data_5GKI
# 
_entry.id   5GKI 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.321 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5GKI         
WWPDB D_1300000899 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 5GKE unspecified . 
PDB 5GKF unspecified . 
PDB 5GKG unspecified . 
PDB 5GKH unspecified . 
PDB 5GKJ unspecified . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5GKI 
_pdbx_database_status.recvd_initial_deposition_date   2016-07-04 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nakae, S.'    1 
'Hijikata, A.' 2 
'Tsuji, T.'    3 
'Yonezawa, K.' 4 
'Kouyama, K.'  5 
'Mayanagi, K.' 6 
'Ishino, S.'   7 
'Ishino, Y.'   8 
'Shirai, T.'   9 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Structure 
_citation.journal_id_ASTM           STRUE6 
_citation.journal_id_CSD            2005 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            24 
_citation.language                  ? 
_citation.page_first                1960 
_citation.page_last                 1971 
_citation.title                     'Structure of the EndoMS-DNA Complex as Mismatch Restriction Endonuclease' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.str.2016.09.005 
_citation.pdbx_database_id_PubMed   27773688 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Nakae, S.'     1 ? 
primary 'Hijikata, A.'  2 ? 
primary 'Tsuji, T.'     3 ? 
primary 'Yonezawa, K.'  4 ? 
primary 'Kouyama, K.I.' 5 ? 
primary 'Mayanagi, K.'  6 ? 
primary 'Ishino, S.'    7 ? 
primary 'Ishino, Y.'    8 ? 
primary 'Shirai, T.'    9 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5GKI 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     92.030 
_cell.length_a_esd                 ? 
_cell.length_b                     92.030 
_cell.length_b_esd                 ? 
_cell.length_c                     405.350 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        24 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5GKI 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                178 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 61 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Endonuclease EndoMS'                                         28598.096 2  3.1.-.- D165A ? ? 
2 polymer     syn 
;DNA (5'-D(*GP*CP*CP*TP*AP*GP*GP*TP*CP*CP*CP*GP*TP*CP*C)-3')
;
4521.923  1  ?       ?     ? ? 
3 polymer     syn 
;DNA (5'-D(*GP*GP*AP*CP*GP*GP*GP*GP*CP*CP*TP*AP*GP*GP*C)-3')
;
4676.022  1  ?       ?     ? ? 
4 non-polymer syn 'MAGNESIUM ION'                                               24.305    2  ?       ?     ? ? 
5 non-polymer syn '(4S)-2-METHYL-2,4-PENTANEDIOL'                               118.174   4  ?       ?     ? ? 
6 water       nat water                                                         18.015    21 ?       ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Endonuclease NucS' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MSKDKVTVITSPSTEELVSLVNSALLEEAMLTIFARCKVHYDGRAKSELGSGDRVIIVKPDGSFLIHQSKKREPVNWQPP
GSRVRLELRENPVLVSIRRKPRETLEVELEEVYMVSVFRAEDYEELALTGSEAEMAELIFENPEVIEPGFKPLFREKAIG
TGIVAVLGRDSDGNIVVLELKRRRAELHAVRQLKSYVEILREEYGDKVRGILVAPSLTSGAKRLLEKEGLEFRKLEPPKR
DSKKKGRQKTLF
;
;MSKDKVTVITSPSTEELVSLVNSALLEEAMLTIFARCKVHYDGRAKSELGSGDRVIIVKPDGSFLIHQSKKREPVNWQPP
GSRVRLELRENPVLVSIRRKPRETLEVELEEVYMVSVFRAEDYEELALTGSEAEMAELIFENPEVIEPGFKPLFREKAIG
TGIVAVLGRDSDGNIVVLELKRRRAELHAVRQLKSYVEILREEYGDKVRGILVAPSLTSGAKRLLEKEGLEFRKLEPPKR
DSKKKGRQKTLF
;
A,B ? 
2 polydeoxyribonucleotide no no '(DG)(DC)(DC)(DT)(DA)(DG)(DG)(DT)(DC)(DC)(DC)(DG)(DT)(DC)(DC)' GCCTAGGTCCCGTCC C   ? 
3 polydeoxyribonucleotide no no '(DG)(DG)(DA)(DC)(DG)(DG)(DG)(DG)(DC)(DC)(DT)(DA)(DG)(DG)(DC)' GGACGGGGCCTAGGC D   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   LYS n 
1 4   ASP n 
1 5   LYS n 
1 6   VAL n 
1 7   THR n 
1 8   VAL n 
1 9   ILE n 
1 10  THR n 
1 11  SER n 
1 12  PRO n 
1 13  SER n 
1 14  THR n 
1 15  GLU n 
1 16  GLU n 
1 17  LEU n 
1 18  VAL n 
1 19  SER n 
1 20  LEU n 
1 21  VAL n 
1 22  ASN n 
1 23  SER n 
1 24  ALA n 
1 25  LEU n 
1 26  LEU n 
1 27  GLU n 
1 28  GLU n 
1 29  ALA n 
1 30  MET n 
1 31  LEU n 
1 32  THR n 
1 33  ILE n 
1 34  PHE n 
1 35  ALA n 
1 36  ARG n 
1 37  CYS n 
1 38  LYS n 
1 39  VAL n 
1 40  HIS n 
1 41  TYR n 
1 42  ASP n 
1 43  GLY n 
1 44  ARG n 
1 45  ALA n 
1 46  LYS n 
1 47  SER n 
1 48  GLU n 
1 49  LEU n 
1 50  GLY n 
1 51  SER n 
1 52  GLY n 
1 53  ASP n 
1 54  ARG n 
1 55  VAL n 
1 56  ILE n 
1 57  ILE n 
1 58  VAL n 
1 59  LYS n 
1 60  PRO n 
1 61  ASP n 
1 62  GLY n 
1 63  SER n 
1 64  PHE n 
1 65  LEU n 
1 66  ILE n 
1 67  HIS n 
1 68  GLN n 
1 69  SER n 
1 70  LYS n 
1 71  LYS n 
1 72  ARG n 
1 73  GLU n 
1 74  PRO n 
1 75  VAL n 
1 76  ASN n 
1 77  TRP n 
1 78  GLN n 
1 79  PRO n 
1 80  PRO n 
1 81  GLY n 
1 82  SER n 
1 83  ARG n 
1 84  VAL n 
1 85  ARG n 
1 86  LEU n 
1 87  GLU n 
1 88  LEU n 
1 89  ARG n 
1 90  GLU n 
1 91  ASN n 
1 92  PRO n 
1 93  VAL n 
1 94  LEU n 
1 95  VAL n 
1 96  SER n 
1 97  ILE n 
1 98  ARG n 
1 99  ARG n 
1 100 LYS n 
1 101 PRO n 
1 102 ARG n 
1 103 GLU n 
1 104 THR n 
1 105 LEU n 
1 106 GLU n 
1 107 VAL n 
1 108 GLU n 
1 109 LEU n 
1 110 GLU n 
1 111 GLU n 
1 112 VAL n 
1 113 TYR n 
1 114 MET n 
1 115 VAL n 
1 116 SER n 
1 117 VAL n 
1 118 PHE n 
1 119 ARG n 
1 120 ALA n 
1 121 GLU n 
1 122 ASP n 
1 123 TYR n 
1 124 GLU n 
1 125 GLU n 
1 126 LEU n 
1 127 ALA n 
1 128 LEU n 
1 129 THR n 
1 130 GLY n 
1 131 SER n 
1 132 GLU n 
1 133 ALA n 
1 134 GLU n 
1 135 MET n 
1 136 ALA n 
1 137 GLU n 
1 138 LEU n 
1 139 ILE n 
1 140 PHE n 
1 141 GLU n 
1 142 ASN n 
1 143 PRO n 
1 144 GLU n 
1 145 VAL n 
1 146 ILE n 
1 147 GLU n 
1 148 PRO n 
1 149 GLY n 
1 150 PHE n 
1 151 LYS n 
1 152 PRO n 
1 153 LEU n 
1 154 PHE n 
1 155 ARG n 
1 156 GLU n 
1 157 LYS n 
1 158 ALA n 
1 159 ILE n 
1 160 GLY n 
1 161 THR n 
1 162 GLY n 
1 163 ILE n 
1 164 VAL n 
1 165 ALA n 
1 166 VAL n 
1 167 LEU n 
1 168 GLY n 
1 169 ARG n 
1 170 ASP n 
1 171 SER n 
1 172 ASP n 
1 173 GLY n 
1 174 ASN n 
1 175 ILE n 
1 176 VAL n 
1 177 VAL n 
1 178 LEU n 
1 179 GLU n 
1 180 LEU n 
1 181 LYS n 
1 182 ARG n 
1 183 ARG n 
1 184 ARG n 
1 185 ALA n 
1 186 GLU n 
1 187 LEU n 
1 188 HIS n 
1 189 ALA n 
1 190 VAL n 
1 191 ARG n 
1 192 GLN n 
1 193 LEU n 
1 194 LYS n 
1 195 SER n 
1 196 TYR n 
1 197 VAL n 
1 198 GLU n 
1 199 ILE n 
1 200 LEU n 
1 201 ARG n 
1 202 GLU n 
1 203 GLU n 
1 204 TYR n 
1 205 GLY n 
1 206 ASP n 
1 207 LYS n 
1 208 VAL n 
1 209 ARG n 
1 210 GLY n 
1 211 ILE n 
1 212 LEU n 
1 213 VAL n 
1 214 ALA n 
1 215 PRO n 
1 216 SER n 
1 217 LEU n 
1 218 THR n 
1 219 SER n 
1 220 GLY n 
1 221 ALA n 
1 222 LYS n 
1 223 ARG n 
1 224 LEU n 
1 225 LEU n 
1 226 GLU n 
1 227 LYS n 
1 228 GLU n 
1 229 GLY n 
1 230 LEU n 
1 231 GLU n 
1 232 PHE n 
1 233 ARG n 
1 234 LYS n 
1 235 LEU n 
1 236 GLU n 
1 237 PRO n 
1 238 PRO n 
1 239 LYS n 
1 240 ARG n 
1 241 ASP n 
1 242 SER n 
1 243 LYS n 
1 244 LYS n 
1 245 LYS n 
1 246 GLY n 
1 247 ARG n 
1 248 GLN n 
1 249 LYS n 
1 250 THR n 
1 251 LEU n 
1 252 PHE n 
2 1   DG  n 
2 2   DC  n 
2 3   DC  n 
2 4   DT  n 
2 5   DA  n 
2 6   DG  n 
2 7   DG  n 
2 8   DT  n 
2 9   DC  n 
2 10  DC  n 
2 11  DC  n 
2 12  DG  n 
2 13  DT  n 
2 14  DC  n 
2 15  DC  n 
3 1   DG  n 
3 2   DG  n 
3 3   DA  n 
3 4   DC  n 
3 5   DG  n 
3 6   DG  n 
3 7   DG  n 
3 8   DG  n 
3 9   DC  n 
3 10  DC  n 
3 11  DT  n 
3 12  DA  n 
3 13  DG  n 
3 14  DG  n 
3 15  DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   252 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 TK1898 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    KOD1 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Thermococcus kodakarensis KOD1' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     69014 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 15 'synthetic construct' ? 32630 ? 
3 1 sample 1 15 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP NUCS_THEKO Q5JER9 ? 1 
;MSKDKVTVITSPSTEELVSLVNSALLEEAMLTIFARCKVHYDGRAKSELGSGDRVIIVKPDGSFLIHQSKKREPVNWQPP
GSRVRLELRENPVLVSIRRKPRETLEVELEEVYMVSVFRAEDYEELALTGSEAEMAELIFENPEVIEPGFKPLFREKAIG
TGIVDVLGRDSDGNIVVLELKRRRAELHAVRQLKSYVEILREEYGDKVRGILVAPSLTSGAKRLLEKEGLEFRKLEPPKR
DSKKKGRQKTLF
;
1 
2 PDB 5GKI       5GKI   ? 2 ? 1 
3 PDB 5GKI       5GKI   ? 3 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5GKI A 1 ? 252 ? Q5JER9 1 ? 252 ? 1 252 
2 1 5GKI B 1 ? 252 ? Q5JER9 1 ? 252 ? 1 252 
3 2 5GKI C 1 ? 15  ? 5GKI   1 ? 15  ? 1 15  
4 3 5GKI D 1 ? 15  ? 5GKI   1 ? 15  ? 1 15  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5GKI ALA A 165 ? UNP Q5JER9 ASP 165 'engineered mutation' 165 1 
2 5GKI ALA B 165 ? UNP Q5JER9 ASP 165 'engineered mutation' 165 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'            24.305  
MPD non-polymer         . '(4S)-2-METHYL-2,4-PENTANEDIOL'      ? 'C6 H14 O2'       118.174 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5GKI 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.91 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         68.58 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;0.16 M CALCIUM ACETATE, 80 MM SODIUM
 CACODYLATE, 14.4%(W/V) PEG8000, 20%(W/V) GLYCEROL
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-12-09 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL38B1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0000 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL38B1 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5GKI 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.900 
_reflns.d_resolution_low                 24.720 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       23761 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.8 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.200 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            16.8000 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.90 
_reflns_shell.d_res_low                   3.06 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         9.200 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        100.0 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             4.00 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               29.38 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5GKI 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.90 
_refine.ls_d_res_low                             24.72 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     22831 
_refine.ls_number_reflns_R_free                  1162 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    96.5 
_refine.ls_percent_reflns_R_free                 5.090 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.186 
_refine.ls_R_factor_R_free                       0.255 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.182 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      5BSL 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 24.770 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.420 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3800 
_refine_hist.pdbx_number_atoms_nucleic_acid   610 
_refine_hist.pdbx_number_atoms_ligand         34 
_refine_hist.number_atoms_solvent             21 
_refine_hist.number_atoms_total               4465 
_refine_hist.d_res_high                       2.90 
_refine_hist.d_res_low                        24.72 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.009  ? 5252 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.281  ? 7340 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 22.406 ? 2120 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.046  ? 834  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.007  ? 734  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.9000 3.0318  . . 125 2467 91.00 . . . 0.4544 . 0.3296 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0318 3.1913  . . 145 2550 93.00 . . . 0.3214 . 0.2567 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1913 3.3908  . . 131 2634 96.00 . . . 0.2765 . 0.2039 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3908 3.6518  . . 163 2658 97.00 . . . 0.2746 . 0.1700 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.6518 4.0179  . . 159 2705 98.00 . . . 0.2176 . 0.1569 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.0179 4.5961  . . 158 2776 99.00 . . . 0.1881 . 0.1313 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.5961 5.7784  . . 143 2834 99.00 . . . 0.2179 . 0.1482 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.7784 24.7247 . . 138 3045 99.00 . . . 0.2612 . 0.1957 . . . . . . . . . . 
# 
_struct.entry_id                     5GKI 
_struct.title                        'Structure of EndoMS-dsDNA3 complex' 
_struct.pdbx_descriptor              'Endonuclease EndoMS/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5GKI 
_struct_keywords.text            'ENDONUCLEASE, DNA COMPLEX, HYDROLASE-DNA complex' 
_struct_keywords.pdbx_keywords   HYDROLASE/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 4 ? 
H N N 5 ? 
I N N 5 ? 
J N N 5 ? 
K N N 6 ? 
L N N 6 ? 
M N N 6 ? 
N N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 SER A 13  ? GLU A 28  ? SER A 13  GLU A 28  1 ? 16 
HELX_P HELX_P2  AA2 SER A 131 ? ASN A 142 ? SER A 131 ASN A 142 1 ? 12 
HELX_P HELX_P3  AA3 PRO A 143 ? ILE A 146 ? PRO A 143 ILE A 146 5 ? 4  
HELX_P HELX_P4  AA4 GLU A 186 ? GLY A 205 ? GLU A 186 GLY A 205 1 ? 20 
HELX_P HELX_P5  AA5 THR A 218 ? GLU A 228 ? THR A 218 GLU A 228 1 ? 11 
HELX_P HELX_P6  AA6 SER B 13  ? GLU B 28  ? SER B 13  GLU B 28  1 ? 16 
HELX_P HELX_P7  AA7 SER B 131 ? ASN B 142 ? SER B 131 ASN B 142 1 ? 12 
HELX_P HELX_P8  AA8 PRO B 143 ? ILE B 146 ? PRO B 143 ILE B 146 5 ? 4  
HELX_P HELX_P9  AA9 GLU B 186 ? GLY B 205 ? GLU B 186 GLY B 205 1 ? 20 
HELX_P HELX_P10 AB1 ASP B 206 ? VAL B 208 ? ASP B 206 VAL B 208 5 ? 3  
HELX_P HELX_P11 AB2 THR B 218 ? GLU B 228 ? THR B 218 GLU B 228 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A GLU 179 OE1 ? ? ? 1_555 E MG .  MG ? ? A GLU 179 A MG 301 1_555 ? ? ? ? ? ? ?            2.145 ? 
metalc2  metalc ? ? A GLU 179 OE2 ? ? ? 1_555 E MG .  MG ? ? A GLU 179 A MG 301 1_555 ? ? ? ? ? ? ?            2.670 ? 
metalc3  metalc ? ? B GLU 179 OE1 ? ? ? 1_555 G MG .  MG ? ? B GLU 179 B MG 301 1_555 ? ? ? ? ? ? ?            2.290 ? 
metalc4  metalc ? ? B GLU 179 OE2 ? ? ? 1_555 G MG .  MG ? ? B GLU 179 B MG 301 1_555 ? ? ? ? ? ? ?            1.930 ? 
metalc5  metalc ? ? C DG  6   OP1 A ? ? 1_555 G MG .  MG ? ? C DG  6   B MG 301 1_555 ? ? ? ? ? ? ?            2.170 ? 
metalc6  metalc ? ? C DG  6   OP1 B ? ? 1_555 E MG .  MG ? ? C DG  6   A MG 301 1_555 ? ? ? ? ? ? ?            2.031 ? 
metalc7  metalc ? ? D DG  6   OP1 A ? ? 1_555 E MG .  MG ? ? D DG  6   A MG 301 1_555 ? ? ? ? ? ? ?            2.021 ? 
metalc8  metalc ? ? D DG  6   OP1 B ? ? 1_555 G MG .  MG ? ? D DG  6   B MG 301 1_555 ? ? ? ? ? ? ?            2.133 ? 
hydrog1  hydrog ? ? C DG  1   N1  A ? ? 1_555 D DC 15 N3 A ? C DG  1   D DC 15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? C DG  1   N2  A ? ? 1_555 D DC 15 O2 A ? C DG  1   D DC 15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? C DG  1   O6  A ? ? 1_555 D DC 15 N4 A ? C DG  1   D DC 15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? C DC  2   N3  A ? ? 1_555 D DG 14 N1 A ? C DC  2   D DG 14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? C DC  2   N4  A ? ? 1_555 D DG 14 O6 A ? C DC  2   D DG 14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? C DC  2   O2  A ? ? 1_555 D DG 14 N2 A ? C DC  2   D DG 14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? C DC  3   N3  A ? ? 1_555 D DG 13 N1 A ? C DC  3   D DG 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? C DC  3   N4  A ? ? 1_555 D DG 13 O6 A ? C DC  3   D DG 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? C DC  3   O2  A ? ? 1_555 D DG 13 N2 A ? C DC  3   D DG 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? C DT  4   N3  A ? ? 1_555 D DA 12 N1 A ? C DT  4   D DA 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? C DT  4   O4  A ? ? 1_555 D DA 12 N6 A ? C DT  4   D DA 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? C DA  5   N1  A ? ? 1_555 D DT 11 N3 A ? C DA  5   D DT 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? C DA  5   N6  A ? ? 1_555 D DT 11 O4 A ? C DA  5   D DT 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? C DG  6   N1  A ? ? 1_555 D DC 10 N3 A ? C DG  6   D DC 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? C DG  6   N2  A ? ? 1_555 D DC 10 O2 A ? C DG  6   D DC 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? C DG  6   O6  A ? ? 1_555 D DC 10 N4 A ? C DG  6   D DC 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? C DG  7   N1  A ? ? 1_555 D DC 9  N3 A ? C DG  7   D DC 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? C DG  7   N2  A ? ? 1_555 D DC 9  O2 A ? C DG  7   D DC 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? C DG  7   O6  A ? ? 1_555 D DC 9  N4 A ? C DG  7   D DC 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? C DC  9   N3  A ? ? 1_555 D DG 7  N1 A ? C DC  9   D DG 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? C DC  9   N4  A ? ? 1_555 D DG 7  O6 A ? C DC  9   D DG 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? C DC  9   O2  A ? ? 1_555 D DG 7  N2 A ? C DC  9   D DG 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? C DC  10  N3  A ? ? 1_555 D DG 6  N1 A ? C DC  10  D DG 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? C DC  10  N4  A ? ? 1_555 D DG 6  O6 A ? C DC  10  D DG 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? C DC  10  O2  A ? ? 1_555 D DG 6  N2 A ? C DC  10  D DG 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? C DC  11  N3  A ? ? 1_555 D DG 5  N1 A ? C DC  11  D DG 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? C DC  11  N4  A ? ? 1_555 D DG 5  O6 A ? C DC  11  D DG 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? C DC  11  O2  A ? ? 1_555 D DG 5  N2 A ? C DC  11  D DG 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? C DG  12  N1  A ? ? 1_555 D DC 4  N3 A ? C DG  12  D DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? C DG  12  N2  A ? ? 1_555 D DC 4  O2 A ? C DG  12  D DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? C DG  12  O6  A ? ? 1_555 D DC 4  N4 A ? C DG  12  D DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? C DT  13  N3  A ? ? 1_555 D DA 3  N1 A ? C DT  13  D DA 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? C DT  13  O4  A ? ? 1_555 D DA 3  N6 A ? C DT  13  D DA 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? C DC  14  N3  A ? ? 1_555 D DG 2  N1 A ? C DC  14  D DG 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? C DC  14  N4  A ? ? 1_555 D DG 2  O6 A ? C DC  14  D DG 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? C DC  14  O2  A ? ? 1_555 D DG 2  N2 A ? C DC  14  D DG 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? C DC  15  N3  A ? ? 1_555 D DG 1  N1 A ? C DC  15  D DG 1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? C DC  15  N4  A ? ? 1_555 D DG 1  O6 A ? C DC  15  D DG 1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? C DC  15  O2  A ? ? 1_555 D DG 1  N2 A ? C DC  15  D DG 1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LYS 100 A . ? LYS 100 A PRO 101 A ? PRO 101 A 1 -3.79 
2 LYS 100 B . ? LYS 100 B PRO 101 B ? PRO 101 B 1 -3.75 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 6 ? 
AA3 ? 6 ? 
AA4 ? 6 ? 
AA5 ? 5 ? 
AA6 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 5 6 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA3 5 6 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA4 5 6 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? parallel      
AA5 4 5 ? parallel      
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? parallel      
AA6 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 6   ? THR A 10  ? VAL A 6   THR A 10  
AA1 2 GLU A 103 ? PHE A 118 ? GLU A 103 PHE A 118 
AA1 3 MET A 30  ? ASP A 42  ? MET A 30  ASP A 42  
AA1 4 LYS A 46  ? VAL A 58  ? LYS A 46  VAL A 58  
AA1 5 PRO A 92  ? ARG A 98  ? PRO A 92  ARG A 98  
AA1 6 ARG A 83  ? LEU A 88  ? ARG A 83  LEU A 88  
AA2 1 ASN A 76  ? GLN A 78  ? ASN A 76  GLN A 78  
AA2 2 PHE A 64  ? HIS A 67  ? PHE A 64  HIS A 67  
AA2 3 LYS A 46  ? VAL A 58  ? LYS A 46  VAL A 58  
AA2 4 MET A 30  ? ASP A 42  ? MET A 30  ASP A 42  
AA2 5 GLU A 103 ? PHE A 118 ? GLU A 103 PHE A 118 
AA2 6 ALA B 127 ? THR B 129 ? ALA B 127 THR B 129 
AA3 1 ALA A 127 ? THR A 129 ? ALA A 127 THR A 129 
AA3 2 LYS B 46  ? VAL B 58  ? LYS B 46  VAL B 58  
AA3 3 MET B 30  ? ASP B 42  ? MET B 30  ASP B 42  
AA3 4 GLU B 103 ? PHE B 118 ? GLU B 103 PHE B 118 
AA3 5 PHE B 64  ? HIS B 67  ? PHE B 64  HIS B 67  
AA3 6 ASN B 76  ? GLN B 78  ? ASN B 76  GLN B 78  
AA4 1 VAL B 6   ? THR B 10  ? VAL B 6   THR B 10  
AA4 2 GLU B 103 ? PHE B 118 ? GLU B 103 PHE B 118 
AA4 3 MET B 30  ? ASP B 42  ? MET B 30  ASP B 42  
AA4 4 LYS B 46  ? VAL B 58  ? LYS B 46  VAL B 58  
AA4 5 PRO B 92  ? ARG B 98  ? PRO B 92  ARG B 98  
AA4 6 ARG B 83  ? LEU B 88  ? ARG B 83  LEU B 88  
AA5 1 LYS A 151 ? ALA A 158 ? LYS A 151 ALA A 158 
AA5 2 ILE A 163 ? ARG A 169 ? ILE A 163 ARG A 169 
AA5 3 ILE A 175 ? LEU A 180 ? ILE A 175 LEU A 180 
AA5 4 VAL A 208 ? ALA A 214 ? VAL A 208 ALA A 214 
AA5 5 GLU A 231 ? LYS A 234 ? GLU A 231 LYS A 234 
AA6 1 LYS B 151 ? ALA B 158 ? LYS B 151 ALA B 158 
AA6 2 ILE B 163 ? ARG B 169 ? ILE B 163 ARG B 169 
AA6 3 ILE B 175 ? LEU B 180 ? ILE B 175 LEU B 180 
AA6 4 ARG B 209 ? ALA B 214 ? ARG B 209 ALA B 214 
AA6 5 GLU B 231 ? LYS B 234 ? GLU B 231 LYS B 234 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ILE A 9   ? N ILE A 9   O VAL A 115 ? O VAL A 115 
AA1 2 3 O THR A 104 ? O THR A 104 N ASP A 42  ? N ASP A 42  
AA1 3 4 N ILE A 33  ? N ILE A 33  O ILE A 56  ? O ILE A 56  
AA1 5 6 O VAL A 95  ? O VAL A 95  N ARG A 85  ? N ARG A 85  
AA2 1 2 O GLN A 78  ? O GLN A 78  N PHE A 64  ? N PHE A 64  
AA2 2 3 O LEU A 65  ? O LEU A 65  N ILE A 57  ? N ILE A 57  
AA2 3 4 O ILE A 56  ? O ILE A 56  N ILE A 33  ? N ILE A 33  
AA2 4 5 N ASP A 42  ? N ASP A 42  O THR A 104 ? O THR A 104 
AA3 1 2 N THR A 129 ? N THR A 129 O LYS B 46  ? O LYS B 46  
AA3 2 3 O GLY B 52  ? O GLY B 52  N CYS B 37  ? N CYS B 37  
AA3 3 4 N ASP B 42  ? N ASP B 42  O THR B 104 ? O THR B 104 
AA3 5 6 N PHE B 64  ? N PHE B 64  O GLN B 78  ? O GLN B 78  
AA4 1 2 N ILE B 9   ? N ILE B 9   O VAL B 115 ? O VAL B 115 
AA4 2 3 O THR B 104 ? O THR B 104 N ASP B 42  ? N ASP B 42  
AA4 3 4 N CYS B 37  ? N CYS B 37  O GLY B 52  ? O GLY B 52  
AA4 5 6 O ILE B 97  ? O ILE B 97  N ARG B 83  ? N ARG B 83  
AA5 1 2 N LYS A 151 ? N LYS A 151 O ARG A 169 ? O ARG A 169 
AA5 2 3 N GLY A 168 ? N GLY A 168 O VAL A 176 ? O VAL A 176 
AA5 3 4 N GLU A 179 ? N GLU A 179 O VAL A 213 ? O VAL A 213 
AA5 4 5 N LEU A 212 ? N LEU A 212 O GLU A 231 ? O GLU A 231 
AA6 1 2 N LYS B 151 ? N LYS B 151 O ARG B 169 ? O ARG B 169 
AA6 2 3 N GLY B 168 ? N GLY B 168 O VAL B 176 ? O VAL B 176 
AA6 3 4 N VAL B 177 ? N VAL B 177 O ILE B 211 ? O ILE B 211 
AA6 4 5 N LEU B 212 ? N LEU B 212 O GLU B 231 ? O GLU B 231 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MG  301 ? 7  'binding site for residue MG A 301'  
AC2 Software A MPD 302 ? 4  'binding site for residue MPD A 302' 
AC3 Software B MG  301 ? 6  'binding site for residue MG B 301'  
AC4 Software C MPD 101 ? 10 'binding site for residue MPD C 101' 
AC5 Software C MPD 102 ? 8  'binding site for residue MPD C 102' 
AC6 Software C MPD 103 ? 8  'binding site for residue MPD C 103' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7  GLU A 179 ? GLU A 179 . ? 1_555 ? 
2  AC1 7  LYS A 181 ? LYS A 181 . ? 1_555 ? 
3  AC1 7  GLN A 192 ? GLN A 192 . ? 1_555 ? 
4  AC1 7  DA  C 5   ? DA  C 5   . ? 1_555 ? 
5  AC1 7  DG  C 6   ? DG  C 6   . ? 1_555 ? 
6  AC1 7  DG  D 5   ? DG  D 5   . ? 1_555 ? 
7  AC1 7  DG  D 6   ? DG  D 6   . ? 1_555 ? 
8  AC2 4  THR A 10  ? THR A 10  . ? 1_555 ? 
9  AC2 4  SER A 11  ? SER A 11  . ? 1_555 ? 
10 AC2 4  GLU A 16  ? GLU A 16  . ? 1_555 ? 
11 AC2 4  ASP B 172 ? ASP B 172 . ? 5_554 ? 
12 AC3 6  GLU B 179 ? GLU B 179 . ? 1_555 ? 
13 AC3 6  GLN B 192 ? GLN B 192 . ? 1_555 ? 
14 AC3 6  DA  C 5   ? DA  C 5   . ? 1_555 ? 
15 AC3 6  DG  C 6   ? DG  C 6   . ? 1_555 ? 
16 AC3 6  DG  D 5   ? DG  D 5   . ? 1_555 ? 
17 AC3 6  DG  D 6   ? DG  D 6   . ? 1_555 ? 
18 AC4 10 TRP B 77  ? TRP B 77  . ? 1_555 ? 
19 AC4 10 DG  C 6   ? DG  C 6   . ? 1_555 ? 
20 AC4 10 DG  C 7   ? DG  C 7   . ? 1_555 ? 
21 AC4 10 DT  C 8   ? DT  C 8   . ? 1_555 ? 
22 AC4 10 DC  C 9   ? DC  C 9   . ? 1_555 ? 
23 AC4 10 DC  C 11  ? DC  C 11  . ? 1_555 ? 
24 AC4 10 DG  D 6   ? DG  D 6   . ? 1_555 ? 
25 AC4 10 DG  D 7   ? DG  D 7   . ? 1_555 ? 
26 AC4 10 DG  D 8   ? DG  D 8   . ? 1_555 ? 
27 AC4 10 DC  D 9   ? DC  D 9   . ? 1_555 ? 
28 AC5 8  GLU A 156 ? GLU A 156 . ? 1_555 ? 
29 AC5 8  DA  C 5   ? DA  C 5   . ? 1_555 ? 
30 AC5 8  DG  C 6   ? DG  C 6   . ? 1_555 ? 
31 AC5 8  DG  C 12  ? DG  C 12  . ? 1_555 ? 
32 AC5 8  DG  D 5   ? DG  D 5   . ? 1_555 ? 
33 AC5 8  DG  D 6   ? DG  D 6   . ? 1_555 ? 
34 AC5 8  DA  D 12  ? DA  D 12  . ? 1_555 ? 
35 AC5 8  DG  D 13  ? DG  D 13  . ? 1_555 ? 
36 AC6 8  GLU B 156 ? GLU B 156 . ? 1_555 ? 
37 AC6 8  DA  C 5   ? DA  C 5   . ? 1_555 ? 
38 AC6 8  DG  C 6   ? DG  C 6   . ? 1_555 ? 
39 AC6 8  DG  C 12  ? DG  C 12  . ? 1_555 ? 
40 AC6 8  DT  C 13  ? DT  C 13  . ? 1_555 ? 
41 AC6 8  DG  D 6   ? DG  D 6   . ? 1_555 ? 
42 AC6 8  DA  D 12  ? DA  D 12  . ? 1_555 ? 
43 AC6 8  DG  D 13  ? DG  D 13  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          5GKI 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    5GKI 
_atom_sites.fract_transf_matrix[1][1]   0.010866 
_atom_sites.fract_transf_matrix[1][2]   0.006274 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012547 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.002467 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . SER A 1 2   ? -9.611  43.217 -24.350 1.00 69.21  ? 2   SER A N     1 
ATOM   2    C  CA    . SER A 1 2   ? -8.191  43.503 -24.556 1.00 99.33  ? 2   SER A CA    1 
ATOM   3    C  C     . SER A 1 2   ? -7.587  42.823 -25.803 1.00 115.18 ? 2   SER A C     1 
ATOM   4    O  O     . SER A 1 2   ? -6.630  43.334 -26.394 1.00 119.59 ? 2   SER A O     1 
ATOM   5    C  CB    . SER A 1 2   ? -7.397  43.088 -23.311 1.00 120.84 ? 2   SER A CB    1 
ATOM   6    O  OG    . SER A 1 2   ? -6.043  42.797 -23.633 1.00 115.21 ? 2   SER A OG    1 
ATOM   7    N  N     . LYS A 1 3   ? -8.146  41.668 -26.179 1.00 102.31 ? 3   LYS A N     1 
ATOM   8    C  CA    . LYS A 1 3   ? -7.624  40.769 -27.227 1.00 84.01  ? 3   LYS A CA    1 
ATOM   9    C  C     . LYS A 1 3   ? -8.809  39.941 -27.772 1.00 82.69  ? 3   LYS A C     1 
ATOM   10   O  O     . LYS A 1 3   ? -9.957  40.389 -27.736 1.00 47.64  ? 3   LYS A O     1 
ATOM   11   C  CB    . LYS A 1 3   ? -6.488  39.844 -26.715 1.00 85.12  ? 3   LYS A CB    1 
ATOM   12   C  CG    . LYS A 1 3   ? -5.495  40.451 -25.686 1.00 76.31  ? 3   LYS A CG    1 
ATOM   13   C  CD    . LYS A 1 3   ? -4.315  39.521 -25.363 1.00 92.43  ? 3   LYS A CD    1 
ATOM   14   C  CE    . LYS A 1 3   ? -3.656  39.864 -24.016 1.00 59.64  ? 3   LYS A CE    1 
ATOM   15   N  NZ    . LYS A 1 3   ? -3.475  41.322 -23.810 1.00 37.13  ? 3   LYS A NZ    1 
ATOM   16   N  N     . ASP A 1 4   ? -8.519  38.784 -28.364 1.00 92.74  ? 4   ASP A N     1 
ATOM   17   C  CA    . ASP A 1 4   ? -9.560  37.796 -28.682 1.00 49.43  ? 4   ASP A CA    1 
ATOM   18   C  C     . ASP A 1 4   ? -10.274 37.324 -27.434 1.00 57.38  ? 4   ASP A C     1 
ATOM   19   O  O     . ASP A 1 4   ? -9.770  37.491 -26.328 1.00 59.35  ? 4   ASP A O     1 
ATOM   20   C  CB    . ASP A 1 4   ? -8.977  36.561 -29.351 1.00 50.30  ? 4   ASP A CB    1 
ATOM   21   C  CG    . ASP A 1 4   ? -8.428  36.841 -30.700 1.00 67.42  ? 4   ASP A CG    1 
ATOM   22   O  OD1   . ASP A 1 4   ? -8.879  37.821 -31.330 1.00 80.44  ? 4   ASP A OD1   1 
ATOM   23   O  OD2   . ASP A 1 4   ? -7.544  36.073 -31.124 1.00 64.15  ? 4   ASP A OD2   1 
ATOM   24   N  N     . LYS A 1 5   ? -11.454 36.740 -27.612 1.00 49.36  ? 5   LYS A N     1 
ATOM   25   C  CA    . LYS A 1 5   ? -12.188 36.148 -26.495 1.00 23.26  ? 5   LYS A CA    1 
ATOM   26   C  C     . LYS A 1 5   ? -11.354 35.104 -25.731 1.00 40.37  ? 5   LYS A C     1 
ATOM   27   O  O     . LYS A 1 5   ? -11.407 35.040 -24.498 1.00 25.46  ? 5   LYS A O     1 
ATOM   28   C  CB    . LYS A 1 5   ? -13.477 35.508 -26.995 1.00 23.07  ? 5   LYS A CB    1 
ATOM   29   C  CG    . LYS A 1 5   ? -14.635 35.532 -26.009 1.00 15.31  ? 5   LYS A CG    1 
ATOM   30   C  CD    . LYS A 1 5   ? -15.414 36.825 -26.118 1.00 8.20   ? 5   LYS A CD    1 
ATOM   31   C  CE    . LYS A 1 5   ? -16.918 36.576 -26.118 1.00 11.98  ? 5   LYS A CE    1 
ATOM   32   N  NZ    . LYS A 1 5   ? -17.767 37.821 -26.044 1.00 10.95  ? 5   LYS A NZ    1 
ATOM   33   N  N     . VAL A 1 6   ? -10.583 34.290 -26.450 1.00 23.15  ? 6   VAL A N     1 
ATOM   34   C  CA    . VAL A 1 6   ? -9.826  33.229 -25.795 1.00 13.01  ? 6   VAL A CA    1 
ATOM   35   C  C     . VAL A 1 6   ? -8.368  33.146 -26.227 1.00 13.11  ? 6   VAL A C     1 
ATOM   36   O  O     . VAL A 1 6   ? -8.037  33.257 -27.404 1.00 41.30  ? 6   VAL A O     1 
ATOM   37   C  CB    . VAL A 1 6   ? -10.483 31.845 -26.036 1.00 39.42  ? 6   VAL A CB    1 
ATOM   38   C  CG1   . VAL A 1 6   ? -9.542  30.698 -25.646 1.00 16.55  ? 6   VAL A CG1   1 
ATOM   39   C  CG2   . VAL A 1 6   ? -11.787 31.732 -25.272 1.00 18.87  ? 6   VAL A CG2   1 
ATOM   40   N  N     . THR A 1 7   ? -7.503  32.948 -25.242 1.00 13.46  ? 7   THR A N     1 
ATOM   41   C  CA    . THR A 1 7   ? -6.103  32.629 -25.450 1.00 9.90   ? 7   THR A CA    1 
ATOM   42   C  C     . THR A 1 7   ? -5.790  31.253 -24.833 1.00 12.23  ? 7   THR A C     1 
ATOM   43   O  O     . THR A 1 7   ? -6.289  30.909 -23.769 1.00 36.43  ? 7   THR A O     1 
ATOM   44   C  CB    . THR A 1 7   ? -5.208  33.700 -24.828 1.00 9.89   ? 7   THR A CB    1 
ATOM   45   O  OG1   . THR A 1 7   ? -5.819  34.986 -24.991 1.00 19.66  ? 7   THR A OG1   1 
ATOM   46   C  CG2   . THR A 1 7   ? -3.832  33.692 -25.463 1.00 10.24  ? 7   THR A CG2   1 
ATOM   47   N  N     . VAL A 1 8   ? -4.964  30.471 -25.503 1.00 10.84  ? 8   VAL A N     1 
ATOM   48   C  CA    . VAL A 1 8   ? -4.653  29.113 -25.085 1.00 10.42  ? 8   VAL A CA    1 
ATOM   49   C  C     . VAL A 1 8   ? -3.184  28.862 -25.334 1.00 18.04  ? 8   VAL A C     1 
ATOM   50   O  O     . VAL A 1 8   ? -2.691  29.152 -26.423 1.00 22.84  ? 8   VAL A O     1 
ATOM   51   C  CB    . VAL A 1 8   ? -5.459  28.050 -25.884 1.00 6.78   ? 8   VAL A CB    1 
ATOM   52   C  CG1   . VAL A 1 8   ? -4.873  26.662 -25.687 1.00 7.57   ? 8   VAL A CG1   1 
ATOM   53   C  CG2   . VAL A 1 8   ? -6.931  28.083 -25.535 1.00 10.15  ? 8   VAL A CG2   1 
ATOM   54   N  N     . ILE A 1 9   ? -2.479  28.315 -24.355 1.00 10.74  ? 9   ILE A N     1 
ATOM   55   C  CA    . ILE A 1 9   ? -1.135  27.827 -24.621 1.00 11.05  ? 9   ILE A CA    1 
ATOM   56   C  C     . ILE A 1 9   ? -0.924  26.467 -23.998 1.00 19.89  ? 9   ILE A C     1 
ATOM   57   O  O     . ILE A 1 9   ? -1.105  26.291 -22.802 1.00 34.35  ? 9   ILE A O     1 
ATOM   58   C  CB    . ILE A 1 9   ? -0.065  28.765 -24.088 1.00 15.07  ? 9   ILE A CB    1 
ATOM   59   C  CG1   . ILE A 1 9   ? -0.153  30.125 -24.772 1.00 7.08   ? 9   ILE A CG1   1 
ATOM   60   C  CG2   . ILE A 1 9   ? 1.309   28.160 -24.293 1.00 15.90  ? 9   ILE A CG2   1 
ATOM   61   C  CD1   . ILE A 1 9   ? 0.713   31.152 -24.130 1.00 11.21  ? 9   ILE A CD1   1 
ATOM   62   N  N     . THR A 1 10  ? -0.529  25.508 -24.818 1.00 22.30  ? 10  THR A N     1 
ATOM   63   C  CA    . THR A 1 10  ? -0.229  24.169 -24.343 1.00 17.44  ? 10  THR A CA    1 
ATOM   64   C  C     . THR A 1 10  ? 1.255   24.022 -24.042 1.00 17.43  ? 10  THR A C     1 
ATOM   65   O  O     . THR A 1 10  ? 2.094   24.574 -24.756 1.00 49.97  ? 10  THR A O     1 
ATOM   66   C  CB    . THR A 1 10  ? -0.650  23.137 -25.372 1.00 19.42  ? 10  THR A CB    1 
ATOM   67   O  OG1   . THR A 1 10  ? 0.011   23.424 -26.613 1.00 33.08  ? 10  THR A OG1   1 
ATOM   68   C  CG2   . THR A 1 10  ? -2.148  23.221 -25.580 1.00 20.30  ? 10  THR A CG2   1 
ATOM   69   N  N     . SER A 1 11  ? 1.562   23.252 -23.001 1.00 25.18  ? 11  SER A N     1 
ATOM   70   C  CA    . SER A 1 11  ? 2.916   23.118 -22.459 1.00 15.28  ? 11  SER A CA    1 
ATOM   71   C  C     . SER A 1 11  ? 3.599   24.472 -22.399 1.00 22.73  ? 11  SER A C     1 
ATOM   72   O  O     . SER A 1 11  ? 4.571   24.707 -23.115 1.00 30.18  ? 11  SER A O     1 
ATOM   73   C  CB    . SER A 1 11  ? 3.748   22.153 -23.297 1.00 14.01  ? 11  SER A CB    1 
ATOM   74   O  OG    . SER A 1 11  ? 3.005   21.001 -23.653 1.00 39.41  ? 11  SER A OG    1 
ATOM   75   N  N     . PRO A 1 12  ? 3.072   25.385 -21.573 1.00 25.67  ? 12  PRO A N     1 
ATOM   76   C  CA    . PRO A 1 12  ? 3.650   26.726 -21.560 1.00 28.59  ? 12  PRO A CA    1 
ATOM   77   C  C     . PRO A 1 12  ? 4.965   26.778 -20.817 1.00 21.60  ? 12  PRO A C     1 
ATOM   78   O  O     . PRO A 1 12  ? 5.214   25.965 -19.927 1.00 23.59  ? 12  PRO A O     1 
ATOM   79   C  CB    . PRO A 1 12  ? 2.596   27.554 -20.831 1.00 11.01  ? 12  PRO A CB    1 
ATOM   80   C  CG    . PRO A 1 12  ? 1.948   26.602 -19.940 1.00 15.18  ? 12  PRO A CG    1 
ATOM   81   C  CD    . PRO A 1 12  ? 1.940   25.277 -20.640 1.00 19.24  ? 12  PRO A CD    1 
ATOM   82   N  N     . SER A 1 13  ? 5.800   27.723 -21.220 1.00 11.73  ? 13  SER A N     1 
ATOM   83   C  CA    . SER A 1 13  ? 6.963   28.121 -20.455 1.00 21.76  ? 13  SER A CA    1 
ATOM   84   C  C     . SER A 1 13  ? 6.507   28.933 -19.252 1.00 42.48  ? 13  SER A C     1 
ATOM   85   O  O     . SER A 1 13  ? 5.397   29.474 -19.247 1.00 30.99  ? 13  SER A O     1 
ATOM   86   C  CB    . SER A 1 13  ? 7.894   28.960 -21.308 1.00 35.06  ? 13  SER A CB    1 
ATOM   87   O  OG    . SER A 1 13  ? 7.235   30.173 -21.651 1.00 24.99  ? 13  SER A OG    1 
ATOM   88   N  N     . THR A 1 14  ? 7.368   29.038 -18.247 1.00 20.45  ? 14  THR A N     1 
ATOM   89   C  CA    . THR A 1 14  ? 7.051   29.835 -17.079 1.00 27.83  ? 14  THR A CA    1 
ATOM   90   C  C     . THR A 1 14  ? 6.670   31.264 -17.462 1.00 33.66  ? 14  THR A C     1 
ATOM   91   O  O     . THR A 1 14  ? 5.701   31.819 -16.931 1.00 17.10  ? 14  THR A O     1 
ATOM   92   C  CB    . THR A 1 14  ? 8.221   29.876 -16.082 1.00 25.95  ? 14  THR A CB    1 
ATOM   93   O  OG1   . THR A 1 14  ? 8.782   28.570 -15.938 1.00 19.61  ? 14  THR A OG1   1 
ATOM   94   C  CG2   . THR A 1 14  ? 7.724   30.312 -14.730 1.00 13.14  ? 14  THR A CG2   1 
ATOM   95   N  N     . GLU A 1 15  ? 7.421   31.848 -18.390 1.00 28.60  ? 15  GLU A N     1 
ATOM   96   C  CA    . GLU A 1 15  ? 7.134   33.202 -18.842 1.00 28.16  ? 15  GLU A CA    1 
ATOM   97   C  C     . GLU A 1 15  ? 5.735   33.257 -19.450 1.00 31.32  ? 15  GLU A C     1 
ATOM   98   O  O     . GLU A 1 15  ? 4.967   34.187 -19.159 1.00 13.06  ? 15  GLU A O     1 
ATOM   99   C  CB    . GLU A 1 15  ? 8.184   33.691 -19.852 1.00 32.12  ? 15  GLU A CB    1 
ATOM   100  C  CG    . GLU A 1 15  ? 9.627   33.442 -19.432 1.00 84.13  ? 15  GLU A CG    1 
ATOM   101  C  CD    . GLU A 1 15  ? 10.101  32.039 -19.780 1.00 101.20 ? 15  GLU A CD    1 
ATOM   102  O  OE1   . GLU A 1 15  ? 10.435  31.813 -20.968 1.00 90.84  ? 15  GLU A OE1   1 
ATOM   103  O  OE2   . GLU A 1 15  ? 10.120  31.167 -18.872 1.00 55.93  ? 15  GLU A OE2   1 
ATOM   104  N  N     . GLU A 1 16  ? 5.399   32.257 -20.274 1.00 19.68  ? 16  GLU A N     1 
ATOM   105  C  CA    . GLU A 1 16  ? 4.057   32.180 -20.873 1.00 26.41  ? 16  GLU A CA    1 
ATOM   106  C  C     . GLU A 1 16  ? 2.990   31.998 -19.788 1.00 36.04  ? 16  GLU A C     1 
ATOM   107  O  O     . GLU A 1 16  ? 2.001   32.744 -19.756 1.00 19.13  ? 16  GLU A O     1 
ATOM   108  C  CB    . GLU A 1 16  ? 3.955   31.045 -21.901 1.00 12.51  ? 16  GLU A CB    1 
ATOM   109  C  CG    . GLU A 1 16  ? 4.772   31.265 -23.166 1.00 32.82  ? 16  GLU A CG    1 
ATOM   110  C  CD    . GLU A 1 16  ? 4.839   30.039 -24.089 1.00 48.57  ? 16  GLU A CD    1 
ATOM   111  O  OE1   . GLU A 1 16  ? 5.086   28.912 -23.591 1.00 40.52  ? 16  GLU A OE1   1 
ATOM   112  O  OE2   . GLU A 1 16  ? 4.657   30.210 -25.323 1.00 44.30  ? 16  GLU A OE2   1 
ATOM   113  N  N     . LEU A 1 17  ? 3.210   31.020 -18.899 1.00 28.39  ? 17  LEU A N     1 
ATOM   114  C  CA    . LEU A 1 17  ? 2.309   30.758 -17.768 1.00 12.91  ? 17  LEU A CA    1 
ATOM   115  C  C     . LEU A 1 17  ? 2.013   32.019 -16.975 1.00 17.19  ? 17  LEU A C     1 
ATOM   116  O  O     . LEU A 1 17  ? 0.848   32.384 -16.779 1.00 13.83  ? 17  LEU A O     1 
ATOM   117  C  CB    . LEU A 1 17  ? 2.898   29.702 -16.833 1.00 9.57   ? 17  LEU A CB    1 
ATOM   118  C  CG    . LEU A 1 17  ? 2.065   29.372 -15.584 1.00 7.36   ? 17  LEU A CG    1 
ATOM   119  C  CD1   . LEU A 1 17  ? 0.633   29.053 -15.954 1.00 6.80   ? 17  LEU A CD1   1 
ATOM   120  C  CD2   . LEU A 1 17  ? 2.670   28.222 -14.808 1.00 4.36   ? 17  LEU A CD2   1 
ATOM   121  N  N     . VAL A 1 18  ? 3.075   32.684 -16.529 1.00 19.43  ? 18  VAL A N     1 
ATOM   122  C  CA    . VAL A 1 18  ? 2.944   33.960 -15.836 1.00 27.92  ? 18  VAL A CA    1 
ATOM   123  C  C     . VAL A 1 18  ? 2.203   35.007 -16.655 1.00 16.08  ? 18  VAL A C     1 
ATOM   124  O  O     . VAL A 1 18  ? 1.291   35.665 -16.159 1.00 16.06  ? 18  VAL A O     1 
ATOM   125  C  CB    . VAL A 1 18  ? 4.301   34.546 -15.476 1.00 22.43  ? 18  VAL A CB    1 
ATOM   126  C  CG1   . VAL A 1 18  ? 4.106   35.949 -14.955 1.00 4.45   ? 18  VAL A CG1   1 
ATOM   127  C  CG2   . VAL A 1 18  ? 5.035   33.653 -14.458 1.00 6.25   ? 18  VAL A CG2   1 
ATOM   128  N  N     . SER A 1 19  ? 2.605   35.152 -17.910 1.00 19.48  ? 19  SER A N     1 
ATOM   129  C  CA    . SER A 1 19  ? 2.005   36.140 -18.794 1.00 24.05  ? 19  SER A CA    1 
ATOM   130  C  C     . SER A 1 19  ? 0.494   35.999 -18.820 1.00 25.17  ? 19  SER A C     1 
ATOM   131  O  O     . SER A 1 19  ? -0.233  36.978 -18.657 1.00 22.69  ? 19  SER A O     1 
ATOM   132  C  CB    . SER A 1 19  ? 2.572   36.005 -20.207 1.00 20.27  ? 19  SER A CB    1 
ATOM   133  O  OG    . SER A 1 19  ? 2.283   37.157 -20.976 1.00 42.38  ? 19  SER A OG    1 
ATOM   134  N  N     . LEU A 1 20  ? 0.029   34.766 -18.993 1.00 27.38  ? 20  LEU A N     1 
ATOM   135  C  CA    . LEU A 1 20  ? -1.395  34.503 -19.103 1.00 13.75  ? 20  LEU A CA    1 
ATOM   136  C  C     . LEU A 1 20  ? -2.137  34.716 -17.803 1.00 26.67  ? 20  LEU A C     1 
ATOM   137  O  O     . LEU A 1 20  ? -3.104  35.483 -17.764 1.00 28.35  ? 20  LEU A O     1 
ATOM   138  C  CB    . LEU A 1 20  ? -1.631  33.088 -19.594 1.00 18.12  ? 20  LEU A CB    1 
ATOM   139  C  CG    . LEU A 1 20  ? -2.194  33.093 -21.015 1.00 35.86  ? 20  LEU A CG    1 
ATOM   140  C  CD1   . LEU A 1 20  ? -1.183  33.675 -21.983 1.00 27.54  ? 20  LEU A CD1   1 
ATOM   141  C  CD2   . LEU A 1 20  ? -2.607  31.700 -21.432 1.00 40.57  ? 20  LEU A CD2   1 
ATOM   142  N  N     . VAL A 1 21  ? -1.679  34.046 -16.745 1.00 17.71  ? 21  VAL A N     1 
ATOM   143  C  CA    . VAL A 1 21  ? -2.272  34.204 -15.421 1.00 14.72  ? 21  VAL A CA    1 
ATOM   144  C  C     . VAL A 1 21  ? -2.432  35.680 -15.066 1.00 30.43  ? 21  VAL A C     1 
ATOM   145  O  O     . VAL A 1 21  ? -3.516  36.114 -14.661 1.00 33.73  ? 21  VAL A O     1 
ATOM   146  C  CB    . VAL A 1 21  ? -1.432  33.514 -14.341 1.00 15.86  ? 21  VAL A CB    1 
ATOM   147  C  CG1   . VAL A 1 21  ? -1.926  33.905 -12.966 1.00 4.69   ? 21  VAL A CG1   1 
ATOM   148  C  CG2   . VAL A 1 21  ? -1.483  32.007 -14.514 1.00 11.48  ? 21  VAL A CG2   1 
ATOM   149  N  N     . ASN A 1 22  ? -1.358  36.446 -15.251 1.00 31.28  ? 22  ASN A N     1 
ATOM   150  C  CA    . ASN A 1 22  ? -1.398  37.897 -15.074 1.00 27.44  ? 22  ASN A CA    1 
ATOM   151  C  C     . ASN A 1 22  ? -2.528  38.546 -15.868 1.00 30.51  ? 22  ASN A C     1 
ATOM   152  O  O     . ASN A 1 22  ? -3.357  39.274 -15.307 1.00 25.28  ? 22  ASN A O     1 
ATOM   153  C  CB    . ASN A 1 22  ? -0.073  38.538 -15.497 1.00 28.25  ? 22  ASN A CB    1 
ATOM   154  C  CG    . ASN A 1 22  ? 1.079   38.236 -14.535 1.00 76.78  ? 22  ASN A CG    1 
ATOM   155  O  OD1   . ASN A 1 22  ? 0.893   37.770 -13.390 1.00 24.02  ? 22  ASN A OD1   1 
ATOM   156  N  ND2   . ASN A 1 22  ? 2.290   38.519 -15.006 1.00 56.15  ? 22  ASN A ND2   1 
ATOM   157  N  N     . SER A 1 23  ? -2.553  38.282 -17.173 1.00 17.44  ? 23  SER A N     1 
ATOM   158  C  CA    . SER A 1 23  ? -3.561  38.873 -18.040 1.00 17.32  ? 23  SER A CA    1 
ATOM   159  C  C     . SER A 1 23  ? -4.952  38.546 -17.538 1.00 30.71  ? 23  SER A C     1 
ATOM   160  O  O     . SER A 1 23  ? -5.848  39.390 -17.577 1.00 22.00  ? 23  SER A O     1 
ATOM   161  C  CB    . SER A 1 23  ? -3.401  38.393 -19.477 1.00 27.47  ? 23  SER A CB    1 
ATOM   162  O  OG    . SER A 1 23  ? -2.158  38.797 -20.030 1.00 64.67  ? 23  SER A OG    1 
ATOM   163  N  N     . ALA A 1 24  ? -5.118  37.325 -17.034 1.00 28.44  ? 24  ALA A N     1 
ATOM   164  C  CA    . ALA A 1 24  ? -6.431  36.863 -16.614 1.00 17.26  ? 24  ALA A CA    1 
ATOM   165  C  C     . ALA A 1 24  ? -6.921  37.693 -15.447 1.00 24.56  ? 24  ALA A C     1 
ATOM   166  O  O     . ALA A 1 24  ? -8.013  38.280 -15.521 1.00 17.49  ? 24  ALA A O     1 
ATOM   167  C  CB    . ALA A 1 24  ? -6.396  35.393 -16.259 1.00 16.46  ? 24  ALA A CB    1 
ATOM   168  N  N     . LEU A 1 25  ? -6.113  37.763 -14.387 1.00 8.15   ? 25  LEU A N     1 
ATOM   169  C  CA    . LEU A 1 25  ? -6.493  38.537 -13.205 1.00 17.69  ? 25  LEU A CA    1 
ATOM   170  C  C     . LEU A 1 25  ? -6.708  39.998 -13.562 1.00 39.08  ? 25  LEU A C     1 
ATOM   171  O  O     . LEU A 1 25  ? -7.705  40.623 -13.166 1.00 26.46  ? 25  LEU A O     1 
ATOM   172  C  CB    . LEU A 1 25  ? -5.436  38.424 -12.120 1.00 12.45  ? 25  LEU A CB    1 
ATOM   173  C  CG    . LEU A 1 25  ? -5.107  36.970 -11.803 1.00 47.15  ? 25  LEU A CG    1 
ATOM   174  C  CD1   . LEU A 1 25  ? -4.005  36.891 -10.760 1.00 31.68  ? 25  LEU A CD1   1 
ATOM   175  C  CD2   . LEU A 1 25  ? -6.360  36.246 -11.335 1.00 29.69  ? 25  LEU A CD2   1 
ATOM   176  N  N     . LEU A 1 26  ? -5.773  40.529 -14.336 1.00 25.04  ? 26  LEU A N     1 
ATOM   177  C  CA    . LEU A 1 26  ? -5.841  41.913 -14.739 1.00 18.48  ? 26  LEU A CA    1 
ATOM   178  C  C     . LEU A 1 26  ? -7.073  42.214 -15.596 1.00 31.88  ? 26  LEU A C     1 
ATOM   179  O  O     . LEU A 1 26  ? -7.702  43.246 -15.399 1.00 44.27  ? 26  LEU A O     1 
ATOM   180  C  CB    . LEU A 1 26  ? -4.563  42.295 -15.477 1.00 50.05  ? 26  LEU A CB    1 
ATOM   181  C  CG    . LEU A 1 26  ? -4.124  43.755 -15.347 1.00 44.32  ? 26  LEU A CG    1 
ATOM   182  C  CD1   . LEU A 1 26  ? -4.373  44.279 -13.943 1.00 47.40  ? 26  LEU A CD1   1 
ATOM   183  C  CD2   . LEU A 1 26  ? -2.657  43.878 -15.700 1.00 30.53  ? 26  LEU A CD2   1 
ATOM   184  N  N     . GLU A 1 27  ? -7.445  41.319 -16.514 1.00 28.44  ? 27  GLU A N     1 
ATOM   185  C  CA    . GLU A 1 27  ? -8.559  41.602 -17.430 1.00 18.25  ? 27  GLU A CA    1 
ATOM   186  C  C     . GLU A 1 27  ? -9.956  41.180 -16.933 1.00 20.41  ? 27  GLU A C     1 
ATOM   187  O  O     . GLU A 1 27  ? -10.938 41.355 -17.656 1.00 27.25  ? 27  GLU A O     1 
ATOM   188  C  CB    . GLU A 1 27  ? -8.304  40.944 -18.789 1.00 14.54  ? 27  GLU A CB    1 
ATOM   189  C  CG    . GLU A 1 27  ? -7.126  41.507 -19.563 1.00 31.68  ? 27  GLU A CG    1 
ATOM   190  C  CD    . GLU A 1 27  ? -6.787  40.669 -20.777 1.00 43.02  ? 27  GLU A CD    1 
ATOM   191  O  OE1   . GLU A 1 27  ? -7.713  40.394 -21.562 1.00 55.40  ? 27  GLU A OE1   1 
ATOM   192  O  OE2   . GLU A 1 27  ? -5.610  40.271 -20.943 1.00 43.36  ? 27  GLU A OE2   1 
ATOM   193  N  N     . GLU A 1 28  ? -10.042 40.659 -15.709 1.00 18.03  ? 28  GLU A N     1 
ATOM   194  C  CA    . GLU A 1 28  ? -11.285 40.102 -15.142 1.00 23.98  ? 28  GLU A CA    1 
ATOM   195  C  C     . GLU A 1 28  ? -11.777 38.965 -16.001 1.00 27.73  ? 28  GLU A C     1 
ATOM   196  O  O     . GLU A 1 28  ? -12.984 38.809 -16.194 1.00 29.24  ? 28  GLU A O     1 
ATOM   197  C  CB    . GLU A 1 28  ? -12.419 41.134 -15.006 1.00 16.83  ? 28  GLU A CB    1 
ATOM   198  C  CG    . GLU A 1 28  ? -12.218 42.251 -13.991 1.00 54.02  ? 28  GLU A CG    1 
ATOM   199  C  CD    . GLU A 1 28  ? -12.282 41.803 -12.537 1.00 94.32  ? 28  GLU A CD    1 
ATOM   200  O  OE1   . GLU A 1 28  ? -13.152 40.966 -12.225 1.00 138.74 ? 28  GLU A OE1   1 
ATOM   201  O  OE2   . GLU A 1 28  ? -11.473 42.289 -11.703 1.00 48.80  ? 28  GLU A OE2   1 
ATOM   202  N  N     . ALA A 1 29  ? -10.838 38.178 -16.517 1.00 29.18  ? 29  ALA A N     1 
ATOM   203  C  CA    . ALA A 1 29  ? -11.174 37.004 -17.313 1.00 19.88  ? 29  ALA A CA    1 
ATOM   204  C  C     . ALA A 1 29  ? -11.217 35.748 -16.456 1.00 21.52  ? 29  ALA A C     1 
ATOM   205  O  O     . ALA A 1 29  ? -10.949 35.786 -15.250 1.00 31.27  ? 29  ALA A O     1 
ATOM   206  C  CB    . ALA A 1 29  ? -10.181 36.823 -18.435 1.00 16.46  ? 29  ALA A CB    1 
ATOM   207  N  N     . MET A 1 30  ? -11.545 34.630 -17.091 1.00 10.66  ? 30  MET A N     1 
ATOM   208  C  CA    . MET A 1 30  ? -11.549 33.361 -16.402 1.00 10.71  ? 30  MET A CA    1 
ATOM   209  C  C     . MET A 1 30  ? -10.279 32.628 -16.700 1.00 16.56  ? 30  MET A C     1 
ATOM   210  O  O     . MET A 1 30  ? -9.899  32.464 -17.862 1.00 23.81  ? 30  MET A O     1 
ATOM   211  C  CB    . MET A 1 30  ? -12.745 32.529 -16.807 1.00 10.14  ? 30  MET A CB    1 
ATOM   212  C  CG    . MET A 1 30  ? -14.034 33.167 -16.394 1.00 21.30  ? 30  MET A CG    1 
ATOM   213  S  SD    . MET A 1 30  ? -15.271 31.949 -15.978 1.00 48.45  ? 30  MET A SD    1 
ATOM   214  C  CE    . MET A 1 30  ? -16.359 32.056 -17.398 1.00 25.04  ? 30  MET A CE    1 
ATOM   215  N  N     . LEU A 1 31  ? -9.612  32.197 -15.642 1.00 10.90  ? 31  LEU A N     1 
ATOM   216  C  CA    . LEU A 1 31  ? -8.378  31.462 -15.805 1.00 13.64  ? 31  LEU A CA    1 
ATOM   217  C  C     . LEU A 1 31  ? -8.690  29.981 -15.756 1.00 23.77  ? 31  LEU A C     1 
ATOM   218  O  O     . LEU A 1 31  ? -9.384  29.513 -14.844 1.00 14.40  ? 31  LEU A O     1 
ATOM   219  C  CB    . LEU A 1 31  ? -7.360  31.839 -14.729 1.00 12.91  ? 31  LEU A CB    1 
ATOM   220  C  CG    . LEU A 1 31  ? -6.000  31.195 -14.954 1.00 13.30  ? 31  LEU A CG    1 
ATOM   221  C  CD1   . LEU A 1 31  ? -5.455  31.646 -16.278 1.00 23.91  ? 31  LEU A CD1   1 
ATOM   222  C  CD2   . LEU A 1 31  ? -5.072  31.580 -13.861 1.00 13.33  ? 31  LEU A CD2   1 
ATOM   223  N  N     . THR A 1 32  ? -8.196  29.245 -16.746 1.00 17.85  ? 32  THR A N     1 
ATOM   224  C  CA    . THR A 1 32  ? -8.365  27.801 -16.735 1.00 17.91  ? 32  THR A CA    1 
ATOM   225  C  C     . THR A 1 32  ? -7.038  27.109 -16.940 1.00 11.72  ? 32  THR A C     1 
ATOM   226  O  O     . THR A 1 32  ? -6.332  27.411 -17.884 1.00 25.87  ? 32  THR A O     1 
ATOM   227  C  CB    . THR A 1 32  ? -9.339  27.345 -17.805 1.00 17.55  ? 32  THR A CB    1 
ATOM   228  O  OG1   . THR A 1 32  ? -10.457 28.243 -17.832 1.00 33.16  ? 32  THR A OG1   1 
ATOM   229  C  CG2   . THR A 1 32  ? -9.815  25.920 -17.513 1.00 4.88   ? 32  THR A CG2   1 
ATOM   230  N  N     . ILE A 1 33  ? -6.700  26.182 -16.053 1.00 8.64   ? 33  ILE A N     1 
ATOM   231  C  CA    . ILE A 1 33  ? -5.445  25.463 -16.162 1.00 13.99  ? 33  ILE A CA    1 
ATOM   232  C  C     . ILE A 1 33  ? -5.682  23.958 -16.094 1.00 16.75  ? 33  ILE A C     1 
ATOM   233  O  O     . ILE A 1 33  ? -6.419  23.484 -15.247 1.00 21.86  ? 33  ILE A O     1 
ATOM   234  C  CB    . ILE A 1 33  ? -4.466  25.900 -15.057 1.00 17.50  ? 33  ILE A CB    1 
ATOM   235  C  CG1   . ILE A 1 33  ? -4.012  27.342 -15.309 1.00 18.68  ? 33  ILE A CG1   1 
ATOM   236  C  CG2   . ILE A 1 33  ? -3.283  24.946 -14.952 1.00 4.75   ? 33  ILE A CG2   1 
ATOM   237  C  CD1   . ILE A 1 33  ? -3.248  27.967 -14.155 1.00 18.66  ? 33  ILE A CD1   1 
ATOM   238  N  N     . PHE A 1 34  ? -5.091  23.220 -17.026 1.00 15.15  ? 34  PHE A N     1 
ATOM   239  C  CA    . PHE A 1 34  ? -4.988  21.772 -16.904 1.00 19.12  ? 34  PHE A CA    1 
ATOM   240  C  C     . PHE A 1 34  ? -3.591  21.454 -16.416 1.00 16.35  ? 34  PHE A C     1 
ATOM   241  O  O     . PHE A 1 34  ? -2.620  21.759 -17.097 1.00 21.07  ? 34  PHE A O     1 
ATOM   242  C  CB    . PHE A 1 34  ? -5.236  21.058 -18.239 1.00 17.61  ? 34  PHE A CB    1 
ATOM   243  C  CG    . PHE A 1 34  ? -6.562  21.367 -18.871 1.00 14.85  ? 34  PHE A CG    1 
ATOM   244  C  CD1   . PHE A 1 34  ? -7.585  21.947 -18.141 1.00 28.05  ? 34  PHE A CD1   1 
ATOM   245  C  CD2   . PHE A 1 34  ? -6.786  21.056 -20.197 1.00 15.06  ? 34  PHE A CD2   1 
ATOM   246  C  CE1   . PHE A 1 34  ? -8.802  22.233 -18.729 1.00 17.54  ? 34  PHE A CE1   1 
ATOM   247  C  CE2   . PHE A 1 34  ? -7.989  21.341 -20.797 1.00 18.11  ? 34  PHE A CE2   1 
ATOM   248  C  CZ    . PHE A 1 34  ? -9.004  21.932 -20.061 1.00 26.33  ? 34  PHE A CZ    1 
ATOM   249  N  N     . ALA A 1 35  ? -3.457  20.843 -15.253 1.00 9.89   ? 35  ALA A N     1 
ATOM   250  C  CA    . ALA A 1 35  ? -2.107  20.622 -14.755 1.00 14.98  ? 35  ALA A CA    1 
ATOM   251  C  C     . ALA A 1 35  ? -1.967  19.433 -13.833 1.00 23.61  ? 35  ALA A C     1 
ATOM   252  O  O     . ALA A 1 35  ? -2.914  19.023 -13.164 1.00 24.72  ? 35  ALA A O     1 
ATOM   253  C  CB    . ALA A 1 35  ? -1.614  21.863 -14.045 1.00 13.12  ? 35  ALA A CB    1 
ATOM   254  N  N     . ARG A 1 36  ? -0.764  18.882 -13.810 1.00 18.30  ? 36  ARG A N     1 
ATOM   255  C  CA    . ARG A 1 36  ? -0.381  17.956 -12.767 1.00 19.65  ? 36  ARG A CA    1 
ATOM   256  C  C     . ARG A 1 36  ? 0.026   18.819 -11.582 1.00 24.13  ? 36  ARG A C     1 
ATOM   257  O  O     . ARG A 1 36  ? 0.789   19.766 -11.756 1.00 18.76  ? 36  ARG A O     1 
ATOM   258  C  CB    . ARG A 1 36  ? 0.755   17.059 -13.236 1.00 20.76  ? 36  ARG A CB    1 
ATOM   259  C  CG    . ARG A 1 36  ? 1.251   16.086 -12.210 1.00 20.75  ? 36  ARG A CG    1 
ATOM   260  C  CD    . ARG A 1 36  ? 2.418   15.314 -12.757 1.00 19.16  ? 36  ARG A CD    1 
ATOM   261  N  NE    . ARG A 1 36  ? 3.569   15.409 -11.867 1.00 64.37  ? 36  ARG A NE    1 
ATOM   262  C  CZ    . ARG A 1 36  ? 4.795   15.717 -12.279 1.00 92.58  ? 36  ARG A CZ    1 
ATOM   263  N  NH1   . ARG A 1 36  ? 4.998   15.948 -13.576 1.00 63.32  ? 36  ARG A NH1   1 
ATOM   264  N  NH2   . ARG A 1 36  ? 5.808   15.786 -11.403 1.00 20.77  ? 36  ARG A NH2   1 
ATOM   265  N  N     . CYS A 1 37  ? -0.499  18.529 -10.393 1.00 31.45  ? 37  CYS A N     1 
ATOM   266  C  CA    . CYS A 1 37  ? -0.278  19.415 -9.246  1.00 25.77  ? 37  CYS A CA    1 
ATOM   267  C  C     . CYS A 1 37  ? -0.409  18.724 -7.886  1.00 26.02  ? 37  CYS A C     1 
ATOM   268  O  O     . CYS A 1 37  ? -0.911  17.609 -7.790  1.00 21.44  ? 37  CYS A O     1 
ATOM   269  C  CB    . CYS A 1 37  ? -1.254  20.597 -9.301  1.00 5.79   ? 37  CYS A CB    1 
ATOM   270  S  SG    . CYS A 1 37  ? -2.992  20.088 -9.294  1.00 27.04  ? 37  CYS A SG    1 
ATOM   271  N  N     . LYS A 1 38  ? 0.079   19.404 -6.853  1.00 23.17  ? 38  LYS A N     1 
ATOM   272  C  CA    . LYS A 1 38  ? -0.222  19.107 -5.451  1.00 18.62  ? 38  LYS A CA    1 
ATOM   273  C  C     . LYS A 1 38  ? -1.049  20.254 -4.868  1.00 32.54  ? 38  LYS A C     1 
ATOM   274  O  O     . LYS A 1 38  ? -0.879  21.411 -5.263  1.00 36.75  ? 38  LYS A O     1 
ATOM   275  C  CB    . LYS A 1 38  ? 1.062   18.928 -4.637  1.00 18.61  ? 38  LYS A CB    1 
ATOM   276  C  CG    . LYS A 1 38  ? 1.829   17.663 -4.959  1.00 27.71  ? 38  LYS A CG    1 
ATOM   277  C  CD    . LYS A 1 38  ? 3.204   17.710 -4.341  1.00 26.48  ? 38  LYS A CD    1 
ATOM   278  C  CE    . LYS A 1 38  ? 3.898   16.368 -4.430  1.00 33.96  ? 38  LYS A CE    1 
ATOM   279  N  NZ    . LYS A 1 38  ? 5.281   16.453 -3.880  1.00 38.47  ? 38  LYS A NZ    1 
ATOM   280  N  N     . VAL A 1 39  ? -1.938  19.952 -3.927  1.00 26.38  ? 39  VAL A N     1 
ATOM   281  C  CA    . VAL A 1 39  ? -2.779  20.997 -3.339  1.00 20.37  ? 39  VAL A CA    1 
ATOM   282  C  C     . VAL A 1 39  ? -2.682  21.006 -1.822  1.00 19.34  ? 39  VAL A C     1 
ATOM   283  O  O     . VAL A 1 39  ? -2.851  19.980 -1.174  1.00 23.28  ? 39  VAL A O     1 
ATOM   284  C  CB    . VAL A 1 39  ? -4.263  20.829 -3.742  1.00 18.80  ? 39  VAL A CB    1 
ATOM   285  C  CG1   . VAL A 1 39  ? -5.111  21.966 -3.170  1.00 9.59   ? 39  VAL A CG1   1 
ATOM   286  C  CG2   . VAL A 1 39  ? -4.399  20.773 -5.251  1.00 22.13  ? 39  VAL A CG2   1 
ATOM   287  N  N     . HIS A 1 40  ? -2.414  22.174 -1.256  1.00 26.21  ? 40  HIS A N     1 
ATOM   288  C  CA    . HIS A 1 40  ? -2.300  22.304 0.189   1.00 18.02  ? 40  HIS A CA    1 
ATOM   289  C  C     . HIS A 1 40  ? -3.313  23.336 0.670   1.00 16.69  ? 40  HIS A C     1 
ATOM   290  O  O     . HIS A 1 40  ? -3.370  24.443 0.137   1.00 23.56  ? 40  HIS A O     1 
ATOM   291  C  CB    . HIS A 1 40  ? -0.868  22.700 0.594   1.00 10.53  ? 40  HIS A CB    1 
ATOM   292  C  CG    . HIS A 1 40  ? 0.204   22.005 -0.201  1.00 69.09  ? 40  HIS A CG    1 
ATOM   293  N  ND1   . HIS A 1 40  ? 0.514   20.671 -0.034  1.00 38.52  ? 40  HIS A ND1   1 
ATOM   294  C  CD2   . HIS A 1 40  ? 1.032   22.464 -1.173  1.00 68.66  ? 40  HIS A CD2   1 
ATOM   295  C  CE1   . HIS A 1 40  ? 1.488   20.338 -0.867  1.00 48.13  ? 40  HIS A CE1   1 
ATOM   296  N  NE2   . HIS A 1 40  ? 1.820   21.406 -1.571  1.00 43.60  ? 40  HIS A NE2   1 
ATOM   297  N  N     . TYR A 1 41  ? -4.120  22.970 1.665   1.00 19.71  ? 41  TYR A N     1 
ATOM   298  C  CA    . TYR A 1 41  ? -5.143  23.876 2.194   1.00 20.08  ? 41  TYR A CA    1 
ATOM   299  C  C     . TYR A 1 41  ? -5.113  23.978 3.725   1.00 20.97  ? 41  TYR A C     1 
ATOM   300  O  O     . TYR A 1 41  ? -5.180  22.981 4.426   1.00 20.50  ? 41  TYR A O     1 
ATOM   301  C  CB    . TYR A 1 41  ? -6.541  23.440 1.718   1.00 9.62   ? 41  TYR A CB    1 
ATOM   302  C  CG    . TYR A 1 41  ? -7.663  23.974 2.564   1.00 11.92  ? 41  TYR A CG    1 
ATOM   303  C  CD1   . TYR A 1 41  ? -7.958  25.321 2.574   1.00 9.51   ? 41  TYR A CD1   1 
ATOM   304  C  CD2   . TYR A 1 41  ? -8.429  23.127 3.363   1.00 20.65  ? 41  TYR A CD2   1 
ATOM   305  C  CE1   . TYR A 1 41  ? -8.977  25.828 3.356   1.00 15.14  ? 41  TYR A CE1   1 
ATOM   306  C  CE2   . TYR A 1 41  ? -9.463  23.624 4.151   1.00 16.09  ? 41  TYR A CE2   1 
ATOM   307  C  CZ    . TYR A 1 41  ? -9.725  24.984 4.151   1.00 19.42  ? 41  TYR A CZ    1 
ATOM   308  O  OH    . TYR A 1 41  ? -10.737 25.516 4.932   1.00 12.69  ? 41  TYR A OH    1 
ATOM   309  N  N     . ASP A 1 42  ? -5.011  25.203 4.228   1.00 31.69  ? 42  ASP A N     1 
ATOM   310  C  CA    . ASP A 1 42  ? -5.085  25.486 5.660   1.00 13.30  ? 42  ASP A CA    1 
ATOM   311  C  C     . ASP A 1 42  ? -6.047  26.654 5.870   1.00 21.87  ? 42  ASP A C     1 
ATOM   312  O  O     . ASP A 1 42  ? -5.989  27.656 5.157   1.00 25.19  ? 42  ASP A O     1 
ATOM   313  C  CB    . ASP A 1 42  ? -3.697  25.805 6.218   1.00 33.77  ? 42  ASP A CB    1 
ATOM   314  C  CG    . ASP A 1 42  ? -3.661  25.853 7.735   1.00 32.22  ? 42  ASP A CG    1 
ATOM   315  O  OD1   . ASP A 1 42  ? -4.442  25.116 8.376   1.00 45.39  ? 42  ASP A OD1   1 
ATOM   316  O  OD2   . ASP A 1 42  ? -2.839  26.625 8.283   1.00 39.27  ? 42  ASP A OD2   1 
ATOM   317  N  N     . GLY A 1 43  ? -6.923  26.538 6.859   1.00 28.49  ? 43  GLY A N     1 
ATOM   318  C  CA    . GLY A 1 43  ? -8.083  27.405 6.935   1.00 11.10  ? 43  GLY A CA    1 
ATOM   319  C  C     . GLY A 1 43  ? -9.005  26.814 7.969   1.00 16.31  ? 43  GLY A C     1 
ATOM   320  O  O     . GLY A 1 43  ? -8.551  26.232 8.954   1.00 17.92  ? 43  GLY A O     1 
ATOM   321  N  N     . ARG A 1 44  ? -10.300 26.999 7.760   1.00 17.08  ? 44  ARG A N     1 
ATOM   322  C  CA    . ARG A 1 44  ? -11.317 26.377 8.591   1.00 13.85  ? 44  ARG A CA    1 
ATOM   323  C  C     . ARG A 1 44  ? -11.017 24.914 8.870   1.00 8.00   ? 44  ARG A C     1 
ATOM   324  O  O     . ARG A 1 44  ? -11.200 24.437 9.985   1.00 23.02  ? 44  ARG A O     1 
ATOM   325  C  CB    . ARG A 1 44  ? -12.678 26.488 7.916   1.00 26.16  ? 44  ARG A CB    1 
ATOM   326  C  CG    . ARG A 1 44  ? -13.122 27.894 7.618   1.00 3.27   ? 44  ARG A CG    1 
ATOM   327  C  CD    . ARG A 1 44  ? -14.428 27.819 6.913   1.00 8.85   ? 44  ARG A CD    1 
ATOM   328  N  NE    . ARG A 1 44  ? -14.210 27.580 5.494   1.00 37.94  ? 44  ARG A NE    1 
ATOM   329  C  CZ    . ARG A 1 44  ? -15.145 27.713 4.563   1.00 24.20  ? 44  ARG A CZ    1 
ATOM   330  N  NH1   . ARG A 1 44  ? -16.375 28.071 4.913   1.00 10.86  ? 44  ARG A NH1   1 
ATOM   331  N  NH2   . ARG A 1 44  ? -14.847 27.480 3.289   1.00 12.70  ? 44  ARG A NH2   1 
ATOM   332  N  N     . ALA A 1 45  ? -10.552 24.206 7.856   1.00 6.22   ? 45  ALA A N     1 
ATOM   333  C  CA    . ALA A 1 45  ? -9.995  22.873 8.056   1.00 11.23  ? 45  ALA A CA    1 
ATOM   334  C  C     . ALA A 1 45  ? -8.594  22.804 7.439   1.00 19.09  ? 45  ALA A C     1 
ATOM   335  O  O     . ALA A 1 45  ? -7.997  23.840 7.113   1.00 17.45  ? 45  ALA A O     1 
ATOM   336  C  CB    . ALA A 1 45  ? -10.897 21.817 7.477   1.00 9.97   ? 45  ALA A CB    1 
ATOM   337  N  N     . LYS A 1 46  ? -8.048  21.591 7.346   1.00 18.97  ? 46  LYS A N     1 
ATOM   338  C  CA    . LYS A 1 46  ? -6.728  21.369 6.744   1.00 12.09  ? 46  LYS A CA    1 
ATOM   339  C  C     . LYS A 1 46  ? -6.790  20.146 5.853   1.00 19.00  ? 46  LYS A C     1 
ATOM   340  O  O     . LYS A 1 46  ? -7.468  19.164 6.180   1.00 22.32  ? 46  LYS A O     1 
ATOM   341  C  CB    . LYS A 1 46  ? -5.650  21.209 7.825   1.00 22.50  ? 46  LYS A CB    1 
ATOM   342  C  CG    . LYS A 1 46  ? -4.211  21.123 7.334   1.00 33.20  ? 46  LYS A CG    1 
ATOM   343  C  CD    . LYS A 1 46  ? -3.243  21.701 8.379   1.00 43.21  ? 46  LYS A CD    1 
ATOM   344  C  CE    . LYS A 1 46  ? -1.802  21.332 8.071   1.00 19.73  ? 46  LYS A CE    1 
ATOM   345  N  NZ    . LYS A 1 46  ? -1.670  19.853 7.844   1.00 71.07  ? 46  LYS A NZ    1 
ATOM   346  N  N     . SER A 1 47  ? -6.106  20.220 4.715   1.00 18.23  ? 47  SER A N     1 
ATOM   347  C  CA    . SER A 1 47  ? -6.140  19.154 3.724   1.00 18.30  ? 47  SER A CA    1 
ATOM   348  C  C     . SER A 1 47  ? -4.827  19.063 2.950   1.00 21.86  ? 47  SER A C     1 
ATOM   349  O  O     . SER A 1 47  ? -4.055  20.018 2.899   1.00 15.75  ? 47  SER A O     1 
ATOM   350  C  CB    . SER A 1 47  ? -7.297  19.365 2.740   1.00 24.94  ? 47  SER A CB    1 
ATOM   351  O  OG    . SER A 1 47  ? -6.893  20.182 1.645   1.00 51.98  ? 47  SER A OG    1 
ATOM   352  N  N     . GLU A 1 48  ? -4.584  17.900 2.353   1.00 20.84  ? 48  GLU A N     1 
ATOM   353  C  CA    . GLU A 1 48  ? -3.453  17.700 1.462   1.00 15.77  ? 48  GLU A CA    1 
ATOM   354  C  C     . GLU A 1 48  ? -3.915  16.773 0.363   1.00 14.71  ? 48  GLU A C     1 
ATOM   355  O  O     . GLU A 1 48  ? -4.721  15.880 0.604   1.00 16.46  ? 48  GLU A O     1 
ATOM   356  C  CB    . GLU A 1 48  ? -2.233  17.121 2.191   1.00 11.05  ? 48  GLU A CB    1 
ATOM   357  C  CG    . GLU A 1 48  ? -1.475  18.126 3.052   1.00 19.06  ? 48  GLU A CG    1 
ATOM   358  C  CD    . GLU A 1 48  ? -0.636  19.085 2.225   1.00 59.94  ? 48  GLU A CD    1 
ATOM   359  O  OE1   . GLU A 1 48  ? -0.116  18.658 1.171   1.00 81.76  ? 48  GLU A OE1   1 
ATOM   360  O  OE2   . GLU A 1 48  ? -0.494  20.266 2.623   1.00 57.08  ? 48  GLU A OE2   1 
ATOM   361  N  N     . LEU A 1 49  ? -3.426  17.014 -0.848  1.00 14.90  ? 49  LEU A N     1 
ATOM   362  C  CA    . LEU A 1 49  ? -3.769  16.207 -2.010  1.00 11.62  ? 49  LEU A CA    1 
ATOM   363  C  C     . LEU A 1 49  ? -2.507  15.953 -2.818  1.00 40.41  ? 49  LEU A C     1 
ATOM   364  O  O     . LEU A 1 49  ? -1.823  16.901 -3.229  1.00 28.03  ? 49  LEU A O     1 
ATOM   365  C  CB    . LEU A 1 49  ? -4.829  16.904 -2.859  1.00 14.56  ? 49  LEU A CB    1 
ATOM   366  C  CG    . LEU A 1 49  ? -5.332  16.197 -4.116  1.00 29.59  ? 49  LEU A CG    1 
ATOM   367  C  CD1   . LEU A 1 49  ? -5.951  14.856 -3.794  1.00 9.08   ? 49  LEU A CD1   1 
ATOM   368  C  CD2   . LEU A 1 49  ? -6.327  17.084 -4.859  1.00 31.81  ? 49  LEU A CD2   1 
ATOM   369  N  N     . GLY A 1 50  ? -2.200  14.676 -3.035  1.00 27.37  ? 50  GLY A N     1 
ATOM   370  C  CA    . GLY A 1 50  ? -0.969  14.295 -3.697  1.00 36.25  ? 50  GLY A CA    1 
ATOM   371  C  C     . GLY A 1 50  ? -0.956  14.604 -5.180  1.00 37.86  ? 50  GLY A C     1 
ATOM   372  O  O     . GLY A 1 50  ? -1.997  14.947 -5.751  1.00 25.92  ? 50  GLY A O     1 
ATOM   373  N  N     . SER A 1 51  ? 0.219   14.453 -5.798  1.00 34.76  ? 51  SER A N     1 
ATOM   374  C  CA    . SER A 1 51  ? 0.413   14.756 -7.216  1.00 22.96  ? 51  SER A CA    1 
ATOM   375  C  C     . SER A 1 51  ? -0.627  14.086 -8.105  1.00 15.77  ? 51  SER A C     1 
ATOM   376  O  O     . SER A 1 51  ? -0.861  12.889 -8.000  1.00 18.69  ? 51  SER A O     1 
ATOM   377  C  CB    . SER A 1 51  ? 1.810   14.335 -7.658  1.00 23.19  ? 51  SER A CB    1 
ATOM   378  O  OG    . SER A 1 51  ? 2.003   14.560 -9.046  1.00 46.68  ? 51  SER A OG    1 
ATOM   379  N  N     . GLY A 1 52  ? -1.254  14.877 -8.975  1.00 21.49  ? 52  GLY A N     1 
ATOM   380  C  CA    . GLY A 1 52  ? -2.289  14.376 -9.867  1.00 22.46  ? 52  GLY A CA    1 
ATOM   381  C  C     . GLY A 1 52  ? -2.810  15.420 -10.842 1.00 30.67  ? 52  GLY A C     1 
ATOM   382  O  O     . GLY A 1 52  ? -2.583  16.634 -10.664 1.00 22.87  ? 52  GLY A O     1 
ATOM   383  N  N     . ASP A 1 53  ? -3.516  14.939 -11.869 1.00 13.03  ? 53  ASP A N     1 
ATOM   384  C  CA    . ASP A 1 53  ? -4.029  15.792 -12.946 1.00 17.44  ? 53  ASP A CA    1 
ATOM   385  C  C     . ASP A 1 53  ? -5.377  16.389 -12.603 1.00 13.12  ? 53  ASP A C     1 
ATOM   386  O  O     . ASP A 1 53  ? -6.323  15.660 -12.315 1.00 38.73  ? 53  ASP A O     1 
ATOM   387  C  CB    . ASP A 1 53  ? -4.163  15.014 -14.264 1.00 20.13  ? 53  ASP A CB    1 
ATOM   388  C  CG    . ASP A 1 53  ? -2.827  14.639 -14.872 1.00 21.10  ? 53  ASP A CG    1 
ATOM   389  O  OD1   . ASP A 1 53  ? -1.794  15.236 -14.507 1.00 31.93  ? 53  ASP A OD1   1 
ATOM   390  O  OD2   . ASP A 1 53  ? -2.814  13.744 -15.733 1.00 44.45  ? 53  ASP A OD2   1 
ATOM   391  N  N     . ARG A 1 54  ? -5.478  17.712 -12.647 1.00 27.56  ? 54  ARG A N     1 
ATOM   392  C  CA    . ARG A 1 54  ? -6.746  18.375 -12.354 1.00 12.50  ? 54  ARG A CA    1 
ATOM   393  C  C     . ARG A 1 54  ? -7.012  19.583 -13.254 1.00 14.84  ? 54  ARG A C     1 
ATOM   394  O  O     . ARG A 1 54  ? -6.121  20.132 -13.911 1.00 17.75  ? 54  ARG A O     1 
ATOM   395  C  CB    . ARG A 1 54  ? -6.792  18.798 -10.881 1.00 18.02  ? 54  ARG A CB    1 
ATOM   396  C  CG    . ARG A 1 54  ? -6.820  17.624 -9.898  1.00 11.85  ? 54  ARG A CG    1 
ATOM   397  C  CD    . ARG A 1 54  ? -5.620  17.635 -8.947  1.00 14.63  ? 54  ARG A CD    1 
ATOM   398  N  NE    . ARG A 1 54  ? -5.332  16.294 -8.445  1.00 16.47  ? 54  ARG A NE    1 
ATOM   399  C  CZ    . ARG A 1 54  ? -4.335  15.995 -7.618  1.00 25.54  ? 54  ARG A CZ    1 
ATOM   400  N  NH1   . ARG A 1 54  ? -3.534  16.947 -7.170  1.00 21.43  ? 54  ARG A NH1   1 
ATOM   401  N  NH2   . ARG A 1 54  ? -4.154  14.741 -7.220  1.00 23.63  ? 54  ARG A NH2   1 
ATOM   402  N  N     . VAL A 1 55  ? -8.276  19.955 -13.302 1.00 12.16  ? 55  VAL A N     1 
ATOM   403  C  CA    . VAL A 1 55  ? -8.697  21.161 -13.963 1.00 7.84   ? 55  VAL A CA    1 
ATOM   404  C  C     . VAL A 1 55  ? -8.814  22.216 -12.897 1.00 12.89  ? 55  VAL A C     1 
ATOM   405  O  O     . VAL A 1 55  ? -9.411  21.999 -11.856 1.00 16.83  ? 55  VAL A O     1 
ATOM   406  C  CB    . VAL A 1 55  ? -10.034 21.000 -14.672 1.00 14.31  ? 55  VAL A CB    1 
ATOM   407  C  CG1   . VAL A 1 55  ? -10.470 22.339 -15.270 1.00 10.62  ? 55  VAL A CG1   1 
ATOM   408  C  CG2   . VAL A 1 55  ? -9.950  19.892 -15.731 1.00 13.00  ? 55  VAL A CG2   1 
ATOM   409  N  N     . ILE A 1 56  ? -8.236  23.368 -13.166 1.00 19.10  ? 56  ILE A N     1 
ATOM   410  C  CA    . ILE A 1 56  ? -8.129  24.405 -12.181 1.00 8.55   ? 56  ILE A CA    1 
ATOM   411  C  C     . ILE A 1 56  ? -8.794  25.639 -12.734 1.00 14.68  ? 56  ILE A C     1 
ATOM   412  O  O     . ILE A 1 56  ? -8.507  26.048 -13.854 1.00 28.57  ? 56  ILE A O     1 
ATOM   413  C  CB    . ILE A 1 56  ? -6.651  24.668 -11.847 1.00 10.47  ? 56  ILE A CB    1 
ATOM   414  C  CG1   . ILE A 1 56  ? -6.043  23.406 -11.214 1.00 11.76  ? 56  ILE A CG1   1 
ATOM   415  C  CG2   . ILE A 1 56  ? -6.508  25.903 -10.979 1.00 3.85   ? 56  ILE A CG2   1 
ATOM   416  C  CD1   . ILE A 1 56  ? -4.573  23.482 -10.893 1.00 5.05   ? 56  ILE A CD1   1 
ATOM   417  N  N     . ILE A 1 57  ? -9.697  26.234 -11.973 1.00 7.81   ? 57  ILE A N     1 
ATOM   418  C  CA    . ILE A 1 57  ? -10.331 27.454 -12.443 1.00 11.91  ? 57  ILE A CA    1 
ATOM   419  C  C     . ILE A 1 57  ? -10.219 28.569 -11.423 1.00 20.34  ? 57  ILE A C     1 
ATOM   420  O  O     . ILE A 1 57  ? -10.458 28.358 -10.234 1.00 23.92  ? 57  ILE A O     1 
ATOM   421  C  CB    . ILE A 1 57  ? -11.812 27.224 -12.768 1.00 12.76  ? 57  ILE A CB    1 
ATOM   422  C  CG1   . ILE A 1 57  ? -11.944 26.259 -13.945 1.00 11.62  ? 57  ILE A CG1   1 
ATOM   423  C  CG2   . ILE A 1 57  ? -12.532 28.556 -13.029 1.00 3.23   ? 57  ILE A CG2   1 
ATOM   424  C  CD1   . ILE A 1 57  ? -13.360 25.938 -14.299 1.00 11.91  ? 57  ILE A CD1   1 
ATOM   425  N  N     . VAL A 1 58  ? -9.839  29.750 -11.898 1.00 16.48  ? 58  VAL A N     1 
ATOM   426  C  CA    . VAL A 1 58  ? -9.930  30.968 -11.106 1.00 15.25  ? 58  VAL A CA    1 
ATOM   427  C  C     . VAL A 1 58  ? -10.900 31.977 -11.724 1.00 11.16  ? 58  VAL A C     1 
ATOM   428  O  O     . VAL A 1 58  ? -10.668 32.480 -12.822 1.00 18.93  ? 58  VAL A O     1 
ATOM   429  C  CB    . VAL A 1 58  ? -8.563  31.630 -10.951 1.00 12.32  ? 58  VAL A CB    1 
ATOM   430  C  CG1   . VAL A 1 58  ? -8.704  32.899 -10.129 1.00 11.60  ? 58  VAL A CG1   1 
ATOM   431  C  CG2   . VAL A 1 58  ? -7.599  30.676 -10.286 1.00 16.41  ? 58  VAL A CG2   1 
ATOM   432  N  N     . LYS A 1 59  ? -11.991 32.268 -11.026 1.00 10.30  ? 59  LYS A N     1 
ATOM   433  C  CA    . LYS A 1 59  ? -12.958 33.254 -11.516 1.00 15.54  ? 59  LYS A CA    1 
ATOM   434  C  C     . LYS A 1 59  ? -12.541 34.649 -11.076 1.00 21.19  ? 59  LYS A C     1 
ATOM   435  O  O     . LYS A 1 59  ? -11.907 34.807 -10.031 1.00 22.15  ? 59  LYS A O     1 
ATOM   436  C  CB    . LYS A 1 59  ? -14.375 32.949 -11.015 1.00 17.97  ? 59  LYS A CB    1 
ATOM   437  C  CG    . LYS A 1 59  ? -14.879 31.515 -11.268 1.00 19.26  ? 59  LYS A CG    1 
ATOM   438  C  CD    . LYS A 1 59  ? -16.398 31.454 -11.167 1.00 9.36   ? 59  LYS A CD    1 
ATOM   439  C  CE    . LYS A 1 59  ? -16.925 30.042 -11.209 1.00 15.79  ? 59  LYS A CE    1 
ATOM   440  N  NZ    . LYS A 1 59  ? -18.417 29.999 -11.161 1.00 17.03  ? 59  LYS A NZ    1 
ATOM   441  N  N     . PRO A 1 60  ? -12.896 35.669 -11.871 1.00 23.30  ? 60  PRO A N     1 
ATOM   442  C  CA    . PRO A 1 60  ? -12.495 37.045 -11.556 1.00 31.19  ? 60  PRO A CA    1 
ATOM   443  C  C     . PRO A 1 60  ? -13.037 37.558 -10.216 1.00 24.88  ? 60  PRO A C     1 
ATOM   444  O  O     . PRO A 1 60  ? -12.503 38.542 -9.700  1.00 18.16  ? 60  PRO A O     1 
ATOM   445  C  CB    . PRO A 1 60  ? -13.058 37.858 -12.729 1.00 13.46  ? 60  PRO A CB    1 
ATOM   446  C  CG    . PRO A 1 60  ? -14.074 36.982 -13.374 1.00 24.70  ? 60  PRO A CG    1 
ATOM   447  C  CD    . PRO A 1 60  ? -13.602 35.581 -13.158 1.00 24.39  ? 60  PRO A CD    1 
ATOM   448  N  N     . ASP A 1 61  ? -14.042 36.897 -9.645  1.00 25.95  ? 61  ASP A N     1 
ATOM   449  C  CA    . ASP A 1 61  ? -14.564 37.319 -8.340  1.00 18.39  ? 61  ASP A CA    1 
ATOM   450  C  C     . ASP A 1 61  ? -13.802 36.655 -7.198  1.00 21.78  ? 61  ASP A C     1 
ATOM   451  O  O     . ASP A 1 61  ? -14.154 36.808 -6.030  1.00 19.94  ? 61  ASP A O     1 
ATOM   452  C  CB    . ASP A 1 61  ? -16.076 37.049 -8.222  1.00 11.88  ? 61  ASP A CB    1 
ATOM   453  C  CG    . ASP A 1 61  ? -16.424 35.579 -7.992  1.00 26.53  ? 61  ASP A CG    1 
ATOM   454  O  OD1   . ASP A 1 61  ? -15.566 34.680 -8.153  1.00 23.74  ? 61  ASP A OD1   1 
ATOM   455  O  OD2   . ASP A 1 61  ? -17.599 35.325 -7.651  1.00 26.21  ? 61  ASP A OD2   1 
ATOM   456  N  N     . GLY A 1 62  ? -12.760 35.911 -7.546  1.00 12.82  ? 62  GLY A N     1 
ATOM   457  C  CA    . GLY A 1 62  ? -11.852 35.394 -6.546  1.00 20.10  ? 62  GLY A CA    1 
ATOM   458  C  C     . GLY A 1 62  ? -12.092 33.931 -6.287  1.00 19.40  ? 62  GLY A C     1 
ATOM   459  O  O     . GLY A 1 62  ? -11.407 33.307 -5.467  1.00 14.95  ? 62  GLY A O     1 
ATOM   460  N  N     . SER A 1 63  ? -13.068 33.374 -6.990  1.00 17.10  ? 63  SER A N     1 
ATOM   461  C  CA    . SER A 1 63  ? -13.412 31.980 -6.773  1.00 17.12  ? 63  SER A CA    1 
ATOM   462  C  C     . SER A 1 63  ? -12.374 31.094 -7.391  1.00 16.60  ? 63  SER A C     1 
ATOM   463  O  O     . SER A 1 63  ? -11.842 31.374 -8.462  1.00 24.37  ? 63  SER A O     1 
ATOM   464  C  CB    . SER A 1 63  ? -14.773 31.658 -7.335  1.00 6.40   ? 63  SER A CB    1 
ATOM   465  O  OG    . SER A 1 63  ? -15.659 32.698 -6.987  1.00 21.57  ? 63  SER A OG    1 
ATOM   466  N  N     . PHE A 1 64  ? -12.084 30.020 -6.687  1.00 12.43  ? 64  PHE A N     1 
ATOM   467  C  CA    . PHE A 1 64  ? -10.963 29.191 -7.018  1.00 12.20  ? 64  PHE A CA    1 
ATOM   468  C  C     . PHE A 1 64  ? -11.442 27.757 -6.991  1.00 30.10  ? 64  PHE A C     1 
ATOM   469  O  O     . PHE A 1 64  ? -11.836 27.264 -5.939  1.00 27.06  ? 64  PHE A O     1 
ATOM   470  C  CB    . PHE A 1 64  ? -9.847  29.435 -6.016  1.00 9.89   ? 64  PHE A CB    1 
ATOM   471  C  CG    . PHE A 1 64  ? -8.516  28.960 -6.462  1.00 17.71  ? 64  PHE A CG    1 
ATOM   472  C  CD1   . PHE A 1 64  ? -8.317  27.646 -6.812  1.00 30.18  ? 64  PHE A CD1   1 
ATOM   473  C  CD2   . PHE A 1 64  ? -7.452  29.819 -6.498  1.00 22.41  ? 64  PHE A CD2   1 
ATOM   474  C  CE1   . PHE A 1 64  ? -7.092  27.210 -7.206  1.00 24.69  ? 64  PHE A CE1   1 
ATOM   475  C  CE2   . PHE A 1 64  ? -6.230  29.383 -6.898  1.00 43.29  ? 64  PHE A CE2   1 
ATOM   476  C  CZ    . PHE A 1 64  ? -6.049  28.072 -7.253  1.00 16.36  ? 64  PHE A CZ    1 
ATOM   477  N  N     . LEU A 1 65  ? -11.421 27.084 -8.136  1.00 20.39  ? 65  LEU A N     1 
ATOM   478  C  CA    . LEU A 1 65  ? -11.922 25.718 -8.185  1.00 15.13  ? 65  LEU A CA    1 
ATOM   479  C  C     . LEU A 1 65  ? -10.841 24.758 -8.621  1.00 15.80  ? 65  LEU A C     1 
ATOM   480  O  O     . LEU A 1 65  ? -10.103 25.018 -9.567  1.00 32.64  ? 65  LEU A O     1 
ATOM   481  C  CB    . LEU A 1 65  ? -13.119 25.613 -9.126  1.00 12.78  ? 65  LEU A CB    1 
ATOM   482  C  CG    . LEU A 1 65  ? -14.239 26.629 -8.916  1.00 8.84   ? 65  LEU A CG    1 
ATOM   483  C  CD1   . LEU A 1 65  ? -15.320 26.457 -9.960  1.00 11.43  ? 65  LEU A CD1   1 
ATOM   484  C  CD2   . LEU A 1 65  ? -14.818 26.501 -7.532  1.00 9.80   ? 65  LEU A CD2   1 
ATOM   485  N  N     . ILE A 1 66  ? -10.750 23.647 -7.916  1.00 14.12  ? 66  ILE A N     1 
ATOM   486  C  CA    . ILE A 1 66  ? -9.878  22.562 -8.311  1.00 11.89  ? 66  ILE A CA    1 
ATOM   487  C  C     . ILE A 1 66  ? -10.698 21.305 -8.498  1.00 14.09  ? 66  ILE A C     1 
ATOM   488  O  O     . ILE A 1 66  ? -11.313 20.815 -7.560  1.00 22.78  ? 66  ILE A O     1 
ATOM   489  C  CB    . ILE A 1 66  ? -8.811  22.316 -7.277  1.00 16.06  ? 66  ILE A CB    1 
ATOM   490  C  CG1   . ILE A 1 66  ? -8.079  23.624 -6.996  1.00 14.74  ? 66  ILE A CG1   1 
ATOM   491  C  CG2   . ILE A 1 66  ? -7.879  21.204 -7.740  1.00 6.90   ? 66  ILE A CG2   1 
ATOM   492  C  CD1   . ILE A 1 66  ? -7.165  23.542 -5.821  1.00 29.68  ? 66  ILE A CD1   1 
ATOM   493  N  N     . HIS A 1 67  ? -10.714 20.789 -9.717  1.00 17.90  ? 67  HIS A N     1 
ATOM   494  C  CA    . HIS A 1 67  ? -11.554 19.653 -10.046 1.00 11.09  ? 67  HIS A CA    1 
ATOM   495  C  C     . HIS A 1 67  ? -10.753 18.421 -10.428 1.00 11.23  ? 67  HIS A C     1 
ATOM   496  O  O     . HIS A 1 67  ? -9.877  18.485 -11.273 1.00 18.85  ? 67  HIS A O     1 
ATOM   497  C  CB    . HIS A 1 67  ? -12.491 20.013 -11.182 1.00 3.45   ? 67  HIS A CB    1 
ATOM   498  C  CG    . HIS A 1 67  ? -13.763 20.652 -10.736 1.00 7.98   ? 67  HIS A CG    1 
ATOM   499  N  ND1   . HIS A 1 67  ? -14.834 19.924 -10.268 1.00 15.87  ? 67  HIS A ND1   1 
ATOM   500  C  CD2   . HIS A 1 67  ? -14.146 21.949 -10.700 1.00 23.20  ? 67  HIS A CD2   1 
ATOM   501  C  CE1   . HIS A 1 67  ? -15.819 20.744 -9.950  1.00 11.42  ? 67  HIS A CE1   1 
ATOM   502  N  NE2   . HIS A 1 67  ? -15.428 21.982 -10.204 1.00 19.45  ? 67  HIS A NE2   1 
ATOM   503  N  N     . GLN A 1 68  ? -11.049 17.299 -9.789  1.00 23.94  ? 68  GLN A N     1 
ATOM   504  C  CA    . GLN A 1 68  ? -10.522 16.029 -10.248 1.00 23.36  ? 68  GLN A CA    1 
ATOM   505  C  C     . GLN A 1 68  ? -11.485 15.471 -11.268 1.00 25.49  ? 68  GLN A C     1 
ATOM   506  O  O     . GLN A 1 68  ? -12.486 16.114 -11.585 1.00 10.72  ? 68  GLN A O     1 
ATOM   507  C  CB    . GLN A 1 68  ? -10.358 15.054 -9.105  1.00 22.30  ? 68  GLN A CB    1 
ATOM   508  C  CG    . GLN A 1 68  ? -9.768  15.656 -7.892  1.00 13.20  ? 68  GLN A CG    1 
ATOM   509  C  CD    . GLN A 1 68  ? -9.690  14.660 -6.774  1.00 25.05  ? 68  GLN A CD    1 
ATOM   510  O  OE1   . GLN A 1 68  ? -10.676 14.432 -6.059  1.00 22.90  ? 68  GLN A OE1   1 
ATOM   511  N  NE2   . GLN A 1 68  ? -8.519  14.037 -6.618  1.00 13.98  ? 68  GLN A NE2   1 
ATOM   512  N  N     . SER A 1 69  ? -11.216 14.250 -11.727 1.00 21.24  ? 69  SER A N     1 
ATOM   513  C  CA    . SER A 1 69  ? -11.946 13.679 -12.849 1.00 12.43  ? 69  SER A CA    1 
ATOM   514  C  C     . SER A 1 69  ? -13.309 13.134 -12.433 1.00 29.78  ? 69  SER A C     1 
ATOM   515  O  O     . SER A 1 69  ? -14.078 12.675 -13.279 1.00 16.85  ? 69  SER A O     1 
ATOM   516  C  CB    . SER A 1 69  ? -11.114 12.583 -13.504 1.00 6.98   ? 69  SER A CB    1 
ATOM   517  O  OG    . SER A 1 69  ? -10.670 11.651 -12.539 1.00 53.04  ? 69  SER A OG    1 
ATOM   518  N  N     . LYS A 1 70  ? -13.621 13.225 -11.137 1.00 39.94  ? 70  LYS A N     1 
ATOM   519  C  CA    . LYS A 1 70  ? -14.887 12.709 -10.612 1.00 15.05  ? 70  LYS A CA    1 
ATOM   520  C  C     . LYS A 1 70  ? -15.685 13.666 -9.720  1.00 17.16  ? 70  LYS A C     1 
ATOM   521  O  O     . LYS A 1 70  ? -15.225 14.726 -9.314  1.00 40.67  ? 70  LYS A O     1 
ATOM   522  C  CB    . LYS A 1 70  ? -14.637 11.415 -9.848  1.00 18.59  ? 70  LYS A CB    1 
ATOM   523  C  CG    . LYS A 1 70  ? -14.627 10.176 -10.730 1.00 40.54  ? 70  LYS A CG    1 
ATOM   524  C  CD    . LYS A 1 70  ? -14.033 8.966  -10.005 1.00 49.44  ? 70  LYS A CD    1 
ATOM   525  C  CE    . LYS A 1 70  ? -12.649 8.621  -10.553 1.00 51.04  ? 70  LYS A CE    1 
ATOM   526  N  NZ    . LYS A 1 70  ? -12.614 8.736  -12.045 1.00 63.89  ? 70  LYS A NZ    1 
ATOM   527  N  N     . LYS A 1 71  ? -16.904 13.230 -9.451  1.00 22.94  ? 71  LYS A N     1 
ATOM   528  C  CA    . LYS A 1 71  ? -17.983 13.904 -8.719  1.00 34.90  ? 71  LYS A CA    1 
ATOM   529  C  C     . LYS A 1 71  ? -18.447 15.279 -9.238  1.00 20.88  ? 71  LYS A C     1 
ATOM   530  O  O     . LYS A 1 71  ? -18.040 15.686 -10.315 1.00 46.85  ? 71  LYS A O     1 
ATOM   531  C  CB    . LYS A 1 71  ? -17.521 14.054 -7.270  1.00 19.05  ? 71  LYS A CB    1 
ATOM   532  C  CG    . LYS A 1 71  ? -17.260 12.731 -6.547  1.00 16.65  ? 71  LYS A CG    1 
ATOM   533  C  CD    . LYS A 1 71  ? -16.722 12.956 -5.126  1.00 64.25  ? 71  LYS A CD    1 
ATOM   534  C  CE    . LYS A 1 71  ? -17.134 14.337 -4.593  1.00 76.31  ? 71  LYS A CE    1 
ATOM   535  N  NZ    . LYS A 1 71  ? -16.784 14.609 -3.165  1.00 46.46  ? 71  LYS A NZ    1 
ATOM   536  N  N     . ARG A 1 72  ? -19.209 16.032 -8.438  1.00 21.02  ? 72  ARG A N     1 
ATOM   537  C  CA    . ARG A 1 72  ? -19.704 17.365 -8.852  1.00 18.50  ? 72  ARG A CA    1 
ATOM   538  C  C     . ARG A 1 72  ? -18.953 18.472 -8.147  1.00 30.41  ? 72  ARG A C     1 
ATOM   539  O  O     . ARG A 1 72  ? -19.134 19.676 -8.407  1.00 18.96  ? 72  ARG A O     1 
ATOM   540  C  CB    . ARG A 1 72  ? -21.201 17.541 -8.565  1.00 12.07  ? 72  ARG A CB    1 
ATOM   541  C  CG    . ARG A 1 72  ? -21.799 18.658 -9.406  1.00 18.01  ? 72  ARG A CG    1 
ATOM   542  C  CD    . ARG A 1 72  ? -22.895 19.466 -8.769  1.00 9.00   ? 72  ARG A CD    1 
ATOM   543  N  NE    . ARG A 1 72  ? -22.427 20.306 -7.684  1.00 9.67   ? 72  ARG A NE    1 
ATOM   544  C  CZ    . ARG A 1 72  ? -23.113 21.324 -7.175  1.00 14.72  ? 72  ARG A CZ    1 
ATOM   545  N  NH1   . ARG A 1 72  ? -24.278 21.668 -7.689  1.00 10.64  ? 72  ARG A NH1   1 
ATOM   546  N  NH2   . ARG A 1 72  ? -22.615 22.027 -6.167  1.00 40.58  ? 72  ARG A NH2   1 
ATOM   547  N  N     . GLU A 1 73  ? -18.126 18.032 -7.217  1.00 24.84  ? 73  GLU A N     1 
ATOM   548  C  CA    . GLU A 1 73  ? -17.557 18.902 -6.229  1.00 11.21  ? 73  GLU A CA    1 
ATOM   549  C  C     . GLU A 1 73  ? -16.100 19.094 -6.462  1.00 9.95   ? 73  GLU A C     1 
ATOM   550  O  O     . GLU A 1 73  ? -15.379 18.138 -6.714  1.00 31.01  ? 73  GLU A O     1 
ATOM   551  C  CB    . GLU A 1 73  ? -17.832 18.358 -4.840  1.00 21.81  ? 73  GLU A CB    1 
ATOM   552  C  CG    . GLU A 1 73  ? -19.298 18.420 -4.519  1.00 15.89  ? 73  GLU A CG    1 
ATOM   553  C  CD    . GLU A 1 73  ? -19.818 19.838 -4.599  1.00 25.23  ? 73  GLU A CD    1 
ATOM   554  O  OE1   . GLU A 1 73  ? -19.061 20.745 -4.199  1.00 16.40  ? 73  GLU A OE1   1 
ATOM   555  O  OE2   . GLU A 1 73  ? -20.971 20.049 -5.050  1.00 22.45  ? 73  GLU A OE2   1 
ATOM   556  N  N     . PRO A 1 74  ? -15.672 20.351 -6.451  1.00 8.45   ? 74  PRO A N     1 
ATOM   557  C  CA    . PRO A 1 74  ? -14.239 20.619 -6.484  1.00 15.96  ? 74  PRO A CA    1 
ATOM   558  C  C     . PRO A 1 74  ? -13.590 19.922 -5.300  1.00 15.36  ? 74  PRO A C     1 
ATOM   559  O  O     . PRO A 1 74  ? -14.217 19.836 -4.248  1.00 9.52   ? 74  PRO A O     1 
ATOM   560  C  CB    . PRO A 1 74  ? -14.160 22.137 -6.365  1.00 16.31  ? 74  PRO A CB    1 
ATOM   561  C  CG    . PRO A 1 74  ? -15.437 22.523 -5.704  1.00 7.55   ? 74  PRO A CG    1 
ATOM   562  C  CD    . PRO A 1 74  ? -16.464 21.537 -6.099  1.00 4.24   ? 74  PRO A CD    1 
ATOM   563  N  N     . VAL A 1 75  ? -12.392 19.382 -5.469  1.00 9.50   ? 75  VAL A N     1 
ATOM   564  C  CA    . VAL A 1 75  ? -11.769 18.711 -4.353  1.00 13.02  ? 75  VAL A CA    1 
ATOM   565  C  C     . VAL A 1 75  ? -11.315 19.789 -3.379  1.00 17.19  ? 75  VAL A C     1 
ATOM   566  O  O     . VAL A 1 75  ? -11.561 19.705 -2.182  1.00 24.05  ? 75  VAL A O     1 
ATOM   567  C  CB    . VAL A 1 75  ? -10.600 17.808 -4.779  1.00 12.79  ? 75  VAL A CB    1 
ATOM   568  C  CG1   . VAL A 1 75  ? -9.680  18.532 -5.751  1.00 37.04  ? 75  VAL A CG1   1 
ATOM   569  C  CG2   . VAL A 1 75  ? -9.833  17.332 -3.564  1.00 12.22  ? 75  VAL A CG2   1 
ATOM   570  N  N     . ASN A 1 76  ? -10.686 20.827 -3.896  1.00 18.70  ? 76  ASN A N     1 
ATOM   571  C  CA    . ASN A 1 76  ? -10.352 21.961 -3.058  1.00 22.45  ? 76  ASN A CA    1 
ATOM   572  C  C     . ASN A 1 76  ? -10.874 23.207 -3.723  1.00 20.93  ? 76  ASN A C     1 
ATOM   573  O  O     . ASN A 1 76  ? -11.170 23.194 -4.920  1.00 12.57  ? 76  ASN A O     1 
ATOM   574  C  CB    . ASN A 1 76  ? -8.847  22.040 -2.807  1.00 7.71   ? 76  ASN A CB    1 
ATOM   575  C  CG    . ASN A 1 76  ? -8.381  21.001 -1.806  1.00 22.78  ? 76  ASN A CG    1 
ATOM   576  O  OD1   . ASN A 1 76  ? -7.681  20.043 -2.137  1.00 14.51  ? 76  ASN A OD1   1 
ATOM   577  N  ND2   . ASN A 1 76  ? -8.781  21.187 -0.561  1.00 41.36  ? 76  ASN A ND2   1 
ATOM   578  N  N     . TRP A 1 77  ? -11.023 24.274 -2.948  1.00 15.83  ? 77  TRP A N     1 
ATOM   579  C  CA    . TRP A 1 77  ? -11.588 25.486 -3.505  1.00 14.64  ? 77  TRP A CA    1 
ATOM   580  C  C     . TRP A 1 77  ? -11.433 26.699 -2.624  1.00 10.03  ? 77  TRP A C     1 
ATOM   581  O  O     . TRP A 1 77  ? -10.992 26.613 -1.500  1.00 14.29  ? 77  TRP A O     1 
ATOM   582  C  CB    . TRP A 1 77  ? -13.074 25.291 -3.763  1.00 25.34  ? 77  TRP A CB    1 
ATOM   583  C  CG    . TRP A 1 77  ? -13.846 25.317 -2.482  1.00 25.28  ? 77  TRP A CG    1 
ATOM   584  C  CD1   . TRP A 1 77  ? -14.438 26.400 -1.892  1.00 14.10  ? 77  TRP A CD1   1 
ATOM   585  C  CD2   . TRP A 1 77  ? -14.083 24.213 -1.614  1.00 13.60  ? 77  TRP A CD2   1 
ATOM   586  N  NE1   . TRP A 1 77  ? -15.047 26.025 -0.726  1.00 16.92  ? 77  TRP A NE1   1 
ATOM   587  C  CE2   . TRP A 1 77  ? -14.839 24.683 -0.533  1.00 15.31  ? 77  TRP A CE2   1 
ATOM   588  C  CE3   . TRP A 1 77  ? -13.739 22.863 -1.654  1.00 15.45  ? 77  TRP A CE3   1 
ATOM   589  C  CZ2   . TRP A 1 77  ? -15.251 23.857 0.497   1.00 13.36  ? 77  TRP A CZ2   1 
ATOM   590  C  CZ3   . TRP A 1 77  ? -14.150 22.045 -0.629  1.00 15.90  ? 77  TRP A CZ3   1 
ATOM   591  C  CH2   . TRP A 1 77  ? -14.892 22.540 0.431   1.00 8.94   ? 77  TRP A CH2   1 
ATOM   592  N  N     . GLN A 1 78  ? -11.891 27.832 -3.161  1.00 21.92  ? 78  GLN A N     1 
ATOM   593  C  CA    . GLN A 1 78  ? -11.982 29.099 -2.439  1.00 14.74  ? 78  GLN A CA    1 
ATOM   594  C  C     . GLN A 1 78  ? -13.159 29.953 -2.945  1.00 19.41  ? 78  GLN A C     1 
ATOM   595  O  O     . GLN A 1 78  ? -13.252 30.257 -4.135  1.00 25.00  ? 78  GLN A O     1 
ATOM   596  C  CB    . GLN A 1 78  ? -10.673 29.882 -2.560  1.00 17.72  ? 78  GLN A CB    1 
ATOM   597  C  CG    . GLN A 1 78  ? -9.570  29.392 -1.636  1.00 35.37  ? 78  GLN A CG    1 
ATOM   598  C  CD    . GLN A 1 78  ? -9.776  29.830 -0.200  1.00 44.44  ? 78  GLN A CD    1 
ATOM   599  O  OE1   . GLN A 1 78  ? -10.844 29.627 0.377   1.00 30.92  ? 78  GLN A OE1   1 
ATOM   600  N  NE2   . GLN A 1 78  ? -8.749  30.436 0.387   1.00 41.30  ? 78  GLN A NE2   1 
ATOM   601  N  N     . PRO A 1 79  ? -14.048 30.331 -2.028  1.00 27.70  ? 79  PRO A N     1 
ATOM   602  C  CA    . PRO A 1 79  ? -15.230 31.150 -2.318  1.00 28.92  ? 79  PRO A CA    1 
ATOM   603  C  C     . PRO A 1 79  ? -14.823 32.547 -2.803  1.00 20.95  ? 79  PRO A C     1 
ATOM   604  O  O     . PRO A 1 79  ? -13.648 32.888 -2.718  1.00 29.93  ? 79  PRO A O     1 
ATOM   605  C  CB    . PRO A 1 79  ? -15.955 31.198 -0.972  1.00 24.50  ? 79  PRO A CB    1 
ATOM   606  C  CG    . PRO A 1 79  ? -14.875 31.074 0.018   1.00 26.03  ? 79  PRO A CG    1 
ATOM   607  C  CD    . PRO A 1 79  ? -13.825 30.185 -0.581  1.00 22.06  ? 79  PRO A CD    1 
ATOM   608  N  N     . PRO A 1 80  ? -15.770 33.332 -3.335  1.00 18.75  ? 80  PRO A N     1 
ATOM   609  C  CA    . PRO A 1 80  ? -15.447 34.690 -3.779  1.00 22.36  ? 80  PRO A CA    1 
ATOM   610  C  C     . PRO A 1 80  ? -14.737 35.533 -2.722  1.00 24.42  ? 80  PRO A C     1 
ATOM   611  O  O     . PRO A 1 80  ? -14.874 35.290 -1.519  1.00 33.24  ? 80  PRO A O     1 
ATOM   612  C  CB    . PRO A 1 80  ? -16.820 35.276 -4.093  1.00 11.06  ? 80  PRO A CB    1 
ATOM   613  C  CG    . PRO A 1 80  ? -17.616 34.110 -4.509  1.00 9.26   ? 80  PRO A CG    1 
ATOM   614  C  CD    . PRO A 1 80  ? -17.176 32.995 -3.613  1.00 22.35  ? 80  PRO A CD    1 
ATOM   615  N  N     . GLY A 1 81  ? -13.961 36.502 -3.194  1.00 21.14  ? 81  GLY A N     1 
ATOM   616  C  CA    . GLY A 1 81  ? -13.197 37.374 -2.325  1.00 43.12  ? 81  GLY A CA    1 
ATOM   617  C  C     . GLY A 1 81  ? -11.850 36.817 -1.918  1.00 18.68  ? 81  GLY A C     1 
ATOM   618  O  O     . GLY A 1 81  ? -11.351 37.114 -0.847  1.00 38.57  ? 81  GLY A O     1 
ATOM   619  N  N     . SER A 1 82  ? -11.256 36.001 -2.769  1.00 16.31  ? 82  SER A N     1 
ATOM   620  C  CA    . SER A 1 82  ? -9.944  35.481 -2.468  1.00 16.07  ? 82  SER A CA    1 
ATOM   621  C  C     . SER A 1 82  ? -8.938  36.070 -3.404  1.00 21.46  ? 82  SER A C     1 
ATOM   622  O  O     . SER A 1 82  ? -9.057  35.924 -4.618  1.00 57.14  ? 82  SER A O     1 
ATOM   623  C  CB    . SER A 1 82  ? -9.906  33.964 -2.571  1.00 13.40  ? 82  SER A CB    1 
ATOM   624  O  OG    . SER A 1 82  ? -10.844 33.405 -1.688  1.00 45.76  ? 82  SER A OG    1 
ATOM   625  N  N     . ARG A 1 83  ? -7.932  36.723 -2.837  1.00 38.19  ? 83  ARG A N     1 
ATOM   626  C  CA    . ARG A 1 83  ? -6.816  37.204 -3.626  1.00 20.66  ? 83  ARG A CA    1 
ATOM   627  C  C     . ARG A 1 83  ? -6.001  36.025 -4.070  1.00 21.65  ? 83  ARG A C     1 
ATOM   628  O  O     . ARG A 1 83  ? -5.549  35.229 -3.257  1.00 22.25  ? 83  ARG A O     1 
ATOM   629  C  CB    . ARG A 1 83  ? -5.951  38.178 -2.835  1.00 43.08  ? 83  ARG A CB    1 
ATOM   630  C  CG    . ARG A 1 83  ? -6.703  39.397 -2.379  1.00 58.25  ? 83  ARG A CG    1 
ATOM   631  C  CD    . ARG A 1 83  ? -6.010  40.665 -2.815  1.00 62.37  ? 83  ARG A CD    1 
ATOM   632  N  NE    . ARG A 1 83  ? -6.899  41.813 -2.666  1.00 87.08  ? 83  ARG A NE    1 
ATOM   633  C  CZ    . ARG A 1 83  ? -7.145  42.420 -1.508  1.00 69.84  ? 83  ARG A CZ    1 
ATOM   634  N  NH1   . ARG A 1 83  ? -6.559  41.982 -0.395  1.00 32.17  ? 83  ARG A NH1   1 
ATOM   635  N  NH2   . ARG A 1 83  ? -7.976  43.462 -1.465  1.00 28.33  ? 83  ARG A NH2   1 
ATOM   636  N  N     . VAL A 1 84  ? -5.827  35.916 -5.378  1.00 35.13  ? 84  VAL A N     1 
ATOM   637  C  CA    . VAL A 1 84  ? -5.006  34.872 -5.945  1.00 19.30  ? 84  VAL A CA    1 
ATOM   638  C  C     . VAL A 1 84  ? -3.781  35.529 -6.530  1.00 27.28  ? 84  VAL A C     1 
ATOM   639  O  O     . VAL A 1 84  ? -3.814  36.703 -6.897  1.00 20.85  ? 84  VAL A O     1 
ATOM   640  C  CB    . VAL A 1 84  ? -5.764  34.077 -7.002  1.00 32.66  ? 84  VAL A CB    1 
ATOM   641  C  CG1   . VAL A 1 84  ? -4.874  33.001 -7.605  1.00 12.16  ? 84  VAL A CG1   1 
ATOM   642  C  CG2   . VAL A 1 84  ? -7.057  33.472 -6.379  1.00 24.05  ? 84  VAL A CG2   1 
ATOM   643  N  N     . ARG A 1 85  ? -2.678  34.799 -6.535  1.00 28.34  ? 85  ARG A N     1 
ATOM   644  C  CA    . ARG A 1 85  ? -1.450  35.283 -7.122  1.00 11.83  ? 85  ARG A CA    1 
ATOM   645  C  C     . ARG A 1 85  ? -0.575  34.077 -7.419  1.00 27.10  ? 85  ARG A C     1 
ATOM   646  O  O     . ARG A 1 85  ? -0.827  32.986 -6.904  1.00 34.63  ? 85  ARG A O     1 
ATOM   647  C  CB    . ARG A 1 85  ? -0.762  36.270 -6.183  1.00 15.94  ? 85  ARG A CB    1 
ATOM   648  C  CG    . ARG A 1 85  ? -0.016  35.640 -5.034  1.00 27.28  ? 85  ARG A CG    1 
ATOM   649  C  CD    . ARG A 1 85  ? 0.527   36.700 -4.077  1.00 49.71  ? 85  ARG A CD    1 
ATOM   650  N  NE    . ARG A 1 85  ? 1.024   36.109 -2.834  1.00 49.12  ? 85  ARG A NE    1 
ATOM   651  C  CZ    . ARG A 1 85  ? 0.235   35.658 -1.863  1.00 62.50  ? 85  ARG A CZ    1 
ATOM   652  N  NH1   . ARG A 1 85  ? -1.092  35.728 -1.996  1.00 58.32  ? 85  ARG A NH1   1 
ATOM   653  N  NH2   . ARG A 1 85  ? 0.766   35.129 -0.766  1.00 27.37  ? 85  ARG A NH2   1 
ATOM   654  N  N     . LEU A 1 86  ? 0.442   34.251 -8.255  1.00 13.11  ? 86  LEU A N     1 
ATOM   655  C  CA    . LEU A 1 86  ? 1.282   33.115 -8.614  1.00 19.40  ? 86  LEU A CA    1 
ATOM   656  C  C     . LEU A 1 86  ? 2.746   33.319 -8.218  1.00 22.97  ? 86  LEU A C     1 
ATOM   657  O  O     . LEU A 1 86  ? 3.430   34.174 -8.769  1.00 42.40  ? 86  LEU A O     1 
ATOM   658  C  CB    . LEU A 1 86  ? 1.161   32.852 -10.108 1.00 15.01  ? 86  LEU A CB    1 
ATOM   659  C  CG    . LEU A 1 86  ? 2.193   31.978 -10.799 1.00 13.93  ? 86  LEU A CG    1 
ATOM   660  C  CD1   . LEU A 1 86  ? 1.977   30.539 -10.445 1.00 9.45   ? 86  LEU A CD1   1 
ATOM   661  C  CD2   . LEU A 1 86  ? 2.054   32.196 -12.285 1.00 18.71  ? 86  LEU A CD2   1 
ATOM   662  N  N     . GLU A 1 87  ? 3.213   32.522 -7.262  1.00 19.32  ? 87  GLU A N     1 
ATOM   663  C  CA    . GLU A 1 87  ? 4.567   32.639 -6.728  1.00 17.11  ? 87  GLU A CA    1 
ATOM   664  C  C     . GLU A 1 87  ? 5.475   31.627 -7.355  1.00 22.58  ? 87  GLU A C     1 
ATOM   665  O  O     . GLU A 1 87  ? 5.080   30.470 -7.531  1.00 33.63  ? 87  GLU A O     1 
ATOM   666  C  CB    . GLU A 1 87  ? 4.586   32.442 -5.210  1.00 16.17  ? 87  GLU A CB    1 
ATOM   667  C  CG    . GLU A 1 87  ? 3.968   33.582 -4.428  1.00 43.98  ? 87  GLU A CG    1 
ATOM   668  C  CD    . GLU A 1 87  ? 3.684   33.209 -2.991  1.00 52.51  ? 87  GLU A CD    1 
ATOM   669  O  OE1   . GLU A 1 87  ? 4.278   32.221 -2.500  1.00 38.06  ? 87  GLU A OE1   1 
ATOM   670  O  OE2   . GLU A 1 87  ? 2.865   33.910 -2.357  1.00 43.31  ? 87  GLU A OE2   1 
ATOM   671  N  N     . LEU A 1 88  ? 6.705   32.035 -7.660  1.00 25.36  ? 88  LEU A N     1 
ATOM   672  C  CA    . LEU A 1 88  ? 7.627   31.097 -8.280  1.00 31.17  ? 88  LEU A CA    1 
ATOM   673  C  C     . LEU A 1 88  ? 8.637   30.567 -7.276  1.00 34.99  ? 88  LEU A C     1 
ATOM   674  O  O     . LEU A 1 88  ? 9.646   31.200 -6.968  1.00 42.51  ? 88  LEU A O     1 
ATOM   675  C  CB    . LEU A 1 88  ? 8.341   31.770 -9.447  1.00 23.86  ? 88  LEU A CB    1 
ATOM   676  C  CG    . LEU A 1 88  ? 7.396   32.462 -10.435 1.00 24.04  ? 88  LEU A CG    1 
ATOM   677  C  CD1   . LEU A 1 88  ? 7.181   33.941 -10.103 1.00 65.35  ? 88  LEU A CD1   1 
ATOM   678  C  CD2   . LEU A 1 88  ? 7.899   32.314 -11.828 1.00 10.07  ? 88  LEU A CD2   1 
ATOM   679  N  N     . ARG A 1 89  ? 8.330   29.369 -6.801  1.00 27.86  ? 89  ARG A N     1 
ATOM   680  C  CA    . ARG A 1 89  ? 9.190   28.520 -5.996  1.00 26.15  ? 89  ARG A CA    1 
ATOM   681  C  C     . ARG A 1 89  ? 9.787   27.582 -7.008  1.00 29.45  ? 89  ARG A C     1 
ATOM   682  O  O     . ARG A 1 89  ? 9.783   27.917 -8.195  1.00 42.29  ? 89  ARG A O     1 
ATOM   683  C  CB    . ARG A 1 89  ? 8.396   27.822 -4.899  1.00 27.91  ? 89  ARG A CB    1 
ATOM   684  C  CG    . ARG A 1 89  ? 7.520   28.838 -4.174  1.00 23.70  ? 89  ARG A CG    1 
ATOM   685  C  CD    . ARG A 1 89  ? 6.695   28.264 -3.051  1.00 26.08  ? 89  ARG A CD    1 
ATOM   686  N  NE    . ARG A 1 89  ? 5.912   29.328 -2.430  1.00 27.54  ? 89  ARG A NE    1 
ATOM   687  C  CZ    . ARG A 1 89  ? 4.734   29.139 -1.846  1.00 31.50  ? 89  ARG A CZ    1 
ATOM   688  N  NH1   . ARG A 1 89  ? 4.209   27.921 -1.805  1.00 19.67  ? 89  ARG A NH1   1 
ATOM   689  N  NH2   . ARG A 1 89  ? 4.075   30.162 -1.313  1.00 23.18  ? 89  ARG A NH2   1 
ATOM   690  N  N     . GLU A 1 90  ? 10.333  26.444 -6.594  1.00 15.46  ? 90  GLU A N     1 
ATOM   691  C  CA    . GLU A 1 90  ? 10.930  25.573 -7.608  1.00 58.45  ? 90  GLU A CA    1 
ATOM   692  C  C     . GLU A 1 90  ? 9.887   24.935 -8.536  1.00 31.59  ? 90  GLU A C     1 
ATOM   693  O  O     . GLU A 1 90  ? 10.226  24.281 -9.519  1.00 50.82  ? 90  GLU A O     1 
ATOM   694  C  CB    . GLU A 1 90  ? 11.821  24.505 -6.976  1.00 56.56  ? 90  GLU A CB    1 
ATOM   695  C  CG    . GLU A 1 90  ? 13.301  24.838 -7.215  1.00 102.49 ? 90  GLU A CG    1 
ATOM   696  C  CD    . GLU A 1 90  ? 13.667  24.831 -8.707  1.00 127.06 ? 90  GLU A CD    1 
ATOM   697  O  OE1   . GLU A 1 90  ? 13.419  23.804 -9.378  1.00 126.07 ? 90  GLU A OE1   1 
ATOM   698  O  OE2   . GLU A 1 90  ? 14.161  25.866 -9.218  1.00 88.48  ? 90  GLU A OE2   1 
ATOM   699  N  N     . ASN A 1 91  ? 8.619   25.138 -8.216  1.00 42.09  ? 91  ASN A N     1 
ATOM   700  C  CA    . ASN A 1 91  ? 7.548   25.055 -9.202  1.00 16.52  ? 91  ASN A CA    1 
ATOM   701  C  C     . ASN A 1 91  ? 6.666   26.270 -9.006  1.00 23.35  ? 91  ASN A C     1 
ATOM   702  O  O     . ASN A 1 91  ? 6.557   26.786 -7.893  1.00 21.67  ? 91  ASN A O     1 
ATOM   703  C  CB    . ASN A 1 91  ? 6.713   23.787 -9.051  1.00 40.80  ? 91  ASN A CB    1 
ATOM   704  C  CG    . ASN A 1 91  ? 7.360   22.576 -9.663  1.00 38.31  ? 91  ASN A CG    1 
ATOM   705  O  OD1   . ASN A 1 91  ? 7.932   22.630 -10.757 1.00 70.85  ? 91  ASN A OD1   1 
ATOM   706  N  ND2   . ASN A 1 91  ? 7.254   21.457 -8.967  1.00 25.27  ? 91  ASN A ND2   1 
ATOM   707  N  N     . PRO A 1 92  ? 6.041   26.747 -10.081 1.00 20.87  ? 92  PRO A N     1 
ATOM   708  C  CA    . PRO A 1 92  ? 5.040   27.788 -9.867  1.00 19.82  ? 92  PRO A CA    1 
ATOM   709  C  C     . PRO A 1 92  ? 3.951   27.312 -8.905  1.00 19.25  ? 92  PRO A C     1 
ATOM   710  O  O     . PRO A 1 92  ? 3.571   26.141 -8.903  1.00 15.79  ? 92  PRO A O     1 
ATOM   711  C  CB    . PRO A 1 92  ? 4.478   28.027 -11.269 1.00 26.59  ? 92  PRO A CB    1 
ATOM   712  C  CG    . PRO A 1 92  ? 4.827   26.799 -12.045 1.00 26.18  ? 92  PRO A CG    1 
ATOM   713  C  CD    . PRO A 1 92  ? 6.138   26.348 -11.492 1.00 13.94  ? 92  PRO A CD    1 
ATOM   714  N  N     . VAL A 1 93  ? 3.485   28.216 -8.057  1.00 13.75  ? 93  VAL A N     1 
ATOM   715  C  CA    . VAL A 1 93  ? 2.418   27.887 -7.141  1.00 14.84  ? 93  VAL A CA    1 
ATOM   716  C  C     . VAL A 1 93  ? 1.338   28.946 -7.234  1.00 18.45  ? 93  VAL A C     1 
ATOM   717  O  O     . VAL A 1 93  ? 1.614   30.135 -7.115  1.00 11.55  ? 93  VAL A O     1 
ATOM   718  C  CB    . VAL A 1 93  ? 2.927   27.773 -5.685  1.00 13.23  ? 93  VAL A CB    1 
ATOM   719  C  CG1   . VAL A 1 93  ? 1.791   27.435 -4.749  1.00 12.73  ? 93  VAL A CG1   1 
ATOM   720  C  CG2   . VAL A 1 93  ? 3.970   26.710 -5.592  1.00 11.46  ? 93  VAL A CG2   1 
ATOM   721  N  N     . LEU A 1 94  ? 0.108   28.514 -7.485  1.00 26.53  ? 94  LEU A N     1 
ATOM   722  C  CA    . LEU A 1 94  ? -1.039  29.402 -7.351  1.00 24.00  ? 94  LEU A CA    1 
ATOM   723  C  C     . LEU A 1 94  ? -1.365  29.517 -5.872  1.00 19.89  ? 94  LEU A C     1 
ATOM   724  O  O     . LEU A 1 94  ? -1.411  28.510 -5.163  1.00 21.80  ? 94  LEU A O     1 
ATOM   725  C  CB    . LEU A 1 94  ? -2.237  28.875 -8.135  1.00 18.50  ? 94  LEU A CB    1 
ATOM   726  C  CG    . LEU A 1 94  ? -2.223  29.190 -9.627  1.00 24.88  ? 94  LEU A CG    1 
ATOM   727  C  CD1   . LEU A 1 94  ? -3.343  28.465 -10.340 1.00 28.73  ? 94  LEU A CD1   1 
ATOM   728  C  CD2   . LEU A 1 94  ? -2.368  30.682 -9.823  1.00 17.21  ? 94  LEU A CD2   1 
ATOM   729  N  N     . VAL A 1 95  ? -1.557  30.740 -5.394  1.00 21.98  ? 95  VAL A N     1 
ATOM   730  C  CA    . VAL A 1 95  ? -1.817  30.961 -3.976  1.00 9.41   ? 95  VAL A CA    1 
ATOM   731  C  C     . VAL A 1 95  ? -3.025  31.858 -3.777  1.00 20.12  ? 95  VAL A C     1 
ATOM   732  O  O     . VAL A 1 95  ? -3.040  33.029 -4.179  1.00 23.07  ? 95  VAL A O     1 
ATOM   733  C  CB    . VAL A 1 95  ? -0.607  31.577 -3.270  1.00 15.78  ? 95  VAL A CB    1 
ATOM   734  C  CG1   . VAL A 1 95  ? -0.951  31.912 -1.827  1.00 17.81  ? 95  VAL A CG1   1 
ATOM   735  C  CG2   . VAL A 1 95  ? 0.578   30.621 -3.327  1.00 16.94  ? 95  VAL A CG2   1 
ATOM   736  N  N     . SER A 1 96  ? -4.044  31.289 -3.153  1.00 15.14  ? 96  SER A N     1 
ATOM   737  C  CA    . SER A 1 96  ? -5.275  32.003 -2.919  1.00 23.02  ? 96  SER A CA    1 
ATOM   738  C  C     . SER A 1 96  ? -5.450  32.191 -1.426  1.00 38.45  ? 96  SER A C     1 
ATOM   739  O  O     . SER A 1 96  ? -5.468  31.223 -0.655  1.00 22.49  ? 96  SER A O     1 
ATOM   740  C  CB    . SER A 1 96  ? -6.468  31.257 -3.515  1.00 40.02  ? 96  SER A CB    1 
ATOM   741  O  OG    . SER A 1 96  ? -7.668  31.992 -3.326  1.00 51.19  ? 96  SER A OG    1 
ATOM   742  N  N     . ILE A 1 97  ? -5.566  33.454 -1.032  1.00 31.08  ? 97  ILE A N     1 
ATOM   743  C  CA    . ILE A 1 97  ? -5.762  33.816 0.357   1.00 25.52  ? 97  ILE A CA    1 
ATOM   744  C  C     . ILE A 1 97  ? -7.066  34.574 0.535   1.00 26.91  ? 97  ILE A C     1 
ATOM   745  O  O     . ILE A 1 97  ? -7.519  35.319 -0.333  1.00 20.75  ? 97  ILE A O     1 
ATOM   746  C  CB    . ILE A 1 97  ? -4.606  34.670 0.888   1.00 17.91  ? 97  ILE A CB    1 
ATOM   747  C  CG1   . ILE A 1 97  ? -3.275  33.987 0.602   1.00 31.29  ? 97  ILE A CG1   1 
ATOM   748  C  CG2   . ILE A 1 97  ? -4.740  34.896 2.377   1.00 32.76  ? 97  ILE A CG2   1 
ATOM   749  C  CD1   . ILE A 1 97  ? -2.089  34.673 1.270   1.00 73.40  ? 97  ILE A CD1   1 
ATOM   750  N  N     . ARG A 1 98  ? -7.652  34.366 1.696   1.00 20.67  ? 98  ARG A N     1 
ATOM   751  C  CA    . ARG A 1 98  ? -8.934  34.907 2.058   1.00 19.54  ? 98  ARG A CA    1 
ATOM   752  C  C     . ARG A 1 98  ? -8.773  35.269 3.512   1.00 30.51  ? 98  ARG A C     1 
ATOM   753  O  O     . ARG A 1 98  ? -8.056  34.584 4.249   1.00 24.66  ? 98  ARG A O     1 
ATOM   754  C  CB    . ARG A 1 98  ? -10.016 33.857 1.793   1.00 21.46  ? 98  ARG A CB    1 
ATOM   755  C  CG    . ARG A 1 98  ? -11.345 33.953 2.475   1.00 29.85  ? 98  ARG A CG    1 
ATOM   756  C  CD    . ARG A 1 98  ? -12.106 32.706 2.020   1.00 41.06  ? 98  ARG A CD    1 
ATOM   757  N  NE    . ARG A 1 98  ? -13.138 32.182 2.921   1.00 33.58  ? 98  ARG A NE    1 
ATOM   758  C  CZ    . ARG A 1 98  ? -14.340 32.727 3.081   1.00 42.90  ? 98  ARG A CZ    1 
ATOM   759  N  NH1   . ARG A 1 98  ? -14.655 33.840 2.425   1.00 61.77  ? 98  ARG A NH1   1 
ATOM   760  N  NH2   . ARG A 1 98  ? -15.226 32.159 3.892   1.00 32.08  ? 98  ARG A NH2   1 
ATOM   761  N  N     . ARG A 1 99  ? -9.364  36.376 3.927   1.00 40.45  ? 99  ARG A N     1 
ATOM   762  C  CA    . ARG A 1 99  ? -9.357  36.673 5.347   1.00 47.61  ? 99  ARG A CA    1 
ATOM   763  C  C     . ARG A 1 99  ? -10.797 36.684 5.829   1.00 52.72  ? 99  ARG A C     1 
ATOM   764  O  O     . ARG A 1 99  ? -11.728 36.837 5.035   1.00 65.43  ? 99  ARG A O     1 
ATOM   765  C  CB    . ARG A 1 99  ? -8.656  37.992 5.636   1.00 53.07  ? 99  ARG A CB    1 
ATOM   766  C  CG    . ARG A 1 99  ? -7.694  37.921 6.819   1.00 74.65  ? 99  ARG A CG    1 
ATOM   767  C  CD    . ARG A 1 99  ? -6.249  38.153 6.378   1.00 90.11  ? 99  ARG A CD    1 
ATOM   768  N  NE    . ARG A 1 99  ? -5.992  39.551 6.022   1.00 98.07  ? 99  ARG A NE    1 
ATOM   769  C  CZ    . ARG A 1 99  ? -5.011  39.953 5.216   1.00 101.47 ? 99  ARG A CZ    1 
ATOM   770  N  NH1   . ARG A 1 99  ? -4.186  39.062 4.678   1.00 79.62  ? 99  ARG A NH1   1 
ATOM   771  N  NH2   . ARG A 1 99  ? -4.854  41.247 4.947   1.00 79.42  ? 99  ARG A NH2   1 
ATOM   772  N  N     . LYS A 1 100 ? -10.970 36.494 7.128   1.00 42.01  ? 100 LYS A N     1 
ATOM   773  C  CA    . LYS A 1 100 ? -12.295 36.309 7.711   1.00 65.10  ? 100 LYS A CA    1 
ATOM   774  C  C     . LYS A 1 100 ? -13.106 35.211 7.000   1.00 46.23  ? 100 LYS A C     1 
ATOM   775  O  O     . LYS A 1 100 ? -13.944 35.490 6.146   1.00 45.71  ? 100 LYS A O     1 
ATOM   776  C  CB    . LYS A 1 100 ? -13.068 37.626 7.755   1.00 29.25  ? 100 LYS A CB    1 
ATOM   777  C  CG    . LYS A 1 100 ? -13.677 37.854 9.143   1.00 45.48  ? 100 LYS A CG    1 
ATOM   778  C  CD    . LYS A 1 100 ? -12.701 37.354 10.209  1.00 65.27  ? 100 LYS A CD    1 
ATOM   779  C  CE    . LYS A 1 100 ? -13.403 36.920 11.480  1.00 76.38  ? 100 LYS A CE    1 
ATOM   780  N  NZ    . LYS A 1 100 ? -12.493 36.069 12.299  1.00 56.95  ? 100 LYS A NZ    1 
ATOM   781  N  N     . PRO A 1 101 ? -12.797 33.948 7.316   1.00 27.63  ? 101 PRO A N     1 
ATOM   782  C  CA    . PRO A 1 101 ? -11.689 33.638 8.224   1.00 21.99  ? 101 PRO A CA    1 
ATOM   783  C  C     . PRO A 1 101 ? -10.415 33.563 7.441   1.00 37.07  ? 101 PRO A C     1 
ATOM   784  O  O     . PRO A 1 101 ? -10.458 33.644 6.214   1.00 37.62  ? 101 PRO A O     1 
ATOM   785  C  CB    . PRO A 1 101 ? -12.052 32.272 8.775   1.00 37.97  ? 101 PRO A CB    1 
ATOM   786  C  CG    . PRO A 1 101 ? -12.851 31.649 7.658   1.00 25.98  ? 101 PRO A CG    1 
ATOM   787  C  CD    . PRO A 1 101 ? -13.663 32.783 7.090   1.00 17.87  ? 101 PRO A CD    1 
ATOM   788  N  N     . ARG A 1 102 ? -9.303  33.382 8.130   1.00 31.81  ? 102 ARG A N     1 
ATOM   789  C  CA    . ARG A 1 102 ? -8.044  33.264 7.438   1.00 37.43  ? 102 ARG A CA    1 
ATOM   790  C  C     . ARG A 1 102 ? -7.993  31.906 6.758   1.00 30.36  ? 102 ARG A C     1 
ATOM   791  O  O     . ARG A 1 102 ? -8.173  30.885 7.411   1.00 23.30  ? 102 ARG A O     1 
ATOM   792  C  CB    . ARG A 1 102 ? -6.884  33.438 8.407   1.00 31.60  ? 102 ARG A CB    1 
ATOM   793  C  CG    . ARG A 1 102 ? -5.539  33.293 7.755   1.00 73.09  ? 102 ARG A CG    1 
ATOM   794  C  CD    . ARG A 1 102 ? -5.009  34.625 7.263   1.00 74.08  ? 102 ARG A CD    1 
ATOM   795  N  NE    . ARG A 1 102 ? -3.910  34.403 6.332   1.00 101.15 ? 102 ARG A NE    1 
ATOM   796  C  CZ    . ARG A 1 102 ? -3.101  35.350 5.880   1.00 89.76  ? 102 ARG A CZ    1 
ATOM   797  N  NH1   . ARG A 1 102 ? -3.251  36.605 6.288   1.00 72.02  ? 102 ARG A NH1   1 
ATOM   798  N  NH2   . ARG A 1 102 ? -2.132  35.030 5.033   1.00 81.32  ? 102 ARG A NH2   1 
ATOM   799  N  N     . GLU A 1 103 ? -7.782  31.892 5.443   1.00 31.42  ? 103 GLU A N     1 
ATOM   800  C  CA    . GLU A 1 103 ? -7.666  30.630 4.707   1.00 23.77  ? 103 GLU A CA    1 
ATOM   801  C  C     . GLU A 1 103 ? -6.628  30.696 3.592   1.00 18.72  ? 103 GLU A C     1 
ATOM   802  O  O     . GLU A 1 103 ? -6.571  31.651 2.818   1.00 32.85  ? 103 GLU A O     1 
ATOM   803  C  CB    . GLU A 1 103 ? -9.018  30.214 4.118   1.00 19.24  ? 103 GLU A CB    1 
ATOM   804  C  CG    . GLU A 1 103 ? -10.132 30.040 5.138   1.00 34.24  ? 103 GLU A CG    1 
ATOM   805  C  CD    . GLU A 1 103 ? -11.270 29.184 4.634   1.00 35.45  ? 103 GLU A CD    1 
ATOM   806  O  OE1   . GLU A 1 103 ? -11.235 27.952 4.883   1.00 26.08  ? 103 GLU A OE1   1 
ATOM   807  O  OE2   . GLU A 1 103 ? -12.200 29.745 4.001   1.00 39.31  ? 103 GLU A OE2   1 
ATOM   808  N  N     . THR A 1 104 ? -5.814  29.657 3.501   1.00 16.81  ? 104 THR A N     1 
ATOM   809  C  CA    . THR A 1 104 ? -4.781  29.603 2.487   1.00 16.60  ? 104 THR A CA    1 
ATOM   810  C  C     . THR A 1 104 ? -4.943  28.384 1.601   1.00 25.15  ? 104 THR A C     1 
ATOM   811  O  O     . THR A 1 104 ? -4.986  27.259 2.087   1.00 27.20  ? 104 THR A O     1 
ATOM   812  C  CB    . THR A 1 104 ? -3.390  29.590 3.118   1.00 9.60   ? 104 THR A CB    1 
ATOM   813  O  OG1   . THR A 1 104 ? -3.055  30.922 3.512   1.00 24.67  ? 104 THR A OG1   1 
ATOM   814  C  CG2   . THR A 1 104 ? -2.365  29.105 2.124   1.00 19.55  ? 104 THR A CG2   1 
ATOM   815  N  N     . LEU A 1 105 ? -5.036  28.617 0.296   1.00 30.84  ? 105 LEU A N     1 
ATOM   816  C  CA    . LEU A 1 105 ? -5.060  27.533 -0.675  1.00 17.80  ? 105 LEU A CA    1 
ATOM   817  C  C     . LEU A 1 105 ? -3.832  27.634 -1.577  1.00 21.17  ? 105 LEU A C     1 
ATOM   818  O  O     . LEU A 1 105 ? -3.587  28.677 -2.179  1.00 36.18  ? 105 LEU A O     1 
ATOM   819  C  CB    . LEU A 1 105 ? -6.347  27.584 -1.494  1.00 22.02  ? 105 LEU A CB    1 
ATOM   820  C  CG    . LEU A 1 105 ? -6.552  26.428 -2.463  1.00 29.87  ? 105 LEU A CG    1 
ATOM   821  C  CD1   . LEU A 1 105 ? -6.442  25.115 -1.708  1.00 17.32  ? 105 LEU A CD1   1 
ATOM   822  C  CD2   . LEU A 1 105 ? -7.881  26.547 -3.200  1.00 8.48   ? 105 LEU A CD2   1 
ATOM   823  N  N     . GLU A 1 106 ? -3.054  26.562 -1.656  1.00 15.95  ? 106 GLU A N     1 
ATOM   824  C  CA    . GLU A 1 106 ? -1.813  26.577 -2.431  1.00 20.10  ? 106 GLU A CA    1 
ATOM   825  C  C     . GLU A 1 106 ? -1.757  25.462 -3.456  1.00 25.94  ? 106 GLU A C     1 
ATOM   826  O  O     . GLU A 1 106 ? -1.706  24.281 -3.097  1.00 24.57  ? 106 GLU A O     1 
ATOM   827  C  CB    . GLU A 1 106 ? -0.594  26.451 -1.518  1.00 22.66  ? 106 GLU A CB    1 
ATOM   828  C  CG    . GLU A 1 106 ? -0.280  27.677 -0.702  1.00 33.16  ? 106 GLU A CG    1 
ATOM   829  C  CD    . GLU A 1 106 ? 1.137   27.650 -0.184  1.00 40.35  ? 106 GLU A CD    1 
ATOM   830  O  OE1   . GLU A 1 106 ? 1.783   26.586 -0.328  1.00 37.45  ? 106 GLU A OE1   1 
ATOM   831  O  OE2   . GLU A 1 106 ? 1.603   28.686 0.351   1.00 33.86  ? 106 GLU A OE2   1 
ATOM   832  N  N     . VAL A 1 107 ? -1.730  25.826 -4.732  1.00 16.11  ? 107 VAL A N     1 
ATOM   833  C  CA    . VAL A 1 107 ? -1.636  24.813 -5.770  1.00 14.53  ? 107 VAL A CA    1 
ATOM   834  C  C     . VAL A 1 107 ? -0.290  24.862 -6.436  1.00 22.80  ? 107 VAL A C     1 
ATOM   835  O  O     . VAL A 1 107 ? 0.044   25.847 -7.100  1.00 24.90  ? 107 VAL A O     1 
ATOM   836  C  CB    . VAL A 1 107 ? -2.698  24.979 -6.834  1.00 16.24  ? 107 VAL A CB    1 
ATOM   837  C  CG1   . VAL A 1 107 ? -2.770  23.724 -7.654  1.00 15.74  ? 107 VAL A CG1   1 
ATOM   838  C  CG2   . VAL A 1 107 ? -4.036  25.289 -6.196  1.00 17.89  ? 107 VAL A CG2   1 
ATOM   839  N  N     . GLU A 1 108 ? 0.471   23.786 -6.261  1.00 18.86  ? 108 GLU A N     1 
ATOM   840  C  CA    . GLU A 1 108 ? 1.826   23.688 -6.784  1.00 14.00  ? 108 GLU A CA    1 
ATOM   841  C  C     . GLU A 1 108 ? 1.744   23.066 -8.157  1.00 32.62  ? 108 GLU A C     1 
ATOM   842  O  O     . GLU A 1 108 ? 1.389   21.898 -8.282  1.00 33.84  ? 108 GLU A O     1 
ATOM   843  C  CB    . GLU A 1 108 ? 2.698   22.844 -5.864  1.00 10.94  ? 108 GLU A CB    1 
ATOM   844  C  CG    . GLU A 1 108 ? 4.133   22.652 -6.325  1.00 38.94  ? 108 GLU A CG    1 
ATOM   845  C  CD    . GLU A 1 108 ? 4.867   21.567 -5.534  1.00 63.54  ? 108 GLU A CD    1 
ATOM   846  O  OE1   . GLU A 1 108 ? 4.522   21.342 -4.347  1.00 63.75  ? 108 GLU A OE1   1 
ATOM   847  O  OE2   . GLU A 1 108 ? 5.784   20.935 -6.105  1.00 53.52  ? 108 GLU A OE2   1 
ATOM   848  N  N     . LEU A 1 109 ? 2.077   23.832 -9.190  1.00 39.86  ? 109 LEU A N     1 
ATOM   849  C  CA    . LEU A 1 109 ? 1.892   23.336 -10.539 1.00 13.77  ? 109 LEU A CA    1 
ATOM   850  C  C     . LEU A 1 109 ? 3.180   22.655 -10.953 1.00 23.18  ? 109 LEU A C     1 
ATOM   851  O  O     . LEU A 1 109 ? 4.183   23.311 -11.214 1.00 42.76  ? 109 LEU A O     1 
ATOM   852  C  CB    . LEU A 1 109 ? 1.527   24.483 -11.477 1.00 17.32  ? 109 LEU A CB    1 
ATOM   853  C  CG    . LEU A 1 109 ? 0.336   25.308 -10.984 1.00 13.63  ? 109 LEU A CG    1 
ATOM   854  C  CD1   . LEU A 1 109 ? 0.164   26.573 -11.770 1.00 10.62  ? 109 LEU A CD1   1 
ATOM   855  C  CD2   . LEU A 1 109 ? -0.917  24.484 -11.073 1.00 23.12  ? 109 LEU A CD2   1 
ATOM   856  N  N     . GLU A 1 110 ? 3.135   21.325 -10.992 1.00 26.09  ? 110 GLU A N     1 
ATOM   857  C  CA    . GLU A 1 110 ? 4.298   20.494 -11.277 1.00 14.27  ? 110 GLU A CA    1 
ATOM   858  C  C     . GLU A 1 110 ? 4.561   20.418 -12.769 1.00 22.88  ? 110 GLU A C     1 
ATOM   859  O  O     . GLU A 1 110 ? 5.696   20.580 -13.220 1.00 50.42  ? 110 GLU A O     1 
ATOM   860  C  CB    . GLU A 1 110 ? 4.102   19.091 -10.715 1.00 13.81  ? 110 GLU A CB    1 
ATOM   861  C  CG    . GLU A 1 110 ? 4.314   18.982 -9.225  1.00 40.25  ? 110 GLU A CG    1 
ATOM   862  C  CD    . GLU A 1 110 ? 3.955   17.607 -8.700  1.00 43.36  ? 110 GLU A CD    1 
ATOM   863  O  OE1   . GLU A 1 110 ? 2.895   17.087 -9.111  1.00 30.77  ? 110 GLU A OE1   1 
ATOM   864  O  OE2   . GLU A 1 110 ? 4.729   17.051 -7.887  1.00 34.78  ? 110 GLU A OE2   1 
ATOM   865  N  N     . GLU A 1 111 ? 3.492   20.148 -13.516 1.00 23.88  ? 111 GLU A N     1 
ATOM   866  C  CA    . GLU A 1 111 ? 3.487   20.181 -14.976 1.00 30.59  ? 111 GLU A CA    1 
ATOM   867  C  C     . GLU A 1 111 ? 2.221   20.866 -15.497 1.00 19.25  ? 111 GLU A C     1 
ATOM   868  O  O     . GLU A 1 111 ? 1.126   20.359 -15.297 1.00 39.58  ? 111 GLU A O     1 
ATOM   869  C  CB    . GLU A 1 111 ? 3.584   18.755 -15.528 1.00 43.63  ? 111 GLU A CB    1 
ATOM   870  C  CG    . GLU A 1 111 ? 4.953   18.386 -16.073 1.00 80.07  ? 111 GLU A CG    1 
ATOM   871  C  CD    . GLU A 1 111 ? 5.171   18.952 -17.455 1.00 93.22  ? 111 GLU A CD    1 
ATOM   872  O  OE1   . GLU A 1 111 ? 4.274   18.740 -18.302 1.00 61.84  ? 111 GLU A OE1   1 
ATOM   873  O  OE2   . GLU A 1 111 ? 6.213   19.617 -17.683 1.00 94.22  ? 111 GLU A OE2   1 
ATOM   874  N  N     . VAL A 1 112 ? 2.347   21.997 -16.174 1.00 5.41   ? 112 VAL A N     1 
ATOM   875  C  CA    . VAL A 1 112 ? 1.153   22.613 -16.750 1.00 8.03   ? 112 VAL A CA    1 
ATOM   876  C  C     . VAL A 1 112 ? 0.911   22.156 -18.204 1.00 18.03  ? 112 VAL A C     1 
ATOM   877  O  O     . VAL A 1 112 ? 1.661   22.495 -19.110 1.00 23.78  ? 112 VAL A O     1 
ATOM   878  C  CB    . VAL A 1 112 ? 1.241   24.150 -16.730 1.00 8.00   ? 112 VAL A CB    1 
ATOM   879  C  CG1   . VAL A 1 112 ? 0.049   24.756 -17.459 1.00 5.99   ? 112 VAL A CG1   1 
ATOM   880  C  CG2   . VAL A 1 112 ? 1.330   24.670 -15.304 1.00 6.26   ? 112 VAL A CG2   1 
ATOM   881  N  N     . TYR A 1 113 ? -0.144  21.392 -18.436 1.00 18.68  ? 113 TYR A N     1 
ATOM   882  C  CA    . TYR A 1 113 ? -0.415  20.907 -19.784 1.00 10.15  ? 113 TYR A CA    1 
ATOM   883  C  C     . TYR A 1 113 ? -1.090  21.975 -20.638 1.00 10.55  ? 113 TYR A C     1 
ATOM   884  O  O     . TYR A 1 113 ? -0.851  22.057 -21.834 1.00 24.16  ? 113 TYR A O     1 
ATOM   885  C  CB    . TYR A 1 113 ? -1.292  19.649 -19.755 1.00 15.80  ? 113 TYR A CB    1 
ATOM   886  C  CG    . TYR A 1 113 ? -0.865  18.601 -18.755 1.00 23.54  ? 113 TYR A CG    1 
ATOM   887  C  CD1   . TYR A 1 113 ? 0.308   17.882 -18.934 1.00 15.55  ? 113 TYR A CD1   1 
ATOM   888  C  CD2   . TYR A 1 113 ? -1.638  18.331 -17.629 1.00 22.63  ? 113 TYR A CD2   1 
ATOM   889  C  CE1   . TYR A 1 113 ? 0.705   16.921 -18.031 1.00 15.90  ? 113 TYR A CE1   1 
ATOM   890  C  CE2   . TYR A 1 113 ? -1.247  17.370 -16.719 1.00 35.49  ? 113 TYR A CE2   1 
ATOM   891  C  CZ    . TYR A 1 113 ? -0.073  16.671 -16.929 1.00 31.27  ? 113 TYR A CZ    1 
ATOM   892  O  OH    . TYR A 1 113 ? 0.336   15.715 -16.038 1.00 30.54  ? 113 TYR A OH    1 
ATOM   893  N  N     . MET A 1 114 ? -1.954  22.778 -20.037 1.00 13.99  ? 114 MET A N     1 
ATOM   894  C  CA    . MET A 1 114 ? -2.582  23.878 -20.762 1.00 14.96  ? 114 MET A CA    1 
ATOM   895  C  C     . MET A 1 114 ? -2.935  25.019 -19.813 1.00 23.99  ? 114 MET A C     1 
ATOM   896  O  O     . MET A 1 114 ? -3.267  24.801 -18.644 1.00 24.73  ? 114 MET A O     1 
ATOM   897  C  CB    . MET A 1 114 ? -3.836  23.403 -21.504 1.00 10.36  ? 114 MET A CB    1 
ATOM   898  C  CG    . MET A 1 114 ? -4.429  24.441 -22.458 1.00 20.35  ? 114 MET A CG    1 
ATOM   899  S  SD    . MET A 1 114 ? -6.230  24.342 -22.665 1.00 41.92  ? 114 MET A SD    1 
ATOM   900  C  CE    . MET A 1 114 ? -6.739  24.739 -20.985 1.00 38.12  ? 114 MET A CE    1 
ATOM   901  N  N     . VAL A 1 115 ? -2.845  26.239 -20.322 1.00 11.18  ? 115 VAL A N     1 
ATOM   902  C  CA    . VAL A 1 115 ? -3.289  27.411 -19.594 1.00 8.97   ? 115 VAL A CA    1 
ATOM   903  C  C     . VAL A 1 115 ? -4.144  28.167 -20.571 1.00 12.47  ? 115 VAL A C     1 
ATOM   904  O  O     . VAL A 1 115 ? -3.902  28.114 -21.776 1.00 28.54  ? 115 VAL A O     1 
ATOM   905  C  CB    . VAL A 1 115 ? -2.114  28.285 -19.066 1.00 12.60  ? 115 VAL A CB    1 
ATOM   906  C  CG1   . VAL A 1 115 ? -1.192  28.715 -20.198 1.00 20.05  ? 115 VAL A CG1   1 
ATOM   907  C  CG2   . VAL A 1 115 ? -2.641  29.495 -18.343 1.00 5.86   ? 115 VAL A CG2   1 
ATOM   908  N  N     . SER A 1 116 ? -5.182  28.823 -20.078 1.00 14.31  ? 116 SER A N     1 
ATOM   909  C  CA    . SER A 1 116 ? -6.059  29.553 -20.973 1.00 22.00  ? 116 SER A CA    1 
ATOM   910  C  C     . SER A 1 116 ? -6.729  30.727 -20.301 1.00 15.17  ? 116 SER A C     1 
ATOM   911  O  O     . SER A 1 116 ? -7.129  30.660 -19.134 1.00 10.38  ? 116 SER A O     1 
ATOM   912  C  CB    . SER A 1 116 ? -7.120  28.624 -21.553 1.00 11.70  ? 116 SER A CB    1 
ATOM   913  O  OG    . SER A 1 116 ? -7.943  28.115 -20.524 1.00 38.57  ? 116 SER A OG    1 
ATOM   914  N  N     . VAL A 1 117 ? -6.877  31.794 -21.071 1.00 9.77   ? 117 VAL A N     1 
ATOM   915  C  CA    . VAL A 1 117 ? -7.576  32.968 -20.600 1.00 24.63  ? 117 VAL A CA    1 
ATOM   916  C  C     . VAL A 1 117 ? -8.858  33.131 -21.410 1.00 27.65  ? 117 VAL A C     1 
ATOM   917  O  O     . VAL A 1 117 ? -8.823  33.141 -22.636 1.00 37.20  ? 117 VAL A O     1 
ATOM   918  C  CB    . VAL A 1 117 ? -6.683  34.217 -20.701 1.00 25.07  ? 117 VAL A CB    1 
ATOM   919  C  CG1   . VAL A 1 117 ? -7.429  35.459 -20.261 1.00 19.63  ? 117 VAL A CG1   1 
ATOM   920  C  CG2   . VAL A 1 117 ? -5.442  34.034 -19.851 1.00 9.24   ? 117 VAL A CG2   1 
ATOM   921  N  N     . PHE A 1 118 ? -9.991  33.223 -20.719 1.00 29.73  ? 118 PHE A N     1 
ATOM   922  C  CA    . PHE A 1 118 ? -11.298 33.284 -21.376 1.00 30.05  ? 118 PHE A CA    1 
ATOM   923  C  C     . PHE A 1 118 ? -12.002 34.580 -20.983 1.00 16.22  ? 118 PHE A C     1 
ATOM   924  O  O     . PHE A 1 118 ? -12.520 34.702 -19.880 1.00 10.58  ? 118 PHE A O     1 
ATOM   925  C  CB    . PHE A 1 118 ? -12.124 32.038 -20.977 1.00 25.06  ? 118 PHE A CB    1 
ATOM   926  C  CG    . PHE A 1 118 ? -13.532 31.999 -21.523 1.00 19.54  ? 118 PHE A CG    1 
ATOM   927  C  CD1   . PHE A 1 118 ? -13.884 32.665 -22.678 1.00 18.31  ? 118 PHE A CD1   1 
ATOM   928  C  CD2   . PHE A 1 118 ? -14.507 31.266 -20.867 1.00 31.49  ? 118 PHE A CD2   1 
ATOM   929  C  CE1   . PHE A 1 118 ? -15.177 32.611 -23.157 1.00 16.05  ? 118 PHE A CE1   1 
ATOM   930  C  CE2   . PHE A 1 118 ? -15.806 31.210 -21.348 1.00 25.68  ? 118 PHE A CE2   1 
ATOM   931  C  CZ    . PHE A 1 118 ? -16.139 31.884 -22.488 1.00 17.00  ? 118 PHE A CZ    1 
ATOM   932  N  N     . ARG A 1 119 ? -12.108 35.531 -21.895 1.00 17.92  ? 119 ARG A N     1 
ATOM   933  C  CA    . ARG A 1 119 ? -12.704 36.765 -21.449 1.00 11.78  ? 119 ARG A CA    1 
ATOM   934  C  C     . ARG A 1 119 ? -14.169 36.568 -21.681 1.00 16.81  ? 119 ARG A C     1 
ATOM   935  O  O     . ARG A 1 119 ? -14.704 36.928 -22.721 1.00 28.51  ? 119 ARG A O     1 
ATOM   936  C  CB    . ARG A 1 119 ? -12.156 37.954 -22.242 1.00 7.40   ? 119 ARG A CB    1 
ATOM   937  C  CG    . ARG A 1 119 ? -10.650 37.944 -22.289 1.00 15.77  ? 119 ARG A CG    1 
ATOM   938  C  CD    . ARG A 1 119 ? -10.002 38.836 -23.333 1.00 9.90   ? 119 ARG A CD    1 
ATOM   939  N  NE    . ARG A 1 119 ? -8.547  38.808 -23.124 1.00 45.09  ? 119 ARG A NE    1 
ATOM   940  C  CZ    . ARG A 1 119 ? -7.730  37.820 -23.505 1.00 36.53  ? 119 ARG A CZ    1 
ATOM   941  N  NH1   . ARG A 1 119 ? -8.192  36.763 -24.159 1.00 26.96  ? 119 ARG A NH1   1 
ATOM   942  N  NH2   . ARG A 1 119 ? -6.433  37.892 -23.243 1.00 31.45  ? 119 ARG A NH2   1 
ATOM   943  N  N     . ALA A 1 120 ? -14.851 36.123 -20.640 1.00 16.12  ? 120 ALA A N     1 
ATOM   944  C  CA    . ALA A 1 120 ? -16.209 35.683 -20.830 1.00 20.57  ? 120 ALA A CA    1 
ATOM   945  C  C     . ALA A 1 120 ? -17.082 36.872 -20.616 1.00 9.16   ? 120 ALA A C     1 
ATOM   946  O  O     . ALA A 1 120 ? -16.817 37.692 -19.754 1.00 29.06  ? 120 ALA A O     1 
ATOM   947  C  CB    . ALA A 1 120 ? -16.568 34.561 -19.892 1.00 23.37  ? 120 ALA A CB    1 
ATOM   948  N  N     . GLU A 1 121 ? -18.119 36.968 -21.423 1.00 16.48  ? 121 GLU A N     1 
ATOM   949  C  CA    . GLU A 1 121 ? -19.041 38.071 -21.354 1.00 11.47  ? 121 GLU A CA    1 
ATOM   950  C  C     . GLU A 1 121 ? -20.395 37.460 -21.040 1.00 12.80  ? 121 GLU A C     1 
ATOM   951  O  O     . GLU A 1 121 ? -20.858 36.589 -21.767 1.00 7.50   ? 121 GLU A O     1 
ATOM   952  C  CB    . GLU A 1 121 ? -19.020 38.826 -22.675 1.00 16.61  ? 121 GLU A CB    1 
ATOM   953  C  CG    . GLU A 1 121 ? -19.483 40.248 -22.639 1.00 63.95  ? 121 GLU A CG    1 
ATOM   954  C  CD    . GLU A 1 121 ? -19.290 40.903 -23.984 1.00 82.75  ? 121 GLU A CD    1 
ATOM   955  O  OE1   . GLU A 1 121 ? -19.226 40.157 -24.986 1.00 67.50  ? 121 GLU A OE1   1 
ATOM   956  O  OE2   . GLU A 1 121 ? -19.215 42.149 -24.046 1.00 108.32 ? 121 GLU A OE2   1 
ATOM   957  N  N     . ASP A 1 122 ? -20.956 37.797 -19.884 1.00 18.16  ? 122 ASP A N     1 
ATOM   958  C  CA    . ASP A 1 122 ? -22.273 37.287 -19.510 1.00 12.37  ? 122 ASP A CA    1 
ATOM   959  C  C     . ASP A 1 122 ? -23.100 38.331 -18.773 1.00 10.81  ? 122 ASP A C     1 
ATOM   960  O  O     . ASP A 1 122 ? -22.756 38.725 -17.666 1.00 30.03  ? 122 ASP A O     1 
ATOM   961  C  CB    . ASP A 1 122 ? -22.102 36.042 -18.647 1.00 12.99  ? 122 ASP A CB    1 
ATOM   962  C  CG    . ASP A 1 122 ? -23.367 35.233 -18.507 1.00 20.62  ? 122 ASP A CG    1 
ATOM   963  O  OD1   . ASP A 1 122 ? -24.450 35.690 -18.940 1.00 15.26  ? 122 ASP A OD1   1 
ATOM   964  O  OD2   . ASP A 1 122 ? -23.266 34.132 -17.920 1.00 22.30  ? 122 ASP A OD2   1 
ATOM   965  N  N     . TYR A 1 123 ? -24.194 38.768 -19.372 1.00 18.26  ? 123 TYR A N     1 
ATOM   966  C  CA    . TYR A 1 123 ? -25.116 39.677 -18.699 1.00 18.02  ? 123 TYR A CA    1 
ATOM   967  C  C     . TYR A 1 123 ? -26.402 39.021 -18.171 1.00 22.19  ? 123 TYR A C     1 
ATOM   968  O  O     . TYR A 1 123 ? -27.271 39.714 -17.645 1.00 21.22  ? 123 TYR A O     1 
ATOM   969  C  CB    . TYR A 1 123 ? -25.455 40.831 -19.642 1.00 19.57  ? 123 TYR A CB    1 
ATOM   970  C  CG    . TYR A 1 123 ? -24.219 41.556 -20.112 1.00 14.75  ? 123 TYR A CG    1 
ATOM   971  C  CD1   . TYR A 1 123 ? -23.478 42.337 -19.240 1.00 17.78  ? 123 TYR A CD1   1 
ATOM   972  C  CD2   . TYR A 1 123 ? -23.775 41.437 -21.415 1.00 21.07  ? 123 TYR A CD2   1 
ATOM   973  C  CE1   . TYR A 1 123 ? -22.341 42.990 -19.658 1.00 46.26  ? 123 TYR A CE1   1 
ATOM   974  C  CE2   . TYR A 1 123 ? -22.633 42.083 -21.844 1.00 23.68  ? 123 TYR A CE2   1 
ATOM   975  C  CZ    . TYR A 1 123 ? -21.922 42.860 -20.964 1.00 55.47  ? 123 TYR A CZ    1 
ATOM   976  O  OH    . TYR A 1 123 ? -20.786 43.509 -21.392 1.00 67.04  ? 123 TYR A OH    1 
ATOM   977  N  N     . GLU A 1 124 ? -26.540 37.705 -18.339 1.00 18.03  ? 124 GLU A N     1 
ATOM   978  C  CA    . GLU A 1 124 ? -27.797 37.028 -18.020 1.00 16.14  ? 124 GLU A CA    1 
ATOM   979  C  C     . GLU A 1 124 ? -27.774 36.311 -16.683 1.00 33.73  ? 124 GLU A C     1 
ATOM   980  O  O     . GLU A 1 124 ? -26.794 35.644 -16.341 1.00 23.23  ? 124 GLU A O     1 
ATOM   981  C  CB    . GLU A 1 124 ? -28.158 36.021 -19.106 1.00 16.32  ? 124 GLU A CB    1 
ATOM   982  C  CG    . GLU A 1 124 ? -28.652 36.650 -20.395 1.00 39.78  ? 124 GLU A CG    1 
ATOM   983  C  CD    . GLU A 1 124 ? -30.011 37.287 -20.250 1.00 44.39  ? 124 GLU A CD    1 
ATOM   984  O  OE1   . GLU A 1 124 ? -30.750 36.917 -19.309 1.00 57.62  ? 124 GLU A OE1   1 
ATOM   985  O  OE2   . GLU A 1 124 ? -30.332 38.171 -21.073 1.00 63.68  ? 124 GLU A OE2   1 
ATOM   986  N  N     . GLU A 1 125 ? -28.870 36.435 -15.937 1.00 20.90  ? 125 GLU A N     1 
ATOM   987  C  CA    . GLU A 1 125 ? -29.003 35.743 -14.660 1.00 24.45  ? 125 GLU A CA    1 
ATOM   988  C  C     . GLU A 1 125 ? -30.025 34.624 -14.753 1.00 23.95  ? 125 GLU A C     1 
ATOM   989  O  O     . GLU A 1 125 ? -30.999 34.724 -15.494 1.00 35.93  ? 125 GLU A O     1 
ATOM   990  C  CB    . GLU A 1 125 ? -29.392 36.718 -13.553 1.00 27.23  ? 125 GLU A CB    1 
ATOM   991  C  CG    . GLU A 1 125 ? -28.267 37.649 -13.125 1.00 43.11  ? 125 GLU A CG    1 
ATOM   992  C  CD    . GLU A 1 125 ? -28.730 38.673 -12.121 1.00 74.33  ? 125 GLU A CD    1 
ATOM   993  O  OE1   . GLU A 1 125 ? -29.616 39.481 -12.473 1.00 73.75  ? 125 GLU A OE1   1 
ATOM   994  O  OE2   . GLU A 1 125 ? -28.217 38.668 -10.983 1.00 95.71  ? 125 GLU A OE2   1 
ATOM   995  N  N     . LEU A 1 126 ? -29.788 33.556 -13.999 1.00 14.88  ? 126 LEU A N     1 
ATOM   996  C  CA    . LEU A 1 126 ? -30.638 32.372 -14.034 1.00 13.31  ? 126 LEU A CA    1 
ATOM   997  C  C     . LEU A 1 126 ? -32.078 32.636 -13.629 1.00 16.82  ? 126 LEU A C     1 
ATOM   998  O  O     . LEU A 1 126 ? -32.344 33.386 -12.716 1.00 20.22  ? 126 LEU A O     1 
ATOM   999  C  CB    . LEU A 1 126 ? -30.064 31.299 -13.122 1.00 20.66  ? 126 LEU A CB    1 
ATOM   1000 C  CG    . LEU A 1 126 ? -30.885 30.031 -12.937 1.00 11.84  ? 126 LEU A CG    1 
ATOM   1001 C  CD1   . LEU A 1 126 ? -30.896 29.243 -14.237 1.00 33.51  ? 126 LEU A CD1   1 
ATOM   1002 C  CD2   . LEU A 1 126 ? -30.304 29.224 -11.824 1.00 1.79   ? 126 LEU A CD2   1 
ATOM   1003 N  N     . ALA A 1 127 ? -33.019 32.013 -14.319 1.00 29.17  ? 127 ALA A N     1 
ATOM   1004 C  CA    . ALA A 1 127 ? -34.387 32.029 -13.848 1.00 22.30  ? 127 ALA A CA    1 
ATOM   1005 C  C     . ALA A 1 127 ? -34.748 30.624 -13.416 1.00 29.70  ? 127 ALA A C     1 
ATOM   1006 O  O     . ALA A 1 127 ? -34.650 29.687 -14.206 1.00 30.43  ? 127 ALA A O     1 
ATOM   1007 C  CB    . ALA A 1 127 ? -35.305 32.510 -14.903 1.00 16.18  ? 127 ALA A CB    1 
ATOM   1008 N  N     . LEU A 1 128 ? -35.143 30.471 -12.156 1.00 30.45  ? 128 LEU A N     1 
ATOM   1009 C  CA    . LEU A 1 128 ? -35.538 29.164 -11.645 1.00 26.11  ? 128 LEU A CA    1 
ATOM   1010 C  C     . LEU A 1 128 ? -36.943 29.193 -11.052 1.00 36.76  ? 128 LEU A C     1 
ATOM   1011 O  O     . LEU A 1 128 ? -37.375 30.199 -10.494 1.00 42.85  ? 128 LEU A O     1 
ATOM   1012 C  CB    . LEU A 1 128 ? -34.537 28.682 -10.604 1.00 9.47   ? 128 LEU A CB    1 
ATOM   1013 C  CG    . LEU A 1 128 ? -34.743 27.295 -10.003 1.00 15.39  ? 128 LEU A CG    1 
ATOM   1014 C  CD1   . LEU A 1 128 ? -33.400 26.651 -9.705  1.00 21.76  ? 128 LEU A CD1   1 
ATOM   1015 C  CD2   . LEU A 1 128 ? -35.567 27.385 -8.739  1.00 8.47   ? 128 LEU A CD2   1 
ATOM   1016 N  N     . THR A 1 129 ? -37.651 28.078 -11.180 1.00 18.34  ? 129 THR A N     1 
ATOM   1017 C  CA    . THR A 1 129 ? -38.985 27.966 -10.624 1.00 26.96  ? 129 THR A CA    1 
ATOM   1018 C  C     . THR A 1 129 ? -39.088 26.600 -9.951  1.00 25.33  ? 129 THR A C     1 
ATOM   1019 O  O     . THR A 1 129 ? -38.302 25.708 -10.252 1.00 15.84  ? 129 THR A O     1 
ATOM   1020 C  CB    . THR A 1 129 ? -40.076 28.160 -11.717 1.00 16.29  ? 129 THR A CB    1 
ATOM   1021 O  OG1   . THR A 1 129 ? -41.376 28.143 -11.118 1.00 41.21  ? 129 THR A OG1   1 
ATOM   1022 C  CG2   . THR A 1 129 ? -39.998 27.077 -12.779 1.00 9.30   ? 129 THR A CG2   1 
ATOM   1023 N  N     . GLY A 1 130 ? -40.044 26.435 -9.042  1.00 29.59  ? 130 GLY A N     1 
ATOM   1024 C  CA    . GLY A 1 130 ? -40.162 25.195 -8.292  1.00 24.34  ? 130 GLY A CA    1 
ATOM   1025 C  C     . GLY A 1 130 ? -39.554 25.260 -6.901  1.00 28.54  ? 130 GLY A C     1 
ATOM   1026 O  O     . GLY A 1 130 ? -39.253 24.227 -6.314  1.00 16.88  ? 130 GLY A O     1 
ATOM   1027 N  N     . SER A 1 131 ? -39.382 26.477 -6.383  1.00 29.49  ? 131 SER A N     1 
ATOM   1028 C  CA    . SER A 1 131 ? -38.676 26.739 -5.124  1.00 28.53  ? 131 SER A CA    1 
ATOM   1029 C  C     . SER A 1 131 ? -39.566 26.892 -3.885  1.00 32.54  ? 131 SER A C     1 
ATOM   1030 O  O     . SER A 1 131 ? -40.788 26.932 -4.004  1.00 29.86  ? 131 SER A O     1 
ATOM   1031 C  CB    . SER A 1 131 ? -37.878 28.011 -5.300  1.00 31.60  ? 131 SER A CB    1 
ATOM   1032 O  OG    . SER A 1 131 ? -38.666 28.903 -6.062  1.00 16.08  ? 131 SER A OG    1 
ATOM   1033 N  N     . GLU A 1 132 ? -38.954 27.032 -2.702  1.00 40.12  ? 132 GLU A N     1 
ATOM   1034 C  CA    . GLU A 1 132 ? -39.740 27.177 -1.471  1.00 29.21  ? 132 GLU A CA    1 
ATOM   1035 C  C     . GLU A 1 132 ? -40.494 28.490 -1.553  1.00 26.41  ? 132 GLU A C     1 
ATOM   1036 O  O     . GLU A 1 132 ? -41.649 28.563 -1.157  1.00 20.64  ? 132 GLU A O     1 
ATOM   1037 C  CB    . GLU A 1 132 ? -38.874 27.112 -0.184  1.00 25.74  ? 132 GLU A CB    1 
ATOM   1038 C  CG    . GLU A 1 132 ? -39.591 27.601 1.137   1.00 18.20  ? 132 GLU A CG    1 
ATOM   1039 C  CD    . GLU A 1 132 ? -39.074 26.936 2.448   1.00 70.74  ? 132 GLU A CD    1 
ATOM   1040 O  OE1   . GLU A 1 132 ? -38.287 25.967 2.353   1.00 73.65  ? 132 GLU A OE1   1 
ATOM   1041 O  OE2   . GLU A 1 132 ? -39.458 27.366 3.577   1.00 54.32  ? 132 GLU A OE2   1 
ATOM   1042 N  N     . ALA A 1 133 ? -39.854 29.517 -2.103  1.00 30.43  ? 133 ALA A N     1 
ATOM   1043 C  CA    . ALA A 1 133 ? -40.474 30.832 -2.153  1.00 16.58  ? 133 ALA A CA    1 
ATOM   1044 C  C     . ALA A 1 133 ? -41.736 30.803 -3.005  1.00 32.45  ? 133 ALA A C     1 
ATOM   1045 O  O     . ALA A 1 133 ? -42.728 31.471 -2.698  1.00 24.79  ? 133 ALA A O     1 
ATOM   1046 C  CB    . ALA A 1 133 ? -39.512 31.841 -2.679  1.00 6.67   ? 133 ALA A CB    1 
ATOM   1047 N  N     . GLU A 1 134 ? -41.704 30.011 -4.069  1.00 17.74  ? 134 GLU A N     1 
ATOM   1048 C  CA    . GLU A 1 134 ? -42.858 29.913 -4.950  1.00 33.46  ? 134 GLU A CA    1 
ATOM   1049 C  C     . GLU A 1 134 ? -43.997 29.121 -4.313  1.00 30.37  ? 134 GLU A C     1 
ATOM   1050 O  O     . GLU A 1 134 ? -45.161 29.345 -4.614  1.00 21.33  ? 134 GLU A O     1 
ATOM   1051 C  CB    . GLU A 1 134 ? -42.455 29.296 -6.283  1.00 41.74  ? 134 GLU A CB    1 
ATOM   1052 C  CG    . GLU A 1 134 ? -41.470 30.162 -7.055  1.00 42.91  ? 134 GLU A CG    1 
ATOM   1053 C  CD    . GLU A 1 134 ? -41.514 29.890 -8.543  1.00 70.61  ? 134 GLU A CD    1 
ATOM   1054 O  OE1   . GLU A 1 134 ? -41.791 28.734 -8.928  1.00 79.63  ? 134 GLU A OE1   1 
ATOM   1055 O  OE2   . GLU A 1 134 ? -41.296 30.836 -9.329  1.00 79.17  ? 134 GLU A OE2   1 
ATOM   1056 N  N     . MET A 1 135 ? -43.668 28.192 -3.429  1.00 29.94  ? 135 MET A N     1 
ATOM   1057 C  CA    . MET A 1 135 ? -44.703 27.571 -2.621  1.00 29.01  ? 135 MET A CA    1 
ATOM   1058 C  C     . MET A 1 135 ? -45.400 28.638 -1.778  1.00 22.23  ? 135 MET A C     1 
ATOM   1059 O  O     . MET A 1 135 ? -46.626 28.696 -1.703  1.00 21.27  ? 135 MET A O     1 
ATOM   1060 C  CB    . MET A 1 135 ? -44.116 26.492 -1.713  1.00 18.11  ? 135 MET A CB    1 
ATOM   1061 C  CG    . MET A 1 135 ? -43.612 25.277 -2.426  1.00 18.48  ? 135 MET A CG    1 
ATOM   1062 S  SD    . MET A 1 135 ? -43.158 23.968 -1.275  1.00 28.69  ? 135 MET A SD    1 
ATOM   1063 C  CE    . MET A 1 135 ? -44.770 23.431 -0.712  1.00 33.58  ? 135 MET A CE    1 
ATOM   1064 N  N     . ALA A 1 136 ? -44.593 29.470 -1.134  1.00 14.30  ? 136 ALA A N     1 
ATOM   1065 C  CA    . ALA A 1 136 ? -45.101 30.503 -0.262  1.00 20.30  ? 136 ALA A CA    1 
ATOM   1066 C  C     . ALA A 1 136 ? -46.087 31.382 -1.022  1.00 37.99  ? 136 ALA A C     1 
ATOM   1067 O  O     . ALA A 1 136 ? -47.231 31.565 -0.589  1.00 19.08  ? 136 ALA A O     1 
ATOM   1068 C  CB    . ALA A 1 136 ? -43.959 31.320 0.291   1.00 8.32   ? 136 ALA A CB    1 
ATOM   1069 N  N     . GLU A 1 137 ? -45.640 31.892 -2.171  1.00 25.11  ? 137 GLU A N     1 
ATOM   1070 C  CA    . GLU A 1 137 ? -46.467 32.736 -3.027  1.00 26.22  ? 137 GLU A CA    1 
ATOM   1071 C  C     . GLU A 1 137 ? -47.791 32.050 -3.370  1.00 27.37  ? 137 GLU A C     1 
ATOM   1072 O  O     . GLU A 1 137 ? -48.869 32.649 -3.292  1.00 24.77  ? 137 GLU A O     1 
ATOM   1073 C  CB    . GLU A 1 137 ? -45.708 33.094 -4.307  1.00 32.28  ? 137 GLU A CB    1 
ATOM   1074 C  CG    . GLU A 1 137 ? -44.472 33.955 -4.077  1.00 62.87  ? 137 GLU A CG    1 
ATOM   1075 C  CD    . GLU A 1 137 ? -43.633 34.141 -5.334  1.00 83.42  ? 137 GLU A CD    1 
ATOM   1076 O  OE1   . GLU A 1 137 ? -42.415 34.418 -5.198  1.00 65.80  ? 137 GLU A OE1   1 
ATOM   1077 O  OE2   . GLU A 1 137 ? -44.190 34.008 -6.450  1.00 70.83  ? 137 GLU A OE2   1 
ATOM   1078 N  N     . LEU A 1 138 ? -47.702 30.782 -3.739  1.00 34.77  ? 138 LEU A N     1 
ATOM   1079 C  CA    . LEU A 1 138 ? -48.889 30.000 -4.012  1.00 22.35  ? 138 LEU A CA    1 
ATOM   1080 C  C     . LEU A 1 138 ? -49.844 30.138 -2.837  1.00 21.44  ? 138 LEU A C     1 
ATOM   1081 O  O     . LEU A 1 138 ? -51.001 30.508 -3.015  1.00 20.60  ? 138 LEU A O     1 
ATOM   1082 C  CB    . LEU A 1 138 ? -48.517 28.537 -4.275  1.00 14.30  ? 138 LEU A CB    1 
ATOM   1083 C  CG    . LEU A 1 138 ? -49.647 27.540 -4.532  1.00 28.39  ? 138 LEU A CG    1 
ATOM   1084 C  CD1   . LEU A 1 138 ? -50.793 28.162 -5.309  1.00 27.35  ? 138 LEU A CD1   1 
ATOM   1085 C  CD2   . LEU A 1 138 ? -49.093 26.375 -5.289  1.00 10.41  ? 138 LEU A CD2   1 
ATOM   1086 N  N     . ILE A 1 139 ? -49.326 29.902 -1.636  1.00 28.42  ? 139 ILE A N     1 
ATOM   1087 C  CA    . ILE A 1 139 ? -50.139 29.908 -0.428  1.00 22.23  ? 139 ILE A CA    1 
ATOM   1088 C  C     . ILE A 1 139 ? -50.761 31.280 -0.150  1.00 21.44  ? 139 ILE A C     1 
ATOM   1089 O  O     . ILE A 1 139 ? -51.906 31.385 0.288   1.00 13.75  ? 139 ILE A O     1 
ATOM   1090 C  CB    . ILE A 1 139 ? -49.310 29.449 0.770   1.00 12.49  ? 139 ILE A CB    1 
ATOM   1091 C  CG1   . ILE A 1 139 ? -48.942 27.982 0.587   1.00 37.06  ? 139 ILE A CG1   1 
ATOM   1092 C  CG2   . ILE A 1 139 ? -50.095 29.592 2.048   1.00 29.63  ? 139 ILE A CG2   1 
ATOM   1093 C  CD1   . ILE A 1 139 ? -48.268 27.363 1.770   1.00 31.53  ? 139 ILE A CD1   1 
ATOM   1094 N  N     . PHE A 1 140 ? -50.034 32.344 -0.437  1.00 24.05  ? 140 PHE A N     1 
ATOM   1095 C  CA    . PHE A 1 140 ? -50.610 33.648 -0.193  1.00 23.51  ? 140 PHE A CA    1 
ATOM   1096 C  C     . PHE A 1 140 ? -51.695 33.971 -1.226  1.00 24.59  ? 140 PHE A C     1 
ATOM   1097 O  O     . PHE A 1 140 ? -52.791 34.384 -0.850  1.00 21.62  ? 140 PHE A O     1 
ATOM   1098 C  CB    . PHE A 1 140 ? -49.511 34.716 -0.140  1.00 21.10  ? 140 PHE A CB    1 
ATOM   1099 C  CG    . PHE A 1 140 ? -48.949 34.910 1.243   1.00 22.66  ? 140 PHE A CG    1 
ATOM   1100 C  CD1   . PHE A 1 140 ? -47.944 34.086 1.723   1.00 41.96  ? 140 PHE A CD1   1 
ATOM   1101 C  CD2   . PHE A 1 140 ? -49.467 35.874 2.088   1.00 32.57  ? 140 PHE A CD2   1 
ATOM   1102 C  CE1   . PHE A 1 140 ? -47.445 34.246 3.011   1.00 33.03  ? 140 PHE A CE1   1 
ATOM   1103 C  CE2   . PHE A 1 140 ? -48.978 36.037 3.373   1.00 33.20  ? 140 PHE A CE2   1 
ATOM   1104 C  CZ    . PHE A 1 140 ? -47.966 35.220 3.836   1.00 26.13  ? 140 PHE A CZ    1 
ATOM   1105 N  N     . GLU A 1 141 ? -51.440 33.737 -2.511  1.00 35.35  ? 141 GLU A N     1 
ATOM   1106 C  CA    . GLU A 1 141 ? -52.469 34.071 -3.495  1.00 38.15  ? 141 GLU A CA    1 
ATOM   1107 C  C     . GLU A 1 141 ? -53.590 33.020 -3.488  1.00 27.43  ? 141 GLU A C     1 
ATOM   1108 O  O     . GLU A 1 141 ? -54.668 33.266 -4.019  1.00 52.90  ? 141 GLU A O     1 
ATOM   1109 C  CB    . GLU A 1 141 ? -51.868 34.265 -4.912  1.00 24.80  ? 141 GLU A CB    1 
ATOM   1110 C  CG    . GLU A 1 141 ? -51.152 33.072 -5.574  1.00 60.46  ? 141 GLU A CG    1 
ATOM   1111 C  CD    . GLU A 1 141 ? -50.495 33.426 -6.943  1.00 93.53  ? 141 GLU A CD    1 
ATOM   1112 O  OE1   . GLU A 1 141 ? -49.541 34.244 -6.978  1.00 54.54  ? 141 GLU A OE1   1 
ATOM   1113 O  OE2   . GLU A 1 141 ? -50.924 32.875 -7.987  1.00 77.07  ? 141 GLU A OE2   1 
ATOM   1114 N  N     . ASN A 1 142 ? -53.351 31.874 -2.851  1.00 24.39  ? 142 ASN A N     1 
ATOM   1115 C  CA    . ASN A 1 142 ? -54.354 30.805 -2.765  1.00 28.26  ? 142 ASN A CA    1 
ATOM   1116 C  C     . ASN A 1 142 ? -54.386 30.064 -1.421  1.00 46.63  ? 142 ASN A C     1 
ATOM   1117 O  O     . ASN A 1 142 ? -54.116 28.864 -1.381  1.00 38.75  ? 142 ASN A O     1 
ATOM   1118 C  CB    . ASN A 1 142 ? -54.118 29.776 -3.878  1.00 45.80  ? 142 ASN A CB    1 
ATOM   1119 C  CG    . ASN A 1 142 ? -54.977 30.025 -5.108  1.00 74.32  ? 142 ASN A CG    1 
ATOM   1120 O  OD1   . ASN A 1 142 ? -56.203 30.090 -5.014  1.00 69.95  ? 142 ASN A OD1   1 
ATOM   1121 N  ND2   . ASN A 1 142 ? -54.332 30.171 -6.274  1.00 52.10  ? 142 ASN A ND2   1 
ATOM   1122 N  N     . PRO A 1 143 ? -54.745 30.757 -0.325  1.00 29.41  ? 143 PRO A N     1 
ATOM   1123 C  CA    . PRO A 1 143 ? -54.695 30.143 1.009   1.00 35.19  ? 143 PRO A CA    1 
ATOM   1124 C  C     . PRO A 1 143 ? -55.459 28.827 1.140   1.00 37.91  ? 143 PRO A C     1 
ATOM   1125 O  O     . PRO A 1 143 ? -55.140 28.009 2.007   1.00 33.74  ? 143 PRO A O     1 
ATOM   1126 C  CB    . PRO A 1 143 ? -55.317 31.217 1.914   1.00 40.60  ? 143 PRO A CB    1 
ATOM   1127 C  CG    . PRO A 1 143 ? -55.956 32.196 0.991   1.00 44.55  ? 143 PRO A CG    1 
ATOM   1128 C  CD    . PRO A 1 143 ? -55.143 32.169 -0.249  1.00 23.56  ? 143 PRO A CD    1 
ATOM   1129 N  N     . GLU A 1 144 ? -56.444 28.607 0.280   1.00 48.08  ? 144 GLU A N     1 
ATOM   1130 C  CA    . GLU A 1 144 ? -57.269 27.416 0.412   1.00 45.21  ? 144 GLU A CA    1 
ATOM   1131 C  C     . GLU A 1 144 ? -56.483 26.147 0.106   1.00 30.73  ? 144 GLU A C     1 
ATOM   1132 O  O     . GLU A 1 144 ? -56.943 25.056 0.429   1.00 32.63  ? 144 GLU A O     1 
ATOM   1133 C  CB    . GLU A 1 144 ? -58.500 27.501 -0.491  1.00 36.20  ? 144 GLU A CB    1 
ATOM   1134 C  CG    . GLU A 1 144 ? -58.203 27.317 -1.971  1.00 73.69  ? 144 GLU A CG    1 
ATOM   1135 C  CD    . GLU A 1 144 ? -57.968 28.629 -2.700  1.00 100.66 ? 144 GLU A CD    1 
ATOM   1136 O  OE1   . GLU A 1 144 ? -57.518 29.608 -2.059  1.00 80.84  ? 144 GLU A OE1   1 
ATOM   1137 O  OE2   . GLU A 1 144 ? -58.243 28.675 -3.920  1.00 100.30 ? 144 GLU A OE2   1 
ATOM   1138 N  N     . VAL A 1 145 ? -55.295 26.282 -0.491  1.00 36.47  ? 145 VAL A N     1 
ATOM   1139 C  CA    . VAL A 1 145 ? -54.456 25.108 -0.770  1.00 46.94  ? 145 VAL A CA    1 
ATOM   1140 C  C     . VAL A 1 145 ? -54.008 24.474 0.533   1.00 36.78  ? 145 VAL A C     1 
ATOM   1141 O  O     . VAL A 1 145 ? -53.528 23.343 0.558   1.00 44.88  ? 145 VAL A O     1 
ATOM   1142 C  CB    . VAL A 1 145 ? -53.207 25.443 -1.602  1.00 18.70  ? 145 VAL A CB    1 
ATOM   1143 C  CG1   . VAL A 1 145 ? -53.590 26.196 -2.838  1.00 40.51  ? 145 VAL A CG1   1 
ATOM   1144 C  CG2   . VAL A 1 145 ? -52.226 26.253 -0.786  1.00 40.26  ? 145 VAL A CG2   1 
ATOM   1145 N  N     . ILE A 1 146 ? -54.169 25.227 1.612   1.00 27.02  ? 146 ILE A N     1 
ATOM   1146 C  CA    . ILE A 1 146 ? -53.853 24.756 2.941   1.00 37.98  ? 146 ILE A CA    1 
ATOM   1147 C  C     . ILE A 1 146 ? -55.106 24.139 3.536   1.00 38.55  ? 146 ILE A C     1 
ATOM   1148 O  O     . ILE A 1 146 ? -55.154 22.941 3.809   1.00 43.22  ? 146 ILE A O     1 
ATOM   1149 C  CB    . ILE A 1 146 ? -53.322 25.900 3.818   1.00 19.03  ? 146 ILE A CB    1 
ATOM   1150 C  CG1   . ILE A 1 146 ? -51.948 26.327 3.314   1.00 30.01  ? 146 ILE A CG1   1 
ATOM   1151 C  CG2   . ILE A 1 146 ? -53.188 25.460 5.232   1.00 28.90  ? 146 ILE A CG2   1 
ATOM   1152 C  CD1   . ILE A 1 146 ? -50.968 25.168 3.187   1.00 21.30  ? 146 ILE A CD1   1 
ATOM   1153 N  N     . GLU A 1 147 ? -56.124 24.974 3.701   1.00 33.65  ? 147 GLU A N     1 
ATOM   1154 C  CA    . GLU A 1 147 ? -57.415 24.566 4.231   1.00 41.23  ? 147 GLU A CA    1 
ATOM   1155 C  C     . GLU A 1 147 ? -58.308 25.804 4.166   1.00 61.32  ? 147 GLU A C     1 
ATOM   1156 O  O     . GLU A 1 147 ? -57.802 26.925 4.102   1.00 47.15  ? 147 GLU A O     1 
ATOM   1157 C  CB    . GLU A 1 147 ? -57.292 24.010 5.662   1.00 37.49  ? 147 GLU A CB    1 
ATOM   1158 C  CG    . GLU A 1 147 ? -57.214 25.051 6.777   1.00 52.41  ? 147 GLU A CG    1 
ATOM   1159 C  CD    . GLU A 1 147 ? -56.993 24.414 8.153   1.00 56.53  ? 147 GLU A CD    1 
ATOM   1160 O  OE1   . GLU A 1 147 ? -57.274 25.068 9.187   1.00 48.80  ? 147 GLU A OE1   1 
ATOM   1161 O  OE2   . GLU A 1 147 ? -56.530 23.255 8.200   1.00 48.53  ? 147 GLU A OE2   1 
ATOM   1162 N  N     . PRO A 1 148 ? -59.637 25.610 4.146   1.00 59.81  ? 148 PRO A N     1 
ATOM   1163 C  CA    . PRO A 1 148 ? -60.569 26.731 3.987   1.00 23.23  ? 148 PRO A CA    1 
ATOM   1164 C  C     . PRO A 1 148 ? -60.595 27.645 5.198   1.00 36.40  ? 148 PRO A C     1 
ATOM   1165 O  O     . PRO A 1 148 ? -60.509 27.175 6.334   1.00 44.78  ? 148 PRO A O     1 
ATOM   1166 C  CB    . PRO A 1 148 ? -61.927 26.041 3.818   1.00 43.98  ? 148 PRO A CB    1 
ATOM   1167 C  CG    . PRO A 1 148 ? -61.622 24.616 3.534   1.00 51.14  ? 148 PRO A CG    1 
ATOM   1168 C  CD    . PRO A 1 148 ? -60.349 24.327 4.239   1.00 45.09  ? 148 PRO A CD    1 
ATOM   1169 N  N     . GLY A 1 149 ? -60.733 28.941 4.958   1.00 27.98  ? 149 GLY A N     1 
ATOM   1170 C  CA    . GLY A 1 149 ? -60.731 29.901 6.042   1.00 49.75  ? 149 GLY A CA    1 
ATOM   1171 C  C     . GLY A 1 149 ? -59.371 30.008 6.705   1.00 44.82  ? 149 GLY A C     1 
ATOM   1172 O  O     . GLY A 1 149 ? -59.266 30.343 7.882   1.00 50.34  ? 149 GLY A O     1 
ATOM   1173 N  N     . PHE A 1 150 ? -58.321 29.709 5.953   1.00 40.45  ? 150 PHE A N     1 
ATOM   1174 C  CA    . PHE A 1 150 ? -56.980 29.912 6.463   1.00 32.21  ? 150 PHE A CA    1 
ATOM   1175 C  C     . PHE A 1 150 ? -56.490 31.258 5.998   1.00 24.88  ? 150 PHE A C     1 
ATOM   1176 O  O     . PHE A 1 150 ? -56.476 31.555 4.802   1.00 29.19  ? 150 PHE A O     1 
ATOM   1177 C  CB    . PHE A 1 150 ? -56.009 28.814 6.015   1.00 34.40  ? 150 PHE A CB    1 
ATOM   1178 C  CG    . PHE A 1 150 ? -54.561 29.175 6.228   1.00 24.59  ? 150 PHE A CG    1 
ATOM   1179 C  CD1   . PHE A 1 150 ? -53.962 28.980 7.459   1.00 26.45  ? 150 PHE A CD1   1 
ATOM   1180 C  CD2   . PHE A 1 150 ? -53.806 29.732 5.202   1.00 35.78  ? 150 PHE A CD2   1 
ATOM   1181 C  CE1   . PHE A 1 150 ? -52.639 29.323 7.663   1.00 24.08  ? 150 PHE A CE1   1 
ATOM   1182 C  CE2   . PHE A 1 150 ? -52.476 30.075 5.395   1.00 26.55  ? 150 PHE A CE2   1 
ATOM   1183 C  CZ    . PHE A 1 150 ? -51.893 29.871 6.622   1.00 35.66  ? 150 PHE A CZ    1 
ATOM   1184 N  N     . LYS A 1 151 ? -56.082 32.065 6.964   1.00 26.67  ? 151 LYS A N     1 
ATOM   1185 C  CA    . LYS A 1 151 ? -55.590 33.397 6.695   1.00 31.85  ? 151 LYS A CA    1 
ATOM   1186 C  C     . LYS A 1 151 ? -54.094 33.458 6.967   1.00 36.19  ? 151 LYS A C     1 
ATOM   1187 O  O     . LYS A 1 151 ? -53.665 33.387 8.116   1.00 37.26  ? 151 LYS A O     1 
ATOM   1188 C  CB    . LYS A 1 151 ? -56.331 34.422 7.552   1.00 17.80  ? 151 LYS A CB    1 
ATOM   1189 C  CG    . LYS A 1 151 ? -56.952 35.564 6.775   1.00 52.55  ? 151 LYS A CG    1 
ATOM   1190 C  CD    . LYS A 1 151 ? -57.312 36.723 7.702   1.00 79.29  ? 151 LYS A CD    1 
ATOM   1191 C  CE    . LYS A 1 151 ? -57.737 37.960 6.919   1.00 80.86  ? 151 LYS A CE    1 
ATOM   1192 N  NZ    . LYS A 1 151 ? -58.020 39.097 7.832   1.00 48.10  ? 151 LYS A NZ    1 
ATOM   1193 N  N     . PRO A 1 152 ? -53.291 33.553 5.899   1.00 25.68  ? 152 PRO A N     1 
ATOM   1194 C  CA    . PRO A 1 152 ? -51.855 33.811 6.017   1.00 27.15  ? 152 PRO A CA    1 
ATOM   1195 C  C     . PRO A 1 152 ? -51.583 35.276 6.344   1.00 30.62  ? 152 PRO A C     1 
ATOM   1196 O  O     . PRO A 1 152 ? -52.264 36.147 5.806   1.00 31.72  ? 152 PRO A O     1 
ATOM   1197 C  CB    . PRO A 1 152 ? -51.321 33.445 4.636   1.00 25.11  ? 152 PRO A CB    1 
ATOM   1198 C  CG    . PRO A 1 152 ? -52.471 33.676 3.724   1.00 26.67  ? 152 PRO A CG    1 
ATOM   1199 C  CD    . PRO A 1 152 ? -53.709 33.357 4.500   1.00 27.19  ? 152 PRO A CD    1 
ATOM   1200 N  N     . LEU A 1 153 ? -50.601 35.538 7.198   1.00 29.57  ? 153 LEU A N     1 
ATOM   1201 C  CA    . LEU A 1 153 ? -50.280 36.900 7.623   1.00 28.02  ? 153 LEU A CA    1 
ATOM   1202 C  C     . LEU A 1 153 ? -48.826 37.227 7.326   1.00 34.79  ? 153 LEU A C     1 
ATOM   1203 O  O     . LEU A 1 153 ? -48.529 38.221 6.674   1.00 49.01  ? 153 LEU A O     1 
ATOM   1204 C  CB    . LEU A 1 153 ? -50.565 37.110 9.111   1.00 28.29  ? 153 LEU A CB    1 
ATOM   1205 C  CG    . LEU A 1 153 ? -51.941 36.720 9.650   1.00 31.86  ? 153 LEU A CG    1 
ATOM   1206 C  CD1   . LEU A 1 153 ? -52.042 37.100 11.107  1.00 54.38  ? 153 LEU A CD1   1 
ATOM   1207 C  CD2   . LEU A 1 153 ? -53.050 37.359 8.870   1.00 26.06  ? 153 LEU A CD2   1 
ATOM   1208 N  N     . PHE A 1 154 ? -47.914 36.430 7.870   1.00 21.80  ? 154 PHE A N     1 
ATOM   1209 C  CA    . PHE A 1 154 ? -46.500 36.728 7.742   1.00 20.45  ? 154 PHE A CA    1 
ATOM   1210 C  C     . PHE A 1 154 ? -45.704 35.701 6.939   1.00 32.36  ? 154 PHE A C     1 
ATOM   1211 O  O     . PHE A 1 154 ? -45.978 34.501 6.983   1.00 30.98  ? 154 PHE A O     1 
ATOM   1212 C  CB    . PHE A 1 154 ? -45.876 36.858 9.121   1.00 27.41  ? 154 PHE A CB    1 
ATOM   1213 C  CG    . PHE A 1 154 ? -46.633 37.744 10.056  1.00 29.70  ? 154 PHE A CG    1 
ATOM   1214 C  CD1   . PHE A 1 154 ? -47.605 37.217 10.896  1.00 37.06  ? 154 PHE A CD1   1 
ATOM   1215 C  CD2   . PHE A 1 154 ? -46.358 39.097 10.119  1.00 26.89  ? 154 PHE A CD2   1 
ATOM   1216 C  CE1   . PHE A 1 154 ? -48.301 38.028 11.772  1.00 35.51  ? 154 PHE A CE1   1 
ATOM   1217 C  CE2   . PHE A 1 154 ? -47.047 39.916 10.992  1.00 56.97  ? 154 PHE A CE2   1 
ATOM   1218 C  CZ    . PHE A 1 154 ? -48.021 39.383 11.821  1.00 44.12  ? 154 PHE A CZ    1 
ATOM   1219 N  N     . ARG A 1 155 ? -44.687 36.201 6.240   1.00 28.75  ? 155 ARG A N     1 
ATOM   1220 C  CA    . ARG A 1 155 ? -43.771 35.397 5.443   1.00 19.66  ? 155 ARG A CA    1 
ATOM   1221 C  C     . ARG A 1 155 ? -42.324 35.655 5.914   1.00 26.86  ? 155 ARG A C     1 
ATOM   1222 O  O     . ARG A 1 155 ? -41.882 36.805 5.976   1.00 30.31  ? 155 ARG A O     1 
ATOM   1223 C  CB    . ARG A 1 155 ? -43.956 35.731 3.953   1.00 22.19  ? 155 ARG A CB    1 
ATOM   1224 C  CG    . ARG A 1 155 ? -43.201 34.876 2.920   1.00 26.82  ? 155 ARG A CG    1 
ATOM   1225 C  CD    . ARG A 1 155 ? -43.765 35.115 1.489   1.00 68.46  ? 155 ARG A CD    1 
ATOM   1226 N  NE    . ARG A 1 155 ? -43.716 36.525 1.075   1.00 109.15 ? 155 ARG A NE    1 
ATOM   1227 C  CZ    . ARG A 1 155 ? -44.633 37.149 0.329   1.00 69.16  ? 155 ARG A CZ    1 
ATOM   1228 N  NH1   . ARG A 1 155 ? -45.712 36.510 -0.103  1.00 25.62  ? 155 ARG A NH1   1 
ATOM   1229 N  NH2   . ARG A 1 155 ? -44.474 38.433 0.023   1.00 61.10  ? 155 ARG A NH2   1 
ATOM   1230 N  N     . GLU A 1 156 ? -41.604 34.580 6.240   1.00 18.98  ? 156 GLU A N     1 
ATOM   1231 C  CA    . GLU A 1 156 ? -40.241 34.647 6.766   1.00 20.26  ? 156 GLU A CA    1 
ATOM   1232 C  C     . GLU A 1 156 ? -40.220 35.537 7.989   1.00 18.96  ? 156 GLU A C     1 
ATOM   1233 O  O     . GLU A 1 156 ? -39.356 36.412 8.112   1.00 34.97  ? 156 GLU A O     1 
ATOM   1234 C  CB    . GLU A 1 156 ? -39.232 35.176 5.723   1.00 28.50  ? 156 GLU A CB    1 
ATOM   1235 C  CG    . GLU A 1 156 ? -38.968 34.295 4.486   1.00 15.94  ? 156 GLU A CG    1 
ATOM   1236 C  CD    . GLU A 1 156 ? -38.426 32.913 4.809   1.00 59.46  ? 156 GLU A CD    1 
ATOM   1237 O  OE1   . GLU A 1 156 ? -37.633 32.792 5.762   1.00 70.21  ? 156 GLU A OE1   1 
ATOM   1238 O  OE2   . GLU A 1 156 ? -38.790 31.943 4.103   1.00 97.17  ? 156 GLU A OE2   1 
ATOM   1239 N  N     . LYS A 1 157 ? -41.186 35.326 8.880   1.00 22.08  ? 157 LYS A N     1 
ATOM   1240 C  CA    . LYS A 1 157 ? -41.343 36.159 10.083  1.00 45.51  ? 157 LYS A CA    1 
ATOM   1241 C  C     . LYS A 1 157 ? -40.554 35.626 11.244  1.00 24.97  ? 157 LYS A C     1 
ATOM   1242 O  O     . LYS A 1 157 ? -40.841 34.533 11.733  1.00 16.62  ? 157 LYS A O     1 
ATOM   1243 C  CB    . LYS A 1 157 ? -42.813 36.254 10.513  1.00 41.34  ? 157 LYS A CB    1 
ATOM   1244 C  CG    . LYS A 1 157 ? -43.071 37.104 11.763  1.00 19.32  ? 157 LYS A CG    1 
ATOM   1245 C  CD    . LYS A 1 157 ? -42.368 38.454 11.645  1.00 44.53  ? 157 LYS A CD    1 
ATOM   1246 C  CE    . LYS A 1 157 ? -42.663 39.355 12.818  1.00 47.28  ? 157 LYS A CE    1 
ATOM   1247 N  NZ    . LYS A 1 157 ? -42.185 38.802 14.123  1.00 27.08  ? 157 LYS A NZ    1 
ATOM   1248 N  N     . ALA A 1 158 ? -39.594 36.414 11.717  1.00 38.40  ? 158 ALA A N     1 
ATOM   1249 C  CA    . ALA A 1 158 ? -38.841 36.012 12.891  1.00 39.08  ? 158 ALA A CA    1 
ATOM   1250 C  C     . ALA A 1 158 ? -39.763 36.009 14.103  1.00 31.76  ? 158 ALA A C     1 
ATOM   1251 O  O     . ALA A 1 158 ? -40.413 37.012 14.409  1.00 29.70  ? 158 ALA A O     1 
ATOM   1252 C  CB    . ALA A 1 158 ? -37.663 36.938 13.124  1.00 7.58   ? 158 ALA A CB    1 
ATOM   1253 N  N     . ILE A 1 159 ? -39.846 34.865 14.771  1.00 31.42  ? 159 ILE A N     1 
ATOM   1254 C  CA    . ILE A 1 159 ? -40.393 34.838 16.111  1.00 24.21  ? 159 ILE A CA    1 
ATOM   1255 C  C     . ILE A 1 159 ? -39.184 35.003 17.021  1.00 35.69  ? 159 ILE A C     1 
ATOM   1256 O  O     . ILE A 1 159 ? -38.095 35.360 16.544  1.00 37.88  ? 159 ILE A O     1 
ATOM   1257 C  CB    . ILE A 1 159 ? -41.184 33.563 16.398  1.00 22.73  ? 159 ILE A CB    1 
ATOM   1258 C  CG1   . ILE A 1 159 ? -40.339 32.317 16.146  1.00 40.29  ? 159 ILE A CG1   1 
ATOM   1259 C  CG2   . ILE A 1 159 ? -42.426 33.519 15.520  1.00 11.78  ? 159 ILE A CG2   1 
ATOM   1260 C  CD1   . ILE A 1 159 ? -41.120 31.009 16.343  1.00 27.44  ? 159 ILE A CD1   1 
ATOM   1261 N  N     . GLY A 1 160 ? -39.360 34.790 18.317  1.00 13.93  ? 160 GLY A N     1 
ATOM   1262 C  CA    . GLY A 1 160 ? -38.276 35.075 19.236  1.00 47.93  ? 160 GLY A CA    1 
ATOM   1263 C  C     . GLY A 1 160 ? -37.016 34.314 18.875  1.00 25.68  ? 160 GLY A C     1 
ATOM   1264 O  O     . GLY A 1 160 ? -35.994 34.899 18.546  1.00 9.05   ? 160 GLY A O     1 
ATOM   1265 N  N     . THR A 1 161 ? -37.114 32.996 18.868  1.00 50.95  ? 161 THR A N     1 
ATOM   1266 C  CA    . THR A 1 161 ? -35.985 32.168 18.495  1.00 39.70  ? 161 THR A CA    1 
ATOM   1267 C  C     . THR A 1 161 ? -36.334 31.407 17.204  1.00 32.30  ? 161 THR A C     1 
ATOM   1268 O  O     . THR A 1 161 ? -37.183 30.519 17.199  1.00 58.01  ? 161 THR A O     1 
ATOM   1269 C  CB    . THR A 1 161 ? -35.604 31.224 19.672  1.00 28.89  ? 161 THR A CB    1 
ATOM   1270 O  OG1   . THR A 1 161 ? -34.677 31.899 20.530  1.00 32.79  ? 161 THR A OG1   1 
ATOM   1271 C  CG2   . THR A 1 161 ? -34.971 29.928 19.192  1.00 33.64  ? 161 THR A CG2   1 
ATOM   1272 N  N     . GLY A 1 162 ? -35.692 31.781 16.100  1.00 30.90  ? 162 GLY A N     1 
ATOM   1273 C  CA    . GLY A 1 162 ? -35.993 31.180 14.809  1.00 25.35  ? 162 GLY A CA    1 
ATOM   1274 C  C     . GLY A 1 162 ? -36.830 32.024 13.852  1.00 26.34  ? 162 GLY A C     1 
ATOM   1275 O  O     . GLY A 1 162 ? -37.375 33.067 14.221  1.00 25.43  ? 162 GLY A O     1 
ATOM   1276 N  N     . ILE A 1 163 ? -36.928 31.574 12.604  1.00 25.89  ? 163 ILE A N     1 
ATOM   1277 C  CA    . ILE A 1 163 ? -37.734 32.278 11.621  1.00 18.62  ? 163 ILE A CA    1 
ATOM   1278 C  C     . ILE A 1 163 ? -38.726 31.360 10.924  1.00 20.20  ? 163 ILE A C     1 
ATOM   1279 O  O     . ILE A 1 163 ? -38.339 30.464 10.173  1.00 23.88  ? 163 ILE A O     1 
ATOM   1280 C  CB    . ILE A 1 163 ? -36.875 32.944 10.562  1.00 14.38  ? 163 ILE A CB    1 
ATOM   1281 C  CG1   . ILE A 1 163 ? -35.811 33.812 11.215  1.00 24.65  ? 163 ILE A CG1   1 
ATOM   1282 C  CG2   . ILE A 1 163 ? -37.734 33.804 9.691   1.00 18.22  ? 163 ILE A CG2   1 
ATOM   1283 C  CD1   . ILE A 1 163 ? -34.786 34.316 10.251  1.00 9.39   ? 163 ILE A CD1   1 
ATOM   1284 N  N     . VAL A 1 164 ? -40.007 31.629 11.169  1.00 13.52  ? 164 VAL A N     1 
ATOM   1285 C  CA    . VAL A 1 164 ? -41.117 30.824 10.681  1.00 19.25  ? 164 VAL A CA    1 
ATOM   1286 C  C     . VAL A 1 164 ? -41.304 31.034 9.190   1.00 23.57  ? 164 VAL A C     1 
ATOM   1287 O  O     . VAL A 1 164 ? -41.038 32.126 8.695   1.00 25.08  ? 164 VAL A O     1 
ATOM   1288 C  CB    . VAL A 1 164 ? -42.405 31.179 11.446  1.00 16.74  ? 164 VAL A CB    1 
ATOM   1289 C  CG1   . VAL A 1 164 ? -43.610 30.443 10.886  1.00 20.99  ? 164 VAL A CG1   1 
ATOM   1290 C  CG2   . VAL A 1 164 ? -42.229 30.834 12.903  1.00 38.25  ? 164 VAL A CG2   1 
ATOM   1291 N  N     . ALA A 1 165 ? -41.737 30.001 8.468   1.00 20.12  ? 165 ALA A N     1 
ATOM   1292 C  CA    . ALA A 1 165 ? -41.879 30.133 7.016   1.00 20.98  ? 165 ALA A CA    1 
ATOM   1293 C  C     . ALA A 1 165 ? -43.107 30.962 6.681   1.00 16.82  ? 165 ALA A C     1 
ATOM   1294 O  O     . ALA A 1 165 ? -43.019 32.015 6.068   1.00 29.56  ? 165 ALA A O     1 
ATOM   1295 C  CB    . ALA A 1 165 ? -41.958 28.772 6.353   1.00 27.15  ? 165 ALA A CB    1 
ATOM   1296 N  N     . VAL A 1 166 ? -44.261 30.456 7.065   1.00 18.85  ? 166 VAL A N     1 
ATOM   1297 C  CA    . VAL A 1 166 ? -45.500 31.181 6.908   1.00 9.00   ? 166 VAL A CA    1 
ATOM   1298 C  C     . VAL A 1 166 ? -46.222 31.163 8.240   1.00 23.52  ? 166 VAL A C     1 
ATOM   1299 O  O     . VAL A 1 166 ? -46.345 30.115 8.888   1.00 24.55  ? 166 VAL A O     1 
ATOM   1300 C  CB    . VAL A 1 166 ? -46.374 30.551 5.834   1.00 16.27  ? 166 VAL A CB    1 
ATOM   1301 C  CG1   . VAL A 1 166 ? -47.764 31.186 5.814   1.00 12.83  ? 166 VAL A CG1   1 
ATOM   1302 C  CG2   . VAL A 1 166 ? -45.692 30.660 4.498   1.00 11.96  ? 166 VAL A CG2   1 
ATOM   1303 N  N     . LEU A 1 167 ? -46.678 32.326 8.671   1.00 18.57  ? 167 LEU A N     1 
ATOM   1304 C  CA    . LEU A 1 167 ? -47.416 32.405 9.915   1.00 14.40  ? 167 LEU A CA    1 
ATOM   1305 C  C     . LEU A 1 167 ? -48.807 32.951 9.625   1.00 23.73  ? 167 LEU A C     1 
ATOM   1306 O  O     . LEU A 1 167 ? -48.962 33.908 8.865   1.00 28.97  ? 167 LEU A O     1 
ATOM   1307 C  CB    . LEU A 1 167 ? -46.666 33.283 10.912  1.00 17.10  ? 167 LEU A CB    1 
ATOM   1308 C  CG    . LEU A 1 167 ? -47.159 33.363 12.356  1.00 25.06  ? 167 LEU A CG    1 
ATOM   1309 C  CD1   . LEU A 1 167 ? -47.267 31.998 13.000  1.00 16.99  ? 167 LEU A CD1   1 
ATOM   1310 C  CD2   . LEU A 1 167 ? -46.210 34.234 13.126  1.00 23.27  ? 167 LEU A CD2   1 
ATOM   1311 N  N     . GLY A 1 168 ? -49.824 32.354 10.229  1.00 18.91  ? 168 GLY A N     1 
ATOM   1312 C  CA    . GLY A 1 168 ? -51.181 32.777 9.947   1.00 20.54  ? 168 GLY A CA    1 
ATOM   1313 C  C     . GLY A 1 168 ? -52.141 32.281 10.999  1.00 20.59  ? 168 GLY A C     1 
ATOM   1314 O  O     . GLY A 1 168 ? -51.713 31.878 12.079  1.00 19.50  ? 168 GLY A O     1 
ATOM   1315 N  N     . ARG A 1 169 ? -53.435 32.337 10.673  1.00 38.71  ? 169 ARG A N     1 
ATOM   1316 C  CA    . ARG A 1 169 ? -54.531 31.892 11.540  1.00 27.66  ? 169 ARG A CA    1 
ATOM   1317 C  C     . ARG A 1 169 ? -55.460 30.969 10.790  1.00 20.94  ? 169 ARG A C     1 
ATOM   1318 O  O     . ARG A 1 169 ? -55.505 31.005 9.569   1.00 36.72  ? 169 ARG A O     1 
ATOM   1319 C  CB    . ARG A 1 169 ? -55.353 33.075 12.040  1.00 31.75  ? 169 ARG A CB    1 
ATOM   1320 C  CG    . ARG A 1 169 ? -54.574 34.322 12.364  1.00 33.64  ? 169 ARG A CG    1 
ATOM   1321 C  CD    . ARG A 1 169 ? -55.538 35.367 12.825  1.00 42.50  ? 169 ARG A CD    1 
ATOM   1322 N  NE    . ARG A 1 169 ? -56.686 34.758 13.499  1.00 68.63  ? 169 ARG A NE    1 
ATOM   1323 C  CZ    . ARG A 1 169 ? -56.835 34.686 14.823  1.00 70.19  ? 169 ARG A CZ    1 
ATOM   1324 N  NH1   . ARG A 1 169 ? -55.916 35.200 15.631  1.00 51.39  ? 169 ARG A NH1   1 
ATOM   1325 N  NH2   . ARG A 1 169 ? -57.916 34.119 15.344  1.00 38.18  ? 169 ARG A NH2   1 
ATOM   1326 N  N     . ASP A 1 170 ? -56.254 30.188 11.509  1.00 28.27  ? 170 ASP A N     1 
ATOM   1327 C  CA    . ASP A 1 170 ? -57.255 29.367 10.839  1.00 31.58  ? 170 ASP A CA    1 
ATOM   1328 C  C     . ASP A 1 170 ? -58.666 29.854 11.146  1.00 55.41  ? 170 ASP A C     1 
ATOM   1329 O  O     . ASP A 1 170 ? -58.864 30.812 11.912  1.00 30.97  ? 170 ASP A O     1 
ATOM   1330 C  CB    . ASP A 1 170 ? -57.108 27.890 11.224  1.00 38.36  ? 170 ASP A CB    1 
ATOM   1331 C  CG    . ASP A 1 170 ? -57.186 27.653 12.729  1.00 41.96  ? 170 ASP A CG    1 
ATOM   1332 O  OD1   . ASP A 1 170 ? -57.772 28.485 13.443  1.00 42.66  ? 170 ASP A OD1   1 
ATOM   1333 O  OD2   . ASP A 1 170 ? -56.671 26.619 13.206  1.00 39.49  ? 170 ASP A OD2   1 
ATOM   1334 N  N     . SER A 1 171 ? -59.639 29.169 10.554  1.00 60.44  ? 171 SER A N     1 
ATOM   1335 C  CA    . SER A 1 171 ? -61.039 29.565 10.641  1.00 50.52  ? 171 SER A CA    1 
ATOM   1336 C  C     . SER A 1 171 ? -61.599 29.496 12.067  1.00 38.38  ? 171 SER A C     1 
ATOM   1337 O  O     . SER A 1 171 ? -62.421 30.316 12.446  1.00 45.44  ? 171 SER A O     1 
ATOM   1338 C  CB    . SER A 1 171 ? -61.869 28.696 9.702   1.00 40.45  ? 171 SER A CB    1 
ATOM   1339 O  OG    . SER A 1 171 ? -61.631 27.328 9.970   1.00 64.09  ? 171 SER A OG    1 
ATOM   1340 N  N     . ASP A 1 172 ? -61.131 28.542 12.864  1.00 57.16  ? 172 ASP A N     1 
ATOM   1341 C  CA    . ASP A 1 172 ? -61.605 28.390 14.240  1.00 34.77  ? 172 ASP A CA    1 
ATOM   1342 C  C     . ASP A 1 172 ? -60.807 29.264 15.199  1.00 33.62  ? 172 ASP A C     1 
ATOM   1343 O  O     . ASP A 1 172 ? -60.952 29.141 16.414  1.00 51.87  ? 172 ASP A O     1 
ATOM   1344 C  CB    . ASP A 1 172 ? -61.532 26.926 14.694  1.00 48.22  ? 172 ASP A CB    1 
ATOM   1345 C  CG    . ASP A 1 172 ? -62.876 26.205 14.597  1.00 84.98  ? 172 ASP A CG    1 
ATOM   1346 O  OD1   . ASP A 1 172 ? -63.758 26.673 13.844  1.00 88.56  ? 172 ASP A OD1   1 
ATOM   1347 O  OD2   . ASP A 1 172 ? -63.049 25.161 15.268  1.00 82.04  ? 172 ASP A OD2   1 
ATOM   1348 N  N     . GLY A 1 173 ? -59.924 30.104 14.658  1.00 44.42  ? 173 GLY A N     1 
ATOM   1349 C  CA    . GLY A 1 173 ? -59.237 31.115 15.454  1.00 49.96  ? 173 GLY A CA    1 
ATOM   1350 C  C     . GLY A 1 173 ? -57.877 30.828 16.095  1.00 60.65  ? 173 GLY A C     1 
ATOM   1351 O  O     . GLY A 1 173 ? -57.358 31.663 16.837  1.00 37.35  ? 173 GLY A O     1 
ATOM   1352 N  N     . ASN A 1 174 ? -57.301 29.656 15.842  1.00 67.46  ? 174 ASN A N     1 
ATOM   1353 C  CA    . ASN A 1 174 ? -55.950 29.354 16.314  1.00 31.91  ? 174 ASN A CA    1 
ATOM   1354 C  C     . ASN A 1 174 ? -54.870 30.044 15.490  1.00 50.95  ? 174 ASN A C     1 
ATOM   1355 O  O     . ASN A 1 174 ? -55.111 30.489 14.364  1.00 40.94  ? 174 ASN A O     1 
ATOM   1356 C  CB    . ASN A 1 174 ? -55.679 27.854 16.298  1.00 36.66  ? 174 ASN A CB    1 
ATOM   1357 C  CG    . ASN A 1 174 ? -56.814 27.056 16.861  1.00 60.75  ? 174 ASN A CG    1 
ATOM   1358 O  OD1   . ASN A 1 174 ? -56.864 26.783 18.064  1.00 77.71  ? 174 ASN A OD1   1 
ATOM   1359 N  ND2   . ASN A 1 174 ? -57.734 26.650 15.989  1.00 64.19  ? 174 ASN A ND2   1 
ATOM   1360 N  N     . ILE A 1 175 ? -53.675 30.133 16.057  1.00 39.69  ? 175 ILE A N     1 
ATOM   1361 C  CA    . ILE A 1 175 ? -52.521 30.530 15.276  1.00 23.31  ? 175 ILE A CA    1 
ATOM   1362 C  C     . ILE A 1 175 ? -51.921 29.326 14.544  1.00 35.97  ? 175 ILE A C     1 
ATOM   1363 O  O     . ILE A 1 175 ? -51.732 28.255 15.123  1.00 30.99  ? 175 ILE A O     1 
ATOM   1364 C  CB    . ILE A 1 175 ? -51.471 31.168 16.151  1.00 24.78  ? 175 ILE A CB    1 
ATOM   1365 C  CG1   . ILE A 1 175 ? -52.029 32.458 16.738  1.00 15.86  ? 175 ILE A CG1   1 
ATOM   1366 C  CG2   . ILE A 1 175 ? -50.206 31.413 15.349  1.00 25.97  ? 175 ILE A CG2   1 
ATOM   1367 C  CD1   . ILE A 1 175 ? -51.021 33.265 17.527  1.00 19.42  ? 175 ILE A CD1   1 
ATOM   1368 N  N     . VAL A 1 176 ? -51.634 29.500 13.260  1.00 36.38  ? 176 VAL A N     1 
ATOM   1369 C  CA    . VAL A 1 176 ? -51.062 28.419 12.475  1.00 25.78  ? 176 VAL A CA    1 
ATOM   1370 C  C     . VAL A 1 176 ? -49.638 28.742 12.035  1.00 15.19  ? 176 VAL A C     1 
ATOM   1371 O  O     . VAL A 1 176 ? -49.347 29.843 11.563  1.00 19.80  ? 176 VAL A O     1 
ATOM   1372 C  CB    . VAL A 1 176 ? -51.931 28.108 11.242  1.00 22.26  ? 176 VAL A CB    1 
ATOM   1373 C  CG1   . VAL A 1 176 ? -51.324 26.981 10.443  1.00 22.66  ? 176 VAL A CG1   1 
ATOM   1374 C  CG2   . VAL A 1 176 ? -53.337 27.737 11.678  1.00 25.30  ? 176 VAL A CG2   1 
ATOM   1375 N  N     . VAL A 1 177 ? -48.751 27.774 12.233  1.00 18.48  ? 177 VAL A N     1 
ATOM   1376 C  CA    . VAL A 1 177 ? -47.390 27.818 11.716  1.00 13.79  ? 177 VAL A CA    1 
ATOM   1377 C  C     . VAL A 1 177 ? -47.284 26.878 10.545  1.00 19.39  ? 177 VAL A C     1 
ATOM   1378 O  O     . VAL A 1 177 ? -47.726 25.730 10.626  1.00 21.95  ? 177 VAL A O     1 
ATOM   1379 C  CB    . VAL A 1 177 ? -46.349 27.380 12.750  1.00 27.18  ? 177 VAL A CB    1 
ATOM   1380 C  CG1   . VAL A 1 177 ? -44.969 27.635 12.225  1.00 16.30  ? 177 VAL A CG1   1 
ATOM   1381 C  CG2   . VAL A 1 177 ? -46.555 28.087 14.055  1.00 19.63  ? 177 VAL A CG2   1 
ATOM   1382 N  N     . LEU A 1 178 ? -46.700 27.356 9.455   1.00 26.76  ? 178 LEU A N     1 
ATOM   1383 C  CA    . LEU A 1 178 ? -46.376 26.483 8.345   1.00 7.71   ? 178 LEU A CA    1 
ATOM   1384 C  C     . LEU A 1 178 ? -44.866 26.295 8.279   1.00 27.33  ? 178 LEU A C     1 
ATOM   1385 O  O     . LEU A 1 178 ? -44.102 27.267 8.427   1.00 22.82  ? 178 LEU A O     1 
ATOM   1386 C  CB    . LEU A 1 178 ? -46.898 27.054 7.039   1.00 14.36  ? 178 LEU A CB    1 
ATOM   1387 C  CG    . LEU A 1 178 ? -48.404 27.274 6.927   1.00 18.95  ? 178 LEU A CG    1 
ATOM   1388 C  CD1   . LEU A 1 178 ? -48.766 27.627 5.507   1.00 13.65  ? 178 LEU A CD1   1 
ATOM   1389 C  CD2   . LEU A 1 178 ? -49.170 26.058 7.375   1.00 15.62  ? 178 LEU A CD2   1 
ATOM   1390 N  N     . GLU A 1 179 ? -44.436 25.042 8.117   1.00 20.89  ? 179 GLU A N     1 
ATOM   1391 C  CA    . GLU A 1 179 ? -43.084 24.781 7.652   1.00 16.12  ? 179 GLU A CA    1 
ATOM   1392 C  C     . GLU A 1 179 ? -43.193 24.225 6.255   1.00 14.69  ? 179 GLU A C     1 
ATOM   1393 O  O     . GLU A 1 179 ? -43.964 23.300 6.012   1.00 22.56  ? 179 GLU A O     1 
ATOM   1394 C  CB    . GLU A 1 179 ? -42.319 23.825 8.561   1.00 7.43   ? 179 GLU A CB    1 
ATOM   1395 C  CG    . GLU A 1 179 ? -40.836 23.612 8.119   1.00 14.18  ? 179 GLU A CG    1 
ATOM   1396 C  CD    . GLU A 1 179 ? -40.030 24.913 7.943   1.00 34.30  ? 179 GLU A CD    1 
ATOM   1397 O  OE1   . GLU A 1 179 ? -38.979 24.868 7.279   1.00 31.64  ? 179 GLU A OE1   1 
ATOM   1398 O  OE2   . GLU A 1 179 ? -40.420 25.983 8.471   1.00 60.82  ? 179 GLU A OE2   1 
ATOM   1399 N  N     . LEU A 1 180 ? -42.455 24.818 5.325   1.00 20.30  ? 180 LEU A N     1 
ATOM   1400 C  CA    . LEU A 1 180 ? -42.510 24.375 3.934   1.00 17.78  ? 180 LEU A CA    1 
ATOM   1401 C  C     . LEU A 1 180 ? -41.231 23.680 3.527   1.00 14.13  ? 180 LEU A C     1 
ATOM   1402 O  O     . LEU A 1 180 ? -40.140 24.123 3.891   1.00 38.77  ? 180 LEU A O     1 
ATOM   1403 C  CB    . LEU A 1 180 ? -42.741 25.546 2.994   1.00 12.27  ? 180 LEU A CB    1 
ATOM   1404 C  CG    . LEU A 1 180 ? -43.829 26.530 3.375   1.00 22.52  ? 180 LEU A CG    1 
ATOM   1405 C  CD1   . LEU A 1 180 ? -43.906 27.639 2.332   1.00 6.74   ? 180 LEU A CD1   1 
ATOM   1406 C  CD2   . LEU A 1 180 ? -45.127 25.784 3.498   1.00 21.22  ? 180 LEU A CD2   1 
ATOM   1407 N  N     . LYS A 1 181 ? -41.375 22.600 2.771   1.00 8.27   ? 181 LYS A N     1 
ATOM   1408 C  CA    . LYS A 1 181 ? -40.251 21.968 2.096   1.00 29.59  ? 181 LYS A CA    1 
ATOM   1409 C  C     . LYS A 1 181 ? -40.606 21.713 0.628   1.00 31.05  ? 181 LYS A C     1 
ATOM   1410 O  O     . LYS A 1 181 ? -41.682 21.168 0.350   1.00 16.13  ? 181 LYS A O     1 
ATOM   1411 C  CB    . LYS A 1 181 ? -39.870 20.664 2.794   1.00 12.99  ? 181 LYS A CB    1 
ATOM   1412 C  CG    . LYS A 1 181 ? -39.262 20.865 4.161   1.00 22.95  ? 181 LYS A CG    1 
ATOM   1413 C  CD    . LYS A 1 181 ? -38.134 21.883 4.142   1.00 22.73  ? 181 LYS A CD    1 
ATOM   1414 C  CE    . LYS A 1 181 ? -37.857 22.455 5.540   1.00 43.17  ? 181 LYS A CE    1 
ATOM   1415 N  NZ    . LYS A 1 181 ? -37.729 23.950 5.515   1.00 55.05  ? 181 LYS A NZ    1 
ATOM   1416 N  N     . ARG A 1 182 ? -39.722 22.102 -0.301  1.00 25.17  ? 182 ARG A N     1 
ATOM   1417 C  CA    . ARG A 1 182 ? -39.971 21.894 -1.748  1.00 28.66  ? 182 ARG A CA    1 
ATOM   1418 C  C     . ARG A 1 182 ? -39.824 20.444 -2.177  1.00 17.50  ? 182 ARG A C     1 
ATOM   1419 O  O     . ARG A 1 182 ? -40.242 20.062 -3.261  1.00 29.92  ? 182 ARG A O     1 
ATOM   1420 C  CB    . ARG A 1 182 ? -39.030 22.734 -2.610  1.00 21.58  ? 182 ARG A CB    1 
ATOM   1421 C  CG    . ARG A 1 182 ? -37.575 22.290 -2.555  1.00 13.23  ? 182 ARG A CG    1 
ATOM   1422 C  CD    . ARG A 1 182 ? -36.720 23.014 -3.589  1.00 22.06  ? 182 ARG A CD    1 
ATOM   1423 N  NE    . ARG A 1 182 ? -37.319 22.867 -4.901  1.00 24.44  ? 182 ARG A NE    1 
ATOM   1424 C  CZ    . ARG A 1 182 ? -37.335 21.731 -5.583  1.00 16.46  ? 182 ARG A CZ    1 
ATOM   1425 N  NH1   . ARG A 1 182 ? -36.754 20.643 -5.093  1.00 30.36  ? 182 ARG A NH1   1 
ATOM   1426 N  NH2   . ARG A 1 182 ? -37.932 21.686 -6.761  1.00 22.46  ? 182 ARG A NH2   1 
ATOM   1427 N  N     . ARG A 1 183 ? -39.200 19.645 -1.328  1.00 28.29  ? 183 ARG A N     1 
ATOM   1428 C  CA    . ARG A 1 183 ? -39.038 18.229 -1.588  1.00 17.12  ? 183 ARG A CA    1 
ATOM   1429 C  C     . ARG A 1 183 ? -39.596 17.420 -0.425  1.00 20.98  ? 183 ARG A C     1 
ATOM   1430 O  O     . ARG A 1 183 ? -40.130 17.988 0.524   1.00 27.03  ? 183 ARG A O     1 
ATOM   1431 C  CB    . ARG A 1 183 ? -37.563 17.911 -1.825  1.00 13.31  ? 183 ARG A CB    1 
ATOM   1432 C  CG    . ARG A 1 183 ? -36.609 18.642 -0.920  1.00 12.72  ? 183 ARG A CG    1 
ATOM   1433 C  CD    . ARG A 1 183 ? -35.170 18.264 -1.254  1.00 49.21  ? 183 ARG A CD    1 
ATOM   1434 N  NE    . ARG A 1 183 ? -34.267 18.391 -0.112  1.00 50.28  ? 183 ARG A NE    1 
ATOM   1435 C  CZ    . ARG A 1 183 ? -32.982 18.046 -0.128  1.00 50.91  ? 183 ARG A CZ    1 
ATOM   1436 N  NH1   . ARG A 1 183 ? -32.437 17.550 -1.233  1.00 73.77  ? 183 ARG A NH1   1 
ATOM   1437 N  NH2   . ARG A 1 183 ? -32.236 18.200 0.960   1.00 73.28  ? 183 ARG A NH2   1 
ATOM   1438 N  N     . ARG A 1 184 ? -39.480 16.100 -0.498  1.00 17.10  ? 184 ARG A N     1 
ATOM   1439 C  CA    . ARG A 1 184 ? -39.869 15.252 0.617   1.00 11.22  ? 184 ARG A CA    1 
ATOM   1440 C  C     . ARG A 1 184 ? -39.209 15.742 1.900   1.00 28.28  ? 184 ARG A C     1 
ATOM   1441 O  O     . ARG A 1 184 ? -38.016 16.068 1.903   1.00 19.67  ? 184 ARG A O     1 
ATOM   1442 C  CB    . ARG A 1 184 ? -39.490 13.812 0.347   1.00 5.49   ? 184 ARG A CB    1 
ATOM   1443 C  CG    . ARG A 1 184 ? -39.302 12.976 1.585   1.00 21.79  ? 184 ARG A CG    1 
ATOM   1444 C  CD    . ARG A 1 184 ? -39.097 11.529 1.204   1.00 17.31  ? 184 ARG A CD    1 
ATOM   1445 N  NE    . ARG A 1 184 ? -40.279 11.049 0.512   1.00 20.85  ? 184 ARG A NE    1 
ATOM   1446 C  CZ    . ARG A 1 184 ? -40.849 9.887  0.769   1.00 35.96  ? 184 ARG A CZ    1 
ATOM   1447 N  NH1   . ARG A 1 184 ? -40.317 9.095  1.695   1.00 27.18  ? 184 ARG A NH1   1 
ATOM   1448 N  NH2   . ARG A 1 184 ? -41.943 9.527  0.108   1.00 37.66  ? 184 ARG A NH2   1 
ATOM   1449 N  N     . ALA A 1 185 ? -39.998 15.806 2.975   1.00 16.80  ? 185 ALA A N     1 
ATOM   1450 C  CA    . ALA A 1 185 ? -39.560 16.401 4.231   1.00 12.61  ? 185 ALA A CA    1 
ATOM   1451 C  C     . ALA A 1 185 ? -38.918 15.397 5.175   1.00 20.01  ? 185 ALA A C     1 
ATOM   1452 O  O     . ALA A 1 185 ? -39.393 14.269 5.321   1.00 19.40  ? 185 ALA A O     1 
ATOM   1453 C  CB    . ALA A 1 185 ? -40.721 17.075 4.914   1.00 16.41  ? 185 ALA A CB    1 
ATOM   1454 N  N     . GLU A 1 186 ? -37.853 15.843 5.837   1.00 25.35  ? 186 GLU A N     1 
ATOM   1455 C  CA    . GLU A 1 186 ? -37.045 14.992 6.703   1.00 23.53  ? 186 GLU A CA    1 
ATOM   1456 C  C     . GLU A 1 186 ? -37.229 15.396 8.167   1.00 21.20  ? 186 GLU A C     1 
ATOM   1457 O  O     . GLU A 1 186 ? -38.024 16.281 8.465   1.00 23.51  ? 186 GLU A O     1 
ATOM   1458 C  CB    . GLU A 1 186 ? -35.581 15.082 6.272   1.00 29.47  ? 186 GLU A CB    1 
ATOM   1459 C  CG    . GLU A 1 186 ? -35.411 14.862 4.758   1.00 40.43  ? 186 GLU A CG    1 
ATOM   1460 C  CD    . GLU A 1 186 ? -33.974 14.990 4.247   1.00 45.53  ? 186 GLU A CD    1 
ATOM   1461 O  OE1   . GLU A 1 186 ? -33.029 14.591 4.966   1.00 45.74  ? 186 GLU A OE1   1 
ATOM   1462 O  OE2   . GLU A 1 186 ? -33.795 15.484 3.107   1.00 50.98  ? 186 GLU A OE2   1 
ATOM   1463 N  N     . LEU A 1 187 ? -36.529 14.732 9.082   1.00 28.71  ? 187 LEU A N     1 
ATOM   1464 C  CA    . LEU A 1 187 ? -36.622 15.067 10.508  1.00 14.99  ? 187 LEU A CA    1 
ATOM   1465 C  C     . LEU A 1 187 ? -36.318 16.533 10.773  1.00 17.66  ? 187 LEU A C     1 
ATOM   1466 O  O     . LEU A 1 187 ? -37.005 17.191 11.534  1.00 30.66  ? 187 LEU A O     1 
ATOM   1467 C  CB    . LEU A 1 187 ? -35.662 14.214 11.333  1.00 18.41  ? 187 LEU A CB    1 
ATOM   1468 C  CG    . LEU A 1 187 ? -35.980 12.735 11.542  1.00 24.45  ? 187 LEU A CG    1 
ATOM   1469 C  CD1   . LEU A 1 187 ? -34.864 12.076 12.335  1.00 25.62  ? 187 LEU A CD1   1 
ATOM   1470 C  CD2   . LEU A 1 187 ? -37.296 12.576 12.256  1.00 22.77  ? 187 LEU A CD2   1 
ATOM   1471 N  N     . HIS A 1 188 ? -35.284 17.031 10.114  1.00 33.77  ? 188 HIS A N     1 
ATOM   1472 C  CA    . HIS A 1 188 ? -34.837 18.412 10.235  1.00 26.22  ? 188 HIS A CA    1 
ATOM   1473 C  C     . HIS A 1 188 ? -36.020 19.387 10.155  1.00 24.72  ? 188 HIS A C     1 
ATOM   1474 O  O     . HIS A 1 188 ? -36.116 20.328 10.940  1.00 44.96  ? 188 HIS A O     1 
ATOM   1475 C  CB    . HIS A 1 188 ? -33.779 18.661 9.136   1.00 29.03  ? 188 HIS A CB    1 
ATOM   1476 C  CG    . HIS A 1 188 ? -33.507 20.101 8.819   1.00 59.66  ? 188 HIS A CG    1 
ATOM   1477 N  ND1   . HIS A 1 188 ? -32.677 20.894 9.586   1.00 100.01 ? 188 HIS A ND1   1 
ATOM   1478 C  CD2   . HIS A 1 188 ? -33.896 20.868 7.770   1.00 81.31  ? 188 HIS A CD2   1 
ATOM   1479 C  CE1   . HIS A 1 188 ? -32.601 22.099 9.042   1.00 49.75  ? 188 HIS A CE1   1 
ATOM   1480 N  NE2   . HIS A 1 188 ? -33.326 22.111 7.947   1.00 76.79  ? 188 HIS A NE2   1 
ATOM   1481 N  N     . ALA A 1 189 ? -36.952 19.114 9.251   1.00 19.04  ? 189 ALA A N     1 
ATOM   1482 C  CA    . ALA A 1 189 ? -38.079 20.002 9.016   1.00 20.13  ? 189 ALA A CA    1 
ATOM   1483 C  C     . ALA A 1 189 ? -39.106 19.894 10.120  1.00 19.81  ? 189 ALA A C     1 
ATOM   1484 O  O     . ALA A 1 189 ? -39.809 20.860 10.426  1.00 36.97  ? 189 ALA A O     1 
ATOM   1485 C  CB    . ALA A 1 189 ? -38.729 19.700 7.666   1.00 27.43  ? 189 ALA A CB    1 
ATOM   1486 N  N     . VAL A 1 190 ? -39.220 18.714 10.711  1.00 16.38  ? 190 VAL A N     1 
ATOM   1487 C  CA    . VAL A 1 190 ? -40.231 18.537 11.740  1.00 21.72  ? 190 VAL A CA    1 
ATOM   1488 C  C     . VAL A 1 190 ? -39.698 19.142 13.037  1.00 18.93  ? 190 VAL A C     1 
ATOM   1489 O  O     . VAL A 1 190 ? -40.457 19.683 13.830  1.00 24.04  ? 190 VAL A O     1 
ATOM   1490 C  CB    . VAL A 1 190 ? -40.634 17.054 11.904  1.00 16.55  ? 190 VAL A CB    1 
ATOM   1491 C  CG1   . VAL A 1 190 ? -41.608 16.898 13.034  1.00 16.07  ? 190 VAL A CG1   1 
ATOM   1492 C  CG2   . VAL A 1 190 ? -41.285 16.540 10.619  1.00 6.59   ? 190 VAL A CG2   1 
ATOM   1493 N  N     . ARG A 1 191 ? -38.382 19.112 13.213  1.00 22.05  ? 191 ARG A N     1 
ATOM   1494 C  CA    . ARG A 1 191 ? -37.758 19.746 14.368  1.00 20.76  ? 191 ARG A CA    1 
ATOM   1495 C  C     . ARG A 1 191 ? -37.924 21.255 14.314  1.00 19.30  ? 191 ARG A C     1 
ATOM   1496 O  O     . ARG A 1 191 ? -38.191 21.890 15.329  1.00 27.54  ? 191 ARG A O     1 
ATOM   1497 C  CB    . ARG A 1 191 ? -36.275 19.386 14.455  1.00 18.63  ? 191 ARG A CB    1 
ATOM   1498 C  CG    . ARG A 1 191 ? -36.000 17.920 14.768  1.00 5.35   ? 191 ARG A CG    1 
ATOM   1499 C  CD    . ARG A 1 191 ? -34.584 17.747 15.263  1.00 12.76  ? 191 ARG A CD    1 
ATOM   1500 N  NE    . ARG A 1 191 ? -34.096 16.403 15.003  1.00 28.76  ? 191 ARG A NE    1 
ATOM   1501 C  CZ    . ARG A 1 191 ? -33.413 16.085 13.914  1.00 24.28  ? 191 ARG A CZ    1 
ATOM   1502 N  NH1   . ARG A 1 191 ? -33.138 17.026 13.025  1.00 49.85  ? 191 ARG A NH1   1 
ATOM   1503 N  NH2   . ARG A 1 191 ? -33.003 14.846 13.717  1.00 10.80  ? 191 ARG A NH2   1 
ATOM   1504 N  N     . GLN A 1 192 ? -37.752 21.816 13.124  1.00 23.98  ? 192 GLN A N     1 
ATOM   1505 C  CA    . GLN A 1 192 ? -38.005 23.231 12.883  1.00 19.81  ? 192 GLN A CA    1 
ATOM   1506 C  C     . GLN A 1 192 ? -39.443 23.581 13.277  1.00 22.27  ? 192 GLN A C     1 
ATOM   1507 O  O     . GLN A 1 192 ? -39.685 24.460 14.103  1.00 22.03  ? 192 GLN A O     1 
ATOM   1508 C  CB    . GLN A 1 192 ? -37.764 23.570 11.408  1.00 19.08  ? 192 GLN A CB    1 
ATOM   1509 C  CG    . GLN A 1 192 ? -36.432 24.231 11.057  1.00 34.40  ? 192 GLN A CG    1 
ATOM   1510 C  CD    . GLN A 1 192 ? -36.334 24.573 9.561   1.00 51.81  ? 192 GLN A CD    1 
ATOM   1511 O  OE1   . GLN A 1 192 ? -35.765 23.799 8.795   1.00 26.80  ? 192 GLN A OE1   1 
ATOM   1512 N  NE2   . GLN A 1 192 ? -36.900 25.732 9.144   1.00 32.20  ? 192 GLN A NE2   1 
ATOM   1513 N  N     . LEU A 1 193 ? -40.394 22.877 12.676  1.00 15.65  ? 193 LEU A N     1 
ATOM   1514 C  CA    . LEU A 1 193 ? -41.801 23.103 12.951  1.00 9.42   ? 193 LEU A CA    1 
ATOM   1515 C  C     . LEU A 1 193 ? -42.072 23.045 14.457  1.00 21.05  ? 193 LEU A C     1 
ATOM   1516 O  O     . LEU A 1 193 ? -42.459 24.039 15.048  1.00 22.30  ? 193 LEU A O     1 
ATOM   1517 C  CB    . LEU A 1 193 ? -42.648 22.083 12.203  1.00 4.05   ? 193 LEU A CB    1 
ATOM   1518 C  CG    . LEU A 1 193 ? -44.154 22.266 12.333  1.00 15.25  ? 193 LEU A CG    1 
ATOM   1519 C  CD1   . LEU A 1 193 ? -44.530 23.712 11.989  1.00 10.19  ? 193 LEU A CD1   1 
ATOM   1520 C  CD2   . LEU A 1 193 ? -44.924 21.240 11.473  1.00 5.07   ? 193 LEU A CD2   1 
ATOM   1521 N  N     . LYS A 1 194 ? -41.842 21.889 15.073  1.00 25.50  ? 194 LYS A N     1 
ATOM   1522 C  CA    . LYS A 1 194 ? -42.054 21.702 16.507  1.00 19.76  ? 194 LYS A CA    1 
ATOM   1523 C  C     . LYS A 1 194 ? -41.400 22.804 17.357  1.00 17.04  ? 194 LYS A C     1 
ATOM   1524 O  O     . LYS A 1 194 ? -42.053 23.387 18.211  1.00 13.51  ? 194 LYS A O     1 
ATOM   1525 C  CB    . LYS A 1 194 ? -41.543 20.322 16.923  1.00 14.72  ? 194 LYS A CB    1 
ATOM   1526 C  CG    . LYS A 1 194 ? -41.548 20.023 18.416  1.00 28.12  ? 194 LYS A CG    1 
ATOM   1527 C  CD    . LYS A 1 194 ? -40.978 18.626 18.682  1.00 32.78  ? 194 LYS A CD    1 
ATOM   1528 C  CE    . LYS A 1 194 ? -40.804 18.343 20.164  1.00 32.50  ? 194 LYS A CE    1 
ATOM   1529 N  NZ    . LYS A 1 194 ? -39.978 19.381 20.825  1.00 56.80  ? 194 LYS A NZ    1 
ATOM   1530 N  N     . SER A 1 195 ? -40.132 23.102 17.106  1.00 10.80  ? 195 SER A N     1 
ATOM   1531 C  CA    . SER A 1 195 ? -39.467 24.236 17.746  1.00 21.73  ? 195 SER A CA    1 
ATOM   1532 C  C     . SER A 1 195 ? -40.303 25.539 17.656  1.00 21.71  ? 195 SER A C     1 
ATOM   1533 O  O     . SER A 1 195 ? -40.558 26.206 18.666  1.00 17.04  ? 195 SER A O     1 
ATOM   1534 C  CB    . SER A 1 195 ? -38.072 24.431 17.119  1.00 20.27  ? 195 SER A CB    1 
ATOM   1535 O  OG    . SER A 1 195 ? -37.426 25.638 17.506  1.00 18.63  ? 195 SER A OG    1 
ATOM   1536 N  N     . TYR A 1 196 ? -40.752 25.895 16.460  1.00 17.26  ? 196 TYR A N     1 
ATOM   1537 C  CA    . TYR A 1 196 ? -41.513 27.133 16.311  1.00 31.06  ? 196 TYR A CA    1 
ATOM   1538 C  C     . TYR A 1 196 ? -42.819 27.075 17.101  1.00 16.65  ? 196 TYR A C     1 
ATOM   1539 O  O     . TYR A 1 196 ? -43.181 28.027 17.784  1.00 22.28  ? 196 TYR A O     1 
ATOM   1540 C  CB    . TYR A 1 196 ? -41.799 27.423 14.833  1.00 21.28  ? 196 TYR A CB    1 
ATOM   1541 C  CG    . TYR A 1 196 ? -40.550 27.485 13.985  1.00 18.43  ? 196 TYR A CG    1 
ATOM   1542 C  CD1   . TYR A 1 196 ? -39.344 27.943 14.510  1.00 18.47  ? 196 TYR A CD1   1 
ATOM   1543 C  CD2   . TYR A 1 196 ? -40.569 27.066 12.667  1.00 22.36  ? 196 TYR A CD2   1 
ATOM   1544 C  CE1   . TYR A 1 196 ? -38.192 27.992 13.728  1.00 18.70  ? 196 TYR A CE1   1 
ATOM   1545 C  CE2   . TYR A 1 196 ? -39.426 27.107 11.875  1.00 25.43  ? 196 TYR A CE2   1 
ATOM   1546 C  CZ    . TYR A 1 196 ? -38.245 27.570 12.408  1.00 25.76  ? 196 TYR A CZ    1 
ATOM   1547 O  OH    . TYR A 1 196 ? -37.130 27.610 11.602  1.00 42.70  ? 196 TYR A OH    1 
ATOM   1548 N  N     . VAL A 1 197 ? -43.508 25.945 17.012  1.00 15.27  ? 197 VAL A N     1 
ATOM   1549 C  CA    . VAL A 1 197 ? -44.800 25.776 17.660  1.00 20.38  ? 197 VAL A CA    1 
ATOM   1550 C  C     . VAL A 1 197 ? -44.657 25.949 19.163  1.00 25.75  ? 197 VAL A C     1 
ATOM   1551 O  O     . VAL A 1 197 ? -45.501 26.565 19.810  1.00 33.45  ? 197 VAL A O     1 
ATOM   1552 C  CB    . VAL A 1 197 ? -45.427 24.392 17.364  1.00 13.62  ? 197 VAL A CB    1 
ATOM   1553 C  CG1   . VAL A 1 197 ? -46.733 24.241 18.105  1.00 11.95  ? 197 VAL A CG1   1 
ATOM   1554 C  CG2   . VAL A 1 197 ? -45.660 24.208 15.883  1.00 16.49  ? 197 VAL A CG2   1 
ATOM   1555 N  N     . GLU A 1 198 ? -43.575 25.413 19.712  1.00 27.56  ? 198 GLU A N     1 
ATOM   1556 C  CA    . GLU A 1 198 ? -43.338 25.502 21.146  1.00 32.53  ? 198 GLU A CA    1 
ATOM   1557 C  C     . GLU A 1 198 ? -43.258 26.962 21.544  1.00 28.60  ? 198 GLU A C     1 
ATOM   1558 O  O     . GLU A 1 198 ? -43.942 27.408 22.465  1.00 42.21  ? 198 GLU A O     1 
ATOM   1559 C  CB    . GLU A 1 198 ? -42.055 24.753 21.548  1.00 17.63  ? 198 GLU A CB    1 
ATOM   1560 C  CG    . GLU A 1 198 ? -42.324 23.412 22.216  1.00 26.57  ? 198 GLU A CG    1 
ATOM   1561 C  CD    . GLU A 1 198 ? -41.243 22.374 21.953  1.00 70.03  ? 198 GLU A CD    1 
ATOM   1562 O  OE1   . GLU A 1 198 ? -40.062 22.763 21.798  1.00 56.75  ? 198 GLU A OE1   1 
ATOM   1563 O  OE2   . GLU A 1 198 ? -41.584 21.167 21.892  1.00 46.19  ? 198 GLU A OE2   1 
ATOM   1564 N  N     . ILE A 1 199 ? -42.438 27.707 20.818  1.00 20.40  ? 199 ILE A N     1 
ATOM   1565 C  CA    . ILE A 1 199 ? -42.175 29.094 21.149  1.00 20.96  ? 199 ILE A CA    1 
ATOM   1566 C  C     . ILE A 1 199 ? -43.429 29.952 21.088  1.00 31.78  ? 199 ILE A C     1 
ATOM   1567 O  O     . ILE A 1 199 ? -43.642 30.809 21.941  1.00 37.75  ? 199 ILE A O     1 
ATOM   1568 C  CB    . ILE A 1 199 ? -41.126 29.650 20.219  1.00 24.80  ? 199 ILE A CB    1 
ATOM   1569 C  CG1   . ILE A 1 199 ? -39.867 28.795 20.343  1.00 15.48  ? 199 ILE A CG1   1 
ATOM   1570 C  CG2   . ILE A 1 199 ? -40.885 31.124 20.504  1.00 29.84  ? 199 ILE A CG2   1 
ATOM   1571 C  CD1   . ILE A 1 199 ? -38.657 29.407 19.738  1.00 32.23  ? 199 ILE A CD1   1 
ATOM   1572 N  N     . LEU A 1 200 ? -44.263 29.701 20.083  1.00 23.64  ? 200 LEU A N     1 
ATOM   1573 C  CA    . LEU A 1 200 ? -45.527 30.409 19.936  1.00 15.58  ? 200 LEU A CA    1 
ATOM   1574 C  C     . LEU A 1 200 ? -46.582 29.915 20.919  1.00 28.10  ? 200 LEU A C     1 
ATOM   1575 O  O     . LEU A 1 200 ? -47.522 30.634 21.220  1.00 47.40  ? 200 LEU A O     1 
ATOM   1576 C  CB    . LEU A 1 200 ? -46.054 30.274 18.506  1.00 20.95  ? 200 LEU A CB    1 
ATOM   1577 C  CG    . LEU A 1 200 ? -45.368 31.112 17.432  1.00 22.81  ? 200 LEU A CG    1 
ATOM   1578 C  CD1   . LEU A 1 200 ? -45.900 30.712 16.109  1.00 31.32  ? 200 LEU A CD1   1 
ATOM   1579 C  CD2   . LEU A 1 200 ? -45.593 32.602 17.638  1.00 17.50  ? 200 LEU A CD2   1 
ATOM   1580 N  N     . ARG A 1 201 ? -46.449 28.686 21.409  1.00 38.87  ? 201 ARG A N     1 
ATOM   1581 C  CA    . ARG A 1 201 ? -47.313 28.246 22.497  1.00 29.31  ? 201 ARG A CA    1 
ATOM   1582 C  C     . ARG A 1 201 ? -47.039 29.083 23.755  1.00 46.15  ? 201 ARG A C     1 
ATOM   1583 O  O     . ARG A 1 201 ? -47.948 29.339 24.541  1.00 33.61  ? 201 ARG A O     1 
ATOM   1584 C  CB    . ARG A 1 201 ? -47.122 26.760 22.806  1.00 16.55  ? 201 ARG A CB    1 
ATOM   1585 C  CG    . ARG A 1 201 ? -47.758 25.811 21.800  1.00 29.59  ? 201 ARG A CG    1 
ATOM   1586 C  CD    . ARG A 1 201 ? -48.007 24.412 22.393  1.00 32.63  ? 201 ARG A CD    1 
ATOM   1587 N  NE    . ARG A 1 201 ? -48.243 23.407 21.354  1.00 60.01  ? 201 ARG A NE    1 
ATOM   1588 C  CZ    . ARG A 1 201 ? -49.368 23.296 20.644  1.00 86.46  ? 201 ARG A CZ    1 
ATOM   1589 N  NH1   . ARG A 1 201 ? -50.380 24.134 20.860  1.00 66.96  ? 201 ARG A NH1   1 
ATOM   1590 N  NH2   . ARG A 1 201 ? -49.482 22.347 19.708  1.00 21.38  ? 201 ARG A NH2   1 
ATOM   1591 N  N     . GLU A 1 202 ? -45.795 29.526 23.936  1.00 30.12  ? 202 GLU A N     1 
ATOM   1592 C  CA    . GLU A 1 202 ? -45.440 30.264 25.144  1.00 28.89  ? 202 GLU A CA    1 
ATOM   1593 C  C     . GLU A 1 202 ? -46.196 31.591 25.283  1.00 55.75  ? 202 GLU A C     1 
ATOM   1594 O  O     . GLU A 1 202 ? -46.554 31.980 26.399  1.00 58.90  ? 202 GLU A O     1 
ATOM   1595 C  CB    . GLU A 1 202 ? -43.932 30.500 25.200  1.00 19.97  ? 202 GLU A CB    1 
ATOM   1596 C  CG    . GLU A 1 202 ? -43.145 29.226 25.437  1.00 36.52  ? 202 GLU A CG    1 
ATOM   1597 C  CD    . GLU A 1 202 ? -41.666 29.466 25.708  1.00 86.75  ? 202 GLU A CD    1 
ATOM   1598 O  OE1   . GLU A 1 202 ? -41.148 30.564 25.382  1.00 48.81  ? 202 GLU A OE1   1 
ATOM   1599 O  OE2   . GLU A 1 202 ? -41.020 28.538 26.245  1.00 101.11 ? 202 GLU A OE2   1 
ATOM   1600 N  N     . GLU A 1 203 ? -46.427 32.299 24.180  1.00 35.85  ? 203 GLU A N     1 
ATOM   1601 C  CA    . GLU A 1 203 ? -47.306 33.463 24.244  1.00 37.48  ? 203 GLU A CA    1 
ATOM   1602 C  C     . GLU A 1 203 ? -48.805 33.142 24.172  1.00 27.43  ? 203 GLU A C     1 
ATOM   1603 O  O     . GLU A 1 203 ? -49.590 33.624 24.983  1.00 77.89  ? 203 GLU A O     1 
ATOM   1604 C  CB    . GLU A 1 203 ? -46.940 34.450 23.143  1.00 26.00  ? 203 GLU A CB    1 
ATOM   1605 C  CG    . GLU A 1 203 ? -45.592 35.107 23.381  1.00 45.38  ? 203 GLU A CG    1 
ATOM   1606 C  CD    . GLU A 1 203 ? -45.564 36.579 22.993  1.00 80.20  ? 203 GLU A CD    1 
ATOM   1607 O  OE1   . GLU A 1 203 ? -45.997 37.425 23.810  1.00 84.52  ? 203 GLU A OE1   1 
ATOM   1608 O  OE2   . GLU A 1 203 ? -45.100 36.888 21.873  1.00 73.07  ? 203 GLU A OE2   1 
ATOM   1609 N  N     . TYR A 1 204 ? -49.196 32.348 23.190  1.00 23.30  ? 204 TYR A N     1 
ATOM   1610 C  CA    . TYR A 1 204 ? -50.611 32.147 22.861  1.00 41.48  ? 204 TYR A CA    1 
ATOM   1611 C  C     . TYR A 1 204 ? -51.173 30.831 23.402  1.00 48.84  ? 204 TYR A C     1 
ATOM   1612 O  O     . TYR A 1 204 ? -52.301 30.416 23.072  1.00 35.99  ? 204 TYR A O     1 
ATOM   1613 C  CB    . TYR A 1 204 ? -50.820 32.278 21.341  1.00 33.21  ? 204 TYR A CB    1 
ATOM   1614 C  CG    . TYR A 1 204 ? -50.274 33.597 20.822  1.00 38.47  ? 204 TYR A CG    1 
ATOM   1615 C  CD1   . TYR A 1 204 ? -51.021 34.762 20.896  1.00 48.54  ? 204 TYR A CD1   1 
ATOM   1616 C  CD2   . TYR A 1 204 ? -48.991 33.681 20.304  1.00 25.55  ? 204 TYR A CD2   1 
ATOM   1617 C  CE1   . TYR A 1 204 ? -50.503 35.968 20.444  1.00 62.33  ? 204 TYR A CE1   1 
ATOM   1618 C  CE2   . TYR A 1 204 ? -48.471 34.870 19.857  1.00 35.74  ? 204 TYR A CE2   1 
ATOM   1619 C  CZ    . TYR A 1 204 ? -49.223 36.011 19.926  1.00 44.57  ? 204 TYR A CZ    1 
ATOM   1620 O  OH    . TYR A 1 204 ? -48.685 37.194 19.475  1.00 37.08  ? 204 TYR A OH    1 
ATOM   1621 N  N     . GLY A 1 205 ? -50.361 30.141 24.189  1.00 25.60  ? 205 GLY A N     1 
ATOM   1622 C  CA    . GLY A 1 205 ? -50.860 28.982 24.904  1.00 40.94  ? 205 GLY A CA    1 
ATOM   1623 C  C     . GLY A 1 205 ? -51.233 27.828 24.009  1.00 25.61  ? 205 GLY A C     1 
ATOM   1624 O  O     . GLY A 1 205 ? -50.658 27.652 22.940  1.00 68.15  ? 205 GLY A O     1 
ATOM   1625 N  N     . ASP A 1 206 ? -52.221 27.054 24.441  1.00 48.25  ? 206 ASP A N     1 
ATOM   1626 C  CA    . ASP A 1 206 ? -52.534 25.779 23.811  1.00 51.70  ? 206 ASP A CA    1 
ATOM   1627 C  C     . ASP A 1 206 ? -53.159 25.917 22.408  1.00 69.24  ? 206 ASP A C     1 
ATOM   1628 O  O     . ASP A 1 206 ? -53.232 24.928 21.674  1.00 56.36  ? 206 ASP A O     1 
ATOM   1629 C  CB    . ASP A 1 206 ? -53.432 24.956 24.759  1.00 34.51  ? 206 ASP A CB    1 
ATOM   1630 C  CG    . ASP A 1 206 ? -54.106 23.774 24.078  1.00 94.47  ? 206 ASP A CG    1 
ATOM   1631 O  OD1   . ASP A 1 206 ? -53.450 22.720 23.926  1.00 99.26  ? 206 ASP A OD1   1 
ATOM   1632 O  OD2   . ASP A 1 206 ? -55.304 23.881 23.738  1.00 98.05  ? 206 ASP A OD2   1 
ATOM   1633 N  N     . LYS A 1 207 ? -53.562 27.115 21.976  1.00 46.89  ? 207 LYS A N     1 
ATOM   1634 C  CA    . LYS A 1 207 ? -54.084 27.135 20.611  1.00 70.56  ? 207 LYS A CA    1 
ATOM   1635 C  C     . LYS A 1 207 ? -53.078 27.678 19.580  1.00 69.92  ? 207 LYS A C     1 
ATOM   1636 O  O     . LYS A 1 207 ? -53.019 28.866 19.228  1.00 54.45  ? 207 LYS A O     1 
ATOM   1637 C  CB    . LYS A 1 207 ? -55.412 27.912 20.587  1.00 82.01  ? 207 LYS A CB    1 
ATOM   1638 C  CG    . LYS A 1 207 ? -55.359 29.417 20.857  1.00 84.18  ? 207 LYS A CG    1 
ATOM   1639 C  CD    . LYS A 1 207 ? -56.770 30.002 20.998  1.00 81.14  ? 207 LYS A CD    1 
ATOM   1640 C  CE    . LYS A 1 207 ? -57.832 29.133 20.309  1.00 84.49  ? 207 LYS A CE    1 
ATOM   1641 N  NZ    . LYS A 1 207 ? -59.216 29.665 20.474  1.00 63.94  ? 207 LYS A NZ    1 
ATOM   1642 N  N     . VAL A 1 208 ? -52.361 26.710 19.019  1.00 39.55  ? 208 VAL A N     1 
ATOM   1643 C  CA    . VAL A 1 208 ? -51.356 26.905 17.991  1.00 28.60  ? 208 VAL A CA    1 
ATOM   1644 C  C     . VAL A 1 208 ? -51.332 25.605 17.212  1.00 26.12  ? 208 VAL A C     1 
ATOM   1645 O  O     . VAL A 1 208 ? -51.379 24.536 17.811  1.00 35.77  ? 208 VAL A O     1 
ATOM   1646 C  CB    . VAL A 1 208 ? -49.936 27.180 18.549  1.00 21.82  ? 208 VAL A CB    1 
ATOM   1647 C  CG1   . VAL A 1 208 ? -49.005 27.528 17.426  1.00 28.54  ? 208 VAL A CG1   1 
ATOM   1648 C  CG2   . VAL A 1 208 ? -49.917 28.303 19.574  1.00 35.22  ? 208 VAL A CG2   1 
ATOM   1649 N  N     . ARG A 1 209 ? -51.229 25.671 15.893  1.00 25.77  ? 209 ARG A N     1 
ATOM   1650 C  CA    . ARG A 1 209 ? -51.077 24.454 15.109  1.00 17.10  ? 209 ARG A CA    1 
ATOM   1651 C  C     . ARG A 1 209 ? -49.845 24.636 14.253  1.00 23.18  ? 209 ARG A C     1 
ATOM   1652 O  O     . ARG A 1 209 ? -49.644 25.712 13.691  1.00 35.17  ? 209 ARG A O     1 
ATOM   1653 C  CB    . ARG A 1 209 ? -52.308 24.179 14.246  1.00 18.51  ? 209 ARG A CB    1 
ATOM   1654 C  CG    . ARG A 1 209 ? -53.625 24.206 15.013  1.00 22.66  ? 209 ARG A CG    1 
ATOM   1655 C  CD    . ARG A 1 209 ? -54.847 24.359 14.108  1.00 16.43  ? 209 ARG A CD    1 
ATOM   1656 N  NE    . ARG A 1 209 ? -54.851 23.411 12.998  1.00 37.23  ? 209 ARG A NE    1 
ATOM   1657 C  CZ    . ARG A 1 209 ? -55.359 23.667 11.794  1.00 38.57  ? 209 ARG A CZ    1 
ATOM   1658 N  NH1   . ARG A 1 209 ? -55.909 24.847 11.538  1.00 28.00  ? 209 ARG A NH1   1 
ATOM   1659 N  NH2   . ARG A 1 209 ? -55.305 22.749 10.838  1.00 11.60  ? 209 ARG A NH2   1 
ATOM   1660 N  N     . GLY A 1 210 ? -48.961 23.646 14.239  1.00 21.13  ? 210 GLY A N     1 
ATOM   1661 C  CA    . GLY A 1 210 ? -47.986 23.560 13.173  1.00 26.15  ? 210 GLY A CA    1 
ATOM   1662 C  C     . GLY A 1 210 ? -48.510 22.679 12.051  1.00 44.02  ? 210 GLY A C     1 
ATOM   1663 O  O     . GLY A 1 210 ? -49.112 21.624 12.288  1.00 23.70  ? 210 GLY A O     1 
ATOM   1664 N  N     . ILE A 1 211 ? -48.221 23.070 10.818  1.00 23.88  ? 211 ILE A N     1 
ATOM   1665 C  CA    . ILE A 1 211 ? -48.528 22.220 9.691   1.00 17.53  ? 211 ILE A CA    1 
ATOM   1666 C  C     . ILE A 1 211 ? -47.304 22.146 8.810   1.00 25.97  ? 211 ILE A C     1 
ATOM   1667 O  O     . ILE A 1 211 ? -46.770 23.172 8.377   1.00 28.15  ? 211 ILE A O     1 
ATOM   1668 C  CB    . ILE A 1 211 ? -49.700 22.732 8.869   1.00 29.10  ? 211 ILE A CB    1 
ATOM   1669 C  CG1   . ILE A 1 211 ? -50.900 23.042 9.753   1.00 21.13  ? 211 ILE A CG1   1 
ATOM   1670 C  CG2   . ILE A 1 211 ? -50.075 21.718 7.801   1.00 16.04  ? 211 ILE A CG2   1 
ATOM   1671 C  CD1   . ILE A 1 211 ? -52.057 23.599 8.958   1.00 21.14  ? 211 ILE A CD1   1 
ATOM   1672 N  N     . LEU A 1 212 ? -46.851 20.928 8.557   1.00 19.24  ? 212 LEU A N     1 
ATOM   1673 C  CA    . LEU A 1 212 ? -45.766 20.723 7.621   1.00 19.15  ? 212 LEU A CA    1 
ATOM   1674 C  C     . LEU A 1 212 ? -46.345 20.598 6.223   1.00 20.94  ? 212 LEU A C     1 
ATOM   1675 O  O     . LEU A 1 212 ? -47.203 19.755 5.956   1.00 17.50  ? 212 LEU A O     1 
ATOM   1676 C  CB    . LEU A 1 212 ? -44.952 19.491 7.990   1.00 13.02  ? 212 LEU A CB    1 
ATOM   1677 C  CG    . LEU A 1 212 ? -43.899 19.064 6.982   1.00 12.66  ? 212 LEU A CG    1 
ATOM   1678 C  CD1   . LEU A 1 212 ? -43.071 20.247 6.546   1.00 27.26  ? 212 LEU A CD1   1 
ATOM   1679 C  CD2   . LEU A 1 212 ? -43.024 18.083 7.660   1.00 17.42  ? 212 LEU A CD2   1 
ATOM   1680 N  N     . VAL A 1 213 ? -45.883 21.462 5.336   1.00 18.28  ? 213 VAL A N     1 
ATOM   1681 C  CA    . VAL A 1 213 ? -46.381 21.456 3.979   1.00 25.75  ? 213 VAL A CA    1 
ATOM   1682 C  C     . VAL A 1 213 ? -45.244 21.143 3.000   1.00 27.90  ? 213 VAL A C     1 
ATOM   1683 O  O     . VAL A 1 213 ? -44.236 21.852 2.935   1.00 35.51  ? 213 VAL A O     1 
ATOM   1684 C  CB    . VAL A 1 213 ? -47.046 22.796 3.643   1.00 18.37  ? 213 VAL A CB    1 
ATOM   1685 C  CG1   . VAL A 1 213 ? -47.614 22.775 2.244   1.00 29.74  ? 213 VAL A CG1   1 
ATOM   1686 C  CG2   . VAL A 1 213 ? -48.126 23.078 4.624   1.00 13.80  ? 213 VAL A CG2   1 
ATOM   1687 N  N     . ALA A 1 214 ? -45.439 20.084 2.224   1.00 24.31  ? 214 ALA A N     1 
ATOM   1688 C  CA    . ALA A 1 214 ? -44.397 19.500 1.391   1.00 23.81  ? 214 ALA A CA    1 
ATOM   1689 C  C     . ALA A 1 214 ? -45.027 18.373 0.591   1.00 22.92  ? 214 ALA A C     1 
ATOM   1690 O  O     . ALA A 1 214 ? -46.112 17.918 0.928   1.00 29.94  ? 214 ALA A O     1 
ATOM   1691 C  CB    . ALA A 1 214 ? -43.247 18.983 2.248   1.00 20.96  ? 214 ALA A CB    1 
ATOM   1692 N  N     . PRO A 1 215 ? -44.362 17.925 -0.484  1.00 45.49  ? 215 PRO A N     1 
ATOM   1693 C  CA    . PRO A 1 215 ? -44.921 16.840 -1.303  1.00 20.46  ? 215 PRO A CA    1 
ATOM   1694 C  C     . PRO A 1 215 ? -44.981 15.472 -0.601  1.00 26.07  ? 215 PRO A C     1 
ATOM   1695 O  O     . PRO A 1 215 ? -45.764 14.626 -1.023  1.00 26.98  ? 215 PRO A O     1 
ATOM   1696 C  CB    . PRO A 1 215 ? -43.966 16.790 -2.490  1.00 23.41  ? 215 PRO A CB    1 
ATOM   1697 C  CG    . PRO A 1 215 ? -42.706 17.418 -1.992  1.00 16.70  ? 215 PRO A CG    1 
ATOM   1698 C  CD    . PRO A 1 215 ? -43.136 18.485 -1.083  1.00 28.94  ? 215 PRO A CD    1 
ATOM   1699 N  N     . SER A 1 216 ? -44.197 15.275 0.457   1.00 23.37  ? 216 SER A N     1 
ATOM   1700 C  CA    . SER A 1 216 ? -44.138 13.993 1.151   1.00 20.96  ? 216 SER A CA    1 
ATOM   1701 C  C     . SER A 1 216 ? -43.203 14.041 2.355   1.00 29.91  ? 216 SER A C     1 
ATOM   1702 O  O     . SER A 1 216 ? -42.453 15.003 2.526   1.00 25.20  ? 216 SER A O     1 
ATOM   1703 C  CB    . SER A 1 216 ? -43.682 12.882 0.201   1.00 28.67  ? 216 SER A CB    1 
ATOM   1704 O  OG    . SER A 1 216 ? -42.396 13.150 -0.328  1.00 27.97  ? 216 SER A OG    1 
ATOM   1705 N  N     . LEU A 1 217 ? -43.252 12.993 3.180   1.00 20.06  ? 217 LEU A N     1 
ATOM   1706 C  CA    . LEU A 1 217 ? -42.370 12.866 4.336   1.00 13.35  ? 217 LEU A CA    1 
ATOM   1707 C  C     . LEU A 1 217 ? -41.578 11.591 4.313   1.00 15.35  ? 217 LEU A C     1 
ATOM   1708 O  O     . LEU A 1 217 ? -42.055 10.564 3.851   1.00 34.49  ? 217 LEU A O     1 
ATOM   1709 C  CB    . LEU A 1 217 ? -43.153 12.876 5.637   1.00 15.22  ? 217 LEU A CB    1 
ATOM   1710 C  CG    . LEU A 1 217 ? -44.377 13.752 5.750   1.00 22.70  ? 217 LEU A CG    1 
ATOM   1711 C  CD1   . LEU A 1 217 ? -45.115 13.368 7.012   1.00 8.56   ? 217 LEU A CD1   1 
ATOM   1712 C  CD2   . LEU A 1 217 ? -43.870 15.160 5.824   1.00 48.38  ? 217 LEU A CD2   1 
ATOM   1713 N  N     . THR A 1 218 ? -40.389 11.634 4.890   1.00 23.11  ? 218 THR A N     1 
ATOM   1714 C  CA    . THR A 1 218 ? -39.667 10.407 5.155   1.00 22.04  ? 218 THR A CA    1 
ATOM   1715 C  C     . THR A 1 218 ? -40.370 9.644  6.279   1.00 24.45  ? 218 THR A C     1 
ATOM   1716 O  O     . THR A 1 218 ? -41.358 10.119 6.842   1.00 20.76  ? 218 THR A O     1 
ATOM   1717 C  CB    . THR A 1 218 ? -38.215 10.692 5.542   1.00 25.20  ? 218 THR A CB    1 
ATOM   1718 O  OG1   . THR A 1 218 ? -38.167 11.300 6.840   1.00 36.92  ? 218 THR A OG1   1 
ATOM   1719 C  CG2   . THR A 1 218 ? -37.606 11.640 4.545   1.00 34.36  ? 218 THR A CG2   1 
ATOM   1720 N  N     . SER A 1 219 ? -39.856 8.465  6.608   1.00 31.93  ? 219 SER A N     1 
ATOM   1721 C  CA    . SER A 1 219 ? -40.462 7.632  7.638   1.00 29.35  ? 219 SER A CA    1 
ATOM   1722 C  C     . SER A 1 219 ? -40.424 8.323  9.009   1.00 42.95  ? 219 SER A C     1 
ATOM   1723 O  O     . SER A 1 219 ? -41.458 8.513  9.652   1.00 24.88  ? 219 SER A O     1 
ATOM   1724 C  CB    . SER A 1 219 ? -39.757 6.277  7.710   1.00 34.74  ? 219 SER A CB    1 
ATOM   1725 O  OG    . SER A 1 219 ? -38.404 6.419  8.123   1.00 39.36  ? 219 SER A OG    1 
ATOM   1726 N  N     . GLY A 1 220 ? -39.228 8.700  9.449   1.00 36.57  ? 220 GLY A N     1 
ATOM   1727 C  CA    . GLY A 1 220 ? -39.065 9.330  10.747  1.00 36.35  ? 220 GLY A CA    1 
ATOM   1728 C  C     . GLY A 1 220 ? -39.833 10.631 10.858  1.00 34.91  ? 220 GLY A C     1 
ATOM   1729 O  O     . GLY A 1 220 ? -40.358 10.979 11.915  1.00 33.26  ? 220 GLY A O     1 
ATOM   1730 N  N     . ALA A 1 221 ? -39.895 11.359 9.753   1.00 30.00  ? 221 ALA A N     1 
ATOM   1731 C  CA    . ALA A 1 221 ? -40.622 12.607 9.720   1.00 19.42  ? 221 ALA A CA    1 
ATOM   1732 C  C     . ALA A 1 221 ? -42.087 12.369 10.078  1.00 37.05  ? 221 ALA A C     1 
ATOM   1733 O  O     . ALA A 1 221 ? -42.613 13.029 10.970  1.00 33.30  ? 221 ALA A O     1 
ATOM   1734 C  CB    . ALA A 1 221 ? -40.499 13.254 8.353   1.00 38.62  ? 221 ALA A CB    1 
ATOM   1735 N  N     . LYS A 1 222 ? -42.739 11.422 9.400   1.00 26.61  ? 222 LYS A N     1 
ATOM   1736 C  CA    . LYS A 1 222 ? -44.140 11.114 9.706   1.00 33.99  ? 222 LYS A CA    1 
ATOM   1737 C  C     . LYS A 1 222 ? -44.279 10.586 11.130  1.00 29.42  ? 222 LYS A C     1 
ATOM   1738 O  O     . LYS A 1 222 ? -45.212 10.937 11.850  1.00 34.57  ? 222 LYS A O     1 
ATOM   1739 C  CB    . LYS A 1 222 ? -44.722 10.095 8.720   1.00 28.48  ? 222 LYS A CB    1 
ATOM   1740 C  CG    . LYS A 1 222 ? -46.176 9.733  9.024   1.00 25.91  ? 222 LYS A CG    1 
ATOM   1741 C  CD    . LYS A 1 222 ? -46.718 8.612  8.145   1.00 29.69  ? 222 LYS A CD    1 
ATOM   1742 C  CE    . LYS A 1 222 ? -48.246 8.692  8.062   1.00 46.33  ? 222 LYS A CE    1 
ATOM   1743 N  NZ    . LYS A 1 222 ? -48.878 7.713  7.125   1.00 62.07  ? 222 LYS A NZ    1 
ATOM   1744 N  N     . ARG A 1 223 ? -43.333 9.740  11.513  1.00 32.88  ? 223 ARG A N     1 
ATOM   1745 C  CA    . ARG A 1 223 ? -43.273 9.165  12.844  1.00 22.87  ? 223 ARG A CA    1 
ATOM   1746 C  C     . ARG A 1 223 ? -43.281 10.298 13.864  1.00 27.92  ? 223 ARG A C     1 
ATOM   1747 O  O     . ARG A 1 223 ? -44.178 10.394 14.707  1.00 38.89  ? 223 ARG A O     1 
ATOM   1748 C  CB    . ARG A 1 223 ? -42.012 8.289  12.972  1.00 45.48  ? 223 ARG A CB    1 
ATOM   1749 C  CG    . ARG A 1 223 ? -41.981 7.282  14.119  1.00 33.74  ? 223 ARG A CG    1 
ATOM   1750 C  CD    . ARG A 1 223 ? -40.948 6.173  13.853  1.00 21.35  ? 223 ARG A CD    1 
ATOM   1751 N  NE    . ARG A 1 223 ? -39.570 6.669  13.840  1.00 63.21  ? 223 ARG A NE    1 
ATOM   1752 C  CZ    . ARG A 1 223 ? -38.658 6.350  12.920  1.00 73.87  ? 223 ARG A CZ    1 
ATOM   1753 N  NH1   . ARG A 1 223 ? -38.960 5.522  11.921  1.00 42.84  ? 223 ARG A NH1   1 
ATOM   1754 N  NH2   . ARG A 1 223 ? -37.434 6.863  12.997  1.00 52.65  ? 223 ARG A NH2   1 
ATOM   1755 N  N     . LEU A 1 224 ? -42.305 11.189 13.746  1.00 29.31  ? 224 LEU A N     1 
ATOM   1756 C  CA    . LEU A 1 224 ? -42.164 12.281 14.695  1.00 28.99  ? 224 LEU A CA    1 
ATOM   1757 C  C     . LEU A 1 224 ? -43.277 13.322 14.556  1.00 26.46  ? 224 LEU A C     1 
ATOM   1758 O  O     . LEU A 1 224 ? -43.664 13.968 15.529  1.00 20.83  ? 224 LEU A O     1 
ATOM   1759 C  CB    . LEU A 1 224 ? -40.803 12.942 14.523  1.00 24.22  ? 224 LEU A CB    1 
ATOM   1760 C  CG    . LEU A 1 224 ? -40.567 14.137 15.439  1.00 16.66  ? 224 LEU A CG    1 
ATOM   1761 C  CD1   . LEU A 1 224 ? -40.601 13.663 16.860  1.00 9.23   ? 224 LEU A CD1   1 
ATOM   1762 C  CD2   . LEU A 1 224 ? -39.248 14.818 15.110  1.00 22.87  ? 224 LEU A CD2   1 
ATOM   1763 N  N     . LEU A 1 225 ? -43.786 13.489 13.343  1.00 24.12  ? 225 LEU A N     1 
ATOM   1764 C  CA    . LEU A 1 225 ? -44.840 14.457 13.125  1.00 23.83  ? 225 LEU A CA    1 
ATOM   1765 C  C     . LEU A 1 225 ? -46.007 14.070 13.997  1.00 31.49  ? 225 LEU A C     1 
ATOM   1766 O  O     . LEU A 1 225 ? -46.496 14.869 14.791  1.00 25.97  ? 225 LEU A O     1 
ATOM   1767 C  CB    . LEU A 1 225 ? -45.278 14.521 11.651  1.00 14.46  ? 225 LEU A CB    1 
ATOM   1768 C  CG    . LEU A 1 225 ? -45.964 15.866 11.380  1.00 22.34  ? 225 LEU A CG    1 
ATOM   1769 C  CD1   . LEU A 1 225 ? -44.996 17.006 11.689  1.00 13.94  ? 225 LEU A CD1   1 
ATOM   1770 C  CD2   . LEU A 1 225 ? -46.519 16.003 9.974   1.00 21.76  ? 225 LEU A CD2   1 
ATOM   1771 N  N     . GLU A 1 226 ? -46.426 12.820 13.844  1.00 38.64  ? 226 GLU A N     1 
ATOM   1772 C  CA    . GLU A 1 226 ? -47.600 12.307 14.517  1.00 30.06  ? 226 GLU A CA    1 
ATOM   1773 C  C     . GLU A 1 226 ? -47.398 12.299 16.015  1.00 40.89  ? 226 GLU A C     1 
ATOM   1774 O  O     . GLU A 1 226 ? -48.272 12.743 16.763  1.00 31.46  ? 226 GLU A O     1 
ATOM   1775 C  CB    . GLU A 1 226 ? -47.915 10.906 14.018  1.00 26.46  ? 226 GLU A CB    1 
ATOM   1776 C  CG    . GLU A 1 226 ? -48.409 10.882 12.590  1.00 39.04  ? 226 GLU A CG    1 
ATOM   1777 C  CD    . GLU A 1 226 ? -48.454 9.481  12.025  1.00 94.90  ? 226 GLU A CD    1 
ATOM   1778 O  OE1   . GLU A 1 226 ? -47.804 8.582  12.609  1.00 92.08  ? 226 GLU A OE1   1 
ATOM   1779 O  OE2   . GLU A 1 226 ? -49.147 9.279  11.003  1.00 85.74  ? 226 GLU A OE2   1 
ATOM   1780 N  N     . LYS A 1 227 ? -46.238 11.808 16.444  1.00 20.44  ? 227 LYS A N     1 
ATOM   1781 C  CA    . LYS A 1 227 ? -45.946 11.711 17.863  1.00 18.12  ? 227 LYS A CA    1 
ATOM   1782 C  C     . LYS A 1 227 ? -46.188 13.053 18.555  1.00 22.05  ? 227 LYS A C     1 
ATOM   1783 O  O     . LYS A 1 227 ? -46.951 13.131 19.510  1.00 36.78  ? 227 LYS A O     1 
ATOM   1784 C  CB    . LYS A 1 227 ? -44.507 11.218 18.093  1.00 33.18  ? 227 LYS A CB    1 
ATOM   1785 C  CG    . LYS A 1 227 ? -44.053 11.240 19.565  1.00 28.04  ? 227 LYS A CG    1 
ATOM   1786 C  CD    . LYS A 1 227 ? -42.626 10.707 19.767  1.00 57.45  ? 227 LYS A CD    1 
ATOM   1787 C  CE    . LYS A 1 227 ? -41.711 11.790 20.344  1.00 73.84  ? 227 LYS A CE    1 
ATOM   1788 N  NZ    . LYS A 1 227 ? -42.453 12.771 21.196  1.00 75.05  ? 227 LYS A NZ    1 
ATOM   1789 N  N     . GLU A 1 228 ? -45.623 14.126 18.023  1.00 39.39  ? 228 GLU A N     1 
ATOM   1790 C  CA    . GLU A 1 228 ? -45.733 15.419 18.687  1.00 40.93  ? 228 GLU A CA    1 
ATOM   1791 C  C     . GLU A 1 228 ? -47.030 16.150 18.300  1.00 20.46  ? 228 GLU A C     1 
ATOM   1792 O  O     . GLU A 1 228 ? -47.211 17.328 18.605  1.00 29.15  ? 228 GLU A O     1 
ATOM   1793 C  CB    . GLU A 1 228 ? -44.500 16.275 18.399  1.00 20.73  ? 228 GLU A CB    1 
ATOM   1794 C  CG    . GLU A 1 228 ? -43.599 16.429 19.630  1.00 51.28  ? 228 GLU A CG    1 
ATOM   1795 C  CD    . GLU A 1 228 ? -44.231 17.280 20.753  1.00 85.20  ? 228 GLU A CD    1 
ATOM   1796 O  OE1   . GLU A 1 228 ? -44.736 18.392 20.457  1.00 55.43  ? 228 GLU A OE1   1 
ATOM   1797 O  OE2   . GLU A 1 228 ? -44.216 16.839 21.933  1.00 85.84  ? 228 GLU A OE2   1 
ATOM   1798 N  N     . GLY A 1 229 ? -47.913 15.448 17.597  1.00 33.32  ? 229 GLY A N     1 
ATOM   1799 C  CA    . GLY A 1 229 ? -49.258 15.935 17.332  1.00 23.53  ? 229 GLY A CA    1 
ATOM   1800 C  C     . GLY A 1 229 ? -49.311 17.102 16.370  1.00 40.70  ? 229 GLY A C     1 
ATOM   1801 O  O     . GLY A 1 229 ? -50.060 18.054 16.573  1.00 35.81  ? 229 GLY A O     1 
ATOM   1802 N  N     . LEU A 1 230 ? -48.494 17.041 15.327  1.00 41.66  ? 230 LEU A N     1 
ATOM   1803 C  CA    . LEU A 1 230 ? -48.506 18.075 14.315  1.00 19.48  ? 230 LEU A CA    1 
ATOM   1804 C  C     . LEU A 1 230 ? -49.193 17.555 13.046  1.00 35.67  ? 230 LEU A C     1 
ATOM   1805 O  O     . LEU A 1 230 ? -49.536 16.373 12.973  1.00 56.24  ? 230 LEU A O     1 
ATOM   1806 C  CB    . LEU A 1 230 ? -47.082 18.540 14.043  1.00 26.50  ? 230 LEU A CB    1 
ATOM   1807 C  CG    . LEU A 1 230 ? -46.449 19.378 15.157  1.00 19.95  ? 230 LEU A CG    1 
ATOM   1808 C  CD1   . LEU A 1 230 ? -44.931 19.235 15.184  1.00 17.86  ? 230 LEU A CD1   1 
ATOM   1809 C  CD2   . LEU A 1 230 ? -46.799 20.829 14.950  1.00 18.05  ? 230 LEU A CD2   1 
ATOM   1810 N  N     . GLU A 1 231 ? -49.369 18.423 12.050  1.00 24.32  ? 231 GLU A N     1 
ATOM   1811 C  CA    . GLU A 1 231 ? -50.181 18.104 10.875  1.00 28.62  ? 231 GLU A CA    1 
ATOM   1812 C  C     . GLU A 1 231 ? -49.426 18.247 9.557   1.00 33.72  ? 231 GLU A C     1 
ATOM   1813 O  O     . GLU A 1 231 ? -48.459 18.997 9.464   1.00 25.29  ? 231 GLU A O     1 
ATOM   1814 C  CB    . GLU A 1 231 ? -51.410 19.007 10.815  1.00 23.30  ? 231 GLU A CB    1 
ATOM   1815 C  CG    . GLU A 1 231 ? -52.147 19.197 12.118  1.00 21.20  ? 231 GLU A CG    1 
ATOM   1816 C  CD    . GLU A 1 231 ? -53.329 20.163 11.984  1.00 43.58  ? 231 GLU A CD    1 
ATOM   1817 O  OE1   . GLU A 1 231 ? -53.419 21.104 12.810  1.00 14.87  ? 231 GLU A OE1   1 
ATOM   1818 O  OE2   . GLU A 1 231 ? -54.161 19.979 11.058  1.00 37.28  ? 231 GLU A OE2   1 
ATOM   1819 N  N     . PHE A 1 232 ? -49.920 17.570 8.526   1.00 21.13  ? 232 PHE A N     1 
ATOM   1820 C  CA    . PHE A 1 232 ? -49.278 17.577 7.215   1.00 24.53  ? 232 PHE A CA    1 
ATOM   1821 C  C     . PHE A 1 232 ? -50.249 17.870 6.083   1.00 18.37  ? 232 PHE A C     1 
ATOM   1822 O  O     . PHE A 1 232 ? -51.321 17.283 6.017   1.00 26.94  ? 232 PHE A O     1 
ATOM   1823 C  CB    . PHE A 1 232 ? -48.597 16.225 6.973   1.00 26.81  ? 232 PHE A CB    1 
ATOM   1824 C  CG    . PHE A 1 232 ? -48.120 16.011 5.558   1.00 30.62  ? 232 PHE A CG    1 
ATOM   1825 C  CD1   . PHE A 1 232 ? -46.863 16.431 5.164   1.00 22.68  ? 232 PHE A CD1   1 
ATOM   1826 C  CD2   . PHE A 1 232 ? -48.916 15.357 4.634   1.00 30.59  ? 232 PHE A CD2   1 
ATOM   1827 C  CE1   . PHE A 1 232 ? -46.420 16.219 3.879   1.00 26.61  ? 232 PHE A CE1   1 
ATOM   1828 C  CE2   . PHE A 1 232 ? -48.473 15.149 3.342   1.00 29.96  ? 232 PHE A CE2   1 
ATOM   1829 C  CZ    . PHE A 1 232 ? -47.226 15.580 2.967   1.00 28.88  ? 232 PHE A CZ    1 
ATOM   1830 N  N     . ARG A 1 233 ? -49.870 18.775 5.189   1.00 24.46  ? 233 ARG A N     1 
ATOM   1831 C  CA    . ARG A 1 233 ? -50.574 18.915 3.918   1.00 41.55  ? 233 ARG A CA    1 
ATOM   1832 C  C     . ARG A 1 233 ? -49.610 18.646 2.786   1.00 26.93  ? 233 ARG A C     1 
ATOM   1833 O  O     . ARG A 1 233 ? -48.554 19.266 2.705   1.00 24.63  ? 233 ARG A O     1 
ATOM   1834 C  CB    . ARG A 1 233 ? -51.202 20.303 3.738   1.00 15.92  ? 233 ARG A CB    1 
ATOM   1835 C  CG    . ARG A 1 233 ? -52.341 20.619 4.700   1.00 71.19  ? 233 ARG A CG    1 
ATOM   1836 C  CD    . ARG A 1 233 ? -53.456 19.577 4.697   1.00 66.44  ? 233 ARG A CD    1 
ATOM   1837 N  NE    . ARG A 1 233 ? -54.553 19.974 5.582   1.00 94.53  ? 233 ARG A NE    1 
ATOM   1838 C  CZ    . ARG A 1 233 ? -54.645 19.650 6.871   1.00 76.10  ? 233 ARG A CZ    1 
ATOM   1839 N  NH1   . ARG A 1 233 ? -53.714 18.904 7.447   1.00 70.71  ? 233 ARG A NH1   1 
ATOM   1840 N  NH2   . ARG A 1 233 ? -55.680 20.065 7.588   1.00 73.78  ? 233 ARG A NH2   1 
ATOM   1841 N  N     . LYS A 1 234 ? -49.982 17.711 1.920   1.00 20.97  ? 234 LYS A N     1 
ATOM   1842 C  CA    . LYS A 1 234 ? -49.218 17.454 0.717   1.00 22.73  ? 234 LYS A CA    1 
ATOM   1843 C  C     . LYS A 1 234 ? -49.318 18.660 -0.196  1.00 17.79  ? 234 LYS A C     1 
ATOM   1844 O  O     . LYS A 1 234 ? -50.409 19.131 -0.506  1.00 16.07  ? 234 LYS A O     1 
ATOM   1845 C  CB    . LYS A 1 234 ? -49.718 16.185 0.014   1.00 35.55  ? 234 LYS A CB    1 
ATOM   1846 C  CG    . LYS A 1 234 ? -49.419 16.105 -1.481  1.00 37.78  ? 234 LYS A CG    1 
ATOM   1847 C  CD    . LYS A 1 234 ? -49.651 14.692 -2.020  1.00 62.67  ? 234 LYS A CD    1 
ATOM   1848 C  CE    . LYS A 1 234 ? -49.033 14.502 -3.405  1.00 83.53  ? 234 LYS A CE    1 
ATOM   1849 N  NZ    . LYS A 1 234 ? -48.989 13.064 -3.800  1.00 55.72  ? 234 LYS A NZ    1 
ATOM   1850 N  N     . LEU A 1 235 ? -48.169 19.191 -0.593  1.00 28.69  ? 235 LEU A N     1 
ATOM   1851 C  CA    . LEU A 1 235 ? -48.151 20.217 -1.621  1.00 31.03  ? 235 LEU A CA    1 
ATOM   1852 C  C     . LEU A 1 235 ? -46.868 20.158 -2.440  1.00 30.67  ? 235 LEU A C     1 
ATOM   1853 O  O     . LEU A 1 235 ? -45.784 19.973 -1.902  1.00 33.24  ? 235 LEU A O     1 
ATOM   1854 C  CB    . LEU A 1 235 ? -48.313 21.596 -1.001  1.00 18.70  ? 235 LEU A CB    1 
ATOM   1855 C  CG    . LEU A 1 235 ? -48.950 22.581 -1.959  1.00 12.59  ? 235 LEU A CG    1 
ATOM   1856 C  CD1   . LEU A 1 235 ? -50.431 22.266 -2.048  1.00 39.89  ? 235 LEU A CD1   1 
ATOM   1857 C  CD2   . LEU A 1 235 ? -48.698 24.003 -1.498  1.00 21.88  ? 235 LEU A CD2   1 
ATOM   1858 N  N     . GLU A 1 236 ? -47.009 20.323 -3.747  1.00 30.49  ? 236 GLU A N     1 
ATOM   1859 C  CA    . GLU A 1 236 ? -45.888 20.288 -4.668  1.00 21.28  ? 236 GLU A CA    1 
ATOM   1860 C  C     . GLU A 1 236 ? -45.531 21.704 -5.045  1.00 28.46  ? 236 GLU A C     1 
ATOM   1861 O  O     . GLU A 1 236 ? -46.417 22.515 -5.294  1.00 34.01  ? 236 GLU A O     1 
ATOM   1862 C  CB    . GLU A 1 236 ? -46.218 19.469 -5.915  1.00 19.78  ? 236 GLU A CB    1 
ATOM   1863 C  CG    . GLU A 1 236 ? -46.890 18.143 -5.629  1.00 49.02  ? 236 GLU A CG    1 
ATOM   1864 C  CD    . GLU A 1 236 ? -46.086 16.978 -6.141  1.00 75.48  ? 236 GLU A CD    1 
ATOM   1865 O  OE1   . GLU A 1 236 ? -44.899 17.191 -6.467  1.00 79.23  ? 236 GLU A OE1   1 
ATOM   1866 O  OE2   . GLU A 1 236 ? -46.637 15.857 -6.218  1.00 103.67 ? 236 GLU A OE2   1 
ATOM   1867 N  N     . PRO A 1 237 ? -44.238 22.029 -5.038  1.00 23.58  ? 237 PRO A N     1 
ATOM   1868 C  CA    . PRO A 1 237 ? -43.867 23.351 -5.541  1.00 30.57  ? 237 PRO A CA    1 
ATOM   1869 C  C     . PRO A 1 237 ? -44.358 23.534 -6.966  1.00 34.45  ? 237 PRO A C     1 
ATOM   1870 O  O     . PRO A 1 237 ? -44.238 22.611 -7.776  1.00 39.69  ? 237 PRO A O     1 
ATOM   1871 C  CB    . PRO A 1 237 ? -42.332 23.351 -5.471  1.00 21.23  ? 237 PRO A CB    1 
ATOM   1872 C  CG    . PRO A 1 237 ? -41.942 21.940 -5.390  1.00 16.75  ? 237 PRO A CG    1 
ATOM   1873 C  CD    . PRO A 1 237 ? -43.067 21.196 -4.735  1.00 31.58  ? 237 PRO A CD    1 
ATOM   1874 N  N     . PRO A 1 238 ? -44.928 24.709 -7.265  1.00 36.45  ? 238 PRO A N     1 
ATOM   1875 C  CA    . PRO A 1 238 ? -45.434 25.035 -8.601  1.00 54.30  ? 238 PRO A CA    1 
ATOM   1876 C  C     . PRO A 1 238 ? -44.306 25.331 -9.591  1.00 49.03  ? 238 PRO A C     1 
ATOM   1877 O  O     . PRO A 1 238 ? -43.288 25.897 -9.196  1.00 32.28  ? 238 PRO A O     1 
ATOM   1878 C  CB    . PRO A 1 238 ? -46.279 26.286 -8.348  1.00 34.22  ? 238 PRO A CB    1 
ATOM   1879 C  CG    . PRO A 1 238 ? -45.586 26.964 -7.214  1.00 39.50  ? 238 PRO A CG    1 
ATOM   1880 C  CD    . PRO A 1 238 ? -45.027 25.856 -6.344  1.00 49.45  ? 238 PRO A CD    1 
ATOM   1881 N  N     . LYS A 1 239 ? -44.480 24.955 -10.855 1.00 47.39  ? 239 LYS A N     1 
ATOM   1882 C  CA    . LYS A 1 239 ? -43.512 25.335 -11.876 1.00 29.08  ? 239 LYS A CA    1 
ATOM   1883 C  C     . LYS A 1 239 ? -44.128 26.269 -12.904 1.00 33.18  ? 239 LYS A C     1 
ATOM   1884 O  O     . LYS A 1 239 ? -44.960 25.857 -13.709 1.00 80.19  ? 239 LYS A O     1 
ATOM   1885 C  CB    . LYS A 1 239 ? -42.954 24.107 -12.575 1.00 18.01  ? 239 LYS A CB    1 
ATOM   1886 C  CG    . LYS A 1 239 ? -42.035 23.247 -11.730 1.00 38.37  ? 239 LYS A CG    1 
ATOM   1887 C  CD    . LYS A 1 239 ? -41.633 22.019 -12.535 1.00 50.24  ? 239 LYS A CD    1 
ATOM   1888 C  CE    . LYS A 1 239 ? -40.520 21.221 -11.894 1.00 20.66  ? 239 LYS A CE    1 
ATOM   1889 N  NZ    . LYS A 1 239 ? -40.188 20.072 -12.793 1.00 39.49  ? 239 LYS A NZ    1 
ATOM   1890 N  N     . ARG A 1 240 ? -43.698 27.524 -12.884 1.00 24.98  ? 240 ARG A N     1 
ATOM   1891 C  CA    . ARG A 1 240 ? -44.200 28.543 -13.809 1.00 60.37  ? 240 ARG A CA    1 
ATOM   1892 C  C     . ARG A 1 240 ? -43.218 28.824 -14.953 1.00 75.94  ? 240 ARG A C     1 
ATOM   1893 O  O     . ARG A 1 240 ? -42.927 27.945 -15.775 1.00 52.39  ? 240 ARG A O     1 
ATOM   1894 C  CB    . ARG A 1 240 ? -44.510 29.838 -13.040 1.00 55.41  ? 240 ARG A CB    1 
ATOM   1895 C  CG    . ARG A 1 240 ? -45.529 29.653 -11.878 1.00 63.84  ? 240 ARG A CG    1 
ATOM   1896 C  CD    . ARG A 1 240 ? -45.294 30.592 -10.681 1.00 88.10  ? 240 ARG A CD    1 
ATOM   1897 N  NE    . ARG A 1 240 ? -46.552 31.099 -10.119 1.00 104.81 ? 240 ARG A NE    1 
ATOM   1898 C  CZ    . ARG A 1 240 ? -46.861 31.101 -8.821  1.00 104.69 ? 240 ARG A CZ    1 
ATOM   1899 N  NH1   . ARG A 1 240 ? -46.004 30.620 -7.934  1.00 90.67  ? 240 ARG A NH1   1 
ATOM   1900 N  NH2   . ARG A 1 240 ? -48.028 31.582 -8.406  1.00 89.07  ? 240 ARG A NH2   1 
ATOM   1901 N  N     . SER B 1 2   ? -1.941  10.537 -31.866 1.00 78.18  ? 2   SER B N     1 
ATOM   1902 C  CA    . SER B 1 2   ? -3.268  10.665 -31.267 1.00 115.37 ? 2   SER B CA    1 
ATOM   1903 C  C     . SER B 1 2   ? -3.257  11.228 -29.835 1.00 120.74 ? 2   SER B C     1 
ATOM   1904 O  O     . SER B 1 2   ? -3.709  12.359 -29.600 1.00 63.40  ? 2   SER B O     1 
ATOM   1905 C  CB    . SER B 1 2   ? -3.983  9.307  -31.271 1.00 91.37  ? 2   SER B CB    1 
ATOM   1906 O  OG    . SER B 1 2   ? -4.723  9.112  -32.461 1.00 98.89  ? 2   SER B OG    1 
ATOM   1907 N  N     . LYS B 1 3   ? -2.731  10.452 -28.884 1.00 117.27 ? 3   LYS B N     1 
ATOM   1908 C  CA    . LYS B 1 3   ? -3.023  10.705 -27.470 1.00 89.62  ? 3   LYS B CA    1 
ATOM   1909 C  C     . LYS B 1 3   ? -1.932  11.423 -26.659 1.00 76.81  ? 3   LYS B C     1 
ATOM   1910 O  O     . LYS B 1 3   ? -0.925  10.835 -26.251 1.00 56.10  ? 3   LYS B O     1 
ATOM   1911 C  CB    . LYS B 1 3   ? -3.371  9.376  -26.780 1.00 60.98  ? 3   LYS B CB    1 
ATOM   1912 C  CG    . LYS B 1 3   ? -4.880  9.071  -26.720 1.00 71.98  ? 3   LYS B CG    1 
ATOM   1913 C  CD    . LYS B 1 3   ? -5.540  9.237  -28.081 1.00 75.86  ? 3   LYS B CD    1 
ATOM   1914 C  CE    . LYS B 1 3   ? -6.861  8.500  -28.212 1.00 65.43  ? 3   LYS B CE    1 
ATOM   1915 N  NZ    . LYS B 1 3   ? -7.760  9.253  -29.142 1.00 57.45  ? 3   LYS B NZ    1 
ATOM   1916 N  N     . ASP B 1 4   ? -2.212  12.698 -26.393 1.00 80.12  ? 4   ASP B N     1 
ATOM   1917 C  CA    . ASP B 1 4   ? -1.503  13.535 -25.429 1.00 59.58  ? 4   ASP B CA    1 
ATOM   1918 C  C     . ASP B 1 4   ? -2.563  13.891 -24.422 1.00 35.22  ? 4   ASP B C     1 
ATOM   1919 O  O     . ASP B 1 4   ? -3.745  13.782 -24.738 1.00 53.33  ? 4   ASP B O     1 
ATOM   1920 C  CB    . ASP B 1 4   ? -0.937  14.814 -26.046 1.00 78.70  ? 4   ASP B CB    1 
ATOM   1921 C  CG    . ASP B 1 4   ? -0.216  14.568 -27.336 1.00 69.66  ? 4   ASP B CG    1 
ATOM   1922 O  OD1   . ASP B 1 4   ? 0.826   13.883 -27.300 1.00 76.35  ? 4   ASP B OD1   1 
ATOM   1923 O  OD2   . ASP B 1 4   ? -0.709  15.055 -28.380 1.00 43.98  ? 4   ASP B OD2   1 
ATOM   1924 N  N     . LYS B 1 5   ? -2.157  14.320 -23.229 1.00 35.55  ? 5   LYS B N     1 
ATOM   1925 C  CA    . LYS B 1 5   ? -3.104  14.666 -22.171 1.00 19.71  ? 5   LYS B CA    1 
ATOM   1926 C  C     . LYS B 1 5   ? -4.178  15.591 -22.711 1.00 43.15  ? 5   LYS B C     1 
ATOM   1927 O  O     . LYS B 1 5   ? -5.363  15.450 -22.390 1.00 36.32  ? 5   LYS B O     1 
ATOM   1928 C  CB    . LYS B 1 5   ? -2.400  15.346 -20.998 1.00 18.30  ? 5   LYS B CB    1 
ATOM   1929 C  CG    . LYS B 1 5   ? -1.436  14.479 -20.229 1.00 20.14  ? 5   LYS B CG    1 
ATOM   1930 C  CD    . LYS B 1 5   ? -2.165  13.578 -19.263 1.00 25.43  ? 5   LYS B CD    1 
ATOM   1931 C  CE    . LYS B 1 5   ? -1.197  12.837 -18.377 1.00 40.67  ? 5   LYS B CE    1 
ATOM   1932 N  NZ    . LYS B 1 5   ? -0.365  13.833 -17.658 1.00 36.32  ? 5   LYS B NZ    1 
ATOM   1933 N  N     . VAL B 1 6   ? -3.755  16.529 -23.555 1.00 26.70  ? 6   VAL B N     1 
ATOM   1934 C  CA    . VAL B 1 6   ? -4.637  17.605 -23.958 1.00 29.27  ? 6   VAL B CA    1 
ATOM   1935 C  C     . VAL B 1 6   ? -4.804  17.683 -25.461 1.00 25.59  ? 6   VAL B C     1 
ATOM   1936 O  O     . VAL B 1 6   ? -3.876  17.419 -26.220 1.00 28.53  ? 6   VAL B O     1 
ATOM   1937 C  CB    . VAL B 1 6   ? -4.129  18.952 -23.426 1.00 12.87  ? 6   VAL B CB    1 
ATOM   1938 C  CG1   . VAL B 1 6   ? -5.128  20.069 -23.709 1.00 21.19  ? 6   VAL B CG1   1 
ATOM   1939 C  CG2   . VAL B 1 6   ? -3.899  18.844 -21.943 1.00 31.58  ? 6   VAL B CG2   1 
ATOM   1940 N  N     . THR B 1 7   ? -6.023  18.016 -25.867 1.00 20.47  ? 7   THR B N     1 
ATOM   1941 C  CA    . THR B 1 7   ? -6.334  18.314 -27.244 1.00 31.79  ? 7   THR B CA    1 
ATOM   1942 C  C     . THR B 1 7   ? -7.204  19.586 -27.308 1.00 26.92  ? 7   THR B C     1 
ATOM   1943 O  O     . THR B 1 7   ? -8.327  19.611 -26.827 1.00 23.90  ? 7   THR B O     1 
ATOM   1944 C  CB    . THR B 1 7   ? -7.033  17.107 -27.899 1.00 27.50  ? 7   THR B CB    1 
ATOM   1945 O  OG1   . THR B 1 7   ? -6.182  15.959 -27.784 1.00 19.40  ? 7   THR B OG1   1 
ATOM   1946 C  CG2   . THR B 1 7   ? -7.333  17.376 -29.366 1.00 5.20   ? 7   THR B CG2   1 
ATOM   1947 N  N     . VAL B 1 8   ? -6.685  20.649 -27.903 1.00 24.30  ? 8   VAL B N     1 
ATOM   1948 C  CA    . VAL B 1 8   ? -7.436  21.893 -27.944 1.00 15.05  ? 8   VAL B CA    1 
ATOM   1949 C  C     . VAL B 1 8   ? -7.765  22.315 -29.355 1.00 17.84  ? 8   VAL B C     1 
ATOM   1950 O  O     . VAL B 1 8   ? -6.952  22.153 -30.259 1.00 31.70  ? 8   VAL B O     1 
ATOM   1951 C  CB    . VAL B 1 8   ? -6.662  23.053 -27.316 1.00 20.71  ? 8   VAL B CB    1 
ATOM   1952 C  CG1   . VAL B 1 8   ? -7.635  24.073 -26.752 1.00 22.24  ? 8   VAL B CG1   1 
ATOM   1953 C  CG2   . VAL B 1 8   ? -5.679  22.556 -26.268 1.00 21.29  ? 8   VAL B CG2   1 
ATOM   1954 N  N     . ILE B 1 9   ? -8.953  22.864 -29.546 1.00 7.75   ? 9   ILE B N     1 
ATOM   1955 C  CA    . ILE B 1 9   ? -9.252  23.566 -30.775 1.00 8.29   ? 9   ILE B CA    1 
ATOM   1956 C  C     . ILE B 1 9   ? -10.038 24.820 -30.465 1.00 13.78  ? 9   ILE B C     1 
ATOM   1957 O  O     . ILE B 1 9   ? -11.137 24.755 -29.918 1.00 17.66  ? 9   ILE B O     1 
ATOM   1958 C  CB    . ILE B 1 9   ? -10.039 22.689 -31.759 1.00 17.51  ? 9   ILE B CB    1 
ATOM   1959 C  CG1   . ILE B 1 9   ? -9.140  21.561 -32.274 1.00 16.99  ? 9   ILE B CG1   1 
ATOM   1960 C  CG2   . ILE B 1 9   ? -10.544 23.529 -32.908 1.00 7.26   ? 9   ILE B CG2   1 
ATOM   1961 C  CD1   . ILE B 1 9   ? -9.847  20.508 -33.037 1.00 18.87  ? 9   ILE B CD1   1 
ATOM   1962 N  N     . THR B 1 10  ? -9.468  25.969 -30.788 1.00 19.23  ? 10  THR B N     1 
ATOM   1963 C  CA    . THR B 1 10  ? -10.221 27.208 -30.696 1.00 29.97  ? 10  THR B CA    1 
ATOM   1964 C  C     . THR B 1 10  ? -11.059 27.393 -31.962 1.00 25.91  ? 10  THR B C     1 
ATOM   1965 O  O     . THR B 1 10  ? -10.766 26.786 -32.993 1.00 17.68  ? 10  THR B O     1 
ATOM   1966 C  CB    . THR B 1 10  ? -9.302  28.398 -30.431 1.00 12.56  ? 10  THR B CB    1 
ATOM   1967 O  OG1   . THR B 1 10  ? -8.177  28.349 -31.307 1.00 36.73  ? 10  THR B OG1   1 
ATOM   1968 C  CG2   . THR B 1 10  ? -8.775  28.283 -29.048 1.00 12.94  ? 10  THR B CG2   1 
ATOM   1969 N  N     . SER B 1 11  ? -12.130 28.177 -31.841 1.00 22.21  ? 11  SER B N     1 
ATOM   1970 C  CA    . SER B 1 11  ? -13.070 28.455 -32.930 1.00 17.17  ? 11  SER B CA    1 
ATOM   1971 C  C     . SER B 1 11  ? -13.202 27.271 -33.878 1.00 26.60  ? 11  SER B C     1 
ATOM   1972 O  O     . SER B 1 11  ? -12.848 27.364 -35.051 1.00 28.54  ? 11  SER B O     1 
ATOM   1973 C  CB    . SER B 1 11  ? -12.657 29.718 -33.686 1.00 16.01  ? 11  SER B CB    1 
ATOM   1974 O  OG    . SER B 1 11  ? -13.213 30.866 -33.071 1.00 36.95  ? 11  SER B OG    1 
ATOM   1975 N  N     . PRO B 1 12  ? -13.678 26.133 -33.354 1.00 30.82  ? 12  PRO B N     1 
ATOM   1976 C  CA    . PRO B 1 12  ? -13.713 24.890 -34.121 1.00 27.98  ? 12  PRO B CA    1 
ATOM   1977 C  C     . PRO B 1 12  ? -14.875 24.817 -35.107 1.00 35.58  ? 12  PRO B C     1 
ATOM   1978 O  O     . PRO B 1 12  ? -15.889 25.504 -34.942 1.00 16.56  ? 12  PRO B O     1 
ATOM   1979 C  CB    . PRO B 1 12  ? -13.862 23.833 -33.036 1.00 12.00  ? 12  PRO B CB    1 
ATOM   1980 C  CG    . PRO B 1 12  ? -14.695 24.512 -32.013 1.00 21.92  ? 12  PRO B CG    1 
ATOM   1981 C  CD    . PRO B 1 12  ? -14.336 25.976 -32.045 1.00 25.38  ? 12  PRO B CD    1 
ATOM   1982 N  N     . SER B 1 13  ? -14.707 23.988 -36.131 1.00 32.21  ? 13  SER B N     1 
ATOM   1983 C  CA    . SER B 1 13  ? -15.785 23.639 -37.039 1.00 11.01  ? 13  SER B CA    1 
ATOM   1984 C  C     . SER B 1 13  ? -16.749 22.724 -36.340 1.00 40.87  ? 13  SER B C     1 
ATOM   1985 O  O     . SER B 1 13  ? -16.370 22.047 -35.372 1.00 23.32  ? 13  SER B O     1 
ATOM   1986 C  CB    . SER B 1 13  ? -15.238 22.943 -38.276 1.00 13.82  ? 13  SER B CB    1 
ATOM   1987 O  OG    . SER B 1 13  ? -16.213 22.080 -38.832 1.00 78.53  ? 13  SER B OG    1 
ATOM   1988 N  N     . THR B 1 14  ? -17.983 22.674 -36.836 1.00 35.63  ? 14  THR B N     1 
ATOM   1989 C  CA    . THR B 1 14  ? -18.932 21.696 -36.330 1.00 10.56  ? 14  THR B CA    1 
ATOM   1990 C  C     . THR B 1 14  ? -18.324 20.302 -36.408 1.00 18.50  ? 14  THR B C     1 
ATOM   1991 O  O     . THR B 1 14  ? -18.403 19.533 -35.446 1.00 32.83  ? 14  THR B O     1 
ATOM   1992 C  CB    . THR B 1 14  ? -20.263 21.733 -37.081 1.00 11.68  ? 14  THR B CB    1 
ATOM   1993 O  OG1   . THR B 1 14  ? -21.122 22.709 -36.467 1.00 21.85  ? 14  THR B OG1   1 
ATOM   1994 C  CG2   . THR B 1 14  ? -20.950 20.377 -36.995 1.00 14.77  ? 14  THR B CG2   1 
ATOM   1995 N  N     . GLU B 1 15  ? -17.677 19.989 -37.526 1.00 16.59  ? 15  GLU B N     1 
ATOM   1996 C  CA    . GLU B 1 15  ? -16.999 18.707 -37.648 1.00 19.56  ? 15  GLU B CA    1 
ATOM   1997 C  C     . GLU B 1 15  ? -15.993 18.503 -36.502 1.00 21.39  ? 15  GLU B C     1 
ATOM   1998 O  O     . GLU B 1 15  ? -15.936 17.427 -35.897 1.00 20.46  ? 15  GLU B O     1 
ATOM   1999 C  CB    . GLU B 1 15  ? -16.302 18.581 -39.015 1.00 18.66  ? 15  GLU B CB    1 
ATOM   2000 C  CG    . GLU B 1 15  ? -15.637 17.200 -39.224 1.00 84.40  ? 15  GLU B CG    1 
ATOM   2001 C  CD    . GLU B 1 15  ? -15.015 16.991 -40.607 1.00 81.47  ? 15  GLU B CD    1 
ATOM   2002 O  OE1   . GLU B 1 15  ? -15.518 17.564 -41.600 1.00 79.95  ? 15  GLU B OE1   1 
ATOM   2003 O  OE2   . GLU B 1 15  ? -14.019 16.235 -40.696 1.00 61.68  ? 15  GLU B OE2   1 
ATOM   2004 N  N     . GLU B 1 16  ? -15.224 19.541 -36.183 1.00 24.46  ? 16  GLU B N     1 
ATOM   2005 C  CA    . GLU B 1 16  ? -14.198 19.416 -35.148 1.00 26.64  ? 16  GLU B CA    1 
ATOM   2006 C  C     . GLU B 1 16  ? -14.833 19.224 -33.793 1.00 30.75  ? 16  GLU B C     1 
ATOM   2007 O  O     . GLU B 1 16  ? -14.372 18.398 -32.998 1.00 26.90  ? 16  GLU B O     1 
ATOM   2008 C  CB    . GLU B 1 16  ? -13.289 20.641 -35.108 1.00 8.43   ? 16  GLU B CB    1 
ATOM   2009 C  CG    . GLU B 1 16  ? -12.952 21.178 -36.457 1.00 7.62   ? 16  GLU B CG    1 
ATOM   2010 C  CD    . GLU B 1 16  ? -11.636 21.924 -36.475 1.00 35.29  ? 16  GLU B CD    1 
ATOM   2011 O  OE1   . GLU B 1 16  ? -11.697 23.185 -36.482 1.00 11.21  ? 16  GLU B OE1   1 
ATOM   2012 O  OE2   . GLU B 1 16  ? -10.557 21.247 -36.491 1.00 10.17  ? 16  GLU B OE2   1 
ATOM   2013 N  N     . LEU B 1 17  ? -15.878 20.015 -33.539 1.00 31.69  ? 17  LEU B N     1 
ATOM   2014 C  CA    . LEU B 1 17  ? -16.629 19.959 -32.290 1.00 16.54  ? 17  LEU B CA    1 
ATOM   2015 C  C     . LEU B 1 17  ? -17.045 18.537 -32.027 1.00 37.11  ? 17  LEU B C     1 
ATOM   2016 O  O     . LEU B 1 17  ? -16.581 17.906 -31.057 1.00 24.84  ? 17  LEU B O     1 
ATOM   2017 C  CB    . LEU B 1 17  ? -17.866 20.850 -32.348 1.00 14.41  ? 17  LEU B CB    1 
ATOM   2018 C  CG    . LEU B 1 17  ? -18.729 20.871 -31.087 1.00 10.68  ? 17  LEU B CG    1 
ATOM   2019 C  CD1   . LEU B 1 17  ? -17.937 21.423 -29.903 1.00 17.94  ? 17  LEU B CD1   1 
ATOM   2020 C  CD2   . LEU B 1 17  ? -19.938 21.714 -31.319 1.00 6.84   ? 17  LEU B CD2   1 
ATOM   2021 N  N     . VAL B 1 18  ? -17.906 18.045 -32.921 1.00 17.08  ? 18  VAL B N     1 
ATOM   2022 C  CA    . VAL B 1 18  ? -18.405 16.680 -32.867 1.00 19.29  ? 18  VAL B CA    1 
ATOM   2023 C  C     . VAL B 1 18  ? -17.282 15.682 -32.686 1.00 21.79  ? 18  VAL B C     1 
ATOM   2024 O  O     . VAL B 1 18  ? -17.379 14.750 -31.885 1.00 29.09  ? 18  VAL B O     1 
ATOM   2025 C  CB    . VAL B 1 18  ? -19.155 16.300 -34.131 1.00 6.16   ? 18  VAL B CB    1 
ATOM   2026 C  CG1   . VAL B 1 18  ? -19.555 14.843 -34.061 1.00 5.30   ? 18  VAL B CG1   1 
ATOM   2027 C  CG2   . VAL B 1 18  ? -20.366 17.190 -34.330 1.00 4.16   ? 18  VAL B CG2   1 
ATOM   2028 N  N     . SER B 1 19  ? -16.207 15.891 -33.431 1.00 19.74  ? 19  SER B N     1 
ATOM   2029 C  CA    . SER B 1 19  ? -15.095 14.970 -33.382 1.00 24.28  ? 19  SER B CA    1 
ATOM   2030 C  C     . SER B 1 19  ? -14.564 14.855 -31.973 1.00 17.92  ? 19  SER B C     1 
ATOM   2031 O  O     . SER B 1 19  ? -14.500 13.769 -31.412 1.00 27.17  ? 19  SER B O     1 
ATOM   2032 C  CB    . SER B 1 19  ? -13.985 15.412 -34.314 1.00 15.08  ? 19  SER B CB    1 
ATOM   2033 O  OG    . SER B 1 19  ? -12.947 14.452 -34.282 1.00 47.78  ? 19  SER B OG    1 
ATOM   2034 N  N     . LEU B 1 20  ? -14.203 15.998 -31.409 1.00 29.15  ? 20  LEU B N     1 
ATOM   2035 C  CA    . LEU B 1 20  ? -13.626 16.066 -30.081 1.00 26.75  ? 20  LEU B CA    1 
ATOM   2036 C  C     . LEU B 1 20  ? -14.597 15.643 -28.988 1.00 43.42  ? 20  LEU B C     1 
ATOM   2037 O  O     . LEU B 1 20  ? -14.249 14.829 -28.122 1.00 22.54  ? 20  LEU B O     1 
ATOM   2038 C  CB    . LEU B 1 20  ? -13.144 17.483 -29.804 1.00 34.91  ? 20  LEU B CB    1 
ATOM   2039 C  CG    . LEU B 1 20  ? -11.632 17.635 -29.776 1.00 27.31  ? 20  LEU B CG    1 
ATOM   2040 C  CD1   . LEU B 1 20  ? -11.081 17.308 -31.125 1.00 26.35  ? 20  LEU B CD1   1 
ATOM   2041 C  CD2   . LEU B 1 20  ? -11.263 19.041 -29.372 1.00 33.25  ? 20  LEU B CD2   1 
ATOM   2042 N  N     . VAL B 1 21  ? -15.799 16.221 -29.015 1.00 27.36  ? 21  VAL B N     1 
ATOM   2043 C  CA    . VAL B 1 21  ? -16.807 15.926 -28.005 1.00 17.97  ? 21  VAL B CA    1 
ATOM   2044 C  C     . VAL B 1 21  ? -17.047 14.436 -27.920 1.00 18.59  ? 21  VAL B C     1 
ATOM   2045 O  O     . VAL B 1 21  ? -16.951 13.849 -26.850 1.00 25.14  ? 21  VAL B O     1 
ATOM   2046 C  CB    . VAL B 1 21  ? -18.142 16.629 -28.298 1.00 20.12  ? 21  VAL B CB    1 
ATOM   2047 C  CG1   . VAL B 1 21  ? -19.228 16.129 -27.352 1.00 18.22  ? 21  VAL B CG1   1 
ATOM   2048 C  CG2   . VAL B 1 21  ? -17.982 18.114 -28.165 1.00 11.49  ? 21  VAL B CG2   1 
ATOM   2049 N  N     . ASN B 1 22  ? -17.341 13.820 -29.055 1.00 19.48  ? 22  ASN B N     1 
ATOM   2050 C  CA    . ASN B 1 22  ? -17.637 12.403 -29.052 1.00 25.19  ? 22  ASN B CA    1 
ATOM   2051 C  C     . ASN B 1 22  ? -16.418 11.602 -28.635 1.00 23.79  ? 22  ASN B C     1 
ATOM   2052 O  O     . ASN B 1 22  ? -16.538 10.584 -27.968 1.00 30.35  ? 22  ASN B O     1 
ATOM   2053 C  CB    . ASN B 1 22  ? -18.165 11.960 -30.417 1.00 16.84  ? 22  ASN B CB    1 
ATOM   2054 C  CG    . ASN B 1 22  ? -19.641 12.319 -30.604 1.00 33.35  ? 22  ASN B CG    1 
ATOM   2055 O  OD1   . ASN B 1 22  ? -20.383 12.440 -29.622 1.00 47.13  ? 22  ASN B OD1   1 
ATOM   2056 N  ND2   . ASN B 1 22  ? -20.071 12.490 -31.856 1.00 19.22  ? 22  ASN B ND2   1 
ATOM   2057 N  N     . SER B 1 23  ? -15.237 12.087 -28.977 1.00 15.94  ? 23  SER B N     1 
ATOM   2058 C  CA    . SER B 1 23  ? -14.027 11.394 -28.570 1.00 25.97  ? 23  SER B CA    1 
ATOM   2059 C  C     . SER B 1 23  ? -13.831 11.476 -27.054 1.00 33.65  ? 23  SER B C     1 
ATOM   2060 O  O     . SER B 1 23  ? -13.332 10.548 -26.431 1.00 24.47  ? 23  SER B O     1 
ATOM   2061 C  CB    . SER B 1 23  ? -12.810 11.964 -29.298 1.00 14.05  ? 23  SER B CB    1 
ATOM   2062 O  OG    . SER B 1 23  ? -11.656 11.184 -29.041 1.00 43.49  ? 23  SER B OG    1 
ATOM   2063 N  N     . ALA B 1 24  ? -14.227 12.592 -26.459 1.00 41.73  ? 24  ALA B N     1 
ATOM   2064 C  CA    . ALA B 1 24  ? -14.095 12.744 -25.017 1.00 31.01  ? 24  ALA B CA    1 
ATOM   2065 C  C     . ALA B 1 24  ? -14.975 11.734 -24.288 1.00 42.76  ? 24  ALA B C     1 
ATOM   2066 O  O     . ALA B 1 24  ? -14.483 10.957 -23.459 1.00 34.86  ? 24  ALA B O     1 
ATOM   2067 C  CB    . ALA B 1 24  ? -14.452 14.155 -24.598 1.00 28.10  ? 24  ALA B CB    1 
ATOM   2068 N  N     . LEU B 1 25  ? -16.269 11.748 -24.618 1.00 32.71  ? 25  LEU B N     1 
ATOM   2069 C  CA    . LEU B 1 25  ? -17.257 10.840 -24.032 1.00 22.93  ? 25  LEU B CA    1 
ATOM   2070 C  C     . LEU B 1 25  ? -16.830 9.390  -24.137 1.00 21.84  ? 25  LEU B C     1 
ATOM   2071 O  O     . LEU B 1 25  ? -16.927 8.635  -23.180 1.00 50.78  ? 25  LEU B O     1 
ATOM   2072 C  CB    . LEU B 1 25  ? -18.608 11.025 -24.705 1.00 10.84  ? 25  LEU B CB    1 
ATOM   2073 C  CG    . LEU B 1 25  ? -19.063 12.488 -24.692 1.00 35.09  ? 25  LEU B CG    1 
ATOM   2074 C  CD1   . LEU B 1 25  ? -20.460 12.681 -25.303 1.00 14.65  ? 25  LEU B CD1   1 
ATOM   2075 C  CD2   . LEU B 1 25  ? -18.989 13.062 -23.267 1.00 32.55  ? 25  LEU B CD2   1 
ATOM   2076 N  N     . LEU B 1 26  ? -16.317 9.016  -25.296 1.00 30.05  ? 26  LEU B N     1 
ATOM   2077 C  CA    . LEU B 1 26  ? -15.905 7.642  -25.522 1.00 40.39  ? 26  LEU B CA    1 
ATOM   2078 C  C     . LEU B 1 26  ? -14.579 7.311  -24.835 1.00 20.01  ? 26  LEU B C     1 
ATOM   2079 O  O     . LEU B 1 26  ? -14.423 6.216  -24.313 1.00 42.03  ? 26  LEU B O     1 
ATOM   2080 C  CB    . LEU B 1 26  ? -15.825 7.355  -27.031 1.00 48.93  ? 26  LEU B CB    1 
ATOM   2081 C  CG    . LEU B 1 26  ? -17.112 6.884  -27.744 1.00 62.31  ? 26  LEU B CG    1 
ATOM   2082 C  CD1   . LEU B 1 26  ? -18.416 7.529  -27.217 1.00 44.24  ? 26  LEU B CD1   1 
ATOM   2083 C  CD2   . LEU B 1 26  ? -16.992 7.130  -29.246 1.00 72.17  ? 26  LEU B CD2   1 
ATOM   2084 N  N     . GLU B 1 27  ? -13.628 8.239  -24.814 1.00 42.23  ? 27  GLU B N     1 
ATOM   2085 C  CA    . GLU B 1 27  ? -12.337 7.952  -24.181 1.00 41.91  ? 27  GLU B CA    1 
ATOM   2086 C  C     . GLU B 1 27  ? -12.431 8.143  -22.684 1.00 33.06  ? 27  GLU B C     1 
ATOM   2087 O  O     . GLU B 1 27  ? -11.461 7.907  -21.967 1.00 20.76  ? 27  GLU B O     1 
ATOM   2088 C  CB    . GLU B 1 27  ? -11.213 8.834  -24.726 1.00 23.02  ? 27  GLU B CB    1 
ATOM   2089 C  CG    . GLU B 1 27  ? -10.873 8.612  -26.177 1.00 52.43  ? 27  GLU B CG    1 
ATOM   2090 C  CD    . GLU B 1 27  ? -9.794  9.559  -26.655 1.00 69.48  ? 27  GLU B CD    1 
ATOM   2091 O  OE1   . GLU B 1 27  ? -8.927  9.915  -25.832 1.00 34.55  ? 27  GLU B OE1   1 
ATOM   2092 O  OE2   . GLU B 1 27  ? -9.811  9.945  -27.845 1.00 91.79  ? 27  GLU B OE2   1 
ATOM   2093 N  N     . GLU B 1 28  ? -13.603 8.566  -22.221 1.00 36.84  ? 28  GLU B N     1 
ATOM   2094 C  CA    . GLU B 1 28  ? -13.821 8.796  -20.802 1.00 49.56  ? 28  GLU B CA    1 
ATOM   2095 C  C     . GLU B 1 28  ? -12.720 9.708  -20.245 1.00 51.67  ? 28  GLU B C     1 
ATOM   2096 O  O     . GLU B 1 28  ? -11.843 9.285  -19.481 1.00 26.47  ? 28  GLU B O     1 
ATOM   2097 C  CB    . GLU B 1 28  ? -13.891 7.467  -20.054 1.00 51.72  ? 28  GLU B CB    1 
ATOM   2098 C  CG    . GLU B 1 28  ? -15.309 6.923  -19.958 1.00 55.02  ? 28  GLU B CG    1 
ATOM   2099 C  CD    . GLU B 1 28  ? -15.580 6.275  -18.614 1.00 107.26 ? 28  GLU B CD    1 
ATOM   2100 O  OE1   . GLU B 1 28  ? -14.634 5.661  -18.074 1.00 101.98 ? 28  GLU B OE1   1 
ATOM   2101 O  OE2   . GLU B 1 28  ? -16.721 6.390  -18.096 1.00 68.02  ? 28  GLU B OE2   1 
ATOM   2102 N  N     . ALA B 1 29  ? -12.768 10.958 -20.692 1.00 53.45  ? 29  ALA B N     1 
ATOM   2103 C  CA    . ALA B 1 29  ? -11.822 11.987 -20.306 1.00 25.73  ? 29  ALA B CA    1 
ATOM   2104 C  C     . ALA B 1 29  ? -12.602 13.263 -20.020 1.00 26.53  ? 29  ALA B C     1 
ATOM   2105 O  O     . ALA B 1 29  ? -13.825 13.298 -20.168 1.00 33.97  ? 29  ALA B O     1 
ATOM   2106 C  CB    . ALA B 1 29  ? -10.797 12.211 -21.405 1.00 16.83  ? 29  ALA B CB    1 
ATOM   2107 N  N     . MET B 1 30  ? -11.906 14.320 -19.630 1.00 13.01  ? 30  MET B N     1 
ATOM   2108 C  CA    . MET B 1 30  ? -12.598 15.538 -19.277 1.00 9.68   ? 30  MET B CA    1 
ATOM   2109 C  C     . MET B 1 30  ? -12.758 16.451 -20.471 1.00 18.84  ? 30  MET B C     1 
ATOM   2110 O  O     . MET B 1 30  ? -11.790 16.926 -21.066 1.00 43.10  ? 30  MET B O     1 
ATOM   2111 C  CB    . MET B 1 30  ? -11.869 16.256 -18.155 1.00 17.13  ? 30  MET B CB    1 
ATOM   2112 C  CG    . MET B 1 30  ? -11.484 15.342 -17.010 1.00 23.60  ? 30  MET B CG    1 
ATOM   2113 S  SD    . MET B 1 30  ? -11.164 16.266 -15.509 1.00 39.58  ? 30  MET B SD    1 
ATOM   2114 C  CE    . MET B 1 30  ? -12.798 16.892 -15.150 1.00 27.23  ? 30  MET B CE    1 
ATOM   2115 N  N     . LEU B 1 31  ? -14.009 16.695 -20.804 1.00 19.85  ? 31  LEU B N     1 
ATOM   2116 C  CA    . LEU B 1 31  ? -14.375 17.674 -21.799 1.00 12.51  ? 31  LEU B CA    1 
ATOM   2117 C  C     . LEU B 1 31  ? -14.475 19.064 -21.174 1.00 12.86  ? 31  LEU B C     1 
ATOM   2118 O  O     . LEU B 1 31  ? -15.267 19.278 -20.269 1.00 20.89  ? 31  LEU B O     1 
ATOM   2119 C  CB    . LEU B 1 31  ? -15.713 17.290 -22.424 1.00 10.71  ? 31  LEU B CB    1 
ATOM   2120 C  CG    . LEU B 1 31  ? -16.160 18.218 -23.537 1.00 14.65  ? 31  LEU B CG    1 
ATOM   2121 C  CD1   . LEU B 1 31  ? -15.309 17.928 -24.743 1.00 19.77  ? 31  LEU B CD1   1 
ATOM   2122 C  CD2   . LEU B 1 31  ? -17.638 18.072 -23.852 1.00 12.99  ? 31  LEU B CD2   1 
ATOM   2123 N  N     . THR B 1 32  ? -13.686 20.012 -21.654 1.00 12.91  ? 32  THR B N     1 
ATOM   2124 C  CA    . THR B 1 32  ? -13.894 21.408 -21.285 1.00 14.06  ? 32  THR B CA    1 
ATOM   2125 C  C     . THR B 1 32  ? -14.306 22.227 -22.519 1.00 9.16   ? 32  THR B C     1 
ATOM   2126 O  O     . THR B 1 32  ? -13.786 22.005 -23.595 1.00 14.44  ? 32  THR B O     1 
ATOM   2127 C  CB    . THR B 1 32  ? -12.623 21.987 -20.663 1.00 29.64  ? 32  THR B CB    1 
ATOM   2128 O  OG1   . THR B 1 32  ? -12.055 21.015 -19.780 1.00 28.96  ? 32  THR B OG1   1 
ATOM   2129 C  CG2   . THR B 1 32  ? -12.911 23.275 -19.902 1.00 16.28  ? 32  THR B CG2   1 
ATOM   2130 N  N     . ILE B 1 33  ? -15.244 23.157 -22.370 1.00 21.00  ? 33  ILE B N     1 
ATOM   2131 C  CA    . ILE B 1 33  ? -15.681 24.024 -23.481 1.00 22.84  ? 33  ILE B CA    1 
ATOM   2132 C  C     . ILE B 1 33  ? -15.919 25.473 -23.032 1.00 30.63  ? 33  ILE B C     1 
ATOM   2133 O  O     . ILE B 1 33  ? -16.506 25.694 -21.968 1.00 24.96  ? 33  ILE B O     1 
ATOM   2134 C  CB    . ILE B 1 33  ? -16.993 23.525 -24.116 1.00 18.85  ? 33  ILE B CB    1 
ATOM   2135 C  CG1   . ILE B 1 33  ? -16.790 22.233 -24.904 1.00 12.07  ? 33  ILE B CG1   1 
ATOM   2136 C  CG2   . ILE B 1 33  ? -17.601 24.589 -25.017 1.00 7.51   ? 33  ILE B CG2   1 
ATOM   2137 C  CD1   . ILE B 1 33  ? -18.124 21.618 -25.338 1.00 3.21   ? 33  ILE B CD1   1 
ATOM   2138 N  N     . PHE B 1 34  ? -15.474 26.457 -23.820 1.00 12.81  ? 34  PHE B N     1 
ATOM   2139 C  CA    . PHE B 1 34  ? -15.855 27.847 -23.552 1.00 12.06  ? 34  PHE B CA    1 
ATOM   2140 C  C     . PHE B 1 34  ? -16.769 28.283 -24.670 1.00 15.74  ? 34  PHE B C     1 
ATOM   2141 O  O     . PHE B 1 34  ? -16.384 28.201 -25.835 1.00 25.73  ? 34  PHE B O     1 
ATOM   2142 C  CB    . PHE B 1 34  ? -14.658 28.799 -23.474 1.00 12.46  ? 34  PHE B CB    1 
ATOM   2143 C  CG    . PHE B 1 34  ? -13.518 28.325 -22.599 1.00 24.27  ? 34  PHE B CG    1 
ATOM   2144 C  CD1   . PHE B 1 34  ? -13.722 27.430 -21.559 1.00 29.74  ? 34  PHE B CD1   1 
ATOM   2145 C  CD2   . PHE B 1 34  ? -12.228 28.799 -22.825 1.00 18.34  ? 34  PHE B CD2   1 
ATOM   2146 C  CE1   . PHE B 1 34  ? -12.664 27.011 -20.770 1.00 25.97  ? 34  PHE B CE1   1 
ATOM   2147 C  CE2   . PHE B 1 34  ? -11.172 28.391 -22.040 1.00 17.41  ? 34  PHE B CE2   1 
ATOM   2148 C  CZ    . PHE B 1 34  ? -11.386 27.496 -21.008 1.00 20.07  ? 34  PHE B CZ    1 
ATOM   2149 N  N     . ALA B 1 35  ? -17.980 28.729 -24.340 1.00 13.37  ? 35  ALA B N     1 
ATOM   2150 C  CA    . ALA B 1 35  ? -18.963 29.012 -25.382 1.00 10.65  ? 35  ALA B CA    1 
ATOM   2151 C  C     . ALA B 1 35  ? -20.035 30.021 -24.989 1.00 16.89  ? 35  ALA B C     1 
ATOM   2152 O  O     . ALA B 1 35  ? -20.358 30.157 -23.818 1.00 21.25  ? 35  ALA B O     1 
ATOM   2153 C  CB    . ALA B 1 35  ? -19.618 27.716 -25.817 1.00 5.48   ? 35  ALA B CB    1 
ATOM   2154 N  N     . ARG B 1 36  ? -20.584 30.724 -25.979 1.00 15.09  ? 36  ARG B N     1 
ATOM   2155 C  CA    . ARG B 1 36  ? -21.833 31.453 -25.794 1.00 14.88  ? 36  ARG B CA    1 
ATOM   2156 C  C     . ARG B 1 36  ? -22.951 30.422 -25.818 1.00 23.06  ? 36  ARG B C     1 
ATOM   2157 O  O     . ARG B 1 36  ? -23.065 29.665 -26.768 1.00 15.10  ? 36  ARG B O     1 
ATOM   2158 C  CB    . ARG B 1 36  ? -22.056 32.498 -26.887 1.00 13.86  ? 36  ARG B CB    1 
ATOM   2159 C  CG    . ARG B 1 36  ? -23.131 33.551 -26.560 1.00 30.25  ? 36  ARG B CG    1 
ATOM   2160 C  CD    . ARG B 1 36  ? -23.821 34.158 -27.810 1.00 26.04  ? 36  ARG B CD    1 
ATOM   2161 N  NE    . ARG B 1 36  ? -22.928 34.230 -28.960 1.00 50.16  ? 36  ARG B NE    1 
ATOM   2162 C  CZ    . ARG B 1 36  ? -22.100 35.239 -29.209 1.00 72.14  ? 36  ARG B CZ    1 
ATOM   2163 N  NH1   . ARG B 1 36  ? -21.316 35.203 -30.278 1.00 53.13  ? 36  ARG B NH1   1 
ATOM   2164 N  NH2   . ARG B 1 36  ? -22.050 36.282 -28.389 1.00 93.26  ? 36  ARG B NH2   1 
ATOM   2165 N  N     . CYS B 1 37  ? -23.772 30.366 -24.778 1.00 28.52  ? 37  CYS B N     1 
ATOM   2166 C  CA    . CYS B 1 37  ? -24.814 29.355 -24.761 1.00 19.66  ? 37  CYS B CA    1 
ATOM   2167 C  C     . CYS B 1 37  ? -26.092 29.815 -24.110 1.00 25.96  ? 37  CYS B C     1 
ATOM   2168 O  O     . CYS B 1 37  ? -26.154 30.908 -23.544 1.00 18.64  ? 37  CYS B O     1 
ATOM   2169 C  CB    . CYS B 1 37  ? -24.317 28.107 -24.043 1.00 26.88  ? 37  CYS B CB    1 
ATOM   2170 S  SG    . CYS B 1 37  ? -23.514 28.444 -22.481 1.00 24.25  ? 37  CYS B SG    1 
ATOM   2171 N  N     . LYS B 1 38  ? -27.096 28.942 -24.198 1.00 17.23  ? 38  LYS B N     1 
ATOM   2172 C  CA    . LYS B 1 38  ? -28.380 29.097 -23.526 1.00 10.41  ? 38  LYS B CA    1 
ATOM   2173 C  C     . LYS B 1 38  ? -28.630 27.758 -22.866 1.00 17.32  ? 38  LYS B C     1 
ATOM   2174 O  O     . LYS B 1 38  ? -28.281 26.722 -23.437 1.00 18.60  ? 38  LYS B O     1 
ATOM   2175 C  CB    . LYS B 1 38  ? -29.509 29.472 -24.496 1.00 10.40  ? 38  LYS B CB    1 
ATOM   2176 C  CG    . LYS B 1 38  ? -29.256 30.757 -25.283 1.00 27.98  ? 38  LYS B CG    1 
ATOM   2177 C  CD    . LYS B 1 38  ? -30.545 31.496 -25.663 1.00 41.34  ? 38  LYS B CD    1 
ATOM   2178 C  CE    . LYS B 1 38  ? -31.303 30.817 -26.802 1.00 48.95  ? 38  LYS B CE    1 
ATOM   2179 N  NZ    . LYS B 1 38  ? -32.448 31.651 -27.279 1.00 37.52  ? 38  LYS B NZ    1 
ATOM   2180 N  N     . VAL B 1 39  ? -29.175 27.769 -21.647 1.00 19.75  ? 39  VAL B N     1 
ATOM   2181 C  CA    . VAL B 1 39  ? -29.338 26.528 -20.892 1.00 8.23   ? 39  VAL B CA    1 
ATOM   2182 C  C     . VAL B 1 39  ? -30.780 26.289 -20.521 1.00 15.50  ? 39  VAL B C     1 
ATOM   2183 O  O     . VAL B 1 39  ? -31.509 27.234 -20.197 1.00 32.40  ? 39  VAL B O     1 
ATOM   2184 C  CB    . VAL B 1 39  ? -28.505 26.512 -19.611 1.00 9.82   ? 39  VAL B CB    1 
ATOM   2185 C  CG1   . VAL B 1 39  ? -28.384 25.078 -19.113 1.00 15.71  ? 39  VAL B CG1   1 
ATOM   2186 C  CG2   . VAL B 1 39  ? -27.125 27.112 -19.852 1.00 6.74   ? 39  VAL B CG2   1 
ATOM   2187 N  N     . HIS B 1 40  ? -31.189 25.020 -20.588 1.00 15.42  ? 40  HIS B N     1 
ATOM   2188 C  CA    . HIS B 1 40  ? -32.552 24.620 -20.251 1.00 4.50   ? 40  HIS B CA    1 
ATOM   2189 C  C     . HIS B 1 40  ? -32.465 23.409 -19.320 1.00 25.22  ? 40  HIS B C     1 
ATOM   2190 O  O     . HIS B 1 40  ? -31.865 22.374 -19.658 1.00 20.58  ? 40  HIS B O     1 
ATOM   2191 C  CB    . HIS B 1 40  ? -33.364 24.325 -21.513 1.00 12.89  ? 40  HIS B CB    1 
ATOM   2192 C  CG    . HIS B 1 40  ? -33.162 25.336 -22.611 1.00 61.04  ? 40  HIS B CG    1 
ATOM   2193 N  ND1   . HIS B 1 40  ? -33.854 26.526 -22.666 1.00 35.44  ? 40  HIS B ND1   1 
ATOM   2194 C  CD2   . HIS B 1 40  ? -32.332 25.330 -23.685 1.00 49.88  ? 40  HIS B CD2   1 
ATOM   2195 C  CE1   . HIS B 1 40  ? -33.459 27.214 -23.729 1.00 43.62  ? 40  HIS B CE1   1 
ATOM   2196 N  NE2   . HIS B 1 40  ? -32.536 26.515 -24.358 1.00 35.32  ? 40  HIS B NE2   1 
ATOM   2197 N  N     . TYR B 1 41  ? -33.016 23.573 -18.118 1.00 18.77  ? 41  TYR B N     1 
ATOM   2198 C  CA    . TYR B 1 41  ? -32.979 22.530 -17.103 1.00 17.93  ? 41  TYR B CA    1 
ATOM   2199 C  C     . TYR B 1 41  ? -34.388 22.177 -16.660 1.00 24.06  ? 41  TYR B C     1 
ATOM   2200 O  O     . TYR B 1 41  ? -35.193 23.073 -16.380 1.00 19.45  ? 41  TYR B O     1 
ATOM   2201 C  CB    . TYR B 1 41  ? -32.134 22.960 -15.891 1.00 29.67  ? 41  TYR B CB    1 
ATOM   2202 C  CG    . TYR B 1 41  ? -32.499 22.213 -14.632 1.00 16.63  ? 41  TYR B CG    1 
ATOM   2203 C  CD1   . TYR B 1 41  ? -32.141 20.879 -14.462 1.00 16.38  ? 41  TYR B CD1   1 
ATOM   2204 C  CD2   . TYR B 1 41  ? -33.235 22.828 -13.633 1.00 18.40  ? 41  TYR B CD2   1 
ATOM   2205 C  CE1   . TYR B 1 41  ? -32.495 20.181 -13.325 1.00 21.18  ? 41  TYR B CE1   1 
ATOM   2206 C  CE2   . TYR B 1 41  ? -33.596 22.139 -12.489 1.00 26.36  ? 41  TYR B CE2   1 
ATOM   2207 C  CZ    . TYR B 1 41  ? -33.230 20.814 -12.339 1.00 22.94  ? 41  TYR B CZ    1 
ATOM   2208 O  OH    . TYR B 1 41  ? -33.586 20.130 -11.196 1.00 12.34  ? 41  TYR B OH    1 
ATOM   2209 N  N     . ASP B 1 42  ? -34.687 20.874 -16.636 1.00 19.80  ? 42  ASP B N     1 
ATOM   2210 C  CA    . ASP B 1 42  ? -35.952 20.372 -16.102 1.00 17.48  ? 42  ASP B CA    1 
ATOM   2211 C  C     . ASP B 1 42  ? -35.712 19.076 -15.393 1.00 20.51  ? 42  ASP B C     1 
ATOM   2212 O  O     . ASP B 1 42  ? -35.057 18.184 -15.921 1.00 41.41  ? 42  ASP B O     1 
ATOM   2213 C  CB    . ASP B 1 42  ? -37.007 20.168 -17.180 1.00 9.87   ? 42  ASP B CB    1 
ATOM   2214 C  CG    . ASP B 1 42  ? -38.417 20.344 -16.643 1.00 43.46  ? 42  ASP B CG    1 
ATOM   2215 O  OD1   . ASP B 1 42  ? -38.653 20.025 -15.451 1.00 39.62  ? 42  ASP B OD1   1 
ATOM   2216 O  OD2   . ASP B 1 42  ? -39.288 20.816 -17.407 1.00 53.43  ? 42  ASP B OD2   1 
ATOM   2217 N  N     . GLY B 1 43  ? -36.307 18.961 -14.215 1.00 20.01  ? 43  GLY B N     1 
ATOM   2218 C  CA    . GLY B 1 43  ? -35.855 18.025 -13.208 1.00 17.74  ? 43  GLY B CA    1 
ATOM   2219 C  C     . GLY B 1 43  ? -36.577 18.415 -11.946 1.00 12.90  ? 43  GLY B C     1 
ATOM   2220 O  O     . GLY B 1 43  ? -37.702 18.912 -12.026 1.00 8.73   ? 43  GLY B O     1 
ATOM   2221 N  N     . ARG B 1 44  ? -35.950 18.175 -10.797 1.00 6.48   ? 44  ARG B N     1 
ATOM   2222 C  CA    . ARG B 1 44  ? -36.553 18.482 -9.503  1.00 6.93   ? 44  ARG B CA    1 
ATOM   2223 C  C     . ARG B 1 44  ? -37.142 19.882 -9.507  1.00 7.69   ? 44  ARG B C     1 
ATOM   2224 O  O     . ARG B 1 44  ? -38.313 20.062 -9.227  1.00 27.16  ? 44  ARG B O     1 
ATOM   2225 C  CB    . ARG B 1 44  ? -35.516 18.329 -8.400  1.00 18.57  ? 44  ARG B CB    1 
ATOM   2226 C  CG    . ARG B 1 44  ? -34.851 16.953 -8.390  1.00 5.10   ? 44  ARG B CG    1 
ATOM   2227 C  CD    . ARG B 1 44  ? -33.626 16.930 -7.503  1.00 4.99   ? 44  ARG B CD    1 
ATOM   2228 N  NE    . ARG B 1 44  ? -32.419 17.390 -8.176  1.00 14.38  ? 44  ARG B NE    1 
ATOM   2229 C  CZ    . ARG B 1 44  ? -31.209 17.399 -7.619  1.00 22.24  ? 44  ARG B CZ    1 
ATOM   2230 N  NH1   . ARG B 1 44  ? -31.047 16.990 -6.371  1.00 14.94  ? 44  ARG B NH1   1 
ATOM   2231 N  NH2   . ARG B 1 44  ? -30.154 17.815 -8.309  1.00 18.21  ? 44  ARG B NH2   1 
ATOM   2232 N  N     . ALA B 1 45  ? -36.340 20.870 -9.863  1.00 12.51  ? 45  ALA B N     1 
ATOM   2233 C  CA    . ALA B 1 45  ? -36.860 22.186 -10.246 1.00 14.08  ? 45  ALA B CA    1 
ATOM   2234 C  C     . ALA B 1 45  ? -36.760 22.413 -11.767 1.00 15.50  ? 45  ALA B C     1 
ATOM   2235 O  O     . ALA B 1 45  ? -36.451 21.497 -12.526 1.00 18.70  ? 45  ALA B O     1 
ATOM   2236 C  CB    . ALA B 1 45  ? -36.135 23.279 -9.495  1.00 15.49  ? 45  ALA B CB    1 
ATOM   2237 N  N     . LYS B 1 46  ? -37.045 23.631 -12.209 1.00 17.12  ? 46  LYS B N     1 
ATOM   2238 C  CA    . LYS B 1 46  ? -36.980 23.987 -13.632 1.00 18.68  ? 46  LYS B CA    1 
ATOM   2239 C  C     . LYS B 1 46  ? -36.310 25.358 -13.798 1.00 24.96  ? 46  LYS B C     1 
ATOM   2240 O  O     . LYS B 1 46  ? -36.618 26.290 -13.041 1.00 20.46  ? 46  LYS B O     1 
ATOM   2241 C  CB    . LYS B 1 46  ? -38.395 23.975 -14.234 1.00 18.99  ? 46  LYS B CB    1 
ATOM   2242 C  CG    . LYS B 1 46  ? -38.511 24.324 -15.706 1.00 26.18  ? 46  LYS B CG    1 
ATOM   2243 C  CD    . LYS B 1 46  ? -39.790 23.732 -16.309 1.00 27.55  ? 46  LYS B CD    1 
ATOM   2244 C  CE    . LYS B 1 46  ? -40.315 24.532 -17.514 1.00 23.61  ? 46  LYS B CE    1 
ATOM   2245 N  NZ    . LYS B 1 46  ? -40.920 25.850 -17.120 1.00 51.66  ? 46  LYS B NZ    1 
ATOM   2246 N  N     . SER B 1 47  ? -35.377 25.484 -14.750 1.00 23.04  ? 47  SER B N     1 
ATOM   2247 C  CA    . SER B 1 47  ? -34.651 26.752 -14.904 1.00 21.84  ? 47  SER B CA    1 
ATOM   2248 C  C     . SER B 1 47  ? -34.369 27.102 -16.360 1.00 21.01  ? 47  SER B C     1 
ATOM   2249 O  O     . SER B 1 47  ? -34.335 26.229 -17.216 1.00 19.35  ? 47  SER B O     1 
ATOM   2250 C  CB    . SER B 1 47  ? -33.310 26.735 -14.138 1.00 25.42  ? 47  SER B CB    1 
ATOM   2251 O  OG    . SER B 1 47  ? -32.229 26.251 -14.926 1.00 29.58  ? 47  SER B OG    1 
ATOM   2252 N  N     . GLU B 1 48  ? -34.145 28.392 -16.604 1.00 25.60  ? 48  GLU B N     1 
ATOM   2253 C  CA    . GLU B 1 48  ? -33.797 28.936 -17.915 1.00 12.69  ? 48  GLU B CA    1 
ATOM   2254 C  C     . GLU B 1 48  ? -32.632 29.923 -17.805 1.00 31.00  ? 48  GLU B C     1 
ATOM   2255 O  O     . GLU B 1 48  ? -32.628 30.799 -16.929 1.00 21.26  ? 48  GLU B O     1 
ATOM   2256 C  CB    . GLU B 1 48  ? -35.001 29.648 -18.544 1.00 21.52  ? 48  GLU B CB    1 
ATOM   2257 C  CG    . GLU B 1 48  ? -35.976 28.753 -19.303 1.00 33.06  ? 48  GLU B CG    1 
ATOM   2258 C  CD    . GLU B 1 48  ? -35.300 27.963 -20.416 1.00 68.62  ? 48  GLU B CD    1 
ATOM   2259 O  OE1   . GLU B 1 48  ? -34.723 28.585 -21.332 1.00 83.39  ? 48  GLU B OE1   1 
ATOM   2260 O  OE2   . GLU B 1 48  ? -35.333 26.715 -20.374 1.00 67.16  ? 48  GLU B OE2   1 
ATOM   2261 N  N     . LEU B 1 49  ? -31.651 29.802 -18.695 1.00 35.20  ? 49  LEU B N     1 
ATOM   2262 C  CA    . LEU B 1 49  ? -30.533 30.751 -18.703 1.00 20.40  ? 49  LEU B CA    1 
ATOM   2263 C  C     . LEU B 1 49  ? -30.255 31.304 -20.095 1.00 21.21  ? 49  LEU B C     1 
ATOM   2264 O  O     . LEU B 1 49  ? -29.856 30.567 -20.995 1.00 38.22  ? 49  LEU B O     1 
ATOM   2265 C  CB    . LEU B 1 49  ? -29.261 30.107 -18.149 1.00 8.93   ? 49  LEU B CB    1 
ATOM   2266 C  CG    . LEU B 1 49  ? -28.156 31.128 -17.896 1.00 15.86  ? 49  LEU B CG    1 
ATOM   2267 C  CD1   . LEU B 1 49  ? -28.660 32.239 -16.981 1.00 13.13  ? 49  LEU B CD1   1 
ATOM   2268 C  CD2   . LEU B 1 49  ? -26.907 30.486 -17.334 1.00 6.93   ? 49  LEU B CD2   1 
ATOM   2269 N  N     . GLY B 1 50  ? -30.444 32.615 -20.248 1.00 26.66  ? 50  GLY B N     1 
ATOM   2270 C  CA    . GLY B 1 50  ? -30.263 33.284 -21.524 1.00 16.00  ? 50  GLY B CA    1 
ATOM   2271 C  C     . GLY B 1 50  ? -28.838 33.279 -22.054 1.00 21.76  ? 50  GLY B C     1 
ATOM   2272 O  O     . GLY B 1 50  ? -27.900 32.843 -21.390 1.00 13.16  ? 50  GLY B O     1 
ATOM   2273 N  N     . SER B 1 51  ? -28.681 33.790 -23.266 1.00 30.07  ? 51  SER B N     1 
ATOM   2274 C  CA    . SER B 1 51  ? -27.403 33.764 -23.963 1.00 26.65  ? 51  SER B CA    1 
ATOM   2275 C  C     . SER B 1 51  ? -26.259 34.445 -23.193 1.00 22.49  ? 51  SER B C     1 
ATOM   2276 O  O     . SER B 1 51  ? -26.403 35.582 -22.742 1.00 24.50  ? 51  SER B O     1 
ATOM   2277 C  CB    . SER B 1 51  ? -27.574 34.423 -25.329 1.00 23.45  ? 51  SER B CB    1 
ATOM   2278 O  OG    . SER B 1 51  ? -26.490 34.131 -26.180 1.00 32.85  ? 51  SER B OG    1 
ATOM   2279 N  N     . GLY B 1 52  ? -25.126 33.750 -23.055 1.00 11.43  ? 52  GLY B N     1 
ATOM   2280 C  CA    . GLY B 1 52  ? -23.929 34.339 -22.473 1.00 5.97   ? 52  GLY B CA    1 
ATOM   2281 C  C     . GLY B 1 52  ? -22.752 33.382 -22.443 1.00 15.20  ? 52  GLY B C     1 
ATOM   2282 O  O     . GLY B 1 52  ? -22.921 32.179 -22.643 1.00 13.35  ? 52  GLY B O     1 
ATOM   2283 N  N     . ASP B 1 53  ? -21.553 33.899 -22.181 1.00 16.72  ? 53  ASP B N     1 
ATOM   2284 C  CA    . ASP B 1 53  ? -20.358 33.051 -22.218 1.00 24.97  ? 53  ASP B CA    1 
ATOM   2285 C  C     . ASP B 1 53  ? -20.152 32.346 -20.900 1.00 17.39  ? 53  ASP B C     1 
ATOM   2286 O  O     . ASP B 1 53  ? -20.090 32.994 -19.862 1.00 27.27  ? 53  ASP B O     1 
ATOM   2287 C  CB    . ASP B 1 53  ? -19.092 33.852 -22.547 1.00 24.72  ? 53  ASP B CB    1 
ATOM   2288 C  CG    . ASP B 1 53  ? -19.243 34.743 -23.773 1.00 29.80  ? 53  ASP B CG    1 
ATOM   2289 O  OD1   . ASP B 1 53  ? -19.895 34.356 -24.778 1.00 24.74  ? 53  ASP B OD1   1 
ATOM   2290 O  OD2   . ASP B 1 53  ? -18.663 35.839 -23.731 1.00 33.47  ? 53  ASP B OD2   1 
ATOM   2291 N  N     . ARG B 1 54  ? -20.020 31.025 -20.936 1.00 10.89  ? 54  ARG B N     1 
ATOM   2292 C  CA    . ARG B 1 54  ? -19.811 30.256 -19.716 1.00 7.44   ? 54  ARG B CA    1 
ATOM   2293 C  C     . ARG B 1 54  ? -18.742 29.209 -19.949 1.00 10.14  ? 54  ARG B C     1 
ATOM   2294 O  O     . ARG B 1 54  ? -18.332 29.001 -21.079 1.00 13.95  ? 54  ARG B O     1 
ATOM   2295 C  CB    . ARG B 1 54  ? -21.115 29.613 -19.267 1.00 4.54   ? 54  ARG B CB    1 
ATOM   2296 C  CG    . ARG B 1 54  ? -22.110 30.618 -18.757 1.00 5.26   ? 54  ARG B CG    1 
ATOM   2297 C  CD    . ARG B 1 54  ? -23.299 30.762 -19.665 1.00 10.76  ? 54  ARG B CD    1 
ATOM   2298 N  NE    . ARG B 1 54  ? -24.031 31.988 -19.369 1.00 23.97  ? 54  ARG B NE    1 
ATOM   2299 C  CZ    . ARG B 1 54  ? -25.231 32.277 -19.863 1.00 19.06  ? 54  ARG B CZ    1 
ATOM   2300 N  NH1   . ARG B 1 54  ? -25.820 31.420 -20.675 1.00 35.21  ? 54  ARG B NH1   1 
ATOM   2301 N  NH2   . ARG B 1 54  ? -25.845 33.411 -19.559 1.00 50.78  ? 54  ARG B NH2   1 
ATOM   2302 N  N     . VAL B 1 55  ? -18.247 28.599 -18.879 1.00 18.77  ? 55  VAL B N     1 
ATOM   2303 C  CA    . VAL B 1 55  ? -17.381 27.434 -19.003 1.00 17.94  ? 55  VAL B CA    1 
ATOM   2304 C  C     . VAL B 1 55  ? -18.249 26.196 -18.807 1.00 20.23  ? 55  VAL B C     1 
ATOM   2305 O  O     . VAL B 1 55  ? -19.231 26.221 -18.064 1.00 19.76  ? 55  VAL B O     1 
ATOM   2306 C  CB    . VAL B 1 55  ? -16.221 27.459 -17.993 1.00 11.48  ? 55  VAL B CB    1 
ATOM   2307 C  CG1   . VAL B 1 55  ? -15.431 26.143 -18.004 1.00 16.18  ? 55  VAL B CG1   1 
ATOM   2308 C  CG2   . VAL B 1 55  ? -15.319 28.636 -18.269 1.00 11.44  ? 55  VAL B CG2   1 
ATOM   2309 N  N     . ILE B 1 56  ? -17.922 25.128 -19.516 1.00 19.81  ? 56  ILE B N     1 
ATOM   2310 C  CA    . ILE B 1 56  ? -18.692 23.903 -19.443 1.00 9.81   ? 56  ILE B CA    1 
ATOM   2311 C  C     . ILE B 1 56  ? -17.743 22.744 -19.264 1.00 19.11  ? 56  ILE B C     1 
ATOM   2312 O  O     . ILE B 1 56  ? -16.755 22.616 -19.990 1.00 24.20  ? 56  ILE B O     1 
ATOM   2313 C  CB    . ILE B 1 56  ? -19.543 23.700 -20.695 1.00 11.30  ? 56  ILE B CB    1 
ATOM   2314 C  CG1   . ILE B 1 56  ? -20.582 24.820 -20.788 1.00 16.59  ? 56  ILE B CG1   1 
ATOM   2315 C  CG2   . ILE B 1 56  ? -20.208 22.355 -20.656 1.00 8.81   ? 56  ILE B CG2   1 
ATOM   2316 C  CD1   . ILE B 1 56  ? -21.154 25.042 -22.155 1.00 12.42  ? 56  ILE B CD1   1 
ATOM   2317 N  N     . ILE B 1 57  ? -18.021 21.914 -18.270 1.00 21.76  ? 57  ILE B N     1 
ATOM   2318 C  CA    . ILE B 1 57  ? -17.187 20.758 -18.011 1.00 7.78   ? 57  ILE B CA    1 
ATOM   2319 C  C     . ILE B 1 57  ? -18.028 19.499 -17.927 1.00 17.39  ? 57  ILE B C     1 
ATOM   2320 O  O     . ILE B 1 57  ? -19.094 19.494 -17.301 1.00 29.29  ? 57  ILE B O     1 
ATOM   2321 C  CB    . ILE B 1 57  ? -16.395 20.942 -16.742 1.00 4.80   ? 57  ILE B CB    1 
ATOM   2322 C  CG1   . ILE B 1 57  ? -15.379 22.050 -16.960 1.00 12.83  ? 57  ILE B CG1   1 
ATOM   2323 C  CG2   . ILE B 1 57  ? -15.664 19.669 -16.385 1.00 9.68   ? 57  ILE B CG2   1 
ATOM   2324 C  CD1   . ILE B 1 57  ? -14.745 22.555 -15.692 1.00 6.97   ? 57  ILE B CD1   1 
ATOM   2325 N  N     . VAL B 1 58  ? -17.570 18.452 -18.613 1.00 16.18  ? 58  VAL B N     1 
ATOM   2326 C  CA    . VAL B 1 58  ? -18.170 17.130 -18.521 1.00 15.56  ? 58  VAL B CA    1 
ATOM   2327 C  C     . VAL B 1 58  ? -17.121 16.135 -18.058 1.00 18.93  ? 58  VAL B C     1 
ATOM   2328 O  O     . VAL B 1 58  ? -16.163 15.860 -18.783 1.00 32.55  ? 58  VAL B O     1 
ATOM   2329 C  CB    . VAL B 1 58  ? -18.755 16.669 -19.865 1.00 15.25  ? 58  VAL B CB    1 
ATOM   2330 C  CG1   . VAL B 1 58  ? -19.436 15.343 -19.690 1.00 8.80   ? 58  VAL B CG1   1 
ATOM   2331 C  CG2   . VAL B 1 58  ? -19.757 17.688 -20.392 1.00 10.65  ? 58  VAL B CG2   1 
ATOM   2332 N  N     . LYS B 1 59  ? -17.300 15.599 -16.851 1.00 15.53  ? 59  LYS B N     1 
ATOM   2333 C  CA    . LYS B 1 59  ? -16.381 14.593 -16.304 1.00 30.57  ? 59  LYS B CA    1 
ATOM   2334 C  C     . LYS B 1 59  ? -16.706 13.182 -16.821 1.00 21.76  ? 59  LYS B C     1 
ATOM   2335 O  O     . LYS B 1 59  ? -17.848 12.881 -17.184 1.00 14.65  ? 59  LYS B O     1 
ATOM   2336 C  CB    . LYS B 1 59  ? -16.411 14.596 -14.765 1.00 27.00  ? 59  LYS B CB    1 
ATOM   2337 C  CG    . LYS B 1 59  ? -16.245 15.964 -14.116 1.00 16.01  ? 59  LYS B CG    1 
ATOM   2338 C  CD    . LYS B 1 59  ? -15.588 15.846 -12.748 1.00 21.82  ? 59  LYS B CD    1 
ATOM   2339 C  CE    . LYS B 1 59  ? -15.516 17.188 -12.007 1.00 13.48  ? 59  LYS B CE    1 
ATOM   2340 N  NZ    . LYS B 1 59  ? -14.964 17.050 -10.618 1.00 26.06  ? 59  LYS B NZ    1 
ATOM   2341 N  N     . PRO B 1 60  ? -15.698 12.308 -16.855 1.00 12.92  ? 60  PRO B N     1 
ATOM   2342 C  CA    . PRO B 1 60  ? -15.920 10.938 -17.330 1.00 23.96  ? 60  PRO B CA    1 
ATOM   2343 C  C     . PRO B 1 60  ? -16.958 10.166 -16.513 1.00 25.61  ? 60  PRO B C     1 
ATOM   2344 O  O     . PRO B 1 60  ? -17.514 9.177  -17.011 1.00 39.91  ? 60  PRO B O     1 
ATOM   2345 C  CB    . PRO B 1 60  ? -14.534 10.292 -17.211 1.00 10.86  ? 60  PRO B CB    1 
ATOM   2346 C  CG    . PRO B 1 60  ? -13.709 11.237 -16.399 1.00 15.80  ? 60  PRO B CG    1 
ATOM   2347 C  CD    . PRO B 1 60  ? -14.275 12.594 -16.632 1.00 16.96  ? 60  PRO B CD    1 
ATOM   2348 N  N     . ASP B 1 61  ? -17.233 10.629 -15.295 1.00 24.20  ? 61  ASP B N     1 
ATOM   2349 C  CA    . ASP B 1 61  ? -18.231 9.993  -14.445 1.00 10.19  ? 61  ASP B CA    1 
ATOM   2350 C  C     . ASP B 1 61  ? -19.605 10.618 -14.664 1.00 17.87  ? 61  ASP B C     1 
ATOM   2351 O  O     . ASP B 1 61  ? -20.538 10.334 -13.923 1.00 32.76  ? 61  ASP B O     1 
ATOM   2352 C  CB    . ASP B 1 61  ? -17.808 10.034 -12.962 1.00 10.09  ? 61  ASP B CB    1 
ATOM   2353 C  CG    . ASP B 1 61  ? -18.105 11.367 -12.266 1.00 42.11  ? 61  ASP B CG    1 
ATOM   2354 O  OD1   . ASP B 1 61  ? -18.334 12.396 -12.942 1.00 28.49  ? 61  ASP B OD1   1 
ATOM   2355 O  OD2   . ASP B 1 61  ? -18.087 11.374 -11.007 1.00 26.06  ? 61  ASP B OD2   1 
ATOM   2356 N  N     . GLY B 1 62  ? -19.715 11.498 -15.658 1.00 17.82  ? 62  GLY B N     1 
ATOM   2357 C  CA    . GLY B 1 62  ? -21.007 11.998 -16.099 1.00 11.00  ? 62  GLY B CA    1 
ATOM   2358 C  C     . GLY B 1 62  ? -21.492 13.291 -15.458 1.00 22.86  ? 62  GLY B C     1 
ATOM   2359 O  O     . GLY B 1 62  ? -22.513 13.858 -15.877 1.00 26.37  ? 62  GLY B O     1 
ATOM   2360 N  N     . SER B 1 63  ? -20.771 13.762 -14.445 1.00 21.70  ? 63  SER B N     1 
ATOM   2361 C  CA    . SER B 1 63  ? -21.060 15.057 -13.839 1.00 16.14  ? 63  SER B CA    1 
ATOM   2362 C  C     . SER B 1 63  ? -20.878 16.114 -14.892 1.00 17.27  ? 63  SER B C     1 
ATOM   2363 O  O     . SER B 1 63  ? -19.959 16.030 -15.710 1.00 18.33  ? 63  SER B O     1 
ATOM   2364 C  CB    . SER B 1 63  ? -20.135 15.350 -12.671 1.00 11.17  ? 63  SER B CB    1 
ATOM   2365 O  OG    . SER B 1 63  ? -19.694 14.145 -12.081 1.00 25.86  ? 63  SER B OG    1 
ATOM   2366 N  N     . PHE B 1 64  ? -21.727 17.127 -14.843 1.00 18.37  ? 64  PHE B N     1 
ATOM   2367 C  CA    . PHE B 1 64  ? -21.811 18.137 -15.892 1.00 16.53  ? 64  PHE B CA    1 
ATOM   2368 C  C     . PHE B 1 64  ? -21.852 19.488 -15.179 1.00 12.43  ? 64  PHE B C     1 
ATOM   2369 O  O     . PHE B 1 64  ? -22.739 19.718 -14.371 1.00 13.53  ? 64  PHE B O     1 
ATOM   2370 C  CB    . PHE B 1 64  ? -23.067 17.863 -16.724 1.00 12.17  ? 64  PHE B CB    1 
ATOM   2371 C  CG    . PHE B 1 64  ? -23.165 18.609 -18.008 1.00 14.27  ? 64  PHE B CG    1 
ATOM   2372 C  CD1   . PHE B 1 64  ? -23.228 19.986 -18.037 1.00 36.04  ? 64  PHE B CD1   1 
ATOM   2373 C  CD2   . PHE B 1 64  ? -23.314 17.919 -19.192 1.00 32.59  ? 64  PHE B CD2   1 
ATOM   2374 C  CE1   . PHE B 1 64  ? -23.368 20.663 -19.234 1.00 28.88  ? 64  PHE B CE1   1 
ATOM   2375 C  CE2   . PHE B 1 64  ? -23.455 18.587 -20.388 1.00 31.99  ? 64  PHE B CE2   1 
ATOM   2376 C  CZ    . PHE B 1 64  ? -23.482 19.962 -20.410 1.00 26.21  ? 64  PHE B CZ    1 
ATOM   2377 N  N     . LEU B 1 65  ? -20.887 20.367 -15.428 1.00 7.76   ? 65  LEU B N     1 
ATOM   2378 C  CA    . LEU B 1 65  ? -20.899 21.672 -14.763 1.00 7.70   ? 65  LEU B CA    1 
ATOM   2379 C  C     . LEU B 1 65  ? -21.020 22.821 -15.738 1.00 9.22   ? 65  LEU B C     1 
ATOM   2380 O  O     . LEU B 1 65  ? -20.447 22.803 -16.821 1.00 15.75  ? 65  LEU B O     1 
ATOM   2381 C  CB    . LEU B 1 65  ? -19.638 21.871 -13.930 1.00 6.27   ? 65  LEU B CB    1 
ATOM   2382 C  CG    . LEU B 1 65  ? -19.262 20.645 -13.125 1.00 12.71  ? 65  LEU B CG    1 
ATOM   2383 C  CD1   . LEU B 1 65  ? -17.927 20.832 -12.477 1.00 5.33   ? 65  LEU B CD1   1 
ATOM   2384 C  CD2   . LEU B 1 65  ? -20.331 20.386 -12.103 1.00 20.67  ? 65  LEU B CD2   1 
ATOM   2385 N  N     . ILE B 1 66  ? -21.760 23.839 -15.354 1.00 5.34   ? 66  ILE B N     1 
ATOM   2386 C  CA    . ILE B 1 66  ? -21.752 25.049 -16.148 1.00 18.00  ? 66  ILE B CA    1 
ATOM   2387 C  C     . ILE B 1 66  ? -21.452 26.255 -15.277 1.00 19.22  ? 66  ILE B C     1 
ATOM   2388 O  O     . ILE B 1 66  ? -22.262 26.642 -14.444 1.00 18.62  ? 66  ILE B O     1 
ATOM   2389 C  CB    . ILE B 1 66  ? -23.082 25.254 -16.851 1.00 26.19  ? 66  ILE B CB    1 
ATOM   2390 C  CG1   . ILE B 1 66  ? -23.429 24.019 -17.681 1.00 5.31   ? 66  ILE B CG1   1 
ATOM   2391 C  CG2   . ILE B 1 66  ? -23.044 26.520 -17.694 1.00 15.43  ? 66  ILE B CG2   1 
ATOM   2392 C  CD1   . ILE B 1 66  ? -24.838 24.017 -18.082 1.00 12.82  ? 66  ILE B CD1   1 
ATOM   2393 N  N     . HIS B 1 67  ? -20.293 26.860 -15.495 1.00 19.62  ? 67  HIS B N     1 
ATOM   2394 C  CA    . HIS B 1 67  ? -19.853 27.975 -14.677 1.00 13.46  ? 67  HIS B CA    1 
ATOM   2395 C  C     . HIS B 1 67  ? -19.899 29.334 -15.364 1.00 16.59  ? 67  HIS B C     1 
ATOM   2396 O  O     . HIS B 1 67  ? -19.301 29.529 -16.426 1.00 16.53  ? 67  HIS B O     1 
ATOM   2397 C  CB    . HIS B 1 67  ? -18.436 27.714 -14.191 1.00 7.87   ? 67  HIS B CB    1 
ATOM   2398 C  CG    . HIS B 1 67  ? -18.365 26.772 -13.031 1.00 31.29  ? 67  HIS B CG    1 
ATOM   2399 N  ND1   . HIS B 1 67  ? -18.711 27.144 -11.746 1.00 11.71  ? 67  HIS B ND1   1 
ATOM   2400 C  CD2   . HIS B 1 67  ? -17.982 25.476 -12.950 1.00 21.94  ? 67  HIS B CD2   1 
ATOM   2401 C  CE1   . HIS B 1 67  ? -18.553 26.119 -10.935 1.00 9.71   ? 67  HIS B CE1   1 
ATOM   2402 N  NE2   . HIS B 1 67  ? -18.106 25.092 -11.639 1.00 13.70  ? 67  HIS B NE2   1 
ATOM   2403 N  N     . GLN B 1 68  ? -20.604 30.273 -14.740 1.00 7.86   ? 68  GLN B N     1 
ATOM   2404 C  CA    . GLN B 1 68  ? -20.459 31.687 -15.076 1.00 9.14   ? 68  GLN B CA    1 
ATOM   2405 C  C     . GLN B 1 68  ? -19.218 32.357 -14.463 1.00 15.18  ? 68  GLN B C     1 
ATOM   2406 O  O     . GLN B 1 68  ? -18.466 31.755 -13.680 1.00 9.92   ? 68  GLN B O     1 
ATOM   2407 C  CB    . GLN B 1 68  ? -21.691 32.454 -14.636 1.00 9.54   ? 68  GLN B CB    1 
ATOM   2408 C  CG    . GLN B 1 68  ? -22.952 31.882 -15.181 1.00 15.40  ? 68  GLN B CG    1 
ATOM   2409 C  CD    . GLN B 1 68  ? -24.163 32.647 -14.732 1.00 26.94  ? 68  GLN B CD    1 
ATOM   2410 O  OE1   . GLN B 1 68  ? -24.647 32.480 -13.597 1.00 19.47  ? 68  GLN B OE1   1 
ATOM   2411 N  NE2   . GLN B 1 68  ? -24.673 33.495 -15.619 1.00 2.80   ? 68  GLN B NE2   1 
ATOM   2412 N  N     . SER B 1 69  ? -19.039 33.628 -14.807 1.00 17.67  ? 69  SER B N     1 
ATOM   2413 C  CA    . SER B 1 69  ? -17.846 34.383 -14.447 1.00 15.50  ? 69  SER B CA    1 
ATOM   2414 C  C     . SER B 1 69  ? -17.738 34.641 -12.956 1.00 23.20  ? 69  SER B C     1 
ATOM   2415 O  O     . SER B 1 69  ? -16.707 35.101 -12.477 1.00 36.11  ? 69  SER B O     1 
ATOM   2416 C  CB    . SER B 1 69  ? -17.839 35.712 -15.182 1.00 24.51  ? 69  SER B CB    1 
ATOM   2417 O  OG    . SER B 1 69  ? -18.943 36.501 -14.771 1.00 66.86  ? 69  SER B OG    1 
ATOM   2418 N  N     . LYS B 1 70  ? -18.811 34.357 -12.225 1.00 24.26  ? 70  LYS B N     1 
ATOM   2419 C  CA    . LYS B 1 70  ? -18.844 34.594 -10.788 1.00 14.03  ? 70  LYS B CA    1 
ATOM   2420 C  C     . LYS B 1 70  ? -19.272 33.371 -9.969  1.00 22.74  ? 70  LYS B C     1 
ATOM   2421 O  O     . LYS B 1 70  ? -19.521 32.287 -10.491 1.00 47.33  ? 70  LYS B O     1 
ATOM   2422 C  CB    . LYS B 1 70  ? -19.772 35.767 -10.466 1.00 12.89  ? 70  LYS B CB    1 
ATOM   2423 C  CG    . LYS B 1 70  ? -19.283 37.111 -10.982 1.00 24.03  ? 70  LYS B CG    1 
ATOM   2424 C  CD    . LYS B 1 70  ? -20.382 38.161 -10.885 1.00 21.33  ? 70  LYS B CD    1 
ATOM   2425 C  CE    . LYS B 1 70  ? -19.969 39.480 -11.529 1.00 48.77  ? 70  LYS B CE    1 
ATOM   2426 N  NZ    . LYS B 1 70  ? -20.915 40.580 -11.153 1.00 48.05  ? 70  LYS B NZ    1 
ATOM   2427 N  N     . LYS B 1 71  ? -19.352 33.598 -8.669  1.00 14.65  ? 71  LYS B N     1 
ATOM   2428 C  CA    . LYS B 1 71  ? -19.597 32.616 -7.616  1.00 19.23  ? 71  LYS B CA    1 
ATOM   2429 C  C     . LYS B 1 71  ? -18.690 31.375 -7.589  1.00 22.68  ? 71  LYS B C     1 
ATOM   2430 O  O     . LYS B 1 71  ? -17.688 31.310 -8.287  1.00 29.88  ? 71  LYS B O     1 
ATOM   2431 C  CB    . LYS B 1 71  ? -21.049 32.132 -7.727  1.00 21.29  ? 71  LYS B CB    1 
ATOM   2432 C  CG    . LYS B 1 71  ? -22.082 33.231 -7.893  1.00 15.33  ? 71  LYS B CG    1 
ATOM   2433 C  CD    . LYS B 1 71  ? -21.962 34.262 -6.794  1.00 21.17  ? 71  LYS B CD    1 
ATOM   2434 C  CE    . LYS B 1 71  ? -23.247 35.046 -6.607  1.00 44.32  ? 71  LYS B CE    1 
ATOM   2435 N  NZ    . LYS B 1 71  ? -23.107 35.939 -5.420  1.00 51.39  ? 71  LYS B NZ    1 
ATOM   2436 N  N     . ARG B 1 72  ? -19.164 30.329 -6.924  1.00 11.94  ? 72  ARG B N     1 
ATOM   2437 C  CA    . ARG B 1 72  ? -18.382 29.126 -6.659  1.00 13.18  ? 72  ARG B CA    1 
ATOM   2438 C  C     . ARG B 1 72  ? -19.159 27.984 -7.247  1.00 20.26  ? 72  ARG B C     1 
ATOM   2439 O  O     . ARG B 1 72  ? -18.643 27.155 -7.988  1.00 19.27  ? 72  ARG B O     1 
ATOM   2440 C  CB    . ARG B 1 72  ? -18.128 28.860 -5.174  1.00 7.83   ? 72  ARG B CB    1 
ATOM   2441 C  CG    . ARG B 1 72  ? -17.044 27.797 -5.017  1.00 10.19  ? 72  ARG B CG    1 
ATOM   2442 C  CD    . ARG B 1 72  ? -17.107 26.956 -3.789  1.00 7.59   ? 72  ARG B CD    1 
ATOM   2443 N  NE    . ARG B 1 72  ? -18.231 26.022 -3.752  1.00 28.01  ? 72  ARG B NE    1 
ATOM   2444 C  CZ    . ARG B 1 72  ? -18.174 24.787 -3.244  1.00 13.10  ? 72  ARG B CZ    1 
ATOM   2445 N  NH1   . ARG B 1 72  ? -17.043 24.301 -2.761  1.00 8.88   ? 72  ARG B NH1   1 
ATOM   2446 N  NH2   . ARG B 1 72  ? -19.250 24.024 -3.227  1.00 21.87  ? 72  ARG B NH2   1 
ATOM   2447 N  N     . GLU B 1 73  ? -20.395 27.896 -6.792  1.00 15.55  ? 73  GLU B N     1 
ATOM   2448 C  CA    . GLU B 1 73  ? -21.379 27.055 -7.420  1.00 19.55  ? 73  GLU B CA    1 
ATOM   2449 C  C     . GLU B 1 73  ? -21.512 27.270 -8.931  1.00 10.18  ? 73  GLU B C     1 
ATOM   2450 O  O     . GLU B 1 73  ? -21.466 28.397 -9.422  1.00 18.29  ? 73  GLU B O     1 
ATOM   2451 C  CB    . GLU B 1 73  ? -22.725 27.288 -6.733  1.00 24.79  ? 73  GLU B CB    1 
ATOM   2452 C  CG    . GLU B 1 73  ? -22.697 26.845 -5.315  1.00 11.20  ? 73  GLU B CG    1 
ATOM   2453 C  CD    . GLU B 1 73  ? -21.877 25.581 -5.148  1.00 33.58  ? 73  GLU B CD    1 
ATOM   2454 O  OE1   . GLU B 1 73  ? -22.173 24.558 -5.816  1.00 26.04  ? 73  GLU B OE1   1 
ATOM   2455 O  OE2   . GLU B 1 73  ? -20.913 25.626 -4.357  1.00 31.29  ? 73  GLU B OE2   1 
ATOM   2456 N  N     . PRO B 1 74  ? -21.670 26.172 -9.671  1.00 8.46   ? 74  PRO B N     1 
ATOM   2457 C  CA    . PRO B 1 74  ? -22.128 26.201 -11.065 1.00 13.28  ? 74  PRO B CA    1 
ATOM   2458 C  C     . PRO B 1 74  ? -23.541 26.784 -11.189 1.00 9.70   ? 74  PRO B C     1 
ATOM   2459 O  O     . PRO B 1 74  ? -24.331 26.630 -10.258 1.00 7.59   ? 74  PRO B O     1 
ATOM   2460 C  CB    . PRO B 1 74  ? -22.120 24.728 -11.455 1.00 10.85  ? 74  PRO B CB    1 
ATOM   2461 C  CG    . PRO B 1 74  ? -22.223 23.996 -10.146 1.00 9.93   ? 74  PRO B CG    1 
ATOM   2462 C  CD    . PRO B 1 74  ? -21.412 24.803 -9.207  1.00 6.81   ? 74  PRO B CD    1 
ATOM   2463 N  N     . VAL B 1 75  ? -23.861 27.438 -12.305 1.00 6.78   ? 75  VAL B N     1 
ATOM   2464 C  CA    . VAL B 1 75  ? -25.216 27.979 -12.489 1.00 12.91  ? 75  VAL B CA    1 
ATOM   2465 C  C     . VAL B 1 75  ? -26.196 26.854 -12.779 1.00 9.75   ? 75  VAL B C     1 
ATOM   2466 O  O     . VAL B 1 75  ? -27.375 26.921 -12.440 1.00 16.55  ? 75  VAL B O     1 
ATOM   2467 C  CB    . VAL B 1 75  ? -25.298 29.038 -13.622 1.00 2.14   ? 75  VAL B CB    1 
ATOM   2468 C  CG1   . VAL B 1 75  ? -25.088 28.413 -14.970 1.00 12.60  ? 75  VAL B CG1   1 
ATOM   2469 C  CG2   . VAL B 1 75  ? -26.630 29.714 -13.593 1.00 2.92   ? 75  VAL B CG2   1 
ATOM   2470 N  N     . ASN B 1 76  ? -25.676 25.805 -13.389 1.00 18.78  ? 76  ASN B N     1 
ATOM   2471 C  CA    . ASN B 1 76  ? -26.458 24.657 -13.781 1.00 15.79  ? 76  ASN B CA    1 
ATOM   2472 C  C     . ASN B 1 76  ? -25.534 23.476 -13.775 1.00 13.49  ? 76  ASN B C     1 
ATOM   2473 O  O     . ASN B 1 76  ? -24.337 23.606 -14.030 1.00 20.78  ? 76  ASN B O     1 
ATOM   2474 C  CB    . ASN B 1 76  ? -27.089 24.855 -15.160 1.00 6.16   ? 76  ASN B CB    1 
ATOM   2475 C  CG    . ASN B 1 76  ? -28.427 25.532 -15.085 1.00 11.44  ? 76  ASN B CG    1 
ATOM   2476 O  OD1   . ASN B 1 76  ? -28.652 26.580 -15.690 1.00 17.58  ? 76  ASN B OD1   1 
ATOM   2477 N  ND2   . ASN B 1 76  ? -29.336 24.937 -14.331 1.00 21.91  ? 76  ASN B ND2   1 
ATOM   2478 N  N     . TRP B 1 77  ? -26.067 22.313 -13.483 1.00 6.91   ? 77  TRP B N     1 
ATOM   2479 C  CA    . TRP B 1 77  ? -25.196 21.170 -13.413 1.00 14.95  ? 77  TRP B CA    1 
ATOM   2480 C  C     . TRP B 1 77  ? -26.003 19.926 -13.578 1.00 16.17  ? 77  TRP B C     1 
ATOM   2481 O  O     . TRP B 1 77  ? -27.221 19.962 -13.714 1.00 20.89  ? 77  TRP B O     1 
ATOM   2482 C  CB    . TRP B 1 77  ? -24.458 21.116 -12.070 1.00 13.83  ? 77  TRP B CB    1 
ATOM   2483 C  CG    . TRP B 1 77  ? -25.433 20.898 -10.979 1.00 16.51  ? 77  TRP B CG    1 
ATOM   2484 C  CD1   . TRP B 1 77  ? -25.814 19.707 -10.438 1.00 14.53  ? 77  TRP B CD1   1 
ATOM   2485 C  CD2   . TRP B 1 77  ? -26.231 21.899 -10.352 1.00 18.36  ? 77  TRP B CD2   1 
ATOM   2486 N  NE1   . TRP B 1 77  ? -26.779 19.908 -9.485  1.00 17.09  ? 77  TRP B NE1   1 
ATOM   2487 C  CE2   . TRP B 1 77  ? -27.055 21.249 -9.413  1.00 14.61  ? 77  TRP B CE2   1 
ATOM   2488 C  CE3   . TRP B 1 77  ? -26.318 23.291 -10.480 1.00 14.61  ? 77  TRP B CE3   1 
ATOM   2489 C  CZ2   . TRP B 1 77  ? -27.952 21.935 -8.607  1.00 14.47  ? 77  TRP B CZ2   1 
ATOM   2490 C  CZ3   . TRP B 1 77  ? -27.205 23.971 -9.681  1.00 22.36  ? 77  TRP B CZ3   1 
ATOM   2491 C  CH2   . TRP B 1 77  ? -28.010 23.292 -8.746  1.00 15.03  ? 77  TRP B CH2   1 
ATOM   2492 N  N     . GLN B 1 78  ? -25.294 18.817 -13.535 1.00 12.66  ? 78  GLN B N     1 
ATOM   2493 C  CA    . GLN B 1 78  ? -25.903 17.518 -13.462 1.00 17.34  ? 78  GLN B CA    1 
ATOM   2494 C  C     . GLN B 1 78  ? -24.950 16.702 -12.608 1.00 19.55  ? 78  GLN B C     1 
ATOM   2495 O  O     . GLN B 1 78  ? -23.734 16.871 -12.730 1.00 25.48  ? 78  GLN B O     1 
ATOM   2496 C  CB    . GLN B 1 78  ? -26.082 16.958 -14.865 1.00 29.71  ? 78  GLN B CB    1 
ATOM   2497 C  CG    . GLN B 1 78  ? -27.081 15.868 -14.988 1.00 57.93  ? 78  GLN B CG    1 
ATOM   2498 C  CD    . GLN B 1 78  ? -28.491 16.358 -15.018 1.00 38.33  ? 78  GLN B CD    1 
ATOM   2499 O  OE1   . GLN B 1 78  ? -29.019 16.844 -14.010 1.00 23.46  ? 78  GLN B OE1   1 
ATOM   2500 N  NE2   . GLN B 1 78  ? -29.130 16.219 -16.180 1.00 29.86  ? 78  GLN B NE2   1 
ATOM   2501 N  N     . PRO B 1 79  ? -25.473 15.818 -11.743 1.00 27.55  ? 79  PRO B N     1 
ATOM   2502 C  CA    . PRO B 1 79  ? -24.589 15.190 -10.757 1.00 30.00  ? 79  PRO B CA    1 
ATOM   2503 C  C     . PRO B 1 79  ? -23.991 13.924 -11.336 1.00 11.04  ? 79  PRO B C     1 
ATOM   2504 O  O     . PRO B 1 79  ? -24.411 13.546 -12.416 1.00 20.98  ? 79  PRO B O     1 
ATOM   2505 C  CB    . PRO B 1 79  ? -25.543 14.885 -9.614  1.00 15.46  ? 79  PRO B CB    1 
ATOM   2506 C  CG    . PRO B 1 79  ? -26.755 14.443 -10.347 1.00 24.55  ? 79  PRO B CG    1 
ATOM   2507 C  CD    . PRO B 1 79  ? -26.851 15.330 -11.592 1.00 24.63  ? 79  PRO B CD    1 
ATOM   2508 N  N     . PRO B 1 80  ? -23.062 13.262 -10.634 1.00 16.95  ? 80  PRO B N     1 
ATOM   2509 C  CA    . PRO B 1 80  ? -22.429 12.104 -11.282 1.00 20.30  ? 80  PRO B CA    1 
ATOM   2510 C  C     . PRO B 1 80  ? -23.428 11.039 -11.713 1.00 28.91  ? 80  PRO B C     1 
ATOM   2511 O  O     . PRO B 1 80  ? -24.495 10.922 -11.119 1.00 47.10  ? 80  PRO B O     1 
ATOM   2512 C  CB    . PRO B 1 80  ? -21.502 11.559 -10.200 1.00 7.24   ? 80  PRO B CB    1 
ATOM   2513 C  CG    . PRO B 1 80  ? -21.206 12.740 -9.331  1.00 24.36  ? 80  PRO B CG    1 
ATOM   2514 C  CD    . PRO B 1 80  ? -22.433 13.593 -9.341  1.00 24.29  ? 80  PRO B CD    1 
ATOM   2515 N  N     . GLY B 1 81  ? -23.102 10.296 -12.760 1.00 24.45  ? 81  GLY B N     1 
ATOM   2516 C  CA    . GLY B 1 81  ? -23.947 9.201  -13.183 1.00 13.71  ? 81  GLY B CA    1 
ATOM   2517 C  C     . GLY B 1 81  ? -24.777 9.513  -14.401 1.00 20.18  ? 81  GLY B C     1 
ATOM   2518 O  O     . GLY B 1 81  ? -25.291 8.613  -15.064 1.00 50.24  ? 81  GLY B O     1 
ATOM   2519 N  N     . SER B 1 82  ? -24.901 10.790 -14.717 1.00 23.12  ? 82  SER B N     1 
ATOM   2520 C  CA    . SER B 1 82  ? -25.713 11.196 -15.856 1.00 39.10  ? 82  SER B CA    1 
ATOM   2521 C  C     . SER B 1 82  ? -25.114 10.769 -17.179 1.00 28.80  ? 82  SER B C     1 
ATOM   2522 O  O     . SER B 1 82  ? -23.925 10.464 -17.261 1.00 53.40  ? 82  SER B O     1 
ATOM   2523 C  CB    . SER B 1 82  ? -25.906 12.694 -15.832 1.00 26.35  ? 82  SER B CB    1 
ATOM   2524 O  OG    . SER B 1 82  ? -26.424 13.042 -14.564 1.00 72.54  ? 82  SER B OG    1 
ATOM   2525 N  N     . ARG B 1 83  ? -25.954 10.720 -18.206 1.00 18.43  ? 83  ARG B N     1 
ATOM   2526 C  CA    . ARG B 1 83  ? -25.502 10.324 -19.534 1.00 26.45  ? 83  ARG B CA    1 
ATOM   2527 C  C     . ARG B 1 83  ? -25.611 11.522 -20.457 1.00 48.68  ? 83  ARG B C     1 
ATOM   2528 O  O     . ARG B 1 83  ? -26.657 12.197 -20.484 1.00 21.02  ? 83  ARG B O     1 
ATOM   2529 C  CB    . ARG B 1 83  ? -26.316 9.140  -20.073 1.00 20.06  ? 83  ARG B CB    1 
ATOM   2530 C  CG    . ARG B 1 83  ? -26.520 8.014  -19.054 1.00 76.14  ? 83  ARG B CG    1 
ATOM   2531 C  CD    . ARG B 1 83  ? -27.121 6.765  -19.693 1.00 100.13 ? 83  ARG B CD    1 
ATOM   2532 N  NE    . ARG B 1 83  ? -26.198 6.160  -20.651 1.00 110.86 ? 83  ARG B NE    1 
ATOM   2533 C  CZ    . ARG B 1 83  ? -26.508 5.863  -21.911 1.00 105.02 ? 83  ARG B CZ    1 
ATOM   2534 N  NH1   . ARG B 1 83  ? -27.729 6.109  -22.370 1.00 77.38  ? 83  ARG B NH1   1 
ATOM   2535 N  NH2   . ARG B 1 83  ? -25.596 5.321  -22.713 1.00 71.61  ? 83  ARG B NH2   1 
ATOM   2536 N  N     . VAL B 1 84  ? -24.527 11.789 -21.194 1.00 38.49  ? 84  VAL B N     1 
ATOM   2537 C  CA    . VAL B 1 84  ? -24.468 12.933 -22.105 1.00 25.32  ? 84  VAL B CA    1 
ATOM   2538 C  C     . VAL B 1 84  ? -24.328 12.560 -23.587 1.00 29.07  ? 84  VAL B C     1 
ATOM   2539 O  O     . VAL B 1 84  ? -23.608 11.630 -23.949 1.00 46.55  ? 84  VAL B O     1 
ATOM   2540 C  CB    . VAL B 1 84  ? -23.316 13.851 -21.743 1.00 27.29  ? 84  VAL B CB    1 
ATOM   2541 C  CG1   . VAL B 1 84  ? -23.570 15.225 -22.334 1.00 23.74  ? 84  VAL B CG1   1 
ATOM   2542 C  CG2   . VAL B 1 84  ? -23.181 13.938 -20.222 1.00 48.55  ? 84  VAL B CG2   1 
ATOM   2543 N  N     . ARG B 1 85  ? -25.023 13.298 -24.440 1.00 14.42  ? 85  ARG B N     1 
ATOM   2544 C  CA    . ARG B 1 85  ? -24.937 13.089 -25.873 1.00 15.13  ? 85  ARG B CA    1 
ATOM   2545 C  C     . ARG B 1 85  ? -24.902 14.454 -26.575 1.00 32.65  ? 85  ARG B C     1 
ATOM   2546 O  O     . ARG B 1 85  ? -25.560 15.395 -26.134 1.00 23.79  ? 85  ARG B O     1 
ATOM   2547 C  CB    . ARG B 1 85  ? -26.123 12.234 -26.373 1.00 18.61  ? 85  ARG B CB    1 
ATOM   2548 C  CG    . ARG B 1 85  ? -27.409 13.031 -26.722 1.00 34.96  ? 85  ARG B CG    1 
ATOM   2549 C  CD    . ARG B 1 85  ? -28.620 12.129 -27.038 1.00 46.80  ? 85  ARG B CD    1 
ATOM   2550 N  NE    . ARG B 1 85  ? -29.889 12.867 -26.964 1.00 49.17  ? 85  ARG B NE    1 
ATOM   2551 C  CZ    . ARG B 1 85  ? -30.847 12.645 -26.054 1.00 68.15  ? 85  ARG B CZ    1 
ATOM   2552 N  NH1   . ARG B 1 85  ? -30.702 11.696 -25.132 1.00 45.53  ? 85  ARG B NH1   1 
ATOM   2553 N  NH2   . ARG B 1 85  ? -31.963 13.373 -26.061 1.00 28.13  ? 85  ARG B NH2   1 
ATOM   2554 N  N     . LEU B 1 86  ? -24.131 14.582 -27.654 1.00 38.64  ? 86  LEU B N     1 
ATOM   2555 C  CA    . LEU B 1 86  ? -24.210 15.803 -28.456 1.00 21.51  ? 86  LEU B CA    1 
ATOM   2556 C  C     . LEU B 1 86  ? -25.273 15.634 -29.529 1.00 13.45  ? 86  LEU B C     1 
ATOM   2557 O  O     . LEU B 1 86  ? -25.371 14.578 -30.136 1.00 48.72  ? 86  LEU B O     1 
ATOM   2558 C  CB    . LEU B 1 86  ? -22.865 16.155 -29.089 1.00 10.89  ? 86  LEU B CB    1 
ATOM   2559 C  CG    . LEU B 1 86  ? -22.862 17.409 -29.981 1.00 21.99  ? 86  LEU B CG    1 
ATOM   2560 C  CD1   . LEU B 1 86  ? -23.328 18.670 -29.221 1.00 12.00  ? 86  LEU B CD1   1 
ATOM   2561 C  CD2   . LEU B 1 86  ? -21.486 17.634 -30.624 1.00 14.44  ? 86  LEU B CD2   1 
ATOM   2562 N  N     . GLU B 1 87  ? -26.078 16.667 -29.734 1.00 3.11   ? 87  GLU B N     1 
ATOM   2563 C  CA    . GLU B 1 87  ? -27.162 16.626 -30.687 1.00 15.07  ? 87  GLU B CA    1 
ATOM   2564 C  C     . GLU B 1 87  ? -27.060 17.773 -31.677 1.00 41.56  ? 87  GLU B C     1 
ATOM   2565 O  O     . GLU B 1 87  ? -27.000 18.940 -31.289 1.00 47.66  ? 87  GLU B O     1 
ATOM   2566 C  CB    . GLU B 1 87  ? -28.520 16.696 -29.985 1.00 22.93  ? 87  GLU B CB    1 
ATOM   2567 C  CG    . GLU B 1 87  ? -28.945 15.446 -29.221 1.00 36.11  ? 87  GLU B CG    1 
ATOM   2568 C  CD    . GLU B 1 87  ? -30.426 15.494 -28.843 1.00 69.86  ? 87  GLU B CD    1 
ATOM   2569 O  OE1   . GLU B 1 87  ? -30.943 14.494 -28.292 1.00 40.51  ? 87  GLU B OE1   1 
ATOM   2570 O  OE2   . GLU B 1 87  ? -31.072 16.538 -29.110 1.00 48.92  ? 87  GLU B OE2   1 
ATOM   2571 N  N     . LEU B 1 88  ? -27.067 17.457 -32.963 1.00 46.42  ? 88  LEU B N     1 
ATOM   2572 C  CA    . LEU B 1 88  ? -26.992 18.515 -33.952 1.00 26.01  ? 88  LEU B CA    1 
ATOM   2573 C  C     . LEU B 1 88  ? -28.373 18.989 -34.397 1.00 29.26  ? 88  LEU B C     1 
ATOM   2574 O  O     . LEU B 1 88  ? -29.217 18.194 -34.805 1.00 57.62  ? 88  LEU B O     1 
ATOM   2575 C  CB    . LEU B 1 88  ? -26.160 18.045 -35.127 1.00 26.15  ? 88  LEU B CB    1 
ATOM   2576 C  CG    . LEU B 1 88  ? -24.697 18.311 -34.820 1.00 14.34  ? 88  LEU B CG    1 
ATOM   2577 C  CD1   . LEU B 1 88  ? -23.794 17.505 -35.723 1.00 29.29  ? 88  LEU B CD1   1 
ATOM   2578 C  CD2   . LEU B 1 88  ? -24.439 19.809 -34.969 1.00 17.97  ? 88  LEU B CD2   1 
ATOM   2579 N  N     . ARG B 1 89  ? -28.584 20.296 -34.289 1.00 19.05  ? 89  ARG B N     1 
ATOM   2580 C  CA    . ARG B 1 89  ? -29.857 20.977 -34.556 1.00 25.36  ? 89  ARG B CA    1 
ATOM   2581 C  C     . ARG B 1 89  ? -29.434 22.313 -35.132 1.00 34.33  ? 89  ARG B C     1 
ATOM   2582 O  O     . ARG B 1 89  ? -28.321 22.402 -35.660 1.00 33.31  ? 89  ARG B O     1 
ATOM   2583 C  CB    . ARG B 1 89  ? -30.727 21.156 -33.313 1.00 17.99  ? 89  ARG B CB    1 
ATOM   2584 C  CG    . ARG B 1 89  ? -30.647 20.027 -32.298 1.00 38.40  ? 89  ARG B CG    1 
ATOM   2585 C  CD    . ARG B 1 89  ? -32.003 19.745 -31.686 1.00 58.34  ? 89  ARG B CD    1 
ATOM   2586 N  NE    . ARG B 1 89  ? -31.917 19.037 -30.408 1.00 56.83  ? 89  ARG B NE    1 
ATOM   2587 C  CZ    . ARG B 1 89  ? -32.146 19.610 -29.226 1.00 83.59  ? 89  ARG B CZ    1 
ATOM   2588 N  NH1   . ARG B 1 89  ? -32.471 20.898 -29.165 1.00 77.98  ? 89  ARG B NH1   1 
ATOM   2589 N  NH2   . ARG B 1 89  ? -32.052 18.904 -28.103 1.00 26.48  ? 89  ARG B NH2   1 
ATOM   2590 N  N     . GLU B 1 90  ? -30.311 23.321 -35.116 1.00 8.78   ? 90  GLU B N     1 
ATOM   2591 C  CA    . GLU B 1 90  ? -29.927 24.648 -35.631 1.00 19.48  ? 90  GLU B CA    1 
ATOM   2592 C  C     . GLU B 1 90  ? -28.561 25.035 -35.076 1.00 33.50  ? 90  GLU B C     1 
ATOM   2593 O  O     . GLU B 1 90  ? -27.715 25.584 -35.785 1.00 35.87  ? 90  GLU B O     1 
ATOM   2594 C  CB    . GLU B 1 90  ? -30.977 25.712 -35.283 1.00 25.45  ? 90  GLU B CB    1 
ATOM   2595 C  CG    . GLU B 1 90  ? -31.056 26.081 -33.799 1.00 91.45  ? 90  GLU B CG    1 
ATOM   2596 C  CD    . GLU B 1 90  ? -31.724 25.005 -32.944 1.00 109.16 ? 90  GLU B CD    1 
ATOM   2597 O  OE1   . GLU B 1 90  ? -32.124 23.950 -33.501 1.00 82.68  ? 90  GLU B OE1   1 
ATOM   2598 O  OE2   . GLU B 1 90  ? -31.820 25.211 -31.710 1.00 105.27 ? 90  GLU B OE2   1 
ATOM   2599 N  N     . ASN B 1 91  ? -28.355 24.700 -33.803 1.00 66.53  ? 91  ASN B N     1 
ATOM   2600 C  CA    . ASN B 1 91  ? -27.058 24.757 -33.146 1.00 42.02  ? 91  ASN B CA    1 
ATOM   2601 C  C     . ASN B 1 91  ? -26.755 23.413 -32.506 1.00 25.87  ? 91  ASN B C     1 
ATOM   2602 O  O     . ASN B 1 91  ? -27.661 22.599 -32.296 1.00 19.96  ? 91  ASN B O     1 
ATOM   2603 C  CB    . ASN B 1 91  ? -27.032 25.872 -32.108 1.00 23.62  ? 91  ASN B CB    1 
ATOM   2604 C  CG    . ASN B 1 91  ? -27.047 27.254 -32.743 1.00 31.55  ? 91  ASN B CG    1 
ATOM   2605 O  OD1   . ASN B 1 91  ? -26.457 27.479 -33.809 1.00 44.99  ? 91  ASN B OD1   1 
ATOM   2606 N  ND2   . ASN B 1 91  ? -27.725 28.185 -32.092 1.00 31.70  ? 91  ASN B ND2   1 
ATOM   2607 N  N     . PRO B 1 92  ? -25.476 23.146 -32.231 1.00 14.84  ? 92  PRO B N     1 
ATOM   2608 C  CA    . PRO B 1 92  ? -25.195 21.916 -31.483 1.00 27.34  ? 92  PRO B CA    1 
ATOM   2609 C  C     . PRO B 1 92  ? -25.780 22.028 -30.080 1.00 29.27  ? 92  PRO B C     1 
ATOM   2610 O  O     . PRO B 1 92  ? -25.824 23.125 -29.508 1.00 27.38  ? 92  PRO B O     1 
ATOM   2611 C  CB    . PRO B 1 92  ? -23.658 21.849 -31.436 1.00 11.31  ? 92  PRO B CB    1 
ATOM   2612 C  CG    . PRO B 1 92  ? -23.184 22.847 -32.443 1.00 9.60   ? 92  PRO B CG    1 
ATOM   2613 C  CD    . PRO B 1 92  ? -24.259 23.905 -32.534 1.00 8.89   ? 92  PRO B CD    1 
ATOM   2614 N  N     . VAL B 1 93  ? -26.253 20.919 -29.532 1.00 25.74  ? 93  VAL B N     1 
ATOM   2615 C  CA    . VAL B 1 93  ? -26.752 20.942 -28.169 1.00 20.87  ? 93  VAL B CA    1 
ATOM   2616 C  C     . VAL B 1 93  ? -26.166 19.809 -27.326 1.00 27.03  ? 93  VAL B C     1 
ATOM   2617 O  O     . VAL B 1 93  ? -26.321 18.634 -27.659 1.00 20.27  ? 93  VAL B O     1 
ATOM   2618 C  CB    . VAL B 1 93  ? -28.276 20.869 -28.141 1.00 7.41   ? 93  VAL B CB    1 
ATOM   2619 C  CG1   . VAL B 1 93  ? -28.769 20.781 -26.712 1.00 9.55   ? 93  VAL B CG1   1 
ATOM   2620 C  CG2   . VAL B 1 93  ? -28.859 22.089 -28.816 1.00 6.37   ? 93  VAL B CG2   1 
ATOM   2621 N  N     . LEU B 1 94  ? -25.467 20.181 -26.252 1.00 19.11  ? 94  LEU B N     1 
ATOM   2622 C  CA    . LEU B 1 94  ? -25.089 19.234 -25.210 1.00 11.92  ? 94  LEU B CA    1 
ATOM   2623 C  C     . LEU B 1 94  ? -26.297 18.915 -24.338 1.00 18.65  ? 94  LEU B C     1 
ATOM   2624 O  O     . LEU B 1 94  ? -26.992 19.815 -23.839 1.00 17.23  ? 94  LEU B O     1 
ATOM   2625 C  CB    . LEU B 1 94  ? -23.954 19.782 -24.356 1.00 19.40  ? 94  LEU B CB    1 
ATOM   2626 C  CG    . LEU B 1 94  ? -22.559 19.431 -24.864 1.00 21.80  ? 94  LEU B CG    1 
ATOM   2627 C  CD1   . LEU B 1 94  ? -21.513 19.783 -23.839 1.00 6.64   ? 94  LEU B CD1   1 
ATOM   2628 C  CD2   . LEU B 1 94  ? -22.482 17.958 -25.212 1.00 13.79  ? 94  LEU B CD2   1 
ATOM   2629 N  N     . VAL B 1 95  ? -26.552 17.623 -24.177 1.00 13.48  ? 95  VAL B N     1 
ATOM   2630 C  CA    . VAL B 1 95  ? -27.736 17.149 -23.488 1.00 6.87   ? 95  VAL B CA    1 
ATOM   2631 C  C     . VAL B 1 95  ? -27.348 16.079 -22.506 1.00 16.35  ? 95  VAL B C     1 
ATOM   2632 O  O     . VAL B 1 95  ? -26.765 15.053 -22.878 1.00 24.01  ? 95  VAL B O     1 
ATOM   2633 C  CB    . VAL B 1 95  ? -28.785 16.585 -24.458 1.00 12.32  ? 95  VAL B CB    1 
ATOM   2634 C  CG1   . VAL B 1 95  ? -29.750 15.689 -23.730 1.00 10.61  ? 95  VAL B CG1   1 
ATOM   2635 C  CG2   . VAL B 1 95  ? -29.545 17.711 -25.126 1.00 38.07  ? 95  VAL B CG2   1 
ATOM   2636 N  N     . SER B 1 96  ? -27.656 16.335 -21.242 1.00 15.04  ? 96  SER B N     1 
ATOM   2637 C  CA    . SER B 1 96  ? -27.413 15.360 -20.202 1.00 19.39  ? 96  SER B CA    1 
ATOM   2638 C  C     . SER B 1 96  ? -28.744 14.927 -19.648 1.00 25.41  ? 96  SER B C     1 
ATOM   2639 O  O     . SER B 1 96  ? -29.591 15.767 -19.314 1.00 20.95  ? 96  SER B O     1 
ATOM   2640 C  CB    . SER B 1 96  ? -26.529 15.926 -19.099 1.00 23.90  ? 96  SER B CB    1 
ATOM   2641 O  OG    . SER B 1 96  ? -26.370 14.976 -18.067 1.00 36.42  ? 96  SER B OG    1 
ATOM   2642 N  N     . ILE B 1 97  ? -28.928 13.610 -19.584 1.00 26.99  ? 97  ILE B N     1 
ATOM   2643 C  CA    . ILE B 1 97  ? -30.127 13.027 -18.999 1.00 25.12  ? 97  ILE B CA    1 
ATOM   2644 C  C     . ILE B 1 97  ? -29.803 12.280 -17.727 1.00 26.40  ? 97  ILE B C     1 
ATOM   2645 O  O     . ILE B 1 97  ? -28.862 11.486 -17.689 1.00 22.52  ? 97  ILE B O     1 
ATOM   2646 C  CB    . ILE B 1 97  ? -30.836 12.052 -19.946 1.00 17.71  ? 97  ILE B CB    1 
ATOM   2647 C  CG1   . ILE B 1 97  ? -31.276 12.757 -21.238 1.00 27.71  ? 97  ILE B CG1   1 
ATOM   2648 C  CG2   . ILE B 1 97  ? -32.017 11.409 -19.243 1.00 21.08  ? 97  ILE B CG2   1 
ATOM   2649 C  CD1   . ILE B 1 97  ? -32.204 13.942 -21.043 1.00 34.48  ? 97  ILE B CD1   1 
ATOM   2650 N  N     . ARG B 1 98  ? -30.585 12.554 -16.687 1.00 36.92  ? 98  ARG B N     1 
ATOM   2651 C  CA    . ARG B 1 98  ? -30.524 11.778 -15.457 1.00 28.18  ? 98  ARG B CA    1 
ATOM   2652 C  C     . ARG B 1 98  ? -31.777 10.944 -15.298 1.00 24.03  ? 98  ARG B C     1 
ATOM   2653 O  O     . ARG B 1 98  ? -32.871 11.419 -15.602 1.00 30.73  ? 98  ARG B O     1 
ATOM   2654 C  CB    . ARG B 1 98  ? -30.352 12.692 -14.251 1.00 31.26  ? 98  ARG B CB    1 
ATOM   2655 C  CG    . ARG B 1 98  ? -30.078 11.944 -12.978 1.00 41.09  ? 98  ARG B CG    1 
ATOM   2656 C  CD    . ARG B 1 98  ? -29.233 12.761 -12.050 1.00 35.90  ? 98  ARG B CD    1 
ATOM   2657 N  NE    . ARG B 1 98  ? -30.025 13.711 -11.277 1.00 61.65  ? 98  ARG B NE    1 
ATOM   2658 C  CZ    . ARG B 1 98  ? -30.227 13.626 -9.965  1.00 44.63  ? 98  ARG B CZ    1 
ATOM   2659 N  NH1   . ARG B 1 98  ? -29.681 12.643 -9.266  1.00 9.74   ? 98  ARG B NH1   1 
ATOM   2660 N  NH2   . ARG B 1 98  ? -30.960 14.542 -9.351  1.00 38.96  ? 98  ARG B NH2   1 
ATOM   2661 N  N     . ARG B 1 99  ? -31.604 9.696  -14.862 1.00 32.79  ? 99  ARG B N     1 
ATOM   2662 C  CA    . ARG B 1 99  ? -32.700 8.788  -14.506 1.00 49.31  ? 99  ARG B CA    1 
ATOM   2663 C  C     . ARG B 1 99  ? -32.802 8.871  -13.010 1.00 56.65  ? 99  ARG B C     1 
ATOM   2664 O  O     . ARG B 1 99  ? -31.726 8.964  -12.363 1.00 67.03  ? 99  ARG B O     1 
ATOM   2665 C  CB    . ARG B 1 99  ? -32.367 7.348  -14.907 1.00 69.81  ? 99  ARG B CB    1 
ATOM   2666 C  CG    . ARG B 1 99  ? -32.985 6.869  -16.217 1.00 83.81  ? 99  ARG B CG    1 
ATOM   2667 C  CD    . ARG B 1 99  ? -32.189 5.680  -16.833 1.00 93.13  ? 99  ARG B CD    1 
ATOM   2668 N  NE    . ARG B 1 99  ? -32.683 5.292  -18.163 1.00 126.28 ? 99  ARG B NE    1 
ATOM   2669 C  CZ    . ARG B 1 99  ? -31.944 4.740  -19.128 1.00 120.89 ? 99  ARG B CZ    1 
ATOM   2670 N  NH1   . ARG B 1 99  ? -30.647 4.519  -18.942 1.00 107.46 ? 99  ARG B NH1   1 
ATOM   2671 N  NH2   . ARG B 1 99  ? -32.500 4.422  -20.296 1.00 77.32  ? 99  ARG B NH2   1 
ATOM   2672 N  N     . LYS B 1 100 ? -33.996 8.797  -12.414 1.00 38.46  ? 100 LYS B N     1 
ATOM   2673 C  CA    . LYS B 1 100 ? -33.969 8.452  -10.984 1.00 28.21  ? 100 LYS B CA    1 
ATOM   2674 C  C     . LYS B 1 100 ? -33.257 9.497  -10.118 1.00 32.58  ? 100 LYS B C     1 
ATOM   2675 O  O     . LYS B 1 100 ? -32.171 9.247  -9.626  1.00 42.75  ? 100 LYS B O     1 
ATOM   2676 C  CB    . LYS B 1 100 ? -33.273 7.073  -10.878 1.00 53.42  ? 100 LYS B CB    1 
ATOM   2677 C  CG    . LYS B 1 100 ? -33.003 6.429  -9.513  1.00 85.76  ? 100 LYS B CG    1 
ATOM   2678 C  CD    . LYS B 1 100 ? -31.692 5.569  -9.613  1.00 98.40  ? 100 LYS B CD    1 
ATOM   2679 C  CE    . LYS B 1 100 ? -31.332 5.271  -11.085 1.00 84.82  ? 100 LYS B CE    1 
ATOM   2680 N  NZ    . LYS B 1 100 ? -30.048 4.576  -11.328 1.00 67.76  ? 100 LYS B NZ    1 
ATOM   2681 N  N     . PRO B 1 101 ? -33.829 10.709 -10.001 1.00 39.34  ? 101 PRO B N     1 
ATOM   2682 C  CA    . PRO B 1 101 ? -35.021 11.334 -10.597 1.00 23.52  ? 101 PRO B CA    1 
ATOM   2683 C  C     . PRO B 1 101 ? -34.780 11.767 -12.036 1.00 17.06  ? 101 PRO B C     1 
ATOM   2684 O  O     . PRO B 1 101 ? -33.648 12.066 -12.377 1.00 32.34  ? 101 PRO B O     1 
ATOM   2685 C  CB    . PRO B 1 101 ? -35.276 12.542 -9.686  1.00 13.43  ? 101 PRO B CB    1 
ATOM   2686 C  CG    . PRO B 1 101 ? -33.914 12.926 -9.174  1.00 11.42  ? 101 PRO B CG    1 
ATOM   2687 C  CD    . PRO B 1 101 ? -33.135 11.622 -9.074  1.00 27.16  ? 101 PRO B CD    1 
ATOM   2688 N  N     . ARG B 1 102 ? -35.808 11.726 -12.877 1.00 37.29  ? 102 ARG B N     1 
ATOM   2689 C  CA    . ARG B 1 102 ? -35.673 12.147 -14.260 1.00 32.35  ? 102 ARG B CA    1 
ATOM   2690 C  C     . ARG B 1 102 ? -35.311 13.632 -14.246 1.00 18.88  ? 102 ARG B C     1 
ATOM   2691 O  O     . ARG B 1 102 ? -36.050 14.460 -13.729 1.00 22.62  ? 102 ARG B O     1 
ATOM   2692 C  CB    . ARG B 1 102 ? -36.984 11.865 -15.049 1.00 42.11  ? 102 ARG B CB    1 
ATOM   2693 C  CG    . ARG B 1 102 ? -36.972 12.108 -16.597 1.00 40.18  ? 102 ARG B CG    1 
ATOM   2694 C  CD    . ARG B 1 102 ? -35.969 11.215 -17.371 1.00 68.81  ? 102 ARG B CD    1 
ATOM   2695 N  NE    . ARG B 1 102 ? -36.233 9.779  -17.223 1.00 114.58 ? 102 ARG B NE    1 
ATOM   2696 C  CZ    . ARG B 1 102 ? -35.460 8.809  -17.713 1.00 93.67  ? 102 ARG B CZ    1 
ATOM   2697 N  NH1   . ARG B 1 102 ? -34.364 9.105  -18.402 1.00 96.32  ? 102 ARG B NH1   1 
ATOM   2698 N  NH2   . ARG B 1 102 ? -35.782 7.536  -17.516 1.00 87.59  ? 102 ARG B NH2   1 
ATOM   2699 N  N     . GLU B 1 103 ? -34.170 13.960 -14.842 1.00 38.71  ? 103 GLU B N     1 
ATOM   2700 C  CA    . GLU B 1 103 ? -33.730 15.343 -15.011 1.00 24.62  ? 103 GLU B CA    1 
ATOM   2701 C  C     . GLU B 1 103 ? -32.999 15.534 -16.340 1.00 23.59  ? 103 GLU B C     1 
ATOM   2702 O  O     . GLU B 1 103 ? -32.210 14.683 -16.757 1.00 28.78  ? 103 GLU B O     1 
ATOM   2703 C  CB    . GLU B 1 103 ? -32.806 15.774 -13.878 1.00 25.87  ? 103 GLU B CB    1 
ATOM   2704 C  CG    . GLU B 1 103 ? -33.399 15.725 -12.501 1.00 26.06  ? 103 GLU B CG    1 
ATOM   2705 C  CD    . GLU B 1 103 ? -32.599 16.547 -11.526 1.00 23.29  ? 103 GLU B CD    1 
ATOM   2706 O  OE1   . GLU B 1 103 ? -31.472 16.126 -11.186 1.00 17.01  ? 103 GLU B OE1   1 
ATOM   2707 O  OE2   . GLU B 1 103 ? -33.094 17.623 -11.120 1.00 16.54  ? 103 GLU B OE2   1 
ATOM   2708 N  N     . THR B 1 104 ? -33.241 16.673 -16.978 1.00 20.68  ? 104 THR B N     1 
ATOM   2709 C  CA    . THR B 1 104 ? -32.668 16.979 -18.282 1.00 22.28  ? 104 THR B CA    1 
ATOM   2710 C  C     . THR B 1 104 ? -31.919 18.300 -18.291 1.00 26.45  ? 104 THR B C     1 
ATOM   2711 O  O     . THR B 1 104 ? -32.471 19.337 -17.914 1.00 22.08  ? 104 THR B O     1 
ATOM   2712 C  CB    . THR B 1 104 ? -33.761 17.054 -19.348 1.00 22.02  ? 104 THR B CB    1 
ATOM   2713 O  OG1   . THR B 1 104 ? -34.354 15.765 -19.499 1.00 46.89  ? 104 THR B OG1   1 
ATOM   2714 C  CG2   . THR B 1 104 ? -33.188 17.499 -20.666 1.00 28.24  ? 104 THR B CG2   1 
ATOM   2715 N  N     . LEU B 1 105 ? -30.670 18.280 -18.731 1.00 9.06   ? 105 LEU B N     1 
ATOM   2716 C  CA    . LEU B 1 105 ? -29.986 19.537 -18.943 1.00 10.57  ? 105 LEU B CA    1 
ATOM   2717 C  C     . LEU B 1 105 ? -29.674 19.730 -20.425 1.00 14.49  ? 105 LEU B C     1 
ATOM   2718 O  O     . LEU B 1 105 ? -29.088 18.873 -21.070 1.00 16.26  ? 105 LEU B O     1 
ATOM   2719 C  CB    . LEU B 1 105 ? -28.715 19.592 -18.105 1.00 21.68  ? 105 LEU B CB    1 
ATOM   2720 C  CG    . LEU B 1 105 ? -28.057 20.966 -18.062 1.00 13.62  ? 105 LEU B CG    1 
ATOM   2721 C  CD1   . LEU B 1 105 ? -28.963 21.957 -17.369 1.00 13.88  ? 105 LEU B CD1   1 
ATOM   2722 C  CD2   . LEU B 1 105 ? -26.736 20.864 -17.358 1.00 15.85  ? 105 LEU B CD2   1 
ATOM   2723 N  N     . GLU B 1 106 ? -30.086 20.858 -20.973 1.00 21.50  ? 106 GLU B N     1 
ATOM   2724 C  CA    . GLU B 1 106 ? -29.795 21.156 -22.369 1.00 19.56  ? 106 GLU B CA    1 
ATOM   2725 C  C     . GLU B 1 106 ? -28.929 22.395 -22.469 1.00 27.50  ? 106 GLU B C     1 
ATOM   2726 O  O     . GLU B 1 106 ? -29.388 23.498 -22.166 1.00 19.15  ? 106 GLU B O     1 
ATOM   2727 C  CB    . GLU B 1 106 ? -31.083 21.386 -23.166 1.00 30.82  ? 106 GLU B CB    1 
ATOM   2728 C  CG    . GLU B 1 106 ? -31.819 20.133 -23.633 1.00 44.88  ? 106 GLU B CG    1 
ATOM   2729 C  CD    . GLU B 1 106 ? -33.145 20.467 -24.315 1.00 66.58  ? 106 GLU B CD    1 
ATOM   2730 O  OE1   . GLU B 1 106 ? -33.250 20.316 -25.555 1.00 72.20  ? 106 GLU B OE1   1 
ATOM   2731 O  OE2   . GLU B 1 106 ? -34.084 20.887 -23.604 1.00 38.01  ? 106 GLU B OE2   1 
ATOM   2732 N  N     . VAL B 1 107 ? -27.689 22.229 -22.908 1.00 11.57  ? 107 VAL B N     1 
ATOM   2733 C  CA    . VAL B 1 107 ? -26.878 23.389 -23.231 1.00 11.20  ? 107 VAL B CA    1 
ATOM   2734 C  C     . VAL B 1 107 ? -26.823 23.596 -24.742 1.00 16.42  ? 107 VAL B C     1 
ATOM   2735 O  O     . VAL B 1 107 ? -26.165 22.842 -25.456 1.00 17.14  ? 107 VAL B O     1 
ATOM   2736 C  CB    . VAL B 1 107 ? -25.459 23.237 -22.712 1.00 25.98  ? 107 VAL B CB    1 
ATOM   2737 C  CG1   . VAL B 1 107 ? -24.737 24.556 -22.823 1.00 30.04  ? 107 VAL B CG1   1 
ATOM   2738 C  CG2   . VAL B 1 107 ? -25.477 22.746 -21.287 1.00 15.04  ? 107 VAL B CG2   1 
ATOM   2739 N  N     . GLU B 1 108 ? -27.511 24.621 -25.229 1.00 16.41  ? 108 GLU B N     1 
ATOM   2740 C  CA    . GLU B 1 108 ? -27.456 24.969 -26.643 1.00 18.73  ? 108 GLU B CA    1 
ATOM   2741 C  C     . GLU B 1 108 ? -26.192 25.769 -26.915 1.00 17.86  ? 108 GLU B C     1 
ATOM   2742 O  O     . GLU B 1 108 ? -26.047 26.863 -26.381 1.00 13.38  ? 108 GLU B O     1 
ATOM   2743 C  CB    . GLU B 1 108 ? -28.691 25.782 -27.052 1.00 10.14  ? 108 GLU B CB    1 
ATOM   2744 C  CG    . GLU B 1 108 ? -28.670 26.323 -28.491 1.00 27.04  ? 108 GLU B CG    1 
ATOM   2745 C  CD    . GLU B 1 108 ? -29.910 27.169 -28.827 1.00 82.87  ? 108 GLU B CD    1 
ATOM   2746 O  OE1   . GLU B 1 108 ? -30.895 27.124 -28.044 1.00 64.67  ? 108 GLU B OE1   1 
ATOM   2747 O  OE2   . GLU B 1 108 ? -29.896 27.878 -29.869 1.00 35.70  ? 108 GLU B OE2   1 
ATOM   2748 N  N     . LEU B 1 109 ? -25.307 25.264 -27.773 1.00 9.15   ? 109 LEU B N     1 
ATOM   2749 C  CA    . LEU B 1 109 ? -24.072 25.982 -28.052 1.00 6.86   ? 109 LEU B CA    1 
ATOM   2750 C  C     . LEU B 1 109 ? -24.220 26.936 -29.239 1.00 16.87  ? 109 LEU B C     1 
ATOM   2751 O  O     . LEU B 1 109 ? -24.195 26.519 -30.398 1.00 33.02  ? 109 LEU B O     1 
ATOM   2752 C  CB    . LEU B 1 109 ? -22.948 24.985 -28.327 1.00 6.31   ? 109 LEU B CB    1 
ATOM   2753 C  CG    . LEU B 1 109 ? -22.812 23.942 -27.217 1.00 12.51  ? 109 LEU B CG    1 
ATOM   2754 C  CD1   . LEU B 1 109 ? -21.655 22.985 -27.435 1.00 6.22   ? 109 LEU B CD1   1 
ATOM   2755 C  CD2   . LEU B 1 109 ? -22.653 24.646 -25.886 1.00 28.03  ? 109 LEU B CD2   1 
ATOM   2756 N  N     . GLU B 1 110 ? -24.303 28.230 -28.932 1.00 15.38  ? 110 GLU B N     1 
ATOM   2757 C  CA    . GLU B 1 110 ? -24.491 29.271 -29.932 1.00 15.48  ? 110 GLU B CA    1 
ATOM   2758 C  C     . GLU B 1 110 ? -23.182 29.571 -30.640 1.00 14.45  ? 110 GLU B C     1 
ATOM   2759 O  O     . GLU B 1 110 ? -23.118 29.589 -31.863 1.00 28.70  ? 110 GLU B O     1 
ATOM   2760 C  CB    . GLU B 1 110 ? -25.070 30.537 -29.290 1.00 15.10  ? 110 GLU B CB    1 
ATOM   2761 C  CG    . GLU B 1 110 ? -26.418 30.295 -28.603 1.00 24.07  ? 110 GLU B CG    1 
ATOM   2762 C  CD    . GLU B 1 110 ? -27.089 31.576 -28.128 1.00 48.13  ? 110 GLU B CD    1 
ATOM   2763 O  OE1   . GLU B 1 110 ? -28.105 31.992 -28.728 1.00 58.66  ? 110 GLU B OE1   1 
ATOM   2764 O  OE2   . GLU B 1 110 ? -26.606 32.158 -27.138 1.00 44.81  ? 110 GLU B OE2   1 
ATOM   2765 N  N     . GLU B 1 111 ? -22.131 29.780 -29.867 1.00 13.72  ? 111 GLU B N     1 
ATOM   2766 C  CA    . GLU B 1 111 ? -20.802 29.845 -30.433 1.00 24.60  ? 111 GLU B CA    1 
ATOM   2767 C  C     . GLU B 1 111 ? -19.830 29.113 -29.544 1.00 13.63  ? 111 GLU B C     1 
ATOM   2768 O  O     . GLU B 1 111 ? -19.741 29.415 -28.368 1.00 34.49  ? 111 GLU B O     1 
ATOM   2769 C  CB    . GLU B 1 111 ? -20.340 31.293 -30.621 1.00 18.27  ? 111 GLU B CB    1 
ATOM   2770 C  CG    . GLU B 1 111 ? -19.296 31.410 -31.725 1.00 28.53  ? 111 GLU B CG    1 
ATOM   2771 C  CD    . GLU B 1 111 ? -18.531 32.712 -31.710 1.00 73.41  ? 111 GLU B CD    1 
ATOM   2772 O  OE1   . GLU B 1 111 ? -19.113 33.734 -31.288 1.00 80.01  ? 111 GLU B OE1   1 
ATOM   2773 O  OE2   . GLU B 1 111 ? -17.356 32.715 -32.148 1.00 79.01  ? 111 GLU B OE2   1 
ATOM   2774 N  N     . VAL B 1 112 ? -19.082 28.171 -30.098 1.00 3.65   ? 112 VAL B N     1 
ATOM   2775 C  CA    . VAL B 1 112 ? -18.015 27.554 -29.331 1.00 5.83   ? 112 VAL B CA    1 
ATOM   2776 C  C     . VAL B 1 112 ? -16.698 28.255 -29.571 1.00 9.05   ? 112 VAL B C     1 
ATOM   2777 O  O     . VAL B 1 112 ? -16.166 28.195 -30.673 1.00 12.98  ? 112 VAL B O     1 
ATOM   2778 C  CB    . VAL B 1 112 ? -17.840 26.081 -29.683 1.00 3.09   ? 112 VAL B CB    1 
ATOM   2779 C  CG1   . VAL B 1 112 ? -16.657 25.516 -28.951 1.00 4.04   ? 112 VAL B CG1   1 
ATOM   2780 C  CG2   . VAL B 1 112 ? -19.084 25.308 -29.342 1.00 3.84   ? 112 VAL B CG2   1 
ATOM   2781 N  N     . TYR B 1 113 ? -16.160 28.909 -28.545 1.00 10.98  ? 113 TYR B N     1 
ATOM   2782 C  CA    . TYR B 1 113 ? -14.842 29.530 -28.669 1.00 10.62  ? 113 TYR B CA    1 
ATOM   2783 C  C     . TYR B 1 113 ? -13.707 28.521 -28.531 1.00 16.80  ? 113 TYR B C     1 
ATOM   2784 O  O     . TYR B 1 113 ? -12.636 28.691 -29.117 1.00 26.95  ? 113 TYR B O     1 
ATOM   2785 C  CB    . TYR B 1 113 ? -14.655 30.621 -27.635 1.00 10.16  ? 113 TYR B CB    1 
ATOM   2786 C  CG    . TYR B 1 113 ? -15.774 31.627 -27.573 1.00 26.57  ? 113 TYR B CG    1 
ATOM   2787 C  CD1   . TYR B 1 113 ? -15.916 32.594 -28.557 1.00 15.59  ? 113 TYR B CD1   1 
ATOM   2788 C  CD2   . TYR B 1 113 ? -16.675 31.631 -26.508 1.00 14.12  ? 113 TYR B CD2   1 
ATOM   2789 C  CE1   . TYR B 1 113 ? -16.939 33.526 -28.499 1.00 26.31  ? 113 TYR B CE1   1 
ATOM   2790 C  CE2   . TYR B 1 113 ? -17.695 32.566 -26.435 1.00 22.18  ? 113 TYR B CE2   1 
ATOM   2791 C  CZ    . TYR B 1 113 ? -17.825 33.511 -27.438 1.00 32.25  ? 113 TYR B CZ    1 
ATOM   2792 O  OH    . TYR B 1 113 ? -18.835 34.446 -27.379 1.00 21.61  ? 113 TYR B OH    1 
ATOM   2793 N  N     . MET B 1 114 ? -13.925 27.502 -27.709 1.00 16.23  ? 114 MET B N     1 
ATOM   2794 C  CA    . MET B 1 114 ? -12.934 26.457 -27.520 1.00 9.90   ? 114 MET B CA    1 
ATOM   2795 C  C     . MET B 1 114 ? -13.558 25.144 -27.106 1.00 13.50  ? 114 MET B C     1 
ATOM   2796 O  O     . MET B 1 114 ? -14.498 25.119 -26.319 1.00 22.84  ? 114 MET B O     1 
ATOM   2797 C  CB    . MET B 1 114 ? -11.909 26.861 -26.465 1.00 5.87   ? 114 MET B CB    1 
ATOM   2798 C  CG    . MET B 1 114 ? -10.855 25.809 -26.289 1.00 13.12  ? 114 MET B CG    1 
ATOM   2799 S  SD    . MET B 1 114 ? -10.523 25.381 -24.590 1.00 45.50  ? 114 MET B SD    1 
ATOM   2800 C  CE    . MET B 1 114 ? -12.123 24.786 -24.076 1.00 26.14  ? 114 MET B CE    1 
ATOM   2801 N  N     . VAL B 1 115 ? -13.007 24.050 -27.613 1.00 16.40  ? 115 VAL B N     1 
ATOM   2802 C  CA    . VAL B 1 115 ? -13.312 22.723 -27.103 1.00 15.24  ? 115 VAL B CA    1 
ATOM   2803 C  C     . VAL B 1 115 ? -11.985 22.070 -26.766 1.00 19.57  ? 115 VAL B C     1 
ATOM   2804 O  O     . VAL B 1 115 ? -10.965 22.347 -27.401 1.00 26.10  ? 115 VAL B O     1 
ATOM   2805 C  CB    . VAL B 1 115 ? -14.104 21.872 -28.110 1.00 27.42  ? 115 VAL B CB    1 
ATOM   2806 C  CG1   . VAL B 1 115 ? -13.507 22.018 -29.505 1.00 20.20  ? 115 VAL B CG1   1 
ATOM   2807 C  CG2   . VAL B 1 115 ? -14.170 20.402 -27.661 1.00 8.20   ? 115 VAL B CG2   1 
ATOM   2808 N  N     . SER B 1 116 ? -11.982 21.245 -25.730 1.00 15.90  ? 116 SER B N     1 
ATOM   2809 C  CA    . SER B 1 116 ? -10.757 20.614 -25.300 1.00 26.45  ? 116 SER B CA    1 
ATOM   2810 C  C     . SER B 1 116 ? -11.056 19.267 -24.687 1.00 30.65  ? 116 SER B C     1 
ATOM   2811 O  O     . SER B 1 116 ? -12.153 19.041 -24.166 1.00 21.05  ? 116 SER B O     1 
ATOM   2812 C  CB    . SER B 1 116 ? -10.014 21.501 -24.310 1.00 23.46  ? 116 SER B CB    1 
ATOM   2813 O  OG    . SER B 1 116 ? -10.893 21.915 -23.284 1.00 31.58  ? 116 SER B OG    1 
ATOM   2814 N  N     . VAL B 1 117 ? -10.079 18.371 -24.792 1.00 18.79  ? 117 VAL B N     1 
ATOM   2815 C  CA    . VAL B 1 117 ? -10.151 17.069 -24.160 1.00 19.78  ? 117 VAL B CA    1 
ATOM   2816 C  C     . VAL B 1 117 ? -8.930  16.900 -23.285 1.00 35.78  ? 117 VAL B C     1 
ATOM   2817 O  O     . VAL B 1 117 ? -7.786  16.987 -23.747 1.00 21.68  ? 117 VAL B O     1 
ATOM   2818 C  CB    . VAL B 1 117 ? -10.208 15.917 -25.161 1.00 27.19  ? 117 VAL B CB    1 
ATOM   2819 C  CG1   . VAL B 1 117 ? -10.330 14.610 -24.400 1.00 11.61  ? 117 VAL B CG1   1 
ATOM   2820 C  CG2   . VAL B 1 117 ? -11.362 16.103 -26.149 1.00 13.02  ? 117 VAL B CG2   1 
ATOM   2821 N  N     . PHE B 1 118 ? -9.178  16.681 -22.007 1.00 25.81  ? 118 PHE B N     1 
ATOM   2822 C  CA    . PHE B 1 118 ? -8.099  16.568 -21.062 1.00 22.59  ? 118 PHE B CA    1 
ATOM   2823 C  C     . PHE B 1 118 ? -8.105  15.138 -20.585 1.00 18.63  ? 118 PHE B C     1 
ATOM   2824 O  O     . PHE B 1 118 ? -9.033  14.708 -19.912 1.00 26.76  ? 118 PHE B O     1 
ATOM   2825 C  CB    . PHE B 1 118 ? -8.278  17.570 -19.913 1.00 21.79  ? 118 PHE B CB    1 
ATOM   2826 C  CG    . PHE B 1 118 ? -7.166  17.552 -18.905 1.00 19.77  ? 118 PHE B CG    1 
ATOM   2827 C  CD1   . PHE B 1 118 ? -5.897  17.143 -19.256 1.00 19.33  ? 118 PHE B CD1   1 
ATOM   2828 C  CD2   . PHE B 1 118 ? -7.401  17.924 -17.594 1.00 27.31  ? 118 PHE B CD2   1 
ATOM   2829 C  CE1   . PHE B 1 118 ? -4.881  17.113 -18.316 1.00 28.93  ? 118 PHE B CE1   1 
ATOM   2830 C  CE2   . PHE B 1 118 ? -6.384  17.903 -16.651 1.00 14.92  ? 118 PHE B CE2   1 
ATOM   2831 C  CZ    . PHE B 1 118 ? -5.127  17.499 -17.013 1.00 18.43  ? 118 PHE B CZ    1 
ATOM   2832 N  N     . ARG B 1 119 ? -7.067  14.391 -20.923 1.00 26.56  ? 119 ARG B N     1 
ATOM   2833 C  CA    . ARG B 1 119 ? -7.070  13.008 -20.521 1.00 21.29  ? 119 ARG B CA    1 
ATOM   2834 C  C     . ARG B 1 119 ? -6.260  12.960 -19.244 1.00 20.39  ? 119 ARG B C     1 
ATOM   2835 O  O     . ARG B 1 119 ? -5.056  12.748 -19.245 1.00 30.93  ? 119 ARG B O     1 
ATOM   2836 C  CB    . ARG B 1 119 ? -6.461  12.135 -21.625 1.00 24.73  ? 119 ARG B CB    1 
ATOM   2837 C  CG    . ARG B 1 119 ? -6.920  12.536 -23.037 1.00 31.65  ? 119 ARG B CG    1 
ATOM   2838 C  CD    . ARG B 1 119 ? -6.251  11.745 -24.175 1.00 25.32  ? 119 ARG B CD    1 
ATOM   2839 N  NE    . ARG B 1 119 ? -7.036  11.836 -25.408 1.00 39.52  ? 119 ARG B NE    1 
ATOM   2840 C  CZ    . ARG B 1 119 ? -6.968  12.841 -26.282 1.00 66.55  ? 119 ARG B CZ    1 
ATOM   2841 N  NH1   . ARG B 1 119 ? -6.134  13.856 -26.075 1.00 44.76  ? 119 ARG B NH1   1 
ATOM   2842 N  NH2   . ARG B 1 119 ? -7.738  12.833 -27.367 1.00 57.53  ? 119 ARG B NH2   1 
ATOM   2843 N  N     . ALA B 1 120 ? -6.976  13.019 -18.138 1.00 17.91  ? 120 ALA B N     1 
ATOM   2844 C  CA    . ALA B 1 120 ? -6.358  13.333 -16.872 1.00 27.15  ? 120 ALA B CA    1 
ATOM   2845 C  C     . ALA B 1 120 ? -6.209  12.077 -16.031 1.00 30.61  ? 120 ALA B C     1 
ATOM   2846 O  O     . ALA B 1 120 ? -7.138  11.275 -15.900 1.00 19.89  ? 120 ALA B O     1 
ATOM   2847 C  CB    . ALA B 1 120 ? -7.176  14.399 -16.138 1.00 14.16  ? 120 ALA B CB    1 
ATOM   2848 N  N     . GLU B 1 121 ? -5.023  11.914 -15.471 1.00 18.18  ? 121 GLU B N     1 
ATOM   2849 C  CA    . GLU B 1 121 ? -4.712  10.774 -14.639 1.00 17.95  ? 121 GLU B CA    1 
ATOM   2850 C  C     . GLU B 1 121 ? -4.591  11.231 -13.174 1.00 33.46  ? 121 GLU B C     1 
ATOM   2851 O  O     . GLU B 1 121 ? -3.720  12.036 -12.853 1.00 34.09  ? 121 GLU B O     1 
ATOM   2852 C  CB    . GLU B 1 121 ? -3.419  10.134 -15.142 1.00 27.01  ? 121 GLU B CB    1 
ATOM   2853 C  CG    . GLU B 1 121 ? -3.284  8.645  -14.898 1.00 64.24  ? 121 GLU B CG    1 
ATOM   2854 C  CD    . GLU B 1 121 ? -2.106  8.047  -15.651 1.00 49.64  ? 121 GLU B CD    1 
ATOM   2855 O  OE1   . GLU B 1 121 ? -1.933  8.377  -16.843 1.00 61.72  ? 121 GLU B OE1   1 
ATOM   2856 O  OE2   . GLU B 1 121 ? -1.347  7.253  -15.054 1.00 63.32  ? 121 GLU B OE2   1 
ATOM   2857 N  N     . ASP B 1 122 ? -5.490  10.773 -12.299 1.00 38.62  ? 122 ASP B N     1 
ATOM   2858 C  CA    . ASP B 1 122 ? -5.411  11.117 -10.871 1.00 42.20  ? 122 ASP B CA    1 
ATOM   2859 C  C     . ASP B 1 122 ? -5.548  9.875  -10.014 1.00 28.47  ? 122 ASP B C     1 
ATOM   2860 O  O     . ASP B 1 122 ? -6.633  9.307  -9.933  1.00 31.61  ? 122 ASP B O     1 
ATOM   2861 C  CB    . ASP B 1 122 ? -6.512  12.125 -10.486 1.00 38.87  ? 122 ASP B CB    1 
ATOM   2862 C  CG    . ASP B 1 122 ? -6.147  12.985 -9.261  1.00 34.62  ? 122 ASP B CG    1 
ATOM   2863 O  OD1   . ASP B 1 122 ? -5.188  12.668 -8.524  1.00 29.31  ? 122 ASP B OD1   1 
ATOM   2864 O  OD2   . ASP B 1 122 ? -6.843  13.989 -9.026  1.00 38.99  ? 122 ASP B OD2   1 
ATOM   2865 N  N     . TYR B 1 123 ? -4.477  9.459  -9.348  1.00 28.75  ? 123 TYR B N     1 
ATOM   2866 C  CA    . TYR B 1 123 ? -4.592  8.297  -8.468  1.00 28.21  ? 123 TYR B CA    1 
ATOM   2867 C  C     . TYR B 1 123 ? -4.739  8.671  -7.005  1.00 39.65  ? 123 TYR B C     1 
ATOM   2868 O  O     . TYR B 1 123 ? -4.938  7.809  -6.150  1.00 59.75  ? 123 TYR B O     1 
ATOM   2869 C  CB    . TYR B 1 123 ? -3.392  7.377  -8.649  1.00 38.56  ? 123 TYR B CB    1 
ATOM   2870 C  CG    . TYR B 1 123 ? -3.378  6.728  -10.005 1.00 60.10  ? 123 TYR B CG    1 
ATOM   2871 C  CD1   . TYR B 1 123 ? -4.565  6.472  -10.675 1.00 46.38  ? 123 TYR B CD1   1 
ATOM   2872 C  CD2   . TYR B 1 123 ? -2.185  6.389  -10.627 1.00 49.95  ? 123 TYR B CD2   1 
ATOM   2873 C  CE1   . TYR B 1 123 ? -4.567  5.895  -11.919 1.00 53.80  ? 123 TYR B CE1   1 
ATOM   2874 C  CE2   . TYR B 1 123 ? -2.178  5.810  -11.875 1.00 64.58  ? 123 TYR B CE2   1 
ATOM   2875 C  CZ    . TYR B 1 123 ? -3.372  5.566  -12.516 1.00 61.63  ? 123 TYR B CZ    1 
ATOM   2876 O  OH    . TYR B 1 123 ? -3.375  4.984  -13.758 1.00 82.17  ? 123 TYR B OH    1 
ATOM   2877 N  N     . GLU B 1 124 ? -4.663  9.961  -6.723  1.00 30.89  ? 124 GLU B N     1 
ATOM   2878 C  CA    . GLU B 1 124 ? -4.581  10.416 -5.353  1.00 33.52  ? 124 GLU B CA    1 
ATOM   2879 C  C     . GLU B 1 124 ? -5.918  10.948 -4.879  1.00 36.22  ? 124 GLU B C     1 
ATOM   2880 O  O     . GLU B 1 124 ? -6.656  11.541 -5.658  1.00 40.54  ? 124 GLU B O     1 
ATOM   2881 C  CB    . GLU B 1 124 ? -3.491  11.476 -5.226  1.00 31.78  ? 124 GLU B CB    1 
ATOM   2882 C  CG    . GLU B 1 124 ? -2.073  10.901 -5.119  1.00 33.95  ? 124 GLU B CG    1 
ATOM   2883 C  CD    . GLU B 1 124 ? -1.714  10.443 -3.704  1.00 84.63  ? 124 GLU B CD    1 
ATOM   2884 O  OE1   . GLU B 1 124 ? -2.584  10.507 -2.793  1.00 65.09  ? 124 GLU B OE1   1 
ATOM   2885 O  OE2   . GLU B 1 124 ? -0.547  10.028 -3.510  1.00 58.50  ? 124 GLU B OE2   1 
ATOM   2886 N  N     . GLU B 1 125 ? -6.246  10.719 -3.609  1.00 23.71  ? 125 GLU B N     1 
ATOM   2887 C  CA    . GLU B 1 125 ? -7.482  11.273 -3.084  1.00 42.13  ? 125 GLU B CA    1 
ATOM   2888 C  C     . GLU B 1 125 ? -7.242  12.129 -1.843  1.00 34.28  ? 125 GLU B C     1 
ATOM   2889 O  O     . GLU B 1 125 ? -6.170  12.084 -1.241  1.00 34.09  ? 125 GLU B O     1 
ATOM   2890 C  CB    . GLU B 1 125 ? -8.493  10.166 -2.809  1.00 33.85  ? 125 GLU B CB    1 
ATOM   2891 C  CG    . GLU B 1 125 ? -8.157  9.205  -1.726  1.00 47.03  ? 125 GLU B CG    1 
ATOM   2892 C  CD    . GLU B 1 125 ? -9.121  8.039  -1.741  1.00 94.35  ? 125 GLU B CD    1 
ATOM   2893 O  OE1   . GLU B 1 125 ? -9.498  7.631  -2.864  1.00 55.66  ? 125 GLU B OE1   1 
ATOM   2894 O  OE2   . GLU B 1 125 ? -9.508  7.544  -0.655  1.00 82.71  ? 125 GLU B OE2   1 
ATOM   2895 N  N     . LEU B 1 126 ? -8.235  12.949 -1.509  1.00 22.83  ? 126 LEU B N     1 
ATOM   2896 C  CA    . LEU B 1 126 ? -8.068  14.001 -0.514  1.00 26.99  ? 126 LEU B CA    1 
ATOM   2897 C  C     . LEU B 1 126 ? -7.823  13.458 0.892   1.00 21.56  ? 126 LEU B C     1 
ATOM   2898 O  O     . LEU B 1 126 ? -8.399  12.446 1.293   1.00 31.24  ? 126 LEU B O     1 
ATOM   2899 C  CB    . LEU B 1 126 ? -9.299  14.920 -0.512  1.00 20.55  ? 126 LEU B CB    1 
ATOM   2900 C  CG    . LEU B 1 126 ? -9.191  16.187 0.337   1.00 9.65   ? 126 LEU B CG    1 
ATOM   2901 C  CD1   . LEU B 1 126 ? -8.039  17.066 -0.121  1.00 14.61  ? 126 LEU B CD1   1 
ATOM   2902 C  CD2   . LEU B 1 126 ? -10.472 16.958 0.299   1.00 14.98  ? 126 LEU B CD2   1 
ATOM   2903 N  N     . ALA B 1 127 ? -6.937  14.132 1.620   1.00 17.01  ? 127 ALA B N     1 
ATOM   2904 C  CA    . ALA B 1 127 ? -6.702  13.864 3.040   1.00 14.06  ? 127 ALA B CA    1 
ATOM   2905 C  C     . ALA B 1 127 ? -6.985  15.109 3.882   1.00 32.23  ? 127 ALA B C     1 
ATOM   2906 O  O     . ALA B 1 127 ? -6.203  16.059 3.888   1.00 28.66  ? 127 ALA B O     1 
ATOM   2907 C  CB    . ALA B 1 127 ? -5.280  13.407 3.263   1.00 6.42   ? 127 ALA B CB    1 
ATOM   2908 N  N     . LEU B 1 128 ? -8.077  15.071 4.636   1.00 31.83  ? 128 LEU B N     1 
ATOM   2909 C  CA    . LEU B 1 128 ? -8.577  16.251 5.321   1.00 16.26  ? 128 LEU B CA    1 
ATOM   2910 C  C     . LEU B 1 128 ? -8.675  16.012 6.818   1.00 23.12  ? 128 LEU B C     1 
ATOM   2911 O  O     . LEU B 1 128 ? -9.189  14.980 7.258   1.00 20.89  ? 128 LEU B O     1 
ATOM   2912 C  CB    . LEU B 1 128 ? -9.946  16.641 4.746   1.00 11.73  ? 128 LEU B CB    1 
ATOM   2913 C  CG    . LEU B 1 128 ? -10.702 17.789 5.412   1.00 19.81  ? 128 LEU B CG    1 
ATOM   2914 C  CD1   . LEU B 1 128 ? -11.519 18.534 4.396   1.00 19.63  ? 128 LEU B CD1   1 
ATOM   2915 C  CD2   . LEU B 1 128 ? -11.608 17.287 6.518   1.00 35.27  ? 128 LEU B CD2   1 
ATOM   2916 N  N     . THR B 1 129 ? -8.207  16.978 7.596   1.00 13.61  ? 129 THR B N     1 
ATOM   2917 C  CA    . THR B 1 129 ? -8.307  16.887 9.046   1.00 32.73  ? 129 THR B CA    1 
ATOM   2918 C  C     . THR B 1 129 ? -9.116  18.072 9.538   1.00 28.65  ? 129 THR B C     1 
ATOM   2919 O  O     . THR B 1 129 ? -9.273  19.043 8.803   1.00 28.15  ? 129 THR B O     1 
ATOM   2920 C  CB    . THR B 1 129 ? -6.926  16.860 9.732   1.00 22.65  ? 129 THR B CB    1 
ATOM   2921 O  OG1   . THR B 1 129 ? -7.102  16.752 11.150  1.00 67.70  ? 129 THR B OG1   1 
ATOM   2922 C  CG2   . THR B 1 129 ? -6.156  18.123 9.441   1.00 13.87  ? 129 THR B CG2   1 
ATOM   2923 N  N     . GLY B 1 130 ? -9.640  17.981 10.762  1.00 24.04  ? 130 GLY B N     1 
ATOM   2924 C  CA    . GLY B 1 130 ? -10.477 19.026 11.337  1.00 16.25  ? 130 GLY B CA    1 
ATOM   2925 C  C     . GLY B 1 130 ? -11.967 18.763 11.152  1.00 20.63  ? 130 GLY B C     1 
ATOM   2926 O  O     . GLY B 1 130 ? -12.795 19.669 11.252  1.00 10.58  ? 130 GLY B O     1 
ATOM   2927 N  N     . SER B 1 131 ? -12.295 17.513 10.835  1.00 26.08  ? 131 SER B N     1 
ATOM   2928 C  CA    . SER B 1 131 ? -13.673 17.041 10.702  1.00 18.61  ? 131 SER B CA    1 
ATOM   2929 C  C     . SER B 1 131 ? -14.330 16.878 12.054  1.00 23.01  ? 131 SER B C     1 
ATOM   2930 O  O     . SER B 1 131 ? -13.639 16.866 13.074  1.00 27.00  ? 131 SER B O     1 
ATOM   2931 C  CB    . SER B 1 131 ? -13.707 15.718 9.948   1.00 16.75  ? 131 SER B CB    1 
ATOM   2932 O  OG    . SER B 1 131 ? -12.639 14.891 10.364  1.00 33.92  ? 131 SER B OG    1 
ATOM   2933 N  N     . GLU B 1 132 ? -15.658 16.772 12.088  1.00 27.96  ? 132 GLU B N     1 
ATOM   2934 C  CA    . GLU B 1 132 ? -16.292 16.498 13.376  1.00 43.55  ? 132 GLU B CA    1 
ATOM   2935 C  C     . GLU B 1 132 ? -16.060 15.032 13.734  1.00 32.87  ? 132 GLU B C     1 
ATOM   2936 O  O     . GLU B 1 132 ? -16.126 14.666 14.902  1.00 38.92  ? 132 GLU B O     1 
ATOM   2937 C  CB    . GLU B 1 132 ? -17.805 16.795 13.403  1.00 19.50  ? 132 GLU B CB    1 
ATOM   2938 C  CG    . GLU B 1 132 ? -18.656 15.611 13.005  1.00 20.29  ? 132 GLU B CG    1 
ATOM   2939 C  CD    . GLU B 1 132 ? -19.933 15.438 13.818  1.00 54.37  ? 132 GLU B CD    1 
ATOM   2940 O  OE1   . GLU B 1 132 ? -20.291 14.267 14.082  1.00 54.84  ? 132 GLU B OE1   1 
ATOM   2941 O  OE2   . GLU B 1 132 ? -20.591 16.444 14.169  1.00 50.36  ? 132 GLU B OE2   1 
ATOM   2942 N  N     . ALA B 1 133 ? -15.791 14.188 12.743  1.00 28.56  ? 133 ALA B N     1 
ATOM   2943 C  CA    . ALA B 1 133 ? -15.527 12.792 13.059  1.00 31.41  ? 133 ALA B CA    1 
ATOM   2944 C  C     . ALA B 1 133 ? -14.285 12.745 13.930  1.00 33.75  ? 133 ALA B C     1 
ATOM   2945 O  O     . ALA B 1 133 ? -14.237 11.992 14.898  1.00 33.75  ? 133 ALA B O     1 
ATOM   2946 C  CB    . ALA B 1 133 ? -15.350 11.963 11.817  1.00 4.47   ? 133 ALA B CB    1 
ATOM   2947 N  N     . GLU B 1 134 ? -13.310 13.595 13.604  1.00 23.65  ? 134 GLU B N     1 
ATOM   2948 C  CA    . GLU B 1 134 ? -12.065 13.683 14.357  1.00 25.71  ? 134 GLU B CA    1 
ATOM   2949 C  C     . GLU B 1 134 ? -12.277 14.314 15.728  1.00 30.70  ? 134 GLU B C     1 
ATOM   2950 O  O     . GLU B 1 134 ? -11.503 14.054 16.653  1.00 19.79  ? 134 GLU B O     1 
ATOM   2951 C  CB    . GLU B 1 134 ? -11.011 14.457 13.569  1.00 30.97  ? 134 GLU B CB    1 
ATOM   2952 C  CG    . GLU B 1 134 ? -10.671 13.792 12.243  1.00 56.36  ? 134 GLU B CG    1 
ATOM   2953 C  CD    . GLU B 1 134 ? -9.311  14.178 11.684  1.00 69.55  ? 134 GLU B CD    1 
ATOM   2954 O  OE1   . GLU B 1 134 ? -8.459  14.682 12.448  1.00 61.69  ? 134 GLU B OE1   1 
ATOM   2955 O  OE2   . GLU B 1 134 ? -9.108  13.987 10.463  1.00 68.58  ? 134 GLU B OE2   1 
ATOM   2956 N  N     . MET B 1 135 ? -13.319 15.132 15.866  1.00 25.03  ? 135 MET B N     1 
ATOM   2957 C  CA    . MET B 1 135 ? -13.718 15.608 17.188  1.00 23.73  ? 135 MET B CA    1 
ATOM   2958 C  C     . MET B 1 135 ? -14.124 14.405 18.036  1.00 36.56  ? 135 MET B C     1 
ATOM   2959 O  O     . MET B 1 135 ? -13.687 14.256 19.183  1.00 26.30  ? 135 MET B O     1 
ATOM   2960 C  CB    . MET B 1 135 ? -14.870 16.617 17.109  1.00 15.19  ? 135 MET B CB    1 
ATOM   2961 C  CG    . MET B 1 135 ? -14.442 18.085 17.130  1.00 37.58  ? 135 MET B CG    1 
ATOM   2962 S  SD    . MET B 1 135 ? -15.825 19.235 16.892  1.00 42.06  ? 135 MET B SD    1 
ATOM   2963 C  CE    . MET B 1 135 ? -16.401 19.488 18.565  1.00 34.76  ? 135 MET B CE    1 
ATOM   2964 N  N     . ALA B 1 136 ? -14.943 13.534 17.452  1.00 16.99  ? 136 ALA B N     1 
ATOM   2965 C  CA    . ALA B 1 136 ? -15.402 12.343 18.152  1.00 25.11  ? 136 ALA B CA    1 
ATOM   2966 C  C     . ALA B 1 136 ? -14.230 11.423 18.501  1.00 34.05  ? 136 ALA B C     1 
ATOM   2967 O  O     . ALA B 1 136 ? -14.148 10.924 19.621  1.00 26.23  ? 136 ALA B O     1 
ATOM   2968 C  CB    . ALA B 1 136 ? -16.434 11.605 17.320  1.00 10.47  ? 136 ALA B CB    1 
ATOM   2969 N  N     . GLU B 1 137 ? -13.328 11.201 17.546  1.00 21.53  ? 137 GLU B N     1 
ATOM   2970 C  CA    . GLU B 1 137 ? -12.125 10.425 17.812  1.00 33.21  ? 137 GLU B CA    1 
ATOM   2971 C  C     . GLU B 1 137 ? -11.377 11.033 19.000  1.00 31.18  ? 137 GLU B C     1 
ATOM   2972 O  O     . GLU B 1 137 ? -10.895 10.330 19.868  1.00 20.77  ? 137 GLU B O     1 
ATOM   2973 C  CB    . GLU B 1 137 ? -11.215 10.369 16.579  1.00 22.85  ? 137 GLU B CB    1 
ATOM   2974 C  CG    . GLU B 1 137 ? -11.557 9.278  15.565  1.00 24.05  ? 137 GLU B CG    1 
ATOM   2975 C  CD    . GLU B 1 137 ? -10.834 9.475  14.215  1.00 97.70  ? 137 GLU B CD    1 
ATOM   2976 O  OE1   . GLU B 1 137 ? -9.736  10.083 14.210  1.00 95.27  ? 137 GLU B OE1   1 
ATOM   2977 O  OE2   . GLU B 1 137 ? -11.364 9.034  13.160  1.00 47.73  ? 137 GLU B OE2   1 
ATOM   2978 N  N     . LEU B 1 138 ? -11.299 12.351 19.048  1.00 20.33  ? 138 LEU B N     1 
ATOM   2979 C  CA    . LEU B 1 138 ? -10.579 13.004 20.121  1.00 11.41  ? 138 LEU B CA    1 
ATOM   2980 C  C     . LEU B 1 138 ? -11.229 12.739 21.464  1.00 23.68  ? 138 LEU B C     1 
ATOM   2981 O  O     . LEU B 1 138 ? -10.560 12.641 22.488  1.00 23.77  ? 138 LEU B O     1 
ATOM   2982 C  CB    . LEU B 1 138 ? -10.523 14.502 19.876  1.00 14.46  ? 138 LEU B CB    1 
ATOM   2983 C  CG    . LEU B 1 138 ? -9.958  15.265 21.061  1.00 19.35  ? 138 LEU B CG    1 
ATOM   2984 C  CD1   . LEU B 1 138 ? -8.527  14.831 21.277  1.00 31.96  ? 138 LEU B CD1   1 
ATOM   2985 C  CD2   . LEU B 1 138 ? -10.060 16.743 20.834  1.00 21.51  ? 138 LEU B CD2   1 
ATOM   2986 N  N     . ILE B 1 139 ? -12.550 12.652 21.450  1.00 22.57  ? 139 ILE B N     1 
ATOM   2987 C  CA    . ILE B 1 139 ? -13.322 12.603 22.683  1.00 28.72  ? 139 ILE B CA    1 
ATOM   2988 C  C     . ILE B 1 139 ? -13.286 11.195 23.245  1.00 30.91  ? 139 ILE B C     1 
ATOM   2989 O  O     . ILE B 1 139 ? -13.114 10.993 24.449  1.00 32.70  ? 139 ILE B O     1 
ATOM   2990 C  CB    . ILE B 1 139 ? -14.782 13.076 22.441  1.00 32.57  ? 139 ILE B CB    1 
ATOM   2991 C  CG1   . ILE B 1 139 ? -14.814 14.591 22.299  1.00 8.83   ? 139 ILE B CG1   1 
ATOM   2992 C  CG2   . ILE B 1 139 ? -15.728 12.644 23.567  1.00 10.42  ? 139 ILE B CG2   1 
ATOM   2993 C  CD1   . ILE B 1 139 ? -16.118 15.088 21.811  1.00 20.55  ? 139 ILE B CD1   1 
ATOM   2994 N  N     . PHE B 1 140 ? -13.418 10.215 22.362  1.00 28.40  ? 140 PHE B N     1 
ATOM   2995 C  CA    . PHE B 1 140 ? -13.349 8.831  22.787  1.00 26.05  ? 140 PHE B CA    1 
ATOM   2996 C  C     . PHE B 1 140 ? -11.952 8.448  23.274  1.00 25.01  ? 140 PHE B C     1 
ATOM   2997 O  O     . PHE B 1 140 ? -11.827 7.557  24.111  1.00 59.85  ? 140 PHE B O     1 
ATOM   2998 C  CB    . PHE B 1 140 ? -13.775 7.906  21.663  1.00 4.41   ? 140 PHE B CB    1 
ATOM   2999 C  CG    . PHE B 1 140 ? -15.232 7.572  21.671  1.00 11.22  ? 140 PHE B CG    1 
ATOM   3000 C  CD1   . PHE B 1 140 ? -16.159 8.423  21.073  1.00 20.21  ? 140 PHE B CD1   1 
ATOM   3001 C  CD2   . PHE B 1 140 ? -15.679 6.391  22.245  1.00 5.41   ? 140 PHE B CD2   1 
ATOM   3002 C  CE1   . PHE B 1 140 ? -17.513 8.097  21.058  1.00 32.40  ? 140 PHE B CE1   1 
ATOM   3003 C  CE2   . PHE B 1 140 ? -17.032 6.057  22.239  1.00 9.14   ? 140 PHE B CE2   1 
ATOM   3004 C  CZ    . PHE B 1 140 ? -17.951 6.909  21.647  1.00 29.12  ? 140 PHE B CZ    1 
ATOM   3005 N  N     . GLU B 1 141 ? -10.914 9.103  22.754  1.00 10.39  ? 141 GLU B N     1 
ATOM   3006 C  CA    . GLU B 1 141 ? -9.546  8.841  23.208  1.00 23.56  ? 141 GLU B CA    1 
ATOM   3007 C  C     . GLU B 1 141 ? -9.259  9.577  24.497  1.00 25.00  ? 141 GLU B C     1 
ATOM   3008 O  O     . GLU B 1 141 ? -8.394  9.181  25.278  1.00 35.89  ? 141 GLU B O     1 
ATOM   3009 C  CB    . GLU B 1 141 ? -8.500  9.249  22.157  1.00 24.82  ? 141 GLU B CB    1 
ATOM   3010 C  CG    . GLU B 1 141 ? -8.620  8.568  20.796  1.00 55.90  ? 141 GLU B CG    1 
ATOM   3011 C  CD    . GLU B 1 141 ? -7.652  9.151  19.773  1.00 84.71  ? 141 GLU B CD    1 
ATOM   3012 O  OE1   . GLU B 1 141 ? -6.907  10.091 20.133  1.00 70.11  ? 141 GLU B OE1   1 
ATOM   3013 O  OE2   . GLU B 1 141 ? -7.657  8.693  18.606  1.00 68.64  ? 141 GLU B OE2   1 
ATOM   3014 N  N     . ASN B 1 142 ? -9.954  10.687 24.685  1.00 28.94  ? 142 ASN B N     1 
ATOM   3015 C  CA    . ASN B 1 142 ? -9.621  11.586 25.768  1.00 31.05  ? 142 ASN B CA    1 
ATOM   3016 C  C     . ASN B 1 142 ? -10.832 12.306 26.352  1.00 28.10  ? 142 ASN B C     1 
ATOM   3017 O  O     . ASN B 1 142 ? -10.966 13.513 26.185  1.00 26.46  ? 142 ASN B O     1 
ATOM   3018 C  CB    . ASN B 1 142 ? -8.593  12.593 25.269  1.00 24.70  ? 142 ASN B CB    1 
ATOM   3019 C  CG    . ASN B 1 142 ? -7.645  13.019 26.344  1.00 69.46  ? 142 ASN B CG    1 
ATOM   3020 O  OD1   . ASN B 1 142 ? -7.850  14.052 26.992  1.00 41.60  ? 142 ASN B OD1   1 
ATOM   3021 N  ND2   . ASN B 1 142 ? -6.593  12.223 26.557  1.00 82.09  ? 142 ASN B ND2   1 
ATOM   3022 N  N     . PRO B 1 143 ? -11.697 11.574 27.068  1.00 24.85  ? 143 PRO B N     1 
ATOM   3023 C  CA    . PRO B 1 143 ? -13.015 12.082 27.455  1.00 19.57  ? 143 PRO B CA    1 
ATOM   3024 C  C     . PRO B 1 143 ? -12.988 13.329 28.327  1.00 24.17  ? 143 PRO B C     1 
ATOM   3025 O  O     . PRO B 1 143 ? -13.987 14.056 28.363  1.00 22.41  ? 143 PRO B O     1 
ATOM   3026 C  CB    . PRO B 1 143 ? -13.624 10.910 28.219  1.00 20.13  ? 143 PRO B CB    1 
ATOM   3027 C  CG    . PRO B 1 143 ? -12.906 9.731  27.734  1.00 25.55  ? 143 PRO B CG    1 
ATOM   3028 C  CD    . PRO B 1 143 ? -11.508 10.187 27.508  1.00 27.38  ? 143 PRO B CD    1 
ATOM   3029 N  N     . GLU B 1 144 ? -11.871 13.592 28.995  1.00 21.00  ? 144 GLU B N     1 
ATOM   3030 C  CA    . GLU B 1 144 ? -11.794 14.735 29.909  1.00 38.55  ? 144 GLU B CA    1 
ATOM   3031 C  C     . GLU B 1 144 ? -11.931 16.087 29.210  1.00 35.76  ? 144 GLU B C     1 
ATOM   3032 O  O     . GLU B 1 144 ? -12.159 17.102 29.877  1.00 49.39  ? 144 GLU B O     1 
ATOM   3033 C  CB    . GLU B 1 144 ? -10.484 14.706 30.710  1.00 49.14  ? 144 GLU B CB    1 
ATOM   3034 C  CG    . GLU B 1 144 ? -9.221  14.569 29.874  1.00 78.24  ? 144 GLU B CG    1 
ATOM   3035 C  CD    . GLU B 1 144 ? -8.932  13.128 29.486  1.00 90.86  ? 144 GLU B CD    1 
ATOM   3036 O  OE1   . GLU B 1 144 ? -9.886  12.405 29.123  1.00 55.70  ? 144 GLU B OE1   1 
ATOM   3037 O  OE2   . GLU B 1 144 ? -7.751  12.721 29.543  1.00 109.84 ? 144 GLU B OE2   1 
ATOM   3038 N  N     . VAL B 1 145 ? -11.801 16.110 27.884  1.00 14.78  ? 145 VAL B N     1 
ATOM   3039 C  CA    . VAL B 1 145 ? -12.029 17.345 27.147  1.00 21.61  ? 145 VAL B CA    1 
ATOM   3040 C  C     . VAL B 1 145 ? -13.483 17.779 27.268  1.00 26.10  ? 145 VAL B C     1 
ATOM   3041 O  O     . VAL B 1 145 ? -13.803 18.944 27.050  1.00 42.43  ? 145 VAL B O     1 
ATOM   3042 C  CB    . VAL B 1 145 ? -11.669 17.215 25.666  1.00 15.50  ? 145 VAL B CB    1 
ATOM   3043 C  CG1   . VAL B 1 145 ? -10.265 16.671 25.529  1.00 17.18  ? 145 VAL B CG1   1 
ATOM   3044 C  CG2   . VAL B 1 145 ? -12.681 16.339 24.939  1.00 22.53  ? 145 VAL B CG2   1 
ATOM   3045 N  N     . ILE B 1 146 ? -14.359 16.838 27.613  1.00 20.39  ? 146 ILE B N     1 
ATOM   3046 C  CA    . ILE B 1 146 ? -15.738 17.162 27.961  1.00 18.43  ? 146 ILE B CA    1 
ATOM   3047 C  C     . ILE B 1 146 ? -15.843 17.580 29.415  1.00 27.76  ? 146 ILE B C     1 
ATOM   3048 O  O     . ILE B 1 146 ? -16.198 18.719 29.734  1.00 43.02  ? 146 ILE B O     1 
ATOM   3049 C  CB    . ILE B 1 146 ? -16.672 15.990 27.761  1.00 13.43  ? 146 ILE B CB    1 
ATOM   3050 C  CG1   . ILE B 1 146 ? -16.594 15.465 26.323  1.00 36.84  ? 146 ILE B CG1   1 
ATOM   3051 C  CG2   . ILE B 1 146 ? -18.055 16.432 28.075  1.00 6.71   ? 146 ILE B CG2   1 
ATOM   3052 C  CD1   . ILE B 1 146 ? -17.147 16.406 25.277  1.00 15.79  ? 146 ILE B CD1   1 
ATOM   3053 N  N     . GLU B 1 147 ? -15.519 16.634 30.289  1.00 27.16  ? 147 GLU B N     1 
ATOM   3054 C  CA    . GLU B 1 147 ? -15.464 16.865 31.725  1.00 28.84  ? 147 GLU B CA    1 
ATOM   3055 C  C     . GLU B 1 147 ? -14.950 15.599 32.410  1.00 33.59  ? 147 GLU B C     1 
ATOM   3056 O  O     . GLU B 1 147 ? -14.961 14.517 31.814  1.00 24.11  ? 147 GLU B O     1 
ATOM   3057 C  CB    . GLU B 1 147 ? -16.840 17.269 32.273  1.00 13.48  ? 147 GLU B CB    1 
ATOM   3058 C  CG    . GLU B 1 147 ? -17.878 16.165 32.290  1.00 13.12  ? 147 GLU B CG    1 
ATOM   3059 C  CD    . GLU B 1 147 ? -19.177 16.641 32.906  1.00 27.73  ? 147 GLU B CD    1 
ATOM   3060 O  OE1   . GLU B 1 147 ? -20.136 15.846 32.999  1.00 23.72  ? 147 GLU B OE1   1 
ATOM   3061 O  OE2   . GLU B 1 147 ? -19.240 17.823 33.306  1.00 53.08  ? 147 GLU B OE2   1 
ATOM   3062 N  N     . PRO B 1 148 ? -14.473 15.733 33.659  1.00 37.45  ? 148 PRO B N     1 
ATOM   3063 C  CA    . PRO B 1 148 ? -13.980 14.589 34.435  1.00 19.24  ? 148 PRO B CA    1 
ATOM   3064 C  C     . PRO B 1 148 ? -14.995 13.477 34.596  1.00 17.78  ? 148 PRO B C     1 
ATOM   3065 O  O     . PRO B 1 148 ? -16.169 13.718 34.886  1.00 29.23  ? 148 PRO B O     1 
ATOM   3066 C  CB    . PRO B 1 148 ? -13.658 15.208 35.776  1.00 10.01  ? 148 PRO B CB    1 
ATOM   3067 C  CG    . PRO B 1 148 ? -13.258 16.609 35.427  1.00 20.10  ? 148 PRO B CG    1 
ATOM   3068 C  CD    . PRO B 1 148 ? -14.219 17.005 34.356  1.00 19.50  ? 148 PRO B CD    1 
ATOM   3069 N  N     . GLY B 1 149 ? -14.536 12.256 34.374  1.00 18.42  ? 149 GLY B N     1 
ATOM   3070 C  CA    . GLY B 1 149 ? -15.366 11.090 34.582  1.00 15.71  ? 149 GLY B CA    1 
ATOM   3071 C  C     . GLY B 1 149 ? -16.404 10.900 33.513  1.00 17.74  ? 149 GLY B C     1 
ATOM   3072 O  O     . GLY B 1 149 ? -17.367 10.162 33.692  1.00 39.51  ? 149 GLY B O     1 
ATOM   3073 N  N     . PHE B 1 150 ? -16.222 11.559 32.382  1.00 25.79  ? 150 PHE B N     1 
ATOM   3074 C  CA    . PHE B 1 150 ? -17.138 11.304 31.292  1.00 23.16  ? 150 PHE B CA    1 
ATOM   3075 C  C     . PHE B 1 150 ? -16.799 9.960  30.654  1.00 20.61  ? 150 PHE B C     1 
ATOM   3076 O  O     . PHE B 1 150 ? -15.629 9.633  30.467  1.00 18.62  ? 150 PHE B O     1 
ATOM   3077 C  CB    . PHE B 1 150 ? -17.102 12.427 30.261  1.00 14.28  ? 150 PHE B CB    1 
ATOM   3078 C  CG    . PHE B 1 150 ? -18.002 12.173 29.099  1.00 27.60  ? 150 PHE B CG    1 
ATOM   3079 C  CD1   . PHE B 1 150 ? -19.359 12.004 29.296  1.00 19.46  ? 150 PHE B CD1   1 
ATOM   3080 C  CD2   . PHE B 1 150 ? -17.496 12.064 27.817  1.00 17.00  ? 150 PHE B CD2   1 
ATOM   3081 C  CE1   . PHE B 1 150 ? -20.193 11.744 28.236  1.00 25.94  ? 150 PHE B CE1   1 
ATOM   3082 C  CE2   . PHE B 1 150 ? -18.332 11.797 26.762  1.00 14.72  ? 150 PHE B CE2   1 
ATOM   3083 C  CZ    . PHE B 1 150 ? -19.680 11.636 26.973  1.00 11.38  ? 150 PHE B CZ    1 
ATOM   3084 N  N     . LYS B 1 151 ? -17.816 9.171  30.338  1.00 17.05  ? 151 LYS B N     1 
ATOM   3085 C  CA    . LYS B 1 151 ? -17.574 7.875  29.709  1.00 31.78  ? 151 LYS B CA    1 
ATOM   3086 C  C     . LYS B 1 151 ? -18.320 7.736  28.372  1.00 31.53  ? 151 LYS B C     1 
ATOM   3087 O  O     . LYS B 1 151 ? -19.483 7.342  28.328  1.00 23.79  ? 151 LYS B O     1 
ATOM   3088 C  CB    . LYS B 1 151 ? -17.959 6.726  30.656  1.00 32.25  ? 151 LYS B CB    1 
ATOM   3089 C  CG    . LYS B 1 151 ? -17.283 6.761  32.040  1.00 66.97  ? 151 LYS B CG    1 
ATOM   3090 C  CD    . LYS B 1 151 ? -15.760 6.582  31.992  1.00 33.61  ? 151 LYS B CD    1 
ATOM   3091 C  CE    . LYS B 1 151 ? -15.131 6.844  33.364  1.00 38.86  ? 151 LYS B CE    1 
ATOM   3092 N  NZ    . LYS B 1 151 ? -13.958 7.776  33.288  1.00 62.68  ? 151 LYS B NZ    1 
ATOM   3093 N  N     . PRO B 1 152 ? -17.645 8.082  27.272  1.00 34.04  ? 152 PRO B N     1 
ATOM   3094 C  CA    . PRO B 1 152 ? -18.179 7.875  25.922  1.00 27.20  ? 152 PRO B CA    1 
ATOM   3095 C  C     . PRO B 1 152 ? -18.426 6.402  25.634  1.00 17.02  ? 152 PRO B C     1 
ATOM   3096 O  O     . PRO B 1 152 ? -17.554 5.604  25.934  1.00 38.98  ? 152 PRO B O     1 
ATOM   3097 C  CB    . PRO B 1 152 ? -17.072 8.422  25.023  1.00 13.56  ? 152 PRO B CB    1 
ATOM   3098 C  CG    . PRO B 1 152 ? -15.850 8.398  25.865  1.00 20.32  ? 152 PRO B CG    1 
ATOM   3099 C  CD    . PRO B 1 152 ? -16.312 8.704  27.244  1.00 16.23  ? 152 PRO B CD    1 
ATOM   3100 N  N     . LEU B 1 153 ? -19.574 6.061  25.049  1.00 18.96  ? 153 LEU B N     1 
ATOM   3101 C  CA    . LEU B 1 153 ? -19.995 4.664  24.857  1.00 23.30  ? 153 LEU B CA    1 
ATOM   3102 C  C     . LEU B 1 153 ? -20.267 4.367  23.402  1.00 23.08  ? 153 LEU B C     1 
ATOM   3103 O  O     . LEU B 1 153 ? -19.694 3.454  22.834  1.00 33.00  ? 153 LEU B O     1 
ATOM   3104 C  CB    . LEU B 1 153 ? -21.235 4.330  25.694  1.00 23.03  ? 153 LEU B CB    1 
ATOM   3105 C  CG    . LEU B 1 153 ? -21.015 4.629  27.187  1.00 20.11  ? 153 LEU B CG    1 
ATOM   3106 C  CD1   . LEU B 1 153 ? -22.235 4.286  28.000  1.00 18.17  ? 153 LEU B CD1   1 
ATOM   3107 C  CD2   . LEU B 1 153 ? -19.772 3.940  27.732  1.00 16.18  ? 153 LEU B CD2   1 
ATOM   3108 N  N     . PHE B 1 154 ? -21.184 5.112  22.810  1.00 32.53  ? 154 PHE B N     1 
ATOM   3109 C  CA    . PHE B 1 154 ? -21.497 4.925  21.406  1.00 24.42  ? 154 PHE B CA    1 
ATOM   3110 C  C     . PHE B 1 154 ? -21.215 6.137  20.549  1.00 22.35  ? 154 PHE B C     1 
ATOM   3111 O  O     . PHE B 1 154 ? -21.068 7.253  21.038  1.00 31.13  ? 154 PHE B O     1 
ATOM   3112 C  CB    . PHE B 1 154 ? -22.949 4.544  21.256  1.00 19.16  ? 154 PHE B CB    1 
ATOM   3113 C  CG    . PHE B 1 154 ? -23.371 3.502  22.213  1.00 41.29  ? 154 PHE B CG    1 
ATOM   3114 C  CD1   . PHE B 1 154 ? -23.030 2.187  22.005  1.00 26.85  ? 154 PHE B CD1   1 
ATOM   3115 C  CD2   . PHE B 1 154 ? -24.081 3.837  23.342  1.00 66.15  ? 154 PHE B CD2   1 
ATOM   3116 C  CE1   . PHE B 1 154 ? -23.415 1.223  22.879  1.00 18.25  ? 154 PHE B CE1   1 
ATOM   3117 C  CE2   . PHE B 1 154 ? -24.467 2.872  24.228  1.00 51.05  ? 154 PHE B CE2   1 
ATOM   3118 C  CZ    . PHE B 1 154 ? -24.140 1.563  23.990  1.00 26.99  ? 154 PHE B CZ    1 
ATOM   3119 N  N     . ARG B 1 155 ? -21.132 5.882  19.252  1.00 34.99  ? 155 ARG B N     1 
ATOM   3120 C  CA    . ARG B 1 155 ? -20.916 6.911  18.260  1.00 18.88  ? 155 ARG B CA    1 
ATOM   3121 C  C     . ARG B 1 155 ? -21.902 6.696  17.135  1.00 17.56  ? 155 ARG B C     1 
ATOM   3122 O  O     . ARG B 1 155 ? -22.142 5.557  16.729  1.00 36.12  ? 155 ARG B O     1 
ATOM   3123 C  CB    . ARG B 1 155 ? -19.493 6.851  17.758  1.00 27.29  ? 155 ARG B CB    1 
ATOM   3124 C  CG    . ARG B 1 155 ? -19.113 7.903  16.776  1.00 30.24  ? 155 ARG B CG    1 
ATOM   3125 C  CD    . ARG B 1 155 ? -17.628 8.028  16.886  1.00 67.35  ? 155 ARG B CD    1 
ATOM   3126 N  NE    . ARG B 1 155 ? -16.998 8.614  15.718  1.00 96.58  ? 155 ARG B NE    1 
ATOM   3127 C  CZ    . ARG B 1 155 ? -15.703 8.481  15.461  1.00 100.73 ? 155 ARG B CZ    1 
ATOM   3128 N  NH1   . ARG B 1 155 ? -14.933 7.768  16.297  1.00 42.23  ? 155 ARG B NH1   1 
ATOM   3129 N  NH2   . ARG B 1 155 ? -15.187 9.050  14.373  1.00 43.57  ? 155 ARG B NH2   1 
ATOM   3130 N  N     . GLU B 1 156 ? -22.483 7.787  16.647  1.00 26.24  ? 156 GLU B N     1 
ATOM   3131 C  CA    . GLU B 1 156 ? -23.559 7.721  15.661  1.00 29.05  ? 156 GLU B CA    1 
ATOM   3132 C  C     . GLU B 1 156 ? -24.588 6.670  16.100  1.00 15.31  ? 156 GLU B C     1 
ATOM   3133 O  O     . GLU B 1 156 ? -25.039 5.866  15.312  1.00 23.02  ? 156 GLU B O     1 
ATOM   3134 C  CB    . GLU B 1 156 ? -23.010 7.413  14.253  1.00 45.48  ? 156 GLU B CB    1 
ATOM   3135 C  CG    . GLU B 1 156 ? -22.120 8.510  13.597  1.00 19.39  ? 156 GLU B CG    1 
ATOM   3136 C  CD    . GLU B 1 156 ? -22.824 9.863  13.426  1.00 90.14  ? 156 GLU B CD    1 
ATOM   3137 O  OE1   . GLU B 1 156 ? -24.078 9.913  13.441  1.00 77.58  ? 156 GLU B OE1   1 
ATOM   3138 O  OE2   . GLU B 1 156 ? -22.115 10.883 13.265  1.00 116.27 ? 156 GLU B OE2   1 
ATOM   3139 N  N     . LYS B 1 157 ? -24.930 6.671  17.381  1.00 19.43  ? 157 LYS B N     1 
ATOM   3140 C  CA    . LYS B 1 157 ? -25.908 5.738  17.915  1.00 32.34  ? 157 LYS B CA    1 
ATOM   3141 C  C     . LYS B 1 157 ? -27.312 6.156  17.492  1.00 26.88  ? 157 LYS B C     1 
ATOM   3142 O  O     . LYS B 1 157 ? -27.708 7.307  17.681  1.00 38.60  ? 157 LYS B O     1 
ATOM   3143 C  CB    . LYS B 1 157 ? -25.789 5.668  19.454  1.00 32.06  ? 157 LYS B CB    1 
ATOM   3144 C  CG    . LYS B 1 157 ? -26.859 4.837  20.198  1.00 10.32  ? 157 LYS B CG    1 
ATOM   3145 C  CD    . LYS B 1 157 ? -27.050 3.464  19.570  1.00 31.75  ? 157 LYS B CD    1 
ATOM   3146 C  CE    . LYS B 1 157 ? -27.661 2.465  20.528  1.00 31.45  ? 157 LYS B CE    1 
ATOM   3147 N  NZ    . LYS B 1 157 ? -26.646 2.005  21.505  1.00 49.73  ? 157 LYS B NZ    1 
ATOM   3148 N  N     . ALA B 1 158 ? -28.067 5.225  16.921  1.00 20.61  ? 158 ALA B N     1 
ATOM   3149 C  CA    . ALA B 1 158 ? -29.481 5.484  16.661  1.00 19.50  ? 158 ALA B CA    1 
ATOM   3150 C  C     . ALA B 1 158 ? -30.320 5.289  17.896  1.00 23.53  ? 158 ALA B C     1 
ATOM   3151 O  O     . ALA B 1 158 ? -30.407 4.189  18.439  1.00 37.24  ? 158 ALA B O     1 
ATOM   3152 C  CB    . ALA B 1 158 ? -30.001 4.590  15.578  1.00 18.21  ? 158 ALA B CB    1 
ATOM   3153 N  N     . ILE B 1 159 ? -30.965 6.358  18.322  1.00 36.41  ? 159 ILE B N     1 
ATOM   3154 C  CA    . ILE B 1 159 ? -32.045 6.241  19.277  1.00 28.85  ? 159 ILE B CA    1 
ATOM   3155 C  C     . ILE B 1 159 ? -33.306 6.034  18.446  1.00 26.20  ? 159 ILE B C     1 
ATOM   3156 O  O     . ILE B 1 159 ? -33.223 5.714  17.265  1.00 33.96  ? 159 ILE B O     1 
ATOM   3157 C  CB    . ILE B 1 159 ? -32.134 7.461  20.182  1.00 25.19  ? 159 ILE B CB    1 
ATOM   3158 C  CG1   . ILE B 1 159 ? -32.330 8.721  19.358  1.00 24.38  ? 159 ILE B CG1   1 
ATOM   3159 C  CG2   . ILE B 1 159 ? -30.841 7.613  20.959  1.00 15.95  ? 159 ILE B CG2   1 
ATOM   3160 C  CD1   . ILE B 1 159 ? -32.281 9.956  20.199  1.00 34.63  ? 159 ILE B CD1   1 
ATOM   3161 N  N     . GLY B 1 160 ? -34.470 6.164  19.053  1.00 27.64  ? 160 GLY B N     1 
ATOM   3162 C  CA    . GLY B 1 160 ? -35.684 5.790  18.355  1.00 70.74  ? 160 GLY B CA    1 
ATOM   3163 C  C     . GLY B 1 160 ? -35.859 6.551  17.060  1.00 46.17  ? 160 GLY B C     1 
ATOM   3164 O  O     . GLY B 1 160 ? -36.058 5.979  15.989  1.00 29.15  ? 160 GLY B O     1 
ATOM   3165 N  N     . THR B 1 161 ? -35.786 7.866  17.181  1.00 53.84  ? 161 THR B N     1 
ATOM   3166 C  CA    . THR B 1 161 ? -35.961 8.753  16.055  1.00 35.10  ? 161 THR B CA    1 
ATOM   3167 C  C     . THR B 1 161 ? -34.796 9.730  16.053  1.00 41.43  ? 161 THR B C     1 
ATOM   3168 O  O     . THR B 1 161 ? -34.676 10.571 16.948  1.00 38.91  ? 161 THR B O     1 
ATOM   3169 C  CB    . THR B 1 161 ? -37.322 9.457  16.146  1.00 35.52  ? 161 THR B CB    1 
ATOM   3170 O  OG1   . THR B 1 161 ? -38.336 8.576  15.634  1.00 40.62  ? 161 THR B OG1   1 
ATOM   3171 C  CG2   . THR B 1 161 ? -37.330 10.761 15.374  1.00 45.79  ? 161 THR B CG2   1 
ATOM   3172 N  N     . GLY B 1 162 ? -33.932 9.608  15.048  1.00 35.02  ? 162 GLY B N     1 
ATOM   3173 C  CA    . GLY B 1 162 ? -32.660 10.317 15.049  1.00 13.50  ? 162 GLY B CA    1 
ATOM   3174 C  C     . GLY B 1 162 ? -31.422 9.467  15.304  1.00 14.47  ? 162 GLY B C     1 
ATOM   3175 O  O     . GLY B 1 162 ? -31.498 8.275  15.603  1.00 30.64  ? 162 GLY B O     1 
ATOM   3176 N  N     . ILE B 1 163 ? -30.261 10.084 15.131  1.00 17.98  ? 163 ILE B N     1 
ATOM   3177 C  CA    . ILE B 1 163 ? -28.982 9.435  15.390  1.00 13.35  ? 163 ILE B CA    1 
ATOM   3178 C  C     . ILE B 1 163 ? -28.072 10.412 16.129  1.00 29.96  ? 163 ILE B C     1 
ATOM   3179 O  O     . ILE B 1 163 ? -27.674 11.453 15.576  1.00 31.55  ? 163 ILE B O     1 
ATOM   3180 C  CB    . ILE B 1 163 ? -28.283 8.986  14.091  1.00 9.92   ? 163 ILE B CB    1 
ATOM   3181 C  CG1   . ILE B 1 163 ? -29.171 8.067  13.263  1.00 20.50  ? 163 ILE B CG1   1 
ATOM   3182 C  CG2   . ILE B 1 163 ? -26.998 8.298  14.397  1.00 17.82  ? 163 ILE B CG2   1 
ATOM   3183 C  CD1   . ILE B 1 163 ? -28.847 8.121  11.773  1.00 21.43  ? 163 ILE B CD1   1 
ATOM   3184 N  N     . VAL B 1 164 ? -27.703 10.068 17.358  1.00 16.07  ? 164 VAL B N     1 
ATOM   3185 C  CA    . VAL B 1 164 ? -26.940 11.000 18.169  1.00 29.06  ? 164 VAL B CA    1 
ATOM   3186 C  C     . VAL B 1 164 ? -25.441 10.869 17.912  1.00 21.45  ? 164 VAL B C     1 
ATOM   3187 O  O     . VAL B 1 164 ? -24.938 9.789  17.626  1.00 16.69  ? 164 VAL B O     1 
ATOM   3188 C  CB    . VAL B 1 164 ? -27.258 10.816 19.655  1.00 18.56  ? 164 VAL B CB    1 
ATOM   3189 C  CG1   . VAL B 1 164 ? -28.737 10.535 19.809  1.00 18.49  ? 164 VAL B CG1   1 
ATOM   3190 C  CG2   . VAL B 1 164 ? -26.424 9.711  20.265  1.00 13.19  ? 164 VAL B CG2   1 
ATOM   3191 N  N     . ALA B 1 165 ? -24.743 11.995 17.964  1.00 20.25  ? 165 ALA B N     1 
ATOM   3192 C  CA    . ALA B 1 165 ? -23.332 12.006 17.647  1.00 15.72  ? 165 ALA B CA    1 
ATOM   3193 C  C     . ALA B 1 165 ? -22.612 11.068 18.578  1.00 14.27  ? 165 ALA B C     1 
ATOM   3194 O  O     . ALA B 1 165 ? -21.949 10.130 18.143  1.00 23.30  ? 165 ALA B O     1 
ATOM   3195 C  CB    . ALA B 1 165 ? -22.770 13.410 17.750  1.00 32.44  ? 165 ALA B CB    1 
ATOM   3196 N  N     . VAL B 1 166 ? -22.764 11.318 19.872  1.00 23.07  ? 166 VAL B N     1 
ATOM   3197 C  CA    . VAL B 1 166 ? -22.087 10.522 20.890  1.00 34.71  ? 166 VAL B CA    1 
ATOM   3198 C  C     . VAL B 1 166 ? -22.992 10.300 22.069  1.00 23.91  ? 166 VAL B C     1 
ATOM   3199 O  O     . VAL B 1 166 ? -23.655 11.229 22.524  1.00 43.89  ? 166 VAL B O     1 
ATOM   3200 C  CB    . VAL B 1 166 ? -20.806 11.190 21.386  1.00 25.43  ? 166 VAL B CB    1 
ATOM   3201 C  CG1   . VAL B 1 166 ? -20.326 10.523 22.662  1.00 9.91   ? 166 VAL B CG1   1 
ATOM   3202 C  CG2   . VAL B 1 166 ? -19.748 11.129 20.314  1.00 13.61  ? 166 VAL B CG2   1 
ATOM   3203 N  N     . LEU B 1 167 ? -23.024 9.066  22.557  1.00 14.80  ? 167 LEU B N     1 
ATOM   3204 C  CA    . LEU B 1 167 ? -23.831 8.732  23.714  1.00 15.31  ? 167 LEU B CA    1 
ATOM   3205 C  C     . LEU B 1 167 ? -22.940 8.145  24.780  1.00 19.96  ? 167 LEU B C     1 
ATOM   3206 O  O     . LEU B 1 167 ? -22.065 7.349  24.468  1.00 33.43  ? 167 LEU B O     1 
ATOM   3207 C  CB    . LEU B 1 167 ? -24.918 7.757  23.334  1.00 10.89  ? 167 LEU B CB    1 
ATOM   3208 C  CG    . LEU B 1 167 ? -25.946 7.571  24.424  1.00 10.83  ? 167 LEU B CG    1 
ATOM   3209 C  CD1   . LEU B 1 167 ? -26.443 8.925  24.815  1.00 26.29  ? 167 LEU B CD1   1 
ATOM   3210 C  CD2   . LEU B 1 167 ? -27.073 6.736  23.888  1.00 8.04   ? 167 LEU B CD2   1 
ATOM   3211 N  N     . GLY B 1 168 ? -23.150 8.526  26.036  1.00 26.87  ? 168 GLY B N     1 
ATOM   3212 C  CA    . GLY B 1 168 ? -22.228 8.134  27.091  1.00 24.38  ? 168 GLY B CA    1 
ATOM   3213 C  C     . GLY B 1 168 ? -22.811 8.311  28.470  1.00 18.56  ? 168 GLY B C     1 
ATOM   3214 O  O     . GLY B 1 168 ? -24.022 8.458  28.608  1.00 26.93  ? 168 GLY B O     1 
ATOM   3215 N  N     . ARG B 1 169 ? -21.958 8.274  29.492  1.00 35.14  ? 169 ARG B N     1 
ATOM   3216 C  CA    . ARG B 1 169 ? -22.396 8.490  30.875  1.00 24.55  ? 169 ARG B CA    1 
ATOM   3217 C  C     . ARG B 1 169 ? -21.430 9.374  31.662  1.00 21.56  ? 169 ARG B C     1 
ATOM   3218 O  O     . ARG B 1 169 ? -20.228 9.427  31.370  1.00 17.86  ? 169 ARG B O     1 
ATOM   3219 C  CB    . ARG B 1 169 ? -22.578 7.152  31.599  1.00 12.61  ? 169 ARG B CB    1 
ATOM   3220 C  CG    . ARG B 1 169 ? -23.765 6.314  31.109  1.00 8.16   ? 169 ARG B CG    1 
ATOM   3221 C  CD    . ARG B 1 169 ? -24.007 5.102  31.987  1.00 6.99   ? 169 ARG B CD    1 
ATOM   3222 N  NE    . ARG B 1 169 ? -25.225 4.379  31.630  1.00 11.94  ? 169 ARG B NE    1 
ATOM   3223 C  CZ    . ARG B 1 169 ? -26.457 4.764  31.949  1.00 21.74  ? 169 ARG B CZ    1 
ATOM   3224 N  NH1   . ARG B 1 169 ? -26.641 5.886  32.627  1.00 39.81  ? 169 ARG B NH1   1 
ATOM   3225 N  NH2   . ARG B 1 169 ? -27.509 4.039  31.579  1.00 6.68   ? 169 ARG B NH2   1 
ATOM   3226 N  N     . ASP B 1 170 ? -21.961 10.072 32.663  1.00 17.23  ? 170 ASP B N     1 
ATOM   3227 C  CA    . ASP B 1 170 ? -21.133 10.964 33.483  1.00 28.29  ? 170 ASP B CA    1 
ATOM   3228 C  C     . ASP B 1 170 ? -20.748 10.341 34.822  1.00 21.24  ? 170 ASP B C     1 
ATOM   3229 O  O     . ASP B 1 170 ? -21.102 9.204  35.115  1.00 14.47  ? 170 ASP B O     1 
ATOM   3230 C  CB    . ASP B 1 170 ? -21.853 12.297 33.718  1.00 27.18  ? 170 ASP B CB    1 
ATOM   3231 C  CG    . ASP B 1 170 ? -23.215 12.121 34.348  1.00 35.90  ? 170 ASP B CG    1 
ATOM   3232 O  OD1   . ASP B 1 170 ? -23.650 10.951 34.509  1.00 20.88  ? 170 ASP B OD1   1 
ATOM   3233 O  OD2   . ASP B 1 170 ? -23.852 13.157 34.666  1.00 28.74  ? 170 ASP B OD2   1 
ATOM   3234 N  N     . SER B 1 171 ? -20.018 11.092 35.634  1.00 26.98  ? 171 SER B N     1 
ATOM   3235 C  CA    . SER B 1 171 ? -19.630 10.611 36.954  1.00 14.00  ? 171 SER B CA    1 
ATOM   3236 C  C     . SER B 1 171 ? -20.845 10.287 37.870  1.00 27.89  ? 171 SER B C     1 
ATOM   3237 O  O     . SER B 1 171 ? -20.716 9.506  38.808  1.00 31.36  ? 171 SER B O     1 
ATOM   3238 C  CB    . SER B 1 171 ? -18.706 11.635 37.613  1.00 15.51  ? 171 SER B CB    1 
ATOM   3239 O  OG    . SER B 1 171 ? -19.229 12.951 37.482  1.00 65.25  ? 171 SER B OG    1 
ATOM   3240 N  N     . ASP B 1 172 ? -22.020 10.852 37.583  1.00 19.39  ? 172 ASP B N     1 
ATOM   3241 C  CA    . ASP B 1 172 ? -23.235 10.539 38.349  1.00 14.28  ? 172 ASP B CA    1 
ATOM   3242 C  C     . ASP B 1 172 ? -24.022 9.362  37.760  1.00 22.73  ? 172 ASP B C     1 
ATOM   3243 O  O     . ASP B 1 172 ? -25.076 8.992  38.265  1.00 31.78  ? 172 ASP B O     1 
ATOM   3244 C  CB    . ASP B 1 172 ? -24.169 11.756 38.430  1.00 10.27  ? 172 ASP B CB    1 
ATOM   3245 C  CG    . ASP B 1 172 ? -23.537 12.954 39.136  1.00 40.08  ? 172 ASP B CG    1 
ATOM   3246 O  OD1   . ASP B 1 172 ? -22.818 12.768 40.143  1.00 29.22  ? 172 ASP B OD1   1 
ATOM   3247 O  OD2   . ASP B 1 172 ? -23.771 14.095 38.679  1.00 44.16  ? 172 ASP B OD2   1 
ATOM   3248 N  N     . GLY B 1 173 ? -23.534 8.790  36.672  1.00 23.86  ? 173 GLY B N     1 
ATOM   3249 C  CA    . GLY B 1 173 ? -24.227 7.680  36.056  1.00 17.20  ? 173 GLY B CA    1 
ATOM   3250 C  C     . GLY B 1 173 ? -25.408 8.055  35.174  1.00 31.48  ? 173 GLY B C     1 
ATOM   3251 O  O     . GLY B 1 173 ? -26.209 7.182  34.840  1.00 27.52  ? 173 GLY B O     1 
ATOM   3252 N  N     . ASN B 1 174 ? -25.534 9.327  34.791  1.00 20.42  ? 174 ASN B N     1 
ATOM   3253 C  CA    . ASN B 1 174 ? -26.598 9.726  33.857  1.00 24.30  ? 174 ASN B CA    1 
ATOM   3254 C  C     . ASN B 1 174 ? -26.264 9.425  32.422  1.00 33.28  ? 174 ASN B C     1 
ATOM   3255 O  O     . ASN B 1 174 ? -25.093 9.442  32.027  1.00 26.52  ? 174 ASN B O     1 
ATOM   3256 C  CB    . ASN B 1 174 ? -26.897 11.217 33.931  1.00 29.37  ? 174 ASN B CB    1 
ATOM   3257 C  CG    . ASN B 1 174 ? -27.088 11.698 35.328  1.00 44.53  ? 174 ASN B CG    1 
ATOM   3258 O  OD1   . ASN B 1 174 ? -27.705 11.017 36.160  1.00 39.19  ? 174 ASN B OD1   1 
ATOM   3259 N  ND2   . ASN B 1 174 ? -26.546 12.881 35.615  1.00 23.03  ? 174 ASN B ND2   1 
ATOM   3260 N  N     . ILE B 1 175 ? -27.305 9.193  31.635  1.00 34.99  ? 175 ILE B N     1 
ATOM   3261 C  CA    . ILE B 1 175 ? -27.161 9.186  30.193  1.00 25.11  ? 175 ILE B CA    1 
ATOM   3262 C  C     . ILE B 1 175 ? -26.744 10.585 29.732  1.00 23.50  ? 175 ILE B C     1 
ATOM   3263 O  O     . ILE B 1 175 ? -27.329 11.587 30.140  1.00 27.94  ? 175 ILE B O     1 
ATOM   3264 C  CB    . ILE B 1 175 ? -28.466 8.752  29.493  1.00 18.69  ? 175 ILE B CB    1 
ATOM   3265 C  CG1   . ILE B 1 175 ? -28.686 7.268  29.695  1.00 20.46  ? 175 ILE B CG1   1 
ATOM   3266 C  CG2   . ILE B 1 175 ? -28.381 8.979  28.004  1.00 34.80  ? 175 ILE B CG2   1 
ATOM   3267 C  CD1   . ILE B 1 175 ? -27.508 6.455  29.267  1.00 25.79  ? 175 ILE B CD1   1 
ATOM   3268 N  N     . VAL B 1 176 ? -25.715 10.641 28.898  1.00 27.14  ? 176 VAL B N     1 
ATOM   3269 C  CA    . VAL B 1 176 ? -25.257 11.894 28.314  1.00 20.50  ? 176 VAL B CA    1 
ATOM   3270 C  C     . VAL B 1 176 ? -25.283 11.884 26.790  1.00 24.16  ? 176 VAL B C     1 
ATOM   3271 O  O     . VAL B 1 176 ? -24.718 10.990 26.164  1.00 25.96  ? 176 VAL B O     1 
ATOM   3272 C  CB    . VAL B 1 176 ? -23.842 12.208 28.744  1.00 11.82  ? 176 VAL B CB    1 
ATOM   3273 C  CG1   . VAL B 1 176 ? -23.299 13.350 27.917  1.00 12.67  ? 176 VAL B CG1   1 
ATOM   3274 C  CG2   . VAL B 1 176 ? -23.817 12.525 30.220  1.00 19.39  ? 176 VAL B CG2   1 
ATOM   3275 N  N     . VAL B 1 177 ? -25.935 12.887 26.207  1.00 30.55  ? 177 VAL B N     1 
ATOM   3276 C  CA    . VAL B 1 177 ? -25.910 13.123 24.763  1.00 17.97  ? 177 VAL B CA    1 
ATOM   3277 C  C     . VAL B 1 177 ? -24.979 14.267 24.397  1.00 18.63  ? 177 VAL B C     1 
ATOM   3278 O  O     . VAL B 1 177 ? -25.045 15.336 24.995  1.00 20.32  ? 177 VAL B O     1 
ATOM   3279 C  CB    . VAL B 1 177 ? -27.296 13.481 24.224  1.00 13.19  ? 177 VAL B CB    1 
ATOM   3280 C  CG1   . VAL B 1 177 ? -27.251 13.648 22.724  1.00 20.68  ? 177 VAL B CG1   1 
ATOM   3281 C  CG2   . VAL B 1 177 ? -28.288 12.426 24.599  1.00 15.19  ? 177 VAL B CG2   1 
ATOM   3282 N  N     . LEU B 1 178 ? -24.125 14.056 23.405  1.00 21.64  ? 178 LEU B N     1 
ATOM   3283 C  CA    . LEU B 1 178 ? -23.385 15.164 22.815  1.00 15.56  ? 178 LEU B CA    1 
ATOM   3284 C  C     . LEU B 1 178 ? -23.883 15.393 21.383  1.00 20.70  ? 178 LEU B C     1 
ATOM   3285 O  O     . LEU B 1 178 ? -24.122 14.424 20.659  1.00 36.59  ? 178 LEU B O     1 
ATOM   3286 C  CB    . LEU B 1 178 ? -21.883 14.880 22.832  1.00 13.43  ? 178 LEU B CB    1 
ATOM   3287 C  CG    . LEU B 1 178 ? -21.298 14.289 24.122  1.00 8.05   ? 178 LEU B CG    1 
ATOM   3288 C  CD1   . LEU B 1 178 ? -19.769 14.196 24.087  1.00 4.79   ? 178 LEU B CD1   1 
ATOM   3289 C  CD2   . LEU B 1 178 ? -21.733 15.097 25.305  1.00 15.98  ? 178 LEU B CD2   1 
ATOM   3290 N  N     . GLU B 1 179 ? -24.104 16.646 20.980  1.00 8.45   ? 179 GLU B N     1 
ATOM   3291 C  CA    . GLU B 1 179 ? -24.095 16.935 19.544  1.00 28.56  ? 179 GLU B CA    1 
ATOM   3292 C  C     . GLU B 1 179 ? -22.850 17.765 19.313  1.00 15.76  ? 179 GLU B C     1 
ATOM   3293 O  O     . GLU B 1 179 ? -22.608 18.741 20.011  1.00 17.70  ? 179 GLU B O     1 
ATOM   3294 C  CB    . GLU B 1 179 ? -25.365 17.651 19.034  1.00 13.60  ? 179 GLU B CB    1 
ATOM   3295 C  CG    . GLU B 1 179 ? -25.342 18.068 17.507  1.00 15.87  ? 179 GLU B CG    1 
ATOM   3296 C  CD    . GLU B 1 179 ? -25.085 16.921 16.473  1.00 37.75  ? 179 GLU B CD    1 
ATOM   3297 O  OE1   . GLU B 1 179 ? -23.990 16.848 15.854  1.00 39.96  ? 179 GLU B OE1   1 
ATOM   3298 O  OE2   . GLU B 1 179 ? -26.002 16.113 16.231  1.00 51.08  ? 179 GLU B OE2   1 
ATOM   3299 N  N     . LEU B 1 180 ? -22.043 17.330 18.352  1.00 18.31  ? 180 LEU B N     1 
ATOM   3300 C  CA    . LEU B 1 180 ? -20.799 17.994 18.017  1.00 21.44  ? 180 LEU B CA    1 
ATOM   3301 C  C     . LEU B 1 180 ? -20.954 18.862 16.788  1.00 23.42  ? 180 LEU B C     1 
ATOM   3302 O  O     . LEU B 1 180 ? -21.685 18.504 15.858  1.00 18.76  ? 180 LEU B O     1 
ATOM   3303 C  CB    . LEU B 1 180 ? -19.702 16.973 17.760  1.00 19.42  ? 180 LEU B CB    1 
ATOM   3304 C  CG    . LEU B 1 180 ? -19.685 15.782 18.697  1.00 23.75  ? 180 LEU B CG    1 
ATOM   3305 C  CD1   . LEU B 1 180 ? -18.893 14.650 18.061  1.00 37.89  ? 180 LEU B CD1   1 
ATOM   3306 C  CD2   . LEU B 1 180 ? -19.089 16.192 20.023  1.00 26.43  ? 180 LEU B CD2   1 
ATOM   3307 N  N     . LYS B 1 181 ? -20.250 19.993 16.793  1.00 15.67  ? 181 LYS B N     1 
ATOM   3308 C  CA    . LYS B 1 181 ? -20.148 20.861 15.629  1.00 13.08  ? 181 LYS B CA    1 
ATOM   3309 C  C     . LYS B 1 181 ? -18.723 21.348 15.443  1.00 18.25  ? 181 LYS B C     1 
ATOM   3310 O  O     . LYS B 1 181 ? -18.119 21.863 16.382  1.00 18.49  ? 181 LYS B O     1 
ATOM   3311 C  CB    . LYS B 1 181 ? -21.097 22.038 15.761  1.00 7.76   ? 181 LYS B CB    1 
ATOM   3312 C  CG    . LYS B 1 181 ? -22.551 21.599 15.744  1.00 26.01  ? 181 LYS B CG    1 
ATOM   3313 C  CD    . LYS B 1 181 ? -22.922 21.055 14.381  1.00 24.79  ? 181 LYS B CD    1 
ATOM   3314 C  CE    . LYS B 1 181 ? -24.240 20.320 14.400  1.00 26.61  ? 181 LYS B CE    1 
ATOM   3315 N  NZ    . LYS B 1 181 ? -24.104 19.105 13.551  1.00 40.69  ? 181 LYS B NZ    1 
ATOM   3316 N  N     . ARG B 1 182 ? -18.198 21.187 14.226  1.00 22.47  ? 182 ARG B N     1 
ATOM   3317 C  CA    . ARG B 1 182 ? -16.820 21.560 13.898  1.00 10.05  ? 182 ARG B CA    1 
ATOM   3318 C  C     . ARG B 1 182 ? -16.627 23.073 13.712  1.00 21.90  ? 182 ARG B C     1 
ATOM   3319 O  O     . ARG B 1 182 ? -15.497 23.555 13.577  1.00 18.35  ? 182 ARG B O     1 
ATOM   3320 C  CB    . ARG B 1 182 ? -16.382 20.845 12.637  1.00 13.78  ? 182 ARG B CB    1 
ATOM   3321 C  CG    . ARG B 1 182 ? -17.080 21.381 11.397  1.00 17.31  ? 182 ARG B CG    1 
ATOM   3322 C  CD    . ARG B 1 182 ? -16.329 21.073 10.092  1.00 13.49  ? 182 ARG B CD    1 
ATOM   3323 N  NE    . ARG B 1 182 ? -14.895 21.319 10.181  1.00 7.71   ? 182 ARG B NE    1 
ATOM   3324 C  CZ    . ARG B 1 182 ? -14.341 22.528 10.178  1.00 23.05  ? 182 ARG B CZ    1 
ATOM   3325 N  NH1   . ARG B 1 182 ? -15.105 23.621 10.081  1.00 9.21   ? 182 ARG B NH1   1 
ATOM   3326 N  NH2   . ARG B 1 182 ? -13.016 22.642 10.282  1.00 12.78  ? 182 ARG B NH2   1 
ATOM   3327 N  N     . ARG B 1 183 ? -17.735 23.809 13.687  1.00 19.02  ? 183 ARG B N     1 
ATOM   3328 C  CA    . ARG B 1 183 ? -17.717 25.265 13.617  1.00 10.26  ? 183 ARG B CA    1 
ATOM   3329 C  C     . ARG B 1 183 ? -18.780 25.810 14.543  1.00 15.30  ? 183 ARG B C     1 
ATOM   3330 O  O     . ARG B 1 183 ? -19.452 25.037 15.213  1.00 24.31  ? 183 ARG B O     1 
ATOM   3331 C  CB    . ARG B 1 183 ? -17.948 25.759 12.186  1.00 35.75  ? 183 ARG B CB    1 
ATOM   3332 C  CG    . ARG B 1 183 ? -19.293 25.411 11.524  1.00 15.50  ? 183 ARG B CG    1 
ATOM   3333 C  CD    . ARG B 1 183 ? -19.352 26.124 10.158  1.00 67.38  ? 183 ARG B CD    1 
ATOM   3334 N  NE    . ARG B 1 183 ? -20.636 26.048 9.454   1.00 50.99  ? 183 ARG B NE    1 
ATOM   3335 C  CZ    . ARG B 1 183 ? -20.903 26.704 8.320   1.00 72.99  ? 183 ARG B CZ    1 
ATOM   3336 N  NH1   . ARG B 1 183 ? -19.980 27.485 7.756   1.00 47.02  ? 183 ARG B NH1   1 
ATOM   3337 N  NH2   . ARG B 1 183 ? -22.095 26.587 7.744   1.00 85.95  ? 183 ARG B NH2   1 
ATOM   3338 N  N     . ARG B 1 184 ? -18.939 27.130 14.583  1.00 18.21  ? 184 ARG B N     1 
ATOM   3339 C  CA    . ARG B 1 184 ? -19.850 27.741 15.543  1.00 9.75   ? 184 ARG B CA    1 
ATOM   3340 C  C     . ARG B 1 184 ? -21.248 27.199 15.349  1.00 19.79  ? 184 ARG B C     1 
ATOM   3341 O  O     . ARG B 1 184 ? -21.741 27.156 14.228  1.00 19.32  ? 184 ARG B O     1 
ATOM   3342 C  CB    . ARG B 1 184 ? -19.862 29.254 15.407  1.00 4.67   ? 184 ARG B CB    1 
ATOM   3343 C  CG    . ARG B 1 184 ? -21.012 29.931 16.124  1.00 25.98  ? 184 ARG B CG    1 
ATOM   3344 C  CD    . ARG B 1 184 ? -21.067 31.412 15.789  1.00 13.46  ? 184 ARG B CD    1 
ATOM   3345 N  NE    . ARG B 1 184 ? -19.885 32.091 16.287  1.00 12.63  ? 184 ARG B NE    1 
ATOM   3346 C  CZ    . ARG B 1 184 ? -19.893 33.045 17.210  1.00 44.67  ? 184 ARG B CZ    1 
ATOM   3347 N  NH1   . ARG B 1 184 ? -21.036 33.475 17.747  1.00 22.76  ? 184 ARG B NH1   1 
ATOM   3348 N  NH2   . ARG B 1 184 ? -18.739 33.576 17.586  1.00 67.52  ? 184 ARG B NH2   1 
ATOM   3349 N  N     . ALA B 1 185 ? -21.874 26.803 16.454  1.00 16.44  ? 185 ALA B N     1 
ATOM   3350 C  CA    . ALA B 1 185 ? -23.112 26.046 16.441  1.00 9.60   ? 185 ALA B CA    1 
ATOM   3351 C  C     . ALA B 1 185 ? -24.314 26.961 16.417  1.00 17.23  ? 185 ALA B C     1 
ATOM   3352 O  O     . ALA B 1 185 ? -24.401 27.907 17.184  1.00 26.72  ? 185 ALA B O     1 
ATOM   3353 C  CB    . ALA B 1 185 ? -23.173 25.136 17.646  1.00 14.90  ? 185 ALA B CB    1 
ATOM   3354 N  N     . GLU B 1 186 ? -25.260 26.656 15.549  1.00 28.05  ? 186 GLU B N     1 
ATOM   3355 C  CA    . GLU B 1 186 ? -26.391 27.529 15.353  1.00 12.41  ? 186 GLU B CA    1 
ATOM   3356 C  C     . GLU B 1 186 ? -27.653 26.864 15.868  1.00 13.95  ? 186 GLU B C     1 
ATOM   3357 O  O     . GLU B 1 186 ? -27.611 25.769 16.414  1.00 15.94  ? 186 GLU B O     1 
ATOM   3358 C  CB    . GLU B 1 186 ? -26.521 27.877 13.872  1.00 40.63  ? 186 GLU B CB    1 
ATOM   3359 C  CG    . GLU B 1 186 ? -25.176 28.020 13.189  1.00 37.17  ? 186 GLU B CG    1 
ATOM   3360 C  CD    . GLU B 1 186 ? -25.196 28.968 12.004  1.00 54.72  ? 186 GLU B CD    1 
ATOM   3361 O  OE1   . GLU B 1 186 ? -26.118 28.851 11.167  1.00 53.81  ? 186 GLU B OE1   1 
ATOM   3362 O  OE2   . GLU B 1 186 ? -24.282 29.827 11.912  1.00 46.65  ? 186 GLU B OE2   1 
ATOM   3363 N  N     . LEU B 1 187 ? -28.780 27.534 15.688  1.00 18.21  ? 187 LEU B N     1 
ATOM   3364 C  CA    . LEU B 1 187 ? -30.046 27.043 16.193  1.00 15.22  ? 187 LEU B CA    1 
ATOM   3365 C  C     . LEU B 1 187 ? -30.372 25.587 15.880  1.00 13.74  ? 187 LEU B C     1 
ATOM   3366 O  O     . LEU B 1 187 ? -30.893 24.884 16.738  1.00 29.50  ? 187 LEU B O     1 
ATOM   3367 C  CB    . LEU B 1 187 ? -31.166 27.919 15.668  1.00 22.25  ? 187 LEU B CB    1 
ATOM   3368 C  CG    . LEU B 1 187 ? -31.318 29.176 16.494  1.00 11.39  ? 187 LEU B CG    1 
ATOM   3369 C  CD1   . LEU B 1 187 ? -32.634 29.829 16.151  1.00 22.31  ? 187 LEU B CD1   1 
ATOM   3370 C  CD2   . LEU B 1 187 ? -31.263 28.793 17.957  1.00 32.07  ? 187 LEU B CD2   1 
ATOM   3371 N  N     . HIS B 1 188 ? -30.072 25.127 14.673  1.00 10.45  ? 188 HIS B N     1 
ATOM   3372 C  CA    . HIS B 1 188 ? -30.435 23.760 14.300  1.00 24.40  ? 188 HIS B CA    1 
ATOM   3373 C  C     . HIS B 1 188 ? -29.604 22.776 15.129  1.00 14.18  ? 188 HIS B C     1 
ATOM   3374 O  O     . HIS B 1 188 ? -30.052 21.677 15.459  1.00 12.82  ? 188 HIS B O     1 
ATOM   3375 C  CB    . HIS B 1 188 ? -30.234 23.519 12.796  1.00 14.97  ? 188 HIS B CB    1 
ATOM   3376 C  CG    . HIS B 1 188 ? -28.819 23.211 12.439  1.00 65.09  ? 188 HIS B CG    1 
ATOM   3377 N  ND1   . HIS B 1 188 ? -28.437 22.007 11.887  1.00 67.52  ? 188 HIS B ND1   1 
ATOM   3378 C  CD2   . HIS B 1 188 ? -27.682 23.929 12.614  1.00 71.12  ? 188 HIS B CD2   1 
ATOM   3379 C  CE1   . HIS B 1 188 ? -27.127 22.007 11.712  1.00 98.23  ? 188 HIS B CE1   1 
ATOM   3380 N  NE2   . HIS B 1 188 ? -26.644 23.160 12.148  1.00 101.08 ? 188 HIS B NE2   1 
ATOM   3381 N  N     . ALA B 1 189 ? -28.394 23.177 15.489  1.00 10.21  ? 189 ALA B N     1 
ATOM   3382 C  CA    . ALA B 1 189 ? -27.603 22.344 16.366  1.00 12.66  ? 189 ALA B CA    1 
ATOM   3383 C  C     . ALA B 1 189 ? -28.387 22.114 17.658  1.00 18.53  ? 189 ALA B C     1 
ATOM   3384 O  O     . ALA B 1 189 ? -28.653 20.968 18.037  1.00 13.12  ? 189 ALA B O     1 
ATOM   3385 C  CB    . ALA B 1 189 ? -26.248 22.974 16.642  1.00 7.39   ? 189 ALA B CB    1 
ATOM   3386 N  N     . VAL B 1 190 ? -28.808 23.194 18.310  1.00 11.92  ? 190 VAL B N     1 
ATOM   3387 C  CA    . VAL B 1 190 ? -29.532 23.024 19.554  1.00 13.47  ? 190 VAL B CA    1 
ATOM   3388 C  C     . VAL B 1 190 ? -30.791 22.202 19.330  1.00 11.40  ? 190 VAL B C     1 
ATOM   3389 O  O     . VAL B 1 190 ? -31.057 21.278 20.091  1.00 17.32  ? 190 VAL B O     1 
ATOM   3390 C  CB    . VAL B 1 190 ? -29.883 24.354 20.201  1.00 15.21  ? 190 VAL B CB    1 
ATOM   3391 C  CG1   . VAL B 1 190 ? -30.838 24.126 21.360  1.00 3.36   ? 190 VAL B CG1   1 
ATOM   3392 C  CG2   . VAL B 1 190 ? -28.621 25.028 20.689  1.00 10.48  ? 190 VAL B CG2   1 
ATOM   3393 N  N     . ARG B 1 191 ? -31.539 22.493 18.271  1.00 10.32  ? 191 ARG B N     1 
ATOM   3394 C  CA    . ARG B 1 191 ? -32.738 21.706 17.983  1.00 15.85  ? 191 ARG B CA    1 
ATOM   3395 C  C     . ARG B 1 191 ? -32.410 20.220 17.854  1.00 19.58  ? 191 ARG B C     1 
ATOM   3396 O  O     . ARG B 1 191 ? -33.185 19.385 18.291  1.00 19.64  ? 191 ARG B O     1 
ATOM   3397 C  CB    . ARG B 1 191 ? -33.433 22.189 16.716  1.00 11.93  ? 191 ARG B CB    1 
ATOM   3398 C  CG    . ARG B 1 191 ? -33.882 23.630 16.761  1.00 11.70  ? 191 ARG B CG    1 
ATOM   3399 C  CD    . ARG B 1 191 ? -34.853 23.951 15.630  1.00 11.71  ? 191 ARG B CD    1 
ATOM   3400 N  NE    . ARG B 1 191 ? -35.046 25.392 15.520  1.00 41.48  ? 191 ARG B NE    1 
ATOM   3401 C  CZ    . ARG B 1 191 ? -34.464 26.159 14.606  1.00 22.85  ? 191 ARG B CZ    1 
ATOM   3402 N  NH1   . ARG B 1 191 ? -33.681 25.626 13.688  1.00 11.80  ? 191 ARG B NH1   1 
ATOM   3403 N  NH2   . ARG B 1 191 ? -34.697 27.460 14.601  1.00 43.95  ? 191 ARG B NH2   1 
ATOM   3404 N  N     . GLN B 1 192 ? -31.256 19.891 17.281  1.00 19.25  ? 192 GLN B N     1 
ATOM   3405 C  CA    . GLN B 1 192 ? -30.866 18.493 17.148  1.00 16.85  ? 192 GLN B CA    1 
ATOM   3406 C  C     . GLN B 1 192 ? -30.743 17.890 18.537  1.00 19.57  ? 192 GLN B C     1 
ATOM   3407 O  O     . GLN B 1 192 ? -31.456 16.951 18.886  1.00 17.88  ? 192 GLN B O     1 
ATOM   3408 C  CB    . GLN B 1 192 ? -29.539 18.354 16.402  1.00 22.77  ? 192 GLN B CB    1 
ATOM   3409 C  CG    . GLN B 1 192 ? -29.647 18.206 14.905  1.00 21.41  ? 192 GLN B CG    1 
ATOM   3410 C  CD    . GLN B 1 192 ? -28.367 17.719 14.237  1.00 24.40  ? 192 GLN B CD    1 
ATOM   3411 O  OE1   . GLN B 1 192 ? -28.149 18.013 13.073  1.00 69.82  ? 192 GLN B OE1   1 
ATOM   3412 N  NE2   . GLN B 1 192 ? -27.594 16.877 14.914  1.00 23.61  ? 192 GLN B NE2   1 
ATOM   3413 N  N     . LEU B 1 193 ? -29.850 18.467 19.333  1.00 16.37  ? 193 LEU B N     1 
ATOM   3414 C  CA    . LEU B 1 193 ? -29.607 18.012 20.701  1.00 10.55  ? 193 LEU B CA    1 
ATOM   3415 C  C     . LEU B 1 193 ? -30.891 17.916 21.497  1.00 21.71  ? 193 LEU B C     1 
ATOM   3416 O  O     . LEU B 1 193 ? -31.204 16.865 22.043  1.00 30.53  ? 193 LEU B O     1 
ATOM   3417 C  CB    . LEU B 1 193 ? -28.638 18.955 21.408  1.00 10.98  ? 193 LEU B CB    1 
ATOM   3418 C  CG    . LEU B 1 193 ? -28.128 18.667 22.824  1.00 17.64  ? 193 LEU B CG    1 
ATOM   3419 C  CD1   . LEU B 1 193 ? -27.424 17.317 22.886  1.00 17.70  ? 193 LEU B CD1   1 
ATOM   3420 C  CD2   . LEU B 1 193 ? -27.194 19.797 23.311  1.00 3.63   ? 193 LEU B CD2   1 
ATOM   3421 N  N     . LYS B 1 194 ? -31.637 19.017 21.537  1.00 20.70  ? 194 LYS B N     1 
ATOM   3422 C  CA    . LYS B 1 194 ? -32.891 19.076 22.273  1.00 28.40  ? 194 LYS B CA    1 
ATOM   3423 C  C     . LYS B 1 194 ? -33.826 17.949 21.839  1.00 17.68  ? 194 LYS B C     1 
ATOM   3424 O  O     . LYS B 1 194 ? -34.451 17.298 22.661  1.00 16.22  ? 194 LYS B O     1 
ATOM   3425 C  CB    . LYS B 1 194 ? -33.560 20.449 22.091  1.00 18.74  ? 194 LYS B CB    1 
ATOM   3426 C  CG    . LYS B 1 194 ? -35.045 20.474 22.463  1.00 45.30  ? 194 LYS B CG    1 
ATOM   3427 C  CD    . LYS B 1 194 ? -35.551 21.892 22.730  1.00 44.79  ? 194 LYS B CD    1 
ATOM   3428 C  CE    . LYS B 1 194 ? -37.046 21.922 23.082  1.00 28.73  ? 194 LYS B CE    1 
ATOM   3429 N  NZ    . LYS B 1 194 ? -37.921 21.599 21.913  1.00 53.78  ? 194 LYS B NZ    1 
ATOM   3430 N  N     . SER B 1 195 ? -33.889 17.702 20.542  1.00 21.28  ? 195 SER B N     1 
ATOM   3431 C  CA    . SER B 1 195 ? -34.686 16.604 20.017  1.00 23.02  ? 195 SER B CA    1 
ATOM   3432 C  C     . SER B 1 195 ? -34.259 15.246 20.567  1.00 19.78  ? 195 SER B C     1 
ATOM   3433 O  O     . SER B 1 195 ? -35.094 14.429 20.931  1.00 23.10  ? 195 SER B O     1 
ATOM   3434 C  CB    . SER B 1 195 ? -34.595 16.582 18.498  1.00 25.26  ? 195 SER B CB    1 
ATOM   3435 O  OG    . SER B 1 195 ? -35.391 15.562 17.943  1.00 26.49  ? 195 SER B OG    1 
ATOM   3436 N  N     . TYR B 1 196 ? -32.957 14.999 20.608  1.00 24.88  ? 196 TYR B N     1 
ATOM   3437 C  CA    . TYR B 1 196 ? -32.453 13.712 21.065  1.00 28.02  ? 196 TYR B CA    1 
ATOM   3438 C  C     . TYR B 1 196 ? -32.730 13.520 22.567  1.00 26.59  ? 196 TYR B C     1 
ATOM   3439 O  O     . TYR B 1 196 ? -33.123 12.441 23.019  1.00 20.80  ? 196 TYR B O     1 
ATOM   3440 C  CB    . TYR B 1 196 ? -30.952 13.597 20.776  1.00 11.43  ? 196 TYR B CB    1 
ATOM   3441 C  CG    . TYR B 1 196 ? -30.559 13.806 19.323  1.00 28.24  ? 196 TYR B CG    1 
ATOM   3442 C  CD1   . TYR B 1 196 ? -31.444 13.540 18.271  1.00 19.90  ? 196 TYR B CD1   1 
ATOM   3443 C  CD2   . TYR B 1 196 ? -29.287 14.269 19.005  1.00 31.85  ? 196 TYR B CD2   1 
ATOM   3444 C  CE1   . TYR B 1 196 ? -31.056 13.738 16.936  1.00 9.76   ? 196 TYR B CE1   1 
ATOM   3445 C  CE2   . TYR B 1 196 ? -28.893 14.466 17.698  1.00 16.72  ? 196 TYR B CE2   1 
ATOM   3446 C  CZ    . TYR B 1 196 ? -29.776 14.204 16.663  1.00 26.09  ? 196 TYR B CZ    1 
ATOM   3447 O  OH    . TYR B 1 196 ? -29.344 14.419 15.370  1.00 26.66  ? 196 TYR B OH    1 
ATOM   3448 N  N     . VAL B 1 197 ? -32.533 14.585 23.331  1.00 19.29  ? 197 VAL B N     1 
ATOM   3449 C  CA    . VAL B 1 197 ? -32.681 14.534 24.774  1.00 23.02  ? 197 VAL B CA    1 
ATOM   3450 C  C     . VAL B 1 197 ? -34.120 14.250 25.196  1.00 18.52  ? 197 VAL B C     1 
ATOM   3451 O  O     . VAL B 1 197 ? -34.359 13.410 26.056  1.00 13.59  ? 197 VAL B O     1 
ATOM   3452 C  CB    . VAL B 1 197 ? -32.197 15.847 25.410  1.00 26.06  ? 197 VAL B CB    1 
ATOM   3453 C  CG1   . VAL B 1 197 ? -32.439 15.844 26.907  1.00 12.11  ? 197 VAL B CG1   1 
ATOM   3454 C  CG2   . VAL B 1 197 ? -30.722 16.044 25.116  1.00 12.55  ? 197 VAL B CG2   1 
ATOM   3455 N  N     . GLU B 1 198 ? -35.071 14.941 24.580  1.00 21.62  ? 198 GLU B N     1 
ATOM   3456 C  CA    . GLU B 1 198 ? -36.491 14.687 24.819  1.00 31.31  ? 198 GLU B CA    1 
ATOM   3457 C  C     . GLU B 1 198 ? -36.817 13.201 24.661  1.00 31.57  ? 198 GLU B C     1 
ATOM   3458 O  O     . GLU B 1 198 ? -37.393 12.564 25.555  1.00 25.84  ? 198 GLU B O     1 
ATOM   3459 C  CB    . GLU B 1 198 ? -37.355 15.532 23.864  1.00 9.06   ? 198 GLU B CB    1 
ATOM   3460 C  CG    . GLU B 1 198 ? -37.595 16.942 24.375  1.00 16.13  ? 198 GLU B CG    1 
ATOM   3461 C  CD    . GLU B 1 198 ? -38.478 17.764 23.471  1.00 47.02  ? 198 GLU B CD    1 
ATOM   3462 O  OE1   . GLU B 1 198 ? -39.217 17.172 22.656  1.00 63.30  ? 198 GLU B OE1   1 
ATOM   3463 O  OE2   . GLU B 1 198 ? -38.428 19.009 23.579  1.00 55.96  ? 198 GLU B OE2   1 
ATOM   3464 N  N     . ILE B 1 199 ? -36.418 12.666 23.517  1.00 14.35  ? 199 ILE B N     1 
ATOM   3465 C  CA    . ILE B 1 199 ? -36.596 11.268 23.190  1.00 22.24  ? 199 ILE B CA    1 
ATOM   3466 C  C     . ILE B 1 199 ? -35.917 10.335 24.198  1.00 26.78  ? 199 ILE B C     1 
ATOM   3467 O  O     . ILE B 1 199 ? -36.442 9.274  24.533  1.00 26.69  ? 199 ILE B O     1 
ATOM   3468 C  CB    . ILE B 1 199 ? -36.067 11.015 21.783  1.00 14.39  ? 199 ILE B CB    1 
ATOM   3469 C  CG1   . ILE B 1 199 ? -37.016 11.675 20.781  1.00 15.19  ? 199 ILE B CG1   1 
ATOM   3470 C  CG2   . ILE B 1 199 ? -35.944 9.539  21.496  1.00 16.77  ? 199 ILE B CG2   1 
ATOM   3471 C  CD1   . ILE B 1 199 ? -36.514 11.649 19.374  1.00 45.14  ? 199 ILE B CD1   1 
ATOM   3472 N  N     . LEU B 1 200 ? -34.763 10.738 24.705  1.00 19.77  ? 200 LEU B N     1 
ATOM   3473 C  CA    . LEU B 1 200 ? -34.080 9.917  25.682  1.00 15.17  ? 200 LEU B CA    1 
ATOM   3474 C  C     . LEU B 1 200 ? -34.715 10.028 27.054  1.00 30.40  ? 200 LEU B C     1 
ATOM   3475 O  O     . LEU B 1 200 ? -34.748 9.046  27.795  1.00 36.53  ? 200 LEU B O     1 
ATOM   3476 C  CB    . LEU B 1 200 ? -32.606 10.286 25.741  1.00 17.18  ? 200 LEU B CB    1 
ATOM   3477 C  CG    . LEU B 1 200 ? -31.917 9.627  24.553  1.00 22.35  ? 200 LEU B CG    1 
ATOM   3478 C  CD1   . LEU B 1 200 ? -30.420 9.741  24.663  1.00 12.85  ? 200 LEU B CD1   1 
ATOM   3479 C  CD2   . LEU B 1 200 ? -32.347 8.162  24.447  1.00 8.93   ? 200 LEU B CD2   1 
ATOM   3480 N  N     . ARG B 1 201 ? -35.232 11.212 27.383  1.00 32.61  ? 201 ARG B N     1 
ATOM   3481 C  CA    . ARG B 1 201 ? -35.879 11.440 28.675  1.00 17.82  ? 201 ARG B CA    1 
ATOM   3482 C  C     . ARG B 1 201 ? -37.014 10.444 28.866  1.00 19.86  ? 201 ARG B C     1 
ATOM   3483 O  O     . ARG B 1 201 ? -37.318 10.057 29.992  1.00 38.59  ? 201 ARG B O     1 
ATOM   3484 C  CB    . ARG B 1 201 ? -36.406 12.881 28.801  1.00 13.46  ? 201 ARG B CB    1 
ATOM   3485 C  CG    . ARG B 1 201 ? -35.346 13.965 29.074  1.00 10.47  ? 201 ARG B CG    1 
ATOM   3486 C  CD    . ARG B 1 201 ? -35.989 15.339 29.431  1.00 27.34  ? 201 ARG B CD    1 
ATOM   3487 N  NE    . ARG B 1 201 ? -35.133 16.531 29.237  1.00 27.11  ? 201 ARG B NE    1 
ATOM   3488 C  CZ    . ARG B 1 201 ? -33.957 16.747 29.845  1.00 57.44  ? 201 ARG B CZ    1 
ATOM   3489 N  NH1   . ARG B 1 201 ? -33.448 15.839 30.677  1.00 26.47  ? 201 ARG B NH1   1 
ATOM   3490 N  NH2   . ARG B 1 201 ? -33.265 17.868 29.614  1.00 24.51  ? 201 ARG B NH2   1 
ATOM   3491 N  N     . GLU B 1 202 ? -37.626 10.017 27.764  1.00 23.61  ? 202 GLU B N     1 
ATOM   3492 C  CA    . GLU B 1 202 ? -38.697 9.025  27.817  1.00 26.23  ? 202 GLU B CA    1 
ATOM   3493 C  C     . GLU B 1 202 ? -38.223 7.720  28.458  1.00 34.54  ? 202 GLU B C     1 
ATOM   3494 O  O     . GLU B 1 202 ? -38.833 7.232  29.407  1.00 75.50  ? 202 GLU B O     1 
ATOM   3495 C  CB    . GLU B 1 202 ? -39.245 8.742  26.422  1.00 38.31  ? 202 GLU B CB    1 
ATOM   3496 C  CG    . GLU B 1 202 ? -39.860 9.939  25.724  1.00 46.81  ? 202 GLU B CG    1 
ATOM   3497 C  CD    . GLU B 1 202 ? -40.042 9.699  24.237  1.00 77.48  ? 202 GLU B CD    1 
ATOM   3498 O  OE1   . GLU B 1 202 ? -39.854 8.540  23.795  1.00 58.13  ? 202 GLU B OE1   1 
ATOM   3499 O  OE2   . GLU B 1 202 ? -40.367 10.665 23.512  1.00 88.82  ? 202 GLU B OE2   1 
ATOM   3500 N  N     . GLU B 1 203 ? -37.133 7.161  27.949  1.00 37.12  ? 203 GLU B N     1 
ATOM   3501 C  CA    . GLU B 1 203 ? -36.629 5.910  28.487  1.00 40.64  ? 203 GLU B CA    1 
ATOM   3502 C  C     . GLU B 1 203 ? -35.925 6.105  29.831  1.00 32.02  ? 203 GLU B C     1 
ATOM   3503 O  O     . GLU B 1 203 ? -36.188 5.379  30.781  1.00 43.33  ? 203 GLU B O     1 
ATOM   3504 C  CB    . GLU B 1 203 ? -35.684 5.239  27.487  1.00 32.96  ? 203 GLU B CB    1 
ATOM   3505 C  CG    . GLU B 1 203 ? -35.659 3.719  27.609  1.00 57.18  ? 203 GLU B CG    1 
ATOM   3506 C  CD    . GLU B 1 203 ? -35.138 3.023  26.359  1.00 89.83  ? 203 GLU B CD    1 
ATOM   3507 O  OE1   . GLU B 1 203 ? -34.042 3.385  25.878  1.00 95.40  ? 203 GLU B OE1   1 
ATOM   3508 O  OE2   . GLU B 1 203 ? -35.831 2.112  25.854  1.00 94.53  ? 203 GLU B OE2   1 
ATOM   3509 N  N     . TYR B 1 204 ? -35.022 7.074  29.906  1.00 28.88  ? 204 TYR B N     1 
ATOM   3510 C  CA    . TYR B 1 204 ? -34.148 7.197  31.066  1.00 23.44  ? 204 TYR B CA    1 
ATOM   3511 C  C     . TYR B 1 204 ? -34.549 8.245  32.115  1.00 39.61  ? 204 TYR B C     1 
ATOM   3512 O  O     . TYR B 1 204 ? -33.910 8.350  33.165  1.00 54.30  ? 204 TYR B O     1 
ATOM   3513 C  CB    . TYR B 1 204 ? -32.725 7.490  30.589  1.00 22.99  ? 204 TYR B CB    1 
ATOM   3514 C  CG    . TYR B 1 204 ? -32.113 6.392  29.744  1.00 29.70  ? 204 TYR B CG    1 
ATOM   3515 C  CD1   . TYR B 1 204 ? -32.261 6.376  28.365  1.00 54.93  ? 204 TYR B CD1   1 
ATOM   3516 C  CD2   . TYR B 1 204 ? -31.380 5.378  30.326  1.00 29.23  ? 204 TYR B CD2   1 
ATOM   3517 C  CE1   . TYR B 1 204 ? -31.695 5.371  27.597  1.00 57.99  ? 204 TYR B CE1   1 
ATOM   3518 C  CE2   . TYR B 1 204 ? -30.808 4.374  29.568  1.00 68.69  ? 204 TYR B CE2   1 
ATOM   3519 C  CZ    . TYR B 1 204 ? -30.969 4.369  28.208  1.00 51.04  ? 204 TYR B CZ    1 
ATOM   3520 O  OH    . TYR B 1 204 ? -30.393 3.354  27.471  1.00 60.51  ? 204 TYR B OH    1 
ATOM   3521 N  N     . GLY B 1 205 ? -35.596 9.016  31.855  1.00 19.86  ? 205 GLY B N     1 
ATOM   3522 C  CA    . GLY B 1 205 ? -35.996 10.038 32.809  1.00 25.21  ? 205 GLY B CA    1 
ATOM   3523 C  C     . GLY B 1 205 ? -35.308 11.386 32.661  1.00 26.41  ? 205 GLY B C     1 
ATOM   3524 O  O     . GLY B 1 205 ? -34.676 11.660 31.643  1.00 59.35  ? 205 GLY B O     1 
ATOM   3525 N  N     . ASP B 1 206 ? -35.419 12.224 33.690  1.00 37.12  ? 206 ASP B N     1 
ATOM   3526 C  CA    . ASP B 1 206 ? -34.863 13.582 33.674  1.00 42.17  ? 206 ASP B CA    1 
ATOM   3527 C  C     . ASP B 1 206 ? -33.373 13.620 34.000  1.00 44.59  ? 206 ASP B C     1 
ATOM   3528 O  O     . ASP B 1 206 ? -32.787 14.693 34.068  1.00 41.38  ? 206 ASP B O     1 
ATOM   3529 C  CB    . ASP B 1 206 ? -35.593 14.489 34.672  1.00 45.36  ? 206 ASP B CB    1 
ATOM   3530 C  CG    . ASP B 1 206 ? -37.078 14.582 34.408  1.00 71.40  ? 206 ASP B CG    1 
ATOM   3531 O  OD1   . ASP B 1 206 ? -37.478 14.513 33.221  1.00 64.16  ? 206 ASP B OD1   1 
ATOM   3532 O  OD2   . ASP B 1 206 ? -37.836 14.736 35.398  1.00 47.73  ? 206 ASP B OD2   1 
ATOM   3533 N  N     . LYS B 1 207 ? -32.780 12.458 34.251  1.00 58.55  ? 207 LYS B N     1 
ATOM   3534 C  CA    . LYS B 1 207 ? -31.346 12.367 34.496  1.00 47.78  ? 207 LYS B CA    1 
ATOM   3535 C  C     . LYS B 1 207 ? -30.598 13.073 33.378  1.00 72.46  ? 207 LYS B C     1 
ATOM   3536 O  O     . LYS B 1 207 ? -29.707 13.891 33.631  1.00 61.25  ? 207 LYS B O     1 
ATOM   3537 C  CB    . LYS B 1 207 ? -30.889 10.904 34.565  1.00 67.55  ? 207 LYS B CB    1 
ATOM   3538 C  CG    . LYS B 1 207 ? -31.770 9.985  35.395  1.00 80.64  ? 207 LYS B CG    1 
ATOM   3539 C  CD    . LYS B 1 207 ? -31.116 9.585  36.711  1.00 33.72  ? 207 LYS B CD    1 
ATOM   3540 C  CE    . LYS B 1 207 ? -31.954 8.517  37.386  1.00 61.20  ? 207 LYS B CE    1 
ATOM   3541 N  NZ    . LYS B 1 207 ? -33.373 8.938  37.596  1.00 60.99  ? 207 LYS B NZ    1 
ATOM   3542 N  N     . VAL B 1 208 ? -31.038 12.773 32.151  1.00 46.94  ? 208 VAL B N     1 
ATOM   3543 C  CA    . VAL B 1 208 ? -30.337 13.035 30.892  1.00 21.41  ? 208 VAL B CA    1 
ATOM   3544 C  C     . VAL B 1 208 ? -29.836 14.466 30.646  1.00 29.81  ? 208 VAL B C     1 
ATOM   3545 O  O     . VAL B 1 208 ? -30.586 15.438 30.755  1.00 17.52  ? 208 VAL B O     1 
ATOM   3546 C  CB    . VAL B 1 208 ? -31.252 12.674 29.716  1.00 35.87  ? 208 VAL B CB    1 
ATOM   3547 C  CG1   . VAL B 1 208 ? -30.478 12.701 28.421  1.00 25.10  ? 208 VAL B CG1   1 
ATOM   3548 C  CG2   . VAL B 1 208 ? -31.900 11.324 29.942  1.00 34.21  ? 208 VAL B CG2   1 
ATOM   3549 N  N     . ARG B 1 209 ? -28.564 14.575 30.278  1.00 30.63  ? 209 ARG B N     1 
ATOM   3550 C  CA    . ARG B 1 209 ? -27.947 15.856 29.960  1.00 22.83  ? 209 ARG B CA    1 
ATOM   3551 C  C     . ARG B 1 209 ? -27.591 15.935 28.484  1.00 16.38  ? 209 ARG B C     1 
ATOM   3552 O  O     . ARG B 1 209 ? -26.886 15.069 27.987  1.00 38.96  ? 209 ARG B O     1 
ATOM   3553 C  CB    . ARG B 1 209 ? -26.685 16.044 30.790  1.00 20.95  ? 209 ARG B CB    1 
ATOM   3554 C  CG    . ARG B 1 209 ? -26.829 15.624 32.230  1.00 14.20  ? 209 ARG B CG    1 
ATOM   3555 C  CD    . ARG B 1 209 ? -25.476 15.572 32.935  1.00 23.70  ? 209 ARG B CD    1 
ATOM   3556 N  NE    . ARG B 1 209 ? -24.604 16.707 32.629  1.00 10.67  ? 209 ARG B NE    1 
ATOM   3557 C  CZ    . ARG B 1 209 ? -23.270 16.659 32.704  1.00 28.75  ? 209 ARG B CZ    1 
ATOM   3558 N  NH1   . ARG B 1 209 ? -22.652 15.535 33.074  1.00 14.69  ? 209 ARG B NH1   1 
ATOM   3559 N  NH2   . ARG B 1 209 ? -22.545 17.731 32.416  1.00 6.03   ? 209 ARG B NH2   1 
ATOM   3560 N  N     . GLY B 1 210 ? -28.095 16.927 27.760  1.00 16.59  ? 210 GLY B N     1 
ATOM   3561 C  CA    . GLY B 1 210 ? -27.504 17.222 26.468  1.00 15.14  ? 210 GLY B CA    1 
ATOM   3562 C  C     . GLY B 1 210 ? -26.338 18.191 26.583  1.00 19.15  ? 210 GLY B C     1 
ATOM   3563 O  O     . GLY B 1 210 ? -26.438 19.218 27.250  1.00 15.41  ? 210 GLY B O     1 
ATOM   3564 N  N     . ILE B 1 211 ? -25.254 17.920 25.868  1.00 17.38  ? 211 ILE B N     1 
ATOM   3565 C  CA    . ILE B 1 211 ? -24.162 18.875 25.805  1.00 11.38  ? 211 ILE B CA    1 
ATOM   3566 C  C     . ILE B 1 211 ? -23.866 19.205 24.360  1.00 14.82  ? 211 ILE B C     1 
ATOM   3567 O  O     . ILE B 1 211 ? -23.682 18.322 23.526  1.00 22.98  ? 211 ILE B O     1 
ATOM   3568 C  CB    . ILE B 1 211 ? -22.886 18.366 26.480  1.00 11.84  ? 211 ILE B CB    1 
ATOM   3569 C  CG1   . ILE B 1 211 ? -23.199 17.900 27.898  1.00 17.07  ? 211 ILE B CG1   1 
ATOM   3570 C  CG2   . ILE B 1 211 ? -21.812 19.468 26.503  1.00 5.92   ? 211 ILE B CG2   1 
ATOM   3571 C  CD1   . ILE B 1 211 ? -21.992 17.408 28.634  1.00 12.73  ? 211 ILE B CD1   1 
ATOM   3572 N  N     . LEU B 1 212 ? -23.860 20.494 24.067  1.00 15.20  ? 212 LEU B N     1 
ATOM   3573 C  CA    . LEU B 1 212 ? -23.397 20.982 22.788  1.00 9.68   ? 212 LEU B CA    1 
ATOM   3574 C  C     . LEU B 1 212 ? -21.886 21.149 22.850  1.00 13.88  ? 212 LEU B C     1 
ATOM   3575 O  O     . LEU B 1 212 ? -21.361 21.862 23.705  1.00 23.84  ? 212 LEU B O     1 
ATOM   3576 C  CB    . LEU B 1 212 ? -24.087 22.297 22.454  1.00 11.11  ? 212 LEU B CB    1 
ATOM   3577 C  CG    . LEU B 1 212 ? -23.823 22.907 21.087  1.00 14.54  ? 212 LEU B CG    1 
ATOM   3578 C  CD1   . LEU B 1 212 ? -23.869 21.792 20.072  1.00 13.32  ? 212 LEU B CD1   1 
ATOM   3579 C  CD2   . LEU B 1 212 ? -24.887 23.969 20.785  1.00 5.00   ? 212 LEU B CD2   1 
ATOM   3580 N  N     . VAL B 1 213 ? -21.179 20.470 21.965  1.00 10.11  ? 213 VAL B N     1 
ATOM   3581 C  CA    . VAL B 1 213 ? -19.732 20.575 21.937  1.00 13.17  ? 213 VAL B CA    1 
ATOM   3582 C  C     . VAL B 1 213 ? -19.316 21.248 20.640  1.00 21.80  ? 213 VAL B C     1 
ATOM   3583 O  O     . VAL B 1 213 ? -19.454 20.664 19.566  1.00 24.03  ? 213 VAL B O     1 
ATOM   3584 C  CB    . VAL B 1 213 ? -19.079 19.198 22.047  1.00 14.98  ? 213 VAL B CB    1 
ATOM   3585 C  CG1   . VAL B 1 213 ? -17.653 19.322 22.522  1.00 10.91  ? 213 VAL B CG1   1 
ATOM   3586 C  CG2   . VAL B 1 213 ? -19.899 18.299 22.970  1.00 8.11   ? 213 VAL B CG2   1 
ATOM   3587 N  N     . ALA B 1 214 ? -18.831 22.481 20.732  1.00 11.91  ? 214 ALA B N     1 
ATOM   3588 C  CA    . ALA B 1 214 ? -18.450 23.221 19.537  1.00 13.36  ? 214 ALA B CA    1 
ATOM   3589 C  C     . ALA B 1 214 ? -17.459 24.295 19.890  1.00 16.39  ? 214 ALA B C     1 
ATOM   3590 O  O     . ALA B 1 214 ? -17.237 24.571 21.053  1.00 22.77  ? 214 ALA B O     1 
ATOM   3591 C  CB    . ALA B 1 214 ? -19.681 23.842 18.877  1.00 8.57   ? 214 ALA B CB    1 
ATOM   3592 N  N     . PRO B 1 215 ? -16.865 24.927 18.880  1.00 23.02  ? 215 PRO B N     1 
ATOM   3593 C  CA    . PRO B 1 215 ? -15.876 25.931 19.268  1.00 18.65  ? 215 PRO B CA    1 
ATOM   3594 C  C     . PRO B 1 215 ? -16.486 27.206 19.800  1.00 16.70  ? 215 PRO B C     1 
ATOM   3595 O  O     . PRO B 1 215 ? -15.888 27.889 20.633  1.00 24.66  ? 215 PRO B O     1 
ATOM   3596 C  CB    . PRO B 1 215 ? -15.120 26.181 17.972  1.00 14.00  ? 215 PRO B CB    1 
ATOM   3597 C  CG    . PRO B 1 215 ? -15.918 25.505 16.900  1.00 12.38  ? 215 PRO B CG    1 
ATOM   3598 C  CD    . PRO B 1 215 ? -16.617 24.407 17.527  1.00 10.91  ? 215 PRO B CD    1 
ATOM   3599 N  N     . SER B 1 216 ? -17.682 27.508 19.322  1.00 20.75  ? 216 SER B N     1 
ATOM   3600 C  CA    . SER B 1 216 ? -18.428 28.658 19.801  1.00 32.00  ? 216 SER B CA    1 
ATOM   3601 C  C     . SER B 1 216 ? -19.909 28.512 19.454  1.00 29.78  ? 216 SER B C     1 
ATOM   3602 O  O     . SER B 1 216 ? -20.353 27.473 18.997  1.00 25.65  ? 216 SER B O     1 
ATOM   3603 C  CB    . SER B 1 216 ? -17.832 29.960 19.241  1.00 21.62  ? 216 SER B CB    1 
ATOM   3604 O  OG    . SER B 1 216 ? -18.019 30.095 17.827  1.00 24.05  ? 216 SER B OG    1 
ATOM   3605 N  N     . LEU B 1 217 ? -20.679 29.537 19.759  1.00 42.23  ? 217 LEU B N     1 
ATOM   3606 C  CA    . LEU B 1 217 ? -22.107 29.400 19.852  1.00 17.74  ? 217 LEU B CA    1 
ATOM   3607 C  C     . LEU B 1 217 ? -22.781 30.680 19.320  1.00 18.61  ? 217 LEU B C     1 
ATOM   3608 O  O     . LEU B 1 217 ? -22.353 31.776 19.654  1.00 16.01  ? 217 LEU B O     1 
ATOM   3609 C  CB    . LEU B 1 217 ? -22.422 29.120 21.325  1.00 23.65  ? 217 LEU B CB    1 
ATOM   3610 C  CG    . LEU B 1 217 ? -23.769 28.554 21.716  1.00 29.39  ? 217 LEU B CG    1 
ATOM   3611 C  CD1   . LEU B 1 217 ? -23.997 27.343 20.881  1.00 44.68  ? 217 LEU B CD1   1 
ATOM   3612 C  CD2   . LEU B 1 217 ? -23.765 28.109 23.135  1.00 16.41  ? 217 LEU B CD2   1 
ATOM   3613 N  N     . THR B 1 218 ? -23.813 30.583 18.494  1.00 18.20  ? 218 THR B N     1 
ATOM   3614 C  CA    . THR B 1 218 ? -24.460 31.826 18.095  1.00 17.48  ? 218 THR B CA    1 
ATOM   3615 C  C     . THR B 1 218 ? -25.319 32.284 19.231  1.00 18.34  ? 218 THR B C     1 
ATOM   3616 O  O     . THR B 1 218 ? -25.743 31.474 20.044  1.00 34.15  ? 218 THR B O     1 
ATOM   3617 C  CB    . THR B 1 218 ? -25.338 31.720 16.840  1.00 32.12  ? 218 THR B CB    1 
ATOM   3618 O  OG1   . THR B 1 218 ? -26.597 31.106 17.157  1.00 20.43  ? 218 THR B OG1   1 
ATOM   3619 C  CG2   . THR B 1 218 ? -24.623 30.972 15.744  1.00 17.01  ? 218 THR B CG2   1 
ATOM   3620 N  N     . SER B 1 219 ? -25.579 33.585 19.276  1.00 35.10  ? 219 SER B N     1 
ATOM   3621 C  CA    . SER B 1 219 ? -26.384 34.186 20.333  1.00 29.15  ? 219 SER B CA    1 
ATOM   3622 C  C     . SER B 1 219 ? -27.698 33.432 20.522  1.00 29.10  ? 219 SER B C     1 
ATOM   3623 O  O     . SER B 1 219 ? -28.099 33.132 21.650  1.00 27.99  ? 219 SER B O     1 
ATOM   3624 C  CB    . SER B 1 219 ? -26.664 35.642 20.001  1.00 38.48  ? 219 SER B CB    1 
ATOM   3625 O  OG    . SER B 1 219 ? -27.109 35.751 18.663  1.00 28.38  ? 219 SER B OG    1 
ATOM   3626 N  N     . GLY B 1 220 ? -28.343 33.102 19.404  1.00 20.45  ? 220 GLY B N     1 
ATOM   3627 C  CA    . GLY B 1 220 ? -29.632 32.439 19.422  1.00 17.81  ? 220 GLY B CA    1 
ATOM   3628 C  C     . GLY B 1 220 ? -29.549 31.000 19.874  1.00 28.72  ? 220 GLY B C     1 
ATOM   3629 O  O     . GLY B 1 220 ? -30.465 30.471 20.514  1.00 28.13  ? 220 GLY B O     1 
ATOM   3630 N  N     . ALA B 1 221 ? -28.443 30.355 19.529  1.00 31.37  ? 221 ALA B N     1 
ATOM   3631 C  CA    . ALA B 1 221 ? -28.177 29.016 20.018  1.00 16.39  ? 221 ALA B CA    1 
ATOM   3632 C  C     . ALA B 1 221 ? -28.017 29.044 21.539  1.00 20.79  ? 221 ALA B C     1 
ATOM   3633 O  O     . ALA B 1 221 ? -28.621 28.239 22.237  1.00 21.85  ? 221 ALA B O     1 
ATOM   3634 C  CB    . ALA B 1 221 ? -26.951 28.455 19.360  1.00 14.75  ? 221 ALA B CB    1 
ATOM   3635 N  N     . LYS B 1 222 ? -27.222 29.987 22.044  1.00 20.66  ? 222 LYS B N     1 
ATOM   3636 C  CA    . LYS B 1 222 ? -26.989 30.120 23.482  1.00 32.19  ? 222 LYS B CA    1 
ATOM   3637 C  C     . LYS B 1 222 ? -28.285 30.335 24.234  1.00 32.37  ? 222 LYS B C     1 
ATOM   3638 O  O     . LYS B 1 222 ? -28.509 29.735 25.289  1.00 13.46  ? 222 LYS B O     1 
ATOM   3639 C  CB    . LYS B 1 222 ? -26.039 31.271 23.772  1.00 20.66  ? 222 LYS B CB    1 
ATOM   3640 C  CG    . LYS B 1 222 ? -25.673 31.434 25.250  1.00 33.44  ? 222 LYS B CG    1 
ATOM   3641 C  CD    . LYS B 1 222 ? -24.395 32.287 25.401  1.00 29.92  ? 222 LYS B CD    1 
ATOM   3642 C  CE    . LYS B 1 222 ? -24.108 32.652 26.833  1.00 28.50  ? 222 LYS B CE    1 
ATOM   3643 N  NZ    . LYS B 1 222 ? -25.235 33.426 27.418  1.00 61.98  ? 222 LYS B NZ    1 
ATOM   3644 N  N     . ARG B 1 223 ? -29.136 31.188 23.673  1.00 29.64  ? 223 ARG B N     1 
ATOM   3645 C  CA    . ARG B 1 223 ? -30.449 31.447 24.241  1.00 29.28  ? 223 ARG B CA    1 
ATOM   3646 C  C     . ARG B 1 223 ? -31.235 30.157 24.383  1.00 29.55  ? 223 ARG B C     1 
ATOM   3647 O  O     . ARG B 1 223 ? -31.692 29.822 25.474  1.00 27.15  ? 223 ARG B O     1 
ATOM   3648 C  CB    . ARG B 1 223 ? -31.222 32.436 23.374  1.00 28.79  ? 223 ARG B CB    1 
ATOM   3649 C  CG    . ARG B 1 223 ? -32.431 33.067 24.037  1.00 37.81  ? 223 ARG B CG    1 
ATOM   3650 C  CD    . ARG B 1 223 ? -33.122 33.997 23.056  1.00 28.72  ? 223 ARG B CD    1 
ATOM   3651 N  NE    . ARG B 1 223 ? -32.135 34.747 22.285  1.00 49.62  ? 223 ARG B NE    1 
ATOM   3652 C  CZ    . ARG B 1 223 ? -32.231 34.987 20.980  1.00 80.74  ? 223 ARG B CZ    1 
ATOM   3653 N  NH1   . ARG B 1 223 ? -33.281 34.530 20.302  1.00 38.81  ? 223 ARG B NH1   1 
ATOM   3654 N  NH2   . ARG B 1 223 ? -31.275 35.676 20.353  1.00 66.10  ? 223 ARG B NH2   1 
ATOM   3655 N  N     . LEU B 1 224 ? -31.376 29.424 23.283  1.00 25.80  ? 224 LEU B N     1 
ATOM   3656 C  CA    . LEU B 1 224 ? -32.236 28.245 23.289  1.00 22.90  ? 224 LEU B CA    1 
ATOM   3657 C  C     . LEU B 1 224 ? -31.651 27.127 24.138  1.00 26.55  ? 224 LEU B C     1 
ATOM   3658 O  O     . LEU B 1 224 ? -32.381 26.351 24.760  1.00 28.03  ? 224 LEU B O     1 
ATOM   3659 C  CB    . LEU B 1 224 ? -32.483 27.745 21.871  1.00 15.69  ? 224 LEU B CB    1 
ATOM   3660 C  CG    . LEU B 1 224 ? -33.436 26.543 21.812  1.00 16.55  ? 224 LEU B CG    1 
ATOM   3661 C  CD1   . LEU B 1 224 ? -34.753 26.811 22.525  1.00 17.59  ? 224 LEU B CD1   1 
ATOM   3662 C  CD2   . LEU B 1 224 ? -33.686 26.130 20.383  1.00 19.56  ? 224 LEU B CD2   1 
ATOM   3663 N  N     . LEU B 1 225 ? -30.327 27.050 24.150  1.00 31.21  ? 225 LEU B N     1 
ATOM   3664 C  CA    . LEU B 1 225 ? -29.622 26.108 24.998  1.00 14.41  ? 225 LEU B CA    1 
ATOM   3665 C  C     . LEU B 1 225 ? -30.030 26.361 26.432  1.00 28.95  ? 225 LEU B C     1 
ATOM   3666 O  O     . LEU B 1 225 ? -30.580 25.483 27.094  1.00 28.89  ? 225 LEU B O     1 
ATOM   3667 C  CB    . LEU B 1 225 ? -28.115 26.270 24.833  1.00 21.96  ? 225 LEU B CB    1 
ATOM   3668 C  CG    . LEU B 1 225 ? -27.234 25.050 25.044  1.00 22.71  ? 225 LEU B CG    1 
ATOM   3669 C  CD1   . LEU B 1 225 ? -27.827 23.876 24.302  1.00 9.27   ? 225 LEU B CD1   1 
ATOM   3670 C  CD2   . LEU B 1 225 ? -25.837 25.364 24.520  1.00 20.79  ? 225 LEU B CD2   1 
ATOM   3671 N  N     . GLU B 1 226 ? -29.802 27.591 26.884  1.00 47.50  ? 226 GLU B N     1 
ATOM   3672 C  CA    . GLU B 1 226 ? -30.078 27.981 28.267  1.00 49.63  ? 226 GLU B CA    1 
ATOM   3673 C  C     . GLU B 1 226 ? -31.562 27.900 28.641  1.00 18.28  ? 226 GLU B C     1 
ATOM   3674 O  O     . GLU B 1 226 ? -31.885 27.579 29.773  1.00 25.60  ? 226 GLU B O     1 
ATOM   3675 C  CB    . GLU B 1 226 ? -29.543 29.395 28.533  1.00 20.30  ? 226 GLU B CB    1 
ATOM   3676 C  CG    . GLU B 1 226 ? -28.020 29.486 28.539  1.00 13.18  ? 226 GLU B CG    1 
ATOM   3677 C  CD    . GLU B 1 226 ? -27.511 30.923 28.648  1.00 74.66  ? 226 GLU B CD    1 
ATOM   3678 O  OE1   . GLU B 1 226 ? -28.270 31.864 28.302  1.00 57.19  ? 226 GLU B OE1   1 
ATOM   3679 O  OE2   . GLU B 1 226 ? -26.347 31.107 29.076  1.00 49.75  ? 226 GLU B OE2   1 
ATOM   3680 N  N     . LYS B 1 227 ? -32.458 28.179 27.701  1.00 17.22  ? 227 LYS B N     1 
ATOM   3681 C  CA    . LYS B 1 227 ? -33.890 28.070 27.978  1.00 39.27  ? 227 LYS B CA    1 
ATOM   3682 C  C     . LYS B 1 227 ? -34.293 26.610 28.219  1.00 40.80  ? 227 LYS B C     1 
ATOM   3683 O  O     . LYS B 1 227 ? -35.205 26.311 28.998  1.00 38.18  ? 227 LYS B O     1 
ATOM   3684 C  CB    . LYS B 1 227 ? -34.713 28.671 26.828  1.00 35.87  ? 227 LYS B CB    1 
ATOM   3685 C  CG    . LYS B 1 227 ? -36.237 28.588 27.007  1.00 25.46  ? 227 LYS B CG    1 
ATOM   3686 C  CD    . LYS B 1 227 ? -36.995 29.195 25.820  1.00 70.91  ? 227 LYS B CD    1 
ATOM   3687 C  CE    . LYS B 1 227 ? -37.280 28.165 24.720  1.00 78.33  ? 227 LYS B CE    1 
ATOM   3688 N  NZ    . LYS B 1 227 ? -37.947 26.929 25.232  1.00 95.03  ? 227 LYS B NZ    1 
ATOM   3689 N  N     . GLU B 1 228 ? -33.612 25.697 27.544  1.00 30.26  ? 228 GLU B N     1 
ATOM   3690 C  CA    . GLU B 1 228 ? -33.947 24.287 27.659  1.00 46.63  ? 228 GLU B CA    1 
ATOM   3691 C  C     . GLU B 1 228 ? -33.062 23.543 28.675  1.00 50.18  ? 228 GLU B C     1 
ATOM   3692 O  O     . GLU B 1 228 ? -33.118 22.314 28.799  1.00 29.58  ? 228 GLU B O     1 
ATOM   3693 C  CB    . GLU B 1 228 ? -33.897 23.638 26.279  1.00 22.17  ? 228 GLU B CB    1 
ATOM   3694 C  CG    . GLU B 1 228 ? -35.030 24.122 25.360  1.00 48.26  ? 228 GLU B CG    1 
ATOM   3695 C  CD    . GLU B 1 228 ? -36.439 23.733 25.840  1.00 74.65  ? 228 GLU B CD    1 
ATOM   3696 O  OE1   . GLU B 1 228 ? -36.576 22.977 26.832  1.00 59.01  ? 228 GLU B OE1   1 
ATOM   3697 O  OE2   . GLU B 1 228 ? -37.421 24.186 25.206  1.00 58.76  ? 228 GLU B OE2   1 
ATOM   3698 N  N     . GLY B 1 229 ? -32.235 24.293 29.392  1.00 29.93  ? 229 GLY B N     1 
ATOM   3699 C  CA    . GLY B 1 229 ? -31.397 23.710 30.417  1.00 17.25  ? 229 GLY B CA    1 
ATOM   3700 C  C     . GLY B 1 229 ? -30.447 22.670 29.861  1.00 27.89  ? 229 GLY B C     1 
ATOM   3701 O  O     . GLY B 1 229 ? -30.397 21.537 30.329  1.00 41.45  ? 229 GLY B O     1 
ATOM   3702 N  N     . LEU B 1 230 ? -29.704 23.054 28.837  1.00 26.37  ? 230 LEU B N     1 
ATOM   3703 C  CA    . LEU B 1 230 ? -28.705 22.178 28.270  1.00 10.88  ? 230 LEU B CA    1 
ATOM   3704 C  C     . LEU B 1 230 ? -27.361 22.834 28.446  1.00 13.30  ? 230 LEU B C     1 
ATOM   3705 O  O     . LEU B 1 230 ? -27.279 23.968 28.905  1.00 28.43  ? 230 LEU B O     1 
ATOM   3706 C  CB    . LEU B 1 230 ? -28.998 21.900 26.798  1.00 18.57  ? 230 LEU B CB    1 
ATOM   3707 C  CG    . LEU B 1 230 ? -30.295 21.149 26.489  1.00 11.32  ? 230 LEU B CG    1 
ATOM   3708 C  CD1   . LEU B 1 230 ? -30.787 21.405 25.086  1.00 7.75   ? 230 LEU B CD1   1 
ATOM   3709 C  CD2   . LEU B 1 230 ? -30.044 19.673 26.666  1.00 36.56  ? 230 LEU B CD2   1 
ATOM   3710 N  N     . GLU B 1 231 ? -26.303 22.141 28.060  1.00 18.35  ? 231 GLU B N     1 
ATOM   3711 C  CA    . GLU B 1 231 ? -24.966 22.588 28.419  1.00 20.00  ? 231 GLU B CA    1 
ATOM   3712 C  C     . GLU B 1 231 ? -24.042 22.782 27.216  1.00 27.12  ? 231 GLU B C     1 
ATOM   3713 O  O     . GLU B 1 231 ? -24.298 22.276 26.122  1.00 18.68  ? 231 GLU B O     1 
ATOM   3714 C  CB    . GLU B 1 231 ? -24.358 21.594 29.400  1.00 10.69  ? 231 GLU B CB    1 
ATOM   3715 C  CG    . GLU B 1 231 ? -25.165 21.450 30.666  1.00 7.52   ? 231 GLU B CG    1 
ATOM   3716 C  CD    . GLU B 1 231 ? -24.910 20.139 31.374  1.00 33.73  ? 231 GLU B CD    1 
ATOM   3717 O  OE1   . GLU B 1 231 ? -25.839 19.296 31.414  1.00 21.40  ? 231 GLU B OE1   1 
ATOM   3718 O  OE2   . GLU B 1 231 ? -23.786 19.956 31.895  1.00 27.08  ? 231 GLU B OE2   1 
ATOM   3719 N  N     . PHE B 1 232 ? -22.966 23.528 27.423  1.00 17.33  ? 232 PHE B N     1 
ATOM   3720 C  CA    . PHE B 1 232 ? -22.028 23.779 26.342  1.00 22.71  ? 232 PHE B CA    1 
ATOM   3721 C  C     . PHE B 1 232 ? -20.582 23.548 26.739  1.00 16.16  ? 232 PHE B C     1 
ATOM   3722 O  O     . PHE B 1 232 ? -20.064 24.214 27.634  1.00 53.29  ? 232 PHE B O     1 
ATOM   3723 C  CB    . PHE B 1 232 ? -22.170 25.210 25.827  1.00 12.66  ? 232 PHE B CB    1 
ATOM   3724 C  CG    . PHE B 1 232 ? -21.095 25.597 24.858  1.00 27.47  ? 232 PHE B CG    1 
ATOM   3725 C  CD1   . PHE B 1 232 ? -21.214 25.278 23.513  1.00 36.24  ? 232 PHE B CD1   1 
ATOM   3726 C  CD2   . PHE B 1 232 ? -19.954 26.255 25.287  1.00 22.86  ? 232 PHE B CD2   1 
ATOM   3727 C  CE1   . PHE B 1 232 ? -20.222 25.616 22.616  1.00 23.39  ? 232 PHE B CE1   1 
ATOM   3728 C  CE2   . PHE B 1 232 ? -18.954 26.593 24.396  1.00 26.21  ? 232 PHE B CE2   1 
ATOM   3729 C  CZ    . PHE B 1 232 ? -19.091 26.277 23.056  1.00 26.64  ? 232 PHE B CZ    1 
ATOM   3730 N  N     . ARG B 1 233 ? -19.920 22.618 26.066  1.00 14.61  ? 233 ARG B N     1 
ATOM   3731 C  CA    . ARG B 1 233 ? -18.479 22.469 26.240  1.00 40.99  ? 233 ARG B CA    1 
ATOM   3732 C  C     . ARG B 1 233 ? -17.790 23.090 25.038  1.00 30.49  ? 233 ARG B C     1 
ATOM   3733 O  O     . ARG B 1 233 ? -18.069 22.710 23.901  1.00 31.36  ? 233 ARG B O     1 
ATOM   3734 C  CB    . ARG B 1 233 ? -18.067 20.994 26.401  1.00 19.06  ? 233 ARG B CB    1 
ATOM   3735 C  CG    . ARG B 1 233 ? -16.611 20.795 26.849  1.00 16.72  ? 233 ARG B CG    1 
ATOM   3736 C  CD    . ARG B 1 233 ? -16.258 21.723 28.030  1.00 35.23  ? 233 ARG B CD    1 
ATOM   3737 N  NE    . ARG B 1 233 ? -15.059 21.301 28.757  1.00 57.57  ? 233 ARG B NE    1 
ATOM   3738 C  CZ    . ARG B 1 233 ? -13.843 21.828 28.605  1.00 82.16  ? 233 ARG B CZ    1 
ATOM   3739 N  NH1   . ARG B 1 233 ? -13.641 22.822 27.744  1.00 75.51  ? 233 ARG B NH1   1 
ATOM   3740 N  NH2   . ARG B 1 233 ? -12.824 21.362 29.323  1.00 64.89  ? 233 ARG B NH2   1 
ATOM   3741 N  N     . LYS B 1 234 ? -16.913 24.060 25.283  1.00 23.59  ? 234 LYS B N     1 
ATOM   3742 C  CA    . LYS B 1 234 ? -16.130 24.635 24.201  1.00 17.33  ? 234 LYS B CA    1 
ATOM   3743 C  C     . LYS B 1 234 ? -15.045 23.659 23.819  1.00 24.41  ? 234 LYS B C     1 
ATOM   3744 O  O     . LYS B 1 234 ? -14.226 23.279 24.655  1.00 24.01  ? 234 LYS B O     1 
ATOM   3745 C  CB    . LYS B 1 234 ? -15.532 25.981 24.600  1.00 23.03  ? 234 LYS B CB    1 
ATOM   3746 C  CG    . LYS B 1 234 ? -14.420 26.511 23.696  1.00 16.05  ? 234 LYS B CG    1 
ATOM   3747 C  CD    . LYS B 1 234 ? -14.082 27.978 24.048  1.00 34.51  ? 234 LYS B CD    1 
ATOM   3748 C  CE    . LYS B 1 234 ? -12.747 28.448 23.455  1.00 55.76  ? 234 LYS B CE    1 
ATOM   3749 N  NZ    . LYS B 1 234 ? -12.718 28.439 21.957  1.00 51.35  ? 234 LYS B NZ    1 
ATOM   3750 N  N     . LEU B 1 235 ? -15.072 23.248 22.551  1.00 25.41  ? 235 LEU B N     1 
ATOM   3751 C  CA    . LEU B 1 235 ? -14.063 22.374 21.978  1.00 25.96  ? 235 LEU B CA    1 
ATOM   3752 C  C     . LEU B 1 235 ? -13.776 22.756 20.525  1.00 23.25  ? 235 LEU B C     1 
ATOM   3753 O  O     . LEU B 1 235 ? -14.709 22.944 19.750  1.00 34.31  ? 235 LEU B O     1 
ATOM   3754 C  CB    . LEU B 1 235 ? -14.512 20.917 22.064  1.00 17.99  ? 235 LEU B CB    1 
ATOM   3755 C  CG    . LEU B 1 235 ? -13.507 19.915 21.493  1.00 27.52  ? 235 LEU B CG    1 
ATOM   3756 C  CD1   . LEU B 1 235 ? -12.183 20.002 22.239  1.00 17.75  ? 235 LEU B CD1   1 
ATOM   3757 C  CD2   . LEU B 1 235 ? -14.071 18.513 21.548  1.00 32.65  ? 235 LEU B CD2   1 
ATOM   3758 N  N     . GLU B 1 236 ? -12.494 22.880 20.163  1.00 44.29  ? 236 GLU B N     1 
ATOM   3759 C  CA    . GLU B 1 236 ? -12.092 23.119 18.767  1.00 25.24  ? 236 GLU B CA    1 
ATOM   3760 C  C     . GLU B 1 236 ? -11.840 21.792 18.077  1.00 21.65  ? 236 GLU B C     1 
ATOM   3761 O  O     . GLU B 1 236 ? -11.329 20.868 18.705  1.00 35.60  ? 236 GLU B O     1 
ATOM   3762 C  CB    . GLU B 1 236 ? -10.827 23.987 18.668  1.00 14.90  ? 236 GLU B CB    1 
ATOM   3763 C  CG    . GLU B 1 236 ? -10.817 25.268 19.489  1.00 53.97  ? 236 GLU B CG    1 
ATOM   3764 C  CD    . GLU B 1 236 ? -11.199 26.503 18.693  1.00 61.10  ? 236 GLU B CD    1 
ATOM   3765 O  OE1   . GLU B 1 236 ? -11.476 26.374 17.480  1.00 66.17  ? 236 GLU B OE1   1 
ATOM   3766 O  OE2   . GLU B 1 236 ? -11.217 27.607 19.287  1.00 58.28  ? 236 GLU B OE2   1 
ATOM   3767 N  N     . PRO B 1 237 ? -12.198 21.686 16.786  1.00 19.20  ? 237 PRO B N     1 
ATOM   3768 C  CA    . PRO B 1 237 ? -11.837 20.461 16.077  1.00 25.66  ? 237 PRO B CA    1 
ATOM   3769 C  C     . PRO B 1 237 ? -10.345 20.454 15.842  1.00 34.41  ? 237 PRO B C     1 
ATOM   3770 O  O     . PRO B 1 237 ? -9.797  21.477 15.417  1.00 29.58  ? 237 PRO B O     1 
ATOM   3771 C  CB    . PRO B 1 237 ? -12.629 20.546 14.763  1.00 17.96  ? 237 PRO B CB    1 
ATOM   3772 C  CG    . PRO B 1 237 ? -12.853 21.980 14.541  1.00 19.43  ? 237 PRO B CG    1 
ATOM   3773 C  CD    . PRO B 1 237 ? -12.833 22.674 15.898  1.00 31.66  ? 237 PRO B CD    1 
ATOM   3774 N  N     . PRO B 1 238 ? -9.696  19.317 16.128  1.00 48.76  ? 238 PRO B N     1 
ATOM   3775 C  CA    . PRO B 1 238 ? -8.248  19.115 16.037  1.00 32.19  ? 238 PRO B CA    1 
ATOM   3776 C  C     . PRO B 1 238 ? -7.750  18.939 14.605  1.00 54.50  ? 238 PRO B C     1 
ATOM   3777 O  O     . PRO B 1 238 ? -8.449  18.374 13.755  1.00 48.55  ? 238 PRO B O     1 
ATOM   3778 C  CB    . PRO B 1 238 ? -8.039  17.835 16.834  1.00 37.25  ? 238 PRO B CB    1 
ATOM   3779 C  CG    . PRO B 1 238 ? -9.296  17.060 16.593  1.00 36.91  ? 238 PRO B CG    1 
ATOM   3780 C  CD    . PRO B 1 238 ? -10.393 18.093 16.568  1.00 46.30  ? 238 PRO B CD    1 
ATOM   3781 N  N     . LYS B 1 239 ? -6.534  19.415 14.360  1.00 49.05  ? 239 LYS B N     1 
ATOM   3782 C  CA    . LYS B 1 239 ? -5.870  19.225 13.079  1.00 31.85  ? 239 LYS B CA    1 
ATOM   3783 C  C     . LYS B 1 239 ? -4.597  18.362 13.165  1.00 51.09  ? 239 LYS B C     1 
ATOM   3784 O  O     . LYS B 1 239 ? -3.581  18.797 13.728  1.00 50.57  ? 239 LYS B O     1 
ATOM   3785 C  CB    . LYS B 1 239 ? -5.517  20.585 12.488  1.00 39.83  ? 239 LYS B CB    1 
ATOM   3786 C  CG    . LYS B 1 239 ? -6.690  21.521 12.323  1.00 30.42  ? 239 LYS B CG    1 
ATOM   3787 C  CD    . LYS B 1 239 ? -6.211  22.805 11.677  1.00 42.61  ? 239 LYS B CD    1 
ATOM   3788 C  CE    . LYS B 1 239 ? -7.358  23.564 11.042  1.00 28.30  ? 239 LYS B CE    1 
ATOM   3789 N  NZ    . LYS B 1 239 ? -6.968  24.931 10.594  1.00 31.57  ? 239 LYS B NZ    1 
ATOM   3790 N  N     . ARG B 1 240 ? -4.678  17.152 12.601  1.00 39.05  ? 240 ARG B N     1 
ATOM   3791 C  CA    . ARG B 1 240 ? -3.531  16.262 12.366  1.00 68.83  ? 240 ARG B CA    1 
ATOM   3792 C  C     . ARG B 1 240 ? -2.266  17.048 11.991  1.00 70.04  ? 240 ARG B C     1 
ATOM   3793 O  O     . ARG B 1 240 ? -1.227  16.973 12.669  1.00 75.37  ? 240 ARG B O     1 
ATOM   3794 C  CB    . ARG B 1 240 ? -3.865  15.258 11.252  1.00 52.26  ? 240 ARG B CB    1 
ATOM   3795 C  CG    . ARG B 1 240 ? -2.661  14.693 10.477  1.00 76.20  ? 240 ARG B CG    1 
ATOM   3796 C  CD    . ARG B 1 240 ? -1.458  14.217 11.325  1.00 88.98  ? 240 ARG B CD    1 
ATOM   3797 N  NE    . ARG B 1 240 ? -0.318  13.828 10.487  1.00 129.23 ? 240 ARG B NE    1 
ATOM   3798 C  CZ    . ARG B 1 240 ? 0.475   14.683 9.835   1.00 119.93 ? 240 ARG B CZ    1 
ATOM   3799 N  NH1   . ARG B 1 240 ? 0.255   15.993 9.913   1.00 94.93  ? 240 ARG B NH1   1 
ATOM   3800 N  NH2   . ARG B 1 240 ? 1.496   14.231 9.105   1.00 86.42  ? 240 ARG B NH2   1 
ATOM   3801 O  "O5'" A DG  C 2 1   ? -32.265 4.643  -5.579  0.50 48.26  ? 1   DG  C "O5'" 1 
ATOM   3802 O  "O5'" B DG  C 2 1   ? -16.357 42.541 10.678  0.50 29.04  ? 1   DG  C "O5'" 1 
ATOM   3803 C  "C5'" A DG  C 2 1   ? -33.310 3.835  -6.120  0.50 48.02  ? 1   DG  C "C5'" 1 
ATOM   3804 C  "C5'" B DG  C 2 1   ? -17.688 42.478 10.179  0.50 65.81  ? 1   DG  C "C5'" 1 
ATOM   3805 C  "C4'" A DG  C 2 1   ? -34.164 3.226  -5.013  0.50 52.75  ? 1   DG  C "C4'" 1 
ATOM   3806 C  "C4'" B DG  C 2 1   ? -18.705 42.534 11.314  0.50 82.75  ? 1   DG  C "C4'" 1 
ATOM   3807 O  "O4'" A DG  C 2 1   ? -33.517 2.045  -4.486  0.50 50.99  ? 1   DG  C "O4'" 1 
ATOM   3808 O  "O4'" B DG  C 2 1   ? -19.709 43.540 11.015  0.50 87.18  ? 1   DG  C "O4'" 1 
ATOM   3809 C  "C3'" A DG  C 2 1   ? -34.437 4.140  -3.821  0.50 51.40  ? 1   DG  C "C3'" 1 
ATOM   3810 C  "C3'" B DG  C 2 1   ? -19.491 41.250 11.529  0.50 75.90  ? 1   DG  C "C3'" 1 
ATOM   3811 O  "O3'" A DG  C 2 1   ? -35.733 4.692  -3.947  0.50 58.26  ? 1   DG  C "O3'" 1 
ATOM   3812 O  "O3'" B DG  C 2 1   ? -18.831 40.416 12.445  0.50 61.21  ? 1   DG  C "O3'" 1 
ATOM   3813 C  "C2'" A DG  C 2 1   ? -34.353 3.213  -2.605  0.50 32.78  ? 1   DG  C "C2'" 1 
ATOM   3814 C  "C2'" B DG  C 2 1   ? -20.812 41.758 12.089  0.50 57.10  ? 1   DG  C "C2'" 1 
ATOM   3815 C  "C1'" A DG  C 2 1   ? -33.417 2.119  -3.077  0.50 36.58  ? 1   DG  C "C1'" 1 
ATOM   3816 C  "C1'" B DG  C 2 1   ? -21.007 43.025 11.280  0.50 68.34  ? 1   DG  C "C1'" 1 
ATOM   3817 N  N9    A DG  C 2 1   ? -32.012 2.317  -2.733  0.50 30.74  ? 1   DG  C N9    1 
ATOM   3818 N  N9    B DG  C 2 1   ? -21.707 42.824 10.006  0.50 67.40  ? 1   DG  C N9    1 
ATOM   3819 C  C8    A DG  C 2 1   ? -31.007 2.727  -3.576  0.50 35.30  ? 1   DG  C C8    1 
ATOM   3820 C  C8    B DG  C 2 1   ? -21.145 42.756 8.748   0.50 65.34  ? 1   DG  C C8    1 
ATOM   3821 N  N7    A DG  C 2 1   ? -29.834 2.771  -3.004  0.50 29.99  ? 1   DG  C N7    1 
ATOM   3822 N  N7    B DG  C 2 1   ? -22.020 42.592 7.792   0.50 56.70  ? 1   DG  C N7    1 
ATOM   3823 C  C5    A DG  C 2 1   ? -30.076 2.351  -1.706  0.50 17.13  ? 1   DG  C C5    1 
ATOM   3824 C  C5    B DG  C 2 1   ? -23.242 42.553 8.454   0.50 52.40  ? 1   DG  C C5    1 
ATOM   3825 C  C6    A DG  C 2 1   ? -29.183 2.195  -0.627  0.50 22.69  ? 1   DG  C C6    1 
ATOM   3826 C  C6    B DG  C 2 1   ? -24.553 42.399 7.938   0.50 44.75  ? 1   DG  C C6    1 
ATOM   3827 O  O6    A DG  C 2 1   ? -27.959 2.413  -0.607  0.50 30.23  ? 1   DG  C O6    1 
ATOM   3828 O  O6    B DG  C 2 1   ? -24.900 42.259 6.758   0.50 43.36  ? 1   DG  C O6    1 
ATOM   3829 N  N1    A DG  C 2 1   ? -29.838 1.750  0.525   0.50 21.85  ? 1   DG  C N1    1 
ATOM   3830 N  N1    B DG  C 2 1   ? -25.514 42.414 8.952   0.50 50.06  ? 1   DG  C N1    1 
ATOM   3831 C  C2    A DG  C 2 1   ? -31.188 1.487  0.608   0.50 20.41  ? 1   DG  C C2    1 
ATOM   3832 C  C2    B DG  C 2 1   ? -25.240 42.559 10.295  0.50 48.21  ? 1   DG  C C2    1 
ATOM   3833 N  N2    A DG  C 2 1   ? -31.642 1.066  1.800   0.50 14.39  ? 1   DG  C N2    1 
ATOM   3834 N  N2    B DG  C 2 1   ? -26.300 42.545 11.121  0.50 44.50  ? 1   DG  C N2    1 
ATOM   3835 N  N3    A DG  C 2 1   ? -32.034 1.628  -0.407  0.50 19.13  ? 1   DG  C N3    1 
ATOM   3836 N  N3    B DG  C 2 1   ? -24.014 42.707 10.793  0.50 45.93  ? 1   DG  C N3    1 
ATOM   3837 C  C4    A DG  C 2 1   ? -31.411 2.062  -1.524  0.50 18.28  ? 1   DG  C C4    1 
ATOM   3838 C  C4    B DG  C 2 1   ? -23.068 42.695 9.818   0.50 56.95  ? 1   DG  C C4    1 
ATOM   3839 P  P     A DC  C 2 2   ? -36.114 6.029  -3.155  0.50 45.50  ? 2   DC  C P     1 
ATOM   3840 P  P     B DC  C 2 2   ? -18.945 38.827 12.264  0.50 89.80  ? 2   DC  C P     1 
ATOM   3841 O  OP1   A DC  C 2 2   ? -37.552 6.264  -3.407  0.50 31.86  ? 2   DC  C OP1   1 
ATOM   3842 O  OP1   B DC  C 2 2   ? -17.978 38.186 13.184  0.50 82.60  ? 2   DC  C OP1   1 
ATOM   3843 O  OP2   A DC  C 2 2   ? -35.086 7.057  -3.461  0.50 35.14  ? 2   DC  C OP2   1 
ATOM   3844 O  OP2   B DC  C 2 2   ? -18.916 38.542 10.805  0.50 63.91  ? 2   DC  C OP2   1 
ATOM   3845 O  "O5'" A DC  C 2 2   ? -35.917 5.630  -1.625  0.50 39.47  ? 2   DC  C "O5'" 1 
ATOM   3846 O  "O5'" B DC  C 2 2   ? -20.419 38.500 12.770  0.50 53.45  ? 2   DC  C "O5'" 1 
ATOM   3847 C  "C5'" A DC  C 2 2   ? -36.921 4.913  -0.942  0.50 34.03  ? 2   DC  C "C5'" 1 
ATOM   3848 C  "C5'" B DC  C 2 2   ? -20.856 38.970 14.022  0.50 39.18  ? 2   DC  C "C5'" 1 
ATOM   3849 C  "C4'" A DC  C 2 2   ? -36.669 4.973  0.553   0.50 32.96  ? 2   DC  C "C4'" 1 
ATOM   3850 C  "C4'" B DC  C 2 2   ? -22.307 38.613 14.224  0.50 36.66  ? 2   DC  C "C4'" 1 
ATOM   3851 O  "O4'" A DC  C 2 2   ? -35.346 4.454  0.835   0.50 34.97  ? 2   DC  C "O4'" 1 
ATOM   3852 O  "O4'" B DC  C 2 2   ? -23.096 39.182 13.148  0.50 40.73  ? 2   DC  C "O4'" 1 
ATOM   3853 C  "C3'" A DC  C 2 2   ? -36.715 6.378  1.155   0.50 28.73  ? 2   DC  C "C3'" 1 
ATOM   3854 C  "C3'" B DC  C 2 2   ? -22.585 37.114 14.215  0.50 34.51  ? 2   DC  C "C3'" 1 
ATOM   3855 O  "O3'" A DC  C 2 2   ? -37.466 6.366  2.342   0.50 28.78  ? 2   DC  C "O3'" 1 
ATOM   3856 O  "O3'" B DC  C 2 2   ? -23.360 36.767 15.329  0.50 34.24  ? 2   DC  C "O3'" 1 
ATOM   3857 C  "C2'" A DC  C 2 2   ? -35.250 6.716  1.422   0.50 23.17  ? 2   DC  C "C2'" 1 
ATOM   3858 C  "C2'" B DC  C 2 2   ? -23.339 36.880 12.908  0.50 37.56  ? 2   DC  C "C2'" 1 
ATOM   3859 C  "C1'" A DC  C 2 2   ? -34.642 5.346  1.667   0.50 23.77  ? 2   DC  C "C1'" 1 
ATOM   3860 C  "C1'" B DC  C 2 2   ? -24.003 38.222 12.668  0.50 32.78  ? 2   DC  C "C1'" 1 
ATOM   3861 N  N1    A DC  C 2 2   ? -33.203 5.279  1.301   0.50 17.53  ? 2   DC  C N1    1 
ATOM   3862 N  N1    B DC  C 2 2   ? -24.259 38.493 11.219  0.50 32.79  ? 2   DC  C N1    1 
ATOM   3863 C  C2    A DC  C 2 2   ? -32.272 4.758  2.210   0.50 12.92  ? 2   DC  C C2    1 
ATOM   3864 C  C2    B DC  C 2 2   ? -25.565 38.740 10.773  0.50 29.03  ? 2   DC  C C2    1 
ATOM   3865 O  O2    A DC  C 2 2   ? -32.662 4.358  3.306   0.50 14.20  ? 2   DC  C O2    1 
ATOM   3866 O  O2    B DC  C 2 2   ? -26.498 38.741 11.587  0.50 31.19  ? 2   DC  C O2    1 
ATOM   3867 N  N3    A DC  C 2 2   ? -30.966 4.709  1.859   0.50 10.56  ? 2   DC  C N3    1 
ATOM   3868 N  N3    B DC  C 2 2   ? -25.773 38.976 9.461   0.50 21.13  ? 2   DC  C N3    1 
ATOM   3869 C  C4    A DC  C 2 2   ? -30.586 5.155  0.660   0.50 15.22  ? 2   DC  C C4    1 
ATOM   3870 C  C4    B DC  C 2 2   ? -24.745 38.969 8.611   0.50 32.66  ? 2   DC  C C4    1 
ATOM   3871 N  N4    A DC  C 2 2   ? -29.286 5.093  0.349   0.50 17.25  ? 2   DC  C N4    1 
ATOM   3872 N  N4    B DC  C 2 2   ? -25.000 39.210 7.318   0.50 45.45  ? 2   DC  C N4    1 
ATOM   3873 C  C5    A DC  C 2 2   ? -31.519 5.686  -0.277  0.50 19.17  ? 2   DC  C C5    1 
ATOM   3874 C  C5    B DC  C 2 2   ? -23.410 38.716 9.043   0.50 30.06  ? 2   DC  C C5    1 
ATOM   3875 C  C6    A DC  C 2 2   ? -32.804 5.730  0.083   0.50 18.93  ? 2   DC  C C6    1 
ATOM   3876 C  C6    B DC  C 2 2   ? -23.216 38.484 10.340  0.50 32.83  ? 2   DC  C C6    1 
ATOM   3877 P  P     A DC  C 2 3   ? -37.742 7.731  3.138   0.50 31.35  ? 3   DC  C P     1 
ATOM   3878 P  P     B DC  C 2 3   ? -23.795 35.242 15.562  0.50 37.79  ? 3   DC  C P     1 
ATOM   3879 O  OP1   A DC  C 2 3   ? -39.032 7.552  3.843   0.50 25.05  ? 3   DC  C OP1   1 
ATOM   3880 O  OP1   B DC  C 2 3   ? -24.026 35.063 17.019  0.50 31.19  ? 3   DC  C OP1   1 
ATOM   3881 O  OP2   A DC  C 2 3   ? -37.554 8.879  2.218   0.50 35.86  ? 3   DC  C OP2   1 
ATOM   3882 O  OP2   B DC  C 2 3   ? -22.835 34.373 14.845  0.50 31.81  ? 3   DC  C OP2   1 
ATOM   3883 O  "O5'" A DC  C 2 3   ? -36.579 7.760  4.218   0.50 22.36  ? 3   DC  C "O5'" 1 
ATOM   3884 O  "O5'" B DC  C 2 3   ? -25.195 35.157 14.819  0.50 26.46  ? 3   DC  C "O5'" 1 
ATOM   3885 C  "C5'" A DC  C 2 3   ? -36.512 6.731  5.167   0.50 27.97  ? 3   DC  C "C5'" 1 
ATOM   3886 C  "C5'" B DC  C 2 3   ? -26.142 36.174 15.037  0.50 32.48  ? 3   DC  C "C5'" 1 
ATOM   3887 C  "C4'" A DC  C 2 3   ? -35.269 6.859  6.013   0.50 23.21  ? 3   DC  C "C4'" 1 
ATOM   3888 C  "C4'" B DC  C 2 3   ? -27.451 35.826 14.381  0.50 31.09  ? 3   DC  C "C4'" 1 
ATOM   3889 O  "O4'" A DC  C 2 3   ? -34.101 6.683  5.186   0.50 21.09  ? 3   DC  C "O4'" 1 
ATOM   3890 O  "O4'" B DC  C 2 3   ? -27.434 36.263 12.999  0.50 34.68  ? 3   DC  C "O4'" 1 
ATOM   3891 C  "C3'" A DC  C 2 3   ? -35.102 8.204  6.718   0.50 23.78  ? 3   DC  C "C3'" 1 
ATOM   3892 C  "C3'" B DC  C 2 3   ? -27.772 34.339 14.362  0.50 33.97  ? 3   DC  C "C3'" 1 
ATOM   3893 O  "O3'" A DC  C 2 3   ? -34.918 7.975  8.101   0.50 31.77  ? 3   DC  C "O3'" 1 
ATOM   3894 O  "O3'" B DC  C 2 3   ? -29.128 34.163 14.670  0.50 33.47  ? 3   DC  C "O3'" 1 
ATOM   3895 C  "C2'" A DC  C 2 3   ? -33.850 8.814  6.070   0.50 19.09  ? 3   DC  C "C2'" 1 
ATOM   3896 C  "C2'" B DC  C 2 3   ? -27.451 33.918 12.921  0.50 32.42  ? 3   DC  C "C2'" 1 
ATOM   3897 C  "C1'" A DC  C 2 3   ? -33.106 7.576  5.609   0.50 18.00  ? 3   DC  C "C1'" 1 
ATOM   3898 C  "C1'" B DC  C 2 3   ? -27.771 35.188 12.144  0.50 34.22  ? 3   DC  C "C1'" 1 
ATOM   3899 N  N1    A DC  C 2 3   ? -32.178 7.805  4.465   0.50 15.30  ? 3   DC  C N1    1 
ATOM   3900 N  N1    B DC  C 2 3   ? -26.988 35.345 10.861  0.50 26.56  ? 3   DC  C N1    1 
ATOM   3901 C  C2    A DC  C 2 3   ? -30.804 7.645  4.651   0.50 16.13  ? 3   DC  C C2    1 
ATOM   3902 C  C2    B DC  C 2 3   ? -27.664 35.600 9.657   0.50 23.91  ? 3   DC  C C2    1 
ATOM   3903 O  O2    A DC  C 2 3   ? -30.379 7.333  5.777   0.50 17.83  ? 3   DC  C O2    1 
ATOM   3904 O  O2    B DC  C 2 3   ? -28.901 35.675 9.659   0.50 25.20  ? 3   DC  C O2    1 
ATOM   3905 N  N3    A DC  C 2 3   ? -29.973 7.838  3.592   0.50 13.11  ? 3   DC  C N3    1 
ATOM   3906 N  N3    B DC  C 2 3   ? -26.944 35.754 8.521   0.50 22.85  ? 3   DC  C N3    1 
ATOM   3907 C  C4    A DC  C 2 3   ? -30.472 8.165  2.401   0.50 11.93  ? 3   DC  C C4    1 
ATOM   3908 C  C4    B DC  C 2 3   ? -25.611 35.668 8.559   0.50 27.99  ? 3   DC  C C4    1 
ATOM   3909 N  N4    A DC  C 2 3   ? -29.615 8.348  1.395   0.50 11.61  ? 3   DC  C N4    1 
ATOM   3910 N  N4    B DC  C 2 3   ? -24.937 35.827 7.411   0.50 25.31  ? 3   DC  C N4    1 
ATOM   3911 C  C5    A DC  C 2 3   ? -31.870 8.325  2.190   0.50 14.13  ? 3   DC  C C5    1 
ATOM   3912 C  C5    B DC  C 2 3   ? -24.908 35.416 9.774   0.50 23.15  ? 3   DC  C C5    1 
ATOM   3913 C  C6    A DC  C 2 3   ? -32.680 8.131  3.237   0.50 16.77  ? 3   DC  C C6    1 
ATOM   3914 C  C6    B DC  C 2 3   ? -25.629 35.269 10.888  0.50 21.62  ? 3   DC  C C6    1 
ATOM   3915 P  P     A DT  C 2 4   ? -35.363 9.073  9.181   0.50 31.60  ? 4   DT  C P     1 
ATOM   3916 P  P     B DT  C 2 4   ? -29.639 32.811 15.360  0.50 37.89  ? 4   DT  C P     1 
ATOM   3917 O  OP1   A DT  C 2 4   ? -35.762 8.324  10.395  0.50 37.24  ? 4   DT  C OP1   1 
ATOM   3918 O  OP1   B DT  C 2 4   ? -30.549 33.212 16.456  0.50 29.78  ? 4   DT  C OP1   1 
ATOM   3919 O  OP2   A DT  C 2 4   ? -36.285 10.046 8.542   0.50 28.37  ? 4   DT  C OP2   1 
ATOM   3920 O  OP2   B DT  C 2 4   ? -28.464 31.923 15.580  0.50 30.38  ? 4   DT  C OP2   1 
ATOM   3921 O  "O5'" A DT  C 2 4   ? -34.003 9.826  9.511   0.50 18.83  ? 4   DT  C "O5'" 1 
ATOM   3922 O  "O5'" B DT  C 2 4   ? -30.558 32.162 14.238  0.50 30.12  ? 4   DT  C "O5'" 1 
ATOM   3923 C  "C5'" A DT  C 2 4   ? -32.993 9.131  10.157  0.50 17.53  ? 4   DT  C "C5'" 1 
ATOM   3924 C  "C5'" B DT  C 2 4   ? -31.576 32.937 13.664  0.50 24.92  ? 4   DT  C "C5'" 1 
ATOM   3925 C  "C4'" A DT  C 2 4   ? -31.658 9.782  9.905   0.50 24.52  ? 4   DT  C "C4'" 1 
ATOM   3926 C  "C4'" B DT  C 2 4   ? -31.841 32.513 12.230  0.50 25.80  ? 4   DT  C "C4'" 1 
ATOM   3927 O  "O4'" A DT  C 2 4   ? -31.303 9.659  8.520   0.50 26.30  ? 4   DT  C "O4'" 1 
ATOM   3928 O  "O4'" B DT  C 2 4   ? -30.761 32.915 11.366  0.50 19.61  ? 4   DT  C "O4'" 1 
ATOM   3929 C  "C3'" A DT  C 2 4   ? -31.588 11.281 10.193  0.50 21.44  ? 4   DT  C "C3'" 1 
ATOM   3930 C  "C3'" B DT  C 2 4   ? -31.992 31.013 12.014  0.50 20.92  ? 4   DT  C "C3'" 1 
ATOM   3931 O  "O3'" A DT  C 2 4   ? -31.041 11.485 11.509  0.50 16.75  ? 4   DT  C "O3'" 1 
ATOM   3932 O  "O3'" B DT  C 2 4   ? -33.360 30.712 11.867  0.50 19.61  ? 4   DT  C "O3'" 1 
ATOM   3933 C  "C2'" A DT  C 2 4   ? -30.660 11.829 9.067   0.50 19.10  ? 4   DT  C "C2'" 1 
ATOM   3934 C  "C2'" B DT  C 2 4   ? -31.193 30.729 10.719  0.50 18.02  ? 4   DT  C "C2'" 1 
ATOM   3935 C  "C1'" A DT  C 2 4   ? -30.257 10.558 8.305   0.50 19.27  ? 4   DT  C "C1'" 1 
ATOM   3936 C  "C1'" B DT  C 2 4   ? -30.861 32.130 10.214  0.50 17.29  ? 4   DT  C "C1'" 1 
ATOM   3937 N  N1    A DT  C 2 4   ? -30.044 10.727 6.823   0.50 16.52  ? 4   DT  C N1    1 
ATOM   3938 N  N1    B DT  C 2 4   ? -29.588 32.234 9.461   0.50 17.77  ? 4   DT  C N1    1 
ATOM   3939 C  C2    A DT  C 2 4   ? -28.774 10.553 6.310   0.50 16.03  ? 4   DT  C C2    1 
ATOM   3940 C  C2    B DT  C 2 4   ? -29.616 32.553 8.112   0.50 20.20  ? 4   DT  C C2    1 
ATOM   3941 O  O2    A DT  C 2 4   ? -27.805 10.282 7.001   0.50 19.37  ? 4   DT  C O2    1 
ATOM   3942 O  O2    B DT  C 2 4   ? -30.647 32.740 7.479   0.50 20.10  ? 4   DT  C O2    1 
ATOM   3943 N  N3    A DT  C 2 4   ? -28.674 10.715 4.953   0.50 12.25  ? 4   DT  C N3    1 
ATOM   3944 N  N3    B DT  C 2 4   ? -28.386 32.645 7.524   0.50 18.29  ? 4   DT  C N3    1 
ATOM   3945 C  C4    A DT  C 2 4   ? -29.692 11.020 4.066   0.50 15.61  ? 4   DT  C C4    1 
ATOM   3946 C  C4    B DT  C 2 4   ? -27.160 32.454 8.124   0.50 19.22  ? 4   DT  C C4    1 
ATOM   3947 O  O4    A DT  C 2 4   ? -29.495 11.150 2.858   0.50 11.37  ? 4   DT  C O4    1 
ATOM   3948 O  O4    B DT  C 2 4   ? -26.108 32.547 7.503   0.50 16.31  ? 4   DT  C O4    1 
ATOM   3949 C  C5    A DT  C 2 4   ? -31.006 11.182 4.661   0.50 18.59  ? 4   DT  C C5    1 
ATOM   3950 C  C5    B DT  C 2 4   ? -27.201 32.131 9.532   0.50 23.19  ? 4   DT  C C5    1 
ATOM   3951 C  C7    A DT  C 2 4   ? -32.193 11.522 3.792   0.50 11.32  ? 4   DT  C C7    1 
ATOM   3952 C  C7    B DT  C 2 4   ? -25.927 31.904 10.287  0.50 31.14  ? 4   DT  C C7    1 
ATOM   3953 C  C6    A DT  C 2 4   ? -31.118 11.024 5.999   0.50 17.07  ? 4   DT  C C6    1 
ATOM   3954 C  C6    B DT  C 2 4   ? -28.399 32.042 10.126  0.50 19.95  ? 4   DT  C C6    1 
ATOM   3955 P  P     A DA  C 2 5   ? -30.855 12.964 12.116  0.50 17.39  ? 5   DA  C P     1 
ATOM   3956 P  P     B DA  C 2 5   ? -33.839 29.192 11.746  0.50 21.71  ? 5   DA  C P     1 
ATOM   3957 O  OP1   A DA  C 2 5   ? -30.721 12.817 13.579  0.50 24.53  ? 5   DA  C OP1   1 
ATOM   3958 O  OP1   B DA  C 2 5   ? -35.244 29.111 12.194  0.50 23.50  ? 5   DA  C OP1   1 
ATOM   3959 O  OP2   A DA  C 2 5   ? -31.896 13.852 11.559  0.50 22.54  ? 5   DA  C OP2   1 
ATOM   3960 O  OP2   B DA  C 2 5   ? -32.781 28.350 12.351  0.50 20.77  ? 5   DA  C OP2   1 
ATOM   3961 O  "O5'" A DA  C 2 5   ? -29.442 13.438 11.555  0.50 17.81  ? 5   DA  C "O5'" 1 
ATOM   3962 O  "O5'" B DA  C 2 5   ? -33.850 28.938 10.180  0.50 22.55  ? 5   DA  C "O5'" 1 
ATOM   3963 C  "C5'" A DA  C 2 5   ? -28.282 12.703 11.890  0.50 20.86  ? 5   DA  C "C5'" 1 
ATOM   3964 C  "C5'" B DA  C 2 5   ? -34.718 29.682 9.372   0.50 20.67  ? 5   DA  C "C5'" 1 
ATOM   3965 C  "C4'" A DA  C 2 5   ? -27.074 13.237 11.151  0.50 22.84  ? 5   DA  C "C4'" 1 
ATOM   3966 C  "C4'" B DA  C 2 5   ? -34.490 29.365 7.915   0.50 19.97  ? 5   DA  C "C4'" 1 
ATOM   3967 O  "O4'" A DA  C 2 5   ? -27.165 12.889 9.740   0.50 29.38  ? 5   DA  C "O4'" 1 
ATOM   3968 O  "O4'" B DA  C 2 5   ? -33.187 29.863 7.499   0.50 18.15  ? 5   DA  C "O4'" 1 
ATOM   3969 C  "C3'" A DA  C 2 5   ? -26.911 14.762 11.197  0.50 20.29  ? 5   DA  C "C3'" 1 
ATOM   3970 C  "C3'" B DA  C 2 5   ? -34.498 27.874 7.572   0.50 24.26  ? 5   DA  C "C3'" 1 
ATOM   3971 O  "O3'" A DA  C 2 5   ? -25.557 15.079 11.383  0.50 16.98  ? 5   DA  C "O3'" 1 
ATOM   3972 O  "O3'" B DA  C 2 5   ? -35.091 27.714 6.309   0.50 26.28  ? 5   DA  C "O3'" 1 
ATOM   3973 C  "C2'" A DA  C 2 5   ? -27.376 15.187 9.815   0.50 23.28  ? 5   DA  C "C2'" 1 
ATOM   3974 C  "C2'" B DA  C 2 5   ? -33.010 27.545 7.523   0.50 20.53  ? 5   DA  C "C2'" 1 
ATOM   3975 C  "C1'" A DA  C 2 5   ? -26.840 14.035 8.989   0.50 26.62  ? 5   DA  C "C1'" 1 
ATOM   3976 C  "C1'" B DA  C 2 5   ? -32.490 28.807 6.867   0.50 23.96  ? 5   DA  C "C1'" 1 
ATOM   3977 N  N9    A DA  C 2 5   ? -27.440 13.959 7.660   0.50 19.48  ? 5   DA  C N9    1 
ATOM   3978 N  N9    B DA  C 2 5   ? -31.047 28.999 7.008   0.50 20.70  ? 5   DA  C N9    1 
ATOM   3979 C  C8    A DA  C 2 5   ? -28.767 14.046 7.353   0.50 18.72  ? 5   DA  C C8    1 
ATOM   3980 C  C8    B DA  C 2 5   ? -30.273 28.715 8.098   0.50 19.07  ? 5   DA  C C8    1 
ATOM   3981 N  N7    A DA  C 2 5   ? -29.016 13.980 6.070   0.50 16.96  ? 5   DA  C N7    1 
ATOM   3982 N  N7    B DA  C 2 5   ? -28.999 28.981 7.924   0.50 17.13  ? 5   DA  C N7    1 
ATOM   3983 C  C5    A DA  C 2 5   ? -27.765 13.848 5.494   0.50 14.74  ? 5   DA  C C5    1 
ATOM   3984 C  C5    B DA  C 2 5   ? -28.934 29.467 6.625   0.50 18.82  ? 5   DA  C C5    1 
ATOM   3985 C  C6    A DA  C 2 5   ? -27.347 13.736 4.156   0.50 15.80  ? 5   DA  C C6    1 
ATOM   3986 C  C6    B DA  C 2 5   ? -27.860 29.934 5.827   0.50 20.17  ? 5   DA  C C6    1 
ATOM   3987 N  N6    A DA  C 2 5   ? -28.196 13.731 3.124   0.50 17.95  ? 5   DA  C N6    1 
ATOM   3988 N  N6    B DA  C 2 5   ? -26.589 29.981 6.247   0.50 20.59  ? 5   DA  C N6    1 
ATOM   3989 N  N1    A DA  C 2 5   ? -26.021 13.629 3.917   0.50 14.19  ? 5   DA  C N1    1 
ATOM   3990 N  N1    B DA  C 2 5   ? -28.146 30.351 4.578   0.50 17.48  ? 5   DA  C N1    1 
ATOM   3991 C  C2    A DA  C 2 5   ? -25.176 13.633 4.956   0.50 15.51  ? 5   DA  C C2    1 
ATOM   3992 C  C2    B DA  C 2 5   ? -29.414 30.301 4.154   0.50 19.21  ? 5   DA  C C2    1 
ATOM   3993 N  N3    A DA  C 2 5   ? -25.453 13.731 6.259   0.50 21.35  ? 5   DA  C N3    1 
ATOM   3994 N  N3    B DA  C 2 5   ? -30.498 29.890 4.805   0.50 22.73  ? 5   DA  C N3    1 
ATOM   3995 C  C4    A DA  C 2 5   ? -26.781 13.842 6.459   0.50 16.62  ? 5   DA  C C4    1 
ATOM   3996 C  C4    B DA  C 2 5   ? -30.186 29.480 6.047   0.50 19.60  ? 5   DA  C C4    1 
ATOM   3997 P  P     A DG  C 2 6   ? -25.130 16.557 11.830  0.50 25.31  ? 6   DG  C P     1 
ATOM   3998 P  P     B DG  C 2 6   ? -35.450 26.267 5.719   0.50 20.67  ? 6   DG  C P     1 
ATOM   3999 O  OP1   A DG  C 2 6   ? -25.082 16.588 13.315  0.50 37.53  ? 6   DG  C OP1   1 
ATOM   4000 O  OP1   B DG  C 2 6   ? -36.905 26.058 5.926   0.50 32.23  ? 6   DG  C OP1   1 
ATOM   4001 O  OP2   A DG  C 2 6   ? -25.994 17.502 11.088  0.50 23.18  ? 6   DG  C OP2   1 
ATOM   4002 O  OP2   B DG  C 2 6   ? -34.470 25.269 6.197   0.50 17.92  ? 6   DG  C OP2   1 
ATOM   4003 O  "O5'" A DG  C 2 6   ? -23.645 16.696 11.264  0.50 26.81  ? 6   DG  C "O5'" 1 
ATOM   4004 O  "O5'" B DG  C 2 6   ? -35.224 26.477 4.160   0.50 24.19  ? 6   DG  C "O5'" 1 
ATOM   4005 C  "C5'" A DG  C 2 6   ? -22.855 15.532 11.096  0.50 25.83  ? 6   DG  C "C5'" 1 
ATOM   4006 C  "C5'" B DG  C 2 6   ? -35.686 27.672 3.546   0.50 17.73  ? 6   DG  C "C5'" 1 
ATOM   4007 C  "C4'" A DG  C 2 6   ? -21.925 15.656 9.899   0.50 20.68  ? 6   DG  C "C4'" 1 
ATOM   4008 C  "C4'" B DG  C 2 6   ? -35.087 27.862 2.163   0.50 12.80  ? 6   DG  C "C4'" 1 
ATOM   4009 O  "O4'" A DG  C 2 6   ? -22.663 15.487 8.659   0.50 20.03  ? 6   DG  C "O4'" 1 
ATOM   4010 O  "O4'" B DG  C 2 6   ? -33.686 28.196 2.269   0.50 17.98  ? 6   DG  C "O4'" 1 
ATOM   4011 C  "C3'" A DG  C 2 6   ? -21.181 16.975 9.773   0.50 14.13  ? 6   DG  C "C3'" 1 
ATOM   4012 C  "C3'" B DG  C 2 6   ? -35.136 26.659 1.250   0.50 14.14  ? 6   DG  C "C3'" 1 
ATOM   4013 O  "O3'" A DG  C 2 6   ? -19.870 16.699 9.340   0.50 16.88  ? 6   DG  C "O3'" 1 
ATOM   4014 O  "O3'" B DG  C 2 6   ? -35.164 27.110 -0.074  0.50 20.75  ? 6   DG  C "O3'" 1 
ATOM   4015 C  "C2'" A DG  C 2 6   ? -21.990 17.725 8.708   0.50 14.25  ? 6   DG  C "C2'" 1 
ATOM   4016 C  "C2'" B DG  C 2 6   ? -33.816 25.970 1.556   0.50 16.30  ? 6   DG  C "C2'" 1 
ATOM   4017 C  "C1'" A DG  C 2 6   ? -22.434 16.587 7.803   0.50 14.51  ? 6   DG  C "C1'" 1 
ATOM   4018 C  "C1'" B DG  C 2 6   ? -32.897 27.166 1.713   0.50 16.97  ? 6   DG  C "C1'" 1 
ATOM   4019 N  N9    A DG  C 2 6   ? -23.680 16.835 7.075   0.50 21.52  ? 6   DG  C N9    1 
ATOM   4020 N  N9    B DG  C 2 6   ? -31.785 26.927 2.616   0.50 19.95  ? 6   DG  C N9    1 
ATOM   4021 C  C8    A DG  C 2 6   ? -24.932 17.031 7.623   0.50 23.96  ? 6   DG  C C8    1 
ATOM   4022 C  C8    B DG  C 2 6   ? -31.861 26.512 3.920   0.50 20.93  ? 6   DG  C C8    1 
ATOM   4023 N  N7    A DG  C 2 6   ? -25.880 17.188 6.734   0.50 13.81  ? 6   DG  C N7    1 
ATOM   4024 N  N7    B DG  C 2 6   ? -30.700 26.405 4.499   0.50 22.81  ? 6   DG  C N7    1 
ATOM   4025 C  C5    A DG  C 2 6   ? -25.226 17.072 5.520   0.50 13.24  ? 6   DG  C C5    1 
ATOM   4026 C  C5    B DG  C 2 6   ? -29.797 26.777 3.519   0.50 18.76  ? 6   DG  C C5    1 
ATOM   4027 C  C6    A DG  C 2 6   ? -25.743 17.149 4.207   0.50 20.37  ? 6   DG  C C6    1 
ATOM   4028 C  C6    B DG  C 2 6   ? -28.389 26.852 3.569   0.50 20.11  ? 6   DG  C C6    1 
ATOM   4029 O  O6    A DG  C 2 6   ? -26.916 17.345 3.856   0.50 21.09  ? 6   DG  C O6    1 
ATOM   4030 O  O6    B DG  C 2 6   ? -27.647 26.596 4.520   0.50 21.28  ? 6   DG  C O6    1 
ATOM   4031 N  N1    A DG  C 2 6   ? -24.748 16.975 3.244   0.50 23.60  ? 6   DG  C N1    1 
ATOM   4032 N  N1    B DG  C 2 6   ? -27.850 27.270 2.356   0.50 21.34  ? 6   DG  C N1    1 
ATOM   4033 C  C2    A DG  C 2 6   ? -23.415 16.752 3.522   0.50 25.25  ? 6   DG  C C2    1 
ATOM   4034 C  C2    B DG  C 2 6   ? -28.588 27.582 1.235   0.50 26.89  ? 6   DG  C C2    1 
ATOM   4035 N  N2    A DG  C 2 6   ? -22.612 16.611 2.452   0.50 18.66  ? 6   DG  C N2    1 
ATOM   4036 N  N2    B DG  C 2 6   ? -27.888 27.972 0.154   0.50 33.19  ? 6   DG  C N2    1 
ATOM   4037 N  N3    A DG  C 2 6   ? -22.907 16.671 4.764   0.50 12.54  ? 6   DG  C N3    1 
ATOM   4038 N  N3    B DG  C 2 6   ? -29.919 27.520 1.178   0.50 20.06  ? 6   DG  C N3    1 
ATOM   4039 C  C4    A DG  C 2 6   ? -23.869 16.842 5.706   0.50 14.45  ? 6   DG  C C4    1 
ATOM   4040 C  C4    B DG  C 2 6   ? -30.449 27.108 2.352   0.50 18.45  ? 6   DG  C C4    1 
ATOM   4041 P  P     A DG  C 2 7   ? -18.751 17.847 9.295   0.50 17.80  ? 7   DG  C P     1 
ATOM   4042 P  P     B DG  C 2 7   ? -35.421 26.087 -1.276  0.50 18.88  ? 7   DG  C P     1 
ATOM   4043 O  OP1   A DG  C 2 7   ? -17.441 17.166 9.436   0.50 17.39  ? 7   DG  C OP1   1 
ATOM   4044 O  OP1   B DG  C 2 7   ? -36.088 26.888 -2.334  0.50 16.41  ? 7   DG  C OP1   1 
ATOM   4045 O  OP2   A DG  C 2 7   ? -19.125 18.921 10.240  0.50 16.09  ? 7   DG  C OP2   1 
ATOM   4046 O  OP2   B DG  C 2 7   ? -36.079 24.882 -0.713  0.50 19.32  ? 7   DG  C OP2   1 
ATOM   4047 O  "O5'" A DG  C 2 7   ? -18.886 18.444 7.823   0.50 16.78  ? 7   DG  C "O5'" 1 
ATOM   4048 O  "O5'" B DG  C 2 7   ? -33.952 25.648 -1.733  0.50 11.68  ? 7   DG  C "O5'" 1 
ATOM   4049 C  "C5'" A DG  C 2 7   ? -18.388 17.728 6.708   0.50 11.20  ? 7   DG  C "C5'" 1 
ATOM   4050 C  "C5'" B DG  C 2 7   ? -33.041 26.607 -2.218  0.50 7.96   ? 7   DG  C "C5'" 1 
ATOM   4051 C  "C4'" A DG  C 2 7   ? -18.370 18.618 5.483   0.50 13.59  ? 7   DG  C "C4'" 1 
ATOM   4052 C  "C4'" B DG  C 2 7   ? -31.877 25.929 -2.906  0.50 12.89  ? 7   DG  C "C4'" 1 
ATOM   4053 O  "O4'" A DG  C 2 7   ? -19.716 18.767 4.970   0.50 15.57  ? 7   DG  C "O4'" 1 
ATOM   4054 O  "O4'" B DG  C 2 7   ? -30.796 25.732 -1.965  0.50 16.49  ? 7   DG  C "O4'" 1 
ATOM   4055 C  "C3'" A DG  C 2 7   ? -17.838 20.029 5.722   0.50 12.49  ? 7   DG  C "C3'" 1 
ATOM   4056 C  "C3'" B DG  C 2 7   ? -32.186 24.557 -3.496  0.50 16.76  ? 7   DG  C "C3'" 1 
ATOM   4057 O  "O3'" A DG  C 2 7   ? -16.958 20.423 4.649   0.50 17.78  ? 7   DG  C "O3'" 1 
ATOM   4058 O  "O3'" B DG  C 2 7   ? -31.478 24.375 -4.723  0.50 18.27  ? 7   DG  C "O3'" 1 
ATOM   4059 C  "C2'" A DG  C 2 7   ? -19.115 20.883 5.767   0.50 13.11  ? 7   DG  C "C2'" 1 
ATOM   4060 C  "C2'" B DG  C 2 7   ? -31.679 23.604 -2.416  0.50 16.48  ? 7   DG  C "C2'" 1 
ATOM   4061 C  "C1'" A DG  C 2 7   ? -20.037 20.131 4.812   0.50 13.96  ? 7   DG  C "C1'" 1 
ATOM   4062 C  "C1'" B DG  C 2 7   ? -30.470 24.362 -1.876  0.50 17.81  ? 7   DG  C "C1'" 1 
ATOM   4063 N  N9    A DG  C 2 7   ? -21.466 20.266 5.108   0.50 14.10  ? 7   DG  C N9    1 
ATOM   4064 N  N9    B DG  C 2 7   ? -30.185 24.082 -0.478  0.50 16.50  ? 7   DG  C N9    1 
ATOM   4065 C  C8    A DG  C 2 7   ? -22.039 20.316 6.349   0.50 15.94  ? 7   DG  C C8    1 
ATOM   4066 C  C8    B DG  C 2 7   ? -31.100 23.808 0.506   0.50 19.84  ? 7   DG  C C8    1 
ATOM   4067 N  N7    A DG  C 2 7   ? -23.340 20.385 6.326   0.50 13.39  ? 7   DG  C N7    1 
ATOM   4068 N  N7    B DG  C 2 7   ? -30.566 23.624 1.681   0.50 21.29  ? 7   DG  C N7    1 
ATOM   4069 C  C5    A DG  C 2 7   ? -23.660 20.365 4.984   0.50 12.55  ? 7   DG  C C5    1 
ATOM   4070 C  C5    B DG  C 2 7   ? -29.212 23.797 1.468   0.50 17.28  ? 7   DG  C C5    1 
ATOM   4071 C  C6    A DG  C 2 7   ? -24.928 20.418 4.358   0.50 17.81  ? 7   DG  C C6    1 
ATOM   4072 C  C6    B DG  C 2 7   ? -28.136 23.718 2.381   0.50 20.03  ? 7   DG  C C6    1 
ATOM   4073 O  O6    A DG  C 2 7   ? -26.046 20.499 4.888   0.50 20.59  ? 7   DG  C O6    1 
ATOM   4074 O  O6    B DG  C 2 7   ? -28.179 23.468 3.591   0.50 21.34  ? 7   DG  C O6    1 
ATOM   4075 N  N1    A DG  C 2 7   ? -24.822 20.379 2.976   0.50 19.37  ? 7   DG  C N1    1 
ATOM   4076 N  N1    B DG  C 2 7   ? -26.908 23.961 1.760   0.50 23.43  ? 7   DG  C N1    1 
ATOM   4077 C  C2    A DG  C 2 7   ? -23.643 20.291 2.285   0.50 18.07  ? 7   DG  C C2    1 
ATOM   4078 C  C2    B DG  C 2 7   ? -26.749 24.245 0.420   0.50 25.72  ? 7   DG  C C2    1 
ATOM   4079 N  N2    A DG  C 2 7   ? -23.759 20.262 0.952   0.50 22.33  ? 7   DG  C N2    1 
ATOM   4080 N  N2    B DG  C 2 7   ? -25.483 24.447 0.005   0.50 21.23  ? 7   DG  C N2    1 
ATOM   4081 N  N3    A DG  C 2 7   ? -22.434 20.239 2.858   0.50 15.01  ? 7   DG  C N3    1 
ATOM   4082 N  N3    B DG  C 2 7   ? -27.762 24.324 -0.454  0.50 19.59  ? 7   DG  C N3    1 
ATOM   4083 C  C4    A DG  C 2 7   ? -22.522 20.283 4.209   0.50 12.19  ? 7   DG  C C4    1 
ATOM   4084 C  C4    B DG  C 2 7   ? -28.957 24.088 0.141   0.50 16.81  ? 7   DG  C C4    1 
ATOM   4085 P  P     A DT  C 2 8   ? -15.558 19.664 4.375   0.50 20.58  ? 8   DT  C P     1 
ATOM   4086 P  P     B DT  C 2 8   ? -31.779 25.298 -6.008  0.50 16.60  ? 8   DT  C P     1 
ATOM   4087 O  OP1   A DT  C 2 8   ? -15.445 19.491 2.913   0.50 20.38  ? 8   DT  C OP1   1 
ATOM   4088 O  OP1   B DT  C 2 8   ? -30.455 25.717 -6.499  0.50 25.78  ? 8   DT  C OP1   1 
ATOM   4089 O  OP2   A DT  C 2 8   ? -15.404 18.489 5.262   0.50 18.44  ? 8   DT  C OP2   1 
ATOM   4090 O  OP2   B DT  C 2 8   ? -32.812 26.319 -5.718  0.50 19.98  ? 8   DT  C OP2   1 
ATOM   4091 O  "O5'" A DT  C 2 8   ? -14.447 20.725 4.782   0.50 11.15  ? 8   DT  C "O5'" 1 
ATOM   4092 O  "O5'" B DT  C 2 8   ? -32.393 24.286 -7.078  0.50 17.77  ? 8   DT  C "O5'" 1 
ATOM   4093 C  "C5'" A DT  C 2 8   ? -14.401 21.226 6.094   0.50 13.73  ? 8   DT  C "C5'" 1 
ATOM   4094 C  "C5'" B DT  C 2 8   ? -33.597 23.598 -6.798  0.50 17.63  ? 8   DT  C "C5'" 1 
ATOM   4095 C  "C4'" A DT  C 2 8   ? -14.345 22.736 6.072   0.50 19.32  ? 8   DT  C "C4'" 1 
ATOM   4096 C  "C4'" B DT  C 2 8   ? -33.435 22.121 -7.088  0.50 21.32  ? 8   DT  C "C4'" 1 
ATOM   4097 O  "O4'" A DT  C 2 8   ? -13.206 23.153 5.279   0.50 19.50  ? 8   DT  C "O4'" 1 
ATOM   4098 O  "O4'" B DT  C 2 8   ? -33.110 21.943 -8.489  0.50 21.19  ? 8   DT  C "O4'" 1 
ATOM   4099 C  "C3'" A DT  C 2 8   ? -15.568 23.407 5.452   0.50 16.64  ? 8   DT  C "C3'" 1 
ATOM   4100 C  "C3'" B DT  C 2 8   ? -32.319 21.440 -6.297  0.50 17.67  ? 8   DT  C "C3'" 1 
ATOM   4101 O  "O3'" A DT  C 2 8   ? -15.921 24.561 6.190   0.50 14.97  ? 8   DT  C "O3'" 1 
ATOM   4102 O  "O3'" B DT  C 2 8   ? -32.746 20.160 -5.847  0.50 25.46  ? 8   DT  C "O3'" 1 
ATOM   4103 C  "C2'" A DT  C 2 8   ? -15.107 23.754 4.046   0.50 14.39  ? 8   DT  C "C2'" 1 
ATOM   4104 C  "C2'" B DT  C 2 8   ? -31.180 21.341 -7.299  0.50 13.73  ? 8   DT  C "C2'" 1 
ATOM   4105 C  "C1'" A DT  C 2 8   ? -13.627 24.028 4.262   0.50 17.05  ? 8   DT  C "C1'" 1 
ATOM   4106 C  "C1'" B DT  C 2 8   ? -31.930 21.180 -8.614  0.50 24.40  ? 8   DT  C "C1'" 1 
ATOM   4107 N  N1    A DT  C 2 8   ? -12.808 23.769 3.060   0.50 17.09  ? 8   DT  C N1    1 
ATOM   4108 N  N1    B DT  C 2 8   ? -31.157 21.672 -9.810  0.50 17.77  ? 8   DT  C N1    1 
ATOM   4109 C  C2    A DT  C 2 8   ? -12.451 24.822 2.261   0.50 17.94  ? 8   DT  C C2    1 
ATOM   4110 C  C2    B DT  C 2 8   ? -30.535 20.758 -10.638 0.50 18.32  ? 8   DT  C C2    1 
ATOM   4111 O  O2    A DT  C 2 8   ? -12.765 25.979 2.501   0.50 17.10  ? 8   DT  C O2    1 
ATOM   4112 O  O2    B DT  C 2 8   ? -30.585 19.553 -10.467 0.50 19.55  ? 8   DT  C O2    1 
ATOM   4113 N  N3    A DT  C 2 8   ? -11.705 24.478 1.166   0.50 17.20  ? 8   DT  C N3    1 
ATOM   4114 N  N3    B DT  C 2 8   ? -29.858 21.306 -11.688 0.50 17.52  ? 8   DT  C N3    1 
ATOM   4115 C  C4    A DT  C 2 8   ? -11.289 23.209 0.798   0.50 21.11  ? 8   DT  C C4    1 
ATOM   4116 C  C4    B DT  C 2 8   ? -29.733 22.647 -11.993 0.50 20.98  ? 8   DT  C C4    1 
ATOM   4117 O  O4    A DT  C 2 8   ? -10.613 23.005 -0.206  0.50 23.79  ? 8   DT  C O4    1 
ATOM   4118 O  O4    B DT  C 2 8   ? -29.095 23.038 -12.965 0.50 24.18  ? 8   DT  C O4    1 
ATOM   4119 C  C5    A DT  C 2 8   ? -11.704 22.143 1.680   0.50 21.04  ? 8   DT  C C5    1 
ATOM   4120 C  C5    B DT  C 2 8   ? -30.402 23.556 -11.087 0.50 19.50  ? 8   DT  C C5    1 
ATOM   4121 C  C7    A DT  C 2 8   ? -11.321 20.718 1.382   0.50 8.93   ? 8   DT  C C7    1 
ATOM   4122 C  C7    B DT  C 2 8   ? -30.329 25.046 -11.314 0.50 8.69   ? 8   DT  C C7    1 
ATOM   4123 C  C6    A DT  C 2 8   ? -12.436 22.472 2.757   0.50 22.50  ? 8   DT  C C6    1 
ATOM   4124 C  C6    B DT  C 2 8   ? -31.075 23.026 -10.050 0.50 14.10  ? 8   DT  C C6    1 
ATOM   4125 P  P     A DC  C 2 9   ? -17.290 24.560 7.023   0.50 20.87  ? 9   DC  C P     1 
ATOM   4126 P  P     B DC  C 2 9   ? -33.231 19.975 -4.323  0.50 21.12  ? 9   DC  C P     1 
ATOM   4127 O  OP1   A DC  C 2 9   ? -17.562 25.947 7.460   0.50 18.57  ? 9   DC  C OP1   1 
ATOM   4128 O  OP1   B DC  C 2 9   ? -33.461 18.539 -4.055  0.50 18.05  ? 9   DC  C OP1   1 
ATOM   4129 O  OP2   A DC  C 2 9   ? -17.198 23.451 7.996   0.50 16.77  ? 9   DC  C OP2   1 
ATOM   4130 O  OP2   B DC  C 2 9   ? -34.312 20.960 -4.111  0.50 20.20  ? 9   DC  C OP2   1 
ATOM   4131 O  "O5'" A DC  C 2 9   ? -18.383 24.115 5.947   0.50 17.44  ? 9   DC  C "O5'" 1 
ATOM   4132 O  "O5'" B DC  C 2 9   ? -31.958 20.414 -3.467  0.50 16.73  ? 9   DC  C "O5'" 1 
ATOM   4133 C  "C5'" A DC  C 2 9   ? -18.835 25.038 4.998   0.50 17.60  ? 9   DC  C "C5'" 1 
ATOM   4134 C  "C5'" B DC  C 2 9   ? -30.803 19.592 -3.469  0.50 17.68  ? 9   DC  C "C5'" 1 
ATOM   4135 C  "C4'" A DC  C 2 9   ? -19.046 24.383 3.651   0.50 11.59  ? 9   DC  C "C4'" 1 
ATOM   4136 C  "C4'" B DC  C 2 9   ? -29.561 20.403 -3.776  0.50 17.26  ? 9   DC  C "C4'" 1 
ATOM   4137 O  "O4'" A DC  C 2 9   ? -20.037 23.344 3.778   0.50 14.44  ? 9   DC  C "O4'" 1 
ATOM   4138 O  "O4'" B DC  C 2 9   ? -29.345 21.358 -2.711  0.50 17.53  ? 9   DC  C "O4'" 1 
ATOM   4139 C  "C3'" A DC  C 2 9   ? -19.558 25.336 2.587   0.50 12.82  ? 9   DC  C "C3'" 1 
ATOM   4140 C  "C3'" B DC  C 2 9   ? -28.286 19.579 -3.907  0.50 18.10  ? 9   DC  C "C3'" 1 
ATOM   4141 O  "O3'" A DC  C 2 9   ? -18.469 25.790 1.809   0.50 15.97  ? 9   DC  C "O3'" 1 
ATOM   4142 O  "O3'" B DC  C 2 9   ? -27.970 19.414 -5.282  0.50 18.35  ? 9   DC  C "O3'" 1 
ATOM   4143 C  "C2'" A DC  C 2 9   ? -20.508 24.486 1.751   0.50 11.64  ? 9   DC  C "C2'" 1 
ATOM   4144 C  "C2'" B DC  C 2 9   ? -27.214 20.406 -3.192  0.50 17.93  ? 9   DC  C "C2'" 1 
ATOM   4145 C  "C1'" A DC  C 2 9   ? -20.982 23.415 2.722   0.50 12.96  ? 9   DC  C "C1'" 1 
ATOM   4146 C  "C1'" B DC  C 2 9   ? -28.009 21.317 -2.257  0.50 17.76  ? 9   DC  C "C1'" 1 
ATOM   4147 N  N1    A DC  C 2 9   ? -22.354 23.654 3.314   0.50 13.67  ? 9   DC  C N1    1 
ATOM   4148 N  N1    B DC  C 2 9   ? -28.008 20.915 -0.799  0.50 15.23  ? 9   DC  C N1    1 
ATOM   4149 C  C2    A DC  C 2 9   ? -23.480 23.791 2.480   0.50 14.51  ? 9   DC  C C2    1 
ATOM   4150 C  C2    B DC  C 2 9   ? -26.796 20.835 -0.088  0.50 14.05  ? 9   DC  C C2    1 
ATOM   4151 O  O2    A DC  C 2 9   ? -23.346 23.741 1.257   0.50 16.51  ? 9   DC  C O2    1 
ATOM   4152 O  O2    B DC  C 2 9   ? -25.735 21.058 -0.673  0.50 17.23  ? 9   DC  C O2    1 
ATOM   4153 N  N3    A DC  C 2 9   ? -24.693 23.984 3.045   0.50 13.54  ? 9   DC  C N3    1 
ATOM   4154 N  N3    B DC  C 2 9   ? -26.822 20.502 1.225   0.50 12.62  ? 9   DC  C N3    1 
ATOM   4155 C  C4    A DC  C 2 9   ? -24.812 24.032 4.366   0.50 13.35  ? 9   DC  C C4    1 
ATOM   4156 C  C4    B DC  C 2 9   ? -27.994 20.264 1.829   0.50 21.97  ? 9   DC  C C4    1 
ATOM   4157 N  N4    A DC  C 2 9   ? -26.029 24.221 4.869   0.50 14.76  ? 9   DC  C N4    1 
ATOM   4158 N  N4    B DC  C 2 9   ? -27.970 19.937 3.129   0.50 16.53  ? 9   DC  C N4    1 
ATOM   4159 C  C5    A DC  C 2 9   ? -23.688 23.887 5.232   0.50 12.35  ? 9   DC  C C5    1 
ATOM   4160 C  C5    B DC  C 2 9   ? -29.243 20.350 1.126   0.50 17.22  ? 9   DC  C C5    1 
ATOM   4161 C  C6    A DC  C 2 9   ? -22.495 23.694 4.670   0.50 12.90  ? 9   DC  C C6    1 
ATOM   4162 C  C6    B DC  C 2 9   ? -29.201 20.679 -0.169  0.50 14.27  ? 9   DC  C C6    1 
ATOM   4163 P  P     A DC  C 2 10  ? -18.170 27.359 1.674   0.50 14.81  ? 10  DC  C P     1 
ATOM   4164 P  P     B DC  C 2 10  ? -27.536 17.979 -5.857  0.50 17.39  ? 10  DC  C P     1 
ATOM   4165 O  OP1   A DC  C 2 10  ? -16.763 27.511 1.230   0.50 11.37  ? 10  DC  C OP1   1 
ATOM   4166 O  OP1   B DC  C 2 10  ? -27.256 18.101 -7.309  0.50 20.55  ? 10  DC  C OP1   1 
ATOM   4167 O  OP2   A DC  C 2 10  ? -18.651 27.979 2.921   0.50 14.29  ? 10  DC  C OP2   1 
ATOM   4168 O  OP2   B DC  C 2 10  ? -28.512 16.994 -5.368  0.50 11.35  ? 10  DC  C OP2   1 
ATOM   4169 O  "O5'" A DC  C 2 10  ? -19.162 27.854 0.522   0.50 13.69  ? 10  DC  C "O5'" 1 
ATOM   4170 O  "O5'" B DC  C 2 10  ? -26.129 17.708 -5.183  0.50 13.70  ? 10  DC  C "O5'" 1 
ATOM   4171 C  "C5'" A DC  C 2 10  ? -19.128 27.257 -0.755  0.50 11.57  ? 10  DC  C "C5'" 1 
ATOM   4172 C  "C5'" B DC  C 2 10  ? -25.024 18.480 -5.561  0.50 12.53  ? 10  DC  C "C5'" 1 
ATOM   4173 C  "C4'" A DC  C 2 10  ? -20.427 27.501 -1.503  0.50 14.05  ? 10  DC  C "C4'" 1 
ATOM   4174 C  "C4'" B DC  C 2 10  ? -23.830 18.098 -4.728  0.50 17.47  ? 10  DC  C "C4'" 1 
ATOM   4175 O  "O4'" A DC  C 2 10  ? -21.547 26.990 -0.730  0.50 14.37  ? 10  DC  C "O4'" 1 
ATOM   4176 O  "O4'" B DC  C 2 10  ? -24.122 18.359 -3.321  0.50 29.29  ? 10  DC  C "O4'" 1 
ATOM   4177 C  "C3'" A DC  C 2 10  ? -20.751 28.961 -1.796  0.50 12.31  ? 10  DC  C "C3'" 1 
ATOM   4178 C  "C3'" B DC  C 2 10  ? -23.456 16.632 -4.825  0.50 14.62  ? 10  DC  C "C3'" 1 
ATOM   4179 O  "O3'" A DC  C 2 10  ? -21.373 29.057 -3.078  0.50 17.42  ? 10  DC  C "O3'" 1 
ATOM   4180 O  "O3'" B DC  C 2 10  ? -22.049 16.499 -4.857  0.50 24.81  ? 10  DC  C "O3'" 1 
ATOM   4181 C  "C2'" A DC  C 2 10  ? -21.717 29.321 -0.672  0.50 13.13  ? 10  DC  C "C2'" 1 
ATOM   4182 C  "C2'" B DC  C 2 10  ? -24.061 16.029 -3.557  0.50 20.52  ? 10  DC  C "C2'" 1 
ATOM   4183 C  "C1'" A DC  C 2 10  ? -22.482 28.019 -0.500  0.50 12.58  ? 10  DC  C "C1'" 1 
ATOM   4184 C  "C1'" B DC  C 2 10  ? -23.967 17.185 -2.561  0.50 17.75  ? 10  DC  C "C1'" 1 
ATOM   4185 N  N1    A DC  C 2 10  ? -23.065 27.831 0.867   0.50 15.95  ? 10  DC  C N1    1 
ATOM   4186 N  N1    B DC  C 2 10  ? -25.037 17.157 -1.478  0.50 11.42  ? 10  DC  C N1    1 
ATOM   4187 C  C2    A DC  C 2 10  ? -24.458 27.749 1.020   0.50 17.91  ? 10  DC  C C2    1 
ATOM   4188 C  C2    B DC  C 2 10  ? -24.667 17.095 -0.111  0.50 14.03  ? 10  DC  C C2    1 
ATOM   4189 O  O2    A DC  C 2 10  ? -25.179 27.846 0.021   0.50 22.03  ? 10  DC  C O2    1 
ATOM   4190 O  O2    B DC  C 2 10  ? -23.477 17.072 0.196   0.50 15.21  ? 10  DC  C O2    1 
ATOM   4191 N  N3    A DC  C 2 10  ? -24.977 27.568 2.264   0.50 14.74  ? 10  DC  C N3    1 
ATOM   4192 N  N3    B DC  C 2 10  ? -25.635 17.063 0.838   0.50 11.33  ? 10  DC  C N3    1 
ATOM   4193 C  C4    A DC  C 2 10  ? -24.163 27.475 3.320   0.50 17.77  ? 10  DC  C C4    1 
ATOM   4194 C  C4    B DC  C 2 10  ? -26.921 17.085 0.476   0.50 16.22  ? 10  DC  C C4    1 
ATOM   4195 N  N4    A DC  C 2 10  ? -24.722 27.304 4.519   0.50 19.16  ? 10  DC  C N4    1 
ATOM   4196 N  N4    B DC  C 2 10  ? -27.839 17.053 1.448   0.50 13.13  ? 10  DC  C N4    1 
ATOM   4197 C  C5    A DC  C 2 10  ? -22.736 27.554 3.191   0.50 15.07  ? 10  DC  C C5    1 
ATOM   4198 C  C5    B DC  C 2 10  ? -27.324 17.144 -0.902  0.50 12.03  ? 10  DC  C C5    1 
ATOM   4199 C  C6    A DC  C 2 10  ? -22.237 27.730 1.959   0.50 17.42  ? 10  DC  C C6    1 
ATOM   4200 C  C6    B DC  C 2 10  ? -26.357 17.178 -1.833  0.50 9.70   ? 10  DC  C C6    1 
ATOM   4201 P  P     A DC  C 2 11  ? -21.482 30.466 -3.845  0.50 12.82  ? 11  DC  C P     1 
ATOM   4202 P  P     B DC  C 2 11  ? -21.391 15.138 -5.400  0.50 31.22  ? 11  DC  C P     1 
ATOM   4203 O  OP1   A DC  C 2 11  ? -21.840 30.178 -5.253  0.50 8.28   ? 11  DC  C OP1   1 
ATOM   4204 O  OP1   B DC  C 2 11  ? -20.154 15.457 -6.144  0.50 24.03  ? 11  DC  C OP1   1 
ATOM   4205 O  OP2   A DC  C 2 11  ? -20.287 31.276 -3.516  0.50 18.02  ? 11  DC  C OP2   1 
ATOM   4206 O  OP2   B DC  C 2 11  ? -22.490 14.341 -6.004  0.50 27.68  ? 11  DC  C OP2   1 
ATOM   4207 O  "O5'" A DC  C 2 11  ? -22.762 31.134 -3.190  0.50 16.36  ? 11  DC  C "O5'" 1 
ATOM   4208 O  "O5'" B DC  C 2 11  ? -20.938 14.393 -4.084  0.50 23.31  ? 11  DC  C "O5'" 1 
ATOM   4209 C  "C5'" A DC  C 2 11  ? -24.019 30.571 -3.464  0.50 31.39  ? 11  DC  C "C5'" 1 
ATOM   4210 C  "C5'" B DC  C 2 11  ? -20.206 15.083 -3.115  0.50 27.31  ? 11  DC  C "C5'" 1 
ATOM   4211 C  "C4'" A DC  C 2 11  ? -25.099 31.285 -2.701  0.50 23.77  ? 11  DC  C "C4'" 1 
ATOM   4212 C  "C4'" B DC  C 2 11  ? -20.313 14.355 -1.804  0.50 27.72  ? 11  DC  C "C4'" 1 
ATOM   4213 O  "O4'" A DC  C 2 11  ? -25.150 30.769 -1.375  0.50 32.36  ? 11  DC  C "O4'" 1 
ATOM   4214 O  "O4'" B DC  C 2 11  ? -21.612 14.601 -1.244  0.50 24.06  ? 11  DC  C "O4'" 1 
ATOM   4215 C  "C3'" A DC  C 2 11  ? -24.873 32.774 -2.553  0.50 22.80  ? 11  DC  C "C3'" 1 
ATOM   4216 C  "C3'" B DC  C 2 11  ? -20.192 12.838 -1.926  0.50 24.54  ? 11  DC  C "C3'" 1 
ATOM   4217 O  "O3'" A DC  C 2 11  ? -25.604 33.443 -3.583  0.50 35.24  ? 11  DC  C "O3'" 1 
ATOM   4218 O  "O3'" B DC  C 2 11  ? -19.037 12.395 -1.257  0.50 24.98  ? 11  DC  C "O3'" 1 
ATOM   4219 C  "C2'" A DC  C 2 11  ? -25.397 33.098 -1.140  0.50 23.48  ? 11  DC  C "C2'" 1 
ATOM   4220 C  "C2'" B DC  C 2 11  ? -21.476 12.288 -1.283  0.50 25.32  ? 11  DC  C "C2'" 1 
ATOM   4221 C  "C1'" A DC  C 2 11  ? -25.733 31.726 -0.543  0.50 27.16  ? 11  DC  C "C1'" 1 
ATOM   4222 C  "C1'" B DC  C 2 11  ? -22.001 13.482 -0.506  0.50 21.44  ? 11  DC  C "C1'" 1 
ATOM   4223 N  N1    A DC  C 2 11  ? -25.200 31.504 0.829   0.50 16.83  ? 11  DC  C N1    1 
ATOM   4224 N  N1    B DC  C 2 11  ? -23.476 13.516 -0.385  0.50 15.96  ? 11  DC  C N1    1 
ATOM   4225 C  C2    A DC  C 2 11  ? -26.078 31.188 1.861   0.50 16.29  ? 11  DC  C C2    1 
ATOM   4226 C  C2    B DC  C 2 11  ? -24.066 13.628 0.880   0.50 15.63  ? 11  DC  C C2    1 
ATOM   4227 O  O2    A DC  C 2 11  ? -27.287 31.124 1.616   0.50 18.84  ? 11  DC  C O2    1 
ATOM   4228 O  O2    B DC  C 2 11  ? -23.339 13.684 1.879   0.50 14.48  ? 11  DC  C O2    1 
ATOM   4229 N  N3    A DC  C 2 11  ? -25.582 30.974 3.104   0.50 17.72  ? 11  DC  C N3    1 
ATOM   4230 N  N3    B DC  C 2 11  ? -25.419 13.667 0.972   0.50 12.78  ? 11  DC  C N3    1 
ATOM   4231 C  C4    A DC  C 2 11  ? -24.268 31.058 3.320   0.50 19.05  ? 11  DC  C C4    1 
ATOM   4232 C  C4    B DC  C 2 11  ? -26.162 13.597 -0.137  0.50 14.12  ? 11  DC  C C4    1 
ATOM   4233 N  N4    A DC  C 2 11  ? -23.817 30.842 4.562   0.50 15.32  ? 11  DC  C N4    1 
ATOM   4234 N  N4    B DC  C 2 11  ? -27.498 13.643 -0.008  0.50 12.68  ? 11  DC  C N4    1 
ATOM   4235 C  C5    A DC  C 2 11  ? -23.358 31.372 2.272   0.50 17.66  ? 11  DC  C C5    1 
ATOM   4236 C  C5    B DC  C 2 11  ? -25.571 13.484 -1.432  0.50 12.79  ? 11  DC  C C5    1 
ATOM   4237 C  C6    A DC  C 2 11  ? -23.864 31.581 1.054   0.50 15.59  ? 11  DC  C C6    1 
ATOM   4238 C  C6    B DC  C 2 11  ? -24.241 13.448 -1.506  0.50 11.55  ? 11  DC  C C6    1 
ATOM   4239 P  P     A DG  C 2 12  ? -25.922 35.016 -3.519  0.50 31.93  ? 12  DG  C P     1 
ATOM   4240 P  P     B DG  C 2 12  ? -18.526 10.890 -1.461  0.50 42.25  ? 12  DG  C P     1 
ATOM   4241 O  OP1   A DG  C 2 12  ? -26.249 35.403 -4.908  0.50 34.25  ? 12  DG  C OP1   1 
ATOM   4242 O  OP1   B DG  C 2 12  ? -17.076 10.972 -1.761  0.50 33.42  ? 12  DG  C OP1   1 
ATOM   4243 O  OP2   A DG  C 2 12  ? -24.867 35.733 -2.764  0.50 23.19  ? 12  DG  C OP2   1 
ATOM   4244 O  OP2   B DG  C 2 12  ? -19.473 10.193 -2.367  0.50 34.51  ? 12  DG  C OP2   1 
ATOM   4245 O  "O5'" A DG  C 2 12  ? -27.265 35.084 -2.667  0.50 29.07  ? 12  DG  C "O5'" 1 
ATOM   4246 O  "O5'" B DG  C 2 12  ? -18.746 10.223 -0.032  0.50 32.99  ? 12  DG  C "O5'" 1 
ATOM   4247 C  "C5'" A DG  C 2 12  ? -28.380 34.296 -3.049  0.50 29.18  ? 12  DG  C "C5'" 1 
ATOM   4248 C  "C5'" B DG  C 2 12  ? -18.313 10.899 1.127   0.50 33.88  ? 12  DG  C "C5'" 1 
ATOM   4249 C  "C4'" A DG  C 2 12  ? -29.586 34.632 -2.197  0.50 28.11  ? 12  DG  C "C4'" 1 
ATOM   4250 C  "C4'" B DG  C 2 12  ? -18.949 10.297 2.361   0.50 29.30  ? 12  DG  C "C4'" 1 
ATOM   4251 O  "O4'" A DG  C 2 12  ? -29.386 34.135 -0.851  0.50 36.02  ? 12  DG  C "O4'" 1 
ATOM   4252 O  "O4'" B DG  C 2 12  ? -20.337 10.710 2.457   0.50 40.53  ? 12  DG  C "O4'" 1 
ATOM   4253 C  "C3'" A DG  C 2 12  ? -29.863 36.119 -2.045  0.50 36.14  ? 12  DG  C "C3'" 1 
ATOM   4254 C  "C3'" B DG  C 2 12  ? -18.968 8.771  2.399   0.50 35.83  ? 12  DG  C "C3'" 1 
ATOM   4255 O  "O3'" A DG  C 2 12  ? -31.255 36.327 -1.920  0.50 35.21  ? 12  DG  C "O3'" 1 
ATOM   4256 O  "O3'" B DG  C 2 12  ? -18.621 8.350  3.685   0.50 50.26  ? 12  DG  C "O3'" 1 
ATOM   4257 C  "C2'" A DG  C 2 12  ? -29.128 36.464 -0.755  0.50 27.36  ? 12  DG  C "C2'" 1 
ATOM   4258 C  "C2'" B DG  C 2 12  ? -20.424 8.433  2.090   0.50 30.08  ? 12  DG  C "C2'" 1 
ATOM   4259 C  "C1'" A DG  C 2 12  ? -29.393 35.215 0.064   0.50 30.98  ? 12  DG  C "C1'" 1 
ATOM   4260 C  "C1'" B DG  C 2 12  ? -21.118 9.589  2.774   0.50 27.48  ? 12  DG  C "C1'" 1 
ATOM   4261 N  N9    A DG  C 2 12  ? -28.381 34.954 1.065   0.50 26.04  ? 12  DG  C N9    1 
ATOM   4262 N  N9    B DG  C 2 12  ? -22.472 9.820  2.307   0.50 18.52  ? 12  DG  C N9    1 
ATOM   4263 C  C8    A DG  C 2 12  ? -27.029 35.107 0.924   0.50 24.24  ? 12  DG  C C8    1 
ATOM   4264 C  C8    B DG  C 2 12  ? -22.889 9.935  1.009   0.50 17.60  ? 12  DG  C C8    1 
ATOM   4265 N  N7    A DG  C 2 12  ? -26.360 34.781 1.991   0.50 21.75  ? 12  DG  C N7    1 
ATOM   4266 N  N7    B DG  C 2 12  ? -24.172 10.137 0.893   0.50 17.82  ? 12  DG  C N7    1 
ATOM   4267 C  C5    A DG  C 2 12  ? -27.331 34.378 2.891   0.50 19.85  ? 12  DG  C C5    1 
ATOM   4268 C  C5    B DG  C 2 12  ? -24.631 10.164 2.202   0.50 17.19  ? 12  DG  C C5    1 
ATOM   4269 C  C6    A DG  C 2 12  ? -27.202 33.916 4.217   0.50 20.28  ? 12  DG  C C6    1 
ATOM   4270 C  C6    B DG  C 2 12  ? -25.943 10.350 2.708   0.50 15.79  ? 12  DG  C C6    1 
ATOM   4271 O  O6    A DG  C 2 12  ? -26.166 33.763 4.873   0.50 17.82  ? 12  DG  C O6    1 
ATOM   4272 O  O6    B DG  C 2 12  ? -26.996 10.537 2.077   0.50 13.90  ? 12  DG  C O6    1 
ATOM   4273 N  N1    A DG  C 2 12  ? -28.442 33.622 4.785   0.50 23.76  ? 12  DG  C N1    1 
ATOM   4274 N  N1    B DG  C 2 12  ? -25.967 10.299 4.098   0.50 15.79  ? 12  DG  C N1    1 
ATOM   4275 C  C2    A DG  C 2 12  ? -29.653 33.754 4.145   0.50 24.23  ? 12  DG  C C2    1 
ATOM   4276 C  C2    B DG  C 2 12  ? -24.867 10.100 4.901   0.50 21.89  ? 12  DG  C C2    1 
ATOM   4277 N  N2    A DG  C 2 12  ? -30.743 33.415 4.854   0.50 15.80  ? 12  DG  C N2    1 
ATOM   4278 N  N2    B DG  C 2 12  ? -25.094 10.085 6.225   0.50 25.01  ? 12  DG  C N2    1 
ATOM   4279 N  N3    A DG  C 2 12  ? -29.784 34.184 2.895   0.50 25.42  ? 12  DG  C N3    1 
ATOM   4280 N  N3    B DG  C 2 12  ? -23.633 9.928  4.441   0.50 25.51  ? 12  DG  C N3    1 
ATOM   4281 C  C4    A DG  C 2 12  ? -28.583 34.478 2.335   0.50 23.54  ? 12  DG  C C4    1 
ATOM   4282 C  C4    B DG  C 2 12  ? -23.593 9.969  3.084   0.50 21.29  ? 12  DG  C C4    1 
ATOM   4283 P  P     A DT  C 2 13  ? -31.851 37.815 -1.920  0.50 58.78  ? 13  DT  C P     1 
ATOM   4284 P  P     B DT  C 2 13  ? -18.032 6.882  3.912   0.50 51.98  ? 13  DT  C P     1 
ATOM   4285 O  OP1   A DT  C 2 13  ? -33.072 37.724 -2.751  0.50 39.29  ? 13  DT  C OP1   1 
ATOM   4286 O  OP1   B DT  C 2 13  ? -16.722 7.082  4.577   0.50 38.63  ? 13  DT  C OP1   1 
ATOM   4287 O  OP2   A DT  C 2 13  ? -30.773 38.796 -2.207  0.50 29.00  ? 13  DT  C OP2   1 
ATOM   4288 O  OP2   B DT  C 2 13  ? -18.190 6.129  2.635   0.50 16.66  ? 13  DT  C OP2   1 
ATOM   4289 O  "O5'" A DT  C 2 13  ? -32.233 38.076 -0.392  0.50 51.34  ? 13  DT  C "O5'" 1 
ATOM   4290 O  "O5'" B DT  C 2 13  ? -19.027 6.238  4.977   0.50 41.16  ? 13  DT  C "O5'" 1 
ATOM   4291 C  "C5'" A DT  C 2 13  ? -32.948 37.096 0.349   0.50 46.36  ? 13  DT  C "C5'" 1 
ATOM   4292 C  "C5'" B DT  C 2 13  ? -19.611 7.043  5.987   0.50 32.78  ? 13  DT  C "C5'" 1 
ATOM   4293 C  "C4'" A DT  C 2 13  ? -33.075 37.532 1.793   0.50 45.33  ? 13  DT  C "C4'" 1 
ATOM   4294 C  "C4'" B DT  C 2 13  ? -20.848 6.361  6.517   0.50 33.29  ? 13  DT  C "C4'" 1 
ATOM   4295 O  "O4'" A DT  C 2 13  ? -31.944 37.035 2.562   0.50 47.20  ? 13  DT  C "O4'" 1 
ATOM   4296 O  "O4'" B DT  C 2 13  ? -22.029 6.895  5.845   0.50 38.60  ? 13  DT  C "O4'" 1 
ATOM   4297 C  "C3'" A DT  C 2 13  ? -33.091 39.051 1.995   0.50 61.81  ? 13  DT  C "C3'" 1 
ATOM   4298 C  "C3'" B DT  C 2 13  ? -20.881 4.850  6.257   0.50 39.17  ? 13  DT  C "C3'" 1 
ATOM   4299 O  "O3'" A DT  C 2 13  ? -34.114 39.396 2.920   0.50 74.59  ? 13  DT  C "O3'" 1 
ATOM   4300 O  "O3'" B DT  C 2 13  ? -21.496 4.186  7.351   0.50 49.67  ? 13  DT  C "O3'" 1 
ATOM   4301 C  "C2'" A DT  C 2 13  ? -31.694 39.347 2.552   0.50 41.04  ? 13  DT  C "C2'" 1 
ATOM   4302 C  "C2'" B DT  C 2 13  ? -21.747 4.762  5.010   0.50 31.36  ? 13  DT  C "C2'" 1 
ATOM   4303 C  "C1'" A DT  C 2 13  ? -31.429 38.082 3.347   0.50 41.14  ? 13  DT  C "C1'" 1 
ATOM   4304 C  "C1'" B DT  C 2 13  ? -22.781 5.805  5.368   0.50 30.27  ? 13  DT  C "C1'" 1 
ATOM   4305 N  N1    A DT  C 2 13  ? -29.983 37.828 3.624   0.50 34.19  ? 13  DT  C N1    1 
ATOM   4306 N  N1    B DT  C 2 13  ? -23.671 6.229  4.240   0.50 21.48  ? 13  DT  C N1    1 
ATOM   4307 C  C2    A DT  C 2 13  ? -29.630 37.190 4.789   0.50 31.89  ? 13  DT  C C2    1 
ATOM   4308 C  C2    B DT  C 2 13  ? -24.949 6.646  4.537   0.50 23.06  ? 13  DT  C C2    1 
ATOM   4309 O  O2    A DT  C 2 13  ? -30.447 36.802 5.614   0.50 30.41  ? 13  DT  C O2    1 
ATOM   4310 O  O2    B DT  C 2 13  ? -25.380 6.709  5.678   0.50 26.54  ? 13  DT  C O2    1 
ATOM   4311 N  N3    A DT  C 2 13  ? -28.279 37.017 4.958   0.50 29.69  ? 13  DT  C N3    1 
ATOM   4312 N  N3    B DT  C 2 13  ? -25.707 7.000  3.450   0.50 15.22  ? 13  DT  C N3    1 
ATOM   4313 C  C4    A DT  C 2 13  ? -27.269 37.412 4.096   0.50 31.22  ? 13  DT  C C4    1 
ATOM   4314 C  C4    B DT  C 2 13  ? -25.325 6.966  2.120   0.50 16.53  ? 13  DT  C C4    1 
ATOM   4315 O  O4    A DT  C 2 13  ? -26.080 37.211 4.332   0.50 36.50  ? 13  DT  C O4    1 
ATOM   4316 O  O4    B DT  C 2 13  ? -26.077 7.298  1.211   0.50 21.62  ? 13  DT  C O4    1 
ATOM   4317 C  C5    A DT  C 2 13  ? -27.705 38.074 2.900   0.50 28.47  ? 13  DT  C C5    1 
ATOM   4318 C  C5    B DT  C 2 13  ? -23.981 6.512  1.870   0.50 17.49  ? 13  DT  C C5    1 
ATOM   4319 C  C7    A DT  C 2 13  ? -26.693 38.543 1.900   0.50 21.37  ? 13  DT  C C7    1 
ATOM   4320 C  C7    B DT  C 2 13  ? -23.469 6.440  0.454   0.50 11.99  ? 13  DT  C C7    1 
ATOM   4321 C  C6    A DT  C 2 13  ? -29.027 38.254 2.722   0.50 36.67  ? 13  DT  C C6    1 
ATOM   4322 C  C6    B DT  C 2 13  ? -23.222 6.163  2.933   0.50 19.42  ? 13  DT  C C6    1 
ATOM   4323 P  P     A DC  C 2 14  ? -34.823 40.838 2.879   0.50 56.55  ? 14  DC  C P     1 
ATOM   4324 P  P     B DC  C 2 14  ? -20.801 2.903  8.021   0.50 45.69  ? 14  DC  C P     1 
ATOM   4325 O  OP1   A DC  C 2 14  ? -35.811 40.833 1.777   0.50 48.43  ? 14  DC  C OP1   1 
ATOM   4326 O  OP1   B DC  C 2 14  ? -19.679 3.377  8.875   0.50 36.39  ? 14  DC  C OP1   1 
ATOM   4327 O  OP2   A DC  C 2 14  ? -33.769 41.878 2.930   0.50 42.06  ? 14  DC  C OP2   1 
ATOM   4328 O  OP2   B DC  C 2 14  ? -20.590 1.918  6.932   0.50 23.23  ? 14  DC  C OP2   1 
ATOM   4329 O  "O5'" A DC  C 2 14  ? -35.611 40.863 4.260   0.50 54.00  ? 14  DC  C "O5'" 1 
ATOM   4330 O  "O5'" B DC  C 2 14  ? -21.931 2.324  8.991   0.50 46.51  ? 14  DC  C "O5'" 1 
ATOM   4331 C  "C5'" A DC  C 2 14  ? -35.414 39.805 5.183   0.50 54.76  ? 14  DC  C "C5'" 1 
ATOM   4332 C  "C5'" B DC  C 2 14  ? -22.863 3.200  9.602   0.50 33.94  ? 14  DC  C "C5'" 1 
ATOM   4333 C  "C4'" A DC  C 2 14  ? -34.679 40.303 6.411   0.50 67.38  ? 14  DC  C "C4'" 1 
ATOM   4334 C  "C4'" B DC  C 2 14  ? -24.270 2.857  9.157   0.50 33.12  ? 14  DC  C "C4'" 1 
ATOM   4335 O  "O4'" A DC  C 2 14  ? -33.278 39.939 6.357   0.50 53.43  ? 14  DC  C "O4'" 1 
ATOM   4336 O  "O4'" B DC  C 2 14  ? -24.540 3.451  7.866   0.50 35.32  ? 14  DC  C "O4'" 1 
ATOM   4337 C  "C3'" A DC  C 2 14  ? -34.710 41.822 6.621   0.50 57.94  ? 14  DC  C "C3'" 1 
ATOM   4338 C  "C3'" B DC  C 2 14  ? -24.551 1.353  8.981   0.50 47.97  ? 14  DC  C "C3'" 1 
ATOM   4339 O  "O3'" A DC  C 2 14  ? -35.205 42.080 7.910   0.50 74.87  ? 14  DC  C "O3'" 1 
ATOM   4340 O  "O3'" B DC  C 2 14  ? -25.615 0.957  9.832   0.50 58.92  ? 14  DC  C "O3'" 1 
ATOM   4341 C  "C2'" A DC  C 2 14  ? -33.240 42.235 6.497   0.50 46.24  ? 14  DC  C "C2'" 1 
ATOM   4342 C  "C2'" B DC  C 2 14  ? -24.945 1.224  7.505   0.50 40.44  ? 14  DC  C "C2'" 1 
ATOM   4343 C  "C1'" A DC  C 2 14  ? -32.547 40.973 6.956   0.50 44.70  ? 14  DC  C "C1'" 1 
ATOM   4344 C  "C1'" B DC  C 2 14  ? -25.455 2.618  7.218   0.50 31.45  ? 14  DC  C "C1'" 1 
ATOM   4345 N  N1    A DC  C 2 14  ? -31.143 40.873 6.522   0.50 44.02  ? 14  DC  C N1    1 
ATOM   4346 N  N1    B DC  C 2 14  ? -25.504 2.943  5.775   0.50 25.96  ? 14  DC  C N1    1 
ATOM   4347 C  C2    A DC  C 2 14  ? -30.251 40.088 7.257   0.50 43.11  ? 14  DC  C C2    1 
ATOM   4348 C  C2    B DC  C 2 14  ? -26.715 3.337  5.206   0.50 18.92  ? 14  DC  C C2    1 
ATOM   4349 O  O2    A DC  C 2 14  ? -30.661 39.486 8.265   0.50 37.85  ? 14  DC  C O2    1 
ATOM   4350 O  O2    B DC  C 2 14  ? -27.715 3.434  5.933   0.50 14.12  ? 14  DC  C O2    1 
ATOM   4351 N  N3    A DC  C 2 14  ? -28.958 40.006 6.842   0.50 40.11  ? 14  DC  C N3    1 
ATOM   4352 N  N3    B DC  C 2 14  ? -26.753 3.611  3.874   0.50 16.96  ? 14  DC  C N3    1 
ATOM   4353 C  C4    A DC  C 2 14  ? -28.561 40.668 5.750   0.50 41.13  ? 14  DC  C C4    1 
ATOM   4354 C  C4    B DC  C 2 14  ? -25.643 3.485  3.132   0.50 15.46  ? 14  DC  C C4    1 
ATOM   4355 N  N4    A DC  C 2 14  ? -27.279 40.557 5.376   0.50 42.64  ? 14  DC  C N4    1 
ATOM   4356 N  N4    B DC  C 2 14  ? -25.723 3.755  1.823   0.50 13.37  ? 14  DC  C N4    1 
ATOM   4357 C  C5    A DC  C 2 14  ? -29.460 41.472 4.993   0.50 40.95  ? 14  DC  C C5    1 
ATOM   4358 C  C5    B DC  C 2 14  ? -24.407 3.074  3.700   0.50 15.53  ? 14  DC  C C5    1 
ATOM   4359 C  C6    A DC  C 2 14  ? -30.728 41.546 5.413   0.50 50.57  ? 14  DC  C C6    1 
ATOM   4360 C  C6    B DC  C 2 14  ? -24.387 2.804  5.009   0.50 24.67  ? 14  DC  C C6    1 
ATOM   4361 P  P     A DC  C 2 15  ? -35.536 43.571 8.394   0.50 76.62  ? 15  DC  C P     1 
ATOM   4362 P  P     B DC  C 2 15  ? -26.080 -0.581 9.917   0.50 53.63  ? 15  DC  C P     1 
ATOM   4363 O  OP1   A DC  C 2 15  ? -36.984 43.569 8.705   0.50 80.36  ? 15  DC  C OP1   1 
ATOM   4364 O  OP1   B DC  C 2 15  ? -26.376 -0.783 11.355  0.50 49.02  ? 15  DC  C OP1   1 
ATOM   4365 O  OP2   A DC  C 2 15  ? -34.994 44.564 7.437   0.50 74.47  ? 15  DC  C OP2   1 
ATOM   4366 O  OP2   B DC  C 2 15  ? -25.136 -1.487 9.215   0.50 15.94  ? 15  DC  C OP2   1 
ATOM   4367 O  "O5'" A DC  C 2 15  ? -34.714 43.686 9.755   0.50 58.83  ? 15  DC  C "O5'" 1 
ATOM   4368 O  "O5'" B DC  C 2 15  ? -27.444 -0.601 9.096   0.50 26.34  ? 15  DC  C "O5'" 1 
ATOM   4369 C  "C5'" A DC  C 2 15  ? -34.876 42.694 10.772  0.50 58.35  ? 15  DC  C "C5'" 1 
ATOM   4370 C  "C5'" B DC  C 2 15  ? -28.537 0.181  9.539   0.50 37.69  ? 15  DC  C "C5'" 1 
ATOM   4371 C  "C4'" A DC  C 2 15  ? -33.679 42.695 11.705  0.50 69.48  ? 15  DC  C "C4'" 1 
ATOM   4372 C  "C4'" B DC  C 2 15  ? -29.746 -0.071 8.668   0.50 43.86  ? 15  DC  C "C4'" 1 
ATOM   4373 O  "O4'" A DC  C 2 15  ? -32.556 42.082 11.034  0.50 68.07  ? 15  DC  C "O4'" 1 
ATOM   4374 O  "O4'" B DC  C 2 15  ? -29.547 0.564  7.374   0.50 49.87  ? 15  DC  C "O4'" 1 
ATOM   4375 C  "C3'" A DC  C 2 15  ? -33.201 44.080 12.112  0.50 72.09  ? 15  DC  C "C3'" 1 
ATOM   4376 C  "C3'" B DC  C 2 15  ? -30.020 -1.549 8.386   0.50 44.94  ? 15  DC  C "C3'" 1 
ATOM   4377 O  "O3'" A DC  C 2 15  ? -33.861 44.491 13.314  0.50 61.34  ? 15  DC  C "O3'" 1 
ATOM   4378 O  "O3'" B DC  C 2 15  ? -31.398 -1.850 8.615   0.50 36.96  ? 15  DC  C "O3'" 1 
ATOM   4379 C  "C2'" A DC  C 2 15  ? -31.696 43.892 12.332  0.50 61.09  ? 15  DC  C "C2'" 1 
ATOM   4380 C  "C2'" B DC  C 2 15  ? -29.627 -1.715 6.909   0.50 44.66  ? 15  DC  C "C2'" 1 
ATOM   4381 C  "C1'" A DC  C 2 15  ? -31.346 42.683 11.452  0.50 53.84  ? 15  DC  C "C1'" 1 
ATOM   4382 C  "C1'" B DC  C 2 15  ? -29.920 -0.331 6.357   0.50 33.48  ? 15  DC  C "C1'" 1 
ATOM   4383 N  N1    A DC  C 2 15  ? -30.539 43.019 10.230  0.50 64.88  ? 15  DC  C N1    1 
ATOM   4384 N  N1    B DC  C 2 15  ? -29.157 0.003  5.106   0.50 26.51  ? 15  DC  C N1    1 
ATOM   4385 C  C2    A DC  C 2 15  ? -29.141 42.850 10.248  0.50 58.26  ? 15  DC  C C2    1 
ATOM   4386 C  C2    B DC  C 2 15  ? -29.851 0.510  3.993   0.50 24.44  ? 15  DC  C C2    1 
ATOM   4387 O  O2    A DC  C 2 15  ? -28.596 42.438 11.282  0.50 43.84  ? 15  DC  C O2    1 
ATOM   4388 O  O2    B DC  C 2 15  ? -31.081 0.672  4.067   0.50 20.69  ? 15  DC  C O2    1 
ATOM   4389 N  N3    A DC  C 2 15  ? -28.424 43.148 9.127   0.50 47.15  ? 15  DC  C N3    1 
ATOM   4390 N  N3    B DC  C 2 15  ? -29.160 0.803  2.861   0.50 15.84  ? 15  DC  C N3    1 
ATOM   4391 C  C4    A DC  C 2 15  ? -29.053 43.588 8.027   0.50 57.64  ? 15  DC  C C4    1 
ATOM   4392 C  C4    B DC  C 2 15  ? -27.842 0.609  2.817   0.50 20.80  ? 15  DC  C C4    1 
ATOM   4393 N  N4    A DC  C 2 15  ? -28.309 43.865 6.948   0.50 46.33  ? 15  DC  C N4    1 
ATOM   4394 N  N4    B DC  C 2 15  ? -27.207 0.918  1.675   0.50 19.40  ? 15  DC  C N4    1 
ATOM   4395 C  C5    A DC  C 2 15  ? -30.475 43.763 7.989   0.50 57.43  ? 15  DC  C C5    1 
ATOM   4396 C  C5    B DC  C 2 15  ? -27.112 0.093  3.942   0.50 16.85  ? 15  DC  C C5    1 
ATOM   4397 C  C6    A DC  C 2 15  ? -31.171 43.467 9.099   0.50 60.47  ? 15  DC  C C6    1 
ATOM   4398 C  C6    B DC  C 2 15  ? -27.804 -0.196 5.052   0.50 18.95  ? 15  DC  C C6    1 
ATOM   4399 O  "O5'" A DG  D 3 1   ? -18.229 41.221 8.283   0.50 45.85  ? 1   DG  D "O5'" 1 
ATOM   4400 O  "O5'" B DG  D 3 1   ? -31.906 4.809  -5.662  0.50 48.06  ? 1   DG  D "O5'" 1 
ATOM   4401 C  "C5'" A DG  D 3 1   ? -17.658 41.877 9.417   0.50 63.27  ? 1   DG  D "C5'" 1 
ATOM   4402 C  "C5'" B DG  D 3 1   ? -32.929 4.000  -6.237  0.50 47.94  ? 1   DG  D "C5'" 1 
ATOM   4403 C  "C4'" A DG  D 3 1   ? -18.711 42.134 10.486  0.50 84.25  ? 1   DG  D "C4'" 1 
ATOM   4404 C  "C4'" B DG  D 3 1   ? -33.865 3.460  -5.164  0.50 51.60  ? 1   DG  D "C4'" 1 
ATOM   4405 O  "O4'" A DG  D 3 1   ? -19.717 43.025 9.966   0.50 85.29  ? 1   DG  D "O4'" 1 
ATOM   4406 O  "O4'" B DG  D 3 1   ? -33.350 2.209  -4.645  0.50 50.25  ? 1   DG  D "O4'" 1 
ATOM   4407 C  "C3'" A DG  D 3 1   ? -19.489 40.910 10.923  0.50 77.79  ? 1   DG  D "C3'" 1 
ATOM   4408 C  "C3'" B DG  D 3 1   ? -34.057 4.370  -3.955  0.50 51.32  ? 1   DG  D "C3'" 1 
ATOM   4409 O  "O3'" A DG  D 3 1   ? -18.798 40.237 11.945  0.50 69.60  ? 1   DG  D "O3'" 1 
ATOM   4410 O  "O3'" B DG  D 3 1   ? -35.232 5.143  -4.135  0.50 59.71  ? 1   DG  D "O3'" 1 
ATOM   4411 C  "C2'" A DG  D 3 1   ? -20.804 41.495 11.438  0.50 62.93  ? 1   DG  D "C2'" 1 
ATOM   4412 C  "C2'" B DG  D 3 1   ? -34.208 3.387  -2.792  0.50 34.46  ? 1   DG  D "C2'" 1 
ATOM   4413 C  "C1'" A DG  D 3 1   ? -20.956 42.771 10.609  0.50 69.41  ? 1   DG  D "C1'" 1 
ATOM   4414 C  "C1'" B DG  D 3 1   ? -33.318 2.241  -3.229  0.50 36.96  ? 1   DG  D "C1'" 1 
ATOM   4415 N  N9    A DG  D 3 1   ? -22.007 42.714 9.595   0.50 66.43  ? 1   DG  D N9    1 
ATOM   4416 N  N9    B DG  D 3 1   ? -31.923 2.359  -2.813  0.50 30.88  ? 1   DG  D N9    1 
ATOM   4417 C  C8    A DG  D 3 1   ? -21.852 42.851 8.233   0.50 61.97  ? 1   DG  D C8    1 
ATOM   4418 C  C8    B DG  D 3 1   ? -30.857 2.711  -3.607  0.50 35.38  ? 1   DG  D C8    1 
ATOM   4419 N  N7    A DG  D 3 1   ? -22.975 42.786 7.570   0.50 46.70  ? 1   DG  D N7    1 
ATOM   4420 N  N7    B DG  D 3 1   ? -29.713 2.697  -2.980  0.50 29.74  ? 1   DG  D N7    1 
ATOM   4421 C  C5    A DG  D 3 1   ? -23.941 42.601 8.555   0.50 49.93  ? 1   DG  D C5    1 
ATOM   4422 C  C5    B DG  D 3 1   ? -30.038 2.299  -1.693  0.50 17.13  ? 1   DG  D C5    1 
ATOM   4423 C  C6    A DG  D 3 1   ? -25.348 42.463 8.440   0.50 47.88  ? 1   DG  D C6    1 
ATOM   4424 C  C6    B DG  D 3 1   ? -29.204 2.104  -0.573  0.50 22.67  ? 1   DG  D C6    1 
ATOM   4425 O  O6    A DG  D 3 1   ? -26.040 42.477 7.411   0.50 38.03  ? 1   DG  D O6    1 
ATOM   4426 O  O6    B DG  D 3 1   ? -27.973 2.257  -0.496  0.50 30.16  ? 1   DG  D O6    1 
ATOM   4427 N  N1    A DG  D 3 1   ? -25.955 42.293 9.688   0.50 46.15  ? 1   DG  D N1    1 
ATOM   4428 N  N1    B DG  D 3 1   ? -29.933 1.702  0.550   0.50 21.82  ? 1   DG  D N1    1 
ATOM   4429 C  C2    A DG  D 3 1   ? -25.283 42.262 10.894  0.50 45.95  ? 1   DG  D C2    1 
ATOM   4430 C  C2    B DG  D 3 1   ? -31.296 1.510  0.574   0.50 20.39  ? 1   DG  D C2    1 
ATOM   4431 N  N2    A DG  D 3 1   ? -26.036 42.087 11.992  0.50 42.58  ? 1   DG  D N2    1 
ATOM   4432 N  N2    B DG  D 3 1   ? -31.820 1.122  1.750   0.50 14.47  ? 1   DG  D N2    1 
ATOM   4433 N  N3    A DG  D 3 1   ? -23.965 42.393 11.014  0.50 44.07  ? 1   DG  D N3    1 
ATOM   4434 N  N3    B DG  D 3 1   ? -32.090 1.689  -0.480  0.50 19.07  ? 1   DG  D N3    1 
ATOM   4435 C  C4    A DG  D 3 1   ? -23.361 42.558 9.809   0.50 55.35  ? 1   DG  D C4    1 
ATOM   4436 C  C4    B DG  D 3 1   ? -31.394 2.082  -1.572  0.50 18.27  ? 1   DG  D C4    1 
ATOM   4437 P  P     A DG  D 3 2   ? -19.001 38.657 12.099  0.50 90.54  ? 2   DG  D P     1 
ATOM   4438 P  P     B DG  D 3 2   ? -35.474 6.464  -3.260  0.50 43.78  ? 2   DG  D P     1 
ATOM   4439 O  OP1   A DG  D 3 2   ? -18.018 38.148 13.082  0.50 82.76  ? 2   DG  D OP1   1 
ATOM   4440 O  OP1   B DG  D 3 2   ? -36.797 6.983  -3.677  0.50 41.64  ? 2   DG  D OP1   1 
ATOM   4441 O  OP2   A DG  D 3 2   ? -19.073 38.105 10.720  0.50 61.45  ? 2   DG  D OP2   1 
ATOM   4442 O  OP2   B DG  D 3 2   ? -34.257 7.311  -3.310  0.50 22.05  ? 2   DG  D OP2   1 
ATOM   4443 O  "O5'" A DG  D 3 2   ? -20.459 38.530 12.725  0.50 53.47  ? 2   DG  D "O5'" 1 
ATOM   4444 O  "O5'" B DG  D 3 2   ? -35.562 5.916  -1.765  0.50 40.07  ? 2   DG  D "O5'" 1 
ATOM   4445 C  "C5'" A DG  D 3 2   ? -20.727 39.040 14.009  0.50 39.21  ? 2   DG  D "C5'" 1 
ATOM   4446 C  "C5'" B DG  D 3 2   ? -36.721 5.244  -1.295  0.50 34.73  ? 2   DG  D "C5'" 1 
ATOM   4447 C  "C4'" A DG  D 3 2   ? -22.107 38.613 14.455  0.50 36.41  ? 2   DG  D "C4'" 1 
ATOM   4448 C  "C4'" B DG  D 3 2   ? -36.637 5.102  0.213   0.50 34.00  ? 2   DG  D "C4'" 1 
ATOM   4449 O  "O4'" A DG  D 3 2   ? -23.084 39.101 13.504  0.50 40.65  ? 2   DG  D "O4'" 1 
ATOM   4450 O  "O4'" B DG  D 3 2   ? -35.364 4.501  0.552   0.50 34.88  ? 2   DG  D "O4'" 1 
ATOM   4451 C  "C3'" A DG  D 3 2   ? -22.317 37.106 14.532  0.50 34.73  ? 2   DG  D "C3'" 1 
ATOM   4452 C  "C3'" B DG  D 3 2   ? -36.690 6.421  0.980   0.50 28.91  ? 2   DG  D "C3'" 1 
ATOM   4453 O  "O3'" A DG  D 3 2   ? -23.202 36.799 15.588  0.50 36.04  ? 2   DG  D "O3'" 1 
ATOM   4454 O  "O3'" B DG  D 3 2   ? -37.353 6.256  2.209   0.50 28.54  ? 2   DG  D "O3'" 1 
ATOM   4455 C  "C2'" A DG  D 3 2   ? -22.926 36.772 13.176  0.50 37.76  ? 2   DG  D "C2'" 1 
ATOM   4456 C  "C2'" B DG  D 3 2   ? -35.223 6.779  1.186   0.50 23.35  ? 2   DG  D "C2'" 1 
ATOM   4457 C  "C1'" A DG  D 3 2   ? -23.744 38.021 12.878  0.50 33.13  ? 2   DG  D "C1'" 1 
ATOM   4458 C  "C1'" B DG  D 3 2   ? -34.556 5.415  1.270   0.50 23.87  ? 2   DG  D "C1'" 1 
ATOM   4459 N  N9    A DG  D 3 2   ? -23.853 38.316 11.449  0.50 33.21  ? 2   DG  D N9    1 
ATOM   4460 N  N9    B DG  D 3 2   ? -33.221 5.407  0.687   0.50 17.45  ? 2   DG  D N9    1 
ATOM   4461 C  C8    A DG  D 3 2   ? -22.831 38.366 10.530  0.50 34.41  ? 2   DG  D C8    1 
ATOM   4462 C  C8    B DG  D 3 2   ? -32.881 5.713  -0.607  0.50 22.15  ? 2   DG  D C8    1 
ATOM   4463 N  N7    A DG  D 3 2   ? -23.233 38.658 9.325   0.50 29.76  ? 2   DG  D N7    1 
ATOM   4464 N  N7    B DG  D 3 2   ? -31.600 5.625  -0.843  0.50 20.77  ? 2   DG  D N7    1 
ATOM   4465 C  C5    A DG  D 3 2   ? -24.608 38.810 9.455   0.50 25.80  ? 2   DG  D C5    1 
ATOM   4466 C  C5    B DG  D 3 2   ? -31.058 5.245  0.378   0.50 15.75  ? 2   DG  D C5    1 
ATOM   4467 C  C6    A DG  D 3 2   ? -25.587 39.132 8.487   0.50 31.16  ? 2   DG  D C6    1 
ATOM   4468 C  C6    B DG  D 3 2   ? -29.714 4.996  0.741   0.50 16.29  ? 2   DG  D C6    1 
ATOM   4469 O  O6    A DG  D 3 2   ? -25.431 39.353 7.274   0.50 42.72  ? 2   DG  D O6    1 
ATOM   4470 O  O6    B DG  D 3 2   ? -28.692 5.071  0.026   0.50 15.91  ? 2   DG  D O6    1 
ATOM   4471 N  N1    A DG  D 3 2   ? -26.859 39.190 9.042   0.50 22.39  ? 2   DG  D N1    1 
ATOM   4472 N  N1    B DG  D 3 2   ? -29.611 4.624  2.082   0.50 11.71  ? 2   DG  D N1    1 
ATOM   4473 C  C2    A DG  D 3 2   ? -27.150 38.967 10.357  0.50 19.52  ? 2   DG  D C2    1 
ATOM   4474 C  C2    B DG  D 3 2   ? -30.670 4.517  2.950   0.50 10.70  ? 2   DG  D C2    1 
ATOM   4475 N  N2    A DG  D 3 2   ? -28.434 39.066 10.701  0.50 21.68  ? 2   DG  D N2    1 
ATOM   4476 N  N2    B DG  D 3 2   ? -30.380 4.159  4.203   0.50 14.44  ? 2   DG  D N2    1 
ATOM   4477 N  N3    A DG  D 3 2   ? -26.250 38.667 11.273  0.50 30.70  ? 2   DG  D N3    1 
ATOM   4478 N  N3    B DG  D 3 2   ? -31.924 4.746  2.620   0.50 11.57  ? 2   DG  D N3    1 
ATOM   4479 C  C4    A DG  D 3 2   ? -25.002 38.605 10.753  0.50 29.52  ? 2   DG  D C4    1 
ATOM   4480 C  C4    B DG  D 3 2   ? -32.045 5.106  1.327   0.50 14.50  ? 2   DG  D C4    1 
ATOM   4481 P  P     A DA  D 3 3   ? -23.674 35.285 15.838  0.50 39.82  ? 3   DA  D P     1 
ATOM   4482 P  P     B DA  D 3 3   ? -37.660 7.539  3.125   0.50 30.91  ? 3   DA  D P     1 
ATOM   4483 O  OP1   A DA  D 3 3   ? -24.063 35.167 17.269  0.50 29.56  ? 3   DA  D OP1   1 
ATOM   4484 O  OP1   B DA  D 3 3   ? -38.933 7.274  3.835   0.50 24.52  ? 3   DA  D OP1   1 
ATOM   4485 O  OP2   A DA  D 3 3   ? -22.652 34.376 15.272  0.50 31.34  ? 3   DA  D OP2   1 
ATOM   4486 O  OP2   B DA  D 3 3   ? -37.514 8.761  2.299   0.50 35.97  ? 3   DA  D OP2   1 
ATOM   4487 O  "O5'" A DA  D 3 3   ? -24.990 35.171 14.955  0.50 26.58  ? 3   DA  D "O5'" 1 
ATOM   4488 O  "O5'" B DA  D 3 3   ? -36.485 7.520  4.191   0.50 22.04  ? 3   DA  D "O5'" 1 
ATOM   4489 C  "C5'" A DA  D 3 3   ? -26.037 36.089 15.166  0.50 32.38  ? 3   DA  D "C5'" 1 
ATOM   4490 C  "C5'" B DA  D 3 3   ? -36.502 6.540  5.193   0.50 28.28  ? 3   DA  D "C5'" 1 
ATOM   4491 C  "C4'" A DA  D 3 3   ? -27.289 35.647 14.450  0.50 31.06  ? 3   DA  D "C4'" 1 
ATOM   4492 C  "C4'" B DA  D 3 3   ? -35.381 6.750  6.184   0.50 23.18  ? 3   DA  D "C4'" 1 
ATOM   4493 O  "O4'" A DA  D 3 3   ? -27.233 36.074 13.064  0.50 35.07  ? 3   DA  D "O4'" 1 
ATOM   4494 O  "O4'" B DA  D 3 3   ? -34.105 6.574  5.524   0.50 21.03  ? 3   DA  D "O4'" 1 
ATOM   4495 C  "C3'" A DA  D 3 3   ? -27.507 34.139 14.410  0.50 34.32  ? 3   DA  D "C3'" 1 
ATOM   4496 C  "C3'" B DA  D 3 3   ? -35.337 8.125  6.839   0.50 24.01  ? 3   DA  D "C3'" 1 
ATOM   4497 O  "O3'" A DA  D 3 3   ? -28.882 33.882 14.465  0.50 34.12  ? 3   DA  D "O3'" 1 
ATOM   4498 O  "O3'" B DA  D 3 3   ? -35.031 7.958  8.210   0.50 31.76  ? 3   DA  D "O3'" 1 
ATOM   4499 C  "C2'" A DA  D 3 3   ? -26.936 33.761 13.045  0.50 32.82  ? 3   DA  D "C2'" 1 
ATOM   4500 C  "C2'" B DA  D 3 3   ? -34.203 8.831  6.089   0.50 19.80  ? 3   DA  D "C2'" 1 
ATOM   4501 C  "C1'" A DA  D 3 3   ? -27.401 34.949 12.222  0.50 33.70  ? 3   DA  D "C1'" 1 
ATOM   4502 C  "C1'" B DA  D 3 3   ? -33.268 7.669  5.811   0.50 18.07  ? 3   DA  D "C1'" 1 
ATOM   4503 N  N9    A DA  D 3 3   ? -26.644 35.169 10.987  0.50 24.76  ? 3   DA  D N9    1 
ATOM   4504 N  N9    B DA  D 3 3   ? -32.380 7.860  4.666   0.50 15.48  ? 3   DA  D N9    1 
ATOM   4505 C  C8    A DA  D 3 3   ? -25.295 35.063 10.813  0.50 21.55  ? 3   DA  D C8    1 
ATOM   4506 C  C8    B DA  D 3 3   ? -32.738 8.192  3.386   0.50 16.80  ? 3   DA  D C8    1 
ATOM   4507 N  N7    A DA  D 3 3   ? -24.898 35.333 9.592   0.50 23.22  ? 3   DA  D N7    1 
ATOM   4508 N  N7    B DA  D 3 3   ? -31.725 8.264  2.553   0.50 13.77  ? 3   DA  D N7    1 
ATOM   4509 C  C5    A DA  D 3 3   ? -26.070 35.646 8.920   0.50 25.79  ? 3   DA  D C5    1 
ATOM   4510 C  C5    B DA  D 3 3   ? -30.628 7.944  3.336   0.50 12.26  ? 3   DA  D C5    1 
ATOM   4511 C  C6    A DA  D 3 3   ? -26.335 36.025 7.585   0.50 25.48  ? 3   DA  D C6    1 
ATOM   4512 C  C6    B DA  D 3 3   ? -29.251 7.843  3.047   0.50 11.91  ? 3   DA  D C6    1 
ATOM   4513 N  N6    A DA  D 3 3   ? -25.386 36.157 6.652   0.50 21.76  ? 3   DA  D N6    1 
ATOM   4514 N  N6    B DA  D 3 3   ? -28.738 8.069  1.838   0.50 9.35   ? 3   DA  D N6    1 
ATOM   4515 N  N1    A DA  D 3 3   ? -27.617 36.262 7.245   0.50 22.38  ? 3   DA  D N1    1 
ATOM   4516 N  N1    B DA  D 3 3   ? -28.418 7.502  4.058   0.50 15.13  ? 3   DA  D N1    1 
ATOM   4517 C  C2    A DA  D 3 3   ? -28.564 36.131 8.176   0.50 21.02  ? 3   DA  D C2    1 
ATOM   4518 C  C2    B DA  D 3 3   ? -28.937 7.281  5.278   0.50 16.46  ? 3   DA  D C2    1 
ATOM   4519 N  N3    A DA  D 3 3   ? -28.440 35.784 9.452   0.50 23.82  ? 3   DA  D N3    1 
ATOM   4520 N  N3    B DA  D 3 3   ? -30.213 7.341  5.670   0.50 17.77  ? 3   DA  D N3    1 
ATOM   4521 C  C4    A DA  D 3 3   ? -27.154 35.552 9.764   0.50 23.42  ? 3   DA  D C4    1 
ATOM   4522 C  C4    B DA  D 3 3   ? -31.015 7.685  4.640   0.50 16.01  ? 3   DA  D C4    1 
ATOM   4523 P  P     A DC  D 3 4   ? -29.449 32.653 15.319  0.50 39.93  ? 4   DC  D P     1 
ATOM   4524 P  P     B DC  D 3 4   ? -35.380 9.099  9.279   0.50 31.59  ? 4   DC  D P     1 
ATOM   4525 O  OP1   A DC  D 3 4   ? -30.139 33.246 16.484  0.50 31.82  ? 4   DC  D OP1   1 
ATOM   4526 O  OP1   B DC  D 3 4   ? -35.761 8.395  10.525  0.50 37.41  ? 4   DC  D OP1   1 
ATOM   4527 O  OP2   A DC  D 3 4   ? -28.365 31.639 15.462  0.50 27.88  ? 4   DC  D OP2   1 
ATOM   4528 O  OP2   B DC  D 3 4   ? -36.284 10.097 8.653   0.50 28.36  ? 4   DC  D OP2   1 
ATOM   4529 O  "O5'" A DC  D 3 4   ? -30.584 32.050 14.377  0.50 30.31  ? 4   DC  D "O5'" 1 
ATOM   4530 O  "O5'" B DC  D 3 4   ? -33.973 9.792  9.538   0.50 18.82  ? 4   DC  D "O5'" 1 
ATOM   4531 C  "C5'" A DC  D 3 4   ? -31.524 32.916 13.783  0.50 24.79  ? 4   DC  D "C5'" 1 
ATOM   4532 C  "C5'" B DC  D 3 4   ? -32.978 9.071  10.183  0.50 17.55  ? 4   DC  D "C5'" 1 
ATOM   4533 C  "C4'" A DC  D 3 4   ? -31.768 32.540 12.329  0.50 25.85  ? 4   DC  D "C4'" 1 
ATOM   4534 C  "C4'" B DC  D 3 4   ? -31.629 9.698  9.941   0.50 24.55  ? 4   DC  D "C4'" 1 
ATOM   4535 O  "O4'" A DC  D 3 4   ? -30.652 32.933 11.505  0.50 19.68  ? 4   DC  D "O4'" 1 
ATOM   4536 O  "O4'" B DC  D 3 4   ? -31.276 9.565  8.558   0.50 26.36  ? 4   DC  D "O4'" 1 
ATOM   4537 C  "C3'" A DC  D 3 4   ? -31.965 31.051 12.068  0.50 20.92  ? 4   DC  D "C3'" 1 
ATOM   4538 C  "C3'" B DC  D 3 4   ? -31.544 11.194 10.225  0.50 21.46  ? 4   DC  D "C3'" 1 
ATOM   4539 O  "O3'" A DC  D 3 4   ? -33.334 30.802 11.842  0.50 19.59  ? 4   DC  D "O3'" 1 
ATOM   4540 O  "O3'" B DC  D 3 4   ? -31.013 11.396 11.545  0.50 16.73  ? 4   DC  D "O3'" 1 
ATOM   4541 C  "C2'" A DC  D 3 4   ? -31.110 30.758 10.813  0.50 18.04  ? 4   DC  D "C2'" 1 
ATOM   4542 C  "C2'" B DC  D 3 4   ? -30.594 11.728 9.115   0.50 19.16  ? 4   DC  D "C2'" 1 
ATOM   4543 C  "C1'" A DC  D 3 4   ? -30.686 32.148 10.347  0.50 17.25  ? 4   DC  D "C1'" 1 
ATOM   4544 C  "C1'" B DC  D 3 4   ? -30.239 10.469 8.310   0.50 19.29  ? 4   DC  D "C1'" 1 
ATOM   4545 N  N1    A DC  D 3 4   ? -29.343 32.199 9.721   0.50 17.56  ? 4   DC  D N1    1 
ATOM   4546 N  N1    B DC  D 3 4   ? -30.138 10.675 6.831   0.50 16.50  ? 4   DC  D N1    1 
ATOM   4547 C  C2    A DC  D 3 4   ? -29.208 32.539 8.361   0.50 19.73  ? 4   DC  D C2    1 
ATOM   4548 C  C2    B DC  D 3 4   ? -28.887 10.587 6.197   0.50 15.92  ? 4   DC  D C2    1 
ATOM   4549 O  O2    A DC  D 3 4   ? -30.220 32.773 7.683   0.50 20.47  ? 4   DC  D O2    1 
ATOM   4550 O  O2    B DC  D 3 4   ? -27.879 10.357 6.879   0.50 19.27  ? 4   DC  D O2    1 
ATOM   4551 N  N3    A DC  D 3 4   ? -27.965 32.599 7.823   0.50 18.33  ? 4   DC  D N3    1 
ATOM   4552 N  N3    B DC  D 3 4   ? -28.815 10.765 4.853   0.50 12.33  ? 4   DC  D N3    1 
ATOM   4553 C  C4    A DC  D 3 4   ? -26.899 32.337 8.578   0.50 20.67  ? 4   DC  D C4    1 
ATOM   4554 C  C4    B DC  D 3 4   ? -29.926 11.011 4.151   0.50 15.96  ? 4   DC  D C4    1 
ATOM   4555 N  N4    A DC  D 3 4   ? -25.694 32.399 8.003   0.50 18.71  ? 4   DC  D N4    1 
ATOM   4556 N  N4    B DC  D 3 4   ? -29.808 11.187 2.826   0.50 11.81  ? 4   DC  D N4    1 
ATOM   4557 C  C5    A DC  D 3 4   ? -27.020 31.997 9.959   0.50 24.04  ? 4   DC  D C5    1 
ATOM   4558 C  C5    B DC  D 3 4   ? -31.210 11.094 4.778   0.50 18.36  ? 4   DC  D C5    1 
ATOM   4559 C  C6    A DC  D 3 4   ? -28.247 31.945 10.482  0.50 20.61  ? 4   DC  D C6    1 
ATOM   4560 C  C6    B DC  D 3 4   ? -31.267 10.915 6.104   0.50 16.96  ? 4   DC  D C6    1 
ATOM   4561 P  P     A DG  D 3 5   ? -33.871 29.298 11.749  0.50 21.65  ? 5   DG  D P     1 
ATOM   4562 P  P     B DG  D 3 5   ? -30.895 12.870 12.179  0.50 17.42  ? 5   DG  D P     1 
ATOM   4563 O  OP1   A DG  D 3 5   ? -35.298 29.292 12.131  0.50 23.35  ? 5   DG  D OP1   1 
ATOM   4564 O  OP1   B DG  D 3 5   ? -30.740 12.703 13.638  0.50 24.58  ? 5   DG  D OP1   1 
ATOM   4565 O  OP2   A DG  D 3 5   ? -32.879 28.432 12.426  0.50 20.77  ? 5   DG  D OP2   1 
ATOM   4566 O  OP2   B DG  D 3 5   ? -31.983 13.716 11.646  0.50 22.59  ? 5   DG  D OP2   1 
ATOM   4567 O  "O5'" A DG  D 3 5   ? -33.829 28.989 10.194  0.50 22.53  ? 5   DG  D "O5'" 1 
ATOM   4568 O  "O5'" B DG  D 3 5   ? -29.514 13.428 11.617  0.50 17.77  ? 5   DG  D "O5'" 1 
ATOM   4569 C  "C5'" A DG  D 3 5   ? -34.755 29.611 9.350   0.50 20.63  ? 5   DG  D "C5'" 1 
ATOM   4570 C  "C5'" B DG  D 3 5   ? -28.307 12.797 11.992  0.50 20.87  ? 5   DG  D "C5'" 1 
ATOM   4571 C  "C4'" A DG  D 3 5   ? -34.452 29.296 7.907   0.50 19.98  ? 5   DG  D "C4'" 1 
ATOM   4572 C  "C4'" B DG  D 3 5   ? -27.161 13.295 11.141  0.50 22.84  ? 5   DG  D "C4'" 1 
ATOM   4573 O  "O4'" A DG  D 3 5   ? -33.131 29.796 7.558   0.50 18.25  ? 5   DG  D "O4'" 1 
ATOM   4574 O  "O4'" B DG  D 3 5   ? -27.428 12.997 9.742   0.50 29.11  ? 5   DG  D "O4'" 1 
ATOM   4575 C  "C3'" A DG  D 3 5   ? -34.434 27.805 7.562   0.50 24.26  ? 5   DG  D "C3'" 1 
ATOM   4576 C  "C3'" B DG  D 3 5   ? -26.917 14.809 11.212  0.50 20.27  ? 5   DG  D "C3'" 1 
ATOM   4577 O  "O3'" A DG  D 3 5   ? -34.936 27.649 6.264   0.50 25.93  ? 5   DG  D "O3'" 1 
ATOM   4578 O  "O3'" B DG  D 3 5   ? -25.537 15.065 11.325  0.50 16.94  ? 5   DG  D "O3'" 1 
ATOM   4579 C  "C2'" A DG  D 3 5   ? -32.946 27.484 7.606   0.50 20.47  ? 5   DG  D "C2'" 1 
ATOM   4580 C  "C2'" B DG  D 3 5   ? -27.453 15.302 9.877   0.50 23.24  ? 5   DG  D "C2'" 1 
ATOM   4581 C  "C1'" A DG  D 3 5   ? -32.411 28.739 6.954   0.50 23.93  ? 5   DG  D "C1'" 1 
ATOM   4582 C  "C1'" B DG  D 3 5   ? -27.090 14.131 8.985   0.50 26.69  ? 5   DG  D "C1'" 1 
ATOM   4583 N  N9    A DG  D 3 5   ? -30.972 28.943 7.121   0.50 20.60  ? 5   DG  D N9    1 
ATOM   4584 N  N9    B DG  D 3 5   ? -27.820 14.135 7.719   0.50 19.46  ? 5   DG  D N9    1 
ATOM   4585 C  C8    A DG  D 3 5   ? -30.214 28.701 8.241   0.50 19.08  ? 5   DG  D C8    1 
ATOM   4586 C  C8    B DG  D 3 5   ? -29.170 14.308 7.547   0.50 19.62  ? 5   DG  D C8    1 
ATOM   4587 N  N7    A DG  D 3 5   ? -28.946 28.971 8.075   0.50 17.07  ? 5   DG  D N7    1 
ATOM   4588 N  N7    B DG  D 3 5   ? -29.539 14.304 6.298   0.50 17.67  ? 5   DG  D N7    1 
ATOM   4589 C  C5    A DG  D 3 5   ? -28.863 29.416 6.756   0.50 18.86  ? 5   DG  D C5    1 
ATOM   4590 C  C5    B DG  D 3 5   ? -28.354 14.127 5.595   0.50 16.26  ? 5   DG  D C5    1 
ATOM   4591 C  C6    A DG  D 3 5   ? -27.741 29.857 6.000   0.50 20.50  ? 5   DG  D C6    1 
ATOM   4592 C  C6    B DG  D 3 5   ? -28.131 14.049 4.203   0.50 16.50  ? 5   DG  D C6    1 
ATOM   4593 O  O6    A DG  D 3 5   ? -26.553 29.943 6.353   0.50 20.70  ? 5   DG  D O6    1 
ATOM   4594 O  O6    B DG  D 3 5   ? -28.971 14.122 3.291   0.50 13.62  ? 5   DG  D O6    1 
ATOM   4595 N  N1    A DG  D 3 5   ? -28.106 30.222 4.707   0.50 17.46  ? 5   DG  D N1    1 
ATOM   4596 N  N1    B DG  D 3 5   ? -26.776 13.871 3.906   0.50 14.69  ? 5   DG  D N1    1 
ATOM   4597 C  C2    A DG  D 3 5   ? -29.384 30.165 4.204   0.50 19.20  ? 5   DG  D C2    1 
ATOM   4598 C  C2    B DG  D 3 5   ? -25.771 13.783 4.844   0.50 16.14  ? 5   DG  D C2    1 
ATOM   4599 N  N2    A DG  D 3 5   ? -29.542 30.550 2.932   0.50 18.35  ? 5   DG  D N2    1 
ATOM   4600 N  N2    B DG  D 3 5   ? -24.525 13.613 4.375   0.50 12.17  ? 5   DG  D N2    1 
ATOM   4601 N  N3    A DG  D 3 5   ? -30.434 29.759 4.896   0.50 22.81  ? 5   DG  D N3    1 
ATOM   4602 N  N3    B DG  D 3 5   ? -25.975 13.854 6.154   0.50 20.47  ? 5   DG  D N3    1 
ATOM   4603 C  C4    A DG  D 3 5   ? -30.100 29.399 6.161   0.50 19.40  ? 5   DG  D C4    1 
ATOM   4604 C  C4    B DG  D 3 5   ? -27.286 14.029 6.454   0.50 15.77  ? 5   DG  D C4    1 
ATOM   4605 P  P     A DG  D 3 6   ? -35.397 26.220 5.708   0.50 20.65  ? 6   DG  D P     1 
ATOM   4606 P  P     B DG  D 3 6   ? -25.023 16.506 11.804  0.50 25.22  ? 6   DG  D P     1 
ATOM   4607 O  OP1   A DG  D 3 6   ? -36.838 26.055 6.019   0.50 32.30  ? 6   DG  D OP1   1 
ATOM   4608 O  OP1   B DG  D 3 6   ? -24.898 16.488 13.284  0.50 37.74  ? 6   DG  D OP1   1 
ATOM   4609 O  OP2   A DG  D 3 6   ? -34.412 25.205 6.135   0.50 17.96  ? 6   DG  D OP2   1 
ATOM   4610 O  OP2   B DG  D 3 6   ? -25.881 17.510 11.137  0.50 23.36  ? 6   DG  D OP2   1 
ATOM   4611 O  "O5'" A DG  D 3 6   ? -35.272 26.415 4.134   0.50 24.25  ? 6   DG  D "O5'" 1 
ATOM   4612 O  "O5'" B DG  D 3 6   ? -23.564 16.613 11.167  0.50 26.77  ? 6   DG  D "O5'" 1 
ATOM   4613 C  "C5'" A DG  D 3 6   ? -35.689 27.642 3.547   0.50 17.73  ? 6   DG  D "C5'" 1 
ATOM   4614 C  "C5'" B DG  D 3 6   ? -22.794 15.438 10.988  0.50 25.86  ? 6   DG  D "C5'" 1 
ATOM   4615 C  "C4'" A DG  D 3 6   ? -35.089 27.838 2.163   0.50 12.81  ? 6   DG  D "C4'" 1 
ATOM   4616 C  "C4'" B DG  D 3 6   ? -21.793 15.591 9.851   0.50 20.64  ? 6   DG  D "C4'" 1 
ATOM   4617 O  "O4'" A DG  D 3 6   ? -33.692 28.185 2.271   0.50 17.99  ? 6   DG  D "O4'" 1 
ATOM   4618 O  "O4'" B DG  D 3 6   ? -22.449 15.425 8.567   0.50 20.08  ? 6   DG  D "O4'" 1 
ATOM   4619 C  "C3'" A DG  D 3 6   ? -35.125 26.635 1.248   0.50 14.16  ? 6   DG  D "C3'" 1 
ATOM   4620 C  "C3'" B DG  D 3 6   ? -21.063 16.916 9.782   0.50 14.08  ? 6   DG  D "C3'" 1 
ATOM   4621 O  "O3'" A DG  D 3 6   ? -35.149 27.085 -0.077  0.50 20.75  ? 6   DG  D "O3'" 1 
ATOM   4622 O  "O3'" B DG  D 3 6   ? -19.749 16.672 9.337   0.50 16.93  ? 6   DG  D "O3'" 1 
ATOM   4623 C  "C2'" A DG  D 3 6   ? -33.802 25.956 1.560   0.50 16.31  ? 6   DG  D "C2'" 1 
ATOM   4624 C  "C2'" B DG  D 3 6   ? -21.878 17.705 8.753   0.50 14.12  ? 6   DG  D "C2'" 1 
ATOM   4625 C  "C1'" A DG  D 3 6   ? -32.892 27.158 1.722   0.50 16.97  ? 6   DG  D "C1'" 1 
ATOM   4626 C  "C1'" B DG  D 3 6   ? -22.363 16.614 7.803   0.50 14.57  ? 6   DG  D "C1'" 1 
ATOM   4627 N  N9    A DG  D 3 6   ? -31.787 26.925 2.635   0.50 19.96  ? 6   DG  D N9    1 
ATOM   4628 N  N9    B DG  D 3 6   ? -23.694 16.858 7.255   0.50 21.53  ? 6   DG  D N9    1 
ATOM   4629 C  C8    A DG  D 3 6   ? -31.874 26.521 3.942   0.50 20.94  ? 6   DG  D C8    1 
ATOM   4630 C  C8    B DG  D 3 6   ? -24.850 17.052 7.977   0.50 23.55  ? 6   DG  D C8    1 
ATOM   4631 N  N7    A DG  D 3 6   ? -30.717 26.416 4.530   0.50 22.83  ? 6   DG  D N7    1 
ATOM   4632 N  N7    B DG  D 3 6   ? -25.915 17.210 7.236   0.50 16.79  ? 6   DG  D N7    1 
ATOM   4633 C  C5    A DG  D 3 6   ? -29.806 26.778 3.554   0.50 18.76  ? 6   DG  D C5    1 
ATOM   4634 C  C5    B DG  D 3 6   ? -25.447 17.102 5.940   0.50 13.12  ? 6   DG  D C5    1 
ATOM   4635 C  C6    A DG  D 3 6   ? -28.399 26.849 3.614   0.50 20.08  ? 6   DG  D C6    1 
ATOM   4636 C  C6    B DG  D 3 6   ? -26.155 17.185 4.729   0.50 16.83  ? 6   DG  D C6    1 
ATOM   4637 O  O6    A DG  D 3 6   ? -27.666 26.599 4.574   0.50 21.28  ? 6   DG  D O6    1 
ATOM   4638 O  O6    B DG  D 3 6   ? -27.366 17.385 4.570   0.50 20.94  ? 6   DG  D O6    1 
ATOM   4639 N  N1    A DG  D 3 6   ? -27.848 27.256 2.403   0.50 21.32  ? 6   DG  D N1    1 
ATOM   4640 N  N1    B DG  D 3 6   ? -25.321 17.015 3.625   0.50 23.58  ? 6   DG  D N1    1 
ATOM   4641 C  C2    A DG  D 3 6   ? -28.577 27.561 1.273   0.50 26.85  ? 6   DG  D C2    1 
ATOM   4642 C  C2    B DG  D 3 6   ? -23.961 16.791 3.691   0.50 26.05  ? 6   DG  D C2    1 
ATOM   4643 N  N2    A DG  D 3 6   ? -27.868 27.940 0.193   0.50 33.15  ? 6   DG  D N2    1 
ATOM   4644 N  N2    B DG  D 3 6   ? -23.330 16.657 2.505   0.50 16.62  ? 6   DG  D N2    1 
ATOM   4645 N  N3    A DG  D 3 6   ? -29.908 27.502 1.206   0.50 20.06  ? 6   DG  D N3    1 
ATOM   4646 N  N3    B DG  D 3 6   ? -23.269 16.704 4.843   0.50 13.16  ? 6   DG  D N3    1 
ATOM   4647 C  C4    A DG  D 3 6   ? -30.449 27.101 2.380   0.50 18.45  ? 6   DG  D C4    1 
ATOM   4648 C  C4    B DG  D 3 6   ? -24.079 16.872 5.922   0.50 15.08  ? 6   DG  D C4    1 
ATOM   4649 P  P     A DG  D 3 7   ? -35.392 26.059 -1.280  0.50 18.88  ? 7   DG  D P     1 
ATOM   4650 P  P     B DG  D 3 7   ? -18.655 17.844 9.295   0.50 17.80  ? 7   DG  D P     1 
ATOM   4651 O  OP1   A DG  D 3 7   ? -36.070 26.852 -2.337  0.50 16.43  ? 7   DG  D OP1   1 
ATOM   4652 O  OP1   B DG  D 3 7   ? -17.332 17.186 9.418   0.50 17.35  ? 7   DG  D OP1   1 
ATOM   4653 O  OP2   A DG  D 3 7   ? -36.032 24.844 -0.718  0.50 19.30  ? 7   DG  D OP2   1 
ATOM   4654 O  OP2   B DG  D 3 7   ? -19.040 18.898 10.259  0.50 16.09  ? 7   DG  D OP2   1 
ATOM   4655 O  "O5'" A DG  D 3 7   ? -33.919 25.640 -1.740  0.50 12.38  ? 7   DG  D "O5'" 1 
ATOM   4656 O  "O5'" B DG  D 3 7   ? -18.815 18.455 7.831   0.50 16.80  ? 7   DG  D "O5'" 1 
ATOM   4657 C  "C5'" A DG  D 3 7   ? -33.019 26.614 -2.216  0.50 9.83   ? 7   DG  D "C5'" 1 
ATOM   4658 C  "C5'" B DG  D 3 7   ? -18.374 17.732 6.697   0.50 12.68  ? 7   DG  D "C5'" 1 
ATOM   4659 C  "C4'" A DG  D 3 7   ? -31.851 25.962 -2.925  0.50 13.17  ? 7   DG  D "C4'" 1 
ATOM   4660 C  "C4'" B DG  D 3 7   ? -18.388 18.622 5.471   0.50 13.37  ? 7   DG  D "C4'" 1 
ATOM   4661 O  "O4'" A DG  D 3 7   ? -30.771 25.734 -1.991  0.50 16.49  ? 7   DG  D "O4'" 1 
ATOM   4662 O  "O4'" B DG  D 3 7   ? -19.745 18.759 4.984   0.50 15.56  ? 7   DG  D "O4'" 1 
ATOM   4663 C  "C3'" A DG  D 3 7   ? -32.147 24.613 -3.567  0.50 16.76  ? 7   DG  D "C3'" 1 
ATOM   4664 C  "C3'" B DG  D 3 7   ? -17.862 20.037 5.699   0.50 12.51  ? 7   DG  D "C3'" 1 
ATOM   4665 O  "O3'" A DG  D 3 7   ? -31.397 24.467 -4.770  0.50 18.24  ? 7   DG  D "O3'" 1 
ATOM   4666 O  "O3'" B DG  D 3 7   ? -16.982 20.426 4.622   0.50 17.78  ? 7   DG  D "O3'" 1 
ATOM   4667 C  "C2'" A DG  D 3 7   ? -31.678 23.624 -2.505  0.50 16.49  ? 7   DG  D "C2'" 1 
ATOM   4668 C  "C2'" B DG  D 3 7   ? -19.142 20.889 5.740   0.50 13.13  ? 7   DG  D "C2'" 1 
ATOM   4669 C  "C1'" A DG  D 3 7   ? -30.483 24.355 -1.898  0.50 17.81  ? 7   DG  D "C1'" 1 
ATOM   4670 C  "C1'" B DG  D 3 7   ? -20.072 20.119 4.807   0.50 13.97  ? 7   DG  D "C1'" 1 
ATOM   4671 N  N9    A DG  D 3 7   ? -30.296 24.062 -0.492  0.50 16.51  ? 7   DG  D N9    1 
ATOM   4672 N  N9    B DG  D 3 7   ? -21.498 20.255 5.117   0.50 14.09  ? 7   DG  D N9    1 
ATOM   4673 C  C8    A DG  D 3 7   ? -31.282 23.765 0.412   0.50 19.69  ? 7   DG  D C8    1 
ATOM   4674 C  C8    B DG  D 3 7   ? -22.057 20.301 6.364   0.50 15.95  ? 7   DG  D C8    1 
ATOM   4675 N  N7    A DG  D 3 7   ? -30.842 23.573 1.620   0.50 22.18  ? 7   DG  D N7    1 
ATOM   4676 N  N7    B DG  D 3 7   ? -23.358 20.372 6.356   0.50 13.39  ? 7   DG  D N7    1 
ATOM   4677 C  C5    A DG  D 3 7   ? -29.478 23.765 1.518   0.50 17.43  ? 7   DG  D C5    1 
ATOM   4678 C  C5    B DG  D 3 7   ? -23.693 20.357 5.018   0.50 12.62  ? 7   DG  D C5    1 
ATOM   4679 C  C6    A DG  D 3 7   ? -28.487 23.687 2.514   0.50 18.87  ? 7   DG  D C6    1 
ATOM   4680 C  C6    B DG  D 3 7   ? -24.968 20.414 4.407   0.50 17.82  ? 7   DG  D C6    1 
ATOM   4681 O  O6    A DG  D 3 7   ? -28.635 23.420 3.711   0.50 20.84  ? 7   DG  D O6    1 
ATOM   4682 O  O6    B DG  D 3 7   ? -26.079 20.495 4.950   0.50 20.59  ? 7   DG  D O6    1 
ATOM   4683 N  N1    A DG  D 3 7   ? -27.215 23.951 2.004   0.50 23.42  ? 7   DG  D N1    1 
ATOM   4684 N  N1    B DG  D 3 7   ? -24.878 20.380 3.023   0.50 19.37  ? 7   DG  D N1    1 
ATOM   4685 C  C2    A DG  D 3 7   ? -26.944 24.256 0.685   0.50 25.62  ? 7   DG  D C2    1 
ATOM   4686 C  C2    B DG  D 3 7   ? -23.707 20.293 2.318   0.50 18.08  ? 7   DG  D C2    1 
ATOM   4687 N  N2    A DG  D 3 7   ? -25.649 24.477 0.386   0.50 20.23  ? 7   DG  D N2    1 
ATOM   4688 N  N2    B DG  D 3 7   ? -23.840 20.268 0.987   0.50 22.23  ? 7   DG  D N2    1 
ATOM   4689 N  N3    A DG  D 3 7   ? -27.881 24.334 -0.273  0.50 19.62  ? 7   DG  D N3    1 
ATOM   4690 N  N3    B DG  D 3 7   ? -22.491 20.237 2.877   0.50 12.76  ? 7   DG  D N3    1 
ATOM   4691 C  C4    A DG  D 3 7   ? -29.119 24.076 0.221   0.50 16.81  ? 7   DG  D C4    1 
ATOM   4692 C  C4    B DG  D 3 7   ? -22.563 20.276 4.230   0.50 11.07  ? 7   DG  D C4    1 
ATOM   4693 P  P     A DG  D 3 8   ? -31.785 25.287 -6.098  0.50 16.65  ? 8   DG  D P     1 
ATOM   4694 P  P     B DG  D 3 8   ? -15.531 19.741 4.420   0.50 20.55  ? 8   DG  D P     1 
ATOM   4695 O  OP1   A DG  D 3 8   ? -30.492 25.617 -6.727  0.50 26.10  ? 8   DG  D OP1   1 
ATOM   4696 O  OP1   B DG  D 3 8   ? -15.297 19.654 2.964   0.50 20.19  ? 8   DG  D OP1   1 
ATOM   4697 O  OP2   A DG  D 3 8   ? -32.740 26.376 -5.787  0.50 19.94  ? 8   DG  D OP2   1 
ATOM   4698 O  OP2   B DG  D 3 8   ? -15.406 18.519 5.244   0.50 18.46  ? 8   DG  D OP2   1 
ATOM   4699 O  "O5'" A DG  D 3 8   ? -32.522 24.210 -7.025  0.50 17.73  ? 8   DG  D "O5'" 1 
ATOM   4700 O  "O5'" B DG  D 3 8   ? -14.501 20.823 4.968   0.50 11.22  ? 8   DG  D "O5'" 1 
ATOM   4701 C  "C5'" A DG  D 3 8   ? -33.718 23.580 -6.586  0.50 17.66  ? 8   DG  D "C5'" 1 
ATOM   4702 C  "C5'" B DG  D 3 8   ? -14.579 21.259 6.307   0.50 13.80  ? 8   DG  D "C5'" 1 
ATOM   4703 C  "C4'" A DG  D 3 8   ? -33.654 22.080 -6.821  0.50 21.45  ? 8   DG  D "C4'" 1 
ATOM   4704 C  "C4'" B DG  D 3 8   ? -14.541 22.772 6.373   0.50 19.37  ? 8   DG  D "C4'" 1 
ATOM   4705 O  "O4'" A DG  D 3 8   ? -33.385 21.821 -8.222  0.50 20.43  ? 8   DG  D "O4'" 1 
ATOM   4706 O  "O4'" B DG  D 3 8   ? -13.392 23.249 5.633   0.50 20.62  ? 8   DG  D "O4'" 1 
ATOM   4707 C  "C3'" A DG  D 3 8   ? -32.562 21.352 -6.044  0.50 19.13  ? 8   DG  D "C3'" 1 
ATOM   4708 C  "C3'" B DG  D 3 8   ? -15.750 23.472 5.762   0.50 16.93  ? 8   DG  D "C3'" 1 
ATOM   4709 O  "O3'" A DG  D 3 8   ? -32.999 20.047 -5.684  0.50 26.82  ? 8   DG  D "O3'" 1 
ATOM   4710 O  "O3'" B DG  D 3 8   ? -16.036 24.663 6.466   0.50 15.05  ? 8   DG  D "O3'" 1 
ATOM   4711 C  "C2'" A DG  D 3 8   ? -31.414 21.299 -7.034  0.50 13.19  ? 8   DG  D "C2'" 1 
ATOM   4712 C  "C2'" B DG  D 3 8   ? -15.295 23.764 4.345   0.50 14.25  ? 8   DG  D "C2'" 1 
ATOM   4713 C  "C1'" A DG  D 3 8   ? -32.147 21.149 -8.363  0.50 23.71  ? 8   DG  D "C1'" 1 
ATOM   4714 C  "C1'" B DG  D 3 8   ? -13.814 24.049 4.551   0.50 17.34  ? 8   DG  D "C1'" 1 
ATOM   4715 N  N9    A DG  D 3 8   ? -31.415 21.746 -9.480  0.50 18.83  ? 8   DG  D N9    1 
ATOM   4716 N  N9    B DG  D 3 8   ? -13.011 23.708 3.392   0.50 16.88  ? 8   DG  D N9    1 
ATOM   4717 C  C8    A DG  D 3 8   ? -31.305 23.079 -9.764  0.50 13.84  ? 8   DG  D C8    1 
ATOM   4718 C  C8    B DG  D 3 8   ? -12.712 22.449 2.935   0.50 22.42  ? 8   DG  D C8    1 
ATOM   4719 N  N7    A DG  D 3 8   ? -30.575 23.327 -10.811 0.50 18.64  ? 8   DG  D N7    1 
ATOM   4720 N  N7    B DG  D 3 8   ? -11.984 22.447 1.854   0.50 22.15  ? 8   DG  D N7    1 
ATOM   4721 C  C5    A DG  D 3 8   ? -30.165 22.075 -11.249 0.50 16.95  ? 8   DG  D C5    1 
ATOM   4722 C  C5    B DG  D 3 8   ? -11.793 23.793 1.576   0.50 17.59  ? 8   DG  D C5    1 
ATOM   4723 C  C6    A DG  D 3 8   ? -29.350 21.716 -12.349 0.50 18.75  ? 8   DG  D C6    1 
ATOM   4724 C  C6    B DG  D 3 8   ? -11.080 24.411 0.527   0.50 21.55  ? 8   DG  D C6    1 
ATOM   4725 O  O6    A DG  D 3 8   ? -28.809 22.460 -13.178 0.50 22.18  ? 8   DG  D O6    1 
ATOM   4726 O  O6    B DG  D 3 8   ? -10.452 23.872 -0.403  0.50 23.92  ? 8   DG  D O6    1 
ATOM   4727 N  N1    A DG  D 3 8   ? -29.180 20.340 -12.440 0.50 16.53  ? 8   DG  D N1    1 
ATOM   4728 N  N1    B DG  D 3 8   ? -11.133 25.803 0.622   0.50 26.89  ? 8   DG  D N1    1 
ATOM   4729 C  C2    A DG  D 3 8   ? -29.727 19.425 -11.582 0.50 16.10  ? 8   DG  D C2    1 
ATOM   4730 C  C2    B DG  D 3 8   ? -11.794 26.502 1.603   0.50 18.42  ? 8   DG  D C2    1 
ATOM   4731 N  N2    A DG  D 3 8   ? -29.452 18.140 -11.835 0.50 14.28  ? 8   DG  D N2    1 
ATOM   4732 N  N2    B DG  D 3 8   ? -11.732 27.835 1.524   0.50 14.28  ? 8   DG  D N2    1 
ATOM   4733 N  N3    A DG  D 3 8   ? -30.493 19.746 -10.545 0.50 19.57  ? 8   DG  D N3    1 
ATOM   4734 N  N3    B DG  D 3 8   ? -12.471 25.933 2.591   0.50 17.66  ? 8   DG  D N3    1 
ATOM   4735 C  C4    A DG  D 3 8   ? -30.667 21.089 -10.440 0.50 17.86  ? 8   DG  D C4    1 
ATOM   4736 C  C4    B DG  D 3 8   ? -12.425 24.581 2.513   0.50 18.01  ? 8   DG  D C4    1 
ATOM   4737 P  P     A DC  D 3 9   ? -33.253 19.689 -4.138  0.50 19.52  ? 9   DC  D P     1 
ATOM   4738 P  P     B DC  D 3 9   ? -17.474 24.829 7.151   0.50 19.92  ? 9   DC  D P     1 
ATOM   4739 O  OP1   A DC  D 3 9   ? -33.228 18.221 -3.960  0.50 17.31  ? 9   DC  D OP1   1 
ATOM   4740 O  OP1   B DC  D 3 9   ? -17.735 26.271 7.342   0.50 18.98  ? 9   DC  D OP1   1 
ATOM   4741 O  OP2   A DC  D 3 9   ? -34.433 20.479 -3.728  0.50 23.56  ? 9   DC  D OP2   1 
ATOM   4742 O  OP2   B DC  D 3 9   ? -17.495 23.894 8.293   0.50 20.48  ? 9   DC  D OP2   1 
ATOM   4743 O  "O5'" A DC  D 3 9   ? -31.951 20.245 -3.405  0.50 16.74  ? 9   DC  D "O5'" 1 
ATOM   4744 O  "O5'" B DC  D 3 9   ? -18.479 24.238 6.058   0.50 17.35  ? 9   DC  D "O5'" 1 
ATOM   4745 C  "C5'" A DC  D 3 9   ? -30.760 19.478 -3.443  0.50 17.68  ? 9   DC  D "C5'" 1 
ATOM   4746 C  "C5'" B DC  D 3 9   ? -19.052 25.093 5.103   0.50 17.77  ? 9   DC  D "C5'" 1 
ATOM   4747 C  "C4'" A DC  D 3 9   ? -29.560 20.348 -3.756  0.50 17.26  ? 9   DC  D "C4'" 1 
ATOM   4748 C  "C4'" B DC  D 3 9   ? -19.064 24.458 3.728   0.50 11.61  ? 9   DC  D "C4'" 1 
ATOM   4749 O  "O4'" A DC  D 3 9   ? -29.387 21.314 -2.693  0.50 17.51  ? 9   DC  D "O4'" 1 
ATOM   4750 O  "O4'" B DC  D 3 9   ? -20.006 23.367 3.717   0.50 14.57  ? 9   DC  D "O4'" 1 
ATOM   4751 C  "C3'" A DC  D 3 9   ? -28.249 19.583 -3.886  0.50 18.10  ? 9   DC  D "C3'" 1 
ATOM   4752 C  "C3'" B DC  D 3 9   ? -19.475 25.414 2.617   0.50 12.83  ? 9   DC  D "C3'" 1 
ATOM   4753 O  "O3'" A DC  D 3 9   ? -27.931 19.419 -5.261  0.50 18.35  ? 9   DC  D "O3'" 1 
ATOM   4754 O  "O3'" B DC  D 3 9   ? -18.330 25.779 1.866   0.50 15.90  ? 9   DC  D "O3'" 1 
ATOM   4755 C  "C2'" A DC  D 3 9   ? -27.215 20.465 -3.183  0.50 17.91  ? 9   DC  D "C2'" 1 
ATOM   4756 C  "C2'" B DC  D 3 9   ? -20.461 24.628 1.756   0.50 11.68  ? 9   DC  D "C2'" 1 
ATOM   4757 C  "C1'" A DC  D 3 9   ? -28.050 21.331 -2.239  0.50 17.84  ? 9   DC  D "C1'" 1 
ATOM   4758 C  "C1'" B DC  D 3 9   ? -20.935 23.500 2.655   0.50 12.87  ? 9   DC  D "C1'" 1 
ATOM   4759 N  N1    A DC  D 3 9   ? -28.029 20.920 -0.782  0.50 15.08  ? 9   DC  D N1    1 
ATOM   4760 N  N1    B DC  D 3 9   ? -22.320 23.692 3.231   0.50 13.57  ? 9   DC  D N1    1 
ATOM   4761 C  C2    A DC  D 3 9   ? -26.808 20.845 -0.082  0.50 13.84  ? 9   DC  D C2    1 
ATOM   4762 C  C2    B DC  D 3 9   ? -23.434 23.814 2.380   0.50 14.52  ? 9   DC  D C2    1 
ATOM   4763 O  O2    A DC  D 3 9   ? -25.753 21.078 -0.674  0.50 17.25  ? 9   DC  D O2    1 
ATOM   4764 O  O2    B DC  D 3 9   ? -23.276 23.783 1.159   0.50 16.58  ? 9   DC  D O2    1 
ATOM   4765 N  N3    A DC  D 3 9   ? -26.820 20.505 1.230   0.50 11.84  ? 9   DC  D N3    1 
ATOM   4766 N  N3    B DC  D 3 9   ? -24.662 23.968 2.924   0.50 13.56  ? 9   DC  D N3    1 
ATOM   4767 C  C4    A DC  D 3 9   ? -27.984 20.257 1.844   0.50 21.97  ? 9   DC  D C4    1 
ATOM   4768 C  C4    B DC  D 3 9   ? -24.806 23.994 4.242   0.50 13.33  ? 9   DC  D C4    1 
ATOM   4769 N  N4    A DC  D 3 9   ? -27.946 19.925 3.142   0.50 16.70  ? 9   DC  D N4    1 
ATOM   4770 N  N4    B DC  D 3 9   ? -26.036 24.145 4.725   0.50 14.56  ? 9   DC  D N4    1 
ATOM   4771 C  C5    A DC  D 3 9   ? -29.241 20.340 1.154   0.50 17.15  ? 9   DC  D C5    1 
ATOM   4772 C  C5    B DC  D 3 9   ? -23.694 23.867 5.128   0.50 12.28  ? 9   DC  D C5    1 
ATOM   4773 C  C6    A DC  D 3 9   ? -29.214 20.674 -0.140  0.50 14.33  ? 9   DC  D C6    1 
ATOM   4774 C  C6    B DC  D 3 9   ? -22.485 23.712 4.585   0.50 12.79  ? 9   DC  D C6    1 
ATOM   4775 P  P     A DC  D 3 10  ? -27.513 17.980 -5.839  0.50 17.40  ? 10  DC  D P     1 
ATOM   4776 P  P     B DC  D 3 10  ? -17.961 27.323 1.645   0.50 14.96  ? 10  DC  D P     1 
ATOM   4777 O  OP1   A DC  D 3 10  ? -27.236 18.104 -7.291  0.50 20.53  ? 10  DC  D OP1   1 
ATOM   4778 O  OP1   B DC  D 3 10  ? -16.556 27.401 1.180   0.50 11.11  ? 10  DC  D OP1   1 
ATOM   4779 O  OP2   A DC  D 3 10  ? -28.496 17.004 -5.348  0.50 9.17   ? 10  DC  D OP2   1 
ATOM   4780 O  OP2   B DC  D 3 10  ? -18.403 28.024 2.864   0.50 14.50  ? 10  DC  D OP2   1 
ATOM   4781 O  "O5'" A DC  D 3 10  ? -26.103 17.697 -5.173  0.50 13.70  ? 10  DC  D "O5'" 1 
ATOM   4782 O  "O5'" B DC  D 3 10  ? -18.946 27.815 0.487   0.50 13.66  ? 10  DC  D "O5'" 1 
ATOM   4783 C  "C5'" A DC  D 3 10  ? -24.991 18.439 -5.582  0.50 12.49  ? 10  DC  D "C5'" 1 
ATOM   4784 C  "C5'" B DC  D 3 10  ? -19.228 26.992 -0.627  0.50 11.79  ? 10  DC  D "C5'" 1 
ATOM   4785 C  "C4'" A DC  D 3 10  ? -23.789 18.043 -4.769  0.50 17.43  ? 10  DC  D "C4'" 1 
ATOM   4786 C  "C4'" B DC  D 3 10  ? -20.439 27.520 -1.370  0.50 14.03  ? 10  DC  D "C4'" 1 
ATOM   4787 O  "O4'" A DC  D 3 10  ? -24.049 18.321 -3.361  0.50 29.29  ? 10  DC  D "O4'" 1 
ATOM   4788 O  "O4'" B DC  D 3 10  ? -21.653 27.045 -0.730  0.50 14.34  ? 10  DC  D "O4'" 1 
ATOM   4789 C  "C3'" A DC  D 3 10  ? -23.441 16.570 -4.862  0.50 14.62  ? 10  DC  D "C3'" 1 
ATOM   4790 C  "C3'" B DC  D 3 10  ? -20.534 29.039 -1.416  0.50 11.59  ? 10  DC  D "C3'" 1 
ATOM   4791 O  "O3'" A DC  D 3 10  ? -22.047 16.423 -5.001  0.50 24.96  ? 10  DC  D "O3'" 1 
ATOM   4792 O  "O3'" B DC  D 3 10  ? -20.865 29.467 -2.722  0.50 16.60  ? 10  DC  D "O3'" 1 
ATOM   4793 C  "C2'" A DC  D 3 10  ? -23.949 15.993 -3.539  0.50 20.59  ? 10  DC  D "C2'" 1 
ATOM   4794 C  "C2'" B DC  D 3 10  ? -21.633 29.374 -0.411  0.50 13.29  ? 10  DC  D "C2'" 1 
ATOM   4795 C  "C1'" A DC  D 3 10  ? -23.803 17.175 -2.584  0.50 17.81  ? 10  DC  D "C1'" 1 
ATOM   4796 C  "C1'" B DC  D 3 10  ? -22.499 28.124 -0.410  0.50 12.46  ? 10  DC  D "C1'" 1 
ATOM   4797 N  N1    A DC  D 3 10  ? -24.786 17.153 -1.430  0.50 11.69  ? 10  DC  D N1    1 
ATOM   4798 N  N1    B DC  D 3 10  ? -23.123 27.851 0.923   0.50 16.00  ? 10  DC  D N1    1 
ATOM   4799 C  C2    A DC  D 3 10  ? -24.313 17.093 -0.098  0.50 14.04  ? 10  DC  D C2    1 
ATOM   4800 C  C2    B DC  D 3 10  ? -24.521 27.780 1.038   0.50 17.91  ? 10  DC  D C2    1 
ATOM   4801 O  O2    A DC  D 3 10  ? -23.102 17.068 0.112   0.50 17.17  ? 10  DC  D O2    1 
ATOM   4802 O  O2    B DC  D 3 10  ? -25.217 27.939 0.030   0.50 22.00  ? 10  DC  D O2    1 
ATOM   4803 N  N3    A DC  D 3 10  ? -25.205 17.065 0.923   0.50 10.00  ? 10  DC  D N3    1 
ATOM   4804 N  N3    B DC  D 3 10  ? -25.071 27.534 2.257   0.50 14.60  ? 10  DC  D N3    1 
ATOM   4805 C  C4    A DC  D 3 10  ? -26.512 17.089 0.660   0.50 15.37  ? 10  DC  D C4    1 
ATOM   4806 C  C4    B DC  D 3 10  ? -24.283 27.375 3.325   0.50 17.69  ? 10  DC  D C4    1 
ATOM   4807 N  N4    A DC  D 3 10  ? -27.354 17.060 1.694   0.50 12.13  ? 10  DC  D N4    1 
ATOM   4808 N  N4    B DC  D 3 10  ? -24.872 27.143 4.497   0.50 19.11  ? 10  DC  D N4    1 
ATOM   4809 C  C5    A DC  D 3 10  ? -27.018 17.144 -0.686  0.50 12.93  ? 10  DC  D C5    1 
ATOM   4810 C  C5    B DC  D 3 10  ? -22.854 27.448 3.235   0.50 15.18  ? 10  DC  D C5    1 
ATOM   4811 C  C6    A DC  D 3 10  ? -26.127 17.176 -1.686  0.50 9.84   ? 10  DC  D C6    1 
ATOM   4812 C  C6    B DC  D 3 10  ? -22.324 27.686 2.028   0.50 17.44  ? 10  DC  D C6    1 
ATOM   4813 P  P     A DT  D 3 11  ? -21.439 15.008 -5.451  0.50 31.32  ? 11  DT  D P     1 
ATOM   4814 P  P     B DT  D 3 11  ? -20.757 31.020 -3.123  0.50 22.55  ? 11  DT  D P     1 
ATOM   4815 O  OP1   A DT  D 3 11  ? -20.201 15.238 -6.224  0.50 24.09  ? 11  DT  D OP1   1 
ATOM   4816 O  OP1   B DT  D 3 11  ? -20.502 31.071 -4.578  0.50 13.40  ? 11  DT  D OP1   1 
ATOM   4817 O  OP2   A DT  D 3 11  ? -22.566 14.208 -5.999  0.50 27.52  ? 11  DT  D OP2   1 
ATOM   4818 O  OP2   B DT  D 3 11  ? -19.834 31.711 -2.184  0.50 11.12  ? 11  DT  D OP2   1 
ATOM   4819 O  "O5'" A DT  D 3 11  ? -21.005 14.345 -4.086  0.50 23.34  ? 11  DT  D "O5'" 1 
ATOM   4820 O  "O5'" B DT  D 3 11  ? -22.237 31.556 -2.877  0.50 17.55  ? 11  DT  D "O5'" 1 
ATOM   4821 C  "C5'" A DT  D 3 11  ? -20.287 15.095 -3.150  0.50 27.27  ? 11  DT  D "C5'" 1 
ATOM   4822 C  "C5'" B DT  D 3 11  ? -23.296 30.933 -3.546  0.50 21.64  ? 11  DT  D "C5'" 1 
ATOM   4823 C  "C4'" A DT  D 3 11  ? -20.275 14.365 -1.835  0.50 27.73  ? 11  DT  D "C4'" 1 
ATOM   4824 C  "C4'" B DT  D 3 11  ? -24.629 31.328 -2.952  0.50 23.72  ? 11  DT  D "C4'" 1 
ATOM   4825 O  "O4'" A DT  D 3 11  ? -21.514 14.616 -1.144  0.50 24.20  ? 11  DT  D "O4'" 1 
ATOM   4826 O  "O4'" B DT  D 3 11  ? -24.742 30.824 -1.614  0.50 28.69  ? 11  DT  D "O4'" 1 
ATOM   4827 C  "C3'" A DT  D 3 11  ? -20.173 12.845 -1.971  0.50 24.55  ? 11  DT  D "C3'" 1 
ATOM   4828 C  "C3'" B DT  D 3 11  ? -24.890 32.831 -2.860  0.50 23.49  ? 11  DT  D "C3'" 1 
ATOM   4829 O  "O3'" A DT  D 3 11  ? -19.053 12.377 -1.266  0.50 24.98  ? 11  DT  D "O3'" 1 
ATOM   4830 O  "O3'" B DT  D 3 11  ? -26.010 33.142 -3.666  0.50 35.58  ? 11  DT  D "O3'" 1 
ATOM   4831 C  "C2'" A DT  D 3 11  ? -21.483 12.323 -1.370  0.50 25.32  ? 11  DT  D "C2'" 1 
ATOM   4832 C  "C2'" B DT  D 3 11  ? -25.183 33.067 -1.368  0.50 23.52  ? 11  DT  D "C2'" 1 
ATOM   4833 C  "C1'" A DT  D 3 11  ? -21.873 13.459 -0.450  0.50 21.46  ? 11  DT  D "C1'" 1 
ATOM   4834 C  "C1'" B DT  D 3 11  ? -25.595 31.679 -0.919  0.50 27.33  ? 11  DT  D "C1'" 1 
ATOM   4835 N  N1    A DT  D 3 11  ? -23.321 13.522 -0.161  0.50 16.53  ? 11  DT  D N1    1 
ATOM   4836 N  N1    B DT  D 3 11  ? -25.431 31.424 0.533   0.50 18.49  ? 11  DT  D N1    1 
ATOM   4837 C  C2    A DT  D 3 11  ? -23.740 13.579 1.147   0.50 15.76  ? 11  DT  D C2    1 
ATOM   4838 C  C2    B DT  D 3 11  ? -26.549 31.256 1.308   0.50 17.92  ? 11  DT  D C2    1 
ATOM   4839 O  O2    A DT  D 3 11  ? -22.972 13.575 2.090   0.50 13.87  ? 11  DT  D O2    1 
ATOM   4840 O  O2    B DT  D 3 11  ? -27.686 31.323 0.865   0.50 17.93  ? 11  DT  D O2    1 
ATOM   4841 N  N3    A DT  D 3 11  ? -25.098 13.639 1.311   0.50 12.82  ? 11  DT  D N3    1 
ATOM   4842 N  N3    B DT  D 3 11  ? -26.294 31.017 2.628   0.50 17.38  ? 11  DT  D N3    1 
ATOM   4843 C  C4    A DT  D 3 11  ? -26.055 13.642 0.312   0.50 13.77  ? 11  DT  D C4    1 
ATOM   4844 C  C4    B DT  D 3 11  ? -25.059 30.921 3.236   0.50 18.21  ? 11  DT  D C4    1 
ATOM   4845 O  O4    A DT  D 3 11  ? -27.258 13.699 0.552   0.50 13.68  ? 11  DT  D O4    1 
ATOM   4846 O  O4    B DT  D 3 11  ? -24.933 30.701 4.435   0.50 17.13  ? 11  DT  D O4    1 
ATOM   4847 C  C5    A DT  D 3 11  ? -25.541 13.576 -1.037  0.50 12.95  ? 11  DT  D C5    1 
ATOM   4848 C  C5    B DT  D 3 11  ? -23.927 31.102 2.361   0.50 16.94  ? 11  DT  D C5    1 
ATOM   4849 C  C7    A DT  D 3 11  ? -26.485 13.578 -2.202  0.50 16.37  ? 11  DT  D C7    1 
ATOM   4850 C  C7    B DT  D 3 11  ? -22.530 31.022 2.905   0.50 17.40  ? 11  DT  D C7    1 
ATOM   4851 C  C6    A DT  D 3 11  ? -24.216 13.522 -1.206  0.50 11.60  ? 11  DT  D C6    1 
ATOM   4852 C  C6    B DT  D 3 11  ? -24.168 31.339 1.066   0.50 15.02  ? 11  DT  D C6    1 
ATOM   4853 P  P     A DA  D 3 12  ? -18.563 10.863 -1.458  0.50 42.48  ? 12  DA  D P     1 
ATOM   4854 P  P     B DA  D 3 12  ? -26.289 34.647 -4.140  0.50 32.25  ? 12  DA  D P     1 
ATOM   4855 O  OP1   A DA  D 3 12  ? -17.132 10.935 -1.841  0.50 33.52  ? 12  DA  D OP1   1 
ATOM   4856 O  OP1   B DA  D 3 12  ? -26.551 34.590 -5.595  0.50 29.37  ? 12  DA  D OP1   1 
ATOM   4857 O  OP2   A DA  D 3 12  ? -19.560 10.138 -2.288  0.50 34.22  ? 12  DA  D OP2   1 
ATOM   4858 O  OP2   B DA  D 3 12  ? -25.217 35.510 -3.592  0.50 26.62  ? 12  DA  D OP2   1 
ATOM   4859 O  "O5'" A DA  D 3 12  ? -18.700 10.238 -0.001  0.50 33.01  ? 12  DA  D "O5'" 1 
ATOM   4860 O  "O5'" B DA  D 3 12  ? -27.639 35.022 -3.378  0.50 30.58  ? 12  DA  D "O5'" 1 
ATOM   4861 C  "C5'" A DA  D 3 12  ? -18.244 10.966 1.117   0.50 33.92  ? 12  DA  D "C5'" 1 
ATOM   4862 C  "C5'" B DA  D 3 12  ? -28.658 34.047 -3.243  0.50 28.45  ? 12  DA  D "C5'" 1 
ATOM   4863 C  "C4'" A DA  D 3 12  ? -18.845 10.415 2.391   0.50 29.29  ? 12  DA  D "C4'" 1 
ATOM   4864 C  "C4'" B DA  D 3 12  ? -29.664 34.458 -2.184  0.50 28.06  ? 12  DA  D "C4'" 1 
ATOM   4865 O  "O4'" A DA  D 3 12  ? -20.245 10.788 2.479   0.50 40.66  ? 12  DA  D "O4'" 1 
ATOM   4866 O  "O4'" B DA  D 3 12  ? -29.229 34.000 -0.877  0.50 36.17  ? 12  DA  D "O4'" 1 
ATOM   4867 C  "C3'" A DA  D 3 12  ? -18.812 8.896  2.518   0.50 35.86  ? 12  DA  D "C3'" 1 
ATOM   4868 C  "C3'" B DA  D 3 12  ? -29.880 35.962 -2.039  0.50 35.89  ? 12  DA  D "C3'" 1 
ATOM   4869 O  "O3'" A DA  D 3 12  ? -18.468 8.560  3.837   0.50 49.17  ? 12  DA  D "O3'" 1 
ATOM   4870 O  "O3'" B DA  D 3 12  ? -31.248 36.201 -1.767  0.50 35.24  ? 12  DA  D "O3'" 1 
ATOM   4871 C  "C2'" A DA  D 3 12  ? -20.253 8.490  2.205   0.50 30.36  ? 12  DA  D "C2'" 1 
ATOM   4872 C  "C2'" B DA  D 3 12  ? -29.007 36.306 -0.834  0.50 26.99  ? 12  DA  D "C2'" 1 
ATOM   4873 C  "C1'" A DA  D 3 12  ? -21.000 9.654  2.821   0.50 27.63  ? 12  DA  D "C1'" 1 
ATOM   4874 C  "C1'" B DA  D 3 12  ? -29.268 35.087 0.021   0.50 30.99  ? 12  DA  D "C1'" 1 
ATOM   4875 N  N9    A DA  D 3 12  ? -22.347 9.829  2.309   0.50 18.53  ? 12  DA  D N9    1 
ATOM   4876 N  N9    B DA  D 3 12  ? -28.280 34.862 1.057   0.50 26.07  ? 12  DA  D N9    1 
ATOM   4877 C  C8    A DA  D 3 12  ? -22.733 9.881  1.004   0.50 17.69  ? 12  DA  D C8    1 
ATOM   4878 C  C8    B DA  D 3 12  ? -26.932 35.023 0.959   0.50 24.22  ? 12  DA  D C8    1 
ATOM   4879 N  N7    A DA  D 3 12  ? -24.024 10.051 0.842   0.50 17.86  ? 12  DA  D N7    1 
ATOM   4880 N  N7    B DA  D 3 12  ? -26.287 34.731 2.061   0.50 21.73  ? 12  DA  D N7    1 
ATOM   4881 C  C5    A DA  D 3 12  ? -24.513 10.124 2.133   0.50 17.22  ? 12  DA  D C5    1 
ATOM   4882 C  C5    B DA  D 3 12  ? -27.283 34.340 2.935   0.50 19.82  ? 12  DA  D C5    1 
ATOM   4883 C  C6    A DA  D 3 12  ? -25.814 10.301 2.651   0.50 15.87  ? 12  DA  D C6    1 
ATOM   4884 C  C6    B DA  D 3 12  ? -27.253 33.905 4.270   0.50 20.32  ? 12  DA  D C6    1 
ATOM   4885 N  N6    A DA  D 3 12  ? -26.905 10.443 1.884   0.50 14.06  ? 12  DA  D N6    1 
ATOM   4886 N  N6    B DA  D 3 12  ? -26.127 33.786 4.976   0.50 17.89  ? 12  DA  D N6    1 
ATOM   4887 N  N1    A DA  D 3 12  ? -25.953 10.321 3.991   0.50 15.54  ? 12  DA  D N1    1 
ATOM   4888 N  N1    B DA  D 3 12  ? -28.431 33.601 4.857   0.50 23.76  ? 12  DA  D N1    1 
ATOM   4889 C  C2    A DA  D 3 12  ? -24.863 10.179 4.757   0.50 21.78  ? 12  DA  D C2    1 
ATOM   4890 C  C2    B DA  D 3 12  ? -29.558 33.722 4.143   0.50 24.22  ? 12  DA  D C2    1 
ATOM   4891 N  N3    A DA  D 3 12  ? -23.593 10.012 4.388   0.50 25.49  ? 12  DA  D N3    1 
ATOM   4892 N  N3    B DA  D 3 12  ? -29.707 34.116 2.879   0.50 25.39  ? 12  DA  D N3    1 
ATOM   4893 C  C4    A DA  D 3 12  ? -23.489 9.991  3.049   0.50 21.29  ? 12  DA  D C4    1 
ATOM   4894 C  C4    B DA  D 3 12  ? -28.519 34.414 2.330   0.50 23.50  ? 12  DA  D C4    1 
ATOM   4895 P  P     A DG  D 3 13  ? -17.945 7.088  4.178   0.50 52.23  ? 13  DG  D P     1 
ATOM   4896 P  P     B DG  D 3 13  ? -31.871 37.670 -1.921  0.50 62.10  ? 13  DG  D P     1 
ATOM   4897 O  OP1   A DG  D 3 13  ? -16.730 7.280  5.008   0.50 32.10  ? 13  DG  D OP1   1 
ATOM   4898 O  OP1   B DG  D 3 13  ? -32.950 37.505 -2.921  0.50 36.92  ? 13  DG  D OP1   1 
ATOM   4899 O  OP2   A DG  D 3 13  ? -17.958 6.304  2.909   0.50 21.59  ? 13  DG  D OP2   1 
ATOM   4900 O  OP2   B DG  D 3 13  ? -30.785 38.673 -2.080  0.50 29.30  ? 13  DG  D OP2   1 
ATOM   4901 O  "O5'" A DG  D 3 13  ? -19.087 6.492  5.117   0.50 40.79  ? 13  DG  D "O5'" 1 
ATOM   4902 O  "O5'" B DG  D 3 13  ? -32.509 37.965 -0.486  0.50 52.38  ? 13  DG  D "O5'" 1 
ATOM   4903 C  "C5'" A DG  D 3 13  ? -19.509 7.218  6.249   0.50 32.15  ? 13  DG  D "C5'" 1 
ATOM   4904 C  "C5'" B DG  D 3 13  ? -33.321 36.985 0.161   0.50 45.45  ? 13  DG  D "C5'" 1 
ATOM   4905 C  "C4'" A DG  D 3 13  ? -20.736 6.577  6.853   0.50 31.61  ? 13  DG  D "C4'" 1 
ATOM   4906 C  "C4'" B DG  D 3 13  ? -33.507 37.331 1.629   0.50 42.86  ? 13  DG  D "C4'" 1 
ATOM   4907 O  "O4'" A DG  D 3 13  ? -21.926 7.027  6.152   0.50 38.94  ? 13  DG  D "O4'" 1 
ATOM   4908 O  "O4'" B DG  D 3 13  ? -32.308 36.973 2.372   0.50 47.63  ? 13  DG  D "O4'" 1 
ATOM   4909 C  "C3'" A DG  D 3 13  ? -20.757 5.051  6.784   0.50 41.21  ? 13  DG  D "C3'" 1 
ATOM   4910 C  "C3'" B DG  D 3 13  ? -33.743 38.815 1.913   0.50 64.95  ? 13  DG  D "C3'" 1 
ATOM   4911 O  "O3'" A DG  D 3 13  ? -21.231 4.546  8.018   0.50 55.88  ? 13  DG  D "O3'" 1 
ATOM   4912 O  "O3'" B DG  D 3 13  ? -34.679 38.955 2.982   0.50 65.83  ? 13  DG  D "O3'" 1 
ATOM   4913 C  "C2'" A DG  D 3 13  ? -21.737 4.766  5.640   0.50 33.60  ? 13  DG  D "C2'" 1 
ATOM   4914 C  "C2'" B DG  D 3 13  ? -32.349 39.308 2.310   0.50 51.09  ? 13  DG  D "C2'" 1 
ATOM   4915 C  "C1'" A DG  D 3 13  ? -22.718 5.908  5.823   0.50 32.82  ? 13  DG  D "C1'" 1 
ATOM   4916 C  "C1'" B DG  D 3 13  ? -31.834 38.103 3.074   0.50 43.71  ? 13  DG  D "C1'" 1 
ATOM   4917 N  N9    A DG  D 3 13  ? -23.509 6.224  4.637   0.50 22.84  ? 13  DG  D N9    1 
ATOM   4918 N  N9    B DG  D 3 13  ? -30.379 38.036 3.170   0.50 35.43  ? 13  DG  D N9    1 
ATOM   4919 C  C8    A DG  D 3 13  ? -23.065 6.325  3.340   0.50 19.38  ? 13  DG  D C8    1 
ATOM   4920 C  C8    B DG  D 3 13  ? -29.461 38.421 2.225   0.50 40.70  ? 13  DG  D C8    1 
ATOM   4921 N  N7    A DG  D 3 13  ? -24.011 6.634  2.491   0.50 17.11  ? 13  DG  D N7    1 
ATOM   4922 N  N7    B DG  D 3 13  ? -28.221 38.242 2.602   0.50 33.31  ? 13  DG  D N7    1 
ATOM   4923 C  C5    A DG  D 3 13  ? -25.152 6.756  3.279   0.50 16.77  ? 13  DG  D C5    1 
ATOM   4924 C  C5    B DG  D 3 13  ? -28.328 37.710 3.877   0.50 29.51  ? 13  DG  D C5    1 
ATOM   4925 C  C6    A DG  D 3 13  ? -26.489 7.076  2.922   0.50 13.16  ? 13  DG  D C6    1 
ATOM   4926 C  C6    B DG  D 3 13  ? -27.320 37.317 4.788   0.50 30.93  ? 13  DG  D C6    1 
ATOM   4927 O  O6    A DG  D 3 13  ? -26.947 7.324  1.803   0.50 15.14  ? 13  DG  D O6    1 
ATOM   4928 O  O6    B DG  D 3 13  ? -26.089 37.363 4.638   0.50 36.12  ? 13  DG  D O6    1 
ATOM   4929 N  N1    A DG  D 3 13  ? -27.334 7.088  4.026   0.50 12.70  ? 13  DG  D N1    1 
ATOM   4930 N  N1    B DG  D 3 13  ? -27.863 36.826 5.977   0.50 26.81  ? 13  DG  D N1    1 
ATOM   4931 C  C2    A DG  D 3 13  ? -26.945 6.827  5.318   0.50 16.70  ? 13  DG  D C2    1 
ATOM   4932 C  C2    B DG  D 3 13  ? -29.214 36.731 6.244   0.50 31.09  ? 13  DG  D C2    1 
ATOM   4933 N  N2    A DG  D 3 13  ? -27.907 6.889  6.254   0.50 11.27  ? 13  DG  D N2    1 
ATOM   4934 N  N2    B DG  D 3 13  ? -29.553 36.237 7.442   0.50 26.43  ? 13  DG  D N2    1 
ATOM   4935 N  N3    A DG  D 3 13  ? -25.699 6.526  5.670   0.50 25.67  ? 13  DG  D N3    1 
ATOM   4936 N  N3    B DG  D 3 13  ? -30.165 37.098 5.398   0.50 32.07  ? 13  DG  D N3    1 
ATOM   4937 C  C4    A DG  D 3 13  ? -24.858 6.508  4.601   0.50 23.32  ? 13  DG  D C4    1 
ATOM   4938 C  C4    B DG  D 3 13  ? -29.651 37.577 4.240   0.50 32.46  ? 13  DG  D C4    1 
ATOM   4939 P  P     A DG  D 3 14  ? -20.869 3.057  8.494   0.50 49.87  ? 14  DG  D P     1 
ATOM   4940 P  P     B DG  D 3 14  ? -35.534 40.305 3.150   0.50 51.88  ? 14  DG  D P     1 
ATOM   4941 O  OP1   A DG  D 3 14  ? -20.014 3.198  9.702   0.50 32.67  ? 14  DG  D OP1   1 
ATOM   4942 O  OP1   B DG  D 3 14  ? -36.880 40.032 2.605   0.50 53.58  ? 14  DG  D OP1   1 
ATOM   4943 O  OP2   A DG  D 3 14  ? -20.422 2.285  7.306   0.50 27.64  ? 14  DG  D OP2   1 
ATOM   4944 O  OP2   B DG  D 3 14  ? -34.736 41.440 2.622   0.50 50.27  ? 14  DG  D OP2   1 
ATOM   4945 O  "O5'" A DG  D 3 14  ? -22.291 2.464  8.906   0.50 44.94  ? 14  DG  D "O5'" 1 
ATOM   4946 O  "O5'" B DG  D 3 14  ? -35.643 40.476 4.733   0.50 54.14  ? 14  DG  D "O5'" 1 
ATOM   4947 C  "C5'" A DG  D 3 14  ? -23.402 2.680  8.052   0.50 32.95  ? 14  DG  D "C5'" 1 
ATOM   4948 C  "C5'" B DG  D 3 14  ? -35.995 39.358 5.546   0.50 53.14  ? 14  DG  D "C5'" 1 
ATOM   4949 C  "C4'" A DG  D 3 14  ? -24.694 2.641  8.835   0.50 33.41  ? 14  DG  D "C4'" 1 
ATOM   4950 C  "C4'" B DG  D 3 14  ? -35.230 39.395 6.857   0.50 70.40  ? 14  DG  D "C4'" 1 
ATOM   4951 O  "O4'" A DG  D 3 14  ? -25.677 3.466  8.175   0.50 43.29  ? 14  DG  D "O4'" 1 
ATOM   4952 O  "O4'" B DG  D 3 14  ? -33.887 38.920 6.634   0.50 60.08  ? 14  DG  D "O4'" 1 
ATOM   4953 C  "C3'" A DG  D 3 14  ? -25.329 1.270  8.922   0.50 49.17  ? 14  DG  D "C3'" 1 
ATOM   4954 C  "C3'" B DG  D 3 14  ? -35.069 40.787 7.456   0.50 78.91  ? 14  DG  D "C3'" 1 
ATOM   4955 O  "O3'" A DG  D 3 14  ? -26.149 1.178  10.057  0.50 56.28  ? 14  DG  D "O3'" 1 
ATOM   4956 O  "O3'" B DG  D 3 14  ? -36.126 41.056 8.384   0.50 83.08  ? 14  DG  D "O3'" 1 
ATOM   4957 C  "C2'" A DG  D 3 14  ? -26.150 1.203  7.647   0.50 40.57  ? 14  DG  D "C2'" 1 
ATOM   4958 C  "C2'" B DG  D 3 14  ? -33.718 40.732 8.170   0.50 71.29  ? 14  DG  D "C2'" 1 
ATOM   4959 C  "C1'" A DG  D 3 14  ? -26.569 2.657  7.436   0.50 29.18  ? 14  DG  D "C1'" 1 
ATOM   4960 C  "C1'" B DG  D 3 14  ? -33.007 39.527 7.558   0.50 58.15  ? 14  DG  D "C1'" 1 
ATOM   4961 N  N9    A DG  D 3 14  ? -26.497 3.045  6.041   0.50 21.75  ? 14  DG  D N9    1 
ATOM   4962 N  N9    B DG  D 3 14  ? -31.771 39.885 6.873   0.50 46.40  ? 14  DG  D N9    1 
ATOM   4963 C  C8    A DG  D 3 14  ? -25.379 3.040  5.238   0.50 23.40  ? 14  DG  D C8    1 
ATOM   4964 C  C8    B DG  D 3 14  ? -31.640 40.407 5.609   0.50 47.79  ? 14  DG  D C8    1 
ATOM   4965 N  N7    A DG  D 3 14  ? -25.618 3.412  4.014   0.50 16.10  ? 14  DG  D N7    1 
ATOM   4966 N  N7    B DG  D 3 14  ? -30.401 40.626 5.262   0.50 44.51  ? 14  DG  D N7    1 
ATOM   4967 C  C5    A DG  D 3 14  ? -26.984 3.673  4.006   0.50 17.07  ? 14  DG  D C5    1 
ATOM   4968 C  C5    B DG  D 3 14  ? -29.663 40.234 6.373   0.50 42.07  ? 14  DG  D C5    1 
ATOM   4969 C  C6    A DG  D 3 14  ? -27.820 4.111  2.952   0.50 15.65  ? 14  DG  D C6    1 
ATOM   4970 C  C6    B DG  D 3 14  ? -28.262 40.240 6.588   0.50 39.75  ? 14  DG  D C6    1 
ATOM   4971 O  O6    A DG  D 3 14  ? -27.506 4.361  1.780   0.50 16.62  ? 14  DG  D O6    1 
ATOM   4972 O  O6    B DG  D 3 14  ? -27.365 40.607 5.811   0.50 43.94  ? 14  DG  D O6    1 
ATOM   4973 N  N1    A DG  D 3 14  ? -29.144 4.252  3.368   0.50 14.43  ? 14  DG  D N1    1 
ATOM   4974 N  N1    B DG  D 3 14  ? -27.933 39.756 7.856   0.50 36.40  ? 14  DG  D N1    1 
ATOM   4975 C  C2    A DG  D 3 14  ? -29.598 3.996  4.648   0.50 18.70  ? 14  DG  D C2    1 
ATOM   4976 C  C2    B DG  D 3 14  ? -28.844 39.320 8.794   0.50 35.62  ? 14  DG  D C2    1 
ATOM   4977 N  N2    A DG  D 3 14  ? -30.911 4.192  4.867   0.50 13.00  ? 14  DG  D N2    1 
ATOM   4978 N  N2    B DG  D 3 14  ? -28.337 38.891 9.959   0.50 22.05  ? 14  DG  D N2    1 
ATOM   4979 N  N3    A DG  D 3 14  ? -28.818 3.578  5.643   0.50 16.86  ? 14  DG  D N3    1 
ATOM   4980 N  N3    B DG  D 3 14  ? -30.160 39.307 8.603   0.50 35.60  ? 14  DG  D N3    1 
ATOM   4981 C  C4    A DG  D 3 14  ? -27.534 3.443  5.250   0.50 16.68  ? 14  DG  D C4    1 
ATOM   4982 C  C4    B DG  D 3 14  ? -30.495 39.777 7.374   0.50 43.23  ? 14  DG  D C4    1 
ATOM   4983 P  P     A DC  D 3 15  ? -26.502 -0.266 10.654  0.50 55.29  ? 15  DC  D P     1 
ATOM   4984 P  P     B DC  D 3 15  ? -36.482 42.573 8.780   0.50 79.79  ? 15  DC  D P     1 
ATOM   4985 O  OP1   A DC  D 3 15  ? -26.532 -0.110 12.132  0.50 25.14  ? 15  DC  D OP1   1 
ATOM   4986 O  OP1   B DC  D 3 15  ? -37.909 42.613 9.171   0.50 66.82  ? 15  DC  D OP1   1 
ATOM   4987 O  OP2   A DC  D 3 15  ? -25.594 -1.247 10.001  0.50 34.19  ? 15  DC  D OP2   1 
ATOM   4988 O  OP2   B DC  D 3 15  ? -35.989 43.436 7.679   0.50 81.82  ? 15  DC  D OP2   1 
ATOM   4989 O  "O5'" A DC  D 3 15  ? -27.957 -0.579 10.064  0.50 41.30  ? 15  DC  D "O5'" 1 
ATOM   4990 O  "O5'" B DC  D 3 15  ? -35.555 42.891 10.050  0.50 58.10  ? 15  DC  D "O5'" 1 
ATOM   4991 C  "C5'" A DC  D 3 15  ? -28.854 0.476  9.760   0.50 38.42  ? 15  DC  D "C5'" 1 
ATOM   4992 C  "C5'" B DC  D 3 15  ? -35.335 41.922 11.067  0.50 46.32  ? 15  DC  D "C5'" 1 
ATOM   4993 C  "C4'" A DC  D 3 15  ? -29.835 0.032  8.692   0.50 43.85  ? 15  DC  D "C4'" 1 
ATOM   4994 C  "C4'" B DC  D 3 15  ? -34.019 42.205 11.781  0.50 65.63  ? 15  DC  D "C4'" 1 
ATOM   4995 O  "O4'" A DC  D 3 15  ? -29.463 0.599  7.408   0.50 49.92  ? 15  DC  D "O4'" 1 
ATOM   4996 O  "O4'" B DC  D 3 15  ? -32.919 41.863 10.916  0.50 71.69  ? 15  DC  D "O4'" 1 
ATOM   4997 C  "C3'" A DC  D 3 15  ? -29.900 -1.486 8.481   0.50 44.81  ? 15  DC  D "C3'" 1 
ATOM   4998 C  "C3'" B DC  D 3 15  ? -33.784 43.670 12.134  0.50 72.96  ? 15  DC  D "C3'" 1 
ATOM   4999 O  "O3'" A DC  D 3 15  ? -31.219 -1.965 8.750   0.50 36.81  ? 15  DC  D "O3'" 1 
ATOM   5000 O  "O3'" B DC  D 3 15  ? -34.257 43.942 13.453  0.50 61.75  ? 15  DC  D "O3'" 1 
ATOM   5001 C  "C2'" A DC  D 3 15  ? -29.502 -1.680 7.002   0.50 44.59  ? 15  DC  D "C2'" 1 
ATOM   5002 C  "C2'" B DC  D 3 15  ? -32.254 43.846 12.031  0.50 64.41  ? 15  DC  D "C2'" 1 
ATOM   5003 C  "C1'" A DC  D 3 15  ? -29.822 -0.319 6.410   0.50 33.54  ? 15  DC  D "C1'" 1 
ATOM   5004 C  "C1'" B DC  D 3 15  ? -31.772 42.565 11.335  0.50 56.74  ? 15  DC  D "C1'" 1 
ATOM   5005 N  N1    A DC  D 3 15  ? -29.077 -0.002 5.140   0.50 26.48  ? 15  DC  D N1    1 
ATOM   5006 N  N1    B DC  D 3 15  ? -30.887 42.813 10.141  0.50 62.82  ? 15  DC  D N1    1 
ATOM   5007 C  C2    A DC  D 3 15  ? -29.783 0.520  4.044   0.50 24.45  ? 15  DC  D C2    1 
ATOM   5008 C  C2    B DC  D 3 15  ? -29.491 42.698 10.277  0.50 59.84  ? 15  DC  D C2    1 
ATOM   5009 O  O2    A DC  D 3 15  ? -31.007 0.710  4.147   0.50 20.82  ? 15  DC  D O2    1 
ATOM   5010 O  O2    B DC  D 3 15  ? -29.017 42.396 11.382  0.50 44.49  ? 15  DC  D O2    1 
ATOM   5011 N  N3    A DC  D 3 15  ? -29.112 0.798  2.896   0.50 15.88  ? 15  DC  D N3    1 
ATOM   5012 N  N3    B DC  D 3 15  ? -28.698 42.923 9.188   0.50 50.98  ? 15  DC  D N3    1 
ATOM   5013 C  C4    A DC  D 3 15  ? -27.801 0.574  2.820   0.50 20.82  ? 15  DC  D C4    1 
ATOM   5014 C  C4    B DC  D 3 15  ? -29.253 43.245 8.009   0.50 57.75  ? 15  DC  D C4    1 
ATOM   5015 N  N4    A DC  D 3 15  ? -27.186 0.869  1.664   0.50 19.45  ? 15  DC  D N4    1 
ATOM   5016 N  N4    B DC  D 3 15  ? -28.437 43.455 6.966   0.50 44.54  ? 15  DC  D N4    1 
ATOM   5017 C  C5    A DC  D 3 15  ? -27.059 0.041  3.928   0.50 16.86  ? 15  DC  D C5    1 
ATOM   5018 C  C5    B DC  D 3 15  ? -30.674 43.366 7.851   0.50 55.33  ? 15  DC  D C5    1 
ATOM   5019 C  C6    A DC  D 3 15  ? -27.732 -0.235 5.052   0.50 19.07  ? 15  DC  D C6    1 
ATOM   5020 C  C6    B DC  D 3 15  ? -31.443 43.146 8.932   0.50 57.49  ? 15  DC  D C6    1 
HETATM 5021 MG MG    . MG  E 4 .   ? -38.242 26.881 7.215   1.00 13.14  ? 301 MG  A MG    1 
HETATM 5022 C  C1    . MPD F 5 .   ? 3.243   26.906 -29.843 1.00 24.69  ? 302 MPD A C1    1 
HETATM 5023 C  C2    . MPD F 5 .   ? 3.765   26.839 -28.392 1.00 56.19  ? 302 MPD A C2    1 
HETATM 5024 O  O2    . MPD F 5 .   ? 4.203   28.155 -27.926 1.00 7.48   ? 302 MPD A O2    1 
HETATM 5025 C  CM    . MPD F 5 .   ? 2.706   26.359 -27.402 1.00 9.82   ? 302 MPD A CM    1 
HETATM 5026 C  C3    . MPD F 5 .   ? 4.918   25.837 -28.388 1.00 22.61  ? 302 MPD A C3    1 
HETATM 5027 C  C4    . MPD F 5 .   ? 5.872   25.995 -27.214 1.00 35.66  ? 302 MPD A C4    1 
HETATM 5028 O  O4    . MPD F 5 .   ? 5.387   26.989 -26.340 1.00 30.31  ? 302 MPD A O4    1 
HETATM 5029 C  C5    . MPD F 5 .   ? 6.062   24.666 -26.480 1.00 26.39  ? 302 MPD A C5    1 
HETATM 5030 MG MG    . MG  G 4 .   ? -25.082 15.086 14.881  1.00 9.74   ? 301 MG  B MG    1 
HETATM 5031 C  C1    . MPD H 5 .   ? -28.416 27.552 -3.003  1.00 31.07  ? 101 MPD C C1    1 
HETATM 5032 C  C2    . MPD H 5 .   ? -27.469 27.393 -4.181  1.00 58.52  ? 101 MPD C C2    1 
HETATM 5033 O  O2    . MPD H 5 .   ? -27.762 28.480 -5.105  1.00 35.62  ? 101 MPD C O2    1 
HETATM 5034 C  CM    . MPD H 5 .   ? -26.065 27.642 -3.608  1.00 24.19  ? 101 MPD C CM    1 
HETATM 5035 C  C3    . MPD H 5 .   ? -27.767 26.111 -5.012  1.00 13.72  ? 101 MPD C C3    1 
HETATM 5036 C  C4    . MPD H 5 .   ? -27.179 24.694 -4.761  1.00 34.84  ? 101 MPD C C4    1 
HETATM 5037 O  O4    . MPD H 5 .   ? -26.198 24.336 -5.740  1.00 16.87  ? 101 MPD C O4    1 
HETATM 5038 C  C5    . MPD H 5 .   ? -26.603 24.420 -3.366  1.00 33.05  ? 101 MPD C C5    1 
HETATM 5039 C  C1    . MPD I 5 .   ? -32.985 31.111 3.138   1.00 22.83  ? 102 MPD C C1    1 
HETATM 5040 C  C2    . MPD I 5 .   ? -33.820 32.241 2.530   1.00 49.40  ? 102 MPD C C2    1 
HETATM 5041 O  O2    . MPD I 5 .   ? -32.940 33.364 2.270   1.00 29.29  ? 102 MPD C O2    1 
HETATM 5042 C  CM    . MPD I 5 .   ? -34.413 31.891 1.154   1.00 10.27  ? 102 MPD C CM    1 
HETATM 5043 C  C3    . MPD I 5 .   ? -34.831 32.600 3.628   1.00 10.76  ? 102 MPD C C3    1 
HETATM 5044 C  C4    . MPD I 5 .   ? -33.997 32.999 4.860   1.00 52.69  ? 102 MPD C C4    1 
HETATM 5045 O  O4    . MPD I 5 .   ? -33.575 34.338 4.706   1.00 50.75  ? 102 MPD C O4    1 
HETATM 5046 C  C5    . MPD I 5 .   ? -34.650 32.823 6.240   1.00 9.56   ? 102 MPD C C5    1 
HETATM 5047 C  C1    . MPD J 5 .   ? -21.068 12.503 7.238   1.00 22.48  ? 103 MPD C C1    1 
HETATM 5048 C  C2    . MPD J 5 .   ? -21.398 11.223 8.020   1.00 64.84  ? 103 MPD C C2    1 
HETATM 5049 O  O2    . MPD J 5 .   ? -21.987 10.344 7.027   1.00 52.25  ? 103 MPD C O2    1 
HETATM 5050 C  CM    . MPD J 5 .   ? -20.125 10.588 8.598   1.00 26.36  ? 103 MPD C CM    1 
HETATM 5051 C  C3    . MPD J 5 .   ? -22.411 11.427 9.162   1.00 46.53  ? 103 MPD C C3    1 
HETATM 5052 C  C4    . MPD J 5 .   ? -23.727 10.656 8.967   1.00 58.99  ? 103 MPD C C4    1 
HETATM 5053 O  O4    . MPD J 5 .   ? -23.487 9.378  8.416   1.00 62.89  ? 103 MPD C O4    1 
HETATM 5054 C  C5    . MPD J 5 .   ? -24.537 10.452 10.246  1.00 22.05  ? 103 MPD C C5    1 
HETATM 5055 O  O     . HOH K 6 .   ? -30.426 16.482 1.649   1.00 23.76  ? 401 HOH A O     1 
HETATM 5056 O  O     . HOH K 6 .   ? -17.614 23.458 -9.449  1.00 9.63   ? 402 HOH A O     1 
HETATM 5057 O  O     . HOH K 6 .   ? -31.166 38.111 -16.854 1.00 18.76  ? 403 HOH A O     1 
HETATM 5058 O  O     . HOH K 6 .   ? 9.795   27.406 -18.816 1.00 21.05  ? 404 HOH A O     1 
HETATM 5059 O  O     . HOH K 6 .   ? -9.708  33.969 11.212  1.00 28.01  ? 405 HOH A O     1 
HETATM 5060 O  O     . HOH K 6 .   ? -34.209 34.749 15.680  1.00 21.02  ? 406 HOH A O     1 
HETATM 5061 O  O     . HOH L 6 .   ? -20.448 33.863 -17.317 1.00 18.55  ? 401 HOH B O     1 
HETATM 5062 O  O     . HOH L 6 .   ? -31.500 34.358 -18.343 1.00 20.63  ? 402 HOH B O     1 
HETATM 5063 O  O     . HOH L 6 .   ? -3.568  15.811 -28.949 1.00 20.65  ? 403 HOH B O     1 
HETATM 5064 O  O     . HOH L 6 .   ? -34.781 6.415  37.557  1.00 15.49  ? 404 HOH B O     1 
HETATM 5065 O  O     . HOH L 6 .   ? -21.456 29.833 -11.935 1.00 20.30  ? 405 HOH B O     1 
HETATM 5066 O  O     . HOH L 6 .   ? -19.937 3.139  18.616  1.00 9.27   ? 406 HOH B O     1 
HETATM 5067 O  O     . HOH L 6 .   ? -23.620 25.233 30.079  1.00 12.91  ? 407 HOH B O     1 
HETATM 5068 O  O     . HOH L 6 .   ? -19.392 10.756 15.333  1.00 14.67  ? 408 HOH B O     1 
HETATM 5069 O  O     . HOH L 6 .   ? -37.346 20.364 18.970  1.00 11.10  ? 409 HOH B O     1 
HETATM 5070 O  O     . HOH L 6 .   ? -25.273 23.440 -36.515 1.00 16.80  ? 410 HOH B O     1 
HETATM 5071 O  O     . HOH L 6 .   ? -34.848 18.767 -32.002 1.00 29.38  ? 411 HOH B O     1 
HETATM 5072 O  O     . HOH M 6 .   ? -20.285 19.258 12.832  1.00 17.36  ? 201 HOH C O     1 
HETATM 5073 O  O     . HOH N 6 .   ? -37.525 39.773 10.143  1.00 19.20  ? 101 HOH D O     1 
HETATM 5074 O  O     . HOH N 6 .   ? -15.068 18.666 8.235   1.00 12.60  ? 102 HOH D O     1 
HETATM 5075 O  O     . HOH N 6 .   ? -30.171 21.862 5.877   1.00 12.48  ? 103 HOH D O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   2   SER SER A . n 
A 1 3   LYS 3   3   3   LYS LYS A . n 
A 1 4   ASP 4   4   4   ASP ASP A . n 
A 1 5   LYS 5   5   5   LYS LYS A . n 
A 1 6   VAL 6   6   6   VAL VAL A . n 
A 1 7   THR 7   7   7   THR THR A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   ILE 9   9   9   ILE ILE A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  SER 11  11  11  SER SER A . n 
A 1 12  PRO 12  12  12  PRO PRO A . n 
A 1 13  SER 13  13  13  SER SER A . n 
A 1 14  THR 14  14  14  THR THR A . n 
A 1 15  GLU 15  15  15  GLU GLU A . n 
A 1 16  GLU 16  16  16  GLU GLU A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  VAL 18  18  18  VAL VAL A . n 
A 1 19  SER 19  19  19  SER SER A . n 
A 1 20  LEU 20  20  20  LEU LEU A . n 
A 1 21  VAL 21  21  21  VAL VAL A . n 
A 1 22  ASN 22  22  22  ASN ASN A . n 
A 1 23  SER 23  23  23  SER SER A . n 
A 1 24  ALA 24  24  24  ALA ALA A . n 
A 1 25  LEU 25  25  25  LEU LEU A . n 
A 1 26  LEU 26  26  26  LEU LEU A . n 
A 1 27  GLU 27  27  27  GLU GLU A . n 
A 1 28  GLU 28  28  28  GLU GLU A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  MET 30  30  30  MET MET A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  THR 32  32  32  THR THR A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  PHE 34  34  34  PHE PHE A . n 
A 1 35  ALA 35  35  35  ALA ALA A . n 
A 1 36  ARG 36  36  36  ARG ARG A . n 
A 1 37  CYS 37  37  37  CYS CYS A . n 
A 1 38  LYS 38  38  38  LYS LYS A . n 
A 1 39  VAL 39  39  39  VAL VAL A . n 
A 1 40  HIS 40  40  40  HIS HIS A . n 
A 1 41  TYR 41  41  41  TYR TYR A . n 
A 1 42  ASP 42  42  42  ASP ASP A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  ALA 45  45  45  ALA ALA A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  SER 47  47  47  SER SER A . n 
A 1 48  GLU 48  48  48  GLU GLU A . n 
A 1 49  LEU 49  49  49  LEU LEU A . n 
A 1 50  GLY 50  50  50  GLY GLY A . n 
A 1 51  SER 51  51  51  SER SER A . n 
A 1 52  GLY 52  52  52  GLY GLY A . n 
A 1 53  ASP 53  53  53  ASP ASP A . n 
A 1 54  ARG 54  54  54  ARG ARG A . n 
A 1 55  VAL 55  55  55  VAL VAL A . n 
A 1 56  ILE 56  56  56  ILE ILE A . n 
A 1 57  ILE 57  57  57  ILE ILE A . n 
A 1 58  VAL 58  58  58  VAL VAL A . n 
A 1 59  LYS 59  59  59  LYS LYS A . n 
A 1 60  PRO 60  60  60  PRO PRO A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  GLY 62  62  62  GLY GLY A . n 
A 1 63  SER 63  63  63  SER SER A . n 
A 1 64  PHE 64  64  64  PHE PHE A . n 
A 1 65  LEU 65  65  65  LEU LEU A . n 
A 1 66  ILE 66  66  66  ILE ILE A . n 
A 1 67  HIS 67  67  67  HIS HIS A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  SER 69  69  69  SER SER A . n 
A 1 70  LYS 70  70  70  LYS LYS A . n 
A 1 71  LYS 71  71  71  LYS LYS A . n 
A 1 72  ARG 72  72  72  ARG ARG A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  PRO 74  74  74  PRO PRO A . n 
A 1 75  VAL 75  75  75  VAL VAL A . n 
A 1 76  ASN 76  76  76  ASN ASN A . n 
A 1 77  TRP 77  77  77  TRP TRP A . n 
A 1 78  GLN 78  78  78  GLN GLN A . n 
A 1 79  PRO 79  79  79  PRO PRO A . n 
A 1 80  PRO 80  80  80  PRO PRO A . n 
A 1 81  GLY 81  81  81  GLY GLY A . n 
A 1 82  SER 82  82  82  SER SER A . n 
A 1 83  ARG 83  83  83  ARG ARG A . n 
A 1 84  VAL 84  84  84  VAL VAL A . n 
A 1 85  ARG 85  85  85  ARG ARG A . n 
A 1 86  LEU 86  86  86  LEU LEU A . n 
A 1 87  GLU 87  87  87  GLU GLU A . n 
A 1 88  LEU 88  88  88  LEU LEU A . n 
A 1 89  ARG 89  89  89  ARG ARG A . n 
A 1 90  GLU 90  90  90  GLU GLU A . n 
A 1 91  ASN 91  91  91  ASN ASN A . n 
A 1 92  PRO 92  92  92  PRO PRO A . n 
A 1 93  VAL 93  93  93  VAL VAL A . n 
A 1 94  LEU 94  94  94  LEU LEU A . n 
A 1 95  VAL 95  95  95  VAL VAL A . n 
A 1 96  SER 96  96  96  SER SER A . n 
A 1 97  ILE 97  97  97  ILE ILE A . n 
A 1 98  ARG 98  98  98  ARG ARG A . n 
A 1 99  ARG 99  99  99  ARG ARG A . n 
A 1 100 LYS 100 100 100 LYS LYS A . n 
A 1 101 PRO 101 101 101 PRO PRO A . n 
A 1 102 ARG 102 102 102 ARG ARG A . n 
A 1 103 GLU 103 103 103 GLU GLU A . n 
A 1 104 THR 104 104 104 THR THR A . n 
A 1 105 LEU 105 105 105 LEU LEU A . n 
A 1 106 GLU 106 106 106 GLU GLU A . n 
A 1 107 VAL 107 107 107 VAL VAL A . n 
A 1 108 GLU 108 108 108 GLU GLU A . n 
A 1 109 LEU 109 109 109 LEU LEU A . n 
A 1 110 GLU 110 110 110 GLU GLU A . n 
A 1 111 GLU 111 111 111 GLU GLU A . n 
A 1 112 VAL 112 112 112 VAL VAL A . n 
A 1 113 TYR 113 113 113 TYR TYR A . n 
A 1 114 MET 114 114 114 MET MET A . n 
A 1 115 VAL 115 115 115 VAL VAL A . n 
A 1 116 SER 116 116 116 SER SER A . n 
A 1 117 VAL 117 117 117 VAL VAL A . n 
A 1 118 PHE 118 118 118 PHE PHE A . n 
A 1 119 ARG 119 119 119 ARG ARG A . n 
A 1 120 ALA 120 120 120 ALA ALA A . n 
A 1 121 GLU 121 121 121 GLU GLU A . n 
A 1 122 ASP 122 122 122 ASP ASP A . n 
A 1 123 TYR 123 123 123 TYR TYR A . n 
A 1 124 GLU 124 124 124 GLU GLU A . n 
A 1 125 GLU 125 125 125 GLU GLU A . n 
A 1 126 LEU 126 126 126 LEU LEU A . n 
A 1 127 ALA 127 127 127 ALA ALA A . n 
A 1 128 LEU 128 128 128 LEU LEU A . n 
A 1 129 THR 129 129 129 THR THR A . n 
A 1 130 GLY 130 130 130 GLY GLY A . n 
A 1 131 SER 131 131 131 SER SER A . n 
A 1 132 GLU 132 132 132 GLU GLU A . n 
A 1 133 ALA 133 133 133 ALA ALA A . n 
A 1 134 GLU 134 134 134 GLU GLU A . n 
A 1 135 MET 135 135 135 MET MET A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 GLU 137 137 137 GLU GLU A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 ILE 139 139 139 ILE ILE A . n 
A 1 140 PHE 140 140 140 PHE PHE A . n 
A 1 141 GLU 141 141 141 GLU GLU A . n 
A 1 142 ASN 142 142 142 ASN ASN A . n 
A 1 143 PRO 143 143 143 PRO PRO A . n 
A 1 144 GLU 144 144 144 GLU GLU A . n 
A 1 145 VAL 145 145 145 VAL VAL A . n 
A 1 146 ILE 146 146 146 ILE ILE A . n 
A 1 147 GLU 147 147 147 GLU GLU A . n 
A 1 148 PRO 148 148 148 PRO PRO A . n 
A 1 149 GLY 149 149 149 GLY GLY A . n 
A 1 150 PHE 150 150 150 PHE PHE A . n 
A 1 151 LYS 151 151 151 LYS LYS A . n 
A 1 152 PRO 152 152 152 PRO PRO A . n 
A 1 153 LEU 153 153 153 LEU LEU A . n 
A 1 154 PHE 154 154 154 PHE PHE A . n 
A 1 155 ARG 155 155 155 ARG ARG A . n 
A 1 156 GLU 156 156 156 GLU GLU A . n 
A 1 157 LYS 157 157 157 LYS LYS A . n 
A 1 158 ALA 158 158 158 ALA ALA A . n 
A 1 159 ILE 159 159 159 ILE ILE A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 THR 161 161 161 THR THR A . n 
A 1 162 GLY 162 162 162 GLY GLY A . n 
A 1 163 ILE 163 163 163 ILE ILE A . n 
A 1 164 VAL 164 164 164 VAL VAL A . n 
A 1 165 ALA 165 165 165 ALA ALA A . n 
A 1 166 VAL 166 166 166 VAL VAL A . n 
A 1 167 LEU 167 167 167 LEU LEU A . n 
A 1 168 GLY 168 168 168 GLY GLY A . n 
A 1 169 ARG 169 169 169 ARG ARG A . n 
A 1 170 ASP 170 170 170 ASP ASP A . n 
A 1 171 SER 171 171 171 SER SER A . n 
A 1 172 ASP 172 172 172 ASP ASP A . n 
A 1 173 GLY 173 173 173 GLY GLY A . n 
A 1 174 ASN 174 174 174 ASN ASN A . n 
A 1 175 ILE 175 175 175 ILE ILE A . n 
A 1 176 VAL 176 176 176 VAL VAL A . n 
A 1 177 VAL 177 177 177 VAL VAL A . n 
A 1 178 LEU 178 178 178 LEU LEU A . n 
A 1 179 GLU 179 179 179 GLU GLU A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 LYS 181 181 181 LYS LYS A . n 
A 1 182 ARG 182 182 182 ARG ARG A . n 
A 1 183 ARG 183 183 183 ARG ARG A . n 
A 1 184 ARG 184 184 184 ARG ARG A . n 
A 1 185 ALA 185 185 185 ALA ALA A . n 
A 1 186 GLU 186 186 186 GLU GLU A . n 
A 1 187 LEU 187 187 187 LEU LEU A . n 
A 1 188 HIS 188 188 188 HIS HIS A . n 
A 1 189 ALA 189 189 189 ALA ALA A . n 
A 1 190 VAL 190 190 190 VAL VAL A . n 
A 1 191 ARG 191 191 191 ARG ARG A . n 
A 1 192 GLN 192 192 192 GLN GLN A . n 
A 1 193 LEU 193 193 193 LEU LEU A . n 
A 1 194 LYS 194 194 194 LYS LYS A . n 
A 1 195 SER 195 195 195 SER SER A . n 
A 1 196 TYR 196 196 196 TYR TYR A . n 
A 1 197 VAL 197 197 197 VAL VAL A . n 
A 1 198 GLU 198 198 198 GLU GLU A . n 
A 1 199 ILE 199 199 199 ILE ILE A . n 
A 1 200 LEU 200 200 200 LEU LEU A . n 
A 1 201 ARG 201 201 201 ARG ARG A . n 
A 1 202 GLU 202 202 202 GLU GLU A . n 
A 1 203 GLU 203 203 203 GLU GLU A . n 
A 1 204 TYR 204 204 204 TYR TYR A . n 
A 1 205 GLY 205 205 205 GLY GLY A . n 
A 1 206 ASP 206 206 206 ASP ASP A . n 
A 1 207 LYS 207 207 207 LYS LYS A . n 
A 1 208 VAL 208 208 208 VAL VAL A . n 
A 1 209 ARG 209 209 209 ARG ARG A . n 
A 1 210 GLY 210 210 210 GLY GLY A . n 
A 1 211 ILE 211 211 211 ILE ILE A . n 
A 1 212 LEU 212 212 212 LEU LEU A . n 
A 1 213 VAL 213 213 213 VAL VAL A . n 
A 1 214 ALA 214 214 214 ALA ALA A . n 
A 1 215 PRO 215 215 215 PRO PRO A . n 
A 1 216 SER 216 216 216 SER SER A . n 
A 1 217 LEU 217 217 217 LEU LEU A . n 
A 1 218 THR 218 218 218 THR THR A . n 
A 1 219 SER 219 219 219 SER SER A . n 
A 1 220 GLY 220 220 220 GLY GLY A . n 
A 1 221 ALA 221 221 221 ALA ALA A . n 
A 1 222 LYS 222 222 222 LYS LYS A . n 
A 1 223 ARG 223 223 223 ARG ARG A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 LEU 225 225 225 LEU LEU A . n 
A 1 226 GLU 226 226 226 GLU GLU A . n 
A 1 227 LYS 227 227 227 LYS LYS A . n 
A 1 228 GLU 228 228 228 GLU GLU A . n 
A 1 229 GLY 229 229 229 GLY GLY A . n 
A 1 230 LEU 230 230 230 LEU LEU A . n 
A 1 231 GLU 231 231 231 GLU GLU A . n 
A 1 232 PHE 232 232 232 PHE PHE A . n 
A 1 233 ARG 233 233 233 ARG ARG A . n 
A 1 234 LYS 234 234 234 LYS LYS A . n 
A 1 235 LEU 235 235 235 LEU LEU A . n 
A 1 236 GLU 236 236 236 GLU GLU A . n 
A 1 237 PRO 237 237 237 PRO PRO A . n 
A 1 238 PRO 238 238 238 PRO PRO A . n 
A 1 239 LYS 239 239 239 LYS LYS A . n 
A 1 240 ARG 240 240 240 ARG ARG A . n 
A 1 241 ASP 241 241 ?   ?   ?   A . n 
A 1 242 SER 242 242 ?   ?   ?   A . n 
A 1 243 LYS 243 243 ?   ?   ?   A . n 
A 1 244 LYS 244 244 ?   ?   ?   A . n 
A 1 245 LYS 245 245 ?   ?   ?   A . n 
A 1 246 GLY 246 246 ?   ?   ?   A . n 
A 1 247 ARG 247 247 ?   ?   ?   A . n 
A 1 248 GLN 248 248 ?   ?   ?   A . n 
A 1 249 LYS 249 249 ?   ?   ?   A . n 
A 1 250 THR 250 250 ?   ?   ?   A . n 
A 1 251 LEU 251 251 ?   ?   ?   A . n 
A 1 252 PHE 252 252 ?   ?   ?   A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   SER 2   2   2   SER SER B . n 
B 1 3   LYS 3   3   3   LYS LYS B . n 
B 1 4   ASP 4   4   4   ASP ASP B . n 
B 1 5   LYS 5   5   5   LYS LYS B . n 
B 1 6   VAL 6   6   6   VAL VAL B . n 
B 1 7   THR 7   7   7   THR THR B . n 
B 1 8   VAL 8   8   8   VAL VAL B . n 
B 1 9   ILE 9   9   9   ILE ILE B . n 
B 1 10  THR 10  10  10  THR THR B . n 
B 1 11  SER 11  11  11  SER SER B . n 
B 1 12  PRO 12  12  12  PRO PRO B . n 
B 1 13  SER 13  13  13  SER SER B . n 
B 1 14  THR 14  14  14  THR THR B . n 
B 1 15  GLU 15  15  15  GLU GLU B . n 
B 1 16  GLU 16  16  16  GLU GLU B . n 
B 1 17  LEU 17  17  17  LEU LEU B . n 
B 1 18  VAL 18  18  18  VAL VAL B . n 
B 1 19  SER 19  19  19  SER SER B . n 
B 1 20  LEU 20  20  20  LEU LEU B . n 
B 1 21  VAL 21  21  21  VAL VAL B . n 
B 1 22  ASN 22  22  22  ASN ASN B . n 
B 1 23  SER 23  23  23  SER SER B . n 
B 1 24  ALA 24  24  24  ALA ALA B . n 
B 1 25  LEU 25  25  25  LEU LEU B . n 
B 1 26  LEU 26  26  26  LEU LEU B . n 
B 1 27  GLU 27  27  27  GLU GLU B . n 
B 1 28  GLU 28  28  28  GLU GLU B . n 
B 1 29  ALA 29  29  29  ALA ALA B . n 
B 1 30  MET 30  30  30  MET MET B . n 
B 1 31  LEU 31  31  31  LEU LEU B . n 
B 1 32  THR 32  32  32  THR THR B . n 
B 1 33  ILE 33  33  33  ILE ILE B . n 
B 1 34  PHE 34  34  34  PHE PHE B . n 
B 1 35  ALA 35  35  35  ALA ALA B . n 
B 1 36  ARG 36  36  36  ARG ARG B . n 
B 1 37  CYS 37  37  37  CYS CYS B . n 
B 1 38  LYS 38  38  38  LYS LYS B . n 
B 1 39  VAL 39  39  39  VAL VAL B . n 
B 1 40  HIS 40  40  40  HIS HIS B . n 
B 1 41  TYR 41  41  41  TYR TYR B . n 
B 1 42  ASP 42  42  42  ASP ASP B . n 
B 1 43  GLY 43  43  43  GLY GLY B . n 
B 1 44  ARG 44  44  44  ARG ARG B . n 
B 1 45  ALA 45  45  45  ALA ALA B . n 
B 1 46  LYS 46  46  46  LYS LYS B . n 
B 1 47  SER 47  47  47  SER SER B . n 
B 1 48  GLU 48  48  48  GLU GLU B . n 
B 1 49  LEU 49  49  49  LEU LEU B . n 
B 1 50  GLY 50  50  50  GLY GLY B . n 
B 1 51  SER 51  51  51  SER SER B . n 
B 1 52  GLY 52  52  52  GLY GLY B . n 
B 1 53  ASP 53  53  53  ASP ASP B . n 
B 1 54  ARG 54  54  54  ARG ARG B . n 
B 1 55  VAL 55  55  55  VAL VAL B . n 
B 1 56  ILE 56  56  56  ILE ILE B . n 
B 1 57  ILE 57  57  57  ILE ILE B . n 
B 1 58  VAL 58  58  58  VAL VAL B . n 
B 1 59  LYS 59  59  59  LYS LYS B . n 
B 1 60  PRO 60  60  60  PRO PRO B . n 
B 1 61  ASP 61  61  61  ASP ASP B . n 
B 1 62  GLY 62  62  62  GLY GLY B . n 
B 1 63  SER 63  63  63  SER SER B . n 
B 1 64  PHE 64  64  64  PHE PHE B . n 
B 1 65  LEU 65  65  65  LEU LEU B . n 
B 1 66  ILE 66  66  66  ILE ILE B . n 
B 1 67  HIS 67  67  67  HIS HIS B . n 
B 1 68  GLN 68  68  68  GLN GLN B . n 
B 1 69  SER 69  69  69  SER SER B . n 
B 1 70  LYS 70  70  70  LYS LYS B . n 
B 1 71  LYS 71  71  71  LYS LYS B . n 
B 1 72  ARG 72  72  72  ARG ARG B . n 
B 1 73  GLU 73  73  73  GLU GLU B . n 
B 1 74  PRO 74  74  74  PRO PRO B . n 
B 1 75  VAL 75  75  75  VAL VAL B . n 
B 1 76  ASN 76  76  76  ASN ASN B . n 
B 1 77  TRP 77  77  77  TRP TRP B . n 
B 1 78  GLN 78  78  78  GLN GLN B . n 
B 1 79  PRO 79  79  79  PRO PRO B . n 
B 1 80  PRO 80  80  80  PRO PRO B . n 
B 1 81  GLY 81  81  81  GLY GLY B . n 
B 1 82  SER 82  82  82  SER SER B . n 
B 1 83  ARG 83  83  83  ARG ARG B . n 
B 1 84  VAL 84  84  84  VAL VAL B . n 
B 1 85  ARG 85  85  85  ARG ARG B . n 
B 1 86  LEU 86  86  86  LEU LEU B . n 
B 1 87  GLU 87  87  87  GLU GLU B . n 
B 1 88  LEU 88  88  88  LEU LEU B . n 
B 1 89  ARG 89  89  89  ARG ARG B . n 
B 1 90  GLU 90  90  90  GLU GLU B . n 
B 1 91  ASN 91  91  91  ASN ASN B . n 
B 1 92  PRO 92  92  92  PRO PRO B . n 
B 1 93  VAL 93  93  93  VAL VAL B . n 
B 1 94  LEU 94  94  94  LEU LEU B . n 
B 1 95  VAL 95  95  95  VAL VAL B . n 
B 1 96  SER 96  96  96  SER SER B . n 
B 1 97  ILE 97  97  97  ILE ILE B . n 
B 1 98  ARG 98  98  98  ARG ARG B . n 
B 1 99  ARG 99  99  99  ARG ARG B . n 
B 1 100 LYS 100 100 100 LYS LYS B . n 
B 1 101 PRO 101 101 101 PRO PRO B . n 
B 1 102 ARG 102 102 102 ARG ARG B . n 
B 1 103 GLU 103 103 103 GLU GLU B . n 
B 1 104 THR 104 104 104 THR THR B . n 
B 1 105 LEU 105 105 105 LEU LEU B . n 
B 1 106 GLU 106 106 106 GLU GLU B . n 
B 1 107 VAL 107 107 107 VAL VAL B . n 
B 1 108 GLU 108 108 108 GLU GLU B . n 
B 1 109 LEU 109 109 109 LEU LEU B . n 
B 1 110 GLU 110 110 110 GLU GLU B . n 
B 1 111 GLU 111 111 111 GLU GLU B . n 
B 1 112 VAL 112 112 112 VAL VAL B . n 
B 1 113 TYR 113 113 113 TYR TYR B . n 
B 1 114 MET 114 114 114 MET MET B . n 
B 1 115 VAL 115 115 115 VAL VAL B . n 
B 1 116 SER 116 116 116 SER SER B . n 
B 1 117 VAL 117 117 117 VAL VAL B . n 
B 1 118 PHE 118 118 118 PHE PHE B . n 
B 1 119 ARG 119 119 119 ARG ARG B . n 
B 1 120 ALA 120 120 120 ALA ALA B . n 
B 1 121 GLU 121 121 121 GLU GLU B . n 
B 1 122 ASP 122 122 122 ASP ASP B . n 
B 1 123 TYR 123 123 123 TYR TYR B . n 
B 1 124 GLU 124 124 124 GLU GLU B . n 
B 1 125 GLU 125 125 125 GLU GLU B . n 
B 1 126 LEU 126 126 126 LEU LEU B . n 
B 1 127 ALA 127 127 127 ALA ALA B . n 
B 1 128 LEU 128 128 128 LEU LEU B . n 
B 1 129 THR 129 129 129 THR THR B . n 
B 1 130 GLY 130 130 130 GLY GLY B . n 
B 1 131 SER 131 131 131 SER SER B . n 
B 1 132 GLU 132 132 132 GLU GLU B . n 
B 1 133 ALA 133 133 133 ALA ALA B . n 
B 1 134 GLU 134 134 134 GLU GLU B . n 
B 1 135 MET 135 135 135 MET MET B . n 
B 1 136 ALA 136 136 136 ALA ALA B . n 
B 1 137 GLU 137 137 137 GLU GLU B . n 
B 1 138 LEU 138 138 138 LEU LEU B . n 
B 1 139 ILE 139 139 139 ILE ILE B . n 
B 1 140 PHE 140 140 140 PHE PHE B . n 
B 1 141 GLU 141 141 141 GLU GLU B . n 
B 1 142 ASN 142 142 142 ASN ASN B . n 
B 1 143 PRO 143 143 143 PRO PRO B . n 
B 1 144 GLU 144 144 144 GLU GLU B . n 
B 1 145 VAL 145 145 145 VAL VAL B . n 
B 1 146 ILE 146 146 146 ILE ILE B . n 
B 1 147 GLU 147 147 147 GLU GLU B . n 
B 1 148 PRO 148 148 148 PRO PRO B . n 
B 1 149 GLY 149 149 149 GLY GLY B . n 
B 1 150 PHE 150 150 150 PHE PHE B . n 
B 1 151 LYS 151 151 151 LYS LYS B . n 
B 1 152 PRO 152 152 152 PRO PRO B . n 
B 1 153 LEU 153 153 153 LEU LEU B . n 
B 1 154 PHE 154 154 154 PHE PHE B . n 
B 1 155 ARG 155 155 155 ARG ARG B . n 
B 1 156 GLU 156 156 156 GLU GLU B . n 
B 1 157 LYS 157 157 157 LYS LYS B . n 
B 1 158 ALA 158 158 158 ALA ALA B . n 
B 1 159 ILE 159 159 159 ILE ILE B . n 
B 1 160 GLY 160 160 160 GLY GLY B . n 
B 1 161 THR 161 161 161 THR THR B . n 
B 1 162 GLY 162 162 162 GLY GLY B . n 
B 1 163 ILE 163 163 163 ILE ILE B . n 
B 1 164 VAL 164 164 164 VAL VAL B . n 
B 1 165 ALA 165 165 165 ALA ALA B . n 
B 1 166 VAL 166 166 166 VAL VAL B . n 
B 1 167 LEU 167 167 167 LEU LEU B . n 
B 1 168 GLY 168 168 168 GLY GLY B . n 
B 1 169 ARG 169 169 169 ARG ARG B . n 
B 1 170 ASP 170 170 170 ASP ASP B . n 
B 1 171 SER 171 171 171 SER SER B . n 
B 1 172 ASP 172 172 172 ASP ASP B . n 
B 1 173 GLY 173 173 173 GLY GLY B . n 
B 1 174 ASN 174 174 174 ASN ASN B . n 
B 1 175 ILE 175 175 175 ILE ILE B . n 
B 1 176 VAL 176 176 176 VAL VAL B . n 
B 1 177 VAL 177 177 177 VAL VAL B . n 
B 1 178 LEU 178 178 178 LEU LEU B . n 
B 1 179 GLU 179 179 179 GLU GLU B . n 
B 1 180 LEU 180 180 180 LEU LEU B . n 
B 1 181 LYS 181 181 181 LYS LYS B . n 
B 1 182 ARG 182 182 182 ARG ARG B . n 
B 1 183 ARG 183 183 183 ARG ARG B . n 
B 1 184 ARG 184 184 184 ARG ARG B . n 
B 1 185 ALA 185 185 185 ALA ALA B . n 
B 1 186 GLU 186 186 186 GLU GLU B . n 
B 1 187 LEU 187 187 187 LEU LEU B . n 
B 1 188 HIS 188 188 188 HIS HIS B . n 
B 1 189 ALA 189 189 189 ALA ALA B . n 
B 1 190 VAL 190 190 190 VAL VAL B . n 
B 1 191 ARG 191 191 191 ARG ARG B . n 
B 1 192 GLN 192 192 192 GLN GLN B . n 
B 1 193 LEU 193 193 193 LEU LEU B . n 
B 1 194 LYS 194 194 194 LYS LYS B . n 
B 1 195 SER 195 195 195 SER SER B . n 
B 1 196 TYR 196 196 196 TYR TYR B . n 
B 1 197 VAL 197 197 197 VAL VAL B . n 
B 1 198 GLU 198 198 198 GLU GLU B . n 
B 1 199 ILE 199 199 199 ILE ILE B . n 
B 1 200 LEU 200 200 200 LEU LEU B . n 
B 1 201 ARG 201 201 201 ARG ARG B . n 
B 1 202 GLU 202 202 202 GLU GLU B . n 
B 1 203 GLU 203 203 203 GLU GLU B . n 
B 1 204 TYR 204 204 204 TYR TYR B . n 
B 1 205 GLY 205 205 205 GLY GLY B . n 
B 1 206 ASP 206 206 206 ASP ASP B . n 
B 1 207 LYS 207 207 207 LYS LYS B . n 
B 1 208 VAL 208 208 208 VAL VAL B . n 
B 1 209 ARG 209 209 209 ARG ARG B . n 
B 1 210 GLY 210 210 210 GLY GLY B . n 
B 1 211 ILE 211 211 211 ILE ILE B . n 
B 1 212 LEU 212 212 212 LEU LEU B . n 
B 1 213 VAL 213 213 213 VAL VAL B . n 
B 1 214 ALA 214 214 214 ALA ALA B . n 
B 1 215 PRO 215 215 215 PRO PRO B . n 
B 1 216 SER 216 216 216 SER SER B . n 
B 1 217 LEU 217 217 217 LEU LEU B . n 
B 1 218 THR 218 218 218 THR THR B . n 
B 1 219 SER 219 219 219 SER SER B . n 
B 1 220 GLY 220 220 220 GLY GLY B . n 
B 1 221 ALA 221 221 221 ALA ALA B . n 
B 1 222 LYS 222 222 222 LYS LYS B . n 
B 1 223 ARG 223 223 223 ARG ARG B . n 
B 1 224 LEU 224 224 224 LEU LEU B . n 
B 1 225 LEU 225 225 225 LEU LEU B . n 
B 1 226 GLU 226 226 226 GLU GLU B . n 
B 1 227 LYS 227 227 227 LYS LYS B . n 
B 1 228 GLU 228 228 228 GLU GLU B . n 
B 1 229 GLY 229 229 229 GLY GLY B . n 
B 1 230 LEU 230 230 230 LEU LEU B . n 
B 1 231 GLU 231 231 231 GLU GLU B . n 
B 1 232 PHE 232 232 232 PHE PHE B . n 
B 1 233 ARG 233 233 233 ARG ARG B . n 
B 1 234 LYS 234 234 234 LYS LYS B . n 
B 1 235 LEU 235 235 235 LEU LEU B . n 
B 1 236 GLU 236 236 236 GLU GLU B . n 
B 1 237 PRO 237 237 237 PRO PRO B . n 
B 1 238 PRO 238 238 238 PRO PRO B . n 
B 1 239 LYS 239 239 239 LYS LYS B . n 
B 1 240 ARG 240 240 240 ARG ARG B . n 
B 1 241 ASP 241 241 ?   ?   ?   B . n 
B 1 242 SER 242 242 ?   ?   ?   B . n 
B 1 243 LYS 243 243 ?   ?   ?   B . n 
B 1 244 LYS 244 244 ?   ?   ?   B . n 
B 1 245 LYS 245 245 ?   ?   ?   B . n 
B 1 246 GLY 246 246 ?   ?   ?   B . n 
B 1 247 ARG 247 247 ?   ?   ?   B . n 
B 1 248 GLN 248 248 ?   ?   ?   B . n 
B 1 249 LYS 249 249 ?   ?   ?   B . n 
B 1 250 THR 250 250 ?   ?   ?   B . n 
B 1 251 LEU 251 251 ?   ?   ?   B . n 
B 1 252 PHE 252 252 ?   ?   ?   B . n 
C 2 1   DG  1   1   1   DG  DG  C . n 
C 2 2   DC  2   2   2   DC  DC  C . n 
C 2 3   DC  3   3   3   DC  DC  C . n 
C 2 4   DT  4   4   4   DT  DT  C . n 
C 2 5   DA  5   5   5   DA  DA  C . n 
C 2 6   DG  6   6   6   DG  DG  C . n 
C 2 7   DG  7   7   7   DG  DG  C . n 
C 2 8   DT  8   8   8   DT  DT  C . n 
C 2 9   DC  9   9   9   DC  DC  C . n 
C 2 10  DC  10  10  10  DC  DC  C . n 
C 2 11  DC  11  11  11  DC  DC  C . n 
C 2 12  DG  12  12  12  DG  DG  C . n 
C 2 13  DT  13  13  13  DT  DT  C . n 
C 2 14  DC  14  14  14  DC  DC  C . n 
C 2 15  DC  15  15  15  DC  DC  C . n 
D 3 1   DG  1   1   1   DG  DG  D . n 
D 3 2   DG  2   2   2   DG  DG  D . n 
D 3 3   DA  3   3   3   DA  DA  D . n 
D 3 4   DC  4   4   4   DC  DC  D . n 
D 3 5   DG  5   5   5   DG  DG  D . n 
D 3 6   DG  6   6   6   DG  DG  D . n 
D 3 7   DG  7   7   7   DG  DG  D . n 
D 3 8   DG  8   8   8   DG  DG  D . n 
D 3 9   DC  9   9   9   DC  DC  D . n 
D 3 10  DC  10  10  10  DC  DC  D . n 
D 3 11  DT  11  11  11  DT  DT  D . n 
D 3 12  DA  12  12  12  DA  DA  D . n 
D 3 13  DG  13  13  13  DG  DG  D . n 
D 3 14  DG  14  14  14  DG  DG  D . n 
D 3 15  DC  15  15  15  DC  DC  D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 4 MG  1  301 301 MG  MG  A . 
F 5 MPD 1  302 302 MPD MPD A . 
G 4 MG  1  301 301 MG  MG  B . 
H 5 MPD 1  101 101 MPD MPD C . 
I 5 MPD 1  102 102 MPD MPD C . 
J 5 MPD 1  103 103 MPD MPD C . 
K 6 HOH 1  401 401 HOH HOH A . 
K 6 HOH 2  402 402 HOH HOH A . 
K 6 HOH 3  403 403 HOH HOH A . 
K 6 HOH 4  404 404 HOH HOH A . 
K 6 HOH 5  405 405 HOH HOH A . 
K 6 HOH 6  406 406 HOH HOH A . 
L 6 HOH 1  401 401 HOH HOH B . 
L 6 HOH 2  402 402 HOH HOH B . 
L 6 HOH 3  403 403 HOH HOH B . 
L 6 HOH 4  404 404 HOH HOH B . 
L 6 HOH 5  405 405 HOH HOH B . 
L 6 HOH 6  406 406 HOH HOH B . 
L 6 HOH 7  407 407 HOH HOH B . 
L 6 HOH 8  408 408 HOH HOH B . 
L 6 HOH 9  409 409 HOH HOH B . 
L 6 HOH 10 410 410 HOH HOH B . 
L 6 HOH 11 411 411 HOH HOH B . 
M 6 HOH 1  201 201 HOH HOH C . 
N 6 HOH 1  101 101 HOH HOH D . 
N 6 HOH 2  102 102 HOH HOH D . 
N 6 HOH 3  103 103 HOH HOH D . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 13560 ? 
1 MORE         -123  ? 
1 'SSA (A^2)'  22690 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OE1 ? A GLU 179 ? A GLU 179 ? 1_555 MG ? E MG . ? A MG 301 ? 1_555 OE2 ? A GLU 179 ? A GLU 179 ? 1_555 52.4  ? 
2  OE1 ? A GLU 179 ? A GLU 179 ? 1_555 MG ? E MG . ? A MG 301 ? 1_555 OP1 B C DG  6   ? C DG  6   ? 1_555 82.2  ? 
3  OE2 ? A GLU 179 ? A GLU 179 ? 1_555 MG ? E MG . ? A MG 301 ? 1_555 OP1 B C DG  6   ? C DG  6   ? 1_555 134.4 ? 
4  OE1 ? A GLU 179 ? A GLU 179 ? 1_555 MG ? E MG . ? A MG 301 ? 1_555 OP1 A D DG  6   ? D DG  6   ? 1_555 82.7  ? 
5  OE2 ? A GLU 179 ? A GLU 179 ? 1_555 MG ? E MG . ? A MG 301 ? 1_555 OP1 A D DG  6   ? D DG  6   ? 1_555 135.1 ? 
6  OP1 B C DG  6   ? C DG  6   ? 1_555 MG ? E MG . ? A MG 301 ? 1_555 OP1 A D DG  6   ? D DG  6   ? 1_555 3.2   ? 
7  OE1 ? B GLU 179 ? B GLU 179 ? 1_555 MG ? G MG . ? B MG 301 ? 1_555 OE2 ? B GLU 179 ? B GLU 179 ? 1_555 61.4  ? 
8  OE1 ? B GLU 179 ? B GLU 179 ? 1_555 MG ? G MG . ? B MG 301 ? 1_555 OP1 A C DG  6   ? C DG  6   ? 1_555 76.9  ? 
9  OE2 ? B GLU 179 ? B GLU 179 ? 1_555 MG ? G MG . ? B MG 301 ? 1_555 OP1 A C DG  6   ? C DG  6   ? 1_555 97.8  ? 
10 OE1 ? B GLU 179 ? B GLU 179 ? 1_555 MG ? G MG . ? B MG 301 ? 1_555 OP1 B D DG  6   ? D DG  6   ? 1_555 76.8  ? 
11 OE2 ? B GLU 179 ? B GLU 179 ? 1_555 MG ? G MG . ? B MG 301 ? 1_555 OP1 B D DG  6   ? D DG  6   ? 1_555 102.4 ? 
12 OP1 A C DG  6   ? C DG  6   ? 1_555 MG ? G MG . ? B MG 301 ? 1_555 OP1 B D DG  6   ? D DG  6   ? 1_555 5.6   ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-11-02 
2 'Structure model' 1 1 2016-11-16 
3 'Structure model' 1 2 2020-02-26 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'  
2 3 'Structure model' 'Data collection'      
3 3 'Structure model' 'Database references'  
4 3 'Structure model' 'Derived calculations' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' citation              
2 3 'Structure model' diffrn_source         
3 3 'Structure model' pdbx_struct_oper_list 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_citation.journal_id_CSD'                  
2 3 'Structure model' '_diffrn_source.pdbx_synchrotron_site'      
3 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? .        1 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? .        2 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? .        3 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 4 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" C DA 5  ? A "C1'" C DA 5  ? A N9 C DA 5  ? A 110.38 108.30 2.08 0.30 N 
2 1 "O4'" C DA 5  ? B "C1'" C DA 5  ? B N9 C DA 5  ? B 110.19 108.30 1.89 0.30 N 
3 1 "O4'" C DT 13 ? B "C1'" C DT 13 ? B N1 C DT 13 ? B 110.70 108.30 2.40 0.30 N 
4 1 "O4'" D DG 5  ? A "C1'" D DG 5  ? A N9 D DG 5  ? A 110.35 108.30 2.05 0.30 N 
5 1 "O4'" D DG 5  ? B "C1'" D DG 5  ? B N9 D DG 5  ? B 110.42 108.30 2.12 0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LYS A 3   ? ? -155.34 -157.41 
2  1 ALA A 45  ? ? -126.67 -169.23 
3  1 LYS A 71  ? ? 56.99   -165.77 
4  1 LYS A 100 ? ? 51.75   78.45   
5  1 ILE A 146 ? ? -91.48  -62.88  
6  1 LEU A 153 ? ? -123.43 -57.64  
7  1 SER B 11  ? ? 32.11   62.00   
8  1 LYS B 71  ? ? 52.43   -159.96 
9  1 ARG B 72  ? ? -122.84 -55.71  
10 1 LYS B 100 ? ? 63.32   66.79   
11 1 LEU B 153 ? ? -123.42 -58.10  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A ASP 241 ? A ASP 241 
3  1 Y 1 A SER 242 ? A SER 242 
4  1 Y 1 A LYS 243 ? A LYS 243 
5  1 Y 1 A LYS 244 ? A LYS 244 
6  1 Y 1 A LYS 245 ? A LYS 245 
7  1 Y 1 A GLY 246 ? A GLY 246 
8  1 Y 1 A ARG 247 ? A ARG 247 
9  1 Y 1 A GLN 248 ? A GLN 248 
10 1 Y 1 A LYS 249 ? A LYS 249 
11 1 Y 1 A THR 250 ? A THR 250 
12 1 Y 1 A LEU 251 ? A LEU 251 
13 1 Y 1 A PHE 252 ? A PHE 252 
14 1 Y 1 B MET 1   ? B MET 1   
15 1 Y 1 B ASP 241 ? B ASP 241 
16 1 Y 1 B SER 242 ? B SER 242 
17 1 Y 1 B LYS 243 ? B LYS 243 
18 1 Y 1 B LYS 244 ? B LYS 244 
19 1 Y 1 B LYS 245 ? B LYS 245 
20 1 Y 1 B GLY 246 ? B GLY 246 
21 1 Y 1 B ARG 247 ? B ARG 247 
22 1 Y 1 B GLN 248 ? B GLN 248 
23 1 Y 1 B LYS 249 ? B LYS 249 
24 1 Y 1 B THR 250 ? B THR 250 
25 1 Y 1 B LEU 251 ? B LEU 251 
26 1 Y 1 B PHE 252 ? B PHE 252 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
5GKI 'double helix'        
5GKI 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 C DG 1  1_555 D DC 15 1_555 0.632  -0.318 0.172  -11.183 -16.711 2.268  1  C_DG1:DC15_D C 1  ? D 15 ? 19 1 
1 C DC 2  1_555 D DG 14 1_555 -0.217 -0.598 -0.315 2.991   -7.526  -0.298 2  C_DC2:DG14_D C 2  ? D 14 ? 19 1 
1 C DC 3  1_555 D DG 13 1_555 0.201  -0.241 0.444  -6.845  -5.583  1.715  3  C_DC3:DG13_D C 3  ? D 13 ? 19 1 
1 C DT 4  1_555 D DA 12 1_555 0.164  -0.127 0.104  -1.577  -7.902  -4.735 4  C_DT4:DA12_D C 4  ? D 12 ? 20 1 
1 C DA 5  1_555 D DT 11 1_555 0.051  -0.239 -0.140 2.387   -0.967  -4.389 5  C_DA5:DT11_D C 5  ? D 11 ? 20 1 
1 C DG 6  1_555 D DC 10 1_555 0.299  -0.645 0.080  1.164   -9.244  -5.030 6  C_DG6:DC10_D C 6  ? D 10 ? 19 1 
1 C DG 7  1_555 D DC 9  1_555 0.432  -0.349 0.252  4.449   -16.879 -3.312 7  C_DG7:DC9_D  C 7  ? D 9  ? 19 1 
1 C DC 9  1_555 D DG 7  1_555 -0.637 -0.263 0.437  -7.165  -18.633 1.304  8  C_DC9:DG7_D  C 9  ? D 7  ? 19 1 
1 C DC 10 1_555 D DG 6  1_555 0.214  -0.114 0.263  -3.378  -9.540  1.691  9  C_DC10:DG6_D C 10 ? D 6  ? 19 1 
1 C DC 11 1_555 D DG 5  1_555 0.888  -0.007 0.094  -7.003  -0.433  8.014  10 C_DC11:DG5_D C 11 ? D 5  ? 19 1 
1 C DG 12 1_555 D DC 4  1_555 -0.855 0.106  0.266  6.860   -6.461  4.047  11 C_DG12:DC4_D C 12 ? D 4  ? 19 1 
1 C DT 13 1_555 D DA 3  1_555 -0.034 -0.452 -0.296 11.025  -8.167  0.475  12 C_DT13:DA3_D C 13 ? D 3  ? 20 1 
1 C DC 14 1_555 D DG 2  1_555 0.359  0.036  -0.648 18.921  -15.804 -5.113 13 C_DC14:DG2_D C 14 ? D 2  ? 19 1 
1 C DC 15 1_555 D DG 1  1_555 0.697  -0.659 0.696  10.123  -15.281 -5.435 14 C_DC15:DG1_D C 15 ? D 1  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 C DG 1  1_555 D DC 15 1_555 C DC 2  1_555 D DG 14 1_555 -0.613 -0.766 2.975 6.127   6.380  26.649 -2.879 2.511  2.526 13.381 
-12.850 28.053 1  CC_DG1DC2:DG14DC15_DD C 1  ? D 15 ? C 2  ? D 14 ? 
1 C DC 2  1_555 D DG 14 1_555 C DC 3  1_555 D DG 13 1_555 0.509  -0.652 3.485 -3.956  6.960  36.437 -1.979 -1.341 3.240 10.968 
6.235   37.277 2  CC_DC2DC3:DG13DG14_DD C 2  ? D 14 ? C 3  ? D 13 ? 
1 C DC 3  1_555 D DG 13 1_555 C DT 4  1_555 D DA 12 1_555 -0.134 -0.577 3.101 2.918   6.646  31.334 -2.147 0.728  2.896 12.103 
-5.314  32.143 3  CC_DC3DT4:DA12DG13_DD C 3  ? D 13 ? C 4  ? D 12 ? 
1 C DT 4  1_555 D DA 12 1_555 C DA 5  1_555 D DT 11 1_555 0.262  -0.324 3.210 0.581   8.555  31.105 -2.061 -0.371 3.021 15.585 
-1.058  32.237 4  CC_DT4DA5:DT11DA12_DD C 4  ? D 12 ? C 5  ? D 11 ? 
1 C DA 5  1_555 D DT 11 1_555 C DG 6  1_555 D DC 10 1_555 -0.778 -0.321 3.426 -3.285  -2.430 37.065 -0.160 0.756  3.493 -3.809 
5.148   37.282 5  CC_DA5DG6:DC10DT11_DD C 5  ? D 11 ? C 6  ? D 10 ? 
1 C DG 6  1_555 D DC 10 1_555 C DG 7  1_555 D DC 9  1_555 0.169  -0.318 3.261 -1.891  7.635  41.369 -1.223 -0.429 3.146 10.690 
2.648   42.078 6  CC_DG6DG7:DC9DC10_DD  C 6  ? D 10 ? C 7  ? D 9  ? 
1 C DG 7  1_555 D DC 9  1_555 C DC 9  1_555 D DG 7  1_555 0.183  -1.668 3.674 -0.320  -1.728 9.918  -5.783 -1.730 3.897 -9.892 
1.833   10.072 7  CC_DG7DC9:DG7DC9_DD   C 7  ? D 9  ? C 9  ? D 7  ? 
1 C DC 9  1_555 D DG 7  1_555 C DC 10 1_555 D DG 6  1_555 0.001  -0.076 3.246 2.684   7.498  43.225 -0.805 0.251  3.185 10.076 
-3.607  43.918 8  CC_DC9DC10:DG6DG7_DD  C 9  ? D 7  ? C 10 ? D 6  ? 
1 C DC 10 1_555 D DG 6  1_555 C DC 11 1_555 D DG 5  1_555 1.256  -0.127 3.472 5.207   -0.006 40.860 -0.180 -1.176 3.599 -0.008 
-7.421  41.177 9  CC_DC10DC11:DG5DG6_DD C 10 ? D 6  ? C 11 ? D 5  ? 
1 C DC 11 1_555 D DG 5  1_555 C DG 12 1_555 D DC 4  1_555 -0.471 -0.005 2.938 -1.118  7.112  23.366 -2.012 0.799  2.831 17.049 
2.681   24.435 10 CC_DC11DG12:DC4DG5_DD C 11 ? D 5  ? C 12 ? D 4  ? 
1 C DG 12 1_555 D DC 4  1_555 C DT 13 1_555 D DA 3  1_555 0.177  -0.050 3.136 4.894   4.748  34.216 -0.777 0.419  3.097 7.972  
-8.216  34.869 11 CC_DG12DT13:DA3DC4_DD C 12 ? D 4  ? C 13 ? D 3  ? 
1 C DT 13 1_555 D DA 3  1_555 C DC 14 1_555 D DG 2  1_555 -0.224 0.193  3.185 5.097   3.376  32.020 -0.228 1.263  3.117 6.051  
-9.137  32.584 12 CC_DT13DC14:DG2DA3_DD C 13 ? D 3  ? C 14 ? D 2  ? 
1 C DC 14 1_555 D DG 2  1_555 C DC 15 1_555 D DG 1  1_555 0.208  -0.205 3.696 -12.954 8.681  42.752 -1.127 -1.556 3.398 11.463 
17.105  45.381 13 CC_DC14DC15:DG1DG2_DD C 14 ? D 2  ? C 15 ? D 1  ? 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'Japan Agency for Medical Research and Develoment'               Japan 
'Drug Discovery and Life Science Research(Platform for Drug Discovery, Informatics and Structural Life Science)' 1 
'Ministry of Education, Culture, Sports, Science and Technology' Japan 25280109 2 
'Ministry of Education, Culture, Sports, Science and Technology' Japan 26242075 3 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'MAGNESIUM ION'                 MG  
5 '(4S)-2-METHYL-2,4-PENTANEDIOL' MPD 
6 water                           HOH 
#