1.00 25.18  ? 110 THR A C   1 
ATOM 850  O O   . THR A 1 110 ? 31.689  2.592   -1.899  1.00 25.43  ? 110 THR A O   1 
ATOM 851  C CB  . THR A 1 110 ? 30.772  3.974   0.604   1.00 48.00  ? 110 THR A CB  1 
ATOM 852  O OG1 . THR A 1 110 ? 30.867  4.510   1.931   1.00 60.81  ? 110 THR A OG1 1 
ATOM 853  C CG2 . THR A 1 110 ? 29.313  3.685   0.280   1.00 44.70  ? 110 THR A CG2 1 
ATOM 854  N N   . VAL A 1 111 ? 30.782  0.830   -0.841  1.00 26.89  ? 111 VAL A N   1 
ATOM 855  C CA  . VAL A 1 111 ? 30.445  0.126   -2.077  1.00 28.92  ? 111 VAL A CA  1 
ATOM 856  C C   . VAL A 1 111 ? 28.949  0.202   -2.378  1.00 32.77  ? 111 VAL A C   1 
ATOM 857  O O   . VAL A 1 111 ? 28.138  -0.381  -1.658  1.00 37.42  ? 111 VAL A O   1 
ATOM 858  C CB  . VAL A 1 111 ? 30.860  -1.362  -2.022  1.00 26.74  ? 111 VAL A CB  1 
ATOM 859  C CG1 . VAL A 1 111 ? 30.591  -2.029  -3.362  1.00 29.55  ? 111 VAL A CG1 1 
ATOM 860  C CG2 . VAL A 1 111 ? 32.325  -1.505  -1.641  1.00 26.32  ? 111 VAL A CG2 1 
ATOM 861  N N   . SER A 1 112 ? 28.587  0.929   -3.433  1.00 33.14  ? 112 SER A N   1 
ATOM 862  C CA  . SER A 1 112 ? 27.190  1.020   -3.850  1.00 42.39  ? 112 SER A CA  1 
ATOM 863  C C   . SER A 1 112 ? 27.069  1.271   -5.347  1.00 42.80  ? 112 SER A C   1 
ATOM 864  O O   . SER A 1 112 ? 27.964  1.849   -5.963  1.00 30.32  ? 112 SER A O   1 
ATOM 865  C CB  . SER A 1 112 ? 26.464  2.127   -3.075  1.00 38.65  ? 112 SER A CB  1 
ATOM 866  O OG  . SER A 1 112 ? 25.076  2.147   -3.377  1.00 35.08  ? 112 SER A OG  1 
ATOM 867  N N   . SER A 1 113 ? 25.949  0.842   -5.921  1.00 50.92  ? 113 SER A N   1 
ATOM 868  C CA  . SER A 1 113 ? 25.675  1.071   -7.332  1.00 49.51  ? 113 SER A CA  1 
ATOM 869  C C   . SER A 1 113 ? 24.868  2.353   -7.513  1.00 41.89  ? 113 SER A C   1 
ATOM 870  O O   . SER A 1 113 ? 24.585  2.768   -8.635  1.00 37.84  ? 113 SER A O   1 
ATOM 871  C CB  . SER A 1 113 ? 24.932  -0.121  -7.941  1.00 50.89  ? 113 SER A CB  1 
ATOM 872  O OG  . SER A 1 113 ? 23.703  -0.350  -7.276  1.00 49.09  ? 113 SER A OG  1 
ATOM 873  N N   . ALA A 1 114 ? 24.503  2.975   -6.397  1.00 38.98  ? 114 ALA A N   1 
ATOM 874  C CA  . ALA A 1 114 ? 23.729  4.209   -6.419  1.00 38.92  ? 114 ALA A CA  1 
ATOM 875  C C   . ALA A 1 114 ? 24.548  5.386   -6.938  1.00 37.75  ? 114 ALA A C   1 
ATOM 876  O O   . ALA A 1 114 ? 25.732  5.515   -6.632  1.00 34.99  ? 114 ALA A O   1 
ATOM 877  C CB  . ALA A 1 114 ? 23.192  4.514   -5.030  1.00 42.54  ? 114 ALA A CB  1 
ATOM 878  N N   . SER A 1 115 ? 23.906  6.221   -7.751  1.00 41.22  ? 115 SER A N   1 
ATOM 879  C CA  . SER A 1 115 ? 24.493  7.472   -8.233  1.00 44.53  ? 115 SER A CA  1 
ATOM 880  C C   . SER A 1 115 ? 24.478  8.552   -7.154  1.00 44.29  ? 115 SER A C   1 
ATOM 881  O O   . SER A 1 115 ? 23.727  8.450   -6.180  1.00 45.51  ? 115 SER A O   1 
ATOM 882  C CB  . SER A 1 115 ? 23.753  7.972   -9.476  1.00 54.54  ? 115 SER A CB  1 
ATOM 883  O OG  . SER A 1 115 ? 24.029  9.341   -9.725  1.00 61.05  ? 115 SER A OG  1 
ATOM 884  N N   . THR A 1 116 ? 25.294  9.589   -7.331  1.00 42.17  ? 116 THR A N   1 
ATOM 885  C CA  . THR A 1 116 ? 25.309  10.691  -6.380  1.00 45.77  ? 116 THR A CA  1 
ATOM 886  C C   . THR A 1 116 ? 24.083  11.560  -6.635  1.00 51.29  ? 116 THR A C   1 
ATOM 887  O O   . THR A 1 116 ? 23.955  12.184  -7.687  1.00 47.92  ? 116 THR A O   1 
ATOM 888  C CB  . THR A 1 116 ? 26.598  11.547  -6.502  1.00 35.30  ? 116 THR A CB  1 
ATOM 889  O OG1 . THR A 1 116 ? 27.755  10.716  -6.334  1.00 36.58  ? 116 THR A OG1 1 
ATOM 890  C CG2 . THR A 1 116 ? 26.625  12.653  -5.458  1.00 35.25  ? 116 THR A CG2 1 
ATOM 891  N N   . LYS A 1 117 ? 23.202  11.627  -5.641  1.00 50.75  ? 117 LYS A N   1 
ATOM 892  C CA  . LYS A 1 117 ? 21.938  12.343  -5.777  1.00 52.67  ? 117 LYS A CA  1 
ATOM 893  C C   . LYS A 1 117 ? 21.767  13.338  -4.639  1.00 46.66  ? 117 LYS A C   1 
ATOM 894  O O   . LYS A 1 117 ? 22.242  13.115  -3.522  1.00 45.41  ? 117 LYS A O   1 
ATOM 895  C CB  . LYS A 1 117 ? 20.743  11.366  -5.818  1.00 44.98  ? 117 LYS A CB  1 
ATOM 896  C CG  . LYS A 1 117 ? 19.385  12.075  -5.860  1.00 42.08  ? 117 LYS A CG  1 
ATOM 897  C CD  . LYS A 1 117 ? 18.195  11.150  -6.103  1.00 45.69  ? 117 LYS A CD  1 
ATOM 898  C CE  . LYS A 1 117 ? 16.894  11.956  -6.229  1.00 56.33  ? 117 LYS A CE  1 
ATOM 899  N NZ  . LYS A 1 117 ? 16.470  12.573  -4.935  1.00 63.42  ? 117 LYS A NZ  1 
ATOM 900  N N   . GLY A 1 118 ? 21.098  14.444  -4.938  1.00 51.22  ? 118 GLY A N   1 
ATOM 901  C CA  . GLY A 1 118 ? 20.771  15.426  -3.930  1.00 50.08  ? 118 GLY A CA  1 
ATOM 902  C C   . GLY A 1 118 ? 19.560  15.004  -3.124  1.00 54.95  ? 118 GLY A C   1 
ATOM 903  O O   . GLY A 1 118 ? 18.687  14.288  -3.619  1.00 55.18  ? 118 GLY A O   1 
ATOM 904  N N   . PRO A 1 119 ? 19.503  15.445  -1.864  1.00 51.05  ? 119 PRO A N   1 
ATOM 905  C CA  . PRO A 1 119 ? 18.382  15.147  -0.975  1.00 34.70  ? 119 PRO A CA  1 
ATOM 906  C C   . PRO A 1 119 ? 17.121  15.942  -1.290  1.00 46.92  ? 119 PRO A C   1 
ATOM 907  O O   . PRO A 1 119 ? 17.209  17.110  -1.665  1.00 55.12  ? 119 PRO A O   1 
ATOM 908  C CB  . PRO A 1 119 ? 18.939  15.529  0.392   1.00 34.05  ? 119 PRO A CB  1 
ATOM 909  C CG  . PRO A 1 119 ? 19.830  16.681  0.104   1.00 34.07  ? 119 PRO A CG  1 
ATOM 910  C CD  . PRO A 1 119 ? 20.473  16.357  -1.230  1.00 55.09  ? 119 PRO A CD  1 
ATOM 911  N N   . SER A 1 120 ? 15.965  15.300  -1.155  1.00 40.79  ? 120 SER A N   1 
ATOM 912  C CA  . SER A 1 120 ? 14.709  16.026  -1.067  1.00 38.40  ? 120 SER A CA  1 
ATOM 913  C C   . SER A 1 120 ? 14.508  16.377  0.398   1.00 34.29  ? 120 SER A C   1 
ATOM 914  O O   . SER A 1 120 ? 14.800  15.567  1.281   1.00 37.21  ? 120 SER A O   1 
ATOM 915  C CB  . SER A 1 120 ? 13.535  15.204  -1.602  1.00 40.68  ? 120 SER A CB  1 
ATOM 916  O OG  . SER A 1 120 ? 13.476  13.937  -0.972  1.00 47.21  ? 120 SER A OG  1 
ATOM 917  N N   . VAL A 1 121 ? 14.025  17.586  0.656   1.00 36.96  ? 121 VAL A N   1 
ATOM 918  C CA  . VAL A 1 121 ? 13.821  18.036  2.021   1.00 34.63  ? 121 VAL A CA  1 
ATOM 919  C C   . VAL A 1 121 ? 12.350  18.332  2.257   1.00 29.50  ? 121 VAL A C   1 
ATOM 920  O O   . VAL A 1 121 ? 11.764  19.198  1.607   1.00 37.84  ? 121 VAL A O   1 
ATOM 921  C CB  . VAL A 1 121 ? 14.665  19.283  2.333   1.00 26.23  ? 121 VAL A CB  1 
ATOM 922  C CG1 . VAL A 1 121 ? 14.572  19.632  3.813   1.00 33.60  ? 121 VAL A CG1 1 
ATOM 923  C CG2 . VAL A 1 121 ? 16.104  19.049  1.929   1.00 26.04  ? 121 VAL A CG2 1 
ATOM 924  N N   . PHE A 1 122 ? 11.757  17.605  3.194   1.00 25.26  ? 122 PHE A N   1 
ATOM 925  C CA  . PHE A 1 122 ? 10.341  17.751  3.477   1.00 26.70  ? 122 PHE A CA  1 
ATOM 926  C C   . PHE A 1 122 ? 10.134  18.227  4.909   1.00 34.38  ? 122 PHE A C   1 
ATOM 927  O O   . PHE A 1 122 ? 10.844  17.800  5.818   1.00 39.71  ? 122 PHE A O   1 
ATOM 928  C CB  . PHE A 1 122 ? 9.613   16.424  3.255   1.00 29.71  ? 122 PHE A CB  1 
ATOM 929  C CG  . PHE A 1 122 ? 9.845   15.815  1.899   1.00 26.60  ? 122 PHE A CG  1 
ATOM 930  C CD1 . PHE A 1 122 ? 10.468  14.583  1.775   1.00 33.31  ? 122 PHE A CD1 1 
ATOM 931  C CD2 . PHE A 1 122 ? 9.436   16.470  0.752   1.00 27.20  ? 122 PHE A CD2 1 
ATOM 932  C CE1 . PHE A 1 122 ? 10.679  14.018  0.531   1.00 40.65  ? 122 PHE A CE1 1 
ATOM 933  C CE2 . PHE A 1 122 ? 9.644   15.911  -0.494  1.00 31.09  ? 122 PHE A CE2 1 
ATOM 934  C CZ  . PHE A 1 122 ? 10.264  14.683  -0.604  1.00 39.84  ? 122 PHE A CZ  1 
ATOM 935  N N   . PRO A 1 123 ? 9.153   19.118  5.113   1.00 28.18  ? 123 PRO A N   1 
ATOM 936  C CA  . PRO A 1 123 ? 8.843   19.640  6.445   1.00 28.36  ? 123 PRO A CA  1 
ATOM 937  C C   . PRO A 1 123 ? 8.060   18.628  7.269   1.00 30.63  ? 123 PRO A C   1 
ATOM 938  O O   . PRO A 1 123 ? 7.280   17.860  6.707   1.00 28.09  ? 123 PRO A O   1 
ATOM 939  C CB  . PRO A 1 123 ? 8.004   20.881  6.140   1.00 28.65  ? 123 PRO A CB  1 
ATOM 940  C CG  . PRO A 1 123 ? 7.284   20.519  4.883   1.00 28.55  ? 123 PRO A CG  1 
ATOM 941  C CD  . PRO A 1 123 ? 8.271   19.693  4.082   1.00 30.85  ? 123 PRO A CD  1 
ATOM 942  N N   . LEU A 1 124 ? 8.286   18.614  8.577   1.00 32.02  ? 124 LEU A N   1 
ATOM 943  C CA  . LEU A 1 124 ? 7.501   17.792  9.483   1.00 36.50  ? 124 LEU A CA  1 
ATOM 944  C C   . LEU A 1 124 ? 6.633   18.728  10.331  1.00 39.91  ? 124 LEU A C   1 
ATOM 945  O O   . LEU A 1 124 ? 7.147   19.455  11.173  1.00 40.33  ? 124 LEU A O   1 
ATOM 946  C CB  . LEU A 1 124 ? 8.419   16.928  10.352  1.00 35.23  ? 124 LEU A CB  1 
ATOM 947  C CG  . LEU A 1 124 ? 9.296   15.872  9.669   1.00 44.96  ? 124 LEU A CG  1 
ATOM 948  C CD1 . LEU A 1 124 ? 10.002  15.031  10.712  1.00 29.83  ? 124 LEU A CD1 1 
ATOM 949  C CD2 . LEU A 1 124 ? 8.489   14.975  8.736   1.00 45.41  ? 124 LEU A CD2 1 
ATOM 950  N N   . ALA A 1 125 ? 5.322   18.721  10.096  1.00 46.53  ? 125 ALA A N   1 
ATOM 951  C CA  . ALA A 1 125 ? 4.410   19.680  10.739  1.00 44.72  ? 125 ALA A CA  1 
ATOM 952  C C   . ALA A 1 125 ? 4.247   19.427  12.236  1.00 50.23  ? 125 ALA A C   1 
ATOM 953  O O   . ALA A 1 125 ? 4.119   18.279  12.664  1.00 51.53  ? 125 ALA A O   1 
ATOM 954  C CB  . ALA A 1 125 ? 3.057   19.650  10.059  1.00 49.07  ? 125 ALA A CB  1 
ATOM 955  N N   . PRO A 1 126 ? 4.276   20.501  13.041  1.00 44.92  ? 126 PRO A N   1 
ATOM 956  C CA  . PRO A 1 126 ? 4.311   20.223  14.481  1.00 51.14  ? 126 PRO A CA  1 
ATOM 957  C C   . PRO A 1 126 ? 3.033   20.178  15.343  1.00 53.30  ? 126 PRO A C   1 
ATOM 958  O O   . PRO A 1 126 ? 1.922   20.607  15.033  1.00 43.71  ? 126 PRO A O   1 
ATOM 959  C CB  . PRO A 1 126 ? 5.204   21.357  14.998  1.00 44.85  ? 126 PRO A CB  1 
ATOM 960  C CG  . PRO A 1 126 ? 4.925   22.486  14.074  1.00 39.04  ? 126 PRO A CG  1 
ATOM 961  C CD  . PRO A 1 126 ? 4.735   21.862  12.718  1.00 39.73  ? 126 PRO A CD  1 
ATOM 962  N N   . SER A 1 127 ? 3.336   19.644  16.520  1.00 83.07  ? 127 SER A N   1 
ATOM 963  C CA  . SER A 1 127 ? 2.510   19.369  17.702  1.00 81.96  ? 127 SER A CA  1 
ATOM 964  C C   . SER A 1 127 ? 1.131   18.705  17.556  1.00 84.39  ? 127 SER A C   1 
ATOM 965  O O   . SER A 1 127 ? 0.787   18.131  16.508  1.00 88.30  ? 127 SER A O   1 
ATOM 966  C CB  . SER A 1 127 ? 2.327   20.687  18.474  1.00 71.95  ? 127 SER A CB  1 
ATOM 967  O OG  . SER A 1 127 ? 2.092   20.479  19.861  1.00 59.87  ? 127 SER A OG  1 
ATOM 968  N N   . SER A 1 128 ? 0.290   18.958  18.562  1.00 69.73  ? 128 SER A N   1 
ATOM 969  C CA  . SER A 1 128 ? -0.795  18.035  18.914  1.00 59.88  ? 128 SER A CA  1 
ATOM 970  C C   . SER A 1 128 ? -0.490  16.574  18.529  1.00 49.99  ? 128 SER A C   1 
ATOM 971  O O   . SER A 1 128 ? 0.659   16.118  18.570  1.00 45.37  ? 128 SER A O   1 
ATOM 972  C CB  . SER A 1 128 ? -2.102  18.483  18.267  1.00 66.69  ? 128 SER A CB  1 
ATOM 973  O OG  . SER A 1 128 ? -2.246  19.889  18.380  1.00 72.68  ? 128 SER A OG  1 
ATOM 974  N N   . SER A 1 132 ? 2.584   16.395  24.066  1.00 57.71  ? 132 SER A N   1 
ATOM 975  C CA  . SER A 1 132 ? 3.755   17.183  23.733  1.00 64.07  ? 132 SER A CA  1 
ATOM 976  C C   . SER A 1 132 ? 4.380   17.656  25.030  1.00 60.03  ? 132 SER A C   1 
ATOM 977  O O   . SER A 1 132 ? 5.615   17.712  25.172  1.00 66.06  ? 132 SER A O   1 
ATOM 978  C CB  . SER A 1 132 ? 3.371   18.358  22.820  1.00 71.74  ? 132 SER A CB  1 
ATOM 979  O OG  . SER A 1 132 ? 4.486   18.804  22.059  1.00 84.15  ? 132 SER A OG  1 
ATOM 980  N N   . GLY A 1 133 ? 3.501   18.005  25.967  1.00 61.54  ? 133 GLY A N   1 
ATOM 981  C CA  . GLY A 1 133 ? 3.908   18.428  27.291  1.00 63.17  ? 133 GLY A CA  1 
ATOM 982  C C   . GLY A 1 133 ? 4.396   19.865  27.447  1.00 66.13  ? 133 GLY A C   1 
ATOM 983  O O   . GLY A 1 133 ? 5.326   20.112  28.216  1.00 66.81  ? 133 GLY A O   1 
ATOM 984  N N   . GLY A 1 134 ? 3.817   20.806  26.700  1.00 66.77  ? 134 GLY A N   1 
ATOM 985  C CA  . GLY A 1 134 ? 4.183   22.212  26.825  1.00 63.11  ? 134 GLY A CA  1 
ATOM 986  C C   . GLY A 1 134 ? 5.190   22.700  25.802  1.00 63.30  ? 134 GLY A C   1 
ATOM 987  O O   . GLY A 1 134 ? 5.381   23.896  25.613  1.00 69.80  ? 134 GLY A O   1 
ATOM 988  N N   . THR A 1 135 ? 5.836   21.753  25.141  1.00 51.15  ? 135 THR A N   1 
ATOM 989  C CA  . THR A 1 135 ? 6.811   22.032  24.102  1.00 45.63  ? 135 THR A CA  1 
ATOM 990  C C   . THR A 1 135 ? 6.282   21.539  22.758  1.00 35.68  ? 135 THR A C   1 
ATOM 991  O O   . THR A 1 135 ? 5.490   20.608  22.701  1.00 36.27  ? 135 THR A O   1 
ATOM 992  C CB  . THR A 1 135 ? 8.150   21.353  24.419  1.00 53.44  ? 135 THR A CB  1 
ATOM 993  O OG1 . THR A 1 135 ? 9.064   21.541  23.332  1.00 63.59  ? 135 THR A OG1 1 
ATOM 994  C CG2 . THR A 1 135 ? 7.936   19.863  24.656  1.00 54.75  ? 135 THR A CG2 1 
ATOM 995  N N   . ALA A 1 136 ? 6.693   22.169  21.669  1.00 36.50  ? 136 ALA A N   1 
ATOM 996  C CA  . ALA A 1 136 ? 6.292   21.671  20.362  1.00 34.50  ? 136 ALA A CA  1 
ATOM 997  C C   . ALA A 1 136 ? 7.486   21.097  19.617  1.00 50.32  ? 136 ALA A C   1 
ATOM 998  O O   . ALA A 1 136 ? 8.580   21.653  19.651  1.00 50.88  ? 136 ALA A O   1 
ATOM 999  C CB  . ALA A 1 136 ? 5.627   22.767  19.554  1.00 33.20  ? 136 ALA A CB  1 
ATOM 1000 N N   . ALA A 1 137 ? 7.273   19.960  18.968  1.00 43.89  ? 137 ALA A N   1 
ATOM 1001 C CA  . ALA A 1 137 ? 8.336   19.308  18.216  1.00 30.34  ? 137 ALA A CA  1 
ATOM 1002 C C   . ALA A 1 137 ? 8.107   19.420  16.712  1.00 29.52  ? 137 ALA A C   1 
ATOM 1003 O O   . ALA A 1 137 ? 7.085   18.975  16.192  1.00 29.26  ? 137 ALA A O   1 
ATOM 1004 C CB  . ALA A 1 137 ? 8.454   17.852  18.621  1.00 34.95  ? 137 ALA A CB  1 
ATOM 1005 N N   . LEU A 1 138 ? 9.067   20.024  16.021  1.00 29.47  ? 138 LEU A N   1 
ATOM 1006 C CA  . LEU A 1 138 ? 8.998   20.167  14.572  1.00 33.26  ? 138 LEU A CA  1 
ATOM 1007 C C   . LEU A 1 138 ? 10.281  19.663  13.911  1.00 36.64  ? 138 LEU A C   1 
ATOM 1008 O O   . LEU A 1 138 ? 11.381  20.127  14.214  1.00 28.72  ? 138 LEU A O   1 
ATOM 1009 C CB  . LEU A 1 138 ? 8.726   21.626  14.194  1.00 38.06  ? 138 LEU A CB  1 
ATOM 1010 C CG  . LEU A 1 138 ? 9.719   22.711  14.619  1.00 42.54  ? 138 LEU A CG  1 
ATOM 1011 C CD1 . LEU A 1 138 ? 10.519  23.215  13.433  1.00 41.45  ? 138 LEU A CD1 1 
ATOM 1012 C CD2 . LEU A 1 138 ? 9.000   23.855  15.310  1.00 47.32  ? 138 LEU A CD2 1 
ATOM 1013 N N   . GLY A 1 139 ? 10.144  18.688  13.023  1.00 41.67  ? 139 GLY A N   1 
ATOM 1014 C CA  . GLY A 1 139 ? 11.306  18.159  12.334  1.00 40.63  ? 139 GLY A CA  1 
ATOM 1015 C C   . GLY A 1 139 ? 11.441  18.548  10.874  1.00 39.67  ? 139 GLY A C   1 
ATOM 1016 O O   . GLY A 1 139 ? 10.552  19.186  10.307  1.00 36.48  ? 139 GLY A O   1 
ATOM 1017 N N   . CYS A 1 140 ? 12.564  18.168  10.269  1.00 39.04  ? 140 CYS A N   1 
ATOM 1018 C CA  . CYS A 1 140 ? 12.662  18.103  8.810   1.00 34.69  ? 140 CYS A CA  1 
ATOM 1019 C C   . CYS A 1 140 ? 13.290  16.837  8.312   1.00 36.86  ? 140 CYS A C   1 
ATOM 1020 O O   . CYS A 1 140 ? 14.290  16.342  8.838   1.00 32.37  ? 140 CYS A O   1 
ATOM 1021 C CB  . CYS A 1 140 ? 13.413  19.288  8.209   1.00 26.05  ? 140 CYS A CB  1 
ATOM 1022 S SG  . CYS A 1 140 ? 12.623  20.848  8.552   1.00 137.17 ? 140 CYS A SG  1 
ATOM 1023 N N   . LEU A 1 141 ? 12.696  16.366  7.230   1.00 34.23  ? 141 LEU A N   1 
ATOM 1024 C CA  . LEU A 1 141 ? 12.955  15.053  6.709   1.00 36.41  ? 141 LEU A CA  1 
ATOM 1025 C C   . LEU A 1 141 ? 13.738  15.166  5.413   1.00 34.00  ? 141 LEU A C   1 
ATOM 1026 O O   . LEU A 1 141 ? 13.274  15.729  4.423   1.00 38.85  ? 141 LEU A O   1 
ATOM 1027 C CB  . LEU A 1 141 ? 11.625  14.313  6.546   1.00 37.97  ? 141 LEU A CB  1 
ATOM 1028 C CG  . LEU A 1 141 ? 11.575  12.934  5.913   1.00 44.69  ? 141 LEU A CG  1 
ATOM 1029 C CD1 . LEU A 1 141 ? 12.391  11.969  6.744   1.00 43.41  ? 141 LEU A CD1 1 
ATOM 1030 C CD2 . LEU A 1 141 ? 10.125  12.501  5.903   1.00 51.19  ? 141 LEU A CD2 1 
ATOM 1031 N N   . VAL A 1 142 ? 14.959  14.654  5.465   1.00 31.99  ? 142 VAL A N   1 
ATOM 1032 C CA  . VAL A 1 142 ? 15.894  14.706  4.358   1.00 29.75  ? 142 VAL A CA  1 
ATOM 1033 C C   . VAL A 1 142 ? 15.940  13.320  3.722   1.00 29.15  ? 142 VAL A C   1 
ATOM 1034 O O   . VAL A 1 142 ? 16.415  12.371  4.336   1.00 25.23  ? 142 VAL A O   1 
ATOM 1035 C CB  . VAL A 1 142 ? 17.293  15.146  4.845   1.00 28.88  ? 142 VAL A CB  1 
ATOM 1036 C CG1 . VAL A 1 142 ? 18.206  15.413  3.685   1.00 32.57  ? 142 VAL A CG1 1 
ATOM 1037 C CG2 . VAL A 1 142 ? 17.181  16.390  5.722   1.00 26.05  ? 142 VAL A CG2 1 
ATOM 1038 N N   . LYS A 1 143 ? 15.428  13.186  2.504   1.00 28.01  ? 143 LYS A N   1 
ATOM 1039 C CA  . LYS A 1 143 ? 15.283  11.856  1.918   1.00 27.89  ? 143 LYS A CA  1 
ATOM 1040 C C   . LYS A 1 143 ? 15.980  11.630  0.574   1.00 28.20  ? 143 LYS A C   1 
ATOM 1041 O O   . LYS A 1 143 ? 16.243  12.571  -0.179  1.00 28.77  ? 143 LYS A O   1 
ATOM 1042 C CB  . LYS A 1 143 ? 13.798  11.525  1.760   1.00 27.62  ? 143 LYS A CB  1 
ATOM 1043 C CG  . LYS A 1 143 ? 13.531  10.049  1.557   1.00 47.47  ? 143 LYS A CG  1 
ATOM 1044 C CD  . LYS A 1 143 ? 12.053  9.674   1.466   1.00 44.38  ? 143 LYS A CD  1 
ATOM 1045 C CE  . LYS A 1 143 ? 11.105  10.714  2.097   1.00 60.05  ? 143 LYS A CE  1 
ATOM 1046 N NZ  . LYS A 1 143 ? 11.232  10.807  3.580   1.00 71.40  ? 143 LYS A NZ  1 
ATOM 1047 N N   . ASP A 1 144 ? 16.285  10.359  0.308   1.00 34.25  ? 144 ASP A N   1 
ATOM 1048 C CA  . ASP A 1 144 ? 16.775  9.889   -0.982  1.00 34.11  ? 144 ASP A CA  1 
ATOM 1049 C C   . ASP A 1 144 ? 17.920  10.733  -1.520  1.00 35.08  ? 144 ASP A C   1 
ATOM 1050 O O   . ASP A 1 144 ? 17.772  11.469  -2.496  1.00 35.17  ? 144 ASP A O   1 
ATOM 1051 C CB  . ASP A 1 144 ? 15.620  9.813   -1.985  1.00 42.82  ? 144 ASP A CB  1 
ATOM 1052 C CG  . ASP A 1 144 ? 14.635  8.709   -1.642  1.00 51.43  ? 144 ASP A CG  1 
ATOM 1053 O OD1 . ASP A 1 144 ? 15.104  7.589   -1.351  1.00 58.85  ? 144 ASP A OD1 1 
ATOM 1054 O OD2 . ASP A 1 144 ? 13.409  8.940   -1.703  1.00 51.53  ? 144 ASP A OD2 1 
ATOM 1055 N N   . TYR A 1 145 ? 19.052  10.629  -0.834  1.00 30.32  ? 145 TYR A N   1 
ATOM 1056 C CA  . TYR A 1 145 ? 20.288  11.276  -1.238  1.00 34.45  ? 145 TYR A CA  1 
ATOM 1057 C C   . TYR A 1 145 ? 21.429  10.288  -1.093  1.00 28.28  ? 145 TYR A C   1 
ATOM 1058 O O   . TYR A 1 145 ? 21.275  9.237   -0.466  1.00 28.00  ? 145 TYR A O   1 
ATOM 1059 C CB  . TYR A 1 145 ? 20.574  12.521  -0.400  1.00 31.95  ? 145 TYR A CB  1 
ATOM 1060 C CG  . TYR A 1 145 ? 21.017  12.209  1.008   1.00 36.47  ? 145 TYR A CG  1 
ATOM 1061 C CD1 . TYR A 1 145 ? 20.181  11.535  1.885   1.00 32.14  ? 145 TYR A CD1 1 
ATOM 1062 C CD2 . TYR A 1 145 ? 22.280  12.574  1.456   1.00 43.17  ? 145 TYR A CD2 1 
ATOM 1063 C CE1 . TYR A 1 145 ? 20.583  11.238  3.173   1.00 34.57  ? 145 TYR A CE1 1 
ATOM 1064 C CE2 . TYR A 1 145 ? 22.693  12.281  2.745   1.00 45.24  ? 145 TYR A CE2 1 
ATOM 1065 C CZ  . TYR A 1 145 ? 21.840  11.611  3.597   1.00 43.81  ? 145 TYR A CZ  1 
ATOM 1066 O OH  . TYR A 1 145 ? 22.250  11.314  4.877   1.00 27.74  ? 145 TYR A OH  1 
ATOM 1067 N N   . PHE A 1 146 ? 22.579  10.654  -1.649  1.00 30.18  ? 146 PHE A N   1 
ATOM 1068 C CA  . PHE A 1 146 ? 23.743  9.783   -1.687  1.00 36.56  ? 146 PHE A CA  1 
ATOM 1069 C C   . PHE A 1 146 ? 24.919  10.527  -2.310  1.00 40.05  ? 146 PHE A C   1 
ATOM 1070 O O   . PHE A 1 146 ? 24.741  11.297  -3.252  1.00 45.99  ? 146 PHE A O   1 
ATOM 1071 C CB  . PHE A 1 146 ? 23.437  8.509   -2.481  1.00 38.90  ? 146 PHE A CB  1 
ATOM 1072 C CG  . PHE A 1 146 ? 24.592  7.561   -2.584  1.00 36.11  ? 146 PHE A CG  1 
ATOM 1073 C CD1 . PHE A 1 146 ? 25.540  7.697   -3.586  1.00 33.49  ? 146 PHE A CD1 1 
ATOM 1074 C CD2 . PHE A 1 146 ? 24.736  6.537   -1.666  1.00 32.67  ? 146 PHE A CD2 1 
ATOM 1075 C CE1 . PHE A 1 146 ? 26.601  6.827   -3.674  1.00 35.97  ? 146 PHE A CE1 1 
ATOM 1076 C CE2 . PHE A 1 146 ? 25.793  5.664   -1.748  1.00 34.34  ? 146 PHE A CE2 1 
ATOM 1077 C CZ  . PHE A 1 146 ? 26.728  5.807   -2.752  1.00 36.34  ? 146 PHE A CZ  1 
ATOM 1078 N N   . PRO A 1 147 ? 26.127  10.305  -1.771  1.00 33.40  ? 147 PRO A N   1 
ATOM 1079 C CA  . PRO A 1 147 ? 26.315  9.550   -0.533  1.00 37.91  ? 147 PRO A CA  1 
ATOM 1080 C C   . PRO A 1 147 ? 26.300  10.454  0.692   1.00 42.16  ? 147 PRO A C   1 
ATOM 1081 O O   . PRO A 1 147 ? 26.034  11.653  0.580   1.00 54.83  ? 147 PRO A O   1 
ATOM 1082 C CB  . PRO A 1 147 ? 27.684  8.915   -0.733  1.00 28.44  ? 147 PRO A CB  1 
ATOM 1083 C CG  . PRO A 1 147 ? 28.434  9.962   -1.481  1.00 29.36  ? 147 PRO A CG  1 
ATOM 1084 C CD  . PRO A 1 147 ? 27.422  10.647  -2.387  1.00 29.29  ? 147 PRO A CD  1 
ATOM 1085 N N   . GLU A 1 148 ? 26.575  9.862   1.849   1.00 34.63  ? 148 GLU A N   1 
ATOM 1086 C CA  . GLU A 1 148 ? 26.669  10.591  3.106   1.00 25.22  ? 148 GLU A CA  1 
ATOM 1087 C C   . GLU A 1 148 ? 28.013  11.348  3.115   1.00 40.29  ? 148 GLU A C   1 
ATOM 1088 O O   . GLU A 1 148 ? 28.824  11.147  2.206   1.00 35.81  ? 148 GLU A O   1 
ATOM 1089 C CB  . GLU A 1 148 ? 26.559  9.622   4.291   1.00 25.85  ? 148 GLU A CB  1 
ATOM 1090 C CG  . GLU A 1 148 ? 25.431  9.948   5.262   1.00 45.61  ? 148 GLU A CG  1 
ATOM 1091 C CD  . GLU A 1 148 ? 25.481  9.116   6.528   1.00 53.37  ? 148 GLU A CD  1 
ATOM 1092 O OE1 . GLU A 1 148 ? 26.531  9.138   7.206   1.00 61.37  ? 148 GLU A OE1 1 
ATOM 1093 O OE2 . GLU A 1 148 ? 24.464  8.471   6.859   1.00 62.88  ? 148 GLU A OE2 1 
ATOM 1094 N N   . PRO A 1 149 ? 28.236  12.259  4.085   1.00 40.69  ? 149 PRO A N   1 
ATOM 1095 C CA  . PRO A 1 149 ? 27.249  12.844  4.984   1.00 34.65  ? 149 PRO A CA  1 
ATOM 1096 C C   . PRO A 1 149 ? 26.583  14.131  4.488   1.00 39.98  ? 149 PRO A C   1 
ATOM 1097 O O   . PRO A 1 149 ? 26.947  14.691  3.456   1.00 44.44  ? 149 PRO A O   1 
ATOM 1098 C CB  . PRO A 1 149 ? 28.070  13.092  6.253   1.00 39.28  ? 149 PRO A CB  1 
ATOM 1099 C CG  . PRO A 1 149 ? 29.450  13.345  5.799   1.00 40.86  ? 149 PRO A CG  1 
ATOM 1100 C CD  . PRO A 1 149 ? 29.600  12.387  4.633   1.00 39.40  ? 149 PRO A CD  1 
ATOM 1101 N N   . VAL A 1 150 ? 25.612  14.583  5.279   1.00 27.42  ? 150 VAL A N   1 
ATOM 1102 C CA  . VAL A 1 150 ? 24.848  15.804  5.042   1.00 27.28  ? 150 VAL A CA  1 
ATOM 1103 C C   . VAL A 1 150 ? 24.826  16.616  6.323   1.00 27.41  ? 150 VAL A C   1 
ATOM 1104 O O   . VAL A 1 150 ? 24.479  16.110  7.400   1.00 27.15  ? 150 VAL A O   1 
ATOM 1105 C CB  . VAL A 1 150 ? 23.370  15.523  4.578   1.00 26.54  ? 150 VAL A CB  1 
ATOM 1106 C CG1 . VAL A 1 150 ? 22.703  14.495  5.462   1.00 35.29  ? 150 VAL A CG1 1 
ATOM 1107 C CG2 . VAL A 1 150 ? 22.543  16.808  4.534   1.00 41.22  ? 150 VAL A CG2 1 
ATOM 1108 N N   . THR A 1 151 ? 25.247  17.867  6.213   1.00 43.54  ? 151 THR A N   1 
ATOM 1109 C CA  . THR A 1 151 ? 25.236  18.754  7.357   1.00 41.21  ? 151 THR A CA  1 
ATOM 1110 C C   . THR A 1 151 ? 23.862  19.406  7.437   1.00 37.46  ? 151 THR A C   1 
ATOM 1111 O O   . THR A 1 151 ? 23.267  19.765  6.417   1.00 30.28  ? 151 THR A O   1 
ATOM 1112 C CB  . THR A 1 151 ? 26.350  19.813  7.267   1.00 48.57  ? 151 THR A CB  1 
ATOM 1113 O OG1 . THR A 1 151 ? 26.259  20.513  6.020   1.00 54.65  ? 151 THR A OG1 1 
ATOM 1114 C CG2 . THR A 1 151 ? 27.708  19.156  7.346   1.00 48.14  ? 151 THR A CG2 1 
ATOM 1115 N N   . VAL A 1 152 ? 23.340  19.493  8.653   1.00 24.57  ? 152 VAL A N   1 
ATOM 1116 C CA  . VAL A 1 152 ? 22.067  20.142  8.897   1.00 33.02  ? 152 VAL A CA  1 
ATOM 1117 C C   . VAL A 1 152 ? 22.246  21.191  9.980   1.00 40.61  ? 152 VAL A C   1 
ATOM 1118 O O   . VAL A 1 152 ? 22.867  20.930  11.009  1.00 43.04  ? 152 VAL A O   1 
ATOM 1119 C CB  . VAL A 1 152 ? 20.979  19.140  9.327   1.00 23.64  ? 152 VAL A CB  1 
ATOM 1120 C CG1 . VAL A 1 152 ? 19.680  19.875  9.643   1.00 23.44  ? 152 VAL A CG1 1 
ATOM 1121 C CG2 . VAL A 1 152 ? 20.758  18.100  8.248   1.00 23.19  ? 152 VAL A CG2 1 
ATOM 1122 N N   . SER A 1 153 ? 21.712  22.382  9.741   1.00 42.24  ? 153 SER A N   1 
ATOM 1123 C CA  . SER A 1 153 ? 21.676  23.414  10.766  1.00 39.44  ? 153 SER A CA  1 
ATOM 1124 C C   . SER A 1 153 ? 20.243  23.935  10.896  1.00 44.20  ? 153 SER A C   1 
ATOM 1125 O O   . SER A 1 153 ? 19.423  23.756  10.001  1.00 36.45  ? 153 SER A O   1 
ATOM 1126 C CB  . SER A 1 153 ? 22.672  24.541  10.444  1.00 39.13  ? 153 SER A CB  1 
ATOM 1127 O OG  . SER A 1 153 ? 22.069  25.613  9.743   1.00 38.78  ? 153 SER A OG  1 
ATOM 1128 N N   . TRP A 1 154 ? 19.922  24.539  12.031  1.00 46.46  ? 154 TRP A N   1 
ATOM 1129 C CA  . TRP A 1 154 ? 18.592  25.109  12.203  1.00 39.81  ? 154 TRP A CA  1 
ATOM 1130 C C   . TRP A 1 154 ? 18.708  26.611  12.381  1.00 42.55  ? 154 TRP A C   1 
ATOM 1131 O O   . TRP A 1 154 ? 19.312  27.078  13.348  1.00 46.43  ? 154 TRP A O   1 
ATOM 1132 C CB  . TRP A 1 154 ? 17.857  24.462  13.386  1.00 41.11  ? 154 TRP A CB  1 
ATOM 1133 C CG  . TRP A 1 154 ? 17.235  23.156  13.017  1.00 35.49  ? 154 TRP A CG  1 
ATOM 1134 C CD1 . TRP A 1 154 ? 17.844  21.938  12.996  1.00 43.42  ? 154 TRP A CD1 1 
ATOM 1135 C CD2 . TRP A 1 154 ? 15.882  22.930  12.591  1.00 34.12  ? 154 TRP A CD2 1 
ATOM 1136 N NE1 . TRP A 1 154 ? 16.961  20.969  12.596  1.00 42.85  ? 154 TRP A NE1 1 
ATOM 1137 C CE2 . TRP A 1 154 ? 15.757  21.550  12.344  1.00 34.29  ? 154 TRP A CE2 1 
ATOM 1138 C CE3 . TRP A 1 154 ? 14.785  23.770  12.409  1.00 32.80  ? 154 TRP A CE3 1 
ATOM 1139 C CZ2 . TRP A 1 154 ? 14.556  20.984  11.906  1.00 32.88  ? 154 TRP A CZ2 1 
ATOM 1140 C CZ3 . TRP A 1 154 ? 13.598  23.204  11.983  1.00 33.21  ? 154 TRP A CZ3 1 
ATOM 1141 C CH2 . TRP A 1 154 ? 13.494  21.827  11.725  1.00 33.17  ? 154 TRP A CH2 1 
ATOM 1142 N N   . ASN A 1 155 ? 18.141  27.358  11.436  1.00 34.83  ? 155 ASN A N   1 
ATOM 1143 C CA  . ASN A 1 155 ? 18.257  28.810  11.445  1.00 36.91  ? 155 ASN A CA  1 
ATOM 1144 C C   . ASN A 1 155 ? 19.721  29.235  11.479  1.00 41.44  ? 155 ASN A C   1 
ATOM 1145 O O   . ASN A 1 155 ? 20.112  30.064  12.296  1.00 43.21  ? 155 ASN A O   1 
ATOM 1146 C CB  . ASN A 1 155 ? 17.505  29.395  12.642  1.00 33.06  ? 155 ASN A CB  1 
ATOM 1147 C CG  . ASN A 1 155 ? 16.078  29.792  12.305  1.00 39.55  ? 155 ASN A CG  1 
ATOM 1148 O OD1 . ASN A 1 155 ? 15.842  30.804  11.645  1.00 43.39  ? 155 ASN A OD1 1 
ATOM 1149 N ND2 . ASN A 1 155 ? 15.118  28.990  12.755  1.00 42.57  ? 155 ASN A ND2 1 
ATOM 1150 N N   . SER A 1 156 ? 20.518  28.642  10.596  1.00 44.34  ? 156 SER A N   1 
ATOM 1151 C CA  . SER A 1 156 ? 21.958  28.882  10.523  1.00 45.58  ? 156 SER A CA  1 
ATOM 1152 C C   . SER A 1 156 ? 22.639  28.811  11.887  1.00 38.01  ? 156 SER A C   1 
ATOM 1153 O O   . SER A 1 156 ? 23.247  29.780  12.330  1.00 36.74  ? 156 SER A O   1 
ATOM 1154 C CB  . SER A 1 156 ? 22.240  30.246  9.887   1.00 47.41  ? 156 SER A CB  1 
ATOM 1155 O OG  . SER A 1 156 ? 21.823  30.272  8.535   1.00 49.53  ? 156 SER A OG  1 
ATOM 1156 N N   . GLY A 1 157 ? 22.558  27.653  12.535  1.00 39.40  ? 157 GLY A N   1 
ATOM 1157 C CA  . GLY A 1 157 ? 23.241  27.428  13.797  1.00 42.42  ? 157 GLY A CA  1 
ATOM 1158 C C   . GLY A 1 157 ? 22.871  28.411  14.894  1.00 44.46  ? 157 GLY A C   1 
ATOM 1159 O O   . GLY A 1 157 ? 23.562  28.501  15.912  1.00 46.06  ? 157 GLY A O   1 
ATOM 1160 N N   . ALA A 1 158 ? 21.765  29.125  14.708  1.00 37.18  ? 158 ALA A N   1 
ATOM 1161 C CA  . ALA A 1 158 ? 21.316  30.086  15.707  1.00 36.51  ? 158 ALA A CA  1 
ATOM 1162 C C   . ALA A 1 158 ? 20.270  29.467  16.623  1.00 42.95  ? 158 ALA A C   1 
ATOM 1163 O O   . ALA A 1 158 ? 19.779  30.120  17.542  1.00 44.14  ? 158 ALA A O   1 
ATOM 1164 C CB  . ALA A 1 158 ? 20.772  31.344  15.044  1.00 35.09  ? 158 ALA A CB  1 
ATOM 1165 N N   . LEU A 1 159 ? 19.902  28.218  16.355  1.00 43.34  ? 159 LEU A N   1 
ATOM 1166 C CA  . LEU A 1 159 ? 19.092  27.464  17.307  1.00 41.61  ? 159 LEU A CA  1 
ATOM 1167 C C   . LEU A 1 159 ? 19.711  26.088  17.557  1.00 47.00  ? 159 LEU A C   1 
ATOM 1168 O O   . LEU A 1 159 ? 19.603  25.205  16.709  1.00 41.41  ? 159 LEU A O   1 
ATOM 1169 C CB  . LEU A 1 159 ? 17.664  27.337  16.757  1.00 36.63  ? 159 LEU A CB  1 
ATOM 1170 C CG  . LEU A 1 159 ? 16.647  26.312  17.262  1.00 40.65  ? 159 LEU A CG  1 
ATOM 1171 C CD1 . LEU A 1 159 ? 16.354  26.467  18.749  1.00 34.73  ? 159 LEU A CD1 1 
ATOM 1172 C CD2 . LEU A 1 159 ? 15.375  26.458  16.440  1.00 44.35  ? 159 LEU A CD2 1 
ATOM 1173 N N   . THR A 1 160 ? 20.381  25.902  18.696  1.00 48.80  ? 160 THR A N   1 
ATOM 1174 C CA  . THR A 1 160 ? 20.854  24.564  19.072  1.00 50.63  ? 160 THR A CA  1 
ATOM 1175 C C   . THR A 1 160 ? 20.107  23.830  20.194  1.00 52.19  ? 160 THR A C   1 
ATOM 1176 O O   . THR A 1 160 ? 20.266  22.621  20.342  1.00 33.46  ? 160 THR A O   1 
ATOM 1177 C CB  . THR A 1 160 ? 22.342  24.589  19.486  1.00 55.99  ? 160 THR A CB  1 
ATOM 1178 O OG1 . THR A 1 160 ? 22.475  25.156  20.797  1.00 59.42  ? 160 THR A OG1 1 
ATOM 1179 C CG2 . THR A 1 160 ? 23.180  25.364  18.474  1.00 43.40  ? 160 THR A CG2 1 
ATOM 1180 N N   . SER A 1 161 ? 19.295  24.524  20.983  1.00 50.69  ? 161 SER A N   1 
ATOM 1181 C CA  . SER A 1 161 ? 18.719  23.868  22.157  1.00 49.45  ? 161 SER A CA  1 
ATOM 1182 C C   . SER A 1 161 ? 17.481  23.062  21.769  1.00 55.68  ? 161 SER A C   1 
ATOM 1183 O O   . SER A 1 161 ? 16.503  23.597  21.242  1.00 61.25  ? 161 SER A O   1 
ATOM 1184 C CB  . SER A 1 161 ? 18.390  24.886  23.254  1.00 54.69  ? 161 SER A CB  1 
ATOM 1185 O OG  . SER A 1 161 ? 19.501  25.085  24.114  1.00 53.18  ? 161 SER A OG  1 
ATOM 1186 N N   . GLY A 1 162 ? 17.541  21.761  22.026  1.00 38.70  ? 162 GLY A N   1 
ATOM 1187 C CA  . GLY A 1 162 ? 16.484  20.858  21.621  1.00 42.88  ? 162 GLY A CA  1 
ATOM 1188 C C   . GLY A 1 162 ? 16.681  20.313  20.219  1.00 42.12  ? 162 GLY A C   1 
ATOM 1189 O O   . GLY A 1 162 ? 15.783  19.681  19.666  1.00 56.54  ? 162 GLY A O   1 
ATOM 1190 N N   . VAL A 1 163 ? 17.850  20.558  19.637  1.00 34.00  ? 163 VAL A N   1 
ATOM 1191 C CA  . VAL A 1 163 ? 18.140  20.038  18.304  1.00 36.03  ? 163 VAL A CA  1 
ATOM 1192 C C   . VAL A 1 163 ? 18.613  18.590  18.350  1.00 35.34  ? 163 VAL A C   1 
ATOM 1193 O O   . VAL A 1 163 ? 19.547  18.252  19.080  1.00 33.98  ? 163 VAL A O   1 
ATOM 1194 C CB  . VAL A 1 163 ? 19.190  20.892  17.576  1.00 35.75  ? 163 VAL A CB  1 
ATOM 1195 C CG1 . VAL A 1 163 ? 19.572  20.248  16.251  1.00 31.40  ? 163 VAL A CG1 1 
ATOM 1196 C CG2 . VAL A 1 163 ? 18.642  22.285  17.331  1.00 39.39  ? 163 VAL A CG2 1 
ATOM 1197 N N   . HIS A 1 164 ? 17.947  17.740  17.574  1.00 30.56  ? 164 HIS A N   1 
ATOM 1198 C CA  . HIS A 1 164 ? 18.311  16.335  17.480  1.00 38.87  ? 164 HIS A CA  1 
ATOM 1199 C C   . HIS A 1 164 ? 18.381  15.918  16.017  1.00 40.36  ? 164 HIS A C   1 
ATOM 1200 O O   . HIS A 1 164 ? 17.374  15.927  15.308  1.00 34.02  ? 164 HIS A O   1 
ATOM 1201 C CB  . HIS A 1 164 ? 17.308  15.472  18.247  1.00 33.09  ? 164 HIS A CB  1 
ATOM 1202 C CG  . HIS A 1 164 ? 17.686  15.217  19.683  1.00 31.99  ? 164 HIS A CG  1 
ATOM 1203 N ND1 . HIS A 1 164 ? 16.769  15.122  20.679  1.00 57.48  ? 164 HIS A ND1 1 
ATOM 1204 C CD2 . HIS A 1 164 ? 18.911  15.027  20.246  1.00 31.59  ? 164 HIS A CD2 1 
ATOM 1205 C CE1 . HIS A 1 164 ? 17.398  14.894  21.841  1.00 65.08  ? 164 HIS A CE1 1 
ATOM 1206 N NE2 . HIS A 1 164 ? 18.684  14.833  21.590  1.00 71.92  ? 164 HIS A NE2 1 
ATOM 1207 N N   . THR A 1 165 ? 19.575  15.551  15.566  1.00 28.54  ? 165 THR A N   1 
ATOM 1208 C CA  . THR A 1 165 ? 19.743  15.087  14.199  1.00 32.84  ? 165 THR A CA  1 
ATOM 1209 C C   . THR A 1 165 ? 20.067  13.603  14.210  1.00 33.04  ? 165 THR A C   1 
ATOM 1210 O O   . THR A 1 165 ? 21.161  13.193  14.599  1.00 30.41  ? 165 THR A O   1 
ATOM 1211 C CB  . THR A 1 165 ? 20.846  15.858  13.467  1.00 32.60  ? 165 THR A CB  1 
ATOM 1212 O OG1 . THR A 1 165 ? 20.470  17.236  13.360  1.00 27.21  ? 165 THR A OG1 1 
ATOM 1213 C CG2 . THR A 1 165 ? 21.053  15.291  12.071  1.00 26.52  ? 165 THR A CG2 1 
ATOM 1214 N N   . PHE A 1 166 ? 19.101  12.803  13.776  1.00 37.77  ? 166 PHE A N   1 
ATOM 1215 C CA  . PHE A 1 166 ? 19.232  11.353  13.810  1.00 37.66  ? 166 PHE A CA  1 
ATOM 1216 C C   . PHE A 1 166 ? 20.204  10.854  12.756  1.00 34.85  ? 166 PHE A C   1 
ATOM 1217 O O   . PHE A 1 166 ? 20.315  11.445  11.683  1.00 31.73  ? 166 PHE A O   1 
ATOM 1218 C CB  . PHE A 1 166 ? 17.864  10.694  13.624  1.00 27.40  ? 166 PHE A CB  1 
ATOM 1219 C CG  . PHE A 1 166 ? 16.948  10.870  14.798  1.00 42.46  ? 166 PHE A CG  1 
ATOM 1220 C CD1 . PHE A 1 166 ? 17.052  10.036  15.897  1.00 42.85  ? 166 PHE A CD1 1 
ATOM 1221 C CD2 . PHE A 1 166 ? 15.993  11.873  14.810  1.00 41.39  ? 166 PHE A CD2 1 
ATOM 1222 C CE1 . PHE A 1 166 ? 16.219  10.193  16.981  1.00 38.29  ? 166 PHE A CE1 1 
ATOM 1223 C CE2 . PHE A 1 166 ? 15.156  12.036  15.897  1.00 35.94  ? 166 PHE A CE2 1 
ATOM 1224 C CZ  . PHE A 1 166 ? 15.270  11.192  16.983  1.00 35.77  ? 166 PHE A CZ  1 
ATOM 1225 N N   . PRO A 1 167 ? 20.925  9.768   13.069  1.00 31.37  ? 167 PRO A N   1 
ATOM 1226 C CA  . PRO A 1 167 ? 21.832  9.157   12.095  1.00 23.08  ? 167 PRO A CA  1 
ATOM 1227 C C   . PRO A 1 167 ? 21.069  8.700   10.862  1.00 23.17  ? 167 PRO A C   1 
ATOM 1228 O O   . PRO A 1 167 ? 20.045  8.040   11.012  1.00 23.98  ? 167 PRO A O   1 
ATOM 1229 C CB  . PRO A 1 167 ? 22.413  7.958   12.854  1.00 23.51  ? 167 PRO A CB  1 
ATOM 1230 C CG  . PRO A 1 167 ? 22.257  8.307   14.292  1.00 24.07  ? 167 PRO A CG  1 
ATOM 1231 C CD  . PRO A 1 167 ? 20.978  9.084   14.372  1.00 31.74  ? 167 PRO A CD  1 
ATOM 1232 N N   . ALA A 1 168 ? 21.548  9.044   9.673   1.00 25.10  ? 168 ALA A N   1 
ATOM 1233 C CA  . ALA A 1 168 ? 20.873  8.626   8.452   1.00 39.34  ? 168 ALA A CA  1 
ATOM 1234 C C   . ALA A 1 168 ? 20.929  7.118   8.306   1.00 25.67  ? 168 ALA A C   1 
ATOM 1235 O O   . ALA A 1 168 ? 21.959  6.504   8.574   1.00 30.46  ? 168 ALA A O   1 
ATOM 1236 C CB  . ALA A 1 168 ? 21.489  9.295   7.240   1.00 40.94  ? 168 ALA A CB  1 
ATOM 1237 N N   . VAL A 1 169 ? 19.817  6.523   7.886   1.00 27.94  ? 169 VAL A N   1 
ATOM 1238 C CA  . VAL A 1 169 ? 19.775  5.086   7.660   1.00 36.77  ? 169 VAL A CA  1 
ATOM 1239 C C   . VAL A 1 169 ? 19.646  4.782   6.166   1.00 41.37  ? 169 VAL A C   1 
ATOM 1240 O O   . VAL A 1 169 ? 18.912  5.452   5.436   1.00 28.44  ? 169 VAL A O   1 
ATOM 1241 C CB  . VAL A 1 169 ? 18.620  4.422   8.458   1.00 36.87  ? 169 VAL A CB  1 
ATOM 1242 C CG1 . VAL A 1 169 ? 17.265  4.958   8.018   1.00 37.31  ? 169 VAL A CG1 1 
ATOM 1243 C CG2 . VAL A 1 169 ? 18.674  2.906   8.324   1.00 38.64  ? 169 VAL A CG2 1 
ATOM 1244 N N   . LEU A 1 170 ? 20.396  3.785   5.711   1.00 33.54  ? 170 LEU A N   1 
ATOM 1245 C CA  . LEU A 1 170 ? 20.333  3.359   4.322   1.00 36.10  ? 170 LEU A CA  1 
ATOM 1246 C C   . LEU A 1 170 ? 19.075  2.520   4.135   1.00 36.98  ? 170 LEU A C   1 
ATOM 1247 O O   . LEU A 1 170 ? 18.759  1.676   4.971   1.00 39.90  ? 170 LEU A O   1 
ATOM 1248 C CB  . LEU A 1 170 ? 21.598  2.579   3.943   1.00 34.73  ? 170 LEU A CB  1 
ATOM 1249 C CG  . LEU A 1 170 ? 21.497  1.464   2.902   1.00 28.22  ? 170 LEU A CG  1 
ATOM 1250 C CD1 . LEU A 1 170 ? 21.217  2.027   1.520   1.00 41.07  ? 170 LEU A CD1 1 
ATOM 1251 C CD2 . LEU A 1 170 ? 22.770  0.631   2.903   1.00 28.08  ? 170 LEU A CD2 1 
ATOM 1252 N N   . GLN A 1 171 ? 18.364  2.750   3.036   1.00 31.31  ? 171 GLN A N   1 
ATOM 1253 C CA  . GLN A 1 171 ? 17.063  2.123   2.820   1.00 40.17  ? 171 GLN A CA  1 
ATOM 1254 C C   . GLN A 1 171 ? 17.074  1.323   1.530   1.00 38.51  ? 171 GLN A C   1 
ATOM 1255 O O   . GLN A 1 171 ? 18.028  1.401   0.751   1.00 37.64  ? 171 GLN A O   1 
ATOM 1256 C CB  . GLN A 1 171 ? 15.933  3.158   2.786   1.00 43.70  ? 171 GLN A CB  1 
ATOM 1257 C CG  . GLN A 1 171 ? 16.134  4.252   1.772   1.00 47.51  ? 171 GLN A CG  1 
ATOM 1258 C CD  . GLN A 1 171 ? 15.321  5.496   2.059   1.00 57.72  ? 171 GLN A CD  1 
ATOM 1259 O OE1 . GLN A 1 171 ? 15.480  6.519   1.388   1.00 61.78  ? 171 GLN A OE1 1 
ATOM 1260 N NE2 . GLN A 1 171 ? 14.433  5.413   3.046   1.00 54.58  ? 171 GLN A NE2 1 
ATOM 1261 N N   . SER A 1 172 ? 16.027  0.531   1.330   1.00 44.18  ? 172 SER A N   1 
ATOM 1262 C CA  . SER A 1 172 ? 15.976  -0.458  0.257   1.00 50.77  ? 172 SER A CA  1 
ATOM 1263 C C   . SER A 1 172 ? 16.359  0.087   -1.127  1.00 52.49  ? 172 SER A C   1 
ATOM 1264 O O   . SER A 1 172 ? 16.793  -0.663  -1.992  1.00 64.01  ? 172 SER A O   1 
ATOM 1265 C CB  . SER A 1 172 ? 14.580  -1.074  0.178   1.00 56.24  ? 172 SER A CB  1 
ATOM 1266 O OG  . SER A 1 172 ? 14.547  -2.125  -0.769  1.00 62.16  ? 172 SER A OG  1 
ATOM 1267 N N   . SER A 1 173 ? 16.186  1.388   -1.335  1.00 32.74  ? 173 SER A N   1 
ATOM 1268 C CA  . SER A 1 173 ? 16.537  2.026   -2.602  1.00 32.24  ? 173 SER A CA  1 
ATOM 1269 C C   . SER A 1 173 ? 18.038  2.195   -2.822  1.00 31.05  ? 173 SER A C   1 
ATOM 1270 O O   . SER A 1 173 ? 18.463  2.554   -3.916  1.00 30.74  ? 173 SER A O   1 
ATOM 1271 C CB  . SER A 1 173 ? 15.862  3.394   -2.695  1.00 63.90  ? 173 SER A CB  1 
ATOM 1272 O OG  . SER A 1 173 ? 16.470  4.320   -1.809  1.00 31.19  ? 173 SER A OG  1 
ATOM 1273 N N   . GLY A 1 174 ? 18.840  1.949   -1.791  1.00 27.95  ? 174 GLY A N   1 
ATOM 1274 C CA  . GLY A 1 174 ? 20.267  2.204   -1.882  1.00 26.94  ? 174 GLY A CA  1 
ATOM 1275 C C   . GLY A 1 174 ? 20.601  3.665   -1.616  1.00 35.49  ? 174 GLY A C   1 
ATOM 1276 O O   . GLY A 1 174 ? 21.735  4.098   -1.806  1.00 32.79  ? 174 GLY A O   1 
ATOM 1277 N N   . LEU A 1 175 ? 19.603  4.422   -1.168  1.00 39.61  ? 175 LEU A N   1 
ATOM 1278 C CA  . LEU A 1 175 ? 19.746  5.846   -0.877  1.00 36.22  ? 175 LEU A CA  1 
ATOM 1279 C C   . LEU A 1 175 ? 19.565  6.105   0.615   1.00 35.50  ? 175 LEU A C   1 
ATOM 1280 O O   . LEU A 1 175 ? 18.706  5.512   1.241   1.00 34.43  ? 175 LEU A O   1 
ATOM 1281 C CB  . LEU A 1 175 ? 18.721  6.654   -1.678  1.00 27.03  ? 175 LEU A CB  1 
ATOM 1282 C CG  . LEU A 1 175 ? 18.969  6.856   -3.175  1.00 27.03  ? 175 LEU A CG  1 
ATOM 1283 C CD1 . LEU A 1 175 ? 17.779  7.527   -3.833  1.00 27.79  ? 175 LEU A CD1 1 
ATOM 1284 C CD2 . LEU A 1 175 ? 20.208  7.691   -3.379  1.00 26.11  ? 175 LEU A CD2 1 
ATOM 1285 N N   . TYR A 1 176 ? 20.374  6.982   1.195   1.00 36.07  ? 176 TYR A N   1 
ATOM 1286 C CA  . TYR A 1 176 ? 20.223  7.287   2.616   1.00 39.93  ? 176 TYR A CA  1 
ATOM 1287 C C   . TYR A 1 176 ? 19.024  8.195   2.851   1.00 29.31  ? 176 TYR A C   1 
ATOM 1288 O O   . TYR A 1 176 ? 18.568  8.879   1.934   1.00 29.42  ? 176 TYR A O   1 
ATOM 1289 C CB  . TYR A 1 176 ? 21.488  7.941   3.176   1.00 36.71  ? 176 TYR A CB  1 
ATOM 1290 C CG  . TYR A 1 176 ? 22.728  7.096   3.048   1.00 27.68  ? 176 TYR A CG  1 
ATOM 1291 C CD1 . TYR A 1 176 ? 23.103  6.221   4.059   1.00 27.89  ? 176 TYR A CD1 1 
ATOM 1292 C CD2 . TYR A 1 176 ? 23.520  7.166   1.913   1.00 27.30  ? 176 TYR A CD2 1 
ATOM 1293 C CE1 . TYR A 1 176 ? 24.239  5.443   3.943   1.00 27.72  ? 176 TYR A CE1 1 
ATOM 1294 C CE2 . TYR A 1 176 ? 24.654  6.394   1.788   1.00 54.29  ? 176 TYR A CE2 1 
ATOM 1295 C CZ  . TYR A 1 176 ? 25.010  5.535   2.805   1.00 58.45  ? 176 TYR A CZ  1 
ATOM 1296 O OH  . TYR A 1 176 ? 26.144  4.768   2.677   1.00 66.16  ? 176 TYR A OH  1 
ATOM 1297 N N   . SER A 1 177 ? 18.499  8.174   4.072   1.00 30.94  ? 177 SER A N   1 
ATOM 1298 C CA  . SER A 1 177 ? 17.496  9.147   4.481   1.00 27.81  ? 177 SER A CA  1 
ATOM 1299 C C   . SER A 1 177 ? 17.613  9.411   5.982   1.00 27.82  ? 177 SER A C   1 
ATOM 1300 O O   . SER A 1 177 ? 17.874  8.486   6.756   1.00 54.68  ? 177 SER A O   1 
ATOM 1301 C CB  . SER A 1 177 ? 16.092  8.651   4.119   1.00 42.29  ? 177 SER A CB  1 
ATOM 1302 O OG  . SER A 1 177 ? 15.947  8.533   2.710   1.00 50.40  ? 177 SER A OG  1 
ATOM 1303 N N   . LEU A 1 178 ? 17.417  10.665  6.393   1.00 33.66  ? 178 LEU A N   1 
ATOM 1304 C CA  . LEU A 1 178 ? 17.403  10.995  7.821   1.00 33.88  ? 178 LEU A CA  1 
ATOM 1305 C C   . LEU A 1 178 ? 16.346  12.032  8.179   1.00 36.34  ? 178 LEU A C   1 
ATOM 1306 O O   . LEU A 1 178 ? 15.659  12.576  7.318   1.00 32.15  ? 178 LEU A O   1 
ATOM 1307 C CB  . LEU A 1 178 ? 18.792  11.478  8.287   1.00 25.14  ? 178 LEU A CB  1 
ATOM 1308 C CG  . LEU A 1 178 ? 19.415  12.857  8.011   1.00 40.56  ? 178 LEU A CG  1 
ATOM 1309 C CD1 . LEU A 1 178 ? 18.947  13.958  8.966   1.00 41.89  ? 178 LEU A CD1 1 
ATOM 1310 C CD2 . LEU A 1 178 ? 20.931  12.736  8.053   1.00 25.31  ? 178 LEU A CD2 1 
ATOM 1311 N N   . SER A 1 179 ? 16.235  12.296  9.473   1.00 37.44  ? 179 SER A N   1 
ATOM 1312 C CA  . SER A 1 179 ? 15.288  13.265  9.992   1.00 33.73  ? 179 SER A CA  1 
ATOM 1313 C C   . SER A 1 179 ? 15.992  14.103  11.040  1.00 36.14  ? 179 SER A C   1 
ATOM 1314 O O   . SER A 1 179 ? 16.650  13.571  11.934  1.00 32.93  ? 179 SER A O   1 
ATOM 1315 C CB  . SER A 1 179 ? 14.055  12.576  10.589  1.00 34.86  ? 179 SER A CB  1 
ATOM 1316 O OG  . SER A 1 179 ? 13.662  11.452  9.818   1.00 30.77  ? 179 SER A OG  1 
ATOM 1317 N N   . SER A 1 180 ? 15.877  15.417  10.910  1.00 37.82  ? 180 SER A N   1 
ATOM 1318 C CA  . SER A 1 180 ? 16.379  16.324  11.927  1.00 38.77  ? 180 SER A CA  1 
ATOM 1319 C C   . SER A 1 180 ? 15.207  17.020  12.602  1.00 34.29  ? 180 SER A C   1 
ATOM 1320 O O   . SER A 1 180 ? 14.393  17.654  11.933  1.00 29.29  ? 180 SER A O   1 
ATOM 1321 C CB  . SER A 1 180 ? 17.337  17.347  11.320  1.00 35.10  ? 180 SER A CB  1 
ATOM 1322 O OG  . SER A 1 180 ? 17.908  18.156  12.331  1.00 30.45  ? 180 SER A OG  1 
ATOM 1323 N N   . VAL A 1 181 ? 15.120  16.895  13.923  1.00 28.20  ? 181 VAL A N   1 
ATOM 1324 C CA  . VAL A 1 181 ? 14.018  17.490  14.671  1.00 31.98  ? 181 VAL A CA  1 
ATOM 1325 C C   . VAL A 1 181 ? 14.523  18.466  15.731  1.00 30.14  ? 181 VAL A C   1 
ATOM 1326 O O   . VAL A 1 181 ? 15.629  18.321  16.250  1.00 35.21  ? 181 VAL A O   1 
ATOM 1327 C CB  . VAL A 1 181 ? 13.145  16.410  15.349  1.00 32.84  ? 181 VAL A CB  1 
ATOM 1328 C CG1 . VAL A 1 181 ? 12.572  15.463  14.308  1.00 34.61  ? 181 VAL A CG1 1 
ATOM 1329 C CG2 . VAL A 1 181 ? 13.945  15.637  16.390  1.00 32.62  ? 181 VAL A CG2 1 
ATOM 1330 N N   . VAL A 1 182 ? 13.711  19.473  16.035  1.00 24.58  ? 182 VAL A N   1 
ATOM 1331 C CA  . VAL A 1 182 ? 14.048  20.433  17.079  1.00 25.92  ? 182 VAL A CA  1 
ATOM 1332 C C   . VAL A 1 182 ? 12.835  20.640  17.990  1.00 26.56  ? 182 VAL A C   1 
ATOM 1333 O O   . VAL A 1 182 ? 11.695  20.653  17.527  1.00 78.69  ? 182 VAL A O   1 
ATOM 1334 C CB  . VAL A 1 182 ? 14.531  21.784  16.478  1.00 39.16  ? 182 VAL A CB  1 
ATOM 1335 C CG1 . VAL A 1 182 ? 13.459  22.406  15.594  1.00 26.21  ? 182 VAL A CG1 1 
ATOM 1336 C CG2 . VAL A 1 182 ? 14.960  22.751  17.578  1.00 41.59  ? 182 VAL A CG2 1 
ATOM 1337 N N   . THR A 1 183 ? 13.078  20.757  19.293  1.00 28.61  ? 183 THR A N   1 
ATOM 1338 C CA  . THR A 1 183 ? 11.999  20.984  20.249  1.00 48.10  ? 183 THR A CA  1 
ATOM 1339 C C   . THR A 1 183 ? 11.989  22.447  20.688  1.00 49.19  ? 183 THR A C   1 
ATOM 1340 O O   . THR A 1 183 ? 13.021  22.998  21.075  1.00 45.64  ? 183 THR A O   1 
ATOM 1341 C CB  . THR A 1 183 ? 12.124  20.070  21.490  1.00 59.60  ? 183 THR A CB  1 
ATOM 1342 O OG1 . THR A 1 183 ? 13.441  20.179  22.042  1.00 63.77  ? 183 THR A OG1 1 
ATOM 1343 C CG2 . THR A 1 183 ? 11.867  18.618  21.111  1.00 49.06  ? 183 THR A CG2 1 
ATOM 1344 N N   . VAL A 1 184 ? 10.816  23.070  20.605  1.00 44.86  ? 184 VAL A N   1 
ATOM 1345 C CA  . VAL A 1 184 ? 10.638  24.480  20.940  1.00 45.37  ? 184 VAL A CA  1 
ATOM 1346 C C   . VAL A 1 184 ? 9.336   24.663  21.720  1.00 46.19  ? 184 VAL A C   1 
ATOM 1347 O O   . VAL A 1 184 ? 8.446   23.818  21.640  1.00 42.51  ? 184 VAL A O   1 
ATOM 1348 C CB  . VAL A 1 184 ? 10.616  25.367  19.669  1.00 35.40  ? 184 VAL A CB  1 
ATOM 1349 C CG1 . VAL A 1 184 ? 11.944  25.289  18.932  1.00 34.80  ? 184 VAL A CG1 1 
ATOM 1350 C CG2 . VAL A 1 184 ? 9.477   24.959  18.755  1.00 34.50  ? 184 VAL A CG2 1 
ATOM 1351 N N   . PRO A 1 185 ? 9.223   25.761  22.489  1.00 54.03  ? 185 PRO A N   1 
ATOM 1352 C CA  . PRO A 1 185 ? 7.967   26.046  23.194  1.00 56.69  ? 185 PRO A CA  1 
ATOM 1353 C C   . PRO A 1 185 ? 6.790   26.279  22.239  1.00 53.56  ? 185 PRO A C   1 
ATOM 1354 O O   . PRO A 1 185 ? 6.924   26.982  21.234  1.00 41.34  ? 185 PRO A O   1 
ATOM 1355 C CB  . PRO A 1 185 ? 8.294   27.315  23.994  1.00 63.16  ? 185 PRO A CB  1 
ATOM 1356 C CG  . PRO A 1 185 ? 9.457   27.929  23.276  1.00 42.72  ? 185 PRO A CG  1 
ATOM 1357 C CD  . PRO A 1 185 ? 10.261  26.758  22.800  1.00 41.31  ? 185 PRO A CD  1 
ATOM 1358 N N   . SER A 1 186 ? 5.655   25.666  22.565  1.00 53.24  ? 186 SER A N   1 
ATOM 1359 C CA  . SER A 1 186 ? 4.416   25.761  21.789  1.00 58.23  ? 186 SER A CA  1 
ATOM 1360 C C   . SER A 1 186 ? 4.015   27.193  21.436  1.00 57.51  ? 186 SER A C   1 
ATOM 1361 O O   . SER A 1 186 ? 3.878   27.540  20.264  1.00 56.41  ? 186 SER A O   1 
ATOM 1362 C CB  . SER A 1 186 ? 3.274   25.087  22.552  1.00 60.63  ? 186 SER A CB  1 
ATOM 1363 O OG  . SER A 1 186 ? 2.015   25.569  22.118  1.00 67.53  ? 186 SER A OG  1 
ATOM 1364 N N   . SER A 1 187 ? 3.796   28.006  22.464  1.00 61.39  ? 187 SER A N   1 
ATOM 1365 C CA  . SER A 1 187 ? 3.352   29.390  22.305  1.00 61.89  ? 187 SER A CA  1 
ATOM 1366 C C   . SER A 1 187 ? 4.248   30.195  21.370  1.00 54.85  ? 187 SER A C   1 
ATOM 1367 O O   . SER A 1 187 ? 3.807   31.172  20.764  1.00 49.01  ? 187 SER A O   1 
ATOM 1368 C CB  . SER A 1 187 ? 3.290   30.081  23.669  1.00 65.37  ? 187 SER A CB  1 
ATOM 1369 O OG  . SER A 1 187 ? 4.478   29.841  24.403  1.00 67.63  ? 187 SER A OG  1 
ATOM 1370 N N   . SER A 1 188 ? 5.502   29.780  21.240  1.00 58.20  ? 188 SER A N   1 
ATOM 1371 C CA  . SER A 1 188 ? 6.436   30.494  20.374  1.00 57.46  ? 188 SER A CA  1 
ATOM 1372 C C   . SER A 1 188 ? 6.193   30.254  18.885  1.00 44.71  ? 188 SER A C   1 
ATOM 1373 O O   . SER A 1 188 ? 6.859   30.866  18.057  1.00 44.52  ? 188 SER A O   1 
ATOM 1374 C CB  . SER A 1 188 ? 7.886   30.106  20.710  1.00 54.99  ? 188 SER A CB  1 
ATOM 1375 O OG  . SER A 1 188 ? 8.136   28.759  20.346  1.00 51.58  ? 188 SER A OG  1 
ATOM 1376 N N   . LEU A 1 189 ? 5.266   29.369  18.533  1.00 48.92  ? 189 LEU A N   1 
ATOM 1377 C CA  . LEU A 1 189 ? 5.132   29.013  17.133  1.00 48.21  ? 189 LEU A CA  1 
ATOM 1378 C C   . LEU A 1 189 ? 4.456   30.196  16.413  1.00 68.21  ? 189 LEU A C   1 
ATOM 1379 O O   . LEU A 1 189 ? 3.303   30.540  16.654  1.00 79.54  ? 189 LEU A O   1 
ATOM 1380 C CB  . LEU A 1 189 ? 4.340   27.695  16.993  1.00 41.60  ? 189 LEU A CB  1 
ATOM 1381 C CG  . LEU A 1 189 ? 4.944   26.383  17.533  1.00 42.78  ? 189 LEU A CG  1 
ATOM 1382 C CD1 . LEU A 1 189 ? 3.843   25.358  17.711  1.00 39.63  ? 189 LEU A CD1 1 
ATOM 1383 C CD2 . LEU A 1 189 ? 6.042   25.792  16.641  1.00 48.60  ? 189 LEU A CD2 1 
ATOM 1384 N N   . GLY A 1 190 ? 5.198   30.803  15.495  1.00 64.01  ? 190 GLY A N   1 
ATOM 1385 C CA  . GLY A 1 190 ? 4.759   32.032  14.861  1.00 61.41  ? 190 GLY A CA  1 
ATOM 1386 C C   . GLY A 1 190 ? 5.336   33.355  15.353  1.00 55.68  ? 190 GLY A C   1 
ATOM 1387 O O   . GLY A 1 190 ? 5.287   34.310  14.593  1.00 59.34  ? 190 GLY A O   1 
ATOM 1388 N N   . THR A 1 191 ? 5.893   33.449  16.567  1.00 51.58  ? 191 THR A N   1 
ATOM 1389 C CA  . THR A 1 191 ? 6.675   34.655  16.902  1.00 55.25  ? 191 THR A CA  1 
ATOM 1390 C C   . THR A 1 191 ? 8.098   34.465  16.408  1.00 62.40  ? 191 THR A C   1 
ATOM 1391 O O   . THR A 1 191 ? 8.797   35.421  16.071  1.00 66.92  ? 191 THR A O   1 
ATOM 1392 C CB  . THR A 1 191 ? 6.703   35.025  18.421  1.00 68.82  ? 191 THR A CB  1 
ATOM 1393 O OG1 . THR A 1 191 ? 7.015   33.884  19.226  1.00 69.59  ? 191 THR A OG1 1 
ATOM 1394 C CG2 . THR A 1 191 ? 5.394   35.680  18.875  1.00 69.92  ? 191 THR A CG2 1 
ATOM 1395 N N   . GLN A 1 192 ? 8.516   33.206  16.391  1.00 53.46  ? 192 GLN A N   1 
ATOM 1396 C CA  . GLN A 1 192 ? 9.848   32.831  15.952  1.00 50.88  ? 192 GLN A CA  1 
ATOM 1397 C C   . GLN A 1 192 ? 9.759   31.864  14.781  1.00 44.49  ? 192 GLN A C   1 
ATOM 1398 O O   . GLN A 1 192 ? 9.285   30.737  14.928  1.00 35.41  ? 192 GLN A O   1 
ATOM 1399 C CB  . GLN A 1 192 ? 10.639  32.208  17.106  1.00 43.48  ? 192 GLN A CB  1 
ATOM 1400 C CG  . GLN A 1 192 ? 12.023  31.673  16.743  1.00 43.48  ? 192 GLN A CG  1 
ATOM 1401 C CD  . GLN A 1 192 ? 12.983  32.737  16.226  1.00 46.89  ? 192 GLN A CD  1 
ATOM 1402 O OE1 . GLN A 1 192 ? 12.734  33.390  15.211  1.00 46.32  ? 192 GLN A OE1 1 
ATOM 1403 N NE2 . GLN A 1 192 ? 14.093  32.916  16.935  1.00 50.71  ? 192 GLN A NE2 1 
ATOM 1404 N N   . THR A 1 193 ? 10.212  32.322  13.618  1.00 46.70  ? 193 THR A N   1 
ATOM 1405 C CA  . THR A 1 193 ? 10.174  31.522  12.402  1.00 40.55  ? 193 THR A CA  1 
ATOM 1406 C C   . THR A 1 193 ? 11.255  30.449  12.411  1.00 39.01  ? 193 THR A C   1 
ATOM 1407 O O   . THR A 1 193 ? 12.399  30.705  12.779  1.00 37.88  ? 193 THR A O   1 
ATOM 1408 C CB  . THR A 1 193 ? 10.343  32.401  11.149  1.00 31.55  ? 193 THR A CB  1 
ATOM 1409 O OG1 . THR A 1 193 ? 9.319   33.403  11.129  1.00 32.60  ? 193 THR A OG1 1 
ATOM 1410 C CG2 . THR A 1 193 ? 10.249  31.562  9.885   1.00 30.06  ? 193 THR A CG2 1 
ATOM 1411 N N   . TYR A 1 194 ? 10.882  29.244  11.999  1.00 45.05  ? 194 TYR A N   1 
ATOM 1412 C CA  . TYR A 1 194 ? 11.804  28.120  11.994  1.00 36.66  ? 194 TYR A CA  1 
ATOM 1413 C C   . TYR A 1 194 ? 12.175  27.718  10.584  1.00 40.28  ? 194 TYR A C   1 
ATOM 1414 O O   . TYR A 1 194 ? 11.315  27.398  9.766   1.00 34.54  ? 194 TYR A O   1 
ATOM 1415 C CB  . TYR A 1 194 ? 11.194  26.948  12.752  1.00 30.34  ? 194 TYR A CB  1 
ATOM 1416 C CG  . TYR A 1 194 ? 11.019  27.295  14.201  1.00 31.53  ? 194 TYR A CG  1 
ATOM 1417 C CD1 . TYR A 1 194 ? 12.093  27.768  14.941  1.00 32.36  ? 194 TYR A CD1 1 
ATOM 1418 C CD2 . TYR A 1 194 ? 9.785   27.195  14.825  1.00 31.92  ? 194 TYR A CD2 1 
ATOM 1419 C CE1 . TYR A 1 194 ? 11.952  28.106  16.268  1.00 33.51  ? 194 TYR A CE1 1 
ATOM 1420 C CE2 . TYR A 1 194 ? 9.633   27.532  16.159  1.00 42.73  ? 194 TYR A CE2 1 
ATOM 1421 C CZ  . TYR A 1 194 ? 10.723  27.988  16.875  1.00 33.86  ? 194 TYR A CZ  1 
ATOM 1422 O OH  . TYR A 1 194 ? 10.589  28.332  18.201  1.00 35.07  ? 194 TYR A OH  1 
ATOM 1423 N N   . ILE A 1 195 ? 13.468  27.752  10.296  1.00 47.21  ? 195 ILE A N   1 
ATOM 1424 C CA  . ILE A 1 195 ? 13.934  27.384  8.973   1.00 50.41  ? 195 ILE A CA  1 
ATOM 1425 C C   . ILE A 1 195 ? 15.040  26.331  9.057   1.00 49.99  ? 195 ILE A C   1 
ATOM 1426 O O   . ILE A 1 195 ? 16.055  26.509  9.730   1.00 48.35  ? 195 ILE A O   1 
ATOM 1427 C CB  . ILE A 1 195 ? 14.397  28.640  8.177   1.00 40.10  ? 195 ILE A CB  1 
ATOM 1428 C CG1 . ILE A 1 195 ? 14.772  28.282  6.739   1.00 31.01  ? 195 ILE A CG1 1 
ATOM 1429 C CG2 . ILE A 1 195 ? 15.530  29.371  8.879   1.00 43.80  ? 195 ILE A CG2 1 
ATOM 1430 C CD1 . ILE A 1 195 ? 15.238  29.480  5.925   1.00 32.86  ? 195 ILE A CD1 1 
ATOM 1431 N N   . CYS A 1 196 ? 14.797  25.199  8.402   1.00 53.80  ? 196 CYS A N   1 
ATOM 1432 C CA  . CYS A 1 196 ? 15.790  24.132  8.299   1.00 41.73  ? 196 CYS A CA  1 
ATOM 1433 C C   . CYS A 1 196 ? 16.774  24.400  7.181   1.00 38.94  ? 196 CYS A C   1 
ATOM 1434 O O   . CYS A 1 196 ? 16.430  25.019  6.184   1.00 34.12  ? 196 CYS A O   1 
ATOM 1435 C CB  . CYS A 1 196 ? 15.122  22.785  8.081   1.00 38.24  ? 196 CYS A CB  1 
ATOM 1436 S SG  . CYS A 1 196 ? 16.222  21.449  7.543   1.00 73.61  ? 196 CYS A SG  1 
ATOM 1437 N N   . ASN A 1 197 ? 17.999  23.935  7.398   1.00 33.57  ? 197 ASN A N   1 
ATOM 1438 C CA  . ASN A 1 197 ? 19.176  24.221  6.593   1.00 36.47  ? 197 ASN A CA  1 
ATOM 1439 C C   . ASN A 1 197 ? 19.821  22.902  6.187   1.00 31.85  ? 197 ASN A C   1 
ATOM 1440 O O   . ASN A 1 197 ? 20.449  22.223  6.996   1.00 39.97  ? 197 ASN A O   1 
ATOM 1441 C CB  . ASN A 1 197 ? 20.118  25.084  7.445   1.00 44.02  ? 197 ASN A CB  1 
ATOM 1442 C CG  . ASN A 1 197 ? 19.625  26.520  7.653   1.00 53.81  ? 197 ASN A CG  1 
ATOM 1443 O OD1 . ASN A 1 197 ? 20.380  27.443  7.313   1.00 61.06  ? 197 ASN A OD1 1 
ATOM 1444 N ND2 . ASN A 1 197 ? 18.297  26.708  7.955   1.00 65.42  ? 197 ASN A ND2 1 
ATOM 1445 N N   . VAL A 1 198 ? 19.698  22.547  4.917   1.00 32.14  ? 198 VAL A N   1 
ATOM 1446 C CA  . VAL A 1 198 ? 20.252  21.271  4.483   1.00 34.21  ? 198 VAL A CA  1 
ATOM 1447 C C   . VAL A 1 198 ? 21.422  21.556  3.553   1.00 34.13  ? 198 VAL A C   1 
ATOM 1448 O O   . VAL A 1 198 ? 21.350  22.467  2.726   1.00 39.66  ? 198 VAL A O   1 
ATOM 1449 C CB  . VAL A 1 198 ? 19.211  20.361  3.788   1.00 36.84  ? 198 VAL A CB  1 
ATOM 1450 C CG1 . VAL A 1 198 ? 19.896  19.118  3.237   1.00 23.38  ? 198 VAL A CG1 1 
ATOM 1451 C CG2 . VAL A 1 198 ? 18.101  19.955  4.760   1.00 39.20  ? 198 VAL A CG2 1 
ATOM 1452 N N   . ASN A 1 199 ? 22.520  20.824  3.754   1.00 23.00  ? 199 ASN A N   1 
ATOM 1453 C CA  . ASN A 1 199 ? 23.671  20.896  2.872   1.00 34.42  ? 199 ASN A CA  1 
ATOM 1454 C C   . ASN A 1 199 ? 24.084  19.504  2.406   1.00 34.11  ? 199 ASN A C   1 
ATOM 1455 O O   . ASN A 1 199 ? 24.488  18.688  3.239   1.00 37.80  ? 199 ASN A O   1 
ATOM 1456 C CB  . ASN A 1 199 ? 24.910  21.470  3.551   1.00 40.06  ? 199 ASN A CB  1 
ATOM 1457 C CG  . ASN A 1 199 ? 25.644  22.461  2.664   1.00 41.08  ? 199 ASN A CG  1 
ATOM 1458 O OD1 . ASN A 1 199 ? 25.391  22.505  1.446   1.00 50.74  ? 199 ASN A OD1 1 
ATOM 1459 N ND2 . ASN A 1 199 ? 26.714  23.076  3.219   1.00 36.94  ? 199 ASN A ND2 1 
ATOM 1460 N N   . HIS A 1 200 ? 24.077  19.222  1.113   1.00 34.88  ? 200 HIS A N   1 
ATOM 1461 C CA  . HIS A 1 200 ? 24.826  18.055  0.691   1.00 30.79  ? 200 HIS A CA  1 
ATOM 1462 C C   . HIS A 1 200 ? 25.973  18.492  -0.215  1.00 38.96  ? 200 HIS A C   1 
ATOM 1463 O O   . HIS A 1 200 ? 25.756  18.845  -1.374  1.00 38.39  ? 200 HIS A O   1 
ATOM 1464 C CB  . HIS A 1 200 ? 23.930  17.054  -0.010  1.00 33.50  ? 200 HIS A CB  1 
ATOM 1465 C CG  . HIS A 1 200 ? 24.592  15.739  -0.287  1.00 31.71  ? 200 HIS A CG  1 
ATOM 1466 N ND1 . HIS A 1 200 ? 24.056  14.796  -1.114  1.00 32.11  ? 200 HIS A ND1 1 
ATOM 1467 C CD2 . HIS A 1 200 ? 25.756  15.226  0.193   1.00 34.05  ? 200 HIS A CD2 1 
ATOM 1468 C CE1 . HIS A 1 200 ? 24.865  13.742  -1.160  1.00 24.18  ? 200 HIS A CE1 1 
ATOM 1469 N NE2 . HIS A 1 200 ? 25.893  13.980  -0.380  1.00 32.00  ? 200 HIS A NE2 1 
ATOM 1470 N N   . LYS A 1 201 ? 27.198  18.416  0.298   1.00 35.64  ? 201 LYS A N   1 
ATOM 1471 C CA  . LYS A 1 201 ? 28.360  18.972  -0.402  1.00 34.43  ? 201 LYS A CA  1 
ATOM 1472 C C   . LYS A 1 201 ? 28.764  18.226  -1.692  1.00 35.23  ? 201 LYS A C   1 
ATOM 1473 O O   . LYS A 1 201 ? 28.993  18.873  -2.713  1.00 39.39  ? 201 LYS A O   1 
ATOM 1474 C CB  . LYS A 1 201 ? 29.560  19.052  0.549   1.00 31.96  ? 201 LYS A CB  1 
ATOM 1475 C CG  . LYS A 1 201 ? 29.188  19.149  2.021   1.00 43.97  ? 201 LYS A CG  1 
ATOM 1476 C CD  . LYS A 1 201 ? 30.355  19.677  2.846   1.00 53.46  ? 201 LYS A CD  1 
ATOM 1477 C CE  . LYS A 1 201 ? 30.643  21.135  2.522   1.00 54.74  ? 201 LYS A CE  1 
ATOM 1478 N NZ  . LYS A 1 201 ? 31.406  21.807  3.613   1.00 54.59  ? 201 LYS A NZ  1 
ATOM 1479 N N   . PRO A 1 202 ? 28.864  16.875  -1.659  1.00 35.60  ? 202 PRO A N   1 
ATOM 1480 C CA  . PRO A 1 202 ? 29.179  16.163  -2.909  1.00 23.70  ? 202 PRO A CA  1 
ATOM 1481 C C   . PRO A 1 202 ? 28.198  16.443  -4.046  1.00 22.21  ? 202 PRO A C   1 
ATOM 1482 O O   . PRO A 1 202 ? 28.623  16.699  -5.171  1.00 42.69  ? 202 PRO A O   1 
ATOM 1483 C CB  . PRO A 1 202 ? 29.101  14.689  -2.497  1.00 22.61  ? 202 PRO A CB  1 
ATOM 1484 C CG  . PRO A 1 202 ? 29.493  14.691  -1.075  1.00 36.55  ? 202 PRO A CG  1 
ATOM 1485 C CD  . PRO A 1 202 ? 28.915  15.960  -0.501  1.00 33.47  ? 202 PRO A CD  1 
ATOM 1486 N N   . SER A 1 203 ? 26.903  16.402  -3.750  1.00 24.62  ? 203 SER A N   1 
ATOM 1487 C CA  . SER A 1 203 ? 25.882  16.693  -4.753  1.00 33.33  ? 203 SER A CA  1 
ATOM 1488 C C   . SER A 1 203 ? 25.805  18.192  -5.008  1.00 24.44  ? 203 SER A C   1 
ATOM 1489 O O   . SER A 1 203 ? 25.126  18.637  -5.932  1.00 30.97  ? 203 SER A O   1 
ATOM 1490 C CB  . SER A 1 203 ? 24.512  16.165  -4.312  1.00 35.19  ? 203 SER A CB  1 
ATOM 1491 O OG  . SER A 1 203 ? 23.955  16.979  -3.295  1.00 34.21  ? 203 SER A OG  1 
ATOM 1492 N N   . ASN A 1 204 ? 26.508  18.955  -4.175  1.00 26.71  ? 204 ASN A N   1 
ATOM 1493 C CA  . ASN A 1 204 ? 26.452  20.411  -4.185  1.00 36.24  ? 204 ASN A CA  1 
ATOM 1494 C C   . ASN A 1 204 ? 25.041  20.914  -4.049  1.00 34.89  ? 204 ASN A C   1 
ATOM 1495 O O   . ASN A 1 204 ? 24.497  21.530  -4.962  1.00 35.10  ? 204 ASN A O   1 
ATOM 1496 C CB  . ASN A 1 204 ? 27.046  20.970  -5.458  1.00 35.01  ? 204 ASN A CB  1 
ATOM 1497 C CG  . ASN A 1 204 ? 27.249  22.472  -5.396  1.00 37.29  ? 204 ASN A CG  1 
ATOM 1498 O OD1 . ASN A 1 204 ? 27.759  23.009  -4.409  1.00 32.68  ? 204 ASN A OD1 1 
ATOM 1499 N ND2 . ASN A 1 204 ? 26.888  23.153  -6.473  1.00 41.54  ? 204 ASN A ND2 1 
ATOM 1500 N N   . THR A 1 205 ? 24.442  20.642  -2.905  1.00 38.23  ? 205 THR A N   1 
ATOM 1501 C CA  . THR A 1 205 ? 23.071  21.034  -2.690  1.00 40.65  ? 205 THR A CA  1 
ATOM 1502 C C   . THR A 1 205 ? 22.950  21.735  -1.353  1.00 40.38  ? 205 THR A C   1 
ATOM 1503 O O   . THR A 1 205 ? 23.457  21.262  -0.338  1.00 28.53  ? 205 THR A O   1 
ATOM 1504 C CB  . THR A 1 205 ? 22.130  19.819  -2.752  1.00 41.53  ? 205 THR A CB  1 
ATOM 1505 O OG1 . THR A 1 205 ? 22.234  19.208  -4.045  1.00 24.21  ? 205 THR A OG1 1 
ATOM 1506 C CG2 . THR A 1 205 ? 20.693  20.245  -2.515  1.00 42.79  ? 205 THR A CG2 1 
ATOM 1507 N N   . LYS A 1 206 ? 22.305  22.892  -1.371  1.00 29.42  ? 206 LYS A N   1 
ATOM 1508 C CA  . LYS A 1 206 ? 21.976  23.588  -0.146  1.00 40.40  ? 206 LYS A CA  1 
ATOM 1509 C C   . LYS A 1 206 ? 20.515  23.985  -0.217  1.00 41.57  ? 206 LYS A C   1 
ATOM 1510 O O   . LYS A 1 206 ? 20.075  24.586  -1.194  1.00 33.63  ? 206 LYS A O   1 
ATOM 1511 C CB  . LYS A 1 206 ? 22.872  24.808  0.056   1.00 43.95  ? 206 LYS A CB  1 
ATOM 1512 C CG  . LYS A 1 206 ? 22.811  25.394  1.451   1.00 51.08  ? 206 LYS A CG  1 
ATOM 1513 C CD  . LYS A 1 206 ? 23.815  26.518  1.598   1.00 58.12  ? 206 LYS A CD  1 
ATOM 1514 C CE  . LYS A 1 206 ? 23.714  27.169  2.963   1.00 63.69  ? 206 LYS A CE  1 
ATOM 1515 N NZ  . LYS A 1 206 ? 23.988  26.191  4.052   1.00 63.34  ? 206 LYS A NZ  1 
ATOM 1516 N N   . VAL A 1 207 ? 19.757  23.628  0.811   1.00 37.30  ? 207 VAL A N   1 
ATOM 1517 C CA  . VAL A 1 207 ? 18.330  23.902  0.830   1.00 37.76  ? 207 VAL A CA  1 
ATOM 1518 C C   . VAL A 1 207 ? 17.915  24.453  2.186   1.00 48.32  ? 207 VAL A C   1 
ATOM 1519 O O   . VAL A 1 207 ? 18.417  24.012  3.221   1.00 46.96  ? 207 VAL A O   1 
ATOM 1520 C CB  . VAL A 1 207 ? 17.511  22.631  0.511   1.00 22.75  ? 207 VAL A CB  1 
ATOM 1521 C CG1 . VAL A 1 207 ? 16.022  22.884  0.705   1.00 37.44  ? 207 VAL A CG1 1 
ATOM 1522 C CG2 . VAL A 1 207 ? 17.793  22.160  -0.907  1.00 21.37  ? 207 VAL A CG2 1 
ATOM 1523 N N   . ASP A 1 208 ? 17.019  25.435  2.177   1.00 49.96  ? 208 ASP A N   1 
ATOM 1524 C CA  . ASP A 1 208 ? 16.467  25.963  3.413   1.00 47.28  ? 208 ASP A CA  1 
ATOM 1525 C C   . ASP A 1 208 ? 14.946  25.819  3.430   1.00 47.63  ? 208 ASP A C   1 
ATOM 1526 O O   . ASP A 1 208 ? 14.251  26.454  2.637   1.00 54.97  ? 208 ASP A O   1 
ATOM 1527 C CB  . ASP A 1 208 ? 16.873  27.427  3.607   1.00 48.62  ? 208 ASP A CB  1 
ATOM 1528 C CG  . ASP A 1 208 ? 18.364  27.592  3.874   1.00 54.67  ? 208 ASP A CG  1 
ATOM 1529 O OD1 . ASP A 1 208 ? 19.019  26.597  4.252   1.00 57.84  ? 208 ASP A OD1 1 
ATOM 1530 O OD2 . ASP A 1 208 ? 18.880  28.719  3.708   1.00 54.68  ? 208 ASP A OD2 1 
ATOM 1531 N N   . LYS A 1 209 ? 14.432  24.992  4.337   1.00 45.69  ? 209 LYS A N   1 
ATOM 1532 C CA  . LYS A 1 209 ? 12.993  24.753  4.410   1.00 42.85  ? 209 LYS A CA  1 
ATOM 1533 C C   . LYS A 1 209 ? 12.361  25.534  5.559   1.00 39.91  ? 209 LYS A C   1 
ATOM 1534 O O   . LYS A 1 209 ? 12.875  25.535  6.678   1.00 35.53  ? 209 LYS A O   1 
ATOM 1535 C CB  . LYS A 1 209 ? 12.701  23.258  4.569   1.00 32.17  ? 209 LYS A CB  1 
ATOM 1536 C CG  . LYS A 1 209 ? 11.455  22.790  3.835   1.00 34.05  ? 209 LYS A CG  1 
ATOM 1537 C CD  . LYS A 1 209 ? 11.652  22.876  2.330   1.00 35.70  ? 209 LYS A CD  1 
ATOM 1538 C CE  . LYS A 1 209 ? 10.398  22.462  1.576   1.00 29.23  ? 209 LYS A CE  1 
ATOM 1539 N NZ  . LYS A 1 209 ? 10.600  22.516  0.101   1.00 40.20  ? 209 LYS A NZ  1 
ATOM 1540 N N   . LYS A 1 210 ? 11.231  26.176  5.285   1.00 39.68  ? 210 LYS A N   1 
ATOM 1541 C CA  . LYS A 1 210 ? 10.555  26.972  6.298   1.00 42.95  ? 210 LYS A CA  1 
ATOM 1542 C C   . LYS A 1 210 ? 9.419   26.151  6.888   1.00 45.34  ? 210 LYS A C   1 
ATOM 1543 O O   . LYS A 1 210 ? 8.391   25.923  6.246   1.00 43.58  ? 210 LYS A O   1 
ATOM 1544 C CB  . LYS A 1 210 ? 10.039  28.287  5.701   1.00 42.57  ? 210 LYS A CB  1 
ATOM 1545 C CG  . LYS A 1 210 ? 9.338   29.206  6.699   1.00 45.40  ? 210 LYS A CG  1 
ATOM 1546 C CD  . LYS A 1 210 ? 9.385   30.674  6.262   1.00 50.32  ? 210 LYS A CD  1 
ATOM 1547 C CE  . LYS A 1 210 ? 8.509   30.935  5.045   1.00 49.14  ? 210 LYS A CE  1 
ATOM 1548 N NZ  . LYS A 1 210 ? 8.502   32.377  4.659   1.00 48.91  ? 210 LYS A NZ  1 
ATOM 1549 N N   . VAL A 1 211 ? 9.607   25.724  8.131   1.00 46.56  ? 211 VAL A N   1 
ATOM 1550 C CA  . VAL A 1 211 ? 8.689   24.790  8.767   1.00 48.41  ? 211 VAL A CA  1 
ATOM 1551 C C   . VAL A 1 211 ? 7.629   25.497  9.580   1.00 51.52  ? 211 VAL A C   1 
ATOM 1552 O O   . VAL A 1 211 ? 7.930   26.210  10.539  1.00 44.75  ? 211 VAL A O   1 
ATOM 1553 C CB  . VAL A 1 211 ? 9.436   23.831  9.671   1.00 44.13  ? 211 VAL A CB  1 
ATOM 1554 C CG1 . VAL A 1 211 ? 8.543   22.666  10.061  1.00 48.25  ? 211 VAL A CG1 1 
ATOM 1555 C CG2 . VAL A 1 211 ? 10.641  23.356  8.947   1.00 34.96  ? 211 VAL A CG2 1 
ATOM 1556 N N   . GLU A 1 212 ? 6.380   25.288  9.192   1.00 58.18  ? 212 GLU A N   1 
ATOM 1557 C CA  . GLU A 1 212 ? 5.275   25.948  9.850   1.00 55.90  ? 212 GLU A CA  1 
ATOM 1558 C C   . GLU A 1 212 ? 4.138   24.969  10.079  1.00 47.20  ? 212 GLU A C   1 
ATOM 1559 O O   . GLU A 1 212 ? 3.878   24.097  9.246   1.00 39.93  ? 212 GLU A O   1 
ATOM 1560 C CB  . GLU A 1 212 ? 4.797   27.139  9.022   1.00 55.50  ? 212 GLU A CB  1 
ATOM 1561 C CG  . GLU A 1 212 ? 5.853   28.201  8.774   1.00 61.12  ? 212 GLU A CG  1 
ATOM 1562 C CD  . GLU A 1 212 ? 5.301   29.381  7.999   1.00 73.74  ? 212 GLU A CD  1 
ATOM 1563 O OE1 . GLU A 1 212 ? 4.244   29.910  8.405   1.00 85.65  ? 212 GLU A OE1 1 
ATOM 1564 O OE2 . GLU A 1 212 ? 5.918   29.774  6.984   1.00 69.58  ? 212 GLU A OE2 1 
ATOM 1565 N N   . PRO A 1 213 ? 3.458   25.108  11.221  1.00 48.29  ? 213 PRO A N   1 
ATOM 1566 C CA  . PRO A 1 213 ? 2.312   24.255  11.529  1.00 53.08  ? 213 PRO A CA  1 
ATOM 1567 C C   . PRO A 1 213 ? 1.056   24.707  10.799  1.00 63.46  ? 213 PRO A C   1 
ATOM 1568 O O   . PRO A 1 213 ? 0.917   25.871  10.422  1.00 67.76  ? 213 PRO A O   1 
ATOM 1569 C CB  . PRO A 1 213 ? 2.166   24.409  13.042  1.00 51.53  ? 213 PRO A CB  1 
ATOM 1570 C CG  . PRO A 1 213 ? 2.648   25.796  13.310  1.00 47.53  ? 213 PRO A CG  1 
ATOM 1571 C CD  . PRO A 1 213 ? 3.756   26.052  12.315  1.00 44.98  ? 213 PRO A CD  1 
ATOM 1572 N N   . GLU B 2 1   ? 36.797  -20.554 12.235  1.00 54.32  ? 1   GLU B N   1 
ATOM 1573 C CA  . GLU B 2 1   ? 36.756  -19.325 13.017  1.00 58.97  ? 1   GLU B CA  1 
ATOM 1574 C C   . GLU B 2 1   ? 36.245  -19.584 14.432  1.00 49.91  ? 1   GLU B C   1 
ATOM 1575 O O   . GLU B 2 1   ? 35.342  -20.394 14.644  1.00 44.90  ? 1   GLU B O   1 
ATOM 1576 C CB  . GLU B 2 1   ? 35.886  -18.273 12.319  1.00 70.78  ? 1   GLU B CB  1 
ATOM 1577 C CG  . GLU B 2 1   ? 34.403  -18.613 12.257  1.00 79.01  ? 1   GLU B CG  1 
ATOM 1578 C CD  . GLU B 2 1   ? 33.594  -17.575 11.501  1.00 82.25  ? 1   GLU B CD  1 
ATOM 1579 O OE1 . GLU B 2 1   ? 33.900  -16.372 11.634  1.00 85.41  ? 1   GLU B OE1 1 
ATOM 1580 O OE2 . GLU B 2 1   ? 32.650  -17.962 10.779  1.00 76.85  ? 1   GLU B OE2 1 
ATOM 1581 N N   . ILE B 2 2   ? 36.844  -18.898 15.399  1.00 42.76  ? 2   ILE B N   1 
ATOM 1582 C CA  . ILE B 2 2   ? 36.441  -19.017 16.795  1.00 41.66  ? 2   ILE B CA  1 
ATOM 1583 C C   . ILE B 2 2   ? 35.403  -17.947 17.123  1.00 40.83  ? 2   ILE B C   1 
ATOM 1584 O O   . ILE B 2 2   ? 35.540  -16.794 16.714  1.00 48.01  ? 2   ILE B O   1 
ATOM 1585 C CB  . ILE B 2 2   ? 37.654  -18.891 17.749  1.00 39.24  ? 2   ILE B CB  1 
ATOM 1586 C CG1 . ILE B 2 2   ? 38.670  -20.001 17.470  1.00 34.77  ? 2   ILE B CG1 1 
ATOM 1587 C CG2 . ILE B 2 2   ? 37.213  -18.938 19.203  1.00 32.34  ? 2   ILE B CG2 1 
ATOM 1588 C CD1 . ILE B 2 2   ? 39.899  -19.963 18.370  1.00 33.58  ? 2   ILE B CD1 1 
ATOM 1589 N N   . VAL B 2 3   ? 34.366  -18.332 17.861  1.00 27.64  ? 3   VAL B N   1 
ATOM 1590 C CA  . VAL B 2 3   ? 33.275  -17.419 18.176  1.00 45.36  ? 3   VAL B CA  1 
ATOM 1591 C C   . VAL B 2 3   ? 33.428  -16.847 19.580  1.00 40.09  ? 3   VAL B C   1 
ATOM 1592 O O   . VAL B 2 3   ? 33.268  -17.558 20.573  1.00 38.99  ? 3   VAL B O   1 
ATOM 1593 C CB  . VAL B 2 3   ? 31.906  -18.120 18.063  1.00 27.55  ? 3   VAL B CB  1 
ATOM 1594 C CG1 . VAL B 2 3   ? 30.772  -17.113 18.211  1.00 27.17  ? 3   VAL B CG1 1 
ATOM 1595 C CG2 . VAL B 2 3   ? 31.796  -18.863 16.734  1.00 27.63  ? 3   VAL B CG2 1 
ATOM 1596 N N   . LEU B 2 4   ? 33.733  -15.556 19.655  1.00 33.34  ? 4   LEU B N   1 
ATOM 1597 C CA  . LEU B 2 4   ? 33.849  -14.875 20.938  1.00 38.55  ? 4   LEU B CA  1 
ATOM 1598 C C   . LEU B 2 4   ? 32.559  -14.149 21.288  1.00 44.48  ? 4   LEU B C   1 
ATOM 1599 O O   . LEU B 2 4   ? 32.163  -13.203 20.608  1.00 42.77  ? 4   LEU B O   1 
ATOM 1600 C CB  . LEU B 2 4   ? 35.019  -13.889 20.927  1.00 38.26  ? 4   LEU B CB  1 
ATOM 1601 C CG  . LEU B 2 4   ? 36.406  -14.527 20.841  1.00 37.27  ? 4   LEU B CG  1 
ATOM 1602 C CD1 . LEU B 2 4   ? 37.513  -13.502 21.083  1.00 35.68  ? 4   LEU B CD1 1 
ATOM 1603 C CD2 . LEU B 2 4   ? 36.503  -15.667 21.835  1.00 39.02  ? 4   LEU B CD2 1 
ATOM 1604 N N   . THR B 2 5   ? 31.910  -14.603 22.354  1.00 48.64  ? 5   THR B N   1 
ATOM 1605 C CA  . THR B 2 5   ? 30.674  -13.989 22.816  1.00 46.65  ? 5   THR B CA  1 
ATOM 1606 C C   . THR B 2 5   ? 30.962  -13.056 23.980  1.00 43.00  ? 5   THR B C   1 
ATOM 1607 O O   . THR B 2 5   ? 31.582  -13.453 24.963  1.00 34.78  ? 5   THR B O   1 
ATOM 1608 C CB  . THR B 2 5   ? 29.642  -15.046 23.254  1.00 43.15  ? 5   THR B CB  1 
ATOM 1609 O OG1 . THR B 2 5   ? 29.593  -16.105 22.289  1.00 48.09  ? 5   THR B OG1 1 
ATOM 1610 C CG2 . THR B 2 5   ? 28.264  -14.420 23.391  1.00 37.88  ? 5   THR B CG2 1 
ATOM 1611 N N   . GLN B 2 6   ? 30.522  -11.810 23.866  1.00 35.24  ? 6   GLN B N   1 
ATOM 1612 C CA  . GLN B 2 6   ? 30.745  -10.850 24.938  1.00 33.87  ? 6   GLN B CA  1 
ATOM 1613 C C   . GLN B 2 6   ? 29.465  -10.603 25.724  1.00 29.61  ? 6   GLN B C   1 
ATOM 1614 O O   . GLN B 2 6   ? 28.380  -10.518 25.154  1.00 29.23  ? 6   GLN B O   1 
ATOM 1615 C CB  . GLN B 2 6   ? 31.307  -9.539  24.379  1.00 28.69  ? 6   GLN B CB  1 
ATOM 1616 C CG  . GLN B 2 6   ? 32.668  -9.717  23.728  1.00 28.68  ? 6   GLN B CG  1 
ATOM 1617 C CD  . GLN B 2 6   ? 33.310  -8.409  23.312  1.00 58.32  ? 6   GLN B CD  1 
ATOM 1618 O OE1 . GLN B 2 6   ? 33.716  -8.245  22.162  1.00 48.03  ? 6   GLN B OE1 1 
ATOM 1619 N NE2 . GLN B 2 6   ? 33.412  -7.473  24.250  1.00 49.99  ? 6   GLN B NE2 1 
ATOM 1620 N N   . SER B 2 7   ? 29.602  -10.514 27.041  1.00 30.07  ? 7   SER B N   1 
ATOM 1621 C CA  . SER B 2 7   ? 28.464  -10.261 27.910  1.00 36.31  ? 7   SER B CA  1 
ATOM 1622 C C   . SER B 2 7   ? 28.820  -9.191  28.933  1.00 44.46  ? 7   SER B C   1 
ATOM 1623 O O   . SER B 2 7   ? 29.934  -9.177  29.457  1.00 45.29  ? 7   SER B O   1 
ATOM 1624 C CB  . SER B 2 7   ? 28.029  -11.550 28.614  1.00 42.45  ? 7   SER B CB  1 
ATOM 1625 O OG  . SER B 2 7   ? 29.051  -12.042 29.463  1.00 43.43  ? 7   SER B OG  1 
ATOM 1626 N N   . PRO B 2 8   ? 27.873  -8.289  29.232  1.00 32.07  ? 8   PRO B N   1 
ATOM 1627 C CA  . PRO B 2 8   ? 26.536  -8.151  28.639  1.00 40.00  ? 8   PRO B CA  1 
ATOM 1628 C C   . PRO B 2 8   ? 26.545  -7.379  27.313  1.00 46.17  ? 8   PRO B C   1 
ATOM 1629 O O   . PRO B 2 8   ? 27.618  -7.109  26.773  1.00 46.10  ? 8   PRO B O   1 
ATOM 1630 C CB  . PRO B 2 8   ? 25.773  -7.382  29.715  1.00 35.43  ? 8   PRO B CB  1 
ATOM 1631 C CG  . PRO B 2 8   ? 26.814  -6.493  30.309  1.00 35.41  ? 8   PRO B CG  1 
ATOM 1632 C CD  . PRO B 2 8   ? 28.102  -7.287  30.290  1.00 32.45  ? 8   PRO B CD  1 
ATOM 1633 N N   . ALA B 2 9   ? 25.366  -7.056  26.788  1.00 39.49  ? 9   ALA B N   1 
ATOM 1634 C CA  . ALA B 2 9   ? 25.268  -6.216  25.600  1.00 25.22  ? 9   ALA B CA  1 
ATOM 1635 C C   . ALA B 2 9   ? 25.588  -4.768  25.953  1.00 24.80  ? 9   ALA B C   1 
ATOM 1636 O O   . ALA B 2 9   ? 26.336  -4.094  25.249  1.00 37.33  ? 9   ALA B O   1 
ATOM 1637 C CB  . ALA B 2 9   ? 23.876  -6.323  24.976  1.00 25.90  ? 9   ALA B CB  1 
ATOM 1638 N N   . THR B 2 10  ? 25.020  -4.306  27.060  1.00 25.27  ? 10  THR B N   1 
ATOM 1639 C CA  . THR B 2 10  ? 25.182  -2.932  27.516  1.00 24.96  ? 10  THR B CA  1 
ATOM 1640 C C   . THR B 2 10  ? 25.455  -2.939  29.024  1.00 25.22  ? 10  THR B C   1 
ATOM 1641 O O   . THR B 2 10  ? 25.007  -3.844  29.726  1.00 37.09  ? 10  THR B O   1 
ATOM 1642 C CB  . THR B 2 10  ? 23.925  -2.091  27.189  1.00 34.08  ? 10  THR B CB  1 
ATOM 1643 O OG1 . THR B 2 10  ? 23.725  -2.052  25.770  1.00 34.90  ? 10  THR B OG1 1 
ATOM 1644 C CG2 . THR B 2 10  ? 24.061  -0.666  27.696  1.00 25.01  ? 10  THR B CG2 1 
ATOM 1645 N N   . LEU B 2 11  ? 26.213  -1.963  29.519  1.00 31.42  ? 11  LEU B N   1 
ATOM 1646 C CA  . LEU B 2 11  ? 26.503  -1.892  30.947  1.00 38.42  ? 11  LEU B CA  1 
ATOM 1647 C C   . LEU B 2 11  ? 26.253  -0.471  31.454  1.00 41.94  ? 11  LEU B C   1 
ATOM 1648 O O   . LEU B 2 11  ? 26.902  0.468   31.004  1.00 45.04  ? 11  LEU B O   1 
ATOM 1649 C CB  . LEU B 2 11  ? 27.947  -2.340  31.213  1.00 44.87  ? 11  LEU B CB  1 
ATOM 1650 C CG  . LEU B 2 11  ? 28.251  -3.088  32.515  1.00 44.54  ? 11  LEU B CG  1 
ATOM 1651 C CD1 . LEU B 2 11  ? 27.095  -3.993  32.915  1.00 43.77  ? 11  LEU B CD1 1 
ATOM 1652 C CD2 . LEU B 2 11  ? 29.533  -3.906  32.375  1.00 50.16  ? 11  LEU B CD2 1 
ATOM 1653 N N   . SER B 2 12  ? 25.303  -0.313  32.376  1.00 34.24  ? 12  SER B N   1 
ATOM 1654 C CA  . SER B 2 12  ? 24.936  1.019   32.855  1.00 48.04  ? 12  SER B CA  1 
ATOM 1655 C C   . SER B 2 12  ? 25.538  1.283   34.228  1.00 45.89  ? 12  SER B C   1 
ATOM 1656 O O   . SER B 2 12  ? 25.118  0.705   35.227  1.00 55.50  ? 12  SER B O   1 
ATOM 1657 C CB  . SER B 2 12  ? 23.412  1.191   32.903  1.00 55.36  ? 12  SER B CB  1 
ATOM 1658 O OG  . SER B 2 12  ? 22.803  0.276   33.796  1.00 66.38  ? 12  SER B OG  1 
ATOM 1659 N N   . LEU B 2 13  ? 26.528  2.170   34.261  1.00 40.84  ? 13  LEU B N   1 
ATOM 1660 C CA  . LEU B 2 13  ? 27.279  2.481   35.476  1.00 41.14  ? 13  LEU B CA  1 
ATOM 1661 C C   . LEU B 2 13  ? 27.442  3.984   35.667  1.00 46.57  ? 13  LEU B C   1 
ATOM 1662 O O   . LEU B 2 13  ? 26.953  4.787   34.877  1.00 50.70  ? 13  LEU B O   1 
ATOM 1663 C CB  . LEU B 2 13  ? 28.671  1.840   35.443  1.00 40.72  ? 13  LEU B CB  1 
ATOM 1664 C CG  . LEU B 2 13  ? 28.965  0.352   35.642  1.00 43.27  ? 13  LEU B CG  1 
ATOM 1665 C CD1 . LEU B 2 13  ? 28.089  -0.559  34.811  1.00 42.26  ? 13  LEU B CD1 1 
ATOM 1666 C CD2 . LEU B 2 13  ? 30.422  0.115   35.304  1.00 47.04  ? 13  LEU B CD2 1 
ATOM 1667 N N   . SER B 2 14  ? 28.164  4.355   36.716  1.00 46.97  ? 14  SER B N   1 
ATOM 1668 C CA  . SER B 2 14  ? 28.503  5.750   36.955  1.00 49.10  ? 14  SER B CA  1 
ATOM 1669 C C   . SER B 2 14  ? 29.987  5.860   37.274  1.00 37.01  ? 14  SER B C   1 
ATOM 1670 O O   . SER B 2 14  ? 30.627  4.855   37.574  1.00 37.79  ? 14  SER B O   1 
ATOM 1671 C CB  . SER B 2 14  ? 27.650  6.319   38.088  1.00 36.80  ? 14  SER B CB  1 
ATOM 1672 O OG  . SER B 2 14  ? 26.286  5.967   37.908  1.00 36.22  ? 14  SER B OG  1 
ATOM 1673 N N   . PRO B 2 15  ? 30.548  7.074   37.172  1.00 38.22  ? 15  PRO B N   1 
ATOM 1674 C CA  . PRO B 2 15  ? 31.960  7.226   37.519  1.00 40.23  ? 15  PRO B CA  1 
ATOM 1675 C C   . PRO B 2 15  ? 32.298  6.691   38.905  1.00 46.92  ? 15  PRO B C   1 
ATOM 1676 O O   . PRO B 2 15  ? 31.646  7.036   39.878  1.00 50.56  ? 15  PRO B O   1 
ATOM 1677 C CB  . PRO B 2 15  ? 32.160  8.739   37.448  1.00 41.41  ? 15  PRO B CB  1 
ATOM 1678 C CG  . PRO B 2 15  ? 31.265  9.142   36.326  1.00 36.11  ? 15  PRO B CG  1 
ATOM 1679 C CD  . PRO B 2 15  ? 30.039  8.256   36.453  1.00 37.11  ? 15  PRO B CD  1 
ATOM 1680 N N   . GLY B 2 16  ? 33.322  5.847   38.975  1.00 48.25  ? 16  GLY B N   1 
ATOM 1681 C CA  . GLY B 2 16  ? 33.745  5.255   40.230  1.00 38.30  ? 16  GLY B CA  1 
ATOM 1682 C C   . GLY B 2 16  ? 33.296  3.825   40.463  1.00 39.74  ? 16  GLY B C   1 
ATOM 1683 O O   . GLY B 2 16  ? 33.911  3.116   41.255  1.00 41.92  ? 16  GLY B O   1 
ATOM 1684 N N   . GLU B 2 17  ? 32.264  3.377   39.753  1.00 41.56  ? 17  GLU B N   1 
ATOM 1685 C CA  . GLU B 2 17  ? 31.754  2.024   39.964  1.00 44.08  ? 17  GLU B CA  1 
ATOM 1686 C C   . GLU B 2 17  ? 32.630  0.981   39.275  1.00 50.70  ? 17  GLU B C   1 
ATOM 1687 O O   . GLU B 2 17  ? 33.300  1.267   38.283  1.00 58.86  ? 17  GLU B O   1 
ATOM 1688 C CB  . GLU B 2 17  ? 30.300  1.890   39.483  1.00 43.29  ? 17  GLU B CB  1 
ATOM 1689 C CG  . GLU B 2 17  ? 29.313  2.911   40.054  1.00 45.49  ? 17  GLU B CG  1 
ATOM 1690 C CD  . GLU B 2 17  ? 27.871  2.599   39.654  1.00 50.17  ? 17  GLU B CD  1 
ATOM 1691 O OE1 . GLU B 2 17  ? 27.313  1.595   40.142  1.00 52.20  ? 17  GLU B OE1 1 
ATOM 1692 O OE2 . GLU B 2 17  ? 27.290  3.350   38.843  1.00 52.63  ? 17  GLU B OE2 1 
ATOM 1693 N N   . ARG B 2 18  ? 32.630  -0.226  39.826  1.00 46.63  ? 18  ARG B N   1 
ATOM 1694 C CA  . ARG B 2 18  ? 33.339  -1.354  39.232  1.00 45.15  ? 18  ARG B CA  1 
ATOM 1695 C C   . ARG B 2 18  ? 32.770  -1.688  37.858  1.00 55.50  ? 18  ARG B C   1 
ATOM 1696 O O   . ARG B 2 18  ? 31.581  -1.498  37.628  1.00 56.71  ? 18  ARG B O   1 
ATOM 1697 C CB  . ARG B 2 18  ? 33.230  -2.569  40.144  1.00 47.38  ? 18  ARG B CB  1 
ATOM 1698 C CG  . ARG B 2 18  ? 34.530  -3.071  40.716  1.00 51.72  ? 18  ARG B CG  1 
ATOM 1699 C CD  . ARG B 2 18  ? 34.327  -4.493  41.201  1.00 57.58  ? 18  ARG B CD  1 
ATOM 1700 N NE  . ARG B 2 18  ? 35.529  -5.068  41.792  1.00 66.80  ? 18  ARG B NE  1 
ATOM 1701 C CZ  . ARG B 2 18  ? 36.520  -5.618  41.097  1.00 67.72  ? 18  ARG B CZ  1 
ATOM 1702 N NH1 . ARG B 2 18  ? 36.466  -5.656  39.773  1.00 70.06  ? 18  ARG B NH1 1 
ATOM 1703 N NH2 . ARG B 2 18  ? 37.571  -6.122  41.731  1.00 63.77  ? 18  ARG B NH2 1 
ATOM 1704 N N   . ALA B 2 19  ? 33.609  -2.194  36.957  1.00 40.83  ? 19  ALA B N   1 
ATOM 1705 C CA  . ALA B 2 19  ? 33.136  -2.682  35.664  1.00 39.34  ? 19  ALA B CA  1 
ATOM 1706 C C   . ALA B 2 19  ? 33.748  -4.035  35.326  1.00 39.63  ? 19  ALA B C   1 
ATOM 1707 O O   . ALA B 2 19  ? 34.958  -4.142  35.155  1.00 40.01  ? 19  ALA B O   1 
ATOM 1708 C CB  . ALA B 2 19  ? 33.453  -1.672  34.561  1.00 38.09  ? 19  ALA B CB  1 
ATOM 1709 N N   . THR B 2 20  ? 32.905  -5.057  35.194  1.00 37.29  ? 20  THR B N   1 
ATOM 1710 C CA  . THR B 2 20  ? 33.374  -6.391  34.822  1.00 39.94  ? 20  THR B CA  1 
ATOM 1711 C C   . THR B 2 20  ? 32.692  -6.873  33.541  1.00 36.16  ? 20  THR B C   1 
ATOM 1712 O O   . THR B 2 20  ? 31.465  -6.970  33.469  1.00 35.79  ? 20  THR B O   1 
ATOM 1713 C CB  . THR B 2 20  ? 33.143  -7.417  35.956  1.00 50.40  ? 20  THR B CB  1 
ATOM 1714 O OG1 . THR B 2 20  ? 34.176  -7.274  36.939  1.00 45.25  ? 20  THR B OG1 1 
ATOM 1715 C CG2 . THR B 2 20  ? 33.180  -8.844  35.412  1.00 56.32  ? 20  THR B CG2 1 
ATOM 1716 N N   . LEU B 2 21  ? 33.505  -7.161  32.530  1.00 34.19  ? 21  LEU B N   1 
ATOM 1717 C CA  . LEU B 2 21  ? 33.011  -7.572  31.221  1.00 33.12  ? 21  LEU B CA  1 
ATOM 1718 C C   . LEU B 2 21  ? 33.547  -8.966  30.896  1.00 36.35  ? 21  LEU B C   1 
ATOM 1719 O O   . LEU B 2 21  ? 34.720  -9.258  31.123  1.00 39.59  ? 21  LEU B O   1 
ATOM 1720 C CB  . LEU B 2 21  ? 33.422  -6.566  30.139  1.00 33.61  ? 21  LEU B CB  1 
ATOM 1721 C CG  . LEU B 2 21  ? 32.730  -5.194  30.091  1.00 39.48  ? 21  LEU B CG  1 
ATOM 1722 C CD1 . LEU B 2 21  ? 33.123  -4.299  31.265  1.00 32.08  ? 21  LEU B CD1 1 
ATOM 1723 C CD2 . LEU B 2 21  ? 33.015  -4.475  28.774  1.00 38.45  ? 21  LEU B CD2 1 
ATOM 1724 N N   . SER B 2 22  ? 32.675  -9.827  30.375  1.00 36.68  ? 22  SER B N   1 
ATOM 1725 C CA  . SER B 2 22  ? 33.009  -11.232 30.152  1.00 38.27  ? 22  SER B CA  1 
ATOM 1726 C C   . SER B 2 22  ? 33.088  -11.567 28.667  1.00 43.21  ? 22  SER B C   1 
ATOM 1727 O O   . SER B 2 22  ? 32.407  -10.965 27.844  1.00 48.52  ? 22  SER B O   1 
ATOM 1728 C CB  . SER B 2 22  ? 31.987  -12.150 30.845  1.00 40.85  ? 22  SER B CB  1 
ATOM 1729 O OG  . SER B 2 22  ? 32.413  -13.502 30.793  1.00 43.07  ? 22  SER B OG  1 
ATOM 1730 N N   . CYS B 2 23  ? 33.924  -12.542 28.339  1.00 44.25  ? 23  CYS B N   1 
ATOM 1731 C CA  . CYS B 2 23  ? 34.103  -12.968 26.963  1.00 43.04  ? 23  CYS B CA  1 
ATOM 1732 C C   . CYS B 2 23  ? 34.190  -14.490 26.980  1.00 43.49  ? 23  CYS B C   1 
ATOM 1733 O O   . CYS B 2 23  ? 34.965  -15.055 27.752  1.00 43.57  ? 23  CYS B O   1 
ATOM 1734 C CB  . CYS B 2 23  ? 35.358  -12.305 26.370  1.00 38.07  ? 23  CYS B CB  1 
ATOM 1735 S SG  . CYS B 2 23  ? 35.702  -12.529 24.593  1.00 41.45  ? 23  CYS B SG  1 
ATOM 1736 N N   . ARG B 2 24  ? 33.364  -15.150 26.172  1.00 54.29  ? 24  ARG B N   1 
ATOM 1737 C CA  . ARG B 2 24  ? 33.382  -16.608 26.117  1.00 56.98  ? 24  ARG B CA  1 
ATOM 1738 C C   . ARG B 2 24  ? 33.724  -17.141 24.732  1.00 46.39  ? 24  ARG B C   1 
ATOM 1739 O O   . ARG B 2 24  ? 33.172  -16.704 23.726  1.00 41.95  ? 24  ARG B O   1 
ATOM 1740 C CB  . ARG B 2 24  ? 32.039  -17.194 26.562  1.00 68.94  ? 24  ARG B CB  1 
ATOM 1741 C CG  . ARG B 2 24  ? 31.530  -16.701 27.905  1.00 77.53  ? 24  ARG B CG  1 
ATOM 1742 C CD  . ARG B 2 24  ? 30.089  -17.142 28.149  1.00 83.52  ? 24  ARG B CD  1 
ATOM 1743 N NE  . ARG B 2 24  ? 29.501  -16.462 29.304  1.00 83.08  ? 24  ARG B NE  1 
ATOM 1744 C CZ  . ARG B 2 24  ? 28.827  -17.067 30.279  1.00 81.73  ? 24  ARG B CZ  1 
ATOM 1745 N NH1 . ARG B 2 24  ? 28.639  -18.380 30.250  1.00 78.01  ? 24  ARG B NH1 1 
ATOM 1746 N NH2 . ARG B 2 24  ? 28.338  -16.356 31.286  1.00 81.26  ? 24  ARG B NH2 1 
ATOM 1747 N N   . ALA B 2 25  ? 34.612  -18.125 24.690  1.00 40.83  ? 25  ALA B N   1 
ATOM 1748 C CA  . ALA B 2 25  ? 35.076  -18.664 23.419  1.00 38.72  ? 25  ALA B CA  1 
ATOM 1749 C C   . ALA B 2 25  ? 34.377  -19.973 23.043  1.00 45.30  ? 25  ALA B C   1 
ATOM 1750 O O   . ALA B 2 25  ? 34.060  -20.792 23.902  1.00 46.30  ? 25  ALA B O   1 
ATOM 1751 C CB  . ALA B 2 25  ? 36.585  -18.858 23.460  1.00 38.27  ? 25  ALA B CB  1 
ATOM 1752 N N   . SER B 2 26  ? 34.125  -20.149 21.748  1.00 32.47  ? 26  SER B N   1 
ATOM 1753 C CA  . SER B 2 26  ? 33.571  -21.395 21.213  1.00 32.86  ? 26  SER B CA  1 
ATOM 1754 C C   . SER B 2 26  ? 34.546  -22.546 21.426  1.00 33.58  ? 26  SER B C   1 
ATOM 1755 O O   . SER B 2 26  ? 34.201  -23.715 21.306  1.00 37.31  ? 26  SER B O   1 
ATOM 1756 C CB  . SER B 2 26  ? 33.270  -21.247 19.721  1.00 32.17  ? 26  SER B CB  1 
ATOM 1757 O OG  . SER B 2 26  ? 34.412  -20.771 19.024  1.00 42.71  ? 26  SER B OG  1 
ATOM 1758 N N   . GLN B 2 27  ? 35.778  -22.167 21.741  1.00 34.17  ? 27  GLN B N   1 
ATOM 1759 C CA  . GLN B 2 27  ? 36.932  -23.052 21.850  1.00 39.75  ? 27  GLN B CA  1 
ATOM 1760 C C   . GLN B 2 27  ? 37.882  -22.519 22.923  1.00 53.58  ? 27  GLN B C   1 
ATOM 1761 O O   . GLN B 2 27  ? 37.493  -21.694 23.737  1.00 71.11  ? 27  GLN B O   1 
ATOM 1762 C CB  . GLN B 2 27  ? 37.670  -23.173 20.518  1.00 39.97  ? 27  GLN B CB  1 
ATOM 1763 C CG  . GLN B 2 27  ? 37.919  -24.608 20.107  1.00 39.55  ? 27  GLN B CG  1 
ATOM 1764 C CD  . GLN B 2 27  ? 38.952  -24.714 19.005  1.00 39.01  ? 27  GLN B CD  1 
ATOM 1765 O OE1 . GLN B 2 27  ? 40.152  -24.632 19.266  1.00 36.21  ? 27  GLN B OE1 1 
ATOM 1766 N NE2 . GLN B 2 27  ? 38.496  -24.883 17.768  1.00 38.05  ? 27  GLN B NE2 1 
ATOM 1767 N N   . SER B 2 28  ? 39.113  -23.021 22.963  1.00 45.63  ? 28  SER B N   1 
ATOM 1768 C CA  . SER B 2 28  ? 40.126  -22.442 23.857  1.00 45.04  ? 28  SER B CA  1 
ATOM 1769 C C   . SER B 2 28  ? 41.250  -21.698 23.120  1.00 41.90  ? 28  SER B C   1 
ATOM 1770 O O   . SER B 2 28  ? 41.922  -22.269 22.252  1.00 44.08  ? 28  SER B O   1 
ATOM 1771 C CB  . SER B 2 28  ? 40.743  -23.520 24.743  1.00 37.42  ? 28  SER B CB  1 
ATOM 1772 O OG  . SER B 2 28  ? 41.776  -22.958 25.528  1.00 38.05  ? 28  SER B OG  1 
ATOM 1773 N N   . VAL B 2 29  ? 41.424  -20.419 23.459  1.00 40.17  ? 29  VAL B N   1 
ATOM 1774 C CA  . VAL B 2 29  ? 42.545  -19.620 22.957  1.00 42.02  ? 29  VAL B CA  1 
ATOM 1775 C C   . VAL B 2 29  ? 43.732  -19.547 23.939  1.00 34.20  ? 29  VAL B C   1 
ATOM 1776 O O   . VAL B 2 29  ? 44.696  -18.827 23.688  1.00 34.29  ? 29  VAL B O   1 
ATOM 1777 C CB  . VAL B 2 29  ? 42.107  -18.163 22.617  1.00 66.82  ? 29  VAL B CB  1 
ATOM 1778 C CG1 . VAL B 2 29  ? 41.072  -18.156 21.497  1.00 66.14  ? 29  VAL B CG1 1 
ATOM 1779 C CG2 . VAL B 2 29  ? 41.611  -17.439 23.851  1.00 68.07  ? 29  VAL B CG2 1 
ATOM 1780 N N   . SER B 2 30  ? 43.633  -20.266 25.060  1.00 34.51  ? 30  SER B N   1 
ATOM 1781 C CA  . SER B 2 30  ? 44.568  -20.163 26.196  1.00 35.78  ? 30  SER B CA  1 
ATOM 1782 C C   . SER B 2 30  ? 44.548  -18.747 26.767  1.00 50.27  ? 30  SER B C   1 
ATOM 1783 O O   . SER B 2 30  ? 43.493  -18.263 27.158  1.00 51.93  ? 30  SER B O   1 
ATOM 1784 C CB  . SER B 2 30  ? 46.002  -20.536 25.808  1.00 36.36  ? 30  SER B CB  1 
ATOM 1785 O OG  . SER B 2 30  ? 46.631  -19.475 25.106  1.00 49.46  ? 30  SER B OG  1 
ATOM 1786 N N   . SER B 2 31  ? 45.721  -18.114 26.845  1.00 42.57  ? 31  SER B N   1 
ATOM 1787 C CA  . SER B 2 31  ? 45.852  -16.704 27.240  1.00 42.75  ? 31  SER B CA  1 
ATOM 1788 C C   . SER B 2 31  ? 45.947  -15.703 26.066  1.00 38.02  ? 31  SER B C   1 
ATOM 1789 O O   . SER B 2 31  ? 46.256  -14.538 26.291  1.00 47.30  ? 31  SER B O   1 
ATOM 1790 C CB  . SER B 2 31  ? 47.041  -16.513 28.198  1.00 46.89  ? 31  SER B CB  1 
ATOM 1791 O OG  . SER B 2 31  ? 48.146  -17.331 27.866  1.00 57.83  ? 31  SER B OG  1 
ATOM 1792 N N   . TYR B 2 32  ? 45.686  -16.129 24.831  1.00 36.19  ? 32  TYR B N   1 
ATOM 1793 C CA  . TYR B 2 32  ? 45.938  -15.261 23.665  1.00 35.44  ? 32  TYR B CA  1 
ATOM 1794 C C   . TYR B 2 32  ? 44.882  -14.171 23.463  1.00 48.16  ? 32  TYR B C   1 
ATOM 1795 O O   . TYR B 2 32  ? 44.918  -13.466 22.454  1.00 51.80  ? 32  TYR B O   1 
ATOM 1796 C CB  . TYR B 2 32  ? 46.056  -16.074 22.370  1.00 34.94  ? 32  TYR B CB  1 
ATOM 1797 C CG  . TYR B 2 32  ? 47.287  -16.946 22.325  1.00 37.09  ? 32  TYR B CG  1 
ATOM 1798 C CD1 . TYR B 2 32  ? 48.558  -16.391 22.296  1.00 38.92  ? 32  TYR B CD1 1 
ATOM 1799 C CD2 . TYR B 2 32  ? 47.177  -18.324 22.299  1.00 36.04  ? 32  TYR B CD2 1 
ATOM 1800 C CE1 . TYR B 2 32  ? 49.678  -17.189 22.262  1.00 43.66  ? 32  TYR B CE1 1 
ATOM 1801 C CE2 . TYR B 2 32  ? 48.287  -19.128 22.269  1.00 36.91  ? 32  TYR B CE2 1 
ATOM 1802 C CZ  . TYR B 2 32  ? 49.535  -18.563 22.246  1.00 48.83  ? 32  TYR B CZ  1 
ATOM 1803 O OH  . TYR B 2 32  ? 50.640  -19.384 22.215  1.00 50.72  ? 32  TYR B OH  1 
ATOM 1804 N N   . LEU B 2 33  ? 43.929  -14.053 24.387  1.00 42.20  ? 33  LEU B N   1 
ATOM 1805 C CA  . LEU B 2 33  ? 42.907  -13.003 24.297  1.00 41.34  ? 33  LEU B CA  1 
ATOM 1806 C C   . LEU B 2 33  ? 43.447  -11.579 24.538  1.00 41.84  ? 33  LEU B C   1 
ATOM 1807 O O   . LEU B 2 33  ? 44.286  -11.364 25.412  1.00 24.24  ? 33  LEU B O   1 
ATOM 1808 C CB  . LEU B 2 33  ? 41.771  -13.270 25.292  1.00 25.21  ? 33  LEU B CB  1 
ATOM 1809 C CG  . LEU B 2 33  ? 40.654  -12.231 25.151  1.00 25.07  ? 33  LEU B CG  1 
ATOM 1810 C CD1 . LEU B 2 33  ? 40.064  -12.377 23.778  1.00 32.00  ? 33  LEU B CD1 1 
ATOM 1811 C CD2 . LEU B 2 33  ? 39.561  -12.346 26.183  1.00 25.38  ? 33  LEU B CD2 1 
ATOM 1812 N N   . ALA B 2 34  ? 42.934  -10.613 23.772  1.00 38.34  ? 34  ALA B N   1 
ATOM 1813 C CA  . ALA B 2 34  ? 43.204  -9.189  23.987  1.00 25.13  ? 34  ALA B CA  1 
ATOM 1814 C C   . ALA B 2 34  ? 41.899  -8.427  24.224  1.00 25.17  ? 34  ALA B C   1 
ATOM 1815 O O   . ALA B 2 34  ? 40.822  -8.938  23.935  1.00 25.45  ? 34  ALA B O   1 
ATOM 1816 C CB  . ALA B 2 34  ? 43.949  -8.596  22.800  1.00 24.96  ? 34  ALA B CB  1 
ATOM 1817 N N   . TRP B 2 35  ? 41.998  -7.218  24.771  1.00 33.07  ? 35  TRP B N   1 
ATOM 1818 C CA  . TRP B 2 35  ? 40.827  -6.360  24.961  1.00 25.00  ? 35  TRP B CA  1 
ATOM 1819 C C   . TRP B 2 35  ? 41.059  -4.962  24.387  1.00 44.95  ? 35  TRP B C   1 
ATOM 1820 O O   . TRP B 2 35  ? 42.085  -4.341  24.655  1.00 24.68  ? 35  TRP B O   1 
ATOM 1821 C CB  . TRP B 2 35  ? 40.470  -6.247  26.444  1.00 25.17  ? 35  TRP B CB  1 
ATOM 1822 C CG  . TRP B 2 35  ? 39.767  -7.433  27.047  1.00 29.55  ? 35  TRP B CG  1 
ATOM 1823 C CD1 . TRP B 2 35  ? 40.348  -8.504  27.660  1.00 27.39  ? 35  TRP B CD1 1 
ATOM 1824 C CD2 . TRP B 2 35  ? 38.349  -7.652  27.117  1.00 32.53  ? 35  TRP B CD2 1 
ATOM 1825 N NE1 . TRP B 2 35  ? 39.385  -9.381  28.098  1.00 26.01  ? 35  TRP B NE1 1 
ATOM 1826 C CE2 . TRP B 2 35  ? 38.150  -8.882  27.777  1.00 26.19  ? 35  TRP B CE2 1 
ATOM 1827 C CE3 . TRP B 2 35  ? 37.231  -6.933  26.680  1.00 34.78  ? 35  TRP B CE3 1 
ATOM 1828 C CZ2 . TRP B 2 35  ? 36.880  -9.408  28.011  1.00 26.69  ? 35  TRP B CZ2 1 
ATOM 1829 C CZ3 . TRP B 2 35  ? 35.970  -7.458  26.913  1.00 26.50  ? 35  TRP B CZ3 1 
ATOM 1830 C CH2 . TRP B 2 35  ? 35.806  -8.683  27.572  1.00 27.65  ? 35  TRP B CH2 1 
ATOM 1831 N N   . TYR B 2 36  ? 40.106  -4.460  23.608  1.00 42.52  ? 36  TYR B N   1 
ATOM 1832 C CA  . TYR B 2 36  ? 40.244  -3.128  23.024  1.00 39.04  ? 36  TYR B CA  1 
ATOM 1833 C C   . TYR B 2 36  ? 39.136  -2.177  23.477  1.00 37.09  ? 36  TYR B C   1 
ATOM 1834 O O   . TYR B 2 36  ? 38.040  -2.607  23.825  1.00 34.92  ? 36  TYR B O   1 
ATOM 1835 C CB  . TYR B 2 36  ? 40.260  -3.197  21.491  1.00 22.27  ? 36  TYR B CB  1 
ATOM 1836 C CG  . TYR B 2 36  ? 41.390  -4.015  20.893  1.00 22.12  ? 36  TYR B CG  1 
ATOM 1837 C CD1 . TYR B 2 36  ? 41.388  -5.402  20.973  1.00 22.19  ? 36  TYR B CD1 1 
ATOM 1838 C CD2 . TYR B 2 36  ? 42.441  -3.403  20.223  1.00 28.86  ? 36  TYR B CD2 1 
ATOM 1839 C CE1 . TYR B 2 36  ? 42.412  -6.155  20.421  1.00 43.68  ? 36  TYR B CE1 1 
ATOM 1840 C CE2 . TYR B 2 36  ? 43.466  -4.148  19.666  1.00 31.21  ? 36  TYR B CE2 1 
ATOM 1841 C CZ  . TYR B 2 36  ? 43.448  -5.524  19.768  1.00 38.70  ? 36  TYR B CZ  1 
ATOM 1842 O OH  . TYR B 2 36  ? 44.467  -6.274  19.218  1.00 22.09  ? 36  TYR B OH  1 
ATOM 1843 N N   . GLN B 2 37  ? 39.439  -0.881  23.461  1.00 23.03  ? 37  GLN B N   1 
ATOM 1844 C CA  . GLN B 2 37  ? 38.468  0.176   23.759  1.00 23.38  ? 37  GLN B CA  1 
ATOM 1845 C C   . GLN B 2 37  ? 38.139  0.950   22.484  1.00 23.49  ? 37  GLN B C   1 
ATOM 1846 O O   . GLN B 2 37  ? 39.040  1.255   21.700  1.00 50.27  ? 37  GLN B O   1 
ATOM 1847 C CB  . GLN B 2 37  ? 39.015  1.137   24.823  1.00 23.53  ? 37  GLN B CB  1 
ATOM 1848 C CG  . GLN B 2 37  ? 38.081  2.291   25.178  1.00 35.38  ? 37  GLN B CG  1 
ATOM 1849 C CD  . GLN B 2 37  ? 38.797  3.426   25.887  1.00 36.26  ? 37  GLN B CD  1 
ATOM 1850 O OE1 . GLN B 2 37  ? 39.679  4.070   25.319  1.00 40.40  ? 37  GLN B OE1 1 
ATOM 1851 N NE2 . GLN B 2 37  ? 38.434  3.664   27.143  1.00 36.36  ? 37  GLN B NE2 1 
ATOM 1852 N N   . GLN B 2 38  ? 36.863  1.255   22.256  1.00 41.50  ? 38  GLN B N   1 
ATOM 1853 C CA  . GLN B 2 38  ? 36.512  2.139   21.146  1.00 42.10  ? 38  GLN B CA  1 
ATOM 1854 C C   . GLN B 2 38  ? 35.409  3.140   21.485  1.00 36.21  ? 38  GLN B C   1 
ATOM 1855 O O   . GLN B 2 38  ? 34.308  2.759   21.888  1.00 27.11  ? 38  GLN B O   1 
ATOM 1856 C CB  . GLN B 2 38  ? 36.097  1.322   19.924  1.00 40.86  ? 38  GLN B CB  1 
ATOM 1857 C CG  . GLN B 2 38  ? 35.693  2.174   18.734  1.00 39.31  ? 38  GLN B CG  1 
ATOM 1858 C CD  . GLN B 2 38  ? 35.789  1.415   17.432  1.00 26.44  ? 38  GLN B CD  1 
ATOM 1859 O OE1 . GLN B 2 38  ? 35.156  0.374   17.262  1.00 28.62  ? 38  GLN B OE1 1 
ATOM 1860 N NE2 . GLN B 2 38  ? 36.590  1.926   16.506  1.00 26.40  ? 38  GLN B NE2 1 
ATOM 1861 N N   . LYS B 2 39  ? 35.718  4.422   21.308  1.00 31.78  ? 39  LYS B N   1 
ATOM 1862 C CA  . LYS B 2 39  ? 34.727  5.490   21.394  1.00 33.59  ? 39  LYS B CA  1 
ATOM 1863 C C   . LYS B 2 39  ? 34.151  5.781   20.007  1.00 33.76  ? 39  LYS B C   1 
ATOM 1864 O O   . LYS B 2 39  ? 34.783  5.457   19.000  1.00 26.50  ? 39  LYS B O   1 
ATOM 1865 C CB  . LYS B 2 39  ? 35.351  6.745   22.007  1.00 26.96  ? 39  LYS B CB  1 
ATOM 1866 C CG  . LYS B 2 39  ? 35.454  6.706   23.518  1.00 27.09  ? 39  LYS B CG  1 
ATOM 1867 C CD  . LYS B 2 39  ? 36.536  7.637   23.998  1.00 27.27  ? 39  LYS B CD  1 
ATOM 1868 C CE  . LYS B 2 39  ? 37.874  7.196   23.441  1.00 49.32  ? 39  LYS B CE  1 
ATOM 1869 N NZ  . LYS B 2 39  ? 38.976  8.097   23.865  1.00 50.00  ? 39  LYS B NZ  1 
ATOM 1870 N N   . PRO B 2 40  ? 32.951  6.389   19.941  1.00 36.48  ? 40  PRO B N   1 
ATOM 1871 C CA  . PRO B 2 40  ? 32.380  6.644   18.614  1.00 29.71  ? 40  PRO B CA  1 
ATOM 1872 C C   . PRO B 2 40  ? 33.248  7.560   17.751  1.00 31.69  ? 40  PRO B C   1 
ATOM 1873 O O   . PRO B 2 40  ? 33.804  8.543   18.241  1.00 26.48  ? 40  PRO B O   1 
ATOM 1874 C CB  . PRO B 2 40  ? 31.034  7.301   18.940  1.00 26.87  ? 40  PRO B CB  1 
ATOM 1875 C CG  . PRO B 2 40  ? 31.246  7.933   20.276  1.00 27.12  ? 40  PRO B CG  1 
ATOM 1876 C CD  . PRO B 2 40  ? 32.088  6.923   21.011  1.00 37.68  ? 40  PRO B CD  1 
ATOM 1877 N N   . GLY B 2 41  ? 33.374  7.212   16.474  1.00 36.25  ? 41  GLY B N   1 
ATOM 1878 C CA  . GLY B 2 41  ? 34.163  7.993   15.540  1.00 38.95  ? 41  GLY B CA  1 
ATOM 1879 C C   . GLY B 2 41  ? 35.648  7.963   15.842  1.00 35.77  ? 41  GLY B C   1 
ATOM 1880 O O   . GLY B 2 41  ? 36.342  8.961   15.658  1.00 41.85  ? 41  GLY B O   1 
ATOM 1881 N N   . GLN B 2 42  ? 36.140  6.818   16.307  1.00 27.70  ? 42  GLN B N   1 
ATOM 1882 C CA  . GLN B 2 42  ? 37.565  6.659   16.590  1.00 34.18  ? 42  GLN B CA  1 
ATOM 1883 C C   . GLN B 2 42  ? 38.087  5.268   16.230  1.00 40.79  ? 42  GLN B C   1 
ATOM 1884 O O   . GLN B 2 42  ? 37.324  4.381   15.840  1.00 46.89  ? 42  GLN B O   1 
ATOM 1885 C CB  . GLN B 2 42  ? 37.848  6.938   18.070  1.00 33.57  ? 42  GLN B CB  1 
ATOM 1886 C CG  . GLN B 2 42  ? 37.849  8.411   18.442  1.00 35.39  ? 42  GLN B CG  1 
ATOM 1887 C CD  . GLN B 2 42  ? 38.060  8.645   19.925  1.00 38.28  ? 42  GLN B CD  1 
ATOM 1888 O OE1 . GLN B 2 42  ? 38.952  8.059   20.539  1.00 31.48  ? 42  GLN B OE1 1 
ATOM 1889 N NE2 . GLN B 2 42  ? 37.234  9.507   20.510  1.00 46.65  ? 42  GLN B NE2 1 
ATOM 1890 N N   . ALA B 2 43  ? 39.395  5.093   16.385  1.00 28.16  ? 43  ALA B N   1 
ATOM 1891 C CA  . ALA B 2 43  ? 40.050  3.812   16.161  1.00 27.75  ? 43  ALA B CA  1 
ATOM 1892 C C   . ALA B 2 43  ? 40.060  3.003   17.452  1.00 27.46  ? 43  ALA B C   1 
ATOM 1893 O O   . ALA B 2 43  ? 40.002  3.577   18.536  1.00 27.54  ? 43  ALA B O   1 
ATOM 1894 C CB  . ALA B 2 43  ? 41.468  4.030   15.647  1.00 37.54  ? 43  ALA B CB  1 
ATOM 1895 N N   . PRO B 2 44  ? 40.129  1.666   17.342  1.00 22.87  ? 44  PRO B N   1 
ATOM 1896 C CA  . PRO B 2 44  ? 40.206  0.808   18.531  1.00 35.29  ? 44  PRO B CA  1 
ATOM 1897 C C   . PRO B 2 44  ? 41.438  1.095   19.378  1.00 36.80  ? 44  PRO B C   1 
ATOM 1898 O O   . PRO B 2 44  ? 42.508  1.366   18.836  1.00 39.15  ? 44  PRO B O   1 
ATOM 1899 C CB  . PRO B 2 44  ? 40.287  -0.603  17.945  1.00 22.52  ? 44  PRO B CB  1 
ATOM 1900 C CG  . PRO B 2 44  ? 39.700  -0.487  16.610  1.00 22.75  ? 44  PRO B CG  1 
ATOM 1901 C CD  . PRO B 2 44  ? 40.029  0.877   16.104  1.00 22.89  ? 44  PRO B CD  1 
ATOM 1902 N N   . ARG B 2 45  ? 41.287  1.018   20.694  1.00 23.58  ? 45  ARG B N   1 
ATOM 1903 C CA  . ARG B 2 45  ? 42.397  1.258   21.607  1.00 23.50  ? 45  ARG B CA  1 
ATOM 1904 C C   . ARG B 2 45  ? 42.719  0.016   22.413  1.00 36.10  ? 45  ARG B C   1 
ATOM 1905 O O   . ARG B 2 45  ? 41.866  -0.486  23.139  1.00 38.19  ? 45  ARG B O   1 
ATOM 1906 C CB  . ARG B 2 45  ? 42.074  2.408   22.557  1.00 23.81  ? 45  ARG B CB  1 
ATOM 1907 C CG  . ARG B 2 45  ? 43.188  2.724   23.540  1.00 23.83  ? 45  ARG B CG  1 
ATOM 1908 C CD  . ARG B 2 45  ? 42.691  3.665   24.614  1.00 24.24  ? 45  ARG B CD  1 
ATOM 1909 N NE  . ARG B 2 45  ? 43.727  4.048   25.566  1.00 24.37  ? 45  ARG B NE  1 
ATOM 1910 C CZ  . ARG B 2 45  ? 43.486  4.712   26.691  1.00 47.02  ? 45  ARG B CZ  1 
ATOM 1911 N NH1 . ARG B 2 45  ? 42.242  5.046   27.008  1.00 25.09  ? 45  ARG B NH1 1 
ATOM 1912 N NH2 . ARG B 2 45  ? 44.482  5.035   27.504  1.00 49.14  ? 45  ARG B NH2 1 
ATOM 1913 N N   . LEU B 2 46  ? 43.946  -0.477  22.299  1.00 40.29  ? 46  LEU B N   1 
ATOM 1914 C CA  . LEU B 2 46  ? 44.339  -1.636  23.083  1.00 36.04  ? 46  LEU B CA  1 
ATOM 1915 C C   . LEU B 2 46  ? 44.323  -1.277  24.564  1.00 33.14  ? 46  LEU B C   1 
ATOM 1916 O O   . LEU B 2 46  ? 44.644  -0.153  24.947  1.00 29.26  ? 46  LEU B O   1 
ATOM 1917 C CB  . LEU B 2 46  ? 45.721  -2.152  22.671  1.00 24.63  ? 46  LEU B CB  1 
ATOM 1918 C CG  . LEU B 2 46  ? 46.099  -3.504  23.290  1.00 24.55  ? 46  LEU B CG  1 
ATOM 1919 C CD1 . LEU B 2 46  ? 45.395  -4.646  22.568  1.00 24.59  ? 46  LEU B CD1 1 
ATOM 1920 C CD2 . LEU B 2 46  ? 47.609  -3.715  23.306  1.00 24.52  ? 46  LEU B CD2 1 
ATOM 1921 N N   . LEU B 2 47  ? 43.929  -2.244  25.384  1.00 22.99  ? 47  LEU B N   1 
ATOM 1922 C CA  . LEU B 2 47  ? 43.897  -2.075  26.828  1.00 23.15  ? 47  LEU B CA  1 
ATOM 1923 C C   . LEU B 2 47  ? 44.719  -3.167  27.500  1.00 36.53  ? 47  LEU B C   1 
ATOM 1924 O O   . LEU B 2 47  ? 45.731  -2.892  28.143  1.00 40.05  ? 47  LEU B O   1 
ATOM 1925 C CB  . LEU B 2 47  ? 42.456  -2.101  27.336  1.00 42.66  ? 47  LEU B CB  1 
ATOM 1926 C CG  . LEU B 2 47  ? 41.533  -1.002  26.810  1.00 40.28  ? 47  LEU B CG  1 
ATOM 1927 C CD1 . LEU B 2 47  ? 40.095  -1.489  26.819  1.00 23.76  ? 47  LEU B CD1 1 
ATOM 1928 C CD2 . LEU B 2 47  ? 41.694  0.260   27.641  1.00 23.87  ? 47  LEU B CD2 1 
ATOM 1929 N N   . ILE B 2 48  ? 44.271  -4.409  27.344  1.00 23.59  ? 48  ILE B N   1 
ATOM 1930 C CA  . ILE B 2 48  ? 44.928  -5.561  27.949  1.00 23.60  ? 48  ILE B CA  1 
ATOM 1931 C C   . ILE B 2 48  ? 45.258  -6.616  26.889  1.00 38.96  ? 48  ILE B C   1 
ATOM 1932 O O   . ILE B 2 48  ? 44.372  -7.056  26.155  1.00 39.47  ? 48  ILE B O   1 
ATOM 1933 C CB  . ILE B 2 48  ? 44.035  -6.197  29.039  1.00 40.03  ? 48  ILE B CB  1 
ATOM 1934 C CG1 . ILE B 2 48  ? 43.687  -5.179  30.129  1.00 41.12  ? 48  ILE B CG1 1 
ATOM 1935 C CG2 . ILE B 2 48  ? 44.700  -7.423  29.648  1.00 39.94  ? 48  ILE B CG2 1 
ATOM 1936 C CD1 . ILE B 2 48  ? 44.875  -4.645  30.889  1.00 43.22  ? 48  ILE B CD1 1 
ATOM 1937 N N   . TYR B 2 49  ? 46.528  -7.009  26.795  1.00 36.84  ? 49  TYR B N   1 
ATOM 1938 C CA  . TYR B 2 49  ? 46.919  -8.113  25.914  1.00 34.21  ? 49  TYR B CA  1 
ATOM 1939 C C   . TYR B 2 49  ? 47.399  -9.317  26.731  1.00 43.06  ? 49  TYR B C   1 
ATOM 1940 O O   . TYR B 2 49  ? 47.937  -9.148  27.823  1.00 49.76  ? 49  TYR B O   1 
ATOM 1941 C CB  . TYR B 2 49  ? 48.003  -7.667  24.921  1.00 36.33  ? 49  TYR B CB  1 
ATOM 1942 C CG  . TYR B 2 49  ? 49.328  -7.264  25.542  1.00 38.30  ? 49  TYR B CG  1 
ATOM 1943 C CD1 . TYR B 2 49  ? 50.345  -8.195  25.728  1.00 37.07  ? 49  TYR B CD1 1 
ATOM 1944 C CD2 . TYR B 2 49  ? 49.557  -5.957  25.950  1.00 44.07  ? 49  TYR B CD2 1 
ATOM 1945 C CE1 . TYR B 2 49  ? 51.552  -7.832  26.291  1.00 32.90  ? 49  TYR B CE1 1 
ATOM 1946 C CE2 . TYR B 2 49  ? 50.765  -5.585  26.521  1.00 43.26  ? 49  TYR B CE2 1 
ATOM 1947 C CZ  . TYR B 2 49  ? 51.755  -6.528  26.688  1.00 33.79  ? 49  TYR B CZ  1 
ATOM 1948 O OH  . TYR B 2 49  ? 52.959  -6.170  27.246  1.00 33.24  ? 49  TYR B OH  1 
ATOM 1949 N N   . ASP B 2 50  ? 47.187  -10.522 26.200  1.00 46.15  ? 50  ASP B N   1 
ATOM 1950 C CA  . ASP B 2 50  ? 47.557  -11.779 26.868  1.00 45.47  ? 50  ASP B CA  1 
ATOM 1951 C C   . ASP B 2 50  ? 46.835  -11.952 28.225  1.00 26.05  ? 50  ASP B C   1 
ATOM 1952 O O   . ASP B 2 50  ? 47.315  -12.653 29.126  1.00 26.28  ? 50  ASP B O   1 
ATOM 1953 C CB  . ASP B 2 50  ? 49.082  -11.873 27.030  1.00 25.89  ? 50  ASP B CB  1 
ATOM 1954 C CG  . ASP B 2 50  ? 49.750  -12.587 25.854  1.00 58.41  ? 50  ASP B CG  1 
ATOM 1955 O OD1 . ASP B 2 50  ? 49.126  -12.663 24.767  1.00 43.23  ? 50  ASP B OD1 1 
ATOM 1956 O OD2 . ASP B 2 50  ? 50.898  -13.059 26.011  1.00 64.02  ? 50  ASP B OD2 1 
ATOM 1957 N N   . ALA B 2 51  ? 45.678  -11.292 28.333  1.00 23.28  ? 51  ALA B N   1 
ATOM 1958 C CA  . ALA B 2 51  ? 44.688  -11.435 29.420  1.00 33.27  ? 51  ALA B CA  1 
ATOM 1959 C C   . ALA B 2 51  ? 45.119  -10.863 30.774  1.00 42.59  ? 51  ALA B C   1 
ATOM 1960 O O   . ALA B 2 51  ? 44.287  -10.653 31.655  1.00 53.59  ? 51  ALA B O   1 
ATOM 1961 C CB  . ALA B 2 51  ? 44.299  -12.895 29.586  1.00 30.85  ? 51  ALA B CB  1 
ATOM 1962 N N   . SER B 2 52  ? 46.407  -10.584 30.924  1.00 35.73  ? 52  SER B N   1 
ATOM 1963 C CA  . SER B 2 52  ? 46.948  -10.067 32.170  1.00 36.27  ? 52  SER B CA  1 
ATOM 1964 C C   . SER B 2 52  ? 47.715  -8.800  31.860  1.00 33.65  ? 52  SER B C   1 
ATOM 1965 O O   . SER B 2 52  ? 47.405  -7.727  32.392  1.00 26.12  ? 52  SER B O   1 
ATOM 1966 C CB  . SER B 2 52  ? 47.848  -11.097 32.855  1.00 39.76  ? 52  SER B CB  1 
ATOM 1967 O OG  . SER B 2 52  ? 48.590  -10.495 33.903  1.00 43.95  ? 52  SER B OG  1 
ATOM 1968 N N   . ASN B 2 53  ? 48.743  -8.960  31.023  1.00 25.14  ? 53  ASN B N   1 
ATOM 1969 C CA  . ASN B 2 53  ? 49.607  -7.865  30.618  1.00 43.19  ? 53  ASN B CA  1 
ATOM 1970 C C   . ASN B 2 53  ? 48.809  -6.655  30.172  1.00 45.59  ? 53  ASN B C   1 
ATOM 1971 O O   . ASN B 2 53  ? 47.908  -6.751  29.342  1.00 45.87  ? 53  ASN B O   1 
ATOM 1972 C CB  . ASN B 2 53  ? 50.521  -8.303  29.477  1.00 24.86  ? 53  ASN B CB  1 
ATOM 1973 C CG  . ASN B 2 53  ? 51.687  -9.154  29.948  1.00 36.80  ? 53  ASN B CG  1 
ATOM 1974 O OD1 . ASN B 2 53  ? 52.631  -8.652  30.560  1.00 42.44  ? 53  ASN B OD1 1 
ATOM 1975 N ND2 . ASN B 2 53  ? 51.633  -10.448 29.654  1.00 25.24  ? 53  ASN B ND2 1 
ATOM 1976 N N   . ARG B 2 54  ? 49.146  -5.512  30.749  1.00 48.85  ? 54  ARG B N   1 
ATOM 1977 C CA  . ARG B 2 54  ? 48.467  -4.271  30.437  1.00 24.00  ? 54  ARG B CA  1 
ATOM 1978 C C   . ARG B 2 54  ? 49.274  -3.524  29.389  1.00 35.94  ? 54  ARG B C   1 
ATOM 1979 O O   . ARG B 2 54  ? 50.505  -3.537  29.423  1.00 35.53  ? 54  ARG B O   1 
ATOM 1980 C CB  . ARG B 2 54  ? 48.280  -3.432  31.706  1.00 24.31  ? 54  ARG B CB  1 
ATOM 1981 C CG  . ARG B 2 54  ? 47.837  -2.004  31.463  1.00 24.43  ? 54  ARG B CG  1 
ATOM 1982 C CD  . ARG B 2 54  ? 47.260  -1.380  32.726  1.00 43.26  ? 54  ARG B CD  1 
ATOM 1983 N NE  . ARG B 2 54  ? 48.242  -1.277  33.804  1.00 36.76  ? 54  ARG B NE  1 
ATOM 1984 C CZ  . ARG B 2 54  ? 48.300  -2.102  34.846  1.00 36.80  ? 54  ARG B CZ  1 
ATOM 1985 N NH1 . ARG B 2 54  ? 47.427  -3.096  34.957  1.00 25.20  ? 54  ARG B NH1 1 
ATOM 1986 N NH2 . ARG B 2 54  ? 49.227  -1.930  35.779  1.00 29.38  ? 54  ARG B NH2 1 
ATOM 1987 N N   . ALA B 2 55  ? 48.584  -2.888  28.450  1.00 37.47  ? 55  ALA B N   1 
ATOM 1988 C CA  . ALA B 2 55  ? 49.268  -2.119  27.425  1.00 23.35  ? 55  ALA B CA  1 
ATOM 1989 C C   . ALA B 2 55  ? 50.014  -0.955  28.063  1.00 37.53  ? 55  ALA B C   1 
ATOM 1990 O O   . ALA B 2 55  ? 49.698  -0.545  29.176  1.00 38.95  ? 55  ALA B O   1 
ATOM 1991 C CB  . ALA B 2 55  ? 48.289  -1.620  26.373  1.00 23.29  ? 55  ALA B CB  1 
ATOM 1992 N N   . THR B 2 56  ? 51.023  -0.444  27.367  1.00 39.44  ? 56  THR B N   1 
ATOM 1993 C CA  . THR B 2 56  ? 51.812  0.675   27.875  1.00 41.55  ? 56  THR B CA  1 
ATOM 1994 C C   . THR B 2 56  ? 50.982  1.946   27.930  1.00 40.28  ? 56  THR B C   1 
ATOM 1995 O O   . THR B 2 56  ? 50.041  2.110   27.155  1.00 38.00  ? 56  THR B O   1 
ATOM 1996 C CB  . THR B 2 56  ? 53.056  0.946   27.009  1.00 39.73  ? 56  THR B CB  1 
ATOM 1997 O OG1 . THR B 2 56  ? 52.650  1.402   25.713  1.00 41.75  ? 56  THR B OG1 1 
ATOM 1998 C CG2 . THR B 2 56  ? 53.899  -0.308  26.864  1.00 25.40  ? 56  THR B CG2 1 
ATOM 1999 N N   . GLY B 2 57  ? 51.340  2.841   28.845  1.00 47.59  ? 57  GLY B N   1 
ATOM 2000 C CA  . GLY B 2 57  ? 50.652  4.112   28.992  1.00 48.15  ? 57  GLY B CA  1 
ATOM 2001 C C   . GLY B 2 57  ? 49.159  3.943   29.192  1.00 52.82  ? 57  GLY B C   1 
ATOM 2002 O O   . GLY B 2 57  ? 48.369  4.812   28.830  1.00 47.65  ? 57  GLY B O   1 
ATOM 2003 N N   . ILE B 2 58  ? 48.780  2.795   29.741  1.00 29.22  ? 58  ILE B N   1 
ATOM 2004 C CA  . ILE B 2 58  ? 47.393  2.490   30.055  1.00 36.82  ? 58  ILE B CA  1 
ATOM 2005 C C   . ILE B 2 58  ? 47.174  2.501   31.560  1.00 41.91  ? 58  ILE B C   1 
ATOM 2006 O O   . ILE B 2 58  ? 47.886  1.809   32.286  1.00 49.34  ? 58  ILE B O   1 
ATOM 2007 C CB  . ILE B 2 58  ? 46.982  1.126   29.491  1.00 28.70  ? 58  ILE B CB  1 
ATOM 2008 C CG1 . ILE B 2 58  ? 46.937  1.182   27.966  1.00 42.50  ? 58  ILE B CG1 1 
ATOM 2009 C CG2 . ILE B 2 58  ? 45.624  0.716   30.025  1.00 28.77  ? 58  ILE B CG2 1 
ATOM 2010 C CD1 . ILE B 2 58  ? 45.910  2.126   27.426  1.00 41.58  ? 58  ILE B CD1 1 
ATOM 2011 N N   . PRO B 2 59  ? 46.182  3.278   32.024  1.00 35.04  ? 59  PRO B N   1 
ATOM 2012 C CA  . PRO B 2 59  ? 45.856  3.492   33.440  1.00 37.07  ? 59  PRO B CA  1 
ATOM 2013 C C   . PRO B 2 59  ? 45.786  2.203   34.265  1.00 37.55  ? 59  PRO B C   1 
ATOM 2014 O O   . PRO B 2 59  ? 45.354  1.163   33.766  1.00 26.27  ? 59  PRO B O   1 
ATOM 2015 C CB  . PRO B 2 59  ? 44.482  4.151   33.371  1.00 42.75  ? 59  PRO B CB  1 
ATOM 2016 C CG  . PRO B 2 59  ? 44.535  4.945   32.119  1.00 46.34  ? 59  PRO B CG  1 
ATOM 2017 C CD  . PRO B 2 59  ? 45.343  4.112   31.143  1.00 39.68  ? 59  PRO B CD  1 
ATOM 2018 N N   . ALA B 2 60  ? 46.218  2.287   35.520  1.00 39.63  ? 60  ALA B N   1 
ATOM 2019 C CA  . ALA B 2 60  ? 46.322  1.125   36.400  1.00 25.03  ? 60  ALA B CA  1 
ATOM 2020 C C   . ALA B 2 60  ? 44.968  0.535   36.777  1.00 25.13  ? 60  ALA B C   1 
ATOM 2021 O O   . ALA B 2 60  ? 44.879  -0.635  37.152  1.00 25.00  ? 60  ALA B O   1 
ATOM 2022 C CB  . ALA B 2 60  ? 47.090  1.495   37.660  1.00 25.57  ? 60  ALA B CB  1 
ATOM 2023 N N   . ARG B 2 61  ? 43.919  1.347   36.686  1.00 28.86  ? 61  ARG B N   1 
ATOM 2024 C CA  . ARG B 2 61  ? 42.576  0.898   37.038  1.00 40.85  ? 61  ARG B CA  1 
ATOM 2025 C C   . ARG B 2 61  ? 42.079  -0.172  36.070  1.00 45.12  ? 61  ARG B C   1 
ATOM 2026 O O   . ARG B 2 61  ? 41.177  -0.949  36.391  1.00 28.65  ? 61  ARG B O   1 
ATOM 2027 C CB  . ARG B 2 61  ? 41.600  2.077   37.058  1.00 43.70  ? 61  ARG B CB  1 
ATOM 2028 C CG  . ARG B 2 61  ? 41.384  2.736   35.708  1.00 41.37  ? 61  ARG B CG  1 
ATOM 2029 C CD  . ARG B 2 61  ? 40.253  3.752   35.770  1.00 44.29  ? 61  ARG B CD  1 
ATOM 2030 N NE  . ARG B 2 61  ? 40.112  4.506   34.528  1.00 29.79  ? 61  ARG B NE  1 
ATOM 2031 C CZ  . ARG B 2 61  ? 40.977  5.421   34.104  1.00 43.94  ? 61  ARG B CZ  1 
ATOM 2032 N NH1 . ARG B 2 61  ? 42.045  5.719   34.830  1.00 40.22  ? 61  ARG B NH1 1 
ATOM 2033 N NH2 . ARG B 2 61  ? 40.766  6.051   32.957  1.00 50.37  ? 61  ARG B NH2 1 
ATOM 2034 N N   . PHE B 2 62  ? 42.673  -0.202  34.882  1.00 43.33  ? 62  PHE B N   1 
ATOM 2035 C CA  . PHE B 2 62  ? 42.334  -1.204  33.884  1.00 45.69  ? 62  PHE B CA  1 
ATOM 2036 C C   . PHE B 2 62  ? 43.063  -2.506  34.165  1.00 26.76  ? 62  PHE B C   1 
ATOM 2037 O O   . PHE B 2 62  ? 44.259  -2.510  34.462  1.00 26.68  ? 62  PHE B O   1 
ATOM 2038 C CB  . PHE B 2 62  ? 42.676  -0.706  32.483  1.00 26.61  ? 62  PHE B CB  1 
ATOM 2039 C CG  . PHE B 2 62  ? 41.719  0.319   31.956  1.00 32.28  ? 62  PHE B CG  1 
ATOM 2040 C CD1 . PHE B 2 62  ? 40.497  -0.060  31.433  1.00 31.94  ? 62  PHE B CD1 1 
ATOM 2041 C CD2 . PHE B 2 62  ? 42.038  1.664   31.992  1.00 34.24  ? 62  PHE B CD2 1 
ATOM 2042 C CE1 . PHE B 2 62  ? 39.615  0.881   30.947  1.00 33.12  ? 62  PHE B CE1 1 
ATOM 2043 C CE2 . PHE B 2 62  ? 41.158  2.611   31.509  1.00 36.38  ? 62  PHE B CE2 1 
ATOM 2044 C CZ  . PHE B 2 62  ? 39.945  2.217   30.986  1.00 36.20  ? 62  PHE B CZ  1 
ATOM 2045 N N   . SER B 2 63  ? 42.334  -3.612  34.071  1.00 35.01  ? 63  SER B N   1 
ATOM 2046 C CA  . SER B 2 63  ? 42.922  -4.923  34.295  1.00 32.10  ? 63  SER B CA  1 
ATOM 2047 C C   . SER B 2 63  ? 42.124  -6.021  33.608  1.00 28.56  ? 63  SER B C   1 
ATOM 2048 O O   . SER B 2 63  ? 41.078  -5.768  33.007  1.00 28.61  ? 63  SER B O   1 
ATOM 2049 C CB  . SER B 2 63  ? 43.029  -5.207  35.795  1.00 29.06  ? 63  SER B CB  1 
ATOM 2050 O OG  . SER B 2 63  ? 41.778  -5.041  36.439  1.00 31.42  ? 63  SER B OG  1 
ATOM 2051 N N   . GLY B 2 64  ? 42.624  -7.246  33.715  1.00 32.99  ? 64  GLY B N   1 
ATOM 2052 C CA  . GLY B 2 64  ? 42.010  -8.381  33.058  1.00 32.52  ? 64  GLY B CA  1 
ATOM 2053 C C   . GLY B 2 64  ? 42.277  -9.665  33.815  1.00 33.92  ? 64  GLY B C   1 
ATOM 2054 O O   . GLY B 2 64  ? 43.103  -9.702  34.722  1.00 34.02  ? 64  GLY B O   1 
ATOM 2055 N N   . SER B 2 65  ? 41.577  -10.724 33.429  1.00 34.85  ? 65  SER B N   1 
ATOM 2056 C CA  . SER B 2 65  ? 41.729  -12.029 34.056  1.00 40.33  ? 65  SER B CA  1 
ATOM 2057 C C   . SER B 2 65  ? 41.184  -13.115 33.143  1.00 27.72  ? 65  SER B C   1 
ATOM 2058 O O   . SER B 2 65  ? 40.877  -12.868 31.974  1.00 30.57  ? 65  SER B O   1 
ATOM 2059 C CB  . SER B 2 65  ? 41.016  -12.077 35.406  1.00 63.55  ? 65  SER B CB  1 
ATOM 2060 O OG  . SER B 2 65  ? 41.213  -13.336 36.031  1.00 77.12  ? 65  SER B OG  1 
ATOM 2061 N N   . GLY B 2 66  ? 41.069  -14.321 33.685  1.00 28.10  ? 66  GLY B N   1 
ATOM 2062 C CA  . GLY B 2 66  ? 40.497  -15.429 32.949  1.00 28.50  ? 66  GLY B CA  1 
ATOM 2063 C C   . GLY B 2 66  ? 41.541  -16.086 32.077  1.00 36.38  ? 66  GLY B C   1 
ATOM 2064 O O   . GLY B 2 66  ? 42.579  -15.486 31.783  1.00 41.26  ? 66  GLY B O   1 
ATOM 2065 N N   . SER B 2 67  ? 41.277  -17.328 31.685  1.00 41.51  ? 67  SER B N   1 
ATOM 2066 C CA  . SER B 2 67  ? 42.233  -18.097 30.904  1.00 44.88  ? 67  SER B CA  1 
ATOM 2067 C C   . SER B 2 67  ? 41.497  -19.201 30.160  1.00 55.23  ? 67  SER B C   1 
ATOM 2068 O O   . SER B 2 67  ? 40.358  -19.523 30.510  1.00 58.58  ? 67  SER B O   1 
ATOM 2069 C CB  . SER B 2 67  ? 43.323  -18.660 31.818  1.00 45.98  ? 67  SER B CB  1 
ATOM 2070 O OG  . SER B 2 67  ? 44.111  -19.627 31.158  1.00 45.56  ? 67  SER B OG  1 
ATOM 2071 N N   . GLY B 2 68  ? 42.125  -19.789 29.144  1.00 47.65  ? 68  GLY B N   1 
ATOM 2072 C CA  . GLY B 2 68  ? 41.431  -20.819 28.402  1.00 49.92  ? 68  GLY B CA  1 
ATOM 2073 C C   . GLY B 2 68  ? 40.257  -20.230 27.640  1.00 44.73  ? 68  GLY B C   1 
ATOM 2074 O O   . GLY B 2 68  ? 40.402  -19.472 26.668  1.00 42.29  ? 68  GLY B O   1 
ATOM 2075 N N   . THR B 2 69  ? 39.081  -20.689 28.051  1.00 59.85  ? 69  THR B N   1 
ATOM 2076 C CA  . THR B 2 69  ? 37.792  -20.303 27.484  1.00 56.57  ? 69  THR B CA  1 
ATOM 2077 C C   . THR B 2 69  ? 37.264  -18.902 27.903  1.00 50.02  ? 69  THR B C   1 
ATOM 2078 O O   . THR B 2 69  ? 37.061  -18.035 27.047  1.00 52.91  ? 69  THR B O   1 
ATOM 2079 C CB  . THR B 2 69  ? 36.741  -21.372 27.855  1.00 52.27  ? 69  THR B CB  1 
ATOM 2080 O OG1 . THR B 2 69  ? 36.796  -21.626 29.264  1.00 58.14  ? 69  THR B OG1 1 
ATOM 2081 C CG2 . THR B 2 69  ? 37.047  -22.679 27.123  1.00 41.33  ? 69  THR B CG2 1 
ATOM 2082 N N   . ASP B 2 70  ? 37.018  -18.696 29.199  1.00 44.10  ? 70  ASP B N   1 
ATOM 2083 C CA  . ASP B 2 70  ? 36.425  -17.447 29.706  1.00 47.73  ? 70  ASP B CA  1 
ATOM 2084 C C   . ASP B 2 70  ? 37.446  -16.446 30.260  1.00 35.27  ? 70  ASP B C   1 
ATOM 2085 O O   . ASP B 2 70  ? 38.390  -16.828 30.944  1.00 35.24  ? 70  ASP B O   1 
ATOM 2086 C CB  . ASP B 2 70  ? 35.407  -17.768 30.797  1.00 54.73  ? 70  ASP B CB  1 
ATOM 2087 C CG  . ASP B 2 70  ? 34.436  -18.845 30.378  1.00 64.22  ? 70  ASP B CG  1 
ATOM 2088 O OD1 . ASP B 2 70  ? 34.198  -18.975 29.158  1.00 71.30  ? 70  ASP B OD1 1 
ATOM 2089 O OD2 . ASP B 2 70  ? 33.928  -19.569 31.261  1.00 52.86  ? 70  ASP B OD2 1 
ATOM 2090 N N   . PHE B 2 71  ? 37.231  -15.163 29.967  1.00 32.37  ? 71  PHE B N   1 
ATOM 2091 C CA  . PHE B 2 71  ? 38.100  -14.072 30.429  1.00 31.74  ? 71  PHE B CA  1 
ATOM 2092 C C   . PHE B 2 71  ? 37.280  -12.853 30.883  1.00 31.66  ? 71  PHE B C   1 
ATOM 2093 O O   . PHE B 2 71  ? 36.182  -12.612 30.377  1.00 31.86  ? 71  PHE B O   1 
ATOM 2094 C CB  . PHE B 2 71  ? 39.061  -13.610 29.327  1.00 31.15  ? 71  PHE B CB  1 
ATOM 2095 C CG  . PHE B 2 71  ? 39.798  -14.718 28.624  1.00 38.75  ? 71  PHE B CG  1 
ATOM 2096 C CD1 . PHE B 2 71  ? 39.153  -15.525 27.699  1.00 35.15  ? 71  PHE B CD1 1 
ATOM 2097 C CD2 . PHE B 2 71  ? 41.150  -14.914 28.843  1.00 41.92  ? 71  PHE B CD2 1 
ATOM 2098 C CE1 . PHE B 2 71  ? 39.823  -16.523 27.044  1.00 37.81  ? 71  PHE B CE1 1 
ATOM 2099 C CE2 . PHE B 2 71  ? 41.826  -15.913 28.180  1.00 43.61  ? 71  PHE B CE2 1 
ATOM 2100 C CZ  . PHE B 2 71  ? 41.154  -16.713 27.279  1.00 41.14  ? 71  PHE B CZ  1 
ATOM 2101 N N   . THR B 2 72  ? 37.822  -12.072 31.817  1.00 25.25  ? 72  THR B N   1 
ATOM 2102 C CA  . THR B 2 72  ? 37.157  -10.845 32.270  1.00 25.24  ? 72  THR B CA  1 
ATOM 2103 C C   . THR B 2 72  ? 38.053  -9.591  32.259  1.00 24.71  ? 72  THR B C   1 
ATOM 2104 O O   . THR B 2 72  ? 39.040  -9.543  32.984  1.00 38.96  ? 72  THR B O   1 
ATOM 2105 C CB  . THR B 2 72  ? 36.599  -11.006 33.716  1.00 45.21  ? 72  THR B CB  1 
ATOM 2106 O OG1 . THR B 2 72  ? 37.629  -10.721 34.669  1.00 51.92  ? 72  THR B OG1 1 
ATOM 2107 C CG2 . THR B 2 72  ? 36.066  -12.413 33.973  1.00 40.91  ? 72  THR B CG2 1 
ATOM 2108 N N   . LEU B 2 73  ? 37.717  -8.588  31.442  1.00 24.75  ? 73  LEU B N   1 
ATOM 2109 C CA  . LEU B 2 73  ? 38.276  -7.231  31.612  1.00 24.47  ? 73  LEU B CA  1 
ATOM 2110 C C   . LEU B 2 73  ? 37.640  -6.557  32.836  1.00 24.91  ? 73  LEU B C   1 
ATOM 2111 O O   . LEU B 2 73  ? 36.430  -6.661  33.027  1.00 49.73  ? 73  LEU B O   1 
ATOM 2112 C CB  . LEU B 2 73  ? 38.042  -6.360  30.352  1.00 24.19  ? 73  LEU B CB  1 
ATOM 2113 C CG  . LEU B 2 73  ? 38.602  -4.924  30.233  1.00 41.69  ? 73  LEU B CG  1 
ATOM 2114 C CD1 . LEU B 2 73  ? 38.814  -4.482  28.785  1.00 47.24  ? 73  LEU B CD1 1 
ATOM 2115 C CD2 . LEU B 2 73  ? 37.722  -3.899  30.941  1.00 40.99  ? 73  LEU B CD2 1 
ATOM 2116 N N   . THR B 2 74  ? 38.436  -5.852  33.644  1.00 26.93  ? 74  THR B N   1 
ATOM 2117 C CA  . THR B 2 74  ? 37.890  -5.061  34.754  1.00 27.43  ? 74  THR B CA  1 
ATOM 2118 C C   . THR B 2 74  ? 38.394  -3.609  34.849  1.00 43.17  ? 74  THR B C   1 
ATOM 2119 O O   . THR B 2 74  ? 39.577  -3.321  34.638  1.00 41.93  ? 74  THR B O   1 
ATOM 2120 C CB  . THR B 2 74  ? 38.160  -5.746  36.123  1.00 38.50  ? 74  THR B CB  1 
ATOM 2121 O OG1 . THR B 2 74  ? 39.568  -5.893  36.337  1.00 45.01  ? 74  THR B OG1 1 
ATOM 2122 C CG2 . THR B 2 74  ? 37.501  -7.097  36.217  1.00 35.04  ? 74  THR B CG2 1 
ATOM 2123 N N   . ILE B 2 75  ? 37.464  -2.709  35.167  1.00 46.74  ? 75  ILE B N   1 
ATOM 2124 C CA  . ILE B 2 75  ? 37.764  -1.316  35.478  1.00 44.65  ? 75  ILE B CA  1 
ATOM 2125 C C   . ILE B 2 75  ? 37.377  -1.011  36.926  1.00 48.92  ? 75  ILE B C   1 
ATOM 2126 O O   . ILE B 2 75  ? 36.188  -0.925  37.239  1.00 49.84  ? 75  ILE B O   1 
ATOM 2127 C CB  . ILE B 2 75  ? 37.002  -0.369  34.532  1.00 39.36  ? 75  ILE B CB  1 
ATOM 2128 C CG1 . ILE B 2 75  ? 37.321  -0.711  33.071  1.00 29.86  ? 75  ILE B CG1 1 
ATOM 2129 C CG2 . ILE B 2 75  ? 37.340  1.084   34.842  1.00 38.32  ? 75  ILE B CG2 1 
ATOM 2130 C CD1 . ILE B 2 75  ? 36.425  -0.027  32.059  1.00 35.90  ? 75  ILE B CD1 1 
ATOM 2131 N N   . SER B 2 76  ? 38.365  -0.826  37.801  1.00 47.47  ? 76  SER B N   1 
ATOM 2132 C CA  . SER B 2 76  ? 38.085  -0.632  39.230  1.00 45.18  ? 76  SER B CA  1 
ATOM 2133 C C   . SER B 2 76  ? 37.222  0.598   39.527  1.00 55.29  ? 76  SER B C   1 
ATOM 2134 O O   . SER B 2 76  ? 36.046  0.481   39.864  1.00 65.07  ? 76  SER B O   1 
ATOM 2135 C CB  . SER B 2 76  ? 39.388  -0.536  40.028  1.00 44.53  ? 76  SER B CB  1 
ATOM 2136 O OG  . SER B 2 76  ? 40.333  0.302   39.391  1.00 42.00  ? 76  SER B OG  1 
ATOM 2137 N N   . SER B 2 77  ? 37.811  1.781   39.381  1.00 49.71  ? 77  SER B N   1 
ATOM 2138 C CA  . SER B 2 77  ? 37.063  3.020   39.554  1.00 48.15  ? 77  SER B CA  1 
ATOM 2139 C C   . SER B 2 77  ? 36.778  3.559   38.178  1.00 41.09  ? 77  SER B C   1 
ATOM 2140 O O   . SER B 2 77  ? 37.681  4.034   37.495  1.00 36.71  ? 77  SER B O   1 
ATOM 2141 C CB  . SER B 2 77  ? 37.835  4.047   40.391  1.00 53.38  ? 77  SER B CB  1 
ATOM 2142 O OG  . SER B 2 77  ? 37.110  5.264   40.496  1.00 54.24  ? 77  SER B OG  1 
ATOM 2143 N N   . LEU B 2 78  ? 35.520  3.468   37.767  1.00 44.29  ? 78  LEU B N   1 
ATOM 2144 C CA  . LEU B 2 78  ? 35.151  3.871   36.422  1.00 42.15  ? 78  LEU B CA  1 
ATOM 2145 C C   . LEU B 2 78  ? 35.315  5.378   36.280  1.00 40.19  ? 78  LEU B C   1 
ATOM 2146 O O   . LEU B 2 78  ? 35.194  6.122   37.255  1.00 35.91  ? 78  LEU B O   1 
ATOM 2147 C CB  . LEU B 2 78  ? 33.717  3.454   36.104  1.00 38.38  ? 78  LEU B CB  1 
ATOM 2148 C CG  . LEU B 2 78  ? 33.274  3.571   34.644  1.00 40.44  ? 78  LEU B CG  1 
ATOM 2149 C CD1 . LEU B 2 78  ? 34.072  2.627   33.750  1.00 37.57  ? 78  LEU B CD1 1 
ATOM 2150 C CD2 . LEU B 2 78  ? 31.787  3.311   34.522  1.00 41.12  ? 78  LEU B CD2 1 
ATOM 2151 N N   . GLU B 2 79  ? 35.616  5.822   35.066  1.00 30.35  ? 79  GLU B N   1 
ATOM 2152 C CA  . GLU B 2 79  ? 35.795  7.238   34.808  1.00 30.84  ? 79  GLU B CA  1 
ATOM 2153 C C   . GLU B 2 79  ? 35.033  7.639   33.548  1.00 38.13  ? 79  GLU B C   1 
ATOM 2154 O O   . GLU B 2 79  ? 34.871  6.831   32.635  1.00 30.08  ? 79  GLU B O   1 
ATOM 2155 C CB  . GLU B 2 79  ? 37.286  7.573   34.699  1.00 30.53  ? 79  GLU B CB  1 
ATOM 2156 C CG  . GLU B 2 79  ? 37.943  7.813   36.048  1.00 42.04  ? 79  GLU B CG  1 
ATOM 2157 C CD  . GLU B 2 79  ? 39.242  8.587   35.930  1.00 54.35  ? 79  GLU B CD  1 
ATOM 2158 O OE1 . GLU B 2 79  ? 39.267  9.580   35.172  1.00 60.47  ? 79  GLU B OE1 1 
ATOM 2159 O OE2 . GLU B 2 79  ? 40.232  8.213   36.597  1.00 60.16  ? 79  GLU B OE2 1 
ATOM 2160 N N   . PRO B 2 80  ? 34.542  8.890   33.508  1.00 44.52  ? 80  PRO B N   1 
ATOM 2161 C CA  . PRO B 2 80  ? 33.700  9.409   32.421  1.00 42.29  ? 80  PRO B CA  1 
ATOM 2162 C C   . PRO B 2 80  ? 34.336  9.211   31.046  1.00 38.49  ? 80  PRO B C   1 
ATOM 2163 O O   . PRO B 2 80  ? 33.641  9.080   30.036  1.00 34.64  ? 80  PRO B O   1 
ATOM 2164 C CB  . PRO B 2 80  ? 33.569  10.898  32.766  1.00 42.93  ? 80  PRO B CB  1 
ATOM 2165 C CG  . PRO B 2 80  ? 34.749  11.188  33.649  1.00 45.09  ? 80  PRO B CG  1 
ATOM 2166 C CD  . PRO B 2 80  ? 34.886  9.949   34.471  1.00 42.99  ? 80  PRO B CD  1 
ATOM 2167 N N   . GLU B 2 81  ? 35.663  9.186   31.031  1.00 43.34  ? 81  GLU B N   1 
ATOM 2168 C CA  . GLU B 2 81  ? 36.439  8.881   29.839  1.00 43.48  ? 81  GLU B CA  1 
ATOM 2169 C C   . GLU B 2 81  ? 36.213  7.440   29.374  1.00 42.80  ? 81  GLU B C   1 
ATOM 2170 O O   . GLU B 2 81  ? 36.187  7.159   28.174  1.00 45.26  ? 81  GLU B O   1 
ATOM 2171 C CB  . GLU B 2 81  ? 37.920  9.117   30.131  1.00 44.35  ? 81  GLU B CB  1 
ATOM 2172 C CG  . GLU B 2 81  ? 38.862  8.773   29.009  1.00 57.12  ? 81  GLU B CG  1 
ATOM 2173 C CD  . GLU B 2 81  ? 40.306  8.804   29.461  1.00 78.39  ? 81  GLU B CD  1 
ATOM 2174 O OE1 . GLU B 2 81  ? 40.714  9.805   30.091  1.00 78.78  ? 81  GLU B OE1 1 
ATOM 2175 O OE2 . GLU B 2 81  ? 41.027  7.818   29.198  1.00 87.41  ? 81  GLU B OE2 1 
ATOM 2176 N N   . ASP B 2 82  ? 36.037  6.536   30.334  1.00 47.53  ? 82  ASP B N   1 
ATOM 2177 C CA  . ASP B 2 82  ? 35.951  5.102   30.059  1.00 37.06  ? 82  ASP B CA  1 
ATOM 2178 C C   . ASP B 2 82  ? 34.643  4.648   29.412  1.00 30.19  ? 82  ASP B C   1 
ATOM 2179 O O   . ASP B 2 82  ? 34.479  3.454   29.138  1.00 29.78  ? 82  ASP B O   1 
ATOM 2180 C CB  . ASP B 2 82  ? 36.184  4.307   31.347  1.00 36.64  ? 82  ASP B CB  1 
ATOM 2181 C CG  . ASP B 2 82  ? 37.509  4.637   31.999  1.00 34.77  ? 82  ASP B CG  1 
ATOM 2182 O OD1 . ASP B 2 82  ? 38.482  4.895   31.258  1.00 34.15  ? 82  ASP B OD1 1 
ATOM 2183 O OD2 . ASP B 2 82  ? 37.580  4.625   33.246  1.00 30.54  ? 82  ASP B OD2 1 
ATOM 2184 N N   . PHE B 2 83  ? 33.705  5.566   29.183  1.00 28.09  ? 83  PHE B N   1 
ATOM 2185 C CA  . PHE B 2 83  ? 32.434  5.152   28.595  1.00 37.57  ? 83  PHE B CA  1 
ATOM 2186 C C   . PHE B 2 83  ? 32.580  5.026   27.086  1.00 40.95  ? 83  PHE B C   1 
ATOM 2187 O O   . PHE B 2 83  ? 32.738  6.015   26.368  1.00 40.79  ? 83  PHE B O   1 
ATOM 2188 C CB  . PHE B 2 83  ? 31.324  6.153   28.915  1.00 29.11  ? 83  PHE B CB  1 
ATOM 2189 C CG  . PHE B 2 83  ? 30.829  6.079   30.327  1.00 29.71  ? 83  PHE B CG  1 
ATOM 2190 C CD1 . PHE B 2 83  ? 30.133  4.970   30.776  1.00 46.84  ? 83  PHE B CD1 1 
ATOM 2191 C CD2 . PHE B 2 83  ? 31.056  7.123   31.207  1.00 30.36  ? 83  PHE B CD2 1 
ATOM 2192 C CE1 . PHE B 2 83  ? 29.676  4.904   32.075  1.00 49.51  ? 83  PHE B CE1 1 
ATOM 2193 C CE2 . PHE B 2 83  ? 30.602  7.061   32.509  1.00 31.00  ? 83  PHE B CE2 1 
ATOM 2194 C CZ  . PHE B 2 83  ? 29.912  5.950   32.942  1.00 31.00  ? 83  PHE B CZ  1 
ATOM 2195 N N   . ALA B 2 84  ? 32.462  3.788   26.620  1.00 40.55  ? 84  ALA B N   1 
ATOM 2196 C CA  . ALA B 2 84  ? 32.819  3.432   25.260  1.00 40.80  ? 84  ALA B CA  1 
ATOM 2197 C C   . ALA B 2 84  ? 32.377  1.999   24.975  1.00 25.26  ? 84  ALA B C   1 
ATOM 2198 O O   . ALA B 2 84  ? 31.728  1.360   25.807  1.00 25.51  ? 84  ALA B O   1 
ATOM 2199 C CB  . ALA B 2 84  ? 34.321  3.592   25.048  1.00 25.00  ? 84  ALA B CB  1 
ATOM 2200 N N   . VAL B 2 85  ? 32.736  1.493   23.804  1.00 34.48  ? 85  VAL B N   1 
ATOM 2201 C CA  . VAL B 2 85  ? 32.428  0.115   23.450  1.00 38.70  ? 85  VAL B CA  1 
ATOM 2202 C C   . VAL B 2 85  ? 33.692  -0.734  23.557  1.00 45.76  ? 85  VAL B C   1 
ATOM 2203 O O   . VAL B 2 85  ? 34.766  -0.302  23.139  1.00 24.93  ? 85  VAL B O   1 
ATOM 2204 C CB  . VAL B 2 85  ? 31.845  0.016   22.030  1.00 25.86  ? 85  VAL B CB  1 
ATOM 2205 C CG1 . VAL B 2 85  ? 31.396  -1.404  21.739  1.00 25.90  ? 85  VAL B CG1 1 
ATOM 2206 C CG2 . VAL B 2 85  ? 30.687  0.989   21.868  1.00 26.41  ? 85  VAL B CG2 1 
ATOM 2207 N N   . TYR B 2 86  ? 33.567  -1.934  24.121  1.00 51.89  ? 86  TYR B N   1 
ATOM 2208 C CA  . TYR B 2 86  ? 34.728  -2.794  24.361  1.00 25.46  ? 86  TYR B CA  1 
ATOM 2209 C C   . TYR B 2 86  ? 34.627  -4.147  23.638  1.00 25.45  ? 86  TYR B C   1 
ATOM 2210 O O   . TYR B 2 86  ? 33.693  -4.914  23.866  1.00 25.81  ? 86  TYR B O   1 
ATOM 2211 C CB  . TYR B 2 86  ? 34.912  -3.010  25.869  1.00 25.68  ? 86  TYR B CB  1 
ATOM 2212 C CG  . TYR B 2 86  ? 35.254  -1.740  26.620  1.00 25.63  ? 86  TYR B CG  1 
ATOM 2213 C CD1 . TYR B 2 86  ? 36.571  -1.408  26.903  1.00 25.32  ? 86  TYR B CD1 1 
ATOM 2214 C CD2 . TYR B 2 86  ? 34.257  -0.860  27.023  1.00 46.11  ? 86  TYR B CD2 1 
ATOM 2215 C CE1 . TYR B 2 86  ? 36.887  -0.243  27.584  1.00 25.49  ? 86  TYR B CE1 1 
ATOM 2216 C CE2 . TYR B 2 86  ? 34.564  0.311   27.701  1.00 46.52  ? 86  TYR B CE2 1 
ATOM 2217 C CZ  . TYR B 2 86  ? 35.881  0.613   27.978  1.00 40.63  ? 86  TYR B CZ  1 
ATOM 2218 O OH  . TYR B 2 86  ? 36.193  1.773   28.651  1.00 35.61  ? 86  TYR B OH  1 
ATOM 2219 N N   . TYR B 2 87  ? 35.599  -4.423  22.769  1.00 27.56  ? 87  TYR B N   1 
ATOM 2220 C CA  . TYR B 2 87  ? 35.673  -5.673  22.012  1.00 27.62  ? 87  TYR B CA  1 
ATOM 2221 C C   . TYR B 2 87  ? 36.826  -6.525  22.535  1.00 34.22  ? 87  TYR B C   1 
ATOM 2222 O O   . TYR B 2 87  ? 37.864  -5.979  22.882  1.00 31.14  ? 87  TYR B O   1 
ATOM 2223 C CB  . TYR B 2 87  ? 35.896  -5.401  20.514  1.00 39.45  ? 87  TYR B CB  1 
ATOM 2224 C CG  . TYR B 2 87  ? 34.995  -4.362  19.871  1.00 35.58  ? 87  TYR B CG  1 
ATOM 2225 C CD1 . TYR B 2 87  ? 35.153  -3.002  20.129  1.00 41.67  ? 87  TYR B CD1 1 
ATOM 2226 C CD2 . TYR B 2 87  ? 33.993  -4.745  18.994  1.00 42.21  ? 87  TYR B CD2 1 
ATOM 2227 C CE1 . TYR B 2 87  ? 34.328  -2.057  19.538  1.00 41.98  ? 87  TYR B CE1 1 
ATOM 2228 C CE2 . TYR B 2 87  ? 33.165  -3.810  18.400  1.00 38.06  ? 87  TYR B CE2 1 
ATOM 2229 C CZ  . TYR B 2 87  ? 33.338  -2.467  18.673  1.00 42.98  ? 87  TYR B CZ  1 
ATOM 2230 O OH  . TYR B 2 87  ? 32.520  -1.534  18.077  1.00 45.65  ? 87  TYR B OH  1 
ATOM 2231 N N   . CYS B 2 88  ? 36.693  -7.852  22.572  1.00 35.12  ? 88  CYS B N   1 
ATOM 2232 C CA  . CYS B 2 88  ? 37.903  -8.645  22.825  1.00 36.85  ? 88  CYS B CA  1 
ATOM 2233 C C   . CYS B 2 88  ? 38.465  -9.189  21.517  1.00 36.16  ? 88  CYS B C   1 
ATOM 2234 O O   . CYS B 2 88  ? 37.824  -9.077  20.477  1.00 37.49  ? 88  CYS B O   1 
ATOM 2235 C CB  . CYS B 2 88  ? 37.635  -9.779  23.845  1.00 22.71  ? 88  CYS B CB  1 
ATOM 2236 S SG  . CYS B 2 88  ? 36.323  -10.938 23.439  1.00 83.59  ? 88  CYS B SG  1 
ATOM 2237 N N   . GLN B 2 89  ? 39.656  -9.781  21.581  1.00 34.80  ? 89  GLN B N   1 
ATOM 2238 C CA  . GLN B 2 89  ? 40.260  -10.387 20.396  1.00 28.84  ? 89  GLN B CA  1 
ATOM 2239 C C   . GLN B 2 89  ? 41.198  -11.535 20.731  1.00 31.28  ? 89  GLN B C   1 
ATOM 2240 O O   . GLN B 2 89  ? 41.994  -11.436 21.659  1.00 33.62  ? 89  GLN B O   1 
ATOM 2241 C CB  . GLN B 2 89  ? 41.025  -9.333  19.580  1.00 26.29  ? 89  GLN B CB  1 
ATOM 2242 C CG  . GLN B 2 89  ? 41.800  -9.899  18.393  1.00 26.46  ? 89  GLN B CG  1 
ATOM 2243 C CD  . GLN B 2 89  ? 43.069  -9.118  18.090  1.00 44.70  ? 89  GLN B CD  1 
ATOM 2244 O OE1 . GLN B 2 89  ? 43.921  -8.929  18.963  1.00 37.22  ? 89  GLN B OE1 1 
ATOM 2245 N NE2 . GLN B 2 89  ? 43.203  -8.665  16.847  1.00 39.33  ? 89  GLN B NE2 1 
ATOM 2246 N N   . GLN B 2 90  ? 41.149  -12.596 19.931  1.00 28.90  ? 90  GLN B N   1 
ATOM 2247 C CA  . GLN B 2 90  ? 42.033  -13.737 20.131  1.00 40.79  ? 90  GLN B CA  1 
ATOM 2248 C C   . GLN B 2 90  ? 43.157  -13.786 19.088  1.00 35.62  ? 90  GLN B C   1 
ATOM 2249 O O   . GLN B 2 90  ? 42.914  -13.682 17.880  1.00 29.39  ? 90  GLN B O   1 
ATOM 2250 C CB  . GLN B 2 90  ? 41.214  -15.035 20.132  1.00 37.19  ? 90  GLN B CB  1 
ATOM 2251 C CG  . GLN B 2 90  ? 40.347  -15.267 18.900  1.00 38.65  ? 90  GLN B CG  1 
ATOM 2252 C CD  . GLN B 2 90  ? 40.965  -16.243 17.915  1.00 48.70  ? 90  GLN B CD  1 
ATOM 2253 O OE1 . GLN B 2 90  ? 42.183  -16.402 17.862  1.00 47.40  ? 90  GLN B OE1 1 
ATOM 2254 N NE2 . GLN B 2 90  ? 40.123  -16.881 17.108  1.00 52.26  ? 90  GLN B NE2 1 
ATOM 2255 N N   . SER B 2 91  ? 44.391  -13.892 19.579  1.00 27.95  ? 91  SER B N   1 
ATOM 2256 C CA  . SER B 2 91  ? 45.564  -14.095 18.733  1.00 27.47  ? 91  SER B CA  1 
ATOM 2257 C C   . SER B 2 91  ? 45.995  -15.569 18.633  1.00 43.05  ? 91  SER B C   1 
ATOM 2258 O O   . SER B 2 91  ? 47.039  -15.869 18.048  1.00 46.29  ? 91  SER B O   1 
ATOM 2259 C CB  . SER B 2 91  ? 46.731  -13.226 19.221  1.00 27.32  ? 91  SER B CB  1 
ATOM 2260 O OG  . SER B 2 91  ? 46.713  -13.037 20.629  1.00 80.81  ? 91  SER B OG  1 
ATOM 2261 N N   . SER B 2 92  ? 45.199  -16.471 19.208  1.00 44.75  ? 92  SER B N   1 
ATOM 2262 C CA  . SER B 2 92  ? 45.482  -17.913 19.200  1.00 46.04  ? 92  SER B CA  1 
ATOM 2263 C C   . SER B 2 92  ? 45.883  -18.445 17.828  1.00 47.75  ? 92  SER B C   1 
ATOM 2264 O O   . SER B 2 92  ? 46.986  -18.955 17.627  1.00 45.78  ? 92  SER B O   1 
ATOM 2265 C CB  . SER B 2 92  ? 44.262  -18.692 19.686  1.00 40.32  ? 92  SER B CB  1 
ATOM 2266 O OG  . SER B 2 92  ? 43.151  -18.468 18.840  1.00 40.14  ? 92  SER B OG  1 
ATOM 2267 N N   . ASN B 2 93  ? 44.953  -18.315 16.891  1.00 50.32  ? 93  ASN B N   1 
ATOM 2268 C CA  . ASN B 2 93  ? 45.083  -18.862 15.549  1.00 49.49  ? 93  ASN B CA  1 
ATOM 2269 C C   . ASN B 2 93  ? 44.425  -17.937 14.537  1.00 40.24  ? 93  ASN B C   1 
ATOM 2270 O O   . ASN B 2 93  ? 44.136  -16.780 14.841  1.00 33.31  ? 93  ASN B O   1 
ATOM 2271 C CB  . ASN B 2 93  ? 44.466  -20.259 15.460  1.00 53.70  ? 93  ASN B CB  1 
ATOM 2272 C CG  . ASN B 2 93  ? 43.140  -20.352 16.164  1.00 53.15  ? 93  ASN B CG  1 
ATOM 2273 O OD1 . ASN B 2 93  ? 42.280  -19.490 16.001  1.00 59.52  ? 93  ASN B OD1 1 
ATOM 2274 N ND2 . ASN B 2 93  ? 42.960  -21.405 16.951  1.00 47.08  ? 93  ASN B ND2 1 
ATOM 2275 N N   . TRP B 2 94  ? 44.214  -18.444 13.327  1.00 38.65  ? 94  TRP B N   1 
ATOM 2276 C CA  . TRP B 2 94  ? 43.616  -17.652 12.261  1.00 31.07  ? 94  TRP B CA  1 
ATOM 2277 C C   . TRP B 2 94  ? 42.272  -18.220 11.822  1.00 40.87  ? 94  TRP B C   1 
ATOM 2278 O O   . TRP B 2 94  ? 42.045  -19.427 11.900  1.00 43.62  ? 94  TRP B O   1 
ATOM 2279 C CB  . TRP B 2 94  ? 44.585  -17.564 11.086  1.00 29.12  ? 94  TRP B CB  1 
ATOM 2280 C CG  . TRP B 2 94  ? 45.941  -17.198 11.565  1.00 28.77  ? 94  TRP B CG  1 
ATOM 2281 C CD1 . TRP B 2 94  ? 46.951  -18.049 11.903  1.00 29.78  ? 94  TRP B CD1 1 
ATOM 2282 C CD2 . TRP B 2 94  ? 46.430  -15.877 11.808  1.00 27.48  ? 94  TRP B CD2 1 
ATOM 2283 N NE1 . TRP B 2 94  ? 48.047  -17.337 12.318  1.00 29.28  ? 94  TRP B NE1 1 
ATOM 2284 C CE2 . TRP B 2 94  ? 47.752  -16.002 12.270  1.00 27.86  ? 94  TRP B CE2 1 
ATOM 2285 C CE3 . TRP B 2 94  ? 45.880  -14.600 11.667  1.00 48.56  ? 94  TRP B CE3 1 
ATOM 2286 C CZ2 . TRP B 2 94  ? 48.534  -14.898 12.593  1.00 27.24  ? 94  TRP B CZ2 1 
ATOM 2287 C CZ3 . TRP B 2 94  ? 46.659  -13.507 11.988  1.00 45.64  ? 94  TRP B CZ3 1 
ATOM 2288 C CH2 . TRP B 2 94  ? 47.971  -13.663 12.446  1.00 44.19  ? 94  TRP B CH2 1 
ATOM 2289 N N   . PRO B 2 95  ? 41.357  -17.342 11.390  1.00 45.33  ? 95  PRO B N   1 
ATOM 2290 C CA  . PRO B 2 95  ? 41.497  -15.882 11.415  1.00 47.13  ? 95  PRO B CA  1 
ATOM 2291 C C   . PRO B 2 95  ? 41.353  -15.306 12.827  1.00 44.35  ? 95  PRO B C   1 
ATOM 2292 O O   . PRO B 2 95  ? 40.593  -15.854 13.628  1.00 43.07  ? 95  PRO B O   1 
ATOM 2293 C CB  . PRO B 2 95  ? 40.358  -15.414 10.505  1.00 28.80  ? 95  PRO B CB  1 
ATOM 2294 C CG  . PRO B 2 95  ? 39.341  -16.488 10.598  1.00 30.22  ? 95  PRO B CG  1 
ATOM 2295 C CD  . PRO B 2 95  ? 40.122  -17.763 10.708  1.00 31.34  ? 95  PRO B CD  1 
ATOM 2296 N N   . ARG B 2 96  ? 42.105  -14.249 13.132  1.00 45.47  ? 96  ARG B N   1 
ATOM 2297 C CA  . ARG B 2 96  ? 41.912  -13.510 14.375  1.00 40.15  ? 96  ARG B CA  1 
ATOM 2298 C C   . ARG B 2 96  ? 40.444  -13.104 14.445  1.00 28.14  ? 96  ARG B C   1 
ATOM 2299 O O   . ARG B 2 96  ? 39.914  -12.564 13.481  1.00 30.52  ? 96  ARG B O   1 
ATOM 2300 C CB  . ARG B 2 96  ? 42.812  -12.268 14.436  1.00 37.46  ? 96  ARG B CB  1 
ATOM 2301 C CG  . ARG B 2 96  ? 44.298  -12.501 14.201  1.00 27.86  ? 96  ARG B CG  1 
ATOM 2302 C CD  . ARG B 2 96  ? 44.990  -13.098 15.414  1.00 43.97  ? 96  ARG B CD  1 
ATOM 2303 N NE  . ARG B 2 96  ? 46.421  -12.795 15.435  1.00 42.05  ? 96  ARG B NE  1 
ATOM 2304 C CZ  . ARG B 2 96  ? 46.932  -11.617 15.786  1.00 41.30  ? 96  ARG B CZ  1 
ATOM 2305 N NH1 . ARG B 2 96  ? 46.132  -10.631 16.170  1.00 37.69  ? 96  ARG B NH1 1 
ATOM 2306 N NH2 . ARG B 2 96  ? 48.245  -11.430 15.771  1.00 38.92  ? 96  ARG B NH2 1 
ATOM 2307 N N   . THR B 2 97  ? 39.769  -13.375 15.556  1.00 36.80  ? 97  THR B N   1 
ATOM 2308 C CA  . THR B 2 97  ? 38.350  -13.030 15.635  1.00 32.69  ? 97  THR B CA  1 
ATOM 2309 C C   . THR B 2 97  ? 38.018  -12.152 16.838  1.00 31.88  ? 97  THR B C   1 
ATOM 2310 O O   . THR B 2 97  ? 38.430  -12.428 17.964  1.00 31.93  ? 97  THR B O   1 
ATOM 2311 C CB  . THR B 2 97  ? 37.456  -14.293 15.673  1.00 35.99  ? 97  THR B CB  1 
ATOM 2312 O OG1 . THR B 2 97  ? 37.868  -15.148 16.746  1.00 29.54  ? 97  THR B OG1 1 
ATOM 2313 C CG2 . THR B 2 97  ? 37.534  -15.053 14.351  1.00 38.83  ? 97  THR B CG2 1 
ATOM 2314 N N   . PHE B 2 98  ? 37.269  -11.084 16.574  1.00 22.68  ? 98  PHE B N   1 
ATOM 2315 C CA  . PHE B 2 98  ? 36.809  -10.171 17.615  1.00 22.97  ? 98  PHE B CA  1 
ATOM 2316 C C   . PHE B 2 98  ? 35.491  -10.661 18.193  1.00 23.97  ? 98  PHE B C   1 
ATOM 2317 O O   . PHE B 2 98  ? 35.002  -11.722 17.821  1.00 49.14  ? 98  PHE B O   1 
ATOM 2318 C CB  . PHE B 2 98  ? 36.626  -8.754  17.064  1.00 23.06  ? 98  PHE B CB  1 
ATOM 2319 C CG  . PHE B 2 98  ? 37.881  -8.145  16.509  1.00 39.71  ? 98  PHE B CG  1 
ATOM 2320 C CD1 . PHE B 2 98  ? 38.973  -7.908  17.321  1.00 31.88  ? 98  PHE B CD1 1 
ATOM 2321 C CD2 . PHE B 2 98  ? 37.963  -7.806  15.170  1.00 30.81  ? 98  PHE B CD2 1 
ATOM 2322 C CE1 . PHE B 2 98  ? 40.124  -7.345  16.808  1.00 21.48  ? 98  PHE B CE1 1 
ATOM 2323 C CE2 . PHE B 2 98  ? 39.107  -7.247  14.655  1.00 41.16  ? 98  PHE B CE2 1 
ATOM 2324 C CZ  . PHE B 2 98  ? 40.189  -7.015  15.474  1.00 40.48  ? 98  PHE B CZ  1 
ATOM 2325 N N   . GLY B 2 99  ? 34.925  -9.886  19.111  1.00 35.61  ? 99  GLY B N   1 
ATOM 2326 C CA  . GLY B 2 99  ? 33.579  -10.131 19.595  1.00 36.02  ? 99  GLY B CA  1 
ATOM 2327 C C   . GLY B 2 99  ? 32.637  -9.087  19.028  1.00 36.87  ? 99  GLY B C   1 
ATOM 2328 O O   . GLY B 2 99  ? 33.071  -8.194  18.301  1.00 42.31  ? 99  GLY B O   1 
ATOM 2329 N N   . GLN B 2 100 ? 31.353  -9.188  19.364  1.00 29.56  ? 100 GLN B N   1 
ATOM 2330 C CA  . GLN B 2 100 ? 30.375  -8.186  18.946  1.00 42.71  ? 100 GLN B CA  1 
ATOM 2331 C C   . GLN B 2 100 ? 30.601  -6.898  19.725  1.00 40.01  ? 100 GLN B C   1 
ATOM 2332 O O   . GLN B 2 100 ? 30.204  -5.811  19.298  1.00 39.37  ? 100 GLN B O   1 
ATOM 2333 C CB  . GLN B 2 100 ? 28.941  -8.689  19.151  1.00 49.40  ? 100 GLN B CB  1 
ATOM 2334 C CG  . GLN B 2 100 ? 28.575  -8.996  20.597  1.00 59.15  ? 100 GLN B CG  1 
ATOM 2335 C CD  . GLN B 2 100 ? 28.869  -10.430 20.990  1.00 71.25  ? 100 GLN B CD  1 
ATOM 2336 O OE1 . GLN B 2 100 ? 30.024  -10.858 21.006  1.00 69.49  ? 100 GLN B OE1 1 
ATOM 2337 N NE2 . GLN B 2 100 ? 27.821  -11.181 21.315  1.00 77.31  ? 100 GLN B NE2 1 
ATOM 2338 N N   . GLY B 2 101 ? 31.239  -7.037  20.882  1.00 29.89  ? 101 GLY B N   1 
ATOM 2339 C CA  . GLY B 2 101 ? 31.557  -5.904  21.727  1.00 38.78  ? 101 GLY B CA  1 
ATOM 2340 C C   . GLY B 2 101 ? 30.513  -5.647  22.795  1.00 30.83  ? 101 GLY B C   1 
ATOM 2341 O O   . GLY B 2 101 ? 29.328  -5.921  22.606  1.00 31.58  ? 101 GLY B O   1 
ATOM 2342 N N   . THR B 2 102 ? 30.964  -5.127  23.930  1.00 30.95  ? 102 THR B N   1 
ATOM 2343 C CA  . THR B 2 102 ? 30.067  -4.700  24.992  1.00 28.69  ? 102 THR B CA  1 
ATOM 2344 C C   . THR B 2 102 ? 30.112  -3.180  25.044  1.00 34.43  ? 102 THR B C   1 
ATOM 2345 O O   . THR B 2 102 ? 31.173  -2.583  24.861  1.00 27.27  ? 102 THR B O   1 
ATOM 2346 C CB  . THR B 2 102 ? 30.459  -5.310  26.359  1.00 29.56  ? 102 THR B CB  1 
ATOM 2347 O OG1 . THR B 2 102 ? 30.295  -6.734  26.318  1.00 30.40  ? 102 THR B OG1 1 
ATOM 2348 C CG2 . THR B 2 102 ? 29.599  -4.743  27.479  1.00 30.61  ? 102 THR B CG2 1 
ATOM 2349 N N   . LYS B 2 103 ? 28.959  -2.557  25.258  1.00 38.79  ? 103 LYS B N   1 
ATOM 2350 C CA  . LYS B 2 103 ? 28.879  -1.107  25.348  1.00 39.32  ? 103 LYS B CA  1 
ATOM 2351 C C   . LYS B 2 103 ? 28.746  -0.671  26.795  1.00 29.40  ? 103 LYS B C   1 
ATOM 2352 O O   . LYS B 2 103 ? 27.810  -1.073  27.482  1.00 29.97  ? 103 LYS B O   1 
ATOM 2353 C CB  . LYS B 2 103 ? 27.694  -0.586  24.533  1.00 35.95  ? 103 LYS B CB  1 
ATOM 2354 C CG  . LYS B 2 103 ? 27.376  0.881   24.754  1.00 27.31  ? 103 LYS B CG  1 
ATOM 2355 C CD  . LYS B 2 103 ? 26.207  1.306   23.880  1.00 26.54  ? 103 LYS B CD  1 
ATOM 2356 C CE  . LYS B 2 103 ? 25.823  2.747   24.148  1.00 31.27  ? 103 LYS B CE  1 
ATOM 2357 N NZ  . LYS B 2 103 ? 26.733  3.669   23.420  1.00 33.20  ? 103 LYS B NZ  1 
ATOM 2358 N N   . VAL B 2 104 ? 29.679  0.148   27.267  1.00 33.45  ? 104 VAL B N   1 
ATOM 2359 C CA  . VAL B 2 104 ? 29.544  0.688   28.610  1.00 31.22  ? 104 VAL B CA  1 
ATOM 2360 C C   . VAL B 2 104 ? 28.803  2.016   28.548  1.00 34.04  ? 104 VAL B C   1 
ATOM 2361 O O   . VAL B 2 104 ? 29.285  3.010   28.005  1.00 32.22  ? 104 VAL B O   1 
ATOM 2362 C CB  . VAL B 2 104 ? 30.896  0.855   29.317  1.00 31.55  ? 104 VAL B CB  1 
ATOM 2363 C CG1 . VAL B 2 104 ? 30.680  1.371   30.730  1.00 32.01  ? 104 VAL B CG1 1 
ATOM 2364 C CG2 . VAL B 2 104 ? 31.620  -0.478  29.368  1.00 39.58  ? 104 VAL B CG2 1 
ATOM 2365 N N   . GLU B 2 105 ? 27.609  1.991   29.126  1.00 36.38  ? 105 GLU B N   1 
ATOM 2366 C CA  . GLU B 2 105 ? 26.630  3.059   29.019  1.00 30.64  ? 105 GLU B CA  1 
ATOM 2367 C C   . GLU B 2 105 ? 26.551  3.833   30.325  1.00 30.91  ? 105 GLU B C   1 
ATOM 2368 O O   . GLU B 2 105 ? 26.734  3.271   31.405  1.00 31.85  ? 105 GLU B O   1 
ATOM 2369 C CB  . GLU B 2 105 ? 25.258  2.477   28.655  1.00 30.74  ? 105 GLU B CB  1 
ATOM 2370 C CG  . GLU B 2 105 ? 24.164  3.500   28.437  1.00 49.91  ? 105 GLU B CG  1 
ATOM 2371 C CD  . GLU B 2 105 ? 22.777  2.904   28.528  1.00 57.88  ? 105 GLU B CD  1 
ATOM 2372 O OE1 . GLU B 2 105 ? 22.422  2.390   29.610  1.00 62.02  ? 105 GLU B OE1 1 
ATOM 2373 O OE2 . GLU B 2 105 ? 22.039  2.950   27.522  1.00 67.24  ? 105 GLU B OE2 1 
ATOM 2374 N N   . ILE B 2 106 ? 26.294  5.130   30.220  1.00 26.78  ? 106 ILE B N   1 
ATOM 2375 C CA  . ILE B 2 106 ? 26.136  5.957   31.400  1.00 26.96  ? 106 ILE B CA  1 
ATOM 2376 C C   . ILE B 2 106 ? 24.791  5.660   32.051  1.00 42.15  ? 106 ILE B C   1 
ATOM 2377 O O   . ILE B 2 106 ? 23.753  5.719   31.396  1.00 39.97  ? 106 ILE B O   1 
ATOM 2378 C CB  . ILE B 2 106 ? 26.240  7.449   31.053  1.00 25.93  ? 106 ILE B CB  1 
ATOM 2379 C CG1 . ILE B 2 106 ? 27.566  7.728   30.344  1.00 47.38  ? 106 ILE B CG1 1 
ATOM 2380 C CG2 . ILE B 2 106 ? 26.119  8.289   32.304  1.00 26.17  ? 106 ILE B CG2 1 
ATOM 2381 C CD1 . ILE B 2 106 ? 27.749  9.168   29.931  1.00 44.89  ? 106 ILE B CD1 1 
ATOM 2382 N N   . LYS B 2 107 ? 24.821  5.322   33.337  1.00 55.14  ? 107 LYS B N   1 
ATOM 2383 C CA  . LYS B 2 107 ? 23.607  5.004   34.087  1.00 48.14  ? 107 LYS B CA  1 
ATOM 2384 C C   . LYS B 2 107 ? 22.999  6.251   34.713  1.00 48.04  ? 107 LYS B C   1 
ATOM 2385 O O   . LYS B 2 107 ? 23.662  6.967   35.461  1.00 47.51  ? 107 LYS B O   1 
ATOM 2386 C CB  . LYS B 2 107 ? 23.905  3.971   35.176  1.00 48.50  ? 107 LYS B CB  1 
ATOM 2387 C CG  . LYS B 2 107 ? 22.853  3.849   36.273  1.00 50.36  ? 107 LYS B CG  1 
ATOM 2388 C CD  . LYS B 2 107 ? 21.509  3.365   35.747  1.00 52.64  ? 107 LYS B CD  1 
ATOM 2389 C CE  . LYS B 2 107 ? 20.587  2.981   36.898  1.00 46.59  ? 107 LYS B CE  1 
ATOM 2390 N NZ  . LYS B 2 107 ? 19.324  2.340   36.434  1.00 40.24  ? 107 LYS B NZ  1 
ATOM 2391 N N   . ARG B 2 108 ? 21.731  6.499   34.405  1.00 33.85  ? 108 ARG B N   1 
ATOM 2392 C CA  . ARG B 2 108 ? 21.015  7.639   34.956  1.00 42.86  ? 108 ARG B CA  1 
ATOM 2393 C C   . ARG B 2 108 ? 19.671  7.204   35.536  1.00 54.02  ? 108 ARG B C   1 
ATOM 2394 O O   . ARG B 2 108 ? 19.354  6.016   35.576  1.00 50.25  ? 108 ARG B O   1 
ATOM 2395 C CB  . ARG B 2 108 ? 20.802  8.711   33.885  1.00 44.96  ? 108 ARG B CB  1 
ATOM 2396 C CG  . ARG B 2 108 ? 19.615  8.430   32.981  1.00 43.13  ? 108 ARG B CG  1 
ATOM 2397 C CD  . ARG B 2 108 ? 19.426  9.491   31.921  1.00 41.97  ? 108 ARG B CD  1 
ATOM 2398 N NE  . ARG B 2 108 ? 19.108  10.815  32.455  1.00 41.21  ? 108 ARG B NE  1 
ATOM 2399 C CZ  . ARG B 2 108 ? 17.987  11.128  33.100  1.00 40.67  ? 108 ARG B CZ  1 
ATOM 2400 N NH1 . ARG B 2 108 ? 17.045  10.214  33.306  1.00 48.59  ? 108 ARG B NH1 1 
ATOM 2401 N NH2 . ARG B 2 108 ? 17.804  12.366  33.537  1.00 30.08  ? 108 ARG B NH2 1 
ATOM 2402 N N   . THR B 2 109 ? 18.892  8.180   35.989  1.00 52.99  ? 109 THR B N   1 
ATOM 2403 C CA  . THR B 2 109 ? 17.536  7.953   36.470  1.00 51.02  ? 109 THR B CA  1 
ATOM 2404 C C   . THR B 2 109 ? 16.629  7.528   35.319  1.00 46.62  ? 109 THR B C   1 
ATOM 2405 O O   . THR B 2 109 ? 16.949  7.764   34.158  1.00 43.72  ? 109 THR B O   1 
ATOM 2406 C CB  . THR B 2 109 ? 16.961  9.219   37.121  1.00 51.00  ? 109 THR B CB  1 
ATOM 2407 O OG1 . THR B 2 109 ? 16.474  10.101  36.102  1.00 54.55  ? 109 THR B OG1 1 
ATOM 2408 C CG2 . THR B 2 109 ? 18.033  9.932   37.929  1.00 43.39  ? 109 THR B CG2 1 
ATOM 2409 N N   . VAL B 2 110 ? 15.492  6.916   35.627  1.00 48.98  ? 110 VAL B N   1 
ATOM 2410 C CA  . VAL B 2 110 ? 14.623  6.417   34.566  1.00 49.00  ? 110 VAL B CA  1 
ATOM 2411 C C   . VAL B 2 110 ? 13.589  7.454   34.130  1.00 53.89  ? 110 VAL B C   1 
ATOM 2412 O O   . VAL B 2 110 ? 12.685  7.815   34.884  1.00 53.91  ? 110 VAL B O   1 
ATOM 2413 C CB  . VAL B 2 110 ? 13.897  5.130   34.996  1.00 50.55  ? 110 VAL B CB  1 
ATOM 2414 C CG1 . VAL B 2 110 ? 12.941  4.668   33.906  1.00 46.74  ? 110 VAL B CG1 1 
ATOM 2415 C CG2 . VAL B 2 110 ? 14.909  4.041   35.320  1.00 47.54  ? 110 VAL B CG2 1 
ATOM 2416 N N   . ALA B 2 111 ? 13.731  7.922   32.894  1.00 52.99  ? 111 ALA B N   1 
ATOM 2417 C CA  . ALA B 2 111 ? 12.829  8.924   32.343  1.00 47.62  ? 111 ALA B CA  1 
ATOM 2418 C C   . ALA B 2 111 ? 12.079  8.377   31.130  1.00 47.24  ? 111 ALA B C   1 
ATOM 2419 O O   . ALA B 2 111 ? 12.684  7.828   30.212  1.00 46.07  ? 111 ALA B O   1 
ATOM 2420 C CB  . ALA B 2 111 ? 13.600  10.180  31.973  1.00 37.75  ? 111 ALA B CB  1 
ATOM 2421 N N   . ALA B 2 112 ? 10.758  8.525   31.140  1.00 53.04  ? 112 ALA B N   1 
ATOM 2422 C CA  . ALA B 2 112 ? 9.906   8.034   30.059  1.00 43.80  ? 112 ALA B CA  1 
ATOM 2423 C C   . ALA B 2 112 ? 9.970   8.968   28.852  1.00 31.84  ? 112 ALA B C   1 
ATOM 2424 O O   . ALA B 2 112 ? 10.359  10.125  28.988  1.00 42.93  ? 112 ALA B O   1 
ATOM 2425 C CB  . ALA B 2 112 ? 8.475   7.887   30.551  1.00 33.15  ? 112 ALA B CB  1 
ATOM 2426 N N   . PRO B 2 113 ? 9.604   8.469   27.659  1.00 32.62  ? 113 PRO B N   1 
ATOM 2427 C CA  . PRO B 2 113 ? 9.753   9.331   26.481  1.00 43.04  ? 113 PRO B CA  1 
ATOM 2428 C C   . PRO B 2 113 ? 8.580   10.260  26.196  1.00 47.17  ? 113 PRO B C   1 
ATOM 2429 O O   . PRO B 2 113 ? 7.575   10.270  26.908  1.00 42.06  ? 113 PRO B O   1 
ATOM 2430 C CB  . PRO B 2 113 ? 9.916   8.321   25.343  1.00 32.08  ? 113 PRO B CB  1 
ATOM 2431 C CG  . PRO B 2 113 ? 9.094   7.158   25.788  1.00 32.80  ? 113 PRO B CG  1 
ATOM 2432 C CD  . PRO B 2 113 ? 9.323   7.072   27.281  1.00 33.15  ? 113 PRO B CD  1 
ATOM 2433 N N   . SER B 2 114 ? 8.745   11.050  25.141  1.00 60.84  ? 114 SER B N   1 
ATOM 2434 C CA  . SER B 2 114 ? 7.732   11.981  24.680  1.00 61.66  ? 114 SER B CA  1 
ATOM 2435 C C   . SER B 2 114 ? 7.388   11.534  23.280  1.00 59.96  ? 114 SER B C   1 
ATOM 2436 O O   . SER B 2 114 ? 8.283   11.430  22.437  1.00 58.05  ? 114 SER B O   1 
ATOM 2437 C CB  . SER B 2 114 ? 8.266   13.406  24.673  1.00 57.02  ? 114 SER B CB  1 
ATOM 2438 O OG  . SER B 2 114 ? 9.119   13.617  25.789  1.00 53.27  ? 114 SER B OG  1 
ATOM 2439 N N   . VAL B 2 115 ? 6.119   11.239  23.028  1.00 54.14  ? 115 VAL B N   1 
ATOM 2440 C CA  . VAL B 2 115 ? 5.752   10.682  21.736  1.00 53.35  ? 115 VAL B CA  1 
ATOM 2441 C C   . VAL B 2 115 ? 5.125   11.719  20.815  1.00 52.30  ? 115 VAL B C   1 
ATOM 2442 O O   . VAL B 2 115 ? 4.196   12.437  21.192  1.00 42.08  ? 115 VAL B O   1 
ATOM 2443 C CB  . VAL B 2 115 ? 4.803   9.506   21.895  1.00 48.60  ? 115 VAL B CB  1 
ATOM 2444 C CG1 . VAL B 2 115 ? 4.603   8.810   20.555  1.00 44.76  ? 115 VAL B CG1 1 
ATOM 2445 C CG2 . VAL B 2 115 ? 5.373   8.547   22.916  1.00 51.75  ? 115 VAL B CG2 1 
ATOM 2446 N N   . PHE B 2 116 ? 5.665   11.786  19.603  1.00 51.17  ? 116 PHE B N   1 
ATOM 2447 C CA  . PHE B 2 116 ? 5.233   12.734  18.589  1.00 47.99  ? 116 PHE B CA  1 
ATOM 2448 C C   . PHE B 2 116 ? 5.040   12.020  17.269  1.00 38.87  ? 116 PHE B C   1 
ATOM 2449 O O   . PHE B 2 116 ? 5.852   11.181  16.889  1.00 38.10  ? 116 PHE B O   1 
ATOM 2450 C CB  . PHE B 2 116 ? 6.255   13.855  18.429  1.00 50.28  ? 116 PHE B CB  1 
ATOM 2451 C CG  . PHE B 2 116 ? 6.546   14.580  19.698  1.00 59.75  ? 116 PHE B CG  1 
ATOM 2452 C CD1 . PHE B 2 116 ? 5.774   15.657  20.073  1.00 62.08  ? 116 PHE B CD1 1 
ATOM 2453 C CD2 . PHE B 2 116 ? 7.580   14.180  20.524  1.00 63.40  ? 116 PHE B CD2 1 
ATOM 2454 C CE1 . PHE B 2 116 ? 6.025   16.327  21.241  1.00 60.34  ? 116 PHE B CE1 1 
ATOM 2455 C CE2 . PHE B 2 116 ? 7.835   14.851  21.698  1.00 61.40  ? 116 PHE B CE2 1 
ATOM 2456 C CZ  . PHE B 2 116 ? 7.056   15.925  22.058  1.00 58.28  ? 116 PHE B CZ  1 
ATOM 2457 N N   . ILE B 2 117 ? 3.973   12.365  16.562  1.00 41.72  ? 117 ILE B N   1 
ATOM 2458 C CA  . ILE B 2 117 ? 3.683   11.724  15.293  1.00 41.61  ? 117 ILE B CA  1 
ATOM 2459 C C   . ILE B 2 117 ? 3.547   12.785  14.188  1.00 56.80  ? 117 ILE B C   1 
ATOM 2460 O O   . ILE B 2 117 ? 2.867   13.803  14.353  1.00 40.92  ? 117 ILE B O   1 
ATOM 2461 C CB  . ILE B 2 117 ? 2.412   10.830  15.406  1.00 43.95  ? 117 ILE B CB  1 
ATOM 2462 C CG1 . ILE B 2 117 ? 2.360   9.808   14.273  1.00 46.15  ? 117 ILE B CG1 1 
ATOM 2463 C CG2 . ILE B 2 117 ? 1.137   11.657  15.517  1.00 59.42  ? 117 ILE B CG2 1 
ATOM 2464 C CD1 . ILE B 2 117 ? 3.326   8.690   14.466  1.00 46.23  ? 117 ILE B CD1 1 
ATOM 2465 N N   . PHE B 2 118 ? 4.249   12.566  13.080  1.00 57.01  ? 118 PHE B N   1 
ATOM 2466 C CA  . PHE B 2 118 ? 4.247   13.512  11.966  1.00 51.57  ? 118 PHE B CA  1 
ATOM 2467 C C   . PHE B 2 118 ? 3.640   12.889  10.710  1.00 52.05  ? 118 PHE B C   1 
ATOM 2468 O O   . PHE B 2 118 ? 4.197   11.940  10.159  1.00 46.65  ? 118 PHE B O   1 
ATOM 2469 C CB  . PHE B 2 118 ? 5.671   14.008  11.666  1.00 51.82  ? 118 PHE B CB  1 
ATOM 2470 C CG  . PHE B 2 118 ? 6.355   14.677  12.839  1.00 48.25  ? 118 PHE B CG  1 
ATOM 2471 C CD1 . PHE B 2 118 ? 6.871   13.930  13.887  1.00 38.56  ? 118 PHE B CD1 1 
ATOM 2472 C CD2 . PHE B 2 118 ? 6.464   16.057  12.896  1.00 46.35  ? 118 PHE B CD2 1 
ATOM 2473 C CE1 . PHE B 2 118 ? 7.492   14.546  14.956  1.00 33.96  ? 118 PHE B CE1 1 
ATOM 2474 C CE2 . PHE B 2 118 ? 7.085   16.676  13.959  1.00 33.06  ? 118 PHE B CE2 1 
ATOM 2475 C CZ  . PHE B 2 118 ? 7.598   15.921  14.991  1.00 37.66  ? 118 PHE B CZ  1 
ATOM 2476 N N   . PRO B 2 119 ? 2.496   13.423  10.251  1.00 52.72  ? 119 PRO B N   1 
ATOM 2477 C CA  . PRO B 2 119 ? 1.888   12.963  8.998   1.00 50.01  ? 119 PRO B CA  1 
ATOM 2478 C C   . PRO B 2 119 ? 2.799   13.240  7.809   1.00 50.82  ? 119 PRO B C   1 
ATOM 2479 O O   . PRO B 2 119 ? 3.650   14.128  7.900   1.00 47.91  ? 119 PRO B O   1 
ATOM 2480 C CB  . PRO B 2 119 ? 0.600   13.790  8.903   1.00 48.53  ? 119 PRO B CB  1 
ATOM 2481 C CG  . PRO B 2 119 ? 0.299   14.173  10.307  1.00 52.95  ? 119 PRO B CG  1 
ATOM 2482 C CD  . PRO B 2 119 ? 1.633   14.382  10.960  1.00 54.14  ? 119 PRO B CD  1 
ATOM 2483 N N   . PRO B 2 120 ? 2.620   12.499  6.705   1.00 50.58  ? 120 PRO B N   1 
ATOM 2484 C CA  . PRO B 2 120 ? 3.465   12.683  5.519   1.00 47.40  ? 120 PRO B CA  1 
ATOM 2485 C C   . PRO B 2 120 ? 3.434   14.115  4.998   1.00 51.52  ? 120 PRO B C   1 
ATOM 2486 O O   . PRO B 2 120 ? 2.356   14.703  4.895   1.00 33.76  ? 120 PRO B O   1 
ATOM 2487 C CB  . PRO B 2 120 ? 2.849   11.725  4.497   1.00 52.65  ? 120 PRO B CB  1 
ATOM 2488 C CG  . PRO B 2 120 ? 2.205   10.667  5.331   1.00 60.02  ? 120 PRO B CG  1 
ATOM 2489 C CD  . PRO B 2 120 ? 1.655   11.400  6.526   1.00 59.99  ? 120 PRO B CD  1 
ATOM 2490 N N   . SER B 2 121 ? 4.604   14.658  4.674   1.00 45.47  ? 121 SER B N   1 
ATOM 2491 C CA  . SER B 2 121 ? 4.695   15.992  4.102   1.00 51.09  ? 121 SER B CA  1 
ATOM 2492 C C   . SER B 2 121 ? 3.760   16.121  2.909   1.00 49.58  ? 121 SER B C   1 
ATOM 2493 O O   . SER B 2 121 ? 3.746   15.256  2.032   1.00 61.43  ? 121 SER B O   1 
ATOM 2494 C CB  . SER B 2 121 ? 6.131   16.291  3.680   1.00 31.20  ? 121 SER B CB  1 
ATOM 2495 O OG  . SER B 2 121 ? 6.212   17.500  2.947   1.00 30.85  ? 121 SER B OG  1 
ATOM 2496 N N   . ASP B 2 122 ? 2.970   17.190  2.897   1.00 46.52  ? 122 ASP B N   1 
ATOM 2497 C CA  . ASP B 2 122 ? 2.005   17.429  1.832   1.00 49.34  ? 122 ASP B CA  1 
ATOM 2498 C C   . ASP B 2 122 ? 2.716   17.382  0.492   1.00 44.47  ? 122 ASP B C   1 
ATOM 2499 O O   . ASP B 2 122 ? 2.237   16.784  -0.470  1.00 48.30  ? 122 ASP B O   1 
ATOM 2500 C CB  . ASP B 2 122 ? 1.316   18.780  2.021   1.00 59.96  ? 122 ASP B CB  1 
ATOM 2501 C CG  . ASP B 2 122 ? 0.020   18.884  1.250   1.00 73.20  ? 122 ASP B CG  1 
ATOM 2502 O OD1 . ASP B 2 122 ? 0.029   18.639  0.025   1.00 75.38  ? 122 ASP B OD1 1 
ATOM 2503 O OD2 . ASP B 2 122 ? -1.009  19.222  1.872   1.00 79.41  ? 122 ASP B OD2 1 
ATOM 2504 N N   . GLU B 2 123 ? 3.884   18.008  0.464   1.00 46.80  ? 123 GLU B N   1 
ATOM 2505 C CA  . GLU B 2 123 ? 4.735   18.055  -0.713  1.00 41.64  ? 123 GLU B CA  1 
ATOM 2506 C C   . GLU B 2 123 ? 5.340   16.695  -1.048  1.00 42.41  ? 123 GLU B C   1 
ATOM 2507 O O   . GLU B 2 123 ? 5.520   16.372  -2.220  1.00 38.84  ? 123 GLU B O   1 
ATOM 2508 C CB  . GLU B 2 123 ? 5.843   19.075  -0.494  1.00 50.38  ? 123 GLU B CB  1 
ATOM 2509 C CG  . GLU B 2 123 ? 5.486   20.117  0.547   1.00 61.41  ? 123 GLU B CG  1 
ATOM 2510 C CD  . GLU B 2 123 ? 6.604   21.105  0.769   1.00 74.32  ? 123 GLU B CD  1 
ATOM 2511 O OE1 . GLU B 2 123 ? 6.525   21.894  1.736   1.00 76.52  ? 123 GLU B OE1 1 
ATOM 2512 O OE2 . GLU B 2 123 ? 7.562   21.097  -0.033  1.00 73.86  ? 123 GLU B OE2 1 
ATOM 2513 N N   . GLN B 2 124 ? 5.653   15.896  -0.027  1.00 46.70  ? 124 GLN B N   1 
ATOM 2514 C CA  . GLN B 2 124 ? 6.227   14.569  -0.261  1.00 46.17  ? 124 GLN B CA  1 
ATOM 2515 C C   . GLN B 2 124 ? 5.253   13.729  -1.074  1.00 46.07  ? 124 GLN B C   1 
ATOM 2516 O O   . GLN B 2 124 ? 5.652   12.836  -1.820  1.00 34.96  ? 124 GLN B O   1 
ATOM 2517 C CB  . GLN B 2 124 ? 6.567   13.853  1.052   1.00 46.58  ? 124 GLN B CB  1 
ATOM 2518 C CG  . GLN B 2 124 ? 7.229   12.489  0.850   1.00 42.21  ? 124 GLN B CG  1 
ATOM 2519 C CD  . GLN B 2 124 ? 7.225   11.634  2.099   1.00 42.20  ? 124 GLN B CD  1 
ATOM 2520 O OE1 . GLN B 2 124 ? 7.688   10.492  2.084   1.00 34.45  ? 124 GLN B OE1 1 
ATOM 2521 N NE2 . GLN B 2 124 ? 6.694   12.178  3.188   1.00 34.58  ? 124 GLN B NE2 1 
ATOM 2522 N N   . LEU B 2 125 ? 3.970   14.035  -0.934  1.00 44.95  ? 125 LEU B N   1 
ATOM 2523 C CA  . LEU B 2 125 ? 2.947   13.370  -1.722  1.00 51.47  ? 125 LEU B CA  1 
ATOM 2524 C C   . LEU B 2 125 ? 3.032   13.800  -3.190  1.00 56.00  ? 125 LEU B C   1 
ATOM 2525 O O   . LEU B 2 125 ? 2.914   12.971  -4.086  1.00 47.19  ? 125 LEU B O   1 
ATOM 2526 C CB  . LEU B 2 125 ? 1.567   13.660  -1.137  1.00 54.89  ? 125 LEU B CB  1 
ATOM 2527 C CG  . LEU B 2 125 ? 1.509   13.320  0.356   1.00 47.13  ? 125 LEU B CG  1 
ATOM 2528 C CD1 . LEU B 2 125 ? 0.504   14.198  1.094   1.00 52.55  ? 125 LEU B CD1 1 
ATOM 2529 C CD2 . LEU B 2 125 ? 1.222   11.836  0.584   1.00 40.23  ? 125 LEU B CD2 1 
ATOM 2530 N N   . LYS B 2 126 ? 3.305   15.084  -3.431  1.00 68.22  ? 126 LYS B N   1 
ATOM 2531 C CA  . LYS B 2 126 ? 3.427   15.612  -4.797  1.00 74.51  ? 126 LYS B CA  1 
ATOM 2532 C C   . LYS B 2 126 ? 4.392   14.744  -5.601  1.00 77.95  ? 126 LYS B C   1 
ATOM 2533 O O   . LYS B 2 126 ? 4.271   14.617  -6.816  1.00 81.88  ? 126 LYS B O   1 
ATOM 2534 C CB  . LYS B 2 126 ? 3.905   17.072  -4.797  1.00 73.39  ? 126 LYS B CB  1 
ATOM 2535 C CG  . LYS B 2 126 ? 3.149   17.987  -5.753  1.00 76.98  ? 126 LYS B CG  1 
ATOM 2536 C CD  . LYS B 2 126 ? 1.668   17.656  -5.751  1.00 83.91  ? 126 LYS B CD  1 
ATOM 2537 C CE  . LYS B 2 126 ? 0.843   18.791  -6.337  1.00 83.60  ? 126 LYS B CE  1 
ATOM 2538 N NZ  . LYS B 2 126 ? -0.616  18.588  -6.112  1.00 82.36  ? 126 LYS B NZ  1 
ATOM 2539 N N   . SER B 2 127 ? 5.333   14.123  -4.895  1.00 65.36  ? 127 SER B N   1 
ATOM 2540 C CA  . SER B 2 127 ? 6.251   13.149  -5.481  1.00 63.50  ? 127 SER B CA  1 
ATOM 2541 C C   . SER B 2 127 ? 5.639   11.788  -5.793  1.00 53.13  ? 127 SER B C   1 
ATOM 2542 O O   . SER B 2 127 ? 6.059   11.128  -6.748  1.00 52.21  ? 127 SER B O   1 
ATOM 2543 C CB  . SER B 2 127 ? 7.432   12.922  -4.551  1.00 65.12  ? 127 SER B CB  1 
ATOM 2544 O OG  . SER B 2 127 ? 8.232   14.078  -4.447  1.00 71.56  ? 127 SER B OG  1 
ATOM 2545 N N   . GLY B 2 128 ? 4.620   11.390  -5.035  1.00 54.20  ? 128 GLY B N   1 
ATOM 2546 C CA  . GLY B 2 128 ? 4.181   10.009  -5.068  1.00 57.88  ? 128 GLY B CA  1 
ATOM 2547 C C   . GLY B 2 128 ? 4.702   9.088   -3.974  1.00 60.00  ? 128 GLY B C   1 
ATOM 2548 O O   . GLY B 2 128 ? 4.785   7.881   -4.179  1.00 62.42  ? 128 GLY B O   1 
ATOM 2549 N N   . THR B 2 129 ? 5.093   9.639   -2.826  1.00 68.63  ? 129 THR B N   1 
ATOM 2550 C CA  . THR B 2 129 ? 5.420   8.797   -1.665  1.00 65.69  ? 129 THR B CA  1 
ATOM 2551 C C   . THR B 2 129 ? 4.961   9.434   -0.338  1.00 56.96  ? 129 THR B C   1 
ATOM 2552 O O   . THR B 2 129 ? 4.730   10.640  -0.274  1.00 57.42  ? 129 THR B O   1 
ATOM 2553 C CB  . THR B 2 129 ? 6.947   8.493   -1.594  1.00 47.20  ? 129 THR B CB  1 
ATOM 2554 O OG1 . THR B 2 129 ? 7.450   8.225   -2.909  1.00 48.20  ? 129 THR B OG1 1 
ATOM 2555 C CG2 . THR B 2 129 ? 7.221   7.279   -0.712  1.00 47.75  ? 129 THR B CG2 1 
ATOM 2556 N N   . ALA B 2 130 ? 4.815   8.618   0.709   1.00 49.07  ? 130 ALA B N   1 
ATOM 2557 C CA  . ALA B 2 130 ? 4.425   9.109   2.031   1.00 42.82  ? 130 ALA B CA  1 
ATOM 2558 C C   . ALA B 2 130 ? 5.334   8.578   3.137   1.00 41.99  ? 130 ALA B C   1 
ATOM 2559 O O   . ALA B 2 130 ? 5.670   7.399   3.155   1.00 48.46  ? 130 ALA B O   1 
ATOM 2560 C CB  . ALA B 2 130 ? 2.978   8.736   2.325   1.00 41.62  ? 130 ALA B CB  1 
ATOM 2561 N N   . SER B 2 131 ? 5.715   9.450   4.066   1.00 38.80  ? 131 SER B N   1 
ATOM 2562 C CA  . SER B 2 131 ? 6.530   9.044   5.211   1.00 38.43  ? 131 SER B CA  1 
ATOM 2563 C C   . SER B 2 131 ? 5.940   9.537   6.529   1.00 46.11  ? 131 SER B C   1 
ATOM 2564 O O   . SER B 2 131 ? 5.745   10.736  6.719   1.00 54.73  ? 131 SER B O   1 
ATOM 2565 C CB  . SER B 2 131 ? 7.965   9.559   5.064   1.00 32.13  ? 131 SER B CB  1 
ATOM 2566 O OG  . SER B 2 131 ? 8.536   9.139   3.835   1.00 35.74  ? 131 SER B OG  1 
ATOM 2567 N N   . VAL B 2 132 ? 5.653   8.608   7.435   1.00 34.21  ? 132 VAL B N   1 
ATOM 2568 C CA  . VAL B 2 132 ? 5.160   8.963   8.761   1.00 35.03  ? 132 VAL B CA  1 
ATOM 2569 C C   . VAL B 2 132 ? 6.281   8.786   9.780   1.00 34.32  ? 132 VAL B C   1 
ATOM 2570 O O   . VAL B 2 132 ? 6.920   7.736   9.824   1.00 34.46  ? 132 VAL B O   1 
ATOM 2571 C CB  . VAL B 2 132 ? 3.948   8.101   9.176   1.00 37.33  ? 132 VAL B CB  1 
ATOM 2572 C CG1 . VAL B 2 132 ? 3.386   8.573   10.512  1.00 46.57  ? 132 VAL B CG1 1 
ATOM 2573 C CG2 . VAL B 2 132 ? 2.878   8.129   8.099   1.00 38.16  ? 132 VAL B CG2 1 
ATOM 2574 N N   . VAL B 2 133 ? 6.525   9.812   10.590  1.00 31.00  ? 133 VAL B N   1 
ATOM 2575 C CA  . VAL B 2 133 ? 7.604   9.770   11.573  1.00 38.31  ? 133 VAL B CA  1 
ATOM 2576 C C   . VAL B 2 133 ? 7.064   9.783   13.000  1.00 41.06  ? 133 VAL B C   1 
ATOM 2577 O O   . VAL B 2 133 ? 6.284   10.662  13.364  1.00 37.32  ? 133 VAL B O   1 
ATOM 2578 C CB  . VAL B 2 133 ? 8.573   10.958  11.395  1.00 28.40  ? 133 VAL B CB  1 
ATOM 2579 C CG1 . VAL B 2 133 ? 9.676   10.905  12.440  1.00 27.81  ? 133 VAL B CG1 1 
ATOM 2580 C CG2 . VAL B 2 133 ? 9.161   10.964  9.993   1.00 27.18  ? 133 VAL B CG2 1 
ATOM 2581 N N   . CYS B 2 134 ? 7.472   8.803   13.801  1.00 41.37  ? 134 CYS B N   1 
ATOM 2582 C CA  . CYS B 2 134 ? 7.111   8.777   15.210  1.00 37.98  ? 134 CYS B CA  1 
ATOM 2583 C C   . CYS B 2 134 ? 8.355   9.116   16.028  1.00 45.74  ? 134 CYS B C   1 
ATOM 2584 O O   . CYS B 2 134 ? 9.279   8.307   16.121  1.00 47.42  ? 134 CYS B O   1 
ATOM 2585 C CB  . CYS B 2 134 ? 6.542   7.406   15.597  1.00 37.16  ? 134 CYS B CB  1 
ATOM 2586 S SG  . CYS B 2 134 ? 5.810   7.292   17.257  1.00 75.24  ? 134 CYS B SG  1 
ATOM 2587 N N   . LEU B 2 135 ? 8.373   10.310  16.620  1.00 49.07  ? 135 LEU B N   1 
ATOM 2588 C CA  . LEU B 2 135 ? 9.547   10.796  17.346  1.00 41.90  ? 135 LEU B CA  1 
ATOM 2589 C C   . LEU B 2 135 ? 9.432   10.536  18.843  1.00 46.33  ? 135 LEU B C   1 
ATOM 2590 O O   . LEU B 2 135 ? 8.372   10.704  19.447  1.00 43.22  ? 135 LEU B O   1 
ATOM 2591 C CB  . LEU B 2 135 ? 9.763   12.297  17.088  1.00 44.38  ? 135 LEU B CB  1 
ATOM 2592 C CG  . LEU B 2 135 ? 10.559  13.155  18.089  1.00 46.67  ? 135 LEU B CG  1 
ATOM 2593 C CD1 . LEU B 2 135 ? 12.019  12.710  18.234  1.00 31.94  ? 135 LEU B CD1 1 
ATOM 2594 C CD2 . LEU B 2 135 ? 10.482  14.637  17.723  1.00 51.44  ? 135 LEU B CD2 1 
ATOM 2595 N N   . LEU B 2 136 ? 10.543  10.113  19.430  1.00 36.52  ? 136 LEU B N   1 
ATOM 2596 C CA  . LEU B 2 136 ? 10.633  9.868   20.858  1.00 31.55  ? 136 LEU B CA  1 
ATOM 2597 C C   . LEU B 2 136 ? 11.824  10.666  21.380  1.00 39.50  ? 136 LEU B C   1 
ATOM 2598 O O   . LEU B 2 136 ? 12.959  10.395  20.996  1.00 37.28  ? 136 LEU B O   1 
ATOM 2599 C CB  . LEU B 2 136 ? 10.803  8.372   21.147  1.00 32.66  ? 136 LEU B CB  1 
ATOM 2600 C CG  . LEU B 2 136 ? 9.679   7.345   20.938  1.00 34.55  ? 136 LEU B CG  1 
ATOM 2601 C CD1 . LEU B 2 136 ? 9.268   7.182   19.476  1.00 34.06  ? 136 LEU B CD1 1 
ATOM 2602 C CD2 . LEU B 2 136 ? 10.137  6.015   21.507  1.00 35.61  ? 136 LEU B CD2 1 
ATOM 2603 N N   . ASN B 2 137 ? 11.572  11.656  22.232  1.00 44.66  ? 137 ASN B N   1 
ATOM 2604 C CA  . ASN B 2 137 ? 12.639  12.533  22.714  1.00 46.83  ? 137 ASN B CA  1 
ATOM 2605 C C   . ASN B 2 137 ? 12.925  12.369  24.204  1.00 48.84  ? 137 ASN B C   1 
ATOM 2606 O O   . ASN B 2 137 ? 11.999  12.294  25.014  1.00 57.69  ? 137 ASN B O   1 
ATOM 2607 C CB  . ASN B 2 137 ? 12.295  14.000  22.427  1.00 33.73  ? 137 ASN B CB  1 
ATOM 2608 C CG  . ASN B 2 137 ? 13.143  14.598  21.314  1.00 50.30  ? 137 ASN B CG  1 
ATOM 2609 O OD1 . ASN B 2 137 ? 14.351  14.366  21.240  1.00 44.27  ? 137 ASN B OD1 1 
ATOM 2610 N ND2 . ASN B 2 137 ? 12.512  15.380  20.445  1.00 44.84  ? 137 ASN B ND2 1 
ATOM 2611 N N   . ASN B 2 138 ? 14.209  12.312  24.556  1.00 37.75  ? 138 ASN B N   1 
ATOM 2612 C CA  . ASN B 2 138 ? 14.636  12.384  25.958  1.00 46.52  ? 138 ASN B CA  1 
ATOM 2613 C C   . ASN B 2 138 ? 14.098  11.311  26.909  1.00 54.72  ? 138 ASN B C   1 
ATOM 2614 O O   . ASN B 2 138 ? 13.193  11.580  27.700  1.00 64.37  ? 138 ASN B O   1 
ATOM 2615 C CB  . ASN B 2 138 ? 14.293  13.763  26.524  1.00 46.79  ? 138 ASN B CB  1 
ATOM 2616 C CG  . ASN B 2 138 ? 15.027  14.881  25.809  1.00 46.00  ? 138 ASN B CG  1 
ATOM 2617 O OD1 . ASN B 2 138 ? 14.870  15.086  24.603  1.00 44.62  ? 138 ASN B OD1 1 
ATOM 2618 N ND2 . ASN B 2 138 ? 15.865  15.592  26.550  1.00 52.56  ? 138 ASN B ND2 1 
ATOM 2619 N N   . PHE B 2 139 ? 14.633  10.096  26.805  1.00 38.38  ? 139 PHE B N   1 
ATOM 2620 C CA  . PHE B 2 139 ? 14.239  9.006   27.700  1.00 46.14  ? 139 PHE B CA  1 
ATOM 2621 C C   . PHE B 2 139 ? 15.401  8.098   28.121  1.00 44.72  ? 139 PHE B C   1 
ATOM 2622 O O   . PHE B 2 139 ? 16.515  8.232   27.623  1.00 44.42  ? 139 PHE B O   1 
ATOM 2623 C CB  . PHE B 2 139 ? 13.151  8.159   27.035  1.00 41.44  ? 139 PHE B CB  1 
ATOM 2624 C CG  . PHE B 2 139 ? 13.596  7.482   25.766  1.00 50.63  ? 139 PHE B CG  1 
ATOM 2625 C CD1 . PHE B 2 139 ? 13.807  6.114   25.733  1.00 46.34  ? 139 PHE B CD1 1 
ATOM 2626 C CD2 . PHE B 2 139 ? 13.814  8.213   24.608  1.00 49.78  ? 139 PHE B CD2 1 
ATOM 2627 C CE1 . PHE B 2 139 ? 14.221  5.486   24.567  1.00 44.88  ? 139 PHE B CE1 1 
ATOM 2628 C CE2 . PHE B 2 139 ? 14.231  7.594   23.440  1.00 44.36  ? 139 PHE B CE2 1 
ATOM 2629 C CZ  . PHE B 2 139 ? 14.434  6.228   23.419  1.00 42.88  ? 139 PHE B CZ  1 
ATOM 2630 N N   . TYR B 2 140 ? 15.104  7.118   28.974  1.00 40.16  ? 140 TYR B N   1 
ATOM 2631 C CA  . TYR B 2 140 ? 16.106  6.184   29.492  1.00 40.21  ? 140 TYR B CA  1 
ATOM 2632 C C   . TYR B 2 140 ? 15.426  5.094   30.305  1.00 41.55  ? 140 TYR B C   1 
ATOM 2633 O O   . TYR B 2 140 ? 14.551  5.380   31.121  1.00 43.02  ? 140 TYR B O   1 
ATOM 2634 C CB  . TYR B 2 140 ? 17.149  6.896   30.370  1.00 43.92  ? 140 TYR B CB  1 
ATOM 2635 C CG  . TYR B 2 140 ? 18.331  6.013   30.726  1.00 42.32  ? 140 TYR B CG  1 
ATOM 2636 C CD1 . TYR B 2 140 ? 19.470  6.014   29.938  1.00 44.11  ? 140 TYR B CD1 1 
ATOM 2637 C CD2 . TYR B 2 140 ? 18.306  5.177   31.841  1.00 40.30  ? 140 TYR B CD2 1 
ATOM 2638 C CE1 . TYR B 2 140 ? 20.549  5.209   30.237  1.00 44.71  ? 140 TYR B CE1 1 
ATOM 2639 C CE2 . TYR B 2 140 ? 19.386  4.364   32.150  1.00 40.42  ? 140 TYR B CE2 1 
ATOM 2640 C CZ  . TYR B 2 140 ? 20.506  4.386   31.343  1.00 48.74  ? 140 TYR B CZ  1 
ATOM 2641 O OH  . TYR B 2 140 ? 21.587  3.587   31.639  1.00 51.10  ? 140 TYR B OH  1 
ATOM 2642 N N   . PRO B 2 141 ? 15.856  3.836   30.118  1.00 42.65  ? 141 PRO B N   1 
ATOM 2643 C CA  . PRO B 2 141 ? 16.929  3.365   29.231  1.00 41.23  ? 141 PRO B CA  1 
ATOM 2644 C C   . PRO B 2 141 ? 16.591  3.362   27.741  1.00 46.24  ? 141 PRO B C   1 
ATOM 2645 O O   . PRO B 2 141 ? 15.558  3.878   27.313  1.00 44.29  ? 141 PRO B O   1 
ATOM 2646 C CB  . PRO B 2 141 ? 17.169  1.935   29.718  1.00 42.96  ? 141 PRO B CB  1 
ATOM 2647 C CG  . PRO B 2 141 ? 15.852  1.506   30.227  1.00 51.20  ? 141 PRO B CG  1 
ATOM 2648 C CD  . PRO B 2 141 ? 15.255  2.724   30.873  1.00 51.85  ? 141 PRO B CD  1 
ATOM 2649 N N   . ARG B 2 142 ? 17.483  2.755   26.966  1.00 44.67  ? 142 ARG B N   1 
ATOM 2650 C CA  . ARG B 2 142 ? 17.377  2.735   25.516  1.00 43.15  ? 142 ARG B CA  1 
ATOM 2651 C C   . ARG B 2 142 ? 16.264  1.818   25.027  1.00 50.47  ? 142 ARG B C   1 
ATOM 2652 O O   . ARG B 2 142 ? 15.706  2.045   23.951  1.00 48.25  ? 142 ARG B O   1 
ATOM 2653 C CB  . ARG B 2 142 ? 18.704  2.305   24.905  1.00 41.68  ? 142 ARG B CB  1 
ATOM 2654 C CG  . ARG B 2 142 ? 18.764  2.381   23.404  1.00 41.59  ? 142 ARG B CG  1 
ATOM 2655 C CD  . ARG B 2 142 ? 20.160  2.076   22.948  1.00 49.38  ? 142 ARG B CD  1 
ATOM 2656 N NE  . ARG B 2 142 ? 20.344  2.265   21.517  1.00 56.10  ? 142 ARG B NE  1 
ATOM 2657 C CZ  . ARG B 2 142 ? 21.518  2.136   20.912  1.00 61.74  ? 142 ARG B CZ  1 
ATOM 2658 N NH1 . ARG B 2 142 ? 22.594  1.827   21.626  1.00 57.83  ? 142 ARG B NH1 1 
ATOM 2659 N NH2 . ARG B 2 142 ? 21.622  2.320   19.603  1.00 63.96  ? 142 ARG B NH2 1 
ATOM 2660 N N   . GLU B 2 143 ? 15.931  0.795   25.814  1.00 55.41  ? 143 GLU B N   1 
ATOM 2661 C CA  . GLU B 2 143 ? 14.919  -0.171  25.387  1.00 60.00  ? 143 GLU B CA  1 
ATOM 2662 C C   . GLU B 2 143 ? 13.596  0.511   25.056  1.00 65.09  ? 143 GLU B C   1 
ATOM 2663 O O   . GLU B 2 143 ? 12.997  1.178   25.900  1.00 66.13  ? 143 GLU B O   1 
ATOM 2664 C CB  . GLU B 2 143 ? 14.684  -1.227  26.467  1.00 68.06  ? 143 GLU B CB  1 
ATOM 2665 C CG  . GLU B 2 143 ? 13.531  -2.165  26.144  1.00 74.61  ? 143 GLU B CG  1 
ATOM 2666 C CD  . GLU B 2 143 ? 12.746  -2.577  27.376  1.00 80.86  ? 143 GLU B CD  1 
ATOM 2667 O OE1 . GLU B 2 143 ? 13.362  -3.074  28.342  1.00 83.07  ? 143 GLU B OE1 1 
ATOM 2668 O OE2 . GLU B 2 143 ? 11.510  -2.396  27.379  1.00 80.51  ? 143 GLU B OE2 1 
ATOM 2669 N N   . ALA B 2 144 ? 13.146  0.321   23.821  1.00 65.23  ? 144 ALA B N   1 
ATOM 2670 C CA  . ALA B 2 144 ? 11.879  0.865   23.364  1.00 62.52  ? 144 ALA B CA  1 
ATOM 2671 C C   . ALA B 2 144 ? 11.306  -0.016  22.259  1.00 65.10  ? 144 ALA B C   1 
ATOM 2672 O O   . ALA B 2 144 ? 12.050  -0.542  21.437  1.00 65.59  ? 144 ALA B O   1 
ATOM 2673 C CB  . ALA B 2 144 ? 12.058  2.293   22.874  1.00 57.10  ? 144 ALA B CB  1 
ATOM 2674 N N   . LYS B 2 145 ? 9.986   -0.184  22.240  1.00 62.06  ? 145 LYS B N   1 
ATOM 2675 C CA  . LYS B 2 145 ? 9.323   -0.881  21.133  1.00 63.26  ? 145 LYS B CA  1 
ATOM 2676 C C   . LYS B 2 145 ? 8.314   0.058   20.493  1.00 66.81  ? 145 LYS B C   1 
ATOM 2677 O O   . LYS B 2 145 ? 7.628   0.813   21.184  1.00 80.42  ? 145 LYS B O   1 
ATOM 2678 C CB  . LYS B 2 145 ? 8.637   -2.191  21.588  1.00 60.08  ? 145 LYS B CB  1 
ATOM 2679 C CG  . LYS B 2 145 ? 7.096   -2.292  21.391  1.00 79.05  ? 145 LYS B CG  1 
ATOM 2680 C CD  . LYS B 2 145 ? 6.653   -3.763  21.565  1.00 84.15  ? 145 LYS B CD  1 
ATOM 2681 C CE  . LYS B 2 145 ? 5.151   -4.051  21.346  1.00 89.68  ? 145 LYS B CE  1 
ATOM 2682 N NZ  . LYS B 2 145 ? 4.238   -3.706  22.477  1.00 92.61  ? 145 LYS B NZ  1 
ATOM 2683 N N   . VAL B 2 146 ? 8.251   0.034   19.168  1.00 55.56  ? 146 VAL B N   1 
ATOM 2684 C CA  . VAL B 2 146 ? 7.275   0.835   18.454  1.00 54.94  ? 146 VAL B CA  1 
ATOM 2685 C C   . VAL B 2 146 ? 6.498   -0.032  17.468  1.00 56.42  ? 146 VAL B C   1 
ATOM 2686 O O   . VAL B 2 146 ? 7.059   -0.548  16.502  1.00 55.67  ? 146 VAL B O   1 
ATOM 2687 C CB  . VAL B 2 146 ? 7.948   2.024   17.720  1.00 59.53  ? 146 VAL B CB  1 
ATOM 2688 C CG1 . VAL B 2 146 ? 8.291   3.130   18.704  1.00 57.73  ? 146 VAL B CG1 1 
ATOM 2689 C CG2 . VAL B 2 146 ? 9.199   1.566   16.996  1.00 60.45  ? 146 VAL B CG2 1 
ATOM 2690 N N   . GLN B 2 147 ? 5.202   -0.197  17.716  1.00 59.68  ? 147 GLN B N   1 
ATOM 2691 C CA  . GLN B 2 147 ? 4.357   -0.944  16.793  1.00 68.39  ? 147 GLN B CA  1 
ATOM 2692 C C   . GLN B 2 147 ? 3.532   0.034   15.962  1.00 61.25  ? 147 GLN B C   1 
ATOM 2693 O O   . GLN B 2 147 ? 2.840   0.898   16.505  1.00 58.01  ? 147 GLN B O   1 
ATOM 2694 C CB  . GLN B 2 147 ? 3.439   -1.922  17.540  1.00 78.85  ? 147 GLN B CB  1 
ATOM 2695 C CG  . GLN B 2 147 ? 4.136   -3.101  18.221  1.00 78.97  ? 147 GLN B CG  1 
ATOM 2696 C CD  . GLN B 2 147 ? 4.630   -4.174  17.259  1.00 73.49  ? 147 GLN B CD  1 
ATOM 2697 O OE1 . GLN B 2 147 ? 4.010   -4.436  16.229  1.00 67.31  ? 147 GLN B OE1 1 
ATOM 2698 N NE2 . GLN B 2 147 ? 5.744   -4.813  17.608  1.00 72.56  ? 147 GLN B NE2 1 
ATOM 2699 N N   . TRP B 2 148 ? 3.618   -0.097  14.643  1.00 56.31  ? 148 TRP B N   1 
ATOM 2700 C CA  . TRP B 2 148 ? 2.807   0.720   13.747  1.00 52.53  ? 148 TRP B CA  1 
ATOM 2701 C C   . TRP B 2 148 ? 1.450   0.059   13.531  1.00 57.57  ? 148 TRP B C   1 
ATOM 2702 O O   . TRP B 2 148 ? 1.378   -1.104  13.131  1.00 64.75  ? 148 TRP B O   1 
ATOM 2703 C CB  . TRP B 2 148 ? 3.516   0.928   12.406  1.00 48.75  ? 148 TRP B CB  1 
ATOM 2704 C CG  . TRP B 2 148 ? 4.572   1.990   12.429  1.00 47.02  ? 148 TRP B CG  1 
ATOM 2705 C CD1 . TRP B 2 148 ? 5.921   1.805   12.328  1.00 47.42  ? 148 TRP B CD1 1 
ATOM 2706 C CD2 . TRP B 2 148 ? 4.372   3.408   12.561  1.00 50.38  ? 148 TRP B CD2 1 
ATOM 2707 N NE1 . TRP B 2 148 ? 6.571   3.015   12.391  1.00 38.81  ? 148 TRP B NE1 1 
ATOM 2708 C CE2 . TRP B 2 148 ? 5.649   4.003   12.531  1.00 48.16  ? 148 TRP B CE2 1 
ATOM 2709 C CE3 . TRP B 2 148 ? 3.241   4.211   12.699  1.00 41.86  ? 148 TRP B CE3 1 
ATOM 2710 C CZ2 . TRP B 2 148 ? 5.816   5.383   12.636  1.00 37.44  ? 148 TRP B CZ2 1 
ATOM 2711 C CZ3 . TRP B 2 148 ? 3.418   5.576   12.801  1.00 40.34  ? 148 TRP B CZ3 1 
ATOM 2712 C CH2 . TRP B 2 148 ? 4.696   6.147   12.768  1.00 38.17  ? 148 TRP B CH2 1 
ATOM 2713 N N   . LYS B 2 149 ? 0.375   0.795   13.800  1.00 58.08  ? 149 LYS B N   1 
ATOM 2714 C CA  . LYS B 2 149 ? -0.967  0.247   13.642  1.00 65.73  ? 149 LYS B CA  1 
ATOM 2715 C C   . LYS B 2 149 ? -1.793  1.154   12.731  1.00 71.40  ? 149 LYS B C   1 
ATOM 2716 O O   . LYS B 2 149 ? -2.131  2.275   13.106  1.00 70.63  ? 149 LYS B O   1 
ATOM 2717 C CB  . LYS B 2 149 ? -1.654  0.098   15.008  1.00 63.56  ? 149 LYS B CB  1 
ATOM 2718 C CG  . LYS B 2 149 ? -2.175  -1.303  15.300  1.00 64.08  ? 149 LYS B CG  1 
ATOM 2719 C CD  . LYS B 2 149 ? -3.327  -1.309  16.287  1.00 64.48  ? 149 LYS B CD  1 
ATOM 2720 C CE  . LYS B 2 149 ? -3.521  -2.694  16.880  1.00 65.00  ? 149 LYS B CE  1 
ATOM 2721 N NZ  . LYS B 2 149 ? -4.656  -2.730  17.839  1.00 67.80  ? 149 LYS B NZ  1 
ATOM 2722 N N   . VAL B 2 150 ? -2.130  0.664   11.542  1.00 77.99  ? 150 VAL B N   1 
ATOM 2723 C CA  . VAL B 2 150 ? -2.973  1.416   10.616  1.00 69.47  ? 150 VAL B CA  1 
ATOM 2724 C C   . VAL B 2 150 ? -4.413  0.887   10.649  1.00 75.15  ? 150 VAL B C   1 
ATOM 2725 O O   . VAL B 2 150 ? -4.636  -0.274  10.334  1.00 75.59  ? 150 VAL B O   1 
ATOM 2726 C CB  . VAL B 2 150 ? -2.451  1.331   9.165   1.00 57.26  ? 150 VAL B CB  1 
ATOM 2727 C CG1 . VAL B 2 150 ? -3.159  2.345   8.310   1.00 56.76  ? 150 VAL B CG1 1 
ATOM 2728 C CG2 . VAL B 2 150 ? -0.946  1.543   9.103   1.00 53.95  ? 150 VAL B CG2 1 
ATOM 2729 N N   . ASP B 2 151 ? -5.380  1.727   11.023  1.00 71.90  ? 151 ASP B N   1 
ATOM 2730 C CA  . ASP B 2 151 ? -6.790  1.314   11.093  1.00 76.54  ? 151 ASP B CA  1 
ATOM 2731 C C   . ASP B 2 151 ? -6.990  0.073   11.948  1.00 89.40  ? 151 ASP B C   1 
ATOM 2732 O O   . ASP B 2 151 ? -7.544  -0.918  11.458  1.00 99.44  ? 151 ASP B O   1 
ATOM 2733 C CB  . ASP B 2 151 ? -7.369  1.038   9.697   1.00 71.24  ? 151 ASP B CB  1 
ATOM 2734 C CG  . ASP B 2 151 ? -7.670  2.303   8.929   1.00 69.16  ? 151 ASP B CG  1 
ATOM 2735 O OD1 . ASP B 2 151 ? -8.134  3.261   9.572   1.00 69.07  ? 151 ASP B OD1 1 
ATOM 2736 O OD2 . ASP B 2 151 ? -7.495  2.334   7.691   1.00 69.87  ? 151 ASP B OD2 1 
ATOM 2737 N N   . ASN B 2 152 ? -6.482  0.091   13.180  1.00 97.29  ? 152 ASN B N   1 
ATOM 2738 C CA  . ASN B 2 152 ? -6.602  -1.064  14.054  1.00 98.01  ? 152 ASN B CA  1 
ATOM 2739 C C   . ASN B 2 152 ? -5.746  -2.233  13.517  1.00 98.55  ? 152 ASN B C   1 
ATOM 2740 O O   . ASN B 2 152 ? -5.276  -3.062  14.313  1.00 95.35  ? 152 ASN B O   1 
ATOM 2741 C CB  . ASN B 2 152 ? -8.101  -1.425  14.177  1.00 101.70 ? 152 ASN B CB  1 
ATOM 2742 C CG  . ASN B 2 152 ? -8.382  -2.939  14.218  1.00 106.43 ? 152 ASN B CG  1 
ATOM 2743 O OD1 . ASN B 2 152 ? -7.581  -3.749  14.659  1.00 107.05 ? 152 ASN B OD1 1 
ATOM 2744 N ND2 . ASN B 2 152 ? -9.551  -3.312  13.743  1.00 106.98 ? 152 ASN B ND2 1 
ATOM 2745 N N   . ALA B 2 153 ? -5.405  -2.216  12.225  1.00 89.37  ? 153 ALA B N   1 
ATOM 2746 C CA  . ALA B 2 153 ? -4.744  -3.360  11.608  1.00 88.04  ? 153 ALA B CA  1 
ATOM 2747 C C   . ALA B 2 153 ? -3.296  -3.463  12.046  1.00 80.18  ? 153 ALA B C   1 
ATOM 2748 O O   . ALA B 2 153 ? -2.695  -2.488  12.491  1.00 73.01  ? 153 ALA B O   1 
ATOM 2749 C CB  . ALA B 2 153 ? -4.833  -3.288  10.080  1.00 84.24  ? 153 ALA B CB  1 
ATOM 2750 N N   . LEU B 2 154 ? -2.753  -4.663  11.891  1.00 91.03  ? 154 LEU B N   1 
ATOM 2751 C CA  . LEU B 2 154 ? -1.351  -4.932  12.118  1.00 85.99  ? 154 LEU B CA  1 
ATOM 2752 C C   . LEU B 2 154 ? -0.535  -4.155  11.095  1.00 83.53  ? 154 LEU B C   1 
ATOM 2753 O O   . LEU B 2 154 ? -1.065  -3.756  10.048  1.00 87.37  ? 154 LEU B O   1 
ATOM 2754 C CB  . LEU B 2 154 ? -1.064  -6.421  11.944  1.00 86.22  ? 154 LEU B CB  1 
ATOM 2755 C CG  . LEU B 2 154 ? -1.710  -7.503  12.799  1.00 81.08  ? 154 LEU B CG  1 
ATOM 2756 C CD1 . LEU B 2 154 ? -2.502  -8.414  11.880  1.00 78.38  ? 154 LEU B CD1 1 
ATOM 2757 C CD2 . LEU B 2 154 ? -0.655  -8.310  13.524  1.00 79.38  ? 154 LEU B CD2 1 
ATOM 2758 N N   . GLN B 2 155 ? 0.756   -3.988  11.387  1.00 67.97  ? 155 GLN B N   1 
ATOM 2759 C CA  . GLN B 2 155 ? 1.751   -3.781  10.332  1.00 71.00  ? 155 GLN B CA  1 
ATOM 2760 C C   . GLN B 2 155 ? 3.205   -3.812  10.824  1.00 70.91  ? 155 GLN B C   1 
ATOM 2761 O O   . GLN B 2 155 ? 3.500   -3.547  11.997  1.00 74.35  ? 155 GLN B O   1 
ATOM 2762 C CB  . GLN B 2 155 ? 1.496   -2.451  9.609   1.00 70.21  ? 155 GLN B CB  1 
ATOM 2763 C CG  . GLN B 2 155 ? 2.126   -2.374  8.230   1.00 75.89  ? 155 GLN B CG  1 
ATOM 2764 C CD  . GLN B 2 155 ? 1.141   -1.935  7.162   1.00 87.39  ? 155 GLN B CD  1 
ATOM 2765 O OE1 . GLN B 2 155 ? 0.366   -1.002  7.367   1.00 92.65  ? 155 GLN B OE1 1 
ATOM 2766 N NE2 . GLN B 2 155 ? 1.186   -2.589  6.003   1.00 86.17  ? 155 GLN B NE2 1 
ATOM 2767 N N   . SER B 2 156 ? 4.086   -4.134  9.870   1.00 74.08  ? 156 SER B N   1 
ATOM 2768 C CA  . SER B 2 156 ? 5.514   -4.376  10.073  1.00 68.98  ? 156 SER B CA  1 
ATOM 2769 C C   . SER B 2 156 ? 6.193   -4.863  8.780   1.00 68.67  ? 156 SER B C   1 
ATOM 2770 O O   . SER B 2 156 ? 5.538   -5.346  7.858   1.00 65.13  ? 156 SER B O   1 
ATOM 2771 C CB  . SER B 2 156 ? 5.738   -5.394  11.195  1.00 64.02  ? 156 SER B CB  1 
ATOM 2772 O OG  . SER B 2 156 ? 5.083   -6.624  10.929  1.00 66.50  ? 156 SER B OG  1 
ATOM 2773 N N   . GLY B 2 157 ? 7.518   -4.766  8.740   1.00 76.86  ? 157 GLY B N   1 
ATOM 2774 C CA  . GLY B 2 157 ? 8.276   -5.051  7.531   1.00 77.38  ? 157 GLY B CA  1 
ATOM 2775 C C   . GLY B 2 157 ? 8.459   -3.783  6.721   1.00 71.43  ? 157 GLY B C   1 
ATOM 2776 O O   . GLY B 2 157 ? 8.959   -3.800  5.597   1.00 65.75  ? 157 GLY B O   1 
ATOM 2777 N N   . ASN B 2 158 ? 8.048   -2.673  7.318   1.00 69.86  ? 158 ASN B N   1 
ATOM 2778 C CA  . ASN B 2 158 ? 7.997   -1.378  6.655   1.00 64.51  ? 158 ASN B CA  1 
ATOM 2779 C C   . ASN B 2 158 ? 9.061   -0.427  7.194   1.00 64.49  ? 158 ASN B C   1 
ATOM 2780 O O   . ASN B 2 158 ? 10.017  -0.030  6.503   1.00 67.08  ? 158 ASN B O   1 
ATOM 2781 C CB  . ASN B 2 158 ? 6.621   -0.762  6.861   1.00 60.17  ? 158 ASN B CB  1 
ATOM 2782 C CG  . ASN B 2 158 ? 5.647   -1.113  5.745   1.00 67.04  ? 158 ASN B CG  1 
ATOM 2783 O OD1 . ASN B 2 158 ? 6.019   -1.132  4.575   1.00 73.40  ? 158 ASN B OD1 1 
ATOM 2784 N ND2 . ASN B 2 158 ? 4.407   -1.408  6.102   1.00 69.69  ? 158 ASN B ND2 1 
ATOM 2785 N N   . SER B 2 159 ? 8.884   -0.144  8.480   1.00 50.69  ? 159 SER B N   1 
ATOM 2786 C CA  . SER B 2 159 ? 9.626   0.813   9.287   1.00 44.21  ? 159 SER B CA  1 
ATOM 2787 C C   . SER B 2 159 ? 11.109  0.534   9.484   1.00 44.73  ? 159 SER B C   1 
ATOM 2788 O O   . SER B 2 159 ? 11.571  -0.606  9.391   1.00 44.78  ? 159 SER B O   1 
ATOM 2789 C CB  . SER B 2 159 ? 8.947   0.869   10.654  1.00 45.24  ? 159 SER B CB  1 
ATOM 2790 O OG  . SER B 2 159 ? 8.866   -0.446  11.178  1.00 52.54  ? 159 SER B OG  1 
ATOM 2791 N N   . GLN B 2 160 ? 11.833  1.600   9.803   1.00 43.70  ? 160 GLN B N   1 
ATOM 2792 C CA  . GLN B 2 160 ? 13.224  1.520   10.217  1.00 50.21  ? 160 GLN B CA  1 
ATOM 2793 C C   . GLN B 2 160 ? 13.443  2.511   11.346  1.00 47.73  ? 160 GLN B C   1 
ATOM 2794 O O   . GLN B 2 160 ? 13.026  3.661   11.241  1.00 45.47  ? 160 GLN B O   1 
ATOM 2795 C CB  . GLN B 2 160 ? 14.162  1.819   9.048   1.00 51.92  ? 160 GLN B CB  1 
ATOM 2796 C CG  . GLN B 2 160 ? 14.141  0.758   7.978   1.00 57.59  ? 160 GLN B CG  1 
ATOM 2797 C CD  . GLN B 2 160 ? 15.161  1.005   6.888   1.00 61.48  ? 160 GLN B CD  1 
ATOM 2798 O OE1 . GLN B 2 160 ? 15.019  1.932   6.087   1.00 60.49  ? 160 GLN B OE1 1 
ATOM 2799 N NE2 . GLN B 2 160 ? 16.195  0.171   6.844   1.00 63.34  ? 160 GLN B NE2 1 
ATOM 2800 N N   . GLU B 2 161 ? 14.076  2.084   12.434  1.00 54.16  ? 161 GLU B N   1 
ATOM 2801 C CA  . GLU B 2 161 ? 14.308  3.022   13.526  1.00 48.62  ? 161 GLU B CA  1 
ATOM 2802 C C   . GLU B 2 161 ? 15.642  3.744   13.367  1.00 53.39  ? 161 GLU B C   1 
ATOM 2803 O O   . GLU B 2 161 ? 16.465  3.380   12.524  1.00 46.76  ? 161 GLU B O   1 
ATOM 2804 C CB  . GLU B 2 161 ? 14.280  2.296   14.880  1.00 51.31  ? 161 GLU B CB  1 
ATOM 2805 C CG  . GLU B 2 161 ? 12.968  1.604   15.236  1.00 54.01  ? 161 GLU B CG  1 
ATOM 2806 C CD  . GLU B 2 161 ? 13.016  0.929   16.598  1.00 57.60  ? 161 GLU B CD  1 
ATOM 2807 O OE1 . GLU B 2 161 ? 13.773  -0.051  16.750  1.00 64.22  ? 161 GLU B OE1 1 
ATOM 2808 O OE2 . GLU B 2 161 ? 12.301  1.377   17.517  1.00 60.44  ? 161 GLU B OE2 1 
ATOM 2809 N N   . SER B 2 162 ? 15.851  4.751   14.208  1.00 47.84  ? 162 SER B N   1 
ATOM 2810 C CA  . SER B 2 162 ? 17.159  5.359   14.398  1.00 44.22  ? 162 SER B CA  1 
ATOM 2811 C C   . SER B 2 162 ? 17.216  5.907   15.818  1.00 35.52  ? 162 SER B C   1 
ATOM 2812 O O   . SER B 2 162 ? 16.227  6.462   16.299  1.00 28.02  ? 162 SER B O   1 
ATOM 2813 C CB  . SER B 2 162 ? 17.414  6.471   13.376  1.00 42.84  ? 162 SER B CB  1 
ATOM 2814 O OG  . SER B 2 162 ? 18.762  6.901   13.424  1.00 43.09  ? 162 SER B OG  1 
ATOM 2815 N N   . VAL B 2 163 ? 18.367  5.786   16.476  1.00 33.73  ? 163 VAL B N   1 
ATOM 2816 C CA  . VAL B 2 163 ? 18.521  6.357   17.810  1.00 37.38  ? 163 VAL B CA  1 
ATOM 2817 C C   . VAL B 2 163 ? 19.817  7.151   17.925  1.00 30.75  ? 163 VAL B C   1 
ATOM 2818 O O   . VAL B 2 163 ? 20.895  6.638   17.641  1.00 32.89  ? 163 VAL B O   1 
ATOM 2819 C CB  . VAL B 2 163 ? 18.509  5.276   18.917  1.00 43.68  ? 163 VAL B CB  1 
ATOM 2820 C CG1 . VAL B 2 163 ? 18.703  5.923   20.283  1.00 54.59  ? 163 VAL B CG1 1 
ATOM 2821 C CG2 . VAL B 2 163 ? 17.228  4.465   18.883  1.00 39.25  ? 163 VAL B CG2 1 
ATOM 2822 N N   . THR B 2 164 ? 19.709  8.401   18.365  1.00 32.39  ? 164 THR B N   1 
ATOM 2823 C CA  . THR B 2 164 ? 20.888  9.241   18.535  1.00 32.31  ? 164 THR B CA  1 
ATOM 2824 C C   . THR B 2 164 ? 21.754  8.705   19.661  1.00 34.74  ? 164 THR B C   1 
ATOM 2825 O O   . THR B 2 164 ? 21.285  7.954   20.519  1.00 27.01  ? 164 THR B O   1 
ATOM 2826 C CB  . THR B 2 164 ? 20.528  10.715  18.842  1.00 37.38  ? 164 THR B CB  1 
ATOM 2827 O OG1 . THR B 2 164 ? 19.753  10.787  20.046  1.00 37.54  ? 164 THR B OG1 1 
ATOM 2828 C CG2 . THR B 2 164 ? 19.749  11.333  17.693  1.00 32.40  ? 164 THR B CG2 1 
ATOM 2829 N N   . GLU B 2 165 ? 23.026  9.085   19.646  1.00 41.01  ? 165 GLU B N   1 
ATOM 2830 C CA  . GLU B 2 165 ? 23.938  8.691   20.706  1.00 39.58  ? 165 GLU B CA  1 
ATOM 2831 C C   . GLU B 2 165 ? 23.509  9.364   22.002  1.00 38.83  ? 165 GLU B C   1 
ATOM 2832 O O   . GLU B 2 165 ? 22.774  10.349  21.976  1.00 40.55  ? 165 GLU B O   1 
ATOM 2833 C CB  . GLU B 2 165 ? 25.379  9.057   20.356  1.00 54.40  ? 165 GLU B CB  1 
ATOM 2834 C CG  . GLU B 2 165 ? 26.410  8.375   21.229  1.00 63.82  ? 165 GLU B CG  1 
ATOM 2835 C CD  . GLU B 2 165 ? 27.820  8.726   20.833  1.00 80.48  ? 165 GLU B CD  1 
ATOM 2836 O OE1 . GLU B 2 165 ? 28.149  8.583   19.637  1.00 79.00  ? 165 GLU B OE1 1 
ATOM 2837 O OE2 . GLU B 2 165 ? 28.596  9.150   21.717  1.00 83.81  ? 165 GLU B OE2 1 
ATOM 2838 N N   . GLN B 2 166 ? 23.957  8.816   23.128  1.00 36.86  ? 166 GLN B N   1 
ATOM 2839 C CA  . GLN B 2 166 ? 23.552  9.297   24.443  1.00 31.21  ? 166 GLN B CA  1 
ATOM 2840 C C   . GLN B 2 166 ? 23.877  10.763  24.660  1.00 37.40  ? 166 GLN B C   1 
ATOM 2841 O O   . GLN B 2 166 ? 24.983  11.214  24.366  1.00 29.97  ? 166 GLN B O   1 
ATOM 2842 C CB  . GLN B 2 166 ? 24.218  8.467   25.532  1.00 27.77  ? 166 GLN B CB  1 
ATOM 2843 C CG  . GLN B 2 166 ? 23.320  8.184   26.711  1.00 27.93  ? 166 GLN B CG  1 
ATOM 2844 C CD  . GLN B 2 166 ? 23.978  7.263   27.702  1.00 28.42  ? 166 GLN B CD  1 
ATOM 2845 O OE1 . GLN B 2 166 ? 24.625  6.293   27.317  1.00 32.97  ? 166 GLN B OE1 1 
ATOM 2846 N NE2 . GLN B 2 166 ? 23.800  7.543   28.985  1.00 29.37  ? 166 GLN B NE2 1 
ATOM 2847 N N   . ASP B 2 167 ? 22.905  11.499  25.187  1.00 48.56  ? 167 ASP B N   1 
ATOM 2848 C CA  . ASP B 2 167 ? 23.069  12.926  25.402  1.00 52.27  ? 167 ASP B CA  1 
ATOM 2849 C C   . ASP B 2 167 ? 24.189  13.196  26.394  1.00 50.38  ? 167 ASP B C   1 
ATOM 2850 O O   . ASP B 2 167 ? 24.335  12.490  27.392  1.00 43.36  ? 167 ASP B O   1 
ATOM 2851 C CB  . ASP B 2 167 ? 21.773  13.560  25.900  1.00 58.32  ? 167 ASP B CB  1 
ATOM 2852 C CG  . ASP B 2 167 ? 21.811  15.074  25.835  1.00 64.98  ? 167 ASP B CG  1 
ATOM 2853 O OD1 . ASP B 2 167 ? 21.544  15.632  24.750  1.00 61.98  ? 167 ASP B OD1 1 
ATOM 2854 O OD2 . ASP B 2 167 ? 22.151  15.706  26.858  1.00 73.69  ? 167 ASP B OD2 1 
ATOM 2855 N N   . SER B 2 168 ? 24.978  14.222  26.097  1.00 55.98  ? 168 SER B N   1 
ATOM 2856 C CA  . SER B 2 168 ? 26.111  14.615  26.927  1.00 60.43  ? 168 SER B CA  1 
ATOM 2857 C C   . SER B 2 168 ? 25.701  14.916  28.367  1.00 75.28  ? 168 SER B C   1 
ATOM 2858 O O   . SER B 2 168 ? 26.076  14.204  29.298  1.00 87.26  ? 168 SER B O   1 
ATOM 2859 C CB  . SER B 2 168 ? 26.798  15.835  26.318  1.00 51.64  ? 168 SER B CB  1 
ATOM 2860 O OG  . SER B 2 168 ? 25.846  16.831  25.984  1.00 53.38  ? 168 SER B OG  1 
ATOM 2861 N N   . LYS B 2 169 ? 24.918  15.974  28.534  1.00 66.92  ? 169 LYS B N   1 
ATOM 2862 C CA  . LYS B 2 169 ? 24.475  16.413  29.851  1.00 59.03  ? 169 LYS B CA  1 
ATOM 2863 C C   . LYS B 2 169 ? 23.379  15.499  30.393  1.00 60.82  ? 169 LYS B C   1 
ATOM 2864 O O   . LYS B 2 169 ? 23.540  14.856  31.430  1.00 62.03  ? 169 LYS B O   1 
ATOM 2865 C CB  . LYS B 2 169 ? 23.971  17.855  29.785  1.00 57.54  ? 169 LYS B CB  1 
ATOM 2866 C CG  . LYS B 2 169 ? 24.800  18.758  28.889  1.00 59.37  ? 169 LYS B CG  1 
ATOM 2867 C CD  . LYS B 2 169 ? 23.976  19.944  28.411  1.00 66.72  ? 169 LYS B CD  1 
ATOM 2868 C CE  . LYS B 2 169 ? 22.676  19.481  27.773  1.00 70.92  ? 169 LYS B CE  1 
ATOM 2869 N NZ  . LYS B 2 169 ? 22.911  18.475  26.700  1.00 72.02  ? 169 LYS B NZ  1 
ATOM 2870 N N   . ASP B 2 170 ? 22.263  15.469  29.671  1.00 53.76  ? 170 ASP B N   1 
ATOM 2871 C CA  . ASP B 2 170 ? 21.036  14.772  30.054  1.00 54.19  ? 170 ASP B CA  1 
ATOM 2872 C C   . ASP B 2 170 ? 21.175  13.254  30.252  1.00 44.55  ? 170 ASP B C   1 
ATOM 2873 O O   . ASP B 2 170 ? 20.490  12.672  31.100  1.00 36.50  ? 170 ASP B O   1 
ATOM 2874 C CB  . ASP B 2 170 ? 19.978  15.068  28.988  1.00 66.62  ? 170 ASP B CB  1 
ATOM 2875 C CG  . ASP B 2 170 ? 18.646  14.423  29.276  1.00 82.97  ? 170 ASP B CG  1 
ATOM 2876 O OD1 . ASP B 2 170 ? 18.306  14.220  30.462  1.00 92.09  ? 170 ASP B OD1 1 
ATOM 2877 O OD2 . ASP B 2 170 ? 17.923  14.140  28.297  1.00 88.33  ? 170 ASP B OD2 1 
ATOM 2878 N N   . SER B 2 171 ? 22.060  12.633  29.473  1.00 53.40  ? 171 SER B N   1 
ATOM 2879 C CA  . SER B 2 171 ? 22.295  11.182  29.486  1.00 45.91  ? 171 SER B CA  1 
ATOM 2880 C C   . SER B 2 171 ? 21.100  10.350  28.994  1.00 39.54  ? 171 SER B C   1 
ATOM 2881 O O   . SER B 2 171 ? 20.966  9.183   29.354  1.00 36.08  ? 171 SER B O   1 
ATOM 2882 C CB  . SER B 2 171 ? 22.699  10.709  30.891  1.00 43.17  ? 171 SER B CB  1 
ATOM 2883 O OG  . SER B 2 171 ? 24.010  11.128  31.227  1.00 38.62  ? 171 SER B OG  1 
ATOM 2884 N N   . THR B 2 172 ? 20.272  10.922  28.125  1.00 40.64  ? 172 THR B N   1 
ATOM 2885 C CA  . THR B 2 172 ? 19.110  10.204  27.592  1.00 41.07  ? 172 THR B CA  1 
ATOM 2886 C C   . THR B 2 172 ? 19.224  10.006  26.084  1.00 34.32  ? 172 THR B C   1 
ATOM 2887 O O   . THR B 2 172 ? 19.999  10.689  25.422  1.00 34.42  ? 172 THR B O   1 
ATOM 2888 C CB  . THR B 2 172 ? 17.782  10.938  27.899  1.00 45.55  ? 172 THR B CB  1 
ATOM 2889 O OG1 . THR B 2 172 ? 17.739  12.187  27.197  1.00 43.38  ? 172 THR B OG1 1 
ATOM 2890 C CG2 . THR B 2 172 ? 17.603  11.159  29.396  1.00 52.68  ? 172 THR B CG2 1 
ATOM 2891 N N   . TYR B 2 173 ? 18.475  9.048   25.548  1.00 35.58  ? 173 TYR B N   1 
ATOM 2892 C CA  . TYR B 2 173 ? 18.478  8.807   24.108  1.00 34.74  ? 173 TYR B CA  1 
ATOM 2893 C C   . TYR B 2 173 ? 17.298  9.466   23.407  1.00 33.64  ? 173 TYR B C   1 
ATOM 2894 O O   . TYR B 2 173 ? 16.416  10.031  24.054  1.00 35.55  ? 173 TYR B O   1 
ATOM 2895 C CB  . TYR B 2 173 ? 18.451  7.307   23.819  1.00 32.55  ? 173 TYR B CB  1 
ATOM 2896 C CG  . TYR B 2 173 ? 19.723  6.583   24.163  1.00 37.03  ? 173 TYR B CG  1 
ATOM 2897 C CD1 . TYR B 2 173 ? 19.729  5.585   25.123  1.00 30.88  ? 173 TYR B CD1 1 
ATOM 2898 C CD2 . TYR B 2 173 ? 20.919  6.895   23.531  1.00 46.18  ? 173 TYR B CD2 1 
ATOM 2899 C CE1 . TYR B 2 173 ? 20.893  4.921   25.450  1.00 45.59  ? 173 TYR B CE1 1 
ATOM 2900 C CE2 . TYR B 2 173 ? 22.085  6.233   23.849  1.00 49.46  ? 173 TYR B CE2 1 
ATOM 2901 C CZ  . TYR B 2 173 ? 22.067  5.247   24.809  1.00 47.15  ? 173 TYR B CZ  1 
ATOM 2902 O OH  . TYR B 2 173 ? 23.227  4.581   25.125  1.00 48.95  ? 173 TYR B OH  1 
ATOM 2903 N N   . SER B 2 174 ? 17.293  9.384   22.080  1.00 39.35  ? 174 SER B N   1 
ATOM 2904 C CA  . SER B 2 174 ? 16.146  9.798   21.282  1.00 35.30  ? 174 SER B CA  1 
ATOM 2905 C C   . SER B 2 174 ? 16.006  8.854   20.097  1.00 33.57  ? 174 SER B C   1 
ATOM 2906 O O   . SER B 2 174 ? 16.994  8.549   19.431  1.00 28.20  ? 174 SER B O   1 
ATOM 2907 C CB  . SER B 2 174 ? 16.301  11.247  20.809  1.00 28.45  ? 174 SER B CB  1 
ATOM 2908 O OG  . SER B 2 174 ? 15.848  12.155  21.801  1.00 29.56  ? 174 SER B OG  1 
ATOM 2909 N N   . LEU B 2 175 ? 14.779  8.411   19.829  1.00 31.20  ? 175 LEU B N   1 
ATOM 2910 C CA  . LEU B 2 175 ? 14.519  7.468   18.743  1.00 34.08  ? 175 LEU B CA  1 
ATOM 2911 C C   . LEU B 2 175 ? 13.499  8.040   17.754  1.00 36.91  ? 175 LEU B C   1 
ATOM 2912 O O   . LEU B 2 175 ? 12.503  8.634   18.159  1.00 40.95  ? 175 LEU B O   1 
ATOM 2913 C CB  . LEU B 2 175 ? 14.036  6.121   19.313  1.00 30.04  ? 175 LEU B CB  1 
ATOM 2914 C CG  . LEU B 2 175 ? 13.560  4.968   18.415  1.00 28.65  ? 175 LEU B CG  1 
ATOM 2915 C CD1 . LEU B 2 175 ? 13.735  3.659   19.161  1.00 28.77  ? 175 LEU B CD1 1 
ATOM 2916 C CD2 . LEU B 2 175 ? 12.108  5.106   17.969  1.00 28.98  ? 175 LEU B CD2 1 
ATOM 2917 N N   . SER B 2 176 ? 13.744  7.864   16.458  1.00 27.96  ? 176 SER B N   1 
ATOM 2918 C CA  . SER B 2 176 ? 12.752  8.237   15.451  1.00 36.76  ? 176 SER B CA  1 
ATOM 2919 C C   . SER B 2 176 ? 12.496  7.087   14.470  1.00 30.64  ? 176 SER B C   1 
ATOM 2920 O O   . SER B 2 176 ? 13.366  6.715   13.684  1.00 27.86  ? 176 SER B O   1 
ATOM 2921 C CB  . SER B 2 176 ? 13.189  9.501   14.693  1.00 44.05  ? 176 SER B CB  1 
ATOM 2922 O OG  . SER B 2 176 ? 13.744  9.209   13.420  1.00 48.82  ? 176 SER B OG  1 
ATOM 2923 N N   . SER B 2 177 ? 11.286  6.538   14.521  1.00 31.54  ? 177 SER B N   1 
ATOM 2924 C CA  . SER B 2 177 ? 10.855  5.486   13.603  1.00 36.88  ? 177 SER B CA  1 
ATOM 2925 C C   . SER B 2 177 ? 10.085  6.086   12.434  1.00 39.53  ? 177 SER B C   1 
ATOM 2926 O O   . SER B 2 177 ? 9.167   6.881   12.631  1.00 28.90  ? 177 SER B O   1 
ATOM 2927 C CB  . SER B 2 177 ? 9.987   4.455   14.334  1.00 45.86  ? 177 SER B CB  1 
ATOM 2928 O OG  . SER B 2 177 ? 9.702   3.337   13.508  1.00 48.86  ? 177 SER B OG  1 
ATOM 2929 N N   . THR B 2 178 ? 10.470  5.717   11.218  1.00 38.38  ? 178 THR B N   1 
ATOM 2930 C CA  . THR B 2 178 ? 9.818   6.242   10.027  1.00 35.11  ? 178 THR B CA  1 
ATOM 2931 C C   . THR B 2 178 ? 9.002   5.149   9.346   1.00 35.77  ? 178 THR B C   1 
ATOM 2932 O O   . THR B 2 178 ? 9.396   3.982   9.331   1.00 35.72  ? 178 THR B O   1 
ATOM 2933 C CB  . THR B 2 178 ? 10.846  6.834   9.032   1.00 32.42  ? 178 THR B CB  1 
ATOM 2934 O OG1 . THR B 2 178 ? 11.562  7.901   9.666   1.00 31.52  ? 178 THR B OG1 1 
ATOM 2935 C CG2 . THR B 2 178 ? 10.156  7.375   7.780   1.00 31.73  ? 178 THR B CG2 1 
ATOM 2936 N N   . LEU B 2 179 ? 7.854   5.530   8.800   1.00 35.92  ? 179 LEU B N   1 
ATOM 2937 C CA  . LEU B 2 179 ? 7.002   4.599   8.085   1.00 39.03  ? 179 LEU B CA  1 
ATOM 2938 C C   . LEU B 2 179 ? 6.785   5.129   6.676   1.00 52.12  ? 179 LEU B C   1 
ATOM 2939 O O   . LEU B 2 179 ? 6.089   6.129   6.492   1.00 63.30  ? 179 LEU B O   1 
ATOM 2940 C CB  . LEU B 2 179 ? 5.676   4.428   8.830   1.00 37.70  ? 179 LEU B CB  1 
ATOM 2941 C CG  . LEU B 2 179 ? 4.559   3.535   8.288   1.00 42.22  ? 179 LEU B CG  1 
ATOM 2942 C CD1 . LEU B 2 179 ? 4.924   2.058   8.380   1.00 41.15  ? 179 LEU B CD1 1 
ATOM 2943 C CD2 . LEU B 2 179 ? 3.269   3.816   9.041   1.00 31.58  ? 179 LEU B CD2 1 
ATOM 2944 N N   . THR B 2 180 ? 7.356   4.457   5.681   1.00 49.37  ? 180 THR B N   1 
ATOM 2945 C CA  . THR B 2 180 ? 7.247   4.932   4.305   1.00 49.29  ? 180 THR B CA  1 
ATOM 2946 C C   . THR B 2 180 ? 6.342   4.035   3.478   1.00 45.38  ? 180 THR B C   1 
ATOM 2947 O O   . THR B 2 180 ? 6.629   2.855   3.269   1.00 44.19  ? 180 THR B O   1 
ATOM 2948 C CB  . THR B 2 180 ? 8.618   5.036   3.611   1.00 51.43  ? 180 THR B CB  1 
ATOM 2949 O OG1 . THR B 2 180 ? 9.443   5.967   4.322   1.00 54.50  ? 180 THR B OG1 1 
ATOM 2950 C CG2 . THR B 2 180 ? 8.447   5.512   2.173   1.00 50.14  ? 180 THR B CG2 1 
ATOM 2951 N N   . LEU B 2 181 ? 5.236   4.612   3.023   1.00 47.75  ? 181 LEU B N   1 
ATOM 2952 C CA  . LEU B 2 181 ? 4.241   3.892   2.241   1.00 46.90  ? 181 LEU B CA  1 
ATOM 2953 C C   . LEU B 2 181 ? 4.025   4.571   0.895   1.00 46.11  ? 181 LEU B C   1 
ATOM 2954 O O   . LEU B 2 181 ? 4.206   5.783   0.768   1.00 46.30  ? 181 LEU B O   1 
ATOM 2955 C CB  . LEU B 2 181 ? 2.916   3.804   3.008   1.00 42.41  ? 181 LEU B CB  1 
ATOM 2956 C CG  . LEU B 2 181 ? 2.661   2.667   4.009   1.00 41.09  ? 181 LEU B CG  1 
ATOM 2957 C CD1 . LEU B 2 181 ? 3.812   2.464   4.980   1.00 42.94  ? 181 LEU B CD1 1 
ATOM 2958 C CD2 . LEU B 2 181 ? 1.363   2.919   4.770   1.00 40.02  ? 181 LEU B CD2 1 
ATOM 2959 N N   . SER B 2 182 ? 3.648   3.783   -0.108  1.00 57.06  ? 182 SER B N   1 
ATOM 2960 C CA  . SER B 2 182 ? 3.296   4.327   -1.411  1.00 59.27  ? 182 SER B CA  1 
ATOM 2961 C C   . SER B 2 182 ? 2.191   5.348   -1.220  1.00 68.33  ? 182 SER B C   1 
ATOM 2962 O O   . SER B 2 182 ? 1.317   5.167   -0.369  1.00 68.92  ? 182 SER B O   1 
ATOM 2963 C CB  . SER B 2 182 ? 2.848   3.223   -2.372  1.00 57.06  ? 182 SER B CB  1 
ATOM 2964 O OG  . SER B 2 182 ? 1.772   2.478   -1.830  1.00 54.36  ? 182 SER B OG  1 
ATOM 2965 N N   . LYS B 2 183 ? 2.239   6.424   -1.999  1.00 69.14  ? 183 LYS B N   1 
ATOM 2966 C CA  . LYS B 2 183 ? 1.221   7.471   -1.931  1.00 67.19  ? 183 LYS B CA  1 
ATOM 2967 C C   . LYS B 2 183 ? -0.187  6.923   -2.118  1.00 59.94  ? 183 LYS B C   1 
ATOM 2968 O O   . LYS B 2 183 ? -1.155  7.481   -1.610  1.00 48.71  ? 183 LYS B O   1 
ATOM 2969 C CB  . LYS B 2 183 ? 1.493   8.552   -2.976  1.00 70.44  ? 183 LYS B CB  1 
ATOM 2970 C CG  . LYS B 2 183 ? 0.462   9.675   -2.998  1.00 71.32  ? 183 LYS B CG  1 
ATOM 2971 C CD  . LYS B 2 183 ? 0.936   10.792  -3.885  1.00 72.74  ? 183 LYS B CD  1 
ATOM 2972 C CE  . LYS B 2 183 ? -0.058  11.940  -3.982  1.00 73.05  ? 183 LYS B CE  1 
ATOM 2973 N NZ  . LYS B 2 183 ? -1.235  11.597  -4.832  1.00 71.02  ? 183 LYS B NZ  1 
ATOM 2974 N N   . ALA B 2 184 ? -0.293  5.811   -2.832  1.00 63.88  ? 184 ALA B N   1 
ATOM 2975 C CA  . ALA B 2 184 ? -1.586  5.201   -3.093  1.00 67.83  ? 184 ALA B CA  1 
ATOM 2976 C C   . ALA B 2 184 ? -2.144  4.543   -1.836  1.00 70.78  ? 184 ALA B C   1 
ATOM 2977 O O   . ALA B 2 184 ? -3.150  4.990   -1.295  1.00 79.16  ? 184 ALA B O   1 
ATOM 2978 C CB  . ALA B 2 184 ? -1.470  4.186   -4.212  1.00 69.59  ? 184 ALA B CB  1 
ATOM 2979 N N   . ASP B 2 185 ? -1.473  3.490   -1.374  1.00 70.10  ? 185 ASP B N   1 
ATOM 2980 C CA  . ASP B 2 185 ? -1.903  2.722   -0.201  1.00 71.91  ? 185 ASP B CA  1 
ATOM 2981 C C   . ASP B 2 185 ? -2.097  3.607   1.021   1.00 69.11  ? 185 ASP B C   1 
ATOM 2982 O O   . ASP B 2 185 ? -2.970  3.353   1.852   1.00 73.34  ? 185 ASP B O   1 
ATOM 2983 C CB  . ASP B 2 185 ? -0.892  1.608   0.100   1.00 79.67  ? 185 ASP B CB  1 
ATOM 2984 C CG  . ASP B 2 185 ? -1.456  0.510   0.992   1.00 94.23  ? 185 ASP B CG  1 
ATOM 2985 O OD1 . ASP B 2 185 ? -2.359  0.767   1.816   1.00 105.30 ? 185 ASP B OD1 1 
ATOM 2986 O OD2 . ASP B 2 185 ? -0.994  -0.637  0.839   1.00 96.59  ? 185 ASP B OD2 1 
ATOM 2987 N N   . TYR B 2 186 ? -1.284  4.650   1.122   1.00 61.47  ? 186 TYR B N   1 
ATOM 2988 C CA  . TYR B 2 186 ? -1.450  5.624   2.184   1.00 52.94  ? 186 TYR B CA  1 
ATOM 2989 C C   . TYR B 2 186 ? -2.842  6.242   2.165   1.00 62.26  ? 186 TYR B C   1 
ATOM 2990 O O   . TYR B 2 186 ? -3.486  6.364   3.208   1.00 67.08  ? 186 TYR B O   1 
ATOM 2991 C CB  . TYR B 2 186 ? -0.396  6.720   2.068   1.00 46.61  ? 186 TYR B CB  1 
ATOM 2992 C CG  . TYR B 2 186 ? -0.646  7.875   3.003   1.00 48.74  ? 186 TYR B CG  1 
ATOM 2993 C CD1 . TYR B 2 186 ? -0.433  7.743   4.367   1.00 41.59  ? 186 TYR B CD1 1 
ATOM 2994 C CD2 . TYR B 2 186 ? -1.110  9.093   2.525   1.00 51.70  ? 186 TYR B CD2 1 
ATOM 2995 C CE1 . TYR B 2 186 ? -0.671  8.789   5.229   1.00 41.72  ? 186 TYR B CE1 1 
ATOM 2996 C CE2 . TYR B 2 186 ? -1.349  10.148  3.380   1.00 50.65  ? 186 TYR B CE2 1 
ATOM 2997 C CZ  . TYR B 2 186 ? -1.127  9.991   4.732   1.00 48.47  ? 186 TYR B CZ  1 
ATOM 2998 O OH  . TYR B 2 186 ? -1.363  11.037  5.593   1.00 43.39  ? 186 TYR B OH  1 
ATOM 2999 N N   . GLU B 2 187 ? -3.305  6.626   0.980   1.00 64.10  ? 187 GLU B N   1 
ATOM 3000 C CA  . GLU B 2 187 ? -4.596  7.288   0.860   1.00 62.82  ? 187 GLU B CA  1 
ATOM 3001 C C   . GLU B 2 187 ? -5.792  6.353   1.068   1.00 62.03  ? 187 GLU B C   1 
ATOM 3002 O O   . GLU B 2 187 ? -6.891  6.830   1.321   1.00 62.10  ? 187 GLU B O   1 
ATOM 3003 C CB  . GLU B 2 187 ? -4.730  7.973   -0.505  1.00 64.89  ? 187 GLU B CB  1 
ATOM 3004 C CG  . GLU B 2 187 ? -3.669  9.003   -0.817  1.00 64.15  ? 187 GLU B CG  1 
ATOM 3005 C CD  . GLU B 2 187 ? -4.125  10.008  -1.851  1.00 66.46  ? 187 GLU B CD  1 
ATOM 3006 O OE1 . GLU B 2 187 ? -4.942  9.637   -2.719  1.00 61.13  ? 187 GLU B OE1 1 
ATOM 3007 O OE2 . GLU B 2 187 ? -3.663  11.167  -1.798  1.00 72.02  ? 187 GLU B OE2 1 
ATOM 3008 N N   . LYS B 2 188 ? -5.603  5.039   0.963   1.00 68.54  ? 188 LYS B N   1 
ATOM 3009 C CA  . LYS B 2 188 ? -6.753  4.134   1.020   1.00 73.74  ? 188 LYS B CA  1 
ATOM 3010 C C   . LYS B 2 188 ? -7.094  3.688   2.450   1.00 78.80  ? 188 LYS B C   1 
ATOM 3011 O O   . LYS B 2 188 ? -8.009  2.894   2.644   1.00 86.68  ? 188 LYS B O   1 
ATOM 3012 C CB  . LYS B 2 188 ? -6.532  2.917   0.083   1.00 65.89  ? 188 LYS B CB  1 
ATOM 3013 C CG  . LYS B 2 188 ? -5.678  1.776   0.583   1.00 61.74  ? 188 LYS B CG  1 
ATOM 3014 C CD  . LYS B 2 188 ? -5.672  0.595   -0.381  1.00 62.37  ? 188 LYS B CD  1 
ATOM 3015 C CE  . LYS B 2 188 ? -4.810  -0.567  0.088   1.00 61.40  ? 188 LYS B CE  1 
ATOM 3016 N NZ  . LYS B 2 188 ? -5.291  -1.194  1.364   1.00 61.07  ? 188 LYS B NZ  1 
ATOM 3017 N N   . HIS B 2 189 ? -6.351  4.198   3.439   1.00 67.84  ? 189 HIS B N   1 
ATOM 3018 C CA  . HIS B 2 189 ? -6.638  3.963   4.873   1.00 65.09  ? 189 HIS B CA  1 
ATOM 3019 C C   . HIS B 2 189 ? -7.068  5.231   5.654   1.00 59.32  ? 189 HIS B C   1 
ATOM 3020 O O   . HIS B 2 189 ? -7.108  6.320   5.093   1.00 55.73  ? 189 HIS B O   1 
ATOM 3021 C CB  . HIS B 2 189 ? -5.432  3.335   5.602   1.00 65.56  ? 189 HIS B CB  1 
ATOM 3022 C CG  . HIS B 2 189 ? -4.819  2.167   4.908   1.00 71.53  ? 189 HIS B CG  1 
ATOM 3023 N ND1 . HIS B 2 189 ? -3.857  1.341   5.494   1.00 72.87  ? 189 HIS B ND1 1 
ATOM 3024 C CD2 . HIS B 2 189 ? -4.991  1.647   3.676   1.00 69.61  ? 189 HIS B CD2 1 
ATOM 3025 C CE1 . HIS B 2 189 ? -3.478  0.431   4.686   1.00 70.00  ? 189 HIS B CE1 1 
ATOM 3026 N NE2 . HIS B 2 189 ? -4.172  0.558   3.528   1.00 70.34  ? 189 HIS B NE2 1 
ATOM 3027 N N   . LYS B 2 190 ? -7.363  5.090   6.953   1.00 65.48  ? 190 LYS B N   1 
ATOM 3028 C CA  . LYS B 2 190 ? -7.914  6.201   7.756   1.00 64.76  ? 190 LYS B CA  1 
ATOM 3029 C C   . LYS B 2 190 ? -6.986  6.731   8.874   1.00 57.12  ? 190 LYS B C   1 
ATOM 3030 O O   . LYS B 2 190 ? -6.534  7.877   8.809   1.00 58.28  ? 190 LYS B O   1 
ATOM 3031 C CB  . LYS B 2 190 ? -9.274  5.779   8.347   1.00 70.79  ? 190 LYS B CB  1 
ATOM 3032 C CG  . LYS B 2 190 ? -9.763  6.553   9.576   1.00 72.65  ? 190 LYS B CG  1 
ATOM 3033 C CD  . LYS B 2 190 ? -10.154 7.986   9.284   1.00 77.65  ? 190 LYS B CD  1 
ATOM 3034 C CE  . LYS B 2 190 ? -11.532 8.283   9.855   1.00 82.59  ? 190 LYS B CE  1 
ATOM 3035 N NZ  . LYS B 2 190 ? -11.609 7.936   11.304  1.00 84.61  ? 190 LYS B NZ  1 
ATOM 3036 N N   . VAL B 2 191 ? -6.707  5.914   9.889   1.00 51.75  ? 191 VAL B N   1 
ATOM 3037 C CA  . VAL B 2 191 ? -5.940  6.369   11.050  1.00 51.83  ? 191 VAL B CA  1 
ATOM 3038 C C   . VAL B 2 191 ? -4.511  5.812   11.049  1.00 49.96  ? 191 VAL B C   1 
ATOM 3039 O O   . VAL B 2 191 ? -4.286  4.671   10.653  1.00 50.97  ? 191 VAL B O   1 
ATOM 3040 C CB  . VAL B 2 191 ? -6.656  5.972   12.366  1.00 58.54  ? 191 VAL B CB  1 
ATOM 3041 C CG1 . VAL B 2 191 ? -5.766  6.205   13.575  1.00 63.04  ? 191 VAL B CG1 1 
ATOM 3042 C CG2 . VAL B 2 191 ? -7.962  6.736   12.516  1.00 57.69  ? 191 VAL B CG2 1 
ATOM 3043 N N   . TYR B 2 192 ? -3.542  6.628   11.460  1.00 49.33  ? 192 TYR B N   1 
ATOM 3044 C CA  . TYR B 2 192 ? -2.161  6.166   11.572  1.00 47.48  ? 192 TYR B CA  1 
ATOM 3045 C C   . TYR B 2 192 ? -1.659  6.323   12.999  1.00 50.60  ? 192 TYR B C   1 
ATOM 3046 O O   . TYR B 2 192 ? -1.463  7.437   13.481  1.00 53.88  ? 192 TYR B O   1 
ATOM 3047 C CB  . TYR B 2 192 ? -1.269  6.919   10.590  1.00 44.30  ? 192 TYR B CB  1 
ATOM 3048 C CG  . TYR B 2 192 ? -1.627  6.603   9.160   1.00 49.35  ? 192 TYR B CG  1 
ATOM 3049 C CD1 . TYR B 2 192 ? -0.888  5.694   8.417   1.00 50.91  ? 192 TYR B CD1 1 
ATOM 3050 C CD2 . TYR B 2 192 ? -2.735  7.189   8.564   1.00 57.12  ? 192 TYR B CD2 1 
ATOM 3051 C CE1 . TYR B 2 192 ? -1.233  5.396   7.107   1.00 58.71  ? 192 TYR B CE1 1 
ATOM 3052 C CE2 . TYR B 2 192 ? -3.090  6.897   7.265   1.00 63.68  ? 192 TYR B CE2 1 
ATOM 3053 C CZ  . TYR B 2 192 ? -2.337  6.001   6.539   1.00 65.93  ? 192 TYR B CZ  1 
ATOM 3054 O OH  . TYR B 2 192 ? -2.690  5.711   5.241   1.00 67.50  ? 192 TYR B OH  1 
ATOM 3055 N N   . ALA B 2 193 ? -1.437  5.193   13.661  1.00 49.36  ? 193 ALA B N   1 
ATOM 3056 C CA  . ALA B 2 193 ? -1.137  5.185   15.084  1.00 47.24  ? 193 ALA B CA  1 
ATOM 3057 C C   . ALA B 2 193 ? 0.262   4.651   15.374  1.00 47.27  ? 193 ALA B C   1 
ATOM 3058 O O   . ALA B 2 193 ? 0.736   3.734   14.707  1.00 46.66  ? 193 ALA B O   1 
ATOM 3059 C CB  . ALA B 2 193 ? -2.180  4.363   15.826  1.00 52.65  ? 193 ALA B CB  1 
ATOM 3060 N N   . CYS B 2 194 ? 0.918   5.237   16.371  1.00 44.77  ? 194 CYS B N   1 
ATOM 3061 C CA  . CYS B 2 194 ? 2.223   4.767   16.823  1.00 43.51  ? 194 CYS B CA  1 
ATOM 3062 C C   . CYS B 2 194 ? 2.151   4.287   18.268  1.00 43.31  ? 194 CYS B C   1 
ATOM 3063 O O   . CYS B 2 194 ? 1.970   5.088   19.181  1.00 46.45  ? 194 CYS B O   1 
ATOM 3064 C CB  . CYS B 2 194 ? 3.271   5.877   16.688  1.00 41.47  ? 194 CYS B CB  1 
ATOM 3065 S SG  . CYS B 2 194 ? 4.929   5.458   17.296  1.00 86.63  ? 194 CYS B SG  1 
ATOM 3066 N N   . GLU B 2 195 ? 2.301   2.980   18.470  1.00 49.47  ? 195 GLU B N   1 
ATOM 3067 C CA  . GLU B 2 195 ? 2.253   2.393   19.809  1.00 53.96  ? 195 GLU B CA  1 
ATOM 3068 C C   . GLU B 2 195 ? 3.661   2.195   20.364  1.00 67.47  ? 195 GLU B C   1 
ATOM 3069 O O   . GLU B 2 195 ? 4.477   1.506   19.755  1.00 74.48  ? 195 GLU B O   1 
ATOM 3070 C CB  . GLU B 2 195 ? 1.496   1.059   19.780  1.00 57.21  ? 195 GLU B CB  1 
ATOM 3071 C CG  . GLU B 2 195 ? 1.335   0.393   21.137  1.00 64.46  ? 195 GLU B CG  1 
ATOM 3072 C CD  . GLU B 2 195 ? 0.442   -0.833  21.082  1.00 75.41  ? 195 GLU B CD  1 
ATOM 3073 O OE1 . GLU B 2 195 ? -0.563  -0.806  20.338  1.00 73.28  ? 195 GLU B OE1 1 
ATOM 3074 O OE2 . GLU B 2 195 ? 0.744   -1.824  21.781  1.00 82.70  ? 195 GLU B OE2 1 
ATOM 3075 N N   . VAL B 2 196 ? 3.948   2.797   21.516  1.00 65.52  ? 196 VAL B N   1 
ATOM 3076 C CA  . VAL B 2 196 ? 5.300   2.734   22.063  1.00 63.06  ? 196 VAL B CA  1 
ATOM 3077 C C   . VAL B 2 196 ? 5.298   2.114   23.463  1.00 57.07  ? 196 VAL B C   1 
ATOM 3078 O O   . VAL B 2 196 ? 4.330   2.262   24.219  1.00 53.64  ? 196 VAL B O   1 
ATOM 3079 C CB  . VAL B 2 196 ? 5.962   4.137   22.100  1.00 65.60  ? 196 VAL B CB  1 
ATOM 3080 C CG1 . VAL B 2 196 ? 5.212   5.054   23.026  1.00 72.35  ? 196 VAL B CG1 1 
ATOM 3081 C CG2 . VAL B 2 196 ? 7.428   4.037   22.493  1.00 61.25  ? 196 VAL B CG2 1 
ATOM 3082 N N   . THR B 2 197 ? 6.368   1.387   23.786  1.00 58.27  ? 197 THR B N   1 
ATOM 3083 C CA  . THR B 2 197 ? 6.502   0.726   25.085  1.00 62.44  ? 197 THR B CA  1 
ATOM 3084 C C   . THR B 2 197 ? 7.864   0.979   25.680  1.00 67.34  ? 197 THR B C   1 
ATOM 3085 O O   . THR B 2 197 ? 8.884   0.649   25.073  1.00 74.33  ? 197 THR B O   1 
ATOM 3086 C CB  . THR B 2 197 ? 6.305   -0.797  24.998  1.00 65.57  ? 197 THR B CB  1 
ATOM 3087 O OG1 . THR B 2 197 ? 7.501   -1.420  24.498  1.00 82.29  ? 197 THR B OG1 1 
ATOM 3088 C CG2 . THR B 2 197 ? 5.115   -1.115  24.133  1.00 57.70  ? 197 THR B CG2 1 
ATOM 3089 N N   . HIS B 2 198 ? 7.887   1.534   26.882  1.00 52.22  ? 198 HIS B N   1 
ATOM 3090 C CA  . HIS B 2 198 ? 9.154   1.838   27.510  1.00 56.21  ? 198 HIS B CA  1 
ATOM 3091 C C   . HIS B 2 198 ? 9.091   1.535   28.996  1.00 59.78  ? 198 HIS B C   1 
ATOM 3092 O O   . HIS B 2 198 ? 8.034   1.628   29.617  1.00 62.11  ? 198 HIS B O   1 
ATOM 3093 C CB  . HIS B 2 198 ? 9.541   3.298   27.258  1.00 50.96  ? 198 HIS B CB  1 
ATOM 3094 C CG  . HIS B 2 198 ? 10.784  3.727   27.978  1.00 50.66  ? 198 HIS B CG  1 
ATOM 3095 N ND1 . HIS B 2 198 ? 10.769  4.657   28.983  1.00 53.81  ? 198 HIS B ND1 1 
ATOM 3096 C CD2 . HIS B 2 198 ? 12.071  3.326   27.840  1.00 48.46  ? 198 HIS B CD2 1 
ATOM 3097 C CE1 . HIS B 2 198 ? 12.002  4.825   29.444  1.00 52.35  ? 198 HIS B CE1 1 
ATOM 3098 N NE2 . HIS B 2 198 ? 12.805  4.030   28.768  1.00 49.86  ? 198 HIS B NE2 1 
ATOM 3099 N N   . GLN B 2 199 ? 10.238  1.169   29.560  1.00 67.50  ? 199 GLN B N   1 
ATOM 3100 C CA  . GLN B 2 199 ? 10.340  0.790   30.968  1.00 66.46  ? 199 GLN B CA  1 
ATOM 3101 C C   . GLN B 2 199 ? 9.959   1.957   31.891  1.00 63.00  ? 199 GLN B C   1 
ATOM 3102 O O   . GLN B 2 199 ? 9.690   1.773   33.082  1.00 62.94  ? 199 GLN B O   1 
ATOM 3103 C CB  . GLN B 2 199 ? 11.758  0.287   31.263  1.00 67.63  ? 199 GLN B CB  1 
ATOM 3104 C CG  . GLN B 2 199 ? 12.027  -0.146  32.689  1.00 71.23  ? 199 GLN B CG  1 
ATOM 3105 C CD  . GLN B 2 199 ? 13.429  -0.701  32.857  1.00 80.85  ? 199 GLN B CD  1 
ATOM 3106 O OE1 . GLN B 2 199 ? 14.415  -0.006  32.610  1.00 82.96  ? 199 GLN B OE1 1 
ATOM 3107 N NE2 . GLN B 2 199 ? 13.526  -1.950  33.299  1.00 86.35  ? 199 GLN B NE2 1 
ATOM 3108 N N   . GLY B 2 200 ? 9.901   3.156   31.320  1.00 58.04  ? 200 GLY B N   1 
ATOM 3109 C CA  . GLY B 2 200 ? 9.427   4.328   32.031  1.00 58.00  ? 200 GLY B CA  1 
ATOM 3110 C C   . GLY B 2 200 ? 7.940   4.585   31.840  1.00 59.80  ? 200 GLY B C   1 
ATOM 3111 O O   . GLY B 2 200 ? 7.372   5.473   32.476  1.00 60.93  ? 200 GLY B O   1 
ATOM 3112 N N   . LEU B 2 201 ? 7.301   3.814   30.966  1.00 63.48  ? 201 LEU B N   1 
ATOM 3113 C CA  . LEU B 2 201 ? 5.882   4.019   30.685  1.00 62.63  ? 201 LEU B CA  1 
ATOM 3114 C C   . LEU B 2 201 ? 4.965   3.132   31.532  1.00 65.23  ? 201 LEU B C   1 
ATOM 3115 O O   . LEU B 2 201 ? 4.985   1.905   31.417  1.00 65.10  ? 201 LEU B O   1 
ATOM 3116 C CB  . LEU B 2 201 ? 5.596   3.787   29.199  1.00 54.84  ? 201 LEU B CB  1 
ATOM 3117 C CG  . LEU B 2 201 ? 6.094   4.877   28.245  1.00 52.46  ? 201 LEU B CG  1 
ATOM 3118 C CD1 . LEU B 2 201 ? 5.780   4.524   26.798  1.00 49.11  ? 201 LEU B CD1 1 
ATOM 3119 C CD2 . LEU B 2 201 ? 5.493   6.232   28.606  1.00 46.33  ? 201 LEU B CD2 1 
ATOM 3120 N N   . SER B 2 202 ? 4.142   3.777   32.360  1.00 72.88  ? 202 SER B N   1 
ATOM 3121 C CA  . SER B 2 202 ? 3.170   3.099   33.224  1.00 77.10  ? 202 SER B CA  1 
ATOM 3122 C C   . SER B 2 202 ? 2.191   2.249   32.427  1.00 73.44  ? 202 SER B C   1 
ATOM 3123 O O   . SER B 2 202 ? 1.557   1.334   32.959  1.00 63.77  ? 202 SER B O   1 
ATOM 3124 C CB  . SER B 2 202 ? 2.399   4.127   34.055  1.00 80.37  ? 202 SER B CB  1 
ATOM 3125 O OG  . SER B 2 202 ? 2.085   5.275   33.277  1.00 79.22  ? 202 SER B OG  1 
ATOM 3126 N N   . SER B 2 203 ? 2.110   2.536   31.136  1.00 75.89  ? 203 SER B N   1 
ATOM 3127 C CA  . SER B 2 203 ? 1.198   1.858   30.234  1.00 75.77  ? 203 SER B CA  1 
ATOM 3128 C C   . SER B 2 203 ? 1.498   2.396   28.856  1.00 79.24  ? 203 SER B C   1 
ATOM 3129 O O   . SER B 2 203 ? 1.635   3.609   28.683  1.00 79.56  ? 203 SER B O   1 
ATOM 3130 C CB  . SER B 2 203 ? -0.265  2.118   30.613  1.00 71.80  ? 203 SER B CB  1 
ATOM 3131 O OG  . SER B 2 203 ? -0.570  3.495   30.490  1.00 69.36  ? 203 SER B OG  1 
ATOM 3132 N N   . PRO B 2 204 ? 1.590   1.493   27.871  1.00 70.31  ? 204 PRO B N   1 
ATOM 3133 C CA  . PRO B 2 204 ? 2.032   1.864   26.527  1.00 63.82  ? 204 PRO B CA  1 
ATOM 3134 C C   . PRO B 2 204 ? 1.136   2.929   25.904  1.00 65.03  ? 204 PRO B C   1 
ATOM 3135 O O   . PRO B 2 204 ? -0.081  2.757   25.822  1.00 64.44  ? 204 PRO B O   1 
ATOM 3136 C CB  . PRO B 2 204 ? 1.942   0.544   25.767  1.00 56.22  ? 204 PRO B CB  1 
ATOM 3137 C CG  . PRO B 2 204 ? 2.251   -0.484  26.820  1.00 55.24  ? 204 PRO B CG  1 
ATOM 3138 C CD  . PRO B 2 204 ? 1.542   0.030   28.050  1.00 63.28  ? 204 PRO B CD  1 
ATOM 3139 N N   . VAL B 2 205 ? 1.747   4.013   25.443  1.00 72.59  ? 205 VAL B N   1 
ATOM 3140 C CA  . VAL B 2 205 ? 0.988   5.139   24.919  1.00 68.15  ? 205 VAL B CA  1 
ATOM 3141 C C   . VAL B 2 205 ? 1.021   5.130   23.396  1.00 67.78  ? 205 VAL B C   1 
ATOM 3142 O O   . VAL B 2 205 ? 2.006   4.713   22.786  1.00 58.53  ? 205 VAL B O   1 
ATOM 3143 C CB  . VAL B 2 205 ? 1.518   6.483   25.468  1.00 67.62  ? 205 VAL B CB  1 
ATOM 3144 C CG1 . VAL B 2 205 ? 1.358   6.526   26.980  1.00 75.42  ? 205 VAL B CG1 1 
ATOM 3145 C CG2 . VAL B 2 205 ? 2.972   6.688   25.095  1.00 51.80  ? 205 VAL B CG2 1 
ATOM 3146 N N   . THR B 2 206 ? -0.081  5.555   22.787  1.00 65.80  ? 206 THR B N   1 
ATOM 3147 C CA  . THR B 2 206 ? -0.201  5.529   21.337  1.00 59.31  ? 206 THR B CA  1 
ATOM 3148 C C   . THR B 2 206 ? -0.617  6.887   20.784  1.00 52.68  ? 206 THR B C   1 
ATOM 3149 O O   . THR B 2 206 ? -1.657  7.430   21.151  1.00 48.93  ? 206 THR B O   1 
ATOM 3150 C CB  . THR B 2 206 ? -1.220  4.463   20.870  1.00 54.13  ? 206 THR B CB  1 
ATOM 3151 O OG1 . THR B 2 206 ? -2.553  4.921   21.130  1.00 55.90  ? 206 THR B OG1 1 
ATOM 3152 C CG2 . THR B 2 206 ? -0.988  3.136   21.585  1.00 51.10  ? 206 THR B CG2 1 
ATOM 3153 N N   . LYS B 2 207 ? 0.212   7.431   19.900  1.00 50.33  ? 207 LYS B N   1 
ATOM 3154 C CA  . LYS B 2 207 ? -0.105  8.673   19.205  1.00 56.56  ? 207 LYS B CA  1 
ATOM 3155 C C   . LYS B 2 207 ? -0.688  8.365   17.832  1.00 60.87  ? 207 LYS B C   1 
ATOM 3156 O O   . LYS B 2 207 ? -0.249  7.431   17.164  1.00 65.85  ? 207 LYS B O   1 
ATOM 3157 C CB  . LYS B 2 207 ? 1.143   9.547   19.073  1.00 47.85  ? 207 LYS B CB  1 
ATOM 3158 C CG  . LYS B 2 207 ? 1.438   10.393  20.294  1.00 50.87  ? 207 LYS B CG  1 
ATOM 3159 C CD  . LYS B 2 207 ? 0.598   11.658  20.319  1.00 56.03  ? 207 LYS B CD  1 
ATOM 3160 C CE  . LYS B 2 207 ? 1.025   12.564  21.464  1.00 61.91  ? 207 LYS B CE  1 
ATOM 3161 N NZ  . LYS B 2 207 ? 0.416   13.920  21.383  1.00 64.75  ? 207 LYS B NZ  1 
ATOM 3162 N N   . SER B 2 208 ? -1.678  9.145   17.408  1.00 67.60  ? 208 SER B N   1 
ATOM 3163 C CA  . SER B 2 208 ? -2.305  8.905   16.112  1.00 60.44  ? 208 SER B CA  1 
ATOM 3164 C C   . SER B 2 208 ? -2.956  10.143  15.505  1.00 53.73  ? 208 SER B C   1 
ATOM 3165 O O   . SER B 2 208 ? -2.941  11.224  16.092  1.00 50.27  ? 208 SER B O   1 
ATOM 3166 C CB  . SER B 2 208 ? -3.351  7.795   16.229  1.00 58.19  ? 208 SER B CB  1 
ATOM 3167 O OG  . SER B 2 208 ? -4.456  8.212   17.008  1.00 55.83  ? 208 SER B OG  1 
ATOM 3168 N N   . PHE B 2 209 ? -3.523  9.963   14.316  1.00 52.23  ? 209 PHE B N   1 
ATOM 3169 C CA  . PHE B 2 209 ? -4.245  11.019  13.619  1.00 54.92  ? 209 PHE B CA  1 
ATOM 3170 C C   . PHE B 2 209 ? -5.074  10.411  12.499  1.00 57.10  ? 209 PHE B C   1 
ATOM 3171 O O   . PHE B 2 209 ? -5.043  9.202   12.279  1.00 62.12  ? 209 PHE B O   1 
ATOM 3172 C CB  . PHE B 2 209 ? -3.282  12.068  13.053  1.00 53.77  ? 209 PHE B CB  1 
ATOM 3173 C CG  . PHE B 2 209 ? -2.419  11.558  11.929  1.00 55.75  ? 209 PHE B CG  1 
ATOM 3174 C CD1 . PHE B 2 209 ? -2.801  11.725  10.608  1.00 57.26  ? 209 PHE B CD1 1 
ATOM 3175 C CD2 . PHE B 2 209 ? -1.228  10.906  12.197  1.00 63.17  ? 209 PHE B CD2 1 
ATOM 3176 C CE1 . PHE B 2 209 ? -2.011  11.254  9.576   1.00 60.02  ? 209 PHE B CE1 1 
ATOM 3177 C CE2 . PHE B 2 209 ? -0.433  10.432  11.169  1.00 63.16  ? 209 PHE B CE2 1 
ATOM 3178 C CZ  . PHE B 2 209 ? -0.826  10.606  9.857   1.00 62.55  ? 209 PHE B CZ  1 
ATOM 3179 N N   . ASN B 2 210 ? -5.810  11.258  11.788  1.00 63.24  ? 210 ASN B N   1 
ATOM 3180 C CA  . ASN B 2 210 ? -6.604  10.810  10.653  1.00 63.40  ? 210 ASN B CA  1 
ATOM 3181 C C   . ASN B 2 210 ? -6.114  11.524  9.398   1.00 67.55  ? 210 ASN B C   1 
ATOM 3182 O O   . ASN B 2 210 ? -5.618  12.650  9.486   1.00 72.38  ? 210 ASN B O   1 
ATOM 3183 C CB  . ASN B 2 210 ? -8.091  11.092  10.877  1.00 65.22  ? 210 ASN B CB  1 
ATOM 3184 C CG  . ASN B 2 210 ? -8.512  10.941  12.332  1.00 72.32  ? 210 ASN B CG  1 
ATOM 3185 O OD1 . ASN B 2 210 ? -9.342  11.706  12.822  1.00 80.18  ? 210 ASN B OD1 1 
ATOM 3186 N ND2 . ASN B 2 210 ? -7.963  9.945   13.021  1.00 69.42  ? 210 ASN B ND2 1 
ATOM 3187 N N   . ARG B 2 211 ? -6.248  10.878  8.240   1.00 65.45  ? 211 ARG B N   1 
ATOM 3188 C CA  . ARG B 2 211 ? -5.806  11.474  6.976   1.00 58.75  ? 211 ARG B CA  1 
ATOM 3189 C C   . ARG B 2 211 ? -6.326  12.888  6.757   1.00 63.94  ? 211 ARG B C   1 
ATOM 3190 O O   . ARG B 2 211 ? -5.594  13.761  6.284   1.00 59.57  ? 211 ARG B O   1 
ATOM 3191 C CB  . ARG B 2 211 ? -6.227  10.617  5.785   1.00 53.34  ? 211 ARG B CB  1 
ATOM 3192 C CG  . ARG B 2 211 ? -5.437  9.348   5.601   1.00 46.84  ? 211 ARG B CG  1 
ATOM 3193 C CD  . ARG B 2 211 ? -5.578  8.830   4.175   1.00 47.15  ? 211 ARG B CD  1 
ATOM 3194 N NE  . ARG B 2 211 ? -5.258  9.834   3.158   1.00 51.94  ? 211 ARG B NE  1 
ATOM 3195 C CZ  . ARG B 2 211 ? -6.157  10.559  2.498   1.00 60.85  ? 211 ARG B CZ  1 
ATOM 3196 N NH1 . ARG B 2 211 ? -7.452  10.408  2.749   1.00 52.65  ? 211 ARG B NH1 1 
ATOM 3197 N NH2 . ARG B 2 211 ? -5.760  11.441  1.590   1.00 71.23  ? 211 ARG B NH2 1 
ATOM 3198 N N   . GLY B 2 212 ? -7.595  13.102  7.088   1.00 59.70  ? 212 GLY B N   1 
ATOM 3199 C CA  . GLY B 2 212 ? -8.209  14.406  6.939   1.00 59.02  ? 212 GLY B CA  1 
ATOM 3200 C C   . GLY B 2 212 ? -7.511  15.452  7.785   1.00 53.67  ? 212 GLY B C   1 
ATOM 3201 O O   . GLY B 2 212 ? -7.039  16.460  7.261   1.00 53.25  ? 212 GLY B O   1 
ATOM 3202 N N   . VAL C 1 2   ? -23.998 -15.716 50.193  1.00 31.89  ? 2   VAL H N   1 
ATOM 3203 C CA  . VAL C 1 2   ? -23.229 -16.950 50.318  1.00 52.27  ? 2   VAL H CA  1 
ATOM 3204 C C   . VAL C 1 2   ? -21.872 -16.738 51.003  1.00 47.81  ? 2   VAL H C   1 
ATOM 3205 O O   . VAL C 1 2   ? -20.963 -16.156 50.422  1.00 30.07  ? 2   VAL H O   1 
ATOM 3206 C CB  . VAL C 1 2   ? -23.009 -17.603 48.927  1.00 59.05  ? 2   VAL H CB  1 
ATOM 3207 C CG1 . VAL C 1 2   ? -22.585 -16.562 47.883  1.00 55.54  ? 2   VAL H CG1 1 
ATOM 3208 C CG2 . VAL C 1 2   ? -21.993 -18.732 49.020  1.00 60.60  ? 2   VAL H CG2 1 
ATOM 3209 N N   . GLN C 1 3   ? -21.737 -17.205 52.244  1.00 44.17  ? 3   GLN H N   1 
ATOM 3210 C CA  . GLN C 1 3   ? -20.481 -17.063 52.997  1.00 42.70  ? 3   GLN H CA  1 
ATOM 3211 C C   . GLN C 1 3   ? -20.265 -18.141 54.068  1.00 35.42  ? 3   GLN H C   1 
ATOM 3212 O O   . GLN C 1 3   ? -21.224 -18.726 54.588  1.00 36.53  ? 3   GLN H O   1 
ATOM 3213 C CB  . GLN C 1 3   ? -20.406 -15.696 53.686  1.00 42.94  ? 3   GLN H CB  1 
ATOM 3214 C CG  . GLN C 1 3   ? -20.011 -14.531 52.803  1.00 43.40  ? 3   GLN H CG  1 
ATOM 3215 C CD  . GLN C 1 3   ? -18.769 -13.827 53.292  1.00 49.24  ? 3   GLN H CD  1 
ATOM 3216 O OE1 . GLN C 1 3   ? -18.726 -13.313 54.409  1.00 54.72  ? 3   GLN H OE1 1 
ATOM 3217 N NE2 . GLN C 1 3   ? -17.733 -13.831 52.465  1.00 46.53  ? 3   GLN H NE2 1 
ATOM 3218 N N   . LEU C 1 4   ? -18.995 -18.390 54.386  1.00 29.73  ? 4   LEU H N   1 
ATOM 3219 C CA  . LEU C 1 4   ? -18.614 -19.153 55.564  1.00 30.98  ? 4   LEU H CA  1 
ATOM 3220 C C   . LEU C 1 4   ? -17.485 -18.430 56.300  1.00 39.65  ? 4   LEU H C   1 
ATOM 3221 O O   . LEU C 1 4   ? -16.371 -18.339 55.777  1.00 48.69  ? 4   LEU H O   1 
ATOM 3222 C CB  . LEU C 1 4   ? -18.181 -20.563 55.158  1.00 25.20  ? 4   LEU H CB  1 
ATOM 3223 C CG  . LEU C 1 4   ? -19.335 -21.502 54.796  1.00 33.41  ? 4   LEU H CG  1 
ATOM 3224 C CD1 . LEU C 1 4   ? -19.101 -22.059 53.415  1.00 25.64  ? 4   LEU H CD1 1 
ATOM 3225 C CD2 . LEU C 1 4   ? -19.483 -22.631 55.795  1.00 40.07  ? 4   LEU H CD2 1 
ATOM 3226 N N   . VAL C 1 5   ? -17.748 -17.962 57.521  1.00 40.34  ? 5   VAL H N   1 
ATOM 3227 C CA  . VAL C 1 5   ? -16.712 -17.271 58.287  1.00 39.72  ? 5   VAL H CA  1 
ATOM 3228 C C   . VAL C 1 5   ? -16.081 -18.215 59.308  1.00 48.87  ? 5   VAL H C   1 
ATOM 3229 O O   . VAL C 1 5   ? -16.763 -19.029 59.934  1.00 52.47  ? 5   VAL H O   1 
ATOM 3230 C CB  . VAL C 1 5   ? -17.253 -16.019 59.017  1.00 30.46  ? 5   VAL H CB  1 
ATOM 3231 C CG1 . VAL C 1 5   ? -16.111 -15.260 59.684  1.00 30.16  ? 5   VAL H CG1 1 
ATOM 3232 C CG2 . VAL C 1 5   ? -17.995 -15.109 58.055  1.00 29.75  ? 5   VAL H CG2 1 
ATOM 3233 N N   . GLU C 1 6   ? -14.768 -18.095 59.468  1.00 39.21  ? 6   GLU H N   1 
ATOM 3234 C CA  . GLU C 1 6   ? -14.019 -18.992 60.328  1.00 37.10  ? 6   GLU H CA  1 
ATOM 3235 C C   . GLU C 1 6   ? -13.305 -18.225 61.425  1.00 39.85  ? 6   GLU H C   1 
ATOM 3236 O O   . GLU C 1 6   ? -12.483 -17.349 61.154  1.00 39.24  ? 6   GLU H O   1 
ATOM 3237 C CB  . GLU C 1 6   ? -13.024 -19.788 59.499  1.00 30.57  ? 6   GLU H CB  1 
ATOM 3238 C CG  . GLU C 1 6   ? -13.665 -20.432 58.300  1.00 41.11  ? 6   GLU H CG  1 
ATOM 3239 C CD  . GLU C 1 6   ? -12.688 -21.238 57.493  1.00 60.94  ? 6   GLU H CD  1 
ATOM 3240 O OE1 . GLU C 1 6   ? -11.918 -21.985 58.122  1.00 78.60  ? 6   GLU H OE1 1 
ATOM 3241 O OE2 . GLU C 1 6   ? -12.695 -21.141 56.248  1.00 57.06  ? 6   GLU H OE2 1 
ATOM 3242 N N   . SER C 1 7   ? -13.625 -18.561 62.666  1.00 45.59  ? 7   SER H N   1 
ATOM 3243 C CA  . SER C 1 7   ? -13.103 -17.828 63.805  1.00 47.29  ? 7   SER H CA  1 
ATOM 3244 C C   . SER C 1 7   ? -12.669 -18.762 64.925  1.00 41.02  ? 7   SER H C   1 
ATOM 3245 O O   . SER C 1 7   ? -13.096 -19.915 64.987  1.00 42.54  ? 7   SER H O   1 
ATOM 3246 C CB  . SER C 1 7   ? -14.155 -16.845 64.319  1.00 45.12  ? 7   SER H CB  1 
ATOM 3247 O OG  . SER C 1 7   ? -15.436 -17.450 64.377  1.00 42.27  ? 7   SER H OG  1 
ATOM 3248 N N   . GLY C 1 8   ? -11.819 -18.260 65.811  1.00 40.36  ? 8   GLY H N   1 
ATOM 3249 C CA  . GLY C 1 8   ? -11.435 -19.010 66.989  1.00 40.20  ? 8   GLY H CA  1 
ATOM 3250 C C   . GLY C 1 8   ? -10.074 -19.669 66.899  1.00 37.93  ? 8   GLY H C   1 
ATOM 3251 O O   . GLY C 1 8   ? -9.752  -20.521 67.718  1.00 28.76  ? 8   GLY H O   1 
ATOM 3252 N N   . GLY C 1 9   ? -9.287  -19.306 65.889  1.00 34.07  ? 9   GLY H N   1 
ATOM 3253 C CA  . GLY C 1 9   ? -7.924  -19.806 65.766  1.00 38.74  ? 9   GLY H CA  1 
ATOM 3254 C C   . GLY C 1 9   ? -6.924  -18.816 66.349  1.00 43.51  ? 9   GLY H C   1 
ATOM 3255 O O   . GLY C 1 9   ? -7.285  -17.660 66.567  1.00 45.42  ? 9   GLY H O   1 
ATOM 3256 N N   . GLY C 1 10  ? -5.680  -19.248 66.593  1.00 44.72  ? 10  GLY H N   1 
ATOM 3257 C CA  . GLY C 1 10  ? -4.648  -18.379 67.169  1.00 27.46  ? 10  GLY H CA  1 
ATOM 3258 C C   . GLY C 1 10  ? -3.365  -19.052 67.668  1.00 27.87  ? 10  GLY H C   1 
ATOM 3259 O O   . GLY C 1 10  ? -3.109  -20.198 67.301  1.00 27.65  ? 10  GLY H O   1 
ATOM 3260 N N   . VAL C 1 11  ? -2.572  -18.347 68.491  1.00 49.13  ? 11  VAL H N   1 
ATOM 3261 C CA  . VAL C 1 11  ? -1.268  -18.823 68.987  1.00 49.91  ? 11  VAL H CA  1 
ATOM 3262 C C   . VAL C 1 11  ? -1.395  -19.512 70.320  1.00 34.80  ? 11  VAL H C   1 
ATOM 3263 O O   . VAL C 1 11  ? -2.131  -18.989 71.164  1.00 35.28  ? 11  VAL H O   1 
ATOM 3264 C CB  . VAL C 1 11  ? -0.255  -17.649 69.189  1.00 37.26  ? 11  VAL H CB  1 
ATOM 3265 C CG1 . VAL C 1 11  ? 1.106   -18.168 69.703  1.00 36.13  ? 11  VAL H CG1 1 
ATOM 3266 C CG2 . VAL C 1 11  ? -0.091  -16.867 67.916  1.00 37.97  ? 11  VAL H CG2 1 
ATOM 3267 N N   . VAL C 1 12  ? -0.640  -20.608 70.539  1.00 49.60  ? 12  VAL H N   1 
ATOM 3268 C CA  . VAL C 1 12  ? -0.569  -21.215 71.876  1.00 59.08  ? 12  VAL H CA  1 
ATOM 3269 C C   . VAL C 1 12  ? 0.216   -22.558 72.047  1.00 39.94  ? 12  VAL H C   1 
ATOM 3270 O O   . VAL C 1 12  ? 0.488   -23.267 71.072  1.00 40.86  ? 12  VAL H O   1 
ATOM 3271 C CB  . VAL C 1 12  ? -1.996  -21.387 72.337  1.00 62.27  ? 12  VAL H CB  1 
ATOM 3272 C CG1 . VAL C 1 12  ? -2.740  -22.255 71.262  1.00 30.00  ? 12  VAL H CG1 1 
ATOM 3273 C CG2 . VAL C 1 12  ? -2.121  -21.804 73.851  1.00 36.76  ? 12  VAL H CG2 1 
ATOM 3274 N N   . GLN C 1 13  ? 0.594   -22.843 73.305  1.00 38.64  ? 13  GLN H N   1 
ATOM 3275 C CA  . GLN C 1 13  ? 1.442   -23.967 73.771  1.00 41.41  ? 13  GLN H CA  1 
ATOM 3276 C C   . GLN C 1 13  ? 0.790   -25.355 73.765  1.00 44.85  ? 13  GLN H C   1 
ATOM 3277 O O   . GLN C 1 13  ? -0.385  -25.462 74.055  1.00 54.57  ? 13  GLN H O   1 
ATOM 3278 C CB  . GLN C 1 13  ? 1.899   -23.665 75.199  1.00 40.78  ? 13  GLN H CB  1 
ATOM 3279 C CG  . GLN C 1 13  ? 1.991   -22.181 75.546  1.00 51.07  ? 13  GLN H CG  1 
ATOM 3280 C CD  . GLN C 1 13  ? 3.159   -21.923 76.463  1.00 73.13  ? 13  GLN H CD  1 
ATOM 3281 O OE1 . GLN C 1 13  ? 4.165   -22.644 76.426  1.00 82.05  ? 13  GLN H OE1 1 
ATOM 3282 N NE2 . GLN C 1 13  ? 3.030   -20.918 77.312  1.00 79.47  ? 13  GLN H NE2 1 
ATOM 3283 N N   . PRO C 1 14  ? 1.565   -26.419 73.500  1.00 45.32  ? 14  PRO H N   1 
ATOM 3284 C CA  . PRO C 1 14  ? 1.029   -27.778 73.316  1.00 42.94  ? 14  PRO H CA  1 
ATOM 3285 C C   . PRO C 1 14  ? 0.175   -28.336 74.457  1.00 46.68  ? 14  PRO H C   1 
ATOM 3286 O O   . PRO C 1 14  ? 0.264   -27.833 75.568  1.00 38.31  ? 14  PRO H O   1 
ATOM 3287 C CB  . PRO C 1 14  ? 2.291   -28.614 73.180  1.00 41.93  ? 14  PRO H CB  1 
ATOM 3288 C CG  . PRO C 1 14  ? 3.322   -27.678 72.740  1.00 39.43  ? 14  PRO H CG  1 
ATOM 3289 C CD  . PRO C 1 14  ? 3.031   -26.388 73.362  1.00 36.62  ? 14  PRO H CD  1 
ATOM 3290 N N   . GLY C 1 15  ? -0.638  -29.349 74.157  1.00 38.28  ? 15  GLY H N   1 
ATOM 3291 C CA  . GLY C 1 15  ? -1.367  -30.094 75.164  1.00 40.37  ? 15  GLY H CA  1 
ATOM 3292 C C   . GLY C 1 15  ? -2.700  -29.501 75.546  1.00 38.95  ? 15  GLY H C   1 
ATOM 3293 O O   . GLY C 1 15  ? -3.496  -30.153 76.192  1.00 40.85  ? 15  GLY H O   1 
ATOM 3294 N N   . ARG C 1 16  ? -2.926  -28.264 75.137  1.00 32.80  ? 16  ARG H N   1 
ATOM 3295 C CA  . ARG C 1 16  ? -4.147  -27.504 75.378  1.00 40.91  ? 16  ARG H CA  1 
ATOM 3296 C C   . ARG C 1 16  ? -5.258  -27.836 74.428  1.00 57.21  ? 16  ARG H C   1 
ATOM 3297 O O   . ARG C 1 16  ? -5.165  -28.796 73.675  1.00 60.74  ? 16  ARG H O   1 
ATOM 3298 C CB  . ARG C 1 16  ? -3.849  -26.061 75.162  1.00 37.56  ? 16  ARG H CB  1 
ATOM 3299 C CG  . ARG C 1 16  ? -3.232  -26.051 73.821  1.00 59.33  ? 16  ARG H CG  1 
ATOM 3300 C CD  . ARG C 1 16  ? -3.518  -24.862 72.998  1.00 81.49  ? 16  ARG H CD  1 
ATOM 3301 N NE  . ARG C 1 16  ? -4.834  -24.492 72.452  1.00 99.32  ? 16  ARG H NE  1 
ATOM 3302 C CZ  . ARG C 1 16  ? -5.514  -23.459 72.932  1.00 107.30 ? 16  ARG H CZ  1 
ATOM 3303 N NH1 . ARG C 1 16  ? -5.060  -22.871 74.037  1.00 107.64 ? 16  ARG H NH1 1 
ATOM 3304 N NH2 . ARG C 1 16  ? -6.681  -23.122 72.425  1.00 106.83 ? 16  ARG H NH2 1 
ATOM 3305 N N   . SER C 1 17  ? -6.272  -26.969 74.428  1.00 37.84  ? 17  SER H N   1 
ATOM 3306 C CA  . SER C 1 17  ? -7.411  -27.137 73.555  1.00 37.01  ? 17  SER H CA  1 
ATOM 3307 C C   . SER C 1 17  ? -7.976  -25.819 72.986  1.00 36.06  ? 17  SER H C   1 
ATOM 3308 O O   . SER C 1 17  ? -8.077  -24.806 73.685  1.00 40.85  ? 17  SER H O   1 
ATOM 3309 C CB  . SER C 1 17  ? -8.476  -27.921 74.321  1.00 38.11  ? 17  SER H CB  1 
ATOM 3310 O OG  . SER C 1 17  ? -7.901  -29.143 74.775  1.00 56.01  ? 17  SER H OG  1 
ATOM 3311 N N   . LEU C 1 18  ? -8.306  -25.854 71.691  1.00 33.20  ? 18  LEU H N   1 
ATOM 3312 C CA  . LEU C 1 18  ? -8.985  -24.752 71.002  1.00 32.40  ? 18  LEU H CA  1 
ATOM 3313 C C   . LEU C 1 18  ? -10.168 -25.264 70.181  1.00 32.00  ? 18  LEU H C   1 
ATOM 3314 O O   . LEU C 1 18  ? -10.094 -26.324 69.560  1.00 37.47  ? 18  LEU H O   1 
ATOM 3315 C CB  . LEU C 1 18  ? -8.016  -24.004 70.085  1.00 31.43  ? 18  LEU H CB  1 
ATOM 3316 C CG  . LEU C 1 18  ? -8.428  -22.634 69.550  1.00 34.73  ? 18  LEU H CG  1 
ATOM 3317 C CD1 . LEU C 1 18  ? -8.864  -21.685 70.662  1.00 41.34  ? 18  LEU H CD1 1 
ATOM 3318 C CD2 . LEU C 1 18  ? -7.235  -22.049 68.841  1.00 38.53  ? 18  LEU H CD2 1 
ATOM 3319 N N   . ARG C 1 19  ? -11.273 -24.534 70.180  1.00 30.72  ? 19  ARG H N   1 
ATOM 3320 C CA  . ARG C 1 19  ? -12.327 -24.905 69.258  1.00 46.17  ? 19  ARG H CA  1 
ATOM 3321 C C   . ARG C 1 19  ? -12.510 -23.829 68.188  1.00 39.91  ? 19  ARG H C   1 
ATOM 3322 O O   . ARG C 1 19  ? -12.425 -22.627 68.459  1.00 29.47  ? 19  ARG H O   1 
ATOM 3323 C CB  . ARG C 1 19  ? -13.630 -25.195 70.000  1.00 31.36  ? 19  ARG H CB  1 
ATOM 3324 C CG  . ARG C 1 19  ? -14.505 -24.010 70.193  1.00 40.69  ? 19  ARG H CG  1 
ATOM 3325 C CD  . ARG C 1 19  ? -15.810 -24.442 70.772  1.00 44.10  ? 19  ARG H CD  1 
ATOM 3326 N NE  . ARG C 1 19  ? -16.794 -23.386 70.617  1.00 50.96  ? 19  ARG H NE  1 
ATOM 3327 C CZ  . ARG C 1 19  ? -18.041 -23.458 71.057  1.00 55.90  ? 19  ARG H CZ  1 
ATOM 3328 N NH1 . ARG C 1 19  ? -18.464 -24.542 71.695  1.00 57.32  ? 19  ARG H NH1 1 
ATOM 3329 N NH2 . ARG C 1 19  ? -18.864 -22.439 70.860  1.00 57.50  ? 19  ARG H NH2 1 
ATOM 3330 N N   . LEU C 1 20  ? -12.704 -24.290 66.956  1.00 39.08  ? 20  LEU H N   1 
ATOM 3331 C CA  . LEU C 1 20  ? -12.925 -23.414 65.814  1.00 35.97  ? 20  LEU H CA  1 
ATOM 3332 C C   . LEU C 1 20  ? -14.408 -23.329 65.493  1.00 31.30  ? 20  LEU H C   1 
ATOM 3333 O O   . LEU C 1 20  ? -15.094 -24.346 65.407  1.00 32.05  ? 20  LEU H O   1 
ATOM 3334 C CB  . LEU C 1 20  ? -12.146 -23.910 64.592  1.00 36.56  ? 20  LEU H CB  1 
ATOM 3335 C CG  . LEU C 1 20  ? -10.628 -23.762 64.667  1.00 37.82  ? 20  LEU H CG  1 
ATOM 3336 C CD1 . LEU C 1 20  ? -9.955  -24.342 63.433  1.00 26.30  ? 20  LEU H CD1 1 
ATOM 3337 C CD2 . LEU C 1 20  ? -10.280 -22.297 64.821  1.00 38.13  ? 20  LEU H CD2 1 
ATOM 3338 N N   . ASP C 1 21  ? -14.899 -22.107 65.325  1.00 26.88  ? 21  ASP H N   1 
ATOM 3339 C CA  . ASP C 1 21  ? -16.300 -21.891 65.005  1.00 27.34  ? 21  ASP H CA  1 
ATOM 3340 C C   . ASP C 1 21  ? -16.445 -21.452 63.563  1.00 26.75  ? 21  ASP H C   1 
ATOM 3341 O O   . ASP C 1 21  ? -15.971 -20.385 63.182  1.00 34.03  ? 21  ASP H O   1 
ATOM 3342 C CB  . ASP C 1 21  ? -16.909 -20.849 65.940  1.00 41.66  ? 21  ASP H CB  1 
ATOM 3343 C CG  . ASP C 1 21  ? -16.695 -21.188 67.398  1.00 51.02  ? 21  ASP H CG  1 
ATOM 3344 O OD1 . ASP C 1 21  ? -17.665 -21.621 68.057  1.00 59.42  ? 21  ASP H OD1 1 
ATOM 3345 O OD2 . ASP C 1 21  ? -15.553 -21.025 67.881  1.00 50.76  ? 21  ASP H OD2 1 
ATOM 3346 N N   . CYS C 1 22  ? -17.101 -22.278 62.759  1.00 25.32  ? 22  CYS H N   1 
ATOM 3347 C CA  . CYS C 1 22  ? -17.342 -21.923 61.373  1.00 24.98  ? 22  CYS H CA  1 
ATOM 3348 C C   . CYS C 1 22  ? -18.769 -21.429 61.203  1.00 36.58  ? 22  CYS H C   1 
ATOM 3349 O O   . CYS C 1 22  ? -19.722 -22.203 61.265  1.00 28.69  ? 22  CYS H O   1 
ATOM 3350 C CB  . CYS C 1 22  ? -17.070 -23.114 60.453  1.00 33.87  ? 22  CYS H CB  1 
ATOM 3351 S SG  . CYS C 1 22  ? -17.534 -22.834 58.731  1.00 58.89  ? 22  CYS H SG  1 
ATOM 3352 N N   . LYS C 1 23  ? -18.903 -20.128 60.977  1.00 41.71  ? 23  LYS H N   1 
ATOM 3353 C CA  . LYS C 1 23  ? -20.207 -19.508 60.807  1.00 37.02  ? 23  LYS H CA  1 
ATOM 3354 C C   . LYS C 1 23  ? -20.603 -19.483 59.338  1.00 37.69  ? 23  LYS H C   1 
ATOM 3355 O O   . LYS C 1 23  ? -19.806 -19.108 58.479  1.00 35.57  ? 23  LYS H O   1 
ATOM 3356 C CB  . LYS C 1 23  ? -20.203 -18.088 61.382  1.00 42.56  ? 23  LYS H CB  1 
ATOM 3357 C CG  . LYS C 1 23  ? -21.408 -17.245 60.988  1.00 45.14  ? 23  LYS H CG  1 
ATOM 3358 C CD  . LYS C 1 23  ? -22.360 -16.999 62.152  1.00 43.65  ? 23  LYS H CD  1 
ATOM 3359 C CE  . LYS C 1 23  ? -22.889 -18.287 62.756  1.00 44.47  ? 23  LYS H CE  1 
ATOM 3360 N NZ  . LYS C 1 23  ? -23.744 -18.020 63.949  1.00 44.91  ? 23  LYS H NZ  1 
ATOM 3361 N N   . ALA C 1 24  ? -21.838 -19.881 59.056  1.00 29.04  ? 24  ALA H N   1 
ATOM 3362 C CA  . ALA C 1 24  ? -22.338 -19.915 57.687  1.00 36.72  ? 24  ALA H CA  1 
ATOM 3363 C C   . ALA C 1 24  ? -23.682 -19.208 57.584  1.00 42.41  ? 24  ALA H C   1 
ATOM 3364 O O   . ALA C 1 24  ? -24.527 -19.342 58.469  1.00 49.62  ? 24  ALA H O   1 
ATOM 3365 C CB  . ALA C 1 24  ? -22.458 -21.347 57.202  1.00 29.11  ? 24  ALA H CB  1 
ATOM 3366 N N   . SER C 1 25  ? -23.878 -18.460 56.502  1.00 50.66  ? 25  SER H N   1 
ATOM 3367 C CA  . SER C 1 25  ? -25.122 -17.723 56.300  1.00 54.15  ? 25  SER H CA  1 
ATOM 3368 C C   . SER C 1 25  ? -25.391 -17.428 54.827  1.00 44.75  ? 25  SER H C   1 
ATOM 3369 O O   . SER C 1 25  ? -24.499 -17.538 53.988  1.00 41.76  ? 25  SER H O   1 
ATOM 3370 C CB  . SER C 1 25  ? -25.100 -16.414 57.090  1.00 58.98  ? 25  SER H CB  1 
ATOM 3371 O OG  . SER C 1 25  ? -25.180 -16.654 58.484  1.00 63.72  ? 25  SER H OG  1 
ATOM 3372 N N   . GLY C 1 26  ? -26.633 -17.063 54.522  1.00 62.69  ? 26  GLY H N   1 
ATOM 3373 C CA  . GLY C 1 26  ? -27.028 -16.715 53.167  1.00 66.37  ? 26  GLY H CA  1 
ATOM 3374 C C   . GLY C 1 26  ? -27.435 -17.923 52.345  1.00 74.31  ? 26  GLY H C   1 
ATOM 3375 O O   . GLY C 1 26  ? -27.935 -17.798 51.229  1.00 69.86  ? 26  GLY H O   1 
ATOM 3376 N N   . ILE C 1 27  ? -27.207 -19.095 52.928  1.00 80.46  ? 27  ILE H N   1 
ATOM 3377 C CA  . ILE C 1 27  ? -27.460 -20.396 52.320  1.00 79.91  ? 27  ILE H CA  1 
ATOM 3378 C C   . ILE C 1 27  ? -28.324 -21.171 53.308  1.00 78.05  ? 27  ILE H C   1 
ATOM 3379 O O   . ILE C 1 27  ? -28.807 -20.599 54.290  1.00 75.68  ? 27  ILE H O   1 
ATOM 3380 C CB  . ILE C 1 27  ? -26.150 -21.166 52.038  1.00 80.20  ? 27  ILE H CB  1 
ATOM 3381 C CG1 . ILE C 1 27  ? -25.088 -20.219 51.520  1.00 76.20  ? 27  ILE H CG1 1 
ATOM 3382 C CG2 . ILE C 1 27  ? -26.352 -22.252 50.979  1.00 74.14  ? 27  ILE H CG2 1 
ATOM 3383 C CD1 . ILE C 1 27  ? -25.437 -19.701 50.150  1.00 76.34  ? 27  ILE H CD1 1 
ATOM 3384 N N   . THR C 1 28  ? -28.568 -22.449 53.037  1.00 67.59  ? 28  THR H N   1 
ATOM 3385 C CA  . THR C 1 28  ? -29.116 -23.330 54.055  1.00 62.91  ? 28  THR H CA  1 
ATOM 3386 C C   . THR C 1 28  ? -28.008 -24.279 54.522  1.00 52.61  ? 28  THR H C   1 
ATOM 3387 O O   . THR C 1 28  ? -27.633 -25.214 53.807  1.00 46.87  ? 28  THR H O   1 
ATOM 3388 C CB  . THR C 1 28  ? -30.327 -24.112 53.531  1.00 66.23  ? 28  THR H CB  1 
ATOM 3389 O OG1 . THR C 1 28  ? -29.929 -24.947 52.437  1.00 76.38  ? 28  THR H OG1 1 
ATOM 3390 C CG2 . THR C 1 28  ? -31.380 -23.141 53.061  1.00 62.95  ? 28  THR H CG2 1 
ATOM 3391 N N   . PHE C 1 29  ? -27.504 -24.032 55.731  1.00 39.01  ? 29  PHE H N   1 
ATOM 3392 C CA  . PHE C 1 29  ? -26.384 -24.783 56.302  1.00 37.93  ? 29  PHE H CA  1 
ATOM 3393 C C   . PHE C 1 29  ? -26.815 -26.190 56.650  1.00 40.01  ? 29  PHE H C   1 
ATOM 3394 O O   . PHE C 1 29  ? -26.069 -27.145 56.438  1.00 34.94  ? 29  PHE H O   1 
ATOM 3395 C CB  . PHE C 1 29  ? -25.834 -24.062 57.547  1.00 35.32  ? 29  PHE H CB  1 
ATOM 3396 C CG  . PHE C 1 29  ? -24.879 -24.898 58.397  1.00 35.46  ? 29  PHE H CG  1 
ATOM 3397 C CD1 . PHE C 1 29  ? -25.361 -25.767 59.374  1.00 36.12  ? 29  PHE H CD1 1 
ATOM 3398 C CD2 . PHE C 1 29  ? -23.502 -24.782 58.250  1.00 32.68  ? 29  PHE H CD2 1 
ATOM 3399 C CE1 . PHE C 1 29  ? -24.498 -26.518 60.156  1.00 39.93  ? 29  PHE H CE1 1 
ATOM 3400 C CE2 . PHE C 1 29  ? -22.635 -25.534 59.039  1.00 32.18  ? 29  PHE H CE2 1 
ATOM 3401 C CZ  . PHE C 1 29  ? -23.136 -26.402 59.988  1.00 43.64  ? 29  PHE H CZ  1 
ATOM 3402 N N   . SER C 1 30  ? -28.032 -26.290 57.178  1.00 41.24  ? 30  SER H N   1 
ATOM 3403 C CA  . SER C 1 30  ? -28.585 -27.538 57.701  1.00 45.24  ? 30  SER H CA  1 
ATOM 3404 C C   . SER C 1 30  ? -28.514 -28.687 56.704  1.00 43.54  ? 30  SER H C   1 
ATOM 3405 O O   . SER C 1 30  ? -28.090 -29.794 57.046  1.00 55.50  ? 30  SER H O   1 
ATOM 3406 C CB  . SER C 1 30  ? -30.033 -27.331 58.106  1.00 48.96  ? 30  SER H CB  1 
ATOM 3407 O OG  . SER C 1 30  ? -30.207 -26.138 58.841  1.00 34.99  ? 30  SER H OG  1 
ATOM 3408 N N   . ASN C 1 31  ? -28.854 -28.388 55.452  1.00 46.53  ? 31  ASN H N   1 
ATOM 3409 C CA  . ASN C 1 31  ? -29.031 -29.418 54.436  1.00 40.74  ? 31  ASN H CA  1 
ATOM 3410 C C   . ASN C 1 31  ? -27.704 -29.830 53.801  1.00 45.91  ? 31  ASN H C   1 
ATOM 3411 O O   . ASN C 1 31  ? -27.695 -30.593 52.844  1.00 52.32  ? 31  ASN H O   1 
ATOM 3412 C CB  . ASN C 1 31  ? -30.027 -28.956 53.347  1.00 41.34  ? 31  ASN H CB  1 
ATOM 3413 C CG  . ASN C 1 31  ? -31.296 -28.317 53.923  1.00 48.45  ? 31  ASN H CG  1 
ATOM 3414 O OD1 . ASN C 1 31  ? -31.669 -28.550 55.083  1.00 55.34  ? 31  ASN H OD1 1 
ATOM 3415 N ND2 . ASN C 1 31  ? -31.993 -27.551 53.087  1.00 44.07  ? 31  ASN H ND2 1 
ATOM 3416 N N   . SER C 1 32  ? -26.594 -29.277 54.290  1.00 38.20  ? 32  SER H N   1 
ATOM 3417 C CA  . SER C 1 32  ? -25.283 -29.630 53.745  1.00 43.29  ? 32  SER H CA  1 
ATOM 3418 C C   . SER C 1 32  ? -24.280 -30.140 54.788  1.00 31.88  ? 32  SER H C   1 
ATOM 3419 O O   . SER C 1 32  ? -24.120 -29.554 55.861  1.00 41.58  ? 32  SER H O   1 
ATOM 3420 C CB  . SER C 1 32  ? -24.696 -28.424 53.004  1.00 50.41  ? 32  SER H CB  1 
ATOM 3421 O OG  . SER C 1 32  ? -23.812 -28.837 51.976  1.00 64.54  ? 32  SER H OG  1 
ATOM 3422 N N   . GLY C 1 33  ? -23.599 -31.232 54.437  1.00 31.75  ? 33  GLY H N   1 
ATOM 3423 C CA  . GLY C 1 33  ? -22.533 -31.784 55.253  1.00 31.11  ? 33  GLY H CA  1 
ATOM 3424 C C   . GLY C 1 33  ? -21.287 -30.927 55.158  1.00 36.41  ? 33  GLY H C   1 
ATOM 3425 O O   . GLY C 1 33  ? -20.903 -30.492 54.068  1.00 30.30  ? 33  GLY H O   1 
ATOM 3426 N N   . MET C 1 34  ? -20.651 -30.680 56.298  1.00 41.24  ? 34  MET H N   1 
ATOM 3427 C CA  . MET C 1 34  ? -19.518 -29.767 56.331  1.00 30.06  ? 34  MET H CA  1 
ATOM 3428 C C   . MET C 1 34  ? -18.158 -30.461 56.366  1.00 29.41  ? 34  MET H C   1 
ATOM 3429 O O   . MET C 1 34  ? -18.067 -31.679 56.515  1.00 29.74  ? 34  MET H O   1 
ATOM 3430 C CB  . MET C 1 34  ? -19.646 -28.843 57.537  1.00 36.62  ? 34  MET H CB  1 
ATOM 3431 C CG  . MET C 1 34  ? -20.805 -27.876 57.433  1.00 36.20  ? 34  MET H CG  1 
ATOM 3432 S SD  . MET C 1 34  ? -20.879 -27.153 55.790  1.00 34.15  ? 34  MET H SD  1 
ATOM 3433 C CE  . MET C 1 34  ? -19.428 -26.114 55.857  1.00 29.36  ? 34  MET H CE  1 
ATOM 3434 N N   . HIS C 1 35  ? -17.100 -29.660 56.278  1.00 44.38  ? 35  HIS H N   1 
ATOM 3435 C CA  . HIS C 1 35  ? -15.739 -30.186 56.195  1.00 40.60  ? 35  HIS H CA  1 
ATOM 3436 C C   . HIS C 1 35  ? -14.734 -29.300 56.930  1.00 24.59  ? 35  HIS H C   1 
ATOM 3437 O O   . HIS C 1 35  ? -15.016 -28.147 57.251  1.00 24.53  ? 35  HIS H O   1 
ATOM 3438 C CB  . HIS C 1 35  ? -15.305 -30.338 54.730  1.00 38.76  ? 35  HIS H CB  1 
ATOM 3439 C CG  . HIS C 1 35  ? -15.578 -31.695 54.145  1.00 25.20  ? 35  HIS H CG  1 
ATOM 3440 N ND1 . HIS C 1 35  ? -14.567 -32.570 53.827  1.00 25.01  ? 35  HIS H ND1 1 
ATOM 3441 C CD2 . HIS C 1 35  ? -16.733 -32.301 53.798  1.00 25.93  ? 35  HIS H CD2 1 
ATOM 3442 C CE1 . HIS C 1 35  ? -15.091 -33.678 53.319  1.00 35.33  ? 35  HIS H CE1 1 
ATOM 3443 N NE2 . HIS C 1 35  ? -16.404 -33.534 53.289  1.00 34.28  ? 35  HIS H NE2 1 
ATOM 3444 N N   . TRP C 1 36  ? -13.563 -29.861 57.200  1.00 33.86  ? 36  TRP H N   1 
ATOM 3445 C CA  . TRP C 1 36  ? -12.440 -29.101 57.724  1.00 36.85  ? 36  TRP H CA  1 
ATOM 3446 C C   . TRP C 1 36  ? -11.190 -29.524 56.957  1.00 22.51  ? 36  TRP H C   1 
ATOM 3447 O O   . TRP C 1 36  ? -10.943 -30.714 56.781  1.00 35.29  ? 36  TRP H O   1 
ATOM 3448 C CB  . TRP C 1 36  ? -12.277 -29.327 59.232  1.00 38.37  ? 36  TRP H CB  1 
ATOM 3449 C CG  . TRP C 1 36  ? -13.114 -28.405 60.078  1.00 23.66  ? 36  TRP H CG  1 
ATOM 3450 C CD1 . TRP C 1 36  ? -14.173 -28.745 60.869  1.00 24.40  ? 36  TRP H CD1 1 
ATOM 3451 C CD2 . TRP C 1 36  ? -12.958 -26.970 60.215  1.00 23.36  ? 36  TRP H CD2 1 
ATOM 3452 N NE1 . TRP C 1 36  ? -14.685 -27.618 61.478  1.00 45.08  ? 36  TRP H NE1 1 
ATOM 3453 C CE2 . TRP C 1 36  ? -13.967 -26.550 61.100  1.00 23.94  ? 36  TRP H CE2 1 
ATOM 3454 C CE3 . TRP C 1 36  ? -12.064 -26.060 59.667  1.00 51.30  ? 36  TRP H CE3 1 
ATOM 3455 C CZ2 . TRP C 1 36  ? -14.092 -25.190 61.445  1.00 23.92  ? 36  TRP H CZ2 1 
ATOM 3456 C CZ3 . TRP C 1 36  ? -12.202 -24.725 60.022  1.00 52.48  ? 36  TRP H CZ3 1 
ATOM 3457 C CH2 . TRP C 1 36  ? -13.209 -24.303 60.903  1.00 52.20  ? 36  TRP H CH2 1 
ATOM 3458 N N   . VAL C 1 37  ? -10.438 -28.555 56.446  1.00 21.08  ? 37  VAL H N   1 
ATOM 3459 C CA  . VAL C 1 37  ? -9.188  -28.848 55.748  1.00 20.79  ? 37  VAL H CA  1 
ATOM 3460 C C   . VAL C 1 37  ? -8.101  -27.889 56.212  1.00 20.54  ? 37  VAL H C   1 
ATOM 3461 O O   . VAL C 1 37  ? -8.292  -26.675 56.189  1.00 35.33  ? 37  VAL H O   1 
ATOM 3462 C CB  . VAL C 1 37  ? -9.338  -28.747 54.209  1.00 20.62  ? 37  VAL H CB  1 
ATOM 3463 C CG1 . VAL C 1 37  ? -8.012  -29.041 53.518  1.00 40.04  ? 37  VAL H CG1 1 
ATOM 3464 C CG2 . VAL C 1 37  ? -10.409 -29.698 53.712  1.00 20.99  ? 37  VAL H CG2 1 
ATOM 3465 N N   . ARG C 1 38  ? -6.969  -28.433 56.647  1.00 22.08  ? 38  ARG H N   1 
ATOM 3466 C CA  . ARG C 1 38  ? -5.862  -27.605 57.111  1.00 30.50  ? 38  ARG H CA  1 
ATOM 3467 C C   . ARG C 1 38  ? -4.739  -27.587 56.088  1.00 29.04  ? 38  ARG H C   1 
ATOM 3468 O O   . ARG C 1 38  ? -4.518  -28.564 55.370  1.00 27.35  ? 38  ARG H O   1 
ATOM 3469 C CB  . ARG C 1 38  ? -5.328  -28.092 58.462  1.00 30.43  ? 38  ARG H CB  1 
ATOM 3470 C CG  . ARG C 1 38  ? -4.667  -29.461 58.434  1.00 22.80  ? 38  ARG H CG  1 
ATOM 3471 C CD  . ARG C 1 38  ? -4.265  -29.862 59.839  1.00 23.42  ? 38  ARG H CD  1 
ATOM 3472 N NE  . ARG C 1 38  ? -3.849  -31.255 59.948  1.00 23.98  ? 38  ARG H NE  1 
ATOM 3473 C CZ  . ARG C 1 38  ? -3.566  -31.854 61.100  1.00 24.74  ? 38  ARG H CZ  1 
ATOM 3474 N NH1 . ARG C 1 38  ? -3.661  -31.182 62.240  1.00 25.01  ? 38  ARG H NH1 1 
ATOM 3475 N NH2 . ARG C 1 38  ? -3.198  -33.127 61.116  1.00 25.34  ? 38  ARG H NH2 1 
ATOM 3476 N N   . GLN C 1 39  ? -4.046  -26.460 56.014  1.00 33.44  ? 39  GLN H N   1 
ATOM 3477 C CA  . GLN C 1 39  ? -2.879  -26.356 55.168  1.00 24.06  ? 39  GLN H CA  1 
ATOM 3478 C C   . GLN C 1 39  ? -1.710  -25.910 56.028  1.00 24.33  ? 39  GLN H C   1 
ATOM 3479 O O   . GLN C 1 39  ? -1.668  -24.766 56.488  1.00 34.32  ? 39  GLN H O   1 
ATOM 3480 C CB  . GLN C 1 39  ? -3.146  -25.381 54.019  1.00 23.85  ? 39  GLN H CB  1 
ATOM 3481 C CG  . GLN C 1 39  ? -1.952  -25.073 53.158  1.00 23.99  ? 39  GLN H CG  1 
ATOM 3482 C CD  . GLN C 1 39  ? -2.329  -24.368 51.871  1.00 32.09  ? 39  GLN H CD  1 
ATOM 3483 O OE1 . GLN C 1 39  ? -3.116  -23.421 51.874  1.00 38.60  ? 39  GLN H OE1 1 
ATOM 3484 N NE2 . GLN C 1 39  ? -1.778  -24.838 50.757  1.00 24.14  ? 39  GLN H NE2 1 
ATOM 3485 N N   . ALA C 1 40  ? -0.761  -26.817 56.237  1.00 23.77  ? 40  ALA H N   1 
ATOM 3486 C CA  . ALA C 1 40  ? 0.400   -26.511 57.056  1.00 24.21  ? 40  ALA H CA  1 
ATOM 3487 C C   . ALA C 1 40  ? 1.197   -25.439 56.332  1.00 55.95  ? 40  ALA H C   1 
ATOM 3488 O O   . ALA C 1 40  ? 1.192   -25.410 55.103  1.00 65.63  ? 40  ALA H O   1 
ATOM 3489 C CB  . ALA C 1 40  ? 1.237   -27.757 57.304  1.00 32.64  ? 40  ALA H CB  1 
ATOM 3490 N N   . PRO C 1 41  ? 1.864   -24.544 57.082  1.00 47.61  ? 41  PRO H N   1 
ATOM 3491 C CA  . PRO C 1 41  ? 2.535   -23.428 56.408  1.00 25.00  ? 41  PRO H CA  1 
ATOM 3492 C C   . PRO C 1 41  ? 3.490   -23.915 55.319  1.00 25.26  ? 41  PRO H C   1 
ATOM 3493 O O   . PRO C 1 41  ? 4.358   -24.748 55.578  1.00 25.74  ? 41  PRO H O   1 
ATOM 3494 C CB  . PRO C 1 41  ? 3.301   -22.748 57.543  1.00 25.53  ? 41  PRO H CB  1 
ATOM 3495 C CG  . PRO C 1 41  ? 2.495   -23.056 58.766  1.00 25.48  ? 41  PRO H CG  1 
ATOM 3496 C CD  . PRO C 1 41  ? 1.968   -24.451 58.550  1.00 41.17  ? 41  PRO H CD  1 
ATOM 3497 N N   . GLY C 1 42  ? 3.322   -23.394 54.108  1.00 28.51  ? 42  GLY H N   1 
ATOM 3498 C CA  . GLY C 1 42  ? 4.140   -23.794 52.976  1.00 33.54  ? 42  GLY H CA  1 
ATOM 3499 C C   . GLY C 1 42  ? 3.950   -25.218 52.472  1.00 28.78  ? 42  GLY H C   1 
ATOM 3500 O O   . GLY C 1 42  ? 4.753   -25.700 51.675  1.00 29.21  ? 42  GLY H O   1 
ATOM 3501 N N   . LYS C 1 43  ? 2.891   -25.890 52.912  1.00 27.59  ? 43  LYS H N   1 
ATOM 3502 C CA  . LYS C 1 43  ? 2.627   -27.266 52.482  1.00 27.62  ? 43  LYS H CA  1 
ATOM 3503 C C   . LYS C 1 43  ? 1.216   -27.413 51.917  1.00 42.16  ? 43  LYS H C   1 
ATOM 3504 O O   . LYS C 1 43  ? 0.399   -26.512 52.043  1.00 37.42  ? 43  LYS H O   1 
ATOM 3505 C CB  . LYS C 1 43  ? 2.838   -28.247 53.634  1.00 46.65  ? 43  LYS H CB  1 
ATOM 3506 C CG  . LYS C 1 43  ? 4.289   -28.408 54.050  1.00 41.56  ? 43  LYS H CG  1 
ATOM 3507 C CD  . LYS C 1 43  ? 4.406   -29.323 55.258  1.00 41.66  ? 43  LYS H CD  1 
ATOM 3508 C CE  . LYS C 1 43  ? 5.834   -29.388 55.777  1.00 40.56  ? 43  LYS H CE  1 
ATOM 3509 N NZ  . LYS C 1 43  ? 6.703   -30.284 54.961  1.00 40.60  ? 43  LYS H NZ  1 
ATOM 3510 N N   . GLY C 1 44  ? 0.943   -28.545 51.276  1.00 49.17  ? 44  GLY H N   1 
ATOM 3511 C CA  . GLY C 1 44  ? -0.325  -28.755 50.596  1.00 49.49  ? 44  GLY H CA  1 
ATOM 3512 C C   . GLY C 1 44  ? -1.523  -28.928 51.510  1.00 28.25  ? 44  GLY H C   1 
ATOM 3513 O O   . GLY C 1 44  ? -1.407  -28.819 52.728  1.00 31.80  ? 44  GLY H O   1 
ATOM 3514 N N   . LEU C 1 45  ? -2.683  -29.197 50.915  1.00 22.84  ? 45  LEU H N   1 
ATOM 3515 C CA  . LEU C 1 45  ? -3.921  -29.378 51.675  1.00 22.32  ? 45  LEU H CA  1 
ATOM 3516 C C   . LEU C 1 45  ? -3.984  -30.740 52.350  1.00 22.58  ? 45  LEU H C   1 
ATOM 3517 O O   . LEU C 1 45  ? -3.385  -31.708 51.880  1.00 40.16  ? 45  LEU H O   1 
ATOM 3518 C CB  . LEU C 1 45  ? -5.141  -29.216 50.772  1.00 40.17  ? 45  LEU H CB  1 
ATOM 3519 C CG  . LEU C 1 45  ? -5.358  -27.868 50.107  1.00 21.63  ? 45  LEU H CG  1 
ATOM 3520 C CD1 . LEU C 1 45  ? -6.450  -27.996 49.070  1.00 21.43  ? 45  LEU H CD1 1 
ATOM 3521 C CD2 . LEU C 1 45  ? -5.723  -26.845 51.164  1.00 21.23  ? 45  LEU H CD2 1 
ATOM 3522 N N   . GLU C 1 46  ? -4.701  -30.800 53.467  1.00 24.20  ? 46  GLU H N   1 
ATOM 3523 C CA  . GLU C 1 46  ? -4.941  -32.055 54.162  1.00 21.86  ? 46  GLU H CA  1 
ATOM 3524 C C   . GLU C 1 46  ? -6.381  -32.122 54.675  1.00 36.13  ? 46  GLU H C   1 
ATOM 3525 O O   . GLU C 1 46  ? -6.797  -31.239 55.425  1.00 32.48  ? 46  GLU H O   1 
ATOM 3526 C CB  . GLU C 1 46  ? -3.946  -32.199 55.311  1.00 22.31  ? 46  GLU H CB  1 
ATOM 3527 C CG  . GLU C 1 46  ? -3.701  -33.617 55.762  1.00 53.43  ? 46  GLU H CG  1 
ATOM 3528 C CD  . GLU C 1 46  ? -3.104  -33.667 57.151  1.00 50.30  ? 46  GLU H CD  1 
ATOM 3529 O OE1 . GLU C 1 46  ? -2.257  -32.800 57.458  1.00 41.06  ? 46  GLU H OE1 1 
ATOM 3530 O OE2 . GLU C 1 46  ? -3.477  -34.566 57.935  1.00 57.55  ? 46  GLU H OE2 1 
ATOM 3531 N N   . TRP C 1 47  ? -7.131  -33.164 54.310  1.00 39.53  ? 47  TRP H N   1 
ATOM 3532 C CA  . TRP C 1 47  ? -8.501  -33.280 54.802  1.00 21.21  ? 47  TRP H CA  1 
ATOM 3533 C C   . TRP C 1 47  ? -8.446  -33.533 56.301  1.00 38.86  ? 47  TRP H C   1 
ATOM 3534 O O   . TRP C 1 47  ? -7.829  -34.496 56.751  1.00 40.40  ? 47  TRP H O   1 
ATOM 3535 C CB  . TRP C 1 47  ? -9.264  -34.412 54.095  1.00 21.25  ? 47  TRP H CB  1 
ATOM 3536 C CG  . TRP C 1 47  ? -10.603 -34.758 54.733  1.00 27.48  ? 47  TRP H CG  1 
ATOM 3537 C CD1 . TRP C 1 47  ? -11.794 -34.103 54.568  1.00 26.48  ? 47  TRP H CD1 1 
ATOM 3538 C CD2 . TRP C 1 47  ? -10.865 -35.840 55.637  1.00 29.20  ? 47  TRP H CD2 1 
ATOM 3539 N NE1 . TRP C 1 47  ? -12.778 -34.714 55.313  1.00 21.18  ? 47  TRP H NE1 1 
ATOM 3540 C CE2 . TRP C 1 47  ? -12.234 -35.780 55.978  1.00 34.81  ? 47  TRP H CE2 1 
ATOM 3541 C CE3 . TRP C 1 47  ? -10.078 -36.850 56.193  1.00 22.59  ? 47  TRP H CE3 1 
ATOM 3542 C CZ2 . TRP C 1 47  ? -12.825 -36.694 56.847  1.00 44.76  ? 47  TRP H CZ2 1 
ATOM 3543 C CZ3 . TRP C 1 47  ? -10.668 -37.752 57.054  1.00 23.11  ? 47  TRP H CZ3 1 
ATOM 3544 C CH2 . TRP C 1 47  ? -12.027 -37.669 57.373  1.00 49.43  ? 47  TRP H CH2 1 
ATOM 3545 N N   . VAL C 1 48  ? -9.106  -32.676 57.074  1.00 40.57  ? 48  VAL H N   1 
ATOM 3546 C CA  . VAL C 1 48  ? -9.099  -32.823 58.524  1.00 24.48  ? 48  VAL H CA  1 
ATOM 3547 C C   . VAL C 1 48  ? -10.230 -33.730 58.981  1.00 24.72  ? 48  VAL H C   1 
ATOM 3548 O O   . VAL C 1 48  ? -9.990  -34.810 59.512  1.00 25.81  ? 48  VAL H O   1 
ATOM 3549 C CB  . VAL C 1 48  ? -9.221  -31.471 59.248  1.00 25.20  ? 48  VAL H CB  1 
ATOM 3550 C CG1 . VAL C 1 48  ? -9.186  -31.673 60.751  1.00 25.57  ? 48  VAL H CG1 1 
ATOM 3551 C CG2 . VAL C 1 48  ? -8.107  -30.539 58.816  1.00 24.76  ? 48  VAL H CG2 1 
ATOM 3552 N N   . ALA C 1 49  ? -11.465 -33.288 58.784  1.00 19.85  ? 49  ALA H N   1 
ATOM 3553 C CA  . ALA C 1 49  ? -12.610 -34.084 59.201  1.00 38.66  ? 49  ALA H CA  1 
ATOM 3554 C C   . ALA C 1 49  ? -13.869 -33.744 58.417  1.00 36.71  ? 49  ALA H C   1 
ATOM 3555 O O   . ALA C 1 49  ? -13.962 -32.698 57.775  1.00 34.10  ? 49  ALA H O   1 
ATOM 3556 C CB  . ALA C 1 49  ? -12.858 -33.911 60.688  1.00 20.62  ? 49  ALA H CB  1 
ATOM 3557 N N   . VAL C 1 50  ? -14.835 -34.652 58.482  1.00 25.82  ? 50  VAL H N   1 
ATOM 3558 C CA  . VAL C 1 50  ? -16.096 -34.510 57.773  1.00 37.65  ? 50  VAL H CA  1 
ATOM 3559 C C   . VAL C 1 50  ? -17.241 -34.660 58.776  1.00 38.39  ? 50  VAL H C   1 
ATOM 3560 O O   . VAL C 1 50  ? -17.053 -35.213 59.860  1.00 40.34  ? 50  VAL H O   1 
ATOM 3561 C CB  . VAL C 1 50  ? -16.225 -35.561 56.636  1.00 32.39  ? 50  VAL H CB  1 
ATOM 3562 C CG1 . VAL C 1 50  ? -16.326 -36.965 57.207  1.00 34.23  ? 50  VAL H CG1 1 
ATOM 3563 C CG2 . VAL C 1 50  ? -17.417 -35.271 55.741  1.00 25.14  ? 50  VAL H CG2 1 
ATOM 3564 N N   . ILE C 1 51  ? -18.409 -34.134 58.423  1.00 39.60  ? 51  ILE H N   1 
ATOM 3565 C CA  . ILE C 1 51  ? -19.625 -34.298 59.210  1.00 41.78  ? 51  ILE H CA  1 
ATOM 3566 C C   . ILE C 1 51  ? -20.796 -34.315 58.239  1.00 47.30  ? 51  ILE H C   1 
ATOM 3567 O O   . ILE C 1 51  ? -20.731 -33.691 57.178  1.00 54.45  ? 51  ILE H O   1 
ATOM 3568 C CB  . ILE C 1 51  ? -19.806 -33.166 60.254  1.00 27.84  ? 51  ILE H CB  1 
ATOM 3569 C CG1 . ILE C 1 51  ? -20.992 -33.449 61.181  1.00 23.41  ? 51  ILE H CG1 1 
ATOM 3570 C CG2 . ILE C 1 51  ? -19.984 -31.815 59.573  1.00 23.45  ? 51  ILE H CG2 1 
ATOM 3571 C CD1 . ILE C 1 51  ? -21.050 -32.539 62.405  1.00 23.77  ? 51  ILE H CD1 1 
ATOM 3572 N N   . TRP C 1 52  ? -21.862 -35.034 58.575  1.00 36.46  ? 52  TRP H N   1 
ATOM 3573 C CA  . TRP C 1 52  ? -23.014 -35.053 57.683  1.00 39.15  ? 52  TRP H CA  1 
ATOM 3574 C C   . TRP C 1 52  ? -24.053 -34.068 58.192  1.00 34.48  ? 52  TRP H C   1 
ATOM 3575 O O   . TRP C 1 52  ? -23.912 -33.518 59.284  1.00 37.34  ? 52  TRP H O   1 
ATOM 3576 C CB  . TRP C 1 52  ? -23.586 -36.472 57.543  1.00 31.90  ? 52  TRP H CB  1 
ATOM 3577 C CG  . TRP C 1 52  ? -22.632 -37.374 56.813  1.00 45.74  ? 52  TRP H CG  1 
ATOM 3578 C CD1 . TRP C 1 52  ? -21.333 -37.087 56.483  1.00 53.23  ? 52  TRP H CD1 1 
ATOM 3579 C CD2 . TRP C 1 52  ? -22.898 -38.681 56.267  1.00 46.78  ? 52  TRP H CD2 1 
ATOM 3580 N NE1 . TRP C 1 52  ? -20.771 -38.135 55.799  1.00 51.76  ? 52  TRP H NE1 1 
ATOM 3581 C CE2 . TRP C 1 52  ? -21.702 -39.113 55.651  1.00 54.88  ? 52  TRP H CE2 1 
ATOM 3582 C CE3 . TRP C 1 52  ? -24.020 -39.511 56.255  1.00 52.33  ? 52  TRP H CE3 1 
ATOM 3583 C CZ2 . TRP C 1 52  ? -21.607 -40.359 55.028  1.00 66.19  ? 52  TRP H CZ2 1 
ATOM 3584 C CZ3 . TRP C 1 52  ? -23.912 -40.746 55.632  1.00 65.93  ? 52  TRP H CZ3 1 
ATOM 3585 C CH2 . TRP C 1 52  ? -22.714 -41.155 55.027  1.00 73.83  ? 52  TRP H CH2 1 
ATOM 3586 N N   . TYR C 1 53  ? -25.104 -33.866 57.408  1.00 43.55  ? 53  TYR H N   1 
ATOM 3587 C CA  . TYR C 1 53  ? -25.958 -32.700 57.581  1.00 27.06  ? 53  TYR H CA  1 
ATOM 3588 C C   . TYR C 1 53  ? -26.667 -32.745 58.928  1.00 27.76  ? 53  TYR H C   1 
ATOM 3589 O O   . TYR C 1 53  ? -26.783 -31.721 59.610  1.00 27.92  ? 53  TYR H O   1 
ATOM 3590 C CB  . TYR C 1 53  ? -26.951 -32.590 56.409  1.00 27.00  ? 53  TYR H CB  1 
ATOM 3591 C CG  . TYR C 1 53  ? -28.047 -33.637 56.370  1.00 30.67  ? 53  TYR H CG  1 
ATOM 3592 C CD1 . TYR C 1 53  ? -29.286 -33.402 56.952  1.00 29.08  ? 53  TYR H CD1 1 
ATOM 3593 C CD2 . TYR C 1 53  ? -27.838 -34.867 55.754  1.00 31.34  ? 53  TYR H CD2 1 
ATOM 3594 C CE1 . TYR C 1 53  ? -30.289 -34.361 56.915  1.00 29.45  ? 53  TYR H CE1 1 
ATOM 3595 C CE2 . TYR C 1 53  ? -28.831 -35.828 55.715  1.00 36.82  ? 53  TYR H CE2 1 
ATOM 3596 C CZ  . TYR C 1 53  ? -30.051 -35.568 56.299  1.00 40.79  ? 53  TYR H CZ  1 
ATOM 3597 O OH  . TYR C 1 53  ? -31.036 -36.521 56.264  1.00 54.79  ? 53  TYR H OH  1 
ATOM 3598 N N   . ASP C 1 54  ? -27.135 -33.941 59.283  1.00 31.36  ? 54  ASP H N   1 
ATOM 3599 C CA  . ASP C 1 54  ? -27.860 -34.222 60.525  1.00 33.14  ? 54  ASP H CA  1 
ATOM 3600 C C   . ASP C 1 54  ? -27.089 -34.848 61.710  1.00 43.20  ? 54  ASP H C   1 
ATOM 3601 O O   . ASP C 1 54  ? -27.719 -35.467 62.565  1.00 47.86  ? 54  ASP H O   1 
ATOM 3602 C CB  . ASP C 1 54  ? -29.134 -35.048 60.205  1.00 28.10  ? 54  ASP H CB  1 
ATOM 3603 C CG  . ASP C 1 54  ? -28.861 -36.369 59.523  1.00 28.00  ? 54  ASP H CG  1 
ATOM 3604 O OD1 . ASP C 1 54  ? -27.955 -36.430 58.677  1.00 27.40  ? 54  ASP H OD1 1 
ATOM 3605 O OD2 . ASP C 1 54  ? -29.583 -37.346 59.815  1.00 33.83  ? 54  ASP H OD2 1 
ATOM 3606 N N   . GLY C 1 55  ? -25.762 -34.760 61.769  1.00 36.10  ? 55  GLY H N   1 
ATOM 3607 C CA  . GLY C 1 55  ? -25.071 -35.634 62.697  1.00 39.00  ? 55  GLY H CA  1 
ATOM 3608 C C   . GLY C 1 55  ? -24.886 -36.945 61.975  1.00 47.50  ? 55  GLY H C   1 
ATOM 3609 O O   . GLY C 1 55  ? -23.988 -37.008 61.123  1.00 64.12  ? 55  GLY H O   1 
ATOM 3610 N N   . SER C 1 56  ? -25.576 -38.013 62.368  1.00 40.90  ? 56  SER H N   1 
ATOM 3611 C CA  . SER C 1 56  ? -25.430 -39.255 61.602  1.00 36.92  ? 56  SER H CA  1 
ATOM 3612 C C   . SER C 1 56  ? -23.997 -39.753 61.708  1.00 29.50  ? 56  SER H C   1 
ATOM 3613 O O   . SER C 1 56  ? -23.581 -40.262 62.745  1.00 38.99  ? 56  SER H O   1 
ATOM 3614 C CB  . SER C 1 56  ? -25.799 -39.049 60.119  1.00 44.36  ? 56  SER H CB  1 
ATOM 3615 O OG  . SER C 1 56  ? -27.000 -38.322 59.992  1.00 47.71  ? 56  SER H OG  1 
ATOM 3616 N N   . LYS C 1 57  ? -23.263 -39.672 60.608  1.00 33.97  ? 57  LYS H N   1 
ATOM 3617 C CA  . LYS C 1 57  ? -21.878 -40.115 60.603  1.00 42.60  ? 57  LYS H CA  1 
ATOM 3618 C C   . LYS C 1 57  ? -20.888 -38.947 60.610  1.00 44.46  ? 57  LYS H C   1 
ATOM 3619 O O   . LYS C 1 57  ? -21.189 -37.853 60.115  1.00 40.70  ? 57  LYS H O   1 
ATOM 3620 C CB  . LYS C 1 57  ? -21.631 -41.009 59.395  1.00 52.70  ? 57  LYS H CB  1 
ATOM 3621 C CG  . LYS C 1 57  ? -20.940 -42.305 59.740  1.00 60.27  ? 57  LYS H CG  1 
ATOM 3622 C CD  . LYS C 1 57  ? -21.650 -43.429 59.020  1.00 61.46  ? 57  LYS H CD  1 
ATOM 3623 C CE  . LYS C 1 57  ? -21.742 -43.137 57.530  1.00 58.16  ? 57  LYS H CE  1 
ATOM 3624 N NZ  . LYS C 1 57  ? -22.457 -44.204 56.774  1.00 56.38  ? 57  LYS H NZ  1 
ATOM 3625 N N   . ARG C 1 58  ? -19.729 -39.184 61.220  1.00 45.49  ? 58  ARG H N   1 
ATOM 3626 C CA  . ARG C 1 58  ? -18.592 -38.277 61.134  1.00 45.69  ? 58  ARG H CA  1 
ATOM 3627 C C   . ARG C 1 58  ? -17.299 -39.085 61.046  1.00 50.25  ? 58  ARG H C   1 
ATOM 3628 O O   . ARG C 1 58  ? -17.133 -40.090 61.740  1.00 56.12  ? 58  ARG H O   1 
ATOM 3629 C CB  . ARG C 1 58  ? -18.575 -37.319 62.332  1.00 48.09  ? 58  ARG H CB  1 
ATOM 3630 C CG  . ARG C 1 58  ? -18.258 -37.970 63.668  1.00 54.69  ? 58  ARG H CG  1 
ATOM 3631 C CD  . ARG C 1 58  ? -18.350 -36.971 64.820  1.00 59.13  ? 58  ARG H CD  1 
ATOM 3632 N NE  . ARG C 1 58  ? -19.645 -36.293 64.895  1.00 55.33  ? 58  ARG H NE  1 
ATOM 3633 C CZ  . ARG C 1 58  ? -20.814 -36.898 65.101  1.00 49.27  ? 58  ARG H CZ  1 
ATOM 3634 N NH1 . ARG C 1 58  ? -20.878 -38.216 65.261  1.00 41.75  ? 58  ARG H NH1 1 
ATOM 3635 N NH2 . ARG C 1 58  ? -21.927 -36.178 65.150  1.00 46.40  ? 58  ARG H NH2 1 
ATOM 3636 N N   . TYR C 1 59  ? -16.399 -38.656 60.164  1.00 43.69  ? 59  TYR H N   1 
ATOM 3637 C CA  . TYR C 1 59  ? -15.088 -39.284 60.023  1.00 36.15  ? 59  TYR H CA  1 
ATOM 3638 C C   . TYR C 1 59  ? -13.973 -38.271 60.304  1.00 34.36  ? 59  TYR H C   1 
ATOM 3639 O O   . TYR C 1 59  ? -14.166 -37.063 60.155  1.00 36.10  ? 59  TYR H O   1 
ATOM 3640 C CB  . TYR C 1 59  ? -14.911 -39.891 58.621  1.00 25.06  ? 59  TYR H CB  1 
ATOM 3641 C CG  . TYR C 1 59  ? -15.959 -40.918 58.224  1.00 25.32  ? 59  TYR H CG  1 
ATOM 3642 C CD1 . TYR C 1 59  ? -15.804 -42.256 58.556  1.00 26.07  ? 59  TYR H CD1 1 
ATOM 3643 C CD2 . TYR C 1 59  ? -17.095 -40.551 57.507  1.00 39.59  ? 59  TYR H CD2 1 
ATOM 3644 C CE1 . TYR C 1 59  ? -16.752 -43.201 58.197  1.00 39.15  ? 59  TYR H CE1 1 
ATOM 3645 C CE2 . TYR C 1 59  ? -18.053 -41.495 57.142  1.00 36.97  ? 59  TYR H CE2 1 
ATOM 3646 C CZ  . TYR C 1 59  ? -17.872 -42.816 57.492  1.00 38.26  ? 59  TYR H CZ  1 
ATOM 3647 O OH  . TYR C 1 59  ? -18.807 -43.759 57.137  1.00 38.91  ? 59  TYR H OH  1 
ATOM 3648 N N   . TYR C 1 60  ? -12.812 -38.772 60.716  1.00 34.65  ? 60  TYR H N   1 
ATOM 3649 C CA  . TYR C 1 60  ? -11.669 -37.921 61.041  1.00 34.04  ? 60  TYR H CA  1 
ATOM 3650 C C   . TYR C 1 60  ? -10.398 -38.325 60.296  1.00 36.08  ? 60  TYR H C   1 
ATOM 3651 O O   . TYR C 1 60  ? -10.265 -39.466 59.850  1.00 36.65  ? 60  TYR H O   1 
ATOM 3652 C CB  . TYR C 1 60  ? -11.382 -37.954 62.544  1.00 35.72  ? 60  TYR H CB  1 
ATOM 3653 C CG  . TYR C 1 60  ? -12.510 -37.483 63.433  1.00 26.80  ? 60  TYR H CG  1 
ATOM 3654 C CD1 . TYR C 1 60  ? -12.822 -36.135 63.529  1.00 38.37  ? 60  TYR H CD1 1 
ATOM 3655 C CD2 . TYR C 1 60  ? -13.253 -38.384 64.188  1.00 30.96  ? 60  TYR H CD2 1 
ATOM 3656 C CE1 . TYR C 1 60  ? -13.844 -35.696 64.339  1.00 26.48  ? 60  TYR H CE1 1 
ATOM 3657 C CE2 . TYR C 1 60  ? -14.281 -37.951 65.005  1.00 36.33  ? 60  TYR H CE2 1 
ATOM 3658 C CZ  . TYR C 1 60  ? -14.570 -36.604 65.075  1.00 33.40  ? 60  TYR H CZ  1 
ATOM 3659 O OH  . TYR C 1 60  ? -15.583 -36.153 65.887  1.00 38.72  ? 60  TYR H OH  1 
ATOM 3660 N N   . ALA C 1 61  ? -9.460  -37.389 60.173  1.00 29.37  ? 61  ALA H N   1 
ATOM 3661 C CA  . ALA C 1 61  ? -8.136  -37.711 59.655  1.00 29.62  ? 61  ALA H CA  1 
ATOM 3662 C C   . ALA C 1 61  ? -7.390  -38.548 60.684  1.00 37.79  ? 61  ALA H C   1 
ATOM 3663 O O   . ALA C 1 61  ? -7.390  -38.214 61.867  1.00 40.10  ? 61  ALA H O   1 
ATOM 3664 C CB  . ALA C 1 61  ? -7.355  -36.444 59.323  1.00 31.40  ? 61  ALA H CB  1 
ATOM 3665 N N   . ASP C 1 62  ? -6.755  -39.625 60.227  1.00 33.95  ? 62  ASP H N   1 
ATOM 3666 C CA  . ASP C 1 62  ? -6.066  -40.569 61.107  1.00 45.19  ? 62  ASP H CA  1 
ATOM 3667 C C   . ASP C 1 62  ? -5.107  -39.893 62.080  1.00 40.76  ? 62  ASP H C   1 
ATOM 3668 O O   . ASP C 1 62  ? -5.010  -40.282 63.248  1.00 29.53  ? 62  ASP H O   1 
ATOM 3669 C CB  . ASP C 1 62  ? -5.307  -41.607 60.280  1.00 48.78  ? 62  ASP H CB  1 
ATOM 3670 C CG  . ASP C 1 62  ? -6.170  -42.788 59.897  1.00 64.15  ? 62  ASP H CG  1 
ATOM 3671 O OD1 . ASP C 1 62  ? -7.393  -42.731 60.142  1.00 73.97  ? 62  ASP H OD1 1 
ATOM 3672 O OD2 . ASP C 1 62  ? -5.623  -43.778 59.367  1.00 69.61  ? 62  ASP H OD2 1 
ATOM 3673 N N   . SER C 1 63  ? -4.408  -38.877 61.590  1.00 52.03  ? 63  SER H N   1 
ATOM 3674 C CA  . SER C 1 63  ? -3.462  -38.135 62.406  1.00 51.26  ? 63  SER H CA  1 
ATOM 3675 C C   . SER C 1 63  ? -4.148  -37.433 63.577  1.00 46.82  ? 63  SER H C   1 
ATOM 3676 O O   . SER C 1 63  ? -3.570  -37.317 64.662  1.00 53.08  ? 63  SER H O   1 
ATOM 3677 C CB  . SER C 1 63  ? -2.707  -37.123 61.543  1.00 30.48  ? 63  SER H CB  1 
ATOM 3678 O OG  . SER C 1 63  ? -3.600  -36.244 60.883  1.00 30.25  ? 63  SER H OG  1 
ATOM 3679 N N   . VAL C 1 64  ? -5.368  -36.949 63.354  1.00 41.22  ? 64  VAL H N   1 
ATOM 3680 C CA  . VAL C 1 64  ? -6.104  -36.251 64.404  1.00 36.32  ? 64  VAL H CA  1 
ATOM 3681 C C   . VAL C 1 64  ? -7.162  -37.070 65.161  1.00 40.55  ? 64  VAL H C   1 
ATOM 3682 O O   . VAL C 1 64  ? -7.799  -36.535 66.068  1.00 31.33  ? 64  VAL H O   1 
ATOM 3683 C CB  . VAL C 1 64  ? -6.808  -34.994 63.846  1.00 29.92  ? 64  VAL H CB  1 
ATOM 3684 C CG1 . VAL C 1 64  ? -5.851  -34.162 63.017  1.00 57.47  ? 64  VAL H CG1 1 
ATOM 3685 C CG2 . VAL C 1 64  ? -8.044  -35.367 63.048  1.00 29.35  ? 64  VAL H CG2 1 
ATOM 3686 N N   . LYS C 1 65  ? -7.374  -38.337 64.808  1.00 42.44  ? 65  LYS H N   1 
ATOM 3687 C CA  . LYS C 1 65  ? -8.421  -39.113 65.480  1.00 47.31  ? 65  LYS H CA  1 
ATOM 3688 C C   . LYS C 1 65  ? -8.175  -39.228 66.984  1.00 43.00  ? 65  LYS H C   1 
ATOM 3689 O O   . LYS C 1 65  ? -7.100  -39.613 67.415  1.00 39.81  ? 65  LYS H O   1 
ATOM 3690 C CB  . LYS C 1 65  ? -8.558  -40.519 64.878  1.00 49.79  ? 65  LYS H CB  1 
ATOM 3691 C CG  . LYS C 1 65  ? -8.719  -40.568 63.372  1.00 54.43  ? 65  LYS H CG  1 
ATOM 3692 C CD  . LYS C 1 65  ? -9.175  -41.942 62.882  1.00 56.15  ? 65  LYS H CD  1 
ATOM 3693 C CE  . LYS C 1 65  ? -8.498  -43.095 63.628  1.00 62.49  ? 65  LYS H CE  1 
ATOM 3694 N NZ  . LYS C 1 65  ? -7.008  -43.025 63.631  1.00 69.96  ? 65  LYS H NZ  1 
ATOM 3695 N N   . GLY C 1 66  ? -9.186  -38.877 67.772  1.00 50.78  ? 66  GLY H N   1 
ATOM 3696 C CA  . GLY C 1 66  ? -9.114  -39.000 69.219  1.00 54.85  ? 66  GLY H CA  1 
ATOM 3697 C C   . GLY C 1 66  ? -8.698  -37.725 69.927  1.00 49.31  ? 66  GLY H C   1 
ATOM 3698 O O   . GLY C 1 66  ? -8.993  -37.542 71.108  1.00 29.71  ? 66  GLY H O   1 
ATOM 3699 N N   . ARG C 1 67  ? -8.052  -36.823 69.195  1.00 50.98  ? 67  ARG H N   1 
ATOM 3700 C CA  . ARG C 1 67  ? -7.713  -35.509 69.730  1.00 43.07  ? 67  ARG H CA  1 
ATOM 3701 C C   . ARG C 1 67  ? -8.772  -34.521 69.275  1.00 30.09  ? 67  ARG H C   1 
ATOM 3702 O O   . ARG C 1 67  ? -9.508  -33.950 70.077  1.00 30.26  ? 67  ARG H O   1 
ATOM 3703 C CB  . ARG C 1 67  ? -6.329  -35.048 69.262  1.00 30.89  ? 67  ARG H CB  1 
ATOM 3704 C CG  . ARG C 1 67  ? -5.228  -36.076 69.401  1.00 31.70  ? 67  ARG H CG  1 
ATOM 3705 C CD  . ARG C 1 67  ? -4.177  -35.838 68.334  1.00 35.27  ? 67  ARG H CD  1 
ATOM 3706 N NE  . ARG C 1 67  ? -3.612  -34.496 68.436  1.00 38.41  ? 67  ARG H NE  1 
ATOM 3707 C CZ  . ARG C 1 67  ? -2.946  -33.888 67.461  1.00 44.47  ? 67  ARG H CZ  1 
ATOM 3708 N NH1 . ARG C 1 67  ? -2.766  -34.492 66.294  1.00 43.84  ? 67  ARG H NH1 1 
ATOM 3709 N NH2 . ARG C 1 67  ? -2.465  -32.670 67.657  1.00 46.99  ? 67  ARG H NH2 1 
ATOM 3710 N N   . PHE C 1 68  ? -8.828  -34.327 67.965  1.00 27.87  ? 68  PHE H N   1 
ATOM 3711 C CA  . PHE C 1 68  ? -9.791  -33.437 67.332  1.00 51.25  ? 68  PHE H CA  1 
ATOM 3712 C C   . PHE C 1 68  ? -11.210 -33.988 67.444  1.00 40.69  ? 68  PHE H C   1 
ATOM 3713 O O   . PHE C 1 68  ? -11.404 -35.194 67.600  1.00 56.78  ? 68  PHE H O   1 
ATOM 3714 C CB  . PHE C 1 68  ? -9.422  -33.230 65.862  1.00 48.34  ? 68  PHE H CB  1 
ATOM 3715 C CG  . PHE C 1 68  ? -8.234  -32.338 65.654  1.00 43.36  ? 68  PHE H CG  1 
ATOM 3716 C CD1 . PHE C 1 68  ? -7.005  -32.640 66.219  1.00 26.84  ? 68  PHE H CD1 1 
ATOM 3717 C CD2 . PHE C 1 68  ? -8.345  -31.199 64.882  1.00 40.07  ? 68  PHE H CD2 1 
ATOM 3718 C CE1 . PHE C 1 68  ? -5.918  -31.823 66.023  1.00 26.81  ? 68  PHE H CE1 1 
ATOM 3719 C CE2 . PHE C 1 68  ? -7.261  -30.377 64.682  1.00 33.94  ? 68  PHE H CE2 1 
ATOM 3720 C CZ  . PHE C 1 68  ? -6.044  -30.688 65.254  1.00 31.65  ? 68  PHE H CZ  1 
ATOM 3721 N N   . THR C 1 69  ? -12.198 -33.098 67.384  1.00 43.15  ? 69  THR H N   1 
ATOM 3722 C CA  . THR C 1 69  ? -13.604 -33.502 67.359  1.00 23.44  ? 69  THR H CA  1 
ATOM 3723 C C   . THR C 1 69  ? -14.443 -32.495 66.574  1.00 22.74  ? 69  THR H C   1 
ATOM 3724 O O   . THR C 1 69  ? -14.199 -31.295 66.657  1.00 26.10  ? 69  THR H O   1 
ATOM 3725 C CB  . THR C 1 69  ? -14.188 -33.641 68.781  1.00 24.25  ? 69  THR H CB  1 
ATOM 3726 O OG1 . THR C 1 69  ? -13.261 -34.343 69.617  1.00 24.98  ? 69  THR H OG1 1 
ATOM 3727 C CG2 . THR C 1 69  ? -15.510 -34.403 68.740  1.00 24.36  ? 69  THR H CG2 1 
ATOM 3728 N N   . ILE C 1 70  ? -15.443 -32.976 65.839  1.00 24.09  ? 70  ILE H N   1 
ATOM 3729 C CA  . ILE C 1 70  ? -16.287 -32.099 65.029  1.00 31.51  ? 70  ILE H CA  1 
ATOM 3730 C C   . ILE C 1 70  ? -17.735 -32.101 65.534  1.00 28.02  ? 70  ILE H C   1 
ATOM 3731 O O   . ILE C 1 70  ? -18.219 -33.108 66.038  1.00 29.06  ? 70  ILE H O   1 
ATOM 3732 C CB  . ILE C 1 70  ? -16.253 -32.517 63.529  1.00 32.12  ? 70  ILE H CB  1 
ATOM 3733 C CG1 . ILE C 1 70  ? -17.027 -31.524 62.654  1.00 22.30  ? 70  ILE H CG1 1 
ATOM 3734 C CG2 . ILE C 1 70  ? -16.805 -33.932 63.347  1.00 30.45  ? 70  ILE H CG2 1 
ATOM 3735 C CD1 . ILE C 1 70  ? -16.706 -31.632 61.167  1.00 21.65  ? 70  ILE H CD1 1 
ATOM 3736 N N   . SER C 1 71  ? -18.416 -30.964 65.423  1.00 26.06  ? 71  SER H N   1 
ATOM 3737 C CA  . SER C 1 71  ? -19.863 -30.922 65.638  1.00 33.52  ? 71  SER H CA  1 
ATOM 3738 C C   . SER C 1 71  ? -20.509 -29.681 65.004  1.00 34.38  ? 71  SER H C   1 
ATOM 3739 O O   . SER C 1 71  ? -19.823 -28.797 64.481  1.00 45.82  ? 71  SER H O   1 
ATOM 3740 C CB  . SER C 1 71  ? -20.197 -30.965 67.132  1.00 37.81  ? 71  SER H CB  1 
ATOM 3741 O OG  . SER C 1 71  ? -21.463 -31.570 67.331  1.00 47.65  ? 71  SER H OG  1 
ATOM 3742 N N   . ARG C 1 72  ? -21.837 -29.623 65.073  1.00 37.86  ? 72  ARG H N   1 
ATOM 3743 C CA  . ARG C 1 72  ? -22.613 -28.564 64.440  1.00 39.62  ? 72  ARG H CA  1 
ATOM 3744 C C   . ARG C 1 72  ? -23.929 -28.321 65.188  1.00 40.81  ? 72  ARG H C   1 
ATOM 3745 O O   . ARG C 1 72  ? -24.491 -29.242 65.790  1.00 29.14  ? 72  ARG H O   1 
ATOM 3746 C CB  . ARG C 1 72  ? -22.880 -28.936 62.982  1.00 38.72  ? 72  ARG H CB  1 
ATOM 3747 C CG  . ARG C 1 72  ? -23.999 -29.945 62.815  1.00 38.20  ? 72  ARG H CG  1 
ATOM 3748 C CD  . ARG C 1 72  ? -23.969 -30.603 61.454  1.00 27.03  ? 72  ARG H CD  1 
ATOM 3749 N NE  . ARG C 1 72  ? -24.078 -29.647 60.361  1.00 33.81  ? 72  ARG H NE  1 
ATOM 3750 C CZ  . ARG C 1 72  ? -23.744 -29.918 59.104  1.00 29.77  ? 72  ARG H CZ  1 
ATOM 3751 N NH1 . ARG C 1 72  ? -23.271 -31.114 58.785  1.00 25.85  ? 72  ARG H NH1 1 
ATOM 3752 N NH2 . ARG C 1 72  ? -23.878 -28.992 58.166  1.00 26.04  ? 72  ARG H NH2 1 
ATOM 3753 N N   . ASP C 1 73  ? -24.410 -27.082 65.163  1.00 44.82  ? 73  ASP H N   1 
ATOM 3754 C CA  . ASP C 1 73  ? -25.745 -26.782 65.659  1.00 46.14  ? 73  ASP H CA  1 
ATOM 3755 C C   . ASP C 1 73  ? -26.471 -25.978 64.585  1.00 37.54  ? 73  ASP H C   1 
ATOM 3756 O O   . ASP C 1 73  ? -26.152 -24.811 64.351  1.00 30.98  ? 73  ASP H O   1 
ATOM 3757 C CB  . ASP C 1 73  ? -25.674 -26.027 66.992  1.00 53.25  ? 73  ASP H CB  1 
ATOM 3758 C CG  . ASP C 1 73  ? -27.023 -25.929 67.682  1.00 62.55  ? 73  ASP H CG  1 
ATOM 3759 O OD1 . ASP C 1 73  ? -28.043 -26.275 67.048  1.00 65.37  ? 73  ASP H OD1 1 
ATOM 3760 O OD2 . ASP C 1 73  ? -27.060 -25.533 68.866  1.00 64.69  ? 73  ASP H OD2 1 
ATOM 3761 N N   . ASN C 1 74  ? -27.474 -26.593 63.965  1.00 35.93  ? 74  ASN H N   1 
ATOM 3762 C CA  . ASN C 1 74  ? -28.073 -26.028 62.759  1.00 44.74  ? 74  ASN H CA  1 
ATOM 3763 C C   . ASN C 1 74  ? -29.021 -24.878 63.056  1.00 49.22  ? 74  ASN H C   1 
ATOM 3764 O O   . ASN C 1 74  ? -29.229 -24.005 62.215  1.00 61.18  ? 74  ASN H O   1 
ATOM 3765 C CB  . ASN C 1 74  ? -28.817 -27.101 61.960  1.00 42.03  ? 74  ASN H CB  1 
ATOM 3766 C CG  . ASN C 1 74  ? -27.959 -28.322 61.656  1.00 48.21  ? 74  ASN H CG  1 
ATOM 3767 O OD1 . ASN C 1 74  ? -26.938 -28.226 60.973  1.00 28.47  ? 74  ASN H OD1 1 
ATOM 3768 N ND2 . ASN C 1 74  ? -28.390 -29.483 62.142  1.00 52.77  ? 74  ASN H ND2 1 
ATOM 3769 N N   . SER C 1 75  ? -29.604 -24.889 64.249  1.00 42.29  ? 75  SER H N   1 
ATOM 3770 C CA  . SER C 1 75  ? -30.389 -23.758 64.718  1.00 41.71  ? 75  SER H CA  1 
ATOM 3771 C C   . SER C 1 75  ? -29.527 -22.502 64.672  1.00 47.72  ? 75  SER H C   1 
ATOM 3772 O O   . SER C 1 75  ? -30.019 -21.409 64.391  1.00 52.32  ? 75  SER H O   1 
ATOM 3773 C CB  . SER C 1 75  ? -30.918 -24.006 66.137  1.00 45.88  ? 75  SER H CB  1 
ATOM 3774 O OG  . SER C 1 75  ? -29.857 -24.179 67.059  1.00 46.63  ? 75  SER H OG  1 
ATOM 3775 N N   . LYS C 1 76  ? -28.238 -22.671 64.954  1.00 51.09  ? 76  LYS H N   1 
ATOM 3776 C CA  . LYS C 1 76  ? -27.297 -21.556 64.949  1.00 44.09  ? 76  LYS H CA  1 
ATOM 3777 C C   . LYS C 1 76  ? -26.458 -21.423 63.672  1.00 39.79  ? 76  LYS H C   1 
ATOM 3778 O O   . LYS C 1 76  ? -25.666 -20.485 63.554  1.00 32.62  ? 76  LYS H O   1 
ATOM 3779 C CB  . LYS C 1 76  ? -26.366 -21.673 66.154  1.00 45.88  ? 76  LYS H CB  1 
ATOM 3780 C CG  . LYS C 1 76  ? -27.096 -21.716 67.486  1.00 48.10  ? 76  LYS H CG  1 
ATOM 3781 C CD  . LYS C 1 76  ? -26.123 -21.708 68.649  1.00 43.74  ? 76  LYS H CD  1 
ATOM 3782 C CE  . LYS C 1 76  ? -25.128 -22.850 68.541  1.00 38.08  ? 76  LYS H CE  1 
ATOM 3783 N NZ  . LYS C 1 76  ? -24.060 -22.742 69.572  1.00 35.02  ? 76  LYS H NZ  1 
ATOM 3784 N N   . ASN C 1 77  ? -26.630 -22.353 62.734  1.00 34.77  ? 77  ASN H N   1 
ATOM 3785 C CA  . ASN C 1 77  ? -25.852 -22.378 61.490  1.00 34.99  ? 77  ASN H CA  1 
ATOM 3786 C C   . ASN C 1 77  ? -24.342 -22.291 61.709  1.00 35.49  ? 77  ASN H C   1 
ATOM 3787 O O   . ASN C 1 77  ? -23.654 -21.530 61.026  1.00 31.36  ? 77  ASN H O   1 
ATOM 3788 C CB  . ASN C 1 77  ? -26.278 -21.238 60.561  1.00 44.18  ? 77  ASN H CB  1 
ATOM 3789 C CG  . ASN C 1 77  ? -27.736 -21.313 60.169  1.00 51.67  ? 77  ASN H CG  1 
ATOM 3790 O OD1 . ASN C 1 77  ? -28.227 -22.362 59.753  1.00 55.64  ? 77  ASN H OD1 1 
ATOM 3791 N ND2 . ASN C 1 77  ? -28.438 -20.192 60.293  1.00 55.01  ? 77  ASN H ND2 1 
ATOM 3792 N N   . THR C 1 78  ? -23.825 -23.065 62.656  1.00 23.96  ? 78  THR H N   1 
ATOM 3793 C CA  . THR C 1 78  ? -22.410 -22.976 62.991  1.00 38.81  ? 78  THR H CA  1 
ATOM 3794 C C   . THR C 1 78  ? -21.743 -24.345 63.011  1.00 37.56  ? 78  THR H C   1 
ATOM 3795 O O   . THR C 1 78  ? -22.270 -25.292 63.588  1.00 23.76  ? 78  THR H O   1 
ATOM 3796 C CB  . THR C 1 78  ? -22.197 -22.305 64.360  1.00 42.82  ? 78  THR H CB  1 
ATOM 3797 O OG1 . THR C 1 78  ? -22.892 -21.053 64.396  1.00 54.85  ? 78  THR H OG1 1 
ATOM 3798 C CG2 . THR C 1 78  ? -20.714 -22.065 64.610  1.00 39.31  ? 78  THR H CG2 1 
ATOM 3799 N N   . LEU C 1 79  ? -20.585 -24.443 62.369  1.00 43.21  ? 79  LEU H N   1 
ATOM 3800 C CA  . LEU C 1 79  ? -19.768 -25.644 62.437  1.00 21.76  ? 79  LEU H CA  1 
ATOM 3801 C C   . LEU C 1 79  ? -18.727 -25.477 63.535  1.00 22.10  ? 79  LEU H C   1 
ATOM 3802 O O   . LEU C 1 79  ? -18.169 -24.398 63.707  1.00 30.31  ? 79  LEU H O   1 
ATOM 3803 C CB  . LEU C 1 79  ? -19.099 -25.916 61.090  1.00 21.03  ? 79  LEU H CB  1 
ATOM 3804 C CG  . LEU C 1 79  ? -17.935 -26.905 61.049  1.00 25.77  ? 79  LEU H CG  1 
ATOM 3805 C CD1 . LEU C 1 79  ? -18.392 -28.307 61.417  1.00 33.11  ? 79  LEU H CD1 1 
ATOM 3806 C CD2 . LEU C 1 79  ? -17.299 -26.895 59.674  1.00 24.03  ? 79  LEU H CD2 1 
ATOM 3807 N N   . PHE C 1 80  ? -18.470 -26.549 64.275  1.00 22.20  ? 80  PHE H N   1 
ATOM 3808 C CA  . PHE C 1 80  ? -17.510 -26.525 65.372  1.00 22.65  ? 80  PHE H CA  1 
ATOM 3809 C C   . PHE C 1 80  ? -16.396 -27.541 65.158  1.00 22.48  ? 80  PHE H C   1 
ATOM 3810 O O   . PHE C 1 80  ? -16.636 -28.619 64.619  1.00 22.30  ? 80  PHE H O   1 
ATOM 3811 C CB  . PHE C 1 80  ? -18.211 -26.818 66.698  1.00 23.46  ? 80  PHE H CB  1 
ATOM 3812 C CG  . PHE C 1 80  ? -19.314 -25.868 67.021  1.00 30.06  ? 80  PHE H CG  1 
ATOM 3813 C CD1 . PHE C 1 80  ? -19.031 -24.567 67.386  1.00 36.38  ? 80  PHE H CD1 1 
ATOM 3814 C CD2 . PHE C 1 80  ? -20.638 -26.272 66.955  1.00 41.69  ? 80  PHE H CD2 1 
ATOM 3815 C CE1 . PHE C 1 80  ? -20.044 -23.685 67.687  1.00 36.76  ? 80  PHE H CE1 1 
ATOM 3816 C CE2 . PHE C 1 80  ? -21.655 -25.393 67.254  1.00 38.68  ? 80  PHE H CE2 1 
ATOM 3817 C CZ  . PHE C 1 80  ? -21.357 -24.098 67.619  1.00 41.32  ? 80  PHE H CZ  1 
ATOM 3818 N N   . LEU C 1 81  ? -15.180 -27.195 65.565  1.00 32.00  ? 81  LEU H N   1 
ATOM 3819 C CA  . LEU C 1 81  ? -14.113 -28.179 65.649  1.00 23.62  ? 81  LEU H CA  1 
ATOM 3820 C C   . LEU C 1 81  ? -13.452 -28.051 67.006  1.00 24.36  ? 81  LEU H C   1 
ATOM 3821 O O   . LEU C 1 81  ? -12.797 -27.053 67.269  1.00 24.45  ? 81  LEU H O   1 
ATOM 3822 C CB  . LEU C 1 81  ? -13.098 -27.986 64.507  1.00 23.02  ? 81  LEU H CB  1 
ATOM 3823 C CG  . LEU C 1 81  ? -11.755 -28.734 64.431  1.00 37.28  ? 81  LEU H CG  1 
ATOM 3824 C CD1 . LEU C 1 81  ? -11.846 -30.201 64.829  1.00 34.55  ? 81  LEU H CD1 1 
ATOM 3825 C CD2 . LEU C 1 81  ? -11.220 -28.631 63.001  1.00 40.51  ? 81  LEU H CD2 1 
ATOM 3826 N N   . GLN C 1 82  ? -13.579 -29.080 67.844  1.00 42.87  ? 82  GLN H N   1 
ATOM 3827 C CA  . GLN C 1 82  ? -12.931 -29.058 69.149  1.00 27.93  ? 82  GLN H CA  1 
ATOM 3828 C C   . GLN C 1 82  ? -11.582 -29.732 69.012  1.00 28.04  ? 82  GLN H C   1 
ATOM 3829 O O   . GLN C 1 82  ? -11.485 -30.951 68.855  1.00 33.27  ? 82  GLN H O   1 
ATOM 3830 C CB  . GLN C 1 82  ? -13.782 -29.752 70.226  1.00 39.60  ? 82  GLN H CB  1 
ATOM 3831 C CG  . GLN C 1 82  ? -13.181 -29.756 71.648  1.00 40.89  ? 82  GLN H CG  1 
ATOM 3832 C CD  . GLN C 1 82  ? -13.082 -28.372 72.285  1.00 40.97  ? 82  GLN H CD  1 
ATOM 3833 O OE1 . GLN C 1 82  ? -14.090 -27.690 72.485  1.00 45.04  ? 82  GLN H OE1 1 
ATOM 3834 N NE2 . GLN C 1 82  ? -11.862 -27.960 72.621  1.00 35.60  ? 82  GLN H NE2 1 
ATOM 3835 N N   . MET C 1 83  ? -10.538 -28.922 69.095  1.00 26.72  ? 83  MET H N   1 
ATOM 3836 C CA  . MET C 1 83  ? -9.184  -29.424 68.986  1.00 26.93  ? 83  MET H CA  1 
ATOM 3837 C C   . MET C 1 83  ? -8.628  -29.609 70.383  1.00 37.90  ? 83  MET H C   1 
ATOM 3838 O O   . MET C 1 83  ? -8.637  -28.679 71.192  1.00 43.87  ? 83  MET H O   1 
ATOM 3839 C CB  . MET C 1 83  ? -8.317  -28.474 68.158  1.00 26.43  ? 83  MET H CB  1 
ATOM 3840 C CG  . MET C 1 83  ? -9.027  -27.923 66.922  1.00 61.11  ? 83  MET H CG  1 
ATOM 3841 S SD  . MET C 1 83  ? -7.937  -27.167 65.701  1.00 32.22  ? 83  MET H SD  1 
ATOM 3842 C CE  . MET C 1 83  ? -7.722  -25.537 66.401  1.00 25.18  ? 83  MET H CE  1 
ATOM 3843 N N   . ASN C 1 84  ? -8.183  -30.829 70.660  1.00 41.38  ? 84  ASN H N   1 
ATOM 3844 C CA  . ASN C 1 84  ? -7.620  -31.177 71.949  1.00 37.14  ? 84  ASN H CA  1 
ATOM 3845 C C   . ASN C 1 84  ? -6.205  -31.732 71.749  1.00 29.25  ? 84  ASN H C   1 
ATOM 3846 O O   . ASN C 1 84  ? -5.883  -32.267 70.689  1.00 43.67  ? 84  ASN H O   1 
ATOM 3847 C CB  . ASN C 1 84  ? -8.504  -32.205 72.670  1.00 42.35  ? 84  ASN H CB  1 
ATOM 3848 C CG  . ASN C 1 84  ? -9.975  -31.811 72.701  1.00 46.55  ? 84  ASN H CG  1 
ATOM 3849 O OD1 . ASN C 1 84  ? -10.331 -30.675 73.022  1.00 45.17  ? 84  ASN H OD1 1 
ATOM 3850 N ND2 . ASN C 1 84  ? -10.839 -32.755 72.328  1.00 48.00  ? 84  ASN H ND2 1 
ATOM 3851 N N   . SER C 1 85  ? -5.372  -31.591 72.774  1.00 26.63  ? 85  SER H N   1 
ATOM 3852 C CA  . SER C 1 85  ? -4.007  -32.109 72.771  1.00 40.20  ? 85  SER H CA  1 
ATOM 3853 C C   . SER C 1 85  ? -3.253  -31.702 71.498  1.00 46.94  ? 85  SER H C   1 
ATOM 3854 O O   . SER C 1 85  ? -2.888  -32.551 70.672  1.00 52.74  ? 85  SER H O   1 
ATOM 3855 C CB  . SER C 1 85  ? -4.034  -33.630 72.931  1.00 36.67  ? 85  SER H CB  1 
ATOM 3856 O OG  . SER C 1 85  ? -4.127  -33.958 74.310  1.00 28.78  ? 85  SER H OG  1 
ATOM 3857 N N   . LEU C 1 86  ? -3.044  -30.398 71.332  1.00 32.44  ? 86  LEU H N   1 
ATOM 3858 C CA  . LEU C 1 86  ? -2.427  -29.884 70.116  1.00 31.75  ? 86  LEU H CA  1 
ATOM 3859 C C   . LEU C 1 86  ? -0.925  -30.145 70.088  1.00 32.39  ? 86  LEU H C   1 
ATOM 3860 O O   . LEU C 1 86  ? -0.235  -30.056 71.114  1.00 33.33  ? 86  LEU H O   1 
ATOM 3861 C CB  . LEU C 1 86  ? -2.713  -28.387 69.950  1.00 31.22  ? 86  LEU H CB  1 
ATOM 3862 C CG  . LEU C 1 86  ? -4.195  -28.015 69.870  1.00 30.62  ? 86  LEU H CG  1 
ATOM 3863 C CD1 . LEU C 1 86  ? -4.428  -26.508 69.813  1.00 30.30  ? 86  LEU H CD1 1 
ATOM 3864 C CD2 . LEU C 1 86  ? -4.809  -28.710 68.676  1.00 31.17  ? 86  LEU H CD2 1 
ATOM 3865 N N   . ARG C 1 87  ? -0.428  -30.462 68.897  1.00 32.50  ? 87  ARG H N   1 
ATOM 3866 C CA  . ARG C 1 87  ? 0.990   -30.697 68.706  1.00 42.58  ? 87  ARG H CA  1 
ATOM 3867 C C   . ARG C 1 87  ? 1.548   -29.585 67.837  1.00 40.66  ? 87  ARG H C   1 
ATOM 3868 O O   . ARG C 1 87  ? 0.791   -28.782 67.304  1.00 38.31  ? 87  ARG H O   1 
ATOM 3869 C CB  . ARG C 1 87  ? 1.232   -32.053 68.040  1.00 34.36  ? 87  ARG H CB  1 
ATOM 3870 C CG  . ARG C 1 87  ? 0.862   -33.274 68.860  1.00 36.32  ? 87  ARG H CG  1 
ATOM 3871 C CD  . ARG C 1 87  ? 0.672   -34.472 67.929  1.00 41.08  ? 87  ARG H CD  1 
ATOM 3872 N NE  . ARG C 1 87  ? 0.598   -35.773 68.598  1.00 48.47  ? 87  ARG H NE  1 
ATOM 3873 C CZ  . ARG C 1 87  ? -0.333  -36.143 69.474  1.00 50.22  ? 87  ARG H CZ  1 
ATOM 3874 N NH1 . ARG C 1 87  ? -1.299  -35.308 69.830  1.00 34.28  ? 87  ARG H NH1 1 
ATOM 3875 N NH2 . ARG C 1 87  ? -0.295  -37.362 69.997  1.00 35.73  ? 87  ARG H NH2 1 
ATOM 3876 N N   . ALA C 1 88  ? 2.861   -29.575 67.640  1.00 47.25  ? 88  ALA H N   1 
ATOM 3877 C CA  . ALA C 1 88  ? 3.484   -28.546 66.818  1.00 43.79  ? 88  ALA H CA  1 
ATOM 3878 C C   . ALA C 1 88  ? 3.157   -28.800 65.354  1.00 50.44  ? 88  ALA H C   1 
ATOM 3879 O O   . ALA C 1 88  ? 3.229   -27.902 64.516  1.00 56.55  ? 88  ALA H O   1 
ATOM 3880 C CB  . ALA C 1 88  ? 4.985   -28.518 67.040  1.00 43.51  ? 88  ALA H CB  1 
ATOM 3881 N N   . GLU C 1 89  ? 2.780   -30.040 65.065  1.00 42.73  ? 89  GLU H N   1 
ATOM 3882 C CA  . GLU C 1 89  ? 2.446   -30.469 63.715  1.00 37.96  ? 89  GLU H CA  1 
ATOM 3883 C C   . GLU C 1 89  ? 1.018   -30.080 63.345  1.00 37.12  ? 89  GLU H C   1 
ATOM 3884 O O   . GLU C 1 89  ? 0.586   -30.270 62.209  1.00 44.51  ? 89  GLU H O   1 
ATOM 3885 C CB  . GLU C 1 89  ? 2.639   -31.980 63.592  1.00 39.41  ? 89  GLU H CB  1 
ATOM 3886 C CG  . GLU C 1 89  ? 3.960   -32.459 64.167  1.00 51.26  ? 89  GLU H CG  1 
ATOM 3887 C CD  . GLU C 1 89  ? 4.094   -33.968 64.146  1.00 67.85  ? 89  GLU H CD  1 
ATOM 3888 O OE1 . GLU C 1 89  ? 4.142   -34.547 63.038  1.00 69.60  ? 89  GLU H OE1 1 
ATOM 3889 O OE2 . GLU C 1 89  ? 4.153   -34.575 65.238  1.00 78.47  ? 89  GLU H OE2 1 
ATOM 3890 N N   . ASP C 1 90  ? 0.296   -29.536 64.317  1.00 27.13  ? 90  ASP H N   1 
ATOM 3891 C CA  . ASP C 1 90  ? -1.065  -29.071 64.100  1.00 26.14  ? 90  ASP H CA  1 
ATOM 3892 C C   . ASP C 1 90  ? -1.098  -27.677 63.497  1.00 25.51  ? 90  ASP H C   1 
ATOM 3893 O O   . ASP C 1 90  ? -2.138  -27.245 62.998  1.00 24.79  ? 90  ASP H O   1 
ATOM 3894 C CB  . ASP C 1 90  ? -1.843  -29.074 65.410  1.00 36.09  ? 90  ASP H CB  1 
ATOM 3895 C CG  . ASP C 1 90  ? -2.337  -30.444 65.783  1.00 45.50  ? 90  ASP H CG  1 
ATOM 3896 O OD1 . ASP C 1 90  ? -1.865  -31.431 65.182  1.00 37.60  ? 90  ASP H OD1 1 
ATOM 3897 O OD2 . ASP C 1 90  ? -3.193  -30.539 66.686  1.00 62.69  ? 90  ASP H OD2 1 
ATOM 3898 N N   . THR C 1 91  ? 0.034   -26.976 63.552  1.00 33.81  ? 91  THR H N   1 
ATOM 3899 C CA  . THR C 1 91  ? 0.112   -25.618 63.023  1.00 37.65  ? 91  THR H CA  1 
ATOM 3900 C C   . THR C 1 91  ? -0.258  -25.598 61.544  1.00 30.16  ? 91  THR H C   1 
ATOM 3901 O O   . THR C 1 91  ? 0.381   -26.262 60.725  1.00 32.50  ? 91  THR H O   1 
ATOM 3902 C CB  . THR C 1 91  ? 1.522   -25.012 63.208  1.00 24.91  ? 91  THR H CB  1 
ATOM 3903 O OG1 . THR C 1 91  ? 1.823   -24.903 64.606  1.00 25.76  ? 91  THR H OG1 1 
ATOM 3904 C CG2 . THR C 1 91  ? 1.599   -23.632 62.568  1.00 24.43  ? 91  THR H CG2 1 
ATOM 3905 N N   . ALA C 1 92  ? -1.271  -24.798 61.218  1.00 30.08  ? 92  ALA H N   1 
ATOM 3906 C CA  . ALA C 1 92  ? -1.843  -24.747 59.876  1.00 27.53  ? 92  ALA H CA  1 
ATOM 3907 C C   . ALA C 1 92  ? -2.994  -23.752 59.800  1.00 30.67  ? 92  ALA H C   1 
ATOM 3908 O O   . ALA C 1 92  ? -3.435  -23.212 60.814  1.00 37.47  ? 92  ALA H O   1 
ATOM 3909 C CB  . ALA C 1 92  ? -2.330  -26.128 59.446  1.00 29.05  ? 92  ALA H CB  1 
ATOM 3910 N N   . VAL C 1 93  ? -3.477  -23.527 58.583  1.00 22.39  ? 93  VAL H N   1 
ATOM 3911 C CA  . VAL C 1 93  ? -4.698  -22.766 58.358  1.00 34.18  ? 93  VAL H CA  1 
ATOM 3912 C C   . VAL C 1 93  ? -5.850  -23.722 58.096  1.00 32.56  ? 93  VAL H C   1 
ATOM 3913 O O   . VAL C 1 93  ? -5.855  -24.425 57.090  1.00 33.41  ? 93  VAL H O   1 
ATOM 3914 C CB  . VAL C 1 93  ? -4.578  -21.806 57.159  1.00 23.22  ? 93  VAL H CB  1 
ATOM 3915 C CG1 . VAL C 1 93  ? -5.908  -21.112 56.902  1.00 23.60  ? 93  VAL H CG1 1 
ATOM 3916 C CG2 . VAL C 1 93  ? -3.469  -20.795 57.378  1.00 24.44  ? 93  VAL H CG2 1 
ATOM 3917 N N   . TYR C 1 94  ? -6.829  -23.746 58.992  1.00 30.02  ? 94  TYR H N   1 
ATOM 3918 C CA  . TYR C 1 94  ? -7.969  -24.647 58.844  1.00 37.74  ? 94  TYR H CA  1 
ATOM 3919 C C   . TYR C 1 94  ? -9.101  -23.966 58.071  1.00 41.52  ? 94  TYR H C   1 
ATOM 3920 O O   . TYR C 1 94  ? -9.499  -22.854 58.406  1.00 24.31  ? 94  TYR H O   1 
ATOM 3921 C CB  . TYR C 1 94  ? -8.442  -25.137 60.221  1.00 35.44  ? 94  TYR H CB  1 
ATOM 3922 C CG  . TYR C 1 94  ? -7.410  -26.008 60.917  1.00 38.98  ? 94  TYR H CG  1 
ATOM 3923 C CD1 . TYR C 1 94  ? -6.221  -25.467 61.394  1.00 33.04  ? 94  TYR H CD1 1 
ATOM 3924 C CD2 . TYR C 1 94  ? -7.618  -27.371 61.083  1.00 46.89  ? 94  TYR H CD2 1 
ATOM 3925 C CE1 . TYR C 1 94  ? -5.268  -26.257 62.016  1.00 24.07  ? 94  TYR H CE1 1 
ATOM 3926 C CE2 . TYR C 1 94  ? -6.670  -28.171 61.708  1.00 52.01  ? 94  TYR H CE2 1 
ATOM 3927 C CZ  . TYR C 1 94  ? -5.497  -27.608 62.171  1.00 24.40  ? 94  TYR H CZ  1 
ATOM 3928 O OH  . TYR C 1 94  ? -4.550  -28.393 62.792  1.00 24.97  ? 94  TYR H OH  1 
ATOM 3929 N N   . TYR C 1 95  ? -9.580  -24.629 57.018  1.00 47.10  ? 95  TYR H N   1 
ATOM 3930 C CA  . TYR C 1 95  ? -10.696 -24.136 56.205  1.00 20.77  ? 95  TYR H CA  1 
ATOM 3931 C C   . TYR C 1 95  ? -11.957 -24.961 56.444  1.00 21.10  ? 95  TYR H C   1 
ATOM 3932 O O   . TYR C 1 95  ? -11.867 -26.168 56.630  1.00 44.24  ? 95  TYR H O   1 
ATOM 3933 C CB  . TYR C 1 95  ? -10.360 -24.197 54.712  1.00 20.46  ? 95  TYR H CB  1 
ATOM 3934 C CG  . TYR C 1 95  ? -9.188  -23.361 54.268  1.00 20.73  ? 95  TYR H CG  1 
ATOM 3935 C CD1 . TYR C 1 95  ? -7.904  -23.886 54.257  1.00 20.48  ? 95  TYR H CD1 1 
ATOM 3936 C CD2 . TYR C 1 95  ? -9.366  -22.054 53.844  1.00 36.19  ? 95  TYR H CD2 1 
ATOM 3937 C CE1 . TYR C 1 95  ? -6.826  -23.127 53.850  1.00 31.06  ? 95  TYR H CE1 1 
ATOM 3938 C CE2 . TYR C 1 95  ? -8.296  -21.287 53.437  1.00 39.29  ? 95  TYR H CE2 1 
ATOM 3939 C CZ  . TYR C 1 95  ? -7.027  -21.830 53.440  1.00 41.17  ? 95  TYR H CZ  1 
ATOM 3940 O OH  . TYR C 1 95  ? -5.950  -21.081 53.028  1.00 46.17  ? 95  TYR H OH  1 
ATOM 3941 N N   . CYS C 1 96  ? -13.132 -24.339 56.411  1.00 25.43  ? 96  CYS H N   1 
ATOM 3942 C CA  . CYS C 1 96  ? -14.361 -25.129 56.467  1.00 33.61  ? 96  CYS H CA  1 
ATOM 3943 C C   . CYS C 1 96  ? -15.168 -24.980 55.189  1.00 33.98  ? 96  CYS H C   1 
ATOM 3944 O O   . CYS C 1 96  ? -15.571 -23.881 54.812  1.00 38.56  ? 96  CYS H O   1 
ATOM 3945 C CB  . CYS C 1 96  ? -15.221 -24.754 57.677  1.00 44.97  ? 96  CYS H CB  1 
ATOM 3946 S SG  . CYS C 1 96  ? -15.773 -23.042 57.747  1.00 35.41  ? 96  CYS H SG  1 
ATOM 3947 N N   . ALA C 1 97  ? -15.399 -26.103 54.523  1.00 30.96  ? 97  ALA H N   1 
ATOM 3948 C CA  . ALA C 1 97  ? -16.134 -26.094 53.273  1.00 28.53  ? 97  ALA H CA  1 
ATOM 3949 C C   . ALA C 1 97  ? -17.284 -27.074 53.291  1.00 29.45  ? 97  ALA H C   1 
ATOM 3950 O O   . ALA C 1 97  ? -17.352 -27.977 54.130  1.00 29.96  ? 97  ALA H O   1 
ATOM 3951 C CB  . ALA C 1 97  ? -15.214 -26.405 52.117  1.00 35.91  ? 97  ALA H CB  1 
ATOM 3952 N N   . THR C 1 98  ? -18.198 -26.890 52.351  1.00 28.12  ? 98  THR H N   1 
ATOM 3953 C CA  . THR C 1 98  ? -19.298 -27.813 52.239  1.00 36.46  ? 98  THR H CA  1 
ATOM 3954 C C   . THR C 1 98  ? -18.911 -28.914 51.267  1.00 34.35  ? 98  THR H C   1 
ATOM 3955 O O   . THR C 1 98  ? -17.839 -28.872 50.651  1.00 34.66  ? 98  THR H O   1 
ATOM 3956 C CB  . THR C 1 98  ? -20.590 -27.092 51.785  1.00 30.41  ? 98  THR H CB  1 
ATOM 3957 O OG1 . THR C 1 98  ? -20.538 -26.828 50.383  1.00 35.13  ? 98  THR H OG1 1 
ATOM 3958 C CG2 . THR C 1 98  ? -20.727 -25.768 52.502  1.00 30.95  ? 98  THR H CG2 1 
ATOM 3959 N N   . ASN C 1 99  ? -19.790 -29.897 51.142  1.00 32.04  ? 99  ASN H N   1 
ATOM 3960 C CA  . ASN C 1 99  ? -19.637 -30.952 50.156  1.00 38.87  ? 99  ASN H CA  1 
ATOM 3961 C C   . ASN C 1 99  ? -20.154 -30.486 48.807  1.00 32.54  ? 99  ASN H C   1 
ATOM 3962 O O   . ASN C 1 99  ? -19.959 -31.156 47.776  1.00 32.99  ? 99  ASN H O   1 
ATOM 3963 C CB  . ASN C 1 99  ? -20.280 -32.209 50.728  1.00 35.19  ? 99  ASN H CB  1 
ATOM 3964 C CG  . ASN C 1 99  ? -20.200 -33.405 49.827  1.00 52.65  ? 99  ASN H CG  1 
ATOM 3965 O OD1 . ASN C 1 99  ? -21.266 -33.846 49.374  1.00 63.58  ? 99  ASN H OD1 1 
ATOM 3966 N ND2 . ASN C 1 99  ? -18.963 -33.806 49.385  1.00 56.25  ? 99  ASN H ND2 1 
ATOM 3967 N N   . ASP C 1 100 ? -20.717 -29.277 48.822  1.00 34.41  ? 100 ASP H N   1 
ATOM 3968 C CA  . ASP C 1 100 ? -20.879 -28.426 47.638  1.00 28.12  ? 100 ASP H CA  1 
ATOM 3969 C C   . ASP C 1 100 ? -19.591 -27.638 47.288  1.00 27.01  ? 100 ASP H C   1 
ATOM 3970 O O   . ASP C 1 100 ? -19.503 -27.013 46.236  1.00 44.50  ? 100 ASP H O   1 
ATOM 3971 C CB  . ASP C 1 100 ? -22.033 -27.448 47.877  1.00 48.04  ? 100 ASP H CB  1 
ATOM 3972 C CG  . ASP C 1 100 ? -23.374 -28.132 47.883  1.00 56.38  ? 100 ASP H CG  1 
ATOM 3973 O OD1 . ASP C 1 100 ? -23.369 -29.378 47.894  1.00 55.58  ? 100 ASP H OD1 1 
ATOM 3974 O OD2 . ASP C 1 100 ? -24.423 -27.453 47.922  1.00 64.52  ? 100 ASP H OD2 1 
ATOM 3975 N N   . ASP C 1 101 ? -18.607 -27.680 48.189  1.00 36.83  ? 101 ASP H N   1 
ATOM 3976 C CA  . ASP C 1 101 ? -17.345 -26.905 48.115  1.00 34.10  ? 101 ASP H CA  1 
ATOM 3977 C C   . ASP C 1 101 ? -17.530 -25.372 48.052  1.00 27.32  ? 101 ASP H C   1 
ATOM 3978 O O   . ASP C 1 101 ? -17.002 -24.688 47.175  1.00 25.39  ? 101 ASP H O   1 
ATOM 3979 C CB  . ASP C 1 101 ? -16.507 -27.407 46.926  1.00 24.94  ? 101 ASP H CB  1 
ATOM 3980 C CG  . ASP C 1 101 ? -15.808 -28.732 47.233  1.00 29.89  ? 101 ASP H CG  1 
ATOM 3981 O OD1 . ASP C 1 101 ? -15.237 -28.863 48.343  1.00 28.74  ? 101 ASP H OD1 1 
ATOM 3982 O OD2 . ASP C 1 101 ? -15.860 -29.658 46.403  1.00 36.88  ? 101 ASP H OD2 1 
ATOM 3983 N N   . TYR C 1 102 ? -18.297 -24.852 49.007  1.00 24.52  ? 102 TYR H N   1 
ATOM 3984 C CA  . TYR C 1 102 ? -18.276 -23.434 49.345  1.00 25.15  ? 102 TYR H CA  1 
ATOM 3985 C C   . TYR C 1 102 ? -17.196 -23.285 50.420  1.00 26.67  ? 102 TYR H C   1 
ATOM 3986 O O   . TYR C 1 102 ? -17.368 -23.784 51.528  1.00 31.84  ? 102 TYR H O   1 
ATOM 3987 C CB  . TYR C 1 102 ? -19.630 -22.962 49.896  1.00 33.76  ? 102 TYR H CB  1 
ATOM 3988 C CG  . TYR C 1 102 ? -20.712 -22.652 48.874  1.00 37.01  ? 102 TYR H CG  1 
ATOM 3989 C CD1 . TYR C 1 102 ? -20.519 -21.697 47.885  1.00 33.97  ? 102 TYR H CD1 1 
ATOM 3990 C CD2 . TYR C 1 102 ? -21.937 -23.310 48.917  1.00 37.41  ? 102 TYR H CD2 1 
ATOM 3991 C CE1 . TYR C 1 102 ? -21.520 -21.405 46.963  1.00 33.13  ? 102 TYR H CE1 1 
ATOM 3992 C CE2 . TYR C 1 102 ? -22.939 -23.032 48.000  1.00 37.55  ? 102 TYR H CE2 1 
ATOM 3993 C CZ  . TYR C 1 102 ? -22.727 -22.082 47.024  1.00 35.00  ? 102 TYR H CZ  1 
ATOM 3994 O OH  . TYR C 1 102 ? -23.730 -21.813 46.119  1.00 32.06  ? 102 TYR H OH  1 
ATOM 3995 N N   . TRP C 1 103 ? -16.091 -22.610 50.109  1.00 24.22  ? 103 TRP H N   1 
ATOM 3996 C CA  . TRP C 1 103 ? -14.983 -22.506 51.066  1.00 23.57  ? 103 TRP H CA  1 
ATOM 3997 C C   . TRP C 1 103 ? -14.889 -21.143 51.730  1.00 24.66  ? 103 TRP H C   1 
ATOM 3998 O O   . TRP C 1 103 ? -15.189 -20.109 51.128  1.00 26.03  ? 103 TRP H O   1 
ATOM 3999 C CB  . TRP C 1 103 ? -13.640 -22.820 50.404  1.00 27.63  ? 103 TRP H CB  1 
ATOM 4000 C CG  . TRP C 1 103 ? -13.507 -24.235 49.970  1.00 22.26  ? 103 TRP H CG  1 
ATOM 4001 C CD1 . TRP C 1 103 ? -14.323 -24.905 49.107  1.00 24.43  ? 103 TRP H CD1 1 
ATOM 4002 C CD2 . TRP C 1 103 ? -12.497 -25.169 50.376  1.00 25.29  ? 103 TRP H CD2 1 
ATOM 4003 N NE1 . TRP C 1 103 ? -13.884 -26.197 48.947  1.00 22.25  ? 103 TRP H NE1 1 
ATOM 4004 C CE2 . TRP C 1 103 ? -12.766 -26.383 49.714  1.00 22.76  ? 103 TRP H CE2 1 
ATOM 4005 C CE3 . TRP C 1 103 ? -11.394 -25.093 51.231  1.00 21.14  ? 103 TRP H CE3 1 
ATOM 4006 C CZ2 . TRP C 1 103 ? -11.969 -27.514 49.882  1.00 22.14  ? 103 TRP H CZ2 1 
ATOM 4007 C CZ3 . TRP C 1 103 ? -10.606 -26.217 51.394  1.00 20.86  ? 103 TRP H CZ3 1 
ATOM 4008 C CH2 . TRP C 1 103 ? -10.897 -27.411 50.725  1.00 21.20  ? 103 TRP H CH2 1 
ATOM 4009 N N   . GLY C 1 104 ? -14.457 -21.162 52.984  1.00 26.39  ? 104 GLY H N   1 
ATOM 4010 C CA  . GLY C 1 104 ? -14.321 -19.949 53.757  1.00 35.79  ? 104 GLY H CA  1 
ATOM 4011 C C   . GLY C 1 104 ? -12.943 -19.329 53.700  1.00 41.08  ? 104 GLY H C   1 
ATOM 4012 O O   . GLY C 1 104 ? -12.020 -19.848 53.070  1.00 42.16  ? 104 GLY H O   1 
ATOM 4013 N N   . GLN C 1 105 ? -12.823 -18.201 54.381  1.00 48.74  ? 105 GLN H N   1 
ATOM 4014 C CA  . GLN C 1 105 ? -11.576 -17.472 54.511  1.00 44.16  ? 105 GLN H CA  1 
ATOM 4015 C C   . GLN C 1 105 ? -10.388 -18.315 54.945  1.00 40.83  ? 105 GLN H C   1 
ATOM 4016 O O   . GLN C 1 105 ? -9.288  -18.178 54.427  1.00 32.63  ? 105 GLN H O   1 
ATOM 4017 C CB  . GLN C 1 105 ? -11.774 -16.395 55.532  1.00 62.08  ? 105 GLN H CB  1 
ATOM 4018 C CG  . GLN C 1 105 ? -10.896 -15.234 55.404  1.00 70.28  ? 105 GLN H CG  1 
ATOM 4019 C CD  . GLN C 1 105 ? -11.048 -14.390 56.608  1.00 78.89  ? 105 GLN H CD  1 
ATOM 4020 O OE1 . GLN C 1 105 ? -11.480 -14.875 57.653  1.00 85.11  ? 105 GLN H OE1 1 
ATOM 4021 N NE2 . GLN C 1 105 ? -10.717 -13.124 56.490  1.00 79.89  ? 105 GLN H NE2 1 
ATOM 4022 N N   . GLY C 1 106 ? -10.634 -19.184 55.918  1.00 41.06  ? 106 GLY H N   1 
ATOM 4023 C CA  . GLY C 1 106 ? -9.603  -19.982 56.560  1.00 40.60  ? 106 GLY H CA  1 
ATOM 4024 C C   . GLY C 1 106 ? -9.120  -19.258 57.800  1.00 39.28  ? 106 GLY H C   1 
ATOM 4025 O O   . GLY C 1 106 ? -9.034  -18.028 57.816  1.00 36.57  ? 106 GLY H O   1 
ATOM 4026 N N   . THR C 1 107 ? -8.802  -20.015 58.841  1.00 34.41  ? 107 THR H N   1 
ATOM 4027 C CA  . THR C 1 107 ? -8.349  -19.426 60.091  1.00 34.66  ? 107 THR H CA  1 
ATOM 4028 C C   . THR C 1 107 ? -7.008  -20.033 60.461  1.00 38.61  ? 107 THR H C   1 
ATOM 4029 O O   . THR C 1 107 ? -6.773  -21.214 60.225  1.00 27.34  ? 107 THR H O   1 
ATOM 4030 C CB  . THR C 1 107 ? -9.378  -19.632 61.237  1.00 44.78  ? 107 THR H CB  1 
ATOM 4031 O OG1 . THR C 1 107 ? -8.801  -19.234 62.488  1.00 37.72  ? 107 THR H OG1 1 
ATOM 4032 C CG2 . THR C 1 107 ? -9.820  -21.081 61.324  1.00 50.79  ? 107 THR H CG2 1 
ATOM 4033 N N   . LEU C 1 108 ? -6.122  -19.229 61.034  1.00 32.71  ? 108 LEU H N   1 
ATOM 4034 C CA  . LEU C 1 108 ? -4.777  -19.712 61.313  1.00 41.83  ? 108 LEU H CA  1 
ATOM 4035 C C   . LEU C 1 108 ? -4.640  -20.242 62.733  1.00 38.48  ? 108 LEU H C   1 
ATOM 4036 O O   . LEU C 1 108 ? -5.178  -19.671 63.682  1.00 31.84  ? 108 LEU H O   1 
ATOM 4037 C CB  . LEU C 1 108 ? -3.745  -18.610 61.059  1.00 28.33  ? 108 LEU H CB  1 
ATOM 4038 C CG  . LEU C 1 108 ? -2.290  -18.989 61.358  1.00 35.97  ? 108 LEU H CG  1 
ATOM 4039 C CD1 . LEU C 1 108 ? -1.853  -20.213 60.560  1.00 26.58  ? 108 LEU H CD1 1 
ATOM 4040 C CD2 . LEU C 1 108 ? -1.362  -17.815 61.091  1.00 41.84  ? 108 LEU H CD2 1 
ATOM 4041 N N   . VAL C 1 109 ? -3.933  -21.360 62.857  1.00 41.37  ? 109 VAL H N   1 
ATOM 4042 C CA  . VAL C 1 109 ? -3.604  -21.924 64.154  1.00 36.67  ? 109 VAL H CA  1 
ATOM 4043 C C   . VAL C 1 109 ? -2.106  -22.150 64.250  1.00 36.86  ? 109 VAL H C   1 
ATOM 4044 O O   . VAL C 1 109 ? -1.478  -22.674 63.323  1.00 27.68  ? 109 VAL H O   1 
ATOM 4045 C CB  . VAL C 1 109 ? -4.352  -23.241 64.412  1.00 33.93  ? 109 VAL H CB  1 
ATOM 4046 C CG1 . VAL C 1 109 ? -3.678  -24.036 65.517  1.00 33.37  ? 109 VAL H CG1 1 
ATOM 4047 C CG2 . VAL C 1 109 ? -5.792  -22.947 64.774  1.00 34.17  ? 109 VAL H CG2 1 
ATOM 4048 N N   . THR C 1 110 ? -1.537  -21.715 65.368  1.00 42.25  ? 110 THR H N   1 
ATOM 4049 C CA  . THR C 1 110 ? -0.112  -21.854 65.615  1.00 24.80  ? 110 THR H CA  1 
ATOM 4050 C C   . THR C 1 110 ? 0.115   -22.506 66.975  1.00 25.84  ? 110 THR H C   1 
ATOM 4051 O O   . THR C 1 110 ? -0.183  -21.924 68.021  1.00 26.43  ? 110 THR H O   1 
ATOM 4052 C CB  . THR C 1 110 ? 0.622   -20.481 65.558  1.00 45.18  ? 110 THR H CB  1 
ATOM 4053 O OG1 . THR C 1 110 ? -0.206  -19.472 66.140  1.00 58.47  ? 110 THR H OG1 1 
ATOM 4054 C CG2 . THR C 1 110 ? 0.905   -20.078 64.136  1.00 38.01  ? 110 THR H CG2 1 
ATOM 4055 N N   . VAL C 1 111 ? 0.662   -23.714 66.964  1.00 24.85  ? 111 VAL H N   1 
ATOM 4056 C CA  . VAL C 1 111 ? 0.920   -24.402 68.216  1.00 25.87  ? 111 VAL H CA  1 
ATOM 4057 C C   . VAL C 1 111 ? 2.403   -24.331 68.540  1.00 31.28  ? 111 VAL H C   1 
ATOM 4058 O O   . VAL C 1 111 ? 3.229   -24.964 67.879  1.00 31.34  ? 111 VAL H O   1 
ATOM 4059 C CB  . VAL C 1 111 ? 0.469   -25.866 68.175  1.00 31.44  ? 111 VAL H CB  1 
ATOM 4060 C CG1 . VAL C 1 111 ? 0.687   -26.515 69.534  1.00 37.71  ? 111 VAL H CG1 1 
ATOM 4061 C CG2 . VAL C 1 111 ? -0.990  -25.964 67.768  1.00 25.10  ? 111 VAL H CG2 1 
ATOM 4062 N N   . SER C 1 112 ? 2.739   -23.565 69.571  1.00 33.72  ? 112 SER H N   1 
ATOM 4063 C CA  . SER C 1 112 ? 4.139   -23.319 69.886  1.00 37.95  ? 112 SER H CA  1 
ATOM 4064 C C   . SER C 1 112 ? 4.421   -23.177 71.370  1.00 54.65  ? 112 SER H C   1 
ATOM 4065 O O   . SER C 1 112 ? 3.644   -22.584 72.113  1.00 31.96  ? 112 SER H O   1 
ATOM 4066 C CB  . SER C 1 112 ? 4.628   -22.061 69.171  1.00 41.13  ? 112 SER H CB  1 
ATOM 4067 O OG  . SER C 1 112 ? 6.013   -21.858 69.400  1.00 37.97  ? 112 SER H OG  1 
ATOM 4068 N N   . SER C 1 113 ? 5.561   -23.713 71.782  1.00 52.78  ? 113 SER H N   1 
ATOM 4069 C CA  . SER C 1 113 ? 6.017   -23.591 73.153  1.00 54.65  ? 113 SER H CA  1 
ATOM 4070 C C   . SER C 1 113 ? 6.496   -22.176 73.462  1.00 51.67  ? 113 SER H C   1 
ATOM 4071 O O   . SER C 1 113 ? 6.231   -21.645 74.539  1.00 49.39  ? 113 SER H O   1 
ATOM 4072 C CB  . SER C 1 113 ? 7.138   -24.591 73.421  1.00 56.89  ? 113 SER H CB  1 
ATOM 4073 O OG  . SER C 1 113 ? 8.106   -24.044 74.300  1.00 57.04  ? 113 SER H OG  1 
ATOM 4074 N N   . ALA C 1 114 ? 7.202   -21.567 72.514  1.00 43.88  ? 114 ALA H N   1 
ATOM 4075 C CA  . ALA C 1 114 ? 7.791   -20.252 72.741  1.00 38.98  ? 114 ALA H CA  1 
ATOM 4076 C C   . ALA C 1 114 ? 6.716   -19.185 72.887  1.00 37.12  ? 114 ALA H C   1 
ATOM 4077 O O   . ALA C 1 114 ? 5.586   -19.345 72.416  1.00 37.05  ? 114 ALA H O   1 
ATOM 4078 C CB  . ALA C 1 114 ? 8.745   -19.888 71.617  1.00 39.07  ? 114 ALA H CB  1 
ATOM 4079 N N   . SER C 1 115 ? 7.101   -18.080 73.513  1.00 37.81  ? 115 SER H N   1 
ATOM 4080 C CA  . SER C 1 115 ? 6.199   -16.975 73.779  1.00 43.49  ? 115 SER H CA  1 
ATOM 4081 C C   . SER C 1 115 ? 6.754   -15.749 73.075  1.00 45.01  ? 115 SER H C   1 
ATOM 4082 O O   . SER C 1 115 ? 7.884   -15.757 72.589  1.00 53.90  ? 115 SER H O   1 
ATOM 4083 C CB  . SER C 1 115 ? 6.042   -16.721 75.282  1.00 49.31  ? 115 SER H CB  1 
ATOM 4084 O OG  . SER C 1 115 ? 7.292   -16.508 75.917  1.00 55.10  ? 115 SER H OG  1 
ATOM 4085 N N   . THR C 1 116 ? 5.929   -14.718 72.981  1.00 41.79  ? 116 THR H N   1 
ATOM 4086 C CA  . THR C 1 116 ? 6.224   -13.555 72.157  1.00 41.26  ? 116 THR H CA  1 
ATOM 4087 C C   . THR C 1 116 ? 7.585   -12.928 72.481  1.00 48.64  ? 116 THR H C   1 
ATOM 4088 O O   . THR C 1 116 ? 7.990   -12.873 73.649  1.00 52.79  ? 116 THR H O   1 
ATOM 4089 C CB  . THR C 1 116 ? 5.121   -12.503 72.319  1.00 40.12  ? 116 THR H CB  1 
ATOM 4090 O OG1 . THR C 1 116 ? 3.851   -13.097 72.043  1.00 30.63  ? 116 THR H OG1 1 
ATOM 4091 C CG2 . THR C 1 116 ? 5.315   -11.340 71.364  1.00 36.81  ? 116 THR H CG2 1 
ATOM 4092 N N   . LYS C 1 117 ? 8.305   -12.494 71.446  1.00 50.74  ? 117 LYS H N   1 
ATOM 4093 C CA  . LYS C 1 117 ? 9.596   -11.850 71.648  1.00 49.33  ? 117 LYS H CA  1 
ATOM 4094 C C   . LYS C 1 117 ? 9.896   -10.868 70.503  1.00 45.58  ? 117 LYS H C   1 
ATOM 4095 O O   . LYS C 1 117 ? 9.352   -10.991 69.407  1.00 31.34  ? 117 LYS H O   1 
ATOM 4096 C CB  . LYS C 1 117 ? 10.678  -12.933 71.801  1.00 39.11  ? 117 LYS H CB  1 
ATOM 4097 C CG  . LYS C 1 117 ? 11.865  -12.554 72.698  1.00 39.11  ? 117 LYS H CG  1 
ATOM 4098 C CD  . LYS C 1 117 ? 12.883  -11.740 71.943  1.00 42.81  ? 117 LYS H CD  1 
ATOM 4099 C CE  . LYS C 1 117 ? 14.015  -11.230 72.805  1.00 49.70  ? 117 LYS H CE  1 
ATOM 4100 N NZ  . LYS C 1 117 ? 15.030  -10.551 71.945  1.00 53.86  ? 117 LYS H NZ  1 
ATOM 4101 N N   . GLY C 1 118 ? 10.722  -9.866  70.786  1.00 52.25  ? 118 GLY H N   1 
ATOM 4102 C CA  . GLY C 1 118 ? 11.120  -8.896  69.783  1.00 50.36  ? 118 GLY H CA  1 
ATOM 4103 C C   . GLY C 1 118 ? 12.291  -9.358  68.930  1.00 48.95  ? 118 GLY H C   1 
ATOM 4104 O O   . GLY C 1 118 ? 13.160  -10.094 69.394  1.00 43.26  ? 118 GLY H O   1 
ATOM 4105 N N   . PRO C 1 119 ? 12.322  -8.928  67.662  1.00 49.45  ? 119 PRO H N   1 
ATOM 4106 C CA  . PRO C 1 119 ? 13.398  -9.323  66.751  1.00 44.39  ? 119 PRO H CA  1 
ATOM 4107 C C   . PRO C 1 119 ? 14.705  -8.583  67.030  1.00 48.17  ? 119 PRO H C   1 
ATOM 4108 O O   . PRO C 1 119 ? 14.674  -7.453  67.519  1.00 38.19  ? 119 PRO H O   1 
ATOM 4109 C CB  . PRO C 1 119 ? 12.833  -8.944  65.387  1.00 28.75  ? 119 PRO H CB  1 
ATOM 4110 C CG  . PRO C 1 119 ? 11.998  -7.750  65.671  1.00 28.81  ? 119 PRO H CG  1 
ATOM 4111 C CD  . PRO C 1 119 ? 11.358  -8.027  67.009  1.00 44.27  ? 119 PRO H CD  1 
ATOM 4112 N N   . SER C 1 120 ? 15.835  -9.216  66.731  1.00 45.10  ? 120 SER H N   1 
ATOM 4113 C CA  . SER C 1 120 ? 17.118  -8.543  66.852  1.00 49.38  ? 120 SER H CA  1 
ATOM 4114 C C   . SER C 1 120 ? 17.547  -8.131  65.456  1.00 52.33  ? 120 SER H C   1 
ATOM 4115 O O   . SER C 1 120 ? 17.929  -8.970  64.637  1.00 65.66  ? 120 SER H O   1 
ATOM 4116 C CB  . SER C 1 120 ? 18.164  -9.444  67.510  1.00 48.11  ? 120 SER H CB  1 
ATOM 4117 O OG  . SER C 1 120 ? 17.823  -9.706  68.859  1.00 52.15  ? 120 SER H OG  1 
ATOM 4118 N N   . VAL C 1 121 ? 17.486  -6.832  65.190  1.00 45.99  ? 121 VAL H N   1 
ATOM 4119 C CA  . VAL C 1 121 ? 17.748  -6.326  63.851  1.00 32.13  ? 121 VAL H CA  1 
ATOM 4120 C C   . VAL C 1 121 ? 19.245  -6.090  63.669  1.00 50.10  ? 121 VAL H C   1 
ATOM 4121 O O   . VAL C 1 121 ? 19.903  -5.497  64.520  1.00 34.38  ? 121 VAL H O   1 
ATOM 4122 C CB  . VAL C 1 121 ? 16.969  -5.027  63.570  1.00 32.04  ? 121 VAL H CB  1 
ATOM 4123 C CG1 . VAL C 1 121 ? 17.153  -4.601  62.124  1.00 31.92  ? 121 VAL H CG1 1 
ATOM 4124 C CG2 . VAL C 1 121 ? 15.493  -5.217  63.887  1.00 30.98  ? 121 VAL H CG2 1 
ATOM 4125 N N   . PHE C 1 122 ? 19.774  -6.575  62.554  1.00 34.25  ? 122 PHE H N   1 
ATOM 4126 C CA  . PHE C 1 122 ? 21.199  -6.499  62.281  1.00 35.38  ? 122 PHE H CA  1 
ATOM 4127 C C   . PHE C 1 122 ? 21.431  -5.996  60.866  1.00 35.43  ? 122 PHE H C   1 
ATOM 4128 O O   . PHE C 1 122 ? 20.702  -6.366  59.947  1.00 34.42  ? 122 PHE H O   1 
ATOM 4129 C CB  . PHE C 1 122 ? 21.838  -7.872  62.476  1.00 35.42  ? 122 PHE H CB  1 
ATOM 4130 C CG  . PHE C 1 122 ? 21.804  -8.351  63.898  1.00 35.61  ? 122 PHE H CG  1 
ATOM 4131 C CD1 . PHE C 1 122 ? 21.388  -9.636  64.203  1.00 34.90  ? 122 PHE H CD1 1 
ATOM 4132 C CD2 . PHE C 1 122 ? 22.185  -7.513  64.929  1.00 41.88  ? 122 PHE H CD2 1 
ATOM 4133 C CE1 . PHE C 1 122 ? 21.344  -10.071 65.506  1.00 42.40  ? 122 PHE H CE1 1 
ATOM 4134 C CE2 . PHE C 1 122 ? 22.149  -7.945  66.237  1.00 42.30  ? 122 PHE H CE2 1 
ATOM 4135 C CZ  . PHE C 1 122 ? 21.729  -9.227  66.526  1.00 43.73  ? 122 PHE H CZ  1 
ATOM 4136 N N   . PRO C 1 123 ? 22.440  -5.135  60.689  1.00 33.33  ? 123 PRO H N   1 
ATOM 4137 C CA  . PRO C 1 123 ? 22.777  -4.620  59.364  1.00 34.50  ? 123 PRO H CA  1 
ATOM 4138 C C   . PRO C 1 123 ? 23.417  -5.710  58.508  1.00 40.83  ? 123 PRO H C   1 
ATOM 4139 O O   . PRO C 1 123 ? 24.277  -6.443  58.996  1.00 34.06  ? 123 PRO H O   1 
ATOM 4140 C CB  . PRO C 1 123 ? 23.761  -3.484  59.679  1.00 35.08  ? 123 PRO H CB  1 
ATOM 4141 C CG  . PRO C 1 123 ? 24.461  -3.964  60.912  1.00 35.71  ? 123 PRO H CG  1 
ATOM 4142 C CD  . PRO C 1 123 ? 23.405  -4.694  61.712  1.00 34.60  ? 123 PRO H CD  1 
ATOM 4143 N N   . LEU C 1 124 ? 23.000  -5.828  57.255  1.00 40.82  ? 124 LEU H N   1 
ATOM 4144 C CA  . LEU C 1 124 ? 23.760  -6.626  56.313  1.00 42.67  ? 124 LEU H CA  1 
ATOM 4145 C C   . LEU C 1 124 ? 24.511  -5.590  55.510  1.00 47.37  ? 124 LEU H C   1 
ATOM 4146 O O   . LEU C 1 124 ? 23.932  -4.926  54.652  1.00 46.20  ? 124 LEU H O   1 
ATOM 4147 C CB  . LEU C 1 124 ? 22.852  -7.481  55.431  1.00 40.84  ? 124 LEU H CB  1 
ATOM 4148 C CG  . LEU C 1 124 ? 22.164  -8.674  56.091  1.00 33.49  ? 124 LEU H CG  1 
ATOM 4149 C CD1 . LEU C 1 124 ? 21.189  -9.303  55.120  1.00 32.16  ? 124 LEU H CD1 1 
ATOM 4150 C CD2 . LEU C 1 124 ? 23.177  -9.703  56.576  1.00 34.13  ? 124 LEU H CD2 1 
ATOM 4151 N N   . ALA C 1 125 ? 25.805  -5.454  55.766  1.00 47.49  ? 125 ALA H N   1 
ATOM 4152 C CA  . ALA C 1 125 ? 26.545  -4.332  55.206  1.00 46.43  ? 125 ALA H CA  1 
ATOM 4153 C C   . ALA C 1 125 ? 27.075  -4.686  53.817  1.00 49.78  ? 125 ALA H C   1 
ATOM 4154 O O   . ALA C 1 125 ? 27.610  -5.780  53.609  1.00 38.82  ? 125 ALA H O   1 
ATOM 4155 C CB  . ALA C 1 125 ? 27.676  -3.915  56.139  1.00 39.94  ? 125 ALA H CB  1 
ATOM 4156 N N   . PRO C 1 126 ? 26.897  -3.765  52.850  1.00 56.38  ? 126 PRO H N   1 
ATOM 4157 C CA  . PRO C 1 126 ? 27.247  -3.967  51.435  1.00 55.82  ? 126 PRO H CA  1 
ATOM 4158 C C   . PRO C 1 126 ? 28.755  -3.806  51.150  1.00 59.65  ? 126 PRO H C   1 
ATOM 4159 O O   . PRO C 1 126 ? 29.507  -3.866  52.116  1.00 64.01  ? 126 PRO H O   1 
ATOM 4160 C CB  . PRO C 1 126 ? 26.379  -2.920  50.719  1.00 54.27  ? 126 PRO H CB  1 
ATOM 4161 C CG  . PRO C 1 126 ? 26.328  -1.799  51.666  1.00 53.68  ? 126 PRO H CG  1 
ATOM 4162 C CD  . PRO C 1 126 ? 26.356  -2.406  53.069  1.00 54.49  ? 126 PRO H CD  1 
ATOM 4163 N N   . SER C 1 127 ? 29.136  -3.605  49.878  1.00 65.52  ? 127 SER H N   1 
ATOM 4164 C CA  . SER C 1 127 ? 30.507  -3.535  49.268  1.00 69.51  ? 127 SER H CA  1 
ATOM 4165 C C   . SER C 1 127 ? 31.129  -4.755  48.542  1.00 67.02  ? 127 SER H C   1 
ATOM 4166 O O   . SER C 1 127 ? 32.202  -4.539  47.951  1.00 66.34  ? 127 SER H O   1 
ATOM 4167 C CB  . SER C 1 127 ? 31.593  -3.068  50.291  1.00 113.70 ? 127 SER H CB  1 
ATOM 4168 O OG  . SER C 1 127 ? 31.134  -1.984  51.085  1.00 114.53 ? 127 SER H OG  1 
ATOM 4169 N N   . SER C 1 128 ? 30.508  -5.952  48.515  1.00 65.08  ? 128 SER H N   1 
ATOM 4170 C CA  . SER C 1 128 ? 30.992  -7.100  47.665  1.00 59.90  ? 128 SER H CA  1 
ATOM 4171 C C   . SER C 1 128 ? 30.569  -8.516  48.113  1.00 61.28  ? 128 SER H C   1 
ATOM 4172 O O   . SER C 1 128 ? 31.411  -9.382  48.429  1.00 64.51  ? 128 SER H O   1 
ATOM 4173 C CB  . SER C 1 128 ? 32.523  -7.135  47.532  1.00 53.84  ? 128 SER H CB  1 
ATOM 4174 O OG  . SER C 1 128 ? 32.918  -6.259  46.499  1.00 54.23  ? 128 SER H OG  1 
ATOM 4175 N N   . GLY C 1 134 ? 27.092  -4.109  38.580  1.00 44.98  ? 134 GLY H N   1 
ATOM 4176 C CA  . GLY C 1 134 ? 26.327  -2.900  38.352  1.00 59.10  ? 134 GLY H CA  1 
ATOM 4177 C C   . GLY C 1 134 ? 26.082  -2.143  39.641  1.00 57.03  ? 134 GLY H C   1 
ATOM 4178 O O   . GLY C 1 134 ? 26.651  -1.073  39.865  1.00 54.27  ? 134 GLY H O   1 
ATOM 4179 N N   . THR C 1 135 ? 25.245  -2.713  40.503  1.00 64.48  ? 135 THR H N   1 
ATOM 4180 C CA  . THR C 1 135 ? 24.820  -2.037  41.720  1.00 58.74  ? 135 THR H CA  1 
ATOM 4181 C C   . THR C 1 135 ? 25.250  -2.765  42.993  1.00 51.72  ? 135 THR H C   1 
ATOM 4182 O O   . THR C 1 135 ? 25.858  -3.834  42.945  1.00 45.45  ? 135 THR H O   1 
ATOM 4183 C CB  . THR C 1 135 ? 23.293  -1.866  41.733  1.00 58.36  ? 135 THR H CB  1 
ATOM 4184 O OG1 . THR C 1 135 ? 22.671  -3.141  41.932  1.00 55.16  ? 135 THR H OG1 1 
ATOM 4185 C CG2 . THR C 1 135 ? 22.815  -1.264  40.419  1.00 59.05  ? 135 THR H CG2 1 
ATOM 4186 N N   . ALA C 1 136 ? 24.915  -2.170  44.133  1.00 42.21  ? 136 ALA H N   1 
ATOM 4187 C CA  . ALA C 1 136 ? 25.308  -2.690  45.438  1.00 40.43  ? 136 ALA H CA  1 
ATOM 4188 C C   . ALA C 1 136 ? 24.102  -3.247  46.176  1.00 43.72  ? 136 ALA H C   1 
ATOM 4189 O O   . ALA C 1 136 ? 22.988  -2.759  46.005  1.00 47.50  ? 136 ALA H O   1 
ATOM 4190 C CB  . ALA C 1 136 ? 25.975  -1.600  46.265  1.00 40.38  ? 136 ALA H CB  1 
ATOM 4191 N N   . ALA C 1 137 ? 24.321  -4.265  47.001  1.00 34.75  ? 137 ALA H N   1 
ATOM 4192 C CA  . ALA C 1 137 ? 23.220  -4.864  47.745  1.00 30.40  ? 137 ALA H CA  1 
ATOM 4193 C C   . ALA C 1 137 ? 23.481  -4.894  49.248  1.00 30.78  ? 137 ALA H C   1 
ATOM 4194 O O   . ALA C 1 137 ? 24.534  -5.345  49.703  1.00 31.36  ? 137 ALA H O   1 
ATOM 4195 C CB  . ALA C 1 137 ? 22.939  -6.266  47.233  1.00 29.52  ? 137 ALA H CB  1 
ATOM 4196 N N   . LEU C 1 138 ? 22.499  -4.408  50.003  1.00 38.93  ? 138 LEU H N   1 
ATOM 4197 C CA  . LEU C 1 138 ? 22.542  -4.390  51.460  1.00 29.74  ? 138 LEU H CA  1 
ATOM 4198 C C   . LEU C 1 138 ? 21.200  -4.830  52.029  1.00 37.03  ? 138 LEU H C   1 
ATOM 4199 O O   . LEU C 1 138 ? 20.213  -4.908  51.300  1.00 28.05  ? 138 LEU H O   1 
ATOM 4200 C CB  . LEU C 1 138 ? 22.919  -2.995  51.971  1.00 30.82  ? 138 LEU H CB  1 
ATOM 4201 C CG  . LEU C 1 138 ? 22.222  -1.726  51.454  1.00 42.61  ? 138 LEU H CG  1 
ATOM 4202 C CD1 . LEU C 1 138 ? 20.760  -1.591  51.888  1.00 30.23  ? 138 LEU H CD1 1 
ATOM 4203 C CD2 . LEU C 1 138 ? 23.025  -0.493  51.863  1.00 46.79  ? 138 LEU H CD2 1 
ATOM 4204 N N   . GLY C 1 139 ? 21.154  -5.116  53.325  1.00 39.42  ? 139 GLY H N   1 
ATOM 4205 C CA  . GLY C 1 139 ? 19.896  -5.484  53.940  1.00 38.59  ? 139 GLY H CA  1 
ATOM 4206 C C   . GLY C 1 139 ? 19.861  -5.509  55.453  1.00 32.18  ? 139 GLY H C   1 
ATOM 4207 O O   . GLY C 1 139 ? 20.830  -5.154  56.123  1.00 33.08  ? 139 GLY H O   1 
ATOM 4208 N N   . CYS C 1 140 ? 18.721  -5.931  55.988  1.00 43.32  ? 140 CYS H N   1 
ATOM 4209 C CA  . CYS C 1 140 ? 18.551  -6.072  57.425  1.00 41.60  ? 140 CYS H CA  1 
ATOM 4210 C C   . CYS C 1 140 ? 18.320  -7.523  57.810  1.00 43.18  ? 140 CYS H C   1 
ATOM 4211 O O   . CYS C 1 140 ? 17.618  -8.259  57.119  1.00 40.10  ? 140 CYS H O   1 
ATOM 4212 C CB  . CYS C 1 140 ? 17.391  -5.209  57.918  1.00 45.70  ? 140 CYS H CB  1 
ATOM 4213 S SG  . CYS C 1 140 ? 17.822  -3.474  58.092  1.00 89.20  ? 140 CYS H SG  1 
ATOM 4214 N N   . LEU C 1 141 ? 18.926  -7.926  58.919  1.00 47.33  ? 141 LEU H N   1 
ATOM 4215 C CA  . LEU C 1 141 ? 18.726  -9.260  59.450  1.00 30.64  ? 141 LEU H CA  1 
ATOM 4216 C C   . LEU C 1 141 ? 17.799  -9.179  60.653  1.00 35.77  ? 141 LEU H C   1 
ATOM 4217 O O   . LEU C 1 141 ? 18.171  -8.656  61.703  1.00 40.20  ? 141 LEU H O   1 
ATOM 4218 C CB  . LEU C 1 141 ? 20.063  -9.897  59.830  1.00 45.26  ? 141 LEU H CB  1 
ATOM 4219 C CG  . LEU C 1 141 ? 20.042  -11.335 60.347  1.00 45.38  ? 141 LEU H CG  1 
ATOM 4220 C CD1 . LEU C 1 141 ? 20.008  -12.326 59.193  1.00 44.23  ? 141 LEU H CD1 1 
ATOM 4221 C CD2 . LEU C 1 141 ? 21.254  -11.574 61.233  1.00 32.08  ? 141 LEU H CD2 1 
ATOM 4222 N N   . VAL C 1 142 ? 16.589  -9.698  60.490  1.00 46.67  ? 142 VAL H N   1 
ATOM 4223 C CA  . VAL C 1 142 ? 15.594  -9.647  61.548  1.00 33.87  ? 142 VAL H CA  1 
ATOM 4224 C C   . VAL C 1 142 ? 15.557  -10.998 62.239  1.00 29.02  ? 142 VAL H C   1 
ATOM 4225 O O   . VAL C 1 142 ? 15.091  -11.978 61.677  1.00 28.46  ? 142 VAL H O   1 
ATOM 4226 C CB  . VAL C 1 142 ? 14.211  -9.278  60.992  1.00 39.97  ? 142 VAL H CB  1 
ATOM 4227 C CG1 . VAL C 1 142 ? 13.147  -9.373  62.063  1.00 36.58  ? 142 VAL H CG1 1 
ATOM 4228 C CG2 . VAL C 1 142 ? 14.249  -7.887  60.402  1.00 28.78  ? 142 VAL H CG2 1 
ATOM 4229 N N   . LYS C 1 143 ? 16.042  -11.046 63.475  1.00 31.23  ? 143 LYS H N   1 
ATOM 4230 C CA  . LYS C 1 143 ? 16.344  -12.332 64.108  1.00 38.97  ? 143 LYS H CA  1 
ATOM 4231 C C   . LYS C 1 143 ? 15.553  -12.722 65.333  1.00 41.92  ? 143 LYS H C   1 
ATOM 4232 O O   . LYS C 1 143 ? 15.254  -11.892 66.189  1.00 31.62  ? 143 LYS H O   1 
ATOM 4233 C CB  . LYS C 1 143 ? 17.810  -12.399 64.513  1.00 39.92  ? 143 LYS H CB  1 
ATOM 4234 C CG  . LYS C 1 143 ? 18.300  -13.804 64.508  1.00 32.26  ? 143 LYS H CG  1 
ATOM 4235 C CD  . LYS C 1 143 ? 19.277  -13.972 63.434  1.00 57.29  ? 143 LYS H CD  1 
ATOM 4236 C CE  . LYS C 1 143 ? 20.078  -15.204 63.642  1.00 67.29  ? 143 LYS H CE  1 
ATOM 4237 N NZ  . LYS C 1 143 ? 21.161  -15.160 62.651  1.00 76.51  ? 143 LYS H NZ  1 
ATOM 4238 N N   . ASP C 1 144 ? 15.269  -14.019 65.417  1.00 39.07  ? 144 ASP H N   1 
ATOM 4239 C CA  . ASP C 1 144 ? 14.649  -14.627 66.590  1.00 38.96  ? 144 ASP H CA  1 
ATOM 4240 C C   . ASP C 1 144 ? 13.480  -13.813 67.129  1.00 38.12  ? 144 ASP H C   1 
ATOM 4241 O O   . ASP C 1 144 ? 13.552  -13.236 68.215  1.00 28.86  ? 144 ASP H O   1 
ATOM 4242 C CB  . ASP C 1 144 ? 15.697  -14.861 67.683  1.00 41.65  ? 144 ASP H CB  1 
ATOM 4243 C CG  . ASP C 1 144 ? 16.837  -15.746 67.211  1.00 42.96  ? 144 ASP H CG  1 
ATOM 4244 O OD1 . ASP C 1 144 ? 16.540  -16.796 66.603  1.00 50.90  ? 144 ASP H OD1 1 
ATOM 4245 O OD2 . ASP C 1 144 ? 18.013  -15.418 67.476  1.00 36.04  ? 144 ASP H OD2 1 
ATOM 4246 N N   . TYR C 1 145 ? 12.418  -13.753 66.333  1.00 29.33  ? 145 TYR H N   1 
ATOM 4247 C CA  . TYR C 1 145 ? 11.181  -13.096 66.728  1.00 29.12  ? 145 TYR H CA  1 
ATOM 4248 C C   . TYR C 1 145 ? 10.048  -14.104 66.646  1.00 34.35  ? 145 TYR H C   1 
ATOM 4249 O O   . TYR C 1 145 ? 10.188  -15.153 66.014  1.00 28.44  ? 145 TYR H O   1 
ATOM 4250 C CB  . TYR C 1 145 ? 10.868  -11.888 65.841  1.00 36.96  ? 145 TYR H CB  1 
ATOM 4251 C CG  . TYR C 1 145 ? 10.375  -12.266 64.462  1.00 37.53  ? 145 TYR H CG  1 
ATOM 4252 C CD1 . TYR C 1 145 ? 11.260  -12.675 63.474  1.00 35.07  ? 145 TYR H CD1 1 
ATOM 4253 C CD2 . TYR C 1 145 ? 9.021   -12.225 64.151  1.00 33.48  ? 145 TYR H CD2 1 
ATOM 4254 C CE1 . TYR C 1 145 ? 10.809  -13.028 62.210  1.00 27.64  ? 145 TYR H CE1 1 
ATOM 4255 C CE2 . TYR C 1 145 ? 8.561   -12.580 62.888  1.00 34.32  ? 145 TYR H CE2 1 
ATOM 4256 C CZ  . TYR C 1 145 ? 9.460   -12.981 61.926  1.00 33.26  ? 145 TYR H CZ  1 
ATOM 4257 O OH  . TYR C 1 145 ? 9.004   -13.334 60.678  1.00 32.54  ? 145 TYR H OH  1 
ATOM 4258 N N   . PHE C 1 146 ? 8.923   -13.768 67.270  1.00 36.99  ? 146 PHE H N   1 
ATOM 4259 C CA  . PHE C 1 146 ? 7.770   -14.653 67.339  1.00 41.07  ? 146 PHE H CA  1 
ATOM 4260 C C   . PHE C 1 146 ? 6.616   -13.927 68.025  1.00 38.15  ? 146 PHE H C   1 
ATOM 4261 O O   . PHE C 1 146 ? 6.826   -13.185 68.983  1.00 38.22  ? 146 PHE H O   1 
ATOM 4262 C CB  . PHE C 1 146 ? 8.126   -15.947 68.089  1.00 40.74  ? 146 PHE H CB  1 
ATOM 4263 C CG  . PHE C 1 146 ? 6.976   -16.908 68.248  1.00 40.98  ? 146 PHE H CG  1 
ATOM 4264 C CD1 . PHE C 1 146 ? 6.028   -16.724 69.243  1.00 40.84  ? 146 PHE H CD1 1 
ATOM 4265 C CD2 . PHE C 1 146 ? 6.847   -18.000 67.406  1.00 42.82  ? 146 PHE H CD2 1 
ATOM 4266 C CE1 . PHE C 1 146 ? 4.978   -17.595 69.390  1.00 39.88  ? 146 PHE H CE1 1 
ATOM 4267 C CE2 . PHE C 1 146 ? 5.795   -18.880 67.550  1.00 41.89  ? 146 PHE H CE2 1 
ATOM 4268 C CZ  . PHE C 1 146 ? 4.860   -18.675 68.544  1.00 39.17  ? 146 PHE H CZ  1 
ATOM 4269 N N   . PRO C 1 147 ? 5.392   -14.134 67.518  1.00 36.38  ? 147 PRO H N   1 
ATOM 4270 C CA  . PRO C 1 147 ? 5.177   -14.849 66.260  1.00 38.37  ? 147 PRO H CA  1 
ATOM 4271 C C   . PRO C 1 147 ? 5.156   -13.894 65.066  1.00 42.20  ? 147 PRO H C   1 
ATOM 4272 O O   . PRO C 1 147 ? 5.460   -12.709 65.221  1.00 49.76  ? 147 PRO H O   1 
ATOM 4273 C CB  . PRO C 1 147 ? 3.818   -15.504 66.476  1.00 26.53  ? 147 PRO H CB  1 
ATOM 4274 C CG  . PRO C 1 147 ? 3.078   -14.481 67.261  1.00 26.73  ? 147 PRO H CG  1 
ATOM 4275 C CD  . PRO C 1 147 ? 4.108   -13.817 68.171  1.00 27.09  ? 147 PRO H CD  1 
ATOM 4276 N N   . GLU C 1 148 ? 4.826   -14.421 63.890  1.00 26.15  ? 148 GLU H N   1 
ATOM 4277 C CA  . GLU C 1 148 ? 4.655   -13.620 62.682  1.00 25.87  ? 148 GLU H CA  1 
ATOM 4278 C C   . GLU C 1 148 ? 3.453   -12.670 62.814  1.00 51.82  ? 148 GLU H C   1 
ATOM 4279 O O   . GLU C 1 148 ? 2.629   -12.838 63.712  1.00 55.30  ? 148 GLU H O   1 
ATOM 4280 C CB  . GLU C 1 148 ? 4.474   -14.537 61.466  1.00 25.56  ? 148 GLU H CB  1 
ATOM 4281 C CG  . GLU C 1 148 ? 5.707   -15.313 61.035  1.00 33.40  ? 148 GLU H CG  1 
ATOM 4282 C CD  . GLU C 1 148 ? 5.756   -15.486 59.528  1.00 35.52  ? 148 GLU H CD  1 
ATOM 4283 O OE1 . GLU C 1 148 ? 5.863   -14.458 58.828  1.00 32.32  ? 148 GLU H OE1 1 
ATOM 4284 O OE2 . GLU C 1 148 ? 5.679   -16.635 59.041  1.00 39.55  ? 148 GLU H OE2 1 
ATOM 4285 N N   . PRO C 1 149 ? 3.344   -11.664 61.926  1.00 47.64  ? 149 PRO H N   1 
ATOM 4286 C CA  . PRO C 1 149 ? 4.285   -11.229 60.891  1.00 36.01  ? 149 PRO H CA  1 
ATOM 4287 C C   . PRO C 1 149 ? 5.203   -10.097 61.347  1.00 39.33  ? 149 PRO H C   1 
ATOM 4288 O O   . PRO C 1 149 ? 5.096   -9.629  62.481  1.00 36.71  ? 149 PRO H O   1 
ATOM 4289 C CB  . PRO C 1 149 ? 3.352   -10.773 59.769  1.00 38.22  ? 149 PRO H CB  1 
ATOM 4290 C CG  . PRO C 1 149 ? 2.191   -10.182 60.503  1.00 36.25  ? 149 PRO H CG  1 
ATOM 4291 C CD  . PRO C 1 149 ? 2.064   -10.939 61.816  1.00 25.27  ? 149 PRO H CD  1 
ATOM 4292 N N   . VAL C 1 150 ? 6.096   -9.673  60.458  1.00 38.58  ? 150 VAL H N   1 
ATOM 4293 C CA  . VAL C 1 150 ? 6.967   -8.529  60.698  1.00 27.07  ? 150 VAL H CA  1 
ATOM 4294 C C   . VAL C 1 150 ? 7.012   -7.654  59.444  1.00 34.62  ? 150 VAL H C   1 
ATOM 4295 O O   . VAL C 1 150 ? 7.234   -8.143  58.336  1.00 36.99  ? 150 VAL H O   1 
ATOM 4296 C CB  . VAL C 1 150 ? 8.398   -8.969  61.112  1.00 27.31  ? 150 VAL H CB  1 
ATOM 4297 C CG1 . VAL C 1 150 ? 8.920   -10.045 60.184  1.00 36.23  ? 150 VAL H CG1 1 
ATOM 4298 C CG2 . VAL C 1 150 ? 9.349   -7.779  61.137  1.00 44.06  ? 150 VAL H CG2 1 
ATOM 4299 N N   . THR C 1 151 ? 6.774   -6.360  59.632  1.00 40.29  ? 151 THR H N   1 
ATOM 4300 C CA  . THR C 1 151 ? 6.731   -5.405  58.532  1.00 41.60  ? 151 THR H CA  1 
ATOM 4301 C C   . THR C 1 151 ? 8.070   -4.700  58.362  1.00 40.68  ? 151 THR H C   1 
ATOM 4302 O O   . THR C 1 151 ? 8.498   -3.959  59.245  1.00 45.49  ? 151 THR H O   1 
ATOM 4303 C CB  . THR C 1 151 ? 5.638   -4.338  58.755  1.00 48.21  ? 151 THR H CB  1 
ATOM 4304 O OG1 . THR C 1 151 ? 4.402   -4.974  59.106  1.00 37.63  ? 151 THR H OG1 1 
ATOM 4305 C CG2 . THR C 1 151 ? 5.449   -3.488  57.506  1.00 56.19  ? 151 THR H CG2 1 
ATOM 4306 N N   . VAL C 1 152 ? 8.735   -4.925  57.235  1.00 29.13  ? 152 VAL H N   1 
ATOM 4307 C CA  . VAL C 1 152 ? 9.973   -4.210  56.965  1.00 29.68  ? 152 VAL H CA  1 
ATOM 4308 C C   . VAL C 1 152 ? 9.807   -3.237  55.810  1.00 30.01  ? 152 VAL H C   1 
ATOM 4309 O O   . VAL C 1 152 ? 9.453   -3.624  54.696  1.00 29.79  ? 152 VAL H O   1 
ATOM 4310 C CB  . VAL C 1 152 ? 11.138  -5.152  56.644  1.00 29.53  ? 152 VAL H CB  1 
ATOM 4311 C CG1 . VAL C 1 152 ? 12.416  -4.339  56.487  1.00 30.25  ? 152 VAL H CG1 1 
ATOM 4312 C CG2 . VAL C 1 152 ? 11.295  -6.191  57.737  1.00 29.39  ? 152 VAL H CG2 1 
ATOM 4313 N N   . SER C 1 153 ? 10.066  -1.967  56.095  1.00 31.38  ? 153 SER H N   1 
ATOM 4314 C CA  . SER C 1 153 ? 10.009  -0.916  55.093  1.00 39.76  ? 153 SER H CA  1 
ATOM 4315 C C   . SER C 1 153 ? 11.404  -0.323  54.954  1.00 37.80  ? 153 SER H C   1 
ATOM 4316 O O   . SER C 1 153 ? 12.329  -0.768  55.628  1.00 33.00  ? 153 SER H O   1 
ATOM 4317 C CB  . SER C 1 153 ? 8.992   0.151   55.494  1.00 49.37  ? 153 SER H CB  1 
ATOM 4318 O OG  . SER C 1 153 ? 7.790   -0.450  55.951  1.00 55.10  ? 153 SER H OG  1 
ATOM 4319 N N   . TRP C 1 154 ? 11.566  0.672   54.089  1.00 45.48  ? 154 TRP H N   1 
ATOM 4320 C CA  . TRP C 1 154 ? 12.861  1.334   53.959  1.00 48.04  ? 154 TRP H CA  1 
ATOM 4321 C C   . TRP C 1 154 ? 12.722  2.842   53.820  1.00 43.96  ? 154 TRP H C   1 
ATOM 4322 O O   . TRP C 1 154 ? 11.986  3.340   52.962  1.00 36.56  ? 154 TRP H O   1 
ATOM 4323 C CB  . TRP C 1 154 ? 13.643  0.764   52.777  1.00 42.50  ? 154 TRP H CB  1 
ATOM 4324 C CG  . TRP C 1 154 ? 14.160  -0.618  53.035  1.00 36.99  ? 154 TRP H CG  1 
ATOM 4325 C CD1 . TRP C 1 154 ? 13.466  -1.787  52.918  1.00 33.10  ? 154 TRP H CD1 1 
ATOM 4326 C CD2 . TRP C 1 154 ? 15.477  -0.974  53.474  1.00 38.88  ? 154 TRP H CD2 1 
ATOM 4327 N NE1 . TRP C 1 154 ? 14.270  -2.849  53.251  1.00 32.49  ? 154 TRP H NE1 1 
ATOM 4328 C CE2 . TRP C 1 154 ? 15.508  -2.379  53.595  1.00 37.50  ? 154 TRP H CE2 1 
ATOM 4329 C CE3 . TRP C 1 154 ? 16.630  -0.245  53.773  1.00 33.07  ? 154 TRP H CE3 1 
ATOM 4330 C CZ2 . TRP C 1 154 ? 16.650  -3.068  54.002  1.00 31.50  ? 154 TRP H CZ2 1 
ATOM 4331 C CZ3 . TRP C 1 154 ? 17.763  -0.932  54.177  1.00 33.29  ? 154 TRP H CZ3 1 
ATOM 4332 C CH2 . TRP C 1 154 ? 17.763  -2.329  54.287  1.00 32.50  ? 154 TRP H CH2 1 
ATOM 4333 N N   . ASN C 1 155 ? 13.447  3.554   54.680  1.00 47.32  ? 155 ASN H N   1 
ATOM 4334 C CA  . ASN C 1 155 ? 13.359  5.004   54.784  1.00 54.53  ? 155 ASN H CA  1 
ATOM 4335 C C   . ASN C 1 155 ? 11.909  5.405   55.000  1.00 60.68  ? 155 ASN H C   1 
ATOM 4336 O O   . ASN C 1 155 ? 11.386  6.313   54.354  1.00 70.00  ? 155 ASN H O   1 
ATOM 4337 C CB  . ASN C 1 155 ? 13.966  5.651   53.544  1.00 43.12  ? 155 ASN H CB  1 
ATOM 4338 C CG  . ASN C 1 155 ? 15.439  5.296   53.386  1.00 43.02  ? 155 ASN H CG  1 
ATOM 4339 O OD1 . ASN C 1 155 ? 16.169  5.213   54.373  1.00 40.57  ? 155 ASN H OD1 1 
ATOM 4340 N ND2 . ASN C 1 155 ? 15.871  5.047   52.156  1.00 44.69  ? 155 ASN H ND2 1 
ATOM 4341 N N   . SER C 1 156 ? 11.278  4.688   55.930  1.00 63.91  ? 156 SER H N   1 
ATOM 4342 C CA  . SER C 1 156 ? 9.848   4.785   56.209  1.00 58.46  ? 156 SER H CA  1 
ATOM 4343 C C   . SER C 1 156 ? 9.036   4.789   54.928  1.00 44.22  ? 156 SER H C   1 
ATOM 4344 O O   . SER C 1 156 ? 8.339   5.749   54.653  1.00 45.00  ? 156 SER H O   1 
ATOM 4345 C CB  . SER C 1 156 ? 9.524   6.047   57.028  1.00 60.49  ? 156 SER H CB  1 
ATOM 4346 O OG  . SER C 1 156 ? 9.591   5.817   58.426  1.00 64.80  ? 156 SER H OG  1 
ATOM 4347 N N   . GLY C 1 157 ? 9.133   3.718   54.147  1.00 40.83  ? 157 GLY H N   1 
ATOM 4348 C CA  . GLY C 1 157 ? 8.325   3.577   52.947  1.00 39.07  ? 157 GLY H CA  1 
ATOM 4349 C C   . GLY C 1 157 ? 8.741   4.396   51.730  1.00 40.39  ? 157 GLY H C   1 
ATOM 4350 O O   . GLY C 1 157 ? 8.277   4.123   50.621  1.00 40.07  ? 157 GLY H O   1 
ATOM 4351 N N   . ALA C 1 158 ? 9.614   5.384   51.916  1.00 44.35  ? 158 ALA H N   1 
ATOM 4352 C CA  . ALA C 1 158 ? 10.049  6.225   50.799  1.00 42.82  ? 158 ALA H CA  1 
ATOM 4353 C C   . ALA C 1 158 ? 10.705  5.376   49.717  1.00 41.24  ? 158 ALA H C   1 
ATOM 4354 O O   . ALA C 1 158 ? 10.498  5.594   48.525  1.00 37.45  ? 158 ALA H O   1 
ATOM 4355 C CB  . ALA C 1 158 ? 11.005  7.308   51.278  1.00 44.62  ? 158 ALA H CB  1 
ATOM 4356 N N   . LEU C 1 159 ? 11.495  4.401   50.151  1.00 48.30  ? 159 LEU H N   1 
ATOM 4357 C CA  . LEU C 1 159 ? 12.125  3.452   49.240  1.00 47.00  ? 159 LEU H CA  1 
ATOM 4358 C C   . LEU C 1 159 ? 11.202  2.274   48.957  1.00 54.16  ? 159 LEU H C   1 
ATOM 4359 O O   . LEU C 1 159 ? 10.726  1.612   49.882  1.00 60.19  ? 159 LEU H O   1 
ATOM 4360 C CB  . LEU C 1 159 ? 13.448  2.952   49.817  1.00 37.95  ? 159 LEU H CB  1 
ATOM 4361 C CG  . LEU C 1 159 ? 14.117  1.839   49.011  1.00 38.07  ? 159 LEU H CG  1 
ATOM 4362 C CD1 . LEU C 1 159 ? 14.403  2.308   47.596  1.00 35.59  ? 159 LEU H CD1 1 
ATOM 4363 C CD2 . LEU C 1 159 ? 15.395  1.370   49.690  1.00 48.32  ? 159 LEU H CD2 1 
ATOM 4364 N N   . THR C 1 160 ? 10.953  2.017   47.676  1.00 49.22  ? 160 THR H N   1 
ATOM 4365 C CA  . THR C 1 160 ? 10.030  0.958   47.283  1.00 47.12  ? 160 THR H CA  1 
ATOM 4366 C C   . THR C 1 160 ? 10.668  -0.106  46.393  1.00 47.71  ? 160 THR H C   1 
ATOM 4367 O O   . THR C 1 160 ? 10.996  -1.188  46.863  1.00 49.84  ? 160 THR H O   1 
ATOM 4368 C CB  . THR C 1 160 ? 8.804   1.535   46.544  1.00 53.63  ? 160 THR H CB  1 
ATOM 4369 O OG1 . THR C 1 160 ? 9.241   2.411   45.498  1.00 61.64  ? 160 THR H OG1 1 
ATOM 4370 C CG2 . THR C 1 160 ? 7.917   2.317   47.509  1.00 49.79  ? 160 THR H CG2 1 
ATOM 4371 N N   . SER C 1 161 ? 10.866  0.208   45.117  1.00 44.93  ? 161 SER H N   1 
ATOM 4372 C CA  . SER C 1 161 ? 11.295  -0.803  44.149  1.00 48.29  ? 161 SER H CA  1 
ATOM 4373 C C   . SER C 1 161 ? 12.697  -1.327  44.456  1.00 30.17  ? 161 SER H C   1 
ATOM 4374 O O   . SER C 1 161 ? 13.542  -0.609  44.989  1.00 30.85  ? 161 SER H O   1 
ATOM 4375 C CB  . SER C 1 161 ? 11.241  -0.245  42.724  1.00 42.23  ? 161 SER H CB  1 
ATOM 4376 O OG  . SER C 1 161 ? 9.941   0.221   42.409  1.00 45.51  ? 161 SER H OG  1 
ATOM 4377 N N   . GLY C 1 162 ? 12.932  -2.591  44.126  1.00 27.68  ? 162 GLY H N   1 
ATOM 4378 C CA  . GLY C 1 162 ? 14.205  -3.225  44.405  1.00 27.76  ? 162 GLY H CA  1 
ATOM 4379 C C   . GLY C 1 162 ? 14.239  -3.940  45.741  1.00 38.24  ? 162 GLY H C   1 
ATOM 4380 O O   . GLY C 1 162 ? 15.159  -4.711  46.004  1.00 35.52  ? 162 GLY H O   1 
ATOM 4381 N N   . VAL C 1 163 ? 13.243  -3.694  46.587  1.00 34.09  ? 163 VAL H N   1 
ATOM 4382 C CA  . VAL C 1 163 ? 13.224  -4.296  47.917  1.00 33.93  ? 163 VAL H CA  1 
ATOM 4383 C C   . VAL C 1 163 ? 12.902  -5.786  47.820  1.00 36.64  ? 163 VAL H C   1 
ATOM 4384 O O   . VAL C 1 163 ? 12.073  -6.202  47.009  1.00 29.07  ? 163 VAL H O   1 
ATOM 4385 C CB  . VAL C 1 163 ? 12.199  -3.604  48.853  1.00 30.22  ? 163 VAL H CB  1 
ATOM 4386 C CG1 . VAL C 1 163 ? 10.761  -3.850  48.384  1.00 37.71  ? 163 VAL H CG1 1 
ATOM 4387 C CG2 . VAL C 1 163 ? 12.392  -4.058  50.297  1.00 30.20  ? 163 VAL H CG2 1 
ATOM 4388 N N   . HIS C 1 164 ? 13.583  -6.596  48.624  1.00 34.52  ? 164 HIS H N   1 
ATOM 4389 C CA  . HIS C 1 164 ? 13.254  -8.011  48.711  1.00 51.14  ? 164 HIS H CA  1 
ATOM 4390 C C   . HIS C 1 164 ? 13.076  -8.423  50.168  1.00 41.27  ? 164 HIS H C   1 
ATOM 4391 O O   . HIS C 1 164 ? 14.029  -8.417  50.948  1.00 48.66  ? 164 HIS H O   1 
ATOM 4392 C CB  . HIS C 1 164 ? 14.336  -8.859  48.037  1.00 22.36  ? 164 HIS H CB  1 
ATOM 4393 C CG  . HIS C 1 164 ? 14.235  -8.891  46.541  1.00 37.68  ? 164 HIS H CG  1 
ATOM 4394 N ND1 . HIS C 1 164 ? 13.241  -9.569  45.876  1.00 36.58  ? 164 HIS H ND1 1 
ATOM 4395 C CD2 . HIS C 1 164 ? 15.007  -8.310  45.591  1.00 40.55  ? 164 HIS H CD2 1 
ATOM 4396 C CE1 . HIS C 1 164 ? 13.410  -9.413  44.567  1.00 43.50  ? 164 HIS H CE1 1 
ATOM 4397 N NE2 . HIS C 1 164 ? 14.466  -8.658  44.374  1.00 47.61  ? 164 HIS H NE2 1 
ATOM 4398 N N   . THR C 1 165 ? 11.851  -8.782  50.530  1.00 28.30  ? 165 THR H N   1 
ATOM 4399 C CA  . THR C 1 165 ? 11.591  -9.309  51.860  1.00 36.64  ? 165 THR H CA  1 
ATOM 4400 C C   . THR C 1 165 ? 11.308  -10.796 51.760  1.00 39.11  ? 165 THR H C   1 
ATOM 4401 O O   . THR C 1 165 ? 10.326  -11.216 51.147  1.00 27.49  ? 165 THR H O   1 
ATOM 4402 C CB  . THR C 1 165 ? 10.415  -8.611  52.547  1.00 38.31  ? 165 THR H CB  1 
ATOM 4403 O OG1 . THR C 1 165 ? 10.796  -7.277  52.905  1.00 28.76  ? 165 THR H OG1 1 
ATOM 4404 C CG2 . THR C 1 165 ? 10.027  -9.372  53.808  1.00 35.00  ? 165 THR H CG2 1 
ATOM 4405 N N   . PHE C 1 166 ? 12.181  -11.589 52.364  1.00 38.02  ? 166 PHE H N   1 
ATOM 4406 C CA  . PHE C 1 166 ? 12.092  -13.037 52.273  1.00 25.76  ? 166 PHE H CA  1 
ATOM 4407 C C   . PHE C 1 166 ? 11.102  -13.585 53.293  1.00 25.60  ? 166 PHE H C   1 
ATOM 4408 O O   . PHE C 1 166 ? 10.936  -13.008 54.367  1.00 27.48  ? 166 PHE H O   1 
ATOM 4409 C CB  . PHE C 1 166 ? 13.481  -13.654 52.465  1.00 26.10  ? 166 PHE H CB  1 
ATOM 4410 C CG  . PHE C 1 166 ? 14.427  -13.382 51.325  1.00 26.27  ? 166 PHE H CG  1 
ATOM 4411 C CD1 . PHE C 1 166 ? 14.512  -14.256 50.255  1.00 26.10  ? 166 PHE H CD1 1 
ATOM 4412 C CD2 . PHE C 1 166 ? 15.229  -12.251 51.322  1.00 41.57  ? 166 PHE H CD2 1 
ATOM 4413 C CE1 . PHE C 1 166 ? 15.380  -14.011 49.207  1.00 26.29  ? 166 PHE H CE1 1 
ATOM 4414 C CE2 . PHE C 1 166 ? 16.097  -11.999 50.273  1.00 34.39  ? 166 PHE H CE2 1 
ATOM 4415 C CZ  . PHE C 1 166 ? 16.171  -12.881 49.214  1.00 33.21  ? 166 PHE H CZ  1 
ATOM 4416 N N   . PRO C 1 167 ? 10.420  -14.688 52.944  1.00 34.24  ? 167 PRO H N   1 
ATOM 4417 C CA  . PRO C 1 167 ? 9.504   -15.339 53.884  1.00 24.13  ? 167 PRO H CA  1 
ATOM 4418 C C   . PRO C 1 167 ? 10.189  -15.693 55.195  1.00 27.02  ? 167 PRO H C   1 
ATOM 4419 O O   . PRO C 1 167 ? 11.379  -15.996 55.211  1.00 24.70  ? 167 PRO H O   1 
ATOM 4420 C CB  . PRO C 1 167 ? 9.077   -16.606 53.138  1.00 24.00  ? 167 PRO H CB  1 
ATOM 4421 C CG  . PRO C 1 167 ? 9.198   -16.247 51.702  1.00 23.85  ? 167 PRO H CG  1 
ATOM 4422 C CD  . PRO C 1 167 ? 10.387  -15.325 51.615  1.00 24.02  ? 167 PRO H CD  1 
ATOM 4423 N N   . ALA C 1 168 ? 9.436   -15.646 56.285  1.00 25.73  ? 168 ALA H N   1 
ATOM 4424 C CA  . ALA C 1 168 ? 9.964   -16.007 57.589  1.00 26.06  ? 168 ALA H CA  1 
ATOM 4425 C C   . ALA C 1 168 ? 10.270  -17.492 57.619  1.00 40.69  ? 168 ALA H C   1 
ATOM 4426 O O   . ALA C 1 168 ? 9.738   -18.261 56.818  1.00 46.17  ? 168 ALA H O   1 
ATOM 4427 C CB  . ALA C 1 168 ? 8.983   -15.652 58.676  1.00 51.21  ? 168 ALA H CB  1 
ATOM 4428 N N   . VAL C 1 169 ? 11.125  -17.905 58.543  1.00 37.67  ? 169 VAL H N   1 
ATOM 4429 C CA  . VAL C 1 169 ? 11.425  -19.319 58.672  1.00 40.96  ? 169 VAL H CA  1 
ATOM 4430 C C   . VAL C 1 169 ? 11.409  -19.715 60.143  1.00 36.22  ? 169 VAL H C   1 
ATOM 4431 O O   . VAL C 1 169 ? 11.811  -18.936 61.006  1.00 38.00  ? 169 VAL H O   1 
ATOM 4432 C CB  . VAL C 1 169 ? 12.779  -19.664 58.006  1.00 26.09  ? 169 VAL H CB  1 
ATOM 4433 C CG1 . VAL C 1 169 ? 13.938  -19.066 58.782  1.00 26.54  ? 169 VAL H CG1 1 
ATOM 4434 C CG2 . VAL C 1 169 ? 12.944  -21.174 57.871  1.00 34.78  ? 169 VAL H CG2 1 
ATOM 4435 N N   . LEU C 1 170 ? 10.934  -20.920 60.433  1.00 33.12  ? 170 LEU H N   1 
ATOM 4436 C CA  . LEU C 1 170 ? 10.833  -21.337 61.817  1.00 36.33  ? 170 LEU H CA  1 
ATOM 4437 C C   . LEU C 1 170 ? 12.145  -22.013 62.167  1.00 26.95  ? 170 LEU H C   1 
ATOM 4438 O O   . LEU C 1 170 ? 12.429  -23.130 61.734  1.00 27.19  ? 170 LEU H O   1 
ATOM 4439 C CB  . LEU C 1 170 ? 9.640   -22.279 62.024  1.00 37.47  ? 170 LEU H CB  1 
ATOM 4440 C CG  . LEU C 1 170 ? 9.332   -22.797 63.434  1.00 26.84  ? 170 LEU H CG  1 
ATOM 4441 C CD1 . LEU C 1 170 ? 8.524   -21.803 64.278  1.00 44.97  ? 170 LEU H CD1 1 
ATOM 4442 C CD2 . LEU C 1 170 ? 8.618   -24.139 63.338  1.00 27.10  ? 170 LEU H CD2 1 
ATOM 4443 N N   . GLN C 1 171 ? 12.941  -21.321 62.973  1.00 34.16  ? 171 GLN H N   1 
ATOM 4444 C CA  . GLN C 1 171 ? 14.242  -21.827 63.381  1.00 29.38  ? 171 GLN H CA  1 
ATOM 4445 C C   . GLN C 1 171 ? 14.045  -22.881 64.456  1.00 33.13  ? 171 GLN H C   1 
ATOM 4446 O O   . GLN C 1 171 ? 12.986  -22.947 65.087  1.00 32.89  ? 171 GLN H O   1 
ATOM 4447 C CB  . GLN C 1 171 ? 15.159  -20.697 63.881  1.00 36.76  ? 171 GLN H CB  1 
ATOM 4448 C CG  . GLN C 1 171 ? 15.069  -19.388 63.101  1.00 39.07  ? 171 GLN H CG  1 
ATOM 4449 C CD  . GLN C 1 171 ? 15.903  -18.276 63.722  1.00 48.03  ? 171 GLN H CD  1 
ATOM 4450 O OE1 . GLN C 1 171 ? 17.118  -18.200 63.524  1.00 45.98  ? 171 GLN H OE1 1 
ATOM 4451 N NE2 . GLN C 1 171 ? 15.249  -17.414 64.495  1.00 51.66  ? 171 GLN H NE2 1 
ATOM 4452 N N   . SER C 1 172 ? 15.068  -23.705 64.655  1.00 41.04  ? 172 SER H N   1 
ATOM 4453 C CA  . SER C 1 172 ? 15.044  -24.733 65.686  1.00 42.64  ? 172 SER H CA  1 
ATOM 4454 C C   . SER C 1 172 ? 14.664  -24.156 67.052  1.00 46.68  ? 172 SER H C   1 
ATOM 4455 O O   . SER C 1 172 ? 14.082  -24.848 67.885  1.00 45.66  ? 172 SER H O   1 
ATOM 4456 C CB  . SER C 1 172 ? 16.406  -25.426 65.765  1.00 50.87  ? 172 SER H CB  1 
ATOM 4457 O OG  . SER C 1 172 ? 17.449  -24.478 65.925  1.00 54.36  ? 172 SER H OG  1 
ATOM 4458 N N   . SER C 1 173 ? 14.975  -22.881 67.267  1.00 33.96  ? 173 SER H N   1 
ATOM 4459 C CA  . SER C 1 173 ? 14.627  -22.200 68.508  1.00 28.01  ? 173 SER H CA  1 
ATOM 4460 C C   . SER C 1 173 ? 13.118  -22.119 68.730  1.00 33.31  ? 173 SER H C   1 
ATOM 4461 O O   . SER C 1 173 ? 12.662  -21.857 69.841  1.00 27.71  ? 173 SER H O   1 
ATOM 4462 C CB  . SER C 1 173 ? 15.225  -20.791 68.525  1.00 27.99  ? 173 SER H CB  1 
ATOM 4463 O OG  . SER C 1 173 ? 14.791  -20.035 67.408  1.00 27.28  ? 173 SER H OG  1 
ATOM 4464 N N   . GLY C 1 174 ? 12.345  -22.347 67.674  1.00 35.20  ? 174 GLY H N   1 
ATOM 4465 C CA  . GLY C 1 174 ? 10.912  -22.134 67.735  1.00 26.53  ? 174 GLY H CA  1 
ATOM 4466 C C   . GLY C 1 174 ? 10.611  -20.672 67.469  1.00 40.16  ? 174 GLY H C   1 
ATOM 4467 O O   . GLY C 1 174 ? 9.460   -20.245 67.488  1.00 47.31  ? 174 GLY H O   1 
ATOM 4468 N N   . LEU C 1 175 ? 11.669  -19.905 67.221  1.00 35.11  ? 175 LEU H N   1 
ATOM 4469 C CA  . LEU C 1 175 ? 11.560  -18.488 66.894  1.00 23.85  ? 175 LEU H CA  1 
ATOM 4470 C C   . LEU C 1 175 ? 11.731  -18.294 65.394  1.00 32.34  ? 175 LEU H C   1 
ATOM 4471 O O   . LEU C 1 175 ? 12.507  -19.009 64.765  1.00 23.50  ? 175 LEU H O   1 
ATOM 4472 C CB  . LEU C 1 175 ? 12.614  -17.679 67.657  1.00 24.40  ? 175 LEU H CB  1 
ATOM 4473 C CG  . LEU C 1 175 ? 12.477  -17.620 69.181  1.00 24.91  ? 175 LEU H CG  1 
ATOM 4474 C CD1 . LEU C 1 175 ? 13.748  -17.087 69.815  1.00 25.62  ? 175 LEU H CD1 1 
ATOM 4475 C CD2 . LEU C 1 175 ? 11.294  -16.755 69.562  1.00 25.33  ? 175 LEU H CD2 1 
ATOM 4476 N N   . TYR C 1 176 ? 11.003  -17.347 64.811  1.00 37.79  ? 176 TYR H N   1 
ATOM 4477 C CA  . TYR C 1 176 ? 11.207  -17.052 63.399  1.00 26.04  ? 176 TYR H CA  1 
ATOM 4478 C C   . TYR C 1 176 ? 12.403  -16.130 63.211  1.00 26.32  ? 176 TYR H C   1 
ATOM 4479 O O   . TYR C 1 176 ? 13.005  -15.681 64.185  1.00 33.53  ? 176 TYR H O   1 
ATOM 4480 C CB  . TYR C 1 176 ? 9.970   -16.409 62.772  1.00 39.54  ? 176 TYR H CB  1 
ATOM 4481 C CG  . TYR C 1 176 ? 8.692   -17.194 62.936  1.00 35.93  ? 176 TYR H CG  1 
ATOM 4482 C CD1 . TYR C 1 176 ? 8.433   -18.315 62.158  1.00 25.19  ? 176 TYR H CD1 1 
ATOM 4483 C CD2 . TYR C 1 176 ? 7.740   -16.806 63.865  1.00 25.40  ? 176 TYR H CD2 1 
ATOM 4484 C CE1 . TYR C 1 176 ? 7.262   -19.030 62.307  1.00 25.14  ? 176 TYR H CE1 1 
ATOM 4485 C CE2 . TYR C 1 176 ? 6.567   -17.512 64.021  1.00 47.23  ? 176 TYR H CE2 1 
ATOM 4486 C CZ  . TYR C 1 176 ? 6.331   -18.622 63.242  1.00 54.46  ? 176 TYR H CZ  1 
ATOM 4487 O OH  . TYR C 1 176 ? 5.157   -19.318 63.404  1.00 65.24  ? 176 TYR H OH  1 
ATOM 4488 N N   . SER C 1 177 ? 12.710  -15.842 61.947  1.00 36.76  ? 177 SER H N   1 
ATOM 4489 C CA  . SER C 1 177 ? 13.698  -14.839 61.555  1.00 39.43  ? 177 SER H CA  1 
ATOM 4490 C C   . SER C 1 177 ? 13.727  -14.743 60.031  1.00 41.45  ? 177 SER H C   1 
ATOM 4491 O O   . SER C 1 177 ? 13.319  -15.676 59.336  1.00 46.59  ? 177 SER H O   1 
ATOM 4492 C CB  . SER C 1 177 ? 15.096  -15.174 62.097  1.00 23.52  ? 177 SER H CB  1 
ATOM 4493 O OG  . SER C 1 177 ? 15.661  -16.295 61.442  1.00 23.53  ? 177 SER H OG  1 
ATOM 4494 N N   . LEU C 1 178 ? 14.232  -13.623 59.520  1.00 42.33  ? 178 LEU H N   1 
ATOM 4495 C CA  . LEU C 1 178 ? 14.270  -13.384 58.082  1.00 41.99  ? 178 LEU H CA  1 
ATOM 4496 C C   . LEU C 1 178 ? 15.175  -12.211 57.750  1.00 41.42  ? 178 LEU H C   1 
ATOM 4497 O O   . LEU C 1 178 ? 15.715  -11.548 58.636  1.00 29.30  ? 178 LEU H O   1 
ATOM 4498 C CB  . LEU C 1 178 ? 12.851  -13.148 57.532  1.00 27.75  ? 178 LEU H CB  1 
ATOM 4499 C CG  . LEU C 1 178 ? 12.083  -11.840 57.762  1.00 27.74  ? 178 LEU H CG  1 
ATOM 4500 C CD1 . LEU C 1 178 ? 12.342  -10.783 56.681  1.00 27.79  ? 178 LEU H CD1 1 
ATOM 4501 C CD2 . LEU C 1 178 ? 10.601  -12.154 57.864  1.00 50.62  ? 178 LEU H CD2 1 
ATOM 4502 N N   . SER C 1 179 ? 15.334  -11.965 56.457  1.00 43.89  ? 179 SER H N   1 
ATOM 4503 C CA  . SER C 1 179 ? 16.191  -10.897 55.988  1.00 37.32  ? 179 SER H CA  1 
ATOM 4504 C C   . SER C 1 179 ? 15.449  -10.048 54.969  1.00 39.41  ? 179 SER H C   1 
ATOM 4505 O O   . SER C 1 179 ? 14.753  -10.568 54.101  1.00 29.14  ? 179 SER H O   1 
ATOM 4506 C CB  . SER C 1 179 ? 17.480  -11.462 55.381  1.00 30.33  ? 179 SER H CB  1 
ATOM 4507 O OG  . SER C 1 179 ? 17.980  -12.545 56.148  1.00 30.54  ? 179 SER H OG  1 
ATOM 4508 N N   . SER C 1 180 ? 15.580  -8.736  55.107  1.00 40.75  ? 180 SER H N   1 
ATOM 4509 C CA  . SER C 1 180 ? 15.091  -7.803  54.107  1.00 40.96  ? 180 SER H CA  1 
ATOM 4510 C C   . SER C 1 180 ? 16.284  -7.144  53.450  1.00 45.17  ? 180 SER H C   1 
ATOM 4511 O O   . SER C 1 180 ? 17.135  -6.595  54.137  1.00 51.76  ? 180 SER H O   1 
ATOM 4512 C CB  . SER C 1 180 ? 14.179  -6.754  54.731  1.00 46.70  ? 180 SER H CB  1 
ATOM 4513 O OG  . SER C 1 180 ? 13.897  -5.719  53.806  1.00 29.53  ? 180 SER H OG  1 
ATOM 4514 N N   . VAL C 1 181 ? 16.341  -7.206  52.122  1.00 42.78  ? 181 VAL H N   1 
ATOM 4515 C CA  . VAL C 1 181 ? 17.466  -6.672  51.354  1.00 30.79  ? 181 VAL H CA  1 
ATOM 4516 C C   . VAL C 1 181 ? 16.995  -5.805  50.188  1.00 30.75  ? 181 VAL H C   1 
ATOM 4517 O O   . VAL C 1 181 ? 15.889  -5.992  49.678  1.00 33.70  ? 181 VAL H O   1 
ATOM 4518 C CB  . VAL C 1 181 ? 18.341  -7.799  50.785  1.00 30.71  ? 181 VAL H CB  1 
ATOM 4519 C CG1 . VAL C 1 181 ? 18.841  -8.716  51.892  1.00 31.98  ? 181 VAL H CG1 1 
ATOM 4520 C CG2 . VAL C 1 181 ? 17.541  -8.593  49.771  1.00 29.94  ? 181 VAL H CG2 1 
ATOM 4521 N N   . VAL C 1 182 ? 17.816  -4.844  49.779  1.00 28.88  ? 182 VAL H N   1 
ATOM 4522 C CA  . VAL C 1 182 ? 17.502  -4.068  48.585  1.00 34.69  ? 182 VAL H CA  1 
ATOM 4523 C C   . VAL C 1 182 ? 18.754  -3.726  47.773  1.00 38.25  ? 182 VAL H C   1 
ATOM 4524 O O   . VAL C 1 182 ? 19.757  -3.279  48.329  1.00 42.62  ? 182 VAL H O   1 
ATOM 4525 C CB  . VAL C 1 182 ? 16.719  -2.767  48.945  1.00 40.31  ? 182 VAL H CB  1 
ATOM 4526 C CG1 . VAL C 1 182 ? 17.441  -1.958  50.009  1.00 33.91  ? 182 VAL H CG1 1 
ATOM 4527 C CG2 . VAL C 1 182 ? 16.492  -1.918  47.694  1.00 46.85  ? 182 VAL H CG2 1 
ATOM 4528 N N   . THR C 1 183 ? 18.692  -3.946  46.460  1.00 31.68  ? 183 THR H N   1 
ATOM 4529 C CA  . THR C 1 183 ? 19.777  -3.536  45.573  1.00 32.35  ? 183 THR H CA  1 
ATOM 4530 C C   . THR C 1 183 ? 19.645  -2.046  45.266  1.00 39.38  ? 183 THR H C   1 
ATOM 4531 O O   . THR C 1 183 ? 18.582  -1.583  44.851  1.00 34.78  ? 183 THR H O   1 
ATOM 4532 C CB  . THR C 1 183 ? 19.803  -4.338  44.239  1.00 47.33  ? 183 THR H CB  1 
ATOM 4533 O OG1 . THR C 1 183 ? 18.477  -4.466  43.708  1.00 45.95  ? 183 THR H OG1 1 
ATOM 4534 C CG2 . THR C 1 183 ? 20.408  -5.723  44.438  1.00 45.08  ? 183 THR H CG2 1 
ATOM 4535 N N   . VAL C 1 184 ? 20.725  -1.303  45.486  1.00 42.80  ? 184 VAL H N   1 
ATOM 4536 C CA  . VAL C 1 184 ? 20.758  0.135   45.231  1.00 44.24  ? 184 VAL H CA  1 
ATOM 4537 C C   . VAL C 1 184 ? 21.966  0.442   44.348  1.00 48.63  ? 184 VAL H C   1 
ATOM 4538 O O   . VAL C 1 184 ? 22.925  -0.327  44.351  1.00 50.42  ? 184 VAL H O   1 
ATOM 4539 C CB  . VAL C 1 184 ? 20.835  0.950   46.555  1.00 41.90  ? 184 VAL H CB  1 
ATOM 4540 C CG1 . VAL C 1 184 ? 19.565  0.770   47.372  1.00 44.29  ? 184 VAL H CG1 1 
ATOM 4541 C CG2 . VAL C 1 184 ? 22.060  0.561   47.367  1.00 43.20  ? 184 VAL H CG2 1 
ATOM 4542 N N   . PRO C 1 185 ? 21.925  1.553   43.586  1.00 52.80  ? 185 PRO H N   1 
ATOM 4543 C CA  . PRO C 1 185 ? 23.096  1.897   42.767  1.00 52.00  ? 185 PRO H CA  1 
ATOM 4544 C C   . PRO C 1 185 ? 24.369  1.944   43.613  1.00 59.06  ? 185 PRO H C   1 
ATOM 4545 O O   . PRO C 1 185 ? 24.344  2.510   44.708  1.00 53.69  ? 185 PRO H O   1 
ATOM 4546 C CB  . PRO C 1 185 ? 22.736  3.281   42.192  1.00 48.43  ? 185 PRO H CB  1 
ATOM 4547 C CG  . PRO C 1 185 ? 21.642  3.802   43.090  1.00 46.92  ? 185 PRO H CG  1 
ATOM 4548 C CD  . PRO C 1 185 ? 20.871  2.577   43.485  1.00 46.39  ? 185 PRO H CD  1 
ATOM 4549 N N   . SER C 1 186 ? 25.443  1.325   43.123  1.00 58.04  ? 186 SER H N   1 
ATOM 4550 C CA  . SER C 1 186 ? 26.682  1.180   43.890  1.00 57.75  ? 186 SER H CA  1 
ATOM 4551 C C   . SER C 1 186 ? 27.170  2.482   44.512  1.00 60.89  ? 186 SER H C   1 
ATOM 4552 O O   . SER C 1 186 ? 27.212  2.621   45.722  1.00 66.69  ? 186 SER H O   1 
ATOM 4553 C CB  . SER C 1 186 ? 27.789  0.613   43.010  1.00 52.02  ? 186 SER H CB  1 
ATOM 4554 O OG  . SER C 1 186 ? 28.974  0.434   43.758  1.00 48.97  ? 186 SER H OG  1 
ATOM 4555 N N   . SER C 1 187 ? 27.502  3.449   43.669  1.00 58.37  ? 187 SER H N   1 
ATOM 4556 C CA  . SER C 1 187 ? 28.116  4.700   44.117  1.00 58.05  ? 187 SER H CA  1 
ATOM 4557 C C   . SER C 1 187 ? 27.200  5.560   45.002  1.00 59.63  ? 187 SER H C   1 
ATOM 4558 O O   . SER C 1 187 ? 27.623  6.599   45.505  1.00 59.05  ? 187 SER H O   1 
ATOM 4559 C CB  . SER C 1 187 ? 28.606  5.508   42.907  1.00 56.11  ? 187 SER H CB  1 
ATOM 4560 O OG  . SER C 1 187 ? 27.695  5.420   41.825  1.00 55.10  ? 187 SER H OG  1 
ATOM 4561 N N   . SER C 1 188 ? 25.958  5.124   45.198  1.00 63.03  ? 188 SER H N   1 
ATOM 4562 C CA  . SER C 1 188 ? 24.999  5.852   46.029  1.00 60.54  ? 188 SER H CA  1 
ATOM 4563 C C   . SER C 1 188 ? 25.195  5.568   47.521  1.00 60.94  ? 188 SER H C   1 
ATOM 4564 O O   . SER C 1 188 ? 24.411  6.024   48.353  1.00 60.10  ? 188 SER H O   1 
ATOM 4565 C CB  . SER C 1 188 ? 23.562  5.516   45.614  1.00 56.00  ? 188 SER H CB  1 
ATOM 4566 O OG  . SER C 1 188 ? 23.224  4.179   45.928  1.00 52.90  ? 188 SER H OG  1 
ATOM 4567 N N   . LEU C 1 189 ? 26.238  4.807   47.845  1.00 67.82  ? 189 LEU H N   1 
ATOM 4568 C CA  . LEU C 1 189 ? 26.576  4.474   49.230  1.00 68.14  ? 189 LEU H CA  1 
ATOM 4569 C C   . LEU C 1 189 ? 27.029  5.675   50.075  1.00 70.64  ? 189 LEU H C   1 
ATOM 4570 O O   . LEU C 1 189 ? 26.621  5.817   51.230  1.00 72.80  ? 189 LEU H O   1 
ATOM 4571 C CB  . LEU C 1 189 ? 27.666  3.398   49.248  1.00 67.38  ? 189 LEU H CB  1 
ATOM 4572 C CG  . LEU C 1 189 ? 27.232  2.056   48.655  1.00 59.63  ? 189 LEU H CG  1 
ATOM 4573 C CD1 . LEU C 1 189 ? 28.418  1.127   48.415  1.00 56.92  ? 189 LEU H CD1 1 
ATOM 4574 C CD2 . LEU C 1 189 ? 26.182  1.391   49.530  1.00 56.21  ? 189 LEU H CD2 1 
ATOM 4575 N N   . GLY C 1 190 ? 27.876  6.532   49.510  1.00 59.89  ? 190 GLY H N   1 
ATOM 4576 C CA  . GLY C 1 190 ? 28.405  7.669   50.247  1.00 59.05  ? 190 GLY H CA  1 
ATOM 4577 C C   . GLY C 1 190 ? 27.495  8.882   50.204  1.00 54.88  ? 190 GLY H C   1 
ATOM 4578 O O   . GLY C 1 190 ? 27.669  9.838   50.963  1.00 57.31  ? 190 GLY H O   1 
ATOM 4579 N N   . THR C 1 191 ? 26.517  8.837   49.308  1.00 61.16  ? 191 THR H N   1 
ATOM 4580 C CA  . THR C 1 191 ? 25.580  9.936   49.132  1.00 63.59  ? 191 THR H CA  1 
ATOM 4581 C C   . THR C 1 191 ? 24.298  9.723   49.939  1.00 63.39  ? 191 THR H C   1 
ATOM 4582 O O   . THR C 1 191 ? 23.964  10.527  50.808  1.00 65.47  ? 191 THR H O   1 
ATOM 4583 C CB  . THR C 1 191 ? 25.229  10.134  47.648  1.00 62.08  ? 191 THR H CB  1 
ATOM 4584 O OG1 . THR C 1 191 ? 24.850  8.878   47.073  1.00 68.68  ? 191 THR H OG1 1 
ATOM 4585 C CG2 . THR C 1 191 ? 26.431  10.680  46.894  1.00 61.57  ? 191 THR H CG2 1 
ATOM 4586 N N   . GLN C 1 192 ? 23.573  8.653   49.631  1.00 60.51  ? 192 GLN H N   1 
ATOM 4587 C CA  . GLN C 1 192 ? 22.286  8.390   50.270  1.00 57.95  ? 192 GLN H CA  1 
ATOM 4588 C C   . GLN C 1 192 ? 22.389  7.416   51.448  1.00 60.62  ? 192 GLN H C   1 
ATOM 4589 O O   . GLN C 1 192 ? 23.146  6.444   51.404  1.00 61.23  ? 192 GLN H O   1 
ATOM 4590 C CB  . GLN C 1 192 ? 21.293  7.861   49.229  1.00 48.39  ? 192 GLN H CB  1 
ATOM 4591 C CG  . GLN C 1 192 ? 19.952  7.383   49.778  1.00 44.78  ? 192 GLN H CG  1 
ATOM 4592 C CD  . GLN C 1 192 ? 19.079  8.498   50.327  1.00 48.57  ? 192 GLN H CD  1 
ATOM 4593 O OE1 . GLN C 1 192 ? 19.466  9.219   51.248  1.00 58.79  ? 192 GLN H OE1 1 
ATOM 4594 N NE2 . GLN C 1 192 ? 17.883  8.637   49.766  1.00 45.71  ? 192 GLN H NE2 1 
ATOM 4595 N N   . THR C 1 193 ? 21.622  7.694   52.500  1.00 61.49  ? 193 THR H N   1 
ATOM 4596 C CA  . THR C 1 193 ? 21.588  6.857   53.695  1.00 53.10  ? 193 THR H CA  1 
ATOM 4597 C C   . THR C 1 193 ? 20.382  5.925   53.672  1.00 49.48  ? 193 THR H C   1 
ATOM 4598 O O   . THR C 1 193 ? 19.297  6.311   53.238  1.00 39.77  ? 193 THR H O   1 
ATOM 4599 C CB  . THR C 1 193 ? 21.540  7.703   54.982  1.00 49.14  ? 193 THR H CB  1 
ATOM 4600 O OG1 . THR C 1 193 ? 20.361  8.519   54.980  1.00 42.92  ? 193 THR H OG1 1 
ATOM 4601 C CG2 . THR C 1 193 ? 22.766  8.596   55.075  1.00 44.72  ? 193 THR H CG2 1 
ATOM 4602 N N   . TYR C 1 194 ? 20.570  4.701   54.154  1.00 41.69  ? 194 TYR H N   1 
ATOM 4603 C CA  . TYR C 1 194 ? 19.520  3.690   54.076  1.00 41.27  ? 194 TYR H CA  1 
ATOM 4604 C C   . TYR C 1 194 ? 19.148  3.111   55.430  1.00 47.26  ? 194 TYR H C   1 
ATOM 4605 O O   . TYR C 1 194 ? 20.011  2.695   56.204  1.00 50.56  ? 194 TYR H O   1 
ATOM 4606 C CB  . TYR C 1 194 ? 19.944  2.572   53.130  1.00 39.10  ? 194 TYR H CB  1 
ATOM 4607 C CG  . TYR C 1 194 ? 20.204  3.080   51.740  1.00 42.78  ? 194 TYR H CG  1 
ATOM 4608 C CD1 . TYR C 1 194 ? 19.156  3.487   50.928  1.00 40.65  ? 194 TYR H CD1 1 
ATOM 4609 C CD2 . TYR C 1 194 ? 21.495  3.160   51.238  1.00 49.80  ? 194 TYR H CD2 1 
ATOM 4610 C CE1 . TYR C 1 194 ? 19.384  3.958   49.652  1.00 45.36  ? 194 TYR H CE1 1 
ATOM 4611 C CE2 . TYR C 1 194 ? 21.734  3.630   49.962  1.00 53.87  ? 194 TYR H CE2 1 
ATOM 4612 C CZ  . TYR C 1 194 ? 20.674  4.029   49.172  1.00 50.23  ? 194 TYR H CZ  1 
ATOM 4613 O OH  . TYR C 1 194 ? 20.905  4.500   47.899  1.00 51.73  ? 194 TYR H OH  1 
ATOM 4614 N N   . ILE C 1 195 ? 17.847  3.082   55.696  1.00 47.61  ? 195 ILE H N   1 
ATOM 4615 C CA  . ILE C 1 195 ? 17.322  2.572   56.952  1.00 49.79  ? 195 ILE H CA  1 
ATOM 4616 C C   . ILE C 1 195 ? 16.115  1.663   56.722  1.00 50.84  ? 195 ILE H C   1 
ATOM 4617 O O   . ILE C 1 195 ? 15.181  2.043   56.022  1.00 59.89  ? 195 ILE H O   1 
ATOM 4618 C CB  . ILE C 1 195 ? 16.907  3.720   57.892  1.00 41.17  ? 195 ILE H CB  1 
ATOM 4619 C CG1 . ILE C 1 195 ? 18.131  4.482   58.400  1.00 45.67  ? 195 ILE H CG1 1 
ATOM 4620 C CG2 . ILE C 1 195 ? 16.117  3.189   59.063  1.00 39.65  ? 195 ILE H CG2 1 
ATOM 4621 C CD1 . ILE C 1 195 ? 17.802  5.510   59.460  1.00 46.89  ? 195 ILE H CD1 1 
ATOM 4622 N N   . CYS C 1 196 ? 16.135  0.468   57.308  1.00 44.17  ? 196 CYS H N   1 
ATOM 4623 C CA  . CYS C 1 196 ? 14.994  -0.446  57.225  1.00 43.00  ? 196 CYS H CA  1 
ATOM 4624 C C   . CYS C 1 196 ? 14.062  -0.197  58.406  1.00 39.16  ? 196 CYS H C   1 
ATOM 4625 O O   . CYS C 1 196 ? 14.530  -0.010  59.527  1.00 33.45  ? 196 CYS H O   1 
ATOM 4626 C CB  . CYS C 1 196 ? 15.457  -1.906  57.218  1.00 46.88  ? 196 CYS H CB  1 
ATOM 4627 S SG  . CYS C 1 196 ? 16.226  -2.424  58.771  1.00 58.27  ? 196 CYS H SG  1 
ATOM 4628 N N   . ASN C 1 197 ? 12.753  -0.185  58.184  1.00 46.19  ? 197 ASN H N   1 
ATOM 4629 C CA  . ASN C 1 197 ? 11.867  -0.010  59.320  1.00 47.55  ? 197 ASN H CA  1 
ATOM 4630 C C   . ASN C 1 197 ? 11.298  -1.357  59.700  1.00 36.83  ? 197 ASN H C   1 
ATOM 4631 O O   . ASN C 1 197 ? 10.357  -1.859  59.075  1.00 37.83  ? 197 ASN H O   1 
ATOM 4632 C CB  . ASN C 1 197 ? 10.755  0.982   58.982  1.00 52.07  ? 197 ASN H CB  1 
ATOM 4633 C CG  . ASN C 1 197 ? 11.244  2.110   58.104  1.00 45.71  ? 197 ASN H CG  1 
ATOM 4634 O OD1 . ASN C 1 197 ? 11.360  1.943   56.892  1.00 42.86  ? 197 ASN H OD1 1 
ATOM 4635 N ND2 . ASN C 1 197 ? 11.542  3.263   58.705  1.00 44.55  ? 197 ASN H ND2 1 
ATOM 4636 N N   . VAL C 1 198 ? 11.841  -1.916  60.773  1.00 36.02  ? 198 VAL H N   1 
ATOM 4637 C CA  . VAL C 1 198 ? 11.465  -3.258  61.171  1.00 37.99  ? 198 VAL H CA  1 
ATOM 4638 C C   . VAL C 1 198 ? 10.315  -3.132  62.143  1.00 34.88  ? 198 VAL H C   1 
ATOM 4639 O O   . VAL C 1 198 ? 10.345  -2.302  63.055  1.00 33.28  ? 198 VAL H O   1 
ATOM 4640 C CB  . VAL C 1 198 ? 12.635  -4.033  61.789  1.00 46.75  ? 198 VAL H CB  1 
ATOM 4641 C CG1 . VAL C 1 198 ? 12.191  -5.421  62.191  1.00 51.25  ? 198 VAL H CG1 1 
ATOM 4642 C CG2 . VAL C 1 198 ? 13.784  -4.132  60.789  1.00 40.24  ? 198 VAL H CG2 1 
ATOM 4643 N N   . ASN C 1 199 ? 9.263   -3.900  61.903  1.00 36.12  ? 199 ASN H N   1 
ATOM 4644 C CA  . ASN C 1 199 ? 8.108   -3.795  62.760  1.00 41.24  ? 199 ASN H CA  1 
ATOM 4645 C C   . ASN C 1 199 ? 7.540   -5.129  63.184  1.00 47.34  ? 199 ASN H C   1 
ATOM 4646 O O   . ASN C 1 199 ? 7.015   -5.877  62.361  1.00 61.91  ? 199 ASN H O   1 
ATOM 4647 C CB  . ASN C 1 199 ? 7.036   -2.974  62.062  1.00 37.73  ? 199 ASN H CB  1 
ATOM 4648 C CG  . ASN C 1 199 ? 6.613   -1.783  62.878  1.00 42.91  ? 199 ASN H CG  1 
ATOM 4649 O OD1 . ASN C 1 199 ? 7.298   -1.395  63.826  1.00 44.95  ? 199 ASN H OD1 1 
ATOM 4650 N ND2 . ASN C 1 199 ? 5.492   -1.179  62.510  1.00 43.92  ? 199 ASN H ND2 1 
ATOM 4651 N N   . HIS C 1 200 ? 7.629   -5.420  64.475  1.00 38.65  ? 200 HIS H N   1 
ATOM 4652 C CA  . HIS C 1 200 ? 6.903   -6.549  65.008  1.00 35.42  ? 200 HIS H CA  1 
ATOM 4653 C C   . HIS C 1 200 ? 5.861   -5.981  65.953  1.00 40.88  ? 200 HIS H C   1 
ATOM 4654 O O   . HIS C 1 200 ? 6.167   -5.611  67.085  1.00 46.07  ? 200 HIS H O   1 
ATOM 4655 C CB  . HIS C 1 200 ? 7.854   -7.514  65.719  1.00 36.47  ? 200 HIS H CB  1 
ATOM 4656 C CG  . HIS C 1 200 ? 7.191   -8.754  66.238  1.00 36.88  ? 200 HIS H CG  1 
ATOM 4657 N ND1 . HIS C 1 200 ? 7.122   -9.051  67.582  1.00 38.63  ? 200 HIS H ND1 1 
ATOM 4658 C CD2 . HIS C 1 200 ? 6.592   -9.778  65.591  1.00 38.73  ? 200 HIS H CD2 1 
ATOM 4659 C CE1 . HIS C 1 200 ? 6.498   -10.206 67.739  1.00 40.37  ? 200 HIS H CE1 1 
ATOM 4660 N NE2 . HIS C 1 200 ? 6.165   -10.668 66.552  1.00 39.51  ? 200 HIS H NE2 1 
ATOM 4661 N N   . LYS C 1 201 ? 4.624   -5.944  65.471  1.00 45.56  ? 201 LYS H N   1 
ATOM 4662 C CA  . LYS C 1 201 ? 3.471   -5.447  66.220  1.00 44.96  ? 201 LYS H CA  1 
ATOM 4663 C C   . LYS C 1 201 ? 3.018   -6.314  67.408  1.00 41.41  ? 201 LYS H C   1 
ATOM 4664 O O   . LYS C 1 201 ? 2.581   -5.767  68.420  1.00 40.00  ? 201 LYS H O   1 
ATOM 4665 C CB  . LYS C 1 201 ? 2.303   -5.213  65.260  1.00 43.97  ? 201 LYS H CB  1 
ATOM 4666 C CG  . LYS C 1 201 ? 2.537   -4.032  64.325  1.00 51.41  ? 201 LYS H CG  1 
ATOM 4667 C CD  . LYS C 1 201 ? 1.487   -3.932  63.228  1.00 59.12  ? 201 LYS H CD  1 
ATOM 4668 C CE  . LYS C 1 201 ? 1.803   -2.773  62.291  1.00 67.38  ? 201 LYS H CE  1 
ATOM 4669 N NZ  . LYS C 1 201 ? 0.952   -2.775  61.069  1.00 70.42  ? 201 LYS H NZ  1 
ATOM 4670 N N   . PRO C 1 202 ? 3.074   -7.659  67.284  1.00 42.83  ? 202 PRO H N   1 
ATOM 4671 C CA  . PRO C 1 202 ? 2.692   -8.476  68.446  1.00 33.07  ? 202 PRO H CA  1 
ATOM 4672 C C   . PRO C 1 202 ? 3.432   -8.119  69.733  1.00 30.47  ? 202 PRO H C   1 
ATOM 4673 O O   . PRO C 1 202 ? 2.805   -7.982  70.780  1.00 30.81  ? 202 PRO H O   1 
ATOM 4674 C CB  . PRO C 1 202 ? 3.066   -9.893  68.011  1.00 31.86  ? 202 PRO H CB  1 
ATOM 4675 C CG  . PRO C 1 202 ? 2.914   -9.880  66.547  1.00 39.86  ? 202 PRO H CG  1 
ATOM 4676 C CD  . PRO C 1 202 ? 3.325   -8.502  66.097  1.00 44.37  ? 202 PRO H CD  1 
ATOM 4677 N N   . SER C 1 203 ? 4.748   -7.961  69.647  1.00 30.57  ? 203 SER H N   1 
ATOM 4678 C CA  . SER C 1 203 ? 5.542   -7.577  70.806  1.00 31.22  ? 203 SER H CA  1 
ATOM 4679 C C   . SER C 1 203 ? 5.640   -6.065  70.873  1.00 42.19  ? 203 SER H C   1 
ATOM 4680 O O   . SER C 1 203 ? 6.135   -5.511  71.853  1.00 43.26  ? 203 SER H O   1 
ATOM 4681 C CB  . SER C 1 203 ? 6.942   -8.199  70.755  1.00 31.30  ? 203 SER H CB  1 
ATOM 4682 O OG  . SER C 1 203 ? 7.738   -7.607  69.744  1.00 31.29  ? 203 SER H OG  1 
ATOM 4683 N N   . ASN C 1 204 ? 5.149   -5.411  69.824  1.00 35.11  ? 204 ASN H N   1 
ATOM 4684 C CA  . ASN C 1 204 ? 5.269   -3.966  69.664  1.00 40.28  ? 204 ASN H CA  1 
ATOM 4685 C C   . ASN C 1 204 ? 6.739   -3.567  69.747  1.00 46.41  ? 204 ASN H C   1 
ATOM 4686 O O   . ASN C 1 204 ? 7.148   -2.815  70.632  1.00 52.42  ? 204 ASN H O   1 
ATOM 4687 C CB  . ASN C 1 204 ? 4.430   -3.240  70.727  1.00 31.71  ? 204 ASN H CB  1 
ATOM 4688 C CG  . ASN C 1 204 ? 4.522   -1.730  70.627  1.00 34.09  ? 204 ASN H CG  1 
ATOM 4689 O OD1 . ASN C 1 204 ? 4.429   -1.153  69.542  1.00 36.75  ? 204 ASN H OD1 1 
ATOM 4690 N ND2 . ASN C 1 204 ? 4.698   -1.080  71.772  1.00 33.49  ? 204 ASN H ND2 1 
ATOM 4691 N N   . THR C 1 205 ? 7.548   -4.095  68.836  1.00 42.85  ? 205 THR H N   1 
ATOM 4692 C CA  . THR C 1 205 ? 8.934   -3.670  68.792  1.00 43.65  ? 205 THR H CA  1 
ATOM 4693 C C   . THR C 1 205 ? 9.144   -2.950  67.471  1.00 44.64  ? 205 THR H C   1 
ATOM 4694 O O   . THR C 1 205 ? 9.283   -3.584  66.424  1.00 51.89  ? 205 THR H O   1 
ATOM 4695 C CB  . THR C 1 205 ? 9.911   -4.864  68.929  1.00 43.11  ? 205 THR H CB  1 
ATOM 4696 O OG1 . THR C 1 205 ? 9.511   -5.690  70.031  1.00 46.88  ? 205 THR H OG1 1 
ATOM 4697 C CG2 . THR C 1 205 ? 11.328  -4.372  69.189  1.00 40.38  ? 205 THR H CG2 1 
ATOM 4698 N N   . LYS C 1 206 ? 9.219   -1.624  67.535  1.00 35.73  ? 206 LYS H N   1 
ATOM 4699 C CA  . LYS C 1 206 ? 9.459   -0.818  66.343  1.00 37.20  ? 206 LYS H CA  1 
ATOM 4700 C C   . LYS C 1 206 ? 10.911  -0.392  66.350  1.00 39.32  ? 206 LYS H C   1 
ATOM 4701 O O   . LYS C 1 206 ? 11.376  0.296   67.265  1.00 41.24  ? 206 LYS H O   1 
ATOM 4702 C CB  . LYS C 1 206 ? 8.536   0.407   66.270  1.00 47.26  ? 206 LYS H CB  1 
ATOM 4703 C CG  . LYS C 1 206 ? 8.737   1.233   64.996  1.00 60.39  ? 206 LYS H CG  1 
ATOM 4704 C CD  . LYS C 1 206 ? 7.495   2.026   64.571  1.00 66.15  ? 206 LYS H CD  1 
ATOM 4705 C CE  . LYS C 1 206 ? 7.760   2.857   63.307  1.00 66.37  ? 206 LYS H CE  1 
ATOM 4706 N NZ  . LYS C 1 206 ? 8.363   2.056   62.201  1.00 59.59  ? 206 LYS H NZ  1 
ATOM 4707 N N   . VAL C 1 207 ? 11.635  -0.830  65.331  1.00 29.96  ? 207 VAL H N   1 
ATOM 4708 C CA  . VAL C 1 207 ? 13.059  -0.585  65.279  1.00 29.46  ? 207 VAL H CA  1 
ATOM 4709 C C   . VAL C 1 207 ? 13.480  -0.164  63.880  1.00 34.31  ? 207 VAL H C   1 
ATOM 4710 O O   . VAL C 1 207 ? 13.123  -0.805  62.890  1.00 42.90  ? 207 VAL H O   1 
ATOM 4711 C CB  . VAL C 1 207 ? 13.853  -1.829  65.711  1.00 29.12  ? 207 VAL H CB  1 
ATOM 4712 C CG1 . VAL C 1 207 ? 15.339  -1.571  65.588  1.00 29.95  ? 207 VAL H CG1 1 
ATOM 4713 C CG2 . VAL C 1 207 ? 13.500  -2.222  67.142  1.00 29.26  ? 207 VAL H CG2 1 
ATOM 4714 N N   . ASP C 1 208 ? 14.224  0.934   63.814  1.00 42.03  ? 208 ASP H N   1 
ATOM 4715 C CA  . ASP C 1 208 ? 14.813  1.420   62.573  1.00 41.65  ? 208 ASP H CA  1 
ATOM 4716 C C   . ASP C 1 208 ? 16.313  1.157   62.576  1.00 43.98  ? 208 ASP H C   1 
ATOM 4717 O O   . ASP C 1 208 ? 17.008  1.547   63.512  1.00 44.49  ? 208 ASP H O   1 
ATOM 4718 C CB  . ASP C 1 208 ? 14.536  2.916   62.400  1.00 48.92  ? 208 ASP H CB  1 
ATOM 4719 C CG  . ASP C 1 208 ? 13.471  3.197   61.359  1.00 55.42  ? 208 ASP H CG  1 
ATOM 4720 O OD1 . ASP C 1 208 ? 13.377  2.422   60.389  1.00 54.27  ? 208 ASP H OD1 1 
ATOM 4721 O OD2 . ASP C 1 208 ? 12.730  4.193   61.509  1.00 58.47  ? 208 ASP H OD2 1 
ATOM 4722 N N   . LYS C 1 209 ? 16.817  0.496   61.537  1.00 36.76  ? 209 LYS H N   1 
ATOM 4723 C CA  . LYS C 1 209 ? 18.248  0.212   61.457  1.00 37.36  ? 209 LYS H CA  1 
ATOM 4724 C C   . LYS C 1 209 ? 18.916  0.914   60.285  1.00 37.87  ? 209 LYS H C   1 
ATOM 4725 O O   . LYS C 1 209 ? 18.508  0.756   59.137  1.00 37.18  ? 209 LYS H O   1 
ATOM 4726 C CB  . LYS C 1 209 ? 18.502  -1.294  61.357  1.00 36.53  ? 209 LYS H CB  1 
ATOM 4727 C CG  . LYS C 1 209 ? 19.569  -1.793  62.313  1.00 37.20  ? 209 LYS H CG  1 
ATOM 4728 C CD  . LYS C 1 209 ? 19.114  -1.589  63.746  1.00 48.91  ? 209 LYS H CD  1 
ATOM 4729 C CE  . LYS C 1 209 ? 20.139  -2.085  64.745  1.00 38.27  ? 209 LYS H CE  1 
ATOM 4730 N NZ  . LYS C 1 209 ? 19.638  -1.931  66.137  1.00 38.57  ? 209 LYS H NZ  1 
ATOM 4731 N N   . LYS C 1 210 ? 19.966  1.667   60.586  1.00 37.19  ? 210 LYS H N   1 
ATOM 4732 C CA  . LYS C 1 210 ? 20.720  2.372   59.564  1.00 47.43  ? 210 LYS H CA  1 
ATOM 4733 C C   . LYS C 1 210 ? 21.839  1.474   59.056  1.00 59.46  ? 210 LYS H C   1 
ATOM 4734 O O   . LYS C 1 210 ? 22.762  1.137   59.797  1.00 70.86  ? 210 LYS H O   1 
ATOM 4735 C CB  . LYS C 1 210 ? 21.274  3.684   60.125  1.00 39.63  ? 210 LYS H CB  1 
ATOM 4736 C CG  . LYS C 1 210 ? 22.398  4.311   59.322  1.00 40.93  ? 210 LYS H CG  1 
ATOM 4737 C CD  . LYS C 1 210 ? 22.863  5.603   59.981  1.00 47.92  ? 210 LYS H CD  1 
ATOM 4738 C CE  . LYS C 1 210 ? 24.062  6.189   59.262  1.00 50.66  ? 210 LYS H CE  1 
ATOM 4739 N NZ  . LYS C 1 210 ? 24.605  7.392   59.947  1.00 49.49  ? 210 LYS H NZ  1 
ATOM 4740 N N   . VAL C 1 211 ? 21.747  1.083   57.790  1.00 55.68  ? 211 VAL H N   1 
ATOM 4741 C CA  . VAL C 1 211 ? 22.692  0.130   57.219  1.00 49.46  ? 211 VAL H CA  1 
ATOM 4742 C C   . VAL C 1 211 ? 23.805  0.849   56.471  1.00 46.89  ? 211 VAL H C   1 
ATOM 4743 O O   . VAL C 1 211 ? 23.555  1.575   55.507  1.00 39.55  ? 211 VAL H O   1 
ATOM 4744 C CB  . VAL C 1 211 ? 21.989  -0.861  56.275  1.00 48.50  ? 211 VAL H CB  1 
ATOM 4745 C CG1 . VAL C 1 211 ? 22.919  -2.013  55.926  1.00 47.24  ? 211 VAL H CG1 1 
ATOM 4746 C CG2 . VAL C 1 211 ? 20.724  -1.391  56.927  1.00 34.81  ? 211 VAL H CG2 1 
ATOM 4747 N N   . GLU C 1 212 ? 25.034  0.644   56.932  1.00 53.57  ? 212 GLU H N   1 
ATOM 4748 C CA  . GLU C 1 212 ? 26.201  1.284   56.341  1.00 56.53  ? 212 GLU H CA  1 
ATOM 4749 C C   . GLU C 1 212 ? 27.303  0.283   56.028  1.00 58.42  ? 212 GLU H C   1 
ATOM 4750 O O   . GLU C 1 212 ? 27.488  -0.695  56.754  1.00 57.50  ? 212 GLU H O   1 
ATOM 4751 C CB  . GLU C 1 212 ? 26.747  2.370   57.266  1.00 57.09  ? 212 GLU H CB  1 
ATOM 4752 C CG  . GLU C 1 212 ? 25.875  3.597   57.379  1.00 64.94  ? 212 GLU H CG  1 
ATOM 4753 C CD  . GLU C 1 212 ? 26.689  4.829   57.713  1.00 79.08  ? 212 GLU H CD  1 
ATOM 4754 O OE1 . GLU C 1 212 ? 27.396  4.810   58.744  1.00 84.89  ? 212 GLU H OE1 1 
ATOM 4755 O OE2 . GLU C 1 212 ? 26.631  5.812   56.942  1.00 85.03  ? 212 GLU H OE2 1 
ATOM 4756 N N   . PRO C 1 213 ? 28.043  0.533   54.940  1.00 60.64  ? 213 PRO H N   1 
ATOM 4757 C CA  . PRO C 1 213 ? 29.128  -0.351  54.510  1.00 51.86  ? 213 PRO H CA  1 
ATOM 4758 C C   . PRO C 1 213 ? 30.358  -0.231  55.402  1.00 64.74  ? 213 PRO H C   1 
ATOM 4759 O O   . PRO C 1 213 ? 30.458  0.671   56.232  1.00 62.69  ? 213 PRO H O   1 
ATOM 4760 C CB  . PRO C 1 213 ? 29.423  0.140   53.094  1.00 51.46  ? 213 PRO H CB  1 
ATOM 4761 C CG  . PRO C 1 213 ? 29.112  1.598   53.155  1.00 41.20  ? 213 PRO H CG  1 
ATOM 4762 C CD  . PRO C 1 213 ? 27.905  1.702   54.050  1.00 40.44  ? 213 PRO H CD  1 
ATOM 4763 N N   . GLU D 2 1   ? -3.885  -45.308 53.558  1.00 55.04  ? 1   GLU L N   1 
ATOM 4764 C CA  . GLU D 2 1   ? -4.655  -44.271 52.881  1.00 55.44  ? 1   GLU L CA  1 
ATOM 4765 C C   . GLU D 2 1   ? -4.472  -44.353 51.368  1.00 53.84  ? 1   GLU L C   1 
ATOM 4766 O O   . GLU D 2 1   ? -3.552  -45.010 50.880  1.00 57.36  ? 1   GLU L O   1 
ATOM 4767 C CB  . GLU D 2 1   ? -4.250  -42.881 53.382  1.00 61.02  ? 1   GLU L CB  1 
ATOM 4768 C CG  . GLU D 2 1   ? -2.863  -42.410 52.933  1.00 71.81  ? 1   GLU L CG  1 
ATOM 4769 C CD  . GLU D 2 1   ? -1.720  -43.009 53.744  1.00 79.43  ? 1   GLU L CD  1 
ATOM 4770 O OE1 . GLU D 2 1   ? -1.631  -44.253 53.844  1.00 91.96  ? 1   GLU L OE1 1 
ATOM 4771 O OE2 . GLU D 2 1   ? -0.904  -42.228 54.282  1.00 69.76  ? 1   GLU L OE2 1 
ATOM 4772 N N   . ILE D 2 2   ? -5.349  -43.685 50.625  1.00 41.97  ? 2   ILE L N   1 
ATOM 4773 C CA  . ILE D 2 2   ? -5.191  -43.623 49.180  1.00 40.38  ? 2   ILE L CA  1 
ATOM 4774 C C   . ILE D 2 2   ? -4.291  -42.449 48.840  1.00 40.66  ? 2   ILE L C   1 
ATOM 4775 O O   . ILE D 2 2   ? -4.649  -41.298 49.072  1.00 41.91  ? 2   ILE L O   1 
ATOM 4776 C CB  . ILE D 2 2   ? -6.534  -43.458 48.437  1.00 36.16  ? 2   ILE L CB  1 
ATOM 4777 C CG1 . ILE D 2 2   ? -7.416  -44.693 48.618  1.00 39.60  ? 2   ILE L CG1 1 
ATOM 4778 C CG2 . ILE D 2 2   ? -6.289  -43.232 46.956  1.00 29.84  ? 2   ILE L CG2 1 
ATOM 4779 C CD1 . ILE D 2 2   ? -8.676  -44.659 47.775  1.00 38.84  ? 2   ILE L CD1 1 
ATOM 4780 N N   . VAL D 2 3   ? -3.119  -42.740 48.288  1.00 24.33  ? 3   VAL L N   1 
ATOM 4781 C CA  . VAL D 2 3   ? -2.159  -41.692 47.970  1.00 38.20  ? 3   VAL L CA  1 
ATOM 4782 C C   . VAL D 2 3   ? -2.386  -41.166 46.552  1.00 33.58  ? 3   VAL L C   1 
ATOM 4783 O O   . VAL D 2 3   ? -2.747  -41.919 45.643  1.00 32.21  ? 3   VAL L O   1 
ATOM 4784 C CB  . VAL D 2 3   ? -0.698  -42.193 48.149  1.00 25.08  ? 3   VAL L CB  1 
ATOM 4785 C CG1 . VAL D 2 3   ? -0.682  -43.541 48.863  1.00 25.92  ? 3   VAL L CG1 1 
ATOM 4786 C CG2 . VAL D 2 3   ? 0.042   -42.272 46.815  1.00 25.61  ? 3   VAL L CG2 1 
ATOM 4787 N N   . LEU D 2 4   ? -2.213  -39.860 46.384  1.00 28.29  ? 4   LEU L N   1 
ATOM 4788 C CA  . LEU D 2 4   ? -2.356  -39.229 45.080  1.00 29.32  ? 4   LEU L CA  1 
ATOM 4789 C C   . LEU D 2 4   ? -1.068  -38.520 44.696  1.00 42.86  ? 4   LEU L C   1 
ATOM 4790 O O   . LEU D 2 4   ? -0.643  -37.578 45.365  1.00 45.15  ? 4   LEU L O   1 
ATOM 4791 C CB  . LEU D 2 4   ? -3.527  -38.244 45.081  1.00 27.09  ? 4   LEU L CB  1 
ATOM 4792 C CG  . LEU D 2 4   ? -4.900  -38.857 44.787  1.00 27.06  ? 4   LEU L CG  1 
ATOM 4793 C CD1 . LEU D 2 4   ? -5.998  -37.809 44.813  1.00 26.36  ? 4   LEU L CD1 1 
ATOM 4794 C CD2 . LEU D 2 4   ? -4.883  -39.559 43.447  1.00 39.22  ? 4   LEU L CD2 1 
ATOM 4795 N N   . THR D 2 5   ? -0.444  -38.990 43.621  1.00 39.71  ? 5   THR L N   1 
ATOM 4796 C CA  . THR D 2 5   ? 0.773   -38.375 43.116  1.00 39.39  ? 5   THR L CA  1 
ATOM 4797 C C   . THR D 2 5   ? 0.426   -37.466 41.948  1.00 37.08  ? 5   THR L C   1 
ATOM 4798 O O   . THR D 2 5   ? -0.407  -37.812 41.110  1.00 31.84  ? 5   THR L O   1 
ATOM 4799 C CB  . THR D 2 5   ? 1.808   -39.430 42.665  1.00 40.74  ? 5   THR L CB  1 
ATOM 4800 O OG1 . THR D 2 5   ? 1.882   -40.481 43.637  1.00 43.27  ? 5   THR L OG1 1 
ATOM 4801 C CG2 . THR D 2 5   ? 3.184   -38.797 42.501  1.00 36.19  ? 5   THR L CG2 1 
ATOM 4802 N N   . GLN D 2 6   ? 1.054   -36.298 41.902  1.00 28.74  ? 6   GLN L N   1 
ATOM 4803 C CA  . GLN D 2 6   ? 0.811   -35.351 40.826  1.00 29.49  ? 6   GLN L CA  1 
ATOM 4804 C C   . GLN D 2 6   ? 2.130   -35.033 40.139  1.00 34.27  ? 6   GLN L C   1 
ATOM 4805 O O   . GLN D 2 6   ? 3.191   -35.254 40.719  1.00 35.46  ? 6   GLN L O   1 
ATOM 4806 C CB  . GLN D 2 6   ? 0.150   -34.087 41.370  1.00 28.08  ? 6   GLN L CB  1 
ATOM 4807 C CG  . GLN D 2 6   ? -1.227  -34.341 41.965  1.00 41.41  ? 6   GLN L CG  1 
ATOM 4808 C CD  . GLN D 2 6   ? -1.895  -33.072 42.456  1.00 37.46  ? 6   GLN L CD  1 
ATOM 4809 O OE1 . GLN D 2 6   ? -2.037  -32.856 43.659  1.00 36.15  ? 6   GLN L OE1 1 
ATOM 4810 N NE2 . GLN D 2 6   ? -2.309  -32.223 41.524  1.00 33.31  ? 6   GLN L NE2 1 
ATOM 4811 N N   . SER D 2 7   ? 2.071   -34.497 38.923  1.00 38.25  ? 7   SER L N   1 
ATOM 4812 C CA  . SER D 2 7   ? 3.279   -34.288 38.126  1.00 41.12  ? 7   SER L CA  1 
ATOM 4813 C C   . SER D 2 7   ? 2.994   -33.549 36.822  1.00 44.96  ? 7   SER L C   1 
ATOM 4814 O O   . SER D 2 7   ? 2.000   -33.825 36.150  1.00 44.42  ? 7   SER L O   1 
ATOM 4815 C CB  . SER D 2 7   ? 3.953   -35.623 37.806  1.00 45.71  ? 7   SER L CB  1 
ATOM 4816 O OG  . SER D 2 7   ? 3.083   -36.440 37.047  1.00 46.78  ? 7   SER L OG  1 
ATOM 4817 N N   . PRO D 2 8   ? 3.882   -32.615 36.449  1.00 30.82  ? 8   PRO L N   1 
ATOM 4818 C CA  . PRO D 2 8   ? 5.122   -32.293 37.168  1.00 39.93  ? 8   PRO L CA  1 
ATOM 4819 C C   . PRO D 2 8   ? 4.876   -31.524 38.470  1.00 46.69  ? 8   PRO L C   1 
ATOM 4820 O O   . PRO D 2 8   ? 3.725   -31.270 38.822  1.00 44.57  ? 8   PRO L O   1 
ATOM 4821 C CB  . PRO D 2 8   ? 5.888   -31.443 36.153  1.00 32.22  ? 8   PRO L CB  1 
ATOM 4822 C CG  . PRO D 2 8   ? 4.805   -30.734 35.405  1.00 40.57  ? 8   PRO L CG  1 
ATOM 4823 C CD  . PRO D 2 8   ? 3.672   -31.726 35.291  1.00 31.30  ? 8   PRO L CD  1 
ATOM 4824 N N   . ALA D 2 9   ? 5.941   -31.195 39.192  1.00 45.59  ? 9   ALA L N   1 
ATOM 4825 C CA  . ALA D 2 9   ? 5.798   -30.361 40.374  1.00 25.83  ? 9   ALA L CA  1 
ATOM 4826 C C   . ALA D 2 9   ? 5.742   -28.896 39.952  1.00 25.80  ? 9   ALA L C   1 
ATOM 4827 O O   . ALA D 2 9   ? 5.328   -28.032 40.723  1.00 43.92  ? 9   ALA L O   1 
ATOM 4828 C CB  . ALA D 2 9   ? 6.938   -30.606 41.359  1.00 26.38  ? 9   ALA L CB  1 
ATOM 4829 N N   . THR D 2 10  ? 6.158   -28.629 38.719  1.00 31.63  ? 10  THR L N   1 
ATOM 4830 C CA  . THR D 2 10  ? 6.099   -27.289 38.159  1.00 31.75  ? 10  THR L CA  1 
ATOM 4831 C C   . THR D 2 10  ? 5.772   -27.337 36.666  1.00 37.61  ? 10  THR L C   1 
ATOM 4832 O O   . THR D 2 10  ? 6.393   -28.098 35.921  1.00 40.32  ? 10  THR L O   1 
ATOM 4833 C CB  . THR D 2 10  ? 7.431   -26.550 38.356  1.00 34.15  ? 10  THR L CB  1 
ATOM 4834 O OG1 . THR D 2 10  ? 7.753   -26.508 39.753  1.00 34.72  ? 10  THR L OG1 1 
ATOM 4835 C CG2 . THR D 2 10  ? 7.327   -25.147 37.821  1.00 36.39  ? 10  THR L CG2 1 
ATOM 4836 N N   . LEU D 2 11  ? 4.843   -26.505 36.206  1.00 27.46  ? 11  LEU L N   1 
ATOM 4837 C CA  . LEU D 2 11  ? 4.656   -26.380 34.766  1.00 28.26  ? 11  LEU L CA  1 
ATOM 4838 C C   . LEU D 2 11  ? 4.883   -24.923 34.365  1.00 52.38  ? 11  LEU L C   1 
ATOM 4839 O O   . LEU D 2 11  ? 4.049   -24.050 34.634  1.00 53.62  ? 11  LEU L O   1 
ATOM 4840 C CB  . LEU D 2 11  ? 3.264   -26.875 34.358  1.00 43.98  ? 11  LEU L CB  1 
ATOM 4841 C CG  . LEU D 2 11  ? 3.041   -27.323 32.910  1.00 43.34  ? 11  LEU L CG  1 
ATOM 4842 C CD1 . LEU D 2 11  ? 3.978   -28.464 32.505  1.00 44.38  ? 11  LEU L CD1 1 
ATOM 4843 C CD2 . LEU D 2 11  ? 1.595   -27.766 32.766  1.00 38.30  ? 11  LEU L CD2 1 
ATOM 4844 N N   . SER D 2 12  ? 6.002   -24.668 33.691  1.00 36.59  ? 12  SER L N   1 
ATOM 4845 C CA  . SER D 2 12  ? 6.388   -23.298 33.380  1.00 37.04  ? 12  SER L CA  1 
ATOM 4846 C C   . SER D 2 12  ? 5.973   -22.968 31.961  1.00 44.43  ? 12  SER L C   1 
ATOM 4847 O O   . SER D 2 12  ? 6.506   -23.518 30.995  1.00 48.48  ? 12  SER L O   1 
ATOM 4848 C CB  . SER D 2 12  ? 7.896   -23.076 33.569  1.00 68.33  ? 12  SER L CB  1 
ATOM 4849 O OG  . SER D 2 12  ? 8.674   -24.040 32.886  1.00 73.56  ? 12  SER L OG  1 
ATOM 4850 N N   . LEU D 2 13  ? 5.010   -22.062 31.844  1.00 40.47  ? 13  LEU L N   1 
ATOM 4851 C CA  . LEU D 2 13  ? 4.438   -21.748 30.551  1.00 36.77  ? 13  LEU L CA  1 
ATOM 4852 C C   . LEU D 2 13  ? 4.179   -20.255 30.430  1.00 40.70  ? 13  LEU L C   1 
ATOM 4853 O O   . LEU D 2 13  ? 4.402   -19.493 31.369  1.00 46.75  ? 13  LEU L O   1 
ATOM 4854 C CB  . LEU D 2 13  ? 3.138   -22.534 30.335  1.00 50.74  ? 13  LEU L CB  1 
ATOM 4855 C CG  . LEU D 2 13  ? 3.035   -23.998 30.799  1.00 58.51  ? 13  LEU L CG  1 
ATOM 4856 C CD1 . LEU D 2 13  ? 1.583   -24.444 30.828  1.00 35.15  ? 13  LEU L CD1 1 
ATOM 4857 C CD2 . LEU D 2 13  ? 3.880   -24.947 29.954  1.00 68.42  ? 13  LEU L CD2 1 
ATOM 4858 N N   . SER D 2 14  ? 3.695   -19.852 29.264  1.00 44.62  ? 14  SER L N   1 
ATOM 4859 C CA  . SER D 2 14  ? 3.363   -18.460 28.991  1.00 40.32  ? 14  SER L CA  1 
ATOM 4860 C C   . SER D 2 14  ? 1.886   -18.387 28.614  1.00 38.73  ? 14  SER L C   1 
ATOM 4861 O O   . SER D 2 14  ? 1.300   -19.403 28.245  1.00 38.75  ? 14  SER L O   1 
ATOM 4862 C CB  . SER D 2 14  ? 4.253   -17.902 27.877  1.00 40.27  ? 14  SER L CB  1 
ATOM 4863 O OG  . SER D 2 14  ? 5.617   -17.961 28.252  1.00 40.42  ? 14  SER L OG  1 
ATOM 4864 N N   . PRO D 2 15  ? 1.268   -17.201 28.743  1.00 37.81  ? 15  PRO L N   1 
ATOM 4865 C CA  . PRO D 2 15  ? -0.158  -17.057 28.429  1.00 41.13  ? 15  PRO L CA  1 
ATOM 4866 C C   . PRO D 2 15  ? -0.545  -17.574 27.046  1.00 44.63  ? 15  PRO L C   1 
ATOM 4867 O O   . PRO D 2 15  ? 0.145   -17.312 26.069  1.00 40.33  ? 15  PRO L O   1 
ATOM 4868 C CB  . PRO D 2 15  ? -0.373  -15.548 28.514  1.00 43.35  ? 15  PRO L CB  1 
ATOM 4869 C CG  . PRO D 2 15  ? 0.575   -15.121 29.563  1.00 43.67  ? 15  PRO L CG  1 
ATOM 4870 C CD  . PRO D 2 15  ? 1.806   -15.981 29.371  1.00 45.05  ? 15  PRO L CD  1 
ATOM 4871 N N   . GLY D 2 16  ? -1.647  -18.312 26.980  1.00 44.18  ? 16  GLY L N   1 
ATOM 4872 C CA  . GLY D 2 16  ? -2.150  -18.854 25.729  1.00 41.43  ? 16  GLY L CA  1 
ATOM 4873 C C   . GLY D 2 16  ? -1.690  -20.274 25.468  1.00 41.85  ? 16  GLY L C   1 
ATOM 4874 O O   . GLY D 2 16  ? -2.348  -21.010 24.739  1.00 43.88  ? 16  GLY L O   1 
ATOM 4875 N N   . GLU D 2 17  ? -0.590  -20.678 26.097  1.00 39.61  ? 17  GLU L N   1 
ATOM 4876 C CA  . GLU D 2 17  ? -0.067  -22.026 25.904  1.00 43.20  ? 17  GLU L CA  1 
ATOM 4877 C C   . GLU D 2 17  ? -0.968  -23.026 26.608  1.00 51.50  ? 17  GLU L C   1 
ATOM 4878 O O   . GLU D 2 17  ? -1.616  -22.696 27.598  1.00 59.79  ? 17  GLU L O   1 
ATOM 4879 C CB  . GLU D 2 17  ? 1.371   -22.150 26.422  1.00 45.24  ? 17  GLU L CB  1 
ATOM 4880 C CG  . GLU D 2 17  ? 2.334   -21.115 25.861  1.00 53.13  ? 17  GLU L CG  1 
ATOM 4881 C CD  . GLU D 2 17  ? 3.789   -21.495 26.074  1.00 62.72  ? 17  GLU L CD  1 
ATOM 4882 O OE1 . GLU D 2 17  ? 4.299   -22.324 25.295  1.00 70.55  ? 17  GLU L OE1 1 
ATOM 4883 O OE2 . GLU D 2 17  ? 4.421   -20.975 27.020  1.00 61.40  ? 17  GLU L OE2 1 
ATOM 4884 N N   . ARG D 2 18  ? -1.021  -24.248 26.091  1.00 46.13  ? 18  ARG L N   1 
ATOM 4885 C CA  . ARG D 2 18  ? -1.827  -25.278 26.731  1.00 41.50  ? 18  ARG L CA  1 
ATOM 4886 C C   . ARG D 2 18  ? -1.164  -25.716 28.034  1.00 41.41  ? 18  ARG L C   1 
ATOM 4887 O O   . ARG D 2 18  ? 0.056   -25.617 28.179  1.00 45.72  ? 18  ARG L O   1 
ATOM 4888 C CB  . ARG D 2 18  ? -2.031  -26.472 25.796  1.00 45.01  ? 18  ARG L CB  1 
ATOM 4889 C CG  . ARG D 2 18  ? -3.104  -27.432 26.270  1.00 51.44  ? 18  ARG L CG  1 
ATOM 4890 C CD  . ARG D 2 18  ? -3.290  -28.589 25.310  1.00 58.39  ? 18  ARG L CD  1 
ATOM 4891 N NE  . ARG D 2 18  ? -4.522  -29.322 25.585  1.00 60.80  ? 18  ARG L NE  1 
ATOM 4892 C CZ  . ARG D 2 18  ? -4.944  -30.368 24.882  1.00 59.00  ? 18  ARG L CZ  1 
ATOM 4893 N NH1 . ARG D 2 18  ? -4.227  -30.814 23.858  1.00 57.51  ? 18  ARG L NH1 1 
ATOM 4894 N NH2 . ARG D 2 18  ? -6.081  -30.972 25.206  1.00 58.00  ? 18  ARG L NH2 1 
ATOM 4895 N N   . ALA D 2 19  ? -1.973  -26.173 28.986  1.00 30.92  ? 19  ALA L N   1 
ATOM 4896 C CA  . ALA D 2 19  ? -1.461  -26.700 30.246  1.00 29.80  ? 19  ALA L CA  1 
ATOM 4897 C C   . ALA D 2 19  ? -2.121  -28.031 30.579  1.00 29.23  ? 19  ALA L C   1 
ATOM 4898 O O   . ALA D 2 19  ? -3.336  -28.098 30.754  1.00 37.75  ? 19  ALA L O   1 
ATOM 4899 C CB  . ALA D 2 19  ? -1.685  -25.702 31.373  1.00 33.37  ? 19  ALA L CB  1 
ATOM 4900 N N   . THR D 2 20  ? -1.320  -29.088 30.667  1.00 37.88  ? 20  THR L N   1 
ATOM 4901 C CA  . THR D 2 20  ? -1.837  -30.411 31.002  1.00 40.12  ? 20  THR L CA  1 
ATOM 4902 C C   . THR D 2 20  ? -1.216  -30.940 32.292  1.00 31.68  ? 20  THR L C   1 
ATOM 4903 O O   . THR D 2 20  ? 0.002   -31.070 32.409  1.00 32.09  ? 20  THR L O   1 
ATOM 4904 C CB  . THR D 2 20  ? -1.594  -31.416 29.860  1.00 41.91  ? 20  THR L CB  1 
ATOM 4905 O OG1 . THR D 2 20  ? -2.455  -31.098 28.759  1.00 42.41  ? 20  THR L OG1 1 
ATOM 4906 C CG2 . THR D 2 20  ? -1.872  -32.840 30.320  1.00 41.02  ? 20  THR L CG2 1 
ATOM 4907 N N   . LEU D 2 21  ? -2.076  -31.244 33.258  1.00 37.41  ? 21  LEU L N   1 
ATOM 4908 C CA  . LEU D 2 21  ? -1.648  -31.680 34.581  1.00 33.97  ? 21  LEU L CA  1 
ATOM 4909 C C   . LEU D 2 21  ? -2.033  -33.144 34.790  1.00 37.36  ? 21  LEU L C   1 
ATOM 4910 O O   . LEU D 2 21  ? -3.135  -33.557 34.426  1.00 44.57  ? 21  LEU L O   1 
ATOM 4911 C CB  . LEU D 2 21  ? -2.271  -30.798 35.674  1.00 33.77  ? 21  LEU L CB  1 
ATOM 4912 C CG  . LEU D 2 21  ? -1.869  -29.322 35.843  1.00 28.92  ? 21  LEU L CG  1 
ATOM 4913 C CD1 . LEU D 2 21  ? -2.164  -28.455 34.617  1.00 29.71  ? 21  LEU L CD1 1 
ATOM 4914 C CD2 . LEU D 2 21  ? -2.543  -28.734 37.072  1.00 30.95  ? 21  LEU L CD2 1 
ATOM 4915 N N   . SER D 2 22  ? -1.132  -33.933 35.368  1.00 40.45  ? 22  SER L N   1 
ATOM 4916 C CA  . SER D 2 22  ? -1.399  -35.357 35.547  1.00 42.74  ? 22  SER L CA  1 
ATOM 4917 C C   . SER D 2 22  ? -1.401  -35.780 37.011  1.00 34.95  ? 22  SER L C   1 
ATOM 4918 O O   . SER D 2 22  ? -0.569  -35.344 37.801  1.00 30.81  ? 22  SER L O   1 
ATOM 4919 C CB  . SER D 2 22  ? -0.380  -36.195 34.775  1.00 48.69  ? 22  SER L CB  1 
ATOM 4920 O OG  . SER D 2 22  ? -0.734  -37.568 34.802  1.00 49.13  ? 22  SER L OG  1 
ATOM 4921 N N   . CYS D 2 23  ? -2.353  -36.641 37.353  1.00 37.37  ? 23  CYS L N   1 
ATOM 4922 C CA  . CYS D 2 23  ? -2.501  -37.178 38.700  1.00 38.47  ? 23  CYS L CA  1 
ATOM 4923 C C   . CYS D 2 23  ? -2.588  -38.701 38.619  1.00 45.79  ? 23  CYS L C   1 
ATOM 4924 O O   . CYS D 2 23  ? -3.216  -39.242 37.707  1.00 48.56  ? 23  CYS L O   1 
ATOM 4925 C CB  . CYS D 2 23  ? -3.746  -36.590 39.373  1.00 35.34  ? 23  CYS L CB  1 
ATOM 4926 S SG  . CYS D 2 23  ? -4.047  -37.079 41.090  1.00 45.57  ? 23  CYS L SG  1 
ATOM 4927 N N   . ARG D 2 24  ? -1.937  -39.392 39.552  1.00 52.21  ? 24  ARG L N   1 
ATOM 4928 C CA  . ARG D 2 24  ? -1.948  -40.855 39.572  1.00 56.02  ? 24  ARG L CA  1 
ATOM 4929 C C   . ARG D 2 24  ? -2.154  -41.385 40.988  1.00 42.38  ? 24  ARG L C   1 
ATOM 4930 O O   . ARG D 2 24  ? -1.396  -41.054 41.897  1.00 40.15  ? 24  ARG L O   1 
ATOM 4931 C CB  . ARG D 2 24  ? -0.644  -41.419 38.992  1.00 58.85  ? 24  ARG L CB  1 
ATOM 4932 C CG  . ARG D 2 24  ? -0.070  -40.609 37.845  1.00 67.86  ? 24  ARG L CG  1 
ATOM 4933 C CD  . ARG D 2 24  ? 1.387   -40.931 37.572  1.00 79.15  ? 24  ARG L CD  1 
ATOM 4934 N NE  . ARG D 2 24  ? 1.981   -39.916 36.705  1.00 83.12  ? 24  ARG L NE  1 
ATOM 4935 C CZ  . ARG D 2 24  ? 2.748   -40.174 35.652  1.00 77.51  ? 24  ARG L CZ  1 
ATOM 4936 N NH1 . ARG D 2 24  ? 3.027   -41.427 35.317  1.00 72.40  ? 24  ARG L NH1 1 
ATOM 4937 N NH2 . ARG D 2 24  ? 3.235   -39.173 34.932  1.00 77.25  ? 24  ARG L NH2 1 
ATOM 4938 N N   . ALA D 2 25  ? -3.169  -42.223 41.171  1.00 39.66  ? 25  ALA L N   1 
ATOM 4939 C CA  . ALA D 2 25  ? -3.454  -42.767 42.494  1.00 41.65  ? 25  ALA L CA  1 
ATOM 4940 C C   . ALA D 2 25  ? -2.700  -44.064 42.753  1.00 44.83  ? 25  ALA L C   1 
ATOM 4941 O O   . ALA D 2 25  ? -2.055  -44.610 41.859  1.00 44.37  ? 25  ALA L O   1 
ATOM 4942 C CB  . ALA D 2 25  ? -4.949  -42.999 42.654  1.00 28.87  ? 25  ALA L CB  1 
ATOM 4943 N N   . SER D 2 26  ? -2.802  -44.561 43.982  1.00 39.23  ? 26  SER L N   1 
ATOM 4944 C CA  . SER D 2 26  ? -2.234  -45.856 44.331  1.00 43.38  ? 26  SER L CA  1 
ATOM 4945 C C   . SER D 2 26  ? -3.292  -46.939 44.190  1.00 48.20  ? 26  SER L C   1 
ATOM 4946 O O   . SER D 2 26  ? -2.993  -48.129 44.230  1.00 46.65  ? 26  SER L O   1 
ATOM 4947 C CB  . SER D 2 26  ? -1.678  -45.837 45.757  1.00 30.04  ? 26  SER L CB  1 
ATOM 4948 O OG  . SER D 2 26  ? -2.654  -45.380 46.678  1.00 29.14  ? 26  SER L OG  1 
ATOM 4949 N N   . GLN D 2 27  ? -4.534  -46.507 44.011  1.00 33.85  ? 27  GLN L N   1 
ATOM 4950 C CA  . GLN D 2 27  ? -5.674  -47.413 43.981  1.00 33.97  ? 27  GLN L CA  1 
ATOM 4951 C C   . GLN D 2 27  ? -6.789  -46.782 43.162  1.00 57.30  ? 27  GLN L C   1 
ATOM 4952 O O   . GLN D 2 27  ? -6.870  -45.558 43.065  1.00 59.59  ? 27  GLN L O   1 
ATOM 4953 C CB  . GLN D 2 27  ? -6.146  -47.720 45.406  1.00 33.81  ? 27  GLN L CB  1 
ATOM 4954 C CG  . GLN D 2 27  ? -7.309  -48.685 45.507  1.00 37.14  ? 27  GLN L CG  1 
ATOM 4955 C CD  . GLN D 2 27  ? -7.773  -48.876 46.936  1.00 40.58  ? 27  GLN L CD  1 
ATOM 4956 O OE1 . GLN D 2 27  ? -6.964  -49.100 47.838  1.00 42.38  ? 27  GLN L OE1 1 
ATOM 4957 N NE2 . GLN D 2 27  ? -9.081  -48.776 47.153  1.00 41.00  ? 27  GLN L NE2 1 
ATOM 4958 N N   . SER D 2 28  ? -7.644  -47.605 42.560  1.00 48.72  ? 28  SER L N   1 
ATOM 4959 C CA  . SER D 2 28  ? -8.741  -47.062 41.766  1.00 42.40  ? 28  SER L CA  1 
ATOM 4960 C C   . SER D 2 28  ? -9.689  -46.253 42.644  1.00 42.84  ? 28  SER L C   1 
ATOM 4961 O O   . SER D 2 28  ? -10.268 -46.770 43.600  1.00 33.46  ? 28  SER L O   1 
ATOM 4962 C CB  . SER D 2 28  ? -9.508  -48.184 41.063  1.00 34.76  ? 28  SER L CB  1 
ATOM 4963 O OG  . SER D 2 28  ? -10.334 -47.665 40.036  1.00 34.39  ? 28  SER L OG  1 
ATOM 4964 N N   . VAL D 2 29  ? -9.821  -44.974 42.312  1.00 28.50  ? 29  VAL L N   1 
ATOM 4965 C CA  . VAL D 2 29  ? -10.789 -44.094 42.955  1.00 42.16  ? 29  VAL L CA  1 
ATOM 4966 C C   . VAL D 2 29  ? -12.030 -43.990 42.063  1.00 27.77  ? 29  VAL L C   1 
ATOM 4967 O O   . VAL D 2 29  ? -12.956 -43.226 42.348  1.00 27.40  ? 29  VAL L O   1 
ATOM 4968 C CB  . VAL D 2 29  ? -10.202 -42.685 43.230  1.00 59.66  ? 29  VAL L CB  1 
ATOM 4969 C CG1 . VAL D 2 29  ? -9.142  -42.738 44.336  1.00 60.85  ? 29  VAL L CG1 1 
ATOM 4970 C CG2 . VAL D 2 29  ? -9.624  -42.102 41.972  1.00 57.36  ? 29  VAL L CG2 1 
ATOM 4971 N N   . SER D 2 30  ? -12.012 -44.762 40.975  1.00 39.98  ? 30  SER L N   1 
ATOM 4972 C CA  . SER D 2 30  ? -12.983 -44.679 39.879  1.00 46.51  ? 30  SER L CA  1 
ATOM 4973 C C   . SER D 2 30  ? -12.956 -43.282 39.288  1.00 44.61  ? 30  SER L C   1 
ATOM 4974 O O   . SER D 2 30  ? -11.902 -42.789 38.906  1.00 47.57  ? 30  SER L O   1 
ATOM 4975 C CB  . SER D 2 30  ? -14.403 -45.026 40.334  1.00 44.04  ? 30  SER L CB  1 
ATOM 4976 O OG  . SER D 2 30  ? -15.009 -43.927 40.992  1.00 44.12  ? 30  SER L OG  1 
ATOM 4977 N N   . SER D 2 31  ? -14.122 -42.650 39.205  1.00 38.48  ? 31  SER L N   1 
ATOM 4978 C CA  . SER D 2 31  ? -14.202 -41.255 38.782  1.00 41.15  ? 31  SER L CA  1 
ATOM 4979 C C   . SER D 2 31  ? -14.285 -40.241 39.933  1.00 29.63  ? 31  SER L C   1 
ATOM 4980 O O   . SER D 2 31  ? -14.473 -39.055 39.667  1.00 34.37  ? 31  SER L O   1 
ATOM 4981 C CB  . SER D 2 31  ? -15.380 -41.046 37.814  1.00 46.40  ? 31  SER L CB  1 
ATOM 4982 O OG  . SER D 2 31  ? -16.581 -41.618 38.293  1.00 58.38  ? 31  SER L OG  1 
ATOM 4983 N N   . TYR D 2 32  ? -14.130 -40.650 41.195  1.00 32.05  ? 32  TYR L N   1 
ATOM 4984 C CA  . TYR D 2 32  ? -14.327 -39.646 42.235  1.00 33.76  ? 32  TYR L CA  1 
ATOM 4985 C C   . TYR D 2 32  ? -13.003 -38.920 42.354  1.00 32.97  ? 32  TYR L C   1 
ATOM 4986 O O   . TYR D 2 32  ? -12.064 -39.383 43.010  1.00 38.31  ? 32  TYR L O   1 
ATOM 4987 C CB  . TYR D 2 32  ? -14.693 -40.263 43.593  1.00 28.93  ? 32  TYR L CB  1 
ATOM 4988 C CG  . TYR D 2 32  ? -15.920 -41.145 43.625  1.00 29.36  ? 32  TYR L CG  1 
ATOM 4989 C CD1 . TYR D 2 32  ? -17.196 -40.619 43.782  1.00 37.50  ? 32  TYR L CD1 1 
ATOM 4990 C CD2 . TYR D 2 32  ? -15.791 -42.520 43.506  1.00 29.73  ? 32  TYR L CD2 1 
ATOM 4991 C CE1 . TYR D 2 32  ? -18.314 -41.457 43.810  1.00 38.43  ? 32  TYR L CE1 1 
ATOM 4992 C CE2 . TYR D 2 32  ? -16.885 -43.352 43.528  1.00 35.12  ? 32  TYR L CE2 1 
ATOM 4993 C CZ  . TYR D 2 32  ? -18.142 -42.824 43.680  1.00 38.05  ? 32  TYR L CZ  1 
ATOM 4994 O OH  . TYR D 2 32  ? -19.217 -43.679 43.699  1.00 47.23  ? 32  TYR L OH  1 
ATOM 4995 N N   . LEU D 2 33  ? -12.972 -37.737 41.750  1.00 23.52  ? 33  LEU L N   1 
ATOM 4996 C CA  . LEU D 2 33  ? -11.753 -36.960 41.644  1.00 23.17  ? 33  LEU L CA  1 
ATOM 4997 C C   . LEU D 2 33  ? -12.107 -35.507 41.382  1.00 42.28  ? 33  LEU L C   1 
ATOM 4998 O O   . LEU D 2 33  ? -13.062 -35.212 40.665  1.00 45.58  ? 33  LEU L O   1 
ATOM 4999 C CB  . LEU D 2 33  ? -10.869 -37.538 40.539  1.00 23.34  ? 33  LEU L CB  1 
ATOM 5000 C CG  . LEU D 2 33  ? -9.357  -37.322 40.490  1.00 23.25  ? 33  LEU L CG  1 
ATOM 5001 C CD1 . LEU D 2 33  ? -8.964  -35.901 40.148  1.00 23.20  ? 33  LEU L CD1 1 
ATOM 5002 C CD2 . LEU D 2 33  ? -8.773  -37.736 41.818  1.00 23.31  ? 33  LEU L CD2 1 
ATOM 5003 N N   . ALA D 2 34  ? -11.317 -34.599 41.931  1.00 42.23  ? 34  ALA L N   1 
ATOM 5004 C CA  . ALA D 2 34  ? -11.558 -33.189 41.711  1.00 27.39  ? 34  ALA L CA  1 
ATOM 5005 C C   . ALA D 2 34  ? -10.235 -32.484 41.519  1.00 32.39  ? 34  ALA L C   1 
ATOM 5006 O O   . ALA D 2 34  ? -9.190  -32.994 41.923  1.00 33.94  ? 34  ALA L O   1 
ATOM 5007 C CB  . ALA D 2 34  ? -12.329 -32.583 42.875  1.00 27.04  ? 34  ALA L CB  1 
ATOM 5008 N N   . TRP D 2 35  ? -10.281 -31.324 40.878  1.00 31.85  ? 35  TRP L N   1 
ATOM 5009 C CA  . TRP D 2 35  ? -9.111  -30.474 40.757  1.00 26.62  ? 35  TRP L CA  1 
ATOM 5010 C C   . TRP D 2 35  ? -9.433  -29.113 41.358  1.00 26.20  ? 35  TRP L C   1 
ATOM 5011 O O   . TRP D 2 35  ? -10.443 -28.504 41.024  1.00 26.29  ? 35  TRP L O   1 
ATOM 5012 C CB  . TRP D 2 35  ? -8.675  -30.339 39.296  1.00 27.00  ? 35  TRP L CB  1 
ATOM 5013 C CG  . TRP D 2 35  ? -8.023  -31.571 38.738  1.00 27.47  ? 35  TRP L CG  1 
ATOM 5014 C CD1 . TRP D 2 35  ? -8.636  -32.600 38.085  1.00 28.05  ? 35  TRP L CD1 1 
ATOM 5015 C CD2 . TRP D 2 35  ? -6.626  -31.889 38.769  1.00 27.52  ? 35  TRP L CD2 1 
ATOM 5016 N NE1 . TRP D 2 35  ? -7.709  -33.544 37.713  1.00 28.47  ? 35  TRP L NE1 1 
ATOM 5017 C CE2 . TRP D 2 35  ? -6.468  -33.132 38.120  1.00 28.15  ? 35  TRP L CE2 1 
ATOM 5018 C CE3 . TRP D 2 35  ? -5.495  -31.250 39.283  1.00 27.15  ? 35  TRP L CE3 1 
ATOM 5019 C CZ2 . TRP D 2 35  ? -5.225  -33.743 37.973  1.00 34.91  ? 35  TRP L CZ2 1 
ATOM 5020 C CZ3 . TRP D 2 35  ? -4.264  -31.859 39.136  1.00 27.41  ? 35  TRP L CZ3 1 
ATOM 5021 C CH2 . TRP D 2 35  ? -4.138  -33.093 38.488  1.00 28.06  ? 35  TRP L CH2 1 
ATOM 5022 N N   . TYR D 2 36  ? -8.566  -28.641 42.245  1.00 25.82  ? 36  TYR L N   1 
ATOM 5023 C CA  . TYR D 2 36  ? -8.752  -27.342 42.880  1.00 36.04  ? 36  TYR L CA  1 
ATOM 5024 C C   . TYR D 2 36  ? -7.671  -26.366 42.438  1.00 41.01  ? 36  TYR L C   1 
ATOM 5025 O O   . TYR D 2 36  ? -6.601  -26.768 41.995  1.00 47.73  ? 36  TYR L O   1 
ATOM 5026 C CB  . TYR D 2 36  ? -8.742  -27.458 44.407  1.00 25.23  ? 36  TYR L CB  1 
ATOM 5027 C CG  . TYR D 2 36  ? -9.889  -28.241 45.004  1.00 30.26  ? 36  TYR L CG  1 
ATOM 5028 C CD1 . TYR D 2 36  ? -9.900  -29.628 44.976  1.00 31.25  ? 36  TYR L CD1 1 
ATOM 5029 C CD2 . TYR D 2 36  ? -10.959 -27.591 45.608  1.00 29.82  ? 36  TYR L CD2 1 
ATOM 5030 C CE1 . TYR D 2 36  ? -10.944 -30.347 45.528  1.00 25.81  ? 36  TYR L CE1 1 
ATOM 5031 C CE2 . TYR D 2 36  ? -12.011 -28.305 46.164  1.00 25.55  ? 36  TYR L CE2 1 
ATOM 5032 C CZ  . TYR D 2 36  ? -11.997 -29.681 46.119  1.00 36.68  ? 36  TYR L CZ  1 
ATOM 5033 O OH  . TYR D 2 36  ? -13.034 -30.400 46.666  1.00 39.98  ? 36  TYR L OH  1 
ATOM 5034 N N   . GLN D 2 37  ? -7.976  -25.078 42.525  1.00 28.10  ? 37  GLN L N   1 
ATOM 5035 C CA  . GLN D 2 37  ? -7.001  -24.032 42.235  1.00 28.06  ? 37  GLN L CA  1 
ATOM 5036 C C   . GLN D 2 37  ? -6.722  -23.225 43.492  1.00 27.78  ? 37  GLN L C   1 
ATOM 5037 O O   . GLN D 2 37  ? -7.653  -22.825 44.193  1.00 61.74  ? 37  GLN L O   1 
ATOM 5038 C CB  . GLN D 2 37  ? -7.511  -23.116 41.126  1.00 31.03  ? 37  GLN L CB  1 
ATOM 5039 C CG  . GLN D 2 37  ? -6.543  -22.038 40.691  1.00 31.15  ? 37  GLN L CG  1 
ATOM 5040 C CD  . GLN D 2 37  ? -7.147  -21.142 39.636  1.00 31.56  ? 37  GLN L CD  1 
ATOM 5041 O OE1 . GLN D 2 37  ? -8.223  -20.575 39.833  1.00 30.76  ? 37  GLN L OE1 1 
ATOM 5042 N NE2 . GLN D 2 37  ? -6.475  -21.032 38.494  1.00 29.14  ? 37  GLN L NE2 1 
ATOM 5043 N N   . GLN D 2 38  ? -5.448  -23.002 43.796  1.00 28.40  ? 38  GLN L N   1 
ATOM 5044 C CA  . GLN D 2 38  ? -5.109  -22.162 44.934  1.00 31.59  ? 38  GLN L CA  1 
ATOM 5045 C C   . GLN D 2 38  ? -3.996  -21.174 44.613  1.00 29.49  ? 38  GLN L C   1 
ATOM 5046 O O   . GLN D 2 38  ? -2.870  -21.561 44.295  1.00 29.84  ? 38  GLN L O   1 
ATOM 5047 C CB  . GLN D 2 38  ? -4.712  -23.025 46.132  1.00 28.04  ? 38  GLN L CB  1 
ATOM 5048 C CG  . GLN D 2 38  ? -4.244  -22.235 47.343  1.00 27.94  ? 38  GLN L CG  1 
ATOM 5049 C CD  . GLN D 2 38  ? -3.997  -23.125 48.540  1.00 27.83  ? 38  GLN L CD  1 
ATOM 5050 O OE1 . GLN D 2 38  ? -3.132  -24.001 48.506  1.00 27.83  ? 38  GLN L OE1 1 
ATOM 5051 N NE2 . GLN D 2 38  ? -4.762  -22.914 49.605  1.00 27.83  ? 38  GLN L NE2 1 
ATOM 5052 N N   . LYS D 2 39  ? -4.331  -19.892 44.707  1.00 35.76  ? 39  LYS L N   1 
ATOM 5053 C CA  . LYS D 2 39  ? -3.351  -18.822 44.661  1.00 37.17  ? 39  LYS L CA  1 
ATOM 5054 C C   . LYS D 2 39  ? -2.887  -18.564 46.092  1.00 36.22  ? 39  LYS L C   1 
ATOM 5055 O O   . LYS D 2 39  ? -3.615  -18.876 47.037  1.00 40.54  ? 39  LYS L O   1 
ATOM 5056 C CB  . LYS D 2 39  ? -3.957  -17.567 44.025  1.00 39.40  ? 39  LYS L CB  1 
ATOM 5057 C CG  . LYS D 2 39  ? -4.031  -17.601 42.505  1.00 31.56  ? 39  LYS L CG  1 
ATOM 5058 C CD  . LYS D 2 39  ? -5.091  -16.650 41.978  1.00 31.88  ? 39  LYS L CD  1 
ATOM 5059 C CE  . LYS D 2 39  ? -6.483  -17.107 42.392  1.00 46.13  ? 39  LYS L CE  1 
ATOM 5060 N NZ  . LYS D 2 39  ? -7.549  -16.194 41.887  1.00 41.35  ? 39  LYS L NZ  1 
ATOM 5061 N N   . PRO D 2 40  ? -1.674  -18.010 46.263  1.00 36.21  ? 40  PRO L N   1 
ATOM 5062 C CA  . PRO D 2 40  ? -1.168  -17.768 47.619  1.00 39.27  ? 40  PRO L CA  1 
ATOM 5063 C C   . PRO D 2 40  ? -2.075  -16.835 48.418  1.00 30.83  ? 40  PRO L C   1 
ATOM 5064 O O   . PRO D 2 40  ? -2.647  -15.893 47.865  1.00 33.28  ? 40  PRO L O   1 
ATOM 5065 C CB  . PRO D 2 40  ? 0.200   -17.127 47.370  1.00 30.93  ? 40  PRO L CB  1 
ATOM 5066 C CG  . PRO D 2 40  ? 0.086   -16.526 46.012  1.00 31.18  ? 40  PRO L CG  1 
ATOM 5067 C CD  . PRO D 2 40  ? -0.740  -17.512 45.240  1.00 31.68  ? 40  PRO L CD  1 
ATOM 5068 N N   . GLY D 2 41  ? -2.222  -17.120 49.707  1.00 25.05  ? 41  GLY L N   1 
ATOM 5069 C CA  . GLY D 2 41  ? -3.075  -16.327 50.570  1.00 25.26  ? 41  GLY L CA  1 
ATOM 5070 C C   . GLY D 2 41  ? -4.555  -16.585 50.360  1.00 38.15  ? 41  GLY L C   1 
ATOM 5071 O O   . GLY D 2 41  ? -5.387  -16.071 51.109  1.00 40.78  ? 41  GLY L O   1 
ATOM 5072 N N   . GLN D 2 42  ? -4.899  -17.365 49.340  1.00 30.01  ? 42  GLN L N   1 
ATOM 5073 C CA  . GLN D 2 42  ? -6.305  -17.628 49.079  1.00 30.04  ? 42  GLN L CA  1 
ATOM 5074 C C   . GLN D 2 42  ? -6.738  -19.035 49.488  1.00 29.81  ? 42  GLN L C   1 
ATOM 5075 O O   . GLN D 2 42  ? -5.914  -19.884 49.837  1.00 29.61  ? 42  GLN L O   1 
ATOM 5076 C CB  . GLN D 2 42  ? -6.602  -17.394 47.597  1.00 33.31  ? 42  GLN L CB  1 
ATOM 5077 C CG  . GLN D 2 42  ? -6.355  -15.958 47.163  1.00 36.28  ? 42  GLN L CG  1 
ATOM 5078 C CD  . GLN D 2 42  ? -6.615  -15.735 45.688  1.00 41.39  ? 42  GLN L CD  1 
ATOM 5079 O OE1 . GLN D 2 42  ? -7.632  -16.178 45.154  1.00 45.59  ? 42  GLN L OE1 1 
ATOM 5080 N NE2 . GLN D 2 42  ? -5.707  -15.026 45.024  1.00 44.54  ? 42  GLN L NE2 1 
ATOM 5081 N N   . ALA D 2 43  ? -8.041  -19.276 49.404  1.00 43.63  ? 43  ALA L N   1 
ATOM 5082 C CA  . ALA D 2 43  ? -8.608  -20.585 49.682  1.00 26.40  ? 43  ALA L CA  1 
ATOM 5083 C C   . ALA D 2 43  ? -8.709  -21.382 48.392  1.00 33.46  ? 43  ALA L C   1 
ATOM 5084 O O   . ALA D 2 43  ? -8.876  -20.798 47.321  1.00 34.71  ? 43  ALA L O   1 
ATOM 5085 C CB  . ALA D 2 43  ? -9.971  -20.446 50.341  1.00 26.64  ? 43  ALA L CB  1 
ATOM 5086 N N   . PRO D 2 44  ? -8.606  -22.717 48.489  1.00 26.33  ? 44  PRO L N   1 
ATOM 5087 C CA  . PRO D 2 44  ? -8.742  -23.598 47.327  1.00 27.71  ? 44  PRO L CA  1 
ATOM 5088 C C   . PRO D 2 44  ? -10.017 -23.324 46.549  1.00 26.60  ? 44  PRO L C   1 
ATOM 5089 O O   . PRO D 2 44  ? -11.052 -22.991 47.128  1.00 26.74  ? 44  PRO L O   1 
ATOM 5090 C CB  . PRO D 2 44  ? -8.779  -24.992 47.950  1.00 26.34  ? 44  PRO L CB  1 
ATOM 5091 C CG  . PRO D 2 44  ? -7.962  -24.853 49.167  1.00 26.21  ? 44  PRO L CG  1 
ATOM 5092 C CD  . PRO D 2 44  ? -8.235  -23.471 49.699  1.00 26.24  ? 44  PRO L CD  1 
ATOM 5093 N N   . ARG D 2 45  ? -9.926  -23.459 45.236  1.00 25.34  ? 45  ARG L N   1 
ATOM 5094 C CA  . ARG D 2 45  ? -11.054 -23.198 44.367  1.00 25.63  ? 45  ARG L CA  1 
ATOM 5095 C C   . ARG D 2 45  ? -11.312 -24.394 43.503  1.00 40.61  ? 45  ARG L C   1 
ATOM 5096 O O   . ARG D 2 45  ? -10.495 -24.761 42.661  1.00 46.26  ? 45  ARG L O   1 
ATOM 5097 C CB  . ARG D 2 45  ? -10.807 -21.988 43.482  1.00 36.59  ? 45  ARG L CB  1 
ATOM 5098 C CG  . ARG D 2 45  ? -11.903 -21.762 42.461  1.00 37.71  ? 45  ARG L CG  1 
ATOM 5099 C CD  . ARG D 2 45  ? -11.408 -20.815 41.400  1.00 26.39  ? 45  ARG L CD  1 
ATOM 5100 N NE  . ARG D 2 45  ? -12.485 -20.190 40.647  1.00 34.11  ? 45  ARG L NE  1 
ATOM 5101 C CZ  . ARG D 2 45  ? -12.284 -19.365 39.625  1.00 39.82  ? 45  ARG L CZ  1 
ATOM 5102 N NH1 . ARG D 2 45  ? -11.049 -19.090 39.233  1.00 27.09  ? 45  ARG L NH1 1 
ATOM 5103 N NH2 . ARG D 2 45  ? -13.315 -18.820 38.993  1.00 45.36  ? 45  ARG L NH2 1 
ATOM 5104 N N   . LEU D 2 46  ? -12.463 -24.996 43.704  1.00 40.85  ? 46  LEU L N   1 
ATOM 5105 C CA  . LEU D 2 46  ? -12.781 -26.175 42.961  1.00 30.11  ? 46  LEU L CA  1 
ATOM 5106 C C   . LEU D 2 46  ? -13.090 -25.805 41.514  1.00 37.00  ? 46  LEU L C   1 
ATOM 5107 O O   . LEU D 2 46  ? -13.781 -24.826 41.230  1.00 35.50  ? 46  LEU L O   1 
ATOM 5108 C CB  . LEU D 2 46  ? -13.917 -26.890 43.648  1.00 30.28  ? 46  LEU L CB  1 
ATOM 5109 C CG  . LEU D 2 46  ? -14.596 -27.989 42.888  1.00 30.69  ? 46  LEU L CG  1 
ATOM 5110 C CD1 . LEU D 2 46  ? -13.694 -29.129 42.557  1.00 45.22  ? 46  LEU L CD1 1 
ATOM 5111 C CD2 . LEU D 2 46  ? -15.619 -28.446 43.818  1.00 42.13  ? 46  LEU L CD2 1 
ATOM 5112 N N   . LEU D 2 47  ? -12.517 -26.592 40.613  1.00 37.78  ? 47  LEU L N   1 
ATOM 5113 C CA  . LEU D 2 47  ? -12.556 -26.346 39.182  1.00 34.70  ? 47  LEU L CA  1 
ATOM 5114 C C   . LEU D 2 47  ? -13.331 -27.473 38.512  1.00 31.73  ? 47  LEU L C   1 
ATOM 5115 O O   . LEU D 2 47  ? -14.308 -27.245 37.811  1.00 47.66  ? 47  LEU L O   1 
ATOM 5116 C CB  . LEU D 2 47  ? -11.142 -26.227 38.612  1.00 34.06  ? 47  LEU L CB  1 
ATOM 5117 C CG  . LEU D 2 47  ? -10.291 -25.095 39.190  1.00 30.83  ? 47  LEU L CG  1 
ATOM 5118 C CD1 . LEU D 2 47  ? -8.866  -25.219 38.684  1.00 30.85  ? 47  LEU L CD1 1 
ATOM 5119 C CD2 . LEU D 2 47  ? -10.890 -23.755 38.818  1.00 37.91  ? 47  LEU L CD2 1 
ATOM 5120 N N   . ILE D 2 48  ? -12.860 -28.696 38.698  1.00 32.93  ? 48  ILE L N   1 
ATOM 5121 C CA  . ILE D 2 48  ? -13.510 -29.857 38.116  1.00 33.46  ? 48  ILE L CA  1 
ATOM 5122 C C   . ILE D 2 48  ? -13.989 -30.897 39.187  1.00 33.43  ? 48  ILE L C   1 
ATOM 5123 O O   . ILE D 2 48  ? -13.215 -31.202 40.079  1.00 33.09  ? 48  ILE L O   1 
ATOM 5124 C CB  . ILE D 2 48  ? -12.522 -30.495 37.129  1.00 36.84  ? 48  ILE L CB  1 
ATOM 5125 C CG1 . ILE D 2 48  ? -12.147 -29.522 36.004  1.00 38.01  ? 48  ILE L CG1 1 
ATOM 5126 C CG2 . ILE D 2 48  ? -13.117 -31.625 36.505  1.00 34.42  ? 48  ILE L CG2 1 
ATOM 5127 C CD1 . ILE D 2 48  ? -13.331 -29.075 35.183  1.00 34.40  ? 48  ILE L CD1 1 
ATOM 5128 N N   . TYR D 2 49  ? -15.229 -31.431 39.128  1.00 35.10  ? 49  TYR L N   1 
ATOM 5129 C CA  . TYR D 2 49  ? -15.600 -32.589 40.006  1.00 35.24  ? 49  TYR L CA  1 
ATOM 5130 C C   . TYR D 2 49  ? -15.869 -33.866 39.220  1.00 35.94  ? 49  TYR L C   1 
ATOM 5131 O O   . TYR D 2 49  ? -16.232 -33.828 38.033  1.00 36.46  ? 49  TYR L O   1 
ATOM 5132 C CB  . TYR D 2 49  ? -16.815 -32.307 40.928  1.00 36.66  ? 49  TYR L CB  1 
ATOM 5133 C CG  . TYR D 2 49  ? -18.199 -32.191 40.317  1.00 46.75  ? 49  TYR L CG  1 
ATOM 5134 C CD1 . TYR D 2 49  ? -19.287 -32.999 40.734  1.00 58.99  ? 49  TYR L CD1 1 
ATOM 5135 C CD2 . TYR D 2 49  ? -18.414 -31.346 39.251  1.00 40.78  ? 49  TYR L CD2 1 
ATOM 5136 C CE1 . TYR D 2 49  ? -20.576 -32.835 40.154  1.00 64.78  ? 49  TYR L CE1 1 
ATOM 5137 C CE2 . TYR D 2 49  ? -19.691 -31.182 38.709  1.00 47.37  ? 49  TYR L CE2 1 
ATOM 5138 C CZ  . TYR D 2 49  ? -20.756 -31.953 39.126  1.00 64.43  ? 49  TYR L CZ  1 
ATOM 5139 O OH  . TYR D 2 49  ? -22.019 -31.814 38.522  1.00 73.24  ? 49  TYR L OH  1 
ATOM 5140 N N   . ASP D 2 50  ? -15.659 -34.993 39.907  1.00 48.21  ? 50  ASP L N   1 
ATOM 5141 C CA  . ASP D 2 50  ? -16.085 -36.296 39.418  1.00 50.44  ? 50  ASP L CA  1 
ATOM 5142 C C   . ASP D 2 50  ? -15.515 -36.474 38.023  1.00 32.83  ? 50  ASP L C   1 
ATOM 5143 O O   . ASP D 2 50  ? -16.269 -36.576 37.062  1.00 33.40  ? 50  ASP L O   1 
ATOM 5144 C CB  . ASP D 2 50  ? -17.626 -36.420 39.439  1.00 32.83  ? 50  ASP L CB  1 
ATOM 5145 C CG  . ASP D 2 50  ? -18.210 -36.478 40.864  1.00 44.09  ? 50  ASP L CG  1 
ATOM 5146 O OD1 . ASP D 2 50  ? -17.614 -37.123 41.751  1.00 45.95  ? 50  ASP L OD1 1 
ATOM 5147 O OD2 . ASP D 2 50  ? -19.298 -35.905 41.088  1.00 46.00  ? 50  ASP L OD2 1 
ATOM 5148 N N   . ALA D 2 51  ? -14.188 -36.422 37.907  1.00 30.20  ? 51  ALA L N   1 
ATOM 5149 C CA  . ALA D 2 51  ? -13.554 -36.494 36.592  1.00 30.64  ? 51  ALA L CA  1 
ATOM 5150 C C   . ALA D 2 51  ? -13.983 -35.340 35.686  1.00 30.60  ? 51  ALA L C   1 
ATOM 5151 O O   . ALA D 2 51  ? -13.459 -34.260 35.819  1.00 30.04  ? 51  ALA L O   1 
ATOM 5152 C CB  . ALA D 2 51  ? -13.835 -37.835 35.924  1.00 56.94  ? 51  ALA L CB  1 
ATOM 5153 N N   . SER D 2 52  ? -14.815 -35.613 34.686  1.00 31.46  ? 52  SER L N   1 
ATOM 5154 C CA  . SER D 2 52  ? -15.219 -34.628 33.673  1.00 31.62  ? 52  SER L CA  1 
ATOM 5155 C C   . SER D 2 52  ? -15.801 -33.271 34.133  1.00 31.03  ? 52  SER L C   1 
ATOM 5156 O O   . SER D 2 52  ? -15.338 -32.227 33.678  1.00 30.82  ? 52  SER L O   1 
ATOM 5157 C CB  . SER D 2 52  ? -16.235 -35.282 32.728  1.00 47.60  ? 52  SER L CB  1 
ATOM 5158 O OG  . SER D 2 52  ? -16.593 -34.384 31.702  1.00 49.80  ? 52  SER L OG  1 
ATOM 5159 N N   . ASN D 2 53  ? -16.829 -33.275 34.974  1.00 30.73  ? 53  ASN L N   1 
ATOM 5160 C CA  . ASN D 2 53  ? -17.677 -32.089 35.131  1.00 30.51  ? 53  ASN L CA  1 
ATOM 5161 C C   . ASN D 2 53  ? -16.998 -30.756 35.553  1.00 45.14  ? 53  ASN L C   1 
ATOM 5162 O O   . ASN D 2 53  ? -16.128 -30.735 36.421  1.00 45.18  ? 53  ASN L O   1 
ATOM 5163 C CB  . ASN D 2 53  ? -18.741 -32.374 36.157  1.00 30.47  ? 53  ASN L CB  1 
ATOM 5164 C CG  . ASN D 2 53  ? -19.514 -33.652 35.923  1.00 31.19  ? 53  ASN L CG  1 
ATOM 5165 O OD1 . ASN D 2 53  ? -19.227 -34.434 35.024  1.00 64.47  ? 53  ASN L OD1 1 
ATOM 5166 N ND2 . ASN D 2 53  ? -20.468 -33.907 36.812  1.00 31.24  ? 53  ASN L ND2 1 
ATOM 5167 N N   . ARG D 2 54  ? -17.450 -29.640 34.974  1.00 33.77  ? 54  ARG L N   1 
ATOM 5168 C CA  . ARG D 2 54  ? -16.832 -28.313 35.187  1.00 33.28  ? 54  ARG L CA  1 
ATOM 5169 C C   . ARG D 2 54  ? -17.517 -27.432 36.196  1.00 32.94  ? 54  ARG L C   1 
ATOM 5170 O O   . ARG D 2 54  ? -18.736 -27.462 36.305  1.00 54.55  ? 54  ARG L O   1 
ATOM 5171 C CB  . ARG D 2 54  ? -16.784 -27.519 33.883  1.00 33.71  ? 54  ARG L CB  1 
ATOM 5172 C CG  . ARG D 2 54  ? -16.034 -28.117 32.740  1.00 66.08  ? 54  ARG L CG  1 
ATOM 5173 C CD  . ARG D 2 54  ? -15.833 -27.105 31.609  1.00 59.94  ? 54  ARG L CD  1 
ATOM 5174 N NE  . ARG D 2 54  ? -17.092 -26.669 31.008  1.00 52.03  ? 54  ARG L NE  1 
ATOM 5175 C CZ  . ARG D 2 54  ? -17.804 -25.617 31.410  1.00 50.98  ? 54  ARG L CZ  1 
ATOM 5176 N NH1 . ARG D 2 54  ? -17.373 -24.850 32.404  1.00 49.69  ? 54  ARG L NH1 1 
ATOM 5177 N NH2 . ARG D 2 54  ? -18.941 -25.314 30.795  1.00 55.71  ? 54  ARG L NH2 1 
ATOM 5178 N N   . ALA D 2 55  ? -16.759 -26.633 36.934  1.00 58.76  ? 55  ALA L N   1 
ATOM 5179 C CA  . ALA D 2 55  ? -17.433 -25.956 38.026  1.00 47.08  ? 55  ALA L CA  1 
ATOM 5180 C C   . ALA D 2 55  ? -18.355 -24.833 37.580  1.00 47.96  ? 55  ALA L C   1 
ATOM 5181 O O   . ALA D 2 55  ? -18.272 -24.328 36.451  1.00 50.31  ? 55  ALA L O   1 
ATOM 5182 C CB  . ALA D 2 55  ? -16.441 -25.447 39.043  1.00 31.07  ? 55  ALA L CB  1 
ATOM 5183 N N   . THR D 2 56  ? -19.250 -24.486 38.504  1.00 40.24  ? 56  THR L N   1 
ATOM 5184 C CA  . THR D 2 56  ? -20.139 -23.361 38.330  1.00 43.01  ? 56  THR L CA  1 
ATOM 5185 C C   . THR D 2 56  ? -19.267 -22.146 38.122  1.00 42.84  ? 56  THR L C   1 
ATOM 5186 O O   . THR D 2 56  ? -18.369 -21.848 38.920  1.00 47.16  ? 56  THR L O   1 
ATOM 5187 C CB  . THR D 2 56  ? -21.099 -23.168 39.524  1.00 43.14  ? 56  THR L CB  1 
ATOM 5188 O OG1 . THR D 2 56  ? -22.302 -23.905 39.274  1.00 34.26  ? 56  THR L OG1 1 
ATOM 5189 C CG2 . THR D 2 56  ? -21.452 -21.696 39.699  1.00 44.14  ? 56  THR L CG2 1 
ATOM 5190 N N   . GLY D 2 57  ? -19.547 -21.472 37.014  1.00 46.26  ? 57  GLY L N   1 
ATOM 5191 C CA  . GLY D 2 57  ? -18.836 -20.285 36.606  1.00 45.73  ? 57  GLY L CA  1 
ATOM 5192 C C   . GLY D 2 57  ? -17.357 -20.511 36.391  1.00 43.61  ? 57  GLY L C   1 
ATOM 5193 O O   . GLY D 2 57  ? -16.570 -19.579 36.534  1.00 40.44  ? 57  GLY L O   1 
ATOM 5194 N N   . ILE D 2 58  ? -16.963 -21.736 36.066  1.00 44.14  ? 58  ILE L N   1 
ATOM 5195 C CA  . ILE D 2 58  ? -15.574 -21.985 35.717  1.00 44.62  ? 58  ILE L CA  1 
ATOM 5196 C C   . ILE D 2 58  ? -15.455 -22.186 34.217  1.00 48.37  ? 58  ILE L C   1 
ATOM 5197 O O   . ILE D 2 58  ? -15.954 -23.171 33.672  1.00 50.11  ? 58  ILE L O   1 
ATOM 5198 C CB  . ILE D 2 58  ? -15.009 -23.181 36.478  1.00 30.34  ? 58  ILE L CB  1 
ATOM 5199 C CG1 . ILE D 2 58  ? -14.956 -22.837 37.963  1.00 29.82  ? 58  ILE L CG1 1 
ATOM 5200 C CG2 . ILE D 2 58  ? -13.620 -23.537 35.972  1.00 32.10  ? 58  ILE L CG2 1 
ATOM 5201 C CD1 . ILE D 2 58  ? -14.152 -21.680 38.296  1.00 29.59  ? 58  ILE L CD1 1 
ATOM 5202 N N   . PRO D 2 59  ? -14.774 -21.241 33.552  1.00 30.45  ? 59  PRO L N   1 
ATOM 5203 C CA  . PRO D 2 59  ? -14.713 -21.073 32.097  1.00 46.12  ? 59  PRO L CA  1 
ATOM 5204 C C   . PRO D 2 59  ? -14.378 -22.357 31.337  1.00 39.07  ? 59  PRO L C   1 
ATOM 5205 O O   . PRO D 2 59  ? -13.671 -23.229 31.848  1.00 36.11  ? 59  PRO L O   1 
ATOM 5206 C CB  . PRO D 2 59  ? -13.607 -20.037 31.930  1.00 52.30  ? 59  PRO L CB  1 
ATOM 5207 C CG  . PRO D 2 59  ? -13.751 -19.182 33.143  1.00 54.55  ? 59  PRO L CG  1 
ATOM 5208 C CD  . PRO D 2 59  ? -14.063 -20.155 34.253  1.00 30.09  ? 59  PRO L CD  1 
ATOM 5209 N N   . ALA D 2 60  ? -14.900 -22.455 30.117  1.00 31.12  ? 60  ALA L N   1 
ATOM 5210 C CA  . ALA D 2 60  ? -14.761 -23.645 29.284  1.00 31.57  ? 60  ALA L CA  1 
ATOM 5211 C C   . ALA D 2 60  ? -13.307 -23.980 28.973  1.00 31.50  ? 60  ALA L C   1 
ATOM 5212 O O   . ALA D 2 60  ? -13.000 -25.073 28.493  1.00 39.69  ? 60  ALA L O   1 
ATOM 5213 C CB  . ALA D 2 60  ? -15.537 -23.464 27.998  1.00 32.49  ? 60  ALA L CB  1 
ATOM 5214 N N   . ARG D 2 61  ? -12.416 -23.033 29.249  1.00 34.68  ? 61  ARG L N   1 
ATOM 5215 C CA  . ARG D 2 61  ? -10.987 -23.243 29.067  1.00 40.58  ? 61  ARG L CA  1 
ATOM 5216 C C   . ARG D 2 61  ? -10.465 -24.325 30.012  1.00 40.19  ? 61  ARG L C   1 
ATOM 5217 O O   . ARG D 2 61  ? -9.361  -24.832 29.836  1.00 37.78  ? 61  ARG L O   1 
ATOM 5218 C CB  . ARG D 2 61  ? -10.220 -21.942 29.302  1.00 46.43  ? 61  ARG L CB  1 
ATOM 5219 C CG  . ARG D 2 61  ? -11.078 -20.689 29.250  1.00 52.09  ? 61  ARG L CG  1 
ATOM 5220 C CD  . ARG D 2 61  ? -10.257 -19.446 29.561  1.00 53.01  ? 61  ARG L CD  1 
ATOM 5221 N NE  . ARG D 2 61  ? -9.752  -19.449 30.930  1.00 47.57  ? 61  ARG L NE  1 
ATOM 5222 C CZ  . ARG D 2 61  ? -8.516  -19.792 31.269  1.00 55.38  ? 61  ARG L CZ  1 
ATOM 5223 N NH1 . ARG D 2 61  ? -7.649  -20.180 30.346  1.00 70.80  ? 61  ARG L NH1 1 
ATOM 5224 N NH2 . ARG D 2 61  ? -8.155  -19.759 32.536  1.00 51.53  ? 61  ARG L NH2 1 
ATOM 5225 N N   . PHE D 2 62  ? -11.257 -24.670 31.022  1.00 41.62  ? 62  PHE L N   1 
ATOM 5226 C CA  . PHE D 2 62  ? -10.864 -25.691 31.985  1.00 36.70  ? 62  PHE L CA  1 
ATOM 5227 C C   . PHE D 2 62  ? -11.531 -27.014 31.685  1.00 34.78  ? 62  PHE L C   1 
ATOM 5228 O O   . PHE D 2 62  ? -12.735 -27.076 31.469  1.00 33.38  ? 62  PHE L O   1 
ATOM 5229 C CB  . PHE D 2 62  ? -11.203 -25.253 33.405  1.00 31.99  ? 62  PHE L CB  1 
ATOM 5230 C CG  . PHE D 2 62  ? -10.300 -24.190 33.931  1.00 31.58  ? 62  PHE L CG  1 
ATOM 5231 C CD1 . PHE D 2 62  ? -9.237  -24.513 34.753  1.00 31.12  ? 62  PHE L CD1 1 
ATOM 5232 C CD2 . PHE D 2 62  ? -10.506 -22.867 33.596  1.00 47.66  ? 62  PHE L CD2 1 
ATOM 5233 C CE1 . PHE D 2 62  ? -8.398  -23.531 35.237  1.00 39.65  ? 62  PHE L CE1 1 
ATOM 5234 C CE2 . PHE D 2 62  ? -9.677  -21.889 34.074  1.00 47.50  ? 62  PHE L CE2 1 
ATOM 5235 C CZ  . PHE D 2 62  ? -8.619  -22.217 34.896  1.00 30.97  ? 62  PHE L CZ  1 
ATOM 5236 N N   . SER D 2 63  ? -10.746 -28.080 31.685  1.00 34.96  ? 63  SER L N   1 
ATOM 5237 C CA  . SER D 2 63  ? -11.306 -29.399 31.454  1.00 37.33  ? 63  SER L CA  1 
ATOM 5238 C C   . SER D 2 63  ? -10.486 -30.484 32.125  1.00 39.86  ? 63  SER L C   1 
ATOM 5239 O O   . SER D 2 63  ? -9.434  -30.224 32.709  1.00 42.29  ? 63  SER L O   1 
ATOM 5240 C CB  . SER D 2 63  ? -11.401 -29.677 29.953  1.00 35.16  ? 63  SER L CB  1 
ATOM 5241 O OG  . SER D 2 63  ? -10.114 -29.694 29.362  1.00 44.46  ? 63  SER L OG  1 
ATOM 5242 N N   . GLY D 2 64  ? -10.983 -31.709 32.044  1.00 41.54  ? 64  GLY L N   1 
ATOM 5243 C CA  . GLY D 2 64  ? -10.220 -32.844 32.502  1.00 41.77  ? 64  GLY L CA  1 
ATOM 5244 C C   . GLY D 2 64  ? -10.962 -34.156 32.416  1.00 43.62  ? 64  GLY L C   1 
ATOM 5245 O O   . GLY D 2 64  ? -12.191 -34.186 32.454  1.00 40.60  ? 64  GLY L O   1 
ATOM 5246 N N   . SER D 2 65  ? -10.210 -35.250 32.354  1.00 48.14  ? 65  SER L N   1 
ATOM 5247 C CA  . SER D 2 65  ? -10.819 -36.571 32.328  1.00 48.86  ? 65  SER L CA  1 
ATOM 5248 C C   . SER D 2 65  ? -9.854  -37.670 32.756  1.00 36.82  ? 65  SER L C   1 
ATOM 5249 O O   . SER D 2 65  ? -8.636  -37.490 32.754  1.00 36.68  ? 65  SER L O   1 
ATOM 5250 C CB  . SER D 2 65  ? -11.373 -36.879 30.934  1.00 48.94  ? 65  SER L CB  1 
ATOM 5251 O OG  . SER D 2 65  ? -12.078 -38.109 30.934  1.00 48.85  ? 65  SER L OG  1 
ATOM 5252 N N   . GLY D 2 66  ? -10.428 -38.810 33.119  1.00 37.33  ? 66  GLY L N   1 
ATOM 5253 C CA  . GLY D 2 66  ? -9.677  -39.974 33.538  1.00 37.72  ? 66  GLY L CA  1 
ATOM 5254 C C   . GLY D 2 66  ? -10.559 -40.876 34.373  1.00 48.13  ? 66  GLY L C   1 
ATOM 5255 O O   . GLY D 2 66  ? -11.681 -40.511 34.717  1.00 56.16  ? 66  GLY L O   1 
ATOM 5256 N N   . SER D 2 67  ? -10.053 -42.063 34.684  1.00 51.64  ? 67  SER L N   1 
ATOM 5257 C CA  . SER D 2 67  ? -10.752 -43.015 35.539  1.00 51.17  ? 67  SER L CA  1 
ATOM 5258 C C   . SER D 2 67  ? -9.714  -43.953 36.141  1.00 59.26  ? 67  SER L C   1 
ATOM 5259 O O   . SER D 2 67  ? -8.574  -44.001 35.665  1.00 60.69  ? 67  SER L O   1 
ATOM 5260 C CB  . SER D 2 67  ? -11.819 -43.787 34.754  1.00 57.38  ? 67  SER L CB  1 
ATOM 5261 O OG  . SER D 2 67  ? -12.583 -44.624 35.606  1.00 60.92  ? 67  SER L OG  1 
ATOM 5262 N N   . GLY D 2 68  ? -10.090 -44.677 37.190  1.00 59.69  ? 68  GLY L N   1 
ATOM 5263 C CA  . GLY D 2 68  ? -9.151  -45.580 37.815  1.00 60.07  ? 68  GLY L CA  1 
ATOM 5264 C C   . GLY D 2 68  ? -7.990  -44.808 38.418  1.00 50.43  ? 68  GLY L C   1 
ATOM 5265 O O   . GLY D 2 68  ? -8.164  -43.987 39.325  1.00 48.00  ? 68  GLY L O   1 
ATOM 5266 N N   . THR D 2 69  ? -6.788  -45.149 37.959  1.00 55.44  ? 69  THR L N   1 
ATOM 5267 C CA  . THR D 2 69  ? -5.544  -44.543 38.435  1.00 53.89  ? 69  THR L CA  1 
ATOM 5268 C C   . THR D 2 69  ? -5.221  -43.164 37.809  1.00 48.36  ? 69  THR L C   1 
ATOM 5269 O O   . THR D 2 69  ? -4.846  -42.247 38.540  1.00 47.40  ? 69  THR L O   1 
ATOM 5270 C CB  . THR D 2 69  ? -4.341  -45.506 38.193  1.00 68.20  ? 69  THR L CB  1 
ATOM 5271 O OG1 . THR D 2 69  ? -4.552  -46.723 38.923  1.00 65.72  ? 69  THR L OG1 1 
ATOM 5272 C CG2 . THR D 2 69  ? -3.040  -44.875 38.650  1.00 70.36  ? 69  THR L CG2 1 
ATOM 5273 N N   . ASP D 2 70  ? -5.375  -42.995 36.492  1.00 46.43  ? 70  ASP L N   1 
ATOM 5274 C CA  . ASP D 2 70  ? -4.956  -41.741 35.837  1.00 50.83  ? 70  ASP L CA  1 
ATOM 5275 C C   . ASP D 2 70  ? -6.063  -40.704 35.623  1.00 39.74  ? 70  ASP L C   1 
ATOM 5276 O O   . ASP D 2 70  ? -7.169  -41.029 35.197  1.00 40.12  ? 70  ASP L O   1 
ATOM 5277 C CB  . ASP D 2 70  ? -4.301  -42.034 34.483  1.00 57.74  ? 70  ASP L CB  1 
ATOM 5278 C CG  . ASP D 2 70  ? -3.012  -42.820 34.612  1.00 66.73  ? 70  ASP L CG  1 
ATOM 5279 O OD1 . ASP D 2 70  ? -2.159  -42.720 33.702  1.00 68.52  ? 70  ASP L OD1 1 
ATOM 5280 O OD2 . ASP D 2 70  ? -2.856  -43.539 35.619  1.00 67.40  ? 70  ASP L OD2 1 
ATOM 5281 N N   . PHE D 2 71  ? -5.739  -39.446 35.921  1.00 39.40  ? 71  PHE L N   1 
ATOM 5282 C CA  . PHE D 2 71  ? -6.652  -38.317 35.730  1.00 35.85  ? 71  PHE L CA  1 
ATOM 5283 C C   . PHE D 2 71  ? -5.887  -37.116 35.192  1.00 35.52  ? 71  PHE L C   1 
ATOM 5284 O O   . PHE D 2 71  ? -4.793  -36.812 35.662  1.00 35.19  ? 71  PHE L O   1 
ATOM 5285 C CB  . PHE D 2 71  ? -7.346  -37.931 37.038  1.00 35.06  ? 71  PHE L CB  1 
ATOM 5286 C CG  . PHE D 2 71  ? -8.165  -39.026 37.628  1.00 35.40  ? 71  PHE L CG  1 
ATOM 5287 C CD1 . PHE D 2 71  ? -7.557  -40.053 38.322  1.00 39.70  ? 71  PHE L CD1 1 
ATOM 5288 C CD2 . PHE D 2 71  ? -9.538  -39.043 37.478  1.00 40.63  ? 71  PHE L CD2 1 
ATOM 5289 C CE1 . PHE D 2 71  ? -8.292  -41.066 38.857  1.00 36.09  ? 71  PHE L CE1 1 
ATOM 5290 C CE2 . PHE D 2 71  ? -10.281 -40.062 38.020  1.00 35.92  ? 71  PHE L CE2 1 
ATOM 5291 C CZ  . PHE D 2 71  ? -9.651  -41.073 38.708  1.00 36.21  ? 71  PHE L CZ  1 
ATOM 5292 N N   . THR D 2 72  ? -6.462  -36.421 34.219  1.00 31.22  ? 72  THR L N   1 
ATOM 5293 C CA  . THR D 2 72  ? -5.752  -35.318 33.584  1.00 31.07  ? 72  THR L CA  1 
ATOM 5294 C C   . THR D 2 72  ? -6.544  -34.018 33.545  1.00 30.53  ? 72  THR L C   1 
ATOM 5295 O O   . THR D 2 72  ? -7.538  -33.926 32.842  1.00 30.86  ? 72  THR L O   1 
ATOM 5296 C CB  . THR D 2 72  ? -5.360  -35.693 32.144  1.00 32.04  ? 72  THR L CB  1 
ATOM 5297 O OG1 . THR D 2 72  ? -4.376  -36.734 32.173  1.00 55.99  ? 72  THR L OG1 1 
ATOM 5298 C CG2 . THR D 2 72  ? -4.808  -34.493 31.405  1.00 31.98  ? 72  THR L CG2 1 
ATOM 5299 N N   . LEU D 2 73  ? -6.088  -33.011 34.284  1.00 29.79  ? 73  LEU L N   1 
ATOM 5300 C CA  . LEU D 2 73  ? -6.662  -31.668 34.195  1.00 29.39  ? 73  LEU L CA  1 
ATOM 5301 C C   . LEU D 2 73  ? -6.043  -30.953 33.003  1.00 35.40  ? 73  LEU L C   1 
ATOM 5302 O O   . LEU D 2 73  ? -4.848  -31.100 32.755  1.00 35.99  ? 73  LEU L O   1 
ATOM 5303 C CB  . LEU D 2 73  ? -6.417  -30.869 35.481  1.00 28.55  ? 73  LEU L CB  1 
ATOM 5304 C CG  . LEU D 2 73  ? -6.888  -29.411 35.507  1.00 28.17  ? 73  LEU L CG  1 
ATOM 5305 C CD1 . LEU D 2 73  ? -8.399  -29.342 35.609  1.00 36.90  ? 73  LEU L CD1 1 
ATOM 5306 C CD2 . LEU D 2 73  ? -6.243  -28.642 36.653  1.00 35.07  ? 73  LEU L CD2 1 
ATOM 5307 N N   . THR D 2 74  ? -6.841  -30.190 32.259  1.00 36.94  ? 74  THR L N   1 
ATOM 5308 C CA  . THR D 2 74  ? -6.307  -29.479 31.099  1.00 30.54  ? 74  THR L CA  1 
ATOM 5309 C C   . THR D 2 74  ? -6.845  -28.046 30.973  1.00 30.29  ? 74  THR L C   1 
ATOM 5310 O O   . THR D 2 74  ? -8.056  -27.820 30.971  1.00 61.97  ? 74  THR L O   1 
ATOM 5311 C CB  . THR D 2 74  ? -6.600  -30.248 29.783  1.00 33.48  ? 74  THR L CB  1 
ATOM 5312 O OG1 . THR D 2 74  ? -6.495  -31.659 30.013  1.00 34.44  ? 74  THR L OG1 1 
ATOM 5313 C CG2 . THR D 2 74  ? -5.613  -29.844 28.698  1.00 33.30  ? 74  THR L CG2 1 
ATOM 5314 N N   . ILE D 2 75  ? -5.923  -27.091 30.865  1.00 30.09  ? 75  ILE L N   1 
ATOM 5315 C CA  . ILE D 2 75  ? -6.240  -25.680 30.651  1.00 30.01  ? 75  ILE L CA  1 
ATOM 5316 C C   . ILE D 2 75  ? -5.900  -25.302 29.209  1.00 40.50  ? 75  ILE L C   1 
ATOM 5317 O O   . ILE D 2 75  ? -4.733  -25.380 28.811  1.00 47.79  ? 75  ILE L O   1 
ATOM 5318 C CB  . ILE D 2 75  ? -5.455  -24.773 31.634  1.00 29.38  ? 75  ILE L CB  1 
ATOM 5319 C CG1 . ILE D 2 75  ? -5.878  -25.048 33.083  1.00 33.96  ? 75  ILE L CG1 1 
ATOM 5320 C CG2 . ILE D 2 75  ? -5.657  -23.305 31.295  1.00 29.47  ? 75  ILE L CG2 1 
ATOM 5321 C CD1 . ILE D 2 75  ? -5.071  -24.273 34.113  1.00 35.14  ? 75  ILE L CD1 1 
ATOM 5322 N N   . SER D 2 76  ? -6.908  -24.937 28.418  1.00 44.66  ? 76  SER L N   1 
ATOM 5323 C CA  . SER D 2 76  ? -6.686  -24.659 26.996  1.00 39.38  ? 76  SER L CA  1 
ATOM 5324 C C   . SER D 2 76  ? -5.712  -23.526 26.693  1.00 48.62  ? 76  SER L C   1 
ATOM 5325 O O   . SER D 2 76  ? -4.557  -23.754 26.328  1.00 60.58  ? 76  SER L O   1 
ATOM 5326 C CB  . SER D 2 76  ? -8.017  -24.335 26.327  1.00 35.06  ? 76  SER L CB  1 
ATOM 5327 O OG  . SER D 2 76  ? -8.939  -25.394 26.520  1.00 51.53  ? 76  SER L OG  1 
ATOM 5328 N N   . SER D 2 77  ? -6.189  -22.302 26.888  1.00 41.63  ? 77  SER L N   1 
ATOM 5329 C CA  . SER D 2 77  ? -5.375  -21.128 26.654  1.00 42.01  ? 77  SER L CA  1 
ATOM 5330 C C   . SER D 2 77  ? -4.968  -20.667 28.026  1.00 48.15  ? 77  SER L C   1 
ATOM 5331 O O   . SER D 2 77  ? -5.793  -20.585 28.934  1.00 51.32  ? 77  SER L O   1 
ATOM 5332 C CB  . SER D 2 77  ? -6.124  -20.034 25.873  1.00 40.20  ? 77  SER L CB  1 
ATOM 5333 O OG  . SER D 2 77  ? -6.865  -19.170 26.714  1.00 39.73  ? 77  SER L OG  1 
ATOM 5334 N N   . LEU D 2 78  ? -3.682  -20.416 28.197  1.00 57.19  ? 78  LEU L N   1 
ATOM 5335 C CA  . LEU D 2 78  ? -3.200  -20.018 29.497  1.00 54.65  ? 78  LEU L CA  1 
ATOM 5336 C C   . LEU D 2 78  ? -3.507  -18.544 29.664  1.00 48.09  ? 78  LEU L C   1 
ATOM 5337 O O   . LEU D 2 78  ? -3.320  -17.751 28.738  1.00 49.48  ? 78  LEU L O   1 
ATOM 5338 C CB  . LEU D 2 78  ? -1.709  -20.302 29.641  1.00 56.26  ? 78  LEU L CB  1 
ATOM 5339 C CG  . LEU D 2 78  ? -1.194  -20.329 31.075  1.00 55.51  ? 78  LEU L CG  1 
ATOM 5340 C CD1 . LEU D 2 78  ? -2.134  -21.144 31.953  1.00 43.41  ? 78  LEU L CD1 1 
ATOM 5341 C CD2 . LEU D 2 78  ? 0.200   -20.912 31.097  1.00 59.92  ? 78  LEU L CD2 1 
ATOM 5342 N N   . GLU D 2 79  ? -4.019  -18.189 30.833  1.00 41.26  ? 79  GLU L N   1 
ATOM 5343 C CA  . GLU D 2 79  ? -4.310  -16.800 31.127  1.00 50.59  ? 79  GLU L CA  1 
ATOM 5344 C C   . GLU D 2 79  ? -3.704  -16.434 32.478  1.00 46.58  ? 79  GLU L C   1 
ATOM 5345 O O   . GLU D 2 79  ? -3.669  -17.261 33.388  1.00 48.83  ? 79  GLU L O   1 
ATOM 5346 C CB  . GLU D 2 79  ? -5.822  -16.550 31.086  1.00 36.26  ? 79  GLU L CB  1 
ATOM 5347 C CG  . GLU D 2 79  ? -6.361  -16.400 29.673  1.00 37.08  ? 79  GLU L CG  1 
ATOM 5348 C CD  . GLU D 2 79  ? -7.619  -15.558 29.618  1.00 72.85  ? 79  GLU L CD  1 
ATOM 5349 O OE1 . GLU D 2 79  ? -7.644  -14.493 30.273  1.00 66.96  ? 79  GLU L OE1 1 
ATOM 5350 O OE2 . GLU D 2 79  ? -8.579  -15.953 28.920  1.00 70.32  ? 79  GLU L OE2 1 
ATOM 5351 N N   . PRO D 2 80  ? -3.221  -15.189 32.609  1.00 49.98  ? 80  PRO L N   1 
ATOM 5352 C CA  . PRO D 2 80  ? -2.499  -14.691 33.788  1.00 48.31  ? 80  PRO L CA  1 
ATOM 5353 C C   . PRO D 2 80  ? -3.275  -14.869 35.093  1.00 52.04  ? 80  PRO L C   1 
ATOM 5354 O O   . PRO D 2 80  ? -2.685  -14.875 36.170  1.00 56.78  ? 80  PRO L O   1 
ATOM 5355 C CB  . PRO D 2 80  ? -2.296  -13.203 33.470  1.00 44.92  ? 80  PRO L CB  1 
ATOM 5356 C CG  . PRO D 2 80  ? -3.339  -12.886 32.443  1.00 39.76  ? 80  PRO L CG  1 
ATOM 5357 C CD  . PRO D 2 80  ? -3.435  -14.122 31.615  1.00 42.27  ? 80  PRO L CD  1 
ATOM 5358 N N   . GLU D 2 81  ? -4.582  -15.066 34.979  1.00 45.06  ? 81  GLU L N   1 
ATOM 5359 C CA  . GLU D 2 81  ? -5.430  -15.290 36.135  1.00 40.37  ? 81  GLU L CA  1 
ATOM 5360 C C   . GLU D 2 81  ? -5.320  -16.743 36.608  1.00 43.41  ? 81  GLU L C   1 
ATOM 5361 O O   . GLU D 2 81  ? -5.937  -17.126 37.606  1.00 52.79  ? 81  GLU L O   1 
ATOM 5362 C CB  . GLU D 2 81  ? -6.879  -14.922 35.788  1.00 33.80  ? 81  GLU L CB  1 
ATOM 5363 C CG  . GLU D 2 81  ? -7.807  -14.740 36.966  1.00 46.32  ? 81  GLU L CG  1 
ATOM 5364 C CD  . GLU D 2 81  ? -9.267  -14.927 36.582  1.00 57.94  ? 81  GLU L CD  1 
ATOM 5365 O OE1 . GLU D 2 81  ? -9.613  -14.701 35.398  1.00 62.25  ? 81  GLU L OE1 1 
ATOM 5366 O OE2 . GLU D 2 81  ? -10.068 -15.308 37.464  1.00 59.89  ? 81  GLU L OE2 1 
ATOM 5367 N N   . ASP D 2 82  ? -4.578  -17.554 35.854  1.00 43.83  ? 82  ASP L N   1 
ATOM 5368 C CA  . ASP D 2 82  ? -4.423  -18.973 36.166  1.00 40.62  ? 82  ASP L CA  1 
ATOM 5369 C C   . ASP D 2 82  ? -3.137  -19.460 36.832  1.00 36.67  ? 82  ASP L C   1 
ATOM 5370 O O   . ASP D 2 82  ? -3.049  -20.650 37.134  1.00 38.96  ? 82  ASP L O   1 
ATOM 5371 C CB  . ASP D 2 82  ? -4.602  -19.788 34.894  1.00 40.59  ? 82  ASP L CB  1 
ATOM 5372 C CG  . ASP D 2 82  ? -5.937  -19.582 34.285  1.00 42.29  ? 82  ASP L CG  1 
ATOM 5373 O OD1 . ASP D 2 82  ? -6.953  -19.635 35.010  1.00 41.26  ? 82  ASP L OD1 1 
ATOM 5374 O OD2 . ASP D 2 82  ? -5.960  -19.319 33.070  1.00 44.99  ? 82  ASP L OD2 1 
ATOM 5375 N N   . PHE D 2 83  ? -2.145  -18.613 37.083  1.00 32.43  ? 83  PHE L N   1 
ATOM 5376 C CA  . PHE D 2 83  ? -0.889  -19.195 37.546  1.00 32.28  ? 83  PHE L CA  1 
ATOM 5377 C C   . PHE D 2 83  ? -0.951  -19.361 39.059  1.00 46.53  ? 83  PHE L C   1 
ATOM 5378 O O   . PHE D 2 83  ? -0.888  -18.396 39.827  1.00 36.65  ? 83  PHE L O   1 
ATOM 5379 C CB  . PHE D 2 83  ? 0.322   -18.340 37.170  1.00 32.66  ? 83  PHE L CB  1 
ATOM 5380 C CG  . PHE D 2 83  ? 0.532   -18.177 35.691  1.00 40.12  ? 83  PHE L CG  1 
ATOM 5381 C CD1 . PHE D 2 83  ? 1.373   -19.030 34.988  1.00 40.77  ? 83  PHE L CD1 1 
ATOM 5382 C CD2 . PHE D 2 83  ? -0.096  -17.156 35.005  1.00 40.40  ? 83  PHE L CD2 1 
ATOM 5383 C CE1 . PHE D 2 83  ? 1.574   -18.862 33.624  1.00 34.33  ? 83  PHE L CE1 1 
ATOM 5384 C CE2 . PHE D 2 83  ? 0.099   -16.989 33.647  1.00 44.35  ? 83  PHE L CE2 1 
ATOM 5385 C CZ  . PHE D 2 83  ? 0.931   -17.839 32.956  1.00 46.39  ? 83  PHE L CZ  1 
ATOM 5386 N N   . ALA D 2 84  ? -1.000  -20.621 39.472  1.00 43.07  ? 84  ALA L N   1 
ATOM 5387 C CA  . ALA D 2 84  ? -1.338  -20.977 40.839  1.00 37.67  ? 84  ALA L CA  1 
ATOM 5388 C C   . ALA D 2 84  ? -1.059  -22.454 41.077  1.00 33.53  ? 84  ALA L C   1 
ATOM 5389 O O   . ALA D 2 84  ? -0.525  -23.142 40.208  1.00 27.90  ? 84  ALA L O   1 
ATOM 5390 C CB  . ALA D 2 84  ? -2.797  -20.652 41.121  1.00 27.56  ? 84  ALA L CB  1 
ATOM 5391 N N   . VAL D 2 85  ? -1.419  -22.942 42.256  1.00 25.30  ? 85  VAL L N   1 
ATOM 5392 C CA  . VAL D 2 85  ? -1.155  -24.331 42.585  1.00 25.28  ? 85  VAL L CA  1 
ATOM 5393 C C   . VAL D 2 85  ? -2.442  -25.148 42.497  1.00 32.25  ? 85  VAL L C   1 
ATOM 5394 O O   . VAL D 2 85  ? -3.480  -24.747 43.027  1.00 32.32  ? 85  VAL L O   1 
ATOM 5395 C CB  . VAL D 2 85  ? -0.534  -24.460 43.984  1.00 25.03  ? 85  VAL L CB  1 
ATOM 5396 C CG1 . VAL D 2 85  ? -0.303  -25.918 44.337  1.00 25.09  ? 85  VAL L CG1 1 
ATOM 5397 C CG2 . VAL D 2 85  ? 0.766   -23.674 44.048  1.00 25.13  ? 85  VAL L CG2 1 
ATOM 5398 N N   . TYR D 2 86  ? -2.372  -26.283 41.808  1.00 40.41  ? 86  TYR L N   1 
ATOM 5399 C CA  . TYR D 2 86  ? -3.545  -27.126 41.598  1.00 40.36  ? 86  TYR L CA  1 
ATOM 5400 C C   . TYR D 2 86  ? -3.441  -28.447 42.360  1.00 29.94  ? 86  TYR L C   1 
ATOM 5401 O O   . TYR D 2 86  ? -2.412  -29.122 42.313  1.00 30.14  ? 86  TYR L O   1 
ATOM 5402 C CB  . TYR D 2 86  ? -3.743  -27.391 40.103  1.00 38.70  ? 86  TYR L CB  1 
ATOM 5403 C CG  . TYR D 2 86  ? -3.930  -26.133 39.281  1.00 30.48  ? 86  TYR L CG  1 
ATOM 5404 C CD1 . TYR D 2 86  ? -5.197  -25.614 39.042  1.00 38.65  ? 86  TYR L CD1 1 
ATOM 5405 C CD2 . TYR D 2 86  ? -2.835  -25.447 38.767  1.00 30.64  ? 86  TYR L CD2 1 
ATOM 5406 C CE1 . TYR D 2 86  ? -5.368  -24.459 38.298  1.00 39.26  ? 86  TYR L CE1 1 
ATOM 5407 C CE2 . TYR D 2 86  ? -2.998  -24.287 38.026  1.00 37.60  ? 86  TYR L CE2 1 
ATOM 5408 C CZ  . TYR D 2 86  ? -4.266  -23.798 37.795  1.00 39.49  ? 86  TYR L CZ  1 
ATOM 5409 O OH  . TYR D 2 86  ? -4.432  -22.647 37.057  1.00 31.07  ? 86  TYR L OH  1 
ATOM 5410 N N   . TYR D 2 87  ? -4.514  -28.811 43.058  1.00 27.86  ? 87  TYR L N   1 
ATOM 5411 C CA  . TYR D 2 87  ? -4.529  -30.025 43.868  1.00 38.06  ? 87  TYR L CA  1 
ATOM 5412 C C   . TYR D 2 87  ? -5.511  -31.082 43.364  1.00 43.40  ? 87  TYR L C   1 
ATOM 5413 O O   . TYR D 2 87  ? -6.663  -30.785 43.054  1.00 41.22  ? 87  TYR L O   1 
ATOM 5414 C CB  . TYR D 2 87  ? -4.859  -29.691 45.322  1.00 38.48  ? 87  TYR L CB  1 
ATOM 5415 C CG  . TYR D 2 87  ? -3.780  -28.914 46.036  1.00 27.35  ? 87  TYR L CG  1 
ATOM 5416 C CD1 . TYR D 2 87  ? -3.724  -27.528 45.960  1.00 27.14  ? 87  TYR L CD1 1 
ATOM 5417 C CD2 . TYR D 2 87  ? -2.805  -29.570 46.774  1.00 36.87  ? 87  TYR L CD2 1 
ATOM 5418 C CE1 . TYR D 2 87  ? -2.733  -26.817 46.613  1.00 27.00  ? 87  TYR L CE1 1 
ATOM 5419 C CE2 . TYR D 2 87  ? -1.812  -28.870 47.425  1.00 36.74  ? 87  TYR L CE2 1 
ATOM 5420 C CZ  . TYR D 2 87  ? -1.779  -27.494 47.341  1.00 35.87  ? 87  TYR L CZ  1 
ATOM 5421 O OH  . TYR D 2 87  ? -0.789  -26.792 47.991  1.00 35.96  ? 87  TYR L OH  1 
ATOM 5422 N N   . CYS D 2 88  ? -5.035  -32.320 43.310  1.00 47.89  ? 88  CYS L N   1 
ATOM 5423 C CA  . CYS D 2 88  ? -5.838  -33.476 42.926  1.00 28.09  ? 88  CYS L CA  1 
ATOM 5424 C C   . CYS D 2 88  ? -6.455  -34.132 44.166  1.00 48.12  ? 88  CYS L C   1 
ATOM 5425 O O   . CYS D 2 88  ? -5.728  -34.552 45.065  1.00 55.93  ? 88  CYS L O   1 
ATOM 5426 C CB  . CYS D 2 88  ? -4.958  -34.466 42.152  1.00 28.66  ? 88  CYS L CB  1 
ATOM 5427 S SG  . CYS D 2 88  ? -5.700  -36.044 41.674  1.00 102.86 ? 88  CYS L SG  1 
ATOM 5428 N N   . GLN D 2 89  ? -7.786  -34.208 44.225  1.00 44.48  ? 89  GLN L N   1 
ATOM 5429 C CA  . GLN D 2 89  ? -8.463  -34.784 45.394  1.00 44.64  ? 89  GLN L CA  1 
ATOM 5430 C C   . GLN D 2 89  ? -9.455  -35.886 45.025  1.00 51.55  ? 89  GLN L C   1 
ATOM 5431 O O   . GLN D 2 89  ? -10.167 -35.784 44.029  1.00 60.38  ? 89  GLN L O   1 
ATOM 5432 C CB  . GLN D 2 89  ? -9.205  -33.703 46.192  1.00 26.47  ? 89  GLN L CB  1 
ATOM 5433 C CG  . GLN D 2 89  ? -9.870  -34.254 47.462  1.00 26.58  ? 89  GLN L CG  1 
ATOM 5434 C CD  . GLN D 2 89  ? -11.100 -33.482 47.905  1.00 26.45  ? 89  GLN L CD  1 
ATOM 5435 O OE1 . GLN D 2 89  ? -11.987 -33.197 47.102  1.00 32.32  ? 89  GLN L OE1 1 
ATOM 5436 N NE2 . GLN D 2 89  ? -11.181 -33.183 49.200  1.00 26.31  ? 89  GLN L NE2 1 
ATOM 5437 N N   . GLN D 2 90  ? -9.507  -36.926 45.854  1.00 34.30  ? 90  GLN L N   1 
ATOM 5438 C CA  . GLN D 2 90  ? -10.430 -38.039 45.663  1.00 44.43  ? 90  GLN L CA  1 
ATOM 5439 C C   . GLN D 2 90  ? -11.537 -38.028 46.722  1.00 34.91  ? 90  GLN L C   1 
ATOM 5440 O O   . GLN D 2 90  ? -11.263 -37.944 47.916  1.00 42.22  ? 90  GLN L O   1 
ATOM 5441 C CB  . GLN D 2 90  ? -9.660  -39.367 45.682  1.00 43.42  ? 90  GLN L CB  1 
ATOM 5442 C CG  . GLN D 2 90  ? -8.845  -39.635 46.948  1.00 40.65  ? 90  GLN L CG  1 
ATOM 5443 C CD  . GLN D 2 90  ? -9.621  -40.409 48.002  1.00 40.22  ? 90  GLN L CD  1 
ATOM 5444 O OE1 . GLN D 2 90  ? -10.149 -41.487 47.730  1.00 36.44  ? 90  GLN L OE1 1 
ATOM 5445 N NE2 . GLN D 2 90  ? -9.691  -39.862 49.213  1.00 39.23  ? 90  GLN L NE2 1 
ATOM 5446 N N   . SER D 2 91  ? -12.788 -38.061 46.271  1.00 34.56  ? 91  SER L N   1 
ATOM 5447 C CA  . SER D 2 91  ? -13.936 -38.131 47.173  1.00 34.70  ? 91  SER L CA  1 
ATOM 5448 C C   . SER D 2 91  ? -14.437 -39.565 47.329  1.00 47.91  ? 91  SER L C   1 
ATOM 5449 O O   . SER D 2 91  ? -15.456 -39.814 47.977  1.00 52.21  ? 91  SER L O   1 
ATOM 5450 C CB  . SER D 2 91  ? -15.067 -37.221 46.682  1.00 34.59  ? 91  SER L CB  1 
ATOM 5451 O OG  . SER D 2 91  ? -15.718 -37.763 45.546  1.00 39.54  ? 91  SER L OG  1 
ATOM 5452 N N   . SER D 2 92  ? -13.714 -40.499 46.717  1.00 43.34  ? 92  SER L N   1 
ATOM 5453 C CA  . SER D 2 92  ? -14.113 -41.903 46.683  1.00 45.39  ? 92  SER L CA  1 
ATOM 5454 C C   . SER D 2 92  ? -14.270 -42.518 48.071  1.00 52.30  ? 92  SER L C   1 
ATOM 5455 O O   . SER D 2 92  ? -15.286 -43.159 48.350  1.00 34.92  ? 92  SER L O   1 
ATOM 5456 C CB  . SER D 2 92  ? -13.104 -42.716 45.865  1.00 34.51  ? 92  SER L CB  1 
ATOM 5457 O OG  . SER D 2 92  ? -11.776 -42.444 46.275  1.00 34.09  ? 92  SER L OG  1 
ATOM 5458 N N   . ASN D 2 93  ? -13.269 -42.343 48.930  1.00 50.71  ? 93  ASN L N   1 
ATOM 5459 C CA  . ASN D 2 93  ? -13.350 -42.878 50.285  1.00 52.92  ? 93  ASN L CA  1 
ATOM 5460 C C   . ASN D 2 93  ? -12.454 -42.183 51.302  1.00 52.38  ? 93  ASN L C   1 
ATOM 5461 O O   . ASN D 2 93  ? -11.499 -41.493 50.952  1.00 60.20  ? 93  ASN L O   1 
ATOM 5462 C CB  . ASN D 2 93  ? -13.038 -44.374 50.278  1.00 49.26  ? 93  ASN L CB  1 
ATOM 5463 C CG  . ASN D 2 93  ? -11.835 -44.714 49.441  1.00 42.76  ? 93  ASN L CG  1 
ATOM 5464 O OD1 . ASN D 2 93  ? -11.749 -44.325 48.278  1.00 37.78  ? 93  ASN L OD1 1 
ATOM 5465 N ND2 . ASN D 2 93  ? -10.904 -45.465 50.019  1.00 40.62  ? 93  ASN L ND2 1 
ATOM 5466 N N   . TRP D 2 94  ? -12.777 -42.397 52.574  1.00 48.18  ? 94  TRP L N   1 
ATOM 5467 C CA  . TRP D 2 94  ? -12.089 -41.749 53.682  1.00 46.71  ? 94  TRP L CA  1 
ATOM 5468 C C   . TRP D 2 94  ? -10.848 -42.536 54.096  1.00 32.85  ? 94  TRP L C   1 
ATOM 5469 O O   . TRP D 2 94  ? -10.766 -43.737 53.868  1.00 33.56  ? 94  TRP L O   1 
ATOM 5470 C CB  . TRP D 2 94  ? -13.038 -41.594 54.873  1.00 47.19  ? 94  TRP L CB  1 
ATOM 5471 C CG  . TRP D 2 94  ? -14.458 -41.387 54.461  1.00 44.68  ? 94  TRP L CG  1 
ATOM 5472 C CD1 . TRP D 2 94  ? -15.445 -42.327 54.417  1.00 33.65  ? 94  TRP L CD1 1 
ATOM 5473 C CD2 . TRP D 2 94  ? -15.056 -40.157 54.025  1.00 39.53  ? 94  TRP L CD2 1 
ATOM 5474 N NE1 . TRP D 2 94  ? -16.618 -41.758 53.983  1.00 33.60  ? 94  TRP L NE1 1 
ATOM 5475 C CE2 . TRP D 2 94  ? -16.404 -40.433 53.737  1.00 32.81  ? 94  TRP L CE2 1 
ATOM 5476 C CE3 . TRP D 2 94  ? -14.574 -38.857 53.857  1.00 36.38  ? 94  TRP L CE3 1 
ATOM 5477 C CZ2 . TRP D 2 94  ? -17.279 -39.446 53.284  1.00 36.39  ? 94  TRP L CZ2 1 
ATOM 5478 C CZ3 . TRP D 2 94  ? -15.446 -37.884 53.407  1.00 31.33  ? 94  TRP L CZ3 1 
ATOM 5479 C CH2 . TRP D 2 94  ? -16.782 -38.183 53.126  1.00 36.68  ? 94  TRP L CH2 1 
ATOM 5480 N N   . PRO D 2 95  ? -9.868  -41.862 54.706  1.00 33.78  ? 95  PRO L N   1 
ATOM 5481 C CA  . PRO D 2 95  ? -9.791  -40.411 54.865  1.00 46.48  ? 95  PRO L CA  1 
ATOM 5482 C C   . PRO D 2 95  ? -9.485  -39.745 53.517  1.00 47.39  ? 95  PRO L C   1 
ATOM 5483 O O   . PRO D 2 95  ? -8.657  -40.257 52.760  1.00 32.64  ? 95  PRO L O   1 
ATOM 5484 C CB  . PRO D 2 95  ? -8.668  -40.238 55.900  1.00 32.90  ? 95  PRO L CB  1 
ATOM 5485 C CG  . PRO D 2 95  ? -7.802  -41.423 55.697  1.00 33.44  ? 95  PRO L CG  1 
ATOM 5486 C CD  . PRO D 2 95  ? -8.717  -42.549 55.317  1.00 58.69  ? 95  PRO L CD  1 
ATOM 5487 N N   . ARG D 2 96  ? -10.187 -38.653 53.211  1.00 46.04  ? 96  ARG L N   1 
ATOM 5488 C CA  . ARG D 2 96  ? -10.011 -37.929 51.952  1.00 28.39  ? 96  ARG L CA  1 
ATOM 5489 C C   . ARG D 2 96  ? -8.553  -37.503 51.764  1.00 64.64  ? 96  ARG L C   1 
ATOM 5490 O O   . ARG D 2 96  ? -7.906  -37.052 52.709  1.00 71.34  ? 96  ARG L O   1 
ATOM 5491 C CB  . ARG D 2 96  ? -10.916 -36.691 51.905  1.00 27.98  ? 96  ARG L CB  1 
ATOM 5492 C CG  . ARG D 2 96  ? -12.432 -36.926 51.865  1.00 52.78  ? 96  ARG L CG  1 
ATOM 5493 C CD  . ARG D 2 96  ? -12.929 -37.535 50.555  1.00 55.03  ? 96  ARG L CD  1 
ATOM 5494 N NE  . ARG D 2 96  ? -14.371 -37.342 50.372  1.00 51.54  ? 96  ARG L NE  1 
ATOM 5495 C CZ  . ARG D 2 96  ? -14.935 -36.178 50.054  1.00 50.02  ? 96  ARG L CZ  1 
ATOM 5496 N NH1 . ARG D 2 96  ? -14.179 -35.104 49.866  1.00 27.96  ? 96  ARG L NH1 1 
ATOM 5497 N NH2 . ARG D 2 96  ? -16.253 -36.086 49.909  1.00 38.46  ? 96  ARG L NH2 1 
ATOM 5498 N N   . THR D 2 97  ? -8.029  -37.633 50.549  1.00 29.15  ? 97  THR L N   1 
ATOM 5499 C CA  . THR D 2 97  ? -6.630  -37.273 50.322  1.00 28.91  ? 97  THR L CA  1 
ATOM 5500 C C   . THR D 2 97  ? -6.387  -36.362 49.124  1.00 28.57  ? 97  THR L C   1 
ATOM 5501 O O   . THR D 2 97  ? -6.863  -36.613 48.020  1.00 28.78  ? 97  THR L O   1 
ATOM 5502 C CB  . THR D 2 97  ? -5.750  -38.525 50.148  1.00 38.56  ? 97  THR L CB  1 
ATOM 5503 O OG1 . THR D 2 97  ? -6.363  -39.421 49.212  1.00 33.86  ? 97  THR L OG1 1 
ATOM 5504 C CG2 . THR D 2 97  ? -5.560  -39.232 51.478  1.00 43.71  ? 97  THR L CG2 1 
ATOM 5505 N N   . PHE D 2 98  ? -5.629  -35.299 49.377  1.00 38.61  ? 98  PHE L N   1 
ATOM 5506 C CA  . PHE D 2 98  ? -5.158  -34.395 48.342  1.00 26.22  ? 98  PHE L CA  1 
ATOM 5507 C C   . PHE D 2 98  ? -3.790  -34.846 47.866  1.00 26.44  ? 98  PHE L C   1 
ATOM 5508 O O   . PHE D 2 98  ? -3.280  -35.875 48.286  1.00 26.83  ? 98  PHE L O   1 
ATOM 5509 C CB  . PHE D 2 98  ? -5.059  -32.962 48.857  1.00 35.02  ? 98  PHE L CB  1 
ATOM 5510 C CG  . PHE D 2 98  ? -6.359  -32.383 49.303  1.00 35.11  ? 98  PHE L CG  1 
ATOM 5511 C CD1 . PHE D 2 98  ? -7.264  -31.878 48.387  1.00 37.56  ? 98  PHE L CD1 1 
ATOM 5512 C CD2 . PHE D 2 98  ? -6.677  -32.344 50.648  1.00 25.52  ? 98  PHE L CD2 1 
ATOM 5513 C CE1 . PHE D 2 98  ? -8.464  -31.339 48.810  1.00 38.94  ? 98  PHE L CE1 1 
ATOM 5514 C CE2 . PHE D 2 98  ? -7.869  -31.811 51.075  1.00 44.85  ? 98  PHE L CE2 1 
ATOM 5515 C CZ  . PHE D 2 98  ? -8.765  -31.308 50.158  1.00 42.44  ? 98  PHE L CZ  1 
ATOM 5516 N N   . GLY D 2 99  ? -3.210  -34.072 46.962  1.00 32.62  ? 99  GLY L N   1 
ATOM 5517 C CA  . GLY D 2 99  ? -1.883  -34.353 46.455  1.00 32.88  ? 99  GLY L CA  1 
ATOM 5518 C C   . GLY D 2 99  ? -0.793  -33.401 46.893  1.00 32.58  ? 99  GLY L C   1 
ATOM 5519 O O   . GLY D 2 99  ? -1.024  -32.473 47.675  1.00 32.16  ? 99  GLY L O   1 
ATOM 5520 N N   . GLN D 2 100 ? 0.399   -33.637 46.352  1.00 64.98  ? 100 GLN L N   1 
ATOM 5521 C CA  . GLN D 2 100 ? 1.513   -32.714 46.467  1.00 61.98  ? 100 GLN L CA  1 
ATOM 5522 C C   . GLN D 2 100 ? 1.074   -31.346 45.944  1.00 30.90  ? 100 GLN L C   1 
ATOM 5523 O O   . GLN D 2 100 ? 1.496   -30.304 46.442  1.00 30.62  ? 100 GLN L O   1 
ATOM 5524 C CB  . GLN D 2 100 ? 2.725   -33.242 45.675  1.00 61.42  ? 100 GLN L CB  1 
ATOM 5525 C CG  . GLN D 2 100 ? 3.563   -34.390 46.313  1.00 76.41  ? 100 GLN L CG  1 
ATOM 5526 C CD  . GLN D 2 100 ? 2.767   -35.629 46.756  1.00 86.94  ? 100 GLN L CD  1 
ATOM 5527 O OE1 . GLN D 2 100 ? 1.530   -35.649 46.779  1.00 92.87  ? 100 GLN L OE1 1 
ATOM 5528 N NE2 . GLN D 2 100 ? 3.497   -36.697 47.053  1.00 88.77  ? 100 GLN L NE2 1 
ATOM 5529 N N   . GLY D 2 101 ? 0.195   -31.370 44.946  1.00 29.73  ? 101 GLY L N   1 
ATOM 5530 C CA  . GLY D 2 101 ? -0.207  -30.173 44.243  1.00 46.92  ? 101 GLY L CA  1 
ATOM 5531 C C   . GLY D 2 101 ? 0.773   -29.954 43.115  1.00 46.54  ? 101 GLY L C   1 
ATOM 5532 O O   . GLY D 2 101 ? 1.940   -30.345 43.196  1.00 30.10  ? 101 GLY L O   1 
ATOM 5533 N N   . THR D 2 102 ? 0.286   -29.364 42.038  1.00 47.27  ? 102 THR L N   1 
ATOM 5534 C CA  . THR D 2 102 ? 1.159   -28.943 40.967  1.00 30.97  ? 102 THR L CA  1 
ATOM 5535 C C   . THR D 2 102 ? 1.119   -27.430 40.920  1.00 36.62  ? 102 THR L C   1 
ATOM 5536 O O   . THR D 2 102 ? 0.048   -26.831 40.963  1.00 37.28  ? 102 THR L O   1 
ATOM 5537 C CB  . THR D 2 102 ? 0.751   -29.559 39.606  1.00 49.25  ? 102 THR L CB  1 
ATOM 5538 O OG1 . THR D 2 102 ? 0.932   -30.983 39.642  1.00 44.18  ? 102 THR L OG1 1 
ATOM 5539 C CG2 . THR D 2 102 ? 1.569   -28.966 38.470  1.00 31.90  ? 102 THR L CG2 1 
ATOM 5540 N N   . LYS D 2 103 ? 2.290   -26.809 40.871  1.00 38.07  ? 103 LYS L N   1 
ATOM 5541 C CA  . LYS D 2 103 ? 2.344   -25.364 40.733  1.00 38.27  ? 103 LYS L CA  1 
ATOM 5542 C C   . LYS D 2 103 ? 2.609   -25.003 39.286  1.00 37.83  ? 103 LYS L C   1 
ATOM 5543 O O   . LYS D 2 103 ? 3.556   -25.496 38.678  1.00 32.67  ? 103 LYS L O   1 
ATOM 5544 C CB  . LYS D 2 103 ? 3.416   -24.750 41.631  1.00 40.99  ? 103 LYS L CB  1 
ATOM 5545 C CG  . LYS D 2 103 ? 3.612   -23.267 41.371  1.00 39.88  ? 103 LYS L CG  1 
ATOM 5546 C CD  . LYS D 2 103 ? 4.679   -22.679 42.263  1.00 33.15  ? 103 LYS L CD  1 
ATOM 5547 C CE  . LYS D 2 103 ? 4.990   -21.248 41.865  1.00 32.89  ? 103 LYS L CE  1 
ATOM 5548 N NZ  . LYS D 2 103 ? 6.161   -20.719 42.615  1.00 33.99  ? 103 LYS L NZ  1 
ATOM 5549 N N   . VAL D 2 104 ? 1.759   -24.149 38.732  1.00 34.53  ? 104 VAL L N   1 
ATOM 5550 C CA  . VAL D 2 104 ? 1.953   -23.677 37.372  1.00 36.61  ? 104 VAL L CA  1 
ATOM 5551 C C   . VAL D 2 104 ? 2.549   -22.276 37.386  1.00 37.82  ? 104 VAL L C   1 
ATOM 5552 O O   . VAL D 2 104 ? 1.881   -21.307 37.748  1.00 33.69  ? 104 VAL L O   1 
ATOM 5553 C CB  . VAL D 2 104 ? 0.636   -23.685 36.578  1.00 30.61  ? 104 VAL L CB  1 
ATOM 5554 C CG1 . VAL D 2 104 ? 0.880   -23.232 35.150  1.00 31.25  ? 104 VAL L CG1 1 
ATOM 5555 C CG2 . VAL D 2 104 ? 0.033   -25.083 36.584  1.00 30.62  ? 104 VAL L CG2 1 
ATOM 5556 N N   . GLU D 2 105 ? 3.814   -22.182 36.989  1.00 44.29  ? 105 GLU L N   1 
ATOM 5557 C CA  . GLU D 2 105 ? 4.541   -20.919 37.021  1.00 45.30  ? 105 GLU L CA  1 
ATOM 5558 C C   . GLU D 2 105 ? 4.673   -20.312 35.627  1.00 43.45  ? 105 GLU L C   1 
ATOM 5559 O O   . GLU D 2 105 ? 4.161   -20.857 34.650  1.00 32.61  ? 105 GLU L O   1 
ATOM 5560 C CB  . GLU D 2 105 ? 5.931   -21.110 37.642  1.00 45.23  ? 105 GLU L CB  1 
ATOM 5561 C CG  . GLU D 2 105 ? 6.959   -21.726 36.701  1.00 50.08  ? 105 GLU L CG  1 
ATOM 5562 C CD  . GLU D 2 105 ? 8.376   -21.652 37.245  1.00 58.96  ? 105 GLU L CD  1 
ATOM 5563 O OE1 . GLU D 2 105 ? 8.823   -20.531 37.563  1.00 66.66  ? 105 GLU L OE1 1 
ATOM 5564 O OE2 . GLU D 2 105 ? 9.057   -22.696 37.329  1.00 63.67  ? 105 GLU L OE2 1 
ATOM 5565 N N   . ILE D 2 106 ? 5.360   -19.178 35.549  1.00 34.68  ? 106 ILE L N   1 
ATOM 5566 C CA  . ILE D 2 106 ? 5.534   -18.453 34.296  1.00 35.38  ? 106 ILE L CA  1 
ATOM 5567 C C   . ILE D 2 106 ? 6.911   -18.746 33.691  1.00 44.89  ? 106 ILE L C   1 
ATOM 5568 O O   . ILE D 2 106 ? 7.911   -18.771 34.405  1.00 35.97  ? 106 ILE L O   1 
ATOM 5569 C CB  . ILE D 2 106 ? 5.366   -16.934 34.511  1.00 35.44  ? 106 ILE L CB  1 
ATOM 5570 C CG1 . ILE D 2 106 ? 3.982   -16.632 35.091  1.00 34.90  ? 106 ILE L CG1 1 
ATOM 5571 C CG2 . ILE D 2 106 ? 5.572   -16.177 33.210  1.00 49.09  ? 106 ILE L CG2 1 
ATOM 5572 C CD1 . ILE D 2 106 ? 3.652   -15.162 35.166  1.00 38.19  ? 106 ILE L CD1 1 
ATOM 5573 N N   . LYS D 2 107 ? 6.956   -18.990 32.383  1.00 44.14  ? 107 LYS L N   1 
ATOM 5574 C CA  . LYS D 2 107 ? 8.218   -19.270 31.694  1.00 44.24  ? 107 LYS L CA  1 
ATOM 5575 C C   . LYS D 2 107 ? 8.948   -17.980 31.324  1.00 46.82  ? 107 LYS L C   1 
ATOM 5576 O O   . LYS D 2 107 ? 8.317   -16.959 31.060  1.00 37.67  ? 107 LYS L O   1 
ATOM 5577 C CB  . LYS D 2 107 ? 7.979   -20.118 30.441  1.00 46.46  ? 107 LYS L CB  1 
ATOM 5578 C CG  . LYS D 2 107 ? 9.226   -20.306 29.590  1.00 51.22  ? 107 LYS L CG  1 
ATOM 5579 C CD  . LYS D 2 107 ? 9.042   -21.294 28.460  1.00 61.17  ? 107 LYS L CD  1 
ATOM 5580 C CE  . LYS D 2 107 ? 10.376  -21.569 27.785  1.00 67.33  ? 107 LYS L CE  1 
ATOM 5581 N NZ  . LYS D 2 107 ? 11.381  -22.086 28.758  1.00 40.08  ? 107 LYS L NZ  1 
ATOM 5582 N N   . ARG D 2 108 ? 10.279  -18.028 31.331  1.00 43.65  ? 108 ARG L N   1 
ATOM 5583 C CA  . ARG D 2 108 ? 11.102  -16.855 31.036  1.00 34.12  ? 108 ARG L CA  1 
ATOM 5584 C C   . ARG D 2 108 ? 12.472  -17.257 30.469  1.00 34.98  ? 108 ARG L C   1 
ATOM 5585 O O   . ARG D 2 108 ? 12.929  -18.389 30.699  1.00 34.94  ? 108 ARG L O   1 
ATOM 5586 C CB  . ARG D 2 108 ? 11.266  -16.006 32.306  1.00 33.57  ? 108 ARG L CB  1 
ATOM 5587 C CG  . ARG D 2 108 ? 12.393  -14.992 32.259  1.00 34.24  ? 108 ARG L CG  1 
ATOM 5588 C CD  . ARG D 2 108 ? 12.602  -14.296 33.577  1.00 33.76  ? 108 ARG L CD  1 
ATOM 5589 N NE  . ARG D 2 108 ? 13.797  -13.463 33.509  1.00 46.20  ? 108 ARG L NE  1 
ATOM 5590 C CZ  . ARG D 2 108 ? 13.865  -12.301 32.867  1.00 50.72  ? 108 ARG L CZ  1 
ATOM 5591 N NH1 . ARG D 2 108 ? 12.798  -11.818 32.242  1.00 42.43  ? 108 ARG L NH1 1 
ATOM 5592 N NH2 . ARG D 2 108 ? 15.005  -11.619 32.850  1.00 49.26  ? 108 ARG L NH2 1 
ATOM 5593 N N   . THR D 2 109 ? 13.108  -16.346 29.726  1.00 58.43  ? 109 THR L N   1 
ATOM 5594 C CA  . THR D 2 109 ? 14.483  -16.545 29.279  1.00 58.50  ? 109 THR L CA  1 
ATOM 5595 C C   . THR D 2 109 ? 15.386  -16.851 30.477  1.00 55.82  ? 109 THR L C   1 
ATOM 5596 O O   . THR D 2 109 ? 15.363  -16.123 31.475  1.00 46.64  ? 109 THR L O   1 
ATOM 5597 C CB  . THR D 2 109 ? 15.021  -15.302 28.521  1.00 56.39  ? 109 THR L CB  1 
ATOM 5598 O OG1 . THR D 2 109 ? 13.962  -14.705 27.762  1.00 57.14  ? 109 THR L OG1 1 
ATOM 5599 C CG2 . THR D 2 109 ? 16.149  -15.685 27.590  1.00 57.39  ? 109 THR L CG2 1 
ATOM 5600 N N   . VAL D 2 110 ? 16.203  -17.901 30.364  1.00 51.52  ? 110 VAL L N   1 
ATOM 5601 C CA  . VAL D 2 110 ? 16.960  -18.394 31.520  1.00 38.26  ? 110 VAL L CA  1 
ATOM 5602 C C   . VAL D 2 110 ? 17.900  -17.328 32.076  1.00 43.85  ? 110 VAL L C   1 
ATOM 5603 O O   . VAL D 2 110 ? 18.745  -16.778 31.368  1.00 47.37  ? 110 VAL L O   1 
ATOM 5604 C CB  . VAL D 2 110 ? 17.770  -19.659 31.187  1.00 43.12  ? 110 VAL L CB  1 
ATOM 5605 C CG1 . VAL D 2 110 ? 18.536  -20.135 32.399  1.00 50.05  ? 110 VAL L CG1 1 
ATOM 5606 C CG2 . VAL D 2 110 ? 16.841  -20.769 30.709  1.00 45.49  ? 110 VAL L CG2 1 
ATOM 5607 N N   . ALA D 2 111 ? 17.748  -17.063 33.367  1.00 39.57  ? 111 ALA L N   1 
ATOM 5608 C CA  . ALA D 2 111 ? 18.457  -15.974 34.011  1.00 36.89  ? 111 ALA L CA  1 
ATOM 5609 C C   . ALA D 2 111 ? 19.395  -16.473 35.103  1.00 47.14  ? 111 ALA L C   1 
ATOM 5610 O O   . ALA D 2 111 ? 19.018  -17.270 35.959  1.00 45.73  ? 111 ALA L O   1 
ATOM 5611 C CB  . ALA D 2 111 ? 17.469  -14.983 34.577  1.00 36.23  ? 111 ALA L CB  1 
ATOM 5612 N N   . ALA D 2 112 ? 20.628  -15.988 35.061  1.00 36.41  ? 112 ALA L N   1 
ATOM 5613 C CA  . ALA D 2 112 ? 21.615  -16.332 36.069  1.00 36.47  ? 112 ALA L CA  1 
ATOM 5614 C C   . ALA D 2 112 ? 21.553  -15.350 37.227  1.00 36.04  ? 112 ALA L C   1 
ATOM 5615 O O   . ALA D 2 112 ? 21.381  -14.151 37.019  1.00 37.91  ? 112 ALA L O   1 
ATOM 5616 C CB  . ALA D 2 112 ? 23.007  -16.354 35.462  1.00 37.66  ? 112 ALA L CB  1 
ATOM 5617 N N   . PRO D 2 113 ? 21.687  -15.860 38.457  1.00 36.13  ? 113 PRO L N   1 
ATOM 5618 C CA  . PRO D 2 113 ? 21.665  -14.994 39.639  1.00 46.36  ? 113 PRO L CA  1 
ATOM 5619 C C   . PRO D 2 113 ? 22.956  -14.196 39.783  1.00 49.30  ? 113 PRO L C   1 
ATOM 5620 O O   . PRO D 2 113 ? 24.014  -14.684 39.387  1.00 37.46  ? 113 PRO L O   1 
ATOM 5621 C CB  . PRO D 2 113 ? 21.502  -15.989 40.788  1.00 35.11  ? 113 PRO L CB  1 
ATOM 5622 C CG  . PRO D 2 113 ? 22.211  -17.216 40.293  1.00 35.55  ? 113 PRO L CG  1 
ATOM 5623 C CD  . PRO D 2 113 ? 21.911  -17.274 38.811  1.00 35.93  ? 113 PRO L CD  1 
ATOM 5624 N N   . SER D 2 114 ? 22.875  -12.985 40.321  1.00 52.12  ? 114 SER L N   1 
ATOM 5625 C CA  . SER D 2 114 ? 24.083  -12.266 40.674  1.00 49.98  ? 114 SER L CA  1 
ATOM 5626 C C   . SER D 2 114 ? 24.216  -12.446 42.173  1.00 48.38  ? 114 SER L C   1 
ATOM 5627 O O   . SER D 2 114 ? 23.455  -11.865 42.951  1.00 48.94  ? 114 SER L O   1 
ATOM 5628 C CB  . SER D 2 114 ? 24.007  -10.790 40.273  1.00 49.51  ? 114 SER L CB  1 
ATOM 5629 O OG  . SER D 2 114 ? 24.258  -10.624 38.885  1.00 53.73  ? 114 SER L OG  1 
ATOM 5630 N N   . VAL D 2 115 ? 25.182  -13.261 42.577  1.00 54.24  ? 115 VAL L N   1 
ATOM 5631 C CA  . VAL D 2 115 ? 25.244  -13.708 43.963  1.00 53.15  ? 115 VAL L CA  1 
ATOM 5632 C C   . VAL D 2 115 ? 25.803  -12.611 44.877  1.00 51.24  ? 115 VAL L C   1 
ATOM 5633 O O   . VAL D 2 115 ? 26.581  -11.763 44.444  1.00 45.95  ? 115 VAL L O   1 
ATOM 5634 C CB  . VAL D 2 115 ? 26.063  -15.032 44.085  1.00 38.79  ? 115 VAL L CB  1 
ATOM 5635 C CG1 . VAL D 2 115 ? 27.526  -14.822 43.731  1.00 39.98  ? 115 VAL L CG1 1 
ATOM 5636 C CG2 . VAL D 2 115 ? 25.921  -15.636 45.475  1.00 38.25  ? 115 VAL L CG2 1 
ATOM 5637 N N   . PHE D 2 116 ? 25.348  -12.600 46.128  1.00 50.44  ? 116 PHE L N   1 
ATOM 5638 C CA  . PHE D 2 116 ? 25.837  -11.656 47.126  1.00 53.91  ? 116 PHE L CA  1 
ATOM 5639 C C   . PHE D 2 116 ? 26.065  -12.384 48.448  1.00 48.44  ? 116 PHE L C   1 
ATOM 5640 O O   . PHE D 2 116 ? 25.321  -13.304 48.783  1.00 55.36  ? 116 PHE L O   1 
ATOM 5641 C CB  . PHE D 2 116 ? 24.852  -10.496 47.305  1.00 40.82  ? 116 PHE L CB  1 
ATOM 5642 C CG  . PHE D 2 116 ? 25.017  -9.398  46.291  1.00 53.48  ? 116 PHE L CG  1 
ATOM 5643 C CD1 . PHE D 2 116 ? 25.777  -8.277  46.580  1.00 61.63  ? 116 PHE L CD1 1 
ATOM 5644 C CD2 . PHE D 2 116 ? 24.404  -9.485  45.052  1.00 46.98  ? 116 PHE L CD2 1 
ATOM 5645 C CE1 . PHE D 2 116 ? 25.929  -7.263  45.646  1.00 64.83  ? 116 PHE L CE1 1 
ATOM 5646 C CE2 . PHE D 2 116 ? 24.550  -8.478  44.115  1.00 50.30  ? 116 PHE L CE2 1 
ATOM 5647 C CZ  . PHE D 2 116 ? 25.313  -7.366  44.411  1.00 59.78  ? 116 PHE L CZ  1 
ATOM 5648 N N   . ILE D 2 117 ? 27.094  -11.988 49.195  1.00 43.04  ? 117 ILE L N   1 
ATOM 5649 C CA  . ILE D 2 117 ? 27.362  -12.617 50.488  1.00 42.99  ? 117 ILE L CA  1 
ATOM 5650 C C   . ILE D 2 117 ? 27.713  -11.588 51.571  1.00 63.89  ? 117 ILE L C   1 
ATOM 5651 O O   . ILE D 2 117 ? 28.523  -10.683 51.361  1.00 44.34  ? 117 ILE L O   1 
ATOM 5652 C CB  . ILE D 2 117 ? 28.492  -13.681 50.381  1.00 55.26  ? 117 ILE L CB  1 
ATOM 5653 C CG1 . ILE D 2 117 ? 28.730  -14.364 51.733  1.00 55.12  ? 117 ILE L CG1 1 
ATOM 5654 C CG2 . ILE D 2 117 ? 29.780  -13.074 49.837  1.00 54.79  ? 117 ILE L CG2 1 
ATOM 5655 C CD1 . ILE D 2 117 ? 29.781  -15.459 51.692  1.00 55.86  ? 117 ILE L CD1 1 
ATOM 5656 N N   . PHE D 2 118 ? 27.063  -11.733 52.723  1.00 57.74  ? 118 PHE L N   1 
ATOM 5657 C CA  . PHE D 2 118 ? 27.191  -10.797 53.839  1.00 37.92  ? 118 PHE L CA  1 
ATOM 5658 C C   . PHE D 2 118 ? 27.836  -11.418 55.079  1.00 38.22  ? 118 PHE L C   1 
ATOM 5659 O O   . PHE D 2 118 ? 27.327  -12.393 55.625  1.00 37.59  ? 118 PHE L O   1 
ATOM 5660 C CB  . PHE D 2 118 ? 25.818  -10.227 54.216  1.00 44.72  ? 118 PHE L CB  1 
ATOM 5661 C CG  . PHE D 2 118 ? 25.078  -9.598  53.063  1.00 42.08  ? 118 PHE L CG  1 
ATOM 5662 C CD1 . PHE D 2 118 ? 24.368  -10.374 52.157  1.00 36.21  ? 118 PHE L CD1 1 
ATOM 5663 C CD2 . PHE D 2 118 ? 25.113  -8.227  52.877  1.00 37.59  ? 118 PHE L CD2 1 
ATOM 5664 C CE1 . PHE D 2 118 ? 23.698  -9.789  51.101  1.00 40.57  ? 118 PHE L CE1 1 
ATOM 5665 C CE2 . PHE D 2 118 ? 24.447  -7.641  51.827  1.00 40.70  ? 118 PHE L CE2 1 
ATOM 5666 C CZ  . PHE D 2 118 ? 23.739  -8.421  50.937  1.00 40.38  ? 118 PHE L CZ  1 
ATOM 5667 N N   . PRO D 2 119 ? 28.976  -10.861 55.514  1.00 45.34  ? 119 PRO L N   1 
ATOM 5668 C CA  . PRO D 2 119 ? 29.631  -11.230 56.777  1.00 46.08  ? 119 PRO L CA  1 
ATOM 5669 C C   . PRO D 2 119 ? 28.804  -10.802 57.990  1.00 46.33  ? 119 PRO L C   1 
ATOM 5670 O O   . PRO D 2 119 ? 28.107  -9.793  57.899  1.00 40.87  ? 119 PRO L O   1 
ATOM 5671 C CB  . PRO D 2 119 ? 30.962  -10.461 56.725  1.00 42.51  ? 119 PRO L CB  1 
ATOM 5672 C CG  . PRO D 2 119 ? 31.171  -10.156 55.280  1.00 47.99  ? 119 PRO L CG  1 
ATOM 5673 C CD  . PRO D 2 119 ? 29.804  -9.946  54.712  1.00 48.13  ? 119 PRO L CD  1 
ATOM 5674 N N   . PRO D 2 120 ? 28.887  -11.553 59.105  1.00 43.64  ? 120 PRO L N   1 
ATOM 5675 C CA  . PRO D 2 120 ? 28.142  -11.286 60.346  1.00 49.69  ? 120 PRO L CA  1 
ATOM 5676 C C   . PRO D 2 120 ? 28.308  -9.863  60.884  1.00 40.42  ? 120 PRO L C   1 
ATOM 5677 O O   . PRO D 2 120 ? 29.424  -9.355  60.952  1.00 41.42  ? 120 PRO L O   1 
ATOM 5678 C CB  . PRO D 2 120 ? 28.744  -12.288 61.329  1.00 42.59  ? 120 PRO L CB  1 
ATOM 5679 C CG  . PRO D 2 120 ? 29.143  -13.426 60.478  1.00 44.78  ? 120 PRO L CG  1 
ATOM 5680 C CD  . PRO D 2 120 ? 29.644  -12.816 59.187  1.00 43.46  ? 120 PRO L CD  1 
ATOM 5681 N N   . SER D 2 121 ? 27.199  -9.243  61.280  1.00 52.47  ? 121 SER L N   1 
ATOM 5682 C CA  . SER D 2 121 ? 27.198  -7.901  61.871  1.00 50.09  ? 121 SER L CA  1 
ATOM 5683 C C   . SER D 2 121 ? 28.101  -7.838  63.092  1.00 46.71  ? 121 SER L C   1 
ATOM 5684 O O   . SER D 2 121 ? 28.221  -8.832  63.804  1.00 49.80  ? 121 SER L O   1 
ATOM 5685 C CB  . SER D 2 121 ? 25.767  -7.505  62.267  1.00 46.52  ? 121 SER L CB  1 
ATOM 5686 O OG  . SER D 2 121 ? 24.840  -7.633  61.172  1.00 46.99  ? 121 SER L OG  1 
ATOM 5687 N N   . ASP D 2 122 ? 28.746  -6.707  63.354  1.00 58.42  ? 122 ASP L N   1 
ATOM 5688 C CA  . ASP D 2 122 ? 29.539  -6.612  64.582  1.00 64.25  ? 122 ASP L CA  1 
ATOM 5689 C C   . ASP D 2 122 ? 28.567  -6.491  65.756  1.00 63.69  ? 122 ASP L C   1 
ATOM 5690 O O   . ASP D 2 122 ? 28.937  -6.505  66.911  1.00 63.54  ? 122 ASP L O   1 
ATOM 5691 C CB  . ASP D 2 122 ? 30.457  -5.390  64.486  1.00 74.73  ? 122 ASP L CB  1 
ATOM 5692 C CG  . ASP D 2 122 ? 31.850  -5.622  65.010  1.00 86.30  ? 122 ASP L CG  1 
ATOM 5693 O OD1 . ASP D 2 122 ? 31.985  -5.906  66.203  1.00 89.50  ? 122 ASP L OD1 1 
ATOM 5694 O OD2 . ASP D 2 122 ? 32.810  -5.531  64.207  1.00 90.98  ? 122 ASP L OD2 1 
ATOM 5695 N N   . GLU D 2 123 ? 27.304  -6.335  65.459  1.00 58.35  ? 123 GLU L N   1 
ATOM 5696 C CA  . GLU D 2 123 ? 26.347  -6.337  66.525  1.00 61.47  ? 123 GLU L CA  1 
ATOM 5697 C C   . GLU D 2 123 ? 26.080  -7.734  66.996  1.00 61.38  ? 123 GLU L C   1 
ATOM 5698 O O   . GLU D 2 123 ? 26.197  -8.064  68.159  1.00 61.21  ? 123 GLU L O   1 
ATOM 5699 C CB  . GLU D 2 123 ? 25.035  -5.724  66.067  1.00 67.50  ? 123 GLU L CB  1 
ATOM 5700 C CG  . GLU D 2 123 ? 25.172  -4.290  65.722  1.00 69.69  ? 123 GLU L CG  1 
ATOM 5701 C CD  . GLU D 2 123 ? 23.856  -3.602  65.475  1.00 80.58  ? 123 GLU L CD  1 
ATOM 5702 O OE1 . GLU D 2 123 ? 22.997  -3.508  66.373  1.00 86.09  ? 123 GLU L OE1 1 
ATOM 5703 O OE2 . GLU D 2 123 ? 23.685  -3.124  64.357  1.00 80.68  ? 123 GLU L OE2 1 
ATOM 5704 N N   . GLN D 2 124 ? 25.734  -8.562  66.032  1.00 58.78  ? 124 GLN L N   1 
ATOM 5705 C CA  . GLN D 2 124 ? 25.224  -9.878  66.295  1.00 53.31  ? 124 GLN L CA  1 
ATOM 5706 C C   . GLN D 2 124 ? 26.232  -10.725 67.069  1.00 50.06  ? 124 GLN L C   1 
ATOM 5707 O O   . GLN D 2 124 ? 25.920  -11.157 68.185  1.00 48.87  ? 124 GLN L O   1 
ATOM 5708 C CB  . GLN D 2 124 ? 24.805  -10.558 64.994  1.00 45.16  ? 124 GLN L CB  1 
ATOM 5709 C CG  . GLN D 2 124 ? 24.313  -11.902 65.288  1.00 44.46  ? 124 GLN L CG  1 
ATOM 5710 C CD  . GLN D 2 124 ? 23.652  -12.602 64.133  1.00 43.39  ? 124 GLN L CD  1 
ATOM 5711 O OE1 . GLN D 2 124 ? 24.083  -12.476 62.992  1.00 54.02  ? 124 GLN L OE1 1 
ATOM 5712 N NE2 . GLN D 2 124 ? 22.616  -13.384 64.430  1.00 42.66  ? 124 GLN L NE2 1 
ATOM 5713 N N   . LEU D 2 125 ? 27.419  -10.963 66.495  1.00 56.42  ? 125 LEU L N   1 
ATOM 5714 C CA  . LEU D 2 125 ? 28.348  -11.948 67.062  1.00 61.22  ? 125 LEU L CA  1 
ATOM 5715 C C   . LEU D 2 125 ? 29.022  -11.529 68.383  1.00 74.80  ? 125 LEU L C   1 
ATOM 5716 O O   . LEU D 2 125 ? 29.688  -12.342 68.980  1.00 79.77  ? 125 LEU L O   1 
ATOM 5717 C CB  . LEU D 2 125 ? 29.434  -12.338 66.032  1.00 58.98  ? 125 LEU L CB  1 
ATOM 5718 C CG  . LEU D 2 125 ? 30.823  -11.725 65.764  1.00 54.75  ? 125 LEU L CG  1 
ATOM 5719 C CD1 . LEU D 2 125 ? 31.942  -12.441 66.474  1.00 57.40  ? 125 LEU L CD1 1 
ATOM 5720 C CD2 . LEU D 2 125 ? 31.003  -11.797 64.283  1.00 54.35  ? 125 LEU L CD2 1 
ATOM 5721 N N   . LYS D 2 126 ? 28.828  -10.303 68.866  1.00 71.01  ? 126 LYS L N   1 
ATOM 5722 C CA  . LYS D 2 126 ? 29.240  -9.961  70.238  1.00 75.48  ? 126 LYS L CA  1 
ATOM 5723 C C   . LYS D 2 126 ? 28.368  -10.684 71.228  1.00 72.10  ? 126 LYS L C   1 
ATOM 5724 O O   . LYS D 2 126 ? 28.848  -11.131 72.263  1.00 80.37  ? 126 LYS L O   1 
ATOM 5725 C CB  . LYS D 2 126 ? 29.129  -8.478  70.531  1.00 74.21  ? 126 LYS L CB  1 
ATOM 5726 C CG  . LYS D 2 126 ? 29.665  -7.592  69.494  1.00 76.36  ? 126 LYS L CG  1 
ATOM 5727 C CD  . LYS D 2 126 ? 31.084  -8.028  69.047  1.00 86.18  ? 126 LYS L CD  1 
ATOM 5728 C CE  . LYS D 2 126 ? 31.177  -8.459  67.496  1.00 108.72 ? 126 LYS L CE  1 
ATOM 5729 N NZ  . LYS D 2 126 ? 32.445  -9.076  67.240  1.00 108.29 ? 126 LYS L NZ  1 
ATOM 5730 N N   . SER D 2 127 ? 27.100  -10.850 70.858  1.00 62.26  ? 127 SER L N   1 
ATOM 5731 C CA  . SER D 2 127 ? 26.106  -11.501 71.688  1.00 58.22  ? 127 SER L CA  1 
ATOM 5732 C C   . SER D 2 127 ? 26.200  -13.007 71.469  1.00 53.89  ? 127 SER L C   1 
ATOM 5733 O O   . SER D 2 127 ? 25.386  -13.769 71.992  1.00 51.92  ? 127 SER L O   1 
ATOM 5734 C CB  . SER D 2 127 ? 24.714  -10.955 71.386  1.00 59.92  ? 127 SER L CB  1 
ATOM 5735 O OG  . SER D 2 127 ? 24.695  -9.538  71.498  1.00 65.57  ? 127 SER L OG  1 
ATOM 5736 N N   . GLY D 2 128 ? 27.224  -13.427 70.724  1.00 61.88  ? 128 GLY L N   1 
ATOM 5737 C CA  . GLY D 2 128 ? 27.551  -14.839 70.592  1.00 67.06  ? 128 GLY L CA  1 
ATOM 5738 C C   . GLY D 2 128 ? 26.688  -15.608 69.624  1.00 72.29  ? 128 GLY L C   1 
ATOM 5739 O O   . GLY D 2 128 ? 26.102  -16.638 69.965  1.00 72.66  ? 128 GLY L O   1 
ATOM 5740 N N   . THR D 2 129 ? 26.566  -15.044 68.426  1.00 70.27  ? 129 THR L N   1 
ATOM 5741 C CA  . THR D 2 129 ? 25.664  -15.554 67.398  1.00 72.81  ? 129 THR L CA  1 
ATOM 5742 C C   . THR D 2 129 ? 26.249  -15.706 65.964  1.00 49.01  ? 129 THR L C   1 
ATOM 5743 O O   . THR D 2 129 ? 26.522  -16.825 65.542  1.00 57.08  ? 129 THR L O   1 
ATOM 5744 C CB  . THR D 2 129 ? 24.439  -14.661 67.378  1.00 76.51  ? 129 THR L CB  1 
ATOM 5745 O OG1 . THR D 2 129 ? 24.865  -13.335 67.676  1.00 92.58  ? 129 THR L OG1 1 
ATOM 5746 C CG2 . THR D 2 129 ? 23.474  -15.014 68.477  1.00 60.83  ? 129 THR L CG2 1 
ATOM 5747 N N   . ALA D 2 130 ? 26.497  -14.605 65.249  1.00 44.33  ? 130 ALA L N   1 
ATOM 5748 C CA  . ALA D 2 130 ? 27.168  -14.649 63.928  1.00 51.83  ? 130 ALA L CA  1 
ATOM 5749 C C   . ALA D 2 130 ? 26.516  -15.409 62.735  1.00 50.74  ? 130 ALA L C   1 
ATOM 5750 O O   . ALA D 2 130 ? 26.939  -16.521 62.420  1.00 52.00  ? 130 ALA L O   1 
ATOM 5751 C CB  . ALA D 2 130 ? 28.593  -15.201 64.134  1.00 57.28  ? 130 ALA L CB  1 
ATOM 5752 N N   . SER D 2 131 ? 25.476  -14.859 62.104  1.00 44.53  ? 131 SER L N   1 
ATOM 5753 C CA  . SER D 2 131 ? 24.979  -15.482 60.868  1.00 45.63  ? 131 SER L CA  1 
ATOM 5754 C C   . SER D 2 131 ? 25.534  -14.862 59.585  1.00 34.74  ? 131 SER L C   1 
ATOM 5755 O O   . SER D 2 131 ? 25.616  -13.640 59.455  1.00 33.98  ? 131 SER L O   1 
ATOM 5756 C CB  . SER D 2 131 ? 23.457  -15.448 60.809  1.00 59.41  ? 131 SER L CB  1 
ATOM 5757 O OG  . SER D 2 131 ? 22.891  -16.012 61.984  1.00 73.53  ? 131 SER L OG  1 
ATOM 5758 N N   . VAL D 2 132 ? 25.898  -15.729 58.640  1.00 33.15  ? 132 VAL L N   1 
ATOM 5759 C CA  . VAL D 2 132 ? 26.435  -15.321 57.342  1.00 40.18  ? 132 VAL L CA  1 
ATOM 5760 C C   . VAL D 2 132 ? 25.363  -15.484 56.270  1.00 38.17  ? 132 VAL L C   1 
ATOM 5761 O O   . VAL D 2 132 ? 24.869  -16.589 56.046  1.00 32.89  ? 132 VAL L O   1 
ATOM 5762 C CB  . VAL D 2 132 ? 27.676  -16.151 56.957  1.00 41.50  ? 132 VAL L CB  1 
ATOM 5763 C CG1 . VAL D 2 132 ? 28.358  -15.579 55.719  1.00 33.35  ? 132 VAL L CG1 1 
ATOM 5764 C CG2 . VAL D 2 132 ? 28.645  -16.209 58.119  1.00 34.97  ? 132 VAL L CG2 1 
ATOM 5765 N N   . VAL D 2 133 ? 25.004  -14.387 55.612  1.00 35.41  ? 133 VAL L N   1 
ATOM 5766 C CA  . VAL D 2 133 ? 23.920  -14.409 54.641  1.00 37.38  ? 133 VAL L CA  1 
ATOM 5767 C C   . VAL D 2 133 ? 24.427  -14.385 53.202  1.00 39.48  ? 133 VAL L C   1 
ATOM 5768 O O   . VAL D 2 133 ? 25.195  -13.510 52.807  1.00 38.87  ? 133 VAL L O   1 
ATOM 5769 C CB  . VAL D 2 133 ? 22.956  -13.228 54.861  1.00 29.36  ? 133 VAL L CB  1 
ATOM 5770 C CG1 . VAL D 2 133 ? 21.762  -13.338 53.934  1.00 28.95  ? 133 VAL L CG1 1 
ATOM 5771 C CG2 . VAL D 2 133 ? 22.489  -13.206 56.310  1.00 29.74  ? 133 VAL L CG2 1 
ATOM 5772 N N   . CYS D 2 134 ? 23.988  -15.378 52.437  1.00 40.79  ? 134 CYS L N   1 
ATOM 5773 C CA  . CYS D 2 134 ? 24.161  -15.416 50.993  1.00 45.90  ? 134 CYS L CA  1 
ATOM 5774 C C   . CYS D 2 134 ? 22.901  -14.972 50.279  1.00 50.32  ? 134 CYS L C   1 
ATOM 5775 O O   . CYS D 2 134 ? 21.787  -15.193 50.763  1.00 65.44  ? 134 CYS L O   1 
ATOM 5776 C CB  . CYS D 2 134 ? 24.518  -16.816 50.516  1.00 45.32  ? 134 CYS L CB  1 
ATOM 5777 S SG  . CYS D 2 134 ? 24.057  -17.057 48.796  1.00 86.77  ? 134 CYS L SG  1 
ATOM 5778 N N   . LEU D 2 135 ? 23.080  -14.340 49.127  1.00 37.20  ? 135 LEU L N   1 
ATOM 5779 C CA  . LEU D 2 135 ? 21.940  -13.934 48.333  1.00 40.56  ? 135 LEU L CA  1 
ATOM 5780 C C   . LEU D 2 135 ? 22.148  -14.195 46.851  1.00 41.16  ? 135 LEU L C   1 
ATOM 5781 O O   . LEU D 2 135 ? 23.218  -13.959 46.302  1.00 51.63  ? 135 LEU L O   1 
ATOM 5782 C CB  . LEU D 2 135 ? 21.633  -12.460 48.586  1.00 34.77  ? 135 LEU L CB  1 
ATOM 5783 C CG  . LEU D 2 135 ? 20.558  -11.801 47.728  1.00 30.15  ? 135 LEU L CG  1 
ATOM 5784 C CD1 . LEU D 2 135 ? 19.883  -10.787 48.597  1.00 29.00  ? 135 LEU L CD1 1 
ATOM 5785 C CD2 . LEU D 2 135 ? 21.150  -11.116 46.508  1.00 32.53  ? 135 LEU L CD2 1 
ATOM 5786 N N   . LEU D 2 136 ? 21.095  -14.697 46.222  1.00 28.89  ? 136 LEU L N   1 
ATOM 5787 C CA  . LEU D 2 136 ? 21.040  -14.875 44.785  1.00 27.89  ? 136 LEU L CA  1 
ATOM 5788 C C   . LEU D 2 136 ? 19.883  -14.025 44.285  1.00 28.48  ? 136 LEU L C   1 
ATOM 5789 O O   . LEU D 2 136 ? 18.729  -14.330 44.566  1.00 26.77  ? 136 LEU L O   1 
ATOM 5790 C CB  . LEU D 2 136 ? 20.835  -16.348 44.411  1.00 29.29  ? 136 LEU L CB  1 
ATOM 5791 C CG  . LEU D 2 136 ? 21.837  -17.439 44.811  1.00 30.73  ? 136 LEU L CG  1 
ATOM 5792 C CD1 . LEU D 2 136 ? 21.861  -17.690 46.302  1.00 31.00  ? 136 LEU L CD1 1 
ATOM 5793 C CD2 . LEU D 2 136 ? 21.489  -18.719 44.079  1.00 32.09  ? 136 LEU L CD2 1 
ATOM 5794 N N   . ASN D 2 137 ? 20.181  -12.957 43.555  1.00 31.98  ? 137 ASN L N   1 
ATOM 5795 C CA  . ASN D 2 137 ? 19.134  -12.022 43.151  1.00 38.17  ? 137 ASN L CA  1 
ATOM 5796 C C   . ASN D 2 137 ? 18.681  -12.223 41.709  1.00 43.68  ? 137 ASN L C   1 
ATOM 5797 O O   . ASN D 2 137 ? 19.499  -12.438 40.811  1.00 50.38  ? 137 ASN L O   1 
ATOM 5798 C CB  . ASN D 2 137 ? 19.599  -10.572 43.337  1.00 34.22  ? 137 ASN L CB  1 
ATOM 5799 C CG  . ASN D 2 137 ? 18.573  -9.718  44.068  1.00 43.59  ? 137 ASN L CG  1 
ATOM 5800 O OD1 . ASN D 2 137 ? 17.813  -10.221 44.896  1.00 23.87  ? 137 ASN L OD1 1 
ATOM 5801 N ND2 . ASN D 2 137 ? 18.545  -8.424  43.764  1.00 39.97  ? 137 ASN L ND2 1 
ATOM 5802 N N   . ASN D 2 138 ? 17.368  -12.160 41.508  1.00 40.51  ? 138 ASN L N   1 
ATOM 5803 C CA  . ASN D 2 138 ? 16.770  -12.133 40.176  1.00 39.91  ? 138 ASN L CA  1 
ATOM 5804 C C   . ASN D 2 138 ? 17.309  -13.165 39.188  1.00 40.60  ? 138 ASN L C   1 
ATOM 5805 O O   . ASN D 2 138 ? 18.004  -12.816 38.237  1.00 41.71  ? 138 ASN L O   1 
ATOM 5806 C CB  . ASN D 2 138 ? 16.922  -10.736 39.582  1.00 41.69  ? 138 ASN L CB  1 
ATOM 5807 C CG  . ASN D 2 138 ? 15.865  -9.787  40.081  1.00 50.57  ? 138 ASN L CG  1 
ATOM 5808 O OD1 . ASN D 2 138 ? 14.762  -9.742  39.539  1.00 72.62  ? 138 ASN L OD1 1 
ATOM 5809 N ND2 . ASN D 2 138 ? 16.186  -9.027  41.123  1.00 27.45  ? 138 ASN L ND2 1 
ATOM 5810 N N   . PHE D 2 139 ? 16.988  -14.432 39.425  1.00 29.71  ? 139 PHE L N   1 
ATOM 5811 C CA  . PHE D 2 139 ? 17.405  -15.512 38.534  1.00 38.45  ? 139 PHE L CA  1 
ATOM 5812 C C   . PHE D 2 139 ? 16.213  -16.275 37.959  1.00 49.28  ? 139 PHE L C   1 
ATOM 5813 O O   . PHE D 2 139 ? 15.066  -15.989 38.306  1.00 48.29  ? 139 PHE L O   1 
ATOM 5814 C CB  . PHE D 2 139 ? 18.337  -16.483 39.272  1.00 37.17  ? 139 PHE L CB  1 
ATOM 5815 C CG  . PHE D 2 139 ? 17.737  -17.089 40.526  1.00 37.96  ? 139 PHE L CG  1 
ATOM 5816 C CD1 . PHE D 2 139 ? 16.821  -18.132 40.452  1.00 37.35  ? 139 PHE L CD1 1 
ATOM 5817 C CD2 . PHE D 2 139 ? 18.093  -16.613 41.778  1.00 34.92  ? 139 PHE L CD2 1 
ATOM 5818 C CE1 . PHE D 2 139 ? 16.275  -18.685 41.600  1.00 36.54  ? 139 PHE L CE1 1 
ATOM 5819 C CE2 . PHE D 2 139 ? 17.547  -17.162 42.931  1.00 38.02  ? 139 PHE L CE2 1 
ATOM 5820 C CZ  . PHE D 2 139 ? 16.637  -18.199 42.840  1.00 33.78  ? 139 PHE L CZ  1 
ATOM 5821 N N   . TYR D 2 140 ? 16.507  -17.272 37.121  1.00 49.53  ? 140 TYR L N   1 
ATOM 5822 C CA  . TYR D 2 140 ? 15.504  -18.189 36.566  1.00 43.42  ? 140 TYR L CA  1 
ATOM 5823 C C   . TYR D 2 140 ? 16.180  -19.282 35.730  1.00 42.97  ? 140 TYR L C   1 
ATOM 5824 O O   . TYR D 2 140 ? 17.109  -18.997 34.977  1.00 34.46  ? 140 TYR L O   1 
ATOM 5825 C CB  . TYR D 2 140 ? 14.470  -17.443 35.706  1.00 36.24  ? 140 TYR L CB  1 
ATOM 5826 C CG  . TYR D 2 140 ? 13.328  -18.330 35.265  1.00 32.64  ? 140 TYR L CG  1 
ATOM 5827 C CD1 . TYR D 2 140 ? 12.244  -18.565 36.102  1.00 49.27  ? 140 TYR L CD1 1 
ATOM 5828 C CD2 . TYR D 2 140 ? 13.342  -18.946 34.022  1.00 33.70  ? 140 TYR L CD2 1 
ATOM 5829 C CE1 . TYR D 2 140 ? 11.201  -19.388 35.711  1.00 44.51  ? 140 TYR L CE1 1 
ATOM 5830 C CE2 . TYR D 2 140 ? 12.301  -19.770 33.619  1.00 34.77  ? 140 TYR L CE2 1 
ATOM 5831 C CZ  . TYR D 2 140 ? 11.233  -19.988 34.468  1.00 41.38  ? 140 TYR L CZ  1 
ATOM 5832 O OH  . TYR D 2 140 ? 10.197  -20.808 34.075  1.00 37.25  ? 140 TYR L OH  1 
ATOM 5833 N N   . PRO D 2 141 ? 15.707  -20.539 35.843  1.00 38.10  ? 141 PRO L N   1 
ATOM 5834 C CA  . PRO D 2 141 ? 14.605  -21.037 36.680  1.00 39.86  ? 141 PRO L CA  1 
ATOM 5835 C C   . PRO D 2 141 ? 14.924  -21.061 38.176  1.00 38.29  ? 141 PRO L C   1 
ATOM 5836 O O   . PRO D 2 141 ? 16.024  -20.676 38.574  1.00 37.87  ? 141 PRO L O   1 
ATOM 5837 C CB  . PRO D 2 141 ? 14.381  -22.457 36.153  1.00 40.62  ? 141 PRO L CB  1 
ATOM 5838 C CG  . PRO D 2 141 ? 15.690  -22.854 35.597  1.00 48.38  ? 141 PRO L CG  1 
ATOM 5839 C CD  . PRO D 2 141 ? 16.253  -21.606 34.985  1.00 39.97  ? 141 PRO L CD  1 
ATOM 5840 N N   . ARG D 2 142 ? 13.959  -21.497 38.982  1.00 49.71  ? 142 ARG L N   1 
ATOM 5841 C CA  . ARG D 2 142 ? 14.062  -21.368 40.425  1.00 45.00  ? 142 ARG L CA  1 
ATOM 5842 C C   . ARG D 2 142 ? 15.035  -22.342 41.053  1.00 45.28  ? 142 ARG L C   1 
ATOM 5843 O O   . ARG D 2 142 ? 15.711  -21.994 42.030  1.00 40.73  ? 142 ARG L O   1 
ATOM 5844 C CB  . ARG D 2 142 ? 12.690  -21.541 41.084  1.00 43.45  ? 142 ARG L CB  1 
ATOM 5845 C CG  . ARG D 2 142 ? 12.776  -21.445 42.590  1.00 34.48  ? 142 ARG L CG  1 
ATOM 5846 C CD  . ARG D 2 142 ? 11.485  -21.781 43.268  1.00 35.06  ? 142 ARG L CD  1 
ATOM 5847 N NE  . ARG D 2 142 ? 11.705  -22.067 44.680  1.00 35.57  ? 142 ARG L NE  1 
ATOM 5848 C CZ  . ARG D 2 142 ? 10.786  -22.592 45.479  1.00 69.21  ? 142 ARG L CZ  1 
ATOM 5849 N NH1 . ARG D 2 142 ? 9.583   -22.875 44.999  1.00 67.96  ? 142 ARG L NH1 1 
ATOM 5850 N NH2 . ARG D 2 142 ? 11.063  -22.830 46.754  1.00 75.18  ? 142 ARG L NH2 1 
ATOM 5851 N N   . GLU D 2 143 ? 15.127  -23.544 40.494  1.00 63.13  ? 143 GLU L N   1 
ATOM 5852 C CA  . GLU D 2 143 ? 15.882  -24.557 41.180  1.00 68.56  ? 143 GLU L CA  1 
ATOM 5853 C C   . GLU D 2 143 ? 17.343  -24.111 41.016  1.00 63.02  ? 143 GLU L C   1 
ATOM 5854 O O   . GLU D 2 143 ? 17.884  -23.977 39.930  1.00 57.18  ? 143 GLU L O   1 
ATOM 5855 C CB  . GLU D 2 143 ? 15.571  -25.962 40.623  1.00 77.15  ? 143 GLU L CB  1 
ATOM 5856 C CG  . GLU D 2 143 ? 16.577  -27.046 40.954  1.00 86.38  ? 143 GLU L CG  1 
ATOM 5857 C CD  . GLU D 2 143 ? 17.745  -27.162 39.979  1.00 92.64  ? 143 GLU L CD  1 
ATOM 5858 O OE1 . GLU D 2 143 ? 17.524  -27.198 38.742  1.00 94.33  ? 143 GLU L OE1 1 
ATOM 5859 O OE2 . GLU D 2 143 ? 18.900  -27.170 40.455  1.00 91.87  ? 143 GLU L OE2 1 
ATOM 5860 N N   . ALA D 2 144 ? 17.934  -23.829 42.166  1.00 58.68  ? 144 ALA L N   1 
ATOM 5861 C CA  . ALA D 2 144 ? 19.310  -23.394 42.334  1.00 56.10  ? 144 ALA L CA  1 
ATOM 5862 C C   . ALA D 2 144 ? 19.766  -24.055 43.610  1.00 57.12  ? 144 ALA L C   1 
ATOM 5863 O O   . ALA D 2 144 ? 18.957  -24.291 44.498  1.00 61.23  ? 144 ALA L O   1 
ATOM 5864 C CB  . ALA D 2 144 ? 19.412  -21.864 42.430  1.00 51.18  ? 144 ALA L CB  1 
ATOM 5865 N N   . LYS D 2 145 ? 21.027  -24.446 43.676  1.00 57.05  ? 145 LYS L N   1 
ATOM 5866 C CA  . LYS D 2 145 ? 21.550  -24.997 44.917  1.00 64.60  ? 145 LYS L CA  1 
ATOM 5867 C C   . LYS D 2 145 ? 22.860  -24.330 45.244  1.00 59.80  ? 145 LYS L C   1 
ATOM 5868 O O   . LYS D 2 145 ? 23.759  -24.262 44.408  1.00 64.07  ? 145 LYS L O   1 
ATOM 5869 C CB  . LYS D 2 145 ? 21.761  -26.511 44.853  1.00 72.92  ? 145 LYS L CB  1 
ATOM 5870 C CG  . LYS D 2 145 ? 20.696  -27.331 44.170  1.00 78.28  ? 145 LYS L CG  1 
ATOM 5871 C CD  . LYS D 2 145 ? 21.300  -28.567 43.521  1.00 81.94  ? 145 LYS L CD  1 
ATOM 5872 C CE  . LYS D 2 145 ? 20.471  -29.055 42.351  1.00 78.53  ? 145 LYS L CE  1 
ATOM 5873 N NZ  . LYS D 2 145 ? 21.372  -29.558 41.280  1.00 77.57  ? 145 LYS L NZ  1 
ATOM 5874 N N   . VAL D 2 146 ? 22.935  -23.774 46.443  1.00 60.46  ? 146 VAL L N   1 
ATOM 5875 C CA  . VAL D 2 146 ? 24.176  -23.220 46.938  1.00 53.43  ? 146 VAL L CA  1 
ATOM 5876 C C   . VAL D 2 146 ? 24.762  -24.184 47.952  1.00 50.53  ? 146 VAL L C   1 
ATOM 5877 O O   . VAL D 2 146 ? 24.145  -25.196 48.274  1.00 53.48  ? 146 VAL L O   1 
ATOM 5878 C CB  . VAL D 2 146 ? 23.953  -21.849 47.591  1.00 56.74  ? 146 VAL L CB  1 
ATOM 5879 C CG1 . VAL D 2 146 ? 23.121  -20.974 46.669  1.00 59.80  ? 146 VAL L CG1 1 
ATOM 5880 C CG2 . VAL D 2 146 ? 23.271  -22.009 48.932  1.00 52.10  ? 146 VAL L CG2 1 
ATOM 5881 N N   . GLN D 2 147 ? 25.919  -23.831 48.498  1.00 47.26  ? 147 GLN L N   1 
ATOM 5882 C CA  . GLN D 2 147 ? 26.416  -24.476 49.704  1.00 56.39  ? 147 GLN L CA  1 
ATOM 5883 C C   . GLN D 2 147 ? 27.660  -23.792 50.218  1.00 58.05  ? 147 GLN L C   1 
ATOM 5884 O O   . GLN D 2 147 ? 28.378  -23.099 49.490  1.00 50.90  ? 147 GLN L O   1 
ATOM 5885 C CB  . GLN D 2 147 ? 26.719  -25.966 49.494  1.00 65.84  ? 147 GLN L CB  1 
ATOM 5886 C CG  . GLN D 2 147 ? 27.163  -26.408 48.110  1.00 67.43  ? 147 GLN L CG  1 
ATOM 5887 C CD  . GLN D 2 147 ? 26.976  -27.904 47.941  1.00 67.36  ? 147 GLN L CD  1 
ATOM 5888 O OE1 . GLN D 2 147 ? 26.702  -28.616 48.911  1.00 62.24  ? 147 GLN L OE1 1 
ATOM 5889 N NE2 . GLN D 2 147 ? 27.093  -28.385 46.709  1.00 71.36  ? 147 GLN L NE2 1 
ATOM 5890 N N   . TRP D 2 148 ? 27.917  -24.039 51.494  1.00 62.54  ? 148 TRP L N   1 
ATOM 5891 C CA  . TRP D 2 148 ? 28.867  -23.257 52.254  1.00 60.25  ? 148 TRP L CA  1 
ATOM 5892 C C   . TRP D 2 148 ? 30.132  -24.043 52.474  1.00 53.18  ? 148 TRP L C   1 
ATOM 5893 O O   . TRP D 2 148 ? 30.104  -25.212 52.856  1.00 50.46  ? 148 TRP L O   1 
ATOM 5894 C CB  . TRP D 2 148 ? 28.255  -22.836 53.584  1.00 54.37  ? 148 TRP L CB  1 
ATOM 5895 C CG  . TRP D 2 148 ? 27.112  -21.903 53.412  1.00 51.26  ? 148 TRP L CG  1 
ATOM 5896 C CD1 . TRP D 2 148 ? 25.811  -22.242 53.204  1.00 39.66  ? 148 TRP L CD1 1 
ATOM 5897 C CD2 . TRP D 2 148 ? 27.157  -20.473 53.439  1.00 44.99  ? 148 TRP L CD2 1 
ATOM 5898 N NE1 . TRP D 2 148 ? 25.039  -21.114 53.096  1.00 38.18  ? 148 TRP L NE1 1 
ATOM 5899 C CE2 . TRP D 2 148 ? 25.841  -20.013 53.238  1.00 46.30  ? 148 TRP L CE2 1 
ATOM 5900 C CE3 . TRP D 2 148 ? 28.179  -19.535 53.614  1.00 41.18  ? 148 TRP L CE3 1 
ATOM 5901 C CZ2 . TRP D 2 148 ? 25.519  -18.661 53.207  1.00 44.73  ? 148 TRP L CZ2 1 
ATOM 5902 C CZ3 . TRP D 2 148 ? 27.859  -18.193 53.581  1.00 41.11  ? 148 TRP L CZ3 1 
ATOM 5903 C CH2 . TRP D 2 148 ? 26.538  -17.768 53.381  1.00 44.97  ? 148 TRP L CH2 1 
ATOM 5904 N N   . LYS D 2 149 ? 31.252  -23.410 52.178  1.00 54.78  ? 149 LYS L N   1 
ATOM 5905 C CA  . LYS D 2 149 ? 32.510  -24.107 52.285  1.00 60.64  ? 149 LYS L CA  1 
ATOM 5906 C C   . LYS D 2 149 ? 33.424  -23.235 53.133  1.00 64.03  ? 149 LYS L C   1 
ATOM 5907 O O   . LYS D 2 149 ? 33.865  -22.169 52.704  1.00 56.66  ? 149 LYS L O   1 
ATOM 5908 C CB  . LYS D 2 149 ? 33.038  -24.418 50.862  1.00 65.78  ? 149 LYS L CB  1 
ATOM 5909 C CG  . LYS D 2 149 ? 34.330  -25.222 50.719  1.00 72.47  ? 149 LYS L CG  1 
ATOM 5910 C CD  . LYS D 2 149 ? 34.663  -25.532 49.255  1.00 72.76  ? 149 LYS L CD  1 
ATOM 5911 C CE  . LYS D 2 149 ? 35.991  -26.253 49.082  1.00 67.64  ? 149 LYS L CE  1 
ATOM 5912 N NZ  . LYS D 2 149 ? 35.885  -27.315 48.045  1.00 64.06  ? 149 LYS L NZ  1 
ATOM 5913 N N   . VAL D 2 150 ? 33.694  -23.702 54.351  1.00 67.95  ? 150 VAL L N   1 
ATOM 5914 C CA  . VAL D 2 150 ? 34.471  -22.920 55.309  1.00 62.33  ? 150 VAL L CA  1 
ATOM 5915 C C   . VAL D 2 150 ? 35.873  -23.476 55.414  1.00 65.33  ? 150 VAL L C   1 
ATOM 5916 O O   . VAL D 2 150 ? 36.091  -24.546 55.989  1.00 63.70  ? 150 VAL L O   1 
ATOM 5917 C CB  . VAL D 2 150 ? 33.837  -22.899 56.719  1.00 49.70  ? 150 VAL L CB  1 
ATOM 5918 C CG1 . VAL D 2 150 ? 34.612  -21.954 57.629  1.00 49.13  ? 150 VAL L CG1 1 
ATOM 5919 C CG2 . VAL D 2 150 ? 32.388  -22.474 56.647  1.00 46.95  ? 150 VAL L CG2 1 
ATOM 5920 N N   . ASP D 2 151 ? 36.821  -22.717 54.875  1.00 67.72  ? 151 ASP L N   1 
ATOM 5921 C CA  . ASP D 2 151 ? 38.190  -23.185 54.698  1.00 68.18  ? 151 ASP L CA  1 
ATOM 5922 C C   . ASP D 2 151 ? 38.220  -24.556 54.034  1.00 69.32  ? 151 ASP L C   1 
ATOM 5923 O O   . ASP D 2 151 ? 38.601  -25.555 54.647  1.00 74.48  ? 151 ASP L O   1 
ATOM 5924 C CB  . ASP D 2 151 ? 38.908  -23.202 56.032  1.00 68.72  ? 151 ASP L CB  1 
ATOM 5925 C CG  . ASP D 2 151 ? 39.369  -21.825 56.436  1.00 66.06  ? 151 ASP L CG  1 
ATOM 5926 O OD1 . ASP D 2 151 ? 40.025  -21.153 55.606  1.00 69.79  ? 151 ASP L OD1 1 
ATOM 5927 O OD2 . ASP D 2 151 ? 39.054  -21.405 57.568  1.00 58.32  ? 151 ASP L OD2 1 
ATOM 5928 N N   . ASN D 2 152 ? 37.749  -24.586 52.788  1.00 73.74  ? 152 ASN L N   1 
ATOM 5929 C CA  . ASN D 2 152 ? 37.659  -25.802 51.966  1.00 85.12  ? 152 ASN L CA  1 
ATOM 5930 C C   . ASN D 2 152 ? 37.097  -27.026 52.672  1.00 90.45  ? 152 ASN L C   1 
ATOM 5931 O O   . ASN D 2 152 ? 37.593  -28.155 52.487  1.00 93.16  ? 152 ASN L O   1 
ATOM 5932 C CB  . ASN D 2 152 ? 39.004  -26.161 51.322  1.00 95.91  ? 152 ASN L CB  1 
ATOM 5933 C CG  . ASN D 2 152 ? 39.564  -25.038 50.486  1.00 102.43 ? 152 ASN L CG  1 
ATOM 5934 O OD1 . ASN D 2 152 ? 38.845  -24.104 50.101  1.00 105.61 ? 152 ASN L OD1 1 
ATOM 5935 N ND2 . ASN D 2 152 ? 40.823  -25.180 50.092  1.00 99.60  ? 152 ASN L ND2 1 
ATOM 5936 N N   . ALA D 2 153 ? 36.046  -26.801 53.454  1.00 75.68  ? 153 ALA L N   1 
ATOM 5937 C CA  . ALA D 2 153 ? 35.425  -27.879 54.196  1.00 77.78  ? 153 ALA L CA  1 
ATOM 5938 C C   . ALA D 2 153 ? 34.074  -28.311 53.650  1.00 72.24  ? 153 ALA L C   1 
ATOM 5939 O O   . ALA D 2 153 ? 33.578  -27.767 52.670  1.00 66.80  ? 153 ALA L O   1 
ATOM 5940 C CB  . ALA D 2 153 ? 35.300  -27.469 55.649  1.00 73.88  ? 153 ALA L CB  1 
ATOM 5941 N N   . LEU D 2 154 ? 33.503  -29.300 54.326  1.00 90.56  ? 154 LEU L N   1 
ATOM 5942 C CA  . LEU D 2 154 ? 32.173  -29.817 54.069  1.00 84.67  ? 154 LEU L CA  1 
ATOM 5943 C C   . LEU D 2 154 ? 31.174  -28.800 54.603  1.00 73.05  ? 154 LEU L C   1 
ATOM 5944 O O   . LEU D 2 154 ? 31.579  -27.712 55.012  1.00 68.07  ? 154 LEU L O   1 
ATOM 5945 C CB  . LEU D 2 154 ? 32.004  -31.160 54.777  1.00 86.99  ? 154 LEU L CB  1 
ATOM 5946 C CG  . LEU D 2 154 ? 31.570  -32.480 54.146  1.00 88.26  ? 154 LEU L CG  1 
ATOM 5947 C CD1 . LEU D 2 154 ? 32.382  -32.824 52.911  1.00 81.55  ? 154 LEU L CD1 1 
ATOM 5948 C CD2 . LEU D 2 154 ? 31.791  -33.532 55.215  1.00 89.80  ? 154 LEU L CD2 1 
ATOM 5949 N N   . GLN D 2 155 ? 29.886  -29.152 54.594  1.00 65.03  ? 155 GLN L N   1 
ATOM 5950 C CA  . GLN D 2 155 ? 28.884  -28.464 55.418  1.00 61.41  ? 155 GLN L CA  1 
ATOM 5951 C C   . GLN D 2 155 ? 27.513  -29.096 55.309  1.00 66.08  ? 155 GLN L C   1 
ATOM 5952 O O   . GLN D 2 155 ? 27.202  -29.744 54.303  1.00 66.24  ? 155 GLN L O   1 
ATOM 5953 C CB  . GLN D 2 155 ? 28.761  -26.990 55.028  1.00 54.04  ? 155 GLN L CB  1 
ATOM 5954 C CG  . GLN D 2 155 ? 28.539  -26.084 56.221  1.00 56.20  ? 155 GLN L CG  1 
ATOM 5955 C CD  . GLN D 2 155 ? 29.737  -26.070 57.151  1.00 63.55  ? 155 GLN L CD  1 
ATOM 5956 O OE1 . GLN D 2 155 ? 30.809  -25.578 56.794  1.00 64.79  ? 155 GLN L OE1 1 
ATOM 5957 N NE2 . GLN D 2 155 ? 29.565  -26.620 58.348  1.00 63.77  ? 155 GLN L NE2 1 
ATOM 5958 N N   . SER D 2 156 ? 26.707  -28.875 56.351  1.00 65.02  ? 156 SER L N   1 
ATOM 5959 C CA  . SER D 2 156 ? 25.327  -29.343 56.425  1.00 65.59  ? 156 SER L CA  1 
ATOM 5960 C C   . SER D 2 156 ? 24.666  -29.025 57.773  1.00 63.95  ? 156 SER L C   1 
ATOM 5961 O O   . SER D 2 156 ? 25.332  -28.916 58.804  1.00 64.21  ? 156 SER L O   1 
ATOM 5962 C CB  . SER D 2 156 ? 25.271  -30.850 56.198  1.00 63.69  ? 156 SER L CB  1 
ATOM 5963 O OG  . SER D 2 156 ? 23.939  -31.314 56.142  1.00 62.29  ? 156 SER L OG  1 
ATOM 5964 N N   . GLY D 2 157 ? 23.339  -28.935 57.748  1.00 65.68  ? 157 GLY L N   1 
ATOM 5965 C CA  . GLY D 2 157 ? 22.497  -28.791 58.926  1.00 64.04  ? 157 GLY L CA  1 
ATOM 5966 C C   . GLY D 2 157 ? 22.467  -27.385 59.490  1.00 60.36  ? 157 GLY L C   1 
ATOM 5967 O O   . GLY D 2 157 ? 21.489  -26.979 60.112  1.00 54.75  ? 157 GLY L O   1 
ATOM 5968 N N   . ASN D 2 158 ? 23.529  -26.630 59.223  1.00 58.16  ? 158 ASN L N   1 
ATOM 5969 C CA  . ASN D 2 158 ? 23.647  -25.255 59.696  1.00 60.95  ? 158 ASN L CA  1 
ATOM 5970 C C   . ASN D 2 158 ? 23.234  -24.208 58.653  1.00 63.65  ? 158 ASN L C   1 
ATOM 5971 O O   . ASN D 2 158 ? 23.466  -23.016 58.844  1.00 72.31  ? 158 ASN L O   1 
ATOM 5972 C CB  . ASN D 2 158 ? 25.070  -24.999 60.256  1.00 47.09  ? 158 ASN L CB  1 
ATOM 5973 C CG  . ASN D 2 158 ? 26.177  -25.231 59.251  1.00 62.97  ? 158 ASN L CG  1 
ATOM 5974 O OD1 . ASN D 2 158 ? 26.183  -26.223 58.526  1.00 72.13  ? 158 ASN L OD1 1 
ATOM 5975 N ND2 . ASN D 2 158 ? 27.159  -24.332 59.248  1.00 67.57  ? 158 ASN L ND2 1 
ATOM 5976 N N   . SER D 2 159 ? 22.668  -24.664 57.534  1.00 53.23  ? 159 SER L N   1 
ATOM 5977 C CA  . SER D 2 159 ? 22.155  -23.750 56.507  1.00 46.52  ? 159 SER L CA  1 
ATOM 5978 C C   . SER D 2 159 ? 20.629  -23.803 56.318  1.00 39.41  ? 159 SER L C   1 
ATOM 5979 O O   . SER D 2 159 ? 20.032  -24.876 56.368  1.00 45.26  ? 159 SER L O   1 
ATOM 5980 C CB  . SER D 2 159 ? 22.834  -24.042 55.169  1.00 51.26  ? 159 SER L CB  1 
ATOM 5981 O OG  . SER D 2 159 ? 24.241  -23.925 55.289  1.00 60.64  ? 159 SER L OG  1 
ATOM 5982 N N   . GLN D 2 160 ? 20.009  -22.642 56.092  1.00 39.27  ? 160 GLN L N   1 
ATOM 5983 C CA  . GLN D 2 160 ? 18.566  -22.567 55.827  1.00 41.43  ? 160 GLN L CA  1 
ATOM 5984 C C   . GLN D 2 160 ? 18.228  -21.591 54.693  1.00 48.55  ? 160 GLN L C   1 
ATOM 5985 O O   . GLN D 2 160 ? 18.745  -20.474 54.644  1.00 47.38  ? 160 GLN L O   1 
ATOM 5986 C CB  . GLN D 2 160 ? 17.806  -22.174 57.097  1.00 42.48  ? 160 GLN L CB  1 
ATOM 5987 C CG  . GLN D 2 160 ? 16.721  -23.171 57.483  1.00 48.34  ? 160 GLN L CG  1 
ATOM 5988 C CD  . GLN D 2 160 ? 16.394  -23.153 58.964  1.00 57.76  ? 160 GLN L CD  1 
ATOM 5989 O OE1 . GLN D 2 160 ? 16.732  -22.207 59.679  1.00 64.72  ? 160 GLN L OE1 1 
ATOM 5990 N NE2 . GLN D 2 160 ? 15.742  -24.211 59.436  1.00 56.46  ? 160 GLN L NE2 1 
ATOM 5991 N N   . GLU D 2 161 ? 17.338  -22.016 53.798  1.00 47.41  ? 161 GLU L N   1 
ATOM 5992 C CA  . GLU D 2 161 ? 17.033  -21.250 52.590  1.00 46.62  ? 161 GLU L CA  1 
ATOM 5993 C C   . GLU D 2 161 ? 15.645  -20.614 52.590  1.00 43.89  ? 161 GLU L C   1 
ATOM 5994 O O   . GLU D 2 161 ? 14.693  -21.147 53.155  1.00 34.41  ? 161 GLU L O   1 
ATOM 5995 C CB  . GLU D 2 161 ? 17.174  -22.138 51.349  1.00 45.99  ? 161 GLU L CB  1 
ATOM 5996 C CG  . GLU D 2 161 ? 18.609  -22.375 50.906  1.00 49.95  ? 161 GLU L CG  1 
ATOM 5997 C CD  . GLU D 2 161 ? 18.714  -23.384 49.774  1.00 55.52  ? 161 GLU L CD  1 
ATOM 5998 O OE1 . GLU D 2 161 ? 17.833  -23.381 48.886  1.00 51.42  ? 161 GLU L OE1 1 
ATOM 5999 O OE2 . GLU D 2 161 ? 19.683  -24.174 49.766  1.00 63.23  ? 161 GLU L OE2 1 
ATOM 6000 N N   . SER D 2 162 ? 15.550  -19.461 51.939  1.00 38.48  ? 162 SER L N   1 
ATOM 6001 C CA  . SER D 2 162 ? 14.289  -18.752 51.773  1.00 31.16  ? 162 SER L CA  1 
ATOM 6002 C C   . SER D 2 162 ? 14.141  -18.347 50.311  1.00 39.43  ? 162 SER L C   1 
ATOM 6003 O O   . SER D 2 162 ? 15.125  -17.977 49.671  1.00 31.17  ? 162 SER L O   1 
ATOM 6004 C CB  . SER D 2 162 ? 14.238  -17.525 52.683  1.00 30.55  ? 162 SER L CB  1 
ATOM 6005 O OG  . SER D 2 162 ? 13.035  -16.803 52.501  1.00 30.12  ? 162 SER L OG  1 
ATOM 6006 N N   . VAL D 2 163 ? 12.927  -18.432 49.773  1.00 37.00  ? 163 VAL L N   1 
ATOM 6007 C CA  . VAL D 2 163 ? 12.701  -18.080 48.372  1.00 39.90  ? 163 VAL L CA  1 
ATOM 6008 C C   . VAL D 2 163 ? 11.493  -17.167 48.196  1.00 30.22  ? 163 VAL L C   1 
ATOM 6009 O O   . VAL D 2 163 ? 10.386  -17.504 48.606  1.00 31.16  ? 163 VAL L O   1 
ATOM 6010 C CB  . VAL D 2 163 ? 12.495  -19.332 47.491  1.00 51.98  ? 163 VAL L CB  1 
ATOM 6011 C CG1 . VAL D 2 163 ? 12.354  -18.930 46.030  1.00 52.70  ? 163 VAL L CG1 1 
ATOM 6012 C CG2 . VAL D 2 163 ? 13.648  -20.304 47.658  1.00 57.27  ? 163 VAL L CG2 1 
ATOM 6013 N N   . THR D 2 164 ? 11.714  -16.012 47.575  1.00 32.01  ? 164 THR L N   1 
ATOM 6014 C CA  . THR D 2 164 ? 10.629  -15.088 47.263  1.00 31.69  ? 164 THR L CA  1 
ATOM 6015 C C   . THR D 2 164 ? 9.716   -15.684 46.202  1.00 36.03  ? 164 THR L C   1 
ATOM 6016 O O   . THR D 2 164 ? 10.120  -16.581 45.456  1.00 39.58  ? 164 THR L O   1 
ATOM 6017 C CB  . THR D 2 164 ? 11.154  -13.730 46.756  1.00 31.43  ? 164 THR L CB  1 
ATOM 6018 O OG1 . THR D 2 164 ? 11.747  -13.896 45.462  1.00 35.87  ? 164 THR L OG1 1 
ATOM 6019 C CG2 . THR D 2 164 ? 12.179  -13.154 47.717  1.00 31.19  ? 164 THR L CG2 1 
ATOM 6020 N N   . GLU D 2 165 ? 8.479   -15.204 46.145  1.00 35.84  ? 165 GLU L N   1 
ATOM 6021 C CA  . GLU D 2 165 ? 7.571   -15.645 45.101  1.00 44.32  ? 165 GLU L CA  1 
ATOM 6022 C C   . GLU D 2 165 ? 7.848   -14.894 43.801  1.00 44.89  ? 165 GLU L C   1 
ATOM 6023 O O   . GLU D 2 165 ? 8.303   -13.752 43.828  1.00 50.75  ? 165 GLU L O   1 
ATOM 6024 C CB  . GLU D 2 165 ? 6.116   -15.467 45.539  1.00 54.73  ? 165 GLU L CB  1 
ATOM 6025 C CG  . GLU D 2 165 ? 5.150   -16.341 44.763  1.00 66.56  ? 165 GLU L CG  1 
ATOM 6026 C CD  . GLU D 2 165 ? 3.748   -16.332 45.338  1.00 75.48  ? 165 GLU L CD  1 
ATOM 6027 O OE1 . GLU D 2 165 ? 3.595   -16.567 46.559  1.00 79.43  ? 165 GLU L OE1 1 
ATOM 6028 O OE2 . GLU D 2 165 ? 2.798   -16.092 44.563  1.00 78.20  ? 165 GLU L OE2 1 
ATOM 6029 N N   . GLN D 2 166 ? 7.543   -15.542 42.679  1.00 38.05  ? 166 GLN L N   1 
ATOM 6030 C CA  . GLN D 2 166 ? 7.884   -15.059 41.342  1.00 38.60  ? 166 GLN L CA  1 
ATOM 6031 C C   . GLN D 2 166 ? 7.457   -13.611 41.103  1.00 38.03  ? 166 GLN L C   1 
ATOM 6032 O O   . GLN D 2 166 ? 6.309   -13.239 41.360  1.00 46.00  ? 166 GLN L O   1 
ATOM 6033 C CB  . GLN D 2 166 ? 7.238   -15.967 40.297  1.00 32.43  ? 166 GLN L CB  1 
ATOM 6034 C CG  . GLN D 2 166 ? 7.733   -15.777 38.875  1.00 36.04  ? 166 GLN L CG  1 
ATOM 6035 C CD  . GLN D 2 166 ? 7.171   -16.827 37.932  1.00 44.49  ? 166 GLN L CD  1 
ATOM 6036 O OE1 . GLN D 2 166 ? 5.954   -16.965 37.800  1.00 45.79  ? 166 GLN L OE1 1 
ATOM 6037 N NE2 . GLN D 2 166 ? 8.052   -17.553 37.252  1.00 51.68  ? 166 GLN L NE2 1 
ATOM 6038 N N   . ASP D 2 167 ? 8.387   -12.803 40.597  1.00 38.31  ? 167 ASP L N   1 
ATOM 6039 C CA  . ASP D 2 167 ? 8.184   -11.361 40.499  1.00 45.95  ? 167 ASP L CA  1 
ATOM 6040 C C   . ASP D 2 167 ? 7.080   -10.994 39.511  1.00 50.58  ? 167 ASP L C   1 
ATOM 6041 O O   . ASP D 2 167 ? 6.882   -11.661 38.496  1.00 54.45  ? 167 ASP L O   1 
ATOM 6042 C CB  . ASP D 2 167 ? 9.495   -10.669 40.108  1.00 57.46  ? 167 ASP L CB  1 
ATOM 6043 C CG  . ASP D 2 167 ? 9.464   -9.168  40.356  1.00 74.19  ? 167 ASP L CG  1 
ATOM 6044 O OD1 . ASP D 2 167 ? 8.584   -8.488  39.789  1.00 86.63  ? 167 ASP L OD1 1 
ATOM 6045 O OD2 . ASP D 2 167 ? 10.312  -8.665  41.126  1.00 73.58  ? 167 ASP L OD2 1 
ATOM 6046 N N   . SER D 2 168 ? 6.357   -9.926  39.833  1.00 58.31  ? 168 SER L N   1 
ATOM 6047 C CA  . SER D 2 168 ? 5.274   -9.441  38.987  1.00 58.77  ? 168 SER L CA  1 
ATOM 6048 C C   . SER D 2 168 ? 5.819   -8.740  37.746  1.00 62.60  ? 168 SER L C   1 
ATOM 6049 O O   . SER D 2 168 ? 5.126   -8.611  36.737  1.00 66.20  ? 168 SER L O   1 
ATOM 6050 C CB  . SER D 2 168 ? 4.368   -8.493  39.775  1.00 57.25  ? 168 SER L CB  1 
ATOM 6051 O OG  . SER D 2 168 ? 5.068   -7.319  40.154  1.00 54.20  ? 168 SER L OG  1 
ATOM 6052 N N   . LYS D 2 169 ? 7.064   -8.285  37.832  1.00 56.79  ? 169 LYS L N   1 
ATOM 6053 C CA  . LYS D 2 169 ? 7.728   -7.629  36.713  1.00 45.22  ? 169 LYS L CA  1 
ATOM 6054 C C   . LYS D 2 169 ? 8.677   -8.591  36.002  1.00 52.65  ? 169 LYS L C   1 
ATOM 6055 O O   . LYS D 2 169 ? 8.445   -8.972  34.858  1.00 48.20  ? 169 LYS L O   1 
ATOM 6056 C CB  . LYS D 2 169 ? 8.500   -6.397  37.193  1.00 41.94  ? 169 LYS L CB  1 
ATOM 6057 C CG  . LYS D 2 169 ? 7.637   -5.229  37.645  1.00 41.05  ? 169 LYS L CG  1 
ATOM 6058 C CD  . LYS D 2 169 ? 6.891   -4.589  36.485  1.00 48.92  ? 169 LYS L CD  1 
ATOM 6059 C CE  . LYS D 2 169 ? 6.207   -3.301  36.922  1.00 51.92  ? 169 LYS L CE  1 
ATOM 6060 N NZ  . LYS D 2 169 ? 5.696   -2.514  35.766  1.00 55.82  ? 169 LYS L NZ  1 
ATOM 6061 N N   . ASP D 2 170 ? 9.739   -8.981  36.700  1.00 54.60  ? 170 ASP L N   1 
ATOM 6062 C CA  . ASP D 2 170 ? 10.821  -9.775  36.120  1.00 59.87  ? 170 ASP L CA  1 
ATOM 6063 C C   . ASP D 2 170 ? 10.462  -11.237 35.919  1.00 55.18  ? 170 ASP L C   1 
ATOM 6064 O O   . ASP D 2 170 ? 11.061  -11.918 35.085  1.00 50.80  ? 170 ASP L O   1 
ATOM 6065 C CB  . ASP D 2 170 ? 12.060  -9.697  37.008  1.00 68.04  ? 170 ASP L CB  1 
ATOM 6066 C CG  . ASP D 2 170 ? 12.729  -8.349  36.954  1.00 80.84  ? 170 ASP L CG  1 
ATOM 6067 O OD1 . ASP D 2 170 ? 12.906  -7.819  35.837  1.00 86.97  ? 170 ASP L OD1 1 
ATOM 6068 O OD2 . ASP D 2 170 ? 13.066  -7.816  38.031  1.00 79.35  ? 170 ASP L OD2 1 
ATOM 6069 N N   . SER D 2 171 ? 9.488   -11.704 36.695  1.00 51.27  ? 171 SER L N   1 
ATOM 6070 C CA  . SER D 2 171 ? 9.137   -13.119 36.777  1.00 46.55  ? 171 SER L CA  1 
ATOM 6071 C C   . SER D 2 171 ? 10.321  -13.941 37.267  1.00 42.91  ? 171 SER L C   1 
ATOM 6072 O O   . SER D 2 171 ? 10.416  -15.138 36.981  1.00 38.34  ? 171 SER L O   1 
ATOM 6073 C CB  . SER D 2 171 ? 8.650   -13.650 35.426  1.00 40.62  ? 171 SER L CB  1 
ATOM 6074 O OG  . SER D 2 171 ? 7.253   -13.473 35.285  1.00 38.71  ? 171 SER L OG  1 
ATOM 6075 N N   . THR D 2 172 ? 11.222  -13.305 38.012  1.00 48.65  ? 172 THR L N   1 
ATOM 6076 C CA  . THR D 2 172 ? 12.408  -14.006 38.484  1.00 42.28  ? 172 THR L CA  1 
ATOM 6077 C C   . THR D 2 172 ? 12.282  -14.384 39.950  1.00 39.82  ? 172 THR L C   1 
ATOM 6078 O O   . THR D 2 172 ? 11.305  -14.047 40.615  1.00 39.41  ? 172 THR L O   1 
ATOM 6079 C CB  . THR D 2 172 ? 13.682  -13.167 38.286  1.00 38.52  ? 172 THR L CB  1 
ATOM 6080 O OG1 . THR D 2 172 ? 13.494  -11.868 38.855  1.00 37.19  ? 172 THR L OG1 1 
ATOM 6081 C CG2 . THR D 2 172 ? 13.974  -13.026 36.806  1.00 41.16  ? 172 THR L CG2 1 
ATOM 6082 N N   . TYR D 2 173 ? 13.290  -15.081 40.456  1.00 35.36  ? 173 TYR L N   1 
ATOM 6083 C CA  . TYR D 2 173 ? 13.309  -15.459 41.859  1.00 39.37  ? 173 TYR L CA  1 
ATOM 6084 C C   . TYR D 2 173 ? 14.546  -14.907 42.542  1.00 35.42  ? 173 TYR L C   1 
ATOM 6085 O O   . TYR D 2 173 ? 15.558  -14.626 41.903  1.00 37.76  ? 173 TYR L O   1 
ATOM 6086 C CB  . TYR D 2 173 ? 13.262  -16.979 42.034  1.00 34.05  ? 173 TYR L CB  1 
ATOM 6087 C CG  . TYR D 2 173 ? 11.995  -17.643 41.545  1.00 34.29  ? 173 TYR L CG  1 
ATOM 6088 C CD1 . TYR D 2 173 ? 11.767  -17.844 40.190  1.00 42.06  ? 173 TYR L CD1 1 
ATOM 6089 C CD2 . TYR D 2 173 ? 11.038  -18.097 42.444  1.00 40.95  ? 173 TYR L CD2 1 
ATOM 6090 C CE1 . TYR D 2 173 ? 10.614  -18.467 39.744  1.00 40.39  ? 173 TYR L CE1 1 
ATOM 6091 C CE2 . TYR D 2 173 ? 9.882   -18.721 42.009  1.00 43.05  ? 173 TYR L CE2 1 
ATOM 6092 C CZ  . TYR D 2 173 ? 9.674   -18.903 40.660  1.00 44.17  ? 173 TYR L CZ  1 
ATOM 6093 O OH  . TYR D 2 173 ? 8.523   -19.521 40.229  1.00 51.28  ? 173 TYR L OH  1 
ATOM 6094 N N   . SER D 2 174 ? 14.452  -14.757 43.854  1.00 33.89  ? 174 SER L N   1 
ATOM 6095 C CA  . SER D 2 174 ? 15.591  -14.347 44.653  1.00 33.58  ? 174 SER L CA  1 
ATOM 6096 C C   . SER D 2 174 ? 15.658  -15.226 45.895  1.00 31.60  ? 174 SER L C   1 
ATOM 6097 O O   . SER D 2 174 ? 14.659  -15.392 46.595  1.00 31.29  ? 174 SER L O   1 
ATOM 6098 C CB  . SER D 2 174 ? 15.490  -12.867 45.021  1.00 31.09  ? 174 SER L CB  1 
ATOM 6099 O OG  . SER D 2 174 ? 15.400  -12.065 43.852  1.00 31.23  ? 174 SER L OG  1 
ATOM 6100 N N   . LEU D 2 175 ? 16.827  -15.803 46.155  1.00 29.81  ? 175 LEU L N   1 
ATOM 6101 C CA  . LEU D 2 175 ? 16.968  -16.746 47.259  1.00 29.96  ? 175 LEU L CA  1 
ATOM 6102 C C   . LEU D 2 175 ? 17.969  -16.232 48.293  1.00 37.97  ? 175 LEU L C   1 
ATOM 6103 O O   . LEU D 2 175 ? 18.905  -15.506 47.961  1.00 42.37  ? 175 LEU L O   1 
ATOM 6104 C CB  . LEU D 2 175 ? 17.383  -18.129 46.728  1.00 30.81  ? 175 LEU L CB  1 
ATOM 6105 C CG  . LEU D 2 175 ? 17.700  -19.268 47.708  1.00 38.81  ? 175 LEU L CG  1 
ATOM 6106 C CD1 . LEU D 2 175 ? 17.242  -20.598 47.133  1.00 41.04  ? 175 LEU L CD1 1 
ATOM 6107 C CD2 . LEU D 2 175 ? 19.183  -19.334 48.051  1.00 31.68  ? 175 LEU L CD2 1 
ATOM 6108 N N   . SER D 2 176 ? 17.754  -16.603 49.552  1.00 29.46  ? 176 SER L N   1 
ATOM 6109 C CA  . SER D 2 176 ? 18.677  -16.250 50.623  1.00 29.42  ? 176 SER L CA  1 
ATOM 6110 C C   . SER D 2 176 ? 19.021  -17.467 51.477  1.00 29.94  ? 176 SER L C   1 
ATOM 6111 O O   . SER D 2 176 ? 18.145  -18.069 52.097  1.00 29.91  ? 176 SER L O   1 
ATOM 6112 C CB  . SER D 2 176 ? 18.087  -15.142 51.498  1.00 41.62  ? 176 SER L CB  1 
ATOM 6113 O OG  . SER D 2 176 ? 17.072  -15.646 52.349  1.00 41.31  ? 176 SER L OG  1 
ATOM 6114 N N   . SER D 2 177 ? 20.299  -17.827 51.501  1.00 31.79  ? 177 SER L N   1 
ATOM 6115 C CA  . SER D 2 177 ? 20.770  -18.901 52.366  1.00 32.40  ? 177 SER L CA  1 
ATOM 6116 C C   . SER D 2 177 ? 21.557  -18.300 53.521  1.00 40.89  ? 177 SER L C   1 
ATOM 6117 O O   . SER D 2 177 ? 22.434  -17.468 53.305  1.00 32.23  ? 177 SER L O   1 
ATOM 6118 C CB  . SER D 2 177 ? 21.634  -19.895 51.585  1.00 44.88  ? 177 SER L CB  1 
ATOM 6119 O OG  . SER D 2 177 ? 21.864  -21.073 52.343  1.00 45.37  ? 177 SER L OG  1 
ATOM 6120 N N   . THR D 2 178 ? 21.249  -18.714 54.746  1.00 39.48  ? 178 THR L N   1 
ATOM 6121 C CA  . THR D 2 178 ? 21.936  -18.158 55.908  1.00 43.48  ? 178 THR L CA  1 
ATOM 6122 C C   . THR D 2 178 ? 22.630  -19.221 56.757  1.00 43.78  ? 178 THR L C   1 
ATOM 6123 O O   . THR D 2 178 ? 21.994  -20.135 57.281  1.00 39.24  ? 178 THR L O   1 
ATOM 6124 C CB  . THR D 2 178 ? 20.968  -17.362 56.800  1.00 41.14  ? 178 THR L CB  1 
ATOM 6125 O OG1 . THR D 2 178 ? 20.503  -16.209 56.087  1.00 44.26  ? 178 THR L OG1 1 
ATOM 6126 C CG2 . THR D 2 178 ? 21.669  -16.914 58.070  1.00 37.87  ? 178 THR L CG2 1 
ATOM 6127 N N   . LEU D 2 179 ? 23.945  -19.078 56.882  1.00 44.86  ? 179 LEU L N   1 
ATOM 6128 C CA  . LEU D 2 179 ? 24.772  -19.995 57.652  1.00 47.46  ? 179 LEU L CA  1 
ATOM 6129 C C   . LEU D 2 179 ? 24.749  -19.575 59.116  1.00 47.33  ? 179 LEU L C   1 
ATOM 6130 O O   . LEU D 2 179 ? 25.099  -18.442 59.440  1.00 50.42  ? 179 LEU L O   1 
ATOM 6131 C CB  . LEU D 2 179 ? 26.204  -19.993 57.107  1.00 47.70  ? 179 LEU L CB  1 
ATOM 6132 C CG  . LEU D 2 179 ? 27.131  -21.161 57.440  1.00 47.88  ? 179 LEU L CG  1 
ATOM 6133 C CD1 . LEU D 2 179 ? 26.668  -22.419 56.731  1.00 51.95  ? 179 LEU L CD1 1 
ATOM 6134 C CD2 . LEU D 2 179 ? 28.573  -20.827 57.070  1.00 42.36  ? 179 LEU L CD2 1 
ATOM 6135 N N   . THR D 2 180 ? 24.325  -20.467 60.002  1.00 57.37  ? 180 THR L N   1 
ATOM 6136 C CA  . THR D 2 180 ? 24.269  -20.104 61.406  1.00 56.22  ? 180 THR L CA  1 
ATOM 6137 C C   . THR D 2 180 ? 25.382  -20.820 62.176  1.00 58.93  ? 180 THR L C   1 
ATOM 6138 O O   . THR D 2 180 ? 25.711  -21.974 61.912  1.00 63.00  ? 180 THR L O   1 
ATOM 6139 C CB  . THR D 2 180 ? 22.868  -20.395 62.013  1.00 73.25  ? 180 THR L CB  1 
ATOM 6140 O OG1 . THR D 2 180 ? 22.680  -19.616 63.202  1.00 72.43  ? 180 THR L OG1 1 
ATOM 6141 C CG2 . THR D 2 180 ? 22.671  -21.873 62.314  1.00 72.80  ? 180 THR L CG2 1 
ATOM 6142 N N   . LEU D 2 181 ? 25.994  -20.080 63.094  1.00 49.64  ? 181 LEU L N   1 
ATOM 6143 C CA  . LEU D 2 181 ? 27.131  -20.533 63.894  1.00 51.15  ? 181 LEU L CA  1 
ATOM 6144 C C   . LEU D 2 181 ? 27.091  -19.856 65.268  1.00 53.19  ? 181 LEU L C   1 
ATOM 6145 O O   . LEU D 2 181 ? 26.080  -19.263 65.638  1.00 65.81  ? 181 LEU L O   1 
ATOM 6146 C CB  . LEU D 2 181 ? 28.469  -20.231 63.206  1.00 48.00  ? 181 LEU L CB  1 
ATOM 6147 C CG  . LEU D 2 181 ? 28.918  -21.035 61.976  1.00 43.62  ? 181 LEU L CG  1 
ATOM 6148 C CD1 . LEU D 2 181 ? 28.333  -20.532 60.654  1.00 43.80  ? 181 LEU L CD1 1 
ATOM 6149 C CD2 . LEU D 2 181 ? 30.445  -21.161 61.895  1.00 44.15  ? 181 LEU L CD2 1 
ATOM 6150 N N   . SER D 2 182 ? 28.171  -19.977 66.035  1.00 49.27  ? 182 SER L N   1 
ATOM 6151 C CA  . SER D 2 182 ? 28.319  -19.215 67.274  1.00 48.09  ? 182 SER L CA  1 
ATOM 6152 C C   . SER D 2 182 ? 29.584  -18.364 67.213  1.00 56.39  ? 182 SER L C   1 
ATOM 6153 O O   . SER D 2 182 ? 30.503  -18.685 66.461  1.00 65.34  ? 182 SER L O   1 
ATOM 6154 C CB  . SER D 2 182 ? 28.340  -20.150 68.489  1.00 48.29  ? 182 SER L CB  1 
ATOM 6155 O OG  . SER D 2 182 ? 29.436  -21.046 68.450  1.00 50.36  ? 182 SER L OG  1 
ATOM 6156 N N   . LYS D 2 183 ? 29.616  -17.287 68.001  1.00 54.98  ? 183 LYS L N   1 
ATOM 6157 C CA  . LYS D 2 183 ? 30.754  -16.363 68.045  1.00 51.53  ? 183 LYS L CA  1 
ATOM 6158 C C   . LYS D 2 183 ? 32.079  -17.089 68.127  1.00 54.52  ? 183 LYS L C   1 
ATOM 6159 O O   . LYS D 2 183 ? 32.943  -16.945 67.260  1.00 51.34  ? 183 LYS L O   1 
ATOM 6160 C CB  . LYS D 2 183 ? 30.651  -15.424 69.243  1.00 57.62  ? 183 LYS L CB  1 
ATOM 6161 C CG  . LYS D 2 183 ? 31.843  -14.480 69.387  1.00 61.66  ? 183 LYS L CG  1 
ATOM 6162 C CD  . LYS D 2 183 ? 31.751  -13.665 70.667  1.00 64.32  ? 183 LYS L CD  1 
ATOM 6163 C CE  . LYS D 2 183 ? 32.904  -12.689 70.806  1.00 66.63  ? 183 LYS L CE  1 
ATOM 6164 N NZ  . LYS D 2 183 ? 32.689  -11.804 71.985  1.00 70.06  ? 183 LYS L NZ  1 
ATOM 6165 N N   . ALA D 2 184 ? 32.232  -17.830 69.217  1.00 60.44  ? 184 ALA L N   1 
ATOM 6166 C CA  . ALA D 2 184 ? 33.379  -18.689 69.435  1.00 69.06  ? 184 ALA L CA  1 
ATOM 6167 C C   . ALA D 2 184 ? 33.691  -19.523 68.191  1.00 65.32  ? 184 ALA L C   1 
ATOM 6168 O O   . ALA D 2 184 ? 34.751  -19.355 67.586  1.00 67.22  ? 184 ALA L O   1 
ATOM 6169 C CB  . ALA D 2 184 ? 33.131  -19.587 70.638  1.00 69.69  ? 184 ALA L CB  1 
ATOM 6170 N N   . ASP D 2 185 ? 32.760  -20.401 67.811  1.00 59.76  ? 185 ASP L N   1 
ATOM 6171 C CA  . ASP D 2 185 ? 32.908  -21.264 66.630  1.00 61.88  ? 185 ASP L CA  1 
ATOM 6172 C C   . ASP D 2 185 ? 33.240  -20.477 65.368  1.00 61.08  ? 185 ASP L C   1 
ATOM 6173 O O   . ASP D 2 185 ? 34.137  -20.849 64.619  1.00 70.02  ? 185 ASP L O   1 
ATOM 6174 C CB  . ASP D 2 185 ? 31.625  -22.077 66.399  1.00 67.55  ? 185 ASP L CB  1 
ATOM 6175 C CG  . ASP D 2 185 ? 31.798  -23.190 65.362  1.00 71.20  ? 185 ASP L CG  1 
ATOM 6176 O OD1 . ASP D 2 185 ? 32.384  -22.949 64.283  1.00 71.14  ? 185 ASP L OD1 1 
ATOM 6177 O OD2 . ASP D 2 185 ? 31.320  -24.315 65.621  1.00 76.17  ? 185 ASP L OD2 1 
ATOM 6178 N N   . TYR D 2 186 ? 32.494  -19.405 65.133  1.00 56.08  ? 186 TYR L N   1 
ATOM 6179 C CA  . TYR D 2 186 ? 32.701  -18.550 63.969  1.00 49.08  ? 186 TYR L CA  1 
ATOM 6180 C C   . TYR D 2 186 ? 34.139  -18.043 63.878  1.00 52.78  ? 186 TYR L C   1 
ATOM 6181 O O   . TYR D 2 186 ? 34.771  -18.133 62.825  1.00 51.01  ? 186 TYR L O   1 
ATOM 6182 C CB  . TYR D 2 186 ? 31.733  -17.365 64.007  1.00 42.69  ? 186 TYR L CB  1 
ATOM 6183 C CG  . TYR D 2 186 ? 31.968  -16.351 62.922  1.00 38.75  ? 186 TYR L CG  1 
ATOM 6184 C CD1 . TYR D 2 186 ? 31.563  -16.593 61.620  1.00 38.07  ? 186 TYR L CD1 1 
ATOM 6185 C CD2 . TYR D 2 186 ? 32.601  -15.149 63.202  1.00 38.25  ? 186 TYR L CD2 1 
ATOM 6186 C CE1 . TYR D 2 186 ? 31.782  -15.664 60.625  1.00 37.66  ? 186 TYR L CE1 1 
ATOM 6187 C CE2 . TYR D 2 186 ? 32.825  -14.216 62.219  1.00 37.86  ? 186 TYR L CE2 1 
ATOM 6188 C CZ  . TYR D 2 186 ? 32.416  -14.476 60.931  1.00 37.56  ? 186 TYR L CZ  1 
ATOM 6189 O OH  . TYR D 2 186 ? 32.643  -13.539 59.950  1.00 37.26  ? 186 TYR L OH  1 
ATOM 6190 N N   . GLU D 2 187 ? 34.648  -17.528 64.996  1.00 53.85  ? 187 GLU L N   1 
ATOM 6191 C CA  . GLU D 2 187 ? 35.989  -16.945 65.063  1.00 55.77  ? 187 GLU L CA  1 
ATOM 6192 C C   . GLU D 2 187 ? 37.093  -17.961 64.871  1.00 59.38  ? 187 GLU L C   1 
ATOM 6193 O O   . GLU D 2 187 ? 38.267  -17.612 64.789  1.00 60.45  ? 187 GLU L O   1 
ATOM 6194 C CB  . GLU D 2 187 ? 36.208  -16.239 66.399  1.00 55.22  ? 187 GLU L CB  1 
ATOM 6195 C CG  . GLU D 2 187 ? 35.364  -15.013 66.584  1.00 55.57  ? 187 GLU L CG  1 
ATOM 6196 C CD  . GLU D 2 187 ? 35.804  -14.194 67.774  1.00 60.35  ? 187 GLU L CD  1 
ATOM 6197 O OE1 . GLU D 2 187 ? 35.842  -14.748 68.892  1.00 59.29  ? 187 GLU L OE1 1 
ATOM 6198 O OE2 . GLU D 2 187 ? 36.114  -12.998 67.590  1.00 66.92  ? 187 GLU L OE2 1 
ATOM 6199 N N   . LYS D 2 188 ? 36.732  -19.226 64.823  1.00 64.87  ? 188 LYS L N   1 
ATOM 6200 C CA  . LYS D 2 188 ? 37.755  -20.242 64.756  1.00 71.52  ? 188 LYS L CA  1 
ATOM 6201 C C   . LYS D 2 188 ? 38.415  -20.363 63.392  1.00 73.04  ? 188 LYS L C   1 
ATOM 6202 O O   . LYS D 2 188 ? 39.626  -20.539 63.305  1.00 72.81  ? 188 LYS L O   1 
ATOM 6203 C CB  . LYS D 2 188 ? 37.151  -21.562 65.145  1.00 72.75  ? 188 LYS L CB  1 
ATOM 6204 C CG  . LYS D 2 188 ? 38.055  -22.727 65.084  1.00 80.07  ? 188 LYS L CG  1 
ATOM 6205 C CD  . LYS D 2 188 ? 37.130  -23.852 65.318  1.00 83.85  ? 188 LYS L CD  1 
ATOM 6206 C CE  . LYS D 2 188 ? 37.758  -25.177 65.173  1.00 90.28  ? 188 LYS L CE  1 
ATOM 6207 N NZ  . LYS D 2 188 ? 36.651  -26.155 65.292  1.00 92.81  ? 188 LYS L NZ  1 
ATOM 6208 N N   . HIS D 2 189 ? 37.614  -20.304 62.333  1.00 69.53  ? 189 HIS L N   1 
ATOM 6209 C CA  . HIS D 2 189 ? 38.136  -20.438 60.975  1.00 65.34  ? 189 HIS L CA  1 
ATOM 6210 C C   . HIS D 2 189 ? 38.267  -19.086 60.280  1.00 57.95  ? 189 HIS L C   1 
ATOM 6211 O O   . HIS D 2 189 ? 37.953  -18.047 60.863  1.00 53.10  ? 189 HIS L O   1 
ATOM 6212 C CB  . HIS D 2 189 ? 37.249  -21.367 60.144  1.00 69.02  ? 189 HIS L CB  1 
ATOM 6213 C CG  . HIS D 2 189 ? 36.705  -22.529 60.911  1.00 71.67  ? 189 HIS L CG  1 
ATOM 6214 N ND1 . HIS D 2 189 ? 35.385  -22.928 60.819  1.00 73.69  ? 189 HIS L ND1 1 
ATOM 6215 C CD2 . HIS D 2 189 ? 37.292  -23.381 61.780  1.00 71.31  ? 189 HIS L CD2 1 
ATOM 6216 C CE1 . HIS D 2 189 ? 35.190  -23.973 61.599  1.00 72.57  ? 189 HIS L CE1 1 
ATOM 6217 N NE2 . HIS D 2 189 ? 36.333  -24.271 62.195  1.00 70.74  ? 189 HIS L NE2 1 
ATOM 6218 N N   . LYS D 2 190 ? 38.720  -19.107 59.028  1.00 63.57  ? 190 LYS L N   1 
ATOM 6219 C CA  . LYS D 2 190 ? 39.063  -17.872 58.324  1.00 63.59  ? 190 LYS L CA  1 
ATOM 6220 C C   . LYS D 2 190 ? 38.214  -17.583 57.080  1.00 52.65  ? 190 LYS L C   1 
ATOM 6221 O O   . LYS D 2 190 ? 37.464  -16.606 57.052  1.00 48.81  ? 190 LYS L O   1 
ATOM 6222 C CB  . LYS D 2 190 ? 40.540  -17.898 57.932  1.00 69.42  ? 190 LYS L CB  1 
ATOM 6223 C CG  . LYS D 2 190 ? 41.006  -16.633 57.239  1.00 74.33  ? 190 LYS L CG  1 
ATOM 6224 C CD  . LYS D 2 190 ? 42.500  -16.654 56.974  1.00 76.26  ? 190 LYS L CD  1 
ATOM 6225 C CE  . LYS D 2 190 ? 42.869  -17.727 55.963  1.00 73.02  ? 190 LYS L CE  1 
ATOM 6226 N NZ  . LYS D 2 190 ? 44.334  -17.731 55.693  1.00 70.42  ? 190 LYS L NZ  1 
ATOM 6227 N N   . VAL D 2 191 ? 38.342  -18.419 56.054  1.00 52.04  ? 191 VAL L N   1 
ATOM 6228 C CA  . VAL D 2 191 ? 37.630  -18.205 54.794  1.00 51.36  ? 191 VAL L CA  1 
ATOM 6229 C C   . VAL D 2 191 ? 36.180  -18.682 54.863  1.00 50.50  ? 191 VAL L C   1 
ATOM 6230 O O   . VAL D 2 191 ? 35.911  -19.822 55.242  1.00 50.74  ? 191 VAL L O   1 
ATOM 6231 C CB  . VAL D 2 191 ? 38.340  -18.919 53.628  1.00 55.46  ? 191 VAL L CB  1 
ATOM 6232 C CG1 . VAL D 2 191 ? 37.436  -18.978 52.405  1.00 49.39  ? 191 VAL L CG1 1 
ATOM 6233 C CG2 . VAL D 2 191 ? 39.656  -18.229 53.296  1.00 57.33  ? 191 VAL L CG2 1 
ATOM 6234 N N   . TYR D 2 192 ? 35.246  -17.799 54.524  1.00 51.48  ? 192 TYR L N   1 
ATOM 6235 C CA  . TYR D 2 192 ? 33.852  -18.203 54.413  1.00 46.20  ? 192 TYR L CA  1 
ATOM 6236 C C   . TYR D 2 192 ? 33.394  -18.078 52.974  1.00 46.50  ? 192 TYR L C   1 
ATOM 6237 O O   . TYR D 2 192 ? 33.223  -16.980 52.462  1.00 44.51  ? 192 TYR L O   1 
ATOM 6238 C CB  . TYR D 2 192 ? 32.978  -17.360 55.334  1.00 43.15  ? 192 TYR L CB  1 
ATOM 6239 C CG  . TYR D 2 192 ? 33.207  -17.702 56.782  1.00 46.53  ? 192 TYR L CG  1 
ATOM 6240 C CD1 . TYR D 2 192 ? 32.683  -18.862 57.335  1.00 47.61  ? 192 TYR L CD1 1 
ATOM 6241 C CD2 . TYR D 2 192 ? 34.008  -16.901 57.581  1.00 51.87  ? 192 TYR L CD2 1 
ATOM 6242 C CE1 . TYR D 2 192 ? 32.913  -19.186 58.658  1.00 51.94  ? 192 TYR L CE1 1 
ATOM 6243 C CE2 . TYR D 2 192 ? 34.251  -17.220 58.899  1.00 55.05  ? 192 TYR L CE2 1 
ATOM 6244 C CZ  . TYR D 2 192 ? 33.702  -18.363 59.434  1.00 53.48  ? 192 TYR L CZ  1 
ATOM 6245 O OH  . TYR D 2 192 ? 33.941  -18.677 60.751  1.00 48.65  ? 192 TYR L OH  1 
ATOM 6246 N N   . ALA D 2 193 ? 33.176  -19.217 52.330  1.00 52.54  ? 193 ALA L N   1 
ATOM 6247 C CA  . ALA D 2 193 ? 32.918  -19.233 50.901  1.00 48.42  ? 193 ALA L CA  1 
ATOM 6248 C C   . ALA D 2 193 ? 31.483  -19.670 50.609  1.00 47.48  ? 193 ALA L C   1 
ATOM 6249 O O   . ALA D 2 193 ? 30.961  -20.574 51.261  1.00 44.95  ? 193 ALA L O   1 
ATOM 6250 C CB  . ALA D 2 193 ? 33.914  -20.147 50.209  1.00 49.73  ? 193 ALA L CB  1 
ATOM 6251 N N   . CYS D 2 194 ? 30.839  -19.017 49.647  1.00 42.38  ? 194 CYS L N   1 
ATOM 6252 C CA  . CYS D 2 194 ? 29.526  -19.442 49.188  1.00 45.87  ? 194 CYS L CA  1 
ATOM 6253 C C   . CYS D 2 194 ? 29.624  -19.948 47.758  1.00 58.69  ? 194 CYS L C   1 
ATOM 6254 O O   . CYS D 2 194 ? 29.809  -19.164 46.825  1.00 63.31  ? 194 CYS L O   1 
ATOM 6255 C CB  . CYS D 2 194 ? 28.522  -18.290 49.288  1.00 39.54  ? 194 CYS L CB  1 
ATOM 6256 S SG  . CYS D 2 194 ? 26.978  -18.547 48.378  1.00 48.65  ? 194 CYS L SG  1 
ATOM 6257 N N   . GLU D 2 195 ? 29.494  -21.262 47.595  1.00 60.96  ? 195 GLU L N   1 
ATOM 6258 C CA  . GLU D 2 195 ? 29.504  -21.877 46.276  1.00 61.97  ? 195 GLU L CA  1 
ATOM 6259 C C   . GLU D 2 195 ? 28.076  -22.074 45.796  1.00 62.95  ? 195 GLU L C   1 
ATOM 6260 O O   . GLU D 2 195 ? 27.225  -22.563 46.539  1.00 66.07  ? 195 GLU L O   1 
ATOM 6261 C CB  . GLU D 2 195 ? 30.241  -23.216 46.294  1.00 64.31  ? 195 GLU L CB  1 
ATOM 6262 C CG  . GLU D 2 195 ? 30.394  -23.829 44.914  1.00 65.91  ? 195 GLU L CG  1 
ATOM 6263 C CD  . GLU D 2 195 ? 31.108  -25.167 44.934  1.00 69.85  ? 195 GLU L CD  1 
ATOM 6264 O OE1 . GLU D 2 195 ? 32.183  -25.270 45.565  1.00 65.20  ? 195 GLU L OE1 1 
ATOM 6265 O OE2 . GLU D 2 195 ? 30.587  -26.118 44.311  1.00 72.93  ? 195 GLU L OE2 1 
ATOM 6266 N N   . VAL D 2 196 ? 27.816  -21.702 44.550  1.00 57.40  ? 196 VAL L N   1 
ATOM 6267 C CA  . VAL D 2 196 ? 26.463  -21.778 44.021  1.00 53.30  ? 196 VAL L CA  1 
ATOM 6268 C C   . VAL D 2 196 ? 26.419  -22.366 42.612  1.00 50.09  ? 196 VAL L C   1 
ATOM 6269 O O   . VAL D 2 196 ? 27.151  -21.944 41.716  1.00 47.75  ? 196 VAL L O   1 
ATOM 6270 C CB  . VAL D 2 196 ? 25.791  -20.390 44.027  1.00 50.46  ? 196 VAL L CB  1 
ATOM 6271 C CG1 . VAL D 2 196 ? 26.697  -19.344 43.388  1.00 54.51  ? 196 VAL L CG1 1 
ATOM 6272 C CG2 . VAL D 2 196 ? 24.453  -20.448 43.324  1.00 45.21  ? 196 VAL L CG2 1 
ATOM 6273 N N   . THR D 2 197 ? 25.554  -23.358 42.438  1.00 53.34  ? 197 THR L N   1 
ATOM 6274 C CA  . THR D 2 197 ? 25.362  -24.008 41.150  1.00 53.27  ? 197 THR L CA  1 
ATOM 6275 C C   . THR D 2 197 ? 23.994  -23.668 40.564  1.00 50.57  ? 197 THR L C   1 
ATOM 6276 O O   . THR D 2 197 ? 22.963  -23.926 41.184  1.00 50.90  ? 197 THR L O   1 
ATOM 6277 C CB  . THR D 2 197 ? 25.491  -25.537 41.269  1.00 60.66  ? 197 THR L CB  1 
ATOM 6278 O OG1 . THR D 2 197 ? 26.783  -25.871 41.793  1.00 70.89  ? 197 THR L OG1 1 
ATOM 6279 C CG2 . THR D 2 197 ? 25.301  -26.195 39.909  1.00 55.57  ? 197 THR L CG2 1 
ATOM 6280 N N   . HIS D 2 198 ? 23.998  -23.082 39.371  1.00 51.48  ? 198 HIS L N   1 
ATOM 6281 C CA  . HIS D 2 198 ? 22.776  -22.733 38.655  1.00 51.79  ? 198 HIS L CA  1 
ATOM 6282 C C   . HIS D 2 198 ? 23.057  -22.951 37.171  1.00 59.08  ? 198 HIS L C   1 
ATOM 6283 O O   . HIS D 2 198 ? 24.170  -22.704 36.716  1.00 62.67  ? 198 HIS L O   1 
ATOM 6284 C CB  . HIS D 2 198 ? 22.366  -21.283 38.957  1.00 51.46  ? 198 HIS L CB  1 
ATOM 6285 C CG  . HIS D 2 198 ? 21.057  -20.867 38.376  1.00 47.42  ? 198 HIS L CG  1 
ATOM 6286 N ND1 . HIS D 2 198 ? 20.794  -20.893 37.008  1.00 46.59  ? 198 HIS L ND1 1 
ATOM 6287 C CD2 . HIS D 2 198 ? 19.924  -20.395 38.942  1.00 43.33  ? 198 HIS L CD2 1 
ATOM 6288 C CE1 . HIS D 2 198 ? 19.576  -20.469 36.784  1.00 40.93  ? 198 HIS L CE1 1 
ATOM 6289 N NE2 . HIS D 2 198 ? 19.016  -20.155 37.950  1.00 41.56  ? 198 HIS L NE2 1 
ATOM 6290 N N   . GLN D 2 199 ? 22.073  -23.435 36.419  1.00 55.60  ? 199 GLN L N   1 
ATOM 6291 C CA  . GLN D 2 199 ? 22.294  -23.751 35.005  1.00 59.40  ? 199 GLN L CA  1 
ATOM 6292 C C   . GLN D 2 199 ? 22.593  -22.502 34.180  1.00 62.27  ? 199 GLN L C   1 
ATOM 6293 O O   . GLN D 2 199 ? 23.368  -22.548 33.225  1.00 72.51  ? 199 GLN L O   1 
ATOM 6294 C CB  . GLN D 2 199 ? 21.091  -24.485 34.412  1.00 57.44  ? 199 GLN L CB  1 
ATOM 6295 C CG  . GLN D 2 199 ? 19.772  -23.769 34.601  1.00 54.55  ? 199 GLN L CG  1 
ATOM 6296 C CD  . GLN D 2 199 ? 18.715  -24.245 33.627  1.00 57.02  ? 199 GLN L CD  1 
ATOM 6297 O OE1 . GLN D 2 199 ? 18.846  -24.058 32.417  1.00 56.72  ? 199 GLN L OE1 1 
ATOM 6298 N NE2 . GLN D 2 199 ? 17.671  -24.881 34.146  1.00 56.69  ? 199 GLN L NE2 1 
ATOM 6299 N N   . GLY D 2 200 ? 21.980  -21.386 34.560  1.00 49.62  ? 200 GLY L N   1 
ATOM 6300 C CA  . GLY D 2 200 ? 22.265  -20.096 33.957  1.00 47.41  ? 200 GLY L CA  1 
ATOM 6301 C C   . GLY D 2 200 ? 23.703  -19.672 34.201  1.00 50.93  ? 200 GLY L C   1 
ATOM 6302 O O   . GLY D 2 200 ? 24.222  -18.775 33.536  1.00 53.90  ? 200 GLY L O   1 
ATOM 6303 N N   . LEU D 2 201 ? 24.345  -20.321 35.166  1.00 61.59  ? 201 LEU L N   1 
ATOM 6304 C CA  . LEU D 2 201 ? 25.775  -20.169 35.387  1.00 65.43  ? 201 LEU L CA  1 
ATOM 6305 C C   . LEU D 2 201 ? 26.516  -21.256 34.617  1.00 67.76  ? 201 LEU L C   1 
ATOM 6306 O O   . LEU D 2 201 ? 26.278  -22.444 34.838  1.00 69.94  ? 201 LEU L O   1 
ATOM 6307 C CB  . LEU D 2 201 ? 26.099  -20.262 36.876  1.00 59.95  ? 201 LEU L CB  1 
ATOM 6308 C CG  . LEU D 2 201 ? 25.388  -19.250 37.776  1.00 49.83  ? 201 LEU L CG  1 
ATOM 6309 C CD1 . LEU D 2 201 ? 25.622  -19.594 39.238  1.00 48.56  ? 201 LEU L CD1 1 
ATOM 6310 C CD2 . LEU D 2 201 ? 25.827  -17.822 37.471  1.00 48.41  ? 201 LEU L CD2 1 
ATOM 6311 N N   . SER D 2 202 ? 27.388  -20.846 33.701  1.00 71.18  ? 202 SER L N   1 
ATOM 6312 C CA  . SER D 2 202 ? 28.255  -21.773 32.978  1.00 74.57  ? 202 SER L CA  1 
ATOM 6313 C C   . SER D 2 202 ? 28.977  -22.728 33.926  1.00 74.69  ? 202 SER L C   1 
ATOM 6314 O O   . SER D 2 202 ? 28.776  -23.944 33.886  1.00 70.12  ? 202 SER L O   1 
ATOM 6315 C CB  . SER D 2 202 ? 29.274  -20.995 32.144  1.00 75.49  ? 202 SER L CB  1 
ATOM 6316 O OG  . SER D 2 202 ? 30.247  -21.861 31.589  1.00 78.82  ? 202 SER L OG  1 
ATOM 6317 N N   . SER D 2 203 ? 29.822  -22.161 34.777  1.00 70.76  ? 203 SER L N   1 
ATOM 6318 C CA  . SER D 2 203 ? 30.519  -22.932 35.793  1.00 72.44  ? 203 SER L CA  1 
ATOM 6319 C C   . SER D 2 203 ? 30.069  -22.442 37.163  1.00 66.90  ? 203 SER L C   1 
ATOM 6320 O O   . SER D 2 203 ? 29.767  -21.259 37.319  1.00 60.61  ? 203 SER L O   1 
ATOM 6321 C CB  . SER D 2 203 ? 32.034  -22.796 35.625  1.00 72.24  ? 203 SER L CB  1 
ATOM 6322 O OG  . SER D 2 203 ? 32.419  -21.433 35.575  1.00 67.99  ? 203 SER L OG  1 
ATOM 6323 N N   . PRO D 2 204 ? 30.005  -23.350 38.155  1.00 61.43  ? 204 PRO L N   1 
ATOM 6324 C CA  . PRO D 2 204 ? 29.529  -22.931 39.477  1.00 62.35  ? 204 PRO L CA  1 
ATOM 6325 C C   . PRO D 2 204 ? 30.359  -21.789 40.061  1.00 59.83  ? 204 PRO L C   1 
ATOM 6326 O O   . PRO D 2 204 ? 31.577  -21.902 40.194  1.00 64.83  ? 204 PRO L O   1 
ATOM 6327 C CB  . PRO D 2 204 ? 29.686  -24.200 40.313  1.00 59.39  ? 204 PRO L CB  1 
ATOM 6328 C CG  . PRO D 2 204 ? 29.465  -25.301 39.330  1.00 59.78  ? 204 PRO L CG  1 
ATOM 6329 C CD  . PRO D 2 204 ? 30.112  -24.816 38.050  1.00 62.26  ? 204 PRO L CD  1 
ATOM 6330 N N   . VAL D 2 205 ? 29.678  -20.703 40.410  1.00 58.68  ? 205 VAL L N   1 
ATOM 6331 C CA  . VAL D 2 205 ? 30.311  -19.500 40.942  1.00 54.34  ? 205 VAL L CA  1 
ATOM 6332 C C   . VAL D 2 205 ? 30.545  -19.589 42.450  1.00 49.02  ? 205 VAL L C   1 
ATOM 6333 O O   . VAL D 2 205 ? 29.845  -20.315 43.154  1.00 46.77  ? 205 VAL L O   1 
ATOM 6334 C CB  . VAL D 2 205 ? 29.466  -18.259 40.609  1.00 46.70  ? 205 VAL L CB  1 
ATOM 6335 C CG1 . VAL D 2 205 ? 30.283  -16.985 40.786  1.00 46.70  ? 205 VAL L CG1 1 
ATOM 6336 C CG2 . VAL D 2 205 ? 28.971  -18.357 39.182  1.00 49.66  ? 205 VAL L CG2 1 
ATOM 6337 N N   . THR D 2 206 ? 31.536  -18.853 42.942  1.00 50.49  ? 206 THR L N   1 
ATOM 6338 C CA  . THR D 2 206 ? 31.824  -18.820 44.368  1.00 51.33  ? 206 THR L CA  1 
ATOM 6339 C C   . THR D 2 206 ? 32.174  -17.402 44.814  1.00 47.83  ? 206 THR L C   1 
ATOM 6340 O O   . THR D 2 206 ? 32.861  -16.672 44.101  1.00 45.81  ? 206 THR L O   1 
ATOM 6341 C CB  . THR D 2 206 ? 32.978  -19.782 44.729  1.00 56.43  ? 206 THR L CB  1 
ATOM 6342 O OG1 . THR D 2 206 ? 32.667  -21.101 44.262  1.00 61.97  ? 206 THR L OG1 1 
ATOM 6343 C CG2 . THR D 2 206 ? 33.199  -19.824 46.232  1.00 53.78  ? 206 THR L CG2 1 
ATOM 6344 N N   . LYS D 2 207 ? 31.672  -17.004 45.979  1.00 50.06  ? 207 LYS L N   1 
ATOM 6345 C CA  . LYS D 2 207 ? 32.065  -15.734 46.579  1.00 59.60  ? 207 LYS L CA  1 
ATOM 6346 C C   . LYS D 2 207 ? 32.426  -15.937 48.038  1.00 65.90  ? 207 LYS L C   1 
ATOM 6347 O O   . LYS D 2 207 ? 31.664  -16.531 48.800  1.00 71.18  ? 207 LYS L O   1 
ATOM 6348 C CB  . LYS D 2 207 ? 30.956  -14.693 46.452  1.00 59.16  ? 207 LYS L CB  1 
ATOM 6349 C CG  . LYS D 2 207 ? 30.749  -14.209 45.037  1.00 64.27  ? 207 LYS L CG  1 
ATOM 6350 C CD  . LYS D 2 207 ? 30.379  -12.744 45.007  1.00 64.10  ? 207 LYS L CD  1 
ATOM 6351 C CE  . LYS D 2 207 ? 29.183  -12.472 45.893  1.00 68.44  ? 207 LYS L CE  1 
ATOM 6352 N NZ  . LYS D 2 207 ? 28.813  -11.033 45.867  1.00 69.94  ? 207 LYS L NZ  1 
ATOM 6353 N N   . SER D 2 208 ? 33.592  -15.432 48.422  1.00 67.70  ? 208 SER L N   1 
ATOM 6354 C CA  . SER D 2 208 ? 34.103  -15.659 49.763  1.00 62.38  ? 208 SER L CA  1 
ATOM 6355 C C   . SER D 2 208 ? 34.619  -14.385 50.415  1.00 45.82  ? 208 SER L C   1 
ATOM 6356 O O   . SER D 2 208 ? 34.506  -13.294 49.854  1.00 43.14  ? 208 SER L O   1 
ATOM 6357 C CB  . SER D 2 208 ? 35.213  -16.714 49.734  1.00 72.57  ? 208 SER L CB  1 
ATOM 6358 O OG  . SER D 2 208 ? 36.226  -16.373 48.807  1.00 78.81  ? 208 SER L OG  1 
ATOM 6359 N N   . PHE D 2 209 ? 35.202  -14.552 51.598  1.00 44.96  ? 209 PHE L N   1 
ATOM 6360 C CA  . PHE D 2 209 ? 35.779  -13.459 52.368  1.00 46.41  ? 209 PHE L CA  1 
ATOM 6361 C C   . PHE D 2 209 ? 36.474  -14.026 53.591  1.00 53.51  ? 209 PHE L C   1 
ATOM 6362 O O   . PHE D 2 209 ? 36.210  -15.156 54.007  1.00 56.57  ? 209 PHE L O   1 
ATOM 6363 C CB  . PHE D 2 209 ? 34.707  -12.430 52.785  1.00 44.17  ? 209 PHE L CB  1 
ATOM 6364 C CG  . PHE D 2 209 ? 33.788  -12.891 53.903  1.00 44.69  ? 209 PHE L CG  1 
ATOM 6365 C CD1 . PHE D 2 209 ? 34.178  -12.815 55.236  1.00 44.86  ? 209 PHE L CD1 1 
ATOM 6366 C CD2 . PHE D 2 209 ? 32.524  -13.378 53.617  1.00 48.67  ? 209 PHE L CD2 1 
ATOM 6367 C CE1 . PHE D 2 209 ? 33.337  -13.229 56.251  1.00 44.05  ? 209 PHE L CE1 1 
ATOM 6368 C CE2 . PHE D 2 209 ? 31.676  -13.794 54.633  1.00 45.59  ? 209 PHE L CE2 1 
ATOM 6369 C CZ  . PHE D 2 209 ? 32.085  -13.719 55.949  1.00 44.70  ? 209 PHE L CZ  1 
ATOM 6370 N N   . ASN D 2 210 ? 37.356  -13.222 54.171  1.00 54.64  ? 210 ASN L N   1 
ATOM 6371 C CA  . ASN D 2 210 ? 38.092  -13.620 55.359  1.00 56.22  ? 210 ASN L CA  1 
ATOM 6372 C C   . ASN D 2 210 ? 37.770  -12.643 56.478  1.00 52.60  ? 210 ASN L C   1 
ATOM 6373 O O   . ASN D 2 210 ? 37.517  -11.468 56.217  1.00 53.37  ? 210 ASN L O   1 
ATOM 6374 C CB  . ASN D 2 210 ? 39.593  -13.672 55.064  1.00 61.28  ? 210 ASN L CB  1 
ATOM 6375 C CG  . ASN D 2 210 ? 39.941  -14.725 54.023  1.00 67.56  ? 210 ASN L CG  1 
ATOM 6376 O OD1 . ASN D 2 210 ? 39.201  -14.925 53.056  1.00 69.05  ? 210 ASN L OD1 1 
ATOM 6377 N ND2 . ASN D 2 210 ? 41.082  -15.384 54.200  1.00 68.49  ? 210 ASN L ND2 1 
ATOM 6378 N N   . ARG D 2 211 ? 37.780  -13.125 57.717  1.00 47.37  ? 211 ARG L N   1 
ATOM 6379 C CA  . ARG D 2 211 ? 37.373  -12.313 58.862  1.00 51.74  ? 211 ARG L CA  1 
ATOM 6380 C C   . ARG D 2 211 ? 38.170  -11.009 58.993  1.00 55.28  ? 211 ARG L C   1 
ATOM 6381 O O   . ARG D 2 211 ? 37.720  -10.056 59.634  1.00 44.51  ? 211 ARG L O   1 
ATOM 6382 C CB  . ARG D 2 211 ? 37.505  -13.126 60.145  1.00 54.13  ? 211 ARG L CB  1 
ATOM 6383 C CG  . ARG D 2 211 ? 36.537  -14.294 60.250  1.00 51.32  ? 211 ARG L CG  1 
ATOM 6384 C CD  . ARG D 2 211 ? 36.628  -14.985 61.605  1.00 45.34  ? 211 ARG L CD  1 
ATOM 6385 N NE  . ARG D 2 211 ? 37.199  -14.122 62.637  1.00 44.42  ? 211 ARG L NE  1 
ATOM 6386 C CZ  . ARG D 2 211 ? 38.426  -14.257 63.135  1.00 46.23  ? 211 ARG L CZ  1 
ATOM 6387 N NH1 . ARG D 2 211 ? 39.218  -15.227 62.696  1.00 48.35  ? 211 ARG L NH1 1 
ATOM 6388 N NH2 . ARG D 2 211 ? 38.861  -13.423 64.072  1.00 46.00  ? 211 ARG L NH2 1 
ATOM 6389 N N   . GLY D 2 212 ? 39.346  -10.971 58.374  1.00 69.98  ? 212 GLY L N   1 
ATOM 6390 C CA  . GLY D 2 212 ? 40.169  -9.775  58.360  1.00 70.07  ? 212 GLY L CA  1 
ATOM 6391 C C   . GLY D 2 212 ? 39.604  -8.716  57.433  1.00 67.85  ? 212 GLY L C   1 
ATOM 6392 O O   . GLY D 2 212 ? 39.524  -7.545  57.801  1.00 72.11  ? 212 GLY L O   1 
ATOM 6393 N N   . SER E 3 2   ? 55.995  -15.921 14.203  1.00 69.49  ? 27  SER Y N   1 
ATOM 6394 C CA  . SER E 3 2   ? 56.828  -14.722 14.234  1.00 73.63  ? 27  SER Y CA  1 
ATOM 6395 C C   . SER E 3 2   ? 56.474  -13.701 13.149  1.00 73.10  ? 27  SER Y C   1 
ATOM 6396 O O   . SER E 3 2   ? 57.272  -13.442 12.256  1.00 58.44  ? 27  SER Y O   1 
ATOM 6397 C CB  . SER E 3 2   ? 58.309  -15.101 14.105  1.00 75.52  ? 27  SER Y CB  1 
ATOM 6398 O OG  . SER E 3 2   ? 58.610  -15.556 12.798  1.00 77.53  ? 27  SER Y OG  1 
ATOM 6399 N N   . PRO E 3 3   ? 55.274  -13.116 13.213  1.00 79.35  ? 28  PRO Y N   1 
ATOM 6400 C CA  . PRO E 3 3   ? 55.067  -11.962 12.341  1.00 69.90  ? 28  PRO Y CA  1 
ATOM 6401 C C   . PRO E 3 3   ? 56.027  -10.805 12.579  1.00 65.69  ? 28  PRO Y C   1 
ATOM 6402 O O   . PRO E 3 3   ? 56.530  -10.269 11.590  1.00 64.14  ? 28  PRO Y O   1 
ATOM 6403 C CB  . PRO E 3 3   ? 53.632  -11.542 12.674  1.00 66.62  ? 28  PRO Y CB  1 
ATOM 6404 C CG  . PRO E 3 3   ? 53.350  -12.161 14.020  1.00 68.27  ? 28  PRO Y CG  1 
ATOM 6405 C CD  . PRO E 3 3   ? 54.039  -13.477 13.923  1.00 76.57  ? 28  PRO Y CD  1 
ATOM 6406 N N   . ASP E 3 4   ? 56.247  -10.405 13.830  1.00 61.14  ? 29  ASP Y N   1 
ATOM 6407 C CA  . ASP E 3 4   ? 56.955  -9.153  14.058  1.00 55.36  ? 29  ASP Y CA  1 
ATOM 6408 C C   . ASP E 3 4   ? 58.362  -9.179  13.493  1.00 53.72  ? 29  ASP Y C   1 
ATOM 6409 O O   . ASP E 3 4   ? 58.559  -8.784  12.356  1.00 66.80  ? 29  ASP Y O   1 
ATOM 6410 C CB  . ASP E 3 4   ? 56.999  -8.830  15.552  1.00 53.11  ? 29  ASP Y CB  1 
ATOM 6411 C CG  . ASP E 3 4   ? 55.625  -8.557  16.124  1.00 52.71  ? 29  ASP Y CG  1 
ATOM 6412 O OD1 . ASP E 3 4   ? 55.020  -7.543  15.715  1.00 42.89  ? 29  ASP Y OD1 1 
ATOM 6413 O OD2 . ASP E 3 4   ? 55.146  -9.348  16.967  1.00 58.21  ? 29  ASP Y OD2 1 
ATOM 6414 N N   . ARG E 3 5   ? 59.297  -9.744  14.256  1.00 49.87  ? 30  ARG Y N   1 
ATOM 6415 C CA  . ARG E 3 5   ? 60.654  -10.050 13.804  1.00 49.29  ? 30  ARG Y CA  1 
ATOM 6416 C C   . ARG E 3 5   ? 61.534  -10.454 14.977  1.00 51.43  ? 30  ARG Y C   1 
ATOM 6417 O O   . ARG E 3 5   ? 61.498  -9.816  16.028  1.00 59.46  ? 30  ARG Y O   1 
ATOM 6418 C CB  . ARG E 3 5   ? 61.273  -8.864  13.060  1.00 45.05  ? 30  ARG Y CB  1 
ATOM 6419 C CG  . ARG E 3 5   ? 62.759  -8.966  12.797  1.00 44.36  ? 30  ARG Y CG  1 
ATOM 6420 C CD  . ARG E 3 5   ? 63.136  -7.687  12.077  1.00 44.84  ? 30  ARG Y CD  1 
ATOM 6421 N NE  . ARG E 3 5   ? 64.334  -7.026  12.580  1.00 50.73  ? 30  ARG Y NE  1 
ATOM 6422 C CZ  . ARG E 3 5   ? 65.561  -7.256  12.132  1.00 56.57  ? 30  ARG Y CZ  1 
ATOM 6423 N NH1 . ARG E 3 5   ? 65.752  -8.105  11.133  1.00 53.16  ? 30  ARG Y NH1 1 
ATOM 6424 N NH2 . ARG E 3 5   ? 66.592  -6.610  12.660  1.00 64.61  ? 30  ARG Y NH2 1 
ATOM 6425 N N   . PRO E 3 6   ? 62.369  -11.478 14.773  1.00 48.19  ? 31  PRO Y N   1 
ATOM 6426 C CA  . PRO E 3 6   ? 63.277  -11.940 15.823  1.00 41.30  ? 31  PRO Y CA  1 
ATOM 6427 C C   . PRO E 3 6   ? 64.200  -10.845 16.374  1.00 39.99  ? 31  PRO Y C   1 
ATOM 6428 O O   . PRO E 3 6   ? 64.987  -10.221 15.652  1.00 47.96  ? 31  PRO Y O   1 
ATOM 6429 C CB  . PRO E 3 6   ? 64.061  -13.034 15.106  1.00 44.12  ? 31  PRO Y CB  1 
ATOM 6430 C CG  . PRO E 3 6   ? 63.019  -13.630 14.180  1.00 48.89  ? 31  PRO Y CG  1 
ATOM 6431 C CD  . PRO E 3 6   ? 62.295  -12.428 13.646  1.00 49.82  ? 31  PRO Y CD  1 
ATOM 6432 N N   . TRP E 3 7   ? 64.111  -10.683 17.688  1.00 38.73  ? 32  TRP Y N   1 
ATOM 6433 C CA  . TRP E 3 7   ? 64.802  -9.649  18.420  1.00 38.31  ? 32  TRP Y CA  1 
ATOM 6434 C C   . TRP E 3 7   ? 65.516  -10.354 19.562  1.00 47.22  ? 32  TRP Y C   1 
ATOM 6435 O O   . TRP E 3 7   ? 64.876  -10.857 20.495  1.00 57.37  ? 32  TRP Y O   1 
ATOM 6436 C CB  . TRP E 3 7   ? 63.793  -8.608  18.897  1.00 38.77  ? 32  TRP Y CB  1 
ATOM 6437 C CG  . TRP E 3 7   ? 64.122  -7.859  20.121  1.00 48.17  ? 32  TRP Y CG  1 
ATOM 6438 C CD1 . TRP E 3 7   ? 65.274  -7.180  20.408  1.00 59.93  ? 32  TRP Y CD1 1 
ATOM 6439 C CD2 . TRP E 3 7   ? 63.270  -7.699  21.258  1.00 53.84  ? 32  TRP Y CD2 1 
ATOM 6440 N NE1 . TRP E 3 7   ? 65.181  -6.603  21.656  1.00 64.14  ? 32  TRP Y NE1 1 
ATOM 6441 C CE2 . TRP E 3 7   ? 63.966  -6.912  22.191  1.00 59.48  ? 32  TRP Y CE2 1 
ATOM 6442 C CE3 . TRP E 3 7   ? 61.986  -8.154  21.561  1.00 60.01  ? 32  TRP Y CE3 1 
ATOM 6443 C CZ2 . TRP E 3 7   ? 63.409  -6.568  23.422  1.00 54.06  ? 32  TRP Y CZ2 1 
ATOM 6444 C CZ3 . TRP E 3 7   ? 61.446  -7.810  22.777  1.00 60.07  ? 32  TRP Y CZ3 1 
ATOM 6445 C CH2 . TRP E 3 7   ? 62.153  -7.026  23.693  1.00 56.78  ? 32  TRP Y CH2 1 
ATOM 6446 N N   . ASN E 3 8   ? 66.844  -10.377 19.508  1.00 42.70  ? 33  ASN Y N   1 
ATOM 6447 C CA  . ASN E 3 8   ? 67.564  -11.244 20.420  1.00 46.74  ? 33  ASN Y CA  1 
ATOM 6448 C C   . ASN E 3 8   ? 67.894  -10.514 21.721  1.00 42.85  ? 33  ASN Y C   1 
ATOM 6449 O O   . ASN E 3 8   ? 68.265  -9.338  21.719  1.00 42.06  ? 33  ASN Y O   1 
ATOM 6450 C CB  . ASN E 3 8   ? 68.819  -11.832 19.754  1.00 48.64  ? 33  ASN Y CB  1 
ATOM 6451 C CG  . ASN E 3 8   ? 69.849  -10.787 19.376  1.00 59.09  ? 33  ASN Y CG  1 
ATOM 6452 O OD1 . ASN E 3 8   ? 69.524  -9.645  19.038  1.00 69.63  ? 33  ASN Y OD1 1 
ATOM 6453 N ND2 . ASN E 3 8   ? 71.115  -11.183 19.436  1.00 56.42  ? 33  ASN Y ND2 1 
ATOM 6454 N N   . PRO E 3 9   ? 67.723  -11.221 22.846  1.00 46.01  ? 34  PRO Y N   1 
ATOM 6455 C CA  . PRO E 3 9   ? 67.727  -10.668 24.201  1.00 44.32  ? 34  PRO Y CA  1 
ATOM 6456 C C   . PRO E 3 9   ? 69.085  -10.137 24.656  1.00 40.06  ? 34  PRO Y C   1 
ATOM 6457 O O   . PRO E 3 9   ? 70.107  -10.459 24.052  1.00 40.86  ? 34  PRO Y O   1 
ATOM 6458 C CB  . PRO E 3 9   ? 67.287  -11.868 25.047  1.00 46.41  ? 34  PRO Y CB  1 
ATOM 6459 C CG  . PRO E 3 9   ? 67.824  -13.030 24.316  1.00 48.72  ? 34  PRO Y CG  1 
ATOM 6460 C CD  . PRO E 3 9   ? 67.593  -12.689 22.871  1.00 50.42  ? 34  PRO Y CD  1 
ATOM 6461 N N   . PRO E 3 10  ? 69.090  -9.304  25.709  1.00 39.12  ? 35  PRO Y N   1 
ATOM 6462 C CA  . PRO E 3 10  ? 70.333  -8.761  26.263  1.00 43.75  ? 35  PRO Y CA  1 
ATOM 6463 C C   . PRO E 3 10  ? 71.125  -9.812  27.033  1.00 44.48  ? 35  PRO Y C   1 
ATOM 6464 O O   . PRO E 3 10  ? 70.770  -10.990 27.010  1.00 45.27  ? 35  PRO Y O   1 
ATOM 6465 C CB  . PRO E 3 10  ? 69.835  -7.657  27.195  1.00 41.39  ? 35  PRO Y CB  1 
ATOM 6466 C CG  . PRO E 3 10  ? 68.516  -8.163  27.663  1.00 36.30  ? 35  PRO Y CG  1 
ATOM 6467 C CD  . PRO E 3 10  ? 67.911  -8.811  26.446  1.00 35.39  ? 35  PRO Y CD  1 
ATOM 6468 N N   . THR E 3 11  ? 72.194  -9.390  27.698  1.00 44.15  ? 36  THR Y N   1 
ATOM 6469 C CA  . THR E 3 11  ? 72.993  -10.307 28.501  1.00 44.94  ? 36  THR Y CA  1 
ATOM 6470 C C   . THR E 3 11  ? 73.413  -9.667  29.822  1.00 37.84  ? 36  THR Y C   1 
ATOM 6471 O O   . THR E 3 11  ? 73.269  -8.458  30.018  1.00 38.91  ? 36  THR Y O   1 
ATOM 6472 C CB  . THR E 3 11  ? 74.249  -10.788 27.743  1.00 51.78  ? 36  THR Y CB  1 
ATOM 6473 O OG1 . THR E 3 11  ? 75.098  -11.516 28.639  1.00 68.26  ? 36  THR Y OG1 1 
ATOM 6474 C CG2 . THR E 3 11  ? 75.021  -9.611  27.172  1.00 49.12  ? 36  THR Y CG2 1 
ATOM 6475 N N   . PHE E 3 12  ? 73.925  -10.501 30.722  1.00 33.20  ? 37  PHE Y N   1 
ATOM 6476 C CA  . PHE E 3 12  ? 74.277  -10.085 32.072  1.00 33.64  ? 37  PHE Y CA  1 
ATOM 6477 C C   . PHE E 3 12  ? 75.659  -10.619 32.431  1.00 44.83  ? 37  PHE Y C   1 
ATOM 6478 O O   . PHE E 3 12  ? 76.163  -11.529 31.772  1.00 52.92  ? 37  PHE Y O   1 
ATOM 6479 C CB  . PHE E 3 12  ? 73.228  -10.587 33.063  1.00 30.89  ? 37  PHE Y CB  1 
ATOM 6480 C CG  . PHE E 3 12  ? 72.915  -9.619  34.167  1.00 36.78  ? 37  PHE Y CG  1 
ATOM 6481 C CD1 . PHE E 3 12  ? 72.522  -8.327  33.878  1.00 31.17  ? 37  PHE Y CD1 1 
ATOM 6482 C CD2 . PHE E 3 12  ? 72.977  -10.012 35.493  1.00 46.13  ? 37  PHE Y CD2 1 
ATOM 6483 C CE1 . PHE E 3 12  ? 72.218  -7.439  34.888  1.00 31.24  ? 37  PHE Y CE1 1 
ATOM 6484 C CE2 . PHE E 3 12  ? 72.669  -9.124  36.510  1.00 42.19  ? 37  PHE Y CE2 1 
ATOM 6485 C CZ  . PHE E 3 12  ? 72.285  -7.838  36.204  1.00 35.58  ? 37  PHE Y CZ  1 
ATOM 6486 N N   . SER E 3 13  ? 76.253  -10.069 33.487  1.00 41.49  ? 38  SER Y N   1 
ATOM 6487 C CA  . SER E 3 13  ? 77.601  -10.445 33.908  1.00 45.27  ? 38  SER Y CA  1 
ATOM 6488 C C   . SER E 3 13  ? 77.998  -9.716  35.184  1.00 38.87  ? 38  SER Y C   1 
ATOM 6489 O O   . SER E 3 13  ? 77.745  -8.522  35.315  1.00 35.42  ? 38  SER Y O   1 
ATOM 6490 C CB  . SER E 3 13  ? 78.617  -10.135 32.805  1.00 49.83  ? 38  SER Y CB  1 
ATOM 6491 O OG  . SER E 3 13  ? 79.932  -10.464 33.213  1.00 54.31  ? 38  SER Y OG  1 
ATOM 6492 N N   . PRO E 3 14  ? 78.644  -10.429 36.121  1.00 45.13  ? 39  PRO Y N   1 
ATOM 6493 C CA  . PRO E 3 14  ? 78.984  -11.849 35.985  1.00 43.64  ? 39  PRO Y CA  1 
ATOM 6494 C C   . PRO E 3 14  ? 77.877  -12.779 36.480  1.00 37.41  ? 39  PRO Y C   1 
ATOM 6495 O O   . PRO E 3 14  ? 76.868  -12.296 36.990  1.00 33.13  ? 39  PRO Y O   1 
ATOM 6496 C CB  . PRO E 3 14  ? 80.231  -11.974 36.854  1.00 49.49  ? 39  PRO Y CB  1 
ATOM 6497 C CG  . PRO E 3 14  ? 79.964  -11.017 37.973  1.00 53.20  ? 39  PRO Y CG  1 
ATOM 6498 C CD  . PRO E 3 14  ? 79.217  -9.851  37.351  1.00 48.39  ? 39  PRO Y CD  1 
ATOM 6499 N N   . ALA E 3 15  ? 78.075  -14.087 36.331  1.00 42.63  ? 40  ALA Y N   1 
ATOM 6500 C CA  . ALA E 3 15  ? 77.094  -15.083 36.757  1.00 38.04  ? 40  ALA Y CA  1 
ATOM 6501 C C   . ALA E 3 15  ? 76.943  -15.085 38.271  1.00 41.13  ? 40  ALA Y C   1 
ATOM 6502 O O   . ALA E 3 15  ? 75.835  -15.161 38.803  1.00 49.22  ? 40  ALA Y O   1 
ATOM 6503 C CB  . ALA E 3 15  ? 77.497  -16.468 36.263  1.00 33.45  ? 40  ALA Y CB  1 
ATOM 6504 N N   . LEU E 3 16  ? 78.073  -15.024 38.959  1.00 37.16  ? 41  LEU Y N   1 
ATOM 6505 C CA  . LEU E 3 16  ? 78.079  -14.914 40.406  1.00 33.52  ? 41  LEU Y CA  1 
ATOM 6506 C C   . LEU E 3 16  ? 78.972  -13.760 40.812  1.00 33.91  ? 41  LEU Y C   1 
ATOM 6507 O O   . LEU E 3 16  ? 80.177  -13.784 40.570  1.00 37.50  ? 41  LEU Y O   1 
ATOM 6508 C CB  . LEU E 3 16  ? 78.559  -16.209 41.058  1.00 42.36  ? 41  LEU Y CB  1 
ATOM 6509 C CG  . LEU E 3 16  ? 78.730  -16.145 42.577  1.00 50.89  ? 41  LEU Y CG  1 
ATOM 6510 C CD1 . LEU E 3 16  ? 77.377  -15.963 43.252  1.00 54.63  ? 41  LEU Y CD1 1 
ATOM 6511 C CD2 . LEU E 3 16  ? 79.440  -17.387 43.104  1.00 52.84  ? 41  LEU Y CD2 1 
ATOM 6512 N N   . LEU E 3 17  ? 78.371  -12.750 41.426  1.00 35.23  ? 42  LEU Y N   1 
ATOM 6513 C CA  . LEU E 3 17  ? 79.110  -11.589 41.893  1.00 40.06  ? 42  LEU Y CA  1 
ATOM 6514 C C   . LEU E 3 17  ? 79.117  -11.584 43.414  1.00 43.71  ? 42  LEU Y C   1 
ATOM 6515 O O   . LEU E 3 17  ? 78.067  -11.645 44.046  1.00 43.25  ? 42  LEU Y O   1 
ATOM 6516 C CB  . LEU E 3 17  ? 78.490  -10.301 41.348  1.00 42.64  ? 42  LEU Y CB  1 
ATOM 6517 C CG  . LEU E 3 17  ? 79.096  -8.965  41.782  1.00 41.18  ? 42  LEU Y CG  1 
ATOM 6518 C CD1 . LEU E 3 17  ? 80.552  -8.868  41.340  1.00 41.63  ? 42  LEU Y CD1 1 
ATOM 6519 C CD2 . LEU E 3 17  ? 78.280  -7.802  41.231  1.00 41.11  ? 42  LEU Y CD2 1 
ATOM 6520 N N   . VAL E 3 18  ? 80.303  -11.530 44.006  1.00 35.39  ? 43  VAL Y N   1 
ATOM 6521 C CA  . VAL E 3 18  ? 80.396  -11.491 45.459  1.00 36.69  ? 43  VAL Y CA  1 
ATOM 6522 C C   . VAL E 3 18  ? 81.059  -10.207 45.943  1.00 31.13  ? 43  VAL Y C   1 
ATOM 6523 O O   . VAL E 3 18  ? 82.225  -9.942  45.646  1.00 34.03  ? 43  VAL Y O   1 
ATOM 6524 C CB  . VAL E 3 18  ? 81.172  -12.694 46.017  1.00 27.26  ? 43  VAL Y CB  1 
ATOM 6525 C CG1 . VAL E 3 18  ? 81.013  -12.754 47.526  1.00 26.84  ? 43  VAL Y CG1 1 
ATOM 6526 C CG2 . VAL E 3 18  ? 80.674  -13.983 45.384  1.00 26.21  ? 43  VAL Y CG2 1 
ATOM 6527 N N   . VAL E 3 19  ? 80.296  -9.412  46.685  1.00 31.70  ? 44  VAL Y N   1 
ATOM 6528 C CA  . VAL E 3 19  ? 80.798  -8.181  47.274  1.00 31.18  ? 44  VAL Y CA  1 
ATOM 6529 C C   . VAL E 3 19  ? 80.599  -8.220  48.776  1.00 30.49  ? 44  VAL Y C   1 
ATOM 6530 O O   . VAL E 3 19  ? 79.658  -8.831  49.267  1.00 29.68  ? 44  VAL Y O   1 
ATOM 6531 C CB  . VAL E 3 19  ? 80.088  -6.942  46.706  1.00 29.24  ? 44  VAL Y CB  1 
ATOM 6532 C CG1 . VAL E 3 19  ? 80.469  -6.734  45.255  1.00 29.42  ? 44  VAL Y CG1 1 
ATOM 6533 C CG2 . VAL E 3 19  ? 78.587  -7.084  46.858  1.00 28.83  ? 44  VAL Y CG2 1 
ATOM 6534 N N   . THR E 3 20  ? 81.490  -7.566  49.508  1.00 37.85  ? 45  THR Y N   1 
ATOM 6535 C CA  . THR E 3 20  ? 81.354  -7.473  50.953  1.00 43.08  ? 45  THR Y CA  1 
ATOM 6536 C C   . THR E 3 20  ? 80.128  -6.618  51.264  1.00 53.56  ? 45  THR Y C   1 
ATOM 6537 O O   . THR E 3 20  ? 79.647  -5.899  50.396  1.00 61.91  ? 45  THR Y O   1 
ATOM 6538 C CB  . THR E 3 20  ? 82.620  -6.882  51.593  1.00 45.77  ? 45  THR Y CB  1 
ATOM 6539 O OG1 . THR E 3 20  ? 82.865  -5.580  51.049  1.00 59.69  ? 45  THR Y OG1 1 
ATOM 6540 C CG2 . THR E 3 20  ? 83.821  -7.777  51.305  1.00 35.22  ? 45  THR Y CG2 1 
ATOM 6541 N N   . GLU E 3 21  ? 79.580  -6.723  52.470  1.00 47.27  ? 46  GLU Y N   1 
ATOM 6542 C CA  . GLU E 3 21  ? 78.365  -5.967  52.778  1.00 44.41  ? 46  GLU Y CA  1 
ATOM 6543 C C   . GLU E 3 21  ? 78.708  -4.495  52.981  1.00 37.00  ? 46  GLU Y C   1 
ATOM 6544 O O   . GLU E 3 21  ? 79.850  -4.150  53.283  1.00 35.28  ? 46  GLU Y O   1 
ATOM 6545 C CB  . GLU E 3 21  ? 77.647  -6.524  54.014  1.00 36.48  ? 46  GLU Y CB  1 
ATOM 6546 C CG  . GLU E 3 21  ? 78.309  -6.180  55.330  1.00 44.37  ? 46  GLU Y CG  1 
ATOM 6547 C CD  . GLU E 3 21  ? 77.487  -6.631  56.521  1.00 54.95  ? 46  GLU Y CD  1 
ATOM 6548 O OE1 . GLU E 3 21  ? 76.248  -6.474  56.481  1.00 62.20  ? 46  GLU Y OE1 1 
ATOM 6549 O OE2 . GLU E 3 21  ? 78.075  -7.150  57.493  1.00 50.93  ? 46  GLU Y OE2 1 
ATOM 6550 N N   . GLY E 3 22  ? 77.718  -3.630  52.772  1.00 31.37  ? 47  GLY Y N   1 
ATOM 6551 C CA  . GLY E 3 22  ? 77.908  -2.193  52.872  1.00 36.79  ? 47  GLY Y CA  1 
ATOM 6552 C C   . GLY E 3 22  ? 78.673  -1.641  51.682  1.00 46.18  ? 47  GLY Y C   1 
ATOM 6553 O O   . GLY E 3 22  ? 78.799  -0.429  51.507  1.00 40.20  ? 47  GLY Y O   1 
ATOM 6554 N N   . ASP E 3 23  ? 79.174  -2.554  50.857  1.00 51.40  ? 48  ASP Y N   1 
ATOM 6555 C CA  . ASP E 3 23  ? 80.016  -2.237  49.712  1.00 48.59  ? 48  ASP Y CA  1 
ATOM 6556 C C   . ASP E 3 23  ? 79.142  -2.033  48.474  1.00 43.56  ? 48  ASP Y C   1 
ATOM 6557 O O   . ASP E 3 23  ? 77.918  -2.131  48.548  1.00 36.89  ? 48  ASP Y O   1 
ATOM 6558 C CB  . ASP E 3 23  ? 81.038  -3.365  49.505  1.00 50.03  ? 48  ASP Y CB  1 
ATOM 6559 C CG  . ASP E 3 23  ? 82.112  -3.025  48.493  1.00 61.18  ? 48  ASP Y CG  1 
ATOM 6560 O OD1 . ASP E 3 23  ? 81.785  -2.940  47.291  1.00 65.15  ? 48  ASP Y OD1 1 
ATOM 6561 O OD2 . ASP E 3 23  ? 83.284  -2.866  48.894  1.00 65.19  ? 48  ASP Y OD2 1 
ATOM 6562 N N   . ASN E 3 24  ? 79.763  -1.743  47.337  1.00 39.06  ? 49  ASN Y N   1 
ATOM 6563 C CA  . ASN E 3 24  ? 79.008  -1.513  46.117  1.00 36.15  ? 49  ASN Y CA  1 
ATOM 6564 C C   . ASN E 3 24  ? 79.232  -2.615  45.088  1.00 44.91  ? 49  ASN Y C   1 
ATOM 6565 O O   . ASN E 3 24  ? 80.368  -2.937  44.739  1.00 32.59  ? 49  ASN Y O   1 
ATOM 6566 C CB  . ASN E 3 24  ? 79.361  -0.150  45.523  1.00 37.96  ? 49  ASN Y CB  1 
ATOM 6567 C CG  . ASN E 3 24  ? 79.173  0.981   46.515  1.00 38.97  ? 49  ASN Y CG  1 
ATOM 6568 O OD1 . ASN E 3 24  ? 78.242  0.965   47.320  1.00 44.32  ? 49  ASN Y OD1 1 
ATOM 6569 N ND2 . ASN E 3 24  ? 80.043  1.985   46.444  1.00 38.21  ? 49  ASN Y ND2 1 
ATOM 6570 N N   . ALA E 3 25  ? 78.132  -3.201  44.625  1.00 46.14  ? 50  ALA Y N   1 
ATOM 6571 C CA  . ALA E 3 25  ? 78.166  -4.254  43.612  1.00 30.57  ? 50  ALA Y CA  1 
ATOM 6572 C C   . ALA E 3 25  ? 77.698  -3.719  42.265  1.00 29.94  ? 50  ALA Y C   1 
ATOM 6573 O O   . ALA E 3 25  ? 76.857  -2.823  42.206  1.00 29.71  ? 50  ALA Y O   1 
ATOM 6574 C CB  . ALA E 3 25  ? 77.305  -5.423  44.033  1.00 30.03  ? 50  ALA Y CB  1 
ATOM 6575 N N   . THR E 3 26  ? 78.246  -4.263  41.184  1.00 33.91  ? 51  THR Y N   1 
ATOM 6576 C CA  . THR E 3 26  ? 77.880  -3.799  39.853  1.00 40.19  ? 51  THR Y CA  1 
ATOM 6577 C C   . THR E 3 26  ? 77.798  -4.934  38.834  1.00 40.73  ? 51  THR Y C   1 
ATOM 6578 O O   . THR E 3 26  ? 78.681  -5.787  38.764  1.00 42.23  ? 51  THR Y O   1 
ATOM 6579 C CB  . THR E 3 26  ? 78.882  -2.737  39.345  1.00 44.49  ? 51  THR Y CB  1 
ATOM 6580 O OG1 . THR E 3 26  ? 78.700  -1.518  40.077  1.00 43.04  ? 51  THR Y OG1 1 
ATOM 6581 C CG2 . THR E 3 26  ? 78.676  -2.460  37.863  1.00 43.75  ? 51  THR Y CG2 1 
ATOM 6582 N N   . PHE E 3 27  ? 76.728  -4.929  38.044  1.00 45.53  ? 52  PHE Y N   1 
ATOM 6583 C CA  . PHE E 3 27  ? 76.571  -5.860  36.934  1.00 40.51  ? 52  PHE Y CA  1 
ATOM 6584 C C   . PHE E 3 27  ? 76.592  -5.085  35.618  1.00 43.36  ? 52  PHE Y C   1 
ATOM 6585 O O   . PHE E 3 27  ? 76.203  -3.917  35.573  1.00 42.43  ? 52  PHE Y O   1 
ATOM 6586 C CB  . PHE E 3 27  ? 75.266  -6.646  37.062  1.00 31.27  ? 52  PHE Y CB  1 
ATOM 6587 C CG  . PHE E 3 27  ? 75.254  -7.644  38.190  1.00 40.00  ? 52  PHE Y CG  1 
ATOM 6588 C CD1 . PHE E 3 27  ? 75.884  -8.871  38.064  1.00 41.33  ? 52  PHE Y CD1 1 
ATOM 6589 C CD2 . PHE E 3 27  ? 74.598  -7.355  39.374  1.00 37.28  ? 52  PHE Y CD2 1 
ATOM 6590 C CE1 . PHE E 3 27  ? 75.863  -9.788  39.101  1.00 40.48  ? 52  PHE Y CE1 1 
ATOM 6591 C CE2 . PHE E 3 27  ? 74.576  -8.267  40.413  1.00 31.15  ? 52  PHE Y CE2 1 
ATOM 6592 C CZ  . PHE E 3 27  ? 75.209  -9.484  40.277  1.00 37.25  ? 52  PHE Y CZ  1 
ATOM 6593 N N   . THR E 3 28  ? 77.043  -5.732  34.549  1.00 48.09  ? 53  THR Y N   1 
ATOM 6594 C CA  . THR E 3 28  ? 77.092  -5.085  33.244  1.00 53.25  ? 53  THR Y CA  1 
ATOM 6595 C C   . THR E 3 28  ? 76.152  -5.758  32.244  1.00 34.74  ? 53  THR Y C   1 
ATOM 6596 O O   . THR E 3 28  ? 76.317  -6.933  31.916  1.00 35.06  ? 53  THR Y O   1 
ATOM 6597 C CB  . THR E 3 28  ? 78.523  -5.085  32.667  1.00 44.38  ? 53  THR Y CB  1 
ATOM 6598 O OG1 . THR E 3 28  ? 79.457  -4.710  33.688  1.00 49.97  ? 53  THR Y OG1 1 
ATOM 6599 C CG2 . THR E 3 28  ? 78.631  -4.114  31.504  1.00 36.61  ? 53  THR Y CG2 1 
ATOM 6600 N N   . CYS E 3 29  ? 75.158  -5.005  31.777  1.00 33.54  ? 54  CYS Y N   1 
ATOM 6601 C CA  . CYS E 3 29  ? 74.250  -5.467  30.729  1.00 45.36  ? 54  CYS Y CA  1 
ATOM 6602 C C   . CYS E 3 29  ? 74.555  -4.800  29.400  1.00 55.30  ? 54  CYS Y C   1 
ATOM 6603 O O   . CYS E 3 29  ? 74.363  -3.592  29.249  1.00 63.62  ? 54  CYS Y O   1 
ATOM 6604 C CB  . CYS E 3 29  ? 72.792  -5.194  31.101  1.00 34.44  ? 54  CYS Y CB  1 
ATOM 6605 S SG  . CYS E 3 29  ? 71.658  -5.409  29.707  1.00 56.11  ? 54  CYS Y SG  1 
ATOM 6606 N N   . SER E 3 30  ? 75.021  -5.581  28.433  1.00 53.31  ? 55  SER Y N   1 
ATOM 6607 C CA  . SER E 3 30  ? 75.315  -5.027  27.124  1.00 55.16  ? 55  SER Y CA  1 
ATOM 6608 C C   . SER E 3 30  ? 74.208  -5.377  26.140  1.00 58.49  ? 55  SER Y C   1 
ATOM 6609 O O   . SER E 3 30  ? 74.085  -6.519  25.690  1.00 65.62  ? 55  SER Y O   1 
ATOM 6610 C CB  . SER E 3 30  ? 76.670  -5.526  26.622  1.00 52.88  ? 55  SER Y CB  1 
ATOM 6611 O OG  . SER E 3 30  ? 76.671  -6.932  26.467  1.00 52.41  ? 55  SER Y OG  1 
ATOM 6612 N N   . PHE E 3 31  ? 73.420  -4.367  25.791  1.00 57.48  ? 56  PHE Y N   1 
ATOM 6613 C CA  . PHE E 3 31  ? 72.300  -4.540  24.882  1.00 51.19  ? 56  PHE Y CA  1 
ATOM 6614 C C   . PHE E 3 31  ? 72.331  -3.481  23.794  1.00 45.52  ? 56  PHE Y C   1 
ATOM 6615 O O   . PHE E 3 31  ? 72.482  -2.296  24.066  1.00 45.73  ? 56  PHE Y O   1 
ATOM 6616 C CB  . PHE E 3 31  ? 70.972  -4.481  25.637  1.00 51.47  ? 56  PHE Y CB  1 
ATOM 6617 C CG  . PHE E 3 31  ? 69.768  -4.714  24.769  1.00 57.15  ? 56  PHE Y CG  1 
ATOM 6618 C CD1 . PHE E 3 31  ? 69.604  -5.906  24.083  1.00 55.91  ? 56  PHE Y CD1 1 
ATOM 6619 C CD2 . PHE E 3 31  ? 68.797  -3.739  24.644  1.00 39.77  ? 56  PHE Y CD2 1 
ATOM 6620 C CE1 . PHE E 3 31  ? 68.492  -6.117  23.287  1.00 54.07  ? 56  PHE Y CE1 1 
ATOM 6621 C CE2 . PHE E 3 31  ? 67.687  -3.943  23.851  1.00 40.58  ? 56  PHE Y CE2 1 
ATOM 6622 C CZ  . PHE E 3 31  ? 67.534  -5.133  23.172  1.00 48.72  ? 56  PHE Y CZ  1 
ATOM 6623 N N   . SER E 3 32  ? 72.174  -3.919  22.555  1.00 44.03  ? 57  SER Y N   1 
ATOM 6624 C CA  . SER E 3 32  ? 72.241  -3.020  21.414  1.00 50.43  ? 57  SER Y CA  1 
ATOM 6625 C C   . SER E 3 32  ? 71.063  -3.218  20.456  1.00 57.09  ? 57  SER Y C   1 
ATOM 6626 O O   . SER E 3 32  ? 70.924  -4.286  19.846  1.00 68.80  ? 57  SER Y O   1 
ATOM 6627 C CB  . SER E 3 32  ? 73.556  -3.239  20.659  1.00 47.43  ? 57  SER Y CB  1 
ATOM 6628 O OG  . SER E 3 32  ? 73.564  -4.517  20.040  1.00 47.71  ? 57  SER Y OG  1 
ATOM 6629 N N   . ASN E 3 33  ? 70.209  -2.203  20.329  1.00 62.92  ? 58  ASN Y N   1 
ATOM 6630 C CA  . ASN E 3 33  ? 69.315  -2.142  19.176  1.00 58.12  ? 58  ASN Y CA  1 
ATOM 6631 C C   . ASN E 3 33  ? 69.183  -0.717  18.632  1.00 61.85  ? 58  ASN Y C   1 
ATOM 6632 O O   . ASN E 3 33  ? 68.792  0.200   19.363  1.00 64.13  ? 58  ASN Y O   1 
ATOM 6633 C CB  . ASN E 3 33  ? 67.937  -2.719  19.532  1.00 59.99  ? 58  ASN Y CB  1 
ATOM 6634 C CG  . ASN E 3 33  ? 67.246  -3.346  18.339  1.00 68.74  ? 58  ASN Y CG  1 
ATOM 6635 O OD1 . ASN E 3 33  ? 67.047  -2.705  17.303  1.00 79.86  ? 58  ASN Y OD1 1 
ATOM 6636 N ND2 . ASN E 3 33  ? 66.954  -4.635  18.451  1.00 65.58  ? 58  ASN Y ND2 1 
ATOM 6637 N N   . THR E 3 34  ? 69.491  -0.537  17.345  1.00 76.68  ? 59  THR Y N   1 
ATOM 6638 C CA  . THR E 3 34  ? 69.347  0.782   16.733  1.00 79.37  ? 59  THR Y CA  1 
ATOM 6639 C C   . THR E 3 34  ? 67.876  1.042   16.507  1.00 81.17  ? 59  THR Y C   1 
ATOM 6640 O O   . THR E 3 34  ? 67.356  2.107   16.844  1.00 73.37  ? 59  THR Y O   1 
ATOM 6641 C CB  . THR E 3 34  ? 70.080  0.939   15.365  1.00 72.95  ? 59  THR Y CB  1 
ATOM 6642 O OG1 . THR E 3 34  ? 69.425  0.163   14.352  1.00 75.95  ? 59  THR Y OG1 1 
ATOM 6643 C CG2 . THR E 3 34  ? 71.552  0.560   15.456  1.00 70.19  ? 59  THR Y CG2 1 
ATOM 6644 N N   . SER E 3 35  ? 67.210  0.043   15.939  1.00 79.57  ? 60  SER Y N   1 
ATOM 6645 C CA  . SER E 3 35  ? 65.809  0.167   15.581  1.00 80.55  ? 60  SER Y CA  1 
ATOM 6646 C C   . SER E 3 35  ? 64.894  0.224   16.796  1.00 77.73  ? 60  SER Y C   1 
ATOM 6647 O O   . SER E 3 35  ? 65.170  -0.341  17.844  1.00 72.14  ? 60  SER Y O   1 
ATOM 6648 C CB  . SER E 3 35  ? 65.394  -0.982  14.666  1.00 82.43  ? 60  SER Y CB  1 
ATOM 6649 O OG  . SER E 3 35  ? 66.370  -1.179  13.659  1.00 85.57  ? 60  SER Y OG  1 
ATOM 6650 N N   . GLU E 3 36  ? 63.809  0.961   16.607  1.00 80.25  ? 61  GLU Y N   1 
ATOM 6651 C CA  . GLU E 3 36  ? 62.779  1.273   17.597  1.00 85.37  ? 61  GLU Y CA  1 
ATOM 6652 C C   . GLU E 3 36  ? 63.268  1.920   18.892  1.00 83.82  ? 61  GLU Y C   1 
ATOM 6653 O O   . GLU E 3 36  ? 64.330  2.548   18.924  1.00 89.25  ? 61  GLU Y O   1 
ATOM 6654 C CB  . GLU E 3 36  ? 62.031  -0.021  17.926  1.00 89.96  ? 61  GLU Y CB  1 
ATOM 6655 C CG  . GLU E 3 36  ? 60.523  0.026   17.840  1.00 93.35  ? 61  GLU Y CG  1 
ATOM 6656 C CD  . GLU E 3 36  ? 59.900  -1.307  18.235  1.00 90.30  ? 61  GLU Y CD  1 
ATOM 6657 O OE1 . GLU E 3 36  ? 59.598  -1.507  19.434  1.00 88.53  ? 61  GLU Y OE1 1 
ATOM 6658 O OE2 . GLU E 3 36  ? 59.735  -2.163  17.335  1.00 88.26  ? 61  GLU Y OE2 1 
ATOM 6659 N N   . SER E 3 37  ? 62.521  1.679   19.967  1.00 73.11  ? 62  SER Y N   1 
ATOM 6660 C CA  . SER E 3 37  ? 62.745  2.350   21.240  1.00 67.49  ? 62  SER Y CA  1 
ATOM 6661 C C   . SER E 3 37  ? 62.564  1.361   22.366  1.00 63.03  ? 62  SER Y C   1 
ATOM 6662 O O   . SER E 3 37  ? 61.452  0.900   22.646  1.00 60.20  ? 62  SER Y O   1 
ATOM 6663 C CB  . SER E 3 37  ? 61.804  3.550   21.413  1.00 72.68  ? 62  SER Y CB  1 
ATOM 6664 O OG  . SER E 3 37  ? 62.137  4.590   20.513  1.00 77.41  ? 62  SER Y OG  1 
ATOM 6665 N N   . PHE E 3 38  ? 63.660  1.078   23.045  1.00 54.15  ? 63  PHE Y N   1 
ATOM 6666 C CA  . PHE E 3 38  ? 63.671  0.043   24.049  1.00 50.65  ? 63  PHE Y CA  1 
ATOM 6667 C C   . PHE E 3 38  ? 64.047  0.669   25.373  1.00 48.71  ? 63  PHE Y C   1 
ATOM 6668 O O   . PHE E 3 38  ? 64.822  1.624   25.418  1.00 50.24  ? 63  PHE Y O   1 
ATOM 6669 C CB  . PHE E 3 38  ? 64.639  -1.076  23.653  1.00 49.36  ? 63  PHE Y CB  1 
ATOM 6670 C CG  . PHE E 3 38  ? 64.222  -1.825  22.411  1.00 58.65  ? 63  PHE Y CG  1 
ATOM 6671 C CD1 . PHE E 3 38  ? 64.394  -1.275  21.150  1.00 70.32  ? 63  PHE Y CD1 1 
ATOM 6672 C CD2 . PHE E 3 38  ? 63.641  -3.077  22.510  1.00 57.65  ? 63  PHE Y CD2 1 
ATOM 6673 C CE1 . PHE E 3 38  ? 64.003  -1.966  20.019  1.00 73.55  ? 63  PHE Y CE1 1 
ATOM 6674 C CE2 . PHE E 3 38  ? 63.249  -3.767  21.378  1.00 62.25  ? 63  PHE Y CE2 1 
ATOM 6675 C CZ  . PHE E 3 38  ? 63.432  -3.211  20.133  1.00 70.35  ? 63  PHE Y CZ  1 
ATOM 6676 N N   . VAL E 3 39  ? 63.465  0.163   26.451  1.00 41.87  ? 64  VAL Y N   1 
ATOM 6677 C CA  . VAL E 3 39  ? 63.845  0.630   27.770  1.00 39.90  ? 64  VAL Y CA  1 
ATOM 6678 C C   . VAL E 3 39  ? 64.356  -0.551  28.592  1.00 37.20  ? 64  VAL Y C   1 
ATOM 6679 O O   . VAL E 3 39  ? 63.760  -1.631  28.614  1.00 37.32  ? 64  VAL Y O   1 
ATOM 6680 C CB  . VAL E 3 39  ? 62.678  1.375   28.478  1.00 33.23  ? 64  VAL Y CB  1 
ATOM 6681 C CG1 . VAL E 3 39  ? 61.941  2.267   27.481  1.00 34.78  ? 64  VAL Y CG1 1 
ATOM 6682 C CG2 . VAL E 3 39  ? 61.701  0.411   29.129  1.00 32.80  ? 64  VAL Y CG2 1 
ATOM 6683 N N   . LEU E 3 40  ? 65.506  -0.349  29.222  1.00 31.92  ? 65  LEU Y N   1 
ATOM 6684 C CA  . LEU E 3 40  ? 66.152  -1.403  29.990  1.00 30.92  ? 65  LEU Y CA  1 
ATOM 6685 C C   . LEU E 3 40  ? 65.637  -1.446  31.417  1.00 30.32  ? 65  LEU Y C   1 
ATOM 6686 O O   . LEU E 3 40  ? 65.389  -0.410  32.027  1.00 36.67  ? 65  LEU Y O   1 
ATOM 6687 C CB  . LEU E 3 40  ? 67.667  -1.217  29.987  1.00 30.75  ? 65  LEU Y CB  1 
ATOM 6688 C CG  . LEU E 3 40  ? 68.373  -1.928  28.837  1.00 31.15  ? 65  LEU Y CG  1 
ATOM 6689 C CD1 . LEU E 3 40  ? 69.849  -1.601  28.819  1.00 31.26  ? 65  LEU Y CD1 1 
ATOM 6690 C CD2 . LEU E 3 40  ? 68.168  -3.425  28.975  1.00 43.55  ? 65  LEU Y CD2 1 
ATOM 6691 N N   . ASN E 3 41  ? 65.475  -2.653  31.942  1.00 40.17  ? 66  ASN Y N   1 
ATOM 6692 C CA  . ASN E 3 41  ? 64.959  -2.831  33.288  1.00 32.06  ? 66  ASN Y CA  1 
ATOM 6693 C C   . ASN E 3 41  ? 65.834  -3.737  34.144  1.00 35.03  ? 66  ASN Y C   1 
ATOM 6694 O O   . ASN E 3 41  ? 66.433  -4.693  33.657  1.00 34.63  ? 66  ASN Y O   1 
ATOM 6695 C CB  . ASN E 3 41  ? 63.549  -3.397  33.239  1.00 32.40  ? 66  ASN Y CB  1 
ATOM 6696 C CG  . ASN E 3 41  ? 62.495  -2.344  32.981  1.00 33.24  ? 66  ASN Y CG  1 
ATOM 6697 O OD1 . ASN E 3 41  ? 62.750  -1.336  32.328  1.00 42.28  ? 66  ASN Y OD1 1 
ATOM 6698 N ND2 . ASN E 3 41  ? 61.296  -2.574  33.505  1.00 39.57  ? 66  ASN Y ND2 1 
ATOM 6699 N N   . TRP E 3 42  ? 65.894  -3.432  35.432  1.00 37.94  ? 67  TRP Y N   1 
ATOM 6700 C CA  . TRP E 3 42  ? 66.705  -4.209  36.351  1.00 38.08  ? 67  TRP Y CA  1 
ATOM 6701 C C   . TRP E 3 42  ? 65.810  -4.978  37.324  1.00 49.06  ? 67  TRP Y C   1 
ATOM 6702 O O   . TRP E 3 42  ? 64.855  -4.435  37.875  1.00 51.24  ? 67  TRP Y O   1 
ATOM 6703 C CB  . TRP E 3 42  ? 67.683  -3.295  37.091  1.00 28.41  ? 67  TRP Y CB  1 
ATOM 6704 C CG  . TRP E 3 42  ? 68.791  -4.044  37.729  1.00 34.24  ? 67  TRP Y CG  1 
ATOM 6705 C CD1 . TRP E 3 42  ? 69.175  -5.315  37.446  1.00 32.44  ? 67  TRP Y CD1 1 
ATOM 6706 C CD2 . TRP E 3 42  ? 69.698  -3.558  38.725  1.00 28.29  ? 67  TRP Y CD2 1 
ATOM 6707 N NE1 . TRP E 3 42  ? 70.245  -5.670  38.228  1.00 27.93  ? 67  TRP Y NE1 1 
ATOM 6708 C CE2 . TRP E 3 42  ? 70.594  -4.606  39.010  1.00 28.14  ? 67  TRP Y CE2 1 
ATOM 6709 C CE3 . TRP E 3 42  ? 69.836  -2.344  39.401  1.00 28.74  ? 67  TRP Y CE3 1 
ATOM 6710 C CZ2 . TRP E 3 42  ? 71.613  -4.476  39.943  1.00 28.40  ? 67  TRP Y CZ2 1 
ATOM 6711 C CZ3 . TRP E 3 42  ? 70.846  -2.218  40.323  1.00 50.30  ? 67  TRP Y CZ3 1 
ATOM 6712 C CH2 . TRP E 3 42  ? 71.725  -3.278  40.583  1.00 45.76  ? 67  TRP Y CH2 1 
ATOM 6713 N N   . TYR E 3 43  ? 66.103  -6.256  37.524  1.00 45.39  ? 68  TYR Y N   1 
ATOM 6714 C CA  . TYR E 3 43  ? 65.226  -7.059  38.357  1.00 30.91  ? 68  TYR Y CA  1 
ATOM 6715 C C   . TYR E 3 43  ? 65.954  -7.916  39.386  1.00 37.42  ? 68  TYR Y C   1 
ATOM 6716 O O   . TYR E 3 43  ? 67.153  -8.188  39.276  1.00 40.33  ? 68  TYR Y O   1 
ATOM 6717 C CB  . TYR E 3 43  ? 64.332  -7.956  37.492  1.00 39.22  ? 68  TYR Y CB  1 
ATOM 6718 C CG  . TYR E 3 43  ? 63.531  -7.225  36.441  1.00 39.30  ? 68  TYR Y CG  1 
ATOM 6719 C CD1 . TYR E 3 43  ? 62.394  -6.510  36.795  1.00 41.39  ? 68  TYR Y CD1 1 
ATOM 6720 C CD2 . TYR E 3 43  ? 63.866  -7.307  35.085  1.00 43.18  ? 68  TYR Y CD2 1 
ATOM 6721 C CE1 . TYR E 3 43  ? 61.633  -5.853  35.826  1.00 45.83  ? 68  TYR Y CE1 1 
ATOM 6722 C CE2 . TYR E 3 43  ? 63.118  -6.667  34.121  1.00 46.84  ? 68  TYR Y CE2 1 
ATOM 6723 C CZ  . TYR E 3 43  ? 62.002  -5.943  34.493  1.00 48.66  ? 68  TYR Y CZ  1 
ATOM 6724 O OH  . TYR E 3 43  ? 61.249  -5.295  33.531  1.00 50.03  ? 68  TYR Y OH  1 
ATOM 6725 N N   . ARG E 3 44  ? 65.199  -8.280  40.414  1.00 36.80  ? 69  ARG Y N   1 
ATOM 6726 C CA  . ARG E 3 44  ? 65.603  -9.251  41.405  1.00 37.60  ? 69  ARG Y CA  1 
ATOM 6727 C C   . ARG E 3 44  ? 64.359  -10.041 41.754  1.00 45.08  ? 69  ARG Y C   1 
ATOM 6728 O O   . ARG E 3 44  ? 63.265  -9.475  41.855  1.00 59.55  ? 69  ARG Y O   1 
ATOM 6729 C CB  . ARG E 3 44  ? 66.188  -8.587  42.648  1.00 39.50  ? 69  ARG Y CB  1 
ATOM 6730 C CG  . ARG E 3 44  ? 66.602  -9.583  43.712  1.00 43.73  ? 69  ARG Y CG  1 
ATOM 6731 C CD  . ARG E 3 44  ? 66.969  -8.894  45.003  1.00 49.74  ? 69  ARG Y CD  1 
ATOM 6732 N NE  . ARG E 3 44  ? 66.852  -9.800  46.141  1.00 48.78  ? 69  ARG Y NE  1 
ATOM 6733 C CZ  . ARG E 3 44  ? 66.896  -9.410  47.409  1.00 47.87  ? 69  ARG Y CZ  1 
ATOM 6734 N NH1 . ARG E 3 44  ? 67.060  -8.127  47.702  1.00 44.59  ? 69  ARG Y NH1 1 
ATOM 6735 N NH2 . ARG E 3 44  ? 66.777  -10.300 48.384  1.00 48.45  ? 69  ARG Y NH2 1 
ATOM 6736 N N   . MET E 3 45  ? 64.522  -11.343 41.947  1.00 39.02  ? 70  MET Y N   1 
ATOM 6737 C CA  . MET E 3 45  ? 63.379  -12.214 42.172  1.00 33.66  ? 70  MET Y CA  1 
ATOM 6738 C C   . MET E 3 45  ? 63.208  -12.604 43.639  1.00 43.20  ? 70  MET Y C   1 
ATOM 6739 O O   . MET E 3 45  ? 63.912  -12.104 44.514  1.00 51.35  ? 70  MET Y O   1 
ATOM 6740 C CB  . MET E 3 45  ? 63.494  -13.458 41.292  1.00 30.89  ? 70  MET Y CB  1 
ATOM 6741 C CG  . MET E 3 45  ? 64.028  -13.156 39.900  1.00 30.43  ? 70  MET Y CG  1 
ATOM 6742 S SD  . MET E 3 45  ? 63.597  -14.432 38.701  1.00 79.53  ? 70  MET Y SD  1 
ATOM 6743 C CE  . MET E 3 45  ? 61.957  -13.883 38.229  1.00 63.43  ? 70  MET Y CE  1 
ATOM 6744 N N   . SER E 3 46  ? 62.266  -13.508 43.882  1.00 48.28  ? 71  SER Y N   1 
ATOM 6745 C CA  . SER E 3 46  ? 61.821  -13.874 45.223  1.00 52.93  ? 71  SER Y CA  1 
ATOM 6746 C C   . SER E 3 46  ? 60.799  -14.993 45.059  1.00 69.72  ? 71  SER Y C   1 
ATOM 6747 O O   . SER E 3 46  ? 60.222  -15.123 43.997  1.00 77.73  ? 71  SER Y O   1 
ATOM 6748 C CB  . SER E 3 46  ? 61.223  -12.663 45.945  1.00 54.04  ? 71  SER Y CB  1 
ATOM 6749 O OG  . SER E 3 46  ? 60.362  -13.056 46.996  1.00 56.15  ? 71  SER Y OG  1 
ATOM 6750 N N   . PRO E 3 47  ? 60.630  -15.853 46.074  1.00 74.05  ? 72  PRO Y N   1 
ATOM 6751 C CA  . PRO E 3 47  ? 59.654  -16.954 46.010  1.00 72.36  ? 72  PRO Y CA  1 
ATOM 6752 C C   . PRO E 3 47  ? 58.216  -16.516 45.714  1.00 74.09  ? 72  PRO Y C   1 
ATOM 6753 O O   . PRO E 3 47  ? 57.473  -17.179 44.992  1.00 73.84  ? 72  PRO Y O   1 
ATOM 6754 C CB  . PRO E 3 47  ? 59.745  -17.566 47.407  1.00 75.11  ? 72  PRO Y CB  1 
ATOM 6755 C CG  . PRO E 3 47  ? 61.174  -17.363 47.781  1.00 73.10  ? 72  PRO Y CG  1 
ATOM 6756 C CD  . PRO E 3 47  ? 61.574  -16.025 47.192  1.00 69.44  ? 72  PRO Y CD  1 
ATOM 6757 N N   . GLN E 3 50  ? 58.419  -14.156 39.838  1.00 60.09  ? 75  GLN Y N   1 
ATOM 6758 C CA  . GLN E 3 50  ? 58.148  -13.111 40.841  1.00 60.81  ? 75  GLN Y CA  1 
ATOM 6759 C C   . GLN E 3 50  ? 59.051  -11.921 40.650  1.00 62.12  ? 75  GLN Y C   1 
ATOM 6760 O O   . GLN E 3 50  ? 59.889  -11.641 41.506  1.00 68.18  ? 75  GLN Y O   1 
ATOM 6761 C CB  . GLN E 3 50  ? 58.392  -13.600 42.257  1.00 65.34  ? 75  GLN Y CB  1 
ATOM 6762 C CG  . GLN E 3 50  ? 57.579  -14.741 42.815  1.00 72.10  ? 75  GLN Y CG  1 
ATOM 6763 C CD  . GLN E 3 50  ? 57.642  -15.996 41.957  1.00 79.49  ? 75  GLN Y CD  1 
ATOM 6764 O OE1 . GLN E 3 50  ? 58.011  -15.936 40.783  1.00 90.74  ? 75  GLN Y OE1 1 
ATOM 6765 N NE2 . GLN E 3 50  ? 57.551  -17.161 42.628  1.00 72.29  ? 75  GLN Y NE2 1 
ATOM 6766 N N   . THR E 3 51  ? 58.890  -11.223 39.538  1.00 53.43  ? 76  THR Y N   1 
ATOM 6767 C CA  . THR E 3 51  ? 59.612  -9.974  39.260  1.00 48.03  ? 76  THR Y CA  1 
ATOM 6768 C C   . THR E 3 51  ? 59.444  -8.814  40.261  1.00 46.46  ? 76  THR Y C   1 
ATOM 6769 O O   . THR E 3 51  ? 58.324  -8.479  40.625  1.00 46.98  ? 76  THR Y O   1 
ATOM 6770 C CB  . THR E 3 51  ? 59.189  -9.478  37.843  1.00 64.47  ? 76  THR Y CB  1 
ATOM 6771 O OG1 . THR E 3 51  ? 59.695  -10.379 36.848  1.00 70.42  ? 76  THR Y OG1 1 
ATOM 6772 C CG2 . THR E 3 51  ? 59.587  -8.080  37.581  1.00 57.41  ? 76  THR Y CG2 1 
ATOM 6773 N N   . ASP E 3 52  ? 60.563  -8.223  40.700  1.00 46.15  ? 77  ASP Y N   1 
ATOM 6774 C CA  . ASP E 3 52  ? 60.575  -6.932  41.409  1.00 45.86  ? 77  ASP Y CA  1 
ATOM 6775 C C   . ASP E 3 52  ? 61.442  -5.893  40.670  1.00 41.70  ? 77  ASP Y C   1 
ATOM 6776 O O   . ASP E 3 52  ? 62.661  -6.051  40.599  1.00 44.68  ? 77  ASP Y O   1 
ATOM 6777 C CB  . ASP E 3 52  ? 61.098  -7.083  42.847  1.00 49.20  ? 77  ASP Y CB  1 
ATOM 6778 C CG  . ASP E 3 52  ? 60.156  -7.871  43.752  1.00 61.11  ? 77  ASP Y CG  1 
ATOM 6779 O OD1 . ASP E 3 52  ? 59.339  -8.659  43.237  1.00 62.61  ? 77  ASP Y OD1 1 
ATOM 6780 O OD2 . ASP E 3 52  ? 60.200  -7.656  44.986  1.00 69.22  ? 77  ASP Y OD2 1 
ATOM 6781 N N   . LYS E 3 53  ? 60.836  -4.819  40.161  1.00 38.16  ? 78  LYS Y N   1 
ATOM 6782 C CA  . LYS E 3 53  ? 61.583  -3.830  39.373  1.00 34.87  ? 78  LYS Y CA  1 
ATOM 6783 C C   . LYS E 3 53  ? 62.390  -2.879  40.260  1.00 37.78  ? 78  LYS Y C   1 
ATOM 6784 O O   . LYS E 3 53  ? 61.821  -2.100  41.024  1.00 42.45  ? 78  LYS Y O   1 
ATOM 6785 C CB  . LYS E 3 53  ? 60.623  -3.017  38.490  1.00 35.71  ? 78  LYS Y CB  1 
ATOM 6786 C CG  . LYS E 3 53  ? 61.123  -2.773  37.063  1.00 35.07  ? 78  LYS Y CG  1 
ATOM 6787 C CD  . LYS E 3 53  ? 60.303  -1.716  36.333  1.00 36.49  ? 78  LYS Y CD  1 
ATOM 6788 C CE  . LYS E 3 53  ? 60.550  -0.347  36.923  1.00 37.56  ? 78  LYS Y CE  1 
ATOM 6789 N NZ  . LYS E 3 53  ? 59.888  0.723   36.133  1.00 38.48  ? 78  LYS Y NZ  1 
ATOM 6790 N N   . LEU E 3 54  ? 63.712  -2.903  40.129  1.00 31.75  ? 79  LEU Y N   1 
ATOM 6791 C CA  . LEU E 3 54  ? 64.549  -2.065  40.983  1.00 34.64  ? 79  LEU Y CA  1 
ATOM 6792 C C   . LEU E 3 54  ? 64.846  -0.750  40.297  1.00 32.38  ? 79  LEU Y C   1 
ATOM 6793 O O   . LEU E 3 54  ? 64.373  0.305   40.708  1.00 34.30  ? 79  LEU Y O   1 
ATOM 6794 C CB  . LEU E 3 54  ? 65.859  -2.766  41.349  1.00 31.40  ? 79  LEU Y CB  1 
ATOM 6795 C CG  . LEU E 3 54  ? 65.736  -4.061  42.152  1.00 31.24  ? 79  LEU Y CG  1 
ATOM 6796 C CD1 . LEU E 3 54  ? 66.052  -5.225  41.263  1.00 31.29  ? 79  LEU Y CD1 1 
ATOM 6797 C CD2 . LEU E 3 54  ? 66.663  -4.076  43.345  1.00 31.47  ? 79  LEU Y CD2 1 
ATOM 6798 N N   . ALA E 3 55  ? 65.643  -0.815  39.243  1.00 34.16  ? 80  ALA Y N   1 
ATOM 6799 C CA  . ALA E 3 55  ? 65.998  0.385   38.514  1.00 38.13  ? 80  ALA Y CA  1 
ATOM 6800 C C   . ALA E 3 55  ? 65.592  0.221   37.054  1.00 35.94  ? 80  ALA Y C   1 
ATOM 6801 O O   . ALA E 3 55  ? 64.995  -0.793  36.691  1.00 34.22  ? 80  ALA Y O   1 
ATOM 6802 C CB  . ALA E 3 55  ? 67.488  0.666   38.656  1.00 34.53  ? 80  ALA Y CB  1 
ATOM 6803 N N   . ALA E 3 56  ? 65.920  1.208   36.226  1.00 30.66  ? 81  ALA Y N   1 
ATOM 6804 C CA  . ALA E 3 56  ? 65.647  1.144   34.790  1.00 30.85  ? 81  ALA Y CA  1 
ATOM 6805 C C   . ALA E 3 56  ? 66.261  2.340   34.079  1.00 36.82  ? 81  ALA Y C   1 
ATOM 6806 O O   . ALA E 3 56  ? 66.567  3.355   34.708  1.00 39.27  ? 81  ALA Y O   1 
ATOM 6807 C CB  . ALA E 3 56  ? 64.139  1.094   34.524  1.00 31.34  ? 81  ALA Y CB  1 
ATOM 6808 N N   . PHE E 3 57  ? 66.437  2.227   32.765  1.00 34.14  ? 82  PHE Y N   1 
ATOM 6809 C CA  . PHE E 3 57  ? 66.940  3.353   31.993  1.00 35.09  ? 82  PHE Y CA  1 
ATOM 6810 C C   . PHE E 3 57  ? 66.133  3.514   30.704  1.00 35.88  ? 82  PHE Y C   1 
ATOM 6811 O O   . PHE E 3 57  ? 65.884  2.535   30.002  1.00 39.07  ? 82  PHE Y O   1 
ATOM 6812 C CB  . PHE E 3 57  ? 68.434  3.161   31.696  1.00 46.28  ? 82  PHE Y CB  1 
ATOM 6813 C CG  . PHE E 3 57  ? 69.002  4.162   30.731  1.00 49.76  ? 82  PHE Y CG  1 
ATOM 6814 C CD1 . PHE E 3 57  ? 69.314  5.449   31.139  1.00 44.75  ? 82  PHE Y CD1 1 
ATOM 6815 C CD2 . PHE E 3 57  ? 69.236  3.807   29.414  1.00 44.93  ? 82  PHE Y CD2 1 
ATOM 6816 C CE1 . PHE E 3 57  ? 69.842  6.363   30.247  1.00 41.91  ? 82  PHE Y CE1 1 
ATOM 6817 C CE2 . PHE E 3 57  ? 69.763  4.714   28.521  1.00 44.54  ? 82  PHE Y CE2 1 
ATOM 6818 C CZ  . PHE E 3 57  ? 70.067  5.993   28.937  1.00 43.98  ? 82  PHE Y CZ  1 
ATOM 6819 N N   . PRO E 3 58  ? 65.736  4.756   30.369  1.00 34.09  ? 83  PRO Y N   1 
ATOM 6820 C CA  . PRO E 3 58  ? 65.818  6.020   31.118  1.00 34.91  ? 83  PRO Y CA  1 
ATOM 6821 C C   . PRO E 3 58  ? 65.336  5.919   32.573  1.00 34.48  ? 83  PRO Y C   1 
ATOM 6822 O O   . PRO E 3 58  ? 64.368  5.211   32.842  1.00 34.07  ? 83  PRO Y O   1 
ATOM 6823 C CB  . PRO E 3 58  ? 64.878  6.936   30.338  1.00 36.42  ? 83  PRO Y CB  1 
ATOM 6824 C CG  . PRO E 3 58  ? 64.991  6.461   28.942  1.00 38.01  ? 83  PRO Y CG  1 
ATOM 6825 C CD  . PRO E 3 58  ? 65.175  4.963   29.021  1.00 35.09  ? 83  PRO Y CD  1 
ATOM 6826 N N   . GLU E 3 59  ? 66.023  6.603   33.484  1.00 43.31  ? 84  GLU Y N   1 
ATOM 6827 C CA  . GLU E 3 59  ? 65.724  6.548   34.911  1.00 48.56  ? 84  GLU Y CA  1 
ATOM 6828 C C   . GLU E 3 59  ? 64.272  6.915   35.184  1.00 52.07  ? 84  GLU Y C   1 
ATOM 6829 O O   . GLU E 3 59  ? 63.825  7.984   34.788  1.00 60.30  ? 84  GLU Y O   1 
ATOM 6830 C CB  . GLU E 3 59  ? 66.660  7.497   35.666  1.00 54.79  ? 84  GLU Y CB  1 
ATOM 6831 C CG  . GLU E 3 59  ? 66.512  7.497   37.176  1.00 63.76  ? 84  GLU Y CG  1 
ATOM 6832 C CD  . GLU E 3 59  ? 67.471  8.465   37.838  1.00 73.25  ? 84  GLU Y CD  1 
ATOM 6833 O OE1 . GLU E 3 59  ? 68.219  9.143   37.102  1.00 81.34  ? 84  GLU Y OE1 1 
ATOM 6834 O OE2 . GLU E 3 59  ? 67.474  8.556   39.085  1.00 74.75  ? 84  GLU Y OE2 1 
ATOM 6835 N N   . ASP E 3 60  ? 63.529  6.044   35.863  1.00 52.43  ? 85  ASP Y N   1 
ATOM 6836 C CA  . ASP E 3 60  ? 62.125  6.354   36.126  1.00 56.90  ? 85  ASP Y CA  1 
ATOM 6837 C C   . ASP E 3 60  ? 61.993  7.351   37.268  1.00 53.75  ? 85  ASP Y C   1 
ATOM 6838 O O   . ASP E 3 60  ? 62.527  7.161   38.362  1.00 53.61  ? 85  ASP Y O   1 
ATOM 6839 C CB  . ASP E 3 60  ? 61.296  5.082   36.393  1.00 70.24  ? 85  ASP Y CB  1 
ATOM 6840 C CG  . ASP E 3 60  ? 61.834  4.226   37.544  1.00 87.70  ? 85  ASP Y CG  1 
ATOM 6841 O OD1 . ASP E 3 60  ? 62.799  4.626   38.233  1.00 85.03  ? 85  ASP Y OD1 1 
ATOM 6842 O OD2 . ASP E 3 60  ? 61.266  3.130   37.760  1.00 98.27  ? 85  ASP Y OD2 1 
ATOM 6843 N N   . ARG E 3 61  ? 61.357  8.474   36.966  1.00 44.76  ? 86  ARG Y N   1 
ATOM 6844 C CA  . ARG E 3 61  ? 61.068  9.457   37.993  1.00 46.16  ? 86  ARG Y CA  1 
ATOM 6845 C C   . ARG E 3 61  ? 59.622  9.412   38.477  1.00 55.24  ? 86  ARG Y C   1 
ATOM 6846 O O   . ARG E 3 61  ? 59.261  10.124  39.411  1.00 57.23  ? 86  ARG Y O   1 
ATOM 6847 C CB  . ARG E 3 61  ? 61.427  10.847  37.477  1.00 47.26  ? 86  ARG Y CB  1 
ATOM 6848 C CG  . ARG E 3 61  ? 62.843  10.899  36.930  1.00 47.38  ? 86  ARG Y CG  1 
ATOM 6849 C CD  . ARG E 3 61  ? 63.160  12.233  36.290  1.00 60.02  ? 86  ARG Y CD  1 
ATOM 6850 N NE  . ARG E 3 61  ? 64.534  12.279  35.797  1.00 67.17  ? 86  ARG Y NE  1 
ATOM 6851 C CZ  . ARG E 3 61  ? 64.914  11.799  34.617  1.00 71.04  ? 86  ARG Y CZ  1 
ATOM 6852 N NH1 . ARG E 3 61  ? 64.019  11.245  33.809  1.00 61.05  ? 86  ARG Y NH1 1 
ATOM 6853 N NH2 . ARG E 3 61  ? 66.185  11.879  34.241  1.00 75.97  ? 86  ARG Y NH2 1 
ATOM 6854 N N   . SER E 3 62  ? 58.813  8.553   37.863  1.00 61.21  ? 87  SER Y N   1 
ATOM 6855 C CA  . SER E 3 62  ? 57.367  8.558   38.083  1.00 64.45  ? 87  SER Y CA  1 
ATOM 6856 C C   . SER E 3 62  ? 56.949  8.399   39.544  1.00 63.08  ? 87  SER Y C   1 
ATOM 6857 O O   . SER E 3 62  ? 56.083  9.127   40.019  1.00 65.39  ? 87  SER Y O   1 
ATOM 6858 C CB  . SER E 3 62  ? 56.702  7.460   37.251  1.00 66.49  ? 87  SER Y CB  1 
ATOM 6859 O OG  . SER E 3 62  ? 56.758  7.761   35.869  1.00 66.09  ? 87  SER Y OG  1 
ATOM 6860 N N   . GLN E 3 63  ? 57.533  7.432   40.244  1.00 63.71  ? 88  GLN Y N   1 
ATOM 6861 C CA  . GLN E 3 63  ? 57.168  7.187   41.637  1.00 66.05  ? 88  GLN Y CA  1 
ATOM 6862 C C   . GLN E 3 63  ? 58.050  7.965   42.617  1.00 66.36  ? 88  GLN Y C   1 
ATOM 6863 O O   . GLN E 3 63  ? 59.234  8.179   42.353  1.00 58.42  ? 88  GLN Y O   1 
ATOM 6864 C CB  . GLN E 3 63  ? 57.221  5.687   41.929  1.00 62.19  ? 88  GLN Y CB  1 
ATOM 6865 C CG  . GLN E 3 63  ? 56.149  4.911   41.187  1.00 63.10  ? 88  GLN Y CG  1 
ATOM 6866 C CD  . GLN E 3 63  ? 54.755  5.410   41.518  1.00 66.08  ? 88  GLN Y CD  1 
ATOM 6867 O OE1 . GLN E 3 63  ? 54.458  5.735   42.669  1.00 63.93  ? 88  GLN Y OE1 1 
ATOM 6868 N NE2 . GLN E 3 63  ? 53.896  5.490   40.505  1.00 68.42  ? 88  GLN Y NE2 1 
ATOM 6869 N N   . PRO E 3 64  ? 57.472  8.387   43.759  1.00 74.49  ? 89  PRO Y N   1 
ATOM 6870 C CA  . PRO E 3 64  ? 58.191  9.148   44.793  1.00 76.59  ? 89  PRO Y CA  1 
ATOM 6871 C C   . PRO E 3 64  ? 59.207  8.270   45.524  1.00 78.76  ? 89  PRO Y C   1 
ATOM 6872 O O   . PRO E 3 64  ? 59.356  7.113   45.144  1.00 84.71  ? 89  PRO Y O   1 
ATOM 6873 C CB  . PRO E 3 64  ? 57.069  9.614   45.724  1.00 72.73  ? 89  PRO Y CB  1 
ATOM 6874 C CG  . PRO E 3 64  ? 56.045  8.523   45.614  1.00 71.98  ? 89  PRO Y CG  1 
ATOM 6875 C CD  . PRO E 3 64  ? 56.089  8.077   44.170  1.00 73.23  ? 89  PRO Y CD  1 
ATOM 6876 N N   . GLY E 3 65  ? 59.874  8.772   46.557  1.00 89.57  ? 90  GLY Y N   1 
ATOM 6877 C CA  . GLY E 3 65  ? 60.945  7.994   47.143  1.00 84.32  ? 90  GLY Y CA  1 
ATOM 6878 C C   . GLY E 3 65  ? 62.310  8.376   46.620  1.00 86.75  ? 90  GLY Y C   1 
ATOM 6879 O O   . GLY E 3 65  ? 63.204  7.537   46.526  1.00 90.91  ? 90  GLY Y O   1 
ATOM 6880 N N   . GLN E 3 66  ? 62.422  9.625   46.178  1.00 69.17  ? 91  GLN Y N   1 
ATOM 6881 C CA  . GLN E 3 66  ? 63.621  10.455  46.380  1.00 69.91  ? 91  GLN Y CA  1 
ATOM 6882 C C   . GLN E 3 66  ? 64.954  9.679   46.055  1.00 88.09  ? 91  GLN Y C   1 
ATOM 6883 O O   . GLN E 3 66  ? 65.175  9.313   44.916  1.00 91.42  ? 91  GLN Y O   1 
ATOM 6884 C CB  . GLN E 3 66  ? 63.556  11.128  47.787  1.00 95.82  ? 91  GLN Y CB  1 
ATOM 6885 C CG  . GLN E 3 66  ? 64.193  10.508  49.046  1.00 101.56 ? 91  GLN Y CG  1 
ATOM 6886 C CD  . GLN E 3 66  ? 63.654  9.150   49.484  1.00 109.69 ? 91  GLN Y CD  1 
ATOM 6887 O OE1 . GLN E 3 66  ? 62.478  8.998   49.845  1.00 118.88 ? 91  GLN Y OE1 1 
ATOM 6888 N NE2 . GLN E 3 66  ? 64.514  8.140   49.410  1.00 104.41 ? 91  GLN Y NE2 1 
ATOM 6889 N N   . ASP E 3 67  ? 65.824  9.374   47.012  1.00 94.56  ? 92  ASP Y N   1 
ATOM 6890 C CA  . ASP E 3 67  ? 67.078  8.662   46.684  1.00 85.52  ? 92  ASP Y CA  1 
ATOM 6891 C C   . ASP E 3 67  ? 66.851  7.214   46.353  1.00 82.92  ? 92  ASP Y C   1 
ATOM 6892 O O   . ASP E 3 67  ? 65.726  6.768   46.192  1.00 80.09  ? 92  ASP Y O   1 
ATOM 6893 C CB  . ASP E 3 67  ? 68.096  8.696   47.826  1.00 90.89  ? 92  ASP Y CB  1 
ATOM 6894 C CG  . ASP E 3 67  ? 68.010  9.942   48.625  1.00 95.54  ? 92  ASP Y CG  1 
ATOM 6895 O OD1 . ASP E 3 67  ? 68.653  10.957  48.273  1.00 99.25  ? 92  ASP Y OD1 1 
ATOM 6896 O OD2 . ASP E 3 67  ? 67.231  9.911   49.587  1.00 91.97  ? 92  ASP Y OD2 1 
ATOM 6897 N N   . SER E 3 68  ? 67.950  6.478   46.281  1.00 63.59  ? 93  SER Y N   1 
ATOM 6898 C CA  . SER E 3 68  ? 67.937  5.134   45.743  1.00 55.17  ? 93  SER Y CA  1 
ATOM 6899 C C   . SER E 3 68  ? 69.288  4.458   45.925  1.00 46.70  ? 93  SER Y C   1 
ATOM 6900 O O   . SER E 3 68  ? 70.294  5.099   46.237  1.00 45.95  ? 93  SER Y O   1 
ATOM 6901 C CB  . SER E 3 68  ? 67.565  5.168   44.262  1.00 53.42  ? 93  SER Y CB  1 
ATOM 6902 O OG  . SER E 3 68  ? 67.608  3.882   43.676  1.00 49.35  ? 93  SER Y OG  1 
ATOM 6903 N N   . ARG E 3 69  ? 69.280  3.145   45.754  1.00 38.99  ? 94  ARG Y N   1 
ATOM 6904 C CA  . ARG E 3 69  ? 70.464  2.320   45.884  1.00 36.85  ? 94  ARG Y CA  1 
ATOM 6905 C C   . ARG E 3 69  ? 70.755  1.764   44.492  1.00 36.13  ? 94  ARG Y C   1 
ATOM 6906 O O   . ARG E 3 69  ? 71.866  1.900   43.970  1.00 38.51  ? 94  ARG Y O   1 
ATOM 6907 C CB  . ARG E 3 69  ? 70.257  1.235   46.950  1.00 37.60  ? 94  ARG Y CB  1 
ATOM 6908 C CG  . ARG E 3 69  ? 70.589  1.749   48.359  1.00 40.90  ? 94  ARG Y CG  1 
ATOM 6909 C CD  . ARG E 3 69  ? 70.018  0.866   49.462  1.00 48.00  ? 94  ARG Y CD  1 
ATOM 6910 N NE  . ARG E 3 69  ? 70.183  -0.551  49.170  1.00 51.79  ? 94  ARG Y NE  1 
ATOM 6911 C CZ  . ARG E 3 69  ? 69.169  -1.400  49.086  1.00 60.04  ? 94  ARG Y CZ  1 
ATOM 6912 N NH1 . ARG E 3 69  ? 67.930  -0.966  49.263  1.00 66.61  ? 94  ARG Y NH1 1 
ATOM 6913 N NH2 . ARG E 3 69  ? 69.392  -2.674  48.814  1.00 50.77  ? 94  ARG Y NH2 1 
ATOM 6914 N N   . PHE E 3 70  ? 69.754  1.090   43.938  1.00 41.63  ? 95  PHE Y N   1 
ATOM 6915 C CA  . PHE E 3 70  ? 69.752  0.572   42.571  1.00 42.27  ? 95  PHE Y CA  1 
ATOM 6916 C C   . PHE E 3 70  ? 69.686  1.648   41.481  1.00 43.80  ? 95  PHE Y C   1 
ATOM 6917 O O   . PHE E 3 70  ? 68.744  2.442   41.451  1.00 42.40  ? 95  PHE Y O   1 
ATOM 6918 C CB  . PHE E 3 70  ? 68.557  -0.361  42.435  1.00 43.80  ? 95  PHE Y CB  1 
ATOM 6919 C CG  . PHE E 3 70  ? 68.200  -1.031  43.722  1.00 50.13  ? 95  PHE Y CG  1 
ATOM 6920 C CD1 . PHE E 3 70  ? 69.094  -1.893  44.321  1.00 43.51  ? 95  PHE Y CD1 1 
ATOM 6921 C CD2 . PHE E 3 70  ? 66.993  -0.779  44.354  1.00 54.83  ? 95  PHE Y CD2 1 
ATOM 6922 C CE1 . PHE E 3 70  ? 68.799  -2.508  45.513  1.00 42.47  ? 95  PHE Y CE1 1 
ATOM 6923 C CE2 . PHE E 3 70  ? 66.684  -1.398  45.554  1.00 53.63  ? 95  PHE Y CE2 1 
ATOM 6924 C CZ  . PHE E 3 70  ? 67.592  -2.266  46.134  1.00 47.52  ? 95  PHE Y CZ  1 
ATOM 6925 N N   . ARG E 3 71  ? 70.660  1.645   40.568  1.00 37.10  ? 96  ARG Y N   1 
ATOM 6926 C CA  . ARG E 3 71  ? 70.652  2.577   39.430  1.00 30.10  ? 96  ARG Y CA  1 
ATOM 6927 C C   . ARG E 3 71  ? 71.195  1.986   38.118  1.00 29.54  ? 96  ARG Y C   1 
ATOM 6928 O O   . ARG E 3 71  ? 72.097  1.142   38.140  1.00 29.12  ? 96  ARG Y O   1 
ATOM 6929 C CB  . ARG E 3 71  ? 71.436  3.843   39.784  1.00 31.26  ? 96  ARG Y CB  1 
ATOM 6930 C CG  . ARG E 3 71  ? 70.701  4.760   40.742  1.00 37.40  ? 96  ARG Y CG  1 
ATOM 6931 C CD  . ARG E 3 71  ? 71.009  6.215   40.466  1.00 39.27  ? 96  ARG Y CD  1 
ATOM 6932 N NE  . ARG E 3 71  ? 72.408  6.527   40.715  1.00 41.96  ? 96  ARG Y NE  1 
ATOM 6933 C CZ  . ARG E 3 71  ? 72.953  7.713   40.484  1.00 43.73  ? 96  ARG Y CZ  1 
ATOM 6934 N NH1 . ARG E 3 71  ? 72.219  8.703   39.999  1.00 36.49  ? 96  ARG Y NH1 1 
ATOM 6935 N NH2 . ARG E 3 71  ? 74.234  7.907   40.739  1.00 54.59  ? 96  ARG Y NH2 1 
ATOM 6936 N N   . VAL E 3 72  ? 70.643  2.437   36.983  1.00 29.76  ? 97  VAL Y N   1 
ATOM 6937 C CA  . VAL E 3 72  ? 71.045  1.926   35.664  1.00 29.51  ? 97  VAL Y CA  1 
ATOM 6938 C C   . VAL E 3 72  ? 71.625  3.063   34.833  1.00 38.29  ? 97  VAL Y C   1 
ATOM 6939 O O   . VAL E 3 72  ? 70.962  4.073   34.654  1.00 39.45  ? 97  VAL Y O   1 
ATOM 6940 C CB  . VAL E 3 72  ? 69.860  1.316   34.827  1.00 29.16  ? 97  VAL Y CB  1 
ATOM 6941 C CG1 . VAL E 3 72  ? 70.411  0.618   33.608  1.00 29.05  ? 97  VAL Y CG1 1 
ATOM 6942 C CG2 . VAL E 3 72  ? 68.992  0.405   35.639  1.00 50.57  ? 97  VAL Y CG2 1 
ATOM 6943 N N   . THR E 3 73  ? 72.812  2.892   34.262  1.00 40.08  ? 98  THR Y N   1 
ATOM 6944 C CA  . THR E 3 73  ? 73.348  3.936   33.397  1.00 38.82  ? 98  THR Y CA  1 
ATOM 6945 C C   . THR E 3 73  ? 74.090  3.379   32.189  1.00 42.15  ? 98  THR Y C   1 
ATOM 6946 O O   . THR E 3 73  ? 74.825  2.394   32.285  1.00 32.52  ? 98  THR Y O   1 
ATOM 6947 C CB  . THR E 3 73  ? 74.282  4.883   34.179  1.00 42.48  ? 98  THR Y CB  1 
ATOM 6948 O OG1 . THR E 3 73  ? 75.034  4.136   35.144  1.00 40.95  ? 98  THR Y OG1 1 
ATOM 6949 C CG2 . THR E 3 73  ? 73.474  5.953   34.905  1.00 46.61  ? 98  THR Y CG2 1 
ATOM 6950 N N   . GLN E 3 74  ? 73.876  4.022   31.047  1.00 38.30  ? 99  GLN Y N   1 
ATOM 6951 C CA  . GLN E 3 74  ? 74.516  3.625   29.806  1.00 37.33  ? 99  GLN Y CA  1 
ATOM 6952 C C   . GLN E 3 74  ? 75.960  4.102   29.786  1.00 37.34  ? 99  GLN Y C   1 
ATOM 6953 O O   . GLN E 3 74  ? 76.262  5.217   30.211  1.00 38.18  ? 99  GLN Y O   1 
ATOM 6954 C CB  . GLN E 3 74  ? 73.744  4.181   28.610  1.00 37.22  ? 99  GLN Y CB  1 
ATOM 6955 C CG  . GLN E 3 74  ? 74.330  3.831   27.259  1.00 51.76  ? 99  GLN Y CG  1 
ATOM 6956 C CD  . GLN E 3 74  ? 73.448  4.299   26.121  1.00 48.10  ? 99  GLN Y CD  1 
ATOM 6957 O OE1 . GLN E 3 74  ? 73.702  3.994   24.957  1.00 46.21  ? 99  GLN Y OE1 1 
ATOM 6958 N NE2 . GLN E 3 74  ? 72.397  5.043   26.455  1.00 49.93  ? 99  GLN Y NE2 1 
ATOM 6959 N N   . LEU E 3 75  ? 76.850  3.241   29.306  1.00 37.98  ? 100 LEU Y N   1 
ATOM 6960 C CA  . LEU E 3 75  ? 78.263  3.574   29.178  1.00 43.18  ? 100 LEU Y CA  1 
ATOM 6961 C C   . LEU E 3 75  ? 78.511  4.308   27.855  1.00 48.83  ? 100 LEU Y C   1 
ATOM 6962 O O   . LEU E 3 75  ? 77.678  4.234   26.952  1.00 51.81  ? 100 LEU Y O   1 
ATOM 6963 C CB  . LEU E 3 75  ? 79.107  2.299   29.288  1.00 40.76  ? 100 LEU Y CB  1 
ATOM 6964 C CG  . LEU E 3 75  ? 79.030  1.603   30.648  1.00 37.31  ? 100 LEU Y CG  1 
ATOM 6965 C CD1 . LEU E 3 75  ? 80.170  0.605   30.795  1.00 37.57  ? 100 LEU Y CD1 1 
ATOM 6966 C CD2 . LEU E 3 75  ? 79.048  2.619   31.784  1.00 37.41  ? 100 LEU Y CD2 1 
ATOM 6967 N N   . PRO E 3 76  ? 79.646  5.026   27.736  1.00 48.44  ? 101 PRO Y N   1 
ATOM 6968 C CA  . PRO E 3 76  ? 79.912  5.850   26.547  1.00 50.71  ? 101 PRO Y CA  1 
ATOM 6969 C C   . PRO E 3 76  ? 79.803  5.129   25.203  1.00 50.11  ? 101 PRO Y C   1 
ATOM 6970 O O   . PRO E 3 76  ? 79.318  5.725   24.239  1.00 45.97  ? 101 PRO Y O   1 
ATOM 6971 C CB  . PRO E 3 76  ? 81.351  6.332   26.781  1.00 56.16  ? 101 PRO Y CB  1 
ATOM 6972 C CG  . PRO E 3 76  ? 81.933  5.350   27.754  1.00 44.92  ? 101 PRO Y CG  1 
ATOM 6973 C CD  . PRO E 3 76  ? 80.788  5.062   28.667  1.00 50.96  ? 101 PRO Y CD  1 
ATOM 6974 N N   . ASN E 3 77  ? 80.237  3.873   25.144  1.00 55.66  ? 102 ASN Y N   1 
ATOM 6975 C CA  . ASN E 3 77  ? 80.221  3.122   23.893  1.00 61.92  ? 102 ASN Y CA  1 
ATOM 6976 C C   . ASN E 3 77  ? 78.802  2.904   23.386  1.00 57.59  ? 102 ASN Y C   1 
ATOM 6977 O O   . ASN E 3 77  ? 78.592  2.572   22.217  1.00 53.99  ? 102 ASN Y O   1 
ATOM 6978 C CB  . ASN E 3 77  ? 80.962  1.782   24.048  1.00 61.03  ? 102 ASN Y CB  1 
ATOM 6979 C CG  . ASN E 3 77  ? 80.317  0.853   25.065  1.00 60.13  ? 102 ASN Y CG  1 
ATOM 6980 O OD1 . ASN E 3 77  ? 79.122  0.570   25.003  1.00 55.14  ? 102 ASN Y OD1 1 
ATOM 6981 N ND2 . ASN E 3 77  ? 81.118  0.368   26.011  1.00 62.75  ? 102 ASN Y ND2 1 
ATOM 6982 N N   . GLY E 3 78  ? 77.830  3.107   24.270  1.00 58.66  ? 103 GLY Y N   1 
ATOM 6983 C CA  . GLY E 3 78  ? 76.433  3.076   23.883  1.00 64.28  ? 103 GLY Y CA  1 
ATOM 6984 C C   . GLY E 3 78  ? 75.952  1.695   23.504  1.00 67.96  ? 103 GLY Y C   1 
ATOM 6985 O O   . GLY E 3 78  ? 75.128  1.527   22.601  1.00 75.83  ? 103 GLY Y O   1 
ATOM 6986 N N   . ARG E 3 79  ? 76.528  0.699   24.162  1.00 65.68  ? 104 ARG Y N   1 
ATOM 6987 C CA  . ARG E 3 79  ? 76.110  -0.680  24.001  1.00 58.54  ? 104 ARG Y CA  1 
ATOM 6988 C C   . ARG E 3 79  ? 75.946  -1.298  25.397  1.00 59.86  ? 104 ARG Y C   1 
ATOM 6989 O O   . ARG E 3 79  ? 74.876  -1.781  25.740  1.00 70.26  ? 104 ARG Y O   1 
ATOM 6990 C CB  . ARG E 3 79  ? 77.099  -1.407  23.093  1.00 57.46  ? 104 ARG Y CB  1 
ATOM 6991 C CG  . ARG E 3 79  ? 77.457  -2.812  23.415  1.00 56.02  ? 104 ARG Y CG  1 
ATOM 6992 C CD  . ARG E 3 79  ? 78.361  -3.271  22.306  1.00 65.04  ? 104 ARG Y CD  1 
ATOM 6993 N NE  . ARG E 3 79  ? 78.989  -4.549  22.592  1.00 69.23  ? 104 ARG Y NE  1 
ATOM 6994 C CZ  . ARG E 3 79  ? 79.926  -5.098  21.830  1.00 71.29  ? 104 ARG Y CZ  1 
ATOM 6995 N NH1 . ARG E 3 79  ? 80.330  -4.481  20.727  1.00 73.51  ? 104 ARG Y NH1 1 
ATOM 6996 N NH2 . ARG E 3 79  ? 80.455  -6.263  22.173  1.00 63.06  ? 104 ARG Y NH2 1 
ATOM 6997 N N   . ASP E 3 80  ? 77.024  -1.289  26.180  1.00 49.92  ? 105 ASP Y N   1 
ATOM 6998 C CA  . ASP E 3 80  ? 77.049  -1.757  27.579  1.00 40.45  ? 105 ASP Y CA  1 
ATOM 6999 C C   . ASP E 3 80  ? 76.403  -0.820  28.614  1.00 43.34  ? 105 ASP Y C   1 
ATOM 7000 O O   . ASP E 3 80  ? 76.621  0.387   28.586  1.00 42.59  ? 105 ASP Y O   1 
ATOM 7001 C CB  . ASP E 3 80  ? 78.501  -1.985  28.007  1.00 49.17  ? 105 ASP Y CB  1 
ATOM 7002 C CG  . ASP E 3 80  ? 79.185  -3.056  27.193  1.00 60.13  ? 105 ASP Y CG  1 
ATOM 7003 O OD1 . ASP E 3 80  ? 78.710  -3.331  26.077  1.00 62.98  ? 105 ASP Y OD1 1 
ATOM 7004 O OD2 . ASP E 3 80  ? 80.222  -3.590  27.638  1.00 69.79  ? 105 ASP Y OD2 1 
ATOM 7005 N N   . PHE E 3 81  ? 75.659  -1.393  29.559  1.00 39.05  ? 106 PHE Y N   1 
ATOM 7006 C CA  . PHE E 3 81  ? 74.978  -0.617  30.601  1.00 41.16  ? 106 PHE Y CA  1 
ATOM 7007 C C   . PHE E 3 81  ? 75.402  -1.068  32.002  1.00 43.03  ? 106 PHE Y C   1 
ATOM 7008 O O   . PHE E 3 81  ? 75.694  -2.244  32.218  1.00 37.73  ? 106 PHE Y O   1 
ATOM 7009 C CB  . PHE E 3 81  ? 73.457  -0.744  30.454  1.00 42.77  ? 106 PHE Y CB  1 
ATOM 7010 C CG  . PHE E 3 81  ? 72.912  -0.162  29.177  1.00 44.85  ? 106 PHE Y CG  1 
ATOM 7011 C CD1 . PHE E 3 81  ? 72.175  1.008   29.187  1.00 42.69  ? 106 PHE Y CD1 1 
ATOM 7012 C CD2 . PHE E 3 81  ? 73.137  -0.786  27.966  1.00 43.73  ? 106 PHE Y CD2 1 
ATOM 7013 C CE1 . PHE E 3 81  ? 71.672  1.535   28.010  1.00 41.22  ? 106 PHE Y CE1 1 
ATOM 7014 C CE2 . PHE E 3 81  ? 72.642  -0.258  26.792  1.00 45.46  ? 106 PHE Y CE2 1 
ATOM 7015 C CZ  . PHE E 3 81  ? 71.912  0.901   26.813  1.00 40.58  ? 106 PHE Y CZ  1 
ATOM 7016 N N   . HIS E 3 82  ? 75.419  -0.140  32.955  1.00 39.07  ? 107 HIS Y N   1 
ATOM 7017 C CA  . HIS E 3 82  ? 75.848  -0.464  34.315  1.00 39.01  ? 107 HIS Y CA  1 
ATOM 7018 C C   . HIS E 3 82  ? 74.700  -0.610  35.313  1.00 38.10  ? 107 HIS Y C   1 
ATOM 7019 O O   . HIS E 3 82  ? 73.994  0.346   35.618  1.00 38.86  ? 107 HIS Y O   1 
ATOM 7020 C CB  . HIS E 3 82  ? 76.837  0.586   34.818  1.00 42.13  ? 107 HIS Y CB  1 
ATOM 7021 C CG  . HIS E 3 82  ? 78.264  0.260   34.502  1.00 43.50  ? 107 HIS Y CG  1 
ATOM 7022 N ND1 . HIS E 3 82  ? 79.314  1.036   34.936  1.00 43.53  ? 107 HIS Y ND1 1 
ATOM 7023 C CD2 . HIS E 3 82  ? 78.811  -0.761  33.803  1.00 42.88  ? 107 HIS Y CD2 1 
ATOM 7024 C CE1 . HIS E 3 82  ? 80.453  0.509   34.516  1.00 43.94  ? 107 HIS Y CE1 1 
ATOM 7025 N NE2 . HIS E 3 82  ? 80.172  -0.585  33.826  1.00 43.58  ? 107 HIS Y NE2 1 
ATOM 7026 N N   . MET E 3 83  ? 74.561  -1.825  35.833  1.00 31.94  ? 108 MET Y N   1 
ATOM 7027 C CA  . MET E 3 83  ? 73.538  -2.195  36.794  1.00 28.02  ? 108 MET Y CA  1 
ATOM 7028 C C   . MET E 3 83  ? 74.191  -2.185  38.155  1.00 28.21  ? 108 MET Y C   1 
ATOM 7029 O O   . MET E 3 83  ? 75.005  -3.061  38.411  1.00 28.25  ? 108 MET Y O   1 
ATOM 7030 C CB  . MET E 3 83  ? 73.036  -3.601  36.479  1.00 34.90  ? 108 MET Y CB  1 
ATOM 7031 C CG  . MET E 3 83  ? 72.791  -3.812  34.996  1.00 33.61  ? 108 MET Y CG  1 
ATOM 7032 S SD  . MET E 3 83  ? 71.128  -4.248  34.499  1.00 55.24  ? 108 MET Y SD  1 
ATOM 7033 C CE  . MET E 3 83  ? 70.238  -2.781  34.633  1.00 49.23  ? 108 MET Y CE  1 
ATOM 7034 N N   . SER E 3 84  ? 73.873  -1.240  39.035  1.00 29.97  ? 109 SER Y N   1 
ATOM 7035 C CA  . SER E 3 84  ? 74.613  -1.197  40.301  1.00 30.43  ? 109 SER Y CA  1 
ATOM 7036 C C   . SER E 3 84  ? 73.786  -1.003  41.572  1.00 30.56  ? 109 SER Y C   1 
ATOM 7037 O O   . SER E 3 84  ? 73.029  -0.041  41.700  1.00 31.96  ? 109 SER Y O   1 
ATOM 7038 C CB  . SER E 3 84  ? 75.677  -0.097  40.253  1.00 62.65  ? 109 SER Y CB  1 
ATOM 7039 O OG  . SER E 3 84  ? 76.581  -0.288  39.183  1.00 65.49  ? 109 SER Y OG  1 
ATOM 7040 N N   . VAL E 3 85  ? 73.956  -1.923  42.519  1.00 32.43  ? 110 VAL Y N   1 
ATOM 7041 C CA  . VAL E 3 85  ? 73.448  -1.734  43.871  1.00 37.02  ? 110 VAL Y CA  1 
ATOM 7042 C C   . VAL E 3 85  ? 74.567  -1.109  44.686  1.00 33.95  ? 110 VAL Y C   1 
ATOM 7043 O O   . VAL E 3 85  ? 75.698  -1.598  44.660  1.00 38.61  ? 110 VAL Y O   1 
ATOM 7044 C CB  . VAL E 3 85  ? 73.019  -3.056  44.562  1.00 49.71  ? 110 VAL Y CB  1 
ATOM 7045 C CG1 . VAL E 3 85  ? 72.656  -2.799  46.021  1.00 52.02  ? 110 VAL Y CG1 1 
ATOM 7046 C CG2 . VAL E 3 85  ? 71.880  -3.732  43.838  1.00 31.81  ? 110 VAL Y CG2 1 
ATOM 7047 N N   . VAL E 3 86  ? 74.261  -0.045  45.416  1.00 28.06  ? 111 VAL Y N   1 
ATOM 7048 C CA  . VAL E 3 86  ? 75.246  0.556   46.301  1.00 36.87  ? 111 VAL Y CA  1 
ATOM 7049 C C   . VAL E 3 86  ? 74.854  0.293   47.750  1.00 42.50  ? 111 VAL Y C   1 
ATOM 7050 O O   . VAL E 3 86  ? 73.673  0.095   48.053  1.00 40.95  ? 111 VAL Y O   1 
ATOM 7051 C CB  . VAL E 3 86  ? 75.397  2.077   46.059  1.00 35.96  ? 111 VAL Y CB  1 
ATOM 7052 C CG1 . VAL E 3 86  ? 75.868  2.339   44.637  1.00 31.44  ? 111 VAL Y CG1 1 
ATOM 7053 C CG2 . VAL E 3 86  ? 74.092  2.808   46.339  1.00 28.05  ? 111 VAL Y CG2 1 
ATOM 7054 N N   . ARG E 3 87  ? 75.857  0.254   48.627  1.00 29.16  ? 112 ARG Y N   1 
ATOM 7055 C CA  . ARG E 3 87  ? 75.655  0.056   50.063  1.00 29.24  ? 112 ARG Y CA  1 
ATOM 7056 C C   . ARG E 3 87  ? 74.950  -1.270  50.335  1.00 55.46  ? 112 ARG Y C   1 
ATOM 7057 O O   . ARG E 3 87  ? 74.024  -1.330  51.147  1.00 46.06  ? 112 ARG Y O   1 
ATOM 7058 C CB  . ARG E 3 87  ? 74.840  1.211   50.655  1.00 28.53  ? 112 ARG Y CB  1 
ATOM 7059 C CG  . ARG E 3 87  ? 75.206  2.587   50.113  1.00 28.83  ? 112 ARG Y CG  1 
ATOM 7060 C CD  . ARG E 3 87  ? 74.785  3.697   51.059  1.00 28.68  ? 112 ARG Y CD  1 
ATOM 7061 N NE  . ARG E 3 87  ? 73.352  3.657   51.339  1.00 42.68  ? 112 ARG Y NE  1 
ATOM 7062 C CZ  . ARG E 3 87  ? 72.408  4.118   50.523  1.00 40.80  ? 112 ARG Y CZ  1 
ATOM 7063 N NH1 . ARG E 3 87  ? 72.734  4.668   49.360  1.00 39.23  ? 112 ARG Y NH1 1 
ATOM 7064 N NH2 . ARG E 3 87  ? 71.132  4.034   50.877  1.00 42.30  ? 112 ARG Y NH2 1 
ATOM 7065 N N   . ALA E 3 88  ? 75.398  -2.325  49.659  1.00 48.43  ? 113 ALA Y N   1 
ATOM 7066 C CA  . ALA E 3 88  ? 74.697  -3.609  49.661  1.00 46.41  ? 113 ALA Y CA  1 
ATOM 7067 C C   . ALA E 3 88  ? 74.484  -4.182  51.063  1.00 46.06  ? 113 ALA Y C   1 
ATOM 7068 O O   . ALA E 3 88  ? 75.414  -4.262  51.864  1.00 53.70  ? 113 ALA Y O   1 
ATOM 7069 C CB  . ALA E 3 88  ? 75.445  -4.614  48.803  1.00 35.88  ? 113 ALA Y CB  1 
ATOM 7070 N N   . ARG E 3 89  ? 73.244  -4.572  51.345  1.00 46.68  ? 114 ARG Y N   1 
ATOM 7071 C CA  . ARG E 3 89  ? 72.893  -5.210  52.610  1.00 40.94  ? 114 ARG Y CA  1 
ATOM 7072 C C   . ARG E 3 89  ? 73.190  -6.698  52.524  1.00 37.52  ? 114 ARG Y C   1 
ATOM 7073 O O   . ARG E 3 89  ? 73.732  -7.158  51.526  1.00 36.42  ? 114 ARG Y O   1 
ATOM 7074 C CB  . ARG E 3 89  ? 71.417  -4.997  52.942  1.00 31.97  ? 114 ARG Y CB  1 
ATOM 7075 C CG  . ARG E 3 89  ? 70.919  -3.586  52.734  1.00 41.23  ? 114 ARG Y CG  1 
ATOM 7076 C CD  . ARG E 3 89  ? 69.733  -3.308  53.636  1.00 36.57  ? 114 ARG Y CD  1 
ATOM 7077 N NE  . ARG E 3 89  ? 68.728  -2.455  53.007  1.00 38.35  ? 114 ARG Y NE  1 
ATOM 7078 C CZ  . ARG E 3 89  ? 67.739  -2.900  52.238  1.00 42.56  ? 114 ARG Y CZ  1 
ATOM 7079 N NH1 . ARG E 3 89  ? 67.622  -4.199  51.988  1.00 33.70  ? 114 ARG Y NH1 1 
ATOM 7080 N NH2 . ARG E 3 89  ? 66.865  -2.045  51.718  1.00 48.34  ? 114 ARG Y NH2 1 
ATOM 7081 N N   . ARG E 3 90  ? 72.825  -7.447  53.562  1.00 39.89  ? 115 ARG Y N   1 
ATOM 7082 C CA  . ARG E 3 90  ? 72.957  -8.901  53.526  1.00 34.77  ? 115 ARG Y CA  1 
ATOM 7083 C C   . ARG E 3 90  ? 71.803  -9.536  52.758  1.00 31.03  ? 115 ARG Y C   1 
ATOM 7084 O O   . ARG E 3 90  ? 71.968  -10.577 52.126  1.00 31.27  ? 115 ARG Y O   1 
ATOM 7085 C CB  . ARG E 3 90  ? 73.031  -9.495  54.935  1.00 35.10  ? 115 ARG Y CB  1 
ATOM 7086 C CG  . ARG E 3 90  ? 74.359  -9.278  55.648  1.00 42.54  ? 115 ARG Y CG  1 
ATOM 7087 C CD  . ARG E 3 90  ? 74.859  -10.559 56.311  1.00 50.21  ? 115 ARG Y CD  1 
ATOM 7088 N NE  . ARG E 3 90  ? 75.466  -11.480 55.353  1.00 54.62  ? 115 ARG Y NE  1 
ATOM 7089 C CZ  . ARG E 3 90  ? 75.904  -12.699 55.658  1.00 58.11  ? 115 ARG Y CZ  1 
ATOM 7090 N NH1 . ARG E 3 90  ? 75.802  -13.153 56.900  1.00 54.59  ? 115 ARG Y NH1 1 
ATOM 7091 N NH2 . ARG E 3 90  ? 76.447  -13.465 54.722  1.00 62.63  ? 115 ARG Y NH2 1 
ATOM 7092 N N   . ASN E 3 91  ? 70.637  -8.900  52.807  1.00 35.68  ? 116 ASN Y N   1 
ATOM 7093 C CA  . ASN E 3 91  ? 69.437  -9.456  52.190  1.00 34.78  ? 116 ASN Y CA  1 
ATOM 7094 C C   . ASN E 3 91  ? 69.273  -9.028  50.737  1.00 39.78  ? 116 ASN Y C   1 
ATOM 7095 O O   . ASN E 3 91  ? 68.277  -9.350  50.088  1.00 42.76  ? 116 ASN Y O   1 
ATOM 7096 C CB  . ASN E 3 91  ? 68.204  -9.078  53.019  1.00 36.73  ? 116 ASN Y CB  1 
ATOM 7097 C CG  . ASN E 3 91  ? 67.932  -7.582  53.034  1.00 43.01  ? 116 ASN Y CG  1 
ATOM 7098 O OD1 . ASN E 3 91  ? 67.628  -6.974  52.005  1.00 55.24  ? 116 ASN Y OD1 1 
ATOM 7099 N ND2 . ASN E 3 91  ? 68.051  -6.977  54.216  1.00 34.16  ? 116 ASN Y ND2 1 
ATOM 7100 N N   . ASP E 3 92  ? 70.266  -8.304  50.235  1.00 41.46  ? 117 ASP Y N   1 
ATOM 7101 C CA  . ASP E 3 92  ? 70.300  -7.930  48.829  1.00 40.32  ? 117 ASP Y CA  1 
ATOM 7102 C C   . ASP E 3 92  ? 70.673  -9.131  47.960  1.00 43.68  ? 117 ASP Y C   1 
ATOM 7103 O O   . ASP E 3 92  ? 70.447  -9.118  46.751  1.00 45.59  ? 117 ASP Y O   1 
ATOM 7104 C CB  . ASP E 3 92  ? 71.277  -6.777  48.604  1.00 42.72  ? 117 ASP Y CB  1 
ATOM 7105 C CG  . ASP E 3 92  ? 70.658  -5.431  48.914  1.00 46.84  ? 117 ASP Y CG  1 
ATOM 7106 O OD1 . ASP E 3 92  ? 69.435  -5.282  48.710  1.00 47.90  ? 117 ASP Y OD1 1 
ATOM 7107 O OD2 . ASP E 3 92  ? 71.387  -4.518  49.353  1.00 47.92  ? 117 ASP Y OD2 1 
ATOM 7108 N N   . SER E 3 93  ? 71.237  -10.166 48.580  1.00 38.57  ? 118 SER Y N   1 
ATOM 7109 C CA  . SER E 3 93  ? 71.553  -11.403 47.870  1.00 30.34  ? 118 SER Y CA  1 
ATOM 7110 C C   . SER E 3 93  ? 70.319  -11.980 47.219  1.00 33.53  ? 118 SER Y C   1 
ATOM 7111 O O   . SER E 3 93  ? 69.219  -11.886 47.758  1.00 28.32  ? 118 SER Y O   1 
ATOM 7112 C CB  . SER E 3 93  ? 72.135  -12.466 48.800  1.00 34.52  ? 118 SER Y CB  1 
ATOM 7113 O OG  . SER E 3 93  ? 73.102  -11.940 49.674  1.00 33.46  ? 118 SER Y OG  1 
ATOM 7114 N N   . GLY E 3 94  ? 70.507  -12.596 46.064  1.00 32.03  ? 119 GLY Y N   1 
ATOM 7115 C CA  . GLY E 3 94  ? 69.409  -13.256 45.398  1.00 35.30  ? 119 GLY Y CA  1 
ATOM 7116 C C   . GLY E 3 94  ? 69.614  -13.304 43.905  1.00 28.02  ? 119 GLY Y C   1 
ATOM 7117 O O   . GLY E 3 94  ? 70.645  -12.874 43.387  1.00 28.78  ? 119 GLY Y O   1 
ATOM 7118 N N   . THR E 3 95  ? 68.615  -13.816 43.203  1.00 30.31  ? 120 THR Y N   1 
ATOM 7119 C CA  . THR E 3 95  ? 68.724  -13.941 41.768  1.00 31.58  ? 120 THR Y CA  1 
ATOM 7120 C C   . THR E 3 95  ? 68.401  -12.598 41.117  1.00 35.58  ? 120 THR Y C   1 
ATOM 7121 O O   . THR E 3 95  ? 67.282  -12.094 41.222  1.00 29.72  ? 120 THR Y O   1 
ATOM 7122 C CB  . THR E 3 95  ? 67.789  -15.047 41.251  1.00 31.59  ? 120 THR Y CB  1 
ATOM 7123 O OG1 . THR E 3 95  ? 67.978  -16.228 42.041  1.00 40.47  ? 120 THR Y OG1 1 
ATOM 7124 C CG2 . THR E 3 95  ? 68.085  -15.370 39.815  1.00 30.64  ? 120 THR Y CG2 1 
ATOM 7125 N N   . TYR E 3 96  ? 69.391  -12.023 40.439  1.00 26.30  ? 121 TYR Y N   1 
ATOM 7126 C CA  . TYR E 3 96  ? 69.183  -10.788 39.691  1.00 25.66  ? 121 TYR Y CA  1 
ATOM 7127 C C   . TYR E 3 96  ? 69.131  -11.075 38.201  1.00 39.12  ? 121 TYR Y C   1 
ATOM 7128 O O   . TYR E 3 96  ? 69.405  -12.199 37.772  1.00 36.41  ? 121 TYR Y O   1 
ATOM 7129 C CB  . TYR E 3 96  ? 70.292  -9.778  39.989  1.00 26.47  ? 121 TYR Y CB  1 
ATOM 7130 C CG  . TYR E 3 96  ? 70.216  -9.174  41.368  1.00 32.15  ? 121 TYR Y CG  1 
ATOM 7131 C CD1 . TYR E 3 96  ? 69.549  -7.976  41.586  1.00 34.88  ? 121 TYR Y CD1 1 
ATOM 7132 C CD2 . TYR E 3 96  ? 70.803  -9.806  42.454  1.00 33.87  ? 121 TYR Y CD2 1 
ATOM 7133 C CE1 . TYR E 3 96  ? 69.477  -7.418  42.853  1.00 35.43  ? 121 TYR Y CE1 1 
ATOM 7134 C CE2 . TYR E 3 96  ? 70.737  -9.260  43.721  1.00 37.19  ? 121 TYR Y CE2 1 
ATOM 7135 C CZ  . TYR E 3 96  ? 70.073  -8.066  43.917  1.00 37.39  ? 121 TYR Y CZ  1 
ATOM 7136 O OH  . TYR E 3 96  ? 70.005  -7.524  45.182  1.00 31.26  ? 121 TYR Y OH  1 
ATOM 7137 N N   . LEU E 3 97  ? 68.837  -10.037 37.420  1.00 23.82  ? 122 LEU Y N   1 
ATOM 7138 C CA  . LEU E 3 97  ? 68.650  -10.179 35.981  1.00 23.68  ? 122 LEU Y CA  1 
ATOM 7139 C C   . LEU E 3 97  ? 68.336  -8.825  35.353  1.00 41.12  ? 122 LEU Y C   1 
ATOM 7140 O O   . LEU E 3 97  ? 68.114  -7.837  36.054  1.00 48.31  ? 122 LEU Y O   1 
ATOM 7141 C CB  . LEU E 3 97  ? 67.537  -11.196 35.682  1.00 22.90  ? 122 LEU Y CB  1 
ATOM 7142 C CG  . LEU E 3 97  ? 66.077  -10.905 36.044  1.00 28.18  ? 122 LEU Y CG  1 
ATOM 7143 C CD1 . LEU E 3 97  ? 65.361  -10.263 34.869  1.00 21.25  ? 122 LEU Y CD1 1 
ATOM 7144 C CD2 . LEU E 3 97  ? 65.340  -12.151 36.526  1.00 27.91  ? 122 LEU Y CD2 1 
ATOM 7145 N N   . CYS E 3 98  ? 68.343  -8.785  34.026  1.00 39.09  ? 123 CYS Y N   1 
ATOM 7146 C CA  . CYS E 3 98  ? 67.958  -7.592  33.279  1.00 32.61  ? 123 CYS Y CA  1 
ATOM 7147 C C   . CYS E 3 98  ? 67.029  -7.983  32.148  1.00 40.83  ? 123 CYS Y C   1 
ATOM 7148 O O   . CYS E 3 98  ? 66.974  -9.150  31.761  1.00 43.13  ? 123 CYS Y O   1 
ATOM 7149 C CB  . CYS E 3 98  ? 69.183  -6.875  32.715  1.00 32.69  ? 123 CYS Y CB  1 
ATOM 7150 S SG  . CYS E 3 98  ? 69.886  -7.723  31.290  1.00 80.44  ? 123 CYS Y SG  1 
ATOM 7151 N N   . GLY E 3 99  ? 66.311  -7.005  31.610  1.00 40.39  ? 124 GLY Y N   1 
ATOM 7152 C CA  . GLY E 3 99  ? 65.479  -7.251  30.453  1.00 39.03  ? 124 GLY Y CA  1 
ATOM 7153 C C   . GLY E 3 99  ? 65.258  -6.019  29.604  1.00 40.71  ? 124 GLY Y C   1 
ATOM 7154 O O   . GLY E 3 99  ? 65.303  -4.891  30.085  1.00 38.56  ? 124 GLY Y O   1 
ATOM 7155 N N   . ALA E 3 100 ? 65.003  -6.253  28.324  1.00 45.76  ? 125 ALA Y N   1 
ATOM 7156 C CA  . ALA E 3 100 ? 64.725  -5.184  27.372  1.00 26.88  ? 125 ALA Y CA  1 
ATOM 7157 C C   . ALA E 3 100 ? 63.226  -5.092  27.124  1.00 30.79  ? 125 ALA Y C   1 
ATOM 7158 O O   . ALA E 3 100 ? 62.541  -6.113  27.084  1.00 27.55  ? 125 ALA Y O   1 
ATOM 7159 C CB  . ALA E 3 100 ? 65.465  -5.425  26.070  1.00 27.67  ? 125 ALA Y CB  1 
ATOM 7160 N N   . ILE E 3 101 ? 62.712  -3.877  26.966  1.00 34.18  ? 126 ILE Y N   1 
ATOM 7161 C CA  . ILE E 3 101 ? 61.276  -3.688  26.783  1.00 31.13  ? 126 ILE Y CA  1 
ATOM 7162 C C   . ILE E 3 101 ? 60.985  -2.675  25.684  1.00 31.06  ? 126 ILE Y C   1 
ATOM 7163 O O   . ILE E 3 101 ? 61.571  -1.599  25.663  1.00 30.75  ? 126 ILE Y O   1 
ATOM 7164 C CB  . ILE E 3 101 ? 60.597  -3.214  28.085  1.00 37.03  ? 126 ILE Y CB  1 
ATOM 7165 C CG1 . ILE E 3 101 ? 60.828  -4.218  29.210  1.00 38.66  ? 126 ILE Y CG1 1 
ATOM 7166 C CG2 . ILE E 3 101 ? 59.100  -3.008  27.869  1.00 39.79  ? 126 ILE Y CG2 1 
ATOM 7167 C CD1 . ILE E 3 101 ? 60.518  -3.674  30.573  1.00 43.90  ? 126 ILE Y CD1 1 
ATOM 7168 N N   . SER E 3 102 ? 60.080  -3.011  24.770  1.00 28.10  ? 127 SER Y N   1 
ATOM 7169 C CA  . SER E 3 102 ? 59.725  -2.085  23.695  1.00 34.10  ? 127 SER Y CA  1 
ATOM 7170 C C   . SER E 3 102 ? 58.721  -1.025  24.151  1.00 44.48  ? 127 SER Y C   1 
ATOM 7171 O O   . SER E 3 102 ? 58.158  -1.119  25.245  1.00 27.25  ? 127 SER Y O   1 
ATOM 7172 C CB  . SER E 3 102 ? 59.157  -2.861  22.504  1.00 32.15  ? 127 SER Y CB  1 
ATOM 7173 O OG  . SER E 3 102 ? 57.775  -3.124  22.700  1.00 32.69  ? 127 SER Y OG  1 
ATOM 7174 N N   . LEU E 3 103 ? 58.479  -0.032  23.297  1.00 40.20  ? 128 LEU Y N   1 
ATOM 7175 C CA  . LEU E 3 103 ? 57.529  1.033   23.616  1.00 38.90  ? 128 LEU Y CA  1 
ATOM 7176 C C   . LEU E 3 103 ? 56.153  0.949   22.970  1.00 43.44  ? 128 LEU Y C   1 
ATOM 7177 O O   . LEU E 3 103 ? 55.305  1.800   23.229  1.00 46.31  ? 128 LEU Y O   1 
ATOM 7178 C CB  . LEU E 3 103 ? 58.153  2.395   23.299  1.00 37.06  ? 128 LEU Y CB  1 
ATOM 7179 C CG  . LEU E 3 103 ? 59.253  2.715   24.315  1.00 40.28  ? 128 LEU Y CG  1 
ATOM 7180 C CD1 . LEU E 3 103 ? 59.646  4.191   24.286  1.00 42.92  ? 128 LEU Y CD1 1 
ATOM 7181 C CD2 . LEU E 3 103 ? 58.791  2.292   25.706  1.00 30.11  ? 128 LEU Y CD2 1 
ATOM 7182 N N   . ALA E 3 104 ? 55.921  -0.053  22.134  1.00 38.02  ? 129 ALA Y N   1 
ATOM 7183 C CA  . ALA E 3 104 ? 54.600  -0.222  21.545  1.00 30.68  ? 129 ALA Y CA  1 
ATOM 7184 C C   . ALA E 3 104 ? 53.602  -0.600  22.639  1.00 33.92  ? 129 ALA Y C   1 
ATOM 7185 O O   . ALA E 3 104 ? 53.995  -1.153  23.649  1.00 31.20  ? 129 ALA Y O   1 
ATOM 7186 C CB  . ALA E 3 104 ? 54.646  -1.266  20.465  1.00 30.68  ? 129 ALA Y CB  1 
ATOM 7187 N N   . PRO E 3 105 ? 52.308  -0.289  22.452  1.00 33.30  ? 130 PRO Y N   1 
ATOM 7188 C CA  . PRO E 3 105 ? 51.321  -0.567  23.510  1.00 35.51  ? 130 PRO Y CA  1 
ATOM 7189 C C   . PRO E 3 105 ? 51.250  -2.047  23.890  1.00 33.35  ? 130 PRO Y C   1 
ATOM 7190 O O   . PRO E 3 105 ? 51.087  -2.397  25.055  1.00 24.78  ? 130 PRO Y O   1 
ATOM 7191 C CB  . PRO E 3 105 ? 50.001  -0.103  22.885  1.00 30.63  ? 130 PRO Y CB  1 
ATOM 7192 C CG  . PRO E 3 105 ? 50.251  -0.097  21.415  1.00 29.80  ? 130 PRO Y CG  1 
ATOM 7193 C CD  . PRO E 3 105 ? 51.680  0.292   21.256  1.00 29.96  ? 130 PRO Y CD  1 
ATOM 7194 N N   . LYS E 3 106 ? 51.442  -2.899  22.891  1.00 20.29  ? 131 LYS Y N   1 
ATOM 7195 C CA  . LYS E 3 106 ? 51.406  -4.355  23.030  1.00 20.17  ? 131 LYS Y CA  1 
ATOM 7196 C C   . LYS E 3 106 ? 52.822  -4.833  23.398  1.00 38.10  ? 131 LYS Y C   1 
ATOM 7197 O O   . LYS E 3 106 ? 53.236  -5.944  23.062  1.00 45.34  ? 131 LYS Y O   1 
ATOM 7198 C CB  . LYS E 3 106 ? 50.855  -5.044  21.771  1.00 46.96  ? 131 LYS Y CB  1 
ATOM 7199 C CG  . LYS E 3 106 ? 50.712  -6.568  21.902  1.00 46.29  ? 131 LYS Y CG  1 
ATOM 7200 C CD  . LYS E 3 106 ? 50.221  -7.229  20.638  1.00 47.37  ? 131 LYS Y CD  1 
ATOM 7201 C CE  . LYS E 3 106 ? 50.260  -8.748  20.745  1.00 41.82  ? 131 LYS Y CE  1 
ATOM 7202 N NZ  . LYS E 3 106 ? 49.770  -9.411  19.499  1.00 35.79  ? 131 LYS Y NZ  1 
ATOM 7203 N N   . ALA E 3 107 ? 53.586  -3.931  24.014  1.00 38.17  ? 132 ALA Y N   1 
ATOM 7204 C CA  . ALA E 3 107 ? 55.026  -4.089  24.218  1.00 32.48  ? 132 ALA Y CA  1 
ATOM 7205 C C   . ALA E 3 107 ? 55.439  -5.479  24.653  1.00 36.85  ? 132 ALA Y C   1 
ATOM 7206 O O   . ALA E 3 107 ? 54.780  -6.147  25.450  1.00 38.53  ? 132 ALA Y O   1 
ATOM 7207 C CB  . ALA E 3 107 ? 55.523  -3.093  25.256  1.00 25.90  ? 132 ALA Y CB  1 
ATOM 7208 N N   . GLN E 3 108 ? 56.541  -5.904  24.058  1.00 46.48  ? 133 GLN Y N   1 
ATOM 7209 C CA  . GLN E 3 108 ? 57.082  -7.233  24.218  1.00 47.75  ? 133 GLN Y CA  1 
ATOM 7210 C C   . GLN E 3 108 ? 58.406  -7.161  24.972  1.00 37.52  ? 133 GLN Y C   1 
ATOM 7211 O O   . GLN E 3 108 ? 59.224  -6.275  24.720  1.00 34.15  ? 133 GLN Y O   1 
ATOM 7212 C CB  . GLN E 3 108 ? 57.246  -7.872  22.842  1.00 51.27  ? 133 GLN Y CB  1 
ATOM 7213 C CG  . GLN E 3 108 ? 58.127  -7.067  21.899  1.00 56.56  ? 133 GLN Y CG  1 
ATOM 7214 C CD  . GLN E 3 108 ? 58.214  -7.690  20.528  1.00 70.07  ? 133 GLN Y CD  1 
ATOM 7215 O OE1 . GLN E 3 108 ? 58.477  -8.881  20.410  1.00 77.37  ? 133 GLN Y OE1 1 
ATOM 7216 N NE2 . GLN E 3 108 ? 58.033  -6.886  19.484  1.00 69.47  ? 133 GLN Y NE2 1 
ATOM 7217 N N   . ILE E 3 109 ? 58.605  -8.080  25.911  1.00 34.13  ? 134 ILE Y N   1 
ATOM 7218 C CA  . ILE E 3 109 ? 59.767  -8.035  26.792  1.00 36.70  ? 134 ILE Y CA  1 
ATOM 7219 C C   . ILE E 3 109 ? 60.640  -9.281  26.659  1.00 40.67  ? 134 ILE Y C   1 
ATOM 7220 O O   . ILE E 3 109 ? 60.137  -10.397 26.519  1.00 56.13  ? 134 ILE Y O   1 
ATOM 7221 C CB  . ILE E 3 109 ? 59.333  -7.863  28.273  1.00 43.24  ? 134 ILE Y CB  1 
ATOM 7222 C CG1 . ILE E 3 109 ? 60.544  -7.882  29.214  1.00 44.62  ? 134 ILE Y CG1 1 
ATOM 7223 C CG2 . ILE E 3 109 ? 58.314  -8.919  28.663  1.00 23.36  ? 134 ILE Y CG2 1 
ATOM 7224 C CD1 . ILE E 3 109 ? 60.225  -7.467  30.635  1.00 49.23  ? 134 ILE Y CD1 1 
ATOM 7225 N N   . LYS E 3 110 ? 61.953  -9.078  26.686  1.00 35.48  ? 135 LYS Y N   1 
ATOM 7226 C CA  . LYS E 3 110 ? 62.892  -10.188 26.726  1.00 31.31  ? 135 LYS Y CA  1 
ATOM 7227 C C   . LYS E 3 110 ? 63.954  -9.954  27.787  1.00 33.88  ? 135 LYS Y C   1 
ATOM 7228 O O   . LYS E 3 110 ? 64.496  -8.860  27.903  1.00 29.27  ? 135 LYS Y O   1 
ATOM 7229 C CB  . LYS E 3 110 ? 63.528  -10.397 25.359  1.00 31.28  ? 135 LYS Y CB  1 
ATOM 7230 C CG  . LYS E 3 110 ? 62.611  -11.134 24.420  1.00 37.20  ? 135 LYS Y CG  1 
ATOM 7231 C CD  . LYS E 3 110 ? 63.301  -11.520 23.141  1.00 47.62  ? 135 LYS Y CD  1 
ATOM 7232 C CE  . LYS E 3 110 ? 62.352  -12.302 22.255  1.00 58.71  ? 135 LYS Y CE  1 
ATOM 7233 N NZ  . LYS E 3 110 ? 62.915  -12.480 20.891  1.00 65.59  ? 135 LYS Y NZ  1 
ATOM 7234 N N   . GLU E 3 111 ? 64.251  -11.002 28.549  1.00 31.22  ? 136 GLU Y N   1 
ATOM 7235 C CA  . GLU E 3 111 ? 65.145  -10.906 29.699  1.00 29.57  ? 136 GLU Y CA  1 
ATOM 7236 C C   . GLU E 3 111 ? 66.423  -11.709 29.481  1.00 35.94  ? 136 GLU Y C   1 
ATOM 7237 O O   . GLU E 3 111 ? 66.455  -12.653 28.691  1.00 41.25  ? 136 GLU Y O   1 
ATOM 7238 C CB  . GLU E 3 111 ? 64.450  -11.394 30.975  1.00 37.20  ? 136 GLU Y CB  1 
ATOM 7239 C CG  . GLU E 3 111 ? 64.144  -12.888 30.992  1.00 45.39  ? 136 GLU Y CG  1 
ATOM 7240 C CD  . GLU E 3 111 ? 63.735  -13.382 32.369  1.00 60.51  ? 136 GLU Y CD  1 
ATOM 7241 O OE1 . GLU E 3 111 ? 64.636  -13.651 33.192  1.00 67.76  ? 136 GLU Y OE1 1 
ATOM 7242 O OE2 . GLU E 3 111 ? 62.517  -13.506 32.627  1.00 56.57  ? 136 GLU Y OE2 1 
ATOM 7243 N N   . SER E 3 112 ? 67.482  -11.323 30.185  1.00 31.44  ? 137 SER Y N   1 
ATOM 7244 C CA  . SER E 3 112 ? 68.754  -12.029 30.086  1.00 31.13  ? 137 SER Y CA  1 
ATOM 7245 C C   . SER E 3 112 ? 68.780  -13.287 30.950  1.00 40.61  ? 137 SER Y C   1 
ATOM 7246 O O   . SER E 3 112 ? 67.759  -13.707 31.496  1.00 45.12  ? 137 SER Y O   1 
ATOM 7247 C CB  . SER E 3 112 ? 69.910  -11.114 30.488  1.00 34.42  ? 137 SER Y CB  1 
ATOM 7248 O OG  . SER E 3 112 ? 69.886  -10.847 31.880  1.00 28.40  ? 137 SER Y OG  1 
ATOM 7249 N N   . LEU E 3 113 ? 69.964  -13.877 31.068  1.00 38.49  ? 138 LEU Y N   1 
ATOM 7250 C CA  . LEU E 3 113 ? 70.156  -15.062 31.889  1.00 37.57  ? 138 LEU Y CA  1 
ATOM 7251 C C   . LEU E 3 113 ? 70.555  -14.643 33.295  1.00 40.14  ? 138 LEU Y C   1 
ATOM 7252 O O   . LEU E 3 113 ? 71.594  -14.016 33.498  1.00 29.86  ? 138 LEU Y O   1 
ATOM 7253 C CB  . LEU E 3 113 ? 71.209  -15.974 31.265  1.00 38.96  ? 138 LEU Y CB  1 
ATOM 7254 C CG  . LEU E 3 113 ? 70.810  -16.424 29.859  1.00 40.02  ? 138 LEU Y CG  1 
ATOM 7255 C CD1 . LEU E 3 113 ? 71.993  -17.003 29.097  1.00 46.10  ? 138 LEU Y CD1 1 
ATOM 7256 C CD2 . LEU E 3 113 ? 69.659  -17.421 29.934  1.00 32.62  ? 138 LEU Y CD2 1 
ATOM 7257 N N   . ARG E 3 114 ? 69.712  -14.989 34.260  1.00 37.96  ? 139 ARG Y N   1 
ATOM 7258 C CA  . ARG E 3 114 ? 69.837  -14.494 35.626  1.00 39.77  ? 139 ARG Y CA  1 
ATOM 7259 C C   . ARG E 3 114 ? 71.173  -14.799 36.282  1.00 42.37  ? 139 ARG Y C   1 
ATOM 7260 O O   . ARG E 3 114 ? 71.744  -15.870 36.095  1.00 29.76  ? 139 ARG Y O   1 
ATOM 7261 C CB  . ARG E 3 114 ? 68.717  -15.072 36.475  1.00 40.66  ? 139 ARG Y CB  1 
ATOM 7262 C CG  . ARG E 3 114 ? 67.369  -14.940 35.833  1.00 42.82  ? 139 ARG Y CG  1 
ATOM 7263 C CD  . ARG E 3 114 ? 66.280  -15.581 36.670  1.00 47.59  ? 139 ARG Y CD  1 
ATOM 7264 N NE  . ARG E 3 114 ? 65.117  -15.920 35.854  1.00 56.97  ? 139 ARG Y NE  1 
ATOM 7265 C CZ  . ARG E 3 114 ? 65.135  -16.770 34.828  1.00 87.17  ? 139 ARG Y CZ  1 
ATOM 7266 N NH1 . ARG E 3 114 ? 66.254  -17.399 34.486  1.00 88.34  ? 139 ARG Y NH1 1 
ATOM 7267 N NH2 . ARG E 3 114 ? 64.022  -17.003 34.145  1.00 90.18  ? 139 ARG Y NH2 1 
ATOM 7268 N N   . ALA E 3 115 ? 71.661  -13.840 37.057  1.00 33.96  ? 140 ALA Y N   1 
ATOM 7269 C CA  . ALA E 3 115 ? 72.925  -13.993 37.750  1.00 31.56  ? 140 ALA Y CA  1 
ATOM 7270 C C   . ALA E 3 115 ? 72.714  -13.821 39.243  1.00 27.56  ? 140 ALA Y C   1 
ATOM 7271 O O   . ALA E 3 115 ? 71.709  -13.245 39.666  1.00 24.00  ? 140 ALA Y O   1 
ATOM 7272 C CB  . ALA E 3 115 ? 73.930  -12.996 37.229  1.00 32.14  ? 140 ALA Y CB  1 
ATOM 7273 N N   . GLU E 3 116 ? 73.655  -14.320 40.038  1.00 42.35  ? 141 GLU Y N   1 
ATOM 7274 C CA  . GLU E 3 116 ? 73.522  -14.250 41.486  1.00 41.99  ? 141 GLU Y CA  1 
ATOM 7275 C C   . GLU E 3 116 ? 74.511  -13.275 42.107  1.00 39.19  ? 141 GLU Y C   1 
ATOM 7276 O O   . GLU E 3 116 ? 75.614  -13.087 41.599  1.00 41.39  ? 141 GLU Y O   1 
ATOM 7277 C CB  . GLU E 3 116 ? 73.696  -15.636 42.105  1.00 52.55  ? 141 GLU Y CB  1 
ATOM 7278 C CG  . GLU E 3 116 ? 72.748  -15.910 43.258  1.00 66.34  ? 141 GLU Y CG  1 
ATOM 7279 C CD  . GLU E 3 116 ? 72.594  -17.388 43.543  1.00 89.02  ? 141 GLU Y CD  1 
ATOM 7280 O OE1 . GLU E 3 116 ? 72.673  -18.188 42.584  1.00 108.16 ? 141 GLU Y OE1 1 
ATOM 7281 O OE2 . GLU E 3 116 ? 72.405  -17.749 44.726  1.00 85.56  ? 141 GLU Y OE2 1 
ATOM 7282 N N   . LEU E 3 117 ? 74.094  -12.656 43.206  1.00 33.17  ? 142 LEU Y N   1 
ATOM 7283 C CA  . LEU E 3 117 ? 74.944  -11.751 43.967  1.00 30.79  ? 142 LEU Y CA  1 
ATOM 7284 C C   . LEU E 3 117 ? 75.093  -12.273 45.390  1.00 36.48  ? 142 LEU Y C   1 
ATOM 7285 O O   . LEU E 3 117 ? 74.137  -12.787 45.969  1.00 33.55  ? 142 LEU Y O   1 
ATOM 7286 C CB  . LEU E 3 117 ? 74.361  -10.335 43.971  1.00 31.26  ? 142 LEU Y CB  1 
ATOM 7287 C CG  . LEU E 3 117 ? 74.965  -9.256  44.879  1.00 31.69  ? 142 LEU Y CG  1 
ATOM 7288 C CD1 . LEU E 3 117 ? 76.438  -8.992  44.562  1.00 33.16  ? 142 LEU Y CD1 1 
ATOM 7289 C CD2 . LEU E 3 117 ? 74.145  -7.968  44.804  1.00 27.83  ? 142 LEU Y CD2 1 
ATOM 7290 N N   . ARG E 3 118 ? 76.295  -12.151 45.947  1.00 34.47  ? 143 ARG Y N   1 
ATOM 7291 C CA  . ARG E 3 118 ? 76.540  -12.572 47.323  1.00 27.43  ? 143 ARG Y CA  1 
ATOM 7292 C C   . ARG E 3 118 ? 77.160  -11.462 48.147  1.00 27.88  ? 143 ARG Y C   1 
ATOM 7293 O O   . ARG E 3 118 ? 78.089  -10.784 47.708  1.00 28.63  ? 143 ARG Y O   1 
ATOM 7294 C CB  . ARG E 3 118 ? 77.446  -13.799 47.369  1.00 28.79  ? 143 ARG Y CB  1 
ATOM 7295 C CG  . ARG E 3 118 ? 76.905  -14.980 46.617  1.00 28.54  ? 143 ARG Y CG  1 
ATOM 7296 C CD  . ARG E 3 118 ? 76.725  -16.180 47.523  1.00 28.93  ? 143 ARG Y CD  1 
ATOM 7297 N NE  . ARG E 3 118 ? 77.925  -16.481 48.297  1.00 30.41  ? 143 ARG Y NE  1 
ATOM 7298 C CZ  . ARG E 3 118 ? 77.989  -17.427 49.229  1.00 31.00  ? 143 ARG Y CZ  1 
ATOM 7299 N NH1 . ARG E 3 118 ? 76.919  -18.164 49.496  1.00 39.57  ? 143 ARG Y NH1 1 
ATOM 7300 N NH2 . ARG E 3 118 ? 79.118  -17.638 49.893  1.00 32.38  ? 143 ARG Y NH2 1 
ATOM 7301 N N   . VAL E 3 119 ? 76.639  -11.275 49.348  1.00 40.94  ? 144 VAL Y N   1 
ATOM 7302 C CA  . VAL E 3 119 ? 77.169  -10.245 50.212  1.00 46.09  ? 144 VAL Y CA  1 
ATOM 7303 C C   . VAL E 3 119 ? 77.723  -10.847 51.493  1.00 43.25  ? 144 VAL Y C   1 
ATOM 7304 O O   . VAL E 3 119 ? 77.001  -11.401 52.320  1.00 48.98  ? 144 VAL Y O   1 
ATOM 7305 C CB  . VAL E 3 119 ? 76.115  -9.180  50.511  1.00 36.91  ? 144 VAL Y CB  1 
ATOM 7306 C CG1 . VAL E 3 119 ? 75.949  -8.270  49.314  1.00 29.20  ? 144 VAL Y CG1 1 
ATOM 7307 C CG2 . VAL E 3 119 ? 74.811  -9.839  50.820  1.00 43.49  ? 144 VAL Y CG2 1 
ATOM 7308 N N   . THR E 3 120 ? 79.036  -10.726 51.634  1.00 38.57  ? 145 THR Y N   1 
ATOM 7309 C CA  . THR E 3 120 ? 79.769  -11.332 52.735  1.00 40.99  ? 145 THR Y CA  1 
ATOM 7310 C C   . THR E 3 120 ? 79.722  -10.454 53.987  1.00 54.99  ? 145 THR Y C   1 
ATOM 7311 O O   . THR E 3 120 ? 78.890  -9.540  54.085  1.00 64.05  ? 145 THR Y O   1 
ATOM 7312 C CB  . THR E 3 120 ? 81.245  -11.614 52.340  1.00 48.18  ? 145 THR Y CB  1 
ATOM 7313 O OG1 . THR E 3 120 ? 81.872  -10.406 51.893  1.00 57.86  ? 145 THR Y OG1 1 
ATOM 7314 C CG2 . THR E 3 120 ? 81.302  -12.641 51.221  1.00 42.15  ? 145 THR Y CG2 1 
ATOM 7315 N N   . GLU E 3 121 ? 80.590  -10.788 54.946  1.00 61.24  ? 146 GLU Y N   1 
ATOM 7316 C CA  . GLU E 3 121 ? 80.792  -10.049 56.203  1.00 57.36  ? 146 GLU Y CA  1 
ATOM 7317 C C   . GLU E 3 121 ? 79.701  -10.382 57.224  1.00 54.13  ? 146 GLU Y C   1 
ATOM 7318 O O   . GLU E 3 121 ? 79.982  -10.563 58.409  1.00 53.89  ? 146 GLU Y O   1 
ATOM 7319 C CB  . GLU E 3 121 ? 80.856  -8.537  55.957  1.00 54.66  ? 146 GLU Y CB  1 
ATOM 7320 C CG  . GLU E 3 121 ? 81.147  -7.698  57.179  1.00 52.38  ? 146 GLU Y CG  1 
ATOM 7321 C CD  . GLU E 3 121 ? 82.344  -8.175  57.972  1.00 51.67  ? 146 GLU Y CD  1 
ATOM 7322 O OE1 . GLU E 3 121 ? 83.367  -8.551  57.361  1.00 53.24  ? 146 GLU Y OE1 1 
ATOM 7323 O OE2 . GLU E 3 121 ? 82.253  -8.175  59.218  1.00 43.93  ? 146 GLU Y OE2 1 
ATOM 7324 N N   . SER F 3 2   ? -24.303 -40.237 52.224  1.00 64.05  ? 27  SER Z N   1 
ATOM 7325 C CA  . SER F 3 2   ? -25.393 -39.272 52.325  1.00 66.75  ? 27  SER Z CA  1 
ATOM 7326 C C   . SER F 3 2   ? -25.075 -38.020 53.158  1.00 69.98  ? 27  SER Z C   1 
ATOM 7327 O O   . SER F 3 2   ? -25.837 -37.683 54.066  1.00 67.46  ? 27  SER Z O   1 
ATOM 7328 C CB  . SER F 3 2   ? -26.636 -39.959 52.913  1.00 68.34  ? 27  SER Z CB  1 
ATOM 7329 O OG  . SER F 3 2   ? -26.887 -41.203 52.269  1.00 74.05  ? 27  SER Z OG  1 
ATOM 7330 N N   . PRO F 3 3   ? -23.947 -37.336 52.881  1.00 62.91  ? 28  PRO Z N   1 
ATOM 7331 C CA  . PRO F 3 3   ? -23.746 -36.085 53.621  1.00 54.62  ? 28  PRO Z CA  1 
ATOM 7332 C C   . PRO F 3 3   ? -24.776 -34.990 53.352  1.00 53.82  ? 28  PRO Z C   1 
ATOM 7333 O O   . PRO F 3 3   ? -25.245 -34.392 54.307  1.00 49.22  ? 28  PRO Z O   1 
ATOM 7334 C CB  . PRO F 3 3   ? -22.370 -35.614 53.141  1.00 52.27  ? 28  PRO Z CB  1 
ATOM 7335 C CG  . PRO F 3 3   ? -21.679 -36.827 52.678  1.00 53.76  ? 28  PRO Z CG  1 
ATOM 7336 C CD  . PRO F 3 3   ? -22.758 -37.684 52.082  1.00 62.55  ? 28  PRO Z CD  1 
ATOM 7337 N N   . ASP F 3 4   ? -25.085 -34.691 52.094  1.00 52.33  ? 29  ASP Z N   1 
ATOM 7338 C CA  . ASP F 3 4   ? -25.900 -33.505 51.827  1.00 54.30  ? 29  ASP Z CA  1 
ATOM 7339 C C   . ASP F 3 4   ? -27.330 -33.548 52.375  1.00 53.04  ? 29  ASP Z C   1 
ATOM 7340 O O   . ASP F 3 4   ? -27.582 -32.990 53.439  1.00 63.24  ? 29  ASP Z O   1 
ATOM 7341 C CB  . ASP F 3 4   ? -25.928 -33.219 50.326  1.00 58.42  ? 29  ASP Z CB  1 
ATOM 7342 C CG  . ASP F 3 4   ? -24.594 -32.710 49.810  1.00 60.19  ? 29  ASP Z CG  1 
ATOM 7343 O OD1 . ASP F 3 4   ? -24.011 -31.810 50.454  1.00 52.32  ? 29  ASP Z OD1 1 
ATOM 7344 O OD2 . ASP F 3 4   ? -24.123 -33.211 48.770  1.00 67.41  ? 29  ASP Z OD2 1 
ATOM 7345 N N   . ARG F 3 5   ? -28.225 -34.258 51.683  1.00 43.86  ? 30  ARG Z N   1 
ATOM 7346 C CA  . ARG F 3 5   ? -29.637 -34.411 52.078  1.00 47.84  ? 30  ARG Z CA  1 
ATOM 7347 C C   . ARG F 3 5   ? -30.437 -35.056 50.952  1.00 53.49  ? 30  ARG Z C   1 
ATOM 7348 O O   . ARG F 3 5   ? -30.165 -34.801 49.781  1.00 62.74  ? 30  ARG Z O   1 
ATOM 7349 C CB  . ARG F 3 5   ? -30.266 -33.058 52.441  1.00 40.70  ? 30  ARG Z CB  1 
ATOM 7350 C CG  . ARG F 3 5   ? -31.649 -33.129 53.067  1.00 45.32  ? 30  ARG Z CG  1 
ATOM 7351 C CD  . ARG F 3 5   ? -32.498 -31.954 52.609  1.00 54.27  ? 30  ARG Z CD  1 
ATOM 7352 N NE  . ARG F 3 5   ? -33.668 -31.760 53.459  1.00 57.18  ? 30  ARG Z NE  1 
ATOM 7353 C CZ  . ARG F 3 5   ? -33.619 -31.245 54.684  1.00 60.52  ? 30  ARG Z CZ  1 
ATOM 7354 N NH1 . ARG F 3 5   ? -32.455 -30.890 55.214  1.00 60.70  ? 30  ARG Z NH1 1 
ATOM 7355 N NH2 . ARG F 3 5   ? -34.733 -31.099 55.387  1.00 64.24  ? 30  ARG Z NH2 1 
ATOM 7356 N N   . PRO F 3 6   ? -31.437 -35.880 51.300  1.00 50.50  ? 31  PRO Z N   1 
ATOM 7357 C CA  . PRO F 3 6   ? -32.367 -36.349 50.270  1.00 47.23  ? 31  PRO Z CA  1 
ATOM 7358 C C   . PRO F 3 6   ? -33.075 -35.192 49.581  1.00 41.07  ? 31  PRO Z C   1 
ATOM 7359 O O   . PRO F 3 6   ? -33.657 -34.348 50.255  1.00 41.40  ? 31  PRO Z O   1 
ATOM 7360 C CB  . PRO F 3 6   ? -33.359 -37.202 51.061  1.00 49.40  ? 31  PRO Z CB  1 
ATOM 7361 C CG  . PRO F 3 6   ? -32.555 -37.741 52.185  1.00 51.51  ? 31  PRO Z CG  1 
ATOM 7362 C CD  . PRO F 3 6   ? -31.559 -36.657 52.546  1.00 52.31  ? 31  PRO Z CD  1 
ATOM 7363 N N   . TRP F 3 7   ? -33.023 -35.170 48.254  1.00 40.75  ? 32  TRP Z N   1 
ATOM 7364 C CA  . TRP F 3 7   ? -33.607 -34.093 47.471  1.00 38.80  ? 32  TRP Z CA  1 
ATOM 7365 C C   . TRP F 3 7   ? -34.417 -34.692 46.325  1.00 41.54  ? 32  TRP Z C   1 
ATOM 7366 O O   . TRP F 3 7   ? -33.860 -35.340 45.436  1.00 40.36  ? 32  TRP Z O   1 
ATOM 7367 C CB  . TRP F 3 7   ? -32.496 -33.169 46.966  1.00 40.74  ? 32  TRP Z CB  1 
ATOM 7368 C CG  . TRP F 3 7   ? -32.826 -32.297 45.796  1.00 51.33  ? 32  TRP Z CG  1 
ATOM 7369 C CD1 . TRP F 3 7   ? -34.032 -31.734 45.487  1.00 64.52  ? 32  TRP Z CD1 1 
ATOM 7370 C CD2 . TRP F 3 7   ? -31.918 -31.891 44.770  1.00 57.89  ? 32  TRP Z CD2 1 
ATOM 7371 N NE1 . TRP F 3 7   ? -33.927 -31.001 44.328  1.00 67.26  ? 32  TRP Z NE1 1 
ATOM 7372 C CE2 . TRP F 3 7   ? -32.640 -31.081 43.868  1.00 65.63  ? 32  TRP Z CE2 1 
ATOM 7373 C CE3 . TRP F 3 7   ? -30.566 -32.131 44.523  1.00 59.54  ? 32  TRP Z CE3 1 
ATOM 7374 C CZ2 . TRP F 3 7   ? -32.052 -30.514 42.741  1.00 67.23  ? 32  TRP Z CZ2 1 
ATOM 7375 C CZ3 . TRP F 3 7   ? -29.988 -31.569 43.409  1.00 64.46  ? 32  TRP Z CZ3 1 
ATOM 7376 C CH2 . TRP F 3 7   ? -30.727 -30.769 42.531  1.00 67.95  ? 32  TRP Z CH2 1 
ATOM 7377 N N   . ASN F 3 8   ? -35.727 -34.460 46.346  1.00 47.41  ? 33  ASN Z N   1 
ATOM 7378 C CA  . ASN F 3 8   ? -36.634 -35.099 45.399  1.00 47.61  ? 33  ASN Z CA  1 
ATOM 7379 C C   . ASN F 3 8   ? -36.465 -34.627 43.959  1.00 48.07  ? 33  ASN Z C   1 
ATOM 7380 O O   . ASN F 3 8   ? -36.328 -33.432 43.692  1.00 55.11  ? 33  ASN Z O   1 
ATOM 7381 C CB  . ASN F 3 8   ? -38.084 -34.892 45.838  1.00 45.42  ? 33  ASN Z CB  1 
ATOM 7382 C CG  . ASN F 3 8   ? -38.595 -36.026 46.705  1.00 50.29  ? 33  ASN Z CG  1 
ATOM 7383 O OD1 . ASN F 3 8   ? -37.813 -36.801 47.256  1.00 54.96  ? 33  ASN Z OD1 1 
ATOM 7384 N ND2 . ASN F 3 8   ? -39.914 -36.134 46.825  1.00 51.76  ? 33  ASN Z ND2 1 
ATOM 7385 N N   . PRO F 3 9   ? -36.467 -35.583 43.023  1.00 45.50  ? 34  PRO Z N   1 
ATOM 7386 C CA  . PRO F 3 9   ? -36.363 -35.298 41.592  1.00 36.37  ? 34  PRO Z CA  1 
ATOM 7387 C C   . PRO F 3 9   ? -37.658 -34.715 41.031  1.00 36.42  ? 34  PRO Z C   1 
ATOM 7388 O O   . PRO F 3 9   ? -38.745 -35.104 41.460  1.00 43.00  ? 34  PRO Z O   1 
ATOM 7389 C CB  . PRO F 3 9   ? -36.061 -36.671 40.998  1.00 37.26  ? 34  PRO Z CB  1 
ATOM 7390 C CG  . PRO F 3 9   ? -36.773 -37.614 41.912  1.00 41.27  ? 34  PRO Z CG  1 
ATOM 7391 C CD  . PRO F 3 9   ? -36.612 -37.026 43.288  1.00 45.41  ? 34  PRO Z CD  1 
ATOM 7392 N N   . PRO F 3 10  ? -37.544 -33.782 40.078  1.00 34.43  ? 35  PRO Z N   1 
ATOM 7393 C CA  . PRO F 3 10  ? -38.702 -33.125 39.466  1.00 38.40  ? 35  PRO Z CA  1 
ATOM 7394 C C   . PRO F 3 10  ? -39.545 -34.087 38.625  1.00 45.51  ? 35  PRO Z C   1 
ATOM 7395 O O   . PRO F 3 10  ? -39.033 -35.102 38.153  1.00 42.77  ? 35  PRO Z O   1 
ATOM 7396 C CB  . PRO F 3 10  ? -38.060 -32.041 38.598  1.00 35.61  ? 35  PRO Z CB  1 
ATOM 7397 C CG  . PRO F 3 10  ? -36.743 -32.622 38.214  1.00 35.68  ? 35  PRO Z CG  1 
ATOM 7398 C CD  . PRO F 3 10  ? -36.281 -33.373 39.439  1.00 35.39  ? 35  PRO Z CD  1 
ATOM 7399 N N   . THR F 3 11  ? -40.827 -33.776 38.462  1.00 44.21  ? 36  THR Z N   1 
ATOM 7400 C CA  . THR F 3 11  ? -41.732 -34.616 37.681  1.00 50.08  ? 36  THR Z CA  1 
ATOM 7401 C C   . THR F 3 11  ? -42.084 -33.956 36.352  1.00 35.17  ? 36  THR Z C   1 
ATOM 7402 O O   . THR F 3 11  ? -42.388 -32.766 36.302  1.00 35.04  ? 36  THR Z O   1 
ATOM 7403 C CB  . THR F 3 11  ? -43.028 -34.922 38.450  1.00 43.74  ? 36  THR Z CB  1 
ATOM 7404 O OG1 . THR F 3 11  ? -43.440 -33.757 39.176  1.00 39.26  ? 36  THR Z OG1 1 
ATOM 7405 C CG2 . THR F 3 11  ? -42.813 -36.064 39.425  1.00 36.96  ? 36  THR Z CG2 1 
ATOM 7406 N N   . PHE F 3 12  ? -42.023 -34.739 35.279  1.00 33.09  ? 37  PHE Z N   1 
ATOM 7407 C CA  . PHE F 3 12  ? -42.277 -34.241 33.934  1.00 32.76  ? 37  PHE Z CA  1 
ATOM 7408 C C   . PHE F 3 12  ? -43.515 -34.916 33.334  1.00 48.91  ? 37  PHE Z C   1 
ATOM 7409 O O   . PHE F 3 12  ? -43.467 -36.084 32.952  1.00 49.22  ? 37  PHE Z O   1 
ATOM 7410 C CB  . PHE F 3 12  ? -41.036 -34.484 33.068  1.00 34.04  ? 37  PHE Z CB  1 
ATOM 7411 C CG  . PHE F 3 12  ? -40.942 -33.610 31.849  1.00 37.90  ? 37  PHE Z CG  1 
ATOM 7412 C CD1 . PHE F 3 12  ? -41.495 -34.011 30.649  1.00 47.99  ? 37  PHE Z CD1 1 
ATOM 7413 C CD2 . PHE F 3 12  ? -40.273 -32.398 31.898  1.00 37.71  ? 37  PHE Z CD2 1 
ATOM 7414 C CE1 . PHE F 3 12  ? -41.385 -33.222 29.525  1.00 52.68  ? 37  PHE Z CE1 1 
ATOM 7415 C CE2 . PHE F 3 12  ? -40.167 -31.603 30.771  1.00 41.94  ? 37  PHE Z CE2 1 
ATOM 7416 C CZ  . PHE F 3 12  ? -40.724 -32.016 29.587  1.00 49.32  ? 37  PHE Z CZ  1 
ATOM 7417 N N   . SER F 3 13  ? -44.605 -34.160 33.215  1.00 46.32  ? 38  SER Z N   1 
ATOM 7418 C CA  . SER F 3 13  ? -45.883 -34.697 32.747  1.00 46.80  ? 38  SER Z CA  1 
ATOM 7419 C C   . SER F 3 13  ? -46.353 -33.890 31.533  1.00 44.27  ? 38  SER Z C   1 
ATOM 7420 O O   . SER F 3 13  ? -46.052 -32.703 31.436  1.00 36.14  ? 38  SER Z O   1 
ATOM 7421 C CB  . SER F 3 13  ? -46.916 -34.660 33.886  1.00 47.86  ? 38  SER Z CB  1 
ATOM 7422 O OG  . SER F 3 13  ? -48.185 -35.144 33.480  1.00 48.61  ? 38  SER Z OG  1 
ATOM 7423 N N   . PRO F 3 14  ? -47.108 -34.514 30.610  1.00 43.18  ? 39  PRO Z N   1 
ATOM 7424 C CA  . PRO F 3 14  ? -47.660 -35.876 30.607  1.00 51.33  ? 39  PRO Z CA  1 
ATOM 7425 C C   . PRO F 3 14  ? -46.709 -36.960 30.100  1.00 59.91  ? 39  PRO Z C   1 
ATOM 7426 O O   . PRO F 3 14  ? -45.594 -36.658 29.673  1.00 59.84  ? 39  PRO Z O   1 
ATOM 7427 C CB  . PRO F 3 14  ? -48.865 -35.740 29.677  1.00 43.82  ? 39  PRO Z CB  1 
ATOM 7428 C CG  . PRO F 3 14  ? -48.421 -34.731 28.673  1.00 37.82  ? 39  PRO Z CG  1 
ATOM 7429 C CD  . PRO F 3 14  ? -47.553 -33.748 29.430  1.00 36.75  ? 39  PRO Z CD  1 
ATOM 7430 N N   . ALA F 3 15  ? -47.163 -38.211 30.161  1.00 69.94  ? 40  ALA Z N   1 
ATOM 7431 C CA  . ALA F 3 15  ? -46.372 -39.347 29.705  1.00 67.10  ? 40  ALA Z CA  1 
ATOM 7432 C C   . ALA F 3 15  ? -45.988 -39.144 28.254  1.00 58.86  ? 40  ALA Z C   1 
ATOM 7433 O O   . ALA F 3 15  ? -44.806 -39.150 27.895  1.00 49.91  ? 40  ALA Z O   1 
ATOM 7434 C CB  . ALA F 3 15  ? -47.148 -40.647 29.875  1.00 64.79  ? 40  ALA Z CB  1 
ATOM 7435 N N   . LEU F 3 16  ? -47.012 -38.933 27.434  1.00 52.44  ? 41  LEU Z N   1 
ATOM 7436 C CA  . LEU F 3 16  ? -46.816 -38.831 26.009  1.00 47.66  ? 41  LEU Z CA  1 
ATOM 7437 C C   . LEU F 3 16  ? -47.681 -37.719 25.374  1.00 40.49  ? 41  LEU Z C   1 
ATOM 7438 O O   . LEU F 3 16  ? -48.909 -37.749 25.448  1.00 40.60  ? 41  LEU Z O   1 
ATOM 7439 C CB  . LEU F 3 16  ? -47.112 -40.177 25.353  1.00 53.80  ? 41  LEU Z CB  1 
ATOM 7440 C CG  . LEU F 3 16  ? -46.167 -40.241 24.131  1.00 67.93  ? 41  LEU Z CG  1 
ATOM 7441 C CD1 . LEU F 3 16  ? -45.030 -41.159 24.311  1.00 85.02  ? 41  LEU Z CD1 1 
ATOM 7442 C CD2 . LEU F 3 16  ? -46.826 -40.486 22.818  1.00 55.61  ? 41  LEU Z CD2 1 
ATOM 7443 N N   . LEU F 3 17  ? -47.044 -36.749 24.724  1.00 41.75  ? 42  LEU Z N   1 
ATOM 7444 C CA  . LEU F 3 17  ? -47.785 -35.624 24.143  1.00 44.85  ? 42  LEU Z CA  1 
ATOM 7445 C C   . LEU F 3 17  ? -47.859 -35.739 22.613  1.00 35.64  ? 42  LEU Z C   1 
ATOM 7446 O O   . LEU F 3 17  ? -46.848 -35.954 21.950  1.00 35.19  ? 42  LEU Z O   1 
ATOM 7447 C CB  . LEU F 3 17  ? -47.140 -34.297 24.563  1.00 35.30  ? 42  LEU Z CB  1 
ATOM 7448 C CG  . LEU F 3 17  ? -47.735 -32.953 24.138  1.00 47.25  ? 42  LEU Z CG  1 
ATOM 7449 C CD1 . LEU F 3 17  ? -49.251 -32.940 24.285  1.00 46.57  ? 42  LEU Z CD1 1 
ATOM 7450 C CD2 . LEU F 3 17  ? -47.103 -31.866 24.991  1.00 44.06  ? 42  LEU Z CD2 1 
ATOM 7451 N N   . VAL F 3 18  ? -49.066 -35.623 22.060  1.00 29.70  ? 43  VAL Z N   1 
ATOM 7452 C CA  . VAL F 3 18  ? -49.265 -35.714 20.609  1.00 29.58  ? 43  VAL Z CA  1 
ATOM 7453 C C   . VAL F 3 18  ? -49.795 -34.397 20.021  1.00 35.49  ? 43  VAL Z C   1 
ATOM 7454 O O   . VAL F 3 18  ? -50.897 -33.958 20.348  1.00 42.27  ? 43  VAL Z O   1 
ATOM 7455 C CB  . VAL F 3 18  ? -50.244 -36.859 20.235  1.00 30.31  ? 43  VAL Z CB  1 
ATOM 7456 C CG1 . VAL F 3 18  ? -50.125 -37.205 18.752  1.00 30.13  ? 43  VAL Z CG1 1 
ATOM 7457 C CG2 . VAL F 3 18  ? -49.987 -38.093 21.093  1.00 30.75  ? 43  VAL Z CG2 1 
ATOM 7458 N N   . VAL F 3 19  ? -48.998 -33.768 19.158  1.00 33.11  ? 44  VAL Z N   1 
ATOM 7459 C CA  . VAL F 3 19  ? -49.392 -32.525 18.488  1.00 34.41  ? 44  VAL Z CA  1 
ATOM 7460 C C   . VAL F 3 19  ? -49.144 -32.651 16.980  1.00 37.41  ? 44  VAL Z C   1 
ATOM 7461 O O   . VAL F 3 19  ? -48.532 -33.616 16.532  1.00 39.13  ? 44  VAL Z O   1 
ATOM 7462 C CB  . VAL F 3 19  ? -48.644 -31.290 19.066  1.00 32.47  ? 44  VAL Z CB  1 
ATOM 7463 C CG1 . VAL F 3 19  ? -48.494 -31.414 20.572  1.00 37.35  ? 44  VAL Z CG1 1 
ATOM 7464 C CG2 . VAL F 3 19  ? -47.283 -31.134 18.433  1.00 31.86  ? 44  VAL Z CG2 1 
ATOM 7465 N N   . THR F 3 20  ? -49.658 -31.708 16.196  1.00 38.26  ? 45  THR Z N   1 
ATOM 7466 C CA  . THR F 3 20  ? -49.518 -31.755 14.739  1.00 41.35  ? 45  THR Z CA  1 
ATOM 7467 C C   . THR F 3 20  ? -48.603 -30.631 14.257  1.00 47.02  ? 45  THR Z C   1 
ATOM 7468 O O   . THR F 3 20  ? -48.656 -29.543 14.784  1.00 32.51  ? 45  THR Z O   1 
ATOM 7469 C CB  . THR F 3 20  ? -50.892 -31.649 14.045  1.00 45.19  ? 45  THR Z CB  1 
ATOM 7470 O OG1 . THR F 3 20  ? -51.552 -30.451 14.472  1.00 56.32  ? 45  THR Z OG1 1 
ATOM 7471 C CG2 . THR F 3 20  ? -51.761 -32.845 14.392  1.00 37.88  ? 45  THR Z CG2 1 
ATOM 7472 N N   . GLU F 3 21  ? -47.760 -30.882 13.262  1.00 50.33  ? 46  GLU Z N   1 
ATOM 7473 C CA  . GLU F 3 21  ? -46.741 -29.895 12.880  1.00 43.74  ? 46  GLU Z CA  1 
ATOM 7474 C C   . GLU F 3 21  ? -47.318 -28.495 12.627  1.00 32.87  ? 46  GLU Z C   1 
ATOM 7475 O O   . GLU F 3 21  ? -48.356 -28.336 11.979  1.00 33.18  ? 46  GLU Z O   1 
ATOM 7476 C CB  . GLU F 3 21  ? -45.982 -30.370 11.644  1.00 49.76  ? 46  GLU Z CB  1 
ATOM 7477 C CG  . GLU F 3 21  ? -46.890 -30.740 10.502  1.00 47.19  ? 46  GLU Z CG  1 
ATOM 7478 C CD  . GLU F 3 21  ? -46.123 -31.062 9.242   1.00 48.40  ? 46  GLU Z CD  1 
ATOM 7479 O OE1 . GLU F 3 21  ? -44.871 -31.034 9.275   1.00 50.95  ? 46  GLU Z OE1 1 
ATOM 7480 O OE2 . GLU F 3 21  ? -46.775 -31.355 8.218   1.00 37.66  ? 46  GLU Z OE2 1 
ATOM 7481 N N   . GLY F 3 22  ? -46.643 -27.488 13.173  1.00 28.29  ? 47  GLY Z N   1 
ATOM 7482 C CA  . GLY F 3 22  ? -47.131 -26.123 13.137  1.00 28.61  ? 47  GLY Z CA  1 
ATOM 7483 C C   . GLY F 3 22  ? -47.930 -25.785 14.382  1.00 49.30  ? 47  GLY Z C   1 
ATOM 7484 O O   . GLY F 3 22  ? -48.374 -24.653 14.553  1.00 29.32  ? 47  GLY Z O   1 
ATOM 7485 N N   . ASP F 3 23  ? -48.116 -26.779 15.247  1.00 47.08  ? 48  ASP Z N   1 
ATOM 7486 C CA  . ASP F 3 23  ? -48.850 -26.610 16.502  1.00 43.69  ? 48  ASP Z CA  1 
ATOM 7487 C C   . ASP F 3 23  ? -47.877 -26.254 17.618  1.00 36.34  ? 48  ASP Z C   1 
ATOM 7488 O O   . ASP F 3 23  ? -46.692 -26.037 17.373  1.00 29.31  ? 48  ASP Z O   1 
ATOM 7489 C CB  . ASP F 3 23  ? -49.619 -27.894 16.847  1.00 50.35  ? 48  ASP Z CB  1 
ATOM 7490 C CG  . ASP F 3 23  ? -50.798 -27.661 17.758  1.00 63.28  ? 48  ASP Z CG  1 
ATOM 7491 O OD1 . ASP F 3 23  ? -50.584 -27.303 18.934  1.00 73.48  ? 48  ASP Z OD1 1 
ATOM 7492 O OD2 . ASP F 3 23  ? -51.942 -27.853 17.293  1.00 58.54  ? 48  ASP Z OD2 1 
ATOM 7493 N N   . ASN F 3 24  ? -48.374 -26.215 18.848  1.00 33.03  ? 49  ASN Z N   1 
ATOM 7494 C CA  . ASN F 3 24  ? -47.521 -25.939 19.992  1.00 41.58  ? 49  ASN Z CA  1 
ATOM 7495 C C   . ASN F 3 24  ? -47.682 -26.996 21.082  1.00 46.08  ? 49  ASN Z C   1 
ATOM 7496 O O   . ASN F 3 24  ? -48.752 -27.137 21.673  1.00 49.44  ? 49  ASN Z O   1 
ATOM 7497 C CB  . ASN F 3 24  ? -47.825 -24.552 20.556  1.00 47.49  ? 49  ASN Z CB  1 
ATOM 7498 C CG  . ASN F 3 24  ? -47.777 -23.467 19.495  1.00 47.29  ? 49  ASN Z CG  1 
ATOM 7499 O OD1 . ASN F 3 24  ? -46.975 -23.525 18.564  1.00 43.98  ? 49  ASN Z OD1 1 
ATOM 7500 N ND2 . ASN F 3 24  ? -48.634 -22.462 19.640  1.00 48.73  ? 49  ASN Z ND2 1 
ATOM 7501 N N   . ALA F 3 25  ? -46.612 -27.742 21.337  1.00 34.99  ? 50  ALA Z N   1 
ATOM 7502 C CA  . ALA F 3 25  ? -46.600 -28.746 22.398  1.00 28.89  ? 50  ALA Z CA  1 
ATOM 7503 C C   . ALA F 3 25  ? -46.187 -28.123 23.725  1.00 28.08  ? 50  ALA Z C   1 
ATOM 7504 O O   . ALA F 3 25  ? -45.273 -27.302 23.763  1.00 27.73  ? 50  ALA Z O   1 
ATOM 7505 C CB  . ALA F 3 25  ? -45.659 -29.884 22.039  1.00 28.41  ? 50  ALA Z CB  1 
ATOM 7506 N N   . THR F 3 26  ? -46.850 -28.512 24.810  1.00 37.17  ? 51  THR Z N   1 
ATOM 7507 C CA  . THR F 3 26  ? -46.509 -27.978 26.125  1.00 38.70  ? 51  THR Z CA  1 
ATOM 7508 C C   . THR F 3 26  ? -46.486 -29.065 27.201  1.00 34.49  ? 51  THR Z C   1 
ATOM 7509 O O   . THR F 3 26  ? -47.485 -29.749 27.425  1.00 30.23  ? 51  THR Z O   1 
ATOM 7510 C CB  . THR F 3 26  ? -47.498 -26.878 26.565  1.00 45.84  ? 51  THR Z CB  1 
ATOM 7511 O OG1 . THR F 3 26  ? -47.405 -25.759 25.676  1.00 42.15  ? 51  THR Z OG1 1 
ATOM 7512 C CG2 . THR F 3 26  ? -47.168 -26.412 27.976  1.00 48.18  ? 51  THR Z CG2 1 
ATOM 7513 N N   . PHE F 3 27  ? -45.348 -29.199 27.878  1.00 39.83  ? 52  PHE Z N   1 
ATOM 7514 C CA  . PHE F 3 27  ? -45.192 -30.155 28.972  1.00 42.76  ? 52  PHE Z CA  1 
ATOM 7515 C C   . PHE F 3 27  ? -45.192 -29.425 30.320  1.00 41.35  ? 52  PHE Z C   1 
ATOM 7516 O O   . PHE F 3 27  ? -44.718 -28.293 30.418  1.00 42.83  ? 52  PHE Z O   1 
ATOM 7517 C CB  . PHE F 3 27  ? -43.891 -30.953 28.822  1.00 38.98  ? 52  PHE Z CB  1 
ATOM 7518 C CG  . PHE F 3 27  ? -43.912 -31.991 27.728  1.00 40.97  ? 52  PHE Z CG  1 
ATOM 7519 C CD1 . PHE F 3 27  ? -44.313 -33.292 27.989  1.00 40.12  ? 52  PHE Z CD1 1 
ATOM 7520 C CD2 . PHE F 3 27  ? -43.487 -31.675 26.448  1.00 40.83  ? 52  PHE Z CD2 1 
ATOM 7521 C CE1 . PHE F 3 27  ? -44.311 -34.250 26.989  1.00 36.84  ? 52  PHE Z CE1 1 
ATOM 7522 C CE2 . PHE F 3 27  ? -43.485 -32.629 25.444  1.00 38.37  ? 52  PHE Z CE2 1 
ATOM 7523 C CZ  . PHE F 3 27  ? -43.896 -33.916 25.715  1.00 36.61  ? 52  PHE Z CZ  1 
ATOM 7524 N N   . THR F 3 28  ? -45.713 -30.074 31.357  1.00 46.45  ? 53  THR Z N   1 
ATOM 7525 C CA  . THR F 3 28  ? -45.723 -29.483 32.694  1.00 39.70  ? 53  THR Z CA  1 
ATOM 7526 C C   . THR F 3 28  ? -44.719 -30.172 33.610  1.00 41.62  ? 53  THR Z C   1 
ATOM 7527 O O   . THR F 3 28  ? -44.780 -31.375 33.817  1.00 34.72  ? 53  THR Z O   1 
ATOM 7528 C CB  . THR F 3 28  ? -47.128 -29.543 33.331  1.00 32.57  ? 53  THR Z CB  1 
ATOM 7529 O OG1 . THR F 3 28  ? -48.091 -29.018 32.409  1.00 32.35  ? 53  THR Z OG1 1 
ATOM 7530 C CG2 . THR F 3 28  ? -47.168 -28.732 34.620  1.00 31.95  ? 53  THR Z CG2 1 
ATOM 7531 N N   . CYS F 3 29  ? -43.786 -29.398 34.151  1.00 43.40  ? 54  CYS Z N   1 
ATOM 7532 C CA  . CYS F 3 29  ? -42.737 -29.952 35.003  1.00 44.71  ? 54  CYS Z CA  1 
ATOM 7533 C C   . CYS F 3 29  ? -42.871 -29.342 36.396  1.00 51.59  ? 54  CYS Z C   1 
ATOM 7534 O O   . CYS F 3 29  ? -42.815 -28.127 36.544  1.00 54.27  ? 54  CYS Z O   1 
ATOM 7535 C CB  . CYS F 3 29  ? -41.348 -29.692 34.386  1.00 39.46  ? 54  CYS Z CB  1 
ATOM 7536 S SG  . CYS F 3 29  ? -39.878 -30.183 35.352  1.00 83.14  ? 54  CYS Z SG  1 
ATOM 7537 N N   . SER F 3 30  ? -43.089 -30.183 37.406  1.00 54.78  ? 55  SER Z N   1 
ATOM 7538 C CA  . SER F 3 30  ? -43.301 -29.692 38.770  1.00 52.06  ? 55  SER Z CA  1 
ATOM 7539 C C   . SER F 3 30  ? -42.046 -29.784 39.626  1.00 58.05  ? 55  SER Z C   1 
ATOM 7540 O O   . SER F 3 30  ? -41.368 -30.813 39.644  1.00 57.09  ? 55  SER Z O   1 
ATOM 7541 C CB  . SER F 3 30  ? -44.429 -30.461 39.468  1.00 50.13  ? 55  SER Z CB  1 
ATOM 7542 O OG  . SER F 3 30  ? -45.658 -30.317 38.789  1.00 49.50  ? 55  SER Z OG  1 
ATOM 7543 N N   . PHE F 3 31  ? -41.735 -28.706 40.337  1.00 52.17  ? 56  PHE Z N   1 
ATOM 7544 C CA  . PHE F 3 31  ? -40.608 -28.724 41.255  1.00 47.56  ? 56  PHE Z CA  1 
ATOM 7545 C C   . PHE F 3 31  ? -40.871 -27.854 42.486  1.00 42.72  ? 56  PHE Z C   1 
ATOM 7546 O O   . PHE F 3 31  ? -41.334 -26.724 42.348  1.00 43.09  ? 56  PHE Z O   1 
ATOM 7547 C CB  . PHE F 3 31  ? -39.355 -28.265 40.503  1.00 49.68  ? 56  PHE Z CB  1 
ATOM 7548 C CG  . PHE F 3 31  ? -38.080 -28.518 41.236  1.00 50.65  ? 56  PHE Z CG  1 
ATOM 7549 C CD1 . PHE F 3 31  ? -37.582 -29.804 41.360  1.00 51.83  ? 56  PHE Z CD1 1 
ATOM 7550 C CD2 . PHE F 3 31  ? -37.364 -27.470 41.783  1.00 51.15  ? 56  PHE Z CD2 1 
ATOM 7551 C CE1 . PHE F 3 31  ? -36.403 -30.041 42.034  1.00 53.84  ? 56  PHE Z CE1 1 
ATOM 7552 C CE2 . PHE F 3 31  ? -36.184 -27.700 42.453  1.00 54.27  ? 56  PHE Z CE2 1 
ATOM 7553 C CZ  . PHE F 3 31  ? -35.702 -28.986 42.579  1.00 54.34  ? 56  PHE Z CZ  1 
ATOM 7554 N N   . SER F 3 32  ? -40.587 -28.356 43.690  1.00 42.72  ? 57  SER Z N   1 
ATOM 7555 C CA  . SER F 3 32  ? -40.679 -27.481 44.872  1.00 43.25  ? 57  SER Z CA  1 
ATOM 7556 C C   . SER F 3 32  ? -39.524 -27.613 45.876  1.00 54.84  ? 57  SER Z C   1 
ATOM 7557 O O   . SER F 3 32  ? -39.419 -28.614 46.587  1.00 66.72  ? 57  SER Z O   1 
ATOM 7558 C CB  . SER F 3 32  ? -42.004 -27.729 45.610  1.00 42.21  ? 57  SER Z CB  1 
ATOM 7559 O OG  . SER F 3 32  ? -42.173 -29.098 45.930  1.00 41.34  ? 57  SER Z OG  1 
ATOM 7560 N N   . ASN F 3 33  ? -38.675 -26.591 45.964  1.00 63.51  ? 58  ASN Z N   1 
ATOM 7561 C CA  . ASN F 3 33  ? -37.709 -26.522 47.057  1.00 65.87  ? 58  ASN Z CA  1 
ATOM 7562 C C   . ASN F 3 33  ? -37.514 -25.093 47.580  1.00 64.08  ? 58  ASN Z C   1 
ATOM 7563 O O   . ASN F 3 33  ? -37.050 -24.226 46.837  1.00 64.37  ? 58  ASN Z O   1 
ATOM 7564 C CB  . ASN F 3 33  ? -36.375 -27.115 46.604  1.00 65.77  ? 58  ASN Z CB  1 
ATOM 7565 C CG  . ASN F 3 33  ? -35.486 -27.487 47.762  1.00 74.80  ? 58  ASN Z CG  1 
ATOM 7566 O OD1 . ASN F 3 33  ? -35.151 -26.654 48.604  1.00 84.43  ? 58  ASN Z OD1 1 
ATOM 7567 N ND2 . ASN F 3 33  ? -35.126 -28.761 47.832  1.00 67.48  ? 58  ASN Z ND2 1 
ATOM 7568 N N   . THR F 3 34  ? -37.815 -24.853 48.857  1.00 73.46  ? 59  THR Z N   1 
ATOM 7569 C CA  . THR F 3 34  ? -37.749 -23.490 49.395  1.00 75.60  ? 59  THR Z CA  1 
ATOM 7570 C C   . THR F 3 34  ? -36.313 -23.067 49.653  1.00 78.87  ? 59  THR Z C   1 
ATOM 7571 O O   . THR F 3 34  ? -35.941 -21.914 49.448  1.00 75.68  ? 59  THR Z O   1 
ATOM 7572 C CB  . THR F 3 34  ? -38.551 -23.326 50.713  1.00 68.28  ? 59  THR Z CB  1 
ATOM 7573 O OG1 . THR F 3 34  ? -37.953 -24.106 51.757  1.00 69.55  ? 59  THR Z OG1 1 
ATOM 7574 C CG2 . THR F 3 34  ? -40.007 -23.727 50.525  1.00 64.55  ? 59  THR Z CG2 1 
ATOM 7575 N N   . SER F 3 35  ? -35.518 -24.022 50.110  1.00 76.89  ? 60  SER Z N   1 
ATOM 7576 C CA  . SER F 3 35  ? -34.130 -23.801 50.471  1.00 78.01  ? 60  SER Z CA  1 
ATOM 7577 C C   . SER F 3 35  ? -33.206 -23.841 49.257  1.00 75.80  ? 60  SER Z C   1 
ATOM 7578 O O   . SER F 3 35  ? -33.365 -24.702 48.396  1.00 69.48  ? 60  SER Z O   1 
ATOM 7579 C CB  . SER F 3 35  ? -33.709 -24.869 51.475  1.00 74.88  ? 60  SER Z CB  1 
ATOM 7580 O OG  . SER F 3 35  ? -33.911 -26.166 50.943  1.00 70.79  ? 60  SER Z OG  1 
ATOM 7581 N N   . GLU F 3 36  ? -32.244 -22.921 49.185  1.00 74.32  ? 61  GLU Z N   1 
ATOM 7582 C CA  . GLU F 3 36  ? -31.174 -23.028 48.191  1.00 76.16  ? 61  GLU Z CA  1 
ATOM 7583 C C   . GLU F 3 36  ? -31.666 -23.088 46.747  1.00 69.37  ? 61  GLU Z C   1 
ATOM 7584 O O   . GLU F 3 36  ? -31.725 -24.166 46.166  1.00 72.96  ? 61  GLU Z O   1 
ATOM 7585 C CB  . GLU F 3 36  ? -30.289 -24.244 48.472  1.00 85.16  ? 61  GLU Z CB  1 
ATOM 7586 C CG  . GLU F 3 36  ? -28.842 -23.855 48.702  1.00 91.85  ? 61  GLU Z CG  1 
ATOM 7587 C CD  . GLU F 3 36  ? -27.924 -25.045 48.851  1.00 96.14  ? 61  GLU Z CD  1 
ATOM 7588 O OE1 . GLU F 3 36  ? -27.440 -25.282 49.977  1.00 101.59 ? 61  GLU Z OE1 1 
ATOM 7589 O OE2 . GLU F 3 36  ? -27.660 -25.724 47.836  1.00 85.31  ? 61  GLU Z OE2 1 
ATOM 7590 N N   . SER F 3 37  ? -32.034 -21.933 46.196  1.00 62.04  ? 62  SER Z N   1 
ATOM 7591 C CA  . SER F 3 37  ? -32.625 -21.827 44.863  1.00 64.15  ? 62  SER Z CA  1 
ATOM 7592 C C   . SER F 3 37  ? -31.881 -22.651 43.805  1.00 53.65  ? 62  SER Z C   1 
ATOM 7593 O O   . SER F 3 37  ? -30.645 -22.721 43.796  1.00 46.93  ? 62  SER Z O   1 
ATOM 7594 C CB  . SER F 3 37  ? -32.649 -20.359 44.417  1.00 69.80  ? 62  SER Z CB  1 
ATOM 7595 O OG  . SER F 3 37  ? -31.334 -19.894 44.137  1.00 74.14  ? 62  SER Z OG  1 
ATOM 7596 N N   . PHE F 3 38  ? -32.653 -23.285 42.926  1.00 46.25  ? 63  PHE Z N   1 
ATOM 7597 C CA  . PHE F 3 38  ? -32.102 -24.101 41.852  1.00 47.51  ? 63  PHE Z CA  1 
ATOM 7598 C C   . PHE F 3 38  ? -32.431 -23.507 40.487  1.00 43.36  ? 63  PHE Z C   1 
ATOM 7599 O O   . PHE F 3 38  ? -33.039 -22.441 40.399  1.00 33.84  ? 63  PHE Z O   1 
ATOM 7600 C CB  . PHE F 3 38  ? -32.632 -25.531 41.944  1.00 51.14  ? 63  PHE Z CB  1 
ATOM 7601 C CG  . PHE F 3 38  ? -32.311 -26.212 43.242  1.00 61.51  ? 63  PHE Z CG  1 
ATOM 7602 C CD1 . PHE F 3 38  ? -31.073 -26.055 43.835  1.00 71.51  ? 63  PHE Z CD1 1 
ATOM 7603 C CD2 . PHE F 3 38  ? -33.253 -26.997 43.877  1.00 62.85  ? 63  PHE Z CD2 1 
ATOM 7604 C CE1 . PHE F 3 38  ? -30.774 -26.683 45.028  1.00 72.26  ? 63  PHE Z CE1 1 
ATOM 7605 C CE2 . PHE F 3 38  ? -32.965 -27.625 45.073  1.00 62.82  ? 63  PHE Z CE2 1 
ATOM 7606 C CZ  . PHE F 3 38  ? -31.721 -27.464 45.651  1.00 67.94  ? 63  PHE Z CZ  1 
ATOM 7607 N N   . VAL F 3 39  ? -32.008 -24.185 39.424  1.00 40.15  ? 64  VAL Z N   1 
ATOM 7608 C CA  . VAL F 3 39  ? -32.358 -23.773 38.067  1.00 37.61  ? 64  VAL Z CA  1 
ATOM 7609 C C   . VAL F 3 39  ? -32.934 -24.945 37.271  1.00 33.87  ? 64  VAL Z C   1 
ATOM 7610 O O   . VAL F 3 39  ? -32.330 -26.016 37.185  1.00 29.79  ? 64  VAL Z O   1 
ATOM 7611 C CB  . VAL F 3 39  ? -31.147 -23.166 37.318  1.00 31.28  ? 64  VAL Z CB  1 
ATOM 7612 C CG1 . VAL F 3 39  ? -30.809 -21.800 37.886  1.00 36.00  ? 64  VAL Z CG1 1 
ATOM 7613 C CG2 . VAL F 3 39  ? -29.937 -24.084 37.400  1.00 35.94  ? 64  VAL Z CG2 1 
ATOM 7614 N N   . LEU F 3 40  ? -34.118 -24.739 36.706  1.00 33.31  ? 65  LEU Z N   1 
ATOM 7615 C CA  . LEU F 3 40  ? -34.807 -25.795 35.975  1.00 34.06  ? 65  LEU Z CA  1 
ATOM 7616 C C   . LEU F 3 40  ? -34.459 -25.794 34.501  1.00 30.34  ? 65  LEU Z C   1 
ATOM 7617 O O   . LEU F 3 40  ? -34.688 -24.816 33.801  1.00 34.50  ? 65  LEU Z O   1 
ATOM 7618 C CB  . LEU F 3 40  ? -36.315 -25.668 36.144  1.00 29.85  ? 65  LEU Z CB  1 
ATOM 7619 C CG  . LEU F 3 40  ? -36.784 -25.954 37.562  1.00 44.67  ? 65  LEU Z CG  1 
ATOM 7620 C CD1 . LEU F 3 40  ? -38.277 -25.825 37.617  1.00 40.52  ? 65  LEU Z CD1 1 
ATOM 7621 C CD2 . LEU F 3 40  ? -36.357 -27.349 37.966  1.00 43.64  ? 65  LEU Z CD2 1 
ATOM 7622 N N   . ASN F 3 41  ? -33.922 -26.915 34.039  1.00 31.64  ? 66  ASN Z N   1 
ATOM 7623 C CA  . ASN F 3 41  ? -33.465 -27.056 32.667  1.00 30.73  ? 66  ASN Z CA  1 
ATOM 7624 C C   . ASN F 3 41  ? -34.297 -28.075 31.909  1.00 29.71  ? 66  ASN Z C   1 
ATOM 7625 O O   . ASN F 3 41  ? -34.886 -28.964 32.505  1.00 34.43  ? 66  ASN Z O   1 
ATOM 7626 C CB  . ASN F 3 41  ? -31.999 -27.463 32.641  1.00 29.27  ? 66  ASN Z CB  1 
ATOM 7627 C CG  . ASN F 3 41  ? -31.083 -26.379 33.151  1.00 51.22  ? 66  ASN Z CG  1 
ATOM 7628 O OD1 . ASN F 3 41  ? -31.450 -25.598 34.029  1.00 54.03  ? 66  ASN Z OD1 1 
ATOM 7629 N ND2 . ASN F 3 41  ? -29.874 -26.324 32.602  1.00 43.65  ? 66  ASN Z ND2 1 
ATOM 7630 N N   . TRP F 3 42  ? -34.349 -27.942 30.593  1.00 27.81  ? 67  TRP Z N   1 
ATOM 7631 C CA  . TRP F 3 42  ? -35.178 -28.817 29.777  1.00 27.40  ? 67  TRP Z CA  1 
ATOM 7632 C C   . TRP F 3 42  ? -34.379 -29.331 28.584  1.00 39.70  ? 67  TRP Z C   1 
ATOM 7633 O O   . TRP F 3 42  ? -33.910 -28.543 27.763  1.00 30.50  ? 67  TRP Z O   1 
ATOM 7634 C CB  . TRP F 3 42  ? -36.425 -28.060 29.328  1.00 27.15  ? 67  TRP Z CB  1 
ATOM 7635 C CG  . TRP F 3 42  ? -37.352 -28.826 28.463  1.00 34.13  ? 67  TRP Z CG  1 
ATOM 7636 C CD1 . TRP F 3 42  ? -37.439 -30.182 28.338  1.00 34.36  ? 67  TRP Z CD1 1 
ATOM 7637 C CD2 . TRP F 3 42  ? -38.364 -28.279 27.603  1.00 27.55  ? 67  TRP Z CD2 1 
ATOM 7638 N NE1 . TRP F 3 42  ? -38.434 -30.511 27.448  1.00 34.95  ? 67  TRP Z NE1 1 
ATOM 7639 C CE2 . TRP F 3 42  ? -39.009 -29.370 26.991  1.00 29.35  ? 67  TRP Z CE2 1 
ATOM 7640 C CE3 . TRP F 3 42  ? -38.766 -26.980 27.303  1.00 27.21  ? 67  TRP Z CE3 1 
ATOM 7641 C CZ2 . TRP F 3 42  ? -40.053 -29.184 26.083  1.00 34.26  ? 67  TRP Z CZ2 1 
ATOM 7642 C CZ3 . TRP F 3 42  ? -39.795 -26.808 26.405  1.00 37.00  ? 67  TRP Z CZ3 1 
ATOM 7643 C CH2 . TRP F 3 42  ? -40.430 -27.904 25.808  1.00 35.01  ? 67  TRP Z CH2 1 
ATOM 7644 N N   . TYR F 3 43  ? -34.203 -30.647 28.493  1.00 40.01  ? 68  TYR Z N   1 
ATOM 7645 C CA  . TYR F 3 43  ? -33.356 -31.192 27.439  1.00 41.92  ? 68  TYR Z CA  1 
ATOM 7646 C C   . TYR F 3 43  ? -34.105 -32.042 26.414  1.00 48.91  ? 68  TYR Z C   1 
ATOM 7647 O O   . TYR F 3 43  ? -35.317 -32.239 26.496  1.00 24.63  ? 68  TYR Z O   1 
ATOM 7648 C CB  . TYR F 3 43  ? -32.220 -32.036 28.027  1.00 43.29  ? 68  TYR Z CB  1 
ATOM 7649 C CG  . TYR F 3 43  ? -31.483 -31.469 29.226  1.00 39.97  ? 68  TYR Z CG  1 
ATOM 7650 C CD1 . TYR F 3 43  ? -31.335 -30.099 29.419  1.00 42.07  ? 68  TYR Z CD1 1 
ATOM 7651 C CD2 . TYR F 3 43  ? -30.950 -32.319 30.181  1.00 47.81  ? 68  TYR Z CD2 1 
ATOM 7652 C CE1 . TYR F 3 43  ? -30.659 -29.600 30.522  1.00 42.83  ? 68  TYR Z CE1 1 
ATOM 7653 C CE2 . TYR F 3 43  ? -30.279 -31.830 31.288  1.00 47.98  ? 68  TYR Z CE2 1 
ATOM 7654 C CZ  . TYR F 3 43  ? -30.137 -30.471 31.457  1.00 45.44  ? 68  TYR Z CZ  1 
ATOM 7655 O OH  . TYR F 3 43  ? -29.462 -29.994 32.562  1.00 42.10  ? 68  TYR Z OH  1 
ATOM 7656 N N   . ARG F 3 44  ? -33.347 -32.516 25.431  1.00 37.55  ? 69  ARG Z N   1 
ATOM 7657 C CA  . ARG F 3 44  ? -33.833 -33.434 24.411  1.00 35.24  ? 69  ARG Z CA  1 
ATOM 7658 C C   . ARG F 3 44  ? -32.729 -34.477 24.220  1.00 37.19  ? 69  ARG Z C   1 
ATOM 7659 O O   . ARG F 3 44  ? -31.601 -34.268 24.667  1.00 43.35  ? 69  ARG Z O   1 
ATOM 7660 C CB  . ARG F 3 44  ? -34.158 -32.690 23.106  1.00 32.64  ? 69  ARG Z CB  1 
ATOM 7661 C CG  . ARG F 3 44  ? -34.504 -33.585 21.922  1.00 37.61  ? 69  ARG Z CG  1 
ATOM 7662 C CD  . ARG F 3 44  ? -34.792 -32.812 20.649  1.00 44.16  ? 69  ARG Z CD  1 
ATOM 7663 N NE  . ARG F 3 44  ? -34.741 -33.706 19.494  1.00 46.54  ? 69  ARG Z NE  1 
ATOM 7664 C CZ  . ARG F 3 44  ? -34.989 -33.341 18.241  1.00 47.00  ? 69  ARG Z CZ  1 
ATOM 7665 N NH1 . ARG F 3 44  ? -35.319 -32.088 17.965  1.00 47.22  ? 69  ARG Z NH1 1 
ATOM 7666 N NH2 . ARG F 3 44  ? -34.904 -34.235 17.264  1.00 44.06  ? 69  ARG Z NH2 1 
ATOM 7667 N N   . MET F 3 45  ? -33.039 -35.592 23.566  1.00 35.06  ? 70  MET Z N   1 
ATOM 7668 C CA  . MET F 3 45  ? -32.078 -36.679 23.403  1.00 39.97  ? 70  MET Z CA  1 
ATOM 7669 C C   . MET F 3 45  ? -31.563 -36.804 21.969  1.00 47.94  ? 70  MET Z C   1 
ATOM 7670 O O   . MET F 3 45  ? -32.263 -36.478 21.010  1.00 56.23  ? 70  MET Z O   1 
ATOM 7671 C CB  . MET F 3 45  ? -32.707 -37.999 23.847  1.00 38.88  ? 70  MET Z CB  1 
ATOM 7672 C CG  . MET F 3 45  ? -33.241 -37.962 25.269  1.00 37.33  ? 70  MET Z CG  1 
ATOM 7673 S SD  . MET F 3 45  ? -31.978 -37.498 26.468  1.00 39.66  ? 70  MET Z SD  1 
ATOM 7674 C CE  . MET F 3 45  ? -30.829 -38.852 26.270  1.00 31.13  ? 70  MET Z CE  1 
ATOM 7675 N N   . SER F 3 46  ? -30.326 -37.273 21.841  1.00 55.06  ? 71  SER Z N   1 
ATOM 7676 C CA  . SER F 3 46  ? -29.668 -37.420 20.545  1.00 60.88  ? 71  SER Z CA  1 
ATOM 7677 C C   . SER F 3 46  ? -29.745 -38.847 20.004  1.00 70.60  ? 71  SER Z C   1 
ATOM 7678 O O   . SER F 3 46  ? -29.995 -39.806 20.733  1.00 71.79  ? 71  SER Z O   1 
ATOM 7679 C CB  . SER F 3 46  ? -28.203 -36.990 20.653  1.00 56.40  ? 71  SER Z CB  1 
ATOM 7680 O OG  . SER F 3 46  ? -27.484 -37.287 19.468  1.00 53.97  ? 71  SER Z OG  1 
ATOM 7681 N N   . GLN F 3 50  ? -27.624 -38.642 25.633  1.00 51.87  ? 75  GLN Z N   1 
ATOM 7682 C CA  . GLN F 3 50  ? -26.759 -37.484 25.513  1.00 58.09  ? 75  GLN Z CA  1 
ATOM 7683 C C   . GLN F 3 50  ? -27.625 -36.240 25.291  1.00 56.59  ? 75  GLN Z C   1 
ATOM 7684 O O   . GLN F 3 50  ? -28.146 -36.007 24.200  1.00 54.78  ? 75  GLN Z O   1 
ATOM 7685 C CB  . GLN F 3 50  ? -25.727 -37.675 24.386  1.00 66.62  ? 75  GLN Z CB  1 
ATOM 7686 C CG  . GLN F 3 50  ? -26.195 -38.415 23.112  1.00 71.83  ? 75  GLN Z CG  1 
ATOM 7687 C CD  . GLN F 3 50  ? -26.484 -39.906 23.302  1.00 76.48  ? 75  GLN Z CD  1 
ATOM 7688 O OE1 . GLN F 3 50  ? -26.352 -40.451 24.401  1.00 82.03  ? 75  GLN Z OE1 1 
ATOM 7689 N NE2 . GLN F 3 50  ? -26.872 -40.570 22.218  1.00 71.63  ? 75  GLN Z NE2 1 
ATOM 7690 N N   . THR F 3 51  ? -27.767 -35.439 26.342  1.00 56.02  ? 76  THR Z N   1 
ATOM 7691 C CA  . THR F 3 51  ? -28.743 -34.355 26.376  1.00 51.06  ? 76  THR Z CA  1 
ATOM 7692 C C   . THR F 3 51  ? -28.284 -33.074 25.683  1.00 54.23  ? 76  THR Z C   1 
ATOM 7693 O O   . THR F 3 51  ? -27.094 -32.769 25.636  1.00 53.62  ? 76  THR Z O   1 
ATOM 7694 C CB  . THR F 3 51  ? -29.113 -34.021 27.832  1.00 44.43  ? 76  THR Z CB  1 
ATOM 7695 O OG1 . THR F 3 51  ? -28.077 -33.218 28.415  1.00 43.39  ? 76  THR Z OG1 1 
ATOM 7696 C CG2 . THR F 3 51  ? -29.312 -35.290 28.649  1.00 40.15  ? 76  THR Z CG2 1 
ATOM 7697 N N   . ASP F 3 52  ? -29.238 -32.335 25.129  1.00 47.16  ? 77  ASP Z N   1 
ATOM 7698 C CA  . ASP F 3 52  ? -28.965 -31.011 24.587  1.00 44.21  ? 77  ASP Z CA  1 
ATOM 7699 C C   . ASP F 3 52  ? -29.841 -30.006 25.319  1.00 46.68  ? 77  ASP Z C   1 
ATOM 7700 O O   . ASP F 3 52  ? -31.029 -30.251 25.510  1.00 29.65  ? 77  ASP Z O   1 
ATOM 7701 C CB  . ASP F 3 52  ? -29.246 -30.958 23.085  1.00 46.10  ? 77  ASP Z CB  1 
ATOM 7702 C CG  . ASP F 3 52  ? -28.748 -32.192 22.347  1.00 53.13  ? 77  ASP Z CG  1 
ATOM 7703 O OD1 . ASP F 3 52  ? -27.738 -32.789 22.777  1.00 52.37  ? 77  ASP Z OD1 1 
ATOM 7704 O OD2 . ASP F 3 52  ? -29.385 -32.571 21.339  1.00 59.12  ? 77  ASP Z OD2 1 
ATOM 7705 N N   . LYS F 3 53  ? -29.270 -28.878 25.729  1.00 42.31  ? 78  LYS Z N   1 
ATOM 7706 C CA  . LYS F 3 53  ? -30.056 -27.899 26.472  1.00 41.90  ? 78  LYS Z CA  1 
ATOM 7707 C C   . LYS F 3 53  ? -30.963 -27.109 25.537  1.00 40.09  ? 78  LYS Z C   1 
ATOM 7708 O O   . LYS F 3 53  ? -30.533 -26.639 24.484  1.00 42.56  ? 78  LYS Z O   1 
ATOM 7709 C CB  . LYS F 3 53  ? -29.154 -26.954 27.268  1.00 39.72  ? 78  LYS Z CB  1 
ATOM 7710 C CG  . LYS F 3 53  ? -29.900 -26.072 28.269  1.00 39.20  ? 78  LYS Z CG  1 
ATOM 7711 C CD  . LYS F 3 53  ? -28.916 -25.285 29.119  1.00 41.70  ? 78  LYS Z CD  1 
ATOM 7712 C CE  . LYS F 3 53  ? -29.621 -24.330 30.062  1.00 44.67  ? 78  LYS Z CE  1 
ATOM 7713 N NZ  . LYS F 3 53  ? -28.641 -23.516 30.829  1.00 46.89  ? 78  LYS Z NZ  1 
ATOM 7714 N N   . LEU F 3 54  ? -32.225 -26.978 25.933  1.00 33.85  ? 79  LEU Z N   1 
ATOM 7715 C CA  . LEU F 3 54  ? -33.232 -26.276 25.138  1.00 31.34  ? 79  LEU Z CA  1 
ATOM 7716 C C   . LEU F 3 54  ? -33.554 -24.915 25.733  1.00 28.82  ? 79  LEU Z C   1 
ATOM 7717 O O   . LEU F 3 54  ? -33.388 -23.887 25.072  1.00 27.91  ? 79  LEU Z O   1 
ATOM 7718 C CB  . LEU F 3 54  ? -34.505 -27.111 25.017  1.00 26.87  ? 79  LEU Z CB  1 
ATOM 7719 C CG  . LEU F 3 54  ? -34.325 -28.395 24.211  1.00 26.51  ? 79  LEU Z CG  1 
ATOM 7720 C CD1 . LEU F 3 54  ? -35.342 -29.483 24.586  1.00 33.02  ? 79  LEU Z CD1 1 
ATOM 7721 C CD2 . LEU F 3 54  ? -34.385 -28.059 22.738  1.00 27.13  ? 79  LEU Z CD2 1 
ATOM 7722 N N   . ALA F 3 55  ? -34.052 -24.929 26.969  1.00 25.61  ? 80  ALA Z N   1 
ATOM 7723 C CA  . ALA F 3 55  ? -34.267 -23.708 27.736  1.00 27.71  ? 80  ALA Z CA  1 
ATOM 7724 C C   . ALA F 3 55  ? -34.059 -23.953 29.228  1.00 25.84  ? 80  ALA Z C   1 
ATOM 7725 O O   . ALA F 3 55  ? -34.006 -25.100 29.666  1.00 45.40  ? 80  ALA Z O   1 
ATOM 7726 C CB  . ALA F 3 55  ? -35.662 -23.161 27.472  1.00 26.22  ? 80  ALA Z CB  1 
ATOM 7727 N N   . ALA F 3 56  ? -33.934 -22.878 30.003  1.00 23.52  ? 81  ALA Z N   1 
ATOM 7728 C CA  . ALA F 3 56  ? -33.878 -23.004 31.459  1.00 23.67  ? 81  ALA Z CA  1 
ATOM 7729 C C   . ALA F 3 56  ? -34.529 -21.829 32.191  1.00 38.68  ? 81  ALA Z C   1 
ATOM 7730 O O   . ALA F 3 56  ? -34.697 -20.756 31.623  1.00 40.81  ? 81  ALA Z O   1 
ATOM 7731 C CB  . ALA F 3 56  ? -32.431 -23.165 31.925  1.00 35.78  ? 81  ALA Z CB  1 
ATOM 7732 N N   . PHE F 3 57  ? -34.921 -22.053 33.444  1.00 29.42  ? 82  PHE Z N   1 
ATOM 7733 C CA  . PHE F 3 57  ? -35.445 -20.987 34.304  1.00 33.77  ? 82  PHE Z CA  1 
ATOM 7734 C C   . PHE F 3 57  ? -34.480 -20.633 35.440  1.00 32.19  ? 82  PHE Z C   1 
ATOM 7735 O O   . PHE F 3 57  ? -34.040 -21.521 36.165  1.00 34.45  ? 82  PHE Z O   1 
ATOM 7736 C CB  . PHE F 3 57  ? -36.800 -21.370 34.893  1.00 37.32  ? 82  PHE Z CB  1 
ATOM 7737 C CG  . PHE F 3 57  ? -37.388 -20.306 35.772  1.00 41.63  ? 82  PHE Z CG  1 
ATOM 7738 C CD1 . PHE F 3 57  ? -37.948 -19.172 35.212  1.00 37.53  ? 82  PHE Z CD1 1 
ATOM 7739 C CD2 . PHE F 3 57  ? -37.373 -20.432 37.152  1.00 45.41  ? 82  PHE Z CD2 1 
ATOM 7740 C CE1 . PHE F 3 57  ? -38.483 -18.184 36.006  1.00 39.43  ? 82  PHE Z CE1 1 
ATOM 7741 C CE2 . PHE F 3 57  ? -37.910 -19.446 37.952  1.00 46.77  ? 82  PHE Z CE2 1 
ATOM 7742 C CZ  . PHE F 3 57  ? -38.466 -18.320 37.378  1.00 46.21  ? 82  PHE Z CZ  1 
ATOM 7743 N N   . PRO F 3 58  ? -34.139 -19.341 35.604  1.00 32.87  ? 83  PRO Z N   1 
ATOM 7744 C CA  . PRO F 3 58  ? -34.544 -18.171 34.816  1.00 40.15  ? 83  PRO Z CA  1 
ATOM 7745 C C   . PRO F 3 58  ? -34.028 -18.227 33.383  1.00 34.78  ? 83  PRO Z C   1 
ATOM 7746 O O   . PRO F 3 58  ? -33.125 -19.017 33.106  1.00 32.54  ? 83  PRO Z O   1 
ATOM 7747 C CB  . PRO F 3 58  ? -33.902 -17.001 35.574  1.00 39.45  ? 83  PRO Z CB  1 
ATOM 7748 C CG  . PRO F 3 58  ? -33.797 -17.486 36.982  1.00 38.89  ? 83  PRO Z CG  1 
ATOM 7749 C CD  . PRO F 3 58  ? -33.433 -18.939 36.835  1.00 34.29  ? 83  PRO Z CD  1 
ATOM 7750 N N   . GLU F 3 59  ? -34.595 -17.392 32.514  1.00 34.04  ? 84  GLU Z N   1 
ATOM 7751 C CA  . GLU F 3 59  ? -34.274 -17.387 31.093  1.00 38.31  ? 84  GLU Z CA  1 
ATOM 7752 C C   . GLU F 3 59  ? -32.772 -17.371 30.865  1.00 47.73  ? 84  GLU Z C   1 
ATOM 7753 O O   . GLU F 3 59  ? -32.034 -16.677 31.559  1.00 54.53  ? 84  GLU Z O   1 
ATOM 7754 C CB  . GLU F 3 59  ? -34.902 -16.169 30.413  1.00 47.54  ? 84  GLU Z CB  1 
ATOM 7755 C CG  . GLU F 3 59  ? -34.685 -16.100 28.908  1.00 55.21  ? 84  GLU Z CG  1 
ATOM 7756 C CD  . GLU F 3 59  ? -35.976 -16.216 28.123  1.00 66.81  ? 84  GLU Z CD  1 
ATOM 7757 O OE1 . GLU F 3 59  ? -36.953 -15.532 28.494  1.00 73.52  ? 84  GLU Z OE1 1 
ATOM 7758 O OE2 . GLU F 3 59  ? -36.011 -16.973 27.129  1.00 64.79  ? 84  GLU Z OE2 1 
ATOM 7759 N N   . ASP F 3 60  ? -32.313 -18.126 29.878  1.00 44.47  ? 85  ASP Z N   1 
ATOM 7760 C CA  . ASP F 3 60  ? -30.895 -18.125 29.620  1.00 51.11  ? 85  ASP Z CA  1 
ATOM 7761 C C   . ASP F 3 60  ? -30.657 -17.118 28.489  1.00 59.79  ? 85  ASP Z C   1 
ATOM 7762 O O   . ASP F 3 60  ? -30.809 -17.417 27.316  1.00 70.85  ? 85  ASP Z O   1 
ATOM 7763 C CB  . ASP F 3 60  ? -30.436 -19.553 29.279  1.00 53.60  ? 85  ASP Z CB  1 
ATOM 7764 C CG  . ASP F 3 60  ? -28.946 -19.648 29.012  1.00 59.50  ? 85  ASP Z CG  1 
ATOM 7765 O OD1 . ASP F 3 60  ? -28.137 -19.342 29.924  1.00 64.60  ? 85  ASP Z OD1 1 
ATOM 7766 O OD2 . ASP F 3 60  ? -28.582 -20.038 27.884  1.00 63.73  ? 85  ASP Z OD2 1 
ATOM 7767 N N   . ARG F 3 61  ? -30.245 -15.922 28.908  1.00 48.00  ? 86  ARG Z N   1 
ATOM 7768 C CA  . ARG F 3 61  ? -30.062 -14.738 28.070  1.00 45.98  ? 86  ARG Z CA  1 
ATOM 7769 C C   . ARG F 3 61  ? -28.592 -14.569 27.693  1.00 47.48  ? 86  ARG Z C   1 
ATOM 7770 O O   . ARG F 3 61  ? -28.165 -13.543 27.163  1.00 51.29  ? 86  ARG Z O   1 
ATOM 7771 C CB  . ARG F 3 61  ? -30.636 -13.493 28.757  1.00 46.43  ? 86  ARG Z CB  1 
ATOM 7772 C CG  . ARG F 3 61  ? -32.153 -13.376 28.583  1.00 51.96  ? 86  ARG Z CG  1 
ATOM 7773 C CD  . ARG F 3 61  ? -32.814 -12.527 29.644  1.00 56.72  ? 86  ARG Z CD  1 
ATOM 7774 N NE  . ARG F 3 61  ? -32.371 -12.955 30.960  1.00 62.98  ? 86  ARG Z NE  1 
ATOM 7775 C CZ  . ARG F 3 61  ? -32.933 -12.597 32.108  1.00 63.72  ? 86  ARG Z CZ  1 
ATOM 7776 N NH1 . ARG F 3 61  ? -33.990 -11.795 32.125  1.00 64.13  ? 86  ARG Z NH1 1 
ATOM 7777 N NH2 . ARG F 3 61  ? -32.430 -13.051 33.245  1.00 65.29  ? 86  ARG Z NH2 1 
ATOM 7778 N N   . SER F 3 62  ? -27.844 -15.616 28.024  1.00 51.48  ? 87  SER Z N   1 
ATOM 7779 C CA  . SER F 3 62  ? -26.414 -15.775 27.789  1.00 57.04  ? 87  SER Z CA  1 
ATOM 7780 C C   . SER F 3 62  ? -25.985 -15.891 26.294  1.00 60.95  ? 87  SER Z C   1 
ATOM 7781 O O   . SER F 3 62  ? -25.032 -15.215 25.902  1.00 60.73  ? 87  SER Z O   1 
ATOM 7782 C CB  . SER F 3 62  ? -25.917 -17.015 28.568  1.00 59.56  ? 87  SER Z CB  1 
ATOM 7783 O OG  . SER F 3 62  ? -26.058 -16.838 29.963  1.00 61.01  ? 87  SER Z OG  1 
ATOM 7784 N N   . GLN F 3 63  ? -26.593 -16.773 25.485  1.00 64.05  ? 88  GLN Z N   1 
ATOM 7785 C CA  . GLN F 3 63  ? -26.045 -17.038 24.138  1.00 65.16  ? 88  GLN Z CA  1 
ATOM 7786 C C   . GLN F 3 63  ? -26.912 -16.505 22.966  1.00 54.54  ? 88  GLN Z C   1 
ATOM 7787 O O   . GLN F 3 63  ? -28.127 -16.440 23.072  1.00 50.34  ? 88  GLN Z O   1 
ATOM 7788 C CB  . GLN F 3 63  ? -25.808 -18.550 24.005  1.00 61.96  ? 88  GLN Z CB  1 
ATOM 7789 C CG  . GLN F 3 63  ? -24.379 -18.903 23.538  1.00 61.08  ? 88  GLN Z CG  1 
ATOM 7790 C CD  . GLN F 3 63  ? -23.336 -18.749 24.630  1.00 59.62  ? 88  GLN Z CD  1 
ATOM 7791 O OE1 . GLN F 3 63  ? -23.408 -19.391 25.682  1.00 63.77  ? 88  GLN Z OE1 1 
ATOM 7792 N NE2 . GLN F 3 63  ? -22.378 -17.863 24.398  1.00 55.81  ? 88  GLN Z NE2 1 
ATOM 7793 N N   . PRO F 3 64  ? -26.274 -16.127 21.835  1.00 58.41  ? 89  PRO Z N   1 
ATOM 7794 C CA  . PRO F 3 64  ? -26.996 -15.389 20.765  1.00 63.50  ? 89  PRO Z CA  1 
ATOM 7795 C C   . PRO F 3 64  ? -28.156 -16.013 19.959  1.00 65.15  ? 89  PRO Z C   1 
ATOM 7796 O O   . PRO F 3 64  ? -28.523 -17.153 20.140  1.00 66.87  ? 89  PRO Z O   1 
ATOM 7797 C CB  . PRO F 3 64  ? -25.896 -15.076 19.759  1.00 63.54  ? 89  PRO Z CB  1 
ATOM 7798 C CG  . PRO F 3 64  ? -24.641 -15.067 20.524  1.00 64.52  ? 89  PRO Z CG  1 
ATOM 7799 C CD  . PRO F 3 64  ? -24.811 -16.029 21.683  1.00 61.75  ? 89  PRO Z CD  1 
ATOM 7800 N N   . GLY F 3 65  ? -28.781 -15.182 19.117  1.00 68.92  ? 90  GLY Z N   1 
ATOM 7801 C CA  . GLY F 3 65  ? -29.866 -15.583 18.221  1.00 73.08  ? 90  GLY Z CA  1 
ATOM 7802 C C   . GLY F 3 65  ? -31.242 -15.098 18.647  1.00 79.27  ? 90  GLY Z C   1 
ATOM 7803 O O   . GLY F 3 65  ? -32.155 -15.031 17.829  1.00 80.35  ? 90  GLY Z O   1 
ATOM 7804 N N   . GLN F 3 66  ? -31.374 -14.735 19.922  1.00 82.99  ? 91  GLN Z N   1 
ATOM 7805 C CA  . GLN F 3 66  ? -32.513 -13.963 20.456  1.00 84.55  ? 91  GLN Z CA  1 
ATOM 7806 C C   . GLN F 3 66  ? -33.885 -14.640 20.359  1.00 75.20  ? 91  GLN Z C   1 
ATOM 7807 O O   . GLN F 3 66  ? -34.830 -14.204 21.016  1.00 77.66  ? 91  GLN Z O   1 
ATOM 7808 C CB  . GLN F 3 66  ? -32.619 -12.614 19.758  1.00 88.16  ? 91  GLN Z CB  1 
ATOM 7809 C CG  . GLN F 3 66  ? -31.292 -11.931 19.535  1.00 90.05  ? 91  GLN Z CG  1 
ATOM 7810 C CD  . GLN F 3 66  ? -31.447 -10.670 18.746  1.00 94.02  ? 91  GLN Z CD  1 
ATOM 7811 O OE1 . GLN F 3 66  ? -32.222 -10.621 17.791  1.00 96.03  ? 91  GLN Z OE1 1 
ATOM 7812 N NE2 . GLN F 3 66  ? -30.712 -9.637  19.129  1.00 93.82  ? 91  GLN Z NE2 1 
ATOM 7813 N N   . ASP F 3 67  ? -33.993 -15.711 19.576  1.00 77.73  ? 92  ASP Z N   1 
ATOM 7814 C CA  . ASP F 3 67  ? -35.285 -16.344 19.323  1.00 79.68  ? 92  ASP Z CA  1 
ATOM 7815 C C   . ASP F 3 67  ? -35.209 -17.830 19.489  1.00 83.36  ? 92  ASP Z C   1 
ATOM 7816 O O   . ASP F 3 67  ? -34.351 -18.503 18.917  1.00 91.80  ? 92  ASP Z O   1 
ATOM 7817 C CB  . ASP F 3 67  ? -35.802 -16.012 17.925  1.00 84.59  ? 92  ASP Z CB  1 
ATOM 7818 C CG  . ASP F 3 67  ? -36.308 -14.597 17.832  1.00 93.82  ? 92  ASP Z CG  1 
ATOM 7819 O OD1 . ASP F 3 67  ? -36.590 -13.992 18.895  1.00 108.90 ? 92  ASP Z OD1 1 
ATOM 7820 O OD2 . ASP F 3 67  ? -36.420 -14.092 16.703  1.00 79.50  ? 92  ASP Z OD2 1 
ATOM 7821 N N   . SER F 3 68  ? -36.146 -18.341 20.261  1.00 66.59  ? 93  SER Z N   1 
ATOM 7822 C CA  . SER F 3 68  ? -36.188 -19.753 20.486  1.00 58.55  ? 93  SER Z CA  1 
ATOM 7823 C C   . SER F 3 68  ? -37.632 -20.151 20.656  1.00 47.73  ? 93  SER Z C   1 
ATOM 7824 O O   . SER F 3 68  ? -38.440 -19.401 21.202  1.00 43.30  ? 93  SER Z O   1 
ATOM 7825 C CB  . SER F 3 68  ? -35.345 -20.131 21.704  1.00 61.29  ? 93  SER Z CB  1 
ATOM 7826 O OG  . SER F 3 68  ? -35.384 -21.526 21.929  1.00 63.75  ? 93  SER Z OG  1 
ATOM 7827 N N   . ARG F 3 69  ? -37.950 -21.334 20.159  1.00 36.64  ? 94  ARG Z N   1 
ATOM 7828 C CA  . ARG F 3 69  ? -39.293 -21.867 20.257  1.00 36.43  ? 94  ARG Z CA  1 
ATOM 7829 C C   . ARG F 3 69  ? -39.420 -22.637 21.570  1.00 35.07  ? 94  ARG Z C   1 
ATOM 7830 O O   . ARG F 3 69  ? -40.456 -23.223 21.865  1.00 38.78  ? 94  ARG Z O   1 
ATOM 7831 C CB  . ARG F 3 69  ? -39.590 -22.750 19.049  1.00 36.84  ? 94  ARG Z CB  1 
ATOM 7832 C CG  . ARG F 3 69  ? -38.835 -22.311 17.801  1.00 39.51  ? 94  ARG Z CG  1 
ATOM 7833 C CD  . ARG F 3 69  ? -38.922 -23.372 16.741  1.00 44.82  ? 94  ARG Z CD  1 
ATOM 7834 N NE  . ARG F 3 69  ? -38.498 -24.648 17.298  1.00 51.22  ? 94  ARG Z NE  1 
ATOM 7835 C CZ  . ARG F 3 69  ? -38.910 -25.830 16.862  1.00 54.22  ? 94  ARG Z CZ  1 
ATOM 7836 N NH1 . ARG F 3 69  ? -39.768 -25.913 15.854  1.00 61.93  ? 94  ARG Z NH1 1 
ATOM 7837 N NH2 . ARG F 3 69  ? -38.465 -26.929 17.446  1.00 48.02  ? 94  ARG Z NH2 1 
ATOM 7838 N N   . PHE F 3 70  ? -38.353 -22.603 22.364  1.00 37.46  ? 95  PHE Z N   1 
ATOM 7839 C CA  . PHE F 3 70  ? -38.265 -23.356 23.612  1.00 39.69  ? 95  PHE Z CA  1 
ATOM 7840 C C   . PHE F 3 70  ? -38.151 -22.434 24.823  1.00 42.97  ? 95  PHE Z C   1 
ATOM 7841 O O   . PHE F 3 70  ? -37.179 -21.685 24.947  1.00 49.90  ? 95  PHE Z O   1 
ATOM 7842 C CB  . PHE F 3 70  ? -37.058 -24.297 23.576  1.00 38.36  ? 95  PHE Z CB  1 
ATOM 7843 C CG  . PHE F 3 70  ? -37.009 -25.176 22.364  1.00 39.37  ? 95  PHE Z CG  1 
ATOM 7844 C CD1 . PHE F 3 70  ? -37.488 -26.471 22.409  1.00 39.65  ? 95  PHE Z CD1 1 
ATOM 7845 C CD2 . PHE F 3 70  ? -36.482 -24.704 21.174  1.00 39.88  ? 95  PHE Z CD2 1 
ATOM 7846 C CE1 . PHE F 3 70  ? -37.439 -27.279 21.286  1.00 38.79  ? 95  PHE Z CE1 1 
ATOM 7847 C CE2 . PHE F 3 70  ? -36.434 -25.503 20.053  1.00 37.16  ? 95  PHE Z CE2 1 
ATOM 7848 C CZ  . PHE F 3 70  ? -36.911 -26.794 20.110  1.00 36.17  ? 95  PHE Z CZ  1 
ATOM 7849 N N   . ARG F 3 71  ? -39.141 -22.485 25.712  1.00 39.10  ? 96  ARG Z N   1 
ATOM 7850 C CA  . ARG F 3 71  ? -39.144 -21.637 26.907  1.00 34.89  ? 96  ARG Z CA  1 
ATOM 7851 C C   . ARG F 3 71  ? -39.728 -22.305 28.149  1.00 35.79  ? 96  ARG Z C   1 
ATOM 7852 O O   . ARG F 3 71  ? -40.480 -23.276 28.064  1.00 28.33  ? 96  ARG Z O   1 
ATOM 7853 C CB  . ARG F 3 71  ? -39.921 -20.342 26.648  1.00 31.01  ? 96  ARG Z CB  1 
ATOM 7854 C CG  . ARG F 3 71  ? -39.459 -19.557 25.447  1.00 31.32  ? 96  ARG Z CG  1 
ATOM 7855 C CD  . ARG F 3 71  ? -40.272 -18.303 25.248  1.00 46.79  ? 96  ARG Z CD  1 
ATOM 7856 N NE  . ARG F 3 71  ? -40.264 -17.420 26.407  1.00 51.82  ? 96  ARG Z NE  1 
ATOM 7857 C CZ  . ARG F 3 71  ? -40.953 -16.288 26.468  1.00 59.40  ? 96  ARG Z CZ  1 
ATOM 7858 N NH1 . ARG F 3 71  ? -41.714 -15.928 25.443  1.00 55.51  ? 96  ARG Z NH1 1 
ATOM 7859 N NH2 . ARG F 3 71  ? -40.905 -15.533 27.560  1.00 65.61  ? 96  ARG Z NH2 1 
ATOM 7860 N N   . VAL F 3 72  ? -39.380 -21.751 29.306  1.00 42.26  ? 97  VAL Z N   1 
ATOM 7861 C CA  . VAL F 3 72  ? -39.953 -22.186 30.571  1.00 41.46  ? 97  VAL Z CA  1 
ATOM 7862 C C   . VAL F 3 72  ? -40.674 -21.018 31.236  1.00 41.99  ? 97  VAL Z C   1 
ATOM 7863 O O   . VAL F 3 72  ? -40.169 -19.894 31.243  1.00 37.59  ? 97  VAL Z O   1 
ATOM 7864 C CB  . VAL F 3 72  ? -38.877 -22.738 31.526  1.00 38.57  ? 97  VAL Z CB  1 
ATOM 7865 C CG1 . VAL F 3 72  ? -39.511 -23.198 32.835  1.00 43.31  ? 97  VAL Z CG1 1 
ATOM 7866 C CG2 . VAL F 3 72  ? -38.107 -23.868 30.868  1.00 32.25  ? 97  VAL Z CG2 1 
ATOM 7867 N N   . THR F 3 73  ? -41.861 -21.278 31.775  1.00 42.38  ? 98  THR Z N   1 
ATOM 7868 C CA  . THR F 3 73  ? -42.599 -20.258 32.509  1.00 48.98  ? 98  THR Z CA  1 
ATOM 7869 C C   . THR F 3 73  ? -43.081 -20.809 33.842  1.00 46.26  ? 98  THR Z C   1 
ATOM 7870 O O   . THR F 3 73  ? -43.788 -21.817 33.890  1.00 51.64  ? 98  THR Z O   1 
ATOM 7871 C CB  . THR F 3 73  ? -43.816 -19.736 31.719  1.00 52.11  ? 98  THR Z CB  1 
ATOM 7872 O OG1 . THR F 3 73  ? -44.716 -20.816 31.444  1.00 64.13  ? 98  THR Z OG1 1 
ATOM 7873 C CG2 . THR F 3 73  ? -43.377 -19.121 30.412  1.00 43.29  ? 98  THR Z CG2 1 
ATOM 7874 N N   . GLN F 3 74  ? -42.696 -20.145 34.926  1.00 43.00  ? 99  GLN Z N   1 
ATOM 7875 C CA  . GLN F 3 74  ? -43.144 -20.556 36.247  1.00 39.84  ? 99  GLN Z CA  1 
ATOM 7876 C C   . GLN F 3 74  ? -44.599 -20.145 36.440  1.00 39.71  ? 99  GLN Z C   1 
ATOM 7877 O O   . GLN F 3 74  ? -44.950 -18.971 36.315  1.00 47.11  ? 99  GLN Z O   1 
ATOM 7878 C CB  . GLN F 3 74  ? -42.261 -19.948 37.340  1.00 35.53  ? 99  GLN Z CB  1 
ATOM 7879 C CG  . GLN F 3 74  ? -42.687 -20.326 38.745  1.00 39.00  ? 99  GLN Z CG  1 
ATOM 7880 C CD  . GLN F 3 74  ? -41.815 -19.702 39.817  1.00 43.22  ? 99  GLN Z CD  1 
ATOM 7881 O OE1 . GLN F 3 74  ? -41.389 -18.554 39.696  1.00 53.14  ? 99  GLN Z OE1 1 
ATOM 7882 N NE2 . GLN F 3 74  ? -41.542 -20.460 40.875  1.00 40.18  ? 99  GLN Z NE2 1 
ATOM 7883 N N   . LEU F 3 75  ? -45.443 -21.127 36.739  1.00 39.14  ? 100 LEU Z N   1 
ATOM 7884 C CA  . LEU F 3 75  ? -46.871 -20.892 36.919  1.00 40.91  ? 100 LEU Z CA  1 
ATOM 7885 C C   . LEU F 3 75  ? -47.120 -20.143 38.242  1.00 52.26  ? 100 LEU Z C   1 
ATOM 7886 O O   . LEU F 3 75  ? -46.176 -19.924 38.999  1.00 59.07  ? 100 LEU Z O   1 
ATOM 7887 C CB  . LEU F 3 75  ? -47.615 -22.234 36.854  1.00 37.16  ? 100 LEU Z CB  1 
ATOM 7888 C CG  . LEU F 3 75  ? -47.355 -23.025 35.566  1.00 33.73  ? 100 LEU Z CG  1 
ATOM 7889 C CD1 . LEU F 3 75  ? -48.313 -24.207 35.417  1.00 33.58  ? 100 LEU Z CD1 1 
ATOM 7890 C CD2 . LEU F 3 75  ? -47.447 -22.108 34.356  1.00 32.67  ? 100 LEU Z CD2 1 
ATOM 7891 N N   . PRO F 3 76  ? -48.376 -19.734 38.525  1.00 50.67  ? 101 PRO Z N   1 
ATOM 7892 C CA  . PRO F 3 76  ? -48.592 -18.923 39.735  1.00 47.56  ? 101 PRO Z CA  1 
ATOM 7893 C C   . PRO F 3 76  ? -48.138 -19.555 41.048  1.00 49.80  ? 101 PRO Z C   1 
ATOM 7894 O O   . PRO F 3 76  ? -47.498 -18.888 41.862  1.00 44.57  ? 101 PRO Z O   1 
ATOM 7895 C CB  . PRO F 3 76  ? -50.107 -18.746 39.755  1.00 52.92  ? 101 PRO Z CB  1 
ATOM 7896 C CG  . PRO F 3 76  ? -50.482 -18.716 38.334  1.00 52.91  ? 101 PRO Z CG  1 
ATOM 7897 C CD  . PRO F 3 76  ? -49.562 -19.701 37.646  1.00 51.35  ? 101 PRO Z CD  1 
ATOM 7898 N N   . ASN F 3 77  ? -48.475 -20.825 41.244  1.00 49.37  ? 102 ASN Z N   1 
ATOM 7899 C CA  . ASN F 3 77  ? -48.122 -21.540 42.464  1.00 50.66  ? 102 ASN Z CA  1 
ATOM 7900 C C   . ASN F 3 77  ? -46.612 -21.628 42.640  1.00 48.87  ? 102 ASN Z C   1 
ATOM 7901 O O   . ASN F 3 77  ? -46.101 -21.667 43.758  1.00 49.64  ? 102 ASN Z O   1 
ATOM 7902 C CB  . ASN F 3 77  ? -48.743 -22.939 42.452  1.00 47.47  ? 102 ASN Z CB  1 
ATOM 7903 C CG  . ASN F 3 77  ? -48.507 -23.671 41.140  1.00 50.09  ? 102 ASN Z CG  1 
ATOM 7904 O OD1 . ASN F 3 77  ? -47.372 -23.790 40.675  1.00 53.21  ? 102 ASN Z OD1 1 
ATOM 7905 N ND2 . ASN F 3 77  ? -49.585 -24.159 40.534  1.00 50.19  ? 102 ASN Z ND2 1 
ATOM 7906 N N   . GLY F 3 78  ? -45.906 -21.651 41.517  1.00 45.15  ? 103 GLY Z N   1 
ATOM 7907 C CA  . GLY F 3 78  ? -44.458 -21.693 41.517  1.00 50.75  ? 103 GLY Z CA  1 
ATOM 7908 C C   . GLY F 3 78  ? -43.933 -23.114 41.522  1.00 57.29  ? 103 GLY Z C   1 
ATOM 7909 O O   . GLY F 3 78  ? -42.805 -23.373 41.112  1.00 64.30  ? 103 GLY Z O   1 
ATOM 7910 N N   . ARG F 3 79  ? -44.767 -24.040 41.976  1.00 53.20  ? 104 ARG Z N   1 
ATOM 7911 C CA  . ARG F 3 79  ? -44.387 -25.442 42.036  1.00 48.24  ? 104 ARG Z CA  1 
ATOM 7912 C C   . ARG F 3 79  ? -44.404 -26.050 40.634  1.00 50.13  ? 104 ARG Z C   1 
ATOM 7913 O O   . ARG F 3 79  ? -43.454 -26.722 40.230  1.00 60.50  ? 104 ARG Z O   1 
ATOM 7914 C CB  . ARG F 3 79  ? -45.318 -26.197 42.990  1.00 45.24  ? 104 ARG Z CB  1 
ATOM 7915 C CG  . ARG F 3 79  ? -45.865 -27.511 42.468  1.00 49.70  ? 104 ARG Z CG  1 
ATOM 7916 C CD  . ARG F 3 79  ? -46.674 -28.234 43.531  1.00 65.87  ? 104 ARG Z CD  1 
ATOM 7917 N NE  . ARG F 3 79  ? -47.396 -29.371 42.967  1.00 76.33  ? 104 ARG Z NE  1 
ATOM 7918 C CZ  . ARG F 3 79  ? -48.289 -30.098 43.630  1.00 73.41  ? 104 ARG Z CZ  1 
ATOM 7919 N NH1 . ARG F 3 79  ? -48.570 -29.818 44.896  1.00 71.00  ? 104 ARG Z NH1 1 
ATOM 7920 N NH2 . ARG F 3 79  ? -48.896 -31.112 43.027  1.00 70.58  ? 104 ARG Z NH2 1 
ATOM 7921 N N   . ASP F 3 80  ? -45.489 -25.811 39.903  1.00 44.54  ? 105 ASP Z N   1 
ATOM 7922 C CA  . ASP F 3 80  ? -45.625 -26.280 38.529  1.00 39.02  ? 105 ASP Z CA  1 
ATOM 7923 C C   . ASP F 3 80  ? -44.944 -25.338 37.535  1.00 35.15  ? 105 ASP Z C   1 
ATOM 7924 O O   . ASP F 3 80  ? -44.821 -24.141 37.790  1.00 33.37  ? 105 ASP Z O   1 
ATOM 7925 C CB  . ASP F 3 80  ? -47.104 -26.453 38.187  1.00 47.93  ? 105 ASP Z CB  1 
ATOM 7926 C CG  . ASP F 3 80  ? -47.778 -27.496 39.061  1.00 58.71  ? 105 ASP Z CG  1 
ATOM 7927 O OD1 . ASP F 3 80  ? -47.307 -28.654 39.077  1.00 69.28  ? 105 ASP Z OD1 1 
ATOM 7928 O OD2 . ASP F 3 80  ? -48.772 -27.157 39.739  1.00 52.68  ? 105 ASP Z OD2 1 
ATOM 7929 N N   . PHE F 3 81  ? -44.504 -25.885 36.405  1.00 38.93  ? 106 PHE Z N   1 
ATOM 7930 C CA  . PHE F 3 81  ? -43.835 -25.097 35.369  1.00 39.54  ? 106 PHE Z CA  1 
ATOM 7931 C C   . PHE F 3 81  ? -44.350 -25.466 33.982  1.00 42.21  ? 106 PHE Z C   1 
ATOM 7932 O O   . PHE F 3 81  ? -44.715 -26.614 33.734  1.00 40.44  ? 106 PHE Z O   1 
ATOM 7933 C CB  . PHE F 3 81  ? -42.315 -25.296 35.428  1.00 43.95  ? 106 PHE Z CB  1 
ATOM 7934 C CG  . PHE F 3 81  ? -41.672 -24.705 36.648  1.00 47.78  ? 106 PHE Z CG  1 
ATOM 7935 C CD1 . PHE F 3 81  ? -41.007 -23.495 36.575  1.00 49.92  ? 106 PHE Z CD1 1 
ATOM 7936 C CD2 . PHE F 3 81  ? -41.733 -25.358 37.868  1.00 48.72  ? 106 PHE Z CD2 1 
ATOM 7937 C CE1 . PHE F 3 81  ? -40.416 -22.945 37.694  1.00 48.14  ? 106 PHE Z CE1 1 
ATOM 7938 C CE2 . PHE F 3 81  ? -41.149 -24.812 38.994  1.00 47.09  ? 106 PHE Z CE2 1 
ATOM 7939 C CZ  . PHE F 3 81  ? -40.487 -23.602 38.906  1.00 46.46  ? 106 PHE Z CZ  1 
ATOM 7940 N N   . HIS F 3 82  ? -44.381 -24.493 33.078  1.00 36.12  ? 107 HIS Z N   1 
ATOM 7941 C CA  . HIS F 3 82  ? -44.816 -24.757 31.712  1.00 35.51  ? 107 HIS Z CA  1 
ATOM 7942 C C   . HIS F 3 82  ? -43.628 -24.800 30.759  1.00 42.76  ? 107 HIS Z C   1 
ATOM 7943 O O   . HIS F 3 82  ? -43.014 -23.777 30.458  1.00 47.26  ? 107 HIS Z O   1 
ATOM 7944 C CB  . HIS F 3 82  ? -45.823 -23.704 31.251  1.00 36.18  ? 107 HIS Z CB  1 
ATOM 7945 C CG  . HIS F 3 82  ? -47.248 -24.076 31.510  1.00 38.76  ? 107 HIS Z CG  1 
ATOM 7946 N ND1 . HIS F 3 82  ? -48.297 -23.215 31.267  1.00 44.58  ? 107 HIS Z ND1 1 
ATOM 7947 C CD2 . HIS F 3 82  ? -47.802 -25.217 31.987  1.00 38.52  ? 107 HIS Z CD2 1 
ATOM 7948 C CE1 . HIS F 3 82  ? -49.432 -23.806 31.587  1.00 46.84  ? 107 HIS Z CE1 1 
ATOM 7949 N NE2 . HIS F 3 82  ? -49.162 -25.022 32.027  1.00 41.86  ? 107 HIS Z NE2 1 
ATOM 7950 N N   . MET F 3 83  ? -43.318 -25.999 30.283  1.00 42.93  ? 108 MET Z N   1 
ATOM 7951 C CA  . MET F 3 83  ? -42.241 -26.195 29.326  1.00 38.80  ? 108 MET Z CA  1 
ATOM 7952 C C   . MET F 3 83  ? -42.856 -26.448 27.966  1.00 28.43  ? 108 MET Z C   1 
ATOM 7953 O O   . MET F 3 83  ? -43.589 -27.417 27.786  1.00 28.50  ? 108 MET Z O   1 
ATOM 7954 C CB  . MET F 3 83  ? -41.354 -27.367 29.737  1.00 37.67  ? 108 MET Z CB  1 
ATOM 7955 C CG  . MET F 3 83  ? -41.010 -27.387 31.215  1.00 40.60  ? 108 MET Z CG  1 
ATOM 7956 S SD  . MET F 3 83  ? -39.567 -28.394 31.593  1.00 49.70  ? 108 MET Z SD  1 
ATOM 7957 C CE  . MET F 3 83  ? -38.419 -27.163 32.194  1.00 58.90  ? 108 MET Z CE  1 
ATOM 7958 N N   . SER F 3 84  ? -42.571 -25.583 27.003  1.00 36.25  ? 109 SER Z N   1 
ATOM 7959 C CA  . SER F 3 84  ? -43.257 -25.688 25.726  1.00 36.23  ? 109 SER Z CA  1 
ATOM 7960 C C   . SER F 3 84  ? -42.364 -25.474 24.513  1.00 32.73  ? 109 SER Z C   1 
ATOM 7961 O O   . SER F 3 84  ? -41.318 -24.829 24.588  1.00 25.10  ? 109 SER Z O   1 
ATOM 7962 C CB  . SER F 3 84  ? -44.408 -24.687 25.681  1.00 30.56  ? 109 SER Z CB  1 
ATOM 7963 O OG  . SER F 3 84  ? -43.914 -23.369 25.805  1.00 31.66  ? 109 SER Z OG  1 
ATOM 7964 N N   . VAL F 3 85  ? -42.807 -26.027 23.390  1.00 36.85  ? 110 VAL Z N   1 
ATOM 7965 C CA  . VAL F 3 85  ? -42.209 -25.739 22.099  1.00 37.34  ? 110 VAL Z CA  1 
ATOM 7966 C C   . VAL F 3 85  ? -43.277 -25.212 21.155  1.00 45.59  ? 110 VAL Z C   1 
ATOM 7967 O O   . VAL F 3 85  ? -44.289 -25.875 20.931  1.00 28.57  ? 110 VAL Z O   1 
ATOM 7968 C CB  . VAL F 3 85  ? -41.565 -26.976 21.459  1.00 26.84  ? 110 VAL Z CB  1 
ATOM 7969 C CG1 . VAL F 3 85  ? -40.745 -26.557 20.253  1.00 37.70  ? 110 VAL Z CG1 1 
ATOM 7970 C CG2 . VAL F 3 85  ? -40.712 -27.718 22.457  1.00 25.89  ? 110 VAL Z CG2 1 
ATOM 7971 N N   . VAL F 3 86  ? -43.069 -24.023 20.601  1.00 43.18  ? 111 VAL Z N   1 
ATOM 7972 C CA  . VAL F 3 86  ? -44.010 -23.524 19.611  1.00 40.26  ? 111 VAL Z CA  1 
ATOM 7973 C C   . VAL F 3 86  ? -43.503 -23.814 18.208  1.00 37.08  ? 111 VAL Z C   1 
ATOM 7974 O O   . VAL F 3 86  ? -42.379 -24.292 18.034  1.00 32.20  ? 111 VAL Z O   1 
ATOM 7975 C CB  . VAL F 3 86  ? -44.259 -22.013 19.757  1.00 40.27  ? 111 VAL Z CB  1 
ATOM 7976 C CG1 . VAL F 3 86  ? -44.901 -21.718 21.103  1.00 42.96  ? 111 VAL Z CG1 1 
ATOM 7977 C CG2 . VAL F 3 86  ? -42.962 -21.235 19.577  1.00 27.88  ? 111 VAL Z CG2 1 
ATOM 7978 N N   . ARG F 3 87  ? -44.335 -23.500 17.217  1.00 35.39  ? 112 ARG Z N   1 
ATOM 7979 C CA  . ARG F 3 87  ? -44.022 -23.754 15.814  1.00 31.98  ? 112 ARG Z CA  1 
ATOM 7980 C C   . ARG F 3 87  ? -43.491 -25.168 15.604  1.00 41.18  ? 112 ARG Z C   1 
ATOM 7981 O O   . ARG F 3 87  ? -42.517 -25.365 14.879  1.00 24.80  ? 112 ARG Z O   1 
ATOM 7982 C CB  . ARG F 3 87  ? -43.007 -22.726 15.319  1.00 26.97  ? 112 ARG Z CB  1 
ATOM 7983 C CG  . ARG F 3 87  ? -43.500 -21.297 15.431  1.00 24.16  ? 112 ARG Z CG  1 
ATOM 7984 C CD  . ARG F 3 87  ? -42.514 -20.316 14.845  1.00 24.10  ? 112 ARG Z CD  1 
ATOM 7985 N NE  . ARG F 3 87  ? -41.368 -20.107 15.723  1.00 23.99  ? 112 ARG Z NE  1 
ATOM 7986 C CZ  . ARG F 3 87  ? -40.177 -19.689 15.307  1.00 47.99  ? 112 ARG Z CZ  1 
ATOM 7987 N NH1 . ARG F 3 87  ? -39.974 -19.449 14.018  1.00 39.04  ? 112 ARG Z NH1 1 
ATOM 7988 N NH2 . ARG F 3 87  ? -39.190 -19.514 16.176  1.00 46.74  ? 112 ARG Z NH2 1 
ATOM 7989 N N   . ALA F 3 88  ? -44.129 -26.142 16.250  1.00 37.61  ? 113 ALA Z N   1 
ATOM 7990 C CA  . ALA F 3 88  ? -43.586 -27.496 16.336  1.00 36.78  ? 113 ALA Z CA  1 
ATOM 7991 C C   . ALA F 3 88  ? -43.315 -28.113 14.966  1.00 38.28  ? 113 ALA Z C   1 
ATOM 7992 O O   . ALA F 3 88  ? -44.170 -28.097 14.080  1.00 46.81  ? 113 ALA Z O   1 
ATOM 7993 C CB  . ALA F 3 88  ? -44.517 -28.384 17.133  1.00 28.73  ? 113 ALA Z CB  1 
ATOM 7994 N N   . ARG F 3 89  ? -42.103 -28.639 14.805  1.00 39.28  ? 114 ARG Z N   1 
ATOM 7995 C CA  . ARG F 3 89  ? -41.673 -29.258 13.556  1.00 28.51  ? 114 ARG Z CA  1 
ATOM 7996 C C   . ARG F 3 89  ? -41.870 -30.756 13.676  1.00 29.03  ? 114 ARG Z C   1 
ATOM 7997 O O   . ARG F 3 89  ? -42.227 -31.234 14.750  1.00 30.16  ? 114 ARG Z O   1 
ATOM 7998 C CB  . ARG F 3 89  ? -40.207 -28.925 13.280  1.00 32.48  ? 114 ARG Z CB  1 
ATOM 7999 C CG  . ARG F 3 89  ? -39.750 -29.080 11.845  1.00 37.22  ? 114 ARG Z CG  1 
ATOM 8000 C CD  . ARG F 3 89  ? -38.299 -28.653 11.739  1.00 41.95  ? 114 ARG Z CD  1 
ATOM 8001 N NE  . ARG F 3 89  ? -38.042 -27.463 12.546  1.00 34.08  ? 114 ARG Z NE  1 
ATOM 8002 C CZ  . ARG F 3 89  ? -37.138 -27.396 13.519  1.00 34.92  ? 114 ARG Z CZ  1 
ATOM 8003 N NH1 . ARG F 3 89  ? -36.396 -28.455 13.815  1.00 33.05  ? 114 ARG Z NH1 1 
ATOM 8004 N NH2 . ARG F 3 89  ? -36.981 -26.271 14.200  1.00 31.74  ? 114 ARG Z NH2 1 
ATOM 8005 N N   . ARG F 3 90  ? -41.622 -31.504 12.604  1.00 28.48  ? 115 ARG Z N   1 
ATOM 8006 C CA  . ARG F 3 90  ? -41.777 -32.949 12.691  1.00 28.96  ? 115 ARG Z CA  1 
ATOM 8007 C C   . ARG F 3 90  ? -40.555 -33.627 13.315  1.00 44.17  ? 115 ARG Z C   1 
ATOM 8008 O O   . ARG F 3 90  ? -40.687 -34.609 14.047  1.00 29.47  ? 115 ARG Z O   1 
ATOM 8009 C CB  . ARG F 3 90  ? -42.094 -33.568 11.327  1.00 30.88  ? 115 ARG Z CB  1 
ATOM 8010 C CG  . ARG F 3 90  ? -42.788 -34.915 11.486  1.00 43.85  ? 115 ARG Z CG  1 
ATOM 8011 C CD  . ARG F 3 90  ? -43.715 -35.273 10.344  1.00 54.27  ? 115 ARG Z CD  1 
ATOM 8012 N NE  . ARG F 3 90  ? -44.658 -36.318 10.742  1.00 61.81  ? 115 ARG Z NE  1 
ATOM 8013 C CZ  . ARG F 3 90  ? -45.484 -36.946 9.909   1.00 64.85  ? 115 ARG Z CZ  1 
ATOM 8014 N NH1 . ARG F 3 90  ? -45.483 -36.648 8.616   1.00 68.12  ? 115 ARG Z NH1 1 
ATOM 8015 N NH2 . ARG F 3 90  ? -46.308 -37.878 10.369  1.00 57.27  ? 115 ARG Z NH2 1 
ATOM 8016 N N   . ASN F 3 91  ? -39.372 -33.087 13.044  1.00 40.79  ? 116 ASN Z N   1 
ATOM 8017 C CA  . ASN F 3 91  ? -38.131 -33.698 13.506  1.00 42.74  ? 116 ASN Z CA  1 
ATOM 8018 C C   . ASN F 3 91  ? -37.771 -33.287 14.927  1.00 29.66  ? 116 ASN Z C   1 
ATOM 8019 O O   . ASN F 3 91  ? -36.738 -33.690 15.461  1.00 29.93  ? 116 ASN Z O   1 
ATOM 8020 C CB  . ASN F 3 91  ? -36.989 -33.364 12.539  1.00 30.20  ? 116 ASN Z CB  1 
ATOM 8021 C CG  . ASN F 3 91  ? -36.790 -31.868 12.343  1.00 54.75  ? 116 ASN Z CG  1 
ATOM 8022 O OD1 . ASN F 3 91  ? -36.911 -31.078 13.281  1.00 50.75  ? 116 ASN Z OD1 1 
ATOM 8023 N ND2 . ASN F 3 91  ? -36.480 -31.474 11.109  1.00 48.21  ? 116 ASN Z ND2 1 
ATOM 8024 N N   . ASP F 3 92  ? -38.632 -32.473 15.528  1.00 33.66  ? 117 ASP Z N   1 
ATOM 8025 C CA  . ASP F 3 92  ? -38.503 -32.111 16.933  1.00 35.93  ? 117 ASP Z CA  1 
ATOM 8026 C C   . ASP F 3 92  ? -38.858 -33.292 17.815  1.00 36.01  ? 117 ASP Z C   1 
ATOM 8027 O O   . ASP F 3 92  ? -38.402 -33.387 18.956  1.00 41.29  ? 117 ASP Z O   1 
ATOM 8028 C CB  . ASP F 3 92  ? -39.400 -30.926 17.267  1.00 35.59  ? 117 ASP Z CB  1 
ATOM 8029 C CG  . ASP F 3 92  ? -38.911 -29.652 16.644  1.00 45.15  ? 117 ASP Z CG  1 
ATOM 8030 O OD1 . ASP F 3 92  ? -37.689 -29.537 16.409  1.00 57.47  ? 117 ASP Z OD1 1 
ATOM 8031 O OD2 . ASP F 3 92  ? -39.739 -28.751 16.405  1.00 38.16  ? 117 ASP Z OD2 1 
ATOM 8032 N N   . SER F 3 93  ? -39.685 -34.181 17.272  1.00 31.83  ? 118 SER Z N   1 
ATOM 8033 C CA  . SER F 3 93  ? -40.114 -35.374 17.985  1.00 25.72  ? 118 SER Z CA  1 
ATOM 8034 C C   . SER F 3 93  ? -38.932 -36.161 18.508  1.00 26.16  ? 118 SER Z C   1 
ATOM 8035 O O   . SER F 3 93  ? -37.979 -36.449 17.784  1.00 33.15  ? 118 SER Z O   1 
ATOM 8036 C CB  . SER F 3 93  ? -40.971 -36.270 17.093  1.00 26.29  ? 118 SER Z CB  1 
ATOM 8037 O OG  . SER F 3 93  ? -42.273 -35.744 16.949  1.00 29.30  ? 118 SER Z OG  1 
ATOM 8038 N N   . GLY F 3 94  ? -39.006 -36.500 19.785  1.00 26.78  ? 119 GLY Z N   1 
ATOM 8039 C CA  . GLY F 3 94  ? -37.946 -37.231 20.436  1.00 27.24  ? 119 GLY Z CA  1 
ATOM 8040 C C   . GLY F 3 94  ? -38.238 -37.323 21.911  1.00 27.17  ? 119 GLY Z C   1 
ATOM 8041 O O   . GLY F 3 94  ? -39.322 -36.959 22.369  1.00 26.84  ? 119 GLY Z O   1 
ATOM 8042 N N   . THR F 3 95  ? -37.264 -37.817 22.658  1.00 29.82  ? 120 THR Z N   1 
ATOM 8043 C CA  . THR F 3 95  ? -37.418 -37.940 24.090  1.00 33.43  ? 120 THR Z CA  1 
ATOM 8044 C C   . THR F 3 95  ? -37.048 -36.627 24.763  1.00 38.32  ? 120 THR Z C   1 
ATOM 8045 O O   . THR F 3 95  ? -36.027 -36.013 24.441  1.00 42.55  ? 120 THR Z O   1 
ATOM 8046 C CB  . THR F 3 95  ? -36.559 -39.079 24.640  1.00 30.94  ? 120 THR Z CB  1 
ATOM 8047 O OG1 . THR F 3 95  ? -37.009 -40.320 24.081  1.00 32.77  ? 120 THR Z OG1 1 
ATOM 8048 C CG2 . THR F 3 95  ? -36.689 -39.147 26.137  1.00 31.82  ? 120 THR Z CG2 1 
ATOM 8049 N N   . TYR F 3 96  ? -37.900 -36.193 25.684  1.00 36.79  ? 121 TYR Z N   1 
ATOM 8050 C CA  . TYR F 3 96  ? -37.676 -34.952 26.409  1.00 38.25  ? 121 TYR Z CA  1 
ATOM 8051 C C   . TYR F 3 96  ? -37.675 -35.214 27.911  1.00 42.85  ? 121 TYR Z C   1 
ATOM 8052 O O   . TYR F 3 96  ? -38.132 -36.266 28.373  1.00 45.65  ? 121 TYR Z O   1 
ATOM 8053 C CB  . TYR F 3 96  ? -38.730 -33.909 26.028  1.00 35.32  ? 121 TYR Z CB  1 
ATOM 8054 C CG  . TYR F 3 96  ? -38.547 -33.392 24.618  1.00 29.24  ? 121 TYR Z CG  1 
ATOM 8055 C CD1 . TYR F 3 96  ? -37.884 -32.197 24.373  1.00 32.26  ? 121 TYR Z CD1 1 
ATOM 8056 C CD2 . TYR F 3 96  ? -39.029 -34.108 23.531  1.00 27.09  ? 121 TYR Z CD2 1 
ATOM 8057 C CE1 . TYR F 3 96  ? -37.712 -31.725 23.082  1.00 32.74  ? 121 TYR Z CE1 1 
ATOM 8058 C CE2 . TYR F 3 96  ? -38.861 -33.647 22.236  1.00 29.56  ? 121 TYR Z CE2 1 
ATOM 8059 C CZ  . TYR F 3 96  ? -38.202 -32.454 22.016  1.00 26.60  ? 121 TYR Z CZ  1 
ATOM 8060 O OH  . TYR F 3 96  ? -38.033 -31.995 20.728  1.00 26.50  ? 121 TYR Z OH  1 
ATOM 8061 N N   . LEU F 3 97  ? -37.187 -34.236 28.667  1.00 36.14  ? 122 LEU Z N   1 
ATOM 8062 C CA  . LEU F 3 97  ? -36.932 -34.412 30.086  1.00 35.51  ? 122 LEU Z CA  1 
ATOM 8063 C C   . LEU F 3 97  ? -36.517 -33.086 30.692  1.00 40.88  ? 122 LEU Z C   1 
ATOM 8064 O O   . LEU F 3 97  ? -36.053 -32.198 29.988  1.00 36.35  ? 122 LEU Z O   1 
ATOM 8065 C CB  . LEU F 3 97  ? -35.834 -35.473 30.302  1.00 36.93  ? 122 LEU Z CB  1 
ATOM 8066 C CG  . LEU F 3 97  ? -34.395 -35.214 29.817  1.00 39.36  ? 122 LEU Z CG  1 
ATOM 8067 C CD1 . LEU F 3 97  ? -33.543 -34.473 30.852  1.00 35.31  ? 122 LEU Z CD1 1 
ATOM 8068 C CD2 . LEU F 3 97  ? -33.725 -36.513 29.402  1.00 44.00  ? 122 LEU Z CD2 1 
ATOM 8069 N N   . CYS F 3 98  ? -36.656 -32.965 32.005  1.00 39.08  ? 123 CYS Z N   1 
ATOM 8070 C CA  . CYS F 3 98  ? -36.189 -31.766 32.683  1.00 41.84  ? 123 CYS Z CA  1 
ATOM 8071 C C   . CYS F 3 98  ? -35.416 -32.153 33.908  1.00 38.56  ? 123 CYS Z C   1 
ATOM 8072 O O   . CYS F 3 98  ? -35.610 -33.238 34.439  1.00 45.09  ? 123 CYS Z O   1 
ATOM 8073 C CB  . CYS F 3 98  ? -37.357 -30.828 33.033  1.00 41.54  ? 123 CYS Z CB  1 
ATOM 8074 S SG  . CYS F 3 98  ? -38.242 -31.180 34.565  1.00 64.42  ? 123 CYS Z SG  1 
ATOM 8075 N N   . GLY F 3 99  ? -34.521 -31.276 34.337  1.00 36.28  ? 124 GLY Z N   1 
ATOM 8076 C CA  . GLY F 3 99  ? -33.794 -31.550 35.548  1.00 34.53  ? 124 GLY Z CA  1 
ATOM 8077 C C   . GLY F 3 99  ? -33.328 -30.303 36.256  1.00 35.33  ? 124 GLY Z C   1 
ATOM 8078 O O   . GLY F 3 99  ? -33.027 -29.286 35.640  1.00 40.27  ? 124 GLY Z O   1 
ATOM 8079 N N   . ALA F 3 100 ? -33.231 -30.415 37.573  1.00 36.35  ? 125 ALA Z N   1 
ATOM 8080 C CA  . ALA F 3 100 ? -32.984 -29.272 38.434  1.00 29.77  ? 125 ALA Z CA  1 
ATOM 8081 C C   . ALA F 3 100 ? -31.534 -29.284 38.845  1.00 30.26  ? 125 ALA Z C   1 
ATOM 8082 O O   . ALA F 3 100 ? -30.950 -30.347 39.053  1.00 43.82  ? 125 ALA Z O   1 
ATOM 8083 C CB  . ALA F 3 100 ? -33.882 -29.312 39.650  1.00 32.02  ? 125 ALA Z CB  1 
ATOM 8084 N N   . ILE F 3 101 ? -30.946 -28.103 38.958  1.00 28.26  ? 126 ILE Z N   1 
ATOM 8085 C CA  . ILE F 3 101 ? -29.531 -28.011 39.251  1.00 35.04  ? 126 ILE Z CA  1 
ATOM 8086 C C   . ILE F 3 101 ? -29.275 -26.988 40.350  1.00 34.76  ? 126 ILE Z C   1 
ATOM 8087 O O   . ILE F 3 101 ? -29.841 -25.896 40.334  1.00 28.45  ? 126 ILE Z O   1 
ATOM 8088 C CB  . ILE F 3 101 ? -28.727 -27.641 37.990  1.00 28.59  ? 126 ILE Z CB  1 
ATOM 8089 C CG1 . ILE F 3 101 ? -28.917 -28.701 36.900  1.00 31.08  ? 126 ILE Z CG1 1 
ATOM 8090 C CG2 . ILE F 3 101 ? -27.258 -27.511 38.317  1.00 29.18  ? 126 ILE Z CG2 1 
ATOM 8091 C CD1 . ILE F 3 101 ? -28.089 -28.473 35.653  1.00 32.40  ? 126 ILE Z CD1 1 
ATOM 8092 N N   . SER F 3 102 ? -28.438 -27.359 41.315  1.00 34.49  ? 127 SER Z N   1 
ATOM 8093 C CA  . SER F 3 102 ? -28.052 -26.449 42.387  1.00 36.46  ? 127 SER Z CA  1 
ATOM 8094 C C   . SER F 3 102 ? -27.079 -25.394 41.868  1.00 43.13  ? 127 SER Z C   1 
ATOM 8095 O O   . SER F 3 102 ? -26.451 -25.579 40.827  1.00 32.95  ? 127 SER Z O   1 
ATOM 8096 C CB  . SER F 3 102 ? -27.444 -27.226 43.560  1.00 38.69  ? 127 SER Z CB  1 
ATOM 8097 O OG  . SER F 3 102 ? -26.133 -27.663 43.259  1.00 39.71  ? 127 SER Z OG  1 
ATOM 8098 N N   . LEU F 3 103 ? -26.980 -24.279 42.583  1.00 42.50  ? 128 LEU Z N   1 
ATOM 8099 C CA  . LEU F 3 103 ? -26.081 -23.197 42.198  1.00 43.95  ? 128 LEU Z CA  1 
ATOM 8100 C C   . LEU F 3 103 ? -24.745 -23.262 42.919  1.00 39.11  ? 128 LEU Z C   1 
ATOM 8101 O O   . LEU F 3 103 ? -23.892 -22.389 42.753  1.00 34.81  ? 128 LEU Z O   1 
ATOM 8102 C CB  . LEU F 3 103 ? -26.740 -21.847 42.459  1.00 46.93  ? 128 LEU Z CB  1 
ATOM 8103 C CG  . LEU F 3 103 ? -27.792 -21.469 41.420  1.00 50.34  ? 128 LEU Z CG  1 
ATOM 8104 C CD1 . LEU F 3 103 ? -28.358 -20.084 41.707  1.00 52.55  ? 128 LEU Z CD1 1 
ATOM 8105 C CD2 . LEU F 3 103 ? -27.173 -21.535 40.031  1.00 43.23  ? 128 LEU Z CD2 1 
ATOM 8106 N N   . ALA F 3 104 ? -24.580 -24.288 43.740  1.00 35.04  ? 129 ALA Z N   1 
ATOM 8107 C CA  . ALA F 3 104 ? -23.342 -24.489 44.467  1.00 39.59  ? 129 ALA Z CA  1 
ATOM 8108 C C   . ALA F 3 104 ? -22.225 -24.805 43.487  1.00 36.15  ? 129 ALA Z C   1 
ATOM 8109 O O   . ALA F 3 104 ? -22.451 -25.513 42.519  1.00 35.88  ? 129 ALA Z O   1 
ATOM 8110 C CB  . ALA F 3 104 ? -23.512 -25.601 45.468  1.00 44.77  ? 129 ALA Z CB  1 
ATOM 8111 N N   . PRO F 3 105 ? -21.011 -24.316 43.752  1.00 34.61  ? 130 PRO Z N   1 
ATOM 8112 C CA  . PRO F 3 105 ? -19.939 -24.396 42.754  1.00 43.48  ? 130 PRO Z CA  1 
ATOM 8113 C C   . PRO F 3 105 ? -19.786 -25.806 42.147  1.00 41.67  ? 130 PRO Z C   1 
ATOM 8114 O O   . PRO F 3 105 ? -19.557 -25.894 40.925  1.00 49.45  ? 130 PRO Z O   1 
ATOM 8115 C CB  . PRO F 3 105 ? -18.699 -23.958 43.544  1.00 30.51  ? 130 PRO Z CB  1 
ATOM 8116 C CG  . PRO F 3 105 ? -19.076 -24.107 44.988  1.00 30.82  ? 130 PRO Z CG  1 
ATOM 8117 C CD  . PRO F 3 105 ? -20.530 -23.840 45.054  1.00 40.94  ? 130 PRO Z CD  1 
ATOM 8118 N N   . LYS F 3 106 ? -19.988 -26.868 42.933  1.00 28.17  ? 131 LYS Z N   1 
ATOM 8119 C CA  . LYS F 3 106 ? -20.042 -28.185 42.322  1.00 28.32  ? 131 LYS Z CA  1 
ATOM 8120 C C   . LYS F 3 106 ? -21.449 -28.666 42.436  1.00 36.01  ? 131 LYS Z C   1 
ATOM 8121 O O   . LYS F 3 106 ? -21.832 -29.195 43.459  1.00 41.28  ? 131 LYS Z O   1 
ATOM 8122 C CB  . LYS F 3 106 ? -19.068 -29.129 42.986  1.00 68.00  ? 131 LYS Z CB  1 
ATOM 8123 C CG  . LYS F 3 106 ? -18.194 -29.568 41.946  1.00 83.45  ? 131 LYS Z CG  1 
ATOM 8124 C CD  . LYS F 3 106 ? -17.537 -28.351 41.254  1.00 80.91  ? 131 LYS Z CD  1 
ATOM 8125 C CE  . LYS F 3 106 ? -16.449 -28.660 40.225  1.00 87.75  ? 131 LYS Z CE  1 
ATOM 8126 N NZ  . LYS F 3 106 ? -16.890 -29.029 38.884  1.00 88.55  ? 131 LYS Z NZ  1 
ATOM 8127 N N   . ALA F 3 107 ? -22.178 -28.601 41.324  1.00 34.17  ? 132 ALA Z N   1 
ATOM 8128 C CA  . ALA F 3 107 ? -23.646 -28.556 41.380  1.00 33.44  ? 132 ALA Z CA  1 
ATOM 8129 C C   . ALA F 3 107 ? -24.254 -29.934 41.357  1.00 45.98  ? 132 ALA Z C   1 
ATOM 8130 O O   . ALA F 3 107 ? -23.767 -30.816 40.675  1.00 47.88  ? 132 ALA Z O   1 
ATOM 8131 C CB  . ALA F 3 107 ? -24.211 -27.723 40.235  1.00 32.61  ? 132 ALA Z CB  1 
ATOM 8132 N N   . GLN F 3 108 ? -25.291 -30.148 42.151  1.00 41.54  ? 133 GLN Z N   1 
ATOM 8133 C CA  . GLN F 3 108 ? -25.959 -31.437 42.106  1.00 47.18  ? 133 GLN Z CA  1 
ATOM 8134 C C   . GLN F 3 108 ? -26.937 -31.397 40.946  1.00 46.34  ? 133 GLN Z C   1 
ATOM 8135 O O   . GLN F 3 108 ? -27.128 -30.342 40.332  1.00 30.33  ? 133 GLN Z O   1 
ATOM 8136 C CB  . GLN F 3 108 ? -26.676 -31.710 43.420  1.00 53.71  ? 133 GLN Z CB  1 
ATOM 8137 C CG  . GLN F 3 108 ? -25.757 -31.996 44.570  1.00 57.42  ? 133 GLN Z CG  1 
ATOM 8138 C CD  . GLN F 3 108 ? -26.519 -32.170 45.859  1.00 54.34  ? 133 GLN Z CD  1 
ATOM 8139 O OE1 . GLN F 3 108 ? -27.224 -31.263 46.303  1.00 51.13  ? 133 GLN Z OE1 1 
ATOM 8140 N NE2 . GLN F 3 108 ? -26.411 -33.352 46.454  1.00 54.05  ? 133 GLN Z NE2 1 
ATOM 8141 N N   . ILE F 3 109 ? -27.549 -32.531 40.633  1.00 50.01  ? 134 ILE Z N   1 
ATOM 8142 C CA  . ILE F 3 109 ? -28.553 -32.539 39.587  1.00 47.71  ? 134 ILE Z CA  1 
ATOM 8143 C C   . ILE F 3 109 ? -29.564 -33.672 39.774  1.00 42.28  ? 134 ILE Z C   1 
ATOM 8144 O O   . ILE F 3 109 ? -29.211 -34.774 40.195  1.00 38.70  ? 134 ILE Z O   1 
ATOM 8145 C CB  . ILE F 3 109 ? -27.876 -32.615 38.190  1.00 32.97  ? 134 ILE Z CB  1 
ATOM 8146 C CG1 . ILE F 3 109 ? -28.920 -32.628 37.068  1.00 32.32  ? 134 ILE Z CG1 1 
ATOM 8147 C CG2 . ILE F 3 109 ? -26.912 -33.783 38.118  1.00 33.79  ? 134 ILE Z CG2 1 
ATOM 8148 C CD1 . ILE F 3 109 ? -28.380 -32.196 35.717  1.00 62.19  ? 134 ILE Z CD1 1 
ATOM 8149 N N   . LYS F 3 110 ? -30.825 -33.389 39.459  1.00 39.67  ? 135 LYS Z N   1 
ATOM 8150 C CA  . LYS F 3 110 ? -31.873 -34.404 39.479  1.00 37.24  ? 135 LYS Z CA  1 
ATOM 8151 C C   . LYS F 3 110 ? -32.697 -34.352 38.201  1.00 45.77  ? 135 LYS Z C   1 
ATOM 8152 O O   . LYS F 3 110 ? -33.388 -33.371 37.955  1.00 30.44  ? 135 LYS Z O   1 
ATOM 8153 C CB  . LYS F 3 110 ? -32.792 -34.223 40.693  1.00 42.01  ? 135 LYS Z CB  1 
ATOM 8154 C CG  . LYS F 3 110 ? -32.169 -34.623 42.013  1.00 47.05  ? 135 LYS Z CG  1 
ATOM 8155 C CD  . LYS F 3 110 ? -31.721 -36.075 41.974  1.00 52.25  ? 135 LYS Z CD  1 
ATOM 8156 C CE  . LYS F 3 110 ? -31.061 -36.491 43.275  1.00 56.73  ? 135 LYS Z CE  1 
ATOM 8157 N NZ  . LYS F 3 110 ? -30.582 -37.899 43.212  1.00 61.68  ? 135 LYS Z NZ  1 
ATOM 8158 N N   . GLU F 3 111 ? -32.640 -35.413 37.401  1.00 42.77  ? 136 GLU Z N   1 
ATOM 8159 C CA  . GLU F 3 111 ? -33.445 -35.492 36.184  1.00 45.54  ? 136 GLU Z CA  1 
ATOM 8160 C C   . GLU F 3 111 ? -34.891 -35.910 36.443  1.00 28.75  ? 136 GLU Z C   1 
ATOM 8161 O O   . GLU F 3 111 ? -35.184 -36.640 37.386  1.00 29.20  ? 136 GLU Z O   1 
ATOM 8162 C CB  . GLU F 3 111 ? -32.823 -36.466 35.184  1.00 45.71  ? 136 GLU Z CB  1 
ATOM 8163 C CG  . GLU F 3 111 ? -31.432 -36.114 34.723  1.00 51.77  ? 136 GLU Z CG  1 
ATOM 8164 C CD  . GLU F 3 111 ? -30.865 -37.177 33.800  1.00 61.60  ? 136 GLU Z CD  1 
ATOM 8165 O OE1 . GLU F 3 111 ? -31.005 -38.377 34.127  1.00 59.33  ? 136 GLU Z OE1 1 
ATOM 8166 O OE2 . GLU F 3 111 ? -30.278 -36.818 32.754  1.00 58.95  ? 136 GLU Z OE2 1 
ATOM 8167 N N   . SER F 3 112 ? -35.789 -35.438 35.584  1.00 27.45  ? 137 SER Z N   1 
ATOM 8168 C CA  . SER F 3 112 ? -37.175 -35.896 35.568  1.00 27.38  ? 137 SER Z CA  1 
ATOM 8169 C C   . SER F 3 112 ? -37.218 -37.241 34.853  1.00 27.80  ? 137 SER Z C   1 
ATOM 8170 O O   . SER F 3 112 ? -36.176 -37.850 34.602  1.00 28.22  ? 137 SER Z O   1 
ATOM 8171 C CB  . SER F 3 112 ? -38.100 -34.883 34.877  1.00 26.71  ? 137 SER Z CB  1 
ATOM 8172 O OG  . SER F 3 112 ? -37.672 -34.599 33.552  1.00 42.53  ? 137 SER Z OG  1 
ATOM 8173 N N   . LEU F 3 113 ? -38.415 -37.719 34.533  1.00 35.86  ? 138 LEU Z N   1 
ATOM 8174 C CA  . LEU F 3 113 ? -38.544 -38.979 33.803  1.00 37.59  ? 138 LEU Z CA  1 
ATOM 8175 C C   . LEU F 3 113 ? -38.646 -38.756 32.298  1.00 47.48  ? 138 LEU Z C   1 
ATOM 8176 O O   . LEU F 3 113 ? -39.300 -37.810 31.852  1.00 48.54  ? 138 LEU Z O   1 
ATOM 8177 C CB  . LEU F 3 113 ? -39.752 -39.759 34.318  1.00 35.12  ? 138 LEU Z CB  1 
ATOM 8178 C CG  . LEU F 3 113 ? -39.377 -40.459 35.625  1.00 38.75  ? 138 LEU Z CG  1 
ATOM 8179 C CD1 . LEU F 3 113 ? -40.606 -40.957 36.360  1.00 29.60  ? 138 LEU Z CD1 1 
ATOM 8180 C CD2 . LEU F 3 113 ? -38.399 -41.595 35.355  1.00 30.01  ? 138 LEU Z CD2 1 
ATOM 8181 N N   . ARG F 3 114 ? -37.984 -39.622 31.530  1.00 49.95  ? 139 ARG Z N   1 
ATOM 8182 C CA  . ARG F 3 114 ? -37.968 -39.492 30.085  1.00 50.02  ? 139 ARG Z CA  1 
ATOM 8183 C C   . ARG F 3 114 ? -39.404 -39.492 29.574  1.00 54.48  ? 139 ARG Z C   1 
ATOM 8184 O O   . ARG F 3 114 ? -40.158 -40.444 29.783  1.00 59.94  ? 139 ARG Z O   1 
ATOM 8185 C CB  . ARG F 3 114 ? -37.169 -40.632 29.434  1.00 55.26  ? 139 ARG Z CB  1 
ATOM 8186 C CG  . ARG F 3 114 ? -35.674 -40.714 29.781  1.00 52.30  ? 139 ARG Z CG  1 
ATOM 8187 C CD  . ARG F 3 114 ? -34.786 -39.829 28.897  1.00 47.97  ? 139 ARG Z CD  1 
ATOM 8188 N NE  . ARG F 3 114 ? -33.353 -39.968 29.176  1.00 46.92  ? 139 ARG Z NE  1 
ATOM 8189 C CZ  . ARG F 3 114 ? -32.762 -39.667 30.331  1.00 62.89  ? 139 ARG Z CZ  1 
ATOM 8190 N NH1 . ARG F 3 114 ? -33.464 -39.164 31.339  1.00 62.16  ? 139 ARG Z NH1 1 
ATOM 8191 N NH2 . ARG F 3 114 ? -31.454 -39.842 30.470  1.00 72.67  ? 139 ARG Z NH2 1 
ATOM 8192 N N   . ALA F 3 115 ? -39.758 -38.422 28.874  1.00 49.18  ? 140 ALA Z N   1 
ATOM 8193 C CA  . ALA F 3 115 ? -41.056 -38.304 28.243  1.00 43.60  ? 140 ALA Z CA  1 
ATOM 8194 C C   . ALA F 3 115 ? -40.812 -38.120 26.761  1.00 35.93  ? 140 ALA Z C   1 
ATOM 8195 O O   . ALA F 3 115 ? -39.782 -37.576 26.338  1.00 35.13  ? 140 ALA Z O   1 
ATOM 8196 C CB  . ALA F 3 115 ? -41.859 -37.136 28.831  1.00 41.41  ? 140 ALA Z CB  1 
ATOM 8197 N N   . GLU F 3 116 ? -41.762 -38.589 25.974  1.00 33.28  ? 141 GLU Z N   1 
ATOM 8198 C CA  . GLU F 3 116 ? -41.623 -38.539 24.546  1.00 39.28  ? 141 GLU Z CA  1 
ATOM 8199 C C   . GLU F 3 116 ? -42.675 -37.582 23.989  1.00 40.26  ? 141 GLU Z C   1 
ATOM 8200 O O   . GLU F 3 116 ? -43.631 -37.227 24.673  1.00 39.41  ? 141 GLU Z O   1 
ATOM 8201 C CB  . GLU F 3 116 ? -41.757 -39.939 23.972  1.00 43.88  ? 141 GLU Z CB  1 
ATOM 8202 C CG  . GLU F 3 116 ? -41.331 -40.075 22.535  1.00 55.88  ? 141 GLU Z CG  1 
ATOM 8203 C CD  . GLU F 3 116 ? -42.261 -40.985 21.722  1.00 74.05  ? 141 GLU Z CD  1 
ATOM 8204 O OE1 . GLU F 3 116 ? -43.496 -40.741 21.646  1.00 75.01  ? 141 GLU Z OE1 1 
ATOM 8205 O OE2 . GLU F 3 116 ? -41.732 -41.989 21.182  1.00 87.29  ? 141 GLU Z OE2 1 
ATOM 8206 N N   . LEU F 3 117 ? -42.418 -37.073 22.791  1.00 42.25  ? 142 LEU Z N   1 
ATOM 8207 C CA  . LEU F 3 117 ? -43.340 -36.189 22.087  1.00 32.03  ? 142 LEU Z CA  1 
ATOM 8208 C C   . LEU F 3 117 ? -43.654 -36.787 20.724  1.00 37.87  ? 142 LEU Z C   1 
ATOM 8209 O O   . LEU F 3 117 ? -42.787 -37.378 20.083  1.00 30.87  ? 142 LEU Z O   1 
ATOM 8210 C CB  . LEU F 3 117 ? -42.744 -34.787 21.927  1.00 25.48  ? 142 LEU Z CB  1 
ATOM 8211 C CG  . LEU F 3 117 ? -43.496 -33.755 21.084  1.00 25.10  ? 142 LEU Z CG  1 
ATOM 8212 C CD1 . LEU F 3 117 ? -44.873 -33.465 21.660  1.00 44.00  ? 142 LEU Z CD1 1 
ATOM 8213 C CD2 . LEU F 3 117 ? -42.667 -32.483 20.966  1.00 24.67  ? 142 LEU Z CD2 1 
ATOM 8214 N N   . ARG F 3 118 ? -44.898 -36.654 20.289  1.00 37.41  ? 143 ARG Z N   1 
ATOM 8215 C CA  . ARG F 3 118 ? -45.285 -37.138 18.974  1.00 34.20  ? 143 ARG Z CA  1 
ATOM 8216 C C   . ARG F 3 118 ? -45.873 -36.016 18.146  1.00 36.39  ? 143 ARG Z C   1 
ATOM 8217 O O   . ARG F 3 118 ? -46.934 -35.491 18.460  1.00 44.47  ? 143 ARG Z O   1 
ATOM 8218 C CB  . ARG F 3 118 ? -46.287 -38.285 19.092  1.00 30.97  ? 143 ARG Z CB  1 
ATOM 8219 C CG  . ARG F 3 118 ? -45.674 -39.560 19.610  1.00 36.43  ? 143 ARG Z CG  1 
ATOM 8220 C CD  . ARG F 3 118 ? -45.445 -40.555 18.493  1.00 40.05  ? 143 ARG Z CD  1 
ATOM 8221 N NE  . ARG F 3 118 ? -46.675 -40.817 17.750  1.00 44.21  ? 143 ARG Z NE  1 
ATOM 8222 C CZ  . ARG F 3 118 ? -46.783 -41.713 16.775  1.00 41.53  ? 143 ARG Z CZ  1 
ATOM 8223 N NH1 . ARG F 3 118 ? -45.734 -42.446 16.428  1.00 32.57  ? 143 ARG Z NH1 1 
ATOM 8224 N NH2 . ARG F 3 118 ? -47.944 -41.881 16.155  1.00 43.95  ? 143 ARG Z NH2 1 
ATOM 8225 N N   . VAL F 3 119 ? -45.186 -35.637 17.080  1.00 42.07  ? 144 VAL Z N   1 
ATOM 8226 C CA  . VAL F 3 119 ? -45.777 -34.675 16.177  1.00 41.10  ? 144 VAL Z CA  1 
ATOM 8227 C C   . VAL F 3 119 ? -46.046 -35.366 14.844  1.00 51.96  ? 144 VAL Z C   1 
ATOM 8228 O O   . VAL F 3 119 ? -45.300 -36.244 14.417  1.00 58.78  ? 144 VAL Z O   1 
ATOM 8229 C CB  . VAL F 3 119 ? -44.897 -33.439 16.001  1.00 30.82  ? 144 VAL Z CB  1 
ATOM 8230 C CG1 . VAL F 3 119 ? -44.464 -32.908 17.358  1.00 30.47  ? 144 VAL Z CG1 1 
ATOM 8231 C CG2 . VAL F 3 119 ? -43.701 -33.786 15.205  1.00 31.14  ? 144 VAL Z CG2 1 
ATOM 8232 N N   . THR F 3 120 ? -47.144 -34.972 14.210  1.00 49.72  ? 145 THR Z N   1 
ATOM 8233 C CA  . THR F 3 120 ? -47.713 -35.700 13.077  1.00 46.81  ? 145 THR Z CA  1 
ATOM 8234 C C   . THR F 3 120 ? -48.020 -34.824 11.865  1.00 50.87  ? 145 THR Z C   1 
ATOM 8235 O O   . THR F 3 120 ? -47.652 -33.644 11.821  1.00 48.13  ? 145 THR Z O   1 
ATOM 8236 C CB  . THR F 3 120 ? -49.019 -36.421 13.483  1.00 38.14  ? 145 THR Z CB  1 
ATOM 8237 O OG1 . THR F 3 120 ? -49.758 -35.591 14.387  1.00 29.73  ? 145 THR Z OG1 1 
ATOM 8238 C CG2 . THR F 3 120 ? -48.710 -37.750 14.167  1.00 37.45  ? 145 THR Z CG2 1 
ATOM 8239 N N   . GLU F 3 121 ? -48.704 -35.443 10.899  1.00 58.68  ? 146 GLU Z N   1 
ATOM 8240 C CA  . GLU F 3 121 ? -49.115 -34.852 9.619   1.00 54.28  ? 146 GLU Z CA  1 
ATOM 8241 C C   . GLU F 3 121 ? -47.941 -34.761 8.650   1.00 61.00  ? 146 GLU Z C   1 
ATOM 8242 O O   . GLU F 3 121 ? -47.991 -35.319 7.554   1.00 50.95  ? 146 GLU Z O   1 
ATOM 8243 C CB  . GLU F 3 121 ? -49.756 -33.470 9.806   1.00 44.86  ? 146 GLU Z CB  1 
ATOM 8244 C CG  . GLU F 3 121 ? -50.106 -32.792 8.495   1.00 36.70  ? 146 GLU Z CG  1 
ATOM 8245 C CD  . GLU F 3 121 ? -51.236 -31.793 8.629   1.00 40.26  ? 146 GLU Z CD  1 
ATOM 8246 O OE1 . GLU F 3 121 ? -51.028 -30.728 9.251   1.00 37.58  ? 146 GLU Z OE1 1 
ATOM 8247 O OE2 . GLU F 3 121 ? -52.335 -32.074 8.106   1.00 43.68  ? 146 GLU Z OE2 1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . VAL A 2   ? 0.4818 0.8550 0.6736 -0.1001 0.1449  -0.2820 2   VAL A N   
2    C CA  . VAL A 2   ? 0.5174 0.9101 0.7007 -0.0904 0.1305  -0.2753 2   VAL A CA  
3    C C   . VAL A 2   ? 0.5206 0.8923 0.6964 -0.0789 0.1297  -0.2567 2   VAL A C   
4    O O   . VAL A 2   ? 0.3161 0.6953 0.4921 -0.0756 0.1247  -0.2567 2   VAL A O   
5    C CB  . VAL A 2   ? 0.5008 0.9228 0.6916 -0.0970 0.1245  -0.2933 2   VAL A CB  
6    C CG1 . VAL A 2   ? 0.5563 1.0043 0.7370 -0.0880 0.1086  -0.2883 2   VAL A CG1 
7    C CG2 . VAL A 2   ? 0.3464 0.7840 0.5478 -0.1109 0.1289  -0.3141 2   VAL A CG2 
8    N N   . GLN A 3   ? 0.4405 0.7860 0.6097 -0.0725 0.1350  -0.2407 3   GLN A N   
9    C CA  . GLN A 3   ? 0.4429 0.7658 0.6058 -0.0623 0.1359  -0.2234 3   GLN A CA  
10   C C   . GLN A 3   ? 0.5067 0.8142 0.6572 -0.0510 0.1339  -0.2036 3   GLN A C   
11   O O   . GLN A 3   ? 0.3190 0.6313 0.4660 -0.0510 0.1329  -0.2029 3   GLN A O   
12   C CB  . GLN A 3   ? 0.4411 0.7388 0.6122 -0.0685 0.1494  -0.2264 3   GLN A CB  
13   C CG  . GLN A 3   ? 0.4772 0.7860 0.6622 -0.0812 0.1540  -0.2470 3   GLN A CG  
14   C CD  . GLN A 3   ? 0.5914 0.8732 0.7841 -0.0873 0.1674  -0.2490 3   GLN A CD  
15   O OE1 . GLN A 3   ? 0.6074 0.8718 0.7971 -0.0808 0.1691  -0.2378 3   GLN A OE1 
16   N NE2 . GLN A 3   ? 0.6497 0.9271 0.8522 -0.0999 0.1773  -0.2631 3   GLN A NE2 
17   N N   . LEU A 4   ? 0.4377 0.7271 0.5816 -0.0411 0.1334  -0.1876 4   LEU A N   
18   C CA  . LEU A 4   ? 0.2655 0.5351 0.3986 -0.0308 0.1339  -0.1688 4   LEU A CA  
19   C C   . LEU A 4   ? 0.3487 0.5899 0.4815 -0.0277 0.1423  -0.1594 4   LEU A C   
20   O O   . LEU A 4   ? 0.3701 0.6091 0.5023 -0.0230 0.1395  -0.1542 4   LEU A O   
21   C CB  . LEU A 4   ? 0.2495 0.5300 0.3721 -0.0198 0.1209  -0.1566 4   LEU A CB  
22   C CG  . LEU A 4   ? 0.2446 0.5530 0.3643 -0.0206 0.1101  -0.1626 4   LEU A CG  
23   C CD1 . LEU A 4   ? 0.2453 0.5810 0.3704 -0.0260 0.1030  -0.1769 4   LEU A CD1 
24   C CD2 . LEU A 4   ? 0.2305 0.5377 0.3377 -0.0090 0.1004  -0.1462 4   LEU A CD2 
25   N N   . VAL A 5   ? 0.3739 0.5936 0.5065 -0.0298 0.1523  -0.1566 5   VAL A N   
26   C CA  . VAL A 5   ? 0.3871 0.5802 0.5193 -0.0279 0.1598  -0.1489 5   VAL A CA  
27   C C   . VAL A 5   ? 0.4670 0.6429 0.5861 -0.0155 0.1581  -0.1291 5   VAL A C   
28   O O   . VAL A 5   ? 0.5155 0.6883 0.6289 -0.0131 0.1590  -0.1247 5   VAL A O   
29   C CB  . VAL A 5   ? 0.2991 0.4769 0.4405 -0.0401 0.1731  -0.1604 5   VAL A CB  
30   C CG1 . VAL A 5   ? 0.3032 0.4520 0.4432 -0.0382 0.1802  -0.1517 5   VAL A CG1 
31   C CG2 . VAL A 5   ? 0.3080 0.5022 0.4629 -0.0526 0.1752  -0.1806 5   VAL A CG2 
32   N N   . GLU A 6   ? 0.2744 0.4398 0.3888 -0.0075 0.1554  -0.1173 6   GLU A N   
33   C CA  . GLU A 6   ? 0.4702 0.6217 0.5721 0.0044  0.1523  -0.0991 6   GLU A CA  
34   C C   . GLU A 6   ? 0.5332 0.6575 0.6346 0.0023  0.1606  -0.0956 6   GLU A C   
35   O O   . GLU A 6   ? 0.6498 0.7639 0.7608 -0.0080 0.1694  -0.1059 6   GLU A O   
36   C CB  . GLU A 6   ? 0.2498 0.4082 0.3453 0.0153  0.1427  -0.0872 6   GLU A CB  
37   C CG  . GLU A 6   ? 0.4957 0.6777 0.5930 0.0147  0.1349  -0.0925 6   GLU A CG  
38   C CD  . GLU A 6   ? 0.5379 0.7284 0.6373 0.0173  0.1296  -0.0915 6   GLU A CD  
39   O OE1 . GLU A 6   ? 0.6367 0.8149 0.7298 0.0266  0.1281  -0.0769 6   GLU A OE1 
40   O OE2 . GLU A 6   ? 0.2399 0.4501 0.3470 0.0103  0.1270  -0.1053 6   GLU A OE2 
41   N N   . SER A 7   ? 0.4466 0.5581 0.5370 0.0112  0.1575  -0.0814 7   SER A N   
42   C CA  . SER A 7   ? 0.4414 0.5236 0.5301 0.0082  0.1653  -0.0776 7   SER A CA  
43   C C   . SER A 7   ? 0.4290 0.5003 0.5062 0.0183  0.1580  -0.0620 7   SER A C   
44   O O   . SER A 7   ? 0.5094 0.5981 0.5808 0.0272  0.1468  -0.0553 7   SER A O   
45   C CB  . SER A 7   ? 0.4178 0.4910 0.5068 0.0022  0.1739  -0.0828 7   SER A CB  
46   O OG  . SER A 7   ? 0.2958 0.3857 0.3942 -0.0063 0.1776  -0.0974 7   SER A OG  
47   N N   . GLY A 8   ? 0.4106 0.4511 0.4843 0.0160  0.1649  -0.0564 8   GLY A N   
48   C CA  . GLY A 8   ? 0.4023 0.4263 0.4648 0.0234  0.1596  -0.0420 8   GLY A CA  
49   C C   . GLY A 8   ? 0.3872 0.4113 0.4464 0.0295  0.1504  -0.0328 8   GLY A C   
50   O O   . GLY A 8   ? 0.2753 0.2994 0.3257 0.0363  0.1415  -0.0232 8   GLY A O   
51   N N   . GLY A 9   ? 0.2854 0.3078 0.3519 0.0264  0.1528  -0.0356 9   GLY A N   
52   C CA  . GLY A 9   ? 0.2731 0.2946 0.3371 0.0316  0.1451  -0.0270 9   GLY A CA  
53   C C   . GLY A 9   ? 0.5563 0.5411 0.6175 0.0310  0.1509  -0.0154 9   GLY A C   
54   O O   . GLY A 9   ? 0.6162 0.5737 0.6739 0.0283  0.1596  -0.0109 9   GLY A O   
55   N N   . GLY A 10  ? 0.5261 0.5103 0.5883 0.0337  0.1466  -0.0098 10  GLY A N   
56   C CA  . GLY A 10  ? 0.4884 0.4398 0.5473 0.0341  0.1515  0.0030  10  GLY A CA  
57   C C   . GLY A 10  ? 0.4388 0.3734 0.4841 0.0420  0.1439  0.0223  10  GLY A C   
58   O O   . GLY A 10  ? 0.3755 0.3265 0.4151 0.0475  0.1331  0.0257  10  GLY A O   
59   N N   . VAL A 11  ? 0.5272 0.4289 0.5665 0.0424  0.1499  0.0357  11  VAL A N   
60   C CA  . VAL A 11  ? 0.5143 0.4027 0.5397 0.0492  0.1419  0.0543  11  VAL A CA  
61   C C   . VAL A 11  ? 0.4910 0.3819 0.5037 0.0514  0.1329  0.0563  11  VAL A C   
62   O O   . VAL A 11  ? 0.4196 0.2988 0.4309 0.0486  0.1400  0.0535  11  VAL A O   
63   C CB  . VAL A 11  ? 0.3465 0.2339 0.3731 0.0464  0.1386  0.0539  11  VAL A CB  
64   C CG1 . VAL A 11  ? 0.3860 0.2836 0.4003 0.0476  0.1212  0.0573  11  VAL A CG1 
65   C CG2 . VAL A 11  ? 0.5020 0.3934 0.5376 0.0466  0.1408  0.0545  11  VAL A CG2 
66   N N   . VAL A 12  ? 0.3337 0.2402 0.3377 0.0552  0.1170  0.0601  12  VAL A N   
67   C CA  . VAL A 12  ? 0.3895 0.3001 0.3831 0.0557  0.1071  0.0603  12  VAL A CA  
68   C C   . VAL A 12  ? 0.3517 0.3001 0.3442 0.0536  0.0979  0.0516  12  VAL A C   
69   O O   . VAL A 12  ? 0.4331 0.3740 0.4334 0.0622  0.0830  0.0524  12  VAL A O   
70   C CB  . VAL A 12  ? 0.7800 0.6915 0.7710 0.0602  0.1105  0.0617  12  VAL A CB  
71   C CG1 . VAL A 12  ? 0.3219 0.2462 0.3152 0.0645  0.1075  0.0645  12  VAL A CG1 
72   C CG2 . VAL A 12  ? 0.8043 0.7213 0.7854 0.0604  0.0992  0.0614  12  VAL A CG2 
73   N N   . GLN A 13  ? 0.3518 0.3405 0.3702 0.0112  0.0990  -0.0604 13  GLN A N   
74   C CA  . GLN A 13  ? 0.3450 0.3362 0.3661 0.0101  0.0998  -0.0636 13  GLN A CA  
75   C C   . GLN A 13  ? 0.3618 0.3496 0.3825 0.0112  0.1016  -0.0601 13  GLN A C   
76   O O   . GLN A 13  ? 0.4718 0.4565 0.4897 0.0149  0.1016  -0.0537 13  GLN A O   
77   C CB  . GLN A 13  ? 0.4226 0.4195 0.4427 0.0168  0.0977  -0.0623 13  GLN A CB  
78   C CG  . GLN A 13  ? 0.5922 0.5926 0.6132 0.0155  0.0965  -0.0672 13  GLN A CG  
79   C CD  . GLN A 13  ? 0.8244 0.8302 0.8486 0.0148  0.0964  -0.0729 13  GLN A CD  
80   O OE1 . GLN A 13  ? 0.8931 0.8997 0.9203 0.0128  0.0976  -0.0750 13  GLN A OE1 
81   N NE2 . GLN A 13  ? 0.8974 0.9071 0.9215 0.0163  0.0951  -0.0759 13  GLN A NE2 
82   N N   . PRO A 14  ? 0.3878 0.3761 0.4120 0.0077  0.1035  -0.0643 14  PRO A N   
83   C CA  . PRO A 14  ? 0.2697 0.2541 0.2937 0.0085  0.1058  -0.0611 14  PRO A CA  
84   C C   . PRO A 14  ? 0.5516 0.5374 0.5728 0.0174  0.1047  -0.0534 14  PRO A C   
85   O O   . PRO A 14  ? 0.5175 0.5091 0.5380 0.0227  0.1028  -0.0524 14  PRO A O   
86   C CB  . PRO A 14  ? 0.2736 0.2594 0.3030 0.0029  0.1081  -0.0681 14  PRO A CB  
87   C CG  . PRO A 14  ? 0.3806 0.3699 0.4135 -0.0030 0.1079  -0.0756 14  PRO A CG  
88   C CD  . PRO A 14  ? 0.2869 0.2794 0.3163 0.0023  0.1042  -0.0726 14  PRO A CD  
89   N N   . GLY A 15  ? 0.4211 0.4019 0.4408 0.0192  0.1065  -0.0478 15  GLY A N   
90   C CA  . GLY A 15  ? 0.3641 0.3452 0.3823 0.0266  0.1071  -0.0403 15  GLY A CA  
91   C C   . GLY A 15  ? 0.4068 0.3878 0.4222 0.0319  0.1058  -0.0332 15  GLY A C   
92   O O   . GLY A 15  ? 0.3290 0.3069 0.3432 0.0372  0.1077  -0.0249 15  GLY A O   
93   N N   . ARG A 16  ? 0.3363 0.3193 0.3510 0.0302  0.1035  -0.0361 16  ARG A N   
94   C CA  . ARG A 16  ? 0.5089 0.4908 0.5217 0.0340  0.1030  -0.0302 16  ARG A CA  
95   C C   . ARG A 16  ? 0.4208 0.3974 0.4329 0.0324  0.1040  -0.0271 16  ARG A C   
96   O O   . ARG A 16  ? 0.5763 0.5518 0.5887 0.0269  0.1038  -0.0326 16  ARG A O   
97   C CB  . ARG A 16  ? 0.4460 0.4321 0.4586 0.0327  0.1005  -0.0349 16  ARG A CB  
98   C CG  . ARG A 16  ? 0.5283 0.5211 0.5412 0.0355  0.0992  -0.0382 16  ARG A CG  
99   C CD  . ARG A 16  ? 0.5283 0.5218 0.5393 0.0429  0.1003  -0.0307 16  ARG A CD  
100  N NE  . ARG A 16  ? 0.5282 0.5297 0.5394 0.0461  0.0991  -0.0346 16  ARG A NE  
101  C CZ  . ARG A 16  ? 0.5168 0.5198 0.5262 0.0521  0.1002  -0.0300 16  ARG A CZ  
102  N NH1 . ARG A 16  ? 0.4563 0.4511 0.4629 0.0558  0.1032  -0.0193 16  ARG A NH1 
103  N NH2 . ARG A 16  ? 0.4544 0.4663 0.4643 0.0548  0.0987  -0.0352 16  ARG A NH2 
104  N N   . SER A 17  ? 0.4894 0.4624 0.5005 0.0375  0.1056  -0.0177 17  SER A N   
105  C CA  . SER A 17  ? 0.3943 0.3635 0.4051 0.0374  0.1066  -0.0141 17  SER A CA  
106  C C   . SER A 17  ? 0.4958 0.4670 0.5067 0.0340  0.1045  -0.0186 17  SER A C   
107  O O   . SER A 17  ? 0.5905 0.5651 0.6017 0.0314  0.1026  -0.0244 17  SER A O   
108  C CB  . SER A 17  ? 0.3697 0.3338 0.3802 0.0447  0.1100  -0.0010 17  SER A CB  
109  O OG  . SER A 17  ? 0.3567 0.3193 0.3679 0.0457  0.1105  0.0032  17  SER A OG  
110  N N   . LEU A 18  ? 0.4513 0.4209 0.4622 0.0347  0.1052  -0.0156 18  LEU A N   
111  C CA  . LEU A 18  ? 0.4151 0.3871 0.4265 0.0324  0.1038  -0.0189 18  LEU A CA  
112  C C   . LEU A 18  ? 0.3712 0.3425 0.3830 0.0350  0.1051  -0.0140 18  LEU A C   
113  O O   . LEU A 18  ? 0.4140 0.3831 0.4248 0.0364  0.1065  -0.0112 18  LEU A O   
114  C CB  . LEU A 18  ? 0.2548 0.2297 0.2651 0.0253  0.1016  -0.0303 18  LEU A CB  
115  C CG  . LEU A 18  ? 0.4258 0.4030 0.4357 0.0220  0.1004  -0.0353 18  LEU A CG  
116  C CD1 . LEU A 18  ? 0.3700 0.3482 0.3821 0.0240  0.1000  -0.0331 18  LEU A CD1 
117  C CD2 . LEU A 18  ? 0.4738 0.4511 0.4821 0.0148  0.1002  -0.0450 18  LEU A CD2 
118  N N   . ARG A 19  ? 0.2895 0.2632 0.3032 0.0356  0.1048  -0.0131 19  ARG A N   
119  C CA  . ARG A 19  ? 0.4647 0.4397 0.4801 0.0388  0.1062  -0.0080 19  ARG A CA  
120  C C   . ARG A 19  ? 0.4154 0.3968 0.4312 0.0357  0.1041  -0.0153 19  ARG A C   
121  O O   . ARG A 19  ? 0.2861 0.2692 0.3045 0.0349  0.1037  -0.0166 19  ARG A O   
122  C CB  . ARG A 19  ? 0.2940 0.2651 0.3137 0.0463  0.1102  0.0067  19  ARG A CB  
123  C CG  . ARG A 19  ? 0.3922 0.3641 0.4147 0.0509  0.1125  0.0152  19  ARG A CG  
124  C CD  . ARG A 19  ? 0.5193 0.4887 0.5486 0.0585  0.1173  0.0316  19  ARG A CD  
125  N NE  . ARG A 19  ? 0.6543 0.6276 0.6893 0.0579  0.1176  0.0311  19  ARG A NE  
126  C CZ  . ARG A 19  ? 0.7165 0.6919 0.7614 0.0632  0.1217  0.0438  19  ARG A CZ  
127  N NH1 . ARG A 19  ? 0.6688 0.6433 0.7189 0.0698  0.1257  0.0588  19  ARG A NH1 
128  N NH2 . ARG A 19  ? 0.6408 0.6199 0.6924 0.0620  0.1221  0.0425  19  ARG A NH2 
129  N N   . LEU A 20  ? 0.4345 0.4191 0.4473 0.0342  0.1033  -0.0199 20  LEU A N   
130  C CA  . LEU A 20  ? 0.4181 0.4095 0.4296 0.0319  0.1016  -0.0270 20  LEU A CA  
131  C C   . LEU A 20  ? 0.5246 0.5221 0.5424 0.0368  0.1029  -0.0205 20  LEU A C   
132  O O   . LEU A 20  ? 0.6011 0.5970 0.6231 0.0421  0.1056  -0.0098 20  LEU A O   
133  C CB  . LEU A 20  ? 0.3612 0.3530 0.3655 0.0291  0.1012  -0.0339 20  LEU A CB  
134  C CG  . LEU A 20  ? 0.3338 0.3195 0.3336 0.0234  0.1015  -0.0402 20  LEU A CG  
135  C CD1 . LEU A 20  ? 0.3003 0.2843 0.2927 0.0212  0.1030  -0.0452 20  LEU A CD1 
136  C CD2 . LEU A 20  ? 0.3479 0.3330 0.3479 0.0184  0.1004  -0.0464 20  LEU A CD2 
137  N N   . ASP A 21  ? 0.4192 0.4231 0.4383 0.0350  0.1016  -0.0261 21  ASP A N   
138  C CA  . ASP A 21  ? 0.4320 0.4446 0.4595 0.0390  0.1030  -0.0210 21  ASP A CA  
139  C C   . ASP A 21  ? 0.3484 0.3703 0.3704 0.0368  0.1005  -0.0312 21  ASP A C   
140  O O   . ASP A 21  ? 0.3479 0.3667 0.3625 0.0322  0.0987  -0.0404 21  ASP A O   
141  C CB  . ASP A 21  ? 0.5163 0.5279 0.5534 0.0402  0.1051  -0.0154 21  ASP A CB  
142  C CG  . ASP A 21  ? 0.6008 0.6010 0.6376 0.0414  0.1070  -0.0084 21  ASP A CG  
143  O OD1 . ASP A 21  ? 0.4992 0.4943 0.5402 0.0471  0.1108  0.0053  21  ASP A OD1 
144  O OD2 . ASP A 21  ? 0.6612 0.6577 0.6932 0.0370  0.1051  -0.0157 21  ASP A OD2 
145  N N   . CYS A 22  ? 0.3276 0.3594 0.3526 0.0401  0.1013  -0.0286 22  CYS A N   
146  C CA  . CYS A 22  ? 0.3195 0.3610 0.3370 0.0394  0.0994  -0.0374 22  CYS A CA  
147  C C   . CYS A 22  ? 0.5282 0.5872 0.5612 0.0426  0.1007  -0.0324 22  CYS A C   
148  O O   . CYS A 22  ? 0.2399 0.3058 0.2850 0.0456  0.1034  -0.0228 22  CYS A O   
149  C CB  . CYS A 22  ? 0.3064 0.3465 0.3117 0.0396  0.0992  -0.0407 22  CYS A CB  
150  S SG  . CYS A 22  ? 0.5732 0.6228 0.5645 0.0413  0.0984  -0.0481 22  CYS A SG  
151  N N   . LYS A 23  ? 0.4733 0.5374 0.5080 0.0417  0.0999  -0.0368 23  LYS A N   
152  C CA  . LYS A 23  ? 0.4534 0.5387 0.5102 0.0436  0.1015  -0.0310 23  LYS A CA  
153  C C   . LYS A 23  ? 0.3564 0.4539 0.4017 0.0450  0.1002  -0.0376 23  LYS A C   
154  O O   . LYS A 23  ? 0.4049 0.4830 0.4308 0.0427  0.1003  -0.0465 23  LYS A O   
155  C CB  . LYS A 23  ? 0.3640 0.4471 0.4367 0.0426  0.1029  -0.0271 23  LYS A CB  
156  C CG  . LYS A 23  ? 0.3344 0.4424 0.4382 0.0427  0.1036  -0.0201 23  LYS A CG  
157  C CD  . LYS A 23  ? 0.4283 0.5332 0.5620 0.0441  0.1070  -0.0026 23  LYS A CD  
158  C CE  . LYS A 23  ? 0.5765 0.7090 0.7557 0.0422  0.1044  0.0129  23  LYS A CE  
159  N NZ  . LYS A 23  ? 0.6480 0.7735 0.8564 0.0457  0.1073  0.0381  23  LYS A NZ  
160  N N   . ALA A 24  ? 0.3050 0.4252 0.3620 0.0447  0.1004  -0.0339 24  ALA A N   
161  C CA  . ALA A 24  ? 0.3850 0.5121 0.4275 0.0464  0.0994  -0.0324 24  ALA A CA  
162  C C   . ALA A 24  ? 0.3346 0.4946 0.4185 0.0412  0.1013  -0.0232 24  ALA A C   
163  O O   . ALA A 24  ? 0.3223 0.5054 0.4533 0.0339  0.0969  -0.0194 24  ALA A O   
164  C CB  . ALA A 24  ? 0.2457 0.3905 0.2965 0.0381  0.0984  -0.0356 24  ALA A CB  
165  N N   . SER A 25  ? 0.3961 0.5458 0.4861 0.0219  0.1224  -0.0490 25  SER A N   
166  C CA  . SER A 25  ? 0.3633 0.5097 0.4903 -0.0018 0.0769  -0.0266 25  SER A CA  
167  C C   . SER A 25  ? 0.4779 0.5864 0.5573 -0.0286 0.0276  -0.0233 25  SER A C   
168  O O   . SER A 25  ? 0.6125 0.6813 0.6090 -0.0317 0.0283  -0.0501 25  SER A O   
169  C CB  . SER A 25  ? 0.4338 0.5577 0.5499 -0.0052 0.0789  -0.0492 25  SER A CB  
170  O OG  . SER A 25  ? 0.5324 0.6390 0.6640 -0.0319 0.0305  -0.0353 25  SER A OG  
171  N N   . GLY A 26  ? 0.4674 0.5886 0.5997 -0.0478 -0.0150 0.0094  26  GLY A N   
172  C CA  . GLY A 26  ? 0.6541 0.7397 0.7466 -0.0749 -0.0672 0.0136  26  GLY A CA  
173  C C   . GLY A 26  ? 0.8499 0.9281 0.9008 -0.0746 -0.0725 0.0183  26  GLY A C   
174  O O   . GLY A 26  ? 0.9579 0.9913 0.9367 -0.0916 -0.1022 0.0044  26  GLY A O   
175  N N   . ILE A 27  ? 0.9207 1.0440 1.0193 -0.0546 -0.0433 0.0387  27  ILE A N   
176  C CA  . ILE A 27  ? 0.8663 0.9921 0.9394 -0.0491 -0.0396 0.0469  27  ILE A CA  
177  C C   . ILE A 27  ? 0.6583 0.8456 0.8326 -0.0393 -0.0362 0.0903  27  ILE A C   
178  O O   . ILE A 27  ? 0.5388 0.7568 0.7894 -0.0426 -0.0461 0.1126  27  ILE A O   
179  C CB  . ILE A 27  ? 0.9048 1.0188 0.9189 -0.0270 0.0109  0.0143  27  ILE A CB  
180  C CG1 . ILE A 27  ? 0.8361 0.9032 0.7748 -0.0291 0.0231  -0.0309 27  ILE A CG1 
181  C CG2 . ILE A 27  ? 0.9631 1.0597 0.9242 -0.0286 0.0051  0.0160  27  ILE A CG2 
182  C CD1 . ILE A 27  ? 0.8342 0.8420 0.6794 -0.0505 -0.0098 -0.0516 27  ILE A CD1 
183  N N   . THR A 28  ? 0.6736 0.8784 0.8507 -0.0287 -0.0248 0.1041  28  THR A N   
184  C CA  . THR A 28  ? 0.6301 0.8962 0.8991 -0.0103 -0.0020 0.1358  28  THR A CA  
185  C C   . THR A 28  ? 0.5904 0.8699 0.8429 0.0183  0.0553  0.1160  28  THR A C   
186  O O   . THR A 28  ? 0.6123 0.8828 0.8265 0.0245  0.0650  0.1123  28  THR A O   
187  C CB  . THR A 28  ? 0.7517 1.0374 1.0603 -0.0204 -0.0377 0.1750  28  THR A CB  
188  O OG1 . THR A 28  ? 0.7654 1.1074 1.1512 0.0009  -0.0088 0.2009  28  THR A OG1 
189  C CG2 . THR A 28  ? 0.7228 0.9647 0.9453 -0.0307 -0.0577 0.1641  28  THR A CG2 
190  N N   . PHE A 29  ? 0.4809 0.7507 0.7354 0.0321  0.0826  0.0934  29  PHE A N   
191  C CA  . PHE A 29  ? 0.3893 0.6029 0.5721 0.0392  0.0987  0.0464  29  PHE A CA  
192  C C   . PHE A 29  ? 0.4263 0.6338 0.6168 0.0466  0.0949  0.0644  29  PHE A C   
193  O O   . PHE A 29  ? 0.3684 0.5563 0.5274 0.0533  0.1023  0.0592  29  PHE A O   
194  C CB  . PHE A 29  ? 0.3739 0.5624 0.5398 0.0413  0.1006  0.0294  29  PHE A CB  
195  C CG  . PHE A 29  ? 0.2273 0.3816 0.3635 0.0520  0.1064  0.0305  29  PHE A CG  
196  C CD1 . PHE A 29  ? 0.3650 0.5122 0.5198 0.0598  0.1069  0.0561  29  PHE A CD1 
197  C CD2 . PHE A 29  ? 0.2348 0.3654 0.3299 0.0511  0.1094  0.0087  29  PHE A CD2 
198  C CE1 . PHE A 29  ? 0.4493 0.5690 0.5824 0.0661  0.1114  0.0582  29  PHE A CE1 
199  C CE2 . PHE A 29  ? 0.2417 0.3480 0.3232 0.0569  0.1105  0.0138  29  PHE A CE2 
200  C CZ  . PHE A 29  ? 0.5288 0.6300 0.6281 0.0643  0.1121  0.0375  29  PHE A CZ  
201  N N   . SER A 30  ? 0.4411 0.6640 0.6762 0.0465  0.0845  0.0934  30  SER A N   
202  C CA  . SER A 30  ? 0.4836 0.6966 0.7273 0.0557  0.0874  0.1196  30  SER A CA  
203  C C   . SER A 30  ? 0.3890 0.6108 0.6307 0.0573  0.0857  0.1281  30  SER A C   
204  O O   . SER A 30  ? 0.3876 0.5932 0.6188 0.0666  0.0931  0.1400  30  SER A O   
205  C CB  . SER A 30  ? 0.5750 0.8014 0.8670 0.0516  0.0773  0.1494  30  SER A CB  
206  O OG  . SER A 30  ? 0.7267 0.9341 1.0174 0.0612  0.0874  0.1689  30  SER A OG  
207  N N   . ASN A 31  ? 0.2753 0.5276 0.5354 0.0485  0.0749  0.1321  31  ASN A N   
208  C CA  . ASN A 31  ? 0.2860 0.5558 0.5513 0.0514  0.0732  0.1533  31  ASN A CA  
209  C C   . ASN A 31  ? 0.3270 0.5864 0.5399 0.0569  0.0904  0.1308  31  ASN A C   
210  O O   . ASN A 31  ? 0.3579 0.6237 0.5625 0.0615  0.0930  0.1425  31  ASN A O   
211  C CB  . ASN A 31  ? 0.3096 0.6309 0.6420 0.0368  0.0405  0.2025  31  ASN A CB  
212  C CG  . ASN A 31  ? 0.4047 0.7205 0.7766 0.0307  0.0258  0.2221  31  ASN A CG  
213  O OD1 . ASN A 31  ? 0.3812 0.7189 0.7991 0.0138  -0.0088 0.2530  31  ASN A OD1 
214  N ND2 . ASN A 31  ? 0.4906 0.7722 0.8364 0.0410  0.0462  0.2010  31  ASN A ND2 
215  N N   . SER A 32  ? 0.4250 0.6637 0.5968 0.0547  0.1022  0.0977  32  SER A N   
216  C CA  . SER A 32  ? 0.4430 0.6455 0.5451 0.0541  0.1165  0.0637  32  SER A CA  
217  C C   . SER A 32  ? 0.4966 0.6568 0.5775 0.0579  0.1152  0.0419  32  SER A C   
218  O O   . SER A 32  ? 0.6548 0.8086 0.7522 0.0643  0.1125  0.0508  32  SER A O   
219  C CB  . SER A 32  ? 0.4236 0.6135 0.4785 0.0485  0.1257  0.0425  32  SER A CB  
220  O OG  . SER A 32  ? 0.4880 0.6844 0.5230 0.0331  0.0958  0.0649  32  SER A OG  
221  N N   . GLY A 33  ? 0.4503 0.5890 0.4961 0.0592  0.1196  0.0300  33  GLY A N   
222  C CA  . GLY A 33  ? 0.2956 0.4074 0.3295 0.0663  0.1194  0.0259  33  GLY A CA  
223  C C   . GLY A 33  ? 0.3859 0.4791 0.3979 0.0585  0.1188  0.0022  33  GLY A C   
224  O O   . GLY A 33  ? 0.4513 0.5462 0.4455 0.0482  0.1196  -0.0150 33  GLY A O   
225  N N   . MET A 34  ? 0.3093 0.4641 0.2339 0.0775  0.0223  0.0947  34  MET A N   
226  C CA  . MET A 34  ? 0.3067 0.4594 0.2304 0.0747  0.0199  0.0920  34  MET A CA  
227  C C   . MET A 34  ? 0.3062 0.4518 0.2271 0.0764  0.0211  0.0888  34  MET A C   
228  O O   . MET A 34  ? 0.3065 0.4517 0.2273 0.0798  0.0231  0.0882  34  MET A O   
229  C CB  . MET A 34  ? 0.5273 0.6921 0.4560 0.0731  0.0170  0.0917  34  MET A CB  
230  C CG  . MET A 34  ? 0.4896 0.6607 0.4204 0.0697  0.0151  0.0950  34  MET A CG  
231  S SD  . MET A 34  ? 0.4509 0.6099 0.3754 0.0652  0.0133  0.0956  34  MET A SD  
232  C CE  . MET A 34  ? 0.3105 0.4656 0.2329 0.0632  0.0108  0.0916  34  MET A CE  
233  N N   . HIS A 35  ? 0.5333 0.6732 0.4516 0.0739  0.0197  0.0869  35  HIS A N   
234  C CA  . HIS A 35  ? 0.3828 0.5162 0.2985 0.0749  0.0207  0.0843  35  HIS A CA  
235  C C   . HIS A 35  ? 0.3812 0.5183 0.2983 0.0728  0.0176  0.0816  35  HIS A C   
236  O O   . HIS A 35  ? 0.2729 0.4146 0.1915 0.0702  0.0148  0.0818  35  HIS A O   
237  C CB  . HIS A 35  ? 0.4687 0.5890 0.3782 0.0746  0.0233  0.0849  35  HIS A CB  
238  C CG  . HIS A 35  ? 0.2902 0.4035 0.1964 0.0773  0.0272  0.0863  35  HIS A CG  
239  N ND1 . HIS A 35  ? 0.2921 0.3997 0.1956 0.0788  0.0295  0.0851  35  HIS A ND1 
240  C CD2 . HIS A 35  ? 0.2952 0.4055 0.1994 0.0785  0.0292  0.0888  35  HIS A CD2 
241  C CE1 . HIS A 35  ? 0.2985 0.3991 0.1982 0.0807  0.0329  0.0868  35  HIS A CE1 
242  N NE2 . HIS A 35  ? 0.3003 0.4026 0.2005 0.0808  0.0328  0.0890  35  HIS A NE2 
243  N N   . TRP A 36  ? 0.2924 0.4270 0.2084 0.0737  0.0179  0.0791  36  TRP A N   
244  C CA  . TRP A 36  ? 0.3511 0.4872 0.2673 0.0719  0.0152  0.0764  36  TRP A CA  
245  C C   . TRP A 36  ? 0.3628 0.4904 0.2754 0.0720  0.0169  0.0753  36  TRP A C   
246  O O   . TRP A 36  ? 0.3605 0.4839 0.2712 0.0735  0.0194  0.0753  36  TRP A O   
247  C CB  . TRP A 36  ? 0.3786 0.5223 0.2972 0.0727  0.0131  0.0741  36  TRP A CB  
248  C CG  . TRP A 36  ? 0.4485 0.6006 0.3699 0.0715  0.0105  0.0746  36  TRP A CG  
249  C CD1 . TRP A 36  ? 0.5212 0.6806 0.4449 0.0731  0.0107  0.0757  36  TRP A CD1 
250  C CD2 . TRP A 36  ? 0.2317 0.3852 0.1529 0.0682  0.0073  0.0743  36  TRP A CD2 
251  N NE1 . TRP A 36  ? 0.5576 0.7233 0.4829 0.0709  0.0080  0.0763  36  TRP A NE1 
252  C CE2 . TRP A 36  ? 0.4166 0.5781 0.3401 0.0676  0.0058  0.0755  36  TRP A CE2 
253  C CE3 . TRP A 36  ? 0.4825 0.6306 0.4012 0.0659  0.0057  0.0733  36  TRP A CE3 
254  C CZ2 . TRP A 36  ? 0.3391 0.5025 0.2619 0.0643  0.0024  0.0759  36  TRP A CZ2 
255  C CZ3 . TRP A 36  ? 0.4410 0.5907 0.3588 0.0629  0.0022  0.0734  36  TRP A CZ3 
256  C CH2 . TRP A 36  ? 0.3471 0.5040 0.2668 0.0618  0.0005  0.0747  36  TRP A CH2 
257  N N   . VAL A 37  ? 0.2442 0.3687 0.1552 0.0703  0.0158  0.0747  37  VAL A N   
258  C CA  . VAL A 37  ? 0.2465 0.3638 0.1541 0.0705  0.0178  0.0741  37  VAL A CA  
259  C C   . VAL A 37  ? 0.2436 0.3637 0.1518 0.0692  0.0147  0.0715  37  VAL A C   
260  O O   . VAL A 37  ? 0.3025 0.4233 0.2103 0.0678  0.0122  0.0713  37  VAL A O   
261  C CB  . VAL A 37  ? 0.2706 0.3778 0.1732 0.0706  0.0210  0.0764  37  VAL A CB  
262  C CG1 . VAL A 37  ? 0.2571 0.3569 0.1559 0.0710  0.0241  0.0762  37  VAL A CG1 
263  C CG2 . VAL A 37  ? 0.2575 0.3611 0.1588 0.0718  0.0237  0.0789  37  VAL A CG2 
264  N N   . ARG A 38  ? 0.3967 0.5178 0.3051 0.0695  0.0146  0.0695  38  ARG A N   
265  C CA  . ARG A 38  ? 0.3530 0.4768 0.2618 0.0687  0.0115  0.0668  38  ARG A CA  
266  C C   . ARG A 38  ? 0.4127 0.5304 0.3184 0.0691  0.0144  0.0674  38  ARG A C   
267  O O   . ARG A 38  ? 0.2845 0.3950 0.1872 0.0697  0.0191  0.0698  38  ARG A O   
268  C CB  . ARG A 38  ? 0.3516 0.4815 0.2622 0.0686  0.0086  0.0637  38  ARG A CB  
269  C CG  . ARG A 38  ? 0.2744 0.4014 0.1834 0.0692  0.0114  0.0638  38  ARG A CG  
270  C CD  . ARG A 38  ? 0.3207 0.4526 0.2301 0.0690  0.0078  0.0604  38  ARG A CD  
271  N NE  . ARG A 38  ? 0.2973 0.4257 0.2040 0.0692  0.0103  0.0609  38  ARG A NE  
272  C CZ  . ARG A 38  ? 0.2755 0.4058 0.1806 0.0689  0.0075  0.0580  38  ARG A CZ  
273  N NH1 . ARG A 38  ? 0.2739 0.4093 0.1798 0.0688  0.0019  0.0542  38  ARG A NH1 
274  N NH2 . ARG A 38  ? 0.2795 0.4049 0.1806 0.0686  0.0102  0.0588  38  ARG A NH2 
275  N N   . GLN A 39  ? 0.3926 0.5124 0.2982 0.0688  0.0119  0.0653  39  GLN A N   
276  C CA  . GLN A 39  ? 0.2832 0.3992 0.1864 0.0695  0.0147  0.0656  39  GLN A CA  
277  C C   . GLN A 39  ? 0.2796 0.4019 0.1843 0.0694  0.0106  0.0620  39  GLN A C   
278  O O   . GLN A 39  ? 0.2784 0.4036 0.1838 0.0690  0.0059  0.0599  39  GLN A O   
279  C CB  . GLN A 39  ? 0.2891 0.3975 0.1882 0.0703  0.0170  0.0679  39  GLN A CB  
280  C CG  . GLN A 39  ? 0.2931 0.3976 0.1889 0.0714  0.0198  0.0683  39  GLN A CG  
281  C CD  . GLN A 39  ? 0.3504 0.4459 0.2407 0.0724  0.0221  0.0704  39  GLN A CD  
282  O OE1 . GLN A 39  ? 0.3577 0.4529 0.2473 0.0718  0.0187  0.0702  39  GLN A OE1 
283  N NE2 . GLN A 39  ? 0.3086 0.3959 0.1941 0.0736  0.0283  0.0727  39  GLN A NE2 
284  N N   . ALA A 40  ? 0.2109 0.3343 0.1154 0.0693  0.0123  0.0614  40  ALA A N   
285  C CA  . ALA A 40  ? 0.4294 0.5591 0.3352 0.0694  0.0080  0.0576  40  ALA A CA  
286  C C   . ALA A 40  ? 0.5312 0.6588 0.4351 0.0709  0.0087  0.0580  40  ALA A C   
287  O O   . ALA A 40  ? 0.6871 0.8075 0.5878 0.0716  0.0143  0.0616  40  ALA A O   
288  C CB  . ALA A 40  ? 0.3928 0.5242 0.2981 0.0684  0.0100  0.0569  40  ALA A CB  
289  N N   . PRO A 41  ? 0.3302 0.4627 0.2351 0.0715  0.0027  0.0542  41  PRO A N   
290  C CA  . PRO A 41  ? 0.4075 0.5373 0.3097 0.0734  0.0032  0.0545  41  PRO A CA  
291  C C   . PRO A 41  ? 0.3366 0.4647 0.2367 0.0748  0.0100  0.0569  41  PRO A C   
292  O O   . PRO A 41  ? 0.3346 0.4674 0.2360 0.0739  0.0111  0.0557  41  PRO A O   
293  C CB  . PRO A 41  ? 0.4364 0.5715 0.3399 0.0737  -0.0052 0.0493  41  PRO A CB  
294  C CG  . PRO A 41  ? 0.3305 0.4682 0.2363 0.0714  -0.0100 0.0468  41  PRO A CG  
295  C CD  . PRO A 41  ? 0.3277 0.4661 0.2349 0.0706  -0.0050 0.0492  41  PRO A CD  
296  N N   . GLY A 42  ? 0.4830 0.6030 0.3786 0.0763  0.0151  0.0602  42  GLY A N   
297  C CA  . GLY A 42  ? 0.4451 0.5609 0.3370 0.0770  0.0238  0.0628  42  GLY A CA  
298  C C   . GLY A 42  ? 0.4497 0.5586 0.3398 0.0740  0.0331  0.0661  42  GLY A C   
299  O O   . GLY A 42  ? 0.4468 0.5501 0.3339 0.0726  0.0437  0.0678  42  GLY A O   
300  N N   . LYS A 43  ? 0.4210 0.5297 0.3132 0.0724  0.0306  0.0665  43  LYS A N   
301  C CA  . LYS A 43  ? 0.4543 0.5558 0.3444 0.0694  0.0384  0.0691  43  LYS A CA  
302  C C   . LYS A 43  ? 0.4498 0.5437 0.3380 0.0702  0.0379  0.0716  43  LYS A C   
303  O O   . LYS A 43  ? 0.5562 0.6522 0.4457 0.0720  0.0318  0.0708  43  LYS A O   
304  C CB  . LYS A 43  ? 0.4560 0.5643 0.3493 0.0667  0.0367  0.0667  43  LYS A CB  
305  C CG  . LYS A 43  ? 0.4942 0.6125 0.3896 0.0663  0.0399  0.0640  43  LYS A CG  
306  C CD  . LYS A 43  ? 0.2873 0.4224 0.1869 0.0695  0.0390  0.0638  43  LYS A CD  
307  C CE  . LYS A 43  ? 0.2905 0.4591 0.1985 0.0792  0.0451  0.0642  43  LYS A CE  
308  N NZ  . LYS A 43  ? 1.0100 1.1808 0.9278 0.0778  0.0674  0.0654  43  LYS A NZ  
309  N N   . GLY A 44  ? 0.5122 0.5968 0.3970 0.0681  0.0453  0.0742  44  GLY A N   
310  C CA  . GLY A 44  ? 0.4723 0.5493 0.3545 0.0691  0.0456  0.0764  44  GLY A CA  
311  C C   . GLY A 44  ? 0.4452 0.5285 0.3317 0.0694  0.0387  0.0751  44  GLY A C   
312  O O   . GLY A 44  ? 0.3365 0.4298 0.2278 0.0690  0.0334  0.0724  44  GLY A O   
313  N N   . LEU A 45  ? 0.4815 0.5590 0.3659 0.0702  0.0394  0.0769  45  LEU A N   
314  C CA  . LEU A 45  ? 0.3000 0.3832 0.1883 0.0703  0.0346  0.0760  45  LEU A CA  
315  C C   . LEU A 45  ? 0.3001 0.3831 0.1888 0.0692  0.0365  0.0762  45  LEU A C   
316  O O   . LEU A 45  ? 0.5545 0.6288 0.4386 0.0678  0.0430  0.0779  45  LEU A O   
317  C CB  . LEU A 45  ? 0.3044 0.3821 0.1901 0.0712  0.0349  0.0778  45  LEU A CB  
318  C CG  . LEU A 45  ? 0.4266 0.5063 0.3123 0.0716  0.0309  0.0772  45  LEU A CG  
319  C CD1 . LEU A 45  ? 0.3131 0.3820 0.1917 0.0726  0.0351  0.0788  45  LEU A CD1 
320  C CD2 . LEU A 45  ? 0.4368 0.5191 0.3241 0.0711  0.0280  0.0776  45  LEU A CD2 
321  N N   . GLU A 46  ? 0.3378 0.4296 0.2313 0.0695  0.0314  0.0744  46  GLU A N   
322  C CA  . GLU A 46  ? 0.4218 0.5135 0.3150 0.0689  0.0324  0.0744  46  GLU A CA  
323  C C   . GLU A 46  ? 0.3837 0.4803 0.2801 0.0705  0.0292  0.0743  46  GLU A C   
324  O O   . GLU A 46  ? 0.3951 0.5008 0.2962 0.0708  0.0243  0.0725  46  GLU A O   
325  C CB  . GLU A 46  ? 0.4737 0.5719 0.3686 0.0677  0.0299  0.0716  46  GLU A CB  
326  C CG  . GLU A 46  ? 0.5724 0.6689 0.4652 0.0667  0.0311  0.0713  46  GLU A CG  
327  C CD  . GLU A 46  ? 0.6429 0.7483 0.5381 0.0665  0.0257  0.0677  46  GLU A CD  
328  O OE1 . GLU A 46  ? 0.6474 0.7584 0.5448 0.0660  0.0227  0.0655  46  GLU A OE1 
329  O OE2 . GLU A 46  ? 0.6142 0.7206 0.5085 0.0669  0.0242  0.0668  46  GLU A OE2 
330  N N   . TRP A 47  ? 0.4575 0.5478 0.3510 0.0712  0.0326  0.0764  47  TRP A N   
331  C CA  . TRP A 47  ? 0.4092 0.5046 0.3056 0.0729  0.0303  0.0767  47  TRP A CA  
332  C C   . TRP A 47  ? 0.5742 0.6787 0.4741 0.0732  0.0266  0.0742  47  TRP A C   
333  O O   . TRP A 47  ? 0.6135 0.7167 0.5114 0.0722  0.0269  0.0728  47  TRP A O   
334  C CB  . TRP A 47  ? 0.4057 0.4924 0.2977 0.0739  0.0348  0.0791  47  TRP A CB  
335  C CG  . TRP A 47  ? 0.3945 0.4870 0.2896 0.0760  0.0330  0.0797  47  TRP A CG  
336  C CD1 . TRP A 47  ? 0.4338 0.5300 0.3315 0.0767  0.0316  0.0809  47  TRP A CD1 
337  C CD2 . TRP A 47  ? 0.4361 0.5314 0.3315 0.0777  0.0327  0.0793  47  TRP A CD2 
338  N NE1 . TRP A 47  ? 0.2884 0.3905 0.1887 0.0787  0.0308  0.0815  47  TRP A NE1 
339  C CE2 . TRP A 47  ? 0.4001 0.5016 0.2990 0.0798  0.0315  0.0805  47  TRP A CE2 
340  C CE3 . TRP A 47  ? 0.3888 0.4817 0.2812 0.0775  0.0335  0.0781  47  TRP A CE3 
341  C CZ2 . TRP A 47  ? 0.4525 0.5582 0.3523 0.0824  0.0313  0.0805  47  TRP A CZ2 
342  C CZ3 . TRP A 47  ? 0.4140 0.5098 0.3064 0.0800  0.0328  0.0780  47  TRP A CZ3 
343  C CH2 . TRP A 47  ? 0.4169 0.5193 0.3132 0.0828  0.0319  0.0792  47  TRP A CH2 
344  N N   . VAL A 48  ? 0.3138 0.4269 0.2182 0.0744  0.0234  0.0737  48  VAL A N   
345  C CA  . VAL A 48  ? 0.3717 0.4929 0.2785 0.0750  0.0199  0.0712  48  VAL A CA  
346  C C   . VAL A 48  ? 0.3112 0.4347 0.2184 0.0775  0.0206  0.0723  48  VAL A C   
347  O O   . VAL A 48  ? 0.3140 0.4354 0.2183 0.0786  0.0212  0.0715  48  VAL A O   
348  C CB  . VAL A 48  ? 0.3043 0.4339 0.2152 0.0738  0.0157  0.0693  48  VAL A CB  
349  C CG1 . VAL A 48  ? 0.3025 0.4380 0.2139 0.0743  0.0123  0.0663  48  VAL A CG1 
350  C CG2 . VAL A 48  ? 0.3035 0.4306 0.2138 0.0720  0.0151  0.0685  48  VAL A CG2 
351  N N   . ALA A 49  ? 0.2802 0.4081 0.1906 0.0783  0.0206  0.0741  49  ALA A N   
352  C CA  . ALA A 49  ? 0.3503 0.4822 0.2617 0.0811  0.0213  0.0753  49  ALA A CA  
353  C C   . ALA A 49  ? 0.4090 0.5423 0.3225 0.0816  0.0227  0.0784  49  ALA A C   
354  O O   . ALA A 49  ? 0.2853 0.4177 0.1995 0.0794  0.0222  0.0793  49  ALA A O   
355  C CB  . ALA A 49  ? 0.4642 0.6057 0.3782 0.0818  0.0181  0.0733  49  ALA A CB  
356  N N   . VAL A 50  ? 0.3433 0.4784 0.2569 0.0846  0.0244  0.0801  50  VAL A N   
357  C CA  . VAL A 50  ? 0.4042 0.5413 0.3196 0.0853  0.0257  0.0832  50  VAL A CA  
358  C C   . VAL A 50  ? 0.4280 0.5750 0.3467 0.0885  0.0256  0.0843  50  VAL A C   
359  O O   . VAL A 50  ? 0.5678 0.7151 0.4849 0.0914  0.0261  0.0831  50  VAL A O   
360  C CB  . VAL A 50  ? 0.3231 0.4481 0.2332 0.0861  0.0294  0.0851  50  VAL A CB  
361  C CG1 . VAL A 50  ? 0.3281 0.4477 0.2341 0.0892  0.0319  0.0849  50  VAL A CG1 
362  C CG2 . VAL A 50  ? 0.3250 0.4515 0.2363 0.0864  0.0303  0.0881  50  VAL A CG2 
363  N N   . ILE A 51  ? 0.4204 0.5753 0.3434 0.0879  0.0250  0.0867  51  ILE A N   
364  C CA  . ILE A 51  ? 0.4941 0.6588 0.4204 0.0913  0.0257  0.0887  51  ILE A CA  
365  C C   . ILE A 51  ? 0.5181 0.6839 0.4457 0.0915  0.0273  0.0924  51  ILE A C   
366  O O   . ILE A 51  ? 0.6110 0.7763 0.5395 0.0878  0.0262  0.0937  51  ILE A O   
367  C CB  . ILE A 51  ? 0.4199 0.5972 0.3508 0.0902  0.0231  0.0882  51  ILE A CB  
368  C CG1 . ILE A 51  ? 0.3025 0.4905 0.2366 0.0942  0.0243  0.0907  51  ILE A CG1 
369  C CG2 . ILE A 51  ? 0.3719 0.5518 0.3051 0.0850  0.0207  0.0891  51  ILE A CG2 
370  C CD1 . ILE A 51  ? 0.3004 0.4997 0.2374 0.0938  0.0223  0.0903  51  ILE A CD1 
371  N N   . TRP A 52  ? 0.5578 0.7000 0.4330 0.1744  0.0324  -0.1165 52  TRP A N   
372  C CA  . TRP A 52  ? 0.4924 0.6514 0.3655 0.1837  0.0267  -0.1188 52  TRP A CA  
373  C C   . TRP A 52  ? 0.5764 0.7465 0.4610 0.1804  0.0203  -0.1263 52  TRP A C   
374  O O   . TRP A 52  ? 0.5624 0.7205 0.4506 0.1730  0.0196  -0.1286 52  TRP A O   
375  C CB  . TRP A 52  ? 0.4965 0.6387 0.3508 0.1932  0.0236  -0.1160 52  TRP A CB  
376  C CG  . TRP A 52  ? 0.5908 0.7290 0.4339 0.1992  0.0296  -0.1085 52  TRP A CG  
377  C CD1 . TRP A 52  ? 0.5512 0.6904 0.3976 0.1947  0.0385  -0.1034 52  TRP A CD1 
378  C CD2 . TRP A 52  ? 0.6449 0.7790 0.4725 0.2113  0.0280  -0.1049 52  TRP A CD2 
379  N NE1 . TRP A 52  ? 0.5697 0.7064 0.4035 0.2027  0.0431  -0.0962 52  TRP A NE1 
380  C CE2 . TRP A 52  ? 0.7411 0.8737 0.5627 0.2132  0.0367  -0.0969 52  TRP A CE2 
381  C CE3 . TRP A 52  ? 0.7706 0.9027 0.5895 0.2209  0.0205  -0.1075 52  TRP A CE3 
382  C CZ2 . TRP A 52  ? 0.8152 0.9436 0.6213 0.2246  0.0382  -0.0907 52  TRP A CZ2 
383  C CZ3 . TRP A 52  ? 0.8742 1.0011 0.6776 0.2325  0.0213  -0.1022 52  TRP A CZ3 
384  C CH2 . TRP A 52  ? 0.8963 1.0210 0.6931 0.2344  0.0302  -0.0936 52  TRP A CH2 
385  N N   . TYR A 53  ? 0.5710 0.7652 0.4614 0.1859  0.0160  -0.1304 53  TYR A N   
386  C CA  . TYR A 53  ? 0.3920 0.6015 0.2966 0.1818  0.0111  -0.1385 53  TYR A CA  
387  C C   . TYR A 53  ? 0.3924 0.5874 0.2941 0.1799  0.0069  -0.1411 53  TYR A C   
388  O O   . TYR A 53  ? 0.7682 0.9653 0.6813 0.1718  0.0065  -0.1453 53  TYR A O   
389  C CB  . TYR A 53  ? 0.3952 0.6324 0.3039 0.1893  0.0063  -0.1433 53  TYR A CB  
390  C CG  . TYR A 53  ? 0.4072 0.6428 0.3044 0.2000  0.0002  -0.1433 53  TYR A CG  
391  C CD1 . TYR A 53  ? 0.5455 0.7925 0.4493 0.2011  -0.0064 -0.1506 53  TYR A CD1 
392  C CD2 . TYR A 53  ? 0.4216 0.6441 0.3015 0.2091  0.0016  -0.1362 53  TYR A CD2 
393  C CE1 . TYR A 53  ? 0.5431 0.7892 0.4370 0.2114  -0.0118 -0.1511 53  TYR A CE1 
394  C CE2 . TYR A 53  ? 0.4341 0.6541 0.3034 0.2195  -0.0039 -0.1365 53  TYR A CE2 
395  C CZ  . TYR A 53  ? 0.4315 0.6638 0.3080 0.2207  -0.0107 -0.1441 53  TYR A CZ  
396  O OH  . TYR A 53  ? 0.4445 0.6750 0.3110 0.2315  -0.0161 -0.1450 53  TYR A OH  
397  N N   . ASP A 54  ? 0.3948 0.5755 0.2815 0.1874  0.0041  -0.1389 54  ASP A N   
398  C CA  . ASP A 54  ? 0.3983 0.5654 0.2811 0.1860  0.0008  -0.1419 54  ASP A CA  
399  C C   . ASP A 54  ? 0.5550 0.6962 0.4311 0.1788  0.0047  -0.1390 54  ASP A C   
400  O O   . ASP A 54  ? 0.5274 0.6613 0.4050 0.1737  0.0037  -0.1421 54  ASP A O   
401  C CB  . ASP A 54  ? 0.4146 0.5776 0.2845 0.1973  -0.0041 -0.1426 54  ASP A CB  
402  C CG  . ASP A 54  ? 0.5125 0.6608 0.3663 0.2046  -0.0020 -0.1363 54  ASP A CG  
403  O OD1 . ASP A 54  ? 0.5634 0.7019 0.4151 0.2000  0.0038  -0.1313 54  ASP A OD1 
404  O OD2 . ASP A 54  ? 0.4428 0.5895 0.2862 0.2151  -0.0059 -0.1365 54  ASP A OD2 
405  N N   . GLY A 55  ? 0.5714 0.7001 0.4400 0.1784  0.0093  -0.1334 55  GLY A N   
406  C CA  . GLY A 55  ? 0.4076 0.5114 0.2683 0.1721  0.0123  -0.1314 55  GLY A CA  
407  C C   . GLY A 55  ? 0.5371 0.6180 0.3785 0.1782  0.0110  -0.1299 55  GLY A C   
408  O O   . GLY A 55  ? 0.5098 0.5684 0.3423 0.1734  0.0122  -0.1298 55  GLY A O   
409  N N   . SER A 56  ? 0.4596 0.5458 0.2941 0.1889  0.0081  -0.1293 56  SER A N   
410  C CA  . SER A 56  ? 0.5697 0.6342 0.3857 0.1962  0.0066  -0.1283 56  SER A CA  
411  C C   . SER A 56  ? 0.6022 0.6480 0.4099 0.1928  0.0121  -0.1236 56  SER A C   
412  O O   . SER A 56  ? 0.6685 0.6887 0.4621 0.1931  0.0106  -0.1251 56  SER A O   
413  C CB  . SER A 56  ? 0.5585 0.6353 0.3699 0.2088  0.0038  -0.1269 56  SER A CB  
414  O OG  . SER A 56  ? 0.4798 0.5776 0.2988 0.2103  0.0078  -0.1222 56  SER A OG  
415  N N   . LYS A 57  ? 0.4635 0.5226 0.2803 0.1894  0.0184  -0.1188 57  LYS A N   
416  C CA  . LYS A 57  ? 0.4662 0.5100 0.2776 0.1850  0.0247  -0.1147 57  LYS A CA  
417  C C   . LYS A 57  ? 0.4471 0.5058 0.2744 0.1764  0.0315  -0.1122 57  LYS A C   
418  O O   . LYS A 57  ? 0.4335 0.5174 0.2755 0.1759  0.0317  -0.1128 57  LYS A O   
419  C CB  . LYS A 57  ? 0.7206 0.7604 0.5198 0.1946  0.0279  -0.1092 57  LYS A CB  
420  C CG  . LYS A 57  ? 0.9604 0.9668 0.7422 0.1947  0.0272  -0.1102 57  LYS A CG  
421  C CD  . LYS A 57  ? 1.0531 1.0555 0.8246 0.2028  0.0327  -0.1035 57  LYS A CD  
422  C CE  . LYS A 57  ? 1.0524 1.0718 0.8204 0.2159  0.0306  -0.1005 57  LYS A CE  
423  N NZ  . LYS A 57  ? 1.0318 1.0429 0.7862 0.2249  0.0361  -0.0934 57  LYS A NZ  
424  N N   . ARG A 58  ? 0.8034 0.8460 0.6280 0.1697  0.0363  -0.1107 58  ARG A N   
425  C CA  . ARG A 58  ? 0.6970 0.7510 0.5368 0.1615  0.0433  -0.1087 58  ARG A CA  
426  C C   . ARG A 58  ? 0.6168 0.6576 0.4514 0.1590  0.0509  -0.1047 58  ARG A C   
427  O O   . ARG A 58  ? 0.5488 0.5628 0.3677 0.1587  0.0482  -0.1067 58  ARG A O   
428  C CB  . ARG A 58  ? 0.4416 0.4913 0.2892 0.1524  0.0399  -0.1136 58  ARG A CB  
429  C CG  . ARG A 58  ? 0.7715 0.7928 0.6037 0.1492  0.0344  -0.1177 58  ARG A CG  
430  C CD  . ARG A 58  ? 0.4483 0.4708 0.2858 0.1437  0.0297  -0.1223 58  ARG A CD  
431  N NE  . ARG A 58  ? 0.7896 0.8292 0.6325 0.1494  0.0256  -0.1241 58  ARG A NE  
432  C CZ  . ARG A 58  ? 0.8997 0.9460 0.7496 0.1459  0.0226  -0.1277 58  ARG A CZ  
433  N NH1 . ARG A 58  ? 0.9277 0.9649 0.7788 0.1373  0.0232  -0.1291 58  ARG A NH1 
434  N NH2 . ARG A 58  ? 0.8973 0.9596 0.7526 0.1511  0.0191  -0.1300 58  ARG A NH2 
435  N N   . TYR A 59  ? 0.5578 0.6181 0.4068 0.1568  0.0601  -0.0999 59  TYR A N   
436  C CA  . TYR A 59  ? 0.5736 0.6311 0.4184 0.1606  0.0674  -0.0951 59  TYR A CA  
437  C C   . TYR A 59  ? 0.4174 0.4897 0.2819 0.1551  0.0730  -0.0948 59  TYR A C   
438  O O   . TYR A 59  ? 0.4871 0.5732 0.3740 0.1436  0.0764  -0.0960 59  TYR A O   
439  C CB  . TYR A 59  ? 0.4447 0.5225 0.2842 0.1738  0.0737  -0.0858 59  TYR A CB  
440  C CG  . TYR A 59  ? 0.4660 0.5295 0.2831 0.1849  0.0682  -0.0847 59  TYR A CG  
441  C CD1 . TYR A 59  ? 0.8097 0.8386 0.6020 0.1929  0.0589  -0.0894 59  TYR A CD1 
442  C CD2 . TYR A 59  ? 0.6273 0.7099 0.4474 0.1881  0.0714  -0.0798 59  TYR A CD2 
443  C CE1 . TYR A 59  ? 0.8421 0.8561 0.6151 0.2043  0.0536  -0.0890 59  TYR A CE1 
444  C CE2 . TYR A 59  ? 0.4849 0.5558 0.2850 0.2005  0.0663  -0.0784 59  TYR A CE2 
445  C CZ  . TYR A 59  ? 0.5089 0.5454 0.2862 0.2090  0.0579  -0.0828 59  TYR A CZ  
446  O OH  . TYR A 59  ? 0.5627 0.5855 0.3207 0.2225  0.0526  -0.0820 59  TYR A OH  
447  N N   . TYR A 60  ? 0.4132 0.4805 0.2663 0.1675  0.0729  -0.0930 60  TYR A N   
448  C CA  . TYR A 60  ? 0.3992 0.4831 0.2736 0.1647  0.0779  -0.0927 60  TYR A CA  
449  C C   . TYR A 60  ? 0.5945 0.7065 0.4767 0.1790  0.0899  -0.0797 60  TYR A C   
450  O O   . TYR A 60  ? 0.6552 0.7691 0.5196 0.1928  0.0949  -0.0692 60  TYR A O   
451  C CB  . TYR A 60  ? 0.4105 0.4660 0.2708 0.1654  0.0675  -0.1013 60  TYR A CB  
452  C CG  . TYR A 60  ? 0.3964 0.4356 0.2584 0.1485  0.0596  -0.1092 60  TYR A CG  
453  C CD1 . TYR A 60  ? 0.4279 0.4661 0.3007 0.1410  0.0567  -0.1139 60  TYR A CD1 
454  C CD2 . TYR A 60  ? 0.5796 0.6074 0.4339 0.1416  0.0567  -0.1100 60  TYR A CD2 
455  C CE1 . TYR A 60  ? 0.3736 0.3998 0.2469 0.1272  0.0525  -0.1171 60  TYR A CE1 
456  C CE2 . TYR A 60  ? 0.5524 0.5701 0.4110 0.1274  0.0533  -0.1134 60  TYR A CE2 
457  C CZ  . TYR A 60  ? 0.3718 0.3882 0.2386 0.1200  0.0520  -0.1160 60  TYR A CZ  
458  O OH  . TYR A 60  ? 0.6094 0.6251 0.4735 0.1184  0.0448  -0.1195 60  TYR A OH  
459  N N   . ALA A 61  ? 0.3896 0.5269 0.3024 0.1759  0.0962  -0.0771 61  ALA A N   
460  C CA  . ALA A 61  ? 0.5257 0.6805 0.4645 0.1696  0.0990  -0.0530 61  ALA A CA  
461  C C   . ALA A 61  ? 0.5666 0.6730 0.5048 0.1507  0.0761  -0.0383 61  ALA A C   
462  O O   . ALA A 61  ? 0.6039 0.6834 0.5337 0.1453  0.0639  -0.0502 61  ALA A O   
463  C CB  . ALA A 61  ? 0.3634 0.5663 0.3466 0.1662  0.1121  -0.0538 61  ALA A CB  
464  N N   . ASP A 62  ? 0.6254 0.7219 0.5722 0.1405  0.0699  -0.0125 62  ASP A N   
465  C CA  . ASP A 62  ? 0.6236 0.6758 0.5738 0.1217  0.0476  0.0018  62  ASP A CA  
466  C C   . ASP A 62  ? 0.5827 0.6374 0.5612 0.1073  0.0398  0.0000  62  ASP A C   
467  O O   . ASP A 62  ? 0.5328 0.5493 0.5021 0.0963  0.0207  -0.0027 62  ASP A O   
468  C CB  . ASP A 62  ? 0.6757 0.7274 0.6423 0.1116  0.0453  0.0323  62  ASP A CB  
469  C CG  . ASP A 62  ? 0.7164 0.7528 0.6535 0.1230  0.0466  0.0383  62  ASP A CG  
470  O OD1 . ASP A 62  ? 0.7656 0.7584 0.6716 0.1272  0.0335  0.0271  62  ASP A OD1 
471  O OD2 . ASP A 62  ? 0.6801 0.7494 0.6262 0.1278  0.0605  0.0546  62  ASP A OD2 
472  N N   . SER A 63  ? 0.4482 0.5496 0.4615 0.1079  0.0546  0.0006  63  SER A N   
473  C CA  . SER A 63  ? 0.4074 0.5172 0.4544 0.0954  0.0486  0.0008  63  SER A CA  
474  C C   . SER A 63  ? 0.3998 0.4902 0.4285 0.0983  0.0409  -0.0212 63  SER A C   
475  O O   . SER A 63  ? 0.6090 0.6860 0.6528 0.0847  0.0268  -0.0183 63  SER A O   
476  C CB  . SER A 63  ? 0.3751 0.5427 0.4641 0.0992  0.0685  0.0017  63  SER A CB  
477  O OG  . SER A 63  ? 0.3831 0.5735 0.4863 0.0970  0.0775  0.0220  63  SER A OG  
478  N N   . VAL A 64  ? 0.5496 0.6421 0.5475 0.1158  0.0507  -0.0424 64  VAL A N   
479  C CA  . VAL A 64  ? 0.5041 0.5807 0.4828 0.1192  0.0452  -0.0631 64  VAL A CA  
480  C C   . VAL A 64  ? 0.5197 0.5489 0.4506 0.1205  0.0307  -0.0727 64  VAL A C   
481  O O   . VAL A 64  ? 0.5134 0.5315 0.4266 0.1227  0.0267  -0.0896 64  VAL A O   
482  C CB  . VAL A 64  ? 0.4012 0.5150 0.3826 0.1372  0.0659  -0.0845 64  VAL A CB  
483  C CG1 . VAL A 64  ? 0.3709 0.5306 0.4034 0.1352  0.0783  -0.0805 64  VAL A CG1 
484  C CG2 . VAL A 64  ? 0.4057 0.5280 0.3590 0.1550  0.0789  -0.0926 64  VAL A CG2 
485  N N   . LYS A 65  ? 0.5073 0.5098 0.4187 0.1194  0.0232  -0.0628 65  LYS A N   
486  C CA  . LYS A 65  ? 0.5736 0.5326 0.4420 0.1224  0.0101  -0.0748 65  LYS A CA  
487  C C   . LYS A 65  ? 0.6561 0.5849 0.5157 0.1082  -0.0097 -0.0801 65  LYS A C   
488  O O   . LYS A 65  ? 0.6736 0.5984 0.5583 0.0909  -0.0216 -0.0648 65  LYS A O   
489  C CB  . LYS A 65  ? 0.6592 0.5920 0.5171 0.1209  0.0025  -0.0600 65  LYS A CB  
490  C CG  . LYS A 65  ? 0.7543 0.7067 0.6029 0.1385  0.0191  -0.0589 65  LYS A CG  
491  C CD  . LYS A 65  ? 0.8464 0.7603 0.6590 0.1469  0.0102  -0.0650 65  LYS A CD  
492  C CE  . LYS A 65  ? 0.8290 0.7655 0.6301 0.1663  0.0267  -0.0657 65  LYS A CE  
493  N NZ  . LYS A 65  ? 0.7512 0.7176 0.5404 0.1830  0.0429  -0.0904 65  LYS A NZ  
494  N N   . GLY A 66  ? 0.7043 0.6146 0.5281 0.1157  -0.0131 -0.1019 66  GLY A N   
495  C CA  . GLY A 66  ? 0.6853 0.5673 0.4924 0.1036  -0.0319 -0.1092 66  GLY A CA  
496  C C   . GLY A 66  ? 0.6195 0.5236 0.4456 0.0967  -0.0307 -0.1107 66  GLY A C   
497  O O   . GLY A 66  ? 0.5729 0.4621 0.3809 0.0898  -0.0424 -0.1198 66  GLY A O   
498  N N   . ARG A 67  ? 0.4966 0.4381 0.3600 0.0991  -0.0163 -0.1020 67  ARG A N   
499  C CA  . ARG A 67  ? 0.4717 0.4370 0.3643 0.0927  -0.0146 -0.1001 67  ARG A CA  
500  C C   . ARG A 67  ? 0.4724 0.4662 0.3644 0.1091  0.0050  -0.1182 67  ARG A C   
501  O O   . ARG A 67  ? 0.4386 0.4306 0.3182 0.1094  0.0032  -0.1302 67  ARG A O   
502  C CB  . ARG A 67  ? 0.4578 0.4458 0.4000 0.0826  -0.0134 -0.0784 67  ARG A CB  
503  C CG  . ARG A 67  ? 0.4842 0.4465 0.4342 0.0633  -0.0347 -0.0597 67  ARG A CG  
504  C CD  . ARG A 67  ? 0.5419 0.5294 0.5395 0.0563  -0.0298 -0.0390 67  ARG A CD  
505  N NE  . ARG A 67  ? 0.5248 0.5501 0.5620 0.0578  -0.0191 -0.0390 67  ARG A NE  
506  C CZ  . ARG A 67  ? 0.4124 0.4761 0.4839 0.0649  -0.0008 -0.0352 67  ARG A CZ  
507  N NH1 . ARG A 67  ? 0.4179 0.4892 0.4867 0.0705  0.0091  -0.0288 67  ARG A NH1 
508  N NH2 . ARG A 67  ? 0.5300 0.6258 0.6395 0.0663  0.0073  -0.0378 67  ARG A NH2 
509  N N   . PHE A 68  ? 0.3972 0.4192 0.3037 0.1221  0.0235  -0.1197 68  PHE A N   
510  C CA  . PHE A 68  ? 0.3693 0.4186 0.2825 0.1324  0.0415  -0.1321 68  PHE A CA  
511  C C   . PHE A 68  ? 0.4883 0.5135 0.3748 0.1227  0.0393  -0.1296 68  PHE A C   
512  O O   . PHE A 68  ? 0.5084 0.5093 0.3660 0.1261  0.0314  -0.1321 68  PHE A O   
513  C CB  . PHE A 68  ? 0.3496 0.4307 0.2935 0.1344  0.0572  -0.1224 68  PHE A CB  
514  C CG  . PHE A 68  ? 0.4856 0.6029 0.4761 0.1379  0.0630  -0.1195 68  PHE A CG  
515  C CD1 . PHE A 68  ? 0.5671 0.6657 0.5732 0.1190  0.0453  -0.1000 68  PHE A CD1 
516  C CD2 . PHE A 68  ? 0.4422 0.5829 0.4659 0.1301  0.0750  -0.1120 68  PHE A CD2 
517  C CE1 . PHE A 68  ? 0.3275 0.4507 0.3832 0.1098  0.0461  -0.0868 68  PHE A CE1 
518  C CE2 . PHE A 68  ? 0.4246 0.5989 0.4974 0.1300  0.0796  -0.1076 68  PHE A CE2 
519  C CZ  . PHE A 68  ? 0.2965 0.4639 0.3882 0.1196  0.0651  -0.0942 68  PHE A CZ  
520  N N   . THR A 69  ? 0.4933 0.5236 0.3925 0.1113  0.0458  -0.1247 69  THR A N   
521  C CA  . THR A 69  ? 0.3766 0.3931 0.2634 0.1033  0.0470  -0.1215 69  THR A CA  
522  C C   . THR A 69  ? 0.3636 0.4072 0.2687 0.1084  0.0493  -0.1198 69  THR A C   
523  O O   . THR A 69  ? 0.4980 0.5547 0.4204 0.1063  0.0507  -0.1201 69  THR A O   
524  C CB  . THR A 69  ? 0.3883 0.3894 0.2573 0.0987  0.0378  -0.1260 69  THR A CB  
525  O OG1 . THR A 69  ? 0.4116 0.3950 0.2598 0.1006  0.0268  -0.1325 69  THR A OG1 
526  C CG2 . THR A 69  ? 0.5496 0.5485 0.4054 0.1043  0.0326  -0.1277 69  THR A CG2 
527  N N   . ILE A 70  ? 0.3570 0.4081 0.2573 0.1149  0.0487  -0.1189 70  ILE A N   
528  C CA  . ILE A 70  ? 0.3488 0.4243 0.2625 0.1189  0.0486  -0.1193 70  ILE A CA  
529  C C   . ILE A 70  ? 0.7044 0.7798 0.6077 0.1228  0.0409  -0.1224 70  ILE A C   
530  O O   . ILE A 70  ? 0.8314 0.8932 0.7173 0.1268  0.0374  -0.1226 70  ILE A O   
531  C CB  . ILE A 70  ? 0.4700 0.5608 0.3898 0.1240  0.0543  -0.1160 70  ILE A CB  
532  C CG1 . ILE A 70  ? 0.3723 0.4879 0.3030 0.1275  0.0522  -0.1186 70  ILE A CG1 
533  C CG2 . ILE A 70  ? 0.4800 0.5578 0.3801 0.1295  0.0537  -0.1137 70  ILE A CG2 
534  C CD1 . ILE A 70  ? 0.3473 0.4806 0.2822 0.1326  0.0572  -0.1161 70  ILE A CD1 
535  N N   . SER A 71  ? 0.6179 0.7084 0.5332 0.1217  0.0385  -0.1254 71  SER A N   
536  C CA  . SER A 71  ? 0.5725 0.6673 0.4825 0.1256  0.0323  -0.1287 71  SER A CA  
537  C C   . SER A 71  ? 0.3442 0.4627 0.2716 0.1255  0.0313  -0.1324 71  SER A C   
538  O O   . SER A 71  ? 0.3337 0.4640 0.2768 0.1222  0.0351  -0.1329 71  SER A O   
539  C CB  . SER A 71  ? 0.3854 0.4638 0.2849 0.1219  0.0291  -0.1306 71  SER A CB  
540  O OG  . SER A 71  ? 0.3495 0.4321 0.2607 0.1153  0.0306  -0.1317 71  SER A OG  
541  N N   . ARG A 72  ? 0.4562 0.5816 0.3814 0.1291  0.0262  -0.1359 72  ARG A N   
542  C CA  . ARG A 72  ? 0.3451 0.4926 0.2857 0.1287  0.0243  -0.1411 72  ARG A CA  
543  C C   . ARG A 72  ? 0.4200 0.5689 0.3592 0.1289  0.0200  -0.1450 72  ARG A C   
544  O O   . ARG A 72  ? 0.4502 0.5893 0.3755 0.1333  0.0172  -0.1446 72  ARG A O   
545  C CB  . ARG A 72  ? 0.3486 0.5131 0.2909 0.1354  0.0229  -0.1423 72  ARG A CB  
546  C CG  . ARG A 72  ? 0.3625 0.5210 0.2882 0.1443  0.0194  -0.1403 72  ARG A CG  
547  C CD  . ARG A 72  ? 0.3661 0.5410 0.2926 0.1509  0.0196  -0.1400 72  ARG A CD  
548  N NE  . ARG A 72  ? 0.3607 0.5605 0.3008 0.1514  0.0161  -0.1470 72  ARG A NE  
549  C CZ  . ARG A 72  ? 0.3621 0.5821 0.3072 0.1552  0.0162  -0.1493 72  ARG A CZ  
550  N NH1 . ARG A 72  ? 0.3677 0.5865 0.3062 0.1588  0.0206  -0.1439 72  ARG A NH1 
551  N NH2 . ARG A 72  ? 0.4817 0.7241 0.4391 0.1551  0.0122  -0.1576 72  ARG A NH2 
552  N N   . ASP A 73  ? 0.4886 0.6500 0.4430 0.1240  0.0201  -0.1495 73  ASP A N   
553  C CA  . ASP A 73  ? 0.4559 0.6226 0.4118 0.1238  0.0171  -0.1540 73  ASP A CA  
554  C C   . ASP A 73  ? 0.4551 0.6454 0.4237 0.1261  0.0141  -0.1604 73  ASP A C   
555  O O   . ASP A 73  ? 0.3563 0.5585 0.3411 0.1212  0.0156  -0.1647 73  ASP A O   
556  C CB  . ASP A 73  ? 0.5898 0.7506 0.5520 0.1159  0.0203  -0.1544 73  ASP A CB  
557  C CG  . ASP A 73  ? 0.6746 0.8390 0.6365 0.1152  0.0187  -0.1584 73  ASP A CG  
558  O OD1 . ASP A 73  ? 0.6078 0.7881 0.5764 0.1180  0.0155  -0.1637 73  ASP A OD1 
559  O OD2 . ASP A 73  ? 0.8302 0.9819 0.7844 0.1118  0.0208  -0.1567 73  ASP A OD2 
560  N N   . ASN A 74  ? 0.5783 0.4813 0.6174 0.0997  0.1025  -0.0934 74  ASN A N   
561  C CA  . ASN A 74  ? 0.5877 0.4917 0.6389 0.0917  0.1058  -0.0906 74  ASN A CA  
562  C C   . ASN A 74  ? 0.5845 0.5012 0.6370 0.0875  0.1178  -0.0900 74  ASN A C   
563  O O   . ASN A 74  ? 0.6375 0.5570 0.6970 0.0788  0.1240  -0.0857 74  ASN A O   
564  C CB  . ASN A 74  ? 0.5257 0.4214 0.5909 0.0956  0.0940  -0.0981 74  ASN A CB  
565  C CG  . ASN A 74  ? 0.4508 0.3323 0.5221 0.0928  0.0838  -0.0941 74  ASN A CG  
566  O OD1 . ASN A 74  ? 0.4493 0.3240 0.5118 0.0922  0.0825  -0.0883 74  ASN A OD1 
567  N ND2 . ASN A 74  ? 0.4813 0.3586 0.5692 0.0909  0.0759  -0.0969 74  ASN A ND2 
568  N N   . SER A 75  ? 0.5586 0.4823 0.6049 0.0938  0.1207  -0.0945 75  SER A N   
569  C CA  . SER A 75  ? 0.5332 0.4667 0.5792 0.0900  0.1325  -0.0927 75  SER A CA  
570  C C   . SER A 75  ? 0.5418 0.4724 0.5813 0.0792  0.1440  -0.0802 75  SER A C   
571  O O   . SER A 75  ? 0.5190 0.4494 0.5662 0.0705  0.1511  -0.0765 75  SER A O   
572  C CB  . SER A 75  ? 0.5574 0.4955 0.5968 0.0983  0.1366  -0.0983 75  SER A CB  
573  O OG  . SER A 75  ? 0.5935 0.5340 0.6318 0.0926  0.1535  -0.0936 75  SER A OG  
574  N N   . LYS A 76  ? 0.5903 0.5176 0.6153 0.0803  0.1452  -0.0740 76  LYS A N   
575  C CA  . LYS A 76  ? 0.4375 0.3583 0.4525 0.0722  0.1558  -0.0610 76  LYS A CA  
576  C C   . LYS A 76  ? 0.5531 0.4707 0.5693 0.0657  0.1509  -0.0547 76  LYS A C   
577  O O   . LYS A 76  ? 0.4204 0.3315 0.4288 0.0592  0.1582  -0.0441 76  LYS A O   
578  C CB  . LYS A 76  ? 0.4470 0.3650 0.4450 0.0769  0.1585  -0.0563 76  LYS A CB  
579  C CG  . LYS A 76  ? 0.5694 0.4921 0.5650 0.0846  0.1629  -0.0632 76  LYS A CG  
580  C CD  . LYS A 76  ? 0.6107 0.5286 0.5883 0.0873  0.1704  -0.0553 76  LYS A CD  
581  C CE  . LYS A 76  ? 0.6203 0.5394 0.5888 0.0923  0.1600  -0.0561 76  LYS A CE  
582  N NZ  . LYS A 76  ? 0.6260 0.5544 0.6022 0.1012  0.1481  -0.0716 76  LYS A NZ  
583  N N   . ASN A 77  ? 0.5208 0.4380 0.5466 0.0678  0.1412  -0.0606 77  ASN A N   
584  C CA  . ASN A 77  ? 0.5923 0.5031 0.6202 0.0624  0.1392  -0.0549 77  ASN A CA  
585  C C   . ASN A 77  ? 0.4899 0.3947 0.5019 0.0622  0.1401  -0.0455 77  ASN A C   
586  O O   . ASN A 77  ? 0.3548 0.2566 0.3616 0.0557  0.1442  -0.0363 77  ASN A O   
587  C CB  . ASN A 77  ? 0.5476 0.4608 0.5825 0.0531  0.1457  -0.0511 77  ASN A CB  
588  C CG  . ASN A 77  ? 0.4394 0.3583 0.4922 0.0530  0.1439  -0.0608 77  ASN A CG  
589  O OD1 . ASN A 77  ? 0.3634 0.2868 0.4202 0.0582  0.1432  -0.0682 77  ASN A OD1 
590  N ND2 . ASN A 77  ? 0.3481 0.2674 0.4119 0.0476  0.1432  -0.0611 77  ASN A ND2 
591  N N   . THR A 78  ? 0.4667 0.3702 0.4712 0.0700  0.1355  -0.0488 78  THR A N   
592  C CA  . THR A 78  ? 0.3525 0.2512 0.3417 0.0711  0.1360  -0.0410 78  THR A CA  
593  C C   . THR A 78  ? 0.3565 0.2469 0.3472 0.0776  0.1263  -0.0458 78  THR A C   
594  O O   . THR A 78  ? 0.3639 0.2540 0.3617 0.0848  0.1182  -0.0569 78  THR A O   
595  C CB  . THR A 78  ? 0.5810 0.4847 0.5579 0.0748  0.1398  -0.0398 78  THR A CB  
596  O OG1 . THR A 78  ? 0.6045 0.5107 0.5806 0.0690  0.1481  -0.0344 78  THR A OG1 
597  C CG2 . THR A 78  ? 0.6039 0.5031 0.5652 0.0767  0.1392  -0.0321 78  THR A CG2 
598  N N   . LEU A 79  ? 0.4377 0.3199 0.4221 0.0752  0.1262  -0.0376 79  LEU A N   
599  C CA  . LEU A 79  ? 0.3940 0.2647 0.3776 0.0814  0.1168  -0.0401 79  LEU A CA  
600  C C   . LEU A 79  ? 0.4748 0.3480 0.4414 0.0866  0.1182  -0.0380 79  LEU A C   
601  O O   . LEU A 79  ? 0.5489 0.4281 0.5027 0.0830  0.1265  -0.0289 79  LEU A O   
602  C CB  . LEU A 79  ? 0.3301 0.1892 0.3158 0.0770  0.1158  -0.0316 79  LEU A CB  
603  C CG  . LEU A 79  ? 0.3389 0.1808 0.3228 0.0816  0.1054  -0.0297 79  LEU A CG  
604  C CD1 . LEU A 79  ? 0.3459 0.1784 0.3488 0.0833  0.0869  -0.0384 79  LEU A CD1 
605  C CD2 . LEU A 79  ? 0.3305 0.1743 0.3121 0.0707  0.1020  -0.0148 79  LEU A CD2 
606  N N   . PHE A 80  ? 0.4517 0.3196 0.4193 0.0950  0.1084  -0.0468 80  PHE A N   
607  C CA  . PHE A 80  ? 0.4478 0.3188 0.4000 0.1010  0.1088  -0.0466 80  PHE A CA  
608  C C   . PHE A 80  ? 0.3821 0.2385 0.3304 0.1059  0.0995  -0.0461 80  PHE A C   
609  O O   . PHE A 80  ? 0.3867 0.2283 0.3483 0.1071  0.0876  -0.0509 80  PHE A O   
610  C CB  . PHE A 80  ? 0.3832 0.2632 0.3387 0.1077  0.1059  -0.0591 80  PHE A CB  
611  C CG  . PHE A 80  ? 0.5281 0.4212 0.4838 0.1040  0.1153  -0.0581 80  PHE A CG  
612  C CD1 . PHE A 80  ? 0.5342 0.4341 0.4754 0.1025  0.1237  -0.0499 80  PHE A CD1 
613  C CD2 . PHE A 80  ? 0.5602 0.4570 0.5308 0.1025  0.1144  -0.0650 80  PHE A CD2 
614  C CE1 . PHE A 80  ? 0.5711 0.4790 0.5133 0.0992  0.1312  -0.0484 80  PHE A CE1 
615  C CE2 . PHE A 80  ? 0.3762 0.2833 0.3468 0.0995  0.1228  -0.0639 80  PHE A CE2 
616  C CZ  . PHE A 80  ? 0.5584 0.4701 0.5152 0.0976  0.1313  -0.0554 80  PHE A CZ  
617  N N   . LEU A 81  ? 0.3930 0.2519 0.3237 0.1084  0.1030  -0.0396 81  LEU A N   
618  C CA  . LEU A 81  ? 0.4033 0.2490 0.3287 0.1150  0.0928  -0.0408 81  LEU A CA  
619  C C   . LEU A 81  ? 0.4124 0.2680 0.3231 0.1231  0.0920  -0.0452 81  LEU A C   
620  O O   . LEU A 81  ? 0.4088 0.2758 0.3051 0.1216  0.1013  -0.0367 81  LEU A O   
621  C CB  . LEU A 81  ? 0.4762 0.3225 0.3998 0.1042  0.0908  -0.0257 81  LEU A CB  
622  C CG  . LEU A 81  ? 0.4771 0.3247 0.4030 0.1003  0.0716  -0.0232 81  LEU A CG  
623  C CD1 . LEU A 81  ? 0.4036 0.2421 0.3516 0.0958  0.0495  -0.0298 81  LEU A CD1 
624  C CD2 . LEU A 81  ? 0.5015 0.3558 0.4249 0.0884  0.0711  -0.0073 81  LEU A CD2 
625  N N   . GLN A 82  ? 0.4168 0.2675 0.3326 0.1314  0.0792  -0.0584 82  GLN A N   
626  C CA  . GLN A 82  ? 0.4275 0.2875 0.3303 0.1398  0.0769  -0.0641 82  GLN A CA  
627  C C   . GLN A 82  ? 0.4342 0.2864 0.3313 0.1433  0.0638  -0.0632 82  GLN A C   
628  O O   . GLN A 82  ? 0.4660 0.3125 0.3828 0.1362  0.0434  -0.0671 82  GLN A O   
629  C CB  . GLN A 82  ? 0.4375 0.3012 0.3506 0.1451  0.0701  -0.0796 82  GLN A CB  
630  C CG  . GLN A 82  ? 0.6749 0.5502 0.5745 0.1532  0.0702  -0.0852 82  GLN A CG  
631  C CD  . GLN A 82  ? 0.5826 0.4710 0.4642 0.1511  0.0841  -0.0730 82  GLN A CD  
632  O OE1 . GLN A 82  ? 0.5553 0.4440 0.4243 0.1517  0.0847  -0.0642 82  GLN A OE1 
633  N NE2 . GLN A 82  ? 0.4463 0.3446 0.3278 0.1488  0.0938  -0.0724 82  GLN A NE2 
634  N N   . MET A 83  ? 0.4542 0.3152 0.3331 0.1454  0.0713  -0.0550 83  MET A N   
635  C CA  . MET A 83  ? 0.4543 0.3208 0.3362 0.1394  0.0556  -0.0511 83  MET A CA  
636  C C   . MET A 83  ? 0.5954 0.4696 0.4621 0.1544  0.0524  -0.0621 83  MET A C   
637  O O   . MET A 83  ? 0.5295 0.4122 0.3737 0.1637  0.0671  -0.0587 83  MET A O   
638  C CB  . MET A 83  ? 0.4415 0.3147 0.3163 0.1301  0.0642  -0.0339 83  MET A CB  
639  C CG  . MET A 83  ? 0.4274 0.2957 0.3107 0.1188  0.0731  -0.0233 83  MET A CG  
640  S SD  . MET A 83  ? 0.4148 0.2930 0.2866 0.1109  0.0847  -0.0054 83  MET A SD  
641  C CE  . MET A 83  ? 0.7649 0.6478 0.6102 0.1264  0.1077  -0.0065 83  MET A CE  
642  N N   . ASN A 84  ? 0.5470 0.4192 0.4272 0.1555  0.0320  -0.0748 84  ASN A N   
643  C CA  . ASN A 84  ? 0.6238 0.5043 0.4913 0.1701  0.0264  -0.0877 84  ASN A CA  
644  C C   . ASN A 84  ? 0.5251 0.4117 0.4036 0.1626  0.0067  -0.0880 84  ASN A C   
645  O O   . ASN A 84  ? 0.4813 0.3619 0.3825 0.1463  -0.0067 -0.0819 84  ASN A O   
646  C CB  . ASN A 84  ? 0.6810 0.5563 0.5535 0.1814  0.0200  -0.1068 84  ASN A CB  
647  C CG  . ASN A 84  ? 0.8061 0.6841 0.6793 0.1772  0.0373  -0.1018 84  ASN A CG  
648  O OD1 . ASN A 84  ? 0.9068 0.7742 0.7958 0.1708  0.0370  -0.1017 84  ASN A OD1 
649  N ND2 . ASN A 84  ? 0.7920 0.6847 0.6512 0.1790  0.0507  -0.0972 84  ASN A ND2 
650  N N   . SER A 85  ? 0.5081 0.4068 0.3704 0.1749  0.0053  -0.0951 85  SER A N   
651  C CA  . SER A 85  ? 0.5532 0.4613 0.4239 0.1693  -0.0114 -0.0961 85  SER A CA  
652  C C   . SER A 85  ? 0.5994 0.5099 0.4771 0.1522  -0.0088 -0.0767 85  SER A C   
653  O O   . SER A 85  ? 0.6390 0.5451 0.5407 0.1360  -0.0236 -0.0726 85  SER A O   
654  C CB  . SER A 85  ? 0.4705 0.3718 0.3677 0.1643  -0.0357 -0.1105 85  SER A CB  
655  O OG  . SER A 85  ? 0.4885 0.3933 0.3770 0.1821  -0.0404 -0.1307 85  SER A OG  
656  N N   . LEU A 86  ? 0.4639 0.3809 0.3203 0.1560  0.0107  -0.0646 86  LEU A N   
657  C CA  . LEU A 86  ? 0.4484 0.3693 0.3085 0.1416  0.0154  -0.0467 86  LEU A CA  
658  C C   . LEU A 86  ? 0.4496 0.3858 0.3119 0.1386  0.0046  -0.0455 86  LEU A C   
659  O O   . LEU A 86  ? 0.4605 0.4080 0.3077 0.1527  0.0040  -0.0540 86  LEU A O   
660  C CB  . LEU A 86  ? 0.4413 0.3631 0.2793 0.1472  0.0401  -0.0353 86  LEU A CB  
661  C CG  . LEU A 86  ? 0.4496 0.3574 0.2906 0.1450  0.0516  -0.0333 86  LEU A CG  
662  C CD1 . LEU A 86  ? 0.4346 0.3429 0.2521 0.1545  0.0767  -0.0263 86  LEU A CD1 
663  C CD2 . LEU A 86  ? 0.4574 0.3590 0.3210 0.1252  0.0448  -0.0230 86  LEU A CD2 
664  N N   . ARG A 87  ? 0.5143 0.4519 0.3961 0.1202  -0.0041 -0.0350 87  ARG A N   
665  C CA  . ARG A 87  ? 0.4907 0.4437 0.3788 0.1143  -0.0142 -0.0326 87  ARG A CA  
666  C C   . ARG A 87  ? 0.4850 0.4467 0.3658 0.1064  -0.0010 -0.0146 87  ARG A C   
667  O O   . ARG A 87  ? 0.5202 0.4733 0.3994 0.1003  0.0106  -0.0040 87  ARG A O   
668  C CB  . ARG A 87  ? 0.4779 0.4264 0.3971 0.0988  -0.0362 -0.0360 87  ARG A CB  
669  C CG  . ARG A 87  ? 0.6858 0.6229 0.6149 0.1058  -0.0496 -0.0543 87  ARG A CG  
670  C CD  . ARG A 87  ? 0.6839 0.6137 0.6455 0.0897  -0.0711 -0.0565 87  ARG A CD  
671  N NE  . ARG A 87  ? 0.7409 0.6588 0.7133 0.0967  -0.0845 -0.0750 87  ARG A NE  
672  C CZ  . ARG A 87  ? 0.7905 0.6896 0.7812 0.0893  -0.0922 -0.0758 87  ARG A CZ  
673  N NH1 . ARG A 87  ? 0.8712 0.7615 0.8705 0.0746  -0.0881 -0.0587 87  ARG A NH1 
674  N NH2 . ARG A 87  ? 0.7372 0.6268 0.7373 0.0972  -0.1045 -0.0943 87  ARG A NH2 
675  N N   . ALA A 88  ? 0.5407 0.5203 0.4172 0.1072  -0.0029 -0.0122 88  ALA A N   
676  C CA  . ALA A 88  ? 0.5438 0.5341 0.4121 0.1019  0.0097  0.0034  88  ALA A CA  
677  C C   . ALA A 88  ? 0.5694 0.5542 0.4564 0.0811  0.0082  0.0171  88  ALA A C   
678  O O   . ALA A 88  ? 0.6462 0.6332 0.5252 0.0771  0.0221  0.0298  88  ALA A O   
679  C CB  . ALA A 88  ? 0.5657 0.5775 0.4325 0.1043  0.0037  0.0020  88  ALA A CB  
680  N N   . GLU A 89  ? 0.5600 0.5371 0.4716 0.0687  -0.0088 0.0143  89  GLU A N   
681  C CA  . GLU A 89  ? 0.5021 0.4724 0.4318 0.0496  -0.0122 0.0272  89  GLU A CA  
682  C C   . GLU A 89  ? 0.4091 0.3637 0.3330 0.0500  -0.0009 0.0319  89  GLU A C   
683  O O   . GLU A 89  ? 0.8252 0.7774 0.7565 0.0370  0.0017  0.0448  89  GLU A O   
684  C CB  . GLU A 89  ? 0.6129 0.5760 0.5701 0.0381  -0.0336 0.0223  89  GLU A CB  
685  C CG  . GLU A 89  ? 0.6997 0.6790 0.6680 0.0343  -0.0460 0.0180  89  GLU A CG  
686  C CD  . GLU A 89  ? 0.8597 0.8296 0.8564 0.0239  -0.0671 0.0111  89  GLU A CD  
687  O OE1 . GLU A 89  ? 0.9428 0.9011 0.9420 0.0334  -0.0754 -0.0045 89  GLU A OE1 
688  O OE2 . GLU A 89  ? 0.8520 0.8260 0.8688 0.0062  -0.0752 0.0214  89  GLU A OE2 
689  N N   . ASP A 90  ? 0.4170 0.3620 0.3281 0.0650  0.0058  0.0211  90  ASP A N   
690  C CA  . ASP A 90  ? 0.4123 0.3432 0.3201 0.0660  0.0162  0.0231  90  ASP A CA  
691  C C   . ASP A 90  ? 0.4016 0.3376 0.2915 0.0685  0.0371  0.0334  90  ASP A C   
692  O O   . ASP A 90  ? 0.3966 0.3229 0.2844 0.0684  0.0473  0.0357  90  ASP A O   
693  C CB  . ASP A 90  ? 0.4232 0.3434 0.3249 0.0809  0.0166  0.0074  90  ASP A CB  
694  C CG  . ASP A 90  ? 0.4669 0.3781 0.3894 0.0775  -0.0041 -0.0035 90  ASP A CG  
695  O OD1 . ASP A 90  ? 0.5576 0.4575 0.4988 0.0655  -0.0125 0.0009  90  ASP A OD1 
696  O OD2 . ASP A 90  ? 0.5121 0.4272 0.4323 0.0874  -0.0123 -0.0168 90  ASP A OD2 
697  N N   . THR A 91  ? 0.5937 0.5452 0.4719 0.0711  0.0432  0.0386  91  THR A N   
698  C CA  . THR A 91  ? 0.3787 0.3360 0.2426 0.0717  0.0615  0.0493  91  THR A CA  
699  C C   . THR A 91  ? 0.6161 0.5701 0.4931 0.0555  0.0616  0.0606  91  THR A C   
700  O O   . THR A 91  ? 0.6497 0.6080 0.5435 0.0414  0.0486  0.0667  91  THR A O   
701  C CB  . THR A 91  ? 0.4244 0.4006 0.2789 0.0743  0.0639  0.0539  91  THR A CB  
702  O OG1 . THR A 91  ? 0.3891 0.3683 0.2269 0.0921  0.0666  0.0439  91  THR A OG1 
703  C CG2 . THR A 91  ? 0.4001 0.3818 0.2433 0.0728  0.0813  0.0653  91  THR A CG2 
704  N N   . ALA A 92  ? 0.3465 0.2935 0.2156 0.0578  0.0767  0.0633  92  ALA A N   
705  C CA  . ALA A 92  ? 0.3375 0.2799 0.2177 0.0452  0.0774  0.0714  92  ALA A CA  
706  C C   . ALA A 92  ? 0.3327 0.2691 0.2017 0.0512  0.0966  0.0714  92  ALA A C   
707  O O   . ALA A 92  ? 0.7088 0.6426 0.5645 0.0643  0.1078  0.0647  92  ALA A O   
708  C CB  . ALA A 92  ? 0.9204 0.8503 0.8194 0.0385  0.0615  0.0672  92  ALA A CB  
709  N N   . VAL A 93  ? 0.4194 0.3543 0.2965 0.0411  0.0988  0.0780  93  VAL A N   
710  C CA  . VAL A 93  ? 0.5207 0.4524 0.4034 0.0429  0.1061  0.0700  93  VAL A CA  
711  C C   . VAL A 93  ? 0.5795 0.4946 0.4670 0.0412  0.1060  0.0705  93  VAL A C   
712  O O   . VAL A 93  ? 0.3804 0.2958 0.2818 0.0295  0.0935  0.0761  93  VAL A O   
713  C CB  . VAL A 93  ? 0.3597 0.3063 0.2552 0.0323  0.1014  0.0692  93  VAL A CB  
714  C CG1 . VAL A 93  ? 0.3532 0.2943 0.2556 0.0338  0.1059  0.0619  93  VAL A CG1 
715  C CG2 . VAL A 93  ? 0.3533 0.3138 0.2480 0.0330  0.0988  0.0660  93  VAL A CG2 
716  N N   . TYR A 94  ? 0.5562 0.4609 0.4410 0.0513  0.1131  0.0601  94  TYR A N   
717  C CA  . TYR A 94  ? 0.6205 0.5141 0.5205 0.0493  0.1044  0.0533  94  TYR A CA  
718  C C   . TYR A 94  ? 0.6196 0.5101 0.5240 0.0471  0.1157  0.0526  94  TYR A C   
719  O O   . TYR A 94  ? 0.6964 0.5839 0.5926 0.0555  0.1325  0.0472  94  TYR A O   
720  C CB  . TYR A 94  ? 0.3393 0.2246 0.2368 0.0615  0.1025  0.0404  94  TYR A CB  
721  C CG  . TYR A 94  ? 0.5248 0.4123 0.4233 0.0630  0.0870  0.0380  94  TYR A CG  
722  C CD1 . TYR A 94  ? 0.4863 0.3840 0.3712 0.0669  0.0901  0.0415  94  TYR A CD1 
723  C CD2 . TYR A 94  ? 0.5464 0.4259 0.4607 0.0607  0.0687  0.0313  94  TYR A CD2 
724  C CE1 . TYR A 94  ? 0.3566 0.2578 0.2441 0.0680  0.0754  0.0379  94  TYR A CE1 
725  C CE2 . TYR A 94  ? 0.5524 0.4337 0.4696 0.0616  0.0541  0.0278  94  TYR A CE2 
726  C CZ  . TYR A 94  ? 0.5335 0.4264 0.4376 0.0650  0.0575  0.0308  94  TYR A CZ  
727  O OH  . TYR A 94  ? 0.3720 0.2683 0.2806 0.0658  0.0427  0.0261  94  TYR A OH  
728  N N   . TYR A 95  ? 0.6223 0.5134 0.5402 0.0359  0.1060  0.0581  95  TYR A N   
729  C CA  . TYR A 95  ? 0.3351 0.2245 0.2603 0.0332  0.1133  0.0562  95  TYR A CA  
730  C C   . TYR A 95  ? 0.3401 0.2187 0.2800 0.0355  0.1043  0.0464  95  TYR A C   
731  O O   . TYR A 95  ? 0.3463 0.2196 0.2955 0.0331  0.0866  0.0460  95  TYR A O   
732  C CB  . TYR A 95  ? 0.3279 0.2259 0.2586 0.0208  0.1076  0.0674  95  TYR A CB  
733  C CG  . TYR A 95  ? 0.3847 0.3002 0.3094 0.0162  0.1056  0.0730  95  TYR A CG  
734  C CD1 . TYR A 95  ? 0.3247 0.2428 0.2454 0.0128  0.0976  0.0815  95  TYR A CD1 
735  C CD2 . TYR A 95  ? 0.4258 0.3569 0.3543 0.0145  0.1056  0.0665  95  TYR A CD2 
736  C CE1 . TYR A 95  ? 0.3157 0.2534 0.2355 0.0078  0.0921  0.0823  95  TYR A CE1 
737  C CE2 . TYR A 95  ? 0.5383 0.4862 0.4654 0.0096  0.0988  0.0677  95  TYR A CE2 
738  C CZ  . TYR A 95  ? 0.6932 0.6450 0.6159 0.0061  0.0929  0.0751  95  TYR A CZ  
739  O OH  . TYR A 95  ? 0.7543 0.7217 0.6755 0.0007  0.0875  0.0754  95  TYR A OH  
740  N N   . CYS A 96  ? 0.3729 0.2484 0.3164 0.0397  0.1160  0.0383  96  CYS A N   
741  C CA  . CYS A 96  ? 0.3760 0.2440 0.3363 0.0401  0.1064  0.0299  96  CYS A CA  
742  C C   . CYS A 96  ? 0.3691 0.2417 0.3401 0.0311  0.1028  0.0346  96  CYS A C   
743  O O   . CYS A 96  ? 0.5080 0.3886 0.4738 0.0281  0.1155  0.0383  96  CYS A O   
744  C CB  . CYS A 96  ? 0.5633 0.4262 0.5240 0.0508  0.1198  0.0163  96  CYS A CB  
745  S SG  . CYS A 96  ? 0.7275 0.5960 0.6790 0.0532  0.1461  0.0154  96  CYS A SG  
746  N N   . ALA A 97  ? 0.5369 0.4044 0.5228 0.0274  0.0852  0.0341  97  ALA A N   
747  C CA  . ALA A 97  ? 0.5742 0.4458 0.5706 0.0205  0.0797  0.0376  97  ALA A CA  
748  C C   . ALA A 97  ? 0.5969 0.4603 0.6108 0.0233  0.0675  0.0287  97  ALA A C   
749  O O   . ALA A 97  ? 0.3639 0.2174 0.3837 0.0263  0.0544  0.0255  97  ALA A O   
750  C CB  . ALA A 97  ? 0.3488 0.2258 0.3427 0.0100  0.0677  0.0534  97  ALA A CB  
751  N N   . THR A 98  ? 0.5424 0.4104 0.5656 0.0228  0.0715  0.0237  98  THR A N   
752  C CA  . THR A 98  ? 0.5038 0.3661 0.5446 0.0252  0.0587  0.0160  98  THR A CA  
753  C C   . THR A 98  ? 0.5591 0.4187 0.6050 0.0177  0.0375  0.0285  98  THR A C   
754  O O   . THR A 98  ? 0.5594 0.4251 0.5958 0.0098  0.0361  0.0424  98  THR A O   
755  C CB  . THR A 98  ? 0.4931 0.3635 0.5437 0.0265  0.0687  0.0066  98  THR A CB  
756  O OG1 . THR A 98  ? 0.5207 0.4015 0.5692 0.0185  0.0669  0.0162  98  THR A OG1 
757  C CG2 . THR A 98  ? 0.3704 0.2441 0.4150 0.0318  0.0924  -0.0028 98  THR A CG2 
758  N N   . ASN A 99  ? 0.4215 0.2718 0.4822 0.0204  0.0213  0.0241  99  ASN A N   
759  C CA  . ASN A 99  ? 0.4809 0.3263 0.5470 0.0138  0.0009  0.0369  99  ASN A CA  
760  C C   . ASN A 99  ? 0.6102 0.4677 0.6745 0.0074  0.0011  0.0458  99  ASN A C   
761  O O   . ASN A 99  ? 0.4319 0.2899 0.4932 -0.0001 -0.0104 0.0612  99  ASN A O   
762  C CB  . ASN A 99  ? 0.4815 0.3135 0.5647 0.0195  -0.0159 0.0290  99  ASN A CB  
763  C CG  . ASN A 99  ? 0.4631 0.2845 0.5510 0.0133  -0.0375 0.0432  99  ASN A CG  
764  O OD1 . ASN A 99  ? 0.4730 0.2994 0.5589 0.0062  -0.0438 0.0569  99  ASN A OD1 
765  N ND2 . ASN A 99  ? 0.5043 0.3110 0.5989 0.0161  -0.0488 0.0400  99  ASN A ND2 
766  N N   . ASP A 100 ? 0.4730 0.3412 0.5389 0.0104  0.0149  0.0359  100 ASP A N   
767  C CA  . ASP A 100 ? 0.5222 0.4043 0.5869 0.0057  0.0167  0.0408  100 ASP A CA  
768  C C   . ASP A 100 ? 0.5204 0.4137 0.5683 -0.0006 0.0297  0.0504  100 ASP A C   
769  O O   . ASP A 100 ? 0.5071 0.4140 0.5517 -0.0040 0.0352  0.0525  100 ASP A O   
770  C CB  . ASP A 100 ? 0.6307 0.5203 0.7071 0.0113  0.0259  0.0243  100 ASP A CB  
771  C CG  . ASP A 100 ? 0.8576 0.7371 0.9505 0.0196  0.0183  0.0109  100 ASP A CG  
772  O OD1 . ASP A 100 ? 0.9439 0.8121 1.0428 0.0204  -0.0005 0.0159  100 ASP A OD1 
773  O OD2 . ASP A 100 ? 0.8057 0.6889 0.9066 0.0252  0.0314  -0.0049 100 ASP A OD2 
774  N N   . ASP A 101 ? 0.5796 0.4678 0.6174 -0.0012 0.0345  0.0546  101 ASP A N   
775  C CA  . ASP A 101 ? 0.3317 0.2291 0.3534 -0.0065 0.0451  0.0643  101 ASP A CA  
776  C C   . ASP A 101 ? 0.3484 0.2563 0.3632 -0.0044 0.0669  0.0569  101 ASP A C   
777  O O   . ASP A 101 ? 0.3372 0.2575 0.3436 -0.0095 0.0727  0.0639  101 ASP A O   
778  C CB  . ASP A 101 ? 0.3353 0.2409 0.3523 -0.0156 0.0342  0.0811  101 ASP A CB  
779  C CG  . ASP A 101 ? 0.8250 0.7226 0.8398 -0.0209 0.0207  0.0944  101 ASP A CG  
780  O OD1 . ASP A 101 ? 0.6827 0.5815 0.6881 -0.0222 0.0275  0.0977  101 ASP A OD1 
781  O OD2 . ASP A 101 ? 0.6906 0.5807 0.7136 -0.0236 0.0033  0.1014  101 ASP A OD2 
782  N N   . TYR A 102 ? 0.3126 0.2151 0.3310 0.0032  0.0792  0.0430  102 TYR A N   
783  C CA  . TYR A 102 ? 0.3048 0.2128 0.3148 0.0056  0.1012  0.0377  102 TYR A CA  
784  C C   . TYR A 102 ? 0.4160 0.3183 0.4123 0.0087  0.1076  0.0414  102 TYR A C   
785  O O   . TYR A 102 ? 0.4686 0.3605 0.4670 0.0147  0.1051  0.0355  102 TYR A O   
786  C CB  . TYR A 102 ? 0.4849 0.3910 0.5063 0.0119  0.1131  0.0213  102 TYR A CB  
787  C CG  . TYR A 102 ? 0.4991 0.4152 0.5327 0.0093  0.1136  0.0152  102 TYR A CG  
788  C CD1 . TYR A 102 ? 0.5549 0.4837 0.5830 0.0033  0.1170  0.0211  102 TYR A CD1 
789  C CD2 . TYR A 102 ? 0.4269 0.3412 0.4783 0.0133  0.1097  0.0026  102 TYR A CD2 
790  C CE1 . TYR A 102 ? 0.5521 0.4915 0.5916 0.0015  0.1164  0.0141  102 TYR A CE1 
791  C CE2 . TYR A 102 ? 0.4049 0.3299 0.4685 0.0113  0.1090  -0.0042 102 TYR A CE2 
792  C CZ  . TYR A 102 ? 0.4732 0.4107 0.5307 0.0055  0.1121  0.0014  102 TYR A CZ  
793  O OH  . TYR A 102 ? 0.4817 0.4312 0.5516 0.0041  0.1107  -0.0067 102 TYR A OH  
794  N N   . TRP A 103 ? 0.2774 0.1873 0.2598 0.0054  0.1156  0.0501  103 TRP A N   
795  C CA  . TRP A 103 ? 0.4430 0.3496 0.4118 0.0086  0.1206  0.0542  103 TRP A CA  
796  C C   . TRP A 103 ? 0.2734 0.1847 0.2360 0.0152  0.1316  0.0444  103 TRP A C   
797  O O   . TRP A 103 ? 0.2667 0.1857 0.2336 0.0140  0.1319  0.0384  103 TRP A O   
798  C CB  . TRP A 103 ? 0.4918 0.4064 0.4523 0.0011  0.1113  0.0688  103 TRP A CB  
799  C CG  . TRP A 103 ? 0.2854 0.1965 0.2540 -0.0049 0.0901  0.0766  103 TRP A CG  
800  C CD1 . TRP A 103 ? 0.3411 0.2526 0.3209 -0.0095 0.0780  0.0787  103 TRP A CD1 
801  C CD2 . TRP A 103 ? 0.2918 0.1983 0.2587 -0.0071 0.0780  0.0836  103 TRP A CD2 
802  N NE1 . TRP A 103 ? 0.2964 0.2021 0.2810 -0.0143 0.0596  0.0875  103 TRP A NE1 
803  C CE2 . TRP A 103 ? 0.2986 0.2012 0.2765 -0.0135 0.0594  0.0903  103 TRP A CE2 
804  C CE3 . TRP A 103 ? 0.3885 0.2940 0.3462 -0.0039 0.0808  0.0845  103 TRP A CE3 
805  C CZ2 . TRP A 103 ? 0.3072 0.2038 0.2886 -0.0178 0.0442  0.0978  103 TRP A CZ2 
806  C CZ3 . TRP A 103 ? 0.3684 0.2699 0.3300 -0.0080 0.0652  0.0907  103 TRP A CZ3 
807  C CH2 . TRP A 103 ? 0.3077 0.2042 0.2817 -0.0154 0.0474  0.0973  103 TRP A CH2 
808  N N   . GLY A 104 ? 0.2652 0.1710 0.2200 0.0218  0.1330  0.0422  104 GLY A N   
809  C CA  . GLY A 104 ? 0.4099 0.3176 0.3615 0.0262  0.1325  0.0353  104 GLY A CA  
810  C C   . GLY A 104 ? 0.4828 0.4032 0.4285 0.0241  0.1243  0.0390  104 GLY A C   
811  O O   . GLY A 104 ? 0.4460 0.3774 0.3910 0.0178  0.1179  0.0455  104 GLY A O   
812  N N   . GLN A 105 ? 0.5309 0.4504 0.4733 0.0282  0.1238  0.0356  105 GLN A N   
813  C CA  . GLN A 105 ? 0.5192 0.4497 0.4579 0.0270  0.1178  0.0378  105 GLN A CA  
814  C C   . GLN A 105 ? 0.4396 0.3738 0.3713 0.0280  0.1145  0.0428  105 GLN A C   
815  O O   . GLN A 105 ? 0.3734 0.3203 0.3035 0.0233  0.1084  0.0464  105 GLN A O   
816  C CB  . GLN A 105 ? 0.7380 0.6542 0.6733 0.0343  0.1248  0.0361  105 GLN A CB  
817  C CG  . GLN A 105 ? 0.8239 0.7422 0.7537 0.0374  0.1242  0.0396  105 GLN A CG  
818  C CD  . GLN A 105 ? 0.8911 0.7943 0.8153 0.0455  0.1305  0.0404  105 GLN A CD  
819  O OE1 . GLN A 105 ? 0.9322 0.8235 0.8563 0.0479  0.1354  0.0388  105 GLN A OE1 
820  N NE2 . GLN A 105 ? 0.7901 0.6944 0.7092 0.0496  0.1305  0.0436  105 GLN A NE2 
821  N N   . GLY A 106 ? 0.4429 0.3650 0.3699 0.0341  0.1192  0.0428  106 GLY A N   
822  C CA  . GLY A 106 ? 0.4956 0.4173 0.4141 0.0373  0.1181  0.0470  106 GLY A CA  
823  C C   . GLY A 106 ? 0.5184 0.4374 0.4308 0.0450  0.1192  0.0436  106 GLY A C   
824  O O   . GLY A 106 ? 0.4007 0.3241 0.3157 0.0445  0.1173  0.0414  106 GLY A O   
825  N N   . THR A 107 ? 0.3632 0.6653 0.3432 0.0076  0.0531  -0.0784 107 THR A N   
826  C CA  . THR A 107 ? 0.4175 0.6957 0.3890 0.0030  0.0612  -0.0746 107 THR A CA  
827  C C   . THR A 107 ? 0.4275 0.7024 0.3944 0.0070  0.0591  -0.0605 107 THR A C   
828  O O   . THR A 107 ? 0.2645 0.5541 0.2335 0.0121  0.0502  -0.0546 107 THR A O   
829  C CB  . THR A 107 ? 0.4589 0.7306 0.4262 -0.0018 0.0617  -0.0813 107 THR A CB  
830  O OG1 . THR A 107 ? 0.4322 0.6777 0.3876 -0.0049 0.0701  -0.0769 107 THR A OG1 
831  C CG2 . THR A 107 ? 0.4777 0.7581 0.4445 0.0022  0.0520  -0.0774 107 THR A CG2 
832  N N   . LEU A 108 ? 0.3900 0.6509 0.3519 0.0050  0.0667  -0.0555 108 LEU A N   
833  C CA  . LEU A 108 ? 0.3494 0.6155 0.3100 0.0086  0.0641  -0.0425 108 LEU A CA  
834  C C   . LEU A 108 ? 0.3769 0.6344 0.3255 0.0064  0.0628  -0.0384 108 LEU A C   
835  O O   . LEU A 108 ? 0.4892 0.7265 0.4273 0.0015  0.0703  -0.0430 108 LEU A O   
836  C CB  . LEU A 108 ? 0.3797 0.6390 0.3430 0.0088  0.0725  -0.0379 108 LEU A CB  
837  C CG  . LEU A 108 ? 0.3612 0.6294 0.3282 0.0133  0.0707  -0.0232 108 LEU A CG  
838  C CD1 . LEU A 108 ? 0.2421 0.5314 0.2141 0.0195  0.0592  -0.0138 108 LEU A CD1 
839  C CD2 . LEU A 108 ? 0.4394 0.7052 0.4144 0.0149  0.0779  -0.0210 108 LEU A CD2 
840  N N   . VAL A 109 ? 0.2992 0.5711 0.2480 0.0107  0.0534  -0.0292 109 VAL A N   
841  C CA  . VAL A 109 ? 0.2720 0.5371 0.2073 0.0096  0.0498  -0.0230 109 VAL A CA  
842  C C   . VAL A 109 ? 0.2595 0.5376 0.1967 0.0145  0.0450  -0.0062 109 VAL A C   
843  O O   . VAL A 109 ? 0.2469 0.5450 0.1959 0.0204  0.0387  0.0018  109 VAL A O   
844  C CB  . VAL A 109 ? 0.2606 0.5295 0.1932 0.0104  0.0416  -0.0259 109 VAL A CB  
845  C CG1 . VAL A 109 ? 0.2695 0.5274 0.1849 0.0097  0.0361  -0.0179 109 VAL A CG1 
846  C CG2 . VAL A 109 ? 0.3784 0.6364 0.3109 0.0059  0.0464  -0.0404 109 VAL A CG2 
847  N N   . THR A 110 ? 0.5050 0.7711 0.4303 0.0126  0.0482  0.0006  110 THR A N   
848  C CA  . THR A 110 ? 0.5559 0.8340 0.4826 0.0172  0.0423  0.0201  110 THR A CA  
849  C C   . THR A 110 ? 0.2643 0.5168 0.1757 0.0158  0.0275  0.0280  110 THR A C   
850  O O   . THR A 110 ? 0.2829 0.5096 0.1737 0.0117  0.0301  0.0231  110 THR A O   
851  C CB  . THR A 110 ? 0.5396 0.8118 0.4724 0.0174  0.0507  0.0254  110 THR A CB  
852  O OG1 . THR A 110 ? 0.6919 0.9750 0.6434 0.0189  0.0585  0.0191  110 THR A OG1 
853  C CG2 . THR A 110 ? 0.4968 0.7588 0.4429 0.0212  0.0362  0.0450  110 THR A CG2 
854  N N   . VAL A 111 ? 0.2813 0.5380 0.2025 0.0192  0.0120  0.0397  111 VAL A N   
855  C CA  . VAL A 111 ? 0.3194 0.5507 0.2286 0.0181  -0.0045 0.0475  111 VAL A CA  
856  C C   . VAL A 111 ? 0.3667 0.5875 0.2909 0.0208  -0.0173 0.0641  111 VAL A C   
857  O O   . VAL A 111 ? 0.4118 0.6494 0.3606 0.0245  -0.0234 0.0747  111 VAL A O   
858  C CB  . VAL A 111 ? 0.2894 0.5290 0.1978 0.0194  -0.0146 0.0483  111 VAL A CB  
859  C CG1 . VAL A 111 ? 0.3396 0.5505 0.2325 0.0178  -0.0312 0.0547  111 VAL A CG1 
860  C CG2 . VAL A 111 ? 0.2833 0.5369 0.1800 0.0180  -0.0029 0.0318  111 VAL A CG2 
861  N N   . SER A 112 ? 0.3857 0.5783 0.2953 0.0195  -0.0208 0.0663  112 SER A N   
862  C CA  . SER A 112 ? 0.5022 0.6833 0.4251 0.0227  -0.0349 0.0810  112 SER A CA  
863  C C   . SER A 112 ? 0.5284 0.6726 0.4250 0.0221  -0.0453 0.0821  112 SER A C   
864  O O   . SER A 112 ? 0.3861 0.5116 0.2545 0.0193  -0.0354 0.0716  112 SER A O   
865  C CB  . SER A 112 ? 0.4446 0.6371 0.3868 0.0251  -0.0243 0.0851  112 SER A CB  
866  O OG  . SER A 112 ? 0.3958 0.5813 0.3559 0.0288  -0.0383 0.0996  112 SER A OG  
867  N N   . SER A 113 ? 0.6318 0.7649 0.5380 0.0251  -0.0648 0.0945  113 SER A N   
868  C CA  . SER A 113 ? 0.6343 0.7312 0.5154 0.0265  -0.0773 0.0967  113 SER A CA  
869  C C   . SER A 113 ? 0.5411 0.6264 0.4243 0.0302  -0.0743 0.1015  113 SER A C   
870  O O   . SER A 113 ? 0.5078 0.5616 0.3685 0.0331  -0.0829 0.1034  113 SER A O   
871  C CB  . SER A 113 ? 0.6518 0.7415 0.5405 0.0281  -0.1023 0.1061  113 SER A CB  
872  O OG  . SER A 113 ? 0.6092 0.7194 0.5367 0.0309  -0.1109 0.1176  113 SER A OG  
873  N N   . ALA A 114 ? 0.4875 0.5973 0.3963 0.0311  -0.0619 0.1035  114 ALA A N   
874  C CA  . ALA A 114 ? 0.4878 0.5897 0.4013 0.0349  -0.0570 0.1084  114 ALA A CA  
875  C C   . ALA A 114 ? 0.4921 0.5702 0.3720 0.0335  -0.0400 0.0980  114 ALA A C   
876  O O   . ALA A 114 ? 0.4598 0.5431 0.3263 0.0284  -0.0234 0.0855  114 ALA A O   
877  C CB  . ALA A 114 ? 0.5111 0.6454 0.4600 0.0361  -0.0465 0.1129  114 ALA A CB  
878  N N   . SER A 115 ? 0.5494 0.6007 0.4159 0.0383  -0.0443 0.1029  115 SER A N   
879  C CA  . SER A 115 ? 0.6101 0.6358 0.4459 0.0381  -0.0267 0.0949  115 SER A CA  
880  C C   . SER A 115 ? 0.5954 0.6400 0.4474 0.0370  -0.0051 0.0921  115 SER A C   
881  O O   . SER A 115 ? 0.5902 0.6627 0.4764 0.0388  -0.0068 0.0994  115 SER A O   
882  C CB  . SER A 115 ? 0.7567 0.7452 0.5705 0.0454  -0.0395 0.1021  115 SER A CB  
883  O OG  . SER A 115 ? 0.8540 0.8205 0.6449 0.0467  -0.0205 0.0972  115 SER A OG  
884  N N   . THR A 116 ? 0.5822 0.6104 0.4097 0.0342  0.0159  0.0814  116 THR A N   
885  C CA  . THR A 116 ? 0.6189 0.6615 0.4588 0.0330  0.0371  0.0776  116 THR A CA  
886  C C   . THR A 116 ? 0.6920 0.7204 0.5365 0.0408  0.0329  0.0895  116 THR A C   
887  O O   . THR A 116 ? 0.6705 0.6635 0.4868 0.0448  0.0320  0.0908  116 THR A O   
888  C CB  . THR A 116 ? 0.4996 0.5286 0.3132 0.0268  0.0620  0.0611  116 THR A CB  
889  O OG1 . THR A 116 ? 0.5126 0.5547 0.3225 0.0202  0.0647  0.0495  116 THR A OG1 
890  C CG2 . THR A 116 ? 0.4887 0.5340 0.3164 0.0250  0.0836  0.0562  116 THR A CG2 
891  N N   . LYS A 117 ? 0.6645 0.7200 0.5438 0.0435  0.0316  0.0980  117 LYS A N   
892  C CA  . LYS A 117 ? 0.6879 0.7350 0.5783 0.0515  0.0261  0.1104  117 LYS A CA  
893  C C   . LYS A 117 ? 0.5999 0.6650 0.5080 0.0511  0.0468  0.1094  117 LYS A C   
894  O O   . LYS A 117 ? 0.5687 0.6627 0.4938 0.0462  0.0579  0.1035  117 LYS A O   
895  C CB  . LYS A 117 ? 0.5763 0.6365 0.4962 0.0566  0.0002  0.1247  117 LYS A CB  
896  C CG  . LYS A 117 ? 0.5350 0.5912 0.4726 0.0653  -0.0061 0.1374  117 LYS A CG  
897  C CD  . LYS A 117 ? 0.5681 0.6333 0.5344 0.0704  -0.0332 0.1503  117 LYS A CD  
898  C CE  . LYS A 117 ? 0.6993 0.7590 0.6820 0.0798  -0.0390 0.1617  117 LYS A CE  
899  N NZ  . LYS A 117 ? 0.7702 0.8559 0.7834 0.0799  -0.0215 0.1655  117 LYS A NZ  
900  N N   . GLY A 118 ? 0.6659 0.7124 0.5680 0.0571  0.0520  0.1150  118 GLY A N   
901  C CA  . GLY A 118 ? 0.6411 0.7018 0.5600 0.0579  0.0703  0.1159  118 GLY A CA  
902  C C   . GLY A 118 ? 0.6796 0.7678 0.6404 0.0628  0.0595  0.1296  118 GLY A C   
903  O O   . GLY A 118 ? 0.6780 0.7658 0.6530 0.0678  0.0368  0.1406  118 GLY A O   
904  N N   . PRO A 119 ? 0.6153 0.7274 0.5968 0.0613  0.0762  0.1286  119 PRO A N   
905  C CA  . PRO A 119 ? 0.3864 0.5242 0.4081 0.0660  0.0706  0.1413  119 PRO A CA  
906  C C   . PRO A 119 ? 0.5414 0.6672 0.5741 0.0749  0.0664  0.1541  119 PRO A C   
907  O O   . PRO A 119 ? 0.6600 0.7634 0.6709 0.0771  0.0787  0.1514  119 PRO A O   
908  C CB  . PRO A 119 ? 0.3675 0.5283 0.3978 0.0617  0.0932  0.1334  119 PRO A CB  
909  C CG  . PRO A 119 ? 0.3854 0.5255 0.3835 0.0579  0.1128  0.1206  119 PRO A CG  
910  C CD  . PRO A 119 ? 0.6709 0.7845 0.6379 0.0556  0.1027  0.1148  119 PRO A CD  
911  N N   . SER A 120 ? 0.5722 0.5267 0.4508 0.0701  0.1046  -0.0483 120 SER A N   
912  C CA  . SER A 120 ? 0.5458 0.4940 0.4194 0.0672  0.1039  -0.0483 120 SER A CA  
913  C C   . SER A 120 ? 0.4897 0.4482 0.3650 0.0571  0.1038  -0.0525 120 SER A C   
914  O O   . SER A 120 ? 0.5225 0.4908 0.4007 0.0539  0.1015  -0.0545 120 SER A O   
915  C CB  . SER A 120 ? 0.5776 0.5196 0.4486 0.0723  0.0989  -0.0469 120 SER A CB  
916  O OG  . SER A 120 ? 0.6570 0.6051 0.5316 0.0714  0.0951  -0.0486 120 SER A OG  
917  N N   . VAL A 121 ? 0.5254 0.4812 0.3977 0.0526  0.1061  -0.0533 121 VAL A N   
918  C CA  . VAL A 121 ? 0.4928 0.4580 0.3651 0.0437  0.1060  -0.0564 121 VAL A CA  
919  C C   . VAL A 121 ? 0.4299 0.3913 0.2994 0.0414  0.1039  -0.0579 121 VAL A C   
920  O O   . VAL A 121 ? 0.5398 0.4918 0.4064 0.0433  0.1058  -0.0573 121 VAL A O   
921  C CB  . VAL A 121 ? 0.3862 0.3527 0.2578 0.0395  0.1112  -0.0567 121 VAL A CB  
922  C CG1 . VAL A 121 ? 0.4770 0.4525 0.3471 0.0311  0.1107  -0.0587 121 VAL A CG1 
923  C CG2 . VAL A 121 ? 0.3809 0.3522 0.2564 0.0426  0.1139  -0.0562 121 VAL A CG2 
924  N N   . PHE A 122 ? 0.3737 0.3426 0.2434 0.0375  0.1004  -0.0599 122 PHE A N   
925  C CA  . PHE A 122 ? 0.3929 0.3604 0.2610 0.0353  0.0986  -0.0622 122 PHE A CA  
926  C C   . PHE A 122 ? 0.4897 0.4620 0.3545 0.0267  0.0995  -0.0632 122 PHE A C   
927  O O   . PHE A 122 ? 0.5557 0.5342 0.4188 0.0229  0.0994  -0.0620 122 PHE A O   
928  C CB  . PHE A 122 ? 0.4301 0.3989 0.3000 0.0383  0.0945  -0.0633 122 PHE A CB  
929  C CG  . PHE A 122 ? 0.3926 0.3537 0.2643 0.0467  0.0937  -0.0611 122 PHE A CG  
930  C CD1 . PHE A 122 ? 0.4769 0.4385 0.3503 0.0499  0.0919  -0.0596 122 PHE A CD1 
931  C CD2 . PHE A 122 ? 0.4040 0.3557 0.2738 0.0524  0.0946  -0.0596 122 PHE A CD2 
932  C CE1 . PHE A 122 ? 0.5726 0.5257 0.4461 0.0589  0.0909  -0.0563 122 PHE A CE1 
933  C CE2 . PHE A 122 ? 0.4564 0.3999 0.3248 0.0614  0.0935  -0.0559 122 PHE A CE2 
934  C CZ  . PHE A 122 ? 0.5662 0.5108 0.4368 0.0648  0.0914  -0.0542 122 PHE A CZ  
935  N N   . PRO A 123 ? 0.4131 0.3814 0.2762 0.0234  0.1008  -0.0652 123 PRO A N   
936  C CA  . PRO A 123 ? 0.4163 0.3852 0.2763 0.0132  0.1027  -0.0664 123 PRO A CA  
937  C C   . PRO A 123 ? 0.4447 0.4164 0.3028 0.0090  0.1003  -0.0673 123 PRO A C   
938  O O   . PRO A 123 ? 0.4119 0.3838 0.2714 0.0145  0.0975  -0.0683 123 PRO A O   
939  C CB  . PRO A 123 ? 0.4219 0.3850 0.2818 0.0122  0.1051  -0.0689 123 PRO A CB  
940  C CG  . PRO A 123 ? 0.4205 0.3822 0.2822 0.0221  0.1022  -0.0697 123 PRO A CG  
941  C CD  . PRO A 123 ? 0.4486 0.4110 0.3125 0.0285  0.1008  -0.0668 123 PRO A CD  
942  N N   . LEU A 124 ? 0.4628 0.4363 0.3174 -0.0017 0.1017  -0.0672 124 LEU A N   
943  C CA  . LEU A 124 ? 0.5204 0.4946 0.3719 -0.0091 0.1008  -0.0684 124 LEU A CA  
944  C C   . LEU A 124 ? 0.5637 0.5370 0.4158 -0.0216 0.1037  -0.0727 124 LEU A C   
945  O O   . LEU A 124 ? 0.5686 0.5439 0.4197 -0.0311 0.1057  -0.0737 124 LEU A O   
946  C CB  . LEU A 124 ? 0.5049 0.4831 0.3508 -0.0130 0.0997  -0.0652 124 LEU A CB  
947  C CG  . LEU A 124 ? 0.6271 0.6086 0.4727 -0.0016 0.0968  -0.0617 124 LEU A CG  
948  C CD1 . LEU A 124 ? 0.4369 0.4223 0.2744 -0.0063 0.0957  -0.0585 124 LEU A CD1 
949  C CD2 . LEU A 124 ? 0.6324 0.6119 0.4810 0.0067  0.0941  -0.0627 124 LEU A CD2 
950  N N   . ALA A 125 ? 0.6473 0.6190 0.5018 -0.0216 0.1037  -0.0761 125 ALA A N   
951  C CA  . ALA A 125 ? 0.6232 0.5958 0.4801 -0.0323 0.1065  -0.0812 125 ALA A CA  
952  C C   . ALA A 125 ? 0.6925 0.6693 0.5469 -0.0490 0.1079  -0.0836 125 ALA A C   
953  O O   . ALA A 125 ? 0.7099 0.6875 0.5605 -0.0519 0.1066  -0.0823 125 ALA A O   
954  C CB  . ALA A 125 ? 0.6773 0.6494 0.5377 -0.0269 0.1060  -0.0847 125 ALA A CB  
955  N N   . PRO A 126 ? 0.6238 0.6036 0.4795 -0.0602 0.1104  -0.0871 126 PRO A N   
956  C CA  . PRO A 126 ? 0.7021 0.6871 0.5538 -0.0761 0.1109  -0.0889 126 PRO A CA  
957  C C   . PRO A 126 ? 0.7276 0.7169 0.5808 -0.0896 0.1129  -0.0948 126 PRO A C   
958  O O   . PRO A 126 ? 0.6036 0.5941 0.4631 -0.0897 0.1147  -0.0995 126 PRO A O   
959  C CB  . PRO A 126 ? 0.6215 0.6091 0.4733 -0.0821 0.1123  -0.0899 126 PRO A CB  
960  C CG  . PRO A 126 ? 0.5474 0.5309 0.4049 -0.0747 0.1144  -0.0917 126 PRO A CG  
961  C CD  . PRO A 126 ? 0.5577 0.5357 0.4160 -0.0583 0.1125  -0.0880 126 PRO A CD  
962  N N   . SER A 127 ? 1.1058 1.0986 0.9520 -0.1016 0.1124  -0.0943 127 SER A N   
963  C CA  . SER A 127 ? 1.0911 1.0887 0.9343 -0.1181 0.1140  -0.0986 127 SER A CA  
964  C C   . SER A 127 ? 1.1209 1.1183 0.9672 -0.1205 0.1157  -0.1022 127 SER A C   
965  O O   . SER A 127 ? 1.1708 1.1638 1.0203 -0.1084 0.1149  -0.1006 127 SER A O   
966  C CB  . SER A 127 ? 0.9608 0.9651 0.8080 -0.1299 0.1166  -0.1046 127 SER A CB  
967  O OG  . SER A 127 ? 0.8080 0.8181 0.6488 -0.1471 0.1173  -0.1074 127 SER A OG  
968  N N   . SER A 128 ? 0.9330 0.9366 0.7799 -0.1364 0.1186  -0.1084 128 SER A N   
969  C CA  . SER A 128 ? 0.8085 0.8127 0.6539 -0.1446 0.1206  -0.1115 128 SER A CA  
970  C C   . SER A 128 ? 0.6888 0.6848 0.5259 -0.1373 0.1183  -0.1052 128 SER A C   
971  O O   . SER A 128 ? 0.6347 0.6263 0.4628 -0.1321 0.1150  -0.0981 128 SER A O   
972  C CB  . SER A 128 ? 0.8890 0.8977 0.7474 -0.1421 0.1235  -0.1184 128 SER A CB  
973  O OG  . SER A 128 ? 0.9602 0.9751 0.8262 -0.1445 0.1251  -0.1232 128 SER A OG  
974  N N   . SER A 132 ? 0.8024 0.8091 0.5813 -0.1881 0.1112  -0.0933 132 SER A N   
975  C CA  . SER A 132 ? 0.8799 0.8907 0.6637 -0.1793 0.1087  -0.0910 132 SER A CA  
976  C C   . SER A 132 ? 0.8293 0.8480 0.6035 -0.1918 0.1072  -0.0907 132 SER A C   
977  O O   . SER A 132 ? 0.9065 0.9280 0.6754 -0.1872 0.1036  -0.0853 132 SER A O   
978  C CB  . SER A 132 ? 0.9701 0.9834 0.7725 -0.1729 0.1116  -0.0975 132 SER A CB  
979  O OG  . SER A 132 ? 1.1258 1.1386 0.9328 -0.1598 0.1096  -0.0939 132 SER A OG  
980  N N   . GLY A 133 ? 0.8476 0.8709 0.6199 -0.2078 0.1102  -0.0970 133 GLY A N   
981  C CA  . GLY A 133 ? 0.8689 0.9001 0.6310 -0.2215 0.1092  -0.0975 133 GLY A CA  
982  C C   . GLY A 133 ? 0.8996 0.9409 0.6720 -0.2237 0.1101  -0.1028 133 GLY A C   
983  O O   . GLY A 133 ? 0.9088 0.9565 0.6731 -0.2281 0.1074  -0.1000 133 GLY A O   
984  N N   . GLY A 134 ? 0.9016 0.9441 0.6913 -0.2200 0.1137  -0.1099 134 GLY A N   
985  C CA  . GLY A 134 ? 0.8494 0.8999 0.6487 -0.2227 0.1153  -0.1154 134 GLY A CA  
986  C C   . GLY A 134 ? 0.8500 0.8978 0.6573 -0.2080 0.1138  -0.1125 134 GLY A C   
987  O O   . GLY A 134 ? 0.9278 0.9793 0.7448 -0.2080 0.1159  -0.1173 134 GLY A O   
988  N N   . THR A 135 ? 0.6998 0.7411 0.5024 -0.1957 0.1105  -0.1047 135 THR A N   
989  C CA  . THR A 135 ? 0.6289 0.6671 0.4378 -0.1810 0.1093  -0.1015 135 THR A CA  
990  C C   . THR A 135 ? 0.5040 0.5321 0.3197 -0.1668 0.1101  -0.0996 135 THR A C   
991  O O   . THR A 135 ? 0.5141 0.5378 0.3263 -0.1669 0.1101  -0.0983 135 THR A O   
992  C CB  . THR A 135 ? 0.7307 0.7714 0.5285 -0.1772 0.1047  -0.0937 135 THR A CB  
993  O OG1 . THR A 135 ? 0.8579 0.8959 0.6623 -0.1626 0.1042  -0.0910 135 THR A OG1 
994  C CG2 . THR A 135 ? 0.7534 0.7889 0.5381 -0.1762 0.1019  -0.0869 135 THR A CG2 
995  N N   . ALA A 136 ? 0.5124 0.5369 0.3375 -0.1548 0.1111  -0.0995 136 ALA A N   
996  C CA  . ALA A 136 ? 0.4884 0.5039 0.3185 -0.1403 0.1113  -0.0969 136 ALA A CA  
997  C C   . ALA A 136 ? 0.6908 0.7030 0.5181 -0.1264 0.1086  -0.0899 136 ALA A C   
998  O O   . ALA A 136 ? 0.6966 0.7124 0.5242 -0.1249 0.1083  -0.0890 136 ALA A O   
999  C CB  . ALA A 136 ? 0.4691 0.4815 0.3107 -0.1361 0.1147  -0.1018 136 ALA A CB  
1000 N N   . ALA A 137 ? 0.6121 0.6185 0.4368 -0.1167 0.1071  -0.0853 137 ALA A N   
1001 C CA  . ALA A 137 ? 0.4422 0.4461 0.2644 -0.1027 0.1048  -0.0788 137 ALA A CA  
1002 C C   . ALA A 137 ? 0.4312 0.4282 0.2620 -0.0875 0.1059  -0.0783 137 ALA A C   
1003 O O   . ALA A 137 ? 0.4288 0.4210 0.2621 -0.0839 0.1063  -0.0792 137 ALA A O   
1004 C CB  . ALA A 137 ? 0.5048 0.5076 0.3156 -0.1022 0.1017  -0.0731 137 ALA A CB  
1005 N N   . LEU A 138 ? 0.4294 0.4262 0.2641 -0.0790 0.1065  -0.0769 138 LEU A N   
1006 C CA  . LEU A 138 ? 0.4775 0.4678 0.3183 -0.0644 0.1073  -0.0756 138 LEU A CA  
1007 C C   . LEU A 138 ? 0.5205 0.5119 0.3600 -0.0524 0.1059  -0.0703 138 LEU A C   
1008 O O   . LEU A 138 ? 0.4186 0.4150 0.2577 -0.0543 0.1067  -0.0699 138 LEU A O   
1009 C CB  . LEU A 138 ? 0.5370 0.5245 0.3845 -0.0658 0.1107  -0.0799 138 LEU A CB  
1010 C CG  . LEU A 138 ? 0.5922 0.5833 0.4408 -0.0719 0.1129  -0.0818 138 LEU A CG  
1011 C CD1 . LEU A 138 ? 0.5790 0.5653 0.4308 -0.0601 0.1147  -0.0795 138 LEU A CD1 
1012 C CD2 . LEU A 138 ? 0.6514 0.6436 0.5029 -0.0844 0.1155  -0.0882 138 LEU A CD2 
1013 N N   . GLY A 139 ? 0.5852 0.5735 0.4246 -0.0403 0.1040  -0.0670 139 GLY A N   
1014 C CA  . GLY A 139 ? 0.5712 0.5621 0.4104 -0.0284 0.1028  -0.0626 139 GLY A CA  
1015 C C   . GLY A 139 ? 0.5579 0.5454 0.4039 -0.0159 0.1037  -0.0624 139 GLY A C   
1016 O O   . GLY A 139 ? 0.5182 0.5000 0.3679 -0.0150 0.1049  -0.0649 139 GLY A O   
1017 N N   . CYS A 140 ? 0.5480 0.5402 0.3953 -0.0067 0.1031  -0.0596 140 CYS A N   
1018 C CA  . CYS A 140 ? 0.4914 0.4821 0.3447 0.0052  0.1026  -0.0593 140 CYS A CA  
1019 C C   . CYS A 140 ? 0.5161 0.5137 0.3706 0.0141  0.0994  -0.0574 140 CYS A C   
1020 O O   . CYS A 140 ? 0.4574 0.4632 0.3092 0.0147  0.0988  -0.0554 140 CYS A O   
1021 C CB  . CYS A 140 ? 0.3810 0.3702 0.2384 0.0064  0.1065  -0.0602 140 CYS A CB  
1022 S SG  . CYS A 140 ? 1.7914 1.7719 1.6486 -0.0032 0.1105  -0.0636 140 CYS A SG  
1023 N N   . LEU A 141 ? 0.4825 0.4767 0.3416 0.0206  0.0975  -0.0587 141 LEU A N   
1024 C CA  . LEU A 141 ? 0.5079 0.5058 0.3697 0.0263  0.0944  -0.0588 141 LEU A CA  
1025 C C   . LEU A 141 ? 0.4756 0.4715 0.3448 0.0325  0.0960  -0.0595 141 LEU A C   
1026 O O   . LEU A 141 ? 0.5393 0.5258 0.4109 0.0357  0.0973  -0.0596 141 LEU A O   
1027 C CB  . LEU A 141 ? 0.5299 0.5219 0.3909 0.0268  0.0919  -0.0600 141 LEU A CB  
1028 C CG  . LEU A 141 ? 0.6147 0.6047 0.4786 0.0316  0.0893  -0.0608 141 LEU A CG  
1029 C CD1 . LEU A 141 ? 0.5978 0.5947 0.4569 0.0297  0.0881  -0.0594 141 LEU A CD1 
1030 C CD2 . LEU A 141 ? 0.6992 0.6840 0.5616 0.0309  0.0876  -0.0626 141 LEU A CD2 
1031 N N   . VAL A 142 ? 0.4466 0.4505 0.3183 0.0341  0.0963  -0.0595 142 VAL A N   
1032 C CA  . VAL A 142 ? 0.4172 0.4180 0.2953 0.0397  0.0989  -0.0596 142 VAL A CA  
1033 C C   . VAL A 142 ? 0.4110 0.4051 0.2914 0.0458  0.0968  -0.0587 142 VAL A C   
1034 O O   . VAL A 142 ? 0.3598 0.3594 0.2394 0.0449  0.0954  -0.0593 142 VAL A O   
1035 C CB  . VAL A 142 ? 0.4007 0.4156 0.2811 0.0380  0.1015  -0.0607 142 VAL A CB  
1036 C CG1 . VAL A 142 ? 0.4465 0.4576 0.3334 0.0434  0.1054  -0.0611 142 VAL A CG1 
1037 C CG2 . VAL A 142 ? 0.3656 0.3838 0.2406 0.0329  0.1032  -0.0595 142 VAL A CG2 
1038 N N   . LYS A 143 ? 0.4007 0.3816 0.2821 0.0530  0.0963  -0.0564 143 LYS A N   
1039 C CA  . LYS A 143 ? 0.4013 0.3749 0.2834 0.0605  0.0931  -0.0543 143 LYS A CA  
1040 C C   . LYS A 143 ? 0.4062 0.3737 0.2914 0.0709  0.0936  -0.0513 143 LYS A C   
1041 O O   . LYS A 143 ? 0.4145 0.3792 0.2996 0.0727  0.0967  -0.0501 143 LYS A O   
1042 C CB  . LYS A 143 ? 0.4015 0.3677 0.2804 0.0606  0.0900  -0.0543 143 LYS A CB  
1043 C CG  . LYS A 143 ? 0.6547 0.6158 0.5332 0.0662  0.0862  -0.0533 143 LYS A CG  
1044 C CD  . LYS A 143 ? 0.6178 0.5740 0.4944 0.0652  0.0837  -0.0549 143 LYS A CD  
1045 C CE  . LYS A 143 ? 0.8152 0.7761 0.6905 0.0565  0.0852  -0.0582 143 LYS A CE  
1046 N NZ  . LYS A 143 ? 0.9568 0.9275 0.8288 0.0471  0.0861  -0.0603 143 LYS A NZ  
1047 N N   . ASP A 144 ? 0.4829 0.4484 0.3699 0.0778  0.0905  -0.0500 144 ASP A N   
1048 C CA  . ASP A 144 ? 0.4820 0.4428 0.3712 0.0884  0.0894  -0.0473 144 ASP A CA  
1049 C C   . ASP A 144 ? 0.4917 0.4567 0.3847 0.0897  0.0945  -0.0476 144 ASP A C   
1050 O O   . ASP A 144 ? 0.4958 0.4548 0.3856 0.0924  0.0968  -0.0455 144 ASP A O   
1051 C CB  . ASP A 144 ? 0.5974 0.5483 0.4813 0.0931  0.0865  -0.0448 144 ASP A CB  
1052 C CG  . ASP A 144 ? 0.7080 0.6558 0.5904 0.0935  0.0816  -0.0456 144 ASP A CG  
1053 O OD1 . ASP A 144 ? 0.8006 0.7497 0.6857 0.0969  0.0791  -0.0460 144 ASP A OD1 
1054 O OD2 . ASP A 144 ? 0.7115 0.6556 0.5907 0.0910  0.0804  -0.0464 144 ASP A OD2 
1055 N N   . TYR A 145 ? 0.4255 0.4012 0.3252 0.0873  0.0968  -0.0507 145 TYR A N   
1056 C CA  . TYR A 145 ? 0.4733 0.4561 0.3795 0.0881  0.1023  -0.0528 145 TYR A CA  
1057 C C   . TYR A 145 ? 0.3891 0.3803 0.3051 0.0932  0.1017  -0.0553 145 TYR A C   
1058 O O   . TYR A 145 ? 0.3855 0.3765 0.3018 0.0951  0.0972  -0.0551 145 TYR A O   
1059 C CB  . TYR A 145 ? 0.4385 0.4302 0.3450 0.0778  0.1070  -0.0563 145 TYR A CB  
1060 C CG  . TYR A 145 ? 0.4905 0.4952 0.3999 0.0709  0.1066  -0.0604 145 TYR A CG  
1061 C CD1 . TYR A 145 ? 0.4386 0.4408 0.3417 0.0676  0.1023  -0.0594 145 TYR A CD1 
1062 C CD2 . TYR A 145 ? 0.5675 0.5876 0.4850 0.0674  0.1111  -0.0655 145 TYR A CD2 
1063 C CE1 . TYR A 145 ? 0.4662 0.4791 0.3681 0.0608  0.1024  -0.0623 145 TYR A CE1 
1064 C CE2 . TYR A 145 ? 0.5897 0.6217 0.5077 0.0606  0.1112  -0.0689 145 TYR A CE2 
1065 C CZ  . TYR A 145 ? 0.5763 0.6035 0.4848 0.0572  0.1069  -0.0667 145 TYR A CZ  
1066 O OH  . TYR A 145 ? 0.3712 0.4076 0.2753 0.0494  0.1076  -0.0689 145 TYR A OH  
1067 N N   . PHE A 146 ? 0.4079 0.4064 0.3325 0.0955  0.1066  -0.0581 146 PHE A N   
1068 C CA  . PHE A 146 ? 0.4814 0.4886 0.4190 0.1018  0.1067  -0.0614 146 PHE A CA  
1069 C C   . PHE A 146 ? 0.5192 0.5359 0.4667 0.1017  0.1140  -0.0659 146 PHE A C   
1070 O O   . PHE A 146 ? 0.5983 0.6091 0.5401 0.1022  0.1174  -0.0642 146 PHE A O   
1071 C CB  . PHE A 146 ? 0.5140 0.5126 0.4514 0.1127  0.1004  -0.0580 146 PHE A CB  
1072 C CG  . PHE A 146 ? 0.4709 0.4775 0.4235 0.1206  0.0993  -0.0612 146 PHE A CG  
1073 C CD1 . PHE A 146 ? 0.4326 0.4445 0.3953 0.1254  0.1037  -0.0642 146 PHE A CD1 
1074 C CD2 . PHE A 146 ? 0.4250 0.4335 0.3829 0.1240  0.0939  -0.0614 146 PHE A CD2 
1075 C CE1 . PHE A 146 ? 0.4557 0.4756 0.4355 0.1330  0.1025  -0.0677 146 PHE A CE1 
1076 C CE2 . PHE A 146 ? 0.4382 0.4535 0.4130 0.1328  0.0917  -0.0638 146 PHE A CE2 
1077 C CZ  . PHE A 146 ? 0.4575 0.4790 0.4444 0.1372  0.0959  -0.0672 146 PHE A CZ  
1078 N N   . PRO A 147 ? 0.4251 0.4563 0.3878 0.1015  0.1170  -0.0720 147 PRO A N   
1079 C CA  . PRO A 147 ? 0.4791 0.5153 0.4462 0.1008  0.1138  -0.0729 147 PRO A CA  
1080 C C   . PRO A 147 ? 0.5315 0.5762 0.4942 0.0880  0.1178  -0.0759 147 PRO A C   
1081 O O   . PRO A 147 ? 0.6931 0.7402 0.6498 0.0802  0.1214  -0.0773 147 PRO A O   
1082 C CB  . PRO A 147 ? 0.3486 0.3954 0.3367 0.1085  0.1157  -0.0772 147 PRO A CB  
1083 C CG  . PRO A 147 ? 0.3549 0.4102 0.3502 0.1046  0.1244  -0.0828 147 PRO A CG  
1084 C CD  . PRO A 147 ? 0.3641 0.4071 0.3418 0.1033  0.1238  -0.0782 147 PRO A CD  
1085 N N   . GLU A 148 ? 0.4348 0.4836 0.3974 0.0884  0.1168  -0.0756 148 GLU A N   
1086 C CA  . GLU A 148 ? 0.3168 0.3728 0.2686 0.0800  0.1218  -0.0761 148 GLU A CA  
1087 C C   . GLU A 148 ? 0.4979 0.5683 0.4645 0.0773  0.1317  -0.0821 148 GLU A C   
1088 O O   . GLU A 148 ? 0.4339 0.5084 0.4184 0.0838  0.1338  -0.0853 148 GLU A O   
1089 C CB  . GLU A 148 ? 0.3305 0.3876 0.2639 0.0938  0.1164  -0.0686 148 GLU A CB  
1090 C CG  . GLU A 148 ? 0.5907 0.6405 0.5019 0.0807  0.1152  -0.0661 148 GLU A CG  
1091 C CD  . GLU A 148 ? 0.6944 0.7506 0.5827 0.0925  0.1095  -0.0602 148 GLU A CD  
1092 O OE1 . GLU A 148 ? 0.7876 0.8675 0.6765 0.1002  0.1091  -0.0616 148 GLU A OE1 
1093 O OE2 . GLU A 148 ? 0.8257 0.8678 0.6955 0.0930  0.1041  -0.0555 148 GLU A OE2 
1094 N N   . PRO A 149 ? 0.5037 0.5792 0.4632 0.0662  0.1375  -0.0825 149 PRO A N   
1095 C CA  . PRO A 149 ? 0.4350 0.5047 0.3767 0.0516  0.1341  -0.0801 149 PRO A CA  
1096 C C   . PRO A 149 ? 0.4955 0.5810 0.4425 0.0402  0.1234  -0.0841 149 PRO A C   
1097 O O   . PRO A 149 ? 0.5475 0.6408 0.5002 0.0486  0.1236  -0.0849 149 PRO A O   
1098 C CB  . PRO A 149 ? 0.4959 0.5710 0.4253 0.0557  0.1432  -0.0755 149 PRO A CB  
1099 C CG  . PRO A 149 ? 0.5050 0.5935 0.4541 0.0643  0.1507  -0.0776 149 PRO A CG  
1100 C CD  . PRO A 149 ? 0.4796 0.5705 0.4469 0.0749  0.1463  -0.0823 149 PRO A CD  
1101 N N   . VAL A 150 ? 0.3388 0.4313 0.2717 0.0373  0.1156  -0.0797 150 VAL A N   
1102 C CA  . VAL A 150 ? 0.3423 0.4325 0.2618 0.0464  0.1134  -0.0708 150 VAL A CA  
1103 C C   . VAL A 150 ? 0.3515 0.4365 0.2533 0.0509  0.1150  -0.0584 150 VAL A C   
1104 O O   . VAL A 150 ? 0.3550 0.4323 0.2442 0.0514  0.1126  -0.0518 150 VAL A O   
1105 C CB  . VAL A 150 ? 0.3421 0.4116 0.2547 0.0438  0.1130  -0.0705 150 VAL A CB  
1106 C CG1 . VAL A 150 ? 0.4556 0.5228 0.3626 0.0383  0.1081  -0.0700 150 VAL A CG1 
1107 C CG2 . VAL A 150 ? 0.5350 0.5942 0.4371 0.0437  0.1154  -0.0664 150 VAL A CG2 
1108 N N   . THR A 151 ? 0.5582 0.6373 0.4588 0.0484  0.1244  -0.0580 151 THR A N   
1109 C CA  . THR A 151 ? 0.5339 0.6066 0.4252 0.0397  0.1308  -0.0562 151 THR A CA  
1110 C C   . THR A 151 ? 0.4923 0.5531 0.3777 0.0313  0.1284  -0.0576 151 THR A C   
1111 O O   . THR A 151 ? 0.4027 0.4563 0.2914 0.0319  0.1282  -0.0599 151 THR A O   
1112 C CB  . THR A 151 ? 0.6228 0.7001 0.5228 0.0346  0.1399  -0.0594 151 THR A CB  
1113 O OG1 . THR A 151 ? 0.6991 0.7721 0.6051 0.0350  0.1426  -0.0627 151 THR A OG1 
1114 C CG2 . THR A 151 ? 0.6112 0.6993 0.5186 0.0420  0.1443  -0.0582 151 THR A CG2 
1115 N N   . VAL A 152 ? 0.3336 0.3897 0.2104 0.0225  0.1266  -0.0563 152 VAL A N   
1116 C CA  . VAL A 152 ? 0.4458 0.4902 0.3185 0.0136  0.1248  -0.0578 152 VAL A CA  
1117 C C   . VAL A 152 ? 0.5424 0.5866 0.4140 -0.0010 0.1278  -0.0611 152 VAL A C   
1118 O O   . VAL A 152 ? 0.5711 0.6242 0.4399 -0.0061 0.1272  -0.0610 152 VAL A O   
1119 C CB  . VAL A 152 ? 0.3310 0.3718 0.1955 0.0151  0.1181  -0.0550 152 VAL A CB  
1120 C CG1 . VAL A 152 ? 0.3332 0.3624 0.1949 0.0054  0.1174  -0.0572 152 VAL A CG1 
1121 C CG2 . VAL A 152 ? 0.3227 0.3675 0.1910 0.0272  0.1140  -0.0545 152 VAL A CG2 
1122 N N   . SER A 153 ? 0.5656 0.6002 0.4392 -0.0082 0.1307  -0.0646 153 SER A N   
1123 C CA  . SER A 153 ? 0.5302 0.5650 0.4032 -0.0230 0.1326  -0.0692 153 SER A CA  
1124 C C   . SER A 153 ? 0.5961 0.6181 0.4652 -0.0288 0.1309  -0.0707 153 SER A C   
1125 O O   . SER A 153 ? 0.5015 0.5136 0.3700 -0.0213 0.1298  -0.0686 153 SER A O   
1126 C CB  . SER A 153 ? 0.5232 0.5596 0.4038 -0.0274 0.1399  -0.0735 153 SER A CB  
1127 O OG  . SER A 153 ? 0.5236 0.5450 0.4049 -0.0298 0.1439  -0.0757 153 SER A OG  
1128 N N   . TRP A 154 ? 0.6248 0.6485 0.4918 -0.0421 0.1302  -0.0746 154 TRP A N   
1129 C CA  . TRP A 154 ? 0.5451 0.5580 0.4096 -0.0481 0.1294  -0.0768 154 TRP A CA  
1130 C C   . TRP A 154 ? 0.5802 0.5887 0.4479 -0.0584 0.1347  -0.0827 154 TRP A C   
1131 O O   . TRP A 154 ? 0.6258 0.6437 0.4946 -0.0693 0.1355  -0.0871 154 TRP A O   
1132 C CB  . TRP A 154 ? 0.5618 0.5797 0.4204 -0.0554 0.1239  -0.0767 154 TRP A CB  
1133 C CG  . TRP A 154 ? 0.4928 0.5082 0.3475 -0.0456 0.1196  -0.0714 154 TRP A CG  
1134 C CD1 . TRP A 154 ? 0.5920 0.6142 0.4435 -0.0376 0.1167  -0.0667 154 TRP A CD1 
1135 C CD2 . TRP A 154 ? 0.4790 0.4846 0.3326 -0.0425 0.1179  -0.0708 154 TRP A CD2 
1136 N NE1 . TRP A 154 ? 0.5877 0.6045 0.4361 -0.0303 0.1133  -0.0634 154 TRP A NE1 
1137 C CE2 . TRP A 154 ? 0.4818 0.4891 0.3320 -0.0334 0.1139  -0.0660 154 TRP A CE2 
1138 C CE3 . TRP A 154 ? 0.4649 0.4612 0.3202 -0.0466 0.1195  -0.0740 154 TRP A CE3 
1139 C CZ2 . TRP A 154 ? 0.4666 0.4668 0.3158 -0.0289 0.1116  -0.0650 154 TRP A CZ2 
1140 C CZ3 . TRP A 154 ? 0.4726 0.4627 0.3268 -0.0415 0.1171  -0.0726 154 TRP A CZ3 
1141 C CH2 . TRP A 154 ? 0.4722 0.4644 0.3238 -0.0331 0.1132  -0.0684 154 TRP A CH2 
1142 N N   . ASN A 155 ? 0.4869 0.4810 0.3555 -0.0548 0.1384  -0.0829 155 ASN A N   
1143 C CA  . ASN A 155 ? 0.5151 0.5018 0.3857 -0.0632 0.1445  -0.0880 155 ASN A CA  
1144 C C   . ASN A 155 ? 0.5683 0.5625 0.4437 -0.0664 0.1493  -0.0907 155 ASN A C   
1145 O O   . ASN A 155 ? 0.5886 0.5874 0.4660 -0.0785 0.1518  -0.0966 155 ASN A O   
1146 C CB  . ASN A 155 ? 0.4661 0.4548 0.3353 -0.0766 0.1431  -0.0932 155 ASN A CB  
1147 C CG  . ASN A 155 ? 0.5534 0.5293 0.4201 -0.0753 0.1431  -0.0930 155 ASN A CG  
1148 O OD1 . ASN A 155 ? 0.6062 0.5694 0.4729 -0.0744 0.1483  -0.0941 155 ASN A OD1 
1149 N ND2 . ASN A 155 ? 0.5912 0.5705 0.4557 -0.0751 0.1377  -0.0917 155 ASN A ND2 
1150 N N   . SER A 156 ? 0.6035 0.6000 0.4814 -0.0559 0.1507  -0.0868 156 SER A N   
1151 C CA  . SER A 156 ? 0.6141 0.6197 0.4981 -0.0575 0.1556  -0.0891 156 SER A CA  
1152 C C   . SER A 156 ? 0.5116 0.5350 0.3977 -0.0681 0.1534  -0.0935 156 SER A C   
1153 O O   . SER A 156 ? 0.4931 0.5198 0.3832 -0.0785 0.1579  -0.0998 156 SER A O   
1154 C CB  . SER A 156 ? 0.6410 0.6334 0.5271 -0.0618 0.1645  -0.0928 156 SER A CB  
1155 O OG  . SER A 156 ? 0.6740 0.6506 0.5573 -0.0514 0.1671  -0.0882 156 SER A OG  
1156 N N   . GLY A 157 ? 0.5264 0.5613 0.4093 -0.0655 0.1465  -0.0902 157 GLY A N   
1157 C CA  . GLY A 157 ? 0.5586 0.6113 0.4417 -0.0742 0.1436  -0.0931 157 GLY A CA  
1158 C C   . GLY A 157 ? 0.5843 0.6388 0.4660 -0.0902 0.1433  -0.1000 157 GLY A C   
1159 O O   . GLY A 157 ? 0.5991 0.6693 0.4818 -0.0994 0.1418  -0.1040 157 GLY A O   
1160 N N   . ALA A 158 ? 0.4980 0.5373 0.3773 -0.0935 0.1445  -0.1015 158 ALA A N   
1161 C CA  . ALA A 158 ? 0.4895 0.5298 0.3680 -0.1083 0.1446  -0.1083 158 ALA A CA  
1162 C C   . ALA A 158 ? 0.5722 0.6157 0.4440 -0.1126 0.1377  -0.1067 158 ALA A C   
1163 O O   . ALA A 158 ? 0.5868 0.6327 0.4575 -0.1249 0.1370  -0.1120 158 ALA A O   
1164 C CB  . ALA A 158 ? 0.4769 0.4993 0.3570 -0.1104 0.1510  -0.1115 158 ALA A CB  
1165 N N   . LEU A 159 ? 0.5787 0.6217 0.4463 -0.1026 0.1331  -0.0998 159 LEU A N   
1166 C CA  . LEU A 159 ? 0.5576 0.6053 0.4182 -0.1073 0.1269  -0.0979 159 LEU A CA  
1167 C C   . LEU A 159 ? 0.6241 0.6822 0.4796 -0.1007 0.1220  -0.0918 159 LEU A C   
1168 O O   . LEU A 159 ? 0.5556 0.6078 0.4100 -0.0878 0.1212  -0.0859 159 LEU A O   
1169 C CB  . LEU A 159 ? 0.4998 0.5330 0.3589 -0.1027 0.1264  -0.0959 159 LEU A CB  
1170 C CG  . LEU A 159 ? 0.5527 0.5861 0.4055 -0.1029 0.1211  -0.0925 159 LEU A CG  
1171 C CD1 . LEU A 159 ? 0.4759 0.5193 0.3244 -0.1183 0.1184  -0.0963 159 LEU A CD1 
1172 C CD2 . LEU A 159 ? 0.6039 0.6229 0.4584 -0.0973 0.1225  -0.0919 159 LEU A CD2 
1173 N N   . THR A 160 ? 0.7436 0.6039 0.5065 -0.0294 -0.1076 -0.0447 160 THR A N   
1174 C CA  . THR A 160 ? 0.7614 0.6346 0.5277 -0.0384 -0.1057 -0.0339 160 THR A CA  
1175 C C   . THR A 160 ? 0.7734 0.6640 0.5456 -0.0444 -0.0963 -0.0358 160 THR A C   
1176 O O   . THR A 160 ? 0.5319 0.4310 0.3085 -0.0501 -0.0947 -0.0272 160 THR A O   
1177 C CB  . THR A 160 ? 0.8370 0.7045 0.5858 -0.0476 -0.1082 -0.0246 160 THR A CB  
1178 O OG1 . THR A 160 ? 0.8846 0.7536 0.6193 -0.0545 -0.1030 -0.0288 160 THR A OG1 
1179 C CG2 . THR A 160 ? 0.6858 0.5361 0.4272 -0.0444 -0.1154 -0.0228 160 THR A CG2 
1180 N N   . SER A 161 ? 0.7532 0.6482 0.5245 -0.0433 -0.0895 -0.0466 161 SER A N   
1181 C CA  . SER A 161 ? 0.7319 0.6422 0.5047 -0.0508 -0.0789 -0.0476 161 SER A CA  
1182 C C   . SER A 161 ? 0.7975 0.7232 0.5950 -0.0479 -0.0746 -0.0518 161 SER A C   
1183 O O   . SER A 161 ? 0.8614 0.7917 0.6742 -0.0383 -0.0752 -0.0630 161 SER A O   
1184 C CB  . SER A 161 ? 0.8025 0.7123 0.5631 -0.0517 -0.0719 -0.0577 161 SER A CB  
1185 O OG  . SER A 161 ? 0.7937 0.6961 0.5308 -0.0604 -0.0725 -0.0518 161 SER A OG  
1186 N N   . GLY A 162 ? 0.5786 0.5122 0.3797 -0.0562 -0.0708 -0.0429 162 GLY A N   
1187 C CA  . GLY A 162 ? 0.6191 0.5665 0.4435 -0.0561 -0.0669 -0.0458 162 GLY A CA  
1188 C C   . GLY A 162 ? 0.6072 0.5497 0.4436 -0.0504 -0.0773 -0.0411 162 GLY A C   
1189 O O   . GLY A 162 ? 0.7791 0.7323 0.6368 -0.0488 -0.0766 -0.0453 162 GLY A O   
1190 N N   . VAL A 163 ? 0.5138 0.4410 0.3370 -0.0477 -0.0868 -0.0330 163 VAL A N   
1191 C CA  . VAL A 163 ? 0.5388 0.4597 0.3703 -0.0422 -0.0962 -0.0279 163 VAL A CA  
1192 C C   . VAL A 163 ? 0.5301 0.4517 0.3608 -0.0499 -0.0953 -0.0158 163 VAL A C   
1193 O O   . VAL A 163 ? 0.5200 0.4372 0.3338 -0.0569 -0.0936 -0.0062 163 VAL A O   
1194 C CB  . VAL A 163 ? 0.5455 0.4495 0.3634 -0.0362 -0.1056 -0.0244 163 VAL A CB  
1195 C CG1 . VAL A 163 ? 0.4907 0.3879 0.3144 -0.0312 -0.1141 -0.0181 163 VAL A CG1 
1196 C CG2 . VAL A 163 ? 0.5934 0.4919 0.4113 -0.0269 -0.1074 -0.0363 163 VAL A CG2 
1197 N N   . HIS A 164 ? 0.4621 0.3886 0.3105 -0.0482 -0.0969 -0.0170 164 HIS A N   
1198 C CA  . HIS A 164 ? 0.5682 0.4923 0.4162 -0.0544 -0.0965 -0.0064 164 HIS A CA  
1199 C C   . HIS A 164 ? 0.5859 0.5038 0.4439 -0.0467 -0.1063 -0.0053 164 HIS A C   
1200 O O   . HIS A 164 ? 0.4969 0.4219 0.3737 -0.0417 -0.1085 -0.0148 164 HIS A O   
1201 C CB  . HIS A 164 ? 0.4877 0.4236 0.3458 -0.0639 -0.0853 -0.0091 164 HIS A CB  
1202 C CG  . HIS A 164 ? 0.4802 0.4153 0.3198 -0.0742 -0.0758 -0.0025 164 HIS A CG  
1203 N ND1 . HIS A 164 ? 0.7981 0.7445 0.6415 -0.0820 -0.0633 -0.0082 164 HIS A ND1 
1204 C CD2 . HIS A 164 ? 0.4863 0.4109 0.3029 -0.0771 -0.0776 0.0094  164 HIS A CD2 
1205 C CE1 . HIS A 164 ? 0.9039 0.8445 0.7245 -0.0895 -0.0574 0.0003  164 HIS A CE1 
1206 N NE2 . HIS A 164 ? 0.9999 0.9279 0.8047 -0.0862 -0.0667 0.0107  164 HIS A NE2 
1207 N N   . THR A 165 ? 0.4444 0.3502 0.2898 -0.0453 -0.1125 0.0057  165 THR A N   
1208 C CA  . THR A 165 ? 0.4992 0.3976 0.3510 -0.0382 -0.1211 0.0076  165 THR A CA  
1209 C C   . THR A 165 ? 0.5035 0.3980 0.3539 -0.0437 -0.1200 0.0173  165 THR A C   
1210 O O   . THR A 165 ? 0.4776 0.3653 0.3127 -0.0464 -0.1202 0.0283  165 THR A O   
1211 C CB  . THR A 165 ? 0.5043 0.3909 0.3436 -0.0308 -0.1290 0.0117  165 THR A CB  
1212 O OG1 . THR A 165 ? 0.4363 0.3222 0.2754 -0.0251 -0.1303 0.0024  165 THR A OG1 
1213 C CG2 . THR A 165 ? 0.4288 0.3068 0.2722 -0.0235 -0.1370 0.0143  165 THR A CG2 
1214 N N   . PHE A 166 ? 0.5567 0.4553 0.4232 -0.0452 -0.1191 0.0125  166 PHE A N   
1215 C CA  . PHE A 166 ? 0.5577 0.4502 0.4229 -0.0513 -0.1170 0.0204  166 PHE A CA  
1216 C C   . PHE A 166 ? 0.5291 0.4079 0.3870 -0.0441 -0.1260 0.0282  166 PHE A C   
1217 O O   . PHE A 166 ? 0.4895 0.3654 0.3506 -0.0345 -0.1340 0.0242  166 PHE A O   
1218 C CB  . PHE A 166 ? 0.4178 0.3192 0.3039 -0.0564 -0.1131 0.0113  166 PHE A CB  
1219 C CG  . PHE A 166 ? 0.6017 0.5171 0.4946 -0.0660 -0.1014 0.0052  166 PHE A CG  
1220 C CD1 . PHE A 166 ? 0.6115 0.5232 0.4935 -0.0778 -0.0911 0.0130  166 PHE A CD1 
1221 C CD2 . PHE A 166 ? 0.5776 0.5089 0.4861 -0.0625 -0.1002 -0.0084 166 PHE A CD2 
1222 C CE1 . PHE A 166 ? 0.5481 0.4721 0.4346 -0.0871 -0.0790 0.0075  166 PHE A CE1 
1223 C CE2 . PHE A 166 ? 0.5016 0.4471 0.4167 -0.0711 -0.0883 -0.0146 166 PHE A CE2 
1224 C CZ  . PHE A 166 ? 0.5044 0.4464 0.4083 -0.0839 -0.0771 -0.0066 166 PHE A CZ  
1225 N N   . PRO A 167 ? 0.4922 0.3612 0.3384 -0.0480 -0.1245 0.0395  167 PRO A N   
1226 C CA  . PRO A 167 ? 0.3936 0.2501 0.2333 -0.0408 -0.1322 0.0467  167 PRO A CA  
1227 C C   . PRO A 167 ? 0.3909 0.2444 0.2450 -0.0366 -0.1374 0.0395  167 PRO A C   
1228 O O   . PRO A 167 ? 0.3961 0.2528 0.2621 -0.0434 -0.1333 0.0344  167 PRO A O   
1229 C CB  . PRO A 167 ? 0.4066 0.2539 0.2329 -0.0465 -0.1280 0.0583  167 PRO A CB  
1230 C CG  . PRO A 167 ? 0.4136 0.2681 0.2328 -0.0550 -0.1197 0.0595  167 PRO A CG  
1231 C CD  . PRO A 167 ? 0.5007 0.3686 0.3366 -0.0582 -0.1155 0.0464  167 PRO A CD  
1232 N N   . ALA A 168 ? 0.4178 0.2654 0.2705 -0.0261 -0.1459 0.0388  168 ALA A N   
1233 C CA  . ALA A 168 ? 0.5957 0.4395 0.4597 -0.0209 -0.1522 0.0318  168 ALA A CA  
1234 C C   . ALA A 168 ? 0.4267 0.2595 0.2891 -0.0248 -0.1515 0.0370  168 ALA A C   
1235 O O   . ALA A 168 ? 0.4956 0.3183 0.3434 -0.0245 -0.1505 0.0481  168 ALA A O   
1236 C CB  . ALA A 168 ? 0.6200 0.4571 0.4786 -0.0087 -0.1600 0.0311  168 ALA A CB  
1237 N N   . VAL A 169 ? 0.4498 0.2845 0.3273 -0.0284 -0.1523 0.0283  169 VAL A N   
1238 C CA  . VAL A 169 ? 0.5666 0.3879 0.4424 -0.0328 -0.1518 0.0319  169 VAL A CA  
1239 C C   . VAL A 169 ? 0.6262 0.4395 0.5061 -0.0237 -0.1620 0.0263  169 VAL A C   
1240 O O   . VAL A 169 ? 0.4554 0.2776 0.3478 -0.0185 -0.1680 0.0152  169 VAL A O   
1241 C CB  . VAL A 169 ? 0.5615 0.3892 0.4502 -0.0473 -0.1431 0.0269  169 VAL A CB  
1242 C CG1 . VAL A 169 ? 0.5529 0.3986 0.4661 -0.0482 -0.1454 0.0108  169 VAL A CG1 
1243 C CG2 . VAL A 169 ? 0.5919 0.4013 0.4750 -0.0532 -0.1415 0.0319  169 VAL A CG2 
1244 N N   . LEU A 170 ? 0.5371 0.3325 0.4047 -0.0206 -0.1643 0.0339  170 LEU A N   
1245 C CA  . LEU A 170 ? 0.5728 0.3578 0.4411 -0.0123 -0.1734 0.0291  170 LEU A CA  
1246 C C   . LEU A 170 ? 0.5783 0.3639 0.4627 -0.0212 -0.1735 0.0191  170 LEU A C   
1247 O O   . LEU A 170 ? 0.6161 0.3980 0.5019 -0.0335 -0.1656 0.0219  170 LEU A O   
1248 C CB  . LEU A 170 ? 0.5682 0.3340 0.4173 -0.0053 -0.1751 0.0403  170 LEU A CB  
1249 C CG  . LEU A 170 ? 0.4924 0.2409 0.3390 -0.0018 -0.1807 0.0377  170 LEU A CG  
1250 C CD1 . LEU A 170 ? 0.6511 0.4046 0.5049 0.0077  -0.1863 0.0261  170 LEU A CD1 
1251 C CD2 . LEU A 170 ? 0.4950 0.2395 0.3324 0.0012  -0.1698 0.0435  170 LEU A CD2 
1252 N N   . GLN A 171 ? 0.5015 0.2912 0.3971 -0.0154 -0.1825 0.0072  171 GLN A N   
1253 C CA  . GLN A 171 ? 0.6050 0.4009 0.5204 -0.0242 -0.1837 -0.0052 171 GLN A CA  
1254 C C   . GLN A 171 ? 0.5905 0.3705 0.5022 -0.0181 -0.1934 -0.0094 171 GLN A C   
1255 O O   . GLN A 171 ? 0.5899 0.3559 0.4842 -0.0055 -0.1990 -0.0036 171 GLN A O   
1256 C CB  . GLN A 171 ? 0.6341 0.4548 0.5713 -0.0236 -0.1865 -0.0190 171 GLN A CB  
1257 C CG  . GLN A 171 ? 0.6832 0.5058 0.6160 -0.0069 -0.1974 -0.0232 171 GLN A CG  
1258 C CD  . GLN A 171 ? 0.8001 0.6449 0.7481 -0.0043 -0.1982 -0.0329 171 GLN A CD  
1259 O OE1 . GLN A 171 ? 0.8536 0.6982 0.7956 0.0091  -0.2058 -0.0354 171 GLN A OE1 
1260 N NE2 . GLN A 171 ? 0.7480 0.6108 0.7149 -0.0168 -0.1898 -0.0385 171 GLN A NE2 
1261 N N   . SER A 172 ? 0.6562 0.4384 0.5840 -0.0276 -0.1945 -0.0199 172 SER A N   
1262 C CA  . SER A 172 ? 0.7469 0.5114 0.6706 -0.0251 -0.2024 -0.0243 172 SER A CA  
1263 C C   . SER A 172 ? 0.7737 0.5328 0.6878 -0.0070 -0.2155 -0.0279 172 SER A C   
1264 O O   . SER A 172 ? 0.9306 0.6697 0.8318 -0.0013 -0.2211 -0.0269 172 SER A O   
1265 C CB  . SER A 172 ? 0.8045 0.5796 0.7527 -0.0384 -0.2034 -0.0391 172 SER A CB  
1266 O OG  . SER A 172 ? 0.8878 0.6435 0.8306 -0.0378 -0.2105 -0.0434 172 SER A OG  
1267 N N   . SER A 173 ? 0.5167 0.2917 0.4355 0.0022  -0.2200 -0.0322 173 SER A N   
1268 C CA  . SER A 173 ? 0.5166 0.2849 0.4234 0.0195  -0.2311 -0.0348 173 SER A CA  
1269 C C   . SER A 173 ? 0.5149 0.2669 0.3980 0.0289  -0.2234 -0.0203 173 SER A C   
1270 O O   . SER A 173 ? 0.5155 0.2614 0.3911 0.0394  -0.2193 -0.0225 173 SER A O   
1271 C CB  . SER A 173 ? 0.9056 0.6958 0.8266 0.0267  -0.2289 -0.0415 173 SER A CB  
1272 O OG  . SER A 173 ? 0.4916 0.2872 0.4064 0.0265  -0.2212 -0.0329 173 SER A OG  
1273 N N   . GLY A 174 ? 0.4801 0.2281 0.3539 0.0228  -0.2170 -0.0079 174 GLY A N   
1274 C CA  . GLY A 174 ? 0.4722 0.2181 0.3334 0.0272  -0.2010 0.0004  174 GLY A CA  
1275 C C   . GLY A 174 ? 0.5737 0.3364 0.4383 0.0296  -0.1911 0.0007  174 GLY A C   
1276 O O   . GLY A 174 ? 0.5399 0.3077 0.3981 0.0322  -0.1788 0.0044  174 GLY A O   
1277 N N   . LEU A 175 ? 0.6186 0.3920 0.4945 0.0284  -0.1971 -0.0041 175 LEU A N   
1278 C CA  . LEU A 175 ? 0.5705 0.3568 0.4488 0.0310  -0.1897 -0.0045 175 LEU A CA  
1279 C C   . LEU A 175 ? 0.5568 0.3531 0.4388 0.0224  -0.1893 0.0006  175 LEU A C   
1280 O O   . LEU A 175 ? 0.5395 0.3394 0.4291 0.0144  -0.1985 -0.0020 175 LEU A O   
1281 C CB  . LEU A 175 ? 0.4494 0.2410 0.3366 0.0388  -0.1959 -0.0160 175 LEU A CB  
1282 C CG  . LEU A 175 ? 0.4554 0.2372 0.3345 0.0483  -0.1946 -0.0211 175 LEU A CG  
1283 C CD1 . LEU A 175 ? 0.4603 0.2471 0.3487 0.0563  -0.2024 -0.0322 175 LEU A CD1 
1284 C CD2 . LEU A 175 ? 0.4478 0.2294 0.3148 0.0496  -0.1817 -0.0157 175 LEU A CD2 
1285 N N   . TYR A 176 ? 0.5637 0.3662 0.4407 0.0219  -0.1788 0.0063  176 TYR A N   
1286 C CA  . TYR A 176 ? 0.6094 0.4206 0.4873 0.0139  -0.1783 0.0109  176 TYR A CA  
1287 C C   . TYR A 176 ? 0.4665 0.2908 0.3564 0.0145  -0.1851 0.0007  176 TYR A C   
1288 O O   . TYR A 176 ? 0.4656 0.2915 0.3608 0.0235  -0.1869 -0.0076 176 TYR A O   
1289 C CB  . TYR A 176 ? 0.5698 0.3852 0.4398 0.0131  -0.1655 0.0186  176 TYR A CB  
1290 C CG  . TYR A 176 ? 0.4590 0.2703 0.3224 0.0126  -0.1573 0.0258  176 TYR A CG  
1291 C CD1 . TYR A 176 ? 0.4639 0.2732 0.3224 0.0060  -0.1552 0.0342  176 TYR A CD1 
1292 C CD2 . TYR A 176 ? 0.4550 0.2654 0.3167 0.0191  -0.1518 0.0238  176 TYR A CD2 
1293 C CE1 . TYR A 176 ? 0.4635 0.2720 0.3179 0.0075  -0.1478 0.0393  176 TYR A CE1 
1294 C CE2 . TYR A 176 ? 0.7978 0.6089 0.6559 0.0197  -0.1449 0.0290  176 TYR A CE2 
1295 C CZ  . TYR A 176 ? 0.8514 0.6624 0.7069 0.0147  -0.1430 0.0363  176 TYR A CZ  
1296 O OH  . TYR A 176 ? 0.9492 0.7623 0.8022 0.0173  -0.1366 0.0409  176 TYR A OH  
1297 N N   . SER A 177 ? 0.4807 0.3167 0.3781 0.0040  -0.1820 0.0000  177 SER A N   
1298 C CA  . SER A 177 ? 0.4305 0.2837 0.3425 0.0037  -0.1811 -0.0106 177 SER A CA  
1299 C C   . SER A 177 ? 0.4277 0.2903 0.3391 -0.0068 -0.1696 -0.0060 177 SER A C   
1300 O O   . SER A 177 ? 0.7697 0.6298 0.6782 -0.0172 -0.1622 0.0013  177 SER A O   
1301 C CB  . SER A 177 ? 0.6020 0.4676 0.5374 0.0010  -0.1846 -0.0243 177 SER A CB  
1302 O OG  . SER A 177 ? 0.7077 0.5650 0.6422 0.0120  -0.1967 -0.0298 177 SER A OG  
1303 N N   . LEU A 178 ? 0.3639 0.5376 0.3774 0.0253  -0.0591 0.0594  178 LEU A N   
1304 C CA  . LEU A 178 ? 0.3637 0.5480 0.3757 0.0266  -0.0624 0.0543  178 LEU A CA  
1305 C C   . LEU A 178 ? 0.3934 0.5828 0.4046 0.0284  -0.0575 0.0570  178 LEU A C   
1306 O O   . LEU A 178 ? 0.3413 0.5262 0.3540 0.0291  -0.0517 0.0627  178 LEU A O   
1307 C CB  . LEU A 178 ? 0.2489 0.4385 0.2677 0.0269  -0.0692 0.0431  178 LEU A CB  
1308 C CG  . LEU A 178 ? 0.4395 0.6327 0.4688 0.0272  -0.0696 0.0356  178 LEU A CG  
1309 C CD1 . LEU A 178 ? 0.4505 0.6610 0.4800 0.0287  -0.0676 0.0330  178 LEU A CD1 
1310 C CD2 . LEU A 178 ? 0.2418 0.4389 0.2809 0.0253  -0.0758 0.0263  178 LEU A CD2 
1311 N N   . SER A 179 ? 0.4050 0.6039 0.4136 0.0293  -0.0600 0.0529  179 SER A N   
1312 C CA  . SER A 179 ? 0.3564 0.5614 0.3636 0.0317  -0.0561 0.0546  179 SER A CA  
1313 C C   . SER A 179 ? 0.3824 0.5991 0.3915 0.0324  -0.0606 0.0445  179 SER A C   
1314 O O   . SER A 179 ? 0.3418 0.5605 0.3489 0.0302  -0.0668 0.0385  179 SER A O   
1315 C CB  . SER A 179 ? 0.3712 0.5808 0.3725 0.0314  -0.0526 0.0622  179 SER A CB  
1316 O OG  . SER A 179 ? 0.3213 0.5252 0.3225 0.0285  -0.0502 0.0696  179 SER A OG  
1317 N N   . SER A 180 ? 0.3951 0.6332 0.4087 0.0365  -0.0555 0.0446  180 SER A N   
1318 C CA  . SER A 180 ? 0.3979 0.6626 0.4128 0.0378  -0.0568 0.0346  180 SER A CA  
1319 C C   . SER A 180 ? 0.3382 0.6175 0.3471 0.0431  -0.0511 0.0394  180 SER A C   
1320 O O   . SER A 180 ? 0.2734 0.5552 0.2842 0.0488  -0.0438 0.0483  180 SER A O   
1321 C CB  . SER A 180 ? 0.3415 0.6239 0.3684 0.0386  -0.0558 0.0256  180 SER A CB  
1322 O OG  . SER A 180 ? 0.2733 0.5815 0.3023 0.0374  -0.0576 0.0106  180 SER A OG  
1323 N N   . VAL A 181 ? 0.2605 0.5487 0.2621 0.0418  -0.0540 0.0342  181 VAL A N   
1324 C CA  . VAL A 181 ? 0.3058 0.6089 0.3003 0.0471  -0.0487 0.0382  181 VAL A CA  
1325 C C   . VAL A 181 ? 0.2748 0.6055 0.2650 0.0479  -0.0502 0.0240  181 VAL A C   
1326 O O   . VAL A 181 ? 0.3377 0.6712 0.3288 0.0413  -0.0568 0.0109  181 VAL A O   
1327 C CB  . VAL A 181 ? 0.3240 0.6122 0.3114 0.0443  -0.0498 0.0449  181 VAL A CB  
1328 C CG1 . VAL A 181 ? 0.3542 0.6160 0.3446 0.0420  -0.0484 0.0546  181 VAL A CG1 
1329 C CG2 . VAL A 181 ? 0.3244 0.6075 0.3074 0.0380  -0.0585 0.0361  181 VAL A CG2 
1330 N N   . VAL A 182 ? 0.2014 0.5466 0.1861 0.0552  -0.0422 0.0252  182 VAL A N   
1331 C CA  . VAL A 182 ? 0.2219 0.5633 0.1995 0.0507  -0.0330 0.0073  182 VAL A CA  
1332 C C   . VAL A 182 ? 0.2331 0.5782 0.1978 0.0558  -0.0261 0.0131  182 VAL A C   
1333 O O   . VAL A 182 ? 0.8937 1.2368 0.8595 0.0640  -0.0198 0.0285  182 VAL A O   
1334 C CB  . VAL A 182 ? 0.3941 0.7145 0.3791 0.0489  -0.0159 -0.0051 182 VAL A CB  
1335 C CG1 . VAL A 182 ? 0.2338 0.5396 0.2226 0.0580  -0.0013 0.0075  182 VAL A CG1 
1336 C CG2 . VAL A 182 ? 0.4299 0.7451 0.4053 0.0428  -0.0069 -0.0245 182 VAL A CG2 
1337 N N   . THR A 183 ? 0.2611 0.6125 0.2135 0.0506  -0.0279 0.0011  183 THR A N   
1338 C CA  . THR A 183 ? 0.5114 0.8658 0.4504 0.0545  -0.0204 0.0046  183 THR A CA  
1339 C C   . THR A 183 ? 0.5327 0.8697 0.4665 0.0538  -0.0003 -0.0100 183 THR A C   
1340 O O   . THR A 183 ? 0.4907 0.8212 0.4221 0.0453  0.0011  -0.0281 183 THR A O   
1341 C CB  . THR A 183 ? 0.6558 1.0278 0.5807 0.0491  -0.0357 0.0026  183 THR A CB  
1342 O OG1 . THR A 183 ? 0.7090 1.0819 0.6319 0.0390  -0.0428 -0.0156 183 THR A OG1 
1343 C CG2 . THR A 183 ? 0.5207 0.8863 0.4570 0.0483  -0.0462 0.0177  183 THR A CG2 
1344 N N   . VAL A 184 ? 0.4811 0.8105 0.4130 0.0629  0.0153  -0.0018 184 VAL A N   
1345 C CA  . VAL A 184 ? 0.4959 0.8061 0.4220 0.0644  0.0364  -0.0135 184 VAL A CA  
1346 C C   . VAL A 184 ? 0.5087 0.8223 0.4242 0.0720  0.0466  -0.0061 184 VAL A C   
1347 O O   . VAL A 184 ? 0.4563 0.7854 0.3736 0.0778  0.0396  0.0111  184 VAL A O   
1348 C CB  . VAL A 184 ? 0.3720 0.6623 0.3109 0.0697  0.0500  -0.0115 184 VAL A CB  
1349 C CG1 . VAL A 184 ? 0.3626 0.6484 0.3114 0.0614  0.0420  -0.0207 184 VAL A CG1 
1350 C CG2 . VAL A 184 ? 0.3556 0.6507 0.3045 0.0810  0.0506  0.0110  184 VAL A CG2 
1351 N N   . PRO A 185 ? 0.6167 0.9157 0.5205 0.0716  0.0635  -0.0191 185 PRO A N   
1352 C CA  . PRO A 185 ? 0.6529 0.9535 0.5474 0.0798  0.0759  -0.0127 185 PRO A CA  
1353 C C   . PRO A 185 ? 0.6097 0.9083 0.5172 0.0939  0.0865  0.0057  185 PRO A C   
1354 O O   . PRO A 185 ? 0.4566 0.7391 0.3749 0.0980  0.0955  0.0061  185 PRO A O   
1355 C CB  . PRO A 185 ? 0.7467 1.0262 0.6267 0.0759  0.0933  -0.0323 185 PRO A CB  
1356 C CG  . PRO A 185 ? 0.4911 0.7541 0.3779 0.0693  0.0946  -0.0449 185 PRO A CG  
1357 C CD  . PRO A 185 ? 0.4640 0.7445 0.3611 0.0627  0.0716  -0.0407 185 PRO A CD  
1358 N N   . SER A 186 ? 0.6003 0.9160 0.5067 0.1007  0.0847  0.0209  186 SER A N   
1359 C CA  . SER A 186 ? 0.6583 0.9774 0.5770 0.1140  0.0931  0.0404  186 SER A CA  
1360 C C   . SER A 186 ? 0.6555 0.9517 0.5777 0.1234  0.1166  0.0367  186 SER A C   
1361 O O   . SER A 186 ? 0.6402 0.9271 0.5762 0.1296  0.1208  0.0448  186 SER A O   
1362 C CB  . SER A 186 ? 0.6835 1.0238 0.5964 0.1184  0.0911  0.0529  186 SER A CB  
1363 O OG  . SER A 186 ? 0.7675 1.1085 0.6900 0.1320  0.1056  0.0673  186 SER A OG  
1364 N N   . SER A 187 ? 0.7127 0.9989 0.6209 0.1245  0.1321  0.0248  187 SER A N   
1365 C CA  . SER A 187 ? 0.7270 0.9898 0.6350 0.1341  0.1561  0.0205  187 SER A CA  
1366 C C   . SER A 187 ? 0.6440 0.8823 0.5576 0.1316  0.1610  0.0111  187 SER A C   
1367 O O   . SER A 187 ? 0.5745 0.7942 0.4934 0.1414  0.1776  0.0137  187 SER A O   
1368 C CB  . SER A 187 ? 0.7811 1.0338 0.6687 0.1319  0.1702  0.0048  187 SER A CB  
1369 O OG  . SER A 187 ? 0.8151 1.0659 0.6887 0.1162  0.1595  -0.0129 187 SER A OG  
1370 N N   . SER A 188 ? 0.6869 0.9251 0.5994 0.1184  0.1465  0.0006  188 SER A N   
1371 C CA  . SER A 188 ? 0.6832 0.8994 0.6007 0.1142  0.1505  -0.0093 188 SER A CA  
1372 C C   . SER A 188 ? 0.5153 0.7317 0.4519 0.1207  0.1462  0.0070  188 SER A C   
1373 O O   . SER A 188 ? 0.5177 0.7149 0.4590 0.1182  0.1506  0.0006  188 SER A O   
1374 C CB  . SER A 188 ? 0.6530 0.8715 0.5650 0.0978  0.1362  -0.0257 188 SER A CB  
1375 O OG  . SER A 188 ? 0.5988 0.8407 0.5204 0.0940  0.1141  -0.0152 188 SER A OG  
1376 N N   . LEU A 189 ? 0.5584 0.7956 0.5048 0.1281  0.1376  0.0277  189 LEU A N   
1377 C CA  . LEU A 189 ? 0.5436 0.7818 0.5064 0.1319  0.1309  0.0430  189 LEU A CA  
1378 C C   . LEU A 189 ? 0.8022 1.0188 0.7708 0.1440  0.1506  0.0480  189 LEU A C   
1379 O O   . LEU A 189 ? 0.9442 1.1639 0.9139 0.1559  0.1619  0.0580  189 LEU A O   
1380 C CB  . LEU A 189 ? 0.4482 0.7146 0.4179 0.1350  0.1154  0.0638  189 LEU A CB  
1381 C CG  . LEU A 189 ? 0.4579 0.7453 0.4224 0.1241  0.0940  0.0622  189 LEU A CG  
1382 C CD1 . LEU A 189 ? 0.4090 0.7216 0.3752 0.1291  0.0849  0.0820  189 LEU A CD1 
1383 C CD2 . LEU A 189 ? 0.5298 0.8153 0.5014 0.1154  0.0791  0.0603  189 LEU A CD2 
1384 N N   . GLY A 190 ? 0.7548 0.9497 0.7275 0.1408  0.1543  0.0414  190 GLY A N   
1385 C CA  . GLY A 190 ? 0.7296 0.8991 0.7047 0.1506  0.1732  0.0428  190 GLY A CA  
1386 C C   . GLY A 190 ? 0.6711 0.8118 0.6326 0.1479  0.1911  0.0215  190 GLY A C   
1387 O O   . GLY A 190 ? 0.7251 0.8411 0.6885 0.1532  0.2040  0.0210  190 GLY A O   
1388 N N   . THR A 191 ? 0.6238 0.7654 0.5704 0.1393  0.1921  0.0042  191 THR A N   
1389 C CA  . THR A 191 ? 0.6850 0.7970 0.6174 0.1331  0.2068  -0.0174 191 THR A CA  
1390 C C   . THR A 191 ? 0.7765 0.8836 0.7109 0.1180  0.1956  -0.0297 191 THR A C   
1391 O O   . THR A 191 ? 0.8443 0.9251 0.7731 0.1128  0.2059  -0.0431 191 THR A O   
1392 C CB  . THR A 191 ? 0.8639 0.9740 0.7768 0.1293  0.2150  -0.0326 191 THR A CB  
1393 O OG1 . THR A 191 ? 0.8654 1.0029 0.7758 0.1203  0.1971  -0.0338 191 THR A OG1 
1394 C CG2 . THR A 191 ? 0.8816 0.9854 0.7898 0.1449  0.2338  -0.0252 191 THR A CG2 
1395 N N   . GLN A 192 ? 0.6521 0.7850 0.5941 0.1108  0.1746  -0.0250 192 GLN A N   
1396 C CA  . GLN A 192 ? 0.6176 0.7516 0.5640 0.0971  0.1620  -0.0349 192 GLN A CA  
1397 C C   . GLN A 192 ? 0.5265 0.6739 0.4901 0.0994  0.1475  -0.0177 192 GLN A C   
1398 O O   . GLN A 192 ? 0.4015 0.5738 0.3702 0.1019  0.1335  -0.0043 192 GLN A O   
1399 C CB  . GLN A 192 ? 0.5210 0.6723 0.4586 0.0848  0.1494  -0.0480 192 GLN A CB  
1400 C CG  . GLN A 192 ? 0.5167 0.6745 0.4608 0.0711  0.1343  -0.0574 192 GLN A CG  
1401 C CD  . GLN A 192 ? 0.5691 0.7009 0.5114 0.0631  0.1449  -0.0735 192 GLN A CD  
1402 O OE1 . GLN A 192 ? 0.5668 0.6788 0.5142 0.0688  0.1557  -0.0686 192 GLN A OE1 
1403 N NE2 . GLN A 192 ? 0.6202 0.7520 0.5544 0.0493  0.1417  -0.0927 192 GLN A NE2 
1404 N N   . THR A 193 ? 0.5581 0.6872 0.5289 0.0979  0.1514  -0.0183 193 THR A N   
1405 C CA  . THR A 193 ? 0.4729 0.6096 0.4583 0.0993  0.1395  -0.0028 193 THR A CA  
1406 C C   . THR A 193 ? 0.4457 0.6005 0.4359 0.0873  0.1202  -0.0080 193 THR A C   
1407 O O   . THR A 193 ? 0.4342 0.5847 0.4203 0.0760  0.1192  -0.0265 193 THR A O   
1408 C CB  . THR A 193 ? 0.3666 0.4756 0.3565 0.1008  0.1506  -0.0025 193 THR A CB  
1409 O OG1 . THR A 193 ? 0.3872 0.4788 0.3728 0.1132  0.1684  0.0030  193 THR A OG1 
1410 C CG2 . THR A 193 ? 0.3410 0.4567 0.3444 0.1019  0.1386  0.0142  193 THR A CG2 
1411 N N   . TYR A 194 ? 0.5127 0.6875 0.5113 0.0899  0.1050  0.0087  194 TYR A N   
1412 C CA  . TYR A 194 ? 0.3991 0.5916 0.4022 0.0805  0.0862  0.0061  194 TYR A CA  
1413 C C   . TYR A 194 ? 0.4430 0.6299 0.4576 0.0788  0.0801  0.0144  194 TYR A C   
1414 O O   . TYR A 194 ? 0.3686 0.5553 0.3885 0.0864  0.0789  0.0331  194 TYR A O   
1415 C CB  . TYR A 194 ? 0.3109 0.5306 0.3115 0.0833  0.0722  0.0173  194 TYR A CB  
1416 C CG  . TYR A 194 ? 0.3284 0.5534 0.3162 0.0826  0.0772  0.0067  194 TYR A CG  
1417 C CD1 . TYR A 194 ? 0.3428 0.5630 0.3236 0.0723  0.0788  -0.0149 194 TYR A CD1 
1418 C CD2 . TYR A 194 ? 0.3320 0.5665 0.3145 0.0917  0.0810  0.0178  194 TYR A CD2 
1419 C CE1 . TYR A 194 ? 0.3610 0.5841 0.3281 0.0707  0.0836  -0.0250 194 TYR A CE1 
1420 C CE2 . TYR A 194 ? 0.4722 0.7099 0.4415 0.0905  0.0866  0.0074  194 TYR A CE2 
1421 C CZ  . TYR A 194 ? 0.3649 0.5959 0.3258 0.0798  0.0878  -0.0140 194 TYR A CZ  
1422 O OH  . TYR A 194 ? 0.3847 0.6172 0.3306 0.0777  0.0933  -0.0246 194 TYR A OH  
1423 N N   . ILE A 195 ? 0.5312 0.7132 0.5494 0.0683  0.0766  0.0003  195 ILE A N   
1424 C CA  . ILE A 195 ? 0.5706 0.7460 0.5989 0.0655  0.0716  0.0062  195 ILE A CA  
1425 C C   . ILE A 195 ? 0.5576 0.7504 0.5913 0.0565  0.0547  0.0003  195 ILE A C   
1426 O O   . ILE A 195 ? 0.5358 0.7330 0.5683 0.0478  0.0530  -0.0176 195 ILE A O   
1427 C CB  . ILE A 195 ? 0.4494 0.5956 0.4785 0.0625  0.0875  -0.0039 195 ILE A CB  
1428 C CG1 . ILE A 195 ? 0.3341 0.4714 0.3725 0.0599  0.0835  0.0036  195 ILE A CG1 
1429 C CG2 . ILE A 195 ? 0.4997 0.6401 0.5242 0.0520  0.0931  -0.0281 195 ILE A CG2 
1430 C CD1 . ILE A 195 ? 0.3675 0.4753 0.4056 0.0561  0.0988  -0.0060 195 ILE A CD1 
1431 N N   . CYS A 196 ? 0.6006 0.8039 0.6397 0.0588  0.0419  0.0162  196 CYS A N   
1432 C CA  . CYS A 196 ? 0.4409 0.6587 0.4858 0.0519  0.0261  0.0130  196 CYS A CA  
1433 C C   . CYS A 196 ? 0.4076 0.6105 0.4613 0.0454  0.0294  0.0060  196 CYS A C   
1434 O O   . CYS A 196 ? 0.3528 0.5354 0.4081 0.0477  0.0399  0.0116  196 CYS A O   
1435 C CB  . CYS A 196 ? 0.3918 0.6250 0.4363 0.0568  0.0113  0.0328  196 CYS A CB  
1436 S SG  . CYS A 196 ? 0.8336 1.0780 0.8854 0.0505  -0.0064 0.0333  196 CYS A SG  
1437 N N   . ASN A 197 ? 0.3340 0.5479 0.3934 0.0373  0.0205  -0.0063 197 ASN A N   
1438 C CA  . ASN A 197 ? 0.3710 0.5749 0.4396 0.0291  0.0237  -0.0178 197 ASN A CA  
1439 C C   . ASN A 197 ? 0.3049 0.5237 0.3815 0.0271  0.0078  -0.0128 197 ASN A C   
1440 O O   . ASN A 197 ? 0.4003 0.6395 0.4788 0.0242  -0.0042 -0.0193 197 ASN A O   
1441 C CB  . ASN A 197 ? 0.4665 0.6712 0.5347 0.0206  0.0297  -0.0406 197 ASN A CB  
1442 C CG  . ASN A 197 ? 0.6005 0.7841 0.6599 0.0216  0.0481  -0.0474 197 ASN A CG  
1443 O OD1 . ASN A 197 ? 0.6968 0.8649 0.7581 0.0141  0.0587  -0.0616 197 ASN A OD1 
1444 N ND2 . ASN A 197 ? 0.7517 0.9316 0.8023 0.0315  0.0530  -0.0349 197 ASN A ND2 
1445 N N   . VAL A 198 ? 0.3112 0.5184 0.3916 0.0285  0.0078  -0.0014 198 VAL A N   
1446 C CA  . VAL A 198 ? 0.3317 0.5504 0.4179 0.0273  -0.0063 0.0044  198 VAL A CA  
1447 C C   . VAL A 198 ? 0.3307 0.5385 0.4274 0.0196  -0.0011 -0.0067 198 VAL A C   
1448 O O   . VAL A 198 ? 0.4080 0.5936 0.5051 0.0176  0.0125  -0.0084 198 VAL A O   
1449 C CB  . VAL A 198 ? 0.3677 0.5839 0.4482 0.0341  -0.0132 0.0277  198 VAL A CB  
1450 C CG1 . VAL A 198 ? 0.1933 0.4167 0.2784 0.0321  -0.0259 0.0321  198 VAL A CG1 
1451 C CG2 . VAL A 198 ? 0.3961 0.6265 0.4667 0.0409  -0.0197 0.0387  198 VAL A CG2 
1452 N N   . ASN A 199 ? 0.1814 0.4055 0.2869 0.0153  -0.0113 -0.0150 199 ASN A N   
1453 C CA  . ASN A 199 ? 0.3244 0.5420 0.4415 0.0084  -0.0078 -0.0245 199 ASN A CA  
1454 C C   . ASN A 199 ? 0.3153 0.5432 0.4374 0.0103  -0.0213 -0.0160 199 ASN A C   
1455 O O   . ASN A 199 ? 0.3537 0.6040 0.4783 0.0115  -0.0345 -0.0183 199 ASN A O   
1456 C CB  . ASN A 199 ? 0.3889 0.6176 0.5155 -0.0001 -0.0057 -0.0468 199 ASN A CB  
1457 C CG  . ASN A 199 ? 0.4058 0.6159 0.5393 -0.0083 0.0089  -0.0588 199 ASN A CG  
1458 O OD1 . ASN A 199 ? 0.5350 0.7251 0.6678 -0.0077 0.0153  -0.0502 199 ASN A OD1 
1459 N ND2 . ASN A 199 ? 0.3478 0.5666 0.4891 -0.0171 0.0120  -0.0787 199 ASN A ND2 
1460 N N   . HIS A 200 ? 0.3302 0.5417 0.4534 0.0100  -0.0182 -0.0073 200 HIS A N   
1461 C CA  . HIS A 200 ? 0.2732 0.4936 0.4032 0.0099  -0.0286 -0.0049 200 HIS A CA  
1462 C C   . HIS A 200 ? 0.3758 0.5863 0.5182 0.0022  -0.0192 -0.0175 200 HIS A C   
1463 O O   . HIS A 200 ? 0.3773 0.5644 0.5169 0.0001  -0.0095 -0.0123 200 HIS A O   
1464 C CB  . HIS A 200 ? 0.3139 0.5258 0.4331 0.0157  -0.0355 0.0168  200 HIS A CB  
1465 C CG  . HIS A 200 ? 0.2870 0.5081 0.4099 0.0170  -0.0474 0.0206  200 HIS A CG  
1466 N ND1 . HIS A 200 ? 0.3044 0.5031 0.4126 0.0192  -0.0503 0.0357  200 HIS A ND1 
1467 C CD2 . HIS A 200 ? 0.3114 0.5408 0.4417 0.0150  -0.0532 0.0083  200 HIS A CD2 
1468 C CE1 . HIS A 200 ? 0.2072 0.3987 0.3130 0.0190  -0.0562 0.0310  200 HIS A CE1 
1469 N NE2 . HIS A 200 ? 0.2953 0.5050 0.4155 0.0170  -0.0585 0.0165  200 HIS A NE2 
1470 N N   . LYS A 201 ? 0.3231 0.5521 0.4791 -0.0022 -0.0228 -0.0335 201 LYS A N   
1471 C CA  . LYS A 201 ? 0.3052 0.5283 0.4747 -0.0107 -0.0129 -0.0482 201 LYS A CA  
1472 C C   . LYS A 201 ? 0.3176 0.5297 0.4913 -0.0109 -0.0125 -0.0413 201 LYS A C   
1473 O O   . LYS A 201 ? 0.3768 0.5680 0.5520 -0.0166 0.0004  -0.0447 201 LYS A O   
1474 C CB  . LYS A 201 ? 0.2603 0.5095 0.4446 -0.0156 -0.0179 -0.0666 201 LYS A CB  
1475 C CG  . LYS A 201 ? 0.4082 0.6755 0.5868 -0.0132 -0.0260 -0.0695 201 LYS A CG  
1476 C CD  . LYS A 201 ? 0.5176 0.8045 0.7091 -0.0213 -0.0263 -0.0902 201 LYS A CD  
1477 C CE  . LYS A 201 ? 0.5391 0.8090 0.7316 -0.0310 -0.0089 -0.1039 201 LYS A CE  
1478 N NZ  . LYS A 201 ? 0.5297 0.8166 0.7278 -0.0391 -0.0093 -0.1223 201 LYS A NZ  
1479 N N   . PRO A 202 ? 0.3181 0.5423 0.4922 -0.0049 -0.0261 -0.0319 202 PRO A N   
1480 C CA  . PRO A 202 ? 0.1715 0.3821 0.3468 -0.0049 -0.0247 -0.0247 202 PRO A CA  
1481 C C   . PRO A 202 ? 0.1679 0.3474 0.3287 -0.0053 -0.0158 -0.0106 202 PRO A C   
1482 O O   . PRO A 202 ? 0.4326 0.5934 0.5960 -0.0106 -0.0057 -0.0128 202 PRO A O   
1483 C CB  . PRO A 202 ? 0.1536 0.3799 0.3257 0.0032  -0.0417 -0.0139 202 PRO A CB  
1484 C CG  . PRO A 202 ? 0.3235 0.5679 0.4974 0.0042  -0.0494 -0.0225 202 PRO A CG  
1485 C CD  . PRO A 202 ? 0.2820 0.5328 0.4567 0.0011  -0.0426 -0.0301 202 PRO A CD  
1486 N N   . SER A 203 ? 0.2051 0.3795 0.3508 0.0000  -0.0196 0.0039  203 SER A N   
1487 C CA  . SER A 203 ? 0.3292 0.4761 0.4612 0.0000  -0.0123 0.0186  203 SER A CA  
1488 C C   . SER A 203 ? 0.2217 0.3521 0.3547 -0.0055 0.0035  0.0093  203 SER A C   
1489 O O   . SER A 203 ? 0.3158 0.4214 0.4395 -0.0068 0.0116  0.0187  203 SER A O   
1490 C CB  . SER A 203 ? 0.3569 0.5064 0.4738 0.0075  -0.0217 0.0373  203 SER A CB  
1491 O OG  . SER A 203 ? 0.3419 0.5004 0.4575 0.0096  -0.0196 0.0331  203 SER A OG  
1492 N N   . ASN A 204 ? 0.2425 0.3864 0.3860 -0.0092 0.0073  -0.0091 204 ASN A N   
1493 C CA  . ASN A 204 ? 0.3679 0.4979 0.5110 -0.0143 0.0218  -0.0196 204 ASN A CA  
1494 C C   . ASN A 204 ? 0.3597 0.4773 0.4886 -0.0087 0.0247  -0.0066 204 ASN A C   
1495 O O   . ASN A 204 ? 0.3735 0.4654 0.4949 -0.0100 0.0347  0.0000  204 ASN A O   
1496 C CB  . ASN A 204 ? 0.3593 0.4656 0.5053 -0.0224 0.0349  -0.0252 204 ASN A CB  
1497 C CG  . ASN A 204 ? 0.3925 0.4855 0.5388 -0.0292 0.0497  -0.0396 204 ASN A CG  
1498 O OD1 . ASN A 204 ? 0.3268 0.4353 0.4797 -0.0321 0.0505  -0.0546 204 ASN A OD1 
1499 N ND2 . ASN A 204 ? 0.4590 0.5221 0.5974 -0.0326 0.0616  -0.0352 204 ASN A ND2 
1500 N N   . THR A 205 ? 0.5113 0.4006 0.5408 -0.0437 -0.1638 0.0672  205 THR A N   
1501 C CA  . THR A 205 ? 0.5469 0.4410 0.5565 -0.0329 -0.1544 0.0710  205 THR A CA  
1502 C C   . THR A 205 ? 0.5604 0.4325 0.5414 -0.0342 -0.1657 0.0717  205 THR A C   
1503 O O   . THR A 205 ? 0.4137 0.2809 0.3896 -0.0423 -0.1763 0.0694  205 THR A O   
1504 C CB  . THR A 205 ? 0.5492 0.4680 0.5607 -0.0276 -0.1407 0.0726  205 THR A CB  
1505 O OG1 . THR A 205 ? 0.3182 0.2521 0.3497 -0.0266 -0.1299 0.0710  205 THR A OG1 
1506 C CG2 . THR A 205 ? 0.5703 0.4935 0.5619 -0.0151 -0.1298 0.0775  205 THR A CG2 
1507 N N   . LYS A 206 ? 0.4346 0.2894 0.3939 -0.0256 -0.1607 0.0750  206 LYS A N   
1508 C CA  . LYS A 206 ? 0.5940 0.4236 0.5175 -0.0251 -0.1672 0.0759  206 LYS A CA  
1509 C C   . LYS A 206 ? 0.6142 0.4464 0.5190 -0.0105 -0.1487 0.0820  206 LYS A C   
1510 O O   . LYS A 206 ? 0.5127 0.3435 0.4218 -0.0011 -0.1342 0.0847  206 LYS A O   
1511 C CB  . LYS A 206 ? 0.6581 0.4475 0.5644 -0.0305 -0.1785 0.0730  206 LYS A CB  
1512 C CG  . LYS A 206 ? 0.7677 0.5348 0.6384 -0.0349 -0.1812 0.0665  206 LYS A CG  
1513 C CD  . LYS A 206 ? 0.8677 0.6084 0.7323 -0.0437 -0.1802 0.0536  206 LYS A CD  
1514 C CE  . LYS A 206 ? 0.9587 0.6754 0.7858 -0.0479 -0.1810 0.0465  206 LYS A CE  
1515 N NZ  . LYS A 206 ? 0.9524 0.6790 0.7753 -0.0570 -0.2008 0.0474  206 LYS A NZ  
1516 N N   . VAL A 207 ? 0.5646 0.4020 0.4505 -0.0086 -0.1480 0.0839  207 VAL A N   
1517 C CA  . VAL A 207 ? 0.5736 0.4175 0.4438 0.0052  -0.1307 0.0902  207 VAL A CA  
1518 C C   . VAL A 207 ? 0.7284 0.5488 0.5586 0.0056  -0.1343 0.0902  207 VAL A C   
1519 O O   . VAL A 207 ? 0.7151 0.5320 0.5372 -0.0045 -0.1483 0.0861  207 VAL A O   
1520 C CB  . VAL A 207 ? 0.3624 0.2471 0.2549 0.0101  -0.1201 0.0931  207 VAL A CB  
1521 C CG1 . VAL A 207 ? 0.5507 0.4443 0.4275 0.0236  -0.1043 0.1003  207 VAL A CG1 
1522 C CG2 . VAL A 207 ? 0.3284 0.2316 0.2520 0.0113  -0.1129 0.0917  207 VAL A CG2 
1523 N N   . ASP A 208 ? 0.7637 0.5669 0.5679 0.0173  -0.1203 0.0939  208 ASP A N   
1524 C CA  . ASP A 208 ? 0.7507 0.5322 0.5136 0.0198  -0.1192 0.0933  208 ASP A CA  
1525 C C   . ASP A 208 ? 0.7477 0.5530 0.5090 0.0328  -0.1013 0.1006  208 ASP A C   
1526 O O   . ASP A 208 ? 0.8403 0.6456 0.6029 0.0444  -0.0852 0.1045  208 ASP A O   
1527 C CB  . ASP A 208 ? 0.7920 0.5305 0.5249 0.0206  -0.1134 0.0853  208 ASP A CB  
1528 C CG  . ASP A 208 ? 0.8710 0.5945 0.6116 0.0045  -0.1281 0.0739  208 ASP A CG  
1529 O OD1 . ASP A 208 ? 0.9020 0.6392 0.6565 -0.0067 -0.1474 0.0744  208 ASP A OD1 
1530 O OD2 . ASP A 208 ? 0.8823 0.5804 0.6150 0.0029  -0.1205 0.0645  208 ASP A OD2 
1531 N N   . LYS A 209 ? 0.7163 0.5428 0.4771 0.0304  -0.1041 0.1023  209 LYS A N   
1532 C CA  . LYS A 209 ? 0.6703 0.5237 0.4342 0.0402  -0.0893 0.1102  209 LYS A CA  
1533 C C   . LYS A 209 ? 0.6552 0.4845 0.3768 0.0446  -0.0842 0.1087  209 LYS A C   
1534 O O   . LYS A 209 ? 0.6140 0.4241 0.3117 0.0370  -0.0952 0.1028  209 LYS A O   
1535 C CB  . LYS A 209 ? 0.5113 0.4070 0.3042 0.0370  -0.0917 0.1133  209 LYS A CB  
1536 C CG  . LYS A 209 ? 0.5133 0.4485 0.3318 0.0451  -0.0766 0.1237  209 LYS A CG  
1537 C CD  . LYS A 209 ? 0.5220 0.4664 0.3679 0.0483  -0.0698 0.1253  209 LYS A CD  
1538 C CE  . LYS A 209 ? 0.4204 0.3909 0.2992 0.0354  -0.0656 0.1288  209 LYS A CE  
1539 N NZ  . LYS A 209 ? 0.5668 0.5079 0.4525 0.0263  -0.0747 0.1179  209 LYS A NZ  
1540 N N   . LYS A 210 ? 0.6542 0.4855 0.3678 0.0563  -0.0672 0.1129  210 LYS A N   
1541 C CA  . LYS A 210 ? 0.7161 0.5255 0.3902 0.0632  -0.0582 0.1103  210 LYS A CA  
1542 C C   . LYS A 210 ? 0.7315 0.5752 0.4162 0.0622  -0.0558 0.1165  210 LYS A C   
1543 O O   . LYS A 210 ? 0.6938 0.5625 0.3995 0.0661  -0.0467 0.1223  210 LYS A O   
1544 C CB  . LYS A 210 ? 0.7243 0.5116 0.3814 0.0779  -0.0391 0.1089  210 LYS A CB  
1545 C CG  . LYS A 210 ? 0.7817 0.5453 0.3979 0.0869  -0.0266 0.1055  210 LYS A CG  
1546 C CD  . LYS A 210 ? 0.8648 0.5916 0.4556 0.0989  -0.0107 0.1008  210 LYS A CD  
1547 C CE  . LYS A 210 ? 0.8337 0.5822 0.4511 0.1109  0.0051  0.1053  210 LYS A CE  
1548 N NZ  . LYS A 210 ? 0.8504 0.5640 0.4438 0.1232  0.0218  0.1006  210 LYS A NZ  
1549 N N   . VAL A 211 ? 0.7531 0.5942 0.4217 0.0552  -0.0650 0.1142  211 VAL A N   
1550 C CA  . VAL A 211 ? 0.7614 0.6359 0.4421 0.0514  -0.0653 0.1202  211 VAL A CA  
1551 C C   . VAL A 211 ? 0.8150 0.6775 0.4652 0.0594  -0.0530 0.1196  211 VAL A C   
1552 O O   . VAL A 211 ? 0.7521 0.5830 0.3651 0.0614  -0.0525 0.1129  211 VAL A O   
1553 C CB  . VAL A 211 ? 0.7034 0.5859 0.3875 0.0411  -0.0803 0.1174  211 VAL A CB  
1554 C CG1 . VAL A 211 ? 0.7340 0.6589 0.4403 0.0380  -0.0793 0.1253  211 VAL A CG1 
1555 C CG2 . VAL A 211 ? 0.5793 0.4625 0.2864 0.0355  -0.0911 0.1138  211 VAL A CG2 
1556 N N   . GLU A 212 ? 0.8866 0.7719 0.5519 0.0630  -0.0435 0.1253  212 GLU A N   
1557 C CA  . GLU A 212 ? 0.8684 0.7460 0.5094 0.0730  -0.0297 0.1245  212 GLU A CA  
1558 C C   . GLU A 212 ? 0.7426 0.6500 0.4007 0.0667  -0.0308 0.1302  212 GLU A C   
1559 O O   . GLU A 212 ? 0.6337 0.5613 0.3222 0.0594  -0.0360 0.1335  212 GLU A O   
1560 C CB  . GLU A 212 ? 0.8705 0.7334 0.5050 0.0896  -0.0118 0.1225  212 GLU A CB  
1561 C CG  . GLU A 212 ? 0.9614 0.7871 0.5739 0.0950  -0.0095 0.1161  212 GLU A CG  
1562 C CD  . GLU A 212 ? 1.1278 0.9400 0.7341 0.1116  0.0096  0.1146  212 GLU A CD  
1563 O OE1 . GLU A 212 ? 1.2830 1.0951 0.8763 0.1225  0.0234  0.1148  212 GLU A OE1 
1564 O OE2 . GLU A 212 ? 1.0752 0.8776 0.6909 0.1139  0.0110  0.1133  212 GLU A OE2 
1565 N N   . PRO A 213 ? 0.7650 0.6695 0.4004 0.0688  -0.0262 0.1298  213 PRO A N   
1566 C CA  . PRO A 213 ? 0.8148 0.7413 0.4608 0.0633  -0.0265 0.1341  213 PRO A CA  
1567 C C   . PRO A 213 ? 0.9409 0.8749 0.5952 0.0773  -0.0103 0.1351  213 PRO A C   
1568 O O   . PRO A 213 ? 1.0031 0.9242 0.6472 0.0930  0.0037  0.1329  213 PRO A O   
1569 C CB  . PRO A 213 ? 0.8077 0.7260 0.4241 0.0620  -0.0264 0.1327  213 PRO A CB  
1570 C CG  . PRO A 213 ? 0.7782 0.6645 0.3633 0.0752  -0.0166 0.1263  213 PRO A CG  
1571 C CD  . PRO A 213 ? 0.7460 0.6214 0.3417 0.0753  -0.0213 0.1240  213 PRO A CD  
1572 N N   . GLU B 1   ? 0.7474 0.6715 0.6450 -0.2141 -0.0029 0.0243  1   GLU B N   
1573 C CA  . GLU B 1   ? 0.8031 0.7348 0.7026 -0.2108 0.0011  0.0266  1   GLU B CA  
1574 C C   . GLU B 1   ? 0.6912 0.6133 0.5919 -0.2070 0.0046  0.0341  1   GLU B C   
1575 O O   . GLU B 1   ? 0.6299 0.5388 0.5371 -0.2033 0.0056  0.0405  1   GLU B O   
1576 C CB  . GLU B 1   ? 0.9487 0.8843 0.8564 -0.2065 0.0007  0.0290  1   GLU B CB  
1577 C CG  . GLU B 1   ? 1.0520 0.9774 0.9726 -0.2011 -0.0008 0.0354  1   GLU B CG  
1578 C CD  . GLU B 1   ? 1.0898 1.0186 1.0169 -0.1984 -0.0023 0.0364  1   GLU B CD  
1579 O OE1 . GLU B 1   ? 1.1275 1.0649 1.0526 -0.1972 0.0002  0.0356  1   GLU B OE1 
1580 O OE2 . GLU B 1   ? 1.0210 0.9430 0.9559 -0.1979 -0.0062 0.0374  1   GLU B OE2 
1581 N N   . ILE B 2   ? 0.6009 0.5285 0.4952 -0.2083 0.0074  0.0331  2   ILE B N   
1582 C CA  . ILE B 2   ? 0.5926 0.5088 0.4816 -0.2052 0.0119  0.0411  2   ILE B CA  
1583 C C   . ILE B 2   ? 0.5769 0.4964 0.4782 -0.1976 0.0145  0.0459  2   ILE B C   
1584 O O   . ILE B 2   ? 0.6612 0.5943 0.5687 -0.1975 0.0130  0.0413  2   ILE B O   
1585 C CB  . ILE B 2   ? 0.5645 0.4868 0.4398 -0.2020 0.0115  0.0345  2   ILE B CB  
1586 C CG1 . ILE B 2   ? 0.5090 0.4337 0.3782 -0.1940 0.0068  0.0252  2   ILE B CG1 
1587 C CG2 . ILE B 2   ? 0.4844 0.3946 0.3498 -0.1898 0.0160  0.0423  2   ILE B CG2 
1588 C CD1 . ILE B 2   ? 0.4938 0.4283 0.3539 -0.1798 0.0030  0.0141  2   ILE B CD1 
1589 N N   . VAL B 3   ? 0.4127 0.3186 0.3188 -0.1908 0.0195  0.0552  3   VAL B N   
1590 C CA  . VAL B 3   ? 0.6313 0.5397 0.5525 -0.1835 0.0225  0.0591  3   VAL B CA  
1591 C C   . VAL B 3   ? 0.5695 0.4745 0.4792 -0.1818 0.0275  0.0632  3   VAL B C   
1592 O O   . VAL B 3   ? 0.5651 0.4534 0.4629 -0.1783 0.0339  0.0713  3   VAL B O   
1593 C CB  . VAL B 3   ? 0.4028 0.3005 0.3433 -0.1767 0.0264  0.0655  3   VAL B CB  
1594 C CG1 . VAL B 3   ? 0.3902 0.2927 0.3496 -0.1702 0.0291  0.0676  3   VAL B CG1 
1595 C CG2 . VAL B 3   ? 0.4011 0.2991 0.3496 -0.1799 0.0208  0.0612  3   VAL B CG2 
1596 N N   . LEU B 4   ? 0.4788 0.3976 0.3902 -0.1835 0.0254  0.0583  4   LEU B N   
1597 C CA  . LEU B 4   ? 0.5490 0.4658 0.4498 -0.1829 0.0293  0.0612  4   LEU B CA  
1598 C C   . LEU B 4   ? 0.6186 0.5347 0.5366 -0.1742 0.0333  0.0663  4   LEU B C   
1599 O O   . LEU B 4   ? 0.5874 0.5154 0.5224 -0.1724 0.0303  0.0621  4   LEU B O   
1600 C CB  . LEU B 4   ? 0.5415 0.4749 0.4373 -0.1914 0.0251  0.0513  4   LEU B CB  
1601 C CG  . LEU B 4   ? 0.5331 0.4692 0.4136 -0.2012 0.0223  0.0443  4   LEU B CG  
1602 C CD1 . LEU B 4   ? 0.5040 0.4616 0.3901 -0.1990 0.0176  0.0296  4   LEU B CD1 
1603 C CD2 . LEU B 4   ? 0.5668 0.4874 0.4283 -0.1832 0.0232  0.0474  4   LEU B CD2 
1604 N N   . THR B 5   ? 0.6783 0.5788 0.5908 -0.1678 0.0413  0.0759  5   THR B N   
1605 C CA  . THR B 5   ? 0.6475 0.5471 0.5780 -0.1597 0.0468  0.0812  5   THR B CA  
1606 C C   . THR B 5   ? 0.6066 0.5059 0.5214 -0.1600 0.0494  0.0825  5   THR B C   
1607 O O   . THR B 5   ? 0.5169 0.4028 0.4018 -0.1601 0.0533  0.0868  5   THR B O   
1608 C CB  . THR B 5   ? 0.6052 0.4889 0.5453 -0.1512 0.0562  0.0920  5   THR B CB  
1609 O OG1 . THR B 5   ? 0.6655 0.5469 0.6150 -0.1530 0.0537  0.0905  5   THR B OG1 
1610 C CG2 . THR B 5   ? 0.5276 0.4151 0.4964 -0.1441 0.0609  0.0959  5   THR B CG2 
1611 N N   . GLN B 6   ? 0.4986 0.4104 0.4299 -0.1591 0.0474  0.0787  6   GLN B N   
1612 C CA  . GLN B 6   ? 0.4852 0.3978 0.4038 -0.1603 0.0493  0.0792  6   GLN B CA  
1613 C C   . GLN B 6   ? 0.4301 0.3349 0.3601 -0.1506 0.0579  0.0880  6   GLN B C   
1614 O O   . GLN B 6   ? 0.4145 0.3230 0.3732 -0.1451 0.0592  0.0894  6   GLN B O   
1615 C CB  . GLN B 6   ? 0.4097 0.3422 0.3384 -0.1667 0.0416  0.0685  6   GLN B CB  
1616 C CG  . GLN B 6   ? 0.4092 0.3515 0.3291 -0.1764 0.0351  0.0597  6   GLN B CG  
1617 C CD  . GLN B 6   ? 0.7743 0.7357 0.7061 -0.1810 0.0302  0.0496  6   GLN B CD  
1618 O OE1 . GLN B 6   ? 0.6372 0.6080 0.5796 -0.1814 0.0265  0.0437  6   GLN B OE1 
1619 N NE2 . GLN B 6   ? 0.6681 0.6338 0.5974 -0.1838 0.0314  0.0480  6   GLN B NE2 
1620 N N   . SER B 7   ? 0.4484 0.3409 0.3534 -0.1481 0.0643  0.0943  7   SER B N   
1621 C CA  . SER B 7   ? 0.5269 0.4123 0.4403 -0.1386 0.0733  0.1037  7   SER B CA  
1622 C C   . SER B 7   ? 0.6379 0.5219 0.5294 -0.1404 0.0745  0.1023  7   SER B C   
1623 O O   . SER B 7   ? 0.6631 0.5399 0.5177 -0.1447 0.0731  0.0994  7   SER B O   
1624 C CB  . SER B 7   ? 0.6152 0.4810 0.5166 -0.1288 0.0831  0.1167  7   SER B CB  
1625 O OG  . SER B 7   ? 0.6505 0.4962 0.5035 -0.1254 0.0869  0.1185  7   SER B OG  
1626 N N   . PRO B 8   ? 0.4719 0.3623 0.3843 -0.1369 0.0770  0.1044  8   PRO B N   
1627 C CA  . PRO B 8   ? 0.5552 0.4547 0.5097 -0.1313 0.0779  0.1077  8   PRO B CA  
1628 C C   . PRO B 8   ? 0.6193 0.5355 0.5992 -0.1354 0.0690  0.0958  8   PRO B C   
1629 O O   . PRO B 8   ? 0.6195 0.5434 0.5886 -0.1433 0.0611  0.0865  8   PRO B O   
1630 C CB  . PRO B 8   ? 0.4976 0.3954 0.4533 -0.1266 0.0836  0.1147  8   PRO B CB  
1631 C CG  . PRO B 8   ? 0.5079 0.4045 0.4331 -0.1335 0.0815  0.1070  8   PRO B CG  
1632 C CD  . PRO B 8   ? 0.4850 0.3723 0.3758 -0.1381 0.0794  0.1038  8   PRO B CD  
1633 N N   . ALA B 9   ? 0.5253 0.4443 0.5309 -0.1332 0.0697  0.0963  9   ALA B N   
1634 C CA  . ALA B 9   ? 0.3388 0.2673 0.3520 -0.1403 0.0611  0.0858  9   ALA B CA  
1635 C C   . ALA B 9   ? 0.3309 0.2689 0.3424 -0.1425 0.0579  0.0807  9   ALA B C   
1636 O O   . ALA B 9   ? 0.4868 0.4354 0.4962 -0.1471 0.0503  0.0725  9   ALA B O   
1637 C CB  . ALA B 9   ? 0.3431 0.2674 0.3737 -0.1414 0.0626  0.0876  9   ALA B CB  
1638 N N   . THR B 10  ? 0.3374 0.2716 0.3510 -0.1386 0.0642  0.0864  10  THR B N   
1639 C CA  . THR B 10  ? 0.3306 0.2728 0.3452 -0.1403 0.0622  0.0821  10  THR B CA  
1640 C C   . THR B 10  ? 0.3398 0.2766 0.3418 -0.1355 0.0692  0.0891  10  THR B C   
1641 O O   . THR B 10  ? 0.4970 0.4221 0.4903 -0.1308 0.0767  0.1001  10  THR B O   
1642 C CB  . THR B 10  ? 0.4408 0.3838 0.4703 -0.1420 0.0620  0.0818  10  THR B CB  
1643 O OG1 . THR B 10  ? 0.4482 0.3951 0.4827 -0.1465 0.0553  0.0764  10  THR B OG1 
1644 C CG2 . THR B 10  ? 0.3226 0.2736 0.3542 -0.1435 0.0602  0.0778  10  THR B CG2 
1645 N N   . LEU B 11  ? 0.4207 0.3637 0.4094 -0.1431 0.0656  0.0828  11  LEU B N   
1646 C CA  . LEU B 11  ? 0.5231 0.4559 0.4809 -0.1465 0.0715  0.0873  11  LEU B CA  
1647 C C   . LEU B 11  ? 0.5621 0.5031 0.5284 -0.1491 0.0707  0.0834  11  LEU B C   
1648 O O   . LEU B 11  ? 0.5925 0.5492 0.5695 -0.1562 0.0626  0.0727  11  LEU B O   
1649 C CB  . LEU B 11  ? 0.6175 0.5473 0.5402 -0.1566 0.0688  0.0825  11  LEU B CB  
1650 C CG  . LEU B 11  ? 0.6386 0.5431 0.5106 -0.1522 0.0789  0.0911  11  LEU B CG  
1651 C CD1 . LEU B 11  ? 0.6340 0.5209 0.5080 -0.1363 0.0896  0.1050  11  LEU B CD1 
1652 C CD2 . LEU B 11  ? 0.7170 0.6224 0.5663 -0.1483 0.0718  0.0835  11  LEU B CD2 
1653 N N   . SER B 12  ? 0.4683 0.3999 0.4326 -0.1426 0.0792  0.0925  12  SER B N   
1654 C CA  . SER B 12  ? 0.6373 0.5761 0.6117 -0.1445 0.0789  0.0894  12  SER B CA  
1655 C C   . SER B 12  ? 0.6282 0.5553 0.5599 -0.1507 0.0854  0.0895  12  SER B C   
1656 O O   . SER B 12  ? 0.7671 0.6725 0.6692 -0.1416 0.0972  0.1000  12  SER B O   
1657 C CB  . SER B 12  ? 0.7203 0.6590 0.7240 -0.1337 0.0833  0.0990  12  SER B CB  
1658 O OG  . SER B 12  ? 0.8696 0.7952 0.8572 -0.1278 0.0916  0.1133  12  SER B OG  
1659 N N   . LEU B 13  ? 0.5608 0.5024 0.4886 -0.1641 0.0785  0.0772  13  LEU B N   
1660 C CA  . LEU B 13  ? 0.5747 0.5163 0.4722 -0.1521 0.0760  0.0671  13  LEU B CA  
1661 C C   . LEU B 13  ? 0.6279 0.5918 0.5498 -0.1573 0.0684  0.0538  13  LEU B C   
1662 O O   . LEU B 13  ? 0.6658 0.6402 0.6206 -0.1795 0.0700  0.0570  13  LEU B O   
1663 C CB  . LEU B 13  ? 0.5710 0.5217 0.4545 -0.1384 0.0631  0.0526  13  LEU B CB  
1664 C CG  . LEU B 13  ? 0.6209 0.5520 0.4713 -0.1229 0.0659  0.0588  13  LEU B CG  
1665 C CD1 . LEU B 13  ? 0.6122 0.5257 0.4677 -0.1383 0.0787  0.0786  13  LEU B CD1 
1666 C CD2 . LEU B 13  ? 0.6617 0.6113 0.5142 -0.1168 0.0499  0.0402  13  LEU B CD2 
1667 N N   . SER B 14  ? 0.6360 0.6069 0.5417 -0.1355 0.0592  0.0377  14  SER B N   
1668 C CA  . SER B 14  ? 0.6468 0.6411 0.5776 -0.1378 0.0499  0.0212  14  SER B CA  
1669 C C   . SER B 14  ? 0.4875 0.5011 0.4175 -0.1215 0.0321  -0.0038 14  SER B C   
1670 O O   . SER B 14  ? 0.5096 0.5148 0.4113 -0.1040 0.0276  -0.0072 14  SER B O   
1671 C CB  . SER B 14  ? 0.4997 0.4825 0.4159 -0.1265 0.0569  0.0252  14  SER B CB  
1672 O OG  . SER B 14  ? 0.5007 0.4614 0.4139 -0.1379 0.0747  0.0486  14  SER B OG  
1673 N N   . PRO B 15  ? 0.4826 0.5225 0.4470 -0.1276 0.0221  -0.0220 15  PRO B N   
1674 C CA  . PRO B 15  ? 0.4997 0.5593 0.4694 -0.1115 0.0046  -0.0485 15  PRO B CA  
1675 C C   . PRO B 15  ? 0.6035 0.6505 0.5287 -0.0770 -0.0031 -0.0576 15  PRO B C   
1676 O O   . PRO B 15  ? 0.6602 0.6959 0.5649 -0.0640 0.0004  -0.0545 15  PRO B O   
1677 C CB  . PRO B 15  ? 0.4917 0.5767 0.5050 -0.1221 -0.0013 -0.0641 15  PRO B CB  
1678 C CG  . PRO B 15  ? 0.4161 0.4999 0.4560 -0.1526 0.0120  -0.0453 15  PRO B CG  
1679 C CD  . PRO B 15  ? 0.4499 0.5040 0.4561 -0.1529 0.0262  -0.0195 15  PRO B CD  
1680 N N   . GLY B 16  ? 0.6253 0.6733 0.5345 -0.0615 -0.0136 -0.0687 16  GLY B N   
1681 C CA  . GLY B 16  ? 0.5190 0.5537 0.3825 -0.0263 -0.0225 -0.0780 16  GLY B CA  
1682 C C   . GLY B 16  ? 0.5642 0.5665 0.3791 -0.0142 -0.0114 -0.0572 16  GLY B C   
1683 O O   . GLY B 16  ? 0.6079 0.5996 0.3852 0.0145  -0.0202 -0.0656 16  GLY B O   
1684 N N   . GLU B 17  ? 0.5918 0.5784 0.4089 -0.0353 0.0072  -0.0312 17  GLU B N   
1685 C CA  . GLU B 17  ? 0.6482 0.6029 0.4240 -0.0251 0.0201  -0.0107 17  GLU B CA  
1686 C C   . GLU B 17  ? 0.7318 0.6888 0.5058 -0.0254 0.0138  -0.0139 17  GLU B C   
1687 O O   . GLU B 17  ? 0.8148 0.7958 0.6259 -0.0434 0.0057  -0.0244 17  GLU B O   
1688 C CB  . GLU B 17  ? 0.6417 0.5784 0.4246 -0.0466 0.0421  0.0166  17  GLU B CB  
1689 C CG  . GLU B 17  ? 0.6686 0.6023 0.4574 -0.0498 0.0505  0.0218  17  GLU B CG  
1690 C CD  . GLU B 17  ? 0.7333 0.6459 0.5272 -0.0680 0.0724  0.0484  17  GLU B CD  
1691 O OE1 . GLU B 17  ? 0.7801 0.6628 0.5405 -0.0554 0.0868  0.0647  17  GLU B OE1 
1692 O OE2 . GLU B 17  ? 0.7473 0.6724 0.5802 -0.0944 0.0756  0.0527  17  GLU B OE2 
1693 N N   . ARG B 18  ? 0.7036 0.6346 0.4336 -0.0045 0.0186  -0.0046 18  ARG B N   
1694 C CA  . ARG B 18  ? 0.6875 0.6164 0.4116 -0.0036 0.0146  -0.0049 18  ARG B CA  
1695 C C   . ARG B 18  ? 0.8081 0.7382 0.5623 -0.0357 0.0262  0.0115  18  ARG B C   
1696 O O   . ARG B 18  ? 0.8244 0.7432 0.5871 -0.0514 0.0417  0.0298  18  ARG B O   
1697 C CB  . ARG B 18  ? 0.7452 0.6410 0.4142 0.0250  0.0213  0.0059  18  ARG B CB  
1698 C CG  . ARG B 18  ? 0.8076 0.7066 0.4509 0.0536  0.0025  -0.0141 18  ARG B CG  
1699 C CD  . ARG B 18  ? 0.9098 0.7738 0.5043 0.0741  0.0132  0.0026  18  ARG B CD  
1700 N NE  . ARG B 18  ? 1.0366 0.9000 0.6014 0.1041  -0.0049 -0.0153 18  ARG B NE  
1701 C CZ  . ARG B 18  ? 1.0381 0.9163 0.6184 0.1001  -0.0173 -0.0271 18  ARG B CZ  
1702 N NH1 . ARG B 18  ? 1.0482 0.9426 0.6713 0.0677  -0.0131 -0.0225 18  ARG B NH1 
1703 N NH2 . ARG B 18  ? 0.9983 0.8745 0.5503 0.1297  -0.0343 -0.0440 18  ARG B NH2 
1704 N N   . ALA B 19  ? 0.6127 0.5557 0.3828 -0.0442 0.0182  0.0041  19  ALA B N   
1705 C CA  . ALA B 19  ? 0.5872 0.5285 0.3791 -0.0706 0.0279  0.0189  19  ALA B CA  
1706 C C   . ALA B 19  ? 0.5994 0.5317 0.3746 -0.0633 0.0258  0.0203  19  ALA B C   
1707 O O   . ALA B 19  ? 0.5968 0.5458 0.3774 -0.0567 0.0113  0.0019  19  ALA B O   
1708 C CB  . ALA B 19  ? 0.5458 0.5162 0.3851 -0.0964 0.0220  0.0091  19  ALA B CB  
1709 N N   . THR B 20  ? 0.5840 0.4903 0.3426 -0.0653 0.0405  0.0414  20  THR B N   
1710 C CA  . THR B 20  ? 0.6257 0.5217 0.3701 -0.0599 0.0401  0.0446  20  THR B CA  
1711 C C   . THR B 20  ? 0.5708 0.4637 0.3395 -0.0861 0.0498  0.0591  20  THR B C   
1712 O O   . THR B 20  ? 0.5706 0.4465 0.3426 -0.0959 0.0647  0.0771  20  THR B O   
1713 C CB  . THR B 20  ? 0.7847 0.6487 0.4816 -0.0321 0.0483  0.0552  20  THR B CB  
1714 O OG1 . THR B 20  ? 0.7264 0.5954 0.3975 -0.0041 0.0334  0.0369  20  THR B OG1 
1715 C CG2 . THR B 20  ? 0.8678 0.7159 0.5561 -0.0330 0.0543  0.0657  20  THR B CG2 
1716 N N   . LEU B 21  ? 0.5345 0.4437 0.3209 -0.0966 0.0408  0.0499  21  LEU B N   
1717 C CA  . LEU B 21  ? 0.5135 0.4223 0.3226 -0.1202 0.0467  0.0602  21  LEU B CA  
1718 C C   . LEU B 21  ? 0.5623 0.4616 0.3573 -0.1130 0.0453  0.0612  21  LEU B C   
1719 O O   . LEU B 21  ? 0.6038 0.5122 0.3883 -0.0990 0.0339  0.0465  21  LEU B O   
1720 C CB  . LEU B 21  ? 0.4985 0.4350 0.3434 -0.1416 0.0392  0.0494  21  LEU B CB  
1721 C CG  . LEU B 21  ? 0.5624 0.5084 0.4292 -0.1556 0.0422  0.0511  21  LEU B CG  
1722 C CD1 . LEU B 21  ? 0.4683 0.4228 0.3277 -0.1397 0.0363  0.0389  21  LEU B CD1 
1723 C CD2 . LEU B 21  ? 0.5313 0.4981 0.4314 -0.1783 0.0384  0.0453  21  LEU B CD2 
1724 N N   . SER B 22  ? 0.5718 0.4529 0.3688 -0.1222 0.0564  0.0777  22  SER B N   
1725 C CA  . SER B 22  ? 0.6009 0.4691 0.3842 -0.1147 0.0574  0.0811  22  SER B CA  
1726 C C   . SER B 22  ? 0.6515 0.5300 0.4603 -0.1357 0.0543  0.0802  22  SER B C   
1727 O O   . SER B 22  ? 0.7083 0.5934 0.5419 -0.1561 0.0568  0.0846  22  SER B O   
1728 C CB  . SER B 22  ? 0.6511 0.4863 0.4147 -0.1045 0.0740  0.1002  22  SER B CB  
1729 O OG  . SER B 22  ? 0.6890 0.5107 0.4367 -0.0938 0.0747  0.1026  22  SER B OG  
1730 N N   . CYS B 23  ? 0.6671 0.5462 0.4680 -0.1292 0.0485  0.0743  23  CYS B N   
1731 C CA  . CYS B 23  ? 0.6423 0.5300 0.4629 -0.1460 0.0452  0.0724  23  CYS B CA  
1732 C C   . CYS B 23  ? 0.6593 0.5286 0.4647 -0.1360 0.0484  0.0782  23  CYS B C   
1733 O O   . CYS B 23  ? 0.6697 0.5341 0.4518 -0.1158 0.0446  0.0728  23  CYS B O   
1734 C CB  . CYS B 23  ? 0.5657 0.4815 0.3994 -0.1509 0.0324  0.0535  23  CYS B CB  
1735 S SG  . CYS B 23  ? 0.5962 0.5254 0.4532 -0.1719 0.0286  0.0492  23  CYS B SG  
1736 N N   . ARG B 24  ? 0.7951 0.6534 0.6142 -0.1488 0.0550  0.0889  24  ARG B N   
1737 C CA  . ARG B 24  ? 0.8382 0.6790 0.6477 -0.1408 0.0589  0.0945  24  ARG B CA  
1738 C C   . ARG B 24  ? 0.6949 0.5459 0.5217 -0.1545 0.0520  0.0887  24  ARG B C   
1739 O O   . ARG B 24  ? 0.6252 0.4887 0.4800 -0.1668 0.0494  0.0869  24  ARG B O   
1740 C CB  . ARG B 24  ? 0.9963 0.8129 0.8103 -0.1370 0.0740  0.1114  24  ARG B CB  
1741 C CG  . ARG B 24  ? 1.1150 0.9185 0.9121 -0.1236 0.0836  0.1193  24  ARG B CG  
1742 C CD  . ARG B 24  ? 1.1808 0.9825 1.0101 -0.1156 0.0929  0.1297  24  ARG B CD  
1743 N NE  . ARG B 24  ? 1.1799 0.9762 1.0006 -0.1061 0.1002  0.1358  24  ARG B NE  
1744 C CZ  . ARG B 24  ? 1.1711 0.9503 0.9837 -0.0927 0.1110  0.1459  24  ARG B CZ  
1745 N NH1 . ARG B 24  ? 1.1283 0.8937 0.9419 -0.0872 0.1163  0.1513  24  ARG B NH1 
1746 N NH2 . ARG B 24  ? 1.1699 0.9448 0.9729 -0.0850 0.1167  0.1494  24  ARG B NH2 
1747 N N   . ALA B 25  ? 0.6289 0.4788 0.4438 -0.1439 0.0471  0.0826  25  ALA B N   
1748 C CA  . ALA B 25  ? 0.5942 0.4543 0.4227 -0.1546 0.0402  0.0755  25  ALA B CA  
1749 C C   . ALA B 25  ? 0.6825 0.5226 0.5161 -0.1559 0.0467  0.0855  25  ALA B C   
1750 O O   . ALA B 25  ? 0.7068 0.5254 0.5268 -0.1422 0.0555  0.0948  25  ALA B O   
1751 C CB  . ALA B 25  ? 0.5872 0.4622 0.4048 -0.1442 0.0294  0.0596  25  ALA B CB  
1752 N N   . SER B 26  ? 0.5113 0.3577 0.3648 -0.1717 0.0429  0.0833  26  SER B N   
1753 C CA  . SER B 26  ? 0.5166 0.3498 0.3820 -0.1717 0.0458  0.0880  26  SER B CA  
1754 C C   . SER B 26  ? 0.5336 0.3608 0.3818 -0.1597 0.0434  0.0838  26  SER B C   
1755 O O   . SER B 26  ? 0.5845 0.3959 0.4371 -0.1566 0.0479  0.0891  26  SER B O   
1756 C CB  . SER B 26  ? 0.4918 0.3444 0.3860 -0.1782 0.0370  0.0787  26  SER B CB  
1757 O OG  . SER B 26  ? 0.6233 0.4915 0.5079 -0.1881 0.0281  0.0681  26  SER B OG  
1758 N N   . GLN B 27  ? 0.5410 0.3835 0.3738 -0.1512 0.0355  0.0724  27  GLN B N   
1759 C CA  . GLN B 27  ? 0.6156 0.4601 0.4347 -0.1383 0.0293  0.0634  27  GLN B CA  
1760 C C   . GLN B 27  ? 0.7952 0.6471 0.5936 -0.1220 0.0246  0.0554  27  GLN B C   
1761 O O   . GLN B 27  ? 1.0202 0.8698 0.8118 -0.1182 0.0284  0.0599  27  GLN B O   
1762 C CB  . GLN B 27  ? 0.6078 0.4710 0.4397 -0.1495 0.0197  0.0507  27  GLN B CB  
1763 C CG  . GLN B 27  ? 0.6057 0.4595 0.4374 -0.1448 0.0185  0.0497  27  GLN B CG  
1764 C CD  . GLN B 27  ? 0.5903 0.4635 0.4284 -0.1511 0.0087  0.0348  27  GLN B CD  
1765 O OE1 . GLN B 27  ? 0.5537 0.4393 0.3829 -0.1424 0.0023  0.0228  27  GLN B OE1 
1766 N NE2 . GLN B 27  ? 0.5723 0.4477 0.4260 -0.1654 0.0073  0.0345  27  GLN B NE2 
1767 N N   . SER B 28  ? 0.6949 0.5552 0.4838 -0.1111 0.0157  0.0428  28  SER B N   
1768 C CA  . SER B 28  ? 0.6887 0.5600 0.4626 -0.0958 0.0077  0.0308  28  SER B CA  
1769 C C   . SER B 28  ? 0.6336 0.5345 0.4237 -0.1042 -0.0032 0.0116  28  SER B C   
1770 O O   . SER B 28  ? 0.6554 0.5650 0.4544 -0.1089 -0.0080 0.0030  28  SER B O   
1771 C CB  . SER B 28  ? 0.6056 0.4621 0.3542 -0.0718 0.0052  0.0296  28  SER B CB  
1772 O OG  . SER B 28  ? 0.6136 0.4823 0.3498 -0.0561 -0.0055 0.0148  28  SER B OG  
1773 N N   . VAL B 29  ? 0.6051 0.5205 0.4007 -0.1062 -0.0059 0.0049  29  VAL B N   
1774 C CA  . VAL B 29  ? 0.6137 0.5562 0.4267 -0.1119 -0.0144 -0.0141 29  VAL B CA  
1775 C C   . VAL B 29  ? 0.5148 0.4662 0.3183 -0.0909 -0.0255 -0.0311 29  VAL B C   
1776 O O   . VAL B 29  ? 0.5023 0.4765 0.3240 -0.0936 -0.0324 -0.0488 29  VAL B O   
1777 C CB  . VAL B 29  ? 0.9172 0.8731 0.7486 -0.1282 -0.0109 -0.0136 29  VAL B CB  
1778 C CG1 . VAL B 29  ? 0.9068 0.8568 0.7496 -0.1487 -0.0028 -0.0004 29  VAL B CG1 
1779 C CG2 . VAL B 29  ? 0.9388 0.8887 0.7589 -0.1181 -0.0096 -0.0091 29  VAL B CG2 
1780 N N   . SER B 30  ? 0.5345 0.4667 0.3101 -0.0692 -0.0267 -0.0259 30  SER B N   
1781 C CA  . SER B 30  ? 0.5545 0.4904 0.3146 -0.0449 -0.0383 -0.0407 30  SER B CA  
1782 C C   . SER B 30  ? 0.7311 0.6803 0.4987 -0.0447 -0.0413 -0.0480 30  SER B C   
1783 O O   . SER B 30  ? 0.7584 0.6962 0.5186 -0.0482 -0.0326 -0.0335 30  SER B O   
1784 C CB  . SER B 30  ? 0.5519 0.5058 0.3238 -0.0397 -0.0507 -0.0622 30  SER B CB  
1785 O OG  . SER B 30  ? 0.6976 0.6793 0.5024 -0.0548 -0.0540 -0.0778 30  SER B OG  
1786 N N   . SER B 31  ? 0.6200 0.5930 0.4044 -0.0399 -0.0537 -0.0712 31  SER B N   
1787 C CA  . SER B 31  ? 0.6113 0.6014 0.4115 -0.0417 -0.0576 -0.0821 31  SER B CA  
1788 C C   . SER B 31  ? 0.5308 0.5436 0.3701 -0.0685 -0.0525 -0.0871 31  SER B C   
1789 O O   . SER B 31  ? 0.6360 0.6661 0.4950 -0.0707 -0.0560 -0.0993 31  SER B O   
1790 C CB  . SER B 31  ? 0.6609 0.6626 0.4582 -0.0175 -0.0748 -0.1064 31  SER B CB  
1791 O OG  . SER B 31  ? 0.7951 0.8041 0.5981 -0.0104 -0.0839 -0.1211 31  SER B OG  
1792 N N   . TYR B 32  ? 0.5044 0.5162 0.3545 -0.0876 -0.0440 -0.0782 32  TYR B N   
1793 C CA  . TYR B 32  ? 0.4772 0.5088 0.3606 -0.1101 -0.0389 -0.0840 32  TYR B CA  
1794 C C   . TYR B 32  ? 0.6358 0.6666 0.5274 -0.1261 -0.0295 -0.0713 32  TYR B C   
1795 O O   . TYR B 32  ? 0.6702 0.7129 0.5851 -0.1448 -0.0232 -0.0723 32  TYR B O   
1796 C CB  . TYR B 32  ? 0.4695 0.4995 0.3585 -0.1232 -0.0336 -0.0798 32  TYR B CB  
1797 C CG  . TYR B 32  ? 0.4939 0.5307 0.3845 -0.1116 -0.0423 -0.0960 32  TYR B CG  
1798 C CD1 . TYR B 32  ? 0.5011 0.5607 0.4172 -0.1088 -0.0489 -0.1194 32  TYR B CD1 
1799 C CD2 . TYR B 32  ? 0.4931 0.5135 0.3628 -0.1036 -0.0436 -0.0887 32  TYR B CD2 
1800 C CE1 . TYR B 32  ? 0.5577 0.6237 0.4775 -0.0979 -0.0573 -0.1352 32  TYR B CE1 
1801 C CE2 . TYR B 32  ? 0.5016 0.5279 0.3727 -0.0926 -0.0519 -0.1035 32  TYR B CE2 
1802 C CZ  . TYR B 32  ? 0.6367 0.6859 0.5326 -0.0898 -0.0591 -0.1269 32  TYR B CZ  
1803 O OH  . TYR B 32  ? 0.6576 0.7127 0.5569 -0.0786 -0.0678 -0.1426 32  TYR B OH  
1804 N N   . LEU B 33  ? 0.6135 0.5011 0.4890 0.0326  -0.0111 0.0764  33  LEU B N   
1805 C CA  . LEU B 33  ? 0.5964 0.4960 0.4784 0.0299  -0.0102 0.0728  33  LEU B CA  
1806 C C   . LEU B 33  ? 0.5969 0.5081 0.4846 0.0333  -0.0053 0.0722  33  LEU B C   
1807 O O   . LEU B 33  ? 0.3717 0.2877 0.2614 0.0328  -0.0027 0.0750  33  LEU B O   
1808 C CB  . LEU B 33  ? 0.3873 0.2960 0.2745 0.0200  -0.0118 0.0737  33  LEU B CB  
1809 C CG  . LEU B 33  ? 0.3791 0.3007 0.2727 0.0185  -0.0109 0.0699  33  LEU B CG  
1810 C CD1 . LEU B 33  ? 0.4707 0.3846 0.3606 0.0214  -0.0142 0.0665  33  LEU B CD1 
1811 C CD2 . LEU B 33  ? 0.3767 0.3115 0.2762 0.0098  -0.0116 0.0713  33  LEU B CD2 
1812 N N   . ALA B 34  ? 0.5504 0.4656 0.4408 0.0363  -0.0046 0.0686  34  ALA B N   
1813 C CA  . ALA B 34  ? 0.3776 0.3026 0.2745 0.0385  -0.0008 0.0675  34  ALA B CA  
1814 C C   . ALA B 34  ? 0.3726 0.3079 0.2758 0.0351  -0.0008 0.0639  34  ALA B C   
1815 O O   . ALA B 34  ? 0.3762 0.3118 0.2787 0.0321  -0.0036 0.0625  34  ALA B O   
1816 C CB  . ALA B 34  ? 0.3775 0.2982 0.2726 0.0468  0.0004  0.0679  34  ALA B CB  
1817 N N   . TRP B 35  ? 0.4677 0.4117 0.3771 0.0357  0.0022  0.0623  35  TRP B N   
1818 C CA  . TRP B 35  ? 0.3603 0.3141 0.2756 0.0346  0.0028  0.0585  35  TRP B CA  
1819 C C   . TRP B 35  ? 0.6113 0.5656 0.5310 0.0404  0.0047  0.0566  35  TRP B C   
1820 O O   . TRP B 35  ? 0.3546 0.3073 0.2758 0.0421  0.0066  0.0576  35  TRP B O   
1821 C CB  . TRP B 35  ? 0.3574 0.3225 0.2763 0.0291  0.0041  0.0574  35  TRP B CB  
1822 C CG  . TRP B 35  ? 0.4121 0.3812 0.3294 0.0223  0.0020  0.0596  35  TRP B CG  
1823 C CD1 . TRP B 35  ? 0.3872 0.3527 0.3007 0.0183  0.0010  0.0638  35  TRP B CD1 
1824 C CD2 . TRP B 35  ? 0.4460 0.4240 0.3660 0.0185  0.0004  0.0587  35  TRP B CD2 
1825 N NE1 . TRP B 35  ? 0.3678 0.3386 0.2818 0.0118  -0.0013 0.0658  35  TRP B NE1 
1826 C CE2 . TRP B 35  ? 0.3659 0.3452 0.2841 0.0115  -0.0017 0.0628  35  TRP B CE2 
1827 C CE3 . TRP B 35  ? 0.4703 0.4564 0.3949 0.0203  0.0005  0.0555  35  TRP B CE3 
1828 C CZ2 . TRP B 35  ? 0.3681 0.3568 0.2890 0.0055  -0.0039 0.0642  35  TRP B CZ2 
1829 C CZ3 . TRP B 35  ? 0.3611 0.3575 0.2882 0.0150  -0.0014 0.0565  35  TRP B CZ3 
1830 C CH2 . TRP B 35  ? 0.3757 0.3736 0.3011 0.0073  -0.0037 0.0610  35  TRP B CH2 
1831 N N   . TYR B 36  ? 0.5789 0.5357 0.5011 0.0430  0.0041  0.0545  36  TYR B N   
1832 C CA  . TYR B 36  ? 0.5332 0.4899 0.4603 0.0487  0.0057  0.0536  36  TYR B CA  
1833 C C   . TYR B 36  ? 0.5032 0.4692 0.4369 0.0489  0.0067  0.0495  36  TYR B C   
1834 O O   . TYR B 36  ? 0.4728 0.4468 0.4071 0.0458  0.0058  0.0478  36  TYR B O   
1835 C CB  . TYR B 36  ? 0.3235 0.2748 0.2479 0.0540  0.0044  0.0557  36  TYR B CB  
1836 C CG  . TYR B 36  ? 0.3269 0.2693 0.2442 0.0560  0.0037  0.0594  36  TYR B CG  
1837 C CD1 . TYR B 36  ? 0.3317 0.2694 0.2421 0.0531  0.0015  0.0598  36  TYR B CD1 
1838 C CD2 . TYR B 36  ? 0.4132 0.3523 0.3310 0.0613  0.0052  0.0629  36  TYR B CD2 
1839 C CE1 . TYR B 36  ? 0.6090 0.5382 0.5124 0.0564  0.0010  0.0627  36  TYR B CE1 
1840 C CE2 . TYR B 36  ? 0.4471 0.3802 0.3584 0.0644  0.0051  0.0664  36  TYR B CE2 
1841 C CZ  . TYR B 36  ? 0.5463 0.4742 0.4500 0.0625  0.0031  0.0658  36  TYR B CZ  
1842 O OH  . TYR B 36  ? 0.3405 0.2619 0.2370 0.0669  0.0030  0.0689  36  TYR B OH  
1843 N N   . GLN B 37  ? 0.3237 0.2888 0.2626 0.0528  0.0083  0.0481  37  GLN B N   
1844 C CA  . GLN B 37  ? 0.3238 0.2956 0.2689 0.0553  0.0093  0.0439  37  GLN B CA  
1845 C C   . GLN B 37  ? 0.3249 0.2941 0.2734 0.0615  0.0090  0.0454  37  GLN B C   
1846 O O   . GLN B 37  ? 0.6667 0.6282 0.6150 0.0644  0.0089  0.0492  37  GLN B O   
1847 C CB  . GLN B 37  ? 0.3248 0.2961 0.2732 0.0551  0.0109  0.0404  37  GLN B CB  
1848 C CG  . GLN B 37  ? 0.4711 0.4477 0.4253 0.0590  0.0120  0.0350  37  GLN B CG  
1849 C CD  . GLN B 37  ? 0.4832 0.4543 0.4404 0.0601  0.0125  0.0313  37  GLN B CD  
1850 O OE1 . GLN B 37  ? 0.5382 0.4993 0.4976 0.0618  0.0119  0.0340  37  GLN B OE1 
1851 N NE2 . GLN B 37  ? 0.4821 0.4602 0.4392 0.0588  0.0135  0.0252  37  GLN B NE2 
1852 N N   . GLN B 38  ? 0.5493 0.5264 0.5013 0.0638  0.0088  0.0434  38  GLN B N   
1853 C CA  . GLN B 38  ? 0.5559 0.5316 0.5121 0.0703  0.0087  0.0451  38  GLN B CA  
1854 C C   . GLN B 38  ? 0.4766 0.4599 0.4395 0.0743  0.0099  0.0412  38  GLN B C   
1855 O O   . GLN B 38  ? 0.3572 0.3519 0.3207 0.0729  0.0098  0.0389  38  GLN B O   
1856 C CB  . GLN B 38  ? 0.5411 0.5183 0.4933 0.0709  0.0065  0.0485  38  GLN B CB  
1857 C CG  . GLN B 38  ? 0.5197 0.4978 0.4760 0.0777  0.0063  0.0510  38  GLN B CG  
1858 C CD  . GLN B 38  ? 0.3592 0.3359 0.3097 0.0788  0.0040  0.0548  38  GLN B CD  
1859 O OE1 . GLN B 38  ? 0.3870 0.3677 0.3327 0.0753  0.0017  0.0537  38  GLN B OE1 
1860 N NE2 . GLN B 38  ? 0.3605 0.3316 0.3111 0.0836  0.0044  0.0593  38  GLN B NE2 
1861 N N   . LYS B 39  ? 0.4206 0.3977 0.3890 0.0796  0.0107  0.0410  39  LYS B N   
1862 C CA  . LYS B 39  ? 0.4398 0.4216 0.4147 0.0856  0.0117  0.0379  39  LYS B CA  
1863 C C   . LYS B 39  ? 0.4403 0.4241 0.4182 0.0910  0.0108  0.0427  39  LYS B C   
1864 O O   . LYS B 39  ? 0.3510 0.3298 0.3263 0.0908  0.0096  0.0481  39  LYS B O   
1865 C CB  . LYS B 39  ? 0.3577 0.3297 0.3369 0.0883  0.0124  0.0347  39  LYS B CB  
1866 C CG  . LYS B 39  ? 0.3592 0.3336 0.3364 0.0849  0.0135  0.0277  39  LYS B CG  
1867 C CD  . LYS B 39  ? 0.3653 0.3265 0.3443 0.0848  0.0129  0.0256  39  LYS B CD  
1868 C CE  . LYS B 39  ? 0.6481 0.6010 0.6248 0.0803  0.0117  0.0322  39  LYS B CE  
1869 N NZ  . LYS B 39  ? 0.6598 0.6008 0.6391 0.0790  0.0106  0.0314  39  LYS B NZ  
1870 N N   . PRO B 40  ? 0.4701 0.4627 0.4532 0.0963  0.0114  0.0409  40  PRO B N   
1871 C CA  . PRO B 40  ? 0.3822 0.3785 0.3682 0.1014  0.0103  0.0460  40  PRO B CA  
1872 C C   . PRO B 40  ? 0.4102 0.3944 0.3995 0.1058  0.0101  0.0512  40  PRO B C   
1873 O O   . PRO B 40  ? 0.3461 0.3203 0.3396 0.1078  0.0108  0.0497  40  PRO B O   
1874 C CB  . PRO B 40  ? 0.3404 0.3480 0.3325 0.1071  0.0115  0.0428  40  PRO B CB  
1875 C CG  . PRO B 40  ? 0.3445 0.3478 0.3381 0.1077  0.0134  0.0361  40  PRO B CG  
1876 C CD  . PRO B 40  ? 0.4816 0.4820 0.4682 0.0989  0.0131  0.0345  40  PRO B CD  
1877 N N   . GLY B 41  ? 0.4682 0.4537 0.4555 0.1069  0.0087  0.0575  41  GLY B N   
1878 C CA  . GLY B 41  ? 0.5040 0.4812 0.4946 0.1110  0.0085  0.0642  41  GLY B CA  
1879 C C   . GLY B 41  ? 0.4684 0.4340 0.4568 0.1070  0.0087  0.0658  41  GLY B C   
1880 O O   . GLY B 41  ? 0.5465 0.5032 0.5404 0.1093  0.0088  0.0697  41  GLY B O   
1881 N N   . GLN B 42  ? 0.3687 0.3344 0.3495 0.1008  0.0085  0.0635  42  GLN B N   
1882 C CA  . GLN B 42  ? 0.4545 0.4113 0.4327 0.0970  0.0087  0.0656  42  GLN B CA  
1883 C C   . GLN B 42  ? 0.5408 0.4994 0.5096 0.0935  0.0081  0.0672  42  GLN B C   
1884 O O   . GLN B 42  ? 0.6175 0.5827 0.5813 0.0930  0.0070  0.0658  42  GLN B O   
1885 C CB  . GLN B 42  ? 0.4479 0.4001 0.4276 0.0929  0.0095  0.0593  42  GLN B CB  
1886 C CG  . GLN B 42  ? 0.4705 0.4154 0.4587 0.0962  0.0096  0.0578  42  GLN B CG  
1887 C CD  . GLN B 42  ? 0.5085 0.4496 0.4965 0.0926  0.0099  0.0502  42  GLN B CD  
1888 O OE1 . GLN B 42  ? 0.4245 0.3635 0.4082 0.0868  0.0099  0.0495  42  GLN B OE1 
1889 N NE2 . GLN B 42  ? 0.6131 0.5539 0.6056 0.0965  0.0103  0.0442  42  GLN B NE2 
1890 N N   . ALA B 43  ? 0.3836 0.3360 0.3503 0.0910  0.0085  0.0701  43  ALA B N   
1891 C CA  . ALA B 43  ? 0.3815 0.3338 0.3391 0.0885  0.0081  0.0714  43  ALA B CA  
1892 C C   . ALA B 43  ? 0.3793 0.3309 0.3330 0.0822  0.0082  0.0657  43  ALA B C   
1893 O O   . ALA B 43  ? 0.3793 0.3298 0.3373 0.0798  0.0089  0.0618  43  ALA B O   
1894 C CB  . ALA B 43  ? 0.5068 0.4551 0.4644 0.0899  0.0088  0.0785  43  ALA B CB  
1895 N N   . PRO B 44  ? 0.3239 0.2760 0.2691 0.0799  0.0072  0.0651  44  PRO B N   
1896 C CA  . PRO B 44  ? 0.4826 0.4343 0.4242 0.0737  0.0071  0.0612  44  PRO B CA  
1897 C C   . PRO B 44  ? 0.5027 0.4500 0.4457 0.0712  0.0085  0.0624  44  PRO B C   
1898 O O   . PRO B 44  ? 0.5334 0.4773 0.4767 0.0736  0.0090  0.0676  44  PRO B O   
1899 C CB  . PRO B 44  ? 0.3245 0.2744 0.2567 0.0730  0.0053  0.0621  44  PRO B CB  
1900 C CG  . PRO B 44  ? 0.3269 0.2793 0.2580 0.0780  0.0040  0.0637  44  PRO B CG  
1901 C CD  . PRO B 44  ? 0.3261 0.2792 0.2645 0.0830  0.0056  0.0676  44  PRO B CD  
1902 N N   . ARG B 45  ? 0.3343 0.2835 0.2783 0.0664  0.0089  0.0580  45  ARG B N   
1903 C CA  . ARG B 45  ? 0.3339 0.2802 0.2789 0.0632  0.0097  0.0585  45  ARG B CA  
1904 C C   . ARG B 45  ? 0.4951 0.4427 0.4339 0.0583  0.0096  0.0580  45  ARG B C   
1905 O O   . ARG B 45  ? 0.5204 0.4728 0.4579 0.0549  0.0093  0.0542  45  ARG B O   
1906 C CB  . ARG B 45  ? 0.3352 0.2827 0.2867 0.0622  0.0103  0.0536  45  ARG B CB  
1907 C CG  . ARG B 45  ? 0.3360 0.2810 0.2885 0.0583  0.0104  0.0533  45  ARG B CG  
1908 C CD  . ARG B 45  ? 0.3393 0.2856 0.2959 0.0573  0.0105  0.0462  45  ARG B CD  
1909 N NE  . ARG B 45  ? 0.3416 0.2855 0.2990 0.0532  0.0099  0.0451  45  ARG B NE  
1910 C CZ  . ARG B 45  ? 0.6275 0.5727 0.5864 0.0516  0.0096  0.0380  45  ARG B CZ  
1911 N NH1 . ARG B 45  ? 0.3479 0.2974 0.3078 0.0545  0.0103  0.0317  45  ARG B NH1 
1912 N NH2 . ARG B 45  ? 0.6550 0.5982 0.6141 0.0475  0.0085  0.0370  45  ARG B NH2 
1913 N N   . LEU B 46  ? 0.5505 0.4945 0.4860 0.0581  0.0098  0.0626  46  LEU B N   
1914 C CA  . LEU B 46  ? 0.4983 0.4427 0.4282 0.0539  0.0096  0.0629  46  LEU B CA  
1915 C C   . LEU B 46  ? 0.4590 0.4082 0.3918 0.0488  0.0101  0.0592  46  LEU B C   
1916 O O   . LEU B 46  ? 0.4081 0.3575 0.3462 0.0487  0.0106  0.0576  46  LEU B O   
1917 C CB  . LEU B 46  ? 0.3563 0.2970 0.2825 0.0559  0.0100  0.0689  46  LEU B CB  
1918 C CG  . LEU B 46  ? 0.3579 0.2975 0.2776 0.0530  0.0095  0.0702  46  LEU B CG  
1919 C CD1 . LEU B 46  ? 0.3621 0.2972 0.2750 0.0546  0.0078  0.0695  46  LEU B CD1 
1920 C CD2 . LEU B 46  ? 0.3583 0.2970 0.2765 0.0546  0.0105  0.0759  46  LEU B CD2 
1921 N N   . LEU B 47  ? 0.3304 0.2834 0.2596 0.0445  0.0098  0.0579  47  LEU B N   
1922 C CA  . LEU B 47  ? 0.3297 0.2895 0.2603 0.0397  0.0104  0.0547  47  LEU B CA  
1923 C C   . LEU B 47  ? 0.5005 0.4609 0.4264 0.0361  0.0102  0.0586  47  LEU B C   
1924 O O   . LEU B 47  ? 0.5444 0.5061 0.4710 0.0344  0.0107  0.0599  47  LEU B O   
1925 C CB  . LEU B 47  ? 0.5738 0.5415 0.5056 0.0380  0.0104  0.0499  47  LEU B CB  
1926 C CG  . LEU B 47  ? 0.5416 0.5104 0.4784 0.0422  0.0107  0.0458  47  LEU B CG  
1927 C CD1 . LEU B 47  ? 0.3297 0.3064 0.2666 0.0411  0.0103  0.0440  47  LEU B CD1 
1928 C CD2 . LEU B 47  ? 0.3316 0.3024 0.2728 0.0427  0.0117  0.0408  47  LEU B CD2 
1929 N N   . ILE B 48  ? 0.3385 0.2977 0.2599 0.0346  0.0092  0.0606  48  ILE B N   
1930 C CA  . ILE B 48  ? 0.3404 0.2991 0.2572 0.0315  0.0088  0.0649  48  ILE B CA  
1931 C C   . ILE B 48  ? 0.5403 0.4886 0.4514 0.0348  0.0074  0.0689  48  ILE B C   
1932 O O   . ILE B 48  ? 0.5486 0.4931 0.4578 0.0355  0.0057  0.0676  48  ILE B O   
1933 C CB  . ILE B 48  ? 0.5457 0.5128 0.4622 0.0255  0.0083  0.0638  48  ILE B CB  
1934 C CG1 . ILE B 48  ? 0.5542 0.5328 0.4751 0.0234  0.0098  0.0589  48  ILE B CG1 
1935 C CG2 . ILE B 48  ? 0.5464 0.5123 0.4587 0.0224  0.0076  0.0693  48  ILE B CG2 
1936 C CD1 . ILE B 48  ? 0.5798 0.5607 0.5014 0.0226  0.0107  0.0593  48  ILE B CD1 
1937 N N   . TYR B 49  ? 0.5157 0.4600 0.4240 0.0371  0.0079  0.0736  49  TYR B N   
1938 C CA  . TYR B 49  ? 0.4880 0.4222 0.3896 0.0412  0.0066  0.0769  49  TYR B CA  
1939 C C   . TYR B 49  ? 0.6020 0.5345 0.4997 0.0384  0.0059  0.0810  49  TYR B C   
1940 O O   . TYR B 49  ? 0.6834 0.6235 0.5836 0.0350  0.0071  0.0829  49  TYR B O   
1941 C CB  . TYR B 49  ? 0.5162 0.4472 0.4170 0.0484  0.0080  0.0799  49  TYR B CB  
1942 C CG  . TYR B 49  ? 0.5384 0.4749 0.4420 0.0483  0.0098  0.0842  49  TYR B CG  
1943 C CD1 . TYR B 49  ? 0.5249 0.4594 0.4241 0.0504  0.0101  0.0895  49  TYR B CD1 
1944 C CD2 . TYR B 49  ? 0.6068 0.5503 0.5174 0.0461  0.0109  0.0830  49  TYR B CD2 
1945 C CE1 . TYR B 49  ? 0.4687 0.4102 0.3710 0.0500  0.0116  0.0941  49  TYR B CE1 
1946 C CE2 . TYR B 49  ? 0.5937 0.5427 0.5071 0.0450  0.0118  0.0871  49  TYR B CE2 
1947 C CZ  . TYR B 49  ? 0.4751 0.4241 0.3845 0.0468  0.0122  0.0928  49  TYR B CZ  
1948 O OH  . TYR B 49  ? 0.4647 0.4210 0.3773 0.0455  0.0129  0.0974  49  TYR B OH  
1949 N N   . ASP B 50  ? 0.6466 0.5688 0.5380 0.0398  0.0036  0.0822  50  ASP B N   
1950 C CA  . ASP B 50  ? 0.6407 0.5585 0.5283 0.0376  0.0023  0.0865  50  ASP B CA  
1951 C C   . ASP B 50  ? 0.3904 0.3176 0.2818 0.0287  0.0019  0.0870  50  ASP B C   
1952 O O   . ASP B 50  ? 0.3931 0.3219 0.2836 0.0260  0.0018  0.0918  50  ASP B O   
1953 C CB  . ASP B 50  ? 0.3931 0.3114 0.2792 0.0423  0.0044  0.0917  50  ASP B CB  
1954 C CG  . ASP B 50  ? 0.8114 0.7175 0.6903 0.0512  0.0038  0.0934  50  ASP B CG  
1955 O OD1 . ASP B 50  ? 0.6230 0.5212 0.4983 0.0544  0.0021  0.0895  50  ASP B OD1 
1956 O OD2 . ASP B 50  ? 0.8837 0.7888 0.7601 0.0554  0.0049  0.0985  50  ASP B OD2 
1957 N N   . ALA B 51  ? 0.3515 0.2858 0.2472 0.0249  0.0017  0.0825  51  ALA B N   
1958 C CA  . ALA B 51  ? 0.4733 0.4183 0.3726 0.0171  0.0012  0.0823  51  ALA B CA  
1959 C C   . ALA B 51  ? 0.5854 0.5445 0.4883 0.0139  0.0037  0.0832  51  ALA B C   
1960 O O   . ALA B 51  ? 0.7196 0.6909 0.6258 0.0088  0.0041  0.0818  51  ALA B O   
1961 C CB  . ALA B 51  ? 0.4462 0.3840 0.3421 0.0128  -0.0022 0.0867  51  ALA B CB  
1962 N N   . SER B 52  ? 0.4989 0.4576 0.4011 0.0171  0.0054  0.0853  52  SER B N   
1963 C CA  . SER B 52  ? 0.5006 0.4722 0.4054 0.0141  0.0072  0.0860  52  SER B CA  
1964 C C   . SER B 52  ? 0.4661 0.4390 0.3736 0.0179  0.0088  0.0829  52  SER B C   
1965 O O   . SER B 52  ? 0.3666 0.3480 0.2778 0.0161  0.0097  0.0778  52  SER B O   
1966 C CB  . SER B 52  ? 0.5456 0.5174 0.4476 0.0128  0.0068  0.0934  52  SER B CB  
1967 O OG  . SER B 52  ? 0.5938 0.5780 0.4980 0.0108  0.0084  0.0940  52  SER B OG  
1968 N N   . ASN B 53  ? 0.3618 0.3261 0.2672 0.0231  0.0090  0.0864  53  ASN B N   
1969 C CA  . ASN B 53  ? 0.5891 0.5543 0.4975 0.0264  0.0101  0.0856  53  ASN B CA  
1970 C C   . ASN B 53  ? 0.6181 0.5835 0.5306 0.0270  0.0103  0.0790  53  ASN B C   
1971 O O   . ASN B 53  ? 0.6238 0.5836 0.5355 0.0291  0.0098  0.0766  53  ASN B O   
1972 C CB  . ASN B 53  ? 0.3611 0.3172 0.2664 0.0332  0.0103  0.0904  53  ASN B CB  
1973 C CG  . ASN B 53  ? 0.5127 0.4703 0.4153 0.0342  0.0107  0.0975  53  ASN B CG  
1974 O OD1 . ASN B 53  ? 0.5803 0.5464 0.4859 0.0328  0.0115  0.1001  53  ASN B OD1 
1975 N ND2 . ASN B 53  ? 0.3710 0.3199 0.2680 0.0367  0.0097  0.1007  53  ASN B ND2 
1976 N N   . ARG B 54  ? 0.6558 0.6277 0.5727 0.0252  0.0108  0.0761  54  ARG B N   
1977 C CA  . ARG B 54  ? 0.3397 0.3112 0.2610 0.0261  0.0109  0.0699  54  ARG B CA  
1978 C C   . ARG B 54  ? 0.4920 0.4574 0.4161 0.0304  0.0110  0.0723  54  ARG B C   
1979 O O   . ARG B 54  ? 0.4863 0.4529 0.4109 0.0306  0.0110  0.0774  54  ARG B O   
1980 C CB  . ARG B 54  ? 0.3396 0.3203 0.2636 0.0218  0.0108  0.0643  54  ARG B CB  
1981 C CG  . ARG B 54  ? 0.3404 0.3189 0.2691 0.0235  0.0106  0.0578  54  ARG B CG  
1982 C CD  . ARG B 54  ? 0.5756 0.5630 0.5050 0.0203  0.0105  0.0503  54  ARG B CD  
1983 N NE  . ARG B 54  ? 0.4914 0.4852 0.4200 0.0162  0.0097  0.0507  54  ARG B NE  
1984 C CZ  . ARG B 54  ? 0.4897 0.4937 0.4147 0.0125  0.0101  0.0524  54  ARG B CZ  
1985 N NH1 . ARG B 54  ? 0.3424 0.3504 0.2648 0.0120  0.0111  0.0542  54  ARG B NH1 
1986 N NH2 . ARG B 54  ? 0.3938 0.4043 0.3180 0.0089  0.0091  0.0528  54  ARG B NH2 
1987 N N   . ALA B 55  ? 0.5123 0.4728 0.4387 0.0338  0.0110  0.0696  55  ALA B N   
1988 C CA  . ALA B 55  ? 0.3338 0.2898 0.2636 0.0378  0.0110  0.0728  55  ALA B CA  
1989 C C   . ALA B 55  ? 0.5105 0.4693 0.4460 0.0346  0.0103  0.0719  55  ALA B C   
1990 O O   . ALA B 55  ? 0.5267 0.4898 0.4633 0.0304  0.0097  0.0664  55  ALA B O   
1991 C CB  . ALA B 55  ? 0.3340 0.2853 0.2655 0.0419  0.0110  0.0701  55  ALA B CB  
1992 N N   . THR B 56  ? 0.5342 0.4913 0.4731 0.0365  0.0101  0.0776  56  THR B N   
1993 C CA  . THR B 56  ? 0.5584 0.5171 0.5034 0.0326  0.0086  0.0778  56  THR B CA  
1994 C C   . THR B 56  ? 0.5421 0.4960 0.4921 0.0321  0.0073  0.0707  56  THR B C   
1995 O O   . THR B 56  ? 0.5146 0.4643 0.4650 0.0363  0.0081  0.0687  56  THR B O   
1996 C CB  . THR B 56  ? 0.5338 0.4931 0.4825 0.0345  0.0085  0.0870  56  THR B CB  
1997 O OG1 . THR B 56  ? 0.5604 0.5145 0.5115 0.0397  0.0091  0.0890  56  THR B OG1 
1998 C CG2 . THR B 56  ? 0.3525 0.3166 0.2961 0.0368  0.0100  0.0941  56  THR B CG2 
1999 N N   . GLY B 57  ? 0.6333 0.5879 0.5869 0.0272  0.0052  0.0668  57  GLY B N   
2000 C CA  . GLY B 57  ? 0.6410 0.5893 0.5992 0.0272  0.0036  0.0595  57  GLY B CA  
2001 C C   . GLY B 57  ? 0.7011 0.6497 0.6561 0.0302  0.0051  0.0517  57  GLY B C   
2002 O O   . GLY B 57  ? 0.6364 0.5793 0.5949 0.0333  0.0047  0.0473  57  GLY B O   
2003 N N   . ILE B 58  ? 0.4018 0.3577 0.3507 0.0293  0.0067  0.0509  58  ILE B N   
2004 C CA  . ILE B 58  ? 0.4978 0.4573 0.4440 0.0310  0.0080  0.0447  58  ILE B CA  
2005 C C   . ILE B 58  ? 0.5605 0.5282 0.5039 0.0271  0.0078  0.0380  58  ILE B C   
2006 O O   . ILE B 58  ? 0.6535 0.6275 0.5937 0.0231  0.0076  0.0407  58  ILE B O   
2007 C CB  . ILE B 58  ? 0.3957 0.3576 0.3372 0.0326  0.0096  0.0494  58  ILE B CB  
2008 C CG1 . ILE B 58  ? 0.5723 0.5271 0.5155 0.0376  0.0099  0.0542  58  ILE B CG1 
2009 C CG2 . ILE B 58  ? 0.3951 0.3636 0.3343 0.0325  0.0106  0.0441  58  ILE B CG2 
2010 C CD1 . ILE B 58  ? 0.5603 0.5118 0.5077 0.0415  0.0098  0.0498  58  ILE B CD1 
2011 N N   . PRO B 59  ? 0.4726 0.4415 0.4171 0.0290  0.0078  0.0293  59  PRO B N   
2012 C CA  . PRO B 59  ? 0.4964 0.4739 0.4380 0.0268  0.0076  0.0213  59  PRO B CA  
2013 C C   . PRO B 59  ? 0.5000 0.4904 0.4362 0.0231  0.0090  0.0241  59  PRO B C   
2014 O O   . PRO B 59  ? 0.3569 0.3495 0.2916 0.0236  0.0105  0.0295  59  PRO B O   
2015 C CB  . PRO B 59  ? 0.5678 0.5457 0.5109 0.0320  0.0087  0.0139  59  PRO B CB  
2016 C CG  . PRO B 59  ? 0.6156 0.5806 0.5644 0.0360  0.0078  0.0161  59  PRO B CG  
2017 C CD  . PRO B 59  ? 0.5324 0.4941 0.4813 0.0345  0.0080  0.0267  59  PRO B CD  
2018 N N   . ALA B 60  ? 0.5247 0.5232 0.4580 0.0193  0.0082  0.0204  60  ALA B N   
2019 C CA  . ALA B 60  ? 0.3370 0.3484 0.2656 0.0154  0.0093  0.0242  60  ALA B CA  
2020 C C   . ALA B 60  ? 0.3353 0.3578 0.2618 0.0165  0.0115  0.0224  60  ALA B C   
2021 O O   . ALA B 60  ? 0.3316 0.3627 0.2554 0.0134  0.0124  0.0282  60  ALA B O   
2022 C CB  . ALA B 60  ? 0.3423 0.3611 0.2683 0.0113  0.0076  0.0203  60  ALA B CB  
2023 N N   . ARG B 61  ? 0.3819 0.4045 0.3102 0.0210  0.0122  0.0149  61  ARG B N   
2024 C CA  . ARG B 61  ? 0.5297 0.5652 0.4570 0.0223  0.0144  0.0134  61  ARG B CA  
2025 C C   . ARG B 61  ? 0.5842 0.6175 0.5127 0.0218  0.0151  0.0216  61  ARG B C   
2026 O O   . ARG B 61  ? 0.3720 0.4170 0.2997 0.0202  0.0163  0.0239  61  ARG B O   
2027 C CB  . ARG B 61  ? 0.5650 0.6009 0.4944 0.0285  0.0151  0.0037  61  ARG B CB  
2028 C CG  . ARG B 61  ? 0.5389 0.5598 0.4733 0.0332  0.0145  0.0039  61  ARG B CG  
2029 C CD  . ARG B 61  ? 0.5744 0.5976 0.5109 0.0401  0.0156  -0.0047 61  ARG B CD  
2030 N NE  . ARG B 61  ? 0.3938 0.4025 0.3354 0.0449  0.0148  -0.0044 61  ARG B NE  
2031 C CZ  . ARG B 61  ? 0.5774 0.5705 0.5216 0.0456  0.0125  -0.0056 61  ARG B CZ  
2032 N NH1 . ARG B 61  ? 0.5320 0.5218 0.4742 0.0416  0.0105  -0.0080 61  ARG B NH1 
2033 N NH2 . ARG B 61  ? 0.6609 0.6427 0.6103 0.0501  0.0120  -0.0040 61  ARG B NH2 
2034 N N   . PHE B 62  ? 0.5657 0.5845 0.4962 0.0230  0.0140  0.0261  62  PHE B N   
2035 C CA  . PHE B 62  ? 0.5971 0.6115 0.5275 0.0228  0.0139  0.0330  62  PHE B CA  
2036 C C   . PHE B 62  ? 0.3581 0.3736 0.2849 0.0180  0.0134  0.0408  62  PHE B C   
2037 O O   . PHE B 62  ? 0.3585 0.3712 0.2839 0.0164  0.0128  0.0431  62  PHE B O   
2038 C CB  . PHE B 62  ? 0.3594 0.3591 0.2926 0.0269  0.0131  0.0345  62  PHE B CB  
2039 C CG  . PHE B 62  ? 0.4303 0.4284 0.3675 0.0321  0.0136  0.0290  62  PHE B CG  
2040 C CD1 . PHE B 62  ? 0.4243 0.4268 0.3625 0.0338  0.0141  0.0295  62  PHE B CD1 
2041 C CD2 . PHE B 62  ? 0.4562 0.4483 0.3966 0.0352  0.0131  0.0236  62  PHE B CD2 
2042 C CE1 . PHE B 62  ? 0.4380 0.4402 0.3803 0.0391  0.0145  0.0251  62  PHE B CE1 
2043 C CE2 . PHE B 62  ? 0.4827 0.4724 0.4270 0.0407  0.0135  0.0190  62  PHE B CE2 
2044 C CZ  . PHE B 62  ? 0.4783 0.4738 0.4235 0.0431  0.0144  0.0199  62  PHE B CZ  
2045 N N   . SER B 63  ? 0.4617 0.4813 0.3872 0.0157  0.0133  0.0452  63  SER B N   
2046 C CA  . SER B 63  ? 0.4262 0.4451 0.3483 0.0115  0.0125  0.0529  63  SER B CA  
2047 C C   . SER B 63  ? 0.3828 0.3983 0.3042 0.0100  0.0113  0.0576  63  SER B C   
2048 O O   . SER B 63  ? 0.3824 0.3985 0.3061 0.0117  0.0111  0.0549  63  SER B O   
2049 C CB  . SER B 63  ? 0.3832 0.4171 0.3037 0.0070  0.0133  0.0536  63  SER B CB  
2050 O OG  . SER B 63  ? 0.4079 0.4563 0.3298 0.0061  0.0144  0.0501  63  SER B OG  
2051 N N   . GLY B 64  ? 0.4411 0.4529 0.3594 0.0068  0.0100  0.0646  64  GLY B N   
2052 C CA  . GLY B 64  ? 0.4378 0.4432 0.3547 0.0048  0.0078  0.0691  64  GLY B CA  
2053 C C   . GLY B 64  ? 0.4555 0.4631 0.3701 -0.0006 0.0066  0.0765  64  GLY B C   
2054 O O   . GLY B 64  ? 0.4553 0.4685 0.3688 -0.0018 0.0077  0.0788  64  GLY B O   
2055 N N   . SER B 65  ? 0.4692 0.4720 0.3830 -0.0040 0.0040  0.0805  65  SER B N   
2056 C CA  . SER B 65  ? 0.5392 0.5418 0.4513 -0.0094 0.0021  0.0885  65  SER B CA  
2057 C C   . SER B 65  ? 0.3848 0.3734 0.2951 -0.0115 -0.0020 0.0916  65  SER B C   
2058 O O   . SER B 65  ? 0.4245 0.4031 0.3338 -0.0079 -0.0032 0.0874  65  SER B O   
2059 C CB  . SER B 65  ? 0.8253 0.8487 0.7407 -0.0155 0.0033  0.0909  65  SER B CB  
2060 O OG  . SER B 65  ? 0.9975 1.0209 0.9119 -0.0210 0.0014  0.0999  65  SER B OG  
2061 N N   . GLY B 66  ? 0.3902 0.3777 0.2999 -0.0174 -0.0044 0.0991  66  GLY B N   
2062 C CA  . GLY B 66  ? 0.4004 0.3740 0.3085 -0.0208 -0.0093 0.1021  66  GLY B CA  
2063 C C   . GLY B 66  ? 0.5100 0.4609 0.4115 -0.0153 -0.0112 0.1028  66  GLY B C   
2064 O O   . GLY B 66  ? 0.5739 0.5209 0.4728 -0.0081 -0.0084 0.1001  66  GLY B O   
2065 N N   . SER B 67  ? 0.5808 0.5168 0.4795 -0.0187 -0.0162 0.1068  67  SER B N   
2066 C CA  . SER B 67  ? 0.6334 0.5470 0.5249 -0.0128 -0.0183 0.1074  67  SER B CA  
2067 C C   . SER B 67  ? 0.7713 0.6676 0.6598 -0.0167 -0.0249 0.1080  67  SER B C   
2068 O O   . SER B 67  ? 0.8097 0.7132 0.7029 -0.0258 -0.0278 0.1106  67  SER B O   
2069 C CB  . SER B 67  ? 0.6479 0.5611 0.5382 -0.0121 -0.0169 0.1146  67  SER B CB  
2070 O OG  . SER B 67  ? 0.6521 0.5433 0.5356 -0.0067 -0.0196 0.1163  67  SER B OG  
2071 N N   . GLY B 68  ? 0.6851 0.5595 0.5658 -0.0100 -0.0275 0.1056  68  GLY B N   
2072 C CA  . GLY B 68  ? 0.7212 0.5776 0.5981 -0.0137 -0.0345 0.1048  68  GLY B CA  
2073 C C   . GLY B 68  ? 0.6527 0.5149 0.5317 -0.0163 -0.0362 0.0986  68  GLY B C   
2074 O O   . GLY B 68  ? 0.6233 0.4844 0.4993 -0.0088 -0.0345 0.0917  68  GLY B O   
2075 N N   . THR B 69  ? 0.8404 0.7087 0.7249 -0.0273 -0.0403 0.1022  69  THR B N   
2076 C CA  . THR B 69  ? 0.7951 0.6714 0.6831 -0.0321 -0.0429 0.0983  69  THR B CA  
2077 C C   . THR B 69  ? 0.7007 0.6035 0.5963 -0.0316 -0.0369 0.0961  69  THR B C   
2078 O O   . THR B 69  ? 0.7367 0.6421 0.6315 -0.0259 -0.0354 0.0894  69  THR B O   
2079 C CB  . THR B 69  ? 0.7398 0.6144 0.6318 -0.0450 -0.0498 0.1045  69  THR B CB  
2080 O OG1 . THR B 69  ? 0.8076 0.6956 0.7059 -0.0514 -0.0476 0.1136  69  THR B OG1 
2081 C CG2 . THR B 69  ? 0.6141 0.4586 0.4977 -0.0451 -0.0572 0.1040  69  THR B CG2 
2082 N N   . ASP B 70  ? 0.6169 0.5391 0.5195 -0.0371 -0.0338 0.1017  70  ASP B N   
2083 C CA  . ASP B 70  ? 0.6523 0.5995 0.5618 -0.0367 -0.0287 0.0994  70  ASP B CA  
2084 C C   . ASP B 70  ? 0.4919 0.4469 0.4011 -0.0291 -0.0218 0.0970  70  ASP B C   
2085 O O   . ASP B 70  ? 0.4934 0.4452 0.4005 -0.0285 -0.0204 0.1011  70  ASP B O   
2086 C CB  . ASP B 70  ? 0.7317 0.6987 0.6490 -0.0472 -0.0295 0.1065  70  ASP B CB  
2087 C CG  . ASP B 70  ? 0.8538 0.8137 0.7726 -0.0567 -0.0370 0.1106  70  ASP B CG  
2088 O OD1 . ASP B 70  ? 0.9497 0.8950 0.8645 -0.0548 -0.0411 0.1053  70  ASP B OD1 
2089 O OD2 . ASP B 70  ? 0.7053 0.6741 0.6291 -0.0664 -0.0392 0.1193  70  ASP B OD2 
2090 N N   . PHE B 71  ? 0.4511 0.4163 0.3625 -0.0237 -0.0181 0.0906  71  PHE B N   
2091 C CA  . PHE B 71  ? 0.4406 0.4130 0.3524 -0.0171 -0.0123 0.0874  71  PHE B CA  
2092 C C   . PHE B 71  ? 0.4305 0.4238 0.3485 -0.0165 -0.0087 0.0834  71  PHE B C   
2093 O O   . PHE B 71  ? 0.4300 0.4292 0.3512 -0.0177 -0.0101 0.0812  71  PHE B O   
2094 C CB  . PHE B 71  ? 0.4400 0.3970 0.3466 -0.0079 -0.0113 0.0827  71  PHE B CB  
2095 C CG  . PHE B 71  ? 0.5457 0.4815 0.4452 -0.0060 -0.0148 0.0849  71  PHE B CG  
2096 C CD1 . PHE B 71  ? 0.5053 0.4286 0.4015 -0.0080 -0.0202 0.0842  71  PHE B CD1 
2097 C CD2 . PHE B 71  ? 0.5897 0.5178 0.4852 -0.0014 -0.0130 0.0872  71  PHE B CD2 
2098 C CE1 . PHE B 71  ? 0.5484 0.4510 0.4370 -0.0052 -0.0236 0.0851  71  PHE B CE1 
2099 C CE2 . PHE B 71  ? 0.6199 0.5287 0.5084 0.0019  -0.0159 0.0889  71  PHE B CE2 
2100 C CZ  . PHE B 71  ? 0.5943 0.4897 0.4790 0.0003  -0.0212 0.0874  71  PHE B CZ  
2101 N N   . THR B 72  ? 0.3451 0.3495 0.2646 -0.0142 -0.0043 0.0820  72  THR B N   
2102 C CA  . THR B 72  ? 0.3376 0.3597 0.2618 -0.0119 -0.0007 0.0769  72  THR B CA  
2103 C C   . THR B 72  ? 0.3318 0.3518 0.2552 -0.0044 0.0029  0.0707  72  THR B C   
2104 O O   . THR B 72  ? 0.5128 0.5332 0.4344 -0.0041 0.0045  0.0718  72  THR B O   
2105 C CB  . THR B 72  ? 0.5821 0.6259 0.5099 -0.0177 0.0009  0.0805  72  THR B CB  
2106 O OG1 . THR B 72  ? 0.6665 0.7139 0.5922 -0.0163 0.0036  0.0804  72  THR B OG1 
2107 C CG2 . THR B 72  ? 0.5270 0.5719 0.4556 -0.0267 -0.0030 0.0892  72  THR B CG2 
2108 N N   . LEU B 73  ? 0.3323 0.3504 0.2576 0.0013  0.0038  0.0649  73  LEU B N   
2109 C CA  . LEU B 73  ? 0.3279 0.3474 0.2544 0.0073  0.0070  0.0590  73  LEU B CA  
2110 C C   . LEU B 73  ? 0.3259 0.3648 0.2556 0.0065  0.0096  0.0556  73  LEU B C   
2111 O O   . LEU B 73  ? 0.6349 0.6868 0.5678 0.0045  0.0096  0.0558  73  LEU B O   
2112 C CB  . LEU B 73  ? 0.3265 0.3381 0.2546 0.0137  0.0069  0.0547  73  LEU B CB  
2113 C CG  . LEU B 73  ? 0.5484 0.5573 0.4785 0.0201  0.0093  0.0492  73  LEU B CG  
2114 C CD1 . LEU B 73  ? 0.6228 0.6190 0.5530 0.0256  0.0084  0.0487  73  LEU B CD1 
2115 C CD2 . LEU B 73  ? 0.5334 0.5563 0.4678 0.0221  0.0115  0.0435  73  LEU B CD2 
2116 N N   . THR B 74  ? 0.3508 0.3927 0.2797 0.0084  0.0118  0.0523  74  THR B N   
2117 C CA  . THR B 74  ? 0.3507 0.4099 0.2815 0.0093  0.0143  0.0472  74  THR B CA  
2118 C C   . THR B 74  ? 0.5512 0.6066 0.4824 0.0154  0.0158  0.0389  74  THR B C   
2119 O O   . THR B 74  ? 0.5401 0.5834 0.4696 0.0165  0.0153  0.0387  74  THR B O   
2120 C CB  . THR B 74  ? 0.4873 0.5597 0.4158 0.0038  0.0149  0.0511  74  THR B CB  
2121 O OG1 . THR B 74  ? 0.5740 0.6370 0.4991 0.0031  0.0144  0.0529  74  THR B OG1 
2122 C CG2 . THR B 74  ? 0.4412 0.5197 0.3704 -0.0029 0.0132  0.0596  74  THR B CG2 
2123 N N   . ILE B 75  ? 0.5920 0.6581 0.5259 0.0195  0.0176  0.0325  75  ILE B N   
2124 C CA  . ILE B 75  ? 0.5662 0.6300 0.5004 0.0251  0.0187  0.0237  75  ILE B CA  
2125 C C   . ILE B 75  ? 0.6146 0.6970 0.5470 0.0252  0.0206  0.0187  75  ILE B C   
2126 O O   . ILE B 75  ? 0.6206 0.7184 0.5548 0.0273  0.0223  0.0169  75  ILE B O   
2127 C CB  . ILE B 75  ? 0.4995 0.5580 0.4380 0.0319  0.0190  0.0192  75  ILE B CB  
2128 C CG1 . ILE B 75  ? 0.3842 0.4266 0.3239 0.0321  0.0171  0.0245  75  ILE B CG1 
2129 C CG2 . ILE B 75  ? 0.4880 0.5411 0.4270 0.0378  0.0195  0.0101  75  ILE B CG2 
2130 C CD1 . ILE B 75  ? 0.4600 0.4999 0.4040 0.0380  0.0172  0.0223  75  ILE B CD1 
2131 N N   . SER B 76  ? 0.5975 0.6801 0.5262 0.0234  0.0204  0.0164  76  SER B N   
2132 C CA  . SER B 76  ? 0.5631 0.6648 0.4888 0.0234  0.0220  0.0118  76  SER B CA  
2133 C C   . SER B 76  ? 0.6887 0.7969 0.6151 0.0312  0.0237  0.0011  76  SER B C   
2134 O O   . SER B 76  ? 0.8064 0.9321 0.7340 0.0334  0.0259  0.0007  76  SER B O   
2135 C CB  . SER B 76  ? 0.5572 0.6564 0.4785 0.0203  0.0208  0.0105  76  SER B CB  
2136 O OG  . SER B 76  ? 0.5314 0.6110 0.4535 0.0223  0.0189  0.0068  76  SER B OG  
2137 N N   . SER B 77  ? 0.6229 0.7169 0.5488 0.0356  0.0225  -0.0072 77  SER B N   
2138 C CA  . SER B 77  ? 0.6024 0.6982 0.5290 0.0442  0.0236  -0.0179 77  SER B CA  
2139 C C   . SER B 77  ? 0.5166 0.5960 0.4488 0.0486  0.0229  -0.0174 77  SER B C   
2140 O O   . SER B 77  ? 0.4672 0.5270 0.4008 0.0482  0.0206  -0.0173 77  SER B O   
2141 C CB  . SER B 77  ? 0.6719 0.7622 0.5941 0.0463  0.0221  -0.0284 77  SER B CB  
2142 O OG  . SER B 77  ? 0.6831 0.7721 0.6056 0.0555  0.0228  -0.0394 77  SER B OG  
2143 N N   . LEU B 78  ? 0.5527 0.6418 0.4884 0.0526  0.0248  -0.0161 78  LEU B N   
2144 C CA  . LEU B 78  ? 0.5281 0.6043 0.4692 0.0566  0.0242  -0.0144 78  LEU B CA  
2145 C C   . LEU B 78  ? 0.5076 0.5697 0.4500 0.0645  0.0234  -0.0239 78  LEU B C   
2146 O O   . LEU B 78  ? 0.4527 0.5199 0.3920 0.0689  0.0241  -0.0333 78  LEU B O   
2147 C CB  . LEU B 78  ? 0.4737 0.5660 0.4185 0.0590  0.0261  -0.0109 78  LEU B CB  
2148 C CG  . LEU B 78  ? 0.5013 0.5836 0.4515 0.0616  0.0252  -0.0068 78  LEU B CG  
2149 C CD1 . LEU B 78  ? 0.4694 0.5389 0.4192 0.0544  0.0228  0.0020  78  LEU B CD1 
2150 C CD2 . LEU B 78  ? 0.5022 0.6038 0.4562 0.0644  0.0270  -0.0047 78  LEU B CD2 
2151 N N   . GLU B 79  ? 0.3874 0.4315 0.3341 0.0663  0.0218  -0.0212 79  GLU B N   
2152 C CA  . GLU B 79  ? 0.3980 0.4265 0.3471 0.0731  0.0205  -0.0286 79  GLU B CA  
2153 C C   . GLU B 79  ? 0.4901 0.5131 0.4456 0.0791  0.0208  -0.0255 79  GLU B C   
2154 O O   . GLU B 79  ? 0.3869 0.4113 0.3445 0.0760  0.0208  -0.0167 79  GLU B O   
2155 C CB  . GLU B 79  ? 0.4005 0.4104 0.3489 0.0683  0.0172  -0.0280 79  GLU B CB  
2156 C CG  . GLU B 79  ? 0.5474 0.5601 0.4900 0.0657  0.0162  -0.0355 79  GLU B CG  
2157 C CD  . GLU B 79  ? 0.7094 0.7025 0.6529 0.0628  0.0123  -0.0372 79  GLU B CD  
2158 O OE1 . GLU B 79  ? 0.7907 0.7677 0.7391 0.0672  0.0106  -0.0387 79  GLU B OE1 
2159 O OE2 . GLU B 79  ? 0.7839 0.7783 0.7236 0.0560  0.0108  -0.0365 79  GLU B OE2 
2160 N N   . PRO B 80  ? 0.5722 0.5889 0.5304 0.0882  0.0209  -0.0329 80  PRO B N   
2161 C CA  . PRO B 80  ? 0.5430 0.5564 0.5074 0.0955  0.0214  -0.0306 80  PRO B CA  
2162 C C   . PRO B 80  ? 0.4983 0.4975 0.4666 0.0920  0.0194  -0.0212 80  PRO B C   
2163 O O   . PRO B 80  ? 0.4472 0.4493 0.4197 0.0949  0.0199  -0.0157 80  PRO B O   
2164 C CB  . PRO B 80  ? 0.5544 0.5566 0.5202 0.1047  0.0207  -0.0409 80  PRO B CB  
2165 C CG  . PRO B 80  ? 0.5869 0.5786 0.5478 0.0998  0.0182  -0.0467 80  PRO B CG  
2166 C CD  . PRO B 80  ? 0.5562 0.5658 0.5114 0.0921  0.0198  -0.0443 80  PRO B CD  
2167 N N   . GLU B 81  ? 0.5648 0.5505 0.5315 0.0858  0.0170  -0.0192 81  GLU B N   
2168 C CA  . GLU B 81  ? 0.5694 0.5440 0.5386 0.0820  0.0154  -0.0098 81  GLU B CA  
2169 C C   . GLU B 81  ? 0.5578 0.5435 0.5247 0.0769  0.0163  -0.0018 81  GLU B C   
2170 O O   . GLU B 81  ? 0.5895 0.5714 0.5587 0.0772  0.0158  0.0052  81  GLU B O   
2171 C CB  . GLU B 81  ? 0.5853 0.5466 0.5531 0.0763  0.0128  -0.0095 81  GLU B CB  
2172 C CG  . GLU B 81  ? 0.7495 0.7014 0.7193 0.0724  0.0114  0.0005  81  GLU B CG  
2173 C CD  . GLU B 81  ? 1.0221 0.9660 0.9902 0.0659  0.0092  0.0015  81  GLU B CD  
2174 O OE1 . GLU B 81  ? 1.0296 0.9649 0.9989 0.0662  0.0072  -0.0049 81  GLU B OE1 
2175 O OE2 . GLU B 81  ? 1.1364 1.0829 1.1020 0.0605  0.0093  0.0086  81  GLU B OE2 
2176 N N   . ASP B 82  ? 0.6149 0.6140 0.5770 0.0722  0.0175  -0.0030 82  ASP B N   
2177 C CA  . ASP B 82  ? 0.4804 0.4879 0.4399 0.0661  0.0177  0.0044  82  ASP B CA  
2178 C C   . ASP B 82  ? 0.3887 0.4076 0.3506 0.0683  0.0185  0.0074  82  ASP B C   
2179 O O   . ASP B 82  ? 0.3824 0.4070 0.3422 0.0629  0.0179  0.0132  82  ASP B O   
2180 C CB  . ASP B 82  ? 0.4731 0.4916 0.4274 0.0600  0.0184  0.0031  82  ASP B CB  
2181 C CG  . ASP B 82  ? 0.4534 0.4627 0.4050 0.0569  0.0172  0.0007  82  ASP B CG  
2182 O OD1 . ASP B 82  ? 0.4501 0.4446 0.4030 0.0560  0.0155  0.0042  82  ASP B OD1 
2183 O OD2 . ASP B 82  ? 0.3981 0.4162 0.3462 0.0551  0.0179  -0.0042 82  ASP B OD2 
2184 N N   . PHE B 83  ? 0.3596 0.3817 0.3260 0.0761  0.0195  0.0037  83  PHE B N   
2185 C CA  . PHE B 83  ? 0.4743 0.5095 0.4436 0.0780  0.0201  0.0070  83  PHE B CA  
2186 C C   . PHE B 83  ? 0.5197 0.5453 0.4910 0.0785  0.0182  0.0135  83  PHE B C   
2187 O O   . PHE B 83  ? 0.5200 0.5350 0.4951 0.0845  0.0178  0.0133  83  PHE B O   
2188 C CB  . PHE B 83  ? 0.3626 0.4074 0.3361 0.0870  0.0221  0.0011  83  PHE B CB  
2189 C CG  . PHE B 83  ? 0.3656 0.4267 0.3367 0.0873  0.0244  -0.0046 83  PHE B CG  
2190 C CD1 . PHE B 83  ? 0.5763 0.6572 0.5463 0.0818  0.0252  -0.0007 83  PHE B CD1 
2191 C CD2 . PHE B 83  ? 0.3755 0.4326 0.3453 0.0931  0.0254  -0.0137 83  PHE B CD2 
2192 C CE1 . PHE B 83  ? 0.6050 0.7034 0.5729 0.0824  0.0275  -0.0050 83  PHE B CE1 
2193 C CE2 . PHE B 83  ? 0.3791 0.4529 0.3458 0.0942  0.0277  -0.0194 83  PHE B CE2 
2194 C CZ  . PHE B 83  ? 0.3721 0.4677 0.3379 0.0890  0.0290  -0.0146 83  PHE B CZ  
2195 N N   . ALA B 84  ? 0.5140 0.5440 0.4827 0.0723  0.0168  0.0194  84  ALA B N   
2196 C CA  . ALA B 84  ? 0.5206 0.5410 0.4887 0.0717  0.0146  0.0253  84  ALA B CA  
2197 C C   . ALA B 84  ? 0.3223 0.3502 0.2871 0.0650  0.0127  0.0298  84  ALA B C   
2198 O O   . ALA B 84  ? 0.3212 0.3624 0.2855 0.0607  0.0131  0.0293  84  ALA B O   
2199 C CB  . ALA B 84  ? 0.3269 0.3304 0.2925 0.0703  0.0139  0.0268  84  ALA B CB  
2200 N N   . VAL B 85  ? 0.4427 0.4622 0.4050 0.0640  0.0104  0.0344  85  VAL B N   
2201 C CA  . VAL B 85  ? 0.4965 0.5191 0.4547 0.0575  0.0077  0.0381  85  VAL B CA  
2202 C C   . VAL B 85  ? 0.5923 0.6026 0.5439 0.0528  0.0067  0.0402  85  VAL B C   
2203 O O   . VAL B 85  ? 0.3329 0.3311 0.2832 0.0558  0.0072  0.0409  85  VAL B O   
2204 C CB  . VAL B 85  ? 0.3337 0.3565 0.2924 0.0601  0.0053  0.0409  85  VAL B CB  
2205 C CG1 . VAL B 85  ? 0.3346 0.3605 0.2890 0.0528  0.0016  0.0437  85  VAL B CG1 
2206 C CG2 . VAL B 85  ? 0.3342 0.3691 0.3001 0.0662  0.0065  0.0395  85  VAL B CG2 
2207 N N   . TYR B 86  ? 0.6698 0.6837 0.6179 0.0455  0.0052  0.0418  86  TYR B N   
2208 C CA  . TYR B 86  ? 0.3408 0.3439 0.2829 0.0413  0.0044  0.0440  86  TYR B CA  
2209 C C   . TYR B 86  ? 0.3443 0.3417 0.2809 0.0369  0.0005  0.0475  86  TYR B C   
2210 O O   . TYR B 86  ? 0.3461 0.3516 0.2832 0.0313  -0.0017 0.0487  86  TYR B O   
2211 C CB  . TYR B 86  ? 0.3412 0.3512 0.2834 0.0367  0.0061  0.0431  86  TYR B CB  
2212 C CG  . TYR B 86  ? 0.3387 0.3510 0.2842 0.0410  0.0094  0.0386  86  TYR B CG  
2213 C CD1 . TYR B 86  ? 0.3387 0.3410 0.2822 0.0417  0.0103  0.0383  86  TYR B CD1 
2214 C CD2 . TYR B 86  ? 0.5923 0.6165 0.5430 0.0446  0.0112  0.0346  86  TYR B CD2 
2215 C CE1 . TYR B 86  ? 0.3398 0.3427 0.2862 0.0449  0.0123  0.0336  86  TYR B CE1 
2216 C CE2 . TYR B 86  ? 0.5968 0.6208 0.5498 0.0490  0.0136  0.0294  86  TYR B CE2 
2217 C CZ  . TYR B 86  ? 0.5268 0.5395 0.4775 0.0487  0.0138  0.0287  86  TYR B CZ  
2218 O OH  . TYR B 86  ? 0.4630 0.4742 0.4158 0.0523  0.0153  0.0230  86  TYR B OH  
2219 N N   . TYR B 87  ? 0.3775 0.3610 0.3088 0.0395  -0.0006 0.0490  87  TYR B N   
2220 C CA  . TYR B 87  ? 0.3833 0.3583 0.3078 0.0368  -0.0045 0.0511  87  TYR B CA  
2221 C C   . TYR B 87  ? 0.4721 0.4370 0.3910 0.0342  -0.0046 0.0532  87  TYR B C   
2222 O O   . TYR B 87  ? 0.4340 0.3957 0.3533 0.0372  -0.0017 0.0536  87  TYR B O   
2223 C CB  . TYR B 87  ? 0.5365 0.5043 0.4580 0.0433  -0.0057 0.0512  87  TYR B CB  
2224 C CG  . TYR B 87  ? 0.4826 0.4594 0.4099 0.0479  -0.0052 0.0500  87  TYR B CG  
2225 C CD1 . TYR B 87  ? 0.5564 0.5369 0.4901 0.0529  -0.0014 0.0492  87  TYR B CD1 
2226 C CD2 . TYR B 87  ? 0.5655 0.5464 0.4919 0.0472  -0.0087 0.0499  87  TYR B CD2 
2227 C CE1 . TYR B 87  ? 0.5559 0.5438 0.4952 0.0577  -0.0010 0.0486  87  TYR B CE1 
2228 C CE2 . TYR B 87  ? 0.5080 0.4982 0.4399 0.0517  -0.0082 0.0495  87  TYR B CE2 
2229 C CZ  . TYR B 87  ? 0.5671 0.5605 0.5056 0.0573  -0.0041 0.0491  87  TYR B CZ  
2230 O OH  . TYR B 87  ? 0.5961 0.5980 0.5404 0.0626  -0.0036 0.0493  87  TYR B OH  
2231 N N   . CYS B 88  ? 0.4869 0.4464 0.4009 0.0288  -0.0082 0.0549  88  CYS B N   
2232 C CA  . CYS B 88  ? 0.5148 0.4626 0.4228 0.0286  -0.0083 0.0573  88  CYS B CA  
2233 C C   . CYS B 88  ? 0.5134 0.4472 0.4134 0.0336  -0.0107 0.0572  88  CYS B C   
2234 O O   . CYS B 88  ? 0.5306 0.4643 0.4295 0.0359  -0.0130 0.0552  88  CYS B O   
2235 C CB  . CYS B 88  ? 0.3357 0.2844 0.2429 0.0201  -0.0104 0.0600  88  CYS B CB  
2236 S SG  . CYS B 88  ? 1.1075 1.0553 1.0133 0.0126  -0.0167 0.0607  88  CYS B SG  
2237 N N   . GLN B 89  ? 0.5015 0.4249 0.3959 0.0358  -0.0103 0.0592  89  GLN B N   
2238 C CA  . GLN B 89  ? 0.4333 0.3437 0.3189 0.0417  -0.0124 0.0588  89  GLN B CA  
2239 C C   . GLN B 89  ? 0.4703 0.3688 0.3493 0.0416  -0.0135 0.0612  89  GLN B C   
2240 O O   . GLN B 89  ? 0.4984 0.3992 0.3796 0.0408  -0.0106 0.0642  89  GLN B O   
2241 C CB  . GLN B 89  ? 0.4002 0.3122 0.2863 0.0505  -0.0090 0.0591  89  GLN B CB  
2242 C CG  . GLN B 89  ? 0.4092 0.3105 0.2859 0.0581  -0.0103 0.0592  89  GLN B CG  
2243 C CD  . GLN B 89  ? 0.6392 0.5425 0.5167 0.0655  -0.0060 0.0625  89  GLN B CD  
2244 O OE1 . GLN B 89  ? 0.5427 0.4479 0.4234 0.0645  -0.0032 0.0656  89  GLN B OE1 
2245 N NE2 . GLN B 89  ? 0.5717 0.4759 0.4468 0.0728  -0.0057 0.0625  89  GLN B NE2 
2246 N N   . GLN B 90  ? 0.4474 0.3328 0.3177 0.0431  -0.0179 0.0597  90  GLN B N   
2247 C CA  . GLN B 90  ? 0.6050 0.4769 0.4680 0.0445  -0.0193 0.0616  90  GLN B CA  
2248 C C   . GLN B 90  ? 0.5449 0.4086 0.3998 0.0558  -0.0180 0.0611  90  GLN B C   
2249 O O   . GLN B 90  ? 0.4685 0.3295 0.3185 0.0611  -0.0197 0.0576  90  GLN B O   
2250 C CB  . GLN B 90  ? 0.5646 0.4253 0.4232 0.0378  -0.0258 0.0604  90  GLN B CB  
2251 C CG  . GLN B 90  ? 0.5865 0.4419 0.4401 0.0386  -0.0308 0.0552  90  GLN B CG  
2252 C CD  . GLN B 90  ? 0.7244 0.5608 0.5652 0.0457  -0.0344 0.0521  90  GLN B CD  
2253 O OE1 . GLN B 90  ? 0.7115 0.5419 0.5475 0.0535  -0.0315 0.0537  90  GLN B OE1 
2254 N NE2 . GLN B 90  ? 0.7742 0.6021 0.6093 0.0433  -0.0409 0.0475  90  GLN B NE2 
2255 N N   . SER B 91  ? 0.4011 0.4454 0.2155 -0.0273 -0.0381 0.0990  91  SER B N   
2256 C CA  . SER B 91  ? 0.3959 0.4526 0.1952 -0.0203 -0.0493 0.0736  91  SER B CA  
2257 C C   . SER B 91  ? 0.5966 0.6513 0.3878 -0.0076 -0.0817 0.0690  91  SER B C   
2258 O O   . SER B 91  ? 0.6372 0.7004 0.4212 -0.0013 -0.0964 0.0420  91  SER B O   
2259 C CB  . SER B 91  ? 0.3895 0.4658 0.1829 -0.0223 -0.0356 0.0564  91  SER B CB  
2260 O OG  . SER B 91  ? 1.0703 1.1397 0.8605 -0.0192 -0.0285 0.0676  91  SER B OG  
2261 N N   . SER B 92  ? 0.6215 0.6586 0.4200 -0.0035 -0.0918 0.0926  92  SER B N   
2262 C CA  . SER B 92  ? 0.6382 0.6723 0.4388 0.0113  -0.1210 0.0908  92  SER B CA  
2263 C C   . SER B 92  ? 0.6484 0.7040 0.4618 0.0135  -0.1406 0.0666  92  SER B C   
2264 O O   . SER B 92  ? 0.6133 0.6969 0.4291 0.0270  -0.1514 0.0390  92  SER B O   
2265 C CB  . SER B 92  ? 0.5708 0.5730 0.3881 0.0058  -0.1235 0.1235  92  SER B CB  
2266 O OG  . SER B 92  ? 0.5618 0.5607 0.4027 -0.0125 -0.1202 0.1342  92  SER B OG  
2267 N N   . ASN B 93  ? 0.6772 0.7278 0.5069 -0.0014 -0.1400 0.0759  93  ASN B N   
2268 C CA  . ASN B 93  ? 0.6568 0.7216 0.5018 0.0003  -0.1564 0.0558  93  ASN B CA  
2269 C C   . ASN B 93  ? 0.5393 0.6048 0.3850 -0.0121 -0.1441 0.0562  93  ASN B C   
2270 O O   . ASN B 93  ? 0.4564 0.5190 0.2902 -0.0218 -0.1201 0.0666  93  ASN B O   
2271 C CB  . ASN B 93  ? 0.7096 0.7525 0.5783 -0.0001 -0.1806 0.0693  93  ASN B CB  
2272 C CG  . ASN B 93  ? 0.7109 0.7182 0.5904 -0.0119 -0.1778 0.1064  93  ASN B CG  
2273 O OD1 . ASN B 93  ? 0.7900 0.7974 0.6741 -0.0256 -0.1618 0.1201  93  ASN B OD1 
2274 N ND2 . ASN B 93  ? 0.6420 0.6192 0.5277 -0.0064 -0.1904 0.1212  93  ASN B ND2 
2275 N N   . TRP B 94  ? 0.5119 0.5839 0.3728 -0.0108 -0.1580 0.0437  94  TRP B N   
2276 C CA  . TRP B 94  ? 0.4169 0.4889 0.2747 -0.0175 -0.1495 0.0417  94  TRP B CA  
2277 C C   . TRP B 94  ? 0.5376 0.5947 0.4207 -0.0255 -0.1643 0.0608  94  TRP B C   
2278 O O   . TRP B 94  ? 0.5682 0.6143 0.4751 -0.0237 -0.1852 0.0647  94  TRP B O   
2279 C CB  . TRP B 94  ? 0.3886 0.4786 0.2394 -0.0051 -0.1506 0.0050  94  TRP B CB  
2280 C CG  . TRP B 94  ? 0.3944 0.4713 0.2272 0.0012  -0.1432 -0.0138 94  TRP B CG  
2281 C CD1 . TRP B 94  ? 0.4092 0.4724 0.2500 0.0095  -0.1560 -0.0285 94  TRP B CD1 
2282 C CD2 . TRP B 94  ? 0.3916 0.4566 0.1959 -0.0109 -0.1192 -0.0121 94  TRP B CD2 
2283 N NE1 . TRP B 94  ? 0.4173 0.4645 0.2306 -0.0151 -0.1455 -0.0263 94  TRP B NE1 
2284 C CE2 . TRP B 94  ? 0.4007 0.4600 0.1979 -0.0134 -0.1197 -0.0262 94  TRP B CE2 
2285 C CE3 . TRP B 94  ? 0.6602 0.7295 0.4556 -0.0212 -0.0903 0.0001  94  TRP B CE3 
2286 C CZ2 . TRP B 94  ? 0.3881 0.4674 0.1796 -0.0204 -0.0890 -0.0333 94  TRP B CZ2 
2287 C CZ3 . TRP B 94  ? 0.6227 0.7006 0.4107 -0.0285 -0.0625 -0.0059 94  TRP B CZ3 
2288 C CH2 . TRP B 94  ? 0.6001 0.6895 0.3893 -0.0278 -0.0614 -0.0232 94  TRP B CH2 
2289 N N   . PRO B 95  ? 0.5966 0.6495 0.4761 -0.0339 -0.1535 0.0722  95  PRO B N   
2290 C CA  . PRO B 95  ? 0.6272 0.6843 0.4793 -0.0378 -0.1249 0.0718  95  PRO B CA  
2291 C C   . PRO B 95  ? 0.5935 0.6466 0.4448 -0.0463 -0.1033 0.0921  95  PRO B C   
2292 O O   . PRO B 95  ? 0.5741 0.6163 0.4462 -0.0523 -0.1090 0.1144  95  PRO B O   
2293 C CB  . PRO B 95  ? 0.3955 0.4478 0.2508 -0.0409 -0.1254 0.0783  95  PRO B CB  
2294 C CG  . PRO B 95  ? 0.4046 0.4475 0.2960 -0.0454 -0.1498 0.0945  95  PRO B CG  
2295 C CD  . PRO B 95  ? 0.4142 0.4573 0.3192 -0.0380 -0.1695 0.0819  95  PRO B CD  
2296 N N   . ARG B 96  ? 0.6120 0.6709 0.4446 -0.0450 -0.0783 0.0812  96  ARG B N   
2297 C CA  . ARG B 96  ? 0.5442 0.5988 0.3826 -0.0482 -0.0554 0.0922  96  ARG B CA  
2298 C C   . ARG B 96  ? 0.3884 0.4349 0.2458 -0.0544 -0.0487 0.1089  96  ARG B C   
2299 O O   . ARG B 96  ? 0.4195 0.4664 0.2735 -0.0555 -0.0467 0.1058  96  ARG B O   
2300 C CB  . ARG B 96  ? 0.5099 0.5758 0.3377 -0.0502 -0.0332 0.0766  96  ARG B CB  
2301 C CG  . ARG B 96  ? 0.3907 0.4653 0.2024 -0.0436 -0.0366 0.0536  96  ARG B CG  
2302 C CD  . ARG B 96  ? 0.5953 0.6706 0.4049 -0.0372 -0.0427 0.0537  96  ARG B CD  
2303 N NE  . ARG B 96  ? 0.5686 0.6590 0.3700 -0.0354 -0.0373 0.0300  96  ARG B NE  
2304 C CZ  . ARG B 96  ? 0.5505 0.6590 0.3597 -0.0439 -0.0152 0.0243  96  ARG B CZ  
2305 N NH1 . ARG B 96  ? 0.5005 0.6090 0.3224 -0.0526 -0.0013 0.0386  96  ARG B NH1 
2306 N NH2 . ARG B 96  ? 0.5139 0.6412 0.3237 -0.0428 -0.0109 0.0018  96  ARG B NH2 
2307 N N   . THR B 97  ? 0.4937 0.5341 0.3703 -0.0585 -0.0469 0.1253  97  THR B N   
2308 C CA  . THR B 97  ? 0.4348 0.4740 0.3334 -0.0652 -0.0437 0.1379  97  THR B CA  
2309 C C   . THR B 97  ? 0.4185 0.4651 0.3277 -0.0683 -0.0286 0.1424  97  THR B C   
2310 O O   . THR B 97  ? 0.4205 0.4632 0.3297 -0.0662 -0.0255 0.1461  97  THR B O   
2311 C CB  . THR B 97  ? 0.4740 0.4990 0.3945 -0.0669 -0.0608 0.1534  97  THR B CB  
2312 O OG1 . THR B 97  ? 0.3953 0.4088 0.3184 -0.0645 -0.0639 0.1607  97  THR B OG1 
2313 C CG2 . THR B 97  ? 0.5082 0.5368 0.4302 -0.0713 -0.0888 0.1551  97  THR B CG2 
2314 N N   . PHE B 98  ? 0.2978 0.3522 0.2119 -0.0704 -0.0209 0.1413  98  PHE B N   
2315 C CA  . PHE B 98  ? 0.2967 0.3567 0.2194 -0.0704 -0.0102 0.1446  98  PHE B CA  
2316 C C   . PHE B 98  ? 0.3031 0.3585 0.2492 -0.0726 -0.0140 0.1601  98  PHE B C   
2317 O O   . PHE B 98  ? 0.6209 0.6677 0.5787 -0.0749 -0.0248 0.1682  98  PHE B O   
2318 C CB  . PHE B 98  ? 0.2990 0.3648 0.2125 -0.0693 -0.0010 0.1359  98  PHE B CB  
2319 C CG  . PHE B 98  ? 0.5165 0.5837 0.4084 -0.0674 0.0056  0.1201  98  PHE B CG  
2320 C CD1 . PHE B 98  ? 0.4177 0.4891 0.3043 -0.0665 0.0113  0.1133  98  PHE B CD1 
2321 C CD2 . PHE B 98  ? 0.4106 0.4733 0.2867 -0.0660 0.0068  0.1118  98  PHE B CD2 
2322 C CE1 . PHE B 98  ? 0.2904 0.3645 0.1610 -0.0661 0.0176  0.0982  98  PHE B CE1 
2323 C CE2 . PHE B 98  ? 0.5481 0.6103 0.4054 -0.0645 0.0144  0.0970  98  PHE B CE2 
2324 C CZ  . PHE B 98  ? 0.5372 0.6065 0.3941 -0.0656 0.0197  0.0900  98  PHE B CZ  
2325 N N   . GLY B 99  ? 0.4469 0.5062 0.4002 -0.0715 -0.0054 0.1639  99  GLY B N   
2326 C CA  . GLY B 99  ? 0.4456 0.5022 0.4208 -0.0733 -0.0063 0.1771  99  GLY B CA  
2327 C C   . GLY B 99  ? 0.4521 0.5177 0.4313 -0.0732 -0.0037 0.1761  99  GLY B C   
2328 O O   . GLY B 99  ? 0.5252 0.5950 0.4874 -0.0713 -0.0001 0.1653  99  GLY B O   
2329 N N   . GLN B 100 ? 0.3526 0.4181 0.3525 -0.0748 -0.0042 0.1871  100 GLN B N   
2330 C CA  . GLN B 100 ? 0.5153 0.5885 0.5189 -0.0738 -0.0014 0.1874  100 GLN B CA  
2331 C C   . GLN B 100 ? 0.4835 0.5608 0.4758 -0.0696 0.0097  0.1822  100 GLN B C   
2332 O O   . GLN B 100 ? 0.4767 0.5575 0.4616 -0.0673 0.0138  0.1781  100 GLN B O   
2333 C CB  . GLN B 100 ? 0.5911 0.6631 0.6228 -0.0768 -0.0047 0.2006  100 GLN B CB  
2334 C CG  . GLN B 100 ? 0.7124 0.7778 0.7571 -0.0769 0.0023  0.2097  100 GLN B CG  
2335 C CD  . GLN B 100 ? 0.8682 0.9179 0.9211 -0.0801 -0.0011 0.2158  100 GLN B CD  
2336 O OE1 . GLN B 100 ? 0.8529 0.8976 0.8899 -0.0790 -0.0031 0.2105  100 GLN B OE1 
2337 N NE2 . GLN B 100 ? 0.9403 0.9793 1.0179 -0.0841 -0.0006 0.2266  100 GLN B NE2 
2338 N N   . GLY B 101 ? 0.3574 0.4311 0.3472 -0.0682 0.0144  0.1827  101 GLY B N   
2339 C CA  . GLY B 101 ? 0.4726 0.5480 0.4528 -0.0645 0.0235  0.1781  101 GLY B CA  
2340 C C   . GLY B 101 ? 0.3670 0.4423 0.3621 -0.0636 0.0283  0.1883  101 GLY B C   
2341 O O   . GLY B 101 ? 0.3702 0.4469 0.3826 -0.0655 0.0260  0.1971  101 GLY B O   
2342 N N   . THR B 102 ? 0.3715 0.4443 0.3600 -0.0607 0.0353  0.1871  102 THR B N   
2343 C CA  . THR B 102 ? 0.3397 0.4116 0.3388 -0.0591 0.0414  0.1953  102 THR B CA  
2344 C C   . THR B 102 ? 0.4137 0.4911 0.4033 -0.0560 0.0462  0.1881  102 THR B C   
2345 O O   . THR B 102 ? 0.3289 0.4055 0.3017 -0.0549 0.0479  0.1772  102 THR B O   
2346 C CB  . THR B 102 ? 0.3549 0.4157 0.3524 -0.0581 0.0465  0.2010  102 THR B CB  
2347 O OG1 . THR B 102 ? 0.3669 0.4166 0.3715 -0.0614 0.0435  0.2088  102 THR B OG1 
2348 C CG2 . THR B 102 ? 0.3664 0.4251 0.3717 -0.0563 0.0542  0.2085  102 THR B CG2 
2349 N N   . LYS B 103 ? 0.4084 0.4123 0.6531 0.0304  0.0700  -0.0754 103 LYS B N   
2350 C CA  . LYS B 103 ? 0.4121 0.4309 0.6509 0.0365  0.0662  -0.0781 103 LYS B CA  
2351 C C   . LYS B 103 ? 0.2989 0.3062 0.5119 0.0338  0.0580  -0.0705 103 LYS B C   
2352 O O   . LYS B 103 ? 0.3142 0.3181 0.5066 0.0251  0.0628  -0.0705 103 LYS B O   
2353 C CB  . LYS B 103 ? 0.3611 0.4062 0.5985 0.0350  0.0788  -0.0910 103 LYS B CB  
2354 C CG  . LYS B 103 ? 0.2500 0.3106 0.4771 0.0396  0.0758  -0.0944 103 LYS B CG  
2355 C CD  . LYS B 103 ? 0.2315 0.3181 0.4588 0.0379  0.0888  -0.1073 103 LYS B CD  
2356 C CE  . LYS B 103 ? 0.2902 0.3920 0.5060 0.0420  0.0859  -0.1107 103 LYS B CE  
2357 N NZ  . LYS B 103 ? 0.3098 0.4163 0.5353 0.0502  0.0760  -0.1068 103 LYS B NZ  
2358 N N   . VAL B 104 ? 0.3520 0.3533 0.5658 0.0413  0.0454  -0.0640 104 VAL B N   
2359 C CA  . VAL B 104 ? 0.3347 0.3271 0.5242 0.0395  0.0375  -0.0575 104 VAL B CA  
2360 C C   . VAL B 104 ? 0.3666 0.3806 0.5461 0.0423  0.0397  -0.0652 104 VAL B C   
2361 O O   . VAL B 104 ? 0.3357 0.3614 0.5273 0.0509  0.0357  -0.0679 104 VAL B O   
2362 C CB  . VAL B 104 ? 0.3444 0.3173 0.5372 0.0454  0.0221  -0.0458 104 VAL B CB  
2363 C CG1 . VAL B 104 ? 0.3618 0.3260 0.5284 0.0430  0.0145  -0.0395 104 VAL B CG1 
2364 C CG2 . VAL B 104 ? 0.4498 0.4014 0.6528 0.0426  0.0200  -0.0384 104 VAL B CG2 
2365 N N   . GLU B 105 ? 0.4023 0.4209 0.5592 0.0345  0.0462  -0.0684 105 GLU B N   
2366 C CA  . GLU B 105 ? 0.3261 0.3664 0.4717 0.0350  0.0514  -0.0773 105 GLU B CA  
2367 C C   . GLU B 105 ? 0.3393 0.3737 0.4615 0.0351  0.0422  -0.0718 105 GLU B C   
2368 O O   . GLU B 105 ? 0.3624 0.3775 0.4703 0.0305  0.0366  -0.0628 105 GLU B O   
2369 C CB  . GLU B 105 ? 0.3261 0.3782 0.4635 0.0261  0.0663  -0.0859 105 GLU B CB  
2370 C CG  . GLU B 105 ? 0.5647 0.6404 0.6915 0.0261  0.0731  -0.0961 105 GLU B CG  
2371 C CD  . GLU B 105 ? 0.6686 0.7510 0.7797 0.0159  0.0856  -0.1020 105 GLU B CD  
2372 O OE1 . GLU B 105 ? 0.7323 0.8012 0.8229 0.0087  0.0841  -0.0961 105 GLU B OE1 
2373 O OE2 . GLU B 105 ? 0.7782 0.8795 0.8971 0.0149  0.0970  -0.1124 105 GLU B OE2 
2374 N N   . ILE B 106 ? 0.2824 0.3337 0.4013 0.0405  0.0406  -0.0772 106 ILE B N   
2375 C CA  . ILE B 106 ? 0.2932 0.3414 0.3899 0.0409  0.0325  -0.0734 106 ILE B CA  
2376 C C   . ILE B 106 ? 0.4927 0.5445 0.5643 0.0311  0.0407  -0.0767 106 ILE B C   
2377 O O   . ILE B 106 ? 0.4593 0.5293 0.5299 0.0278  0.0526  -0.0868 106 ILE B O   
2378 C CB  . ILE B 106 ? 0.2727 0.3385 0.3739 0.0498  0.0283  -0.0787 106 ILE B CB  
2379 C CG1 . ILE B 106 ? 0.5367 0.5999 0.6637 0.0594  0.0205  -0.0755 106 ILE B CG1 
2380 C CG2 . ILE B 106 ? 0.2846 0.3465 0.3631 0.0505  0.0193  -0.0747 106 ILE B CG2 
2381 C CD1 . ILE B 106 ? 0.4972 0.5775 0.6311 0.0684  0.0160  -0.0803 106 ILE B CD1 
2382 N N   . LYS B 107 ? 0.6696 0.7043 0.7214 0.0264  0.0345  -0.0681 107 LYS B N   
2383 C CA  . LYS B 107 ? 0.5886 0.6250 0.6153 0.0168  0.0412  -0.0698 107 LYS B CA  
2384 C C   . LYS B 107 ? 0.5896 0.6385 0.5973 0.0188  0.0384  -0.0736 107 LYS B C   
2385 O O   . LYS B 107 ? 0.5873 0.6288 0.5892 0.0240  0.0264  -0.0676 107 LYS B O   
2386 C CB  . LYS B 107 ? 0.6056 0.6175 0.6198 0.0102  0.0362  -0.0585 107 LYS B CB  
2387 C CG  . LYS B 107 ? 0.6391 0.6502 0.6242 0.0015  0.0390  -0.0576 107 LYS B CG  
2388 C CD  . LYS B 107 ? 0.6650 0.6906 0.6445 -0.0066 0.0543  -0.0669 107 LYS B CD  
2389 C CE  . LYS B 107 ? 0.5993 0.6200 0.5508 -0.0162 0.0566  -0.0640 107 LYS B CE  
2390 N NZ  . LYS B 107 ? 0.5169 0.5491 0.4631 -0.0249 0.0714  -0.0718 107 LYS B NZ  
2391 N N   . ARG B 108 ? 0.4067 0.4745 0.4049 0.0145  0.0495  -0.0835 108 ARG B N   
2392 C CA  . ARG B 108 ? 0.5225 0.6038 0.5022 0.0157  0.0482  -0.0882 108 ARG B CA  
2393 C C   . ARG B 108 ? 0.6703 0.7561 0.6263 0.0053  0.0574  -0.0915 108 ARG B C   
2394 O O   . ARG B 108 ? 0.6262 0.7032 0.5799 -0.0027 0.0639  -0.0891 108 ARG B O   
2395 C CB  . ARG B 108 ? 0.5368 0.6415 0.5300 0.0228  0.0520  -0.0989 108 ARG B CB  
2396 C CG  . ARG B 108 ? 0.5068 0.6302 0.5018 0.0175  0.0677  -0.1101 108 ARG B CG  
2397 C CD  . ARG B 108 ? 0.4797 0.6263 0.4885 0.0246  0.0712  -0.1203 108 ARG B CD  
2398 N NE  . ARG B 108 ? 0.4710 0.6285 0.4662 0.0288  0.0657  -0.1234 108 ARG B NE  
2399 C CZ  . ARG B 108 ? 0.4691 0.6350 0.4410 0.0236  0.0700  -0.1277 108 ARG B CZ  
2400 N NH1 . ARG B 108 ? 0.5740 0.7391 0.5331 0.0137  0.0800  -0.1293 108 ARG B NH1 
2401 N NH2 . ARG B 108 ? 0.3355 0.5096 0.2977 0.0281  0.0636  -0.1293 108 ARG B NH2 
2402 N N   . THR B 109 ? 0.6583 0.7579 0.5970 0.0057  0.0577  -0.0968 109 THR B N   
2403 C CA  . THR B 109 ? 0.6383 0.7459 0.5543 -0.0033 0.0668  -0.1013 109 THR B CA  
2404 C C   . THR B 109 ? 0.5741 0.6981 0.4993 -0.0074 0.0821  -0.1117 109 THR B C   
2405 O O   . THR B 109 ? 0.5267 0.6605 0.4739 -0.0019 0.0851  -0.1171 109 THR B O   
2406 C CB  . THR B 109 ? 0.6399 0.7604 0.5374 -0.0006 0.0633  -0.1056 109 THR B CB  
2407 O OG1 . THR B 109 ? 0.6738 0.8175 0.5814 0.0041  0.0696  -0.1172 109 THR B OG1 
2408 C CG2 . THR B 109 ? 0.5484 0.6566 0.4438 0.0068  0.0474  -0.0973 109 THR B CG2 
2409 N N   . VAL B 110 ? 0.6083 0.7359 0.5168 -0.0171 0.0917  -0.1144 110 VAL B N   
2410 C CA  . VAL B 110 ? 0.6010 0.7429 0.5178 -0.0217 0.1064  -0.1238 110 VAL B CA  
2411 C C   . VAL B 110 ? 0.6586 0.8128 0.5761 -0.0183 0.1048  -0.1252 110 VAL B C   
2412 O O   . VAL B 110 ? 0.6649 0.8182 0.5653 -0.0211 0.1023  -0.1220 110 VAL B O   
2413 C CB  . VAL B 110 ? 0.6278 0.7610 0.5317 -0.0334 0.1142  -0.1210 110 VAL B CB  
2414 C CG1 . VAL B 110 ? 0.5724 0.7162 0.4871 -0.0368 0.1250  -0.1267 110 VAL B CG1 
2415 C CG2 . VAL B 110 ? 0.5954 0.7035 0.5073 -0.0351 0.1078  -0.1095 110 VAL B CG2 
2416 N N   . ALA B 111 ? 0.6384 0.7961 0.5789 -0.0120 0.1021  -0.1245 111 ALA B N   
2417 C CA  . ALA B 111 ? 0.5681 0.7280 0.5133 -0.0090 0.0962  -0.1200 111 ALA B CA  
2418 C C   . ALA B 111 ? 0.5595 0.7179 0.5176 -0.0113 0.0995  -0.1179 111 ALA B C   
2419 O O   . ALA B 111 ? 0.5395 0.6975 0.5135 -0.0100 0.1019  -0.1189 111 ALA B O   
2420 C CB  . ALA B 111 ? 0.4380 0.6016 0.3945 -0.0005 0.0877  -0.1195 111 ALA B CB  
2421 N N   . ALA B 112 ? 0.6356 0.7930 0.5867 -0.0143 0.0991  -0.1148 112 ALA B N   
2422 C CA  . ALA B 112 ? 0.5160 0.6720 0.4763 -0.0163 0.1010  -0.1128 112 ALA B CA  
2423 C C   . ALA B 112 ? 0.3562 0.5196 0.3339 -0.0139 0.0945  -0.1139 112 ALA B C   
2424 O O   . ALA B 112 ? 0.4946 0.6620 0.4744 -0.0100 0.0882  -0.1138 112 ALA B O   
2425 C CB  . ALA B 112 ? 0.3848 0.5416 0.3333 -0.0217 0.1026  -0.1121 112 ALA B CB  
2426 N N   . PRO B 113 ? 0.3600 0.5285 0.3511 -0.0180 0.0958  -0.1170 113 PRO B N   
2427 C CA  . PRO B 113 ? 0.4834 0.6613 0.4906 -0.0175 0.0891  -0.1201 113 PRO B CA  
2428 C C   . PRO B 113 ? 0.5305 0.7220 0.5399 -0.0225 0.0838  -0.1243 113 PRO B C   
2429 O O   . PRO B 113 ? 0.4680 0.6625 0.4676 -0.0265 0.0854  -0.1249 113 PRO B O   
2430 C CB  . PRO B 113 ? 0.3416 0.5171 0.3601 -0.0197 0.0926  -0.1216 113 PRO B CB  
2431 C CG  . PRO B 113 ? 0.3551 0.5265 0.3645 -0.0251 0.1000  -0.1217 113 PRO B CG  
2432 C CD  . PRO B 113 ? 0.3678 0.5315 0.3601 -0.0221 0.1028  -0.1173 113 PRO B CD  
2433 N N   . SER B 114 ? 0.6974 0.9449 0.6694 -0.0428 0.2002  0.0642  114 SER B N   
2434 C CA  . SER B 114 ? 0.6995 0.9562 0.6870 -0.0368 0.2057  0.0577  114 SER B CA  
2435 C C   . SER B 114 ? 0.6598 0.9396 0.6788 -0.0388 0.1960  0.0578  114 SER B C   
2436 O O   . SER B 114 ? 0.6376 0.9127 0.6554 -0.0358 0.1837  0.0509  114 SER B O   
2437 C CB  . SER B 114 ? 0.6568 0.8867 0.6232 -0.0252 0.2053  0.0422  114 SER B CB  
2438 O OG  . SER B 114 ? 0.6285 0.8325 0.5631 -0.0250 0.2081  0.0401  114 SER B OG  
2439 N N   . VAL B 115 ? 0.5678 0.8741 0.6152 -0.0444 0.2007  0.0652  115 VAL B N   
2440 C CA  . VAL B 115 ? 0.5394 0.8688 0.6189 -0.0487 0.1906  0.0661  115 VAL B CA  
2441 C C   . VAL B 115 ? 0.5207 0.8541 0.6125 -0.0381 0.1900  0.0552  115 VAL B C   
2442 O O   . VAL B 115 ? 0.3893 0.7267 0.4830 -0.0340 0.2005  0.0546  115 VAL B O   
2443 C CB  . VAL B 115 ? 0.4610 0.8174 0.5684 -0.0650 0.1923  0.0828  115 VAL B CB  
2444 C CG1 . VAL B 115 ? 0.3941 0.7716 0.5350 -0.0720 0.1785  0.0829  115 VAL B CG1 
2445 C CG2 . VAL B 115 ? 0.5085 0.8571 0.6007 -0.0767 0.1932  0.0960  115 VAL B CG2 
2446 N N   . PHE B 116 ? 0.5040 0.8371 0.6031 -0.0337 0.1771  0.0466  116 PHE B N   
2447 C CA  . PHE B 116 ? 0.4603 0.7942 0.5689 -0.0239 0.1739  0.0368  116 PHE B CA  
2448 C C   . PHE B 116 ? 0.3278 0.6834 0.4659 -0.0283 0.1611  0.0361  116 PHE B C   
2449 O O   . PHE B 116 ? 0.3161 0.6753 0.4563 -0.0339 0.1502  0.0355  116 PHE B O   
2450 C CB  . PHE B 116 ? 0.5089 0.8124 0.5892 -0.0124 0.1699  0.0249  116 PHE B CB  
2451 C CG  . PHE B 116 ? 0.6464 0.9260 0.6979 -0.0093 0.1803  0.0238  116 PHE B CG  
2452 C CD1 . PHE B 116 ? 0.6785 0.9541 0.7262 -0.0041 0.1900  0.0206  116 PHE B CD1 
2453 C CD2 . PHE B 116 ? 0.7059 0.9687 0.7344 -0.0121 0.1798  0.0253  116 PHE B CD2 
2454 C CE1 . PHE B 116 ? 0.6701 0.9303 0.6922 -0.0018 0.1980  0.0191  116 PHE B CE1 
2455 C CE2 . PHE B 116 ? 0.6967 0.9372 0.6991 -0.0101 0.1886  0.0234  116 PHE B CE2 
2456 C CZ  . PHE B 116 ? 0.6581 0.8987 0.6576 -0.0054 0.1975  0.0201  116 PHE B CZ  
2457 N N   . ILE B 117 ? 0.3513 0.7219 0.5120 -0.0258 0.1617  0.0349  117 ILE B N   
2458 C CA  . ILE B 117 ? 0.3335 0.7238 0.5236 -0.0301 0.1489  0.0333  117 ILE B CA  
2459 C C   . ILE B 117 ? 0.5285 0.9117 0.7181 -0.0177 0.1436  0.0227  117 ILE B C   
2460 O O   . ILE B 117 ? 0.3302 0.7090 0.5155 -0.0102 0.1524  0.0212  117 ILE B O   
2461 C CB  . ILE B 117 ? 0.3423 0.7612 0.5663 -0.0430 0.1520  0.0448  117 ILE B CB  
2462 C CG1 . ILE B 117 ? 0.3541 0.7905 0.6088 -0.0521 0.1355  0.0442  117 ILE B CG1 
2463 C CG2 . ILE B 117 ? 0.5324 0.9603 0.7650 -0.0371 0.1631  0.0454  117 ILE B CG2 
2464 C CD1 . ILE B 117 ? 0.3558 0.7916 0.6092 -0.0637 0.1257  0.0477  117 ILE B CD1 
2465 N N   . PHE B 118 ? 0.5308 0.9126 0.7228 -0.0159 0.1287  0.0151  118 PHE B N   
2466 C CA  . PHE B 118 ? 0.4658 0.8394 0.6543 -0.0056 0.1219  0.0063  118 PHE B CA  
2467 C C   . PHE B 118 ? 0.4548 0.8487 0.6741 -0.0090 0.1103  0.0047  118 PHE B C   
2468 O O   . PHE B 118 ? 0.3811 0.7819 0.6096 -0.0147 0.0974  0.0015  118 PHE B O   
2469 C CB  . PHE B 118 ? 0.4866 0.8370 0.6453 0.0007  0.1134  -0.0025 118 PHE B CB  
2470 C CG  . PHE B 118 ? 0.4596 0.7860 0.5878 0.0039  0.1225  -0.0018 118 PHE B CG  
2471 C CD1 . PHE B 118 ? 0.3402 0.6652 0.4598 -0.0024 0.1268  0.0027  118 PHE B CD1 
2472 C CD2 . PHE B 118 ? 0.4492 0.7540 0.5580 0.0124  0.1264  -0.0055 118 PHE B CD2 
2473 C CE1 . PHE B 118 ? 0.2996 0.6002 0.3907 0.0007  0.1344  0.0028  118 PHE B CE1 
2474 C CE2 . PHE B 118 ? 0.2971 0.5793 0.3796 0.0144  0.1334  -0.0056 118 PHE B CE2 
2475 C CZ  . PHE B 118 ? 0.3598 0.6380 0.4332 0.0090  0.1375  -0.0018 118 PHE B CZ  
2476 N N   . PRO B 119 ? 0.4547 0.8579 0.6904 -0.0054 0.1139  0.0058  119 PRO B N   
2477 C CA  . PRO B 119 ? 0.4059 0.8250 0.6693 -0.0074 0.1023  0.0036  119 PRO B CA  
2478 C C   . PRO B 119 ? 0.4254 0.8312 0.6744 -0.0010 0.0878  -0.0062 119 PRO B C   
2479 O O   . PRO B 119 ? 0.4055 0.7907 0.6241 0.0063  0.0890  -0.0108 119 PRO B O   
2480 C CB  . PRO B 119 ? 0.3803 0.8081 0.6555 -0.0022 0.1114  0.0060  119 PRO B CB  
2481 C CG  . PRO B 119 ? 0.4407 0.8666 0.7047 -0.0024 0.1282  0.0116  119 PRO B CG  
2482 C CD  . PRO B 119 ? 0.4747 0.8765 0.7059 -0.0002 0.1290  0.0091  119 PRO B CD  
2483 N N   . PRO B 120 ? 0.4117 0.8283 0.6817 -0.0045 0.0737  -0.0095 120 PRO B N   
2484 C CA  . PRO B 120 ? 0.3805 0.7852 0.6352 0.0010  0.0596  -0.0195 120 PRO B CA  
2485 C C   . PRO B 120 ? 0.4439 0.8352 0.6782 0.0115  0.0629  -0.0223 120 PRO B C   
2486 O O   . PRO B 120 ? 0.2123 0.6109 0.4594 0.0145  0.0697  -0.0182 120 PRO B O   
2487 C CB  . PRO B 120 ? 0.4318 0.8512 0.7173 -0.0044 0.0462  -0.0204 120 PRO B CB  
2488 C CG  . PRO B 120 ? 0.5096 0.9469 0.8242 -0.0165 0.0492  -0.0122 120 PRO B CG  
2489 C CD  . PRO B 120 ? 0.5106 0.9498 0.8190 -0.0150 0.0690  -0.0044 120 PRO B CD  
2490 N N   . SER B 121 ? 0.3835 0.7569 0.5875 0.0161  0.0575  -0.0295 121 SER B N   
2491 C CA  . SER B 121 ? 0.4643 0.8286 0.6483 0.0240  0.0577  -0.0327 121 SER B CA  
2492 C C   . SER B 121 ? 0.4348 0.8131 0.6359 0.0263  0.0522  -0.0338 121 SER B C   
2493 O O   . SER B 121 ? 0.5786 0.9627 0.7927 0.0231  0.0413  -0.0373 121 SER B O   
2494 C CB  . SER B 121 ? 0.2273 0.5775 0.3807 0.0257  0.0483  -0.0415 121 SER B CB  
2495 O OG  . SER B 121 ? 0.2291 0.5772 0.3658 0.0318  0.0455  -0.0451 121 SER B OG  
2496 N N   . ASP B 122 ? 0.3943 0.7776 0.5956 0.0323  0.0594  -0.0311 122 ASP B N   
2497 C CA  . ASP B 122 ? 0.4200 0.8175 0.6374 0.0354  0.0554  -0.0315 122 ASP B CA  
2498 C C   . ASP B 122 ? 0.3641 0.7578 0.5678 0.0365  0.0414  -0.0402 122 ASP B C   
2499 O O   . ASP B 122 ? 0.4036 0.8075 0.6241 0.0349  0.0332  -0.0422 122 ASP B O   
2500 C CB  . ASP B 122 ? 0.5552 0.9555 0.7675 0.0435  0.0645  -0.0288 122 ASP B CB  
2501 C CG  . ASP B 122 ? 0.7084 1.1277 0.9452 0.0462  0.0636  -0.0269 122 ASP B CG  
2502 O OD1 . ASP B 122 ? 0.7332 1.1572 0.9737 0.0461  0.0524  -0.0312 122 ASP B OD1 
2503 O OD2 . ASP B 122 ? 0.7783 1.2087 1.0301 0.0487  0.0743  -0.0217 122 ASP B OD2 
2504 N N   . GLU B 123 ? 0.4088 0.7879 0.5815 0.0388  0.0386  -0.0455 123 GLU B N   
2505 C CA  . GLU B 123 ? 0.3510 0.7258 0.5051 0.0397  0.0267  -0.0547 123 GLU B CA  
2506 C C   . GLU B 123 ? 0.3600 0.7333 0.5180 0.0343  0.0178  -0.0607 123 GLU B C   
2507 O O   . GLU B 123 ? 0.3149 0.6908 0.4701 0.0350  0.0086  -0.0682 123 GLU B O   
2508 C CB  . GLU B 123 ? 0.4767 0.8381 0.5992 0.0423  0.0262  -0.0575 123 GLU B CB  
2509 C CG  . GLU B 123 ? 0.6189 0.9756 0.7387 0.0461  0.0375  -0.0502 123 GLU B CG  
2510 C CD  . GLU B 123 ? 0.7960 1.1393 0.8884 0.0479  0.0355  -0.0520 123 GLU B CD  
2511 O OE1 . GLU B 123 ? 0.8282 1.1637 0.9156 0.0508  0.0445  -0.0471 123 GLU B OE1 
2512 O OE2 . GLU B 123 ? 0.7963 1.1373 0.8727 0.0464  0.0248  -0.0587 123 GLU B OE2 
2513 N N   . GLN B 124 ? 0.4138 0.7826 0.5780 0.0295  0.0208  -0.0576 124 GLN B N   
2514 C CA  . GLN B 124 ? 0.4058 0.7725 0.5758 0.0249  0.0119  -0.0628 124 GLN B CA  
2515 C C   . GLN B 124 ? 0.3905 0.7697 0.5901 0.0225  0.0051  -0.0618 124 GLN B C   
2516 O O   . GLN B 124 ? 0.2497 0.6272 0.4512 0.0211  -0.0058 -0.0689 124 GLN B O   
2517 C CB  . GLN B 124 ? 0.4106 0.7722 0.5871 0.0198  0.0166  -0.0575 124 GLN B CB  
2518 C CG  . GLN B 124 ? 0.3536 0.7146 0.5357 0.0157  0.0058  -0.0640 124 GLN B CG  
2519 C CD  . GLN B 124 ? 0.3459 0.7146 0.5428 0.0093  0.0091  -0.0594 124 GLN B CD  
2520 O OE1 . GLN B 124 ? 0.2448 0.6147 0.4494 0.0053  -0.0006 -0.0641 124 GLN B OE1 
2521 N NE2 . GLN B 124 ? 0.2469 0.6196 0.4473 0.0082  0.0228  -0.0499 124 GLN B NE2 
2522 N N   . LEU B 125 ? 0.3645 0.7564 0.5872 0.0224  0.0112  -0.0532 125 LEU B N   
2523 C CA  . LEU B 125 ? 0.4326 0.8384 0.6847 0.0198  0.0041  -0.0512 125 LEU B CA  
2524 C C   . LEU B 125 ? 0.4939 0.9010 0.7329 0.0253  -0.0039 -0.0603 125 LEU B C   
2525 O O   . LEU B 125 ? 0.3775 0.7881 0.6274 0.0234  -0.0148 -0.0648 125 LEU B O   
2526 C CB  . LEU B 125 ? 0.4616 0.8825 0.7413 0.0187  0.0139  -0.0402 125 LEU B CB  
2527 C CG  . LEU B 125 ? 0.3604 0.7801 0.6501 0.0136  0.0244  -0.0319 125 LEU B CG  
2528 C CD1 . LEU B 125 ? 0.4231 0.8522 0.7211 0.0167  0.0395  -0.0248 125 LEU B CD1 
2529 C CD2 . LEU B 125 ? 0.2595 0.6896 0.5795 0.0032  0.0166  -0.0281 125 LEU B CD2 
2530 N N   . LYS B 126 ? 0.6582 1.0614 0.8725 0.0319  0.0010  -0.0632 126 LYS B N   
2531 C CA  . LYS B 126 ? 0.7421 1.1468 0.9419 0.0370  -0.0053 -0.0712 126 LYS B CA  
2532 C C   . LYS B 126 ? 0.7923 1.1898 0.9798 0.0362  -0.0155 -0.0826 126 LYS B C   
2533 O O   . LYS B 126 ? 0.8407 1.2427 1.0275 0.0388  -0.0223 -0.0893 126 LYS B O   
2534 C CB  . LYS B 126 ? 0.7396 1.1381 0.9109 0.0428  -0.0002 -0.0721 126 LYS B CB  
2535 C CG  . LYS B 126 ? 0.7813 1.1894 0.9542 0.0486  -0.0009 -0.0715 126 LYS B CG  
2536 C CD  . LYS B 126 ? 0.8520 1.2762 1.0600 0.0479  0.0009  -0.0643 126 LYS B CD  
2537 C CE  . LYS B 126 ? 0.8444 1.2780 1.0542 0.0549  0.0032  -0.0616 126 LYS B CE  
2538 N NZ  . LYS B 126 ? 0.8115 1.2622 1.0558 0.0548  0.0070  -0.0539 126 LYS B NZ  
2539 N N   . SER B 127 ? 0.6395 1.0260 0.8180 0.0331  -0.0158 -0.0851 127 SER B N   
2540 C CA  . SER B 127 ? 0.6212 1.0005 0.7911 0.0331  -0.0245 -0.0960 127 SER B CA  
2541 C C   . SER B 127 ? 0.4781 0.8627 0.6780 0.0287  -0.0343 -0.0952 127 SER B C   
2542 O O   . SER B 127 ? 0.4688 0.8505 0.6644 0.0311  -0.0430 -0.1055 127 SER B O   
2543 C CB  . SER B 127 ? 0.6518 1.0183 0.8041 0.0317  -0.0220 -0.0983 127 SER B CB  
2544 O OG  . SER B 127 ? 0.7458 1.1064 0.8669 0.0352  -0.0165 -0.1011 127 SER B OG  
2545 N N   . GLY B 128 ? 0.4786 0.8718 0.7091 0.0223  -0.0331 -0.0828 128 GLY B N   
2546 C CA  . GLY B 128 ? 0.5147 0.9114 0.7732 0.0153  -0.0441 -0.0795 128 GLY B CA  
2547 C C   . GLY B 128 ? 0.5420 0.9307 0.8071 0.0087  -0.0464 -0.0749 128 GLY B C   
2548 O O   . GLY B 128 ? 0.5695 0.9552 0.8469 0.0036  -0.0593 -0.0761 128 GLY B O   
2549 N N   . THR B 129 ? 0.6562 1.0403 0.9112 0.0087  -0.0351 -0.0701 129 THR B N   
2550 C CA  . THR B 129 ? 0.6158 0.9991 0.8809 0.0018  -0.0362 -0.0660 129 THR B CA  
2551 C C   . THR B 129 ? 0.5000 0.8928 0.7716 -0.0004 -0.0206 -0.0564 129 THR B C   
2552 O O   . THR B 129 ? 0.5103 0.9019 0.7694 0.0053  -0.0091 -0.0539 129 THR B O   
2553 C CB  . THR B 129 ? 0.3968 0.7632 0.6333 0.0056  -0.0402 -0.0775 129 THR B CB  
2554 O OG1 . THR B 129 ? 0.4171 0.7742 0.6402 0.0111  -0.0496 -0.0884 129 THR B OG1 
2555 C CG2 . THR B 129 ? 0.3983 0.7664 0.6494 -0.0020 -0.0479 -0.0767 129 THR B CG2 
2556 N N   . ALA B 130 ? 0.3906 0.7923 0.6813 -0.0091 -0.0204 -0.0509 130 ALA B N   
2557 C CA  . ALA B 130 ? 0.3070 0.7177 0.6024 -0.0116 -0.0037 -0.0418 130 ALA B CA  
2558 C C   . ALA B 130 ? 0.3004 0.7082 0.5867 -0.0162 -0.0022 -0.0431 130 ALA B C   
2559 O O   . ALA B 130 ? 0.3783 0.7866 0.6766 -0.0234 -0.0156 -0.0460 130 ALA B O   
2560 C CB  . ALA B 130 ? 0.2724 0.7030 0.6060 -0.0200 -0.0005 -0.0303 130 ALA B CB  
2561 N N   . SER B 131 ? 0.2687 0.6722 0.5334 -0.0123 0.0131  -0.0407 131 SER B N   
2562 C CA  . SER B 131 ? 0.2676 0.6700 0.5224 -0.0167 0.0169  -0.0405 131 SER B CA  
2563 C C   . SER B 131 ? 0.3624 0.7714 0.6182 -0.0197 0.0364  -0.0282 131 SER B C   
2564 O O   . SER B 131 ? 0.4803 0.8806 0.7184 -0.0117 0.0485  -0.0259 131 SER B O   
2565 C CB  . SER B 131 ? 0.2063 0.5909 0.4235 -0.0082 0.0146  -0.0518 131 SER B CB  
2566 O OG  . SER B 131 ? 0.2567 0.6326 0.4685 -0.0043 -0.0013 -0.0634 131 SER B OG  
2567 N N   . VAL B 132 ? 0.2009 0.6229 0.4760 -0.0319 0.0387  -0.0201 132 VAL B N   
2568 C CA  . VAL B 132 ? 0.2112 0.6371 0.4826 -0.0354 0.0582  -0.0076 132 VAL B CA  
2569 C C   . VAL B 132 ? 0.2129 0.6309 0.4602 -0.0375 0.0625  -0.0077 132 VAL B C   
2570 O O   . VAL B 132 ? 0.2104 0.6336 0.4652 -0.0462 0.0505  -0.0108 132 VAL B O   
2571 C CB  . VAL B 132 ? 0.2218 0.6679 0.5287 -0.0501 0.0608  0.0050  132 VAL B CB  
2572 C CG1 . VAL B 132 ? 0.3414 0.7889 0.6393 -0.0519 0.0823  0.0174  132 VAL B CG1 
2573 C CG2 . VAL B 132 ? 0.2203 0.6758 0.5539 -0.0489 0.0540  0.0036  132 VAL B CG2 
2574 N N   . VAL B 133 ? 0.1855 0.5886 0.4039 -0.0297 0.0777  -0.0051 133 VAL B N   
2575 C CA  . VAL B 133 ? 0.2908 0.6826 0.4822 -0.0302 0.0823  -0.0052 133 VAL B CA  
2576 C C   . VAL B 133 ? 0.3276 0.7184 0.5143 -0.0359 0.0998  0.0093  133 VAL B C   
2577 O O   . VAL B 133 ? 0.2839 0.6678 0.4662 -0.0300 0.1122  0.0136  133 VAL B O   
2578 C CB  . VAL B 133 ? 0.1857 0.5524 0.3410 -0.0167 0.0823  -0.0150 133 VAL B CB  
2579 C CG1 . VAL B 133 ? 0.1919 0.5452 0.3195 -0.0173 0.0864  -0.0152 133 VAL B CG1 
2580 C CG2 . VAL B 133 ? 0.1706 0.5366 0.3256 -0.0115 0.0655  -0.0286 133 VAL B CG2 
2581 N N   . CYS B 134 ? 0.3292 0.7262 0.5164 -0.0480 0.1000  0.0165  134 CYS B N   
2582 C CA  . CYS B 134 ? 0.2918 0.6835 0.4679 -0.0535 0.1160  0.0308  134 CYS B CA  
2583 C C   . CYS B 134 ? 0.4104 0.7796 0.5478 -0.0479 0.1197  0.0272  134 CYS B C   
2584 O O   . CYS B 134 ? 0.4322 0.8049 0.5645 -0.0552 0.1117  0.0258  134 CYS B O   
2585 C CB  . CYS B 134 ? 0.2657 0.6767 0.4693 -0.0743 0.1132  0.0465  134 CYS B CB  
2586 S SG  . CYS B 134 ? 0.7532 1.1592 0.9464 -0.0826 0.1326  0.0666  134 CYS B SG  
2587 N N   . LEU B 135 ? 0.4692 0.8145 0.5808 -0.0360 0.1305  0.0251  135 LEU B N   
2588 C CA  . LEU B 135 ? 0.3996 0.7180 0.4746 -0.0295 0.1321  0.0203  135 LEU B CA  
2589 C C   . LEU B 135 ? 0.4639 0.7729 0.5236 -0.0351 0.1447  0.0322  135 LEU B C   
2590 O O   . LEU B 135 ? 0.4205 0.7336 0.4882 -0.0373 0.1567  0.0407  135 LEU B O   
2591 C CB  . LEU B 135 ? 0.4456 0.7385 0.5022 -0.0155 0.1329  0.0107  135 LEU B CB  
2592 C CG  . LEU B 135 ? 0.4970 0.7565 0.5196 -0.0094 0.1383  0.0084  135 LEU B CG  
2593 C CD1 . LEU B 135 ? 0.3209 0.5696 0.3232 -0.0101 0.1284  0.0034  135 LEU B CD1 
2594 C CD2 . LEU B 135 ? 0.5672 0.8063 0.5811 0.0001  0.1390  0.0016  135 LEU B CD2 
2595 N N   . LEU B 136 ? 0.3513 0.6484 0.3878 -0.0374 0.1415  0.0319  136 LEU B N   
2596 C CA  . LEU B 136 ? 0.2996 0.5832 0.3161 -0.0419 0.1516  0.0425  136 LEU B CA  
2597 C C   . LEU B 136 ? 0.4231 0.6737 0.4040 -0.0313 0.1501  0.0327  136 LEU B C   
2598 O O   . LEU B 136 ? 0.4002 0.6465 0.3696 -0.0300 0.1385  0.0250  136 LEU B O   
2599 C CB  . LEU B 136 ? 0.3058 0.6058 0.3295 -0.0591 0.1474  0.0558  136 LEU B CB  
2600 C CG  . LEU B 136 ? 0.3084 0.6360 0.3684 -0.0764 0.1473  0.0717  136 LEU B CG  
2601 C CD1 . LEU B 136 ? 0.2823 0.6341 0.3775 -0.0781 0.1362  0.0641  136 LEU B CD1 
2602 C CD2 . LEU B 136 ? 0.3245 0.6483 0.3803 -0.0945 0.1400  0.0864  136 LEU B CD2 
2603 N N   . ASN B 137 ? 0.5013 0.7294 0.4661 -0.0247 0.1610  0.0320  137 ASN B N   
2604 C CA  . ASN B 137 ? 0.5499 0.7445 0.4848 -0.0166 0.1590  0.0231  137 ASN B CA  
2605 C C   . ASN B 137 ? 0.5896 0.7662 0.4997 -0.0194 0.1676  0.0292  137 ASN B C   
2606 O O   . ASN B 137 ? 0.6992 0.8812 0.6116 -0.0239 0.1801  0.0372  137 ASN B O   
2607 C CB  . ASN B 137 ? 0.3898 0.5686 0.3233 -0.0085 0.1624  0.0148  137 ASN B CB  
2608 C CG  . ASN B 137 ? 0.6029 0.7727 0.5355 -0.0023 0.1488  0.0047  137 ASN B CG  
2609 O OD1 . ASN B 137 ? 0.5344 0.6939 0.4538 -0.0013 0.1385  0.0007  137 ASN B OD1 
2610 N ND2 . ASN B 137 ? 0.5264 0.7041 0.4731 0.0017  0.1477  0.0009  137 ASN B ND2 
2611 N N   . ASN B 138 ? 0.4638 0.6200 0.3506 -0.0169 0.1602  0.0250  138 ASN B N   
2612 C CA  . ASN B 138 ? 0.5919 0.7247 0.4511 -0.0177 0.1670  0.0282  138 ASN B CA  
2613 C C   . ASN B 138 ? 0.6923 0.8370 0.5497 -0.0272 0.1753  0.0431  138 ASN B C   
2614 O O   . ASN B 138 ? 0.8146 0.9598 0.6713 -0.0302 0.1883  0.0479  138 ASN B O   
2615 C CB  . ASN B 138 ? 0.6056 0.7178 0.4543 -0.0143 0.1761  0.0213  138 ASN B CB  
2616 C CG  . ASN B 138 ? 0.5986 0.7052 0.4441 -0.0066 0.1664  0.0105  138 ASN B CG  
2617 O OD1 . ASN B 138 ? 0.5713 0.6892 0.4351 -0.0035 0.1595  0.0068  138 ASN B OD1 
2618 N ND2 . ASN B 138 ? 0.6941 0.7846 0.5184 -0.0045 0.1634  0.0061  138 ASN B ND2 
2619 N N   . PHE B 139 ? 0.4819 0.6377 0.3385 -0.0337 0.1668  0.0505  139 PHE B N   
2620 C CA  . PHE B 139 ? 0.5788 0.7423 0.4319 -0.0454 0.1723  0.0681  139 PHE B CA  
2621 C C   . PHE B 139 ? 0.5719 0.7251 0.4021 -0.0496 0.1619  0.0727  139 PHE B C   
2622 O O   . PHE B 139 ? 0.5746 0.7192 0.3938 -0.0432 0.1497  0.0605  139 PHE B O   
2623 C CB  . PHE B 139 ? 0.4972 0.6935 0.3837 -0.0580 0.1728  0.0806  139 PHE B CB  
2624 C CG  . PHE B 139 ? 0.6021 0.8172 0.5043 -0.0636 0.1579  0.0775  139 PHE B CG  
2625 C CD1 . PHE B 139 ? 0.5439 0.7687 0.4481 -0.0812 0.1491  0.0920  139 PHE B CD1 
2626 C CD2 . PHE B 139 ? 0.5860 0.8063 0.4990 -0.0535 0.1515  0.0606  139 PHE B CD2 
2627 C CE1 . PHE B 139 ? 0.5201 0.7438 0.4414 -0.0832 0.1284  0.0823  139 PHE B CE1 
2628 C CE2 . PHE B 139 ? 0.5064 0.7464 0.4327 -0.0588 0.1382  0.0550  139 PHE B CE2 
2629 C CZ  . PHE B 139 ? 0.4871 0.7232 0.4189 -0.0721 0.1247  0.0637  139 PHE B CZ  
2630 N N   . TYR B 140 ? 0.5157 0.6704 0.3398 -0.0616 0.1653  0.0909  140 TYR B N   
2631 C CA  . TYR B 140 ? 0.5290 0.6706 0.3282 -0.0677 0.1548  0.0983  140 TYR B CA  
2632 C C   . TYR B 140 ? 0.5447 0.6886 0.3452 -0.0846 0.1586  0.1229  140 TYR B C   
2633 O O   . TYR B 140 ? 0.5623 0.7062 0.3660 -0.0844 0.1734  0.1298  140 TYR B O   
2634 C CB  . TYR B 140 ? 0.5968 0.7084 0.3637 -0.0535 0.1553  0.0873  140 TYR B CB  
2635 C CG  . TYR B 140 ? 0.5895 0.6878 0.3306 -0.0568 0.1412  0.0909  140 TYR B CG  
2636 C CD1 . TYR B 140 ? 0.6157 0.7110 0.3493 -0.0512 0.1253  0.0758  140 TYR B CD1 
2637 C CD2 . TYR B 140 ? 0.5736 0.6607 0.2970 -0.0656 0.1426  0.1088  140 TYR B CD2 
2638 C CE1 . TYR B 140 ? 0.6366 0.7178 0.3445 -0.0540 0.1105  0.0770  140 TYR B CE1 
2639 C CE2 . TYR B 140 ? 0.5892 0.6600 0.2867 -0.0691 0.1274  0.1121  140 TYR B CE2 
2640 C CZ  . TYR B 140 ? 0.6986 0.7659 0.3873 -0.0632 0.1111  0.0955  140 TYR B CZ  
2641 O OH  . TYR B 140 ? 0.7446 0.7919 0.4051 -0.0656 0.0940  0.0966  140 TYR B OH  
2642 N N   . PRO B 141 ? 0.5613 0.7025 0.3565 -0.1010 0.1436  0.1365  141 PRO B N   
2643 C CA  . PRO B 141 ? 0.5497 0.6730 0.3440 -0.0961 0.1189  0.1208  141 PRO B CA  
2644 C C   . PRO B 141 ? 0.5964 0.7331 0.4273 -0.0941 0.1082  0.1076  141 PRO B C   
2645 O O   . PRO B 141 ? 0.5546 0.7183 0.4100 -0.0963 0.1213  0.1098  141 PRO B O   
2646 C CB  . PRO B 141 ? 0.5830 0.6767 0.3726 -0.1073 0.1011  0.1350  141 PRO B CB  
2647 C CG  . PRO B 141 ? 0.6772 0.7837 0.4845 -0.1242 0.1134  0.1592  141 PRO B CG  
2648 C CD  . PRO B 141 ? 0.6792 0.8144 0.4764 -0.1197 0.1432  0.1627  141 PRO B CD  
2649 N N   . ARG B 142 ? 0.5819 0.6999 0.4154 -0.0889 0.0837  0.0935  142 ARG B N   
2650 C CA  . ARG B 142 ? 0.5492 0.6777 0.4126 -0.0847 0.0708  0.0780  142 ARG B CA  
2651 C C   . ARG B 142 ? 0.6286 0.7607 0.5283 -0.0988 0.0633  0.0897  142 ARG B C   
2652 O O   . ARG B 142 ? 0.5845 0.7357 0.5132 -0.0977 0.0613  0.0814  142 ARG B O   
2653 C CB  . ARG B 142 ? 0.5406 0.6493 0.3937 -0.0741 0.0467  0.0595  142 ARG B CB  
2654 C CG  . ARG B 142 ? 0.5269 0.6479 0.4056 -0.0671 0.0336  0.0411  142 ARG B CG  
2655 C CD  . ARG B 142 ? 0.6355 0.7412 0.4993 -0.0548 0.0127  0.0227  142 ARG B CD  
2656 N NE  . ARG B 142 ? 0.7090 0.8296 0.5931 -0.0462 0.0014  0.0035  142 ARG B NE  
2657 C CZ  . ARG B 142 ? 0.7850 0.9010 0.6599 -0.0338 -0.0156 -0.0150 142 ARG B CZ  
2658 N NH1 . ARG B 142 ? 0.7513 0.8481 0.5979 -0.0286 -0.0233 -0.0167 142 ARG B NH1 
2659 N NH2 . ARG B 142 ? 0.8014 0.9339 0.6950 -0.0264 -0.0248 -0.0316 142 ARG B NH2 
2660 N N   . GLU B 143 ? 0.6978 0.8117 0.5957 -0.1129 0.0588  0.1094  143 GLU B N   
2661 C CA  . GLU B 143 ? 0.7446 0.8587 0.6764 -0.1287 0.0491  0.1217  143 GLU B CA  
2662 C C   . GLU B 143 ? 0.7867 0.9390 0.7476 -0.1343 0.0686  0.1277  143 GLU B C   
2663 O O   . GLU B 143 ? 0.7957 0.9680 0.7490 -0.1371 0.0932  0.1403  143 GLU B O   
2664 C CB  . GLU B 143 ? 0.8577 0.9485 0.7797 -0.1451 0.0455  0.1458  143 GLU B CB  
2665 C CG  . GLU B 143 ? 0.9283 1.0212 0.8854 -0.1648 0.0377  0.1618  143 GLU B CG  
2666 C CD  . GLU B 143 ? 1.0086 1.1029 0.9610 -0.1836 0.0514  0.1915  143 GLU B CD  
2667 O OE1 . GLU B 143 ? 1.0556 1.1224 0.9782 -0.1861 0.0473  0.2016  143 GLU B OE1 
2668 O OE2 . GLU B 143 ? 0.9853 1.1100 0.9636 -0.1958 0.0665  0.2051  143 GLU B OE2 
2669 N N   . ALA B 144 ? 0.7738 0.9368 0.7678 -0.1350 0.0569  0.1183  144 ALA B N   
2670 C CA  . ALA B 144 ? 0.7169 0.9164 0.7424 -0.1400 0.0718  0.1230  144 ALA B CA  
2671 C C   . ALA B 144 ? 0.7373 0.9362 0.8001 -0.1492 0.0511  0.1208  144 ALA B C   
2672 O O   . ALA B 144 ? 0.7501 0.9282 0.8139 -0.1427 0.0274  0.1048  144 ALA B O   
2673 C CB  . ALA B 144 ? 0.6416 0.8656 0.6623 -0.1225 0.0865  0.1058  144 ALA B CB  
2674 N N   . LYS B 145 ? 0.6807 0.9034 0.7741 -0.1641 0.0595  0.1365  145 LYS B N   
2675 C CA  . LYS B 145 ? 0.6816 0.9087 0.8131 -0.1730 0.0413  0.1338  145 LYS B CA  
2676 C C   . LYS B 145 ? 0.7026 0.9739 0.8620 -0.1698 0.0575  0.1308  145 LYS B C   
2677 O O   . LYS B 145 ? 0.8657 1.1651 1.0246 -0.1710 0.0832  0.1425  145 LYS B O   
2678 C CB  . LYS B 145 ? 0.6412 0.8532 0.7884 -0.1974 0.0303  0.1565  145 LYS B CB  
2679 C CG  . LYS B 145 ? 0.8564 1.1031 1.0439 -0.2151 0.0391  0.1728  145 LYS B CG  
2680 C CD  . LYS B 145 ? 0.9238 1.1462 1.1271 -0.2397 0.0191  0.1910  145 LYS B CD  
2681 C CE  . LYS B 145 ? 0.9690 1.2239 1.2146 -0.2608 0.0237  0.2085  145 LYS B CE  
2682 N NZ  . LYS B 145 ? 0.9944 1.2819 1.2423 -0.2736 0.0520  0.2342  145 LYS B NZ  
2683 N N   . VAL B 146 ? 0.5504 0.8279 0.7327 -0.1642 0.0423  0.1141  146 VAL B N   
2684 C CA  . VAL B 146 ? 0.5194 0.8375 0.7305 -0.1612 0.0544  0.1109  146 VAL B CA  
2685 C C   . VAL B 146 ? 0.5235 0.8465 0.7739 -0.1739 0.0346  0.1114  146 VAL B C   
2686 O O   . VAL B 146 ? 0.5189 0.8228 0.7735 -0.1689 0.0104  0.0948  146 VAL B O   
2687 C CB  . VAL B 146 ? 0.5785 0.9066 0.7768 -0.1383 0.0591  0.0878  146 VAL B CB  
2688 C CG1 . VAL B 146 ? 0.5639 0.8987 0.7308 -0.1278 0.0843  0.0903  146 VAL B CG1 
2689 C CG2 . VAL B 146 ? 0.6051 0.9028 0.7889 -0.1284 0.0344  0.0678  146 VAL B CG2 
2690 N N   . GLN B 147 ? 0.5460 0.8962 0.8253 -0.1903 0.0447  0.1302  147 GLN B N   
2691 C CA  . GLN B 147 ? 0.6402 0.9993 0.9592 -0.2037 0.0271  0.1315  147 GLN B CA  
2692 C C   . GLN B 147 ? 0.5262 0.9296 0.8715 -0.1951 0.0389  0.1238  147 GLN B C   
2693 O O   . GLN B 147 ? 0.4726 0.9100 0.8215 -0.1931 0.0649  0.1337  147 GLN B O   
2694 C CB  . GLN B 147 ? 0.7662 1.1261 1.1035 -0.2309 0.0267  0.1585  147 GLN B CB  
2695 C CG  . GLN B 147 ? 0.7908 1.1028 1.1069 -0.2426 0.0094  0.1677  147 GLN B CG  
2696 C CD  . GLN B 147 ? 0.7311 1.0063 1.0547 -0.2447 -0.0261 0.1539  147 GLN B CD  
2697 O OE1 . GLN B 147 ? 0.6381 0.9256 0.9937 -0.2495 -0.0396 0.1473  147 GLN B OE1 
2698 N NE2 . GLN B 147 ? 0.7445 0.9743 1.0379 -0.2405 -0.0418 0.1492  147 GLN B NE2 
2699 N N   . TRP B 148 ? 0.4580 0.8609 0.8206 -0.1888 0.0194  0.1057  148 TRP B N   
2700 C CA  . TRP B 148 ? 0.3877 0.8310 0.7773 -0.1814 0.0270  0.0985  148 TRP B CA  
2701 C C   . TRP B 148 ? 0.4343 0.8932 0.8600 -0.1990 0.0225  0.1108  148 TRP B C   
2702 O O   . TRP B 148 ? 0.5243 0.9671 0.9688 -0.2155 -0.0020 0.1137  148 TRP B O   
2703 C CB  . TRP B 148 ? 0.3433 0.7780 0.7310 -0.1646 0.0087  0.0722  148 TRP B CB  
2704 C CG  . TRP B 148 ? 0.3347 0.7637 0.6881 -0.1422 0.0191  0.0570  148 TRP B CG  
2705 C CD1 . TRP B 148 ? 0.3609 0.7569 0.6840 -0.1316 0.0064  0.0424  148 TRP B CD1 
2706 C CD2 . TRP B 148 ? 0.3705 0.8277 0.7161 -0.1280 0.0438  0.0550  148 TRP B CD2 
2707 N NE1 . TRP B 148 ? 0.2579 0.6608 0.5558 -0.1136 0.0216  0.0323  148 TRP B NE1 
2708 C CE2 . TRP B 148 ? 0.3607 0.7983 0.6709 -0.1111 0.0439  0.0397  148 TRP B CE2 
2709 C CE3 . TRP B 148 ? 0.2561 0.7269 0.6074 -0.1215 0.0628  0.0600  148 TRP B CE3 
2710 C CZ2 . TRP B 148 ? 0.2279 0.6760 0.5185 -0.0942 0.0633  0.0337  148 TRP B CZ2 
2711 C CZ3 . TRP B 148 ? 0.2475 0.7131 0.5723 -0.1007 0.0794  0.0514  148 TRP B CZ3 
2712 C CH2 . TRP B 148 ? 0.2347 0.6864 0.5290 -0.0878 0.0789  0.0394  148 TRP B CH2 
2713 N N   . LYS B 149 ? 0.4325 0.9131 0.8614 -0.1925 0.0444  0.1146  149 LYS B N   
2714 C CA  . LYS B 149 ? 0.5157 1.0092 0.9725 -0.2060 0.0423  0.1237  149 LYS B CA  
2715 C C   . LYS B 149 ? 0.5755 1.0918 1.0454 -0.1898 0.0492  0.1094  149 LYS B C   
2716 O O   . LYS B 149 ? 0.5664 1.0946 1.0228 -0.1744 0.0708  0.1072  149 LYS B O   
2717 C CB  . LYS B 149 ? 0.4886 0.9878 0.9386 -0.2174 0.0612  0.1455  149 LYS B CB  
2718 C CG  . LYS B 149 ? 0.4924 0.9816 0.9608 -0.2447 0.0467  0.1636  149 LYS B CG  
2719 C CD  . LYS B 149 ? 0.4903 0.9979 0.9619 -0.2536 0.0659  0.1814  149 LYS B CD  
2720 C CE  . LYS B 149 ? 0.5006 0.9899 0.9790 -0.2809 0.0531  0.2023  149 LYS B CE  
2721 N NZ  . LYS B 149 ? 0.5279 1.0381 1.0098 -0.2900 0.0714  0.2197  149 LYS B NZ  
2722 N N   . VAL B 150 ? 0.6502 1.1686 1.1444 -0.1932 0.0294  0.0991  150 VAL B N   
2723 C CA  . VAL B 150 ? 0.5310 1.0693 1.0393 -0.1798 0.0336  0.0864  150 VAL B CA  
2724 C C   . VAL B 150 ? 0.5873 1.1449 1.1232 -0.1952 0.0344  0.0976  150 VAL B C   
2725 O O   . VAL B 150 ? 0.5892 1.1396 1.1434 -0.2135 0.0152  0.1021  150 VAL B O   
2726 C CB  . VAL B 150 ? 0.3769 0.9067 0.8920 -0.1703 0.0119  0.0649  150 VAL B CB  
2727 C CG1 . VAL B 150 ? 0.3627 0.9086 0.8852 -0.1530 0.0194  0.0524  150 VAL B CG1 
2728 C CG2 . VAL B 150 ? 0.3499 0.8597 0.8403 -0.1594 0.0055  0.0547  150 VAL B CG2 
2729 N N   . ASP B 151 ? 0.5380 1.1181 1.0759 -0.1876 0.0553  0.1016  151 ASP B N   
2730 C CA  . ASP B 151 ? 0.5802 1.1836 1.1446 -0.2012 0.0578  0.1122  151 ASP B CA  
2731 C C   . ASP B 151 ? 0.7426 1.3401 1.3140 -0.2273 0.0527  0.1332  151 ASP B C   
2732 O O   . ASP B 151 ? 0.8615 1.4599 1.4569 -0.2448 0.0358  0.1371  151 ASP B O   
2733 C CB  . ASP B 151 ? 0.5012 1.1135 1.0923 -0.2017 0.0402  0.0992  151 ASP B CB  
2734 C CG  . ASP B 151 ? 0.4711 1.0955 1.0612 -0.1783 0.0485  0.0831  151 ASP B CG  
2735 O OD1 . ASP B 151 ? 0.4688 1.1059 1.0495 -0.1677 0.0696  0.0874  151 ASP B OD1 
2736 O OD2 . ASP B 151 ? 0.4789 1.0988 1.0769 -0.1706 0.0332  0.0665  151 ASP B OD2 
2737 N N   . ASN B 152 ? 0.8535 1.4409 1.4022 -0.2302 0.0654  0.1461  152 ASN B N   
2738 C CA  . ASN B 152 ? 0.8651 1.4422 1.4165 -0.2548 0.0606  0.1672  152 ASN B CA  
2739 C C   . ASN B 152 ? 0.8817 1.4262 1.4367 -0.2687 0.0317  0.1656  152 ASN B C   
2740 O O   . ASN B 152 ? 0.8522 1.3737 1.3968 -0.2845 0.0258  0.1806  152 ASN B O   
2741 C CB  . ASN B 152 ? 0.8940 1.4984 1.4718 -0.2688 0.0651  0.1792  152 ASN B CB  
2742 C CG  . ASN B 152 ? 0.9527 1.5431 1.5480 -0.2977 0.0451  0.1943  152 ASN B CG  
2743 O OD1 . ASN B 152 ? 0.9751 1.5346 1.5578 -0.3099 0.0335  0.2030  152 ASN B OD1 
2744 N ND2 . ASN B 152 ? 0.9432 1.5546 1.5670 -0.3085 0.0402  0.1973  152 ASN B ND2 
2745 N N   . ALA B 153 ? 0.7643 1.3029 1.3287 -0.2601 0.0137  0.1460  153 ALA B N   
2746 C CA  . ALA B 153 ? 0.7562 1.2631 1.3257 -0.2720 -0.0166 0.1417  153 ALA B CA  
2747 C C   . ALA B 153 ? 0.6753 1.1521 1.2190 -0.2684 -0.0226 0.1404  153 ALA B C   
2748 O O   . ALA B 153 ? 0.5893 1.0729 1.1120 -0.2524 -0.0047 0.1369  153 ALA B O   
2749 C CB  . ALA B 153 ? 0.7021 1.2123 1.2864 -0.2617 -0.0338 0.1189  153 ALA B CB  
2750 N N   . LEU B 154 ? 0.8242 1.2656 1.3689 -0.2830 -0.0493 0.1423  154 LEU B N   
2751 C CA  . LEU B 154 ? 0.7787 1.1867 1.3018 -0.2802 -0.0622 0.1382  154 LEU B CA  
2752 C C   . LEU B 154 ? 0.7484 1.1605 1.2647 -0.2562 -0.0676 0.1120  154 LEU B C   
2753 O O   . LEU B 154 ? 0.7862 1.2173 1.3162 -0.2455 -0.0691 0.0968  154 LEU B O   
2754 C CB  . LEU B 154 ? 0.7951 1.1591 1.3216 -0.2981 -0.0945 0.1412  154 LEU B CB  
2755 C CG  . LEU B 154 ? 0.7341 1.0811 1.2653 -0.3243 -0.0986 0.1659  154 LEU B CG  
2756 C CD1 . LEU B 154 ? 0.6950 1.0337 1.2494 -0.3351 -0.1208 0.1612  154 LEU B CD1 
2757 C CD2 . LEU B 154 ? 0.7359 1.0357 1.2446 -0.3334 -0.1142 0.1742  154 LEU B CD2 
2758 N N   . GLN B 155 ? 0.5651 0.9585 1.0591 -0.2483 -0.0717 0.1068  155 GLN B N   
2759 C CA  . GLN B 155 ? 0.6097 0.9919 1.0960 -0.2297 -0.0895 0.0809  155 GLN B CA  
2760 C C   . GLN B 155 ? 0.6353 0.9795 1.0793 -0.2159 -0.0925 0.0718  155 GLN B C   
2761 O O   . GLN B 155 ? 0.6886 1.0270 1.1094 -0.2170 -0.0742 0.0850  155 GLN B O   
2762 C CB  . GLN B 155 ? 0.5878 1.0054 1.0746 -0.2075 -0.0714 0.0656  155 GLN B CB  
2763 C CG  . GLN B 155 ? 0.6634 1.0731 1.1469 -0.1896 -0.0909 0.0379  155 GLN B CG  
2764 C CD  . GLN B 155 ? 0.7956 1.2298 1.2951 -0.1814 -0.0870 0.0264  155 GLN B CD  
2765 O OE1 . GLN B 155 ? 0.8511 1.3133 1.3561 -0.1762 -0.0634 0.0317  155 GLN B OE1 
2766 N NE2 . GLN B 155 ? 0.7834 1.2046 1.2861 -0.1785 -0.1104 0.0096  155 GLN B NE2 
2767 N N   . SER B 156 ? 0.6869 1.0071 1.1208 -0.2018 -0.1160 0.0480  156 SER B N   
2768 C CA  . SER B 156 ? 0.6476 0.9294 1.0442 -0.1875 -0.1262 0.0350  156 SER B CA  
2769 C C   . SER B 156 ? 0.6497 0.9133 1.0460 -0.1739 -0.1554 0.0084  156 SER B C   
2770 O O   . SER B 156 ? 0.5936 0.8633 1.0179 -0.1805 -0.1729 0.0028  156 SER B O   
2771 C CB  . SER B 156 ? 0.6023 0.8458 0.9845 -0.2033 -0.1331 0.0526  156 SER B CB  
2772 O OG  . SER B 156 ? 0.6318 0.8565 1.0383 -0.2237 -0.1568 0.0603  156 SER B OG  
2773 N N   . GLY B 157 ? 0.7715 1.0134 1.1354 -0.1552 -0.1613 -0.0080 157 GLY B N   
2774 C CA  . GLY B 157 ? 0.7831 1.0141 1.1427 -0.1382 -0.1853 -0.0350 157 GLY B CA  
2775 C C   . GLY B 157 ? 0.6959 0.9640 1.0543 -0.1196 -0.1716 -0.0503 157 GLY B C   
2776 O O   . GLY B 157 ? 0.6270 0.8942 0.9771 -0.1036 -0.1838 -0.0709 157 GLY B O   
2777 N N   . ASN B 158 ? 0.6667 0.9636 1.0238 -0.1202 -0.1418 -0.0379 158 ASN B N   
2778 C CA  . ASN B 158 ? 0.5864 0.9197 0.9449 -0.1056 -0.1261 -0.0477 158 ASN B CA  
2779 C C   . ASN B 158 ? 0.5981 0.9308 0.9213 -0.0903 -0.1088 -0.0523 158 ASN B C   
2780 O O   . ASN B 158 ? 0.6362 0.9700 0.9425 -0.0729 -0.1147 -0.0716 158 ASN B O   
2781 C CB  . ASN B 158 ? 0.5106 0.8791 0.8964 -0.1169 -0.1059 -0.0308 158 ASN B CB  
2782 C CG  . ASN B 158 ? 0.5821 0.9667 0.9983 -0.1222 -0.1191 -0.0349 158 ASN B CG  
2783 O OD1 . ASN B 158 ? 0.6727 1.0466 1.0694 -0.1079 -0.1297 -0.0483 158 ASN B OD1 
2784 N ND2 . ASN B 158 ? 0.6027 1.0000 1.0452 -0.1399 -0.1127 -0.0182 158 ASN B ND2 
2785 N N   . SER B 159 ? 0.4281 0.7581 0.7400 -0.0984 -0.0883 -0.0336 159 SER B N   
2786 C CA  . SER B 159 ? 0.3562 0.6871 0.6365 -0.0885 -0.0673 -0.0321 159 SER B CA  
2787 C C   . SER B 159 ? 0.3835 0.6857 0.6304 -0.0772 -0.0782 -0.0444 159 SER B C   
2788 O O   . SER B 159 ? 0.3947 0.6681 0.6388 -0.0794 -0.1009 -0.0493 159 SER B O   
2789 C CB  . SER B 159 ? 0.3692 0.7009 0.6486 -0.1029 -0.0470 -0.0076 159 SER B CB  
2790 O OG  . SER B 159 ? 0.4702 0.7728 0.7531 -0.1181 -0.0623 0.0030  159 SER B OG  
2791 N N   . GLN B 160 ? 0.3764 0.6864 0.5975 -0.0651 -0.0617 -0.0489 160 GLN B N   
2792 C CA  . GLN B 160 ? 0.4776 0.7652 0.6649 -0.0552 -0.0667 -0.0576 160 GLN B CA  
2793 C C   . GLN B 160 ? 0.4530 0.7446 0.6160 -0.0540 -0.0409 -0.0472 160 GLN B C   
2794 O O   . GLN B 160 ? 0.4154 0.7319 0.5804 -0.0500 -0.0222 -0.0459 160 GLN B O   
2795 C CB  . GLN B 160 ? 0.4991 0.7947 0.6789 -0.0381 -0.0794 -0.0813 160 GLN B CB  
2796 C CG  . GLN B 160 ? 0.5674 0.8551 0.7656 -0.0366 -0.1073 -0.0944 160 GLN B CG  
2797 C CD  . GLN B 160 ? 0.6250 0.9074 0.8035 -0.0181 -0.1140 -0.1116 160 GLN B CD  
2798 O OE1 . GLN B 160 ? 0.6113 0.9027 0.7845 -0.0104 -0.1003 -0.1121 160 GLN B OE1 
2799 N NE2 . GLN B 160 ? 0.6649 0.9181 0.8237 -0.0105 -0.1288 -0.1191 160 GLN B NE2 
2800 N N   . GLU B 161 ? 0.6308 0.6167 0.8101 -0.0104 0.0083  -0.0173 161 GLU B N   
2801 C CA  . GLU B 161 ? 0.5678 0.5495 0.7301 -0.0065 0.0115  -0.0080 161 GLU B CA  
2802 C C   . GLU B 161 ? 0.6357 0.6237 0.7691 -0.0159 0.0101  -0.0119 161 GLU B C   
2803 O O   . GLU B 161 ? 0.5482 0.5505 0.6778 -0.0236 0.0096  -0.0209 161 GLU B O   
2804 C CB  . GLU B 161 ? 0.5936 0.5805 0.7753 0.0064  0.0217  0.0010  161 GLU B CB  
2805 C CG  . GLU B 161 ? 0.6183 0.6036 0.8304 0.0135  0.0244  0.0095  161 GLU B CG  
2806 C CD  . GLU B 161 ? 0.6561 0.6487 0.8836 0.0243  0.0348  0.0218  161 GLU B CD  
2807 O OE1 . GLU B 161 ? 0.7352 0.7315 0.9735 0.0260  0.0380  0.0210  161 GLU B OE1 
2808 O OE2 . GLU B 161 ? 0.6907 0.6868 0.9188 0.0322  0.0393  0.0324  161 GLU B OE2 
2809 N N   . SER B 162 ? 0.5746 0.5544 0.6886 -0.0149 0.0091  -0.0057 162 SER B N   
2810 C CA  . SER B 162 ? 0.5338 0.5212 0.6251 -0.0239 0.0081  -0.0070 162 SER B CA  
2811 C C   . SER B 162 ? 0.4290 0.4088 0.5120 -0.0145 0.0099  -0.0007 162 SER B C   
2812 O O   . SER B 162 ? 0.3407 0.3031 0.4208 -0.0059 0.0071  0.0035  162 SER B O   
2813 C CB  . SER B 162 ? 0.5285 0.5074 0.5920 -0.0422 -0.0029 -0.0080 162 SER B CB  
2814 O OG  . SER B 162 ? 0.5327 0.5259 0.5788 -0.0549 -0.0035 -0.0087 162 SER B OG  
2815 N N   . VAL B 163 ? 0.4028 0.3978 0.4808 -0.0149 0.0138  -0.0013 163 VAL B N   
2816 C CA  . VAL B 163 ? 0.4550 0.4441 0.5210 -0.0064 0.0139  0.0029  163 VAL B CA  
2817 C C   . VAL B 163 ? 0.3770 0.3718 0.4197 -0.0203 0.0076  0.0002  163 VAL B C   
2818 O O   . VAL B 163 ? 0.3937 0.4141 0.4419 -0.0273 0.0110  -0.0029 163 VAL B O   
2819 C CB  . VAL B 163 ? 0.5229 0.5270 0.6097 0.0110  0.0253  0.0079  163 VAL B CB  
2820 C CG1 . VAL B 163 ? 0.6676 0.6689 0.7376 0.0201  0.0248  0.0112  163 VAL B CG1 
2821 C CG2 . VAL B 163 ? 0.4595 0.4599 0.5720 0.0216  0.0313  0.0134  163 VAL B CG2 
2822 N N   . THR B 164 ? 0.4137 0.3854 0.4316 -0.0237 -0.0027 0.0009  164 THR B N   
2823 C CA  . THR B 164 ? 0.4194 0.3930 0.4153 -0.0397 -0.0114 -0.0007 164 THR B CA  
2824 C C   . THR B 164 ? 0.4399 0.4379 0.4421 -0.0306 -0.0048 -0.0014 164 THR B C   
2825 O O   . THR B 164 ? 0.3352 0.3393 0.3516 -0.0103 0.0045  0.0010  164 THR B O   
2826 C CB  . THR B 164 ? 0.5060 0.4414 0.4730 -0.0439 -0.0272 -0.0011 164 THR B CB  
2827 O OG1 . THR B 164 ? 0.5123 0.4357 0.4784 -0.0203 -0.0250 -0.0027 164 THR B OG1 
2828 C CG2 . THR B 164 ? 0.4545 0.3639 0.4128 -0.0535 -0.0366 0.0010  164 THR B CG2 
2829 N N   . GLU B 165 ? 0.5173 0.5317 0.5092 -0.0468 -0.0101 -0.0032 165 GLU B N   
2830 C CA  . GLU B 165 ? 0.4896 0.5288 0.4855 -0.0393 -0.0066 -0.0041 165 GLU B CA  
2831 C C   . GLU B 165 ? 0.4936 0.5099 0.4718 -0.0262 -0.0124 -0.0048 165 GLU B C   
2832 O O   . GLU B 165 ? 0.5331 0.5147 0.4929 -0.0275 -0.0222 -0.0064 165 GLU B O   
2833 C CB  . GLU B 165 ? 0.6704 0.7362 0.6601 -0.0616 -0.0126 -0.0060 165 GLU B CB  
2834 C CG  . GLU B 165 ? 0.7739 0.8759 0.7749 -0.0527 -0.0076 -0.0075 165 GLU B CG  
2835 C CD  . GLU B 165 ? 0.9744 1.1104 0.9732 -0.0755 -0.0131 -0.0093 165 GLU B CD  
2836 O OE1 . GLU B 165 ? 0.9468 1.1025 0.9525 -0.0902 -0.0103 -0.0097 165 GLU B OE1 
2837 O OE2 . GLU B 165 ? 1.0159 1.1622 1.0062 -0.0789 -0.0205 -0.0105 165 GLU B OE2 
2838 N N   . GLN B 166 ? 0.4602 0.4967 0.4434 -0.0117 -0.0071 -0.0042 166 GLN B N   
2839 C CA  . GLN B 166 ? 0.3991 0.4212 0.3654 0.0046  -0.0106 -0.0058 166 GLN B CA  
2840 C C   . GLN B 166 ? 0.4966 0.4923 0.4321 -0.0087 -0.0291 -0.0133 166 GLN B C   
2841 O O   . GLN B 166 ? 0.4018 0.4066 0.3305 -0.0302 -0.0386 -0.0154 166 GLN B O   
2842 C CB  . GLN B 166 ? 0.3426 0.3957 0.3169 0.0189  -0.0034 -0.0028 166 GLN B CB  
2843 C CG  . GLN B 166 ? 0.3469 0.3963 0.3181 0.0444  0.0038  0.0015  166 GLN B CG  
2844 C CD  . GLN B 166 ? 0.3400 0.4204 0.3194 0.0579  0.0107  0.0078  166 GLN B CD  
2845 O OE1 . GLN B 166 ? 0.3828 0.4861 0.3840 0.0558  0.0165  0.0122  166 GLN B OE1 
2846 N NE2 . GLN B 166 ? 0.3577 0.4395 0.3188 0.0738  0.0095  0.0078  166 GLN B NE2 
2847 N N   . ASP B 167 ? 0.6545 0.6183 0.5722 0.0046  -0.0350 -0.0176 167 ASP B N   
2848 C CA  . ASP B 167 ? 0.7235 0.6523 0.6104 -0.0051 -0.0556 -0.0266 167 ASP B CA  
2849 C C   . ASP B 167 ? 0.6994 0.6420 0.5727 -0.0085 -0.0641 -0.0323 167 ASP B C   
2850 O O   . ASP B 167 ? 0.5998 0.5693 0.4785 0.0100  -0.0545 -0.0316 167 ASP B O   
2851 C CB  . ASP B 167 ? 0.8162 0.7119 0.6877 0.0170  -0.0598 -0.0330 167 ASP B CB  
2852 C CG  . ASP B 167 ? 0.9268 0.7751 0.7671 0.0066  -0.0843 -0.0431 167 ASP B CG  
2853 O OD1 . ASP B 167 ? 0.8990 0.7196 0.7362 -0.0095 -0.0935 -0.0401 167 ASP B OD1 
2854 O OD2 . ASP B 167 ? 1.0483 0.8853 0.8661 0.0136  -0.0960 -0.0538 167 ASP B OD2 
2855 N N   . SER B 168 ? 0.7823 0.7067 0.6380 -0.0338 -0.0833 -0.0367 168 SER B N   
2856 C CA  . SER B 168 ? 0.8390 0.7751 0.6818 -0.0425 -0.0954 -0.0430 168 SER B CA  
2857 C C   . SER B 168 ? 1.0382 0.9622 0.8599 -0.0157 -0.1002 -0.0541 168 SER B C   
2858 O O   . SER B 168 ? 1.1768 1.1349 1.0036 -0.0004 -0.0914 -0.0538 168 SER B O   
2859 C CB  . SER B 168 ? 0.7427 0.6511 0.5684 -0.0765 -0.1184 -0.0448 168 SER B CB  
2860 O OG  . SER B 168 ? 0.7902 0.6424 0.5956 -0.0755 -0.1318 -0.0489 168 SER B OG  
2861 N N   . LYS B 169 ? 0.9567 0.8325 0.7535 -0.0086 -0.1147 -0.0643 169 LYS B N   
2862 C CA  . LYS B 169 ? 0.8695 0.7317 0.6417 0.0184  -0.1212 -0.0785 169 LYS B CA  
2863 C C   . LYS B 169 ? 0.8806 0.7658 0.6645 0.0525  -0.0982 -0.0741 169 LYS B C   
2864 O O   . LYS B 169 ? 0.8849 0.8031 0.6689 0.0708  -0.0882 -0.0734 169 LYS B O   
2865 C CB  . LYS B 169 ? 0.8811 0.6819 0.6232 0.0172  -0.1458 -0.0928 169 LYS B CB  
2866 C CG  . LYS B 169 ? 0.9170 0.6871 0.6517 -0.0219 -0.1680 -0.0907 169 LYS B CG  
2867 C CD  . LYS B 169 ? 1.0390 0.7440 0.7522 -0.0220 -0.1881 -0.0980 169 LYS B CD  
2868 C CE  . LYS B 169 ? 1.0874 0.7914 0.8158 -0.0028 -0.1712 -0.0910 169 LYS B CE  
2869 N NZ  . LYS B 169 ? 1.0780 0.8200 0.8383 -0.0205 -0.1514 -0.0718 169 LYS B NZ  
2870 N N   . ASP B 170 ? 0.7936 0.6620 0.5871 0.0595  -0.0911 -0.0699 170 ASP B N   
2871 C CA  . ASP B 170 ? 0.7891 0.6751 0.5948 0.0890  -0.0716 -0.0653 170 ASP B CA  
2872 C C   . ASP B 170 ? 0.6405 0.5765 0.4756 0.0948  -0.0476 -0.0488 170 ASP B C   
2873 O O   . ASP B 170 ? 0.5297 0.4888 0.3683 0.1195  -0.0332 -0.0445 170 ASP B O   
2874 C CB  . ASP B 170 ? 0.9527 0.8116 0.7670 0.0879  -0.0719 -0.0630 170 ASP B CB  
2875 C CG  . ASP B 170 ? 1.1478 1.0265 0.9780 0.1153  -0.0532 -0.0577 170 ASP B CG  
2876 O OD1 . ASP B 170 ? 1.2588 1.1592 1.0810 0.1401  -0.0451 -0.0610 170 ASP B OD1 
2877 O OD2 . ASP B 170 ? 1.2104 1.0851 1.0608 0.1110  -0.0470 -0.0498 170 ASP B OD2 
2878 N N   . SER B 171 ? 0.7403 0.6929 0.5958 0.0723  -0.0441 -0.0394 171 SER B N   
2879 C CA  . SER B 171 ? 0.6222 0.6153 0.5070 0.0760  -0.0248 -0.0246 171 SER B CA  
2880 C C   . SER B 171 ? 0.5312 0.5295 0.4415 0.0866  -0.0079 -0.0135 171 SER B C   
2881 O O   . SER B 171 ? 0.4713 0.4976 0.4019 0.0972  0.0076  -0.0012 171 SER B O   
2882 C CB  . SER B 171 ? 0.5805 0.6025 0.4575 0.0941  -0.0198 -0.0228 171 SER B CB  
2883 O OG  . SER B 171 ? 0.5252 0.5537 0.3883 0.0810  -0.0337 -0.0302 171 SER B OG  
2884 N N   . THR B 172 ? 0.5545 0.5251 0.4648 0.0820  -0.0124 -0.0168 172 THR B N   
2885 C CA  . THR B 172 ? 0.5496 0.5255 0.4851 0.0899  0.0013  -0.0074 172 THR B CA  
2886 C C   . THR B 172 ? 0.4616 0.4284 0.4140 0.0684  -0.0005 -0.0046 172 THR B C   
2887 O O   . THR B 172 ? 0.4721 0.4236 0.4121 0.0481  -0.0134 -0.0103 172 THR B O   
2888 C CB  . THR B 172 ? 0.6160 0.5744 0.5402 0.1088  -0.0008 -0.0134 172 THR B CB  
2889 O OG1 . THR B 172 ? 0.6085 0.5269 0.5129 0.0982  -0.0196 -0.0250 172 THR B OG1 
2890 C CG2 . THR B 172 ? 0.7083 0.6801 0.6131 0.1329  0.0018  -0.0180 172 THR B CG2 
2891 N N   . TYR B 173 ? 0.4644 0.4427 0.4449 0.0718  0.0121  0.0047  173 TYR B N   
2892 C CA  . TYR B 173 ? 0.4509 0.4226 0.4464 0.0541  0.0105  0.0058  173 TYR B CA  
2893 C C   . TYR B 173 ? 0.4459 0.3929 0.4392 0.0553  0.0046  0.0032  173 TYR B C   
2894 O O   . TYR B 173 ? 0.4766 0.4140 0.4603 0.0724  0.0031  0.0004  173 TYR B O   
2895 C CB  . TYR B 173 ? 0.4039 0.4003 0.4323 0.0555  0.0247  0.0153  173 TYR B CB  
2896 C CG  . TYR B 173 ? 0.4512 0.4709 0.4850 0.0525  0.0282  0.0172  173 TYR B CG  
2897 C CD1 . TYR B 173 ? 0.3621 0.4018 0.4095 0.0676  0.0389  0.0269  173 TYR B CD1 
2898 C CD2 . TYR B 173 ? 0.5682 0.5923 0.5941 0.0345  0.0205  0.0105  173 TYR B CD2 
2899 C CE1 . TYR B 173 ? 0.5397 0.6002 0.5923 0.0673  0.0405  0.0286  173 TYR B CE1 
2900 C CE2 . TYR B 173 ? 0.5986 0.6490 0.6317 0.0339  0.0234  0.0113  173 TYR B CE2 
2901 C CZ  . TYR B 173 ? 0.5595 0.6264 0.6058 0.0515  0.0327  0.0197  173 TYR B CZ  
2902 O OH  . TYR B 173 ? 0.5712 0.6637 0.6250 0.0532  0.0340  0.0204  173 TYR B OH  
2903 N N   . SER B 174 ? 0.5179 0.4575 0.5196 0.0389  0.0011  0.0035  174 SER B N   
2904 C CA  . SER B 174 ? 0.4721 0.3926 0.4766 0.0401  -0.0041 0.0030  174 SER B CA  
2905 C C   . SER B 174 ? 0.4379 0.3704 0.4672 0.0291  0.0015  0.0069  174 SER B C   
2906 O O   . SER B 174 ? 0.3668 0.3082 0.3964 0.0128  0.0010  0.0058  174 SER B O   
2907 C CB  . SER B 174 ? 0.4073 0.2922 0.3813 0.0291  -0.0234 -0.0036 174 SER B CB  
2908 O OG  . SER B 174 ? 0.4343 0.3005 0.3884 0.0465  -0.0307 -0.0100 174 SER B OG  
2909 N N   . LEU B 175 ? 0.4001 0.3352 0.4501 0.0384  0.0063  0.0105  175 LEU B N   
2910 C CA  . LEU B 175 ? 0.4253 0.3701 0.4997 0.0297  0.0101  0.0124  175 LEU B CA  
2911 C C   . LEU B 175 ? 0.4671 0.3949 0.5405 0.0270  0.0003  0.0106  175 LEU B C   
2912 O O   . LEU B 175 ? 0.5219 0.4409 0.5933 0.0405  -0.0029 0.0111  175 LEU B O   
2913 C CB  . LEU B 175 ? 0.3556 0.3230 0.4626 0.0408  0.0243  0.0202  175 LEU B CB  
2914 C CG  . LEU B 175 ? 0.3251 0.3008 0.4627 0.0353  0.0278  0.0220  175 LEU B CG  
2915 C CD1 . LEU B 175 ? 0.3127 0.3058 0.4748 0.0421  0.0395  0.0303  175 LEU B CD1 
2916 C CD2 . LEU B 175 ? 0.3258 0.2975 0.4779 0.0392  0.0247  0.0240  175 LEU B CD2 
2917 N N   . SER B 176 ? 0.3541 0.2800 0.4283 0.0111  -0.0049 0.0080  176 SER B N   
2918 C CA  . SER B 176 ? 0.4693 0.3825 0.5449 0.0087  -0.0144 0.0072  176 SER B CA  
2919 C C   . SER B 176 ? 0.3780 0.3070 0.4790 0.0021  -0.0105 0.0057  176 SER B C   
2920 O O   . SER B 176 ? 0.3418 0.2784 0.4384 -0.0114 -0.0107 0.0013  176 SER B O   
2921 C CB  . SER B 176 ? 0.5812 0.4692 0.6232 -0.0056 -0.0303 0.0055  176 SER B CB  
2922 O OG  . SER B 176 ? 0.6403 0.5356 0.6789 -0.0242 -0.0331 0.0041  176 SER B OG  
2923 N N   . SER B 177 ? 0.3781 0.3142 0.5060 0.0119  -0.0076 0.0085  177 SER B N   
2924 C CA  . SER B 177 ? 0.4337 0.3805 0.5870 0.0061  -0.0072 0.0059  177 SER B CA  
2925 C C   . SER B 177 ? 0.4732 0.4094 0.6195 0.0006  -0.0208 0.0029  177 SER B C   
2926 O O   . SER B 177 ? 0.3425 0.2698 0.4856 0.0097  -0.0272 0.0061  177 SER B O   
2927 C CB  . SER B 177 ? 0.5299 0.4923 0.7201 0.0165  0.0026  0.0126  177 SER B CB  
2928 O OG  . SER B 177 ? 0.5572 0.5263 0.7729 0.0093  0.0014  0.0090  177 SER B OG  
2929 N N   . THR B 178 ? 0.4591 0.3978 0.6015 -0.0125 -0.0260 -0.0039 178 THR B N   
2930 C CA  . THR B 178 ? 0.4236 0.3541 0.5563 -0.0187 -0.0398 -0.0062 178 THR B CA  
2931 C C   . THR B 178 ? 0.4173 0.3607 0.5809 -0.0191 -0.0412 -0.0114 178 THR B C   
2932 O O   . THR B 178 ? 0.4066 0.3616 0.5891 -0.0211 -0.0341 -0.0168 178 THR B O   
2933 C CB  . THR B 178 ? 0.4028 0.3280 0.5011 -0.0352 -0.0470 -0.0093 178 THR B CB  
2934 O OG1 . THR B 178 ? 0.4055 0.3158 0.4764 -0.0376 -0.0484 -0.0035 178 THR B OG1 
2935 C CG2 . THR B 178 ? 0.4011 0.3179 0.4866 -0.0417 -0.0623 -0.0095 178 THR B CG2 
2936 N N   . LEU B 179 ? 0.4185 0.3585 0.5877 -0.0166 -0.0522 -0.0101 179 LEU B N   
2937 C CA  . LEU B 179 ? 0.4444 0.3963 0.6424 -0.0187 -0.0569 -0.0155 179 LEU B CA  
2938 C C   . LEU B 179 ? 0.6189 0.5655 0.7958 -0.0272 -0.0728 -0.0207 179 LEU B C   
2939 O O   . LEU B 179 ? 0.7677 0.7045 0.9329 -0.0228 -0.0836 -0.0151 179 LEU B O   
2940 C CB  . LEU B 179 ? 0.4129 0.3748 0.6448 -0.0071 -0.0550 -0.0079 179 LEU B CB  
2941 C CG  . LEU B 179 ? 0.4529 0.4296 0.7217 -0.0098 -0.0611 -0.0105 179 LEU B CG  
2942 C CD1 . LEU B 179 ? 0.4285 0.4113 0.7236 -0.0165 -0.0539 -0.0149 179 LEU B CD1 
2943 C CD2 . LEU B 179 ? 0.3045 0.2959 0.5996 0.0023  -0.0598 -0.0004 179 LEU B CD2 
2944 N N   . THR B 180 ? 0.5836 0.5374 0.7548 -0.0377 -0.0752 -0.0317 180 THR B N   
2945 C CA  . THR B 180 ? 0.5912 0.5438 0.7379 -0.0466 -0.0897 -0.0362 180 THR B CA  
2946 C C   . THR B 180 ? 0.5295 0.4933 0.7013 -0.0476 -0.0989 -0.0465 180 THR B C   
2947 O O   . THR B 180 ? 0.5056 0.4786 0.6950 -0.0499 -0.0951 -0.0586 180 THR B O   
2948 C CB  . THR B 180 ? 0.6276 0.5855 0.7408 -0.0586 -0.0873 -0.0418 180 THR B CB  
2949 O OG1 . THR B 180 ? 0.6780 0.6251 0.7675 -0.0608 -0.0816 -0.0314 180 THR B OG1 
2950 C CG2 . THR B 180 ? 0.6196 0.5799 0.7057 -0.0683 -0.1022 -0.0443 180 THR B CG2 
2951 N N   . LEU B 181 ? 0.5598 0.5213 0.7333 -0.0450 -0.1128 -0.0422 181 LEU B N   
2952 C CA  . LEU B 181 ? 0.5370 0.5101 0.7351 -0.0464 -0.1245 -0.0511 181 LEU B CA  
2953 C C   . LEU B 181 ? 0.5374 0.5097 0.7047 -0.0523 -0.1422 -0.0534 181 LEU B C   
2954 O O   . LEU B 181 ? 0.5552 0.5142 0.6897 -0.0524 -0.1476 -0.0426 181 LEU B O   
2955 C CB  . LEU B 181 ? 0.4644 0.4444 0.7025 -0.0367 -0.1255 -0.0430 181 LEU B CB  
2956 C CG  . LEU B 181 ? 0.4296 0.4196 0.7119 -0.0346 -0.1130 -0.0418 181 LEU B CG  
2957 C CD1 . LEU B 181 ? 0.4583 0.4408 0.7324 -0.0329 -0.0951 -0.0385 181 LEU B CD1 
2958 C CD2 . LEU B 181 ? 0.4007 0.4043 0.7156 -0.0249 -0.1131 -0.0299 181 LEU B CD2 
2959 N N   . SER B 182 ? 0.6691 0.6535 0.8456 -0.0575 -0.1526 -0.0674 182 SER B N   
2960 C CA  . SER B 182 ? 0.7050 0.6924 0.8545 -0.0622 -0.1710 -0.0697 182 SER B CA  
2961 C C   . SER B 182 ? 0.8208 0.8012 0.9742 -0.0537 -0.1827 -0.0552 182 SER B C   
2962 O O   . SER B 182 ? 0.8142 0.7990 1.0055 -0.0444 -0.1799 -0.0507 182 SER B O   
2963 C CB  . SER B 182 ? 0.6663 0.6692 0.8326 -0.0667 -0.1820 -0.0890 182 SER B CB  
2964 O OG  . SER B 182 ? 0.6135 0.6220 0.8301 -0.0625 -0.1843 -0.0907 182 SER B OG  
2965 N N   . LYS B 183 ? 0.8474 0.8181 0.9614 -0.0562 -0.1959 -0.0471 183 LYS B N   
2966 C CA  . LYS B 183 ? 0.8264 0.7868 0.9396 -0.0456 -0.2105 -0.0342 183 LYS B CA  
2967 C C   . LYS B 183 ? 0.7141 0.6945 0.8688 -0.0383 -0.2220 -0.0402 183 LYS B C   
2968 O O   . LYS B 183 ? 0.5653 0.5463 0.7392 -0.0247 -0.2280 -0.0318 183 LYS B O   
2969 C CB  . LYS B 183 ? 0.8892 0.8352 0.9520 -0.0521 -0.2267 -0.0249 183 LYS B CB  
2970 C CG  . LYS B 183 ? 0.9068 0.8375 0.9655 -0.0390 -0.2454 -0.0118 183 LYS B CG  
2971 C CD  . LYS B 183 ? 0.9502 0.8589 0.9548 -0.0475 -0.2604 0.0016  183 LYS B CD  
2972 C CE  . LYS B 183 ? 0.9635 0.8514 0.9606 -0.0328 -0.2825 0.0148  183 LYS B CE  
2973 N NZ  . LYS B 183 ? 0.9242 0.8347 0.9395 -0.0266 -0.3006 0.0085  183 LYS B NZ  
2974 N N   . ALA B 184 ? 0.7527 0.7515 0.9228 -0.0470 -0.2257 -0.0560 184 ALA B N   
2975 C CA  . ALA B 184 ? 0.7821 0.8018 0.9932 -0.0442 -0.2385 -0.0627 184 ALA B CA  
2976 C C   . ALA B 184 ? 0.7981 0.8290 1.0622 -0.0386 -0.2251 -0.0601 184 ALA B C   
2977 O O   . ALA B 184 ? 0.8922 0.9336 1.1818 -0.0272 -0.2286 -0.0505 184 ALA B O   
2978 C CB  . ALA B 184 ? 0.8007 0.8329 1.0105 -0.0559 -0.2479 -0.0823 184 ALA B CB  
2979 N N   . ASP B 185 ? 0.7844 0.8147 1.0642 -0.0459 -0.2100 -0.0680 185 ASP B N   
2980 C CA  . ASP B 185 ? 0.7875 0.8283 1.1163 -0.0439 -0.1967 -0.0637 185 ASP B CA  
2981 C C   . ASP B 185 ? 0.7513 0.7907 1.0839 -0.0300 -0.1846 -0.0464 185 ASP B C   
2982 O O   . ASP B 185 ? 0.7845 0.8435 1.1586 -0.0243 -0.1794 -0.0387 185 ASP B O   
2983 C CB  . ASP B 185 ? 0.8874 0.9192 1.2208 -0.0524 -0.1828 -0.0731 185 ASP B CB  
2984 C CG  . ASP B 185 ? 1.0502 1.0927 1.4375 -0.0556 -0.1752 -0.0700 185 ASP B CG  
2985 O OD1 . ASP B 185 ? 1.1748 1.2335 1.5925 -0.0494 -0.1712 -0.0557 185 ASP B OD1 
2986 O OD2 . ASP B 185 ? 1.0814 1.1152 1.4732 -0.0623 -0.1709 -0.0804 185 ASP B OD2 
2987 N N   . TYR B 186 ? 0.6762 0.6942 0.9651 -0.0248 -0.1807 -0.0404 186 TYR B N   
2988 C CA  . TYR B 186 ? 0.5712 0.5833 0.8569 -0.0096 -0.1730 -0.0271 186 TYR B CA  
2989 C C   . TYR B 186 ? 0.6770 0.7055 0.9832 0.0044  -0.1864 -0.0215 186 TYR B C   
2990 O O   . TYR B 186 ? 0.7231 0.7678 1.0578 0.0175  -0.1778 -0.0142 186 TYR B O   
2991 C CB  . TYR B 186 ? 0.5189 0.5008 0.7513 -0.0092 -0.1730 -0.0226 186 TYR B CB  
2992 C CG  . TYR B 186 ? 0.5528 0.5223 0.7767 0.0081  -0.1713 -0.0116 186 TYR B CG  
2993 C CD1 . TYR B 186 ? 0.4560 0.4288 0.6954 0.0164  -0.1528 -0.0075 186 TYR B CD1 
2994 C CD2 . TYR B 186 ? 0.6040 0.5573 0.8032 0.0177  -0.1895 -0.0061 186 TYR B CD2 
2995 C CE1 . TYR B 186 ? 0.4644 0.4264 0.6944 0.0345  -0.1521 -0.0008 186 TYR B CE1 
2996 C CE2 . TYR B 186 ? 0.5985 0.5367 0.7893 0.0362  -0.1902 0.0010  186 TYR B CE2 
2997 C CZ  . TYR B 186 ? 0.5641 0.5075 0.7700 0.0450  -0.1713 0.0023  186 TYR B CZ  
2998 O OH  . TYR B 186 ? 0.5080 0.4369 0.7037 0.0656  -0.1727 0.0062  186 TYR B OH  
2999 N N   . GLU B 187 ? 0.7052 0.7332 0.9969 0.0028  -0.2076 -0.0249 187 GLU B N   
3000 C CA  . GLU B 187 ? 0.6781 0.7220 0.9867 0.0181  -0.2232 -0.0200 187 GLU B CA  
3001 C C   . GLU B 187 ? 0.6342 0.7199 1.0028 0.0175  -0.2239 -0.0225 187 GLU B C   
3002 O O   . GLU B 187 ? 0.6194 0.7280 1.0122 0.0331  -0.2312 -0.0173 187 GLU B O   
3003 C CB  . GLU B 187 ? 0.7203 0.7514 0.9939 0.0163  -0.2476 -0.0214 187 GLU B CB  
3004 C CG  . GLU B 187 ? 0.7437 0.7353 0.9582 0.0143  -0.2504 -0.0151 187 GLU B CG  
3005 C CD  . GLU B 187 ? 0.7875 0.7661 0.9713 0.0197  -0.2763 -0.0094 187 GLU B CD  
3006 O OE1 . GLU B 187 ? 0.7075 0.7084 0.9067 0.0179  -0.2924 -0.0148 187 GLU B OE1 
3007 O OE2 . GLU B 187 ? 0.8826 0.8272 1.0265 0.0251  -0.2821 0.0012  187 GLU B OE2 
3008 N N   . LYS B 188 ? 0.7047 0.8011 1.0985 -0.0001 -0.2175 -0.0300 188 LYS B N   
3009 C CA  . LYS B 188 ? 0.7389 0.8731 1.1898 -0.0055 -0.2221 -0.0313 188 LYS B CA  
3010 C C   . LYS B 188 ? 0.7811 0.9386 1.2744 -0.0016 -0.2014 -0.0203 188 LYS B C   
3011 O O   . LYS B 188 ? 0.8562 1.0442 1.3931 -0.0088 -0.1999 -0.0176 188 LYS B O   
3012 C CB  . LYS B 188 ? 0.6374 0.7695 1.0965 -0.0271 -0.2311 -0.0460 188 LYS B CB  
3013 C CG  . LYS B 188 ? 0.5872 0.7054 1.0533 -0.0401 -0.2135 -0.0500 188 LYS B CG  
3014 C CD  . LYS B 188 ? 0.5996 0.7094 1.0609 -0.0547 -0.2190 -0.0648 188 LYS B CD  
3015 C CE  . LYS B 188 ? 0.5927 0.6837 1.0566 -0.0634 -0.2030 -0.0689 188 LYS B CE  
3016 N NZ  . LYS B 188 ? 0.5708 0.6738 1.0759 -0.0650 -0.1875 -0.0540 188 LYS B NZ  
3017 N N   . HIS B 189 ? 0.6551 0.7958 1.1268 0.0087  -0.1831 -0.0131 189 HIS B N   
3018 C CA  . HIS B 189 ? 0.6015 0.7660 1.1054 0.0160  -0.1625 -0.0012 189 HIS B CA  
3019 C C   . HIS B 189 ? 0.5287 0.7023 1.0231 0.0429  -0.1586 0.0062  189 HIS B C   
3020 O O   . HIS B 189 ? 0.5002 0.6553 0.9622 0.0558  -0.1731 0.0028  189 HIS B O   
3021 C CB  . HIS B 189 ? 0.6189 0.7611 1.1108 0.0071  -0.1427 0.0006  189 HIS B CB  
3022 C CG  . HIS B 189 ? 0.6991 0.8253 1.1934 -0.0146 -0.1462 -0.0092 189 HIS B CG  
3023 N ND1 . HIS B 189 ? 0.7217 0.8320 1.2150 -0.0233 -0.1309 -0.0084 189 HIS B ND1 
3024 C CD2 . HIS B 189 ? 0.6752 0.7979 1.1717 -0.0277 -0.1642 -0.0219 189 HIS B CD2 
3025 C CE1 . HIS B 189 ? 0.6894 0.7862 1.1842 -0.0386 -0.1393 -0.0205 189 HIS B CE1 
3026 N NE2 . HIS B 189 ? 0.6905 0.7949 1.1873 -0.0424 -0.1601 -0.0301 189 HIS B NE2 
3027 N N   . LYS B 190 ? 0.5890 0.7897 1.1094 0.0521  -0.1397 0.0162  190 LYS B N   
3028 C CA  . LYS B 190 ? 0.5762 0.7927 1.0917 0.0806  -0.1356 0.0203  190 LYS B CA  
3029 C C   . LYS B 190 ? 0.4972 0.6912 0.9820 0.0931  -0.1184 0.0230  190 LYS B C   
3030 O O   . LYS B 190 ? 0.5375 0.6973 0.9794 0.1082  -0.1258 0.0181  190 LYS B O   
3031 C CB  . LYS B 190 ? 0.6219 0.8934 1.1746 0.0836  -0.1249 0.0278  190 LYS B CB  
3032 C CG  . LYS B 190 ? 0.6389 0.9361 1.1853 0.1105  -0.1099 0.0322  190 LYS B CG  
3033 C CD  . LYS B 190 ? 0.7152 1.0014 1.2337 0.1386  -0.1246 0.0249  190 LYS B CD  
3034 C CE  . LYS B 190 ? 0.7517 1.0945 1.2918 0.1588  -0.1186 0.0278  190 LYS B CE  
3035 N NZ  . LYS B 190 ? 0.7621 1.1400 1.3126 0.1651  -0.0932 0.0343  190 LYS B NZ  
3036 N N   . VAL B 191 ? 0.4279 0.7559 0.7825 0.0697  0.1312  -0.0186 191 VAL B N   
3037 C CA  . VAL B 191 ? 0.4295 0.7620 0.7778 0.0488  0.1374  0.0035  191 VAL B CA  
3038 C C   . VAL B 191 ? 0.4116 0.7151 0.7716 0.0419  0.1360  0.0312  191 VAL B C   
3039 O O   . VAL B 191 ? 0.4172 0.7113 0.8081 0.0412  0.1309  0.0382  191 VAL B O   
3040 C CB  . VAL B 191 ? 0.4954 0.8683 0.8606 0.0183  0.1381  0.0118  191 VAL B CB  
3041 C CG1 . VAL B 191 ? 0.5593 0.9248 0.9110 -0.0055 0.1392  0.0373  191 VAL B CG1 
3042 C CG2 . VAL B 191 ? 0.4812 0.8781 0.8327 0.0256  0.1425  -0.0148 191 VAL B CG2 
3043 N N   . TYR B 192 ? 0.4165 0.7058 0.7519 0.0385  0.1396  0.0469  192 TYR B N   
3044 C CA  . TYR B 192 ? 0.3981 0.6652 0.7409 0.0309  0.1374  0.0747  192 TYR B CA  
3045 C C   . TYR B 192 ? 0.4402 0.7108 0.7714 0.0022  0.1352  0.0971  192 TYR B C   
3046 O O   . TYR B 192 ? 0.4922 0.7617 0.7934 -0.0004 0.1383  0.0995  192 TYR B O   
3047 C CB  . TYR B 192 ? 0.3741 0.6155 0.6937 0.0538  0.1396  0.0746  192 TYR B CB  
3048 C CG  . TYR B 192 ? 0.4430 0.6702 0.7620 0.0804  0.1351  0.0507  192 TYR B CG  
3049 C CD1 . TYR B 192 ? 0.4635 0.6735 0.7974 0.0901  0.1305  0.0577  192 TYR B CD1 
3050 C CD2 . TYR B 192 ? 0.5475 0.7775 0.8452 0.0954  0.1322  0.0190  192 TYR B CD2 
3051 C CE1 . TYR B 192 ? 0.5711 0.7657 0.8941 0.1122  0.1221  0.0335  192 TYR B CE1 
3052 C CE2 . TYR B 192 ? 0.6391 0.8537 0.9266 0.1160  0.1224  -0.0040 192 TYR B CE2 
3053 C CZ  . TYR B 192 ? 0.6699 0.8666 0.9684 0.1236  0.1172  0.0033  192 TYR B CZ  
3054 O OH  . TYR B 192 ? 0.7001 0.8831 0.9816 0.1430  0.1047  -0.0199 192 TYR B OH  
3055 N N   . ALA B 193 ? 0.4185 0.6880 0.7689 -0.0178 0.1277  0.1120  193 ALA B N   
3056 C CA  . ALA B 193 ? 0.3984 0.6664 0.7303 -0.0439 0.1217  0.1253  193 ALA B CA  
3057 C C   . ALA B 193 ? 0.4081 0.6500 0.7381 -0.0488 0.1137  0.1476  193 ALA B C   
3058 O O   . ALA B 193 ? 0.3946 0.6272 0.7512 -0.0400 0.1111  0.1560  193 ALA B O   
3059 C CB  . ALA B 193 ? 0.4551 0.7445 0.8007 -0.0636 0.1178  0.1193  193 ALA B CB  
3060 N N   . CYS B 194 ? 0.3897 0.6214 0.6900 -0.0606 0.1097  0.1556  194 CYS B N   
3061 C CA  . CYS B 194 ? 0.3818 0.5938 0.6776 -0.0648 0.1007  0.1726  194 CYS B CA  
3062 C C   . CYS B 194 ? 0.3832 0.5943 0.6679 -0.0862 0.0940  0.1742  194 CYS B C   
3063 O O   . CYS B 194 ? 0.4311 0.6433 0.6906 -0.0957 0.0954  0.1694  194 CYS B O   
3064 C CB  . CYS B 194 ? 0.3685 0.5674 0.6397 -0.0571 0.1002  0.1793  194 CYS B CB  
3065 S SG  . CYS B 194 ? 0.9477 1.1309 1.2131 -0.0607 0.0889  0.1961  194 CYS B SG  
3066 N N   . GLU B 195 ? 0.4555 0.6637 0.7604 -0.0922 0.0874  0.1820  195 GLU B N   
3067 C CA  . GLU B 195 ? 0.5158 0.7224 0.8119 -0.1108 0.0819  0.1842  195 GLU B CA  
3068 C C   . GLU B 195 ? 0.6937 0.8859 0.9840 -0.1095 0.0736  0.1999  195 GLU B C   
3069 O O   . GLU B 195 ? 0.7798 0.9637 1.0863 -0.1002 0.0693  0.2090  195 GLU B O   
3070 C CB  . GLU B 195 ? 0.5455 0.7597 0.8686 -0.1200 0.0779  0.1856  195 GLU B CB  
3071 C CG  . GLU B 195 ? 0.6398 0.8538 0.9555 -0.1391 0.0729  0.1887  195 GLU B CG  
3072 C CD  . GLU B 195 ? 0.7675 0.9900 1.1079 -0.1508 0.0682  0.1896  195 GLU B CD  
3073 O OE1 . GLU B 195 ? 0.7299 0.9683 1.0863 -0.1496 0.0719  0.1803  195 GLU B OE1 
3074 O OE2 . GLU B 195 ? 0.8604 1.0753 1.2065 -0.1613 0.0594  0.2010  195 GLU B OE2 
3075 N N   . VAL B 196 ? 0.6736 0.8684 0.9474 -0.1173 0.0707  0.2065  196 VAL B N   
3076 C CA  . VAL B 196 ? 0.6439 0.8336 0.9183 -0.1151 0.0613  0.2242  196 VAL B CA  
3077 C C   . VAL B 196 ? 0.5651 0.7613 0.8419 -0.1299 0.0536  0.2348  196 VAL B C   
3078 O O   . VAL B 196 ? 0.5215 0.7269 0.7896 -0.1419 0.0567  0.2289  196 VAL B O   
3079 C CB  . VAL B 196 ? 0.6843 0.8711 0.9373 -0.1093 0.0619  0.2250  196 VAL B CB  
3080 C CG1 . VAL B 196 ? 0.7756 0.9674 1.0062 -0.1198 0.0652  0.2177  196 VAL B CG1 
3081 C CG2 . VAL B 196 ? 0.6272 0.8138 0.8862 -0.1062 0.0518  0.2427  196 VAL B CG2 
3082 N N   . THR B 197 ? 0.5766 0.7704 0.8668 -0.1288 0.0439  0.2508  197 THR B N   
3083 C CA  . THR B 197 ? 0.6263 0.8260 0.9200 -0.1422 0.0350  0.2628  197 THR B CA  
3084 C C   . THR B 197 ? 0.6880 0.8895 0.9810 -0.1395 0.0261  0.2773  197 THR B C   
3085 O O   . THR B 197 ? 0.7726 0.9714 1.0801 -0.1287 0.0224  0.2853  197 THR B O   
3086 C CB  . THR B 197 ? 0.6594 0.8559 0.9759 -0.1474 0.0295  0.2689  197 THR B CB  
3087 O OG1 . THR B 197 ? 0.8675 1.0572 1.2018 -0.1366 0.0231  0.2802  197 THR B OG1 
3088 C CG2 . THR B 197 ? 0.5585 0.7531 0.8809 -0.1483 0.0371  0.2546  197 THR B CG2 
3089 N N   . HIS B 198 ? 0.4992 0.7078 0.7771 -0.1497 0.0223  0.2811  198 HIS B N   
3090 C CA  . HIS B 198 ? 0.5487 0.7612 0.8259 -0.1489 0.0129  0.2943  198 HIS B CA  
3091 C C   . HIS B 198 ? 0.5925 0.8133 0.8654 -0.1639 0.0050  0.3033  198 HIS B C   
3092 O O   . HIS B 198 ? 0.6242 0.8497 0.8858 -0.1744 0.0088  0.2974  198 HIS B O   
3093 C CB  . HIS B 198 ? 0.4888 0.6999 0.7476 -0.1430 0.0155  0.2892  198 HIS B CB  
3094 C CG  . HIS B 198 ? 0.4833 0.7008 0.7406 -0.1450 0.0050  0.3021  198 HIS B CG  
3095 N ND1 . HIS B 198 ? 0.5291 0.7494 0.7661 -0.1543 0.0013  0.3023  198 HIS B ND1 
3096 C CD2 . HIS B 198 ? 0.4476 0.6710 0.7225 -0.1393 -0.0030 0.3156  198 HIS B CD2 
3097 C CE1 . HIS B 198 ? 0.5068 0.7336 0.7487 -0.1553 -0.0092 0.3150  198 HIS B CE1 
3098 N NE2 . HIS B 198 ? 0.4663 0.6966 0.7317 -0.1463 -0.0117 0.3234  198 HIS B NE2 
3099 N N   . GLN B 199 ? 0.6855 0.9107 0.9684 -0.1647 -0.0058 0.3181  199 GLN B N   
3100 C CA  . GLN B 199 ? 0.6704 0.9037 0.9510 -0.1786 -0.0149 0.3287  199 GLN B CA  
3101 C C   . GLN B 199 ? 0.6332 0.8721 0.8883 -0.1868 -0.0138 0.3242  199 GLN B C   
3102 O O   . GLN B 199 ? 0.6320 0.8791 0.8806 -0.1995 -0.0188 0.3299  199 GLN B O   
3103 C CB  . GLN B 199 ? 0.6783 0.9159 0.9753 -0.1761 -0.0265 0.3449  199 GLN B CB  
3104 C CG  . GLN B 199 ? 0.7214 0.9673 1.0177 -0.1897 -0.0373 0.3573  199 GLN B CG  
3105 C CD  . GLN B 199 ? 0.8351 1.0861 1.1505 -0.1862 -0.0482 0.3727  199 GLN B CD  
3106 O OE1 . GLN B 199 ? 0.8598 1.1159 1.1765 -0.1789 -0.0505 0.3760  199 GLN B OE1 
3107 N NE2 . GLN B 199 ? 0.8998 1.1507 1.2305 -0.1925 -0.0556 0.3830  199 GLN B NE2 
3108 N N   . GLY B 200 ? 0.5769 0.8111 0.8173 -0.1798 -0.0075 0.3140  200 GLY B N   
3109 C CA  . GLY B 200 ? 0.5841 0.8206 0.7991 -0.1864 -0.0053 0.3076  200 GLY B CA  
3110 C C   . GLY B 200 ? 0.6104 0.8478 0.8138 -0.1887 0.0069  0.2931  200 GLY B C   
3111 O O   . GLY B 200 ? 0.6302 0.8717 0.8130 -0.1943 0.0099  0.2874  200 GLY B O   
3112 N N   . LEU B 201 ? 0.6533 0.8883 0.8704 -0.1846 0.0137  0.2871  201 LEU B N   
3113 C CA  . LEU B 201 ? 0.6435 0.8830 0.8532 -0.1866 0.0255  0.2728  201 LEU B CA  
3114 C C   . LEU B 201 ? 0.6693 0.9243 0.8849 -0.2003 0.0251  0.2762  201 LEU B C   
3115 O O   . LEU B 201 ? 0.6614 0.9161 0.8960 -0.2039 0.0208  0.2831  201 LEU B O   
3116 C CB  . LEU B 201 ? 0.5443 0.7744 0.7649 -0.1753 0.0335  0.2625  201 LEU B CB  
3117 C CG  . LEU B 201 ? 0.5216 0.7399 0.7319 -0.1625 0.0374  0.2555  201 LEU B CG  
3118 C CD1 . LEU B 201 ? 0.4776 0.6885 0.6998 -0.1518 0.0449  0.2462  201 LEU B CD1 
3119 C CD2 . LEU B 201 ? 0.4522 0.6718 0.6365 -0.1645 0.0433  0.2456  201 LEU B CD2 
3120 N N   . SER B 202 ? 0.7668 1.0364 0.9658 -0.2081 0.0292  0.2717  202 SER B N   
3121 C CA  . SER B 202 ? 0.8122 1.1028 1.0145 -0.2220 0.0294  0.2751  202 SER B CA  
3122 C C   . SER B 202 ? 0.7585 1.0542 0.9778 -0.2233 0.0359  0.2681  202 SER B C   
3123 O O   . SER B 202 ? 0.6277 0.9385 0.8567 -0.2358 0.0331  0.2744  202 SER B O   
3124 C CB  . SER B 202 ? 0.8547 1.1638 1.0354 -0.2268 0.0350  0.2691  202 SER B CB  
3125 O OG  . SER B 202 ? 0.8465 1.1492 1.0144 -0.2155 0.0449  0.2540  202 SER B OG  
3126 N N   . SER B 203 ? 0.7924 1.0753 1.0158 -0.2110 0.0434  0.2558  203 SER B N   
3127 C CA  . SER B 203 ? 0.7842 1.0706 1.0239 -0.2109 0.0499  0.2466  203 SER B CA  
3128 C C   . SER B 203 ? 0.8341 1.1027 1.0739 -0.1951 0.0564  0.2346  203 SER B C   
3129 O O   . SER B 203 ? 0.8453 1.1100 1.0677 -0.1870 0.0616  0.2270  203 SER B O   
3130 C CB  . SER B 203 ? 0.7258 1.0403 0.9619 -0.2187 0.0584  0.2373  203 SER B CB  
3131 O OG  . SER B 203 ? 0.6996 1.0188 0.9170 -0.2099 0.0674  0.2247  203 SER B OG  
3132 N N   . PRO B 204 ? 0.7182 0.9760 0.9771 -0.1912 0.0554  0.2336  204 PRO B N   
3133 C CA  . PRO B 204 ? 0.6409 0.8824 0.9016 -0.1758 0.0598  0.2250  204 PRO B CA  
3134 C C   . PRO B 204 ? 0.6577 0.9059 0.9072 -0.1696 0.0725  0.2059  204 PRO B C   
3135 O O   . PRO B 204 ? 0.6423 0.9075 0.8986 -0.1750 0.0792  0.1950  204 PRO B O   
3136 C CB  . PRO B 204 ? 0.5387 0.7737 0.8235 -0.1763 0.0564  0.2268  204 PRO B CB  
3137 C CG  . PRO B 204 ? 0.5226 0.7602 0.8160 -0.1890 0.0450  0.2440  204 PRO B CG  
3138 C CD  . PRO B 204 ? 0.6225 0.8804 0.9016 -0.2011 0.0471  0.2443  204 PRO B CD  
3139 N N   . VAL B 205 ? 0.7626 0.9990 0.9964 -0.1582 0.0750  0.2022  205 VAL B N   
3140 C CA  . VAL B 205 ? 0.7093 0.9505 0.9295 -0.1518 0.0861  0.1851  205 VAL B CA  
3141 C C   . VAL B 205 ? 0.7052 0.9367 0.9332 -0.1394 0.0908  0.1747  205 VAL B C   
3142 O O   . VAL B 205 ? 0.5905 0.8073 0.8262 -0.1323 0.0849  0.1834  205 VAL B O   
3143 C CB  . VAL B 205 ? 0.7139 0.9481 0.9073 -0.1490 0.0853  0.1878  205 VAL B CB  
3144 C CG1 . VAL B 205 ? 0.8109 1.0586 0.9961 -0.1609 0.0809  0.1965  205 VAL B CG1 
3145 C CG2 . VAL B 205 ? 0.5215 0.7354 0.7114 -0.1416 0.0770  0.1990  205 VAL B CG2 
3146 N N   . THR B 206 ? 0.6758 0.9198 0.9045 -0.1359 0.1013  0.1560  206 THR B N   
3147 C CA  . THR B 206 ? 0.5879 0.8349 0.8309 -0.1235 0.1037  0.1513  206 THR B CA  
3148 C C   . THR B 206 ? 0.5046 0.7623 0.7349 -0.1119 0.1113  0.1436  206 THR B C   
3149 O O   . THR B 206 ? 0.4500 0.7324 0.6767 -0.1131 0.1177  0.1347  206 THR B O   
3150 C CB  . THR B 206 ? 0.5060 0.7727 0.7782 -0.1275 0.1049  0.1445  206 THR B CB  
3151 O OG1 . THR B 206 ? 0.5173 0.8145 0.7922 -0.1301 0.1126  0.1317  206 THR B OG1 
3152 C CG2 . THR B 206 ? 0.4668 0.7254 0.7493 -0.1413 0.0971  0.1537  206 THR B CG2 
3153 N N   . LYS B 207 ? 0.4825 0.7240 0.7060 -0.0991 0.1104  0.1483  207 LYS B N   
3154 C CA  . LYS B 207 ? 0.5629 0.8121 0.7739 -0.0855 0.1176  0.1426  207 LYS B CA  
3155 C C   . LYS B 207 ? 0.6049 0.8680 0.8399 -0.0690 0.1240  0.1321  207 LYS B C   
3156 O O   . LYS B 207 ? 0.6639 0.9175 0.9205 -0.0646 0.1205  0.1369  207 LYS B O   
3157 C CB  . LYS B 207 ? 0.4695 0.6918 0.6567 -0.0809 0.1127  0.1548  207 LYS B CB  
3158 C CG  . LYS B 207 ? 0.5205 0.7338 0.6783 -0.0917 0.1086  0.1604  207 LYS B CG  
3159 C CD  . LYS B 207 ? 0.5877 0.8180 0.7231 -0.0859 0.1159  0.1555  207 LYS B CD  
3160 C CE  . LYS B 207 ? 0.6773 0.8950 0.7800 -0.0954 0.1094  0.1646  207 LYS B CE  
3161 N NZ  . LYS B 207 ? 0.7208 0.9509 0.7883 -0.0872 0.1141  0.1629  207 LYS B NZ  
3162 N N   . SER B 208 ? 0.6837 0.9702 0.9147 -0.0561 0.1333  0.1166  208 SER B N   
3163 C CA  . SER B 208 ? 0.5818 0.8806 0.8341 -0.0353 0.1393  0.1005  208 SER B CA  
3164 C C   . SER B 208 ? 0.4998 0.8107 0.7310 -0.0106 0.1483  0.0819  208 SER B C   
3165 O O   . SER B 208 ? 0.4659 0.7796 0.6645 -0.0100 0.1505  0.0841  208 SER B O   
3166 C CB  . SER B 208 ? 0.5353 0.8587 0.8169 -0.0439 0.1380  0.0888  208 SER B CB  
3167 O OG  . SER B 208 ? 0.4983 0.8514 0.7716 -0.0495 0.1420  0.0762  208 SER B OG  
3168 N N   . PHE B 209 ? 0.4756 0.7893 0.7195 0.0127  0.1513  0.0610  209 PHE B N   
3169 C CA  . PHE B 209 ? 0.5190 0.8337 0.7341 0.0419  0.1551  0.0338  209 PHE B CA  
3170 C C   . PHE B 209 ? 0.5404 0.8550 0.7743 0.0591  0.1522  0.0068  209 PHE B C   
3171 O O   . PHE B 209 ? 0.5901 0.9098 0.8603 0.0499  0.1494  0.0126  209 PHE B O   
3172 C CB  . PHE B 209 ? 0.5296 0.8053 0.7079 0.0561  0.1531  0.0399  209 PHE B CB  
3173 C CG  . PHE B 209 ? 0.5550 0.8097 0.7536 0.0666  0.1544  0.0491  209 PHE B CG  
3174 C CD1 . PHE B 209 ? 0.5842 0.8198 0.7718 0.0922  0.1498  0.0230  209 PHE B CD1 
3175 C CD2 . PHE B 209 ? 0.6450 0.8910 0.8640 0.0482  0.1527  0.0798  209 PHE B CD2 
3176 C CE1 . PHE B 209 ? 0.6231 0.8368 0.8205 0.1001  0.1458  0.0288  209 PHE B CE1 
3177 C CE2 . PHE B 209 ? 0.6476 0.8741 0.8782 0.0596  0.1503  0.0855  209 PHE B CE2 
3178 C CZ  . PHE B 209 ? 0.6482 0.8604 0.8681 0.0861  0.1480  0.0605  209 PHE B CZ  
3179 N N   . ASN B 210 ? 0.6330 0.9330 0.8368 0.0827  0.1494  -0.0224 210 ASN B N   
3180 C CA  . ASN B 210 ? 0.6369 0.9198 0.8523 0.0967  0.1453  -0.0439 210 ASN B CA  
3181 C C   . ASN B 210 ? 0.7142 0.9505 0.9018 0.1145  0.1391  -0.0540 210 ASN B C   
3182 O O   . ASN B 210 ? 0.7933 1.0139 0.9428 0.1208  0.1367  -0.0520 210 ASN B O   
3183 C CB  . ASN B 210 ? 0.6611 0.9573 0.8596 0.1015  0.1416  -0.0609 210 ASN B CB  
3184 C CG  . ASN B 210 ? 0.7322 1.0758 0.9396 0.0817  0.1448  -0.0537 210 ASN B CG  
3185 O OD1 . ASN B 210 ? 0.8381 1.1929 1.0155 0.0865  0.1411  -0.0675 210 ASN B OD1 
3186 N ND2 . ASN B 210 ? 0.6743 1.0422 0.9212 0.0575  0.1496  -0.0309 210 ASN B ND2 
3187 N N   . ARG B 211 ? 0.6897 0.9034 0.8937 0.1207  0.1354  -0.0610 211 ARG B N   
3188 C CA  . ARG B 211 ? 0.6255 0.7997 0.8071 0.1303  0.1279  -0.0686 211 ARG B CA  
3189 C C   . ARG B 211 ? 0.7151 0.8657 0.8485 0.1382  0.1242  -0.0771 211 ARG B C   
3190 O O   . ARG B 211 ? 0.6746 0.8059 0.7828 0.1426  0.1181  -0.0761 211 ARG B O   
3191 C CB  . ARG B 211 ? 0.5614 0.7114 0.7541 0.1334  0.1250  -0.0682 211 ARG B CB  
3192 C CG  . ARG B 211 ? 0.4594 0.6368 0.6835 0.1295  0.1077  -0.0779 211 ARG B CG  
3193 C CD  . ARG B 211 ? 0.4774 0.6064 0.7076 0.1317  0.1144  -0.0675 211 ARG B CD  
3194 N NE  . ARG B 211 ? 0.5544 0.6621 0.7569 0.1375  0.1105  -0.0737 211 ARG B NE  
3195 C CZ  . ARG B 211 ? 0.6830 0.7767 0.8525 0.1513  0.1147  -0.0772 211 ARG B CZ  
3196 N NH1 . ARG B 211 ? 0.5792 0.6812 0.7401 0.1578  0.1173  -0.0818 211 ARG B NH1 
3197 N NH2 . ARG B 211 ? 0.8251 0.9076 0.9738 0.1592  0.1095  -0.0845 211 ARG B NH2 
3198 N N   . GLY B 212 ? 0.6637 0.8220 0.7826 0.1404  0.1227  -0.0864 212 GLY B N   
3199 C CA  . GLY B 212 ? 0.6747 0.8166 0.7510 0.1464  0.1133  -0.0987 212 GLY B CA  
3200 C C   . GLY B 212 ? 0.6166 0.7593 0.6634 0.1483  0.1108  -0.0959 212 GLY B C   
3201 O O   . GLY B 212 ? 0.6303 0.7463 0.6467 0.1543  0.1029  -0.0968 212 GLY B O   
3202 N N   . VAL C 2   ? 0.3276 0.3948 0.4892 0.0408  -0.1298 -0.0707 2   VAL H N   
3203 C CA  . VAL C 2   ? 0.5889 0.6577 0.7394 0.0298  -0.1148 -0.0694 2   VAL H CA  
3204 C C   . VAL C 2   ? 0.5469 0.5972 0.6725 0.0268  -0.1070 -0.0611 2   VAL H C   
3205 O O   . VAL C 2   ? 0.3343 0.3704 0.4379 0.0244  -0.1157 -0.0521 2   VAL H O   
3206 C CB  . VAL C 2   ? 0.6761 0.7500 0.8173 0.0216  -0.1224 -0.0667 2   VAL H CB  
3207 C CG1 . VAL C 2   ? 0.6431 0.7032 0.7641 0.0232  -0.1414 -0.0572 2   VAL H CG1 
3208 C CG2 . VAL C 2   ? 0.7016 0.7729 0.8280 0.0110  -0.1079 -0.0639 2   VAL H CG2 
3209 N N   . GLN C 3   ? 0.4998 0.5501 0.6283 0.0269  -0.0905 -0.0644 3   GLN H N   
3210 C CA  . GLN C 3   ? 0.4937 0.5287 0.6002 0.0249  -0.0834 -0.0579 3   GLN H CA  
3211 C C   . GLN C 3   ? 0.4006 0.4382 0.5070 0.0220  -0.0643 -0.0608 3   GLN H C   
3212 O O   . GLN C 3   ? 0.4047 0.4535 0.5296 0.0233  -0.0542 -0.0687 3   GLN H O   
3213 C CB  . GLN C 3   ? 0.5021 0.5244 0.6050 0.0330  -0.0892 -0.0568 3   GLN H CB  
3214 C CG  . GLN C 3   ? 0.5164 0.5257 0.6071 0.0343  -0.1064 -0.0496 3   GLN H CG  
3215 C CD  . GLN C 3   ? 0.6035 0.5948 0.6727 0.0328  -0.1062 -0.0433 3   GLN H CD  
3216 O OE1 . GLN C 3   ? 0.6746 0.6599 0.7447 0.0379  -0.1012 -0.0464 3   GLN H OE1 
3217 N NE2 . GLN C 3   ? 0.5781 0.5615 0.6282 0.0251  -0.1110 -0.0352 3   GLN H NE2 
3218 N N   . LEU C 4   ? 0.3391 0.3661 0.4246 0.0180  -0.0594 -0.0543 4   LEU H N   
3219 C CA  . LEU C 4   ? 0.3578 0.3820 0.4374 0.0176  -0.0435 -0.0550 4   LEU H CA  
3220 C C   . LEU C 4   ? 0.4788 0.4889 0.5387 0.0199  -0.0451 -0.0498 4   LEU H C   
3221 O O   . LEU C 4   ? 0.6003 0.6042 0.6453 0.0156  -0.0506 -0.0436 4   LEU H O   
3222 C CB  . LEU C 4   ? 0.2844 0.3127 0.3605 0.0099  -0.0349 -0.0534 4   LEU H CB  
3223 C CG  . LEU C 4   ? 0.3768 0.4192 0.4736 0.0070  -0.0283 -0.0606 4   LEU H CG  
3224 C CD1 . LEU C 4   ? 0.2767 0.3248 0.3728 -0.0003 -0.0346 -0.0593 4   LEU H CD1 
3225 C CD2 . LEU C 4   ? 0.4608 0.5026 0.5592 0.0055  -0.0095 -0.0631 4   LEU H CD2 
3226 N N   . VAL C 5   ? 0.4890 0.4947 0.5490 0.0261  -0.0396 -0.0533 5   VAL H N   
3227 C CA  . VAL C 5   ? 0.4915 0.4846 0.5332 0.0283  -0.0414 -0.0500 5   VAL H CA  
3228 C C   . VAL C 5   ? 0.6126 0.6027 0.6416 0.0276  -0.0285 -0.0486 5   VAL H C   
3229 O O   . VAL C 5   ? 0.6550 0.6492 0.6896 0.0285  -0.0158 -0.0521 5   VAL H O   
3230 C CB  . VAL C 5   ? 0.3745 0.3621 0.4206 0.0359  -0.0450 -0.0549 5   VAL H CB  
3231 C CG1 . VAL C 5   ? 0.3814 0.3561 0.4086 0.0369  -0.0485 -0.0521 5   VAL H CG1 
3232 C CG2 . VAL C 5   ? 0.3603 0.3497 0.4202 0.0384  -0.0582 -0.0561 5   VAL H CG2 
3233 N N   . GLU C 6   ? 0.4986 0.4812 0.5102 0.0259  -0.0319 -0.0436 6   GLU H N   
3234 C CA  . GLU C 6   ? 0.4775 0.4567 0.4753 0.0261  -0.0225 -0.0412 6   GLU H CA  
3235 C C   . GLU C 6   ? 0.5204 0.4907 0.5032 0.0307  -0.0247 -0.0416 6   GLU H C   
3236 O O   . GLU C 6   ? 0.5159 0.4821 0.4929 0.0294  -0.0351 -0.0401 6   GLU H O   
3237 C CB  . GLU C 6   ? 0.3958 0.3772 0.3885 0.0202  -0.0241 -0.0358 6   GLU H CB  
3238 C CG  . GLU C 6   ? 0.5218 0.5119 0.5282 0.0150  -0.0236 -0.0363 6   GLU H CG  
3239 C CD  . GLU C 6   ? 0.7741 0.7661 0.7753 0.0090  -0.0240 -0.0322 6   GLU H CD  
3240 O OE1 . GLU C 6   ? 1.0021 0.9907 0.9938 0.0102  -0.0175 -0.0299 6   GLU H OE1 
3241 O OE2 . GLU C 6   ? 0.7218 0.7185 0.7279 0.0036  -0.0306 -0.0315 6   GLU H OE2 
3242 N N   . SER C 7   ? 0.5966 0.5634 0.5723 0.0353  -0.0145 -0.0441 7   SER H N   
3243 C CA  . SER C 7   ? 0.6259 0.5846 0.5865 0.0400  -0.0162 -0.0461 7   SER H CA  
3244 C C   . SER C 7