data_5GOW
# 
_entry.id   5GOW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5GOW         
WWPDB D_1300001191 
BMRB  36013        
# 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.details        . 
_pdbx_database_related.db_id          36013 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.entry_id                        5GOW 
_pdbx_database_status.recvd_initial_deposition_date   2016-07-29 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Okuda, M.'     1 
'Nishimura, Y.' 2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'J. Mol. Biol.' 
_citation.journal_id_ASTM           JMOBAK 
_citation.journal_id_CSD            0070 
_citation.journal_id_ISSN           1089-8638 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            428 
_citation.language                  ? 
_citation.page_first                4993 
_citation.page_last                 5006 
_citation.title                     
'The Interaction Mode of the Acidic Region of the Cell Cycle Transcription Factor DP1 with TFIIH' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2016.11.001 
_citation.pdbx_database_id_PubMed   27825926 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Okuda, M.'     1 
primary 'Araki, K.'     2 
primary 'Ohtani, K.'    3 
primary 'Nishimura, Y.' 4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn DP1                                          2279.022  1 ? ? ?                    ? 
2 polymer man 'General transcription factor IIH subunit 1' 12450.445 1 ? ? 'UNP residues 1-108' ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        
;Basic transcription factor 2 62 kDa subunit,BTF2 p62,General transcription factor IIH polypeptide 1,TFIIH basal transcription factor complex p62 subunit
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no YVGEDDEEDDDFNENDEDD YVGEDDEEDDDFNENDEDD A ? 
2 'polypeptide(L)' no no 
;GSMATSSEEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKISPEGKAKIQLQLVLHAGDTTNFH
FSNESTAVKERDAVKDLLQQLLPKFKRKAN
;
;GSMATSSEEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKISPEGKAKIQLQLVLHAGDTTNFH
FSNESTAVKERDAVKDLLQQLLPKFKRKAN
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   TYR n 
1 2   VAL n 
1 3   GLY n 
1 4   GLU n 
1 5   ASP n 
1 6   ASP n 
1 7   GLU n 
1 8   GLU n 
1 9   ASP n 
1 10  ASP n 
1 11  ASP n 
1 12  PHE n 
1 13  ASN n 
1 14  GLU n 
1 15  ASN n 
1 16  ASP n 
1 17  GLU n 
1 18  ASP n 
1 19  ASP n 
2 1   GLY n 
2 2   SER n 
2 3   MET n 
2 4   ALA n 
2 5   THR n 
2 6   SER n 
2 7   SER n 
2 8   GLU n 
2 9   GLU n 
2 10  VAL n 
2 11  LEU n 
2 12  LEU n 
2 13  ILE n 
2 14  VAL n 
2 15  LYS n 
2 16  LYS n 
2 17  VAL n 
2 18  ARG n 
2 19  GLN n 
2 20  LYS n 
2 21  LYS n 
2 22  GLN n 
2 23  ASP n 
2 24  GLY n 
2 25  ALA n 
2 26  LEU n 
2 27  TYR n 
2 28  LEU n 
2 29  MET n 
2 30  ALA n 
2 31  GLU n 
2 32  ARG n 
2 33  ILE n 
2 34  ALA n 
2 35  TRP n 
2 36  ALA n 
2 37  PRO n 
2 38  GLU n 
2 39  GLY n 
2 40  LYS n 
2 41  ASP n 
2 42  ARG n 
2 43  PHE n 
2 44  THR n 
2 45  ILE n 
2 46  SER n 
2 47  HIS n 
2 48  MET n 
2 49  TYR n 
2 50  ALA n 
2 51  ASP n 
2 52  ILE n 
2 53  LYS n 
2 54  CYS n 
2 55  GLN n 
2 56  LYS n 
2 57  ILE n 
2 58  SER n 
2 59  PRO n 
2 60  GLU n 
2 61  GLY n 
2 62  LYS n 
2 63  ALA n 
2 64  LYS n 
2 65  ILE n 
2 66  GLN n 
2 67  LEU n 
2 68  GLN n 
2 69  LEU n 
2 70  VAL n 
2 71  LEU n 
2 72  HIS n 
2 73  ALA n 
2 74  GLY n 
2 75  ASP n 
2 76  THR n 
2 77  THR n 
2 78  ASN n 
2 79  PHE n 
2 80  HIS n 
2 81  PHE n 
2 82  SER n 
2 83  ASN n 
2 84  GLU n 
2 85  SER n 
2 86  THR n 
2 87  ALA n 
2 88  VAL n 
2 89  LYS n 
2 90  GLU n 
2 91  ARG n 
2 92  ASP n 
2 93  ALA n 
2 94  VAL n 
2 95  LYS n 
2 96  ASP n 
2 97  LEU n 
2 98  LEU n 
2 99  GLN n 
2 100 GLN n 
2 101 LEU n 
2 102 LEU n 
2 103 PRO n 
2 104 LYS n 
2 105 PHE n 
2 106 LYS n 
2 107 ARG n 
2 108 LYS n 
2 109 ALA n 
2 110 ASN n 
# 
_entity_src_gen.entity_id                          2 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   110 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'GTF2H1, BTF2' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              1 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       19 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 PDB 5GOW        5GOW   ? 1 ? 1 
2 UNP TF2H1_HUMAN P32780 ? 2 
;MATSSEEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKISPEGKAKIQLQLVLHAGDTTNFHFS
NESTAVKERDAVKDLLQQLLPKFKRKAN
;
1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5GOW A 1 ? 19  ? 5GOW   392 ? 410 ? 392 410 
2 2 5GOW B 3 ? 110 ? P32780 1   ? 108 ? 1   108 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
2 5GOW GLY B 1 ? UNP P32780 ? ? 'expression tag' -1 1 
2 5GOW SER B 2 ? UNP P32780 ? ? 'expression tag' 0  2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.spectrometer_id 
_pdbx_nmr_exptl.sample_state 
1  1 1 '2D 1H-15N HSQC'          1 isotropic 
2  1 2 '2D 1H-13C HSQC'          1 isotropic 
3  1 2 '2D 1H-13C HSQC aromatic' 1 isotropic 
4  1 1 '3D CBCA(CO)NH'           2 isotropic 
5  1 1 '3D HNCO'                 2 isotropic 
6  1 1 '3D HBHA(CO)NH'           2 isotropic 
7  1 1 '3D C(CO)NH'              2 isotropic 
8  1 1 '3D H(CCO)NH'             2 isotropic 
9  1 1 '3D 1H-15N NOESY'         1 isotropic 
10 1 2 '3D 1H-13C NOESY'         1 isotropic 
11 1 3 '2D 1H-15N HSQC'          1 isotropic 
12 1 4 '2D 1H-13C HSQC'          1 isotropic 
13 1 4 '2D 1H-13C HSQC aromatic' 1 isotropic 
14 1 3 '3D CBCA(CO)NH'           2 isotropic 
15 1 3 '3D HNCO'                 2 isotropic 
16 1 3 '3D HBHA(CO)NH'           2 isotropic 
17 1 3 '3D C(CO)NH'              2 isotropic 
18 1 3 '3D H(CCO)NH'             2 isotropic 
19 1 3 '3D 1H-15N NOESY'         1 isotropic 
20 1 4 '3D 1H-13C NOESY'         1 isotropic 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id          1 
_pdbx_nmr_exptl_sample_conditions.temperature            305 
_pdbx_nmr_exptl_sample_conditions.pressure_units         Torr 
_pdbx_nmr_exptl_sample_conditions.pressure               760 
_pdbx_nmr_exptl_sample_conditions.pH                     6.8 
_pdbx_nmr_exptl_sample_conditions.ionic_strength         0.02 
_pdbx_nmr_exptl_sample_conditions.details                ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_err     ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units   M 
_pdbx_nmr_exptl_sample_conditions.label                  condition_1 
_pdbx_nmr_exptl_sample_conditions.pH_err                 ? 
_pdbx_nmr_exptl_sample_conditions.pH_units               pH 
_pdbx_nmr_exptl_sample_conditions.pressure_err           ? 
_pdbx_nmr_exptl_sample_conditions.temperature_err        ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units      K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
_pdbx_nmr_sample_details.label 
_pdbx_nmr_sample_details.type 
_pdbx_nmr_sample_details.details 
1 '0.35 mM [U-99% 13C; U-99% 15N] DP1, 0.42 mM TFIIH p62, 90% H2O/10% D2O' '90% H2O/10% D2O' DP1-p62 solution ? 
2 '0.35 mM [U-99% 13C; U-99% 15N] DP1, 0.42 mM TFIIH p62, 100% D2O'        '100% D2O'        DP1-p62 solution ? 
3 '0.35 mM [U-99% 13C; U-99% 15N] TFIIH p62, 0.42 mM DP1, 90% H2O/10% D2O' '90% H2O/10% D2O' p62-DP1 solution ? 
4 '0.35 mM [U-99% 13C; U-99% 15N] TFIIH p62, 0.42 mM DP1, 100% D2O'        '100% D2O'        p62-DP1 solution ? 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.details 
1 AvanceIII ? Bruker 950 ? 
2 AvanceIII ? Bruker 600 ? 
# 
_pdbx_nmr_refine.entry_id           5GOW 
_pdbx_nmr_refine.method             'DGSA-distance geometry simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   4 
# 
_pdbx_nmr_ensemble.entry_id                                      5GOW 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.representative_conformer                      ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             5GOW 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.ordinal 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
1 processing                  NMRDraw     ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 
2 'chemical shift assignment' NMRView     ? 'Johnson, One Moon Scientific'                      
3 'structure calculation'     X-PLOR_NIH  ? 'Schwieters, Kuszewski, Tjandra and Clore'          
4 refinement                  X-PLOR_NIH  ? 'Schwieters, Kuszewski, Tjandra and Clore'          
5 'data analysis'             Molmol      ? 'Koradi, Billeter and Wuthrich'                     
6 'data analysis'             ProcheckNMR ? 'Laskowski and MacArthur'                           
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5GOW 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                     5GOW 
_struct.title                        'Solution structure of the complex between DP1 acidic region and TFIIH p62 PH domain' 
_struct.pdbx_descriptor              'DP1, General transcription factor IIH subunit 1' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5GOW 
_struct_keywords.text            
'Transcription factor, General transcription factor, Cell cycle, Transcription activation, Solution structure, TRANSCRIPTION' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 TYR B 49 ? ASP B 51  ? TYR B 47 ASP B 49  5 ? 3  
HELX_P HELX_P2 2 THR B 86 ? LYS B 106 ? THR B 84 LYS B 104 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   7 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR B 44 ? MET B 48 ? THR B 42 MET B 46 
A 2 ARG B 32 ? ALA B 36 ? ARG B 30 ALA B 34 
A 3 ASP B 23 ? MET B 29 ? ASP B 21 MET B 27 
A 4 LEU B 11 ? ARG B 18 ? LEU B 9  ARG B 16 
A 5 ASP B 75 ? PHE B 81 ? ASP B 73 PHE B 79 
A 6 ILE B 65 ? LEU B 71 ? ILE B 63 LEU B 69 
A 7 ILE B 52 ? SER B 58 ? ILE B 50 SER B 56 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O HIS B 47 ? O HIS B 45 N ILE B 33 ? N ILE B 31 
A 2 3 O ALA B 36 ? O ALA B 34 N ALA B 25 ? N ALA B 23 
A 3 4 O LEU B 26 ? O LEU B 24 N VAL B 14 ? N VAL B 12 
A 4 5 N ARG B 18 ? N ARG B 16 O HIS B 80 ? O HIS B 78 
A 5 6 O PHE B 79 ? O PHE B 77 N LEU B 67 ? N LEU B 65 
A 6 7 O VAL B 70 ? O VAL B 68 N CYS B 54 ? N CYS B 52 
# 
_atom_sites.entry_id                    5GOW 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . TYR A 1 1   ? 6.093   10.821  15.783  1.00 0.00 ? 392 TYR A N    1  
ATOM 2     C CA   . TYR A 1 1   ? 6.432   10.357  17.144  1.00 0.00 ? 392 TYR A CA   1  
ATOM 3     C C    . TYR A 1 1   ? 7.341   9.133   17.074  1.00 0.00 ? 392 TYR A C    1  
ATOM 4     O O    . TYR A 1 1   ? 8.013   8.916   16.070  1.00 0.00 ? 392 TYR A O    1  
ATOM 5     C CB   . TYR A 1 1   ? 5.154   10.049  17.944  1.00 0.00 ? 392 TYR A CB   1  
ATOM 6     C CG   . TYR A 1 1   ? 4.156   9.152   17.233  1.00 0.00 ? 392 TYR A CG   1  
ATOM 7     C CD1  . TYR A 1 1   ? 4.251   7.770   17.322  1.00 0.00 ? 392 TYR A CD1  1  
ATOM 8     C CD2  . TYR A 1 1   ? 3.113   9.690   16.486  1.00 0.00 ? 392 TYR A CD2  1  
ATOM 9     C CE1  . TYR A 1 1   ? 3.339   6.948   16.690  1.00 0.00 ? 392 TYR A CE1  1  
ATOM 10    C CE2  . TYR A 1 1   ? 2.196   8.872   15.848  1.00 0.00 ? 392 TYR A CE2  1  
ATOM 11    C CZ   . TYR A 1 1   ? 2.315   7.502   15.953  1.00 0.00 ? 392 TYR A CZ   1  
ATOM 12    O OH   . TYR A 1 1   ? 1.405   6.681   15.330  1.00 0.00 ? 392 TYR A OH   1  
ATOM 13    H H1   . TYR A 1 1   ? 6.924   11.288  15.347  1.00 0.00 ? 392 TYR A H1   1  
ATOM 14    H H2   . TYR A 1 1   ? 5.307   11.497  15.812  1.00 0.00 ? 392 TYR A H2   1  
ATOM 15    H H3   . TYR A 1 1   ? 5.822   10.009  15.185  1.00 0.00 ? 392 TYR A H3   1  
ATOM 16    H HA   . TYR A 1 1   ? 6.970   11.153  17.640  1.00 0.00 ? 392 TYR A HA   1  
ATOM 17    H HB2  . TYR A 1 1   ? 5.431   9.561   18.865  1.00 0.00 ? 392 TYR A HB2  1  
ATOM 18    H HB3  . TYR A 1 1   ? 4.655   10.979  18.175  1.00 0.00 ? 392 TYR A HB3  1  
ATOM 19    H HD1  . TYR A 1 1   ? 5.055   7.335   17.899  1.00 0.00 ? 392 TYR A HD1  1  
ATOM 20    H HD2  . TYR A 1 1   ? 3.024   10.763  16.406  1.00 0.00 ? 392 TYR A HD2  1  
ATOM 21    H HE1  . TYR A 1 1   ? 3.432   5.874   16.774  1.00 0.00 ? 392 TYR A HE1  1  
ATOM 22    H HE2  . TYR A 1 1   ? 1.394   9.308   15.271  1.00 0.00 ? 392 TYR A HE2  1  
ATOM 23    H HH   . TYR A 1 1   ? 0.830   7.207   14.757  1.00 0.00 ? 392 TYR A HH   1  
ATOM 24    N N    . VAL A 1 2   ? 7.368   8.340   18.145  1.00 0.00 ? 393 VAL A N    1  
ATOM 25    C CA   . VAL A 1 2   ? 8.198   7.138   18.192  1.00 0.00 ? 393 VAL A CA   1  
ATOM 26    C C    . VAL A 1 2   ? 7.778   6.154   17.103  1.00 0.00 ? 393 VAL A C    1  
ATOM 27    O O    . VAL A 1 2   ? 6.631   5.709   17.065  1.00 0.00 ? 393 VAL A O    1  
ATOM 28    C CB   . VAL A 1 2   ? 8.108   6.444   19.568  1.00 0.00 ? 393 VAL A CB   1  
ATOM 29    C CG1  . VAL A 1 2   ? 9.108   5.300   19.666  1.00 0.00 ? 393 VAL A CG1  1  
ATOM 30    C CG2  . VAL A 1 2   ? 8.331   7.450   20.689  1.00 0.00 ? 393 VAL A CG2  1  
ATOM 31    H H    . VAL A 1 2   ? 6.813   8.563   18.919  1.00 0.00 ? 393 VAL A H    1  
ATOM 32    H HA   . VAL A 1 2   ? 9.224   7.432   18.023  1.00 0.00 ? 393 VAL A HA   1  
ATOM 33    H HB   . VAL A 1 2   ? 7.115   6.033   19.677  1.00 0.00 ? 393 VAL A HB   1  
ATOM 34    H HG11 . VAL A 1 2   ? 8.979   4.787   20.606  1.00 0.00 ? 393 VAL A HG11 1  
ATOM 35    H HG12 . VAL A 1 2   ? 10.112  5.693   19.604  1.00 0.00 ? 393 VAL A HG12 1  
ATOM 36    H HG13 . VAL A 1 2   ? 8.942   4.608   18.853  1.00 0.00 ? 393 VAL A HG13 1  
ATOM 37    H HG21 . VAL A 1 2   ? 9.313   7.889   20.589  1.00 0.00 ? 393 VAL A HG21 1  
ATOM 38    H HG22 . VAL A 1 2   ? 8.255   6.948   21.644  1.00 0.00 ? 393 VAL A HG22 1  
ATOM 39    H HG23 . VAL A 1 2   ? 7.583   8.226   20.630  1.00 0.00 ? 393 VAL A HG23 1  
ATOM 40    N N    . GLY A 1 3   ? 8.705   5.836   16.211  1.00 0.00 ? 394 GLY A N    1  
ATOM 41    C CA   . GLY A 1 3   ? 8.408   4.921   15.127  1.00 0.00 ? 394 GLY A CA   1  
ATOM 42    C C    . GLY A 1 3   ? 7.843   5.652   13.929  1.00 0.00 ? 394 GLY A C    1  
ATOM 43    O O    . GLY A 1 3   ? 8.553   5.908   12.957  1.00 0.00 ? 394 GLY A O    1  
ATOM 44    H H    . GLY A 1 3   ? 9.594   6.236   16.279  1.00 0.00 ? 394 GLY A H    1  
ATOM 45    H HA2  . GLY A 1 3   ? 9.316   4.412   14.836  1.00 0.00 ? 394 GLY A HA2  1  
ATOM 46    H HA3  . GLY A 1 3   ? 7.686   4.193   15.467  1.00 0.00 ? 394 GLY A HA3  1  
ATOM 47    N N    . GLU A 1 4   ? 6.568   6.001   14.008  1.00 0.00 ? 395 GLU A N    1  
ATOM 48    C CA   . GLU A 1 4   ? 5.907   6.726   12.937  1.00 0.00 ? 395 GLU A CA   1  
ATOM 49    C C    . GLU A 1 4   ? 6.026   8.223   13.195  1.00 0.00 ? 395 GLU A C    1  
ATOM 50    O O    . GLU A 1 4   ? 5.559   8.725   14.222  1.00 0.00 ? 395 GLU A O    1  
ATOM 51    C CB   . GLU A 1 4   ? 4.436   6.306   12.835  1.00 0.00 ? 395 GLU A CB   1  
ATOM 52    C CG   . GLU A 1 4   ? 3.688   6.951   11.678  1.00 0.00 ? 395 GLU A CG   1  
ATOM 53    C CD   . GLU A 1 4   ? 4.475   6.928   10.382  1.00 0.00 ? 395 GLU A CD   1  
ATOM 54    O OE1  . GLU A 1 4   ? 5.265   7.864   10.148  1.00 0.00 ? 395 GLU A OE1  1  
ATOM 55    O OE2  . GLU A 1 4   ? 4.313   5.976   9.591   1.00 0.00 ? 395 GLU A OE2  1  
ATOM 56    H H    . GLU A 1 4   ? 6.060   5.769   14.813  1.00 0.00 ? 395 GLU A H    1  
ATOM 57    H HA   . GLU A 1 4   ? 6.412   6.488   12.011  1.00 0.00 ? 395 GLU A HA   1  
ATOM 58    H HB2  . GLU A 1 4   ? 4.388   5.234   12.711  1.00 0.00 ? 395 GLU A HB2  1  
ATOM 59    H HB3  . GLU A 1 4   ? 3.935   6.575   13.753  1.00 0.00 ? 395 GLU A HB3  1  
ATOM 60    H HG2  . GLU A 1 4   ? 2.761   6.420   11.525  1.00 0.00 ? 395 GLU A HG2  1  
ATOM 61    H HG3  . GLU A 1 4   ? 3.475   7.979   11.934  1.00 0.00 ? 395 GLU A HG3  1  
ATOM 62    N N    . ASP A 1 5   ? 6.651   8.931   12.267  1.00 0.00 ? 396 ASP A N    1  
ATOM 63    C CA   . ASP A 1 5   ? 6.854   10.366  12.410  1.00 0.00 ? 396 ASP A CA   1  
ATOM 64    C C    . ASP A 1 5   ? 6.503   11.113  11.140  1.00 0.00 ? 396 ASP A C    1  
ATOM 65    O O    . ASP A 1 5   ? 7.100   12.143  10.863  1.00 0.00 ? 396 ASP A O    1  
ATOM 66    C CB   . ASP A 1 5   ? 8.310   10.685  12.761  1.00 0.00 ? 396 ASP A CB   1  
ATOM 67    C CG   . ASP A 1 5   ? 8.460   12.011  13.486  1.00 0.00 ? 396 ASP A CG   1  
ATOM 68    O OD1  . ASP A 1 5   ? 7.963   12.127  14.626  1.00 0.00 ? 396 ASP A OD1  1  
ATOM 69    O OD2  . ASP A 1 5   ? 9.075   12.938  12.914  1.00 0.00 ? 396 ASP A OD2  1  
ATOM 70    H H    . ASP A 1 5   ? 6.959   8.482   11.451  1.00 0.00 ? 396 ASP A H    1  
ATOM 71    H HA   . ASP A 1 5   ? 6.218   10.715  13.209  1.00 0.00 ? 396 ASP A HA   1  
ATOM 72    H HB2  . ASP A 1 5   ? 8.707   9.906   13.385  1.00 0.00 ? 396 ASP A HB2  1  
ATOM 73    H HB3  . ASP A 1 5   ? 8.883   10.739  11.844  1.00 0.00 ? 396 ASP A HB3  1  
ATOM 74    N N    . ASP A 1 6   ? 5.573   10.606  10.341  1.00 0.00 ? 397 ASP A N    1  
ATOM 75    C CA   . ASP A 1 6   ? 5.202   11.320  9.120   1.00 0.00 ? 397 ASP A CA   1  
ATOM 76    C C    . ASP A 1 6   ? 4.666   12.695  9.484   1.00 0.00 ? 397 ASP A C    1  
ATOM 77    O O    . ASP A 1 6   ? 4.902   13.669  8.770   1.00 0.00 ? 397 ASP A O    1  
ATOM 78    C CB   . ASP A 1 6   ? 4.185   10.550  8.280   1.00 0.00 ? 397 ASP A CB   1  
ATOM 79    C CG   . ASP A 1 6   ? 4.632   10.442  6.834   1.00 0.00 ? 397 ASP A CG   1  
ATOM 80    O OD1  . ASP A 1 6   ? 5.037   11.474  6.247   1.00 0.00 ? 397 ASP A OD1  1  
ATOM 81    O OD2  . ASP A 1 6   ? 4.618   9.318   6.287   1.00 0.00 ? 397 ASP A OD2  1  
ATOM 82    H H    . ASP A 1 6   ? 5.145   9.743   10.559  1.00 0.00 ? 397 ASP A H    1  
ATOM 83    H HA   . ASP A 1 6   ? 6.105   11.455  8.541   1.00 0.00 ? 397 ASP A HA   1  
ATOM 84    H HB2  . ASP A 1 6   ? 4.071   9.554   8.681   1.00 0.00 ? 397 ASP A HB2  1  
ATOM 85    H HB3  . ASP A 1 6   ? 3.235   11.062  8.310   1.00 0.00 ? 397 ASP A HB3  1  
ATOM 86    N N    . GLU A 1 7   ? 3.959   12.751  10.613  1.00 0.00 ? 398 GLU A N    1  
ATOM 87    C CA   . GLU A 1 7   ? 3.416   13.991  11.162  1.00 0.00 ? 398 GLU A CA   1  
ATOM 88    C C    . GLU A 1 7   ? 2.447   13.670  12.298  1.00 0.00 ? 398 GLU A C    1  
ATOM 89    O O    . GLU A 1 7   ? 2.801   13.747  13.475  1.00 0.00 ? 398 GLU A O    1  
ATOM 90    C CB   . GLU A 1 7   ? 2.718   14.839  10.095  1.00 0.00 ? 398 GLU A CB   1  
ATOM 91    C CG   . GLU A 1 7   ? 3.109   16.305  10.160  1.00 0.00 ? 398 GLU A CG   1  
ATOM 92    C CD   . GLU A 1 7   ? 2.769   17.057  8.893   1.00 0.00 ? 398 GLU A CD   1  
ATOM 93    O OE1  . GLU A 1 7   ? 1.568   17.239  8.609   1.00 0.00 ? 398 GLU A OE1  1  
ATOM 94    O OE2  . GLU A 1 7   ? 3.704   17.455  8.170   1.00 0.00 ? 398 GLU A OE2  1  
ATOM 95    H H    . GLU A 1 7   ? 3.779   11.911  11.091  1.00 0.00 ? 398 GLU A H    1  
ATOM 96    H HA   . GLU A 1 7   ? 4.250   14.552  11.564  1.00 0.00 ? 398 GLU A HA   1  
ATOM 97    H HB2  . GLU A 1 7   ? 2.981   14.457  9.119   1.00 0.00 ? 398 GLU A HB2  1  
ATOM 98    H HB3  . GLU A 1 7   ? 1.651   14.764  10.230  1.00 0.00 ? 398 GLU A HB3  1  
ATOM 99    H HG2  . GLU A 1 7   ? 2.589   16.766  10.985  1.00 0.00 ? 398 GLU A HG2  1  
ATOM 100   H HG3  . GLU A 1 7   ? 4.175   16.370  10.325  1.00 0.00 ? 398 GLU A HG3  1  
ATOM 101   N N    . GLU A 1 8   ? 1.237   13.285  11.928  1.00 0.00 ? 399 GLU A N    1  
ATOM 102   C CA   . GLU A 1 8   ? 0.200   12.927  12.886  1.00 0.00 ? 399 GLU A CA   1  
ATOM 103   C C    . GLU A 1 8   ? -0.547  11.724  12.361  1.00 0.00 ? 399 GLU A C    1  
ATOM 104   O O    . GLU A 1 8   ? -1.232  11.808  11.345  1.00 0.00 ? 399 GLU A O    1  
ATOM 105   C CB   . GLU A 1 8   ? -0.778  14.076  13.129  1.00 0.00 ? 399 GLU A CB   1  
ATOM 106   C CG   . GLU A 1 8   ? -0.906  15.036  11.961  1.00 0.00 ? 399 GLU A CG   1  
ATOM 107   C CD   . GLU A 1 8   ? -2.180  15.857  12.002  1.00 0.00 ? 399 GLU A CD   1  
ATOM 108   O OE1  . GLU A 1 8   ? -2.976  15.675  12.943  1.00 0.00 ? 399 GLU A OE1  1  
ATOM 109   O OE2  . GLU A 1 8   ? -2.393  16.673  11.073  1.00 0.00 ? 399 GLU A OE2  1  
ATOM 110   H H    . GLU A 1 8   ? 1.036   13.212  10.972  1.00 0.00 ? 399 GLU A H    1  
ATOM 111   H HA   . GLU A 1 8   ? 0.676   12.661  13.816  1.00 0.00 ? 399 GLU A HA   1  
ATOM 112   H HB2  . GLU A 1 8   ? -1.756  13.657  13.324  1.00 0.00 ? 399 GLU A HB2  1  
ATOM 113   H HB3  . GLU A 1 8   ? -0.455  14.631  13.993  1.00 0.00 ? 399 GLU A HB3  1  
ATOM 114   H HG2  . GLU A 1 8   ? -0.062  15.708  11.969  1.00 0.00 ? 399 GLU A HG2  1  
ATOM 115   H HG3  . GLU A 1 8   ? -0.896  14.462  11.044  1.00 0.00 ? 399 GLU A HG3  1  
ATOM 116   N N    . ASP A 1 9   ? -0.410  10.608  13.042  1.00 0.00 ? 400 ASP A N    1  
ATOM 117   C CA   . ASP A 1 9   ? -1.055  9.385   12.611  1.00 0.00 ? 400 ASP A CA   1  
ATOM 118   C C    . ASP A 1 9   ? -1.634  8.649   13.805  1.00 0.00 ? 400 ASP A C    1  
ATOM 119   O O    . ASP A 1 9   ? -0.996  7.757   14.363  1.00 0.00 ? 400 ASP A O    1  
ATOM 120   C CB   . ASP A 1 9   ? -0.051  8.481   11.903  1.00 0.00 ? 400 ASP A CB   1  
ATOM 121   C CG   . ASP A 1 9   ? 0.845   9.218   10.924  1.00 0.00 ? 400 ASP A CG   1  
ATOM 122   O OD1  . ASP A 1 9   ? 1.801   9.893   11.369  1.00 0.00 ? 400 ASP A OD1  1  
ATOM 123   O OD2  . ASP A 1 9   ? 0.596   9.106   9.707   1.00 0.00 ? 400 ASP A OD2  1  
ATOM 124   H H    . ASP A 1 9   ? 0.139   10.603  13.851  1.00 0.00 ? 400 ASP A H    1  
ATOM 125   H HA   . ASP A 1 9   ? -1.850  9.649   11.924  1.00 0.00 ? 400 ASP A HA   1  
ATOM 126   H HB2  . ASP A 1 9   ? 0.574   8.011   12.644  1.00 0.00 ? 400 ASP A HB2  1  
ATOM 127   H HB3  . ASP A 1 9   ? -0.594  7.721   11.362  1.00 0.00 ? 400 ASP A HB3  1  
ATOM 128   N N    . ASP A 1 10  ? -2.832  9.029   14.201  1.00 0.00 ? 401 ASP A N    1  
ATOM 129   C CA   . ASP A 1 10  ? -3.477  8.419   15.365  1.00 0.00 ? 401 ASP A CA   1  
ATOM 130   C C    . ASP A 1 10  ? -4.963  8.164   15.152  1.00 0.00 ? 401 ASP A C    1  
ATOM 131   O O    . ASP A 1 10  ? -5.436  7.057   15.404  1.00 0.00 ? 401 ASP A O    1  
ATOM 132   C CB   . ASP A 1 10  ? -3.261  9.290   16.608  1.00 0.00 ? 401 ASP A CB   1  
ATOM 133   C CG   . ASP A 1 10  ? -3.228  10.776  16.283  1.00 0.00 ? 401 ASP A CG   1  
ATOM 134   O OD1  . ASP A 1 10  ? -2.343  11.480  16.805  1.00 0.00 ? 401 ASP A OD1  1  
ATOM 135   O OD2  . ASP A 1 10  ? -4.072  11.236  15.481  1.00 0.00 ? 401 ASP A OD2  1  
ATOM 136   H H    . ASP A 1 10  ? -3.295  9.727   13.700  1.00 0.00 ? 401 ASP A H    1  
ATOM 137   H HA   . ASP A 1 10  ? -3.004  7.459   15.518  1.00 0.00 ? 401 ASP A HA   1  
ATOM 138   H HB2  . ASP A 1 10  ? -4.063  9.112   17.309  1.00 0.00 ? 401 ASP A HB2  1  
ATOM 139   H HB3  . ASP A 1 10  ? -2.321  9.020   17.069  1.00 0.00 ? 401 ASP A HB3  1  
ATOM 140   N N    . ASP A 1 11  ? -5.697  9.171   14.683  1.00 0.00 ? 402 ASP A N    1  
ATOM 141   C CA   . ASP A 1 11  ? -7.137  9.026   14.429  1.00 0.00 ? 402 ASP A CA   1  
ATOM 142   C C    . ASP A 1 11  ? -7.369  8.141   13.213  1.00 0.00 ? 402 ASP A C    1  
ATOM 143   O O    . ASP A 1 11  ? -8.481  8.038   12.692  1.00 0.00 ? 402 ASP A O    1  
ATOM 144   C CB   . ASP A 1 11  ? -7.811  10.388  14.223  1.00 0.00 ? 402 ASP A CB   1  
ATOM 145   C CG   . ASP A 1 11  ? -7.085  11.268  13.224  1.00 0.00 ? 402 ASP A CG   1  
ATOM 146   O OD1  . ASP A 1 11  ? -6.692  10.770  12.145  1.00 0.00 ? 402 ASP A OD1  1  
ATOM 147   O OD2  . ASP A 1 11  ? -6.894  12.461  13.529  1.00 0.00 ? 402 ASP A OD2  1  
ATOM 148   H H    . ASP A 1 11  ? -5.270  10.039  14.518  1.00 0.00 ? 402 ASP A H    1  
ATOM 149   H HA   . ASP A 1 11  ? -7.575  8.546   15.292  1.00 0.00 ? 402 ASP A HA   1  
ATOM 150   H HB2  . ASP A 1 11  ? -8.817  10.231  13.866  1.00 0.00 ? 402 ASP A HB2  1  
ATOM 151   H HB3  . ASP A 1 11  ? -7.848  10.906  15.170  1.00 0.00 ? 402 ASP A HB3  1  
ATOM 152   N N    . PHE A 1 12  ? -6.292  7.504   12.790  1.00 0.00 ? 403 PHE A N    1  
ATOM 153   C CA   . PHE A 1 12  ? -6.276  6.607   11.677  1.00 0.00 ? 403 PHE A CA   1  
ATOM 154   C C    . PHE A 1 12  ? -7.324  5.515   11.866  1.00 0.00 ? 403 PHE A C    1  
ATOM 155   O O    . PHE A 1 12  ? -7.212  4.677   12.759  1.00 0.00 ? 403 PHE A O    1  
ATOM 156   C CB   . PHE A 1 12  ? -4.888  6.014   11.615  1.00 0.00 ? 403 PHE A CB   1  
ATOM 157   C CG   . PHE A 1 12  ? -4.113  6.375   10.410  1.00 0.00 ? 403 PHE A CG   1  
ATOM 158   C CD1  . PHE A 1 12  ? -2.839  6.884   10.522  1.00 0.00 ? 403 PHE A CD1  1  
ATOM 159   C CD2  . PHE A 1 12  ? -4.645  6.156   9.164   1.00 0.00 ? 403 PHE A CD2  1  
ATOM 160   C CE1  . PHE A 1 12  ? -2.104  7.164   9.399   1.00 0.00 ? 403 PHE A CE1  1  
ATOM 161   C CE2  . PHE A 1 12  ? -3.923  6.442   8.038   1.00 0.00 ? 403 PHE A CE2  1  
ATOM 162   C CZ   . PHE A 1 12  ? -2.648  6.941   8.155   1.00 0.00 ? 403 PHE A CZ   1  
ATOM 163   H H    . PHE A 1 12  ? -5.459  7.629   13.280  1.00 0.00 ? 403 PHE A H    1  
ATOM 164   H HA   . PHE A 1 12  ? -6.476  7.155   10.775  1.00 0.00 ? 403 PHE A HA   1  
ATOM 165   H HB2  . PHE A 1 12  ? -4.325  6.335   12.476  1.00 0.00 ? 403 PHE A HB2  1  
ATOM 166   H HB3  . PHE A 1 12  ? -4.974  4.958   11.630  1.00 0.00 ? 403 PHE A HB3  1  
ATOM 167   H HD1  . PHE A 1 12  ? -2.418  7.058   11.505  1.00 0.00 ? 403 PHE A HD1  1  
ATOM 168   H HD2  . PHE A 1 12  ? -5.646  5.763   9.080   1.00 0.00 ? 403 PHE A HD2  1  
ATOM 169   H HE1  . PHE A 1 12  ? -1.106  7.564   9.491   1.00 0.00 ? 403 PHE A HE1  1  
ATOM 170   H HE2  . PHE A 1 12  ? -4.351  6.267   7.062   1.00 0.00 ? 403 PHE A HE2  1  
ATOM 171   H HZ   . PHE A 1 12  ? -2.076  7.142   7.277   1.00 0.00 ? 403 PHE A HZ   1  
ATOM 172   N N    . ASN A 1 13  ? -8.322  5.523   11.007  1.00 0.00 ? 404 ASN A N    1  
ATOM 173   C CA   . ASN A 1 13  ? -9.415  4.570   11.095  1.00 0.00 ? 404 ASN A CA   1  
ATOM 174   C C    . ASN A 1 13  ? -9.166  3.365   10.211  1.00 0.00 ? 404 ASN A C    1  
ATOM 175   O O    . ASN A 1 13  ? -8.785  3.503   9.051   1.00 0.00 ? 404 ASN A O    1  
ATOM 176   C CB   . ASN A 1 13  ? -10.733 5.243   10.701  1.00 0.00 ? 404 ASN A CB   1  
ATOM 177   C CG   . ASN A 1 13  ? -11.515 5.745   11.899  1.00 0.00 ? 404 ASN A CG   1  
ATOM 178   O OD1  . ASN A 1 13  ? -12.440 5.086   12.370  1.00 0.00 ? 404 ASN A OD1  1  
ATOM 179   N ND2  . ASN A 1 13  ? -11.141 6.909   12.409  1.00 0.00 ? 404 ASN A ND2  1  
ATOM 180   H H    . ASN A 1 13  ? -8.310  6.169   10.272  1.00 0.00 ? 404 ASN A H    1  
ATOM 181   H HA   . ASN A 1 13  ? -9.486  4.241   12.120  1.00 0.00 ? 404 ASN A HA   1  
ATOM 182   H HB2  . ASN A 1 13  ? -10.521 6.084   10.058  1.00 0.00 ? 404 ASN A HB2  1  
ATOM 183   H HB3  . ASN A 1 13  ? -11.346 4.532   10.165  1.00 0.00 ? 404 ASN A HB3  1  
ATOM 184   H HD21 . ASN A 1 13  ? -10.385 7.380   11.992  1.00 0.00 ? 404 ASN A HD21 1  
ATOM 185   H HD22 . ASN A 1 13  ? -11.631 7.253   13.181  1.00 0.00 ? 404 ASN A HD22 1  
ATOM 186   N N    . GLU A 1 14  ? -9.377  2.187   10.768  1.00 0.00 ? 405 GLU A N    1  
ATOM 187   C CA   . GLU A 1 14  ? -9.191  0.948   10.036  1.00 0.00 ? 405 GLU A CA   1  
ATOM 188   C C    . GLU A 1 14  ? -10.403 0.666   9.186   1.00 0.00 ? 405 GLU A C    1  
ATOM 189   O O    . GLU A 1 14  ? -11.403 1.385   9.253   1.00 0.00 ? 405 GLU A O    1  
ATOM 190   C CB   . GLU A 1 14  ? -8.989  -0.216  10.996  1.00 0.00 ? 405 GLU A CB   1  
ATOM 191   C CG   . GLU A 1 14  ? -7.570  -0.348  11.486  1.00 0.00 ? 405 GLU A CG   1  
ATOM 192   C CD   . GLU A 1 14  ? -6.677  -1.097  10.518  1.00 0.00 ? 405 GLU A CD   1  
ATOM 193   O OE1  . GLU A 1 14  ? -7.194  -1.626  9.513   1.00 0.00 ? 405 GLU A OE1  1  
ATOM 194   O OE2  . GLU A 1 14  ? -5.450  -1.150  10.766  1.00 0.00 ? 405 GLU A OE2  1  
ATOM 195   H H    . GLU A 1 14  ? -9.684  2.149   11.695  1.00 0.00 ? 405 GLU A H    1  
ATOM 196   H HA   . GLU A 1 14  ? -8.323  1.050   9.404   1.00 0.00 ? 405 GLU A HA   1  
ATOM 197   H HB2  . GLU A 1 14  ? -9.633  -0.079  11.853  1.00 0.00 ? 405 GLU A HB2  1  
ATOM 198   H HB3  . GLU A 1 14  ? -9.261  -1.133  10.496  1.00 0.00 ? 405 GLU A HB3  1  
ATOM 199   H HG2  . GLU A 1 14  ? -7.169  0.643   11.625  1.00 0.00 ? 405 GLU A HG2  1  
ATOM 200   H HG3  . GLU A 1 14  ? -7.583  -0.872  12.426  1.00 0.00 ? 405 GLU A HG3  1  
ATOM 201   N N    . ASN A 1 15  ? -10.321 -0.383  8.391   1.00 0.00 ? 406 ASN A N    1  
ATOM 202   C CA   . ASN A 1 15  ? -11.443 -0.751  7.559   1.00 0.00 ? 406 ASN A CA   1  
ATOM 203   C C    . ASN A 1 15  ? -11.305 -2.168  7.021   1.00 0.00 ? 406 ASN A C    1  
ATOM 204   O O    . ASN A 1 15  ? -12.296 -2.794  6.653   1.00 0.00 ? 406 ASN A O    1  
ATOM 205   C CB   . ASN A 1 15  ? -11.615 0.243   6.410   1.00 0.00 ? 406 ASN A CB   1  
ATOM 206   C CG   . ASN A 1 15  ? -13.063 0.652   6.218   1.00 0.00 ? 406 ASN A CG   1  
ATOM 207   O OD1  . ASN A 1 15  ? -13.788 0.073   5.409   1.00 0.00 ? 406 ASN A OD1  1  
ATOM 208   N ND2  . ASN A 1 15  ? -13.498 1.650   6.971   1.00 0.00 ? 406 ASN A ND2  1  
ATOM 209   H H    . ASN A 1 15  ? -9.495  -0.910  8.368   1.00 0.00 ? 406 ASN A H    1  
ATOM 210   H HA   . ASN A 1 15  ? -12.311 -0.707  8.191   1.00 0.00 ? 406 ASN A HA   1  
ATOM 211   H HB2  . ASN A 1 15  ? -11.037 1.131   6.622   1.00 0.00 ? 406 ASN A HB2  1  
ATOM 212   H HB3  . ASN A 1 15  ? -11.259 -0.205  5.496   1.00 0.00 ? 406 ASN A HB3  1  
ATOM 213   H HD21 . ASN A 1 15  ? -12.868 2.061   7.604   1.00 0.00 ? 406 ASN A HD21 1  
ATOM 214   H HD22 . ASN A 1 15  ? -14.428 1.936   6.869   1.00 0.00 ? 406 ASN A HD22 1  
ATOM 215   N N    . ASP A 1 16  ? -10.080 -2.676  6.974   1.00 0.00 ? 407 ASP A N    1  
ATOM 216   C CA   . ASP A 1 16  ? -9.849  -4.033  6.488   1.00 0.00 ? 407 ASP A CA   1  
ATOM 217   C C    . ASP A 1 16  ? -10.099 -5.041  7.605   1.00 0.00 ? 407 ASP A C    1  
ATOM 218   O O    . ASP A 1 16  ? -10.290 -6.229  7.347   1.00 0.00 ? 407 ASP A O    1  
ATOM 219   C CB   . ASP A 1 16  ? -8.429  -4.179  5.948   1.00 0.00 ? 407 ASP A CB   1  
ATOM 220   C CG   . ASP A 1 16  ? -8.392  -4.563  4.481   1.00 0.00 ? 407 ASP A CG   1  
ATOM 221   O OD1  . ASP A 1 16  ? -8.594  -5.755  4.170   1.00 0.00 ? 407 ASP A OD1  1  
ATOM 222   O OD2  . ASP A 1 16  ? -8.142  -3.674  3.640   1.00 0.00 ? 407 ASP A OD2  1  
ATOM 223   H H    . ASP A 1 16  ? -9.320  -2.131  7.258   1.00 0.00 ? 407 ASP A H    1  
ATOM 224   H HA   . ASP A 1 16  ? -10.551 -4.220  5.688   1.00 0.00 ? 407 ASP A HA   1  
ATOM 225   H HB2  . ASP A 1 16  ? -7.909  -3.239  6.065   1.00 0.00 ? 407 ASP A HB2  1  
ATOM 226   H HB3  . ASP A 1 16  ? -7.914  -4.941  6.513   1.00 0.00 ? 407 ASP A HB3  1  
ATOM 227   N N    . GLU A 1 17  ? -10.061 -4.541  8.847   1.00 0.00 ? 408 GLU A N    1  
ATOM 228   C CA   . GLU A 1 17  ? -10.313 -5.338  10.050  1.00 0.00 ? 408 GLU A CA   1  
ATOM 229   C C    . GLU A 1 17  ? -9.127  -6.223  10.393  1.00 0.00 ? 408 GLU A C    1  
ATOM 230   O O    . GLU A 1 17  ? -8.065  -6.132  9.767   1.00 0.00 ? 408 GLU A O    1  
ATOM 231   C CB   . GLU A 1 17  ? -11.579 -6.185  9.907   1.00 0.00 ? 408 GLU A CB   1  
ATOM 232   C CG   . GLU A 1 17  ? -12.631 -5.879  10.957  1.00 0.00 ? 408 GLU A CG   1  
ATOM 233   C CD   . GLU A 1 17  ? -12.064 -5.837  12.359  1.00 0.00 ? 408 GLU A CD   1  
ATOM 234   O OE1  . GLU A 1 17  ? -12.079 -4.754  12.976  1.00 0.00 ? 408 GLU A OE1  1  
ATOM 235   O OE2  . GLU A 1 17  ? -11.586 -6.889  12.832  1.00 0.00 ? 408 GLU A OE2  1  
ATOM 236   H H    . GLU A 1 17  ? -9.817  -3.605  8.961   1.00 0.00 ? 408 GLU A H    1  
ATOM 237   H HA   . GLU A 1 17  ? -10.458 -4.644  10.865  1.00 0.00 ? 408 GLU A HA   1  
ATOM 238   H HB2  . GLU A 1 17  ? -12.010 -6.009  8.933   1.00 0.00 ? 408 GLU A HB2  1  
ATOM 239   H HB3  . GLU A 1 17  ? -11.312 -7.228  9.991   1.00 0.00 ? 408 GLU A HB3  1  
ATOM 240   H HG2  . GLU A 1 17  ? -13.067 -4.919  10.737  1.00 0.00 ? 408 GLU A HG2  1  
ATOM 241   H HG3  . GLU A 1 17  ? -13.391 -6.642  10.916  1.00 0.00 ? 408 GLU A HG3  1  
ATOM 242   N N    . ASP A 1 18  ? -9.302  -7.068  11.400  1.00 0.00 ? 409 ASP A N    1  
ATOM 243   C CA   . ASP A 1 18  ? -8.242  -7.956  11.822  1.00 0.00 ? 409 ASP A CA   1  
ATOM 244   C C    . ASP A 1 18  ? -8.105  -9.137  10.877  1.00 0.00 ? 409 ASP A C    1  
ATOM 245   O O    . ASP A 1 18  ? -8.710  -10.193 11.072  1.00 0.00 ? 409 ASP A O    1  
ATOM 246   C CB   . ASP A 1 18  ? -8.442  -8.453  13.253  1.00 0.00 ? 409 ASP A CB   1  
ATOM 247   C CG   . ASP A 1 18  ? -7.280  -9.315  13.710  1.00 0.00 ? 409 ASP A CG   1  
ATOM 248   O OD1  . ASP A 1 18  ? -7.499  -10.500 14.028  1.00 0.00 ? 409 ASP A OD1  1  
ATOM 249   O OD2  . ASP A 1 18  ? -6.133  -8.807  13.721  1.00 0.00 ? 409 ASP A OD2  1  
ATOM 250   H H    . ASP A 1 18  ? -10.169 -7.084  11.881  1.00 0.00 ? 409 ASP A H    1  
ATOM 251   H HA   . ASP A 1 18  ? -7.333  -7.384  11.782  1.00 0.00 ? 409 ASP A HA   1  
ATOM 252   H HB2  . ASP A 1 18  ? -8.524  -7.605  13.916  1.00 0.00 ? 409 ASP A HB2  1  
ATOM 253   H HB3  . ASP A 1 18  ? -9.347  -9.039  13.304  1.00 0.00 ? 409 ASP A HB3  1  
ATOM 254   N N    . ASP A 1 19  ? -7.335  -8.928  9.827   1.00 0.00 ? 410 ASP A N    1  
ATOM 255   C CA   . ASP A 1 19  ? -7.072  -9.960  8.842   1.00 0.00 ? 410 ASP A CA   1  
ATOM 256   C C    . ASP A 1 19  ? -6.099  -10.976 9.421   1.00 0.00 ? 410 ASP A C    1  
ATOM 257   O O    . ASP A 1 19  ? -6.478  -12.155 9.553   1.00 0.00 ? 410 ASP A O    1  
ATOM 258   C CB   . ASP A 1 19  ? -6.492  -9.335  7.577   1.00 0.00 ? 410 ASP A CB   1  
ATOM 259   C CG   . ASP A 1 19  ? -6.444  -10.296 6.410   1.00 0.00 ? 410 ASP A CG   1  
ATOM 260   O OD1  . ASP A 1 19  ? -5.417  -10.975 6.238   1.00 0.00 ? 410 ASP A OD1  1  
ATOM 261   O OD2  . ASP A 1 19  ? -7.430  -10.344 5.641   1.00 0.00 ? 410 ASP A OD2  1  
ATOM 262   O OXT  . ASP A 1 19  ? -4.975  -10.574 9.788   1.00 0.00 ? 410 ASP A OXT  1  
ATOM 263   H H    . ASP A 1 19  ? -6.947  -8.039  9.696   1.00 0.00 ? 410 ASP A H    1  
ATOM 264   H HA   . ASP A 1 19  ? -8.004  -10.452 8.606   1.00 0.00 ? 410 ASP A HA   1  
ATOM 265   H HB2  . ASP A 1 19  ? -7.099  -8.489  7.293   1.00 0.00 ? 410 ASP A HB2  1  
ATOM 266   H HB3  . ASP A 1 19  ? -5.487  -8.997  7.782   1.00 0.00 ? 410 ASP A HB3  1  
ATOM 267   N N    . MET B 2 3   ? 3.329   -9.183  -8.340  1.00 0.00 ? 1   MET B N    1  
ATOM 268   C CA   . MET B 2 3   ? 4.700   -9.722  -8.234  1.00 0.00 ? 1   MET B CA   1  
ATOM 269   C C    . MET B 2 3   ? 5.573   -9.170  -9.352  1.00 0.00 ? 1   MET B C    1  
ATOM 270   O O    . MET B 2 3   ? 6.311   -8.211  -9.147  1.00 0.00 ? 1   MET B O    1  
ATOM 271   C CB   . MET B 2 3   ? 4.680   -11.253 -8.283  1.00 0.00 ? 1   MET B CB   1  
ATOM 272   C CG   . MET B 2 3   ? 6.017   -11.890 -7.931  1.00 0.00 ? 1   MET B CG   1  
ATOM 273   S SD   . MET B 2 3   ? 6.624   -11.363 -6.317  1.00 0.00 ? 1   MET B SD   1  
ATOM 274   C CE   . MET B 2 3   ? 8.139   -12.312 -6.193  1.00 0.00 ? 1   MET B CE   1  
ATOM 275   H H    . MET B 2 3   ? 2.709   -9.855  -8.853  1.00 0.00 ? 1   MET B H    1  
ATOM 276   H HA   . MET B 2 3   ? 5.113   -9.406  -7.287  1.00 0.00 ? 1   MET B HA   1  
ATOM 277   H HB2  . MET B 2 3   ? 3.939   -11.614 -7.587  1.00 0.00 ? 1   MET B HB2  1  
ATOM 278   H HB3  . MET B 2 3   ? 4.408   -11.567 -9.281  1.00 0.00 ? 1   MET B HB3  1  
ATOM 279   H HG2  . MET B 2 3   ? 5.898   -12.963 -7.924  1.00 0.00 ? 1   MET B HG2  1  
ATOM 280   H HG3  . MET B 2 3   ? 6.742   -11.613 -8.682  1.00 0.00 ? 1   MET B HG3  1  
ATOM 281   H HE1  . MET B 2 3   ? 8.824   -12.001 -6.968  1.00 0.00 ? 1   MET B HE1  1  
ATOM 282   H HE2  . MET B 2 3   ? 7.916   -13.362 -6.311  1.00 0.00 ? 1   MET B HE2  1  
ATOM 283   H HE3  . MET B 2 3   ? 8.590   -12.145 -5.227  1.00 0.00 ? 1   MET B HE3  1  
ATOM 284   N N    . ALA B 2 4   ? 5.466   -9.766  -10.534 1.00 0.00 ? 2   ALA B N    1  
ATOM 285   C CA   . ALA B 2 4   ? 6.244   -9.336  -11.688 1.00 0.00 ? 2   ALA B CA   1  
ATOM 286   C C    . ALA B 2 4   ? 5.597   -9.844  -12.969 1.00 0.00 ? 2   ALA B C    1  
ATOM 287   O O    . ALA B 2 4   ? 6.179   -10.640 -13.706 1.00 0.00 ? 2   ALA B O    1  
ATOM 288   C CB   . ALA B 2 4   ? 7.682   -9.832  -11.581 1.00 0.00 ? 2   ALA B CB   1  
ATOM 289   H H    . ALA B 2 4   ? 4.840   -10.512 -10.640 1.00 0.00 ? 2   ALA B H    1  
ATOM 290   H HA   . ALA B 2 4   ? 6.256   -8.256  -11.703 1.00 0.00 ? 2   ALA B HA   1  
ATOM 291   H HB1  . ALA B 2 4   ? 8.118   -9.472  -10.659 1.00 0.00 ? 2   ALA B HB1  1  
ATOM 292   H HB2  . ALA B 2 4   ? 8.255   -9.462  -12.419 1.00 0.00 ? 2   ALA B HB2  1  
ATOM 293   H HB3  . ALA B 2 4   ? 7.692   -10.912 -11.586 1.00 0.00 ? 2   ALA B HB3  1  
ATOM 294   N N    . THR B 2 5   ? 4.372   -9.401  -13.210 1.00 0.00 ? 3   THR B N    1  
ATOM 295   C CA   . THR B 2 5   ? 3.622   -9.811  -14.390 1.00 0.00 ? 3   THR B CA   1  
ATOM 296   C C    . THR B 2 5   ? 2.551   -8.778  -14.734 1.00 0.00 ? 3   THR B C    1  
ATOM 297   O O    . THR B 2 5   ? 2.641   -8.089  -15.750 1.00 0.00 ? 3   THR B O    1  
ATOM 298   C CB   . THR B 2 5   ? 2.952   -11.188 -14.188 1.00 0.00 ? 3   THR B CB   1  
ATOM 299   O OG1  . THR B 2 5   ? 3.896   -12.123 -13.646 1.00 0.00 ? 3   THR B OG1  1  
ATOM 300   C CG2  . THR B 2 5   ? 2.406   -11.727 -15.504 1.00 0.00 ? 3   THR B CG2  1  
ATOM 301   H H    . THR B 2 5   ? 3.969   -8.757  -12.589 1.00 0.00 ? 3   THR B H    1  
ATOM 302   H HA   . THR B 2 5   ? 4.315   -9.886  -15.216 1.00 0.00 ? 3   THR B HA   1  
ATOM 303   H HB   . THR B 2 5   ? 2.130   -11.075 -13.495 1.00 0.00 ? 3   THR B HB   1  
ATOM 304   H HG1  . THR B 2 5   ? 4.792   -11.806 -13.825 1.00 0.00 ? 3   THR B HG1  1  
ATOM 305   H HG21 . THR B 2 5   ? 1.921   -12.675 -15.331 1.00 0.00 ? 3   THR B HG21 1  
ATOM 306   H HG22 . THR B 2 5   ? 3.219   -11.860 -16.202 1.00 0.00 ? 3   THR B HG22 1  
ATOM 307   H HG23 . THR B 2 5   ? 1.693   -11.025 -15.911 1.00 0.00 ? 3   THR B HG23 1  
ATOM 308   N N    . SER B 2 6   ? 1.544   -8.664  -13.879 1.00 0.00 ? 4   SER B N    1  
ATOM 309   C CA   . SER B 2 6   ? 0.460   -7.722  -14.105 1.00 0.00 ? 4   SER B CA   1  
ATOM 310   C C    . SER B 2 6   ? 0.593   -6.505  -13.195 1.00 0.00 ? 4   SER B C    1  
ATOM 311   O O    . SER B 2 6   ? 0.018   -5.450  -13.461 1.00 0.00 ? 4   SER B O    1  
ATOM 312   C CB   . SER B 2 6   ? -0.883  -8.415  -13.875 1.00 0.00 ? 4   SER B CB   1  
ATOM 313   O OG   . SER B 2 6   ? -0.701  -9.691  -13.282 1.00 0.00 ? 4   SER B OG   1  
ATOM 314   H H    . SER B 2 6   ? 1.522   -9.234  -13.076 1.00 0.00 ? 4   SER B H    1  
ATOM 315   H HA   . SER B 2 6   ? 0.515   -7.396  -15.132 1.00 0.00 ? 4   SER B HA   1  
ATOM 316   H HB2  . SER B 2 6   ? -1.492  -7.810  -13.219 1.00 0.00 ? 4   SER B HB2  1  
ATOM 317   H HB3  . SER B 2 6   ? -1.389  -8.541  -14.821 1.00 0.00 ? 4   SER B HB3  1  
ATOM 318   H HG   . SER B 2 6   ? -0.217  -9.593  -12.444 1.00 0.00 ? 4   SER B HG   1  
ATOM 319   N N    . SER B 2 7   ? 1.373   -6.646  -12.131 1.00 0.00 ? 5   SER B N    1  
ATOM 320   C CA   . SER B 2 7   ? 1.580   -5.561  -11.181 1.00 0.00 ? 5   SER B CA   1  
ATOM 321   C C    . SER B 2 7   ? 2.543   -4.515  -11.718 1.00 0.00 ? 5   SER B C    1  
ATOM 322   O O    . SER B 2 7   ? 3.084   -3.720  -10.965 1.00 0.00 ? 5   SER B O    1  
ATOM 323   C CB   . SER B 2 7   ? 2.109   -6.115  -9.858  1.00 0.00 ? 5   SER B CB   1  
ATOM 324   O OG   . SER B 2 7   ? 3.098   -7.110  -10.071 1.00 0.00 ? 5   SER B OG   1  
ATOM 325   H H    . SER B 2 7   ? 1.811   -7.512  -11.969 1.00 0.00 ? 5   SER B H    1  
ATOM 326   H HA   . SER B 2 7   ? 0.627   -5.092  -11.009 1.00 0.00 ? 5   SER B HA   1  
ATOM 327   H HB2  . SER B 2 7   ? 2.544   -5.312  -9.282  1.00 0.00 ? 5   SER B HB2  1  
ATOM 328   H HB3  . SER B 2 7   ? 1.292   -6.552  -9.301  1.00 0.00 ? 5   SER B HB3  1  
ATOM 329   H HG   . SER B 2 7   ? 3.661   -6.852  -10.833 1.00 0.00 ? 5   SER B HG   1  
ATOM 330   N N    . GLU B 2 8   ? 2.722   -4.496  -13.021 1.00 0.00 ? 6   GLU B N    1  
ATOM 331   C CA   . GLU B 2 8   ? 3.632   -3.557  -13.648 1.00 0.00 ? 6   GLU B CA   1  
ATOM 332   C C    . GLU B 2 8   ? 2.828   -2.476  -14.338 1.00 0.00 ? 6   GLU B C    1  
ATOM 333   O O    . GLU B 2 8   ? 3.367   -1.566  -14.962 1.00 0.00 ? 6   GLU B O    1  
ATOM 334   C CB   . GLU B 2 8   ? 4.567   -4.264  -14.640 1.00 0.00 ? 6   GLU B CB   1  
ATOM 335   C CG   . GLU B 2 8   ? 4.834   -5.738  -14.327 1.00 0.00 ? 6   GLU B CG   1  
ATOM 336   C CD   . GLU B 2 8   ? 5.311   -5.982  -12.904 1.00 0.00 ? 6   GLU B CD   1  
ATOM 337   O OE1  . GLU B 2 8   ? 4.613   -6.709  -12.155 1.00 0.00 ? 6   GLU B OE1  1  
ATOM 338   O OE2  . GLU B 2 8   ? 6.373   -5.447  -12.522 1.00 0.00 ? 6   GLU B OE2  1  
ATOM 339   H H    . GLU B 2 8   ? 2.206   -5.107  -13.577 1.00 0.00 ? 6   GLU B H    1  
ATOM 340   H HA   . GLU B 2 8   ? 4.211   -3.103  -12.870 1.00 0.00 ? 6   GLU B HA   1  
ATOM 341   H HB2  . GLU B 2 8   ? 4.131   -4.207  -15.627 1.00 0.00 ? 6   GLU B HB2  1  
ATOM 342   H HB3  . GLU B 2 8   ? 5.515   -3.746  -14.649 1.00 0.00 ? 6   GLU B HB3  1  
ATOM 343   H HG2  . GLU B 2 8   ? 3.920   -6.293  -14.478 1.00 0.00 ? 6   GLU B HG2  1  
ATOM 344   H HG3  . GLU B 2 8   ? 5.588   -6.103  -15.009 1.00 0.00 ? 6   GLU B HG3  1  
ATOM 345   N N    . GLU B 2 9   ? 1.526   -2.598  -14.184 1.00 0.00 ? 7   GLU B N    1  
ATOM 346   C CA   . GLU B 2 9   ? 0.580   -1.657  -14.749 1.00 0.00 ? 7   GLU B CA   1  
ATOM 347   C C    . GLU B 2 9   ? -0.099  -0.903  -13.618 1.00 0.00 ? 7   GLU B C    1  
ATOM 348   O O    . GLU B 2 9   ? -0.504  -1.500  -12.615 1.00 0.00 ? 7   GLU B O    1  
ATOM 349   C CB   . GLU B 2 9   ? -0.456  -2.378  -15.615 1.00 0.00 ? 7   GLU B CB   1  
ATOM 350   C CG   . GLU B 2 9   ? -1.363  -1.434  -16.391 1.00 0.00 ? 7   GLU B CG   1  
ATOM 351   C CD   . GLU B 2 9   ? -0.585  -0.393  -17.176 1.00 0.00 ? 7   GLU B CD   1  
ATOM 352   O OE1  . GLU B 2 9   ? -0.167  0.619   -16.569 1.00 0.00 ? 7   GLU B OE1  1  
ATOM 353   O OE2  . GLU B 2 9   ? -0.391  -0.590  -18.393 1.00 0.00 ? 7   GLU B OE2  1  
ATOM 354   H H    . GLU B 2 9   ? 1.194   -3.342  -13.651 1.00 0.00 ? 7   GLU B H    1  
ATOM 355   H HA   . GLU B 2 9   ? 1.130   -0.955  -15.360 1.00 0.00 ? 7   GLU B HA   1  
ATOM 356   H HB2  . GLU B 2 9   ? 0.060   -3.010  -16.323 1.00 0.00 ? 7   GLU B HB2  1  
ATOM 357   H HB3  . GLU B 2 9   ? -1.074  -2.994  -14.979 1.00 0.00 ? 7   GLU B HB3  1  
ATOM 358   H HG2  . GLU B 2 9   ? -1.958  -2.013  -17.082 1.00 0.00 ? 7   GLU B HG2  1  
ATOM 359   H HG3  . GLU B 2 9   ? -2.014  -0.927  -15.695 1.00 0.00 ? 7   GLU B HG3  1  
ATOM 360   N N    . VAL B 2 10  ? -0.226  0.398   -13.782 1.00 0.00 ? 8   VAL B N    1  
ATOM 361   C CA   . VAL B 2 10  ? -0.818  1.246   -12.763 1.00 0.00 ? 8   VAL B CA   1  
ATOM 362   C C    . VAL B 2 10  ? -2.308  1.440   -12.997 1.00 0.00 ? 8   VAL B C    1  
ATOM 363   O O    . VAL B 2 10  ? -2.730  1.920   -14.046 1.00 0.00 ? 8   VAL B O    1  
ATOM 364   C CB   . VAL B 2 10  ? -0.120  2.614   -12.720 1.00 0.00 ? 8   VAL B CB   1  
ATOM 365   C CG1  . VAL B 2 10  ? -0.798  3.530   -11.714 1.00 0.00 ? 8   VAL B CG1  1  
ATOM 366   C CG2  . VAL B 2 10  ? 1.351   2.428   -12.387 1.00 0.00 ? 8   VAL B CG2  1  
ATOM 367   H H    . VAL B 2 10  ? 0.056   0.800   -14.640 1.00 0.00 ? 8   VAL B H    1  
ATOM 368   H HA   . VAL B 2 10  ? -0.674  0.770   -11.801 1.00 0.00 ? 8   VAL B HA   1  
ATOM 369   H HB   . VAL B 2 10  ? -0.194  3.068   -13.697 1.00 0.00 ? 8   VAL B HB   1  
ATOM 370   H HG11 . VAL B 2 10  ? -0.269  4.470   -11.666 1.00 0.00 ? 8   VAL B HG11 1  
ATOM 371   H HG12 . VAL B 2 10  ? -0.792  3.063   -10.740 1.00 0.00 ? 8   VAL B HG12 1  
ATOM 372   H HG13 . VAL B 2 10  ? -1.819  3.707   -12.021 1.00 0.00 ? 8   VAL B HG13 1  
ATOM 373   H HG21 . VAL B 2 10  ? 1.444   1.953   -11.420 1.00 0.00 ? 8   VAL B HG21 1  
ATOM 374   H HG22 . VAL B 2 10  ? 1.842   3.387   -12.366 1.00 0.00 ? 8   VAL B HG22 1  
ATOM 375   H HG23 . VAL B 2 10  ? 1.812   1.801   -13.138 1.00 0.00 ? 8   VAL B HG23 1  
ATOM 376   N N    . LEU B 2 11  ? -3.098  1.073   -12.002 1.00 0.00 ? 9   LEU B N    1  
ATOM 377   C CA   . LEU B 2 11  ? -4.539  1.204   -12.093 1.00 0.00 ? 9   LEU B CA   1  
ATOM 378   C C    . LEU B 2 11  ? -4.998  2.507   -11.450 1.00 0.00 ? 9   LEU B C    1  
ATOM 379   O O    . LEU B 2 11  ? -6.010  3.086   -11.842 1.00 0.00 ? 9   LEU B O    1  
ATOM 380   C CB   . LEU B 2 11  ? -5.232  0.017   -11.412 1.00 0.00 ? 9   LEU B CB   1  
ATOM 381   C CG   . LEU B 2 11  ? -4.707  -1.371  -11.796 1.00 0.00 ? 9   LEU B CG   1  
ATOM 382   C CD1  . LEU B 2 11  ? -5.438  -2.449  -11.012 1.00 0.00 ? 9   LEU B CD1  1  
ATOM 383   C CD2  . LEU B 2 11  ? -4.858  -1.608  -13.292 1.00 0.00 ? 9   LEU B CD2  1  
ATOM 384   H H    . LEU B 2 11  ? -2.697  0.708   -11.182 1.00 0.00 ? 9   LEU B H    1  
ATOM 385   H HA   . LEU B 2 11  ? -4.803  1.218   -13.137 1.00 0.00 ? 9   LEU B HA   1  
ATOM 386   H HB2  . LEU B 2 11  ? -5.124  0.134   -10.343 1.00 0.00 ? 9   LEU B HB2  1  
ATOM 387   H HB3  . LEU B 2 11  ? -6.283  0.057   -11.654 1.00 0.00 ? 9   LEU B HB3  1  
ATOM 388   H HG   . LEU B 2 11  ? -3.657  -1.437  -11.549 1.00 0.00 ? 9   LEU B HG   1  
ATOM 389   H HD11 . LEU B 2 11  ? -5.321  -2.266  -9.953  1.00 0.00 ? 9   LEU B HD11 1  
ATOM 390   H HD12 . LEU B 2 11  ? -5.025  -3.415  -11.257 1.00 0.00 ? 9   LEU B HD12 1  
ATOM 391   H HD13 . LEU B 2 11  ? -6.487  -2.430  -11.267 1.00 0.00 ? 9   LEU B HD13 1  
ATOM 392   H HD21 . LEU B 2 11  ? -5.900  -1.525  -13.566 1.00 0.00 ? 9   LEU B HD21 1  
ATOM 393   H HD22 . LEU B 2 11  ? -4.499  -2.596  -13.539 1.00 0.00 ? 9   LEU B HD22 1  
ATOM 394   H HD23 . LEU B 2 11  ? -4.285  -0.871  -13.833 1.00 0.00 ? 9   LEU B HD23 1  
ATOM 395   N N    . LEU B 2 12  ? -4.250  2.963   -10.457 1.00 0.00 ? 10  LEU B N    1  
ATOM 396   C CA   . LEU B 2 12  ? -4.585  4.189   -9.751  1.00 0.00 ? 10  LEU B CA   1  
ATOM 397   C C    . LEU B 2 12  ? -3.376  5.094   -9.590  1.00 0.00 ? 10  LEU B C    1  
ATOM 398   O O    . LEU B 2 12  ? -2.355  4.681   -9.040  1.00 0.00 ? 10  LEU B O    1  
ATOM 399   C CB   . LEU B 2 12  ? -5.134  3.850   -8.375  1.00 0.00 ? 10  LEU B CB   1  
ATOM 400   C CG   . LEU B 2 12  ? -5.560  5.058   -7.539  1.00 0.00 ? 10  LEU B CG   1  
ATOM 401   C CD1  . LEU B 2 12  ? -7.014  5.413   -7.770  1.00 0.00 ? 10  LEU B CD1  1  
ATOM 402   C CD2  . LEU B 2 12  ? -5.316  4.797   -6.069  1.00 0.00 ? 10  LEU B CD2  1  
ATOM 403   H H    . LEU B 2 12  ? -3.458  2.456   -10.182 1.00 0.00 ? 10  LEU B H    1  
ATOM 404   H HA   . LEU B 2 12  ? -5.344  4.710   -10.312 1.00 0.00 ? 10  LEU B HA   1  
ATOM 405   H HB2  . LEU B 2 12  ? -5.977  3.195   -8.507  1.00 0.00 ? 10  LEU B HB2  1  
ATOM 406   H HB3  . LEU B 2 12  ? -4.370  3.316   -7.831  1.00 0.00 ? 10  LEU B HB3  1  
ATOM 407   H HG   . LEU B 2 12  ? -4.963  5.909   -7.830  1.00 0.00 ? 10  LEU B HG   1  
ATOM 408   H HD11 . LEU B 2 12  ? -7.634  4.569   -7.509  1.00 0.00 ? 10  LEU B HD11 1  
ATOM 409   H HD12 . LEU B 2 12  ? -7.162  5.668   -8.806  1.00 0.00 ? 10  LEU B HD12 1  
ATOM 410   H HD13 . LEU B 2 12  ? -7.277  6.258   -7.147  1.00 0.00 ? 10  LEU B HD13 1  
ATOM 411   H HD21 . LEU B 2 12  ? -4.293  4.482   -5.923  1.00 0.00 ? 10  LEU B HD21 1  
ATOM 412   H HD22 . LEU B 2 12  ? -5.984  4.021   -5.726  1.00 0.00 ? 10  LEU B HD22 1  
ATOM 413   H HD23 . LEU B 2 12  ? -5.496  5.701   -5.507  1.00 0.00 ? 10  LEU B HD23 1  
ATOM 414   N N    . ILE B 2 13  ? -3.493  6.323   -10.066 1.00 0.00 ? 11  ILE B N    1  
ATOM 415   C CA   . ILE B 2 13  ? -2.416  7.286   -9.935  1.00 0.00 ? 11  ILE B CA   1  
ATOM 416   C C    . ILE B 2 13  ? -2.803  8.352   -8.927  1.00 0.00 ? 11  ILE B C    1  
ATOM 417   O O    . ILE B 2 13  ? -3.826  9.022   -9.074  1.00 0.00 ? 11  ILE B O    1  
ATOM 418   C CB   . ILE B 2 13  ? -2.049  7.973   -11.263 1.00 0.00 ? 11  ILE B CB   1  
ATOM 419   C CG1  . ILE B 2 13  ? -1.721  6.930   -12.336 1.00 0.00 ? 11  ILE B CG1  1  
ATOM 420   C CG2  . ILE B 2 13  ? -0.870  8.915   -11.038 1.00 0.00 ? 11  ILE B CG2  1  
ATOM 421   C CD1  . ILE B 2 13  ? -1.388  7.527   -13.686 1.00 0.00 ? 11  ILE B CD1  1  
ATOM 422   H H    . ILE B 2 13  ? -4.325  6.592   -10.507 1.00 0.00 ? 11  ILE B H    1  
ATOM 423   H HA   . ILE B 2 13  ? -1.544  6.760   -9.570  1.00 0.00 ? 11  ILE B HA   1  
ATOM 424   H HB   . ILE B 2 13  ? -2.895  8.562   -11.584 1.00 0.00 ? 11  ILE B HB   1  
ATOM 425   H HG12 . ILE B 2 13  ? -0.871  6.347   -12.013 1.00 0.00 ? 11  ILE B HG12 1  
ATOM 426   H HG13 . ILE B 2 13  ? -2.572  6.277   -12.463 1.00 0.00 ? 11  ILE B HG13 1  
ATOM 427   H HG21 . ILE B 2 13  ? -0.608  9.397   -11.965 1.00 0.00 ? 11  ILE B HG21 1  
ATOM 428   H HG22 . ILE B 2 13  ? -0.022  8.349   -10.672 1.00 0.00 ? 11  ILE B HG22 1  
ATOM 429   H HG23 . ILE B 2 13  ? -1.141  9.662   -10.305 1.00 0.00 ? 11  ILE B HG23 1  
ATOM 430   H HD11 . ILE B 2 13  ? -0.477  8.104   -13.608 1.00 0.00 ? 11  ILE B HD11 1  
ATOM 431   H HD12 . ILE B 2 13  ? -2.196  8.169   -14.005 1.00 0.00 ? 11  ILE B HD12 1  
ATOM 432   H HD13 . ILE B 2 13  ? -1.251  6.733   -14.405 1.00 0.00 ? 11  ILE B HD13 1  
ATOM 433   N N    . VAL B 2 14  ? -1.985  8.493   -7.909  1.00 0.00 ? 12  VAL B N    1  
ATOM 434   C CA   . VAL B 2 14  ? -2.213  9.461   -6.863  1.00 0.00 ? 12  VAL B CA   1  
ATOM 435   C C    . VAL B 2 14  ? -1.103  10.492  -6.896  1.00 0.00 ? 12  VAL B C    1  
ATOM 436   O O    . VAL B 2 14  ? 0.025   10.188  -7.280  1.00 0.00 ? 12  VAL B O    1  
ATOM 437   C CB   . VAL B 2 14  ? -2.259  8.785   -5.485  1.00 0.00 ? 12  VAL B CB   1  
ATOM 438   C CG1  . VAL B 2 14  ? -2.830  9.717   -4.439  1.00 0.00 ? 12  VAL B CG1  1  
ATOM 439   C CG2  . VAL B 2 14  ? -3.066  7.501   -5.553  1.00 0.00 ? 12  VAL B CG2  1  
ATOM 440   H H    . VAL B 2 14  ? -1.176  7.933   -7.863  1.00 0.00 ? 12  VAL B H    1  
ATOM 441   H HA   . VAL B 2 14  ? -3.157  9.946   -7.043  1.00 0.00 ? 12  VAL B HA   1  
ATOM 442   H HB   . VAL B 2 14  ? -1.250  8.539   -5.198  1.00 0.00 ? 12  VAL B HB   1  
ATOM 443   H HG11 . VAL B 2 14  ? -2.164  10.556  -4.302  1.00 0.00 ? 12  VAL B HG11 1  
ATOM 444   H HG12 . VAL B 2 14  ? -2.938  9.186   -3.504  1.00 0.00 ? 12  VAL B HG12 1  
ATOM 445   H HG13 . VAL B 2 14  ? -3.796  10.073  -4.765  1.00 0.00 ? 12  VAL B HG13 1  
ATOM 446   H HG21 . VAL B 2 14  ? -4.043  7.711   -5.962  1.00 0.00 ? 12  VAL B HG21 1  
ATOM 447   H HG22 . VAL B 2 14  ? -3.173  7.089   -4.560  1.00 0.00 ? 12  VAL B HG22 1  
ATOM 448   H HG23 . VAL B 2 14  ? -2.557  6.788   -6.185  1.00 0.00 ? 12  VAL B HG23 1  
ATOM 449   N N    . LYS B 2 15  ? -1.416  11.698  -6.493  1.00 0.00 ? 13  LYS B N    1  
ATOM 450   C CA   . LYS B 2 15  ? -0.439  12.767  -6.511  1.00 0.00 ? 13  LYS B CA   1  
ATOM 451   C C    . LYS B 2 15  ? -0.137  13.249  -5.114  1.00 0.00 ? 13  LYS B C    1  
ATOM 452   O O    . LYS B 2 15  ? -0.784  12.817  -4.168  1.00 0.00 ? 13  LYS B O    1  
ATOM 453   C CB   . LYS B 2 15  ? -0.935  13.925  -7.365  1.00 0.00 ? 13  LYS B CB   1  
ATOM 454   C CG   . LYS B 2 15  ? -1.053  13.566  -8.829  1.00 0.00 ? 13  LYS B CG   1  
ATOM 455   C CD   . LYS B 2 15  ? -2.337  14.101  -9.434  1.00 0.00 ? 13  LYS B CD   1  
ATOM 456   C CE   . LYS B 2 15  ? -3.569  13.363  -8.916  1.00 0.00 ? 13  LYS B CE   1  
ATOM 457   N NZ   . LYS B 2 15  ? -4.109  13.961  -7.661  1.00 0.00 ? 13  LYS B NZ   1  
ATOM 458   H H    . LYS B 2 15  ? -2.322  11.867  -6.137  1.00 0.00 ? 13  LYS B H    1  
ATOM 459   H HA   . LYS B 2 15  ? 0.469   12.377  -6.947  1.00 0.00 ? 13  LYS B HA   1  
ATOM 460   H HB2  . LYS B 2 15  ? -1.907  14.233  -7.008  1.00 0.00 ? 13  LYS B HB2  1  
ATOM 461   H HB3  . LYS B 2 15  ? -0.245  14.750  -7.270  1.00 0.00 ? 13  LYS B HB3  1  
ATOM 462   H HG2  . LYS B 2 15  ? -0.214  13.991  -9.359  1.00 0.00 ? 13  LYS B HG2  1  
ATOM 463   H HG3  . LYS B 2 15  ? -1.037  12.491  -8.927  1.00 0.00 ? 13  LYS B HG3  1  
ATOM 464   H HD2  . LYS B 2 15  ? -2.425  15.144  -9.185  1.00 0.00 ? 13  LYS B HD2  1  
ATOM 465   H HD3  . LYS B 2 15  ? -2.283  13.984  -10.505 1.00 0.00 ? 13  LYS B HD3  1  
ATOM 466   H HE2  . LYS B 2 15  ? -4.335  13.395  -9.675  1.00 0.00 ? 13  LYS B HE2  1  
ATOM 467   H HE3  . LYS B 2 15  ? -3.299  12.334  -8.726  1.00 0.00 ? 13  LYS B HE3  1  
ATOM 468   H HZ1  . LYS B 2 15  ? -4.026  13.276  -6.872  1.00 0.00 ? 13  LYS B HZ1  1  
ATOM 469   H HZ2  . LYS B 2 15  ? -5.112  14.206  -7.777  1.00 0.00 ? 13  LYS B HZ2  1  
ATOM 470   H HZ3  . LYS B 2 15  ? -3.583  14.822  -7.407  1.00 0.00 ? 13  LYS B HZ3  1  
ATOM 471   N N    . LYS B 2 16  ? 0.801   14.198  -5.045  1.00 0.00 ? 14  LYS B N    1  
ATOM 472   C CA   . LYS B 2 16  ? 1.286   14.804  -3.796  1.00 0.00 ? 14  LYS B CA   1  
ATOM 473   C C    . LYS B 2 16  ? 0.957   13.969  -2.562  1.00 0.00 ? 14  LYS B C    1  
ATOM 474   O O    . LYS B 2 16  ? 0.024   14.259  -1.813  1.00 0.00 ? 14  LYS B O    1  
ATOM 475   C CB   . LYS B 2 16  ? 0.721   16.215  -3.651  1.00 0.00 ? 14  LYS B CB   1  
ATOM 476   C CG   . LYS B 2 16  ? 1.506   17.268  -4.415  1.00 0.00 ? 14  LYS B CG   1  
ATOM 477   C CD   . LYS B 2 16  ? 2.354   18.113  -3.479  1.00 0.00 ? 14  LYS B CD   1  
ATOM 478   C CE   . LYS B 2 16  ? 3.685   18.484  -4.110  1.00 0.00 ? 14  LYS B CE   1  
ATOM 479   N NZ   . LYS B 2 16  ? 4.508   17.285  -4.404  1.00 0.00 ? 14  LYS B NZ   1  
ATOM 480   H H    . LYS B 2 16  ? 1.201   14.497  -5.885  1.00 0.00 ? 14  LYS B H    1  
ATOM 481   H HA   . LYS B 2 16  ? 2.361   14.877  -3.875  1.00 0.00 ? 14  LYS B HA   1  
ATOM 482   H HB2  . LYS B 2 16  ? -0.291  16.220  -4.021  1.00 0.00 ? 14  LYS B HB2  1  
ATOM 483   H HB3  . LYS B 2 16  ? 0.717   16.487  -2.606  1.00 0.00 ? 14  LYS B HB3  1  
ATOM 484   H HG2  . LYS B 2 16  ? 2.154   16.777  -5.126  1.00 0.00 ? 14  LYS B HG2  1  
ATOM 485   H HG3  . LYS B 2 16  ? 0.814   17.911  -4.940  1.00 0.00 ? 14  LYS B HG3  1  
ATOM 486   H HD2  . LYS B 2 16  ? 1.815   19.019  -3.241  1.00 0.00 ? 14  LYS B HD2  1  
ATOM 487   H HD3  . LYS B 2 16  ? 2.538   17.554  -2.573  1.00 0.00 ? 14  LYS B HD3  1  
ATOM 488   H HE2  . LYS B 2 16  ? 3.497   19.015  -5.031  1.00 0.00 ? 14  LYS B HE2  1  
ATOM 489   H HE3  . LYS B 2 16  ? 4.226   19.124  -3.429  1.00 0.00 ? 14  LYS B HE3  1  
ATOM 490   H HZ1  . LYS B 2 16  ? 4.216   16.852  -5.303  1.00 0.00 ? 14  LYS B HZ1  1  
ATOM 491   H HZ2  . LYS B 2 16  ? 4.402   16.575  -3.642  1.00 0.00 ? 14  LYS B HZ2  1  
ATOM 492   H HZ3  . LYS B 2 16  ? 5.520   17.547  -4.479  1.00 0.00 ? 14  LYS B HZ3  1  
ATOM 493   N N    . VAL B 2 17  ? 1.717   12.901  -2.402  1.00 0.00 ? 15  VAL B N    1  
ATOM 494   C CA   . VAL B 2 17  ? 1.569   11.994  -1.280  1.00 0.00 ? 15  VAL B CA   1  
ATOM 495   C C    . VAL B 2 17  ? 2.896   11.885  -0.551  1.00 0.00 ? 15  VAL B C    1  
ATOM 496   O O    . VAL B 2 17  ? 3.901   11.487  -1.133  1.00 0.00 ? 15  VAL B O    1  
ATOM 497   C CB   . VAL B 2 17  ? 1.107   10.587  -1.733  1.00 0.00 ? 15  VAL B CB   1  
ATOM 498   C CG1  . VAL B 2 17  ? 1.327   9.554   -0.633  1.00 0.00 ? 15  VAL B CG1  1  
ATOM 499   C CG2  . VAL B 2 17  ? -0.355  10.608  -2.136  1.00 0.00 ? 15  VAL B CG2  1  
ATOM 500   H H    . VAL B 2 17  ? 2.411   12.717  -3.073  1.00 0.00 ? 15  VAL B H    1  
ATOM 501   H HA   . VAL B 2 17  ? 0.826   12.403  -0.610  1.00 0.00 ? 15  VAL B HA   1  
ATOM 502   H HB   . VAL B 2 17  ? 1.692   10.296  -2.598  1.00 0.00 ? 15  VAL B HB   1  
ATOM 503   H HG11 . VAL B 2 17  ? 2.368   9.546   -0.350  1.00 0.00 ? 15  VAL B HG11 1  
ATOM 504   H HG12 . VAL B 2 17  ? 1.044   8.577   -0.995  1.00 0.00 ? 15  VAL B HG12 1  
ATOM 505   H HG13 . VAL B 2 17  ? 0.722   9.808   0.225   1.00 0.00 ? 15  VAL B HG13 1  
ATOM 506   H HG21 . VAL B 2 17  ? -0.647  9.628   -2.482  1.00 0.00 ? 15  VAL B HG21 1  
ATOM 507   H HG22 . VAL B 2 17  ? -0.498  11.326  -2.929  1.00 0.00 ? 15  VAL B HG22 1  
ATOM 508   H HG23 . VAL B 2 17  ? -0.959  10.886  -1.285  1.00 0.00 ? 15  VAL B HG23 1  
ATOM 509   N N    . ARG B 2 18  ? 2.896   12.258  0.710   1.00 0.00 ? 16  ARG B N    1  
ATOM 510   C CA   . ARG B 2 18  ? 4.090   12.207  1.520   1.00 0.00 ? 16  ARG B CA   1  
ATOM 511   C C    . ARG B 2 18  ? 4.222   10.858  2.204   1.00 0.00 ? 16  ARG B C    1  
ATOM 512   O O    . ARG B 2 18  ? 3.290   10.374  2.836   1.00 0.00 ? 16  ARG B O    1  
ATOM 513   C CB   . ARG B 2 18  ? 4.067   13.313  2.572   1.00 0.00 ? 16  ARG B CB   1  
ATOM 514   C CG   . ARG B 2 18  ? 4.378   14.690  2.021   1.00 0.00 ? 16  ARG B CG   1  
ATOM 515   C CD   . ARG B 2 18  ? 4.198   15.761  3.079   1.00 0.00 ? 16  ARG B CD   1  
ATOM 516   N NE   . ARG B 2 18  ? 4.569   15.280  4.411   1.00 0.00 ? 16  ARG B NE   1  
ATOM 517   C CZ   . ARG B 2 18  ? 4.408   15.983  5.528   1.00 0.00 ? 16  ARG B CZ   1  
ATOM 518   N NH1  . ARG B 2 18  ? 3.932   17.219  5.482   1.00 0.00 ? 16  ARG B NH1  1  
ATOM 519   N NH2  . ARG B 2 18  ? 4.714   15.451  6.700   1.00 0.00 ? 16  ARG B NH2  1  
ATOM 520   H H    . ARG B 2 18  ? 2.057   12.576  1.114   1.00 0.00 ? 16  ARG B H    1  
ATOM 521   H HA   . ARG B 2 18  ? 4.940   12.356  0.873   1.00 0.00 ? 16  ARG B HA   1  
ATOM 522   H HB2  . ARG B 2 18  ? 3.088   13.344  3.024   1.00 0.00 ? 16  ARG B HB2  1  
ATOM 523   H HB3  . ARG B 2 18  ? 4.797   13.082  3.335   1.00 0.00 ? 16  ARG B HB3  1  
ATOM 524   H HG2  . ARG B 2 18  ? 5.400   14.707  1.673   1.00 0.00 ? 16  ARG B HG2  1  
ATOM 525   H HG3  . ARG B 2 18  ? 3.711   14.895  1.196   1.00 0.00 ? 16  ARG B HG3  1  
ATOM 526   H HD2  . ARG B 2 18  ? 4.819   16.608  2.827   1.00 0.00 ? 16  ARG B HD2  1  
ATOM 527   H HD3  . ARG B 2 18  ? 3.162   16.066  3.093   1.00 0.00 ? 16  ARG B HD3  1  
ATOM 528   H HE   . ARG B 2 18  ? 4.934   14.370  4.473   1.00 0.00 ? 16  ARG B HE   1  
ATOM 529   H HH11 . ARG B 2 18  ? 3.692   17.638  4.607   1.00 0.00 ? 16  ARG B HH11 1  
ATOM 530   H HH12 . ARG B 2 18  ? 3.797   17.736  6.344   1.00 0.00 ? 16  ARG B HH12 1  
ATOM 531   H HH21 . ARG B 2 18  ? 5.066   14.513  6.765   1.00 0.00 ? 16  ARG B HH21 1  
ATOM 532   H HH22 . ARG B 2 18  ? 4.578   15.993  7.544   1.00 0.00 ? 16  ARG B HH22 1  
ATOM 533   N N    . GLN B 2 19  ? 5.374   10.248  2.053   1.00 0.00 ? 17  GLN B N    1  
ATOM 534   C CA   . GLN B 2 19  ? 5.646   8.973   2.675   1.00 0.00 ? 17  GLN B CA   1  
ATOM 535   C C    . GLN B 2 19  ? 6.936   9.086   3.466   1.00 0.00 ? 17  GLN B C    1  
ATOM 536   O O    . GLN B 2 19  ? 8.023   9.139   2.888   1.00 0.00 ? 17  GLN B O    1  
ATOM 537   C CB   . GLN B 2 19  ? 5.749   7.866   1.623   1.00 0.00 ? 17  GLN B CB   1  
ATOM 538   C CG   . GLN B 2 19  ? 5.394   6.484   2.152   1.00 0.00 ? 17  GLN B CG   1  
ATOM 539   C CD   . GLN B 2 19  ? 6.504   5.851   2.970   1.00 0.00 ? 17  GLN B CD   1  
ATOM 540   O OE1  . GLN B 2 19  ? 6.248   5.139   3.936   1.00 0.00 ? 17  GLN B OE1  1  
ATOM 541   N NE2  . GLN B 2 19  ? 7.747   6.100   2.582   1.00 0.00 ? 17  GLN B NE2  1  
ATOM 542   H H    . GLN B 2 19  ? 6.070   10.670  1.499   1.00 0.00 ? 17  GLN B H    1  
ATOM 543   H HA   . GLN B 2 19  ? 4.835   8.750   3.352   1.00 0.00 ? 17  GLN B HA   1  
ATOM 544   H HB2  . GLN B 2 19  ? 5.079   8.098   0.808   1.00 0.00 ? 17  GLN B HB2  1  
ATOM 545   H HB3  . GLN B 2 19  ? 6.761   7.835   1.247   1.00 0.00 ? 17  GLN B HB3  1  
ATOM 546   H HG2  . GLN B 2 19  ? 4.516   6.568   2.775   1.00 0.00 ? 17  GLN B HG2  1  
ATOM 547   H HG3  . GLN B 2 19  ? 5.174   5.840   1.312   1.00 0.00 ? 17  GLN B HG3  1  
ATOM 548   H HE21 . GLN B 2 19  ? 7.884   6.673   1.798   1.00 0.00 ? 17  GLN B HE21 1  
ATOM 549   H HE22 . GLN B 2 19  ? 8.478   5.700   3.096   1.00 0.00 ? 17  GLN B HE22 1  
ATOM 550   N N    . LYS B 2 20  ? 6.789   9.173   4.784   1.00 0.00 ? 18  LYS B N    1  
ATOM 551   C CA   . LYS B 2 20  ? 7.916   9.286   5.702   1.00 0.00 ? 18  LYS B CA   1  
ATOM 552   C C    . LYS B 2 20  ? 8.568   10.662  5.592   1.00 0.00 ? 18  LYS B C    1  
ATOM 553   O O    . LYS B 2 20  ? 9.782   10.776  5.421   1.00 0.00 ? 18  LYS B O    1  
ATOM 554   C CB   . LYS B 2 20  ? 8.935   8.162   5.463   1.00 0.00 ? 18  LYS B CB   1  
ATOM 555   C CG   . LYS B 2 20  ? 8.904   7.061   6.516   1.00 0.00 ? 18  LYS B CG   1  
ATOM 556   C CD   . LYS B 2 20  ? 7.539   6.398   6.595   1.00 0.00 ? 18  LYS B CD   1  
ATOM 557   C CE   . LYS B 2 20  ? 6.675   7.037   7.667   1.00 0.00 ? 18  LYS B CE   1  
ATOM 558   N NZ   . LYS B 2 20  ? 5.228   6.972   7.337   1.00 0.00 ? 18  LYS B NZ   1  
ATOM 559   H H    . LYS B 2 20  ? 5.871   9.180   5.159   1.00 0.00 ? 18  LYS B H    1  
ATOM 560   H HA   . LYS B 2 20  ? 7.521   9.183   6.703   1.00 0.00 ? 18  LYS B HA   1  
ATOM 561   H HB2  . LYS B 2 20  ? 8.729   7.710   4.505   1.00 0.00 ? 18  LYS B HB2  1  
ATOM 562   H HB3  . LYS B 2 20  ? 9.924   8.586   5.447   1.00 0.00 ? 18  LYS B HB3  1  
ATOM 563   H HG2  . LYS B 2 20  ? 9.640   6.314   6.263   1.00 0.00 ? 18  LYS B HG2  1  
ATOM 564   H HG3  . LYS B 2 20  ? 9.141   7.492   7.479   1.00 0.00 ? 18  LYS B HG3  1  
ATOM 565   H HD2  . LYS B 2 20  ? 7.044   6.500   5.640   1.00 0.00 ? 18  LYS B HD2  1  
ATOM 566   H HD3  . LYS B 2 20  ? 7.670   5.352   6.826   1.00 0.00 ? 18  LYS B HD3  1  
ATOM 567   H HE2  . LYS B 2 20  ? 6.844   6.520   8.600   1.00 0.00 ? 18  LYS B HE2  1  
ATOM 568   H HE3  . LYS B 2 20  ? 6.965   8.072   7.772   1.00 0.00 ? 18  LYS B HE3  1  
ATOM 569   H HZ1  . LYS B 2 20  ? 4.683   6.714   8.195   1.00 0.00 ? 18  LYS B HZ1  1  
ATOM 570   H HZ2  . LYS B 2 20  ? 5.056   6.265   6.600   1.00 0.00 ? 18  LYS B HZ2  1  
ATOM 571   H HZ3  . LYS B 2 20  ? 4.894   7.905   6.997   1.00 0.00 ? 18  LYS B HZ3  1  
ATOM 572   N N    . LYS B 2 21  ? 7.730   11.701  5.682   1.00 0.00 ? 19  LYS B N    1  
ATOM 573   C CA   . LYS B 2 21  ? 8.175   13.097  5.621   1.00 0.00 ? 19  LYS B CA   1  
ATOM 574   C C    . LYS B 2 21  ? 8.739   13.453  4.243   1.00 0.00 ? 19  LYS B C    1  
ATOM 575   O O    . LYS B 2 21  ? 9.546   14.372  4.114   1.00 0.00 ? 19  LYS B O    1  
ATOM 576   C CB   . LYS B 2 21  ? 9.222   13.379  6.711   1.00 0.00 ? 19  LYS B CB   1  
ATOM 577   C CG   . LYS B 2 21  ? 8.844   14.501  7.673   1.00 0.00 ? 19  LYS B CG   1  
ATOM 578   C CD   . LYS B 2 21  ? 7.824   14.041  8.706   1.00 0.00 ? 19  LYS B CD   1  
ATOM 579   C CE   . LYS B 2 21  ? 8.025   14.716  10.053  1.00 0.00 ? 19  LYS B CE   1  
ATOM 580   N NZ   . LYS B 2 21  ? 9.275   14.268  10.724  1.00 0.00 ? 19  LYS B NZ   1  
ATOM 581   H H    . LYS B 2 21  ? 6.764   11.518  5.790   1.00 0.00 ? 19  LYS B H    1  
ATOM 582   H HA   . LYS B 2 21  ? 7.311   13.719  5.805   1.00 0.00 ? 19  LYS B HA   1  
ATOM 583   H HB2  . LYS B 2 21  ? 9.371   12.479  7.289   1.00 0.00 ? 19  LYS B HB2  1  
ATOM 584   H HB3  . LYS B 2 21  ? 10.154  13.644  6.233   1.00 0.00 ? 19  LYS B HB3  1  
ATOM 585   H HG2  . LYS B 2 21  ? 9.733   14.838  8.185   1.00 0.00 ? 19  LYS B HG2  1  
ATOM 586   H HG3  . LYS B 2 21  ? 8.423   15.318  7.105   1.00 0.00 ? 19  LYS B HG3  1  
ATOM 587   H HD2  . LYS B 2 21  ? 6.832   14.274  8.352   1.00 0.00 ? 19  LYS B HD2  1  
ATOM 588   H HD3  . LYS B 2 21  ? 7.914   12.971  8.839   1.00 0.00 ? 19  LYS B HD3  1  
ATOM 589   H HE2  . LYS B 2 21  ? 8.062   15.780  9.910   1.00 0.00 ? 19  LYS B HE2  1  
ATOM 590   H HE3  . LYS B 2 21  ? 7.183   14.465  10.688  1.00 0.00 ? 19  LYS B HE3  1  
ATOM 591   H HZ1  . LYS B 2 21  ? 9.045   13.609  11.510  1.00 0.00 ? 19  LYS B HZ1  1  
ATOM 592   H HZ2  . LYS B 2 21  ? 9.784   15.081  11.115  1.00 0.00 ? 19  LYS B HZ2  1  
ATOM 593   H HZ3  . LYS B 2 21  ? 9.889   13.776  10.048  1.00 0.00 ? 19  LYS B HZ3  1  
ATOM 594   N N    . GLN B 2 22  ? 8.291   12.744  3.212   1.00 0.00 ? 20  GLN B N    1  
ATOM 595   C CA   . GLN B 2 22  ? 8.766   12.998  1.856   1.00 0.00 ? 20  GLN B CA   1  
ATOM 596   C C    . GLN B 2 22  ? 7.612   12.943  0.859   1.00 0.00 ? 20  GLN B C    1  
ATOM 597   O O    . GLN B 2 22  ? 6.941   11.925  0.740   1.00 0.00 ? 20  GLN B O    1  
ATOM 598   C CB   . GLN B 2 22  ? 9.844   11.983  1.479   1.00 0.00 ? 20  GLN B CB   1  
ATOM 599   C CG   . GLN B 2 22  ? 10.338  12.124  0.052   1.00 0.00 ? 20  GLN B CG   1  
ATOM 600   C CD   . GLN B 2 22  ? 11.602  11.330  -0.210  1.00 0.00 ? 20  GLN B CD   1  
ATOM 601   O OE1  . GLN B 2 22  ? 12.414  11.697  -1.063  1.00 0.00 ? 20  GLN B OE1  1  
ATOM 602   N NE2  . GLN B 2 22  ? 11.779  10.238  0.517   1.00 0.00 ? 20  GLN B NE2  1  
ATOM 603   H H    . GLN B 2 22  ? 7.634   12.034  3.366   1.00 0.00 ? 20  GLN B H    1  
ATOM 604   H HA   . GLN B 2 22  ? 9.193   13.988  1.837   1.00 0.00 ? 20  GLN B HA   1  
ATOM 605   H HB2  . GLN B 2 22  ? 10.687  12.108  2.144   1.00 0.00 ? 20  GLN B HB2  1  
ATOM 606   H HB3  . GLN B 2 22  ? 9.443   10.988  1.603   1.00 0.00 ? 20  GLN B HB3  1  
ATOM 607   H HG2  . GLN B 2 22  ? 9.566   11.773  -0.616  1.00 0.00 ? 20  GLN B HG2  1  
ATOM 608   H HG3  . GLN B 2 22  ? 10.536  13.166  -0.144  1.00 0.00 ? 20  GLN B HG3  1  
ATOM 609   H HE21 . GLN B 2 22  ? 11.091  10.006  1.178   1.00 0.00 ? 20  GLN B HE21 1  
ATOM 610   H HE22 . GLN B 2 22  ? 12.593  9.714   0.377   1.00 0.00 ? 20  GLN B HE22 1  
ATOM 611   N N    . ASP B 2 23  ? 7.403   14.037  0.140   1.00 0.00 ? 21  ASP B N    1  
ATOM 612   C CA   . ASP B 2 23  ? 6.316   14.137  -0.838  1.00 0.00 ? 21  ASP B CA   1  
ATOM 613   C C    . ASP B 2 23  ? 6.643   13.390  -2.133  1.00 0.00 ? 21  ASP B C    1  
ATOM 614   O O    . ASP B 2 23  ? 7.814   13.192  -2.473  1.00 0.00 ? 21  ASP B O    1  
ATOM 615   C CB   . ASP B 2 23  ? 6.015   15.605  -1.143  1.00 0.00 ? 21  ASP B CB   1  
ATOM 616   C CG   . ASP B 2 23  ? 4.552   15.843  -1.464  1.00 0.00 ? 21  ASP B CG   1  
ATOM 617   O OD1  . ASP B 2 23  ? 4.115   15.460  -2.567  1.00 0.00 ? 21  ASP B OD1  1  
ATOM 618   O OD2  . ASP B 2 23  ? 3.839   16.423  -0.619  1.00 0.00 ? 21  ASP B OD2  1  
ATOM 619   H H    . ASP B 2 23  ? 8.002   14.801  0.259   1.00 0.00 ? 21  ASP B H    1  
ATOM 620   H HA   . ASP B 2 23  ? 5.438   13.689  -0.397  1.00 0.00 ? 21  ASP B HA   1  
ATOM 621   H HB2  . ASP B 2 23  ? 6.277   16.206  -0.285  1.00 0.00 ? 21  ASP B HB2  1  
ATOM 622   H HB3  . ASP B 2 23  ? 6.606   15.919  -1.991  1.00 0.00 ? 21  ASP B HB3  1  
ATOM 623   N N    . GLY B 2 24  ? 5.598   12.961  -2.836  1.00 0.00 ? 22  GLY B N    1  
ATOM 624   C CA   . GLY B 2 24  ? 5.765   12.239  -4.083  1.00 0.00 ? 22  GLY B CA   1  
ATOM 625   C C    . GLY B 2 24  ? 4.433   11.888  -4.727  1.00 0.00 ? 22  GLY B C    1  
ATOM 626   O O    . GLY B 2 24  ? 3.424   12.537  -4.467  1.00 0.00 ? 22  GLY B O    1  
ATOM 627   H H    . GLY B 2 24  ? 4.693   13.153  -2.508  1.00 0.00 ? 22  GLY B H    1  
ATOM 628   H HA2  . GLY B 2 24  ? 6.335   12.849  -4.768  1.00 0.00 ? 22  GLY B HA2  1  
ATOM 629   H HA3  . GLY B 2 24  ? 6.310   11.327  -3.889  1.00 0.00 ? 22  GLY B HA3  1  
ATOM 630   N N    . ALA B 2 25  ? 4.430   10.854  -5.558  1.00 0.00 ? 23  ALA B N    1  
ATOM 631   C CA   . ALA B 2 25  ? 3.224   10.404  -6.247  1.00 0.00 ? 23  ALA B CA   1  
ATOM 632   C C    . ALA B 2 25  ? 3.038   8.906   -6.034  1.00 0.00 ? 23  ALA B C    1  
ATOM 633   O O    . ALA B 2 25  ? 3.983   8.128   -6.172  1.00 0.00 ? 23  ALA B O    1  
ATOM 634   C CB   . ALA B 2 25  ? 3.312   10.726  -7.730  1.00 0.00 ? 23  ALA B CB   1  
ATOM 635   H H    . ALA B 2 25  ? 5.271   10.362  -5.705  1.00 0.00 ? 23  ALA B H    1  
ATOM 636   H HA   . ALA B 2 25  ? 2.367   10.933  -5.836  1.00 0.00 ? 23  ALA B HA   1  
ATOM 637   H HB1  . ALA B 2 25  ? 4.152   10.202  -8.164  1.00 0.00 ? 23  ALA B HB1  1  
ATOM 638   H HB2  . ALA B 2 25  ? 3.444   11.790  -7.861  1.00 0.00 ? 23  ALA B HB2  1  
ATOM 639   H HB3  . ALA B 2 25  ? 2.401   10.413  -8.220  1.00 0.00 ? 23  ALA B HB3  1  
ATOM 640   N N    . LEU B 2 26  ? 1.825   8.510   -5.697  1.00 0.00 ? 24  LEU B N    1  
ATOM 641   C CA   . LEU B 2 26  ? 1.510   7.109   -5.435  1.00 0.00 ? 24  LEU B CA   1  
ATOM 642   C C    . LEU B 2 26  ? 0.896   6.456   -6.676  1.00 0.00 ? 24  LEU B C    1  
ATOM 643   O O    . LEU B 2 26  ? 0.137   7.086   -7.401  1.00 0.00 ? 24  LEU B O    1  
ATOM 644   C CB   . LEU B 2 26  ? 0.550   7.030   -4.247  1.00 0.00 ? 24  LEU B CB   1  
ATOM 645   C CG   . LEU B 2 26  ? 0.099   5.623   -3.861  1.00 0.00 ? 24  LEU B CG   1  
ATOM 646   C CD1  . LEU B 2 26  ? 1.016   4.997   -2.836  1.00 0.00 ? 24  LEU B CD1  1  
ATOM 647   C CD2  . LEU B 2 26  ? -1.327  5.653   -3.340  1.00 0.00 ? 24  LEU B CD2  1  
ATOM 648   H H    . LEU B 2 26  ? 1.106   9.176   -5.644  1.00 0.00 ? 24  LEU B H    1  
ATOM 649   H HA   . LEU B 2 26  ? 2.423   6.592   -5.183  1.00 0.00 ? 24  LEU B HA   1  
ATOM 650   H HB2  . LEU B 2 26  ? 1.033   7.477   -3.393  1.00 0.00 ? 24  LEU B HB2  1  
ATOM 651   H HB3  . LEU B 2 26  ? -0.322  7.615   -4.481  1.00 0.00 ? 24  LEU B HB3  1  
ATOM 652   H HG   . LEU B 2 26  ? 0.137   5.001   -4.734  1.00 0.00 ? 24  LEU B HG   1  
ATOM 653   H HD11 . LEU B 2 26  ? 0.641   4.016   -2.576  1.00 0.00 ? 24  LEU B HD11 1  
ATOM 654   H HD12 . LEU B 2 26  ? 1.045   5.616   -1.954  1.00 0.00 ? 24  LEU B HD12 1  
ATOM 655   H HD13 . LEU B 2 26  ? 2.007   4.904   -3.250  1.00 0.00 ? 24  LEU B HD13 1  
ATOM 656   H HD21 . LEU B 2 26  ? -1.622  4.660   -3.038  1.00 0.00 ? 24  LEU B HD21 1  
ATOM 657   H HD22 . LEU B 2 26  ? -1.988  6.005   -4.120  1.00 0.00 ? 24  LEU B HD22 1  
ATOM 658   H HD23 . LEU B 2 26  ? -1.386  6.321   -2.492  1.00 0.00 ? 24  LEU B HD23 1  
ATOM 659   N N    . TYR B 2 27  ? 1.240   5.201   -6.929  1.00 0.00 ? 25  TYR B N    1  
ATOM 660   C CA   . TYR B 2 27  ? 0.722   4.472   -8.086  1.00 0.00 ? 25  TYR B CA   1  
ATOM 661   C C    . TYR B 2 27  ? 0.351   3.046   -7.690  1.00 0.00 ? 25  TYR B C    1  
ATOM 662   O O    . TYR B 2 27  ? 1.227   2.228   -7.411  1.00 0.00 ? 25  TYR B O    1  
ATOM 663   C CB   . TYR B 2 27  ? 1.764   4.410   -9.213  1.00 0.00 ? 25  TYR B CB   1  
ATOM 664   C CG   . TYR B 2 27  ? 2.337   5.743   -9.642  1.00 0.00 ? 25  TYR B CG   1  
ATOM 665   C CD1  . TYR B 2 27  ? 1.783   6.451   -10.699 1.00 0.00 ? 25  TYR B CD1  1  
ATOM 666   C CD2  . TYR B 2 27  ? 3.444   6.282   -9.000  1.00 0.00 ? 25  TYR B CD2  1  
ATOM 667   C CE1  . TYR B 2 27  ? 2.317   7.660   -11.104 1.00 0.00 ? 25  TYR B CE1  1  
ATOM 668   C CE2  . TYR B 2 27  ? 3.981   7.490   -9.398  1.00 0.00 ? 25  TYR B CE2  1  
ATOM 669   C CZ   . TYR B 2 27  ? 3.414   8.175   -10.450 1.00 0.00 ? 25  TYR B CZ   1  
ATOM 670   O OH   . TYR B 2 27  ? 3.948   9.377   -10.851 1.00 0.00 ? 25  TYR B OH   1  
ATOM 671   H H    . TYR B 2 27  ? 1.860   4.739   -6.316  1.00 0.00 ? 25  TYR B H    1  
ATOM 672   H HA   . TYR B 2 27  ? -0.162  4.986   -8.438  1.00 0.00 ? 25  TYR B HA   1  
ATOM 673   H HB2  . TYR B 2 27  ? 2.585   3.796   -8.891  1.00 0.00 ? 25  TYR B HB2  1  
ATOM 674   H HB3  . TYR B 2 27  ? 1.307   3.955   -10.081 1.00 0.00 ? 25  TYR B HB3  1  
ATOM 675   H HD1  . TYR B 2 27  ? 0.921   6.046   -11.209 1.00 0.00 ? 25  TYR B HD1  1  
ATOM 676   H HD2  . TYR B 2 27  ? 3.887   5.741   -8.176  1.00 0.00 ? 25  TYR B HD2  1  
ATOM 677   H HE1  . TYR B 2 27  ? 1.872   8.196   -11.929 1.00 0.00 ? 25  TYR B HE1  1  
ATOM 678   H HE2  . TYR B 2 27  ? 4.841   7.893   -8.884  1.00 0.00 ? 25  TYR B HE2  1  
ATOM 679   H HH   . TYR B 2 27  ? 4.907   9.328   -10.820 1.00 0.00 ? 25  TYR B HH   1  
ATOM 680   N N    . LEU B 2 28  ? -0.935  2.733   -7.674  1.00 0.00 ? 26  LEU B N    1  
ATOM 681   C CA   . LEU B 2 28  ? -1.366  1.390   -7.305  1.00 0.00 ? 26  LEU B CA   1  
ATOM 682   C C    . LEU B 2 28  ? -1.392  0.492   -8.532  1.00 0.00 ? 26  LEU B C    1  
ATOM 683   O O    . LEU B 2 28  ? -1.985  0.840   -9.553  1.00 0.00 ? 26  LEU B O    1  
ATOM 684   C CB   . LEU B 2 28  ? -2.738  1.403   -6.636  1.00 0.00 ? 26  LEU B CB   1  
ATOM 685   C CG   . LEU B 2 28  ? -2.883  2.378   -5.470  1.00 0.00 ? 26  LEU B CG   1  
ATOM 686   C CD1  . LEU B 2 28  ? -4.058  2.004   -4.596  1.00 0.00 ? 26  LEU B CD1  1  
ATOM 687   C CD2  . LEU B 2 28  ? -1.632  2.435   -4.629  1.00 0.00 ? 26  LEU B CD2  1  
ATOM 688   H H    . LEU B 2 28  ? -1.603  3.411   -7.924  1.00 0.00 ? 26  LEU B H    1  
ATOM 689   H HA   . LEU B 2 28  ? -0.645  1.002   -6.605  1.00 0.00 ? 26  LEU B HA   1  
ATOM 690   H HB2  . LEU B 2 28  ? -3.478  1.656   -7.383  1.00 0.00 ? 26  LEU B HB2  1  
ATOM 691   H HB3  . LEU B 2 28  ? -2.947  0.408   -6.271  1.00 0.00 ? 26  LEU B HB3  1  
ATOM 692   H HG   . LEU B 2 28  ? -3.053  3.358   -5.866  1.00 0.00 ? 26  LEU B HG   1  
ATOM 693   H HD11 . LEU B 2 28  ? -3.882  1.035   -4.155  1.00 0.00 ? 26  LEU B HD11 1  
ATOM 694   H HD12 . LEU B 2 28  ? -4.956  1.978   -5.190  1.00 0.00 ? 26  LEU B HD12 1  
ATOM 695   H HD13 . LEU B 2 28  ? -4.164  2.740   -3.810  1.00 0.00 ? 26  LEU B HD13 1  
ATOM 696   H HD21 . LEU B 2 28  ? -1.435  1.461   -4.212  1.00 0.00 ? 26  LEU B HD21 1  
ATOM 697   H HD22 . LEU B 2 28  ? -1.778  3.150   -3.829  1.00 0.00 ? 26  LEU B HD22 1  
ATOM 698   H HD23 . LEU B 2 28  ? -0.803  2.745   -5.244  1.00 0.00 ? 26  LEU B HD23 1  
ATOM 699   N N    . MET B 2 29  ? -0.746  -0.657  -8.428  1.00 0.00 ? 27  MET B N    1  
ATOM 700   C CA   . MET B 2 29  ? -0.675  -1.605  -9.527  1.00 0.00 ? 27  MET B CA   1  
ATOM 701   C C    . MET B 2 29  ? -1.535  -2.824  -9.240  1.00 0.00 ? 27  MET B C    1  
ATOM 702   O O    . MET B 2 29  ? -1.939  -3.051  -8.105  1.00 0.00 ? 27  MET B O    1  
ATOM 703   C CB   . MET B 2 29  ? 0.771   -2.015  -9.770  1.00 0.00 ? 27  MET B CB   1  
ATOM 704   C CG   . MET B 2 29  ? 1.631   -0.862  -10.247 1.00 0.00 ? 27  MET B CG   1  
ATOM 705   S SD   . MET B 2 29  ? 3.330   -0.954  -9.668  1.00 0.00 ? 27  MET B SD   1  
ATOM 706   C CE   . MET B 2 29  ? 3.958   0.562   -10.370 1.00 0.00 ? 27  MET B CE   1  
ATOM 707   H H    . MET B 2 29  ? -0.310  -0.886  -7.574  1.00 0.00 ? 27  MET B H    1  
ATOM 708   H HA   . MET B 2 29  ? -1.051  -1.114  -10.413 1.00 0.00 ? 27  MET B HA   1  
ATOM 709   H HB2  . MET B 2 29  ? 1.185   -2.399  -8.851  1.00 0.00 ? 27  MET B HB2  1  
ATOM 710   H HB3  . MET B 2 29  ? 0.794   -2.790  -10.521 1.00 0.00 ? 27  MET B HB3  1  
ATOM 711   H HG2  . MET B 2 29  ? 1.636   -0.861  -11.327 1.00 0.00 ? 27  MET B HG2  1  
ATOM 712   H HG3  . MET B 2 29  ? 1.196   0.061   -9.892  1.00 0.00 ? 27  MET B HG3  1  
ATOM 713   H HE1  . MET B 2 29  ? 5.013   0.645   -10.165 1.00 0.00 ? 27  MET B HE1  1  
ATOM 714   H HE2  . MET B 2 29  ? 3.436   1.401   -9.930  1.00 0.00 ? 27  MET B HE2  1  
ATOM 715   H HE3  . MET B 2 29  ? 3.794   0.556   -11.437 1.00 0.00 ? 27  MET B HE3  1  
ATOM 716   N N    . ALA B 2 30  ? -1.767  -3.619  -10.275 1.00 0.00 ? 28  ALA B N    1  
ATOM 717   C CA   . ALA B 2 30  ? -2.615  -4.811  -10.191 1.00 0.00 ? 28  ALA B CA   1  
ATOM 718   C C    . ALA B 2 30  ? -2.347  -5.693  -8.965  1.00 0.00 ? 28  ALA B C    1  
ATOM 719   O O    . ALA B 2 30  ? -3.282  -6.086  -8.277  1.00 0.00 ? 28  ALA B O    1  
ATOM 720   C CB   . ALA B 2 30  ? -2.478  -5.631  -11.463 1.00 0.00 ? 28  ALA B CB   1  
ATOM 721   H H    . ALA B 2 30  ? -1.355  -3.394  -11.136 1.00 0.00 ? 28  ALA B H    1  
ATOM 722   H HA   . ALA B 2 30  ? -3.638  -4.468  -10.142 1.00 0.00 ? 28  ALA B HA   1  
ATOM 723   H HB1  . ALA B 2 30  ? -1.470  -6.011  -11.539 1.00 0.00 ? 28  ALA B HB1  1  
ATOM 724   H HB2  . ALA B 2 30  ? -2.696  -5.009  -12.318 1.00 0.00 ? 28  ALA B HB2  1  
ATOM 725   H HB3  . ALA B 2 30  ? -3.172  -6.458  -11.433 1.00 0.00 ? 28  ALA B HB3  1  
ATOM 726   N N    . GLU B 2 31  ? -1.086  -6.008  -8.682  1.00 0.00 ? 29  GLU B N    1  
ATOM 727   C CA   . GLU B 2 31  ? -0.777  -6.876  -7.541  1.00 0.00 ? 29  GLU B CA   1  
ATOM 728   C C    . GLU B 2 31  ? 0.059   -6.176  -6.469  1.00 0.00 ? 29  GLU B C    1  
ATOM 729   O O    . GLU B 2 31  ? 0.423   -6.799  -5.467  1.00 0.00 ? 29  GLU B O    1  
ATOM 730   C CB   . GLU B 2 31  ? -0.016  -8.126  -8.001  1.00 0.00 ? 29  GLU B CB   1  
ATOM 731   C CG   . GLU B 2 31  ? -0.480  -8.710  -9.328  1.00 0.00 ? 29  GLU B CG   1  
ATOM 732   C CD   . GLU B 2 31  ? 0.624   -9.486  -10.024 1.00 0.00 ? 29  GLU B CD   1  
ATOM 733   O OE1  . GLU B 2 31  ? 1.277   -10.320 -9.362  1.00 0.00 ? 29  GLU B OE1  1  
ATOM 734   O OE2  . GLU B 2 31  ? 0.869   -9.238  -11.222 1.00 0.00 ? 29  GLU B OE2  1  
ATOM 735   H H    . GLU B 2 31  ? -0.366  -5.665  -9.243  1.00 0.00 ? 29  GLU B H    1  
ATOM 736   H HA   . GLU B 2 31  ? -1.713  -7.185  -7.103  1.00 0.00 ? 29  GLU B HA   1  
ATOM 737   H HB2  . GLU B 2 31  ? 1.030   -7.876  -8.096  1.00 0.00 ? 29  GLU B HB2  1  
ATOM 738   H HB3  . GLU B 2 31  ? -0.122  -8.889  -7.243  1.00 0.00 ? 29  GLU B HB3  1  
ATOM 739   H HG2  . GLU B 2 31  ? -1.310  -9.377  -9.145  1.00 0.00 ? 29  GLU B HG2  1  
ATOM 740   H HG3  . GLU B 2 31  ? -0.798  -7.905  -9.972  1.00 0.00 ? 29  GLU B HG3  1  
ATOM 741   N N    . ARG B 2 32  ? 0.344   -4.891  -6.631  1.00 0.00 ? 30  ARG B N    1  
ATOM 742   C CA   . ARG B 2 32  ? 1.182   -4.208  -5.649  1.00 0.00 ? 30  ARG B CA   1  
ATOM 743   C C    . ARG B 2 32  ? 0.951   -2.706  -5.631  1.00 0.00 ? 30  ARG B C    1  
ATOM 744   O O    . ARG B 2 32  ? 0.553   -2.115  -6.627  1.00 0.00 ? 30  ARG B O    1  
ATOM 745   C CB   . ARG B 2 32  ? 2.666   -4.489  -5.934  1.00 0.00 ? 30  ARG B CB   1  
ATOM 746   C CG   . ARG B 2 32  ? 3.220   -3.715  -7.123  1.00 0.00 ? 30  ARG B CG   1  
ATOM 747   C CD   . ARG B 2 32  ? 4.663   -4.094  -7.428  1.00 0.00 ? 30  ARG B CD   1  
ATOM 748   N NE   . ARG B 2 32  ? 5.135   -3.458  -8.658  1.00 0.00 ? 30  ARG B NE   1  
ATOM 749   C CZ   . ARG B 2 32  ? 5.705   -4.111  -9.674  1.00 0.00 ? 30  ARG B CZ   1  
ATOM 750   N NH1  . ARG B 2 32  ? 5.949   -5.412  -9.591  1.00 0.00 ? 30  ARG B NH1  1  
ATOM 751   N NH2  . ARG B 2 32  ? 6.040   -3.463  -10.778 1.00 0.00 ? 30  ARG B NH2  1  
ATOM 752   H H    . ARG B 2 32  ? -0.051  -4.384  -7.379  1.00 0.00 ? 30  ARG B H    1  
ATOM 753   H HA   . ARG B 2 32  ? 0.937   -4.606  -4.676  1.00 0.00 ? 30  ARG B HA   1  
ATOM 754   H HB2  . ARG B 2 32  ? 3.244   -4.224  -5.060  1.00 0.00 ? 30  ARG B HB2  1  
ATOM 755   H HB3  . ARG B 2 32  ? 2.789   -5.544  -6.128  1.00 0.00 ? 30  ARG B HB3  1  
ATOM 756   H HG2  . ARG B 2 32  ? 2.613   -3.926  -7.990  1.00 0.00 ? 30  ARG B HG2  1  
ATOM 757   H HG3  . ARG B 2 32  ? 3.175   -2.658  -6.902  1.00 0.00 ? 30  ARG B HG3  1  
ATOM 758   H HD2  . ARG B 2 32  ? 5.288   -3.780  -6.606  1.00 0.00 ? 30  ARG B HD2  1  
ATOM 759   H HD3  . ARG B 2 32  ? 4.725   -5.167  -7.540  1.00 0.00 ? 30  ARG B HD3  1  
ATOM 760   H HE   . ARG B 2 32  ? 4.991   -2.488  -8.743  1.00 0.00 ? 30  ARG B HE   1  
ATOM 761   H HH11 . ARG B 2 32  ? 5.719   -5.920  -8.765  1.00 0.00 ? 30  ARG B HH11 1  
ATOM 762   H HH12 . ARG B 2 32  ? 6.355   -5.896  -10.379 1.00 0.00 ? 30  ARG B HH12 1  
ATOM 763   H HH21 . ARG B 2 32  ? 5.874   -2.482  -10.859 1.00 0.00 ? 30  ARG B HH21 1  
ATOM 764   H HH22 . ARG B 2 32  ? 6.443   -3.972  -11.558 1.00 0.00 ? 30  ARG B HH22 1  
ATOM 765   N N    . ILE B 2 33  ? 1.210   -2.108  -4.485  1.00 0.00 ? 31  ILE B N    1  
ATOM 766   C CA   . ILE B 2 33  ? 1.080   -0.673  -4.314  1.00 0.00 ? 31  ILE B CA   1  
ATOM 767   C C    . ILE B 2 33  ? 2.471   -0.054  -4.369  1.00 0.00 ? 31  ILE B C    1  
ATOM 768   O O    . ILE B 2 33  ? 3.357   -0.427  -3.594  1.00 0.00 ? 31  ILE B O    1  
ATOM 769   C CB   . ILE B 2 33  ? 0.386   -0.308  -2.975  1.00 0.00 ? 31  ILE B CB   1  
ATOM 770   C CG1  . ILE B 2 33  ? 0.755   1.118   -2.546  1.00 0.00 ? 31  ILE B CG1  1  
ATOM 771   C CG2  . ILE B 2 33  ? 0.743   -1.310  -1.885  1.00 0.00 ? 31  ILE B CG2  1  
ATOM 772   C CD1  . ILE B 2 33  ? -0.082  1.648   -1.405  1.00 0.00 ? 31  ILE B CD1  1  
ATOM 773   H H    . ILE B 2 33  ? 1.519   -2.650  -3.725  1.00 0.00 ? 31  ILE B H    1  
ATOM 774   H HA   . ILE B 2 33  ? 0.481   -0.282  -5.132  1.00 0.00 ? 31  ILE B HA   1  
ATOM 775   H HB   . ILE B 2 33  ? -0.681  -0.359  -3.131  1.00 0.00 ? 31  ILE B HB   1  
ATOM 776   H HG12 . ILE B 2 33  ? 1.788   1.137   -2.234  1.00 0.00 ? 31  ILE B HG12 1  
ATOM 777   H HG13 . ILE B 2 33  ? 0.627   1.782   -3.389  1.00 0.00 ? 31  ILE B HG13 1  
ATOM 778   H HG21 . ILE B 2 33  ? 1.817   -1.405  -1.823  1.00 0.00 ? 31  ILE B HG21 1  
ATOM 779   H HG22 . ILE B 2 33  ? 0.310   -2.271  -2.121  1.00 0.00 ? 31  ILE B HG22 1  
ATOM 780   H HG23 . ILE B 2 33  ? 0.358   -0.964  -0.936  1.00 0.00 ? 31  ILE B HG23 1  
ATOM 781   H HD11 . ILE B 2 33  ? 0.048   1.014   -0.540  1.00 0.00 ? 31  ILE B HD11 1  
ATOM 782   H HD12 . ILE B 2 33  ? -1.123  1.656   -1.693  1.00 0.00 ? 31  ILE B HD12 1  
ATOM 783   H HD13 . ILE B 2 33  ? 0.234   2.653   -1.164  1.00 0.00 ? 31  ILE B HD13 1  
ATOM 784   N N    . ALA B 2 34  ? 2.675   0.855   -5.304  1.00 0.00 ? 32  ALA B N    1  
ATOM 785   C CA   . ALA B 2 34  ? 3.962   1.505   -5.454  1.00 0.00 ? 32  ALA B CA   1  
ATOM 786   C C    . ALA B 2 34  ? 3.827   3.009   -5.300  1.00 0.00 ? 32  ALA B C    1  
ATOM 787   O O    . ALA B 2 34  ? 2.762   3.571   -5.522  1.00 0.00 ? 32  ALA B O    1  
ATOM 788   C CB   . ALA B 2 34  ? 4.576   1.155   -6.801  1.00 0.00 ? 32  ALA B CB   1  
ATOM 789   H H    . ALA B 2 34  ? 1.940   1.105   -5.909  1.00 0.00 ? 32  ALA B H    1  
ATOM 790   H HA   . ALA B 2 34  ? 4.616   1.131   -4.679  1.00 0.00 ? 32  ALA B HA   1  
ATOM 791   H HB1  . ALA B 2 34  ? 4.657   0.082   -6.892  1.00 0.00 ? 32  ALA B HB1  1  
ATOM 792   H HB2  . ALA B 2 34  ? 5.558   1.598   -6.874  1.00 0.00 ? 32  ALA B HB2  1  
ATOM 793   H HB3  . ALA B 2 34  ? 3.948   1.537   -7.592  1.00 0.00 ? 32  ALA B HB3  1  
ATOM 794   N N    . TRP B 2 35  ? 4.899   3.651   -4.885  1.00 0.00 ? 33  TRP B N    1  
ATOM 795   C CA   . TRP B 2 35  ? 4.899   5.090   -4.709  1.00 0.00 ? 33  TRP B CA   1  
ATOM 796   C C    . TRP B 2 35  ? 6.283   5.646   -5.026  1.00 0.00 ? 33  TRP B C    1  
ATOM 797   O O    . TRP B 2 35  ? 7.299   5.090   -4.598  1.00 0.00 ? 33  TRP B O    1  
ATOM 798   C CB   . TRP B 2 35  ? 4.440   5.437   -3.286  1.00 0.00 ? 33  TRP B CB   1  
ATOM 799   C CG   . TRP B 2 35  ? 4.650   6.865   -2.878  1.00 0.00 ? 33  TRP B CG   1  
ATOM 800   C CD1  . TRP B 2 35  ? 3.749   7.876   -2.997  1.00 0.00 ? 33  TRP B CD1  1  
ATOM 801   C CD2  . TRP B 2 35  ? 5.817   7.437   -2.269  1.00 0.00 ? 33  TRP B CD2  1  
ATOM 802   N NE1  . TRP B 2 35  ? 4.277   9.042   -2.516  1.00 0.00 ? 33  TRP B NE1  1  
ATOM 803   C CE2  . TRP B 2 35  ? 5.546   8.801   -2.061  1.00 0.00 ? 33  TRP B CE2  1  
ATOM 804   C CE3  . TRP B 2 35  ? 7.061   6.934   -1.885  1.00 0.00 ? 33  TRP B CE3  1  
ATOM 805   C CZ2  . TRP B 2 35  ? 6.472   9.665   -1.484  1.00 0.00 ? 33  TRP B CZ2  1  
ATOM 806   C CZ3  . TRP B 2 35  ? 7.980   7.791   -1.312  1.00 0.00 ? 33  TRP B CZ3  1  
ATOM 807   C CH2  . TRP B 2 35  ? 7.680   9.144   -1.116  1.00 0.00 ? 33  TRP B CH2  1  
ATOM 808   H H    . TRP B 2 35  ? 5.716   3.142   -4.688  1.00 0.00 ? 33  TRP B H    1  
ATOM 809   H HA   . TRP B 2 35  ? 4.194   5.505   -5.415  1.00 0.00 ? 33  TRP B HA   1  
ATOM 810   H HB2  . TRP B 2 35  ? 3.384   5.237   -3.214  1.00 0.00 ? 33  TRP B HB2  1  
ATOM 811   H HB3  . TRP B 2 35  ? 4.947   4.807   -2.586  1.00 0.00 ? 33  TRP B HB3  1  
ATOM 812   H HD1  . TRP B 2 35  ? 2.765   7.762   -3.421  1.00 0.00 ? 33  TRP B HD1  1  
ATOM 813   H HE1  . TRP B 2 35  ? 3.814   9.909   -2.496  1.00 0.00 ? 33  TRP B HE1  1  
ATOM 814   H HE3  . TRP B 2 35  ? 7.311   5.892   -2.028  1.00 0.00 ? 33  TRP B HE3  1  
ATOM 815   H HZ2  . TRP B 2 35  ? 6.257   10.712  -1.325  1.00 0.00 ? 33  TRP B HZ2  1  
ATOM 816   H HZ3  . TRP B 2 35  ? 8.947   7.419   -1.008  1.00 0.00 ? 33  TRP B HZ3  1  
ATOM 817   H HH2  . TRP B 2 35  ? 8.428   9.780   -0.665  1.00 0.00 ? 33  TRP B HH2  1  
ATOM 818   N N    . ALA B 2 36  ? 6.317   6.724   -5.795  1.00 0.00 ? 34  ALA B N    1  
ATOM 819   C CA   . ALA B 2 36  ? 7.570   7.349   -6.185  1.00 0.00 ? 34  ALA B CA   1  
ATOM 820   C C    . ALA B 2 36  ? 7.716   8.715   -5.532  1.00 0.00 ? 34  ALA B C    1  
ATOM 821   O O    . ALA B 2 36  ? 6.822   9.554   -5.628  1.00 0.00 ? 34  ALA B O    1  
ATOM 822   C CB   . ALA B 2 36  ? 7.649   7.477   -7.699  1.00 0.00 ? 34  ALA B CB   1  
ATOM 823   H H    . ALA B 2 36  ? 5.470   7.127   -6.095  1.00 0.00 ? 34  ALA B H    1  
ATOM 824   H HA   . ALA B 2 36  ? 8.379   6.713   -5.857  1.00 0.00 ? 34  ALA B HA   1  
ATOM 825   H HB1  . ALA B 2 36  ? 6.855   8.120   -8.049  1.00 0.00 ? 34  ALA B HB1  1  
ATOM 826   H HB2  . ALA B 2 36  ? 7.545   6.500   -8.149  1.00 0.00 ? 34  ALA B HB2  1  
ATOM 827   H HB3  . ALA B 2 36  ? 8.602   7.899   -7.976  1.00 0.00 ? 34  ALA B HB3  1  
ATOM 828   N N    . PRO B 2 37  ? 8.843   8.950   -4.855  1.00 0.00 ? 35  PRO B N    1  
ATOM 829   C CA   . PRO B 2 37  ? 9.105   10.220  -4.188  1.00 0.00 ? 35  PRO B CA   1  
ATOM 830   C C    . PRO B 2 37  ? 9.468   11.316  -5.181  1.00 0.00 ? 35  PRO B C    1  
ATOM 831   O O    . PRO B 2 37  ? 10.167  11.069  -6.167  1.00 0.00 ? 35  PRO B O    1  
ATOM 832   C CB   . PRO B 2 37  ? 10.285  9.903   -3.273  1.00 0.00 ? 35  PRO B CB   1  
ATOM 833   C CG   . PRO B 2 37  ? 10.993  8.772   -3.936  1.00 0.00 ? 35  PRO B CG   1  
ATOM 834   C CD   . PRO B 2 37  ? 9.950   7.994   -4.691  1.00 0.00 ? 35  PRO B CD   1  
ATOM 835   H HA   . PRO B 2 37  ? 8.260   10.538  -3.594  1.00 0.00 ? 35  PRO B HA   1  
ATOM 836   H HB2  . PRO B 2 37  ? 10.922  10.773  -3.190  1.00 0.00 ? 35  PRO B HB2  1  
ATOM 837   H HB3  . PRO B 2 37  ? 9.923   9.622   -2.297  1.00 0.00 ? 35  PRO B HB3  1  
ATOM 838   H HG2  . PRO B 2 37  ? 11.739  9.156   -4.617  1.00 0.00 ? 35  PRO B HG2  1  
ATOM 839   H HG3  . PRO B 2 37  ? 11.458  8.145   -3.189  1.00 0.00 ? 35  PRO B HG3  1  
ATOM 840   H HD2  . PRO B 2 37  ? 10.334  7.685   -5.652  1.00 0.00 ? 35  PRO B HD2  1  
ATOM 841   H HD3  . PRO B 2 37  ? 9.634   7.135   -4.118  1.00 0.00 ? 35  PRO B HD3  1  
ATOM 842   N N    . GLU B 2 38  ? 9.003   12.527  -4.909  1.00 0.00 ? 36  GLU B N    1  
ATOM 843   C CA   . GLU B 2 38  ? 9.263   13.663  -5.782  1.00 0.00 ? 36  GLU B CA   1  
ATOM 844   C C    . GLU B 2 38  ? 10.762  13.896  -5.932  1.00 0.00 ? 36  GLU B C    1  
ATOM 845   O O    . GLU B 2 38  ? 11.515  13.862  -4.952  1.00 0.00 ? 36  GLU B O    1  
ATOM 846   C CB   . GLU B 2 38  ? 8.579   14.914  -5.237  1.00 0.00 ? 36  GLU B CB   1  
ATOM 847   C CG   . GLU B 2 38  ? 8.218   15.928  -6.309  1.00 0.00 ? 36  GLU B CG   1  
ATOM 848   C CD   . GLU B 2 38  ? 6.939   16.668  -5.989  1.00 0.00 ? 36  GLU B CD   1  
ATOM 849   O OE1  . GLU B 2 38  ? 5.871   16.276  -6.508  1.00 0.00 ? 36  GLU B OE1  1  
ATOM 850   O OE2  . GLU B 2 38  ? 6.985   17.632  -5.197  1.00 0.00 ? 36  GLU B OE2  1  
ATOM 851   H H    . GLU B 2 38  ? 8.472   12.666  -4.091  1.00 0.00 ? 36  GLU B H    1  
ATOM 852   H HA   . GLU B 2 38  ? 8.850   13.432  -6.752  1.00 0.00 ? 36  GLU B HA   1  
ATOM 853   H HB2  . GLU B 2 38  ? 7.671   14.622  -4.729  1.00 0.00 ? 36  GLU B HB2  1  
ATOM 854   H HB3  . GLU B 2 38  ? 9.238   15.393  -4.528  1.00 0.00 ? 36  GLU B HB3  1  
ATOM 855   H HG2  . GLU B 2 38  ? 9.021   16.645  -6.396  1.00 0.00 ? 36  GLU B HG2  1  
ATOM 856   H HG3  . GLU B 2 38  ? 8.094   15.411  -7.249  1.00 0.00 ? 36  GLU B HG3  1  
ATOM 857   N N    . GLY B 2 39  ? 11.192  14.094  -7.167  1.00 0.00 ? 37  GLY B N    1  
ATOM 858   C CA   . GLY B 2 39  ? 12.594  14.325  -7.440  1.00 0.00 ? 37  GLY B CA   1  
ATOM 859   C C    . GLY B 2 39  ? 13.335  13.047  -7.775  1.00 0.00 ? 37  GLY B C    1  
ATOM 860   O O    . GLY B 2 39  ? 14.514  13.081  -8.115  1.00 0.00 ? 37  GLY B O    1  
ATOM 861   H H    . GLY B 2 39  ? 10.548  14.086  -7.906  1.00 0.00 ? 37  GLY B H    1  
ATOM 862   H HA2  . GLY B 2 39  ? 12.680  15.007  -8.273  1.00 0.00 ? 37  GLY B HA2  1  
ATOM 863   H HA3  . GLY B 2 39  ? 13.049  14.776  -6.571  1.00 0.00 ? 37  GLY B HA3  1  
ATOM 864   N N    . LYS B 2 40  ? 12.652  11.914  -7.657  1.00 0.00 ? 38  LYS B N    1  
ATOM 865   C CA   . LYS B 2 40  ? 13.261  10.626  -7.961  1.00 0.00 ? 38  LYS B CA   1  
ATOM 866   C C    . LYS B 2 40  ? 12.606  10.002  -9.184  1.00 0.00 ? 38  LYS B C    1  
ATOM 867   O O    . LYS B 2 40  ? 11.448  10.278  -9.488  1.00 0.00 ? 38  LYS B O    1  
ATOM 868   C CB   . LYS B 2 40  ? 13.171  9.676   -6.762  1.00 0.00 ? 38  LYS B CB   1  
ATOM 869   C CG   . LYS B 2 40  ? 14.395  9.721   -5.854  1.00 0.00 ? 38  LYS B CG   1  
ATOM 870   C CD   . LYS B 2 40  ? 14.514  11.055  -5.129  1.00 0.00 ? 38  LYS B CD   1  
ATOM 871   C CE   . LYS B 2 40  ? 13.501  11.168  -4.006  1.00 0.00 ? 38  LYS B CE   1  
ATOM 872   N NZ   . LYS B 2 40  ? 13.404  12.551  -3.466  1.00 0.00 ? 38  LYS B NZ   1  
ATOM 873   H H    . LYS B 2 40  ? 11.711  11.943  -7.375  1.00 0.00 ? 38  LYS B H    1  
ATOM 874   H HA   . LYS B 2 40  ? 14.303  10.803  -8.185  1.00 0.00 ? 38  LYS B HA   1  
ATOM 875   H HB2  . LYS B 2 40  ? 12.303  9.938   -6.175  1.00 0.00 ? 38  LYS B HB2  1  
ATOM 876   H HB3  . LYS B 2 40  ? 13.056  8.665   -7.126  1.00 0.00 ? 38  LYS B HB3  1  
ATOM 877   H HG2  . LYS B 2 40  ? 14.312  8.934   -5.120  1.00 0.00 ? 38  LYS B HG2  1  
ATOM 878   H HG3  . LYS B 2 40  ? 15.280  9.567   -6.452  1.00 0.00 ? 38  LYS B HG3  1  
ATOM 879   H HD2  . LYS B 2 40  ? 15.507  11.140  -4.716  1.00 0.00 ? 38  LYS B HD2  1  
ATOM 880   H HD3  . LYS B 2 40  ? 14.346  11.854  -5.837  1.00 0.00 ? 38  LYS B HD3  1  
ATOM 881   H HE2  . LYS B 2 40  ? 12.533  10.872  -4.382  1.00 0.00 ? 38  LYS B HE2  1  
ATOM 882   H HE3  . LYS B 2 40  ? 13.794  10.501  -3.208  1.00 0.00 ? 38  LYS B HE3  1  
ATOM 883   H HZ1  . LYS B 2 40  ? 14.346  12.984  -3.411  1.00 0.00 ? 38  LYS B HZ1  1  
ATOM 884   H HZ2  . LYS B 2 40  ? 12.988  12.529  -2.509  1.00 0.00 ? 38  LYS B HZ2  1  
ATOM 885   H HZ3  . LYS B 2 40  ? 12.796  13.136  -4.084  1.00 0.00 ? 38  LYS B HZ3  1  
ATOM 886   N N    . ASP B 2 41  ? 13.361  9.164   -9.876  1.00 0.00 ? 39  ASP B N    1  
ATOM 887   C CA   . ASP B 2 41  ? 12.886  8.496   -11.080 1.00 0.00 ? 39  ASP B CA   1  
ATOM 888   C C    . ASP B 2 41  ? 12.408  7.080   -10.776 1.00 0.00 ? 39  ASP B C    1  
ATOM 889   O O    . ASP B 2 41  ? 11.765  6.438   -11.605 1.00 0.00 ? 39  ASP B O    1  
ATOM 890   C CB   . ASP B 2 41  ? 14.017  8.434   -12.114 1.00 0.00 ? 39  ASP B CB   1  
ATOM 891   C CG   . ASP B 2 41  ? 15.178  7.563   -11.654 1.00 0.00 ? 39  ASP B CG   1  
ATOM 892   O OD1  . ASP B 2 41  ? 15.796  6.884   -12.499 1.00 0.00 ? 39  ASP B OD1  1  
ATOM 893   O OD2  . ASP B 2 41  ? 15.477  7.546   -10.436 1.00 0.00 ? 39  ASP B OD2  1  
ATOM 894   H H    . ASP B 2 41  ? 14.280  8.989   -9.575  1.00 0.00 ? 39  ASP B H    1  
ATOM 895   H HA   . ASP B 2 41  ? 12.067  9.068   -11.486 1.00 0.00 ? 39  ASP B HA   1  
ATOM 896   H HB2  . ASP B 2 41  ? 13.631  8.027   -13.037 1.00 0.00 ? 39  ASP B HB2  1  
ATOM 897   H HB3  . ASP B 2 41  ? 14.388  9.433   -12.292 1.00 0.00 ? 39  ASP B HB3  1  
ATOM 898   N N    . ARG B 2 42  ? 12.714  6.600   -9.582  1.00 0.00 ? 40  ARG B N    1  
ATOM 899   C CA   . ARG B 2 42  ? 12.343  5.251   -9.191  1.00 0.00 ? 40  ARG B CA   1  
ATOM 900   C C    . ARG B 2 42  ? 11.412  5.242   -7.987  1.00 0.00 ? 40  ARG B C    1  
ATOM 901   O O    . ARG B 2 42  ? 11.431  6.158   -7.160  1.00 0.00 ? 40  ARG B O    1  
ATOM 902   C CB   . ARG B 2 42  ? 13.601  4.432   -8.890  1.00 0.00 ? 40  ARG B CB   1  
ATOM 903   C CG   . ARG B 2 42  ? 14.538  5.095   -7.892  1.00 0.00 ? 40  ARG B CG   1  
ATOM 904   C CD   . ARG B 2 42  ? 15.990  4.786   -8.212  1.00 0.00 ? 40  ARG B CD   1  
ATOM 905   N NE   . ARG B 2 42  ? 16.351  5.218   -9.562  1.00 0.00 ? 40  ARG B NE   1  
ATOM 906   C CZ   . ARG B 2 42  ? 17.202  4.578   -10.358 1.00 0.00 ? 40  ARG B CZ   1  
ATOM 907   N NH1  . ARG B 2 42  ? 17.852  3.503   -9.919  1.00 0.00 ? 40  ARG B NH1  1  
ATOM 908   N NH2  . ARG B 2 42  ? 17.403  5.017   -11.593 1.00 0.00 ? 40  ARG B NH2  1  
ATOM 909   H H    . ARG B 2 42  ? 13.193  7.170   -8.948  1.00 0.00 ? 40  ARG B H    1  
ATOM 910   H HA   . ARG B 2 42  ? 11.828  4.798   -10.025 1.00 0.00 ? 40  ARG B HA   1  
ATOM 911   H HB2  . ARG B 2 42  ? 13.306  3.473   -8.491  1.00 0.00 ? 40  ARG B HB2  1  
ATOM 912   H HB3  . ARG B 2 42  ? 14.143  4.277   -9.811  1.00 0.00 ? 40  ARG B HB3  1  
ATOM 913   H HG2  . ARG B 2 42  ? 14.390  6.164   -7.928  1.00 0.00 ? 40  ARG B HG2  1  
ATOM 914   H HG3  . ARG B 2 42  ? 14.311  4.730   -6.901  1.00 0.00 ? 40  ARG B HG3  1  
ATOM 915   H HD2  . ARG B 2 42  ? 16.621  5.297   -7.498  1.00 0.00 ? 40  ARG B HD2  1  
ATOM 916   H HD3  . ARG B 2 42  ? 16.145  3.720   -8.131  1.00 0.00 ? 40  ARG B HD3  1  
ATOM 917   H HE   . ARG B 2 42  ? 15.907  6.045   -9.907  1.00 0.00 ? 40  ARG B HE   1  
ATOM 918   H HH11 . ARG B 2 42  ? 17.703  3.175   -8.985  1.00 0.00 ? 40  ARG B HH11 1  
ATOM 919   H HH12 . ARG B 2 42  ? 18.491  3.022   -10.518 1.00 0.00 ? 40  ARG B HH12 1  
ATOM 920   H HH21 . ARG B 2 42  ? 16.901  5.841   -11.927 1.00 0.00 ? 40  ARG B HH21 1  
ATOM 921   H HH22 . ARG B 2 42  ? 18.041  4.551   -12.201 1.00 0.00 ? 40  ARG B HH22 1  
ATOM 922   N N    . PHE B 2 43  ? 10.601  4.196   -7.899  1.00 0.00 ? 41  PHE B N    1  
ATOM 923   C CA   . PHE B 2 43  ? 9.658   4.033   -6.803  1.00 0.00 ? 41  PHE B CA   1  
ATOM 924   C C    . PHE B 2 43  ? 10.377  3.465   -5.587  1.00 0.00 ? 41  PHE B C    1  
ATOM 925   O O    . PHE B 2 43  ? 10.992  2.404   -5.668  1.00 0.00 ? 41  PHE B O    1  
ATOM 926   C CB   . PHE B 2 43  ? 8.519   3.085   -7.203  1.00 0.00 ? 41  PHE B CB   1  
ATOM 927   C CG   . PHE B 2 43  ? 7.904   3.378   -8.545  1.00 0.00 ? 41  PHE B CG   1  
ATOM 928   C CD1  . PHE B 2 43  ? 6.821   4.233   -8.654  1.00 0.00 ? 41  PHE B CD1  1  
ATOM 929   C CD2  . PHE B 2 43  ? 8.406   2.789   -9.696  1.00 0.00 ? 41  PHE B CD2  1  
ATOM 930   C CE1  . PHE B 2 43  ? 6.249   4.497   -9.885  1.00 0.00 ? 41  PHE B CE1  1  
ATOM 931   C CE2  . PHE B 2 43  ? 7.839   3.050   -10.929 1.00 0.00 ? 41  PHE B CE2  1  
ATOM 932   C CZ   . PHE B 2 43  ? 6.759   3.906   -11.023 1.00 0.00 ? 41  PHE B CZ   1  
ATOM 933   H H    . PHE B 2 43  ? 10.644  3.506   -8.592  1.00 0.00 ? 41  PHE B H    1  
ATOM 934   H HA   . PHE B 2 43  ? 9.251   5.002   -6.559  1.00 0.00 ? 41  PHE B HA   1  
ATOM 935   H HB2  . PHE B 2 43  ? 8.897   2.075   -7.230  1.00 0.00 ? 41  PHE B HB2  1  
ATOM 936   H HB3  . PHE B 2 43  ? 7.736   3.147   -6.460  1.00 0.00 ? 41  PHE B HB3  1  
ATOM 937   H HD1  . PHE B 2 43  ? 6.421   4.698   -7.764  1.00 0.00 ? 41  PHE B HD1  1  
ATOM 938   H HD2  . PHE B 2 43  ? 9.250   2.120   -9.626  1.00 0.00 ? 41  PHE B HD2  1  
ATOM 939   H HE1  . PHE B 2 43  ? 5.405   5.165   -9.956  1.00 0.00 ? 41  PHE B HE1  1  
ATOM 940   H HE2  . PHE B 2 43  ? 8.241   2.586   -11.819 1.00 0.00 ? 41  PHE B HE2  1  
ATOM 941   H HZ   . PHE B 2 43  ? 6.312   4.112   -11.985 1.00 0.00 ? 41  PHE B HZ   1  
ATOM 942   N N    . THR B 2 44  ? 10.312  4.172   -4.472  1.00 0.00 ? 42  THR B N    1  
ATOM 943   C CA   . THR B 2 44  ? 10.955  3.711   -3.251  1.00 0.00 ? 42  THR B CA   1  
ATOM 944   C C    . THR B 2 44  ? 9.982   2.885   -2.420  1.00 0.00 ? 42  THR B C    1  
ATOM 945   O O    . THR B 2 44  ? 10.356  2.272   -1.421  1.00 0.00 ? 42  THR B O    1  
ATOM 946   C CB   . THR B 2 44  ? 11.475  4.892   -2.415  1.00 0.00 ? 42  THR B CB   1  
ATOM 947   O OG1  . THR B 2 44  ? 10.489  5.931   -2.375  1.00 0.00 ? 42  THR B OG1  1  
ATOM 948   C CG2  . THR B 2 44  ? 12.772  5.438   -2.997  1.00 0.00 ? 42  THR B CG2  1  
ATOM 949   H H    . THR B 2 44  ? 9.825   5.024   -4.466  1.00 0.00 ? 42  THR B H    1  
ATOM 950   H HA   . THR B 2 44  ? 11.795  3.090   -3.530  1.00 0.00 ? 42  THR B HA   1  
ATOM 951   H HB   . THR B 2 44  ? 11.667  4.546   -1.409  1.00 0.00 ? 42  THR B HB   1  
ATOM 952   H HG1  . THR B 2 44  ? 9.810   5.702   -1.732  1.00 0.00 ? 42  THR B HG1  1  
ATOM 953   H HG21 . THR B 2 44  ? 13.528  4.667   -2.983  1.00 0.00 ? 42  THR B HG21 1  
ATOM 954   H HG22 . THR B 2 44  ? 13.104  6.281   -2.407  1.00 0.00 ? 42  THR B HG22 1  
ATOM 955   H HG23 . THR B 2 44  ? 12.603  5.757   -4.016  1.00 0.00 ? 42  THR B HG23 1  
ATOM 956   N N    . ILE B 2 45  ? 8.726   2.887   -2.841  1.00 0.00 ? 43  ILE B N    1  
ATOM 957   C CA   . ILE B 2 45  ? 7.686   2.144   -2.157  1.00 0.00 ? 43  ILE B CA   1  
ATOM 958   C C    . ILE B 2 45  ? 7.117   1.072   -3.074  1.00 0.00 ? 43  ILE B C    1  
ATOM 959   O O    . ILE B 2 45  ? 6.614   1.375   -4.156  1.00 0.00 ? 43  ILE B O    1  
ATOM 960   C CB   . ILE B 2 45  ? 6.550   3.078   -1.678  1.00 0.00 ? 43  ILE B CB   1  
ATOM 961   C CG1  . ILE B 2 45  ? 7.007   3.894   -0.465  1.00 0.00 ? 43  ILE B CG1  1  
ATOM 962   C CG2  . ILE B 2 45  ? 5.287   2.292   -1.349  1.00 0.00 ? 43  ILE B CG2  1  
ATOM 963   C CD1  . ILE B 2 45  ? 7.437   3.048   0.714   1.00 0.00 ? 43  ILE B CD1  1  
ATOM 964   H H    . ILE B 2 45  ? 8.495   3.400   -3.645  1.00 0.00 ? 43  ILE B H    1  
ATOM 965   H HA   . ILE B 2 45  ? 8.126   1.669   -1.292  1.00 0.00 ? 43  ILE B HA   1  
ATOM 966   H HB   . ILE B 2 45  ? 6.315   3.756   -2.485  1.00 0.00 ? 43  ILE B HB   1  
ATOM 967   H HG12 . ILE B 2 45  ? 7.846   4.510   -0.750  1.00 0.00 ? 43  ILE B HG12 1  
ATOM 968   H HG13 . ILE B 2 45  ? 6.195   4.528   -0.139  1.00 0.00 ? 43  ILE B HG13 1  
ATOM 969   H HG21 . ILE B 2 45  ? 5.495   1.591   -0.556  1.00 0.00 ? 43  ILE B HG21 1  
ATOM 970   H HG22 . ILE B 2 45  ? 4.958   1.755   -2.228  1.00 0.00 ? 43  ILE B HG22 1  
ATOM 971   H HG23 . ILE B 2 45  ? 4.509   2.974   -1.034  1.00 0.00 ? 43  ILE B HG23 1  
ATOM 972   H HD11 . ILE B 2 45  ? 7.695   3.690   1.542   1.00 0.00 ? 43  ILE B HD11 1  
ATOM 973   H HD12 . ILE B 2 45  ? 8.296   2.454   0.436   1.00 0.00 ? 43  ILE B HD12 1  
ATOM 974   H HD13 . ILE B 2 45  ? 6.626   2.396   1.003   1.00 0.00 ? 43  ILE B HD13 1  
ATOM 975   N N    . SER B 2 46  ? 7.240   -0.173  -2.653  1.00 0.00 ? 44  SER B N    1  
ATOM 976   C CA   . SER B 2 46  ? 6.724   -1.298  -3.409  1.00 0.00 ? 44  SER B CA   1  
ATOM 977   C C    . SER B 2 46  ? 6.288   -2.391  -2.445  1.00 0.00 ? 44  SER B C    1  
ATOM 978   O O    . SER B 2 46  ? 7.118   -3.121  -1.906  1.00 0.00 ? 44  SER B O    1  
ATOM 979   C CB   . SER B 2 46  ? 7.788   -1.825  -4.381  1.00 0.00 ? 44  SER B CB   1  
ATOM 980   O OG   . SER B 2 46  ? 7.272   -2.863  -5.200  1.00 0.00 ? 44  SER B OG   1  
ATOM 981   H H    . SER B 2 46  ? 7.693   -0.345  -1.801  1.00 0.00 ? 44  SER B H    1  
ATOM 982   H HA   . SER B 2 46  ? 5.865   -0.960  -3.968  1.00 0.00 ? 44  SER B HA   1  
ATOM 983   H HB2  . SER B 2 46  ? 8.121   -1.018  -5.017  1.00 0.00 ? 44  SER B HB2  1  
ATOM 984   H HB3  . SER B 2 46  ? 8.627   -2.208  -3.819  1.00 0.00 ? 44  SER B HB3  1  
ATOM 985   H HG   . SER B 2 46  ? 7.630   -3.705  -4.906  1.00 0.00 ? 44  SER B HG   1  
ATOM 986   N N    . HIS B 2 47  ? 4.989   -2.487  -2.215  1.00 0.00 ? 45  HIS B N    1  
ATOM 987   C CA   . HIS B 2 47  ? 4.452   -3.490  -1.306  1.00 0.00 ? 45  HIS B CA   1  
ATOM 988   C C    . HIS B 2 47  ? 3.405   -4.326  -2.016  1.00 0.00 ? 45  HIS B C    1  
ATOM 989   O O    . HIS B 2 47  ? 2.583   -3.796  -2.765  1.00 0.00 ? 45  HIS B O    1  
ATOM 990   C CB   . HIS B 2 47  ? 3.823   -2.836  -0.068  1.00 0.00 ? 45  HIS B CB   1  
ATOM 991   C CG   . HIS B 2 47  ? 4.716   -1.857  0.630   1.00 0.00 ? 45  HIS B CG   1  
ATOM 992   N ND1  . HIS B 2 47  ? 5.669   -2.209  1.561   1.00 0.00 ? 45  HIS B ND1  1  
ATOM 993   C CD2  . HIS B 2 47  ? 4.794   -0.509  0.505   1.00 0.00 ? 45  HIS B CD2  1  
ATOM 994   C CE1  . HIS B 2 47  ? 6.286   -1.089  1.961   1.00 0.00 ? 45  HIS B CE1  1  
ATOM 995   N NE2  . HIS B 2 47  ? 5.792   -0.029  1.348   1.00 0.00 ? 45  HIS B NE2  1  
ATOM 996   H H    . HIS B 2 47  ? 4.372   -1.870  -2.670  1.00 0.00 ? 45  HIS B H    1  
ATOM 997   H HA   . HIS B 2 47  ? 5.264   -4.131  -0.995  1.00 0.00 ? 45  HIS B HA   1  
ATOM 998   H HB2  . HIS B 2 47  ? 2.928   -2.310  -0.365  1.00 0.00 ? 45  HIS B HB2  1  
ATOM 999   H HB3  . HIS B 2 47  ? 3.559   -3.608  0.641   1.00 0.00 ? 45  HIS B HB3  1  
ATOM 1000  H HD1  . HIS B 2 47  ? 5.856   -3.115  1.881   1.00 0.00 ? 45  HIS B HD1  1  
ATOM 1001  H HD2  . HIS B 2 47  ? 4.175   0.106   -0.135  1.00 0.00 ? 45  HIS B HD2  1  
ATOM 1002  H HE1  . HIS B 2 47  ? 7.083   -1.058  2.688   1.00 0.00 ? 45  HIS B HE1  1  
ATOM 1003  N N    . MET B 2 48  ? 3.436   -5.625  -1.795  1.00 0.00 ? 46  MET B N    1  
ATOM 1004  C CA   . MET B 2 48  ? 2.471   -6.511  -2.413  1.00 0.00 ? 46  MET B CA   1  
ATOM 1005  C C    . MET B 2 48  ? 1.229   -6.577  -1.543  1.00 0.00 ? 46  MET B C    1  
ATOM 1006  O O    . MET B 2 48  ? 1.327   -6.596  -0.321  1.00 0.00 ? 46  MET B O    1  
ATOM 1007  C CB   . MET B 2 48  ? 3.054   -7.916  -2.596  1.00 0.00 ? 46  MET B CB   1  
ATOM 1008  C CG   . MET B 2 48  ? 4.010   -8.045  -3.770  1.00 0.00 ? 46  MET B CG   1  
ATOM 1009  S SD   . MET B 2 48  ? 3.181   -8.544  -5.297  1.00 0.00 ? 46  MET B SD   1  
ATOM 1010  C CE   . MET B 2 48  ? 2.494   -10.126 -4.806  1.00 0.00 ? 46  MET B CE   1  
ATOM 1011  H H    . MET B 2 48  ? 4.109   -6.001  -1.179  1.00 0.00 ? 46  MET B H    1  
ATOM 1012  H HA   . MET B 2 48  ? 2.206   -6.103  -3.377  1.00 0.00 ? 46  MET B HA   1  
ATOM 1013  H HB2  . MET B 2 48  ? 3.587   -8.189  -1.696  1.00 0.00 ? 46  MET B HB2  1  
ATOM 1014  H HB3  . MET B 2 48  ? 2.241   -8.612  -2.745  1.00 0.00 ? 46  MET B HB3  1  
ATOM 1015  H HG2  . MET B 2 48  ? 4.488   -7.089  -3.934  1.00 0.00 ? 46  MET B HG2  1  
ATOM 1016  H HG3  . MET B 2 48  ? 4.760   -8.783  -3.526  1.00 0.00 ? 46  MET B HG3  1  
ATOM 1017  H HE1  . MET B 2 48  ? 1.817   -9.984  -3.977  1.00 0.00 ? 46  MET B HE1  1  
ATOM 1018  H HE2  . MET B 2 48  ? 3.293   -10.790 -4.508  1.00 0.00 ? 46  MET B HE2  1  
ATOM 1019  H HE3  . MET B 2 48  ? 1.958   -10.559 -5.637  1.00 0.00 ? 46  MET B HE3  1  
ATOM 1020  N N    . TYR B 2 49  ? 0.065   -6.593  -2.175  1.00 0.00 ? 47  TYR B N    1  
ATOM 1021  C CA   . TYR B 2 49  ? -1.210  -6.674  -1.449  1.00 0.00 ? 47  TYR B CA   1  
ATOM 1022  C C    . TYR B 2 49  ? -1.249  -7.924  -0.572  1.00 0.00 ? 47  TYR B C    1  
ATOM 1023  O O    . TYR B 2 49  ? -1.965  -7.972  0.424   1.00 0.00 ? 47  TYR B O    1  
ATOM 1024  C CB   . TYR B 2 49  ? -2.363  -6.695  -2.452  1.00 0.00 ? 47  TYR B CB   1  
ATOM 1025  C CG   . TYR B 2 49  ? -2.405  -5.464  -3.325  1.00 0.00 ? 47  TYR B CG   1  
ATOM 1026  C CD1  . TYR B 2 49  ? -2.060  -4.221  -2.812  1.00 0.00 ? 47  TYR B CD1  1  
ATOM 1027  C CD2  . TYR B 2 49  ? -2.778  -5.542  -4.656  1.00 0.00 ? 47  TYR B CD2  1  
ATOM 1028  C CE1  . TYR B 2 49  ? -2.088  -3.091  -3.601  1.00 0.00 ? 47  TYR B CE1  1  
ATOM 1029  C CE2  . TYR B 2 49  ? -2.809  -4.414  -5.452  1.00 0.00 ? 47  TYR B CE2  1  
ATOM 1030  C CZ   . TYR B 2 49  ? -2.464  -3.192  -4.917  1.00 0.00 ? 47  TYR B CZ   1  
ATOM 1031  O OH   . TYR B 2 49  ? -2.487  -2.067  -5.705  1.00 0.00 ? 47  TYR B OH   1  
ATOM 1032  H H    . TYR B 2 49  ? 0.056   -6.541  -3.159  1.00 0.00 ? 47  TYR B H    1  
ATOM 1033  H HA   . TYR B 2 49  ? -1.316  -5.790  -0.807  1.00 0.00 ? 47  TYR B HA   1  
ATOM 1034  H HB2  . TYR B 2 49  ? -2.260  -7.558  -3.093  1.00 0.00 ? 47  TYR B HB2  1  
ATOM 1035  H HB3  . TYR B 2 49  ? -3.298  -6.757  -1.914  1.00 0.00 ? 47  TYR B HB3  1  
ATOM 1036  H HD1  . TYR B 2 49  ? -1.767  -4.144  -1.776  1.00 0.00 ? 47  TYR B HD1  1  
ATOM 1037  H HD2  . TYR B 2 49  ? -3.049  -6.502  -5.071  1.00 0.00 ? 47  TYR B HD2  1  
ATOM 1038  H HE1  . TYR B 2 49  ? -1.817  -2.134  -3.182  1.00 0.00 ? 47  TYR B HE1  1  
ATOM 1039  H HE2  . TYR B 2 49  ? -3.105  -4.494  -6.487  1.00 0.00 ? 47  TYR B HE2  1  
ATOM 1040  H HH   . TYR B 2 49  ? -2.564  -2.329  -6.633  1.00 0.00 ? 47  TYR B HH   1  
ATOM 1041  N N    . ALA B 2 50  ? -0.442  -8.914  -0.937  1.00 0.00 ? 48  ALA B N    1  
ATOM 1042  C CA   . ALA B 2 50  ? -0.376  -10.168 -0.201  1.00 0.00 ? 48  ALA B CA   1  
ATOM 1043  C C    . ALA B 2 50  ? 0.327   -10.004 1.146   1.00 0.00 ? 48  ALA B C    1  
ATOM 1044  O O    . ALA B 2 50  ? 0.146   -10.829 2.035   1.00 0.00 ? 48  ALA B O    1  
ATOM 1045  C CB   . ALA B 2 50  ? 0.330   -11.226 -1.037  1.00 0.00 ? 48  ALA B CB   1  
ATOM 1046  H H    . ALA B 2 50  ? 0.132   -8.792  -1.716  1.00 0.00 ? 48  ALA B H    1  
ATOM 1047  H HA   . ALA B 2 50  ? -1.387  -10.504 -0.029  1.00 0.00 ? 48  ALA B HA   1  
ATOM 1048  H HB1  . ALA B 2 50  ? 0.227   -12.189 -0.559  1.00 0.00 ? 48  ALA B HB1  1  
ATOM 1049  H HB2  . ALA B 2 50  ? 1.378   -10.976 -1.123  1.00 0.00 ? 48  ALA B HB2  1  
ATOM 1050  H HB3  . ALA B 2 50  ? -0.115  -11.263 -2.021  1.00 0.00 ? 48  ALA B HB3  1  
ATOM 1051  N N    . ASP B 2 51  ? 1.124   -8.941  1.289   1.00 0.00 ? 49  ASP B N    1  
ATOM 1052  C CA   . ASP B 2 51  ? 1.851   -8.676  2.526   1.00 0.00 ? 49  ASP B CA   1  
ATOM 1053  C C    . ASP B 2 51  ? 1.107   -7.653  3.366   1.00 0.00 ? 49  ASP B C    1  
ATOM 1054  O O    . ASP B 2 51  ? 1.465   -7.393  4.520   1.00 0.00 ? 49  ASP B O    1  
ATOM 1055  C CB   . ASP B 2 51  ? 3.237   -8.105  2.265   1.00 0.00 ? 49  ASP B CB   1  
ATOM 1056  C CG   . ASP B 2 51  ? 3.870   -8.540  0.955   1.00 0.00 ? 49  ASP B CG   1  
ATOM 1057  O OD1  . ASP B 2 51  ? 3.954   -9.757  0.695   1.00 0.00 ? 49  ASP B OD1  1  
ATOM 1058  O OD2  . ASP B 2 51  ? 4.292   -7.645  0.182   1.00 0.00 ? 49  ASP B OD2  1  
ATOM 1059  H H    . ASP B 2 51  ? 1.237   -8.330  0.546   1.00 0.00 ? 49  ASP B H    1  
ATOM 1060  H HA   . ASP B 2 51  ? 1.940   -9.600  3.083   1.00 0.00 ? 49  ASP B HA   1  
ATOM 1061  H HB2  . ASP B 2 51  ? 3.156   -7.035  2.265   1.00 0.00 ? 49  ASP B HB2  1  
ATOM 1062  H HB3  . ASP B 2 51  ? 3.882   -8.408  3.075   1.00 0.00 ? 49  ASP B HB3  1  
ATOM 1063  N N    . ILE B 2 52  ? 0.081   -7.060  2.791   1.00 0.00 ? 50  ILE B N    1  
ATOM 1064  C CA   . ILE B 2 52  ? -0.697  -6.070  3.506   1.00 0.00 ? 50  ILE B CA   1  
ATOM 1065  C C    . ILE B 2 52  ? -1.791  -6.796  4.282   1.00 0.00 ? 50  ILE B C    1  
ATOM 1066  O O    . ILE B 2 52  ? -2.530  -7.589  3.708   1.00 0.00 ? 50  ILE B O    1  
ATOM 1067  C CB   . ILE B 2 52  ? -1.346  -5.045  2.552   1.00 0.00 ? 50  ILE B CB   1  
ATOM 1068  C CG1  . ILE B 2 52  ? -0.440  -4.753  1.346   1.00 0.00 ? 50  ILE B CG1  1  
ATOM 1069  C CG2  . ILE B 2 52  ? -1.678  -3.762  3.294   1.00 0.00 ? 50  ILE B CG2  1  
ATOM 1070  C CD1  . ILE B 2 52  ? 0.688   -3.784  1.621   1.00 0.00 ? 50  ILE B CD1  1  
ATOM 1071  H H    . ILE B 2 52  ? -0.177  -7.317  1.880   1.00 0.00 ? 50  ILE B H    1  
ATOM 1072  H HA   . ILE B 2 52  ? -0.035  -5.548  4.196   1.00 0.00 ? 50  ILE B HA   1  
ATOM 1073  H HB   . ILE B 2 52  ? -2.274  -5.467  2.194   1.00 0.00 ? 50  ILE B HB   1  
ATOM 1074  H HG12 . ILE B 2 52  ? 0.002   -5.678  1.010   1.00 0.00 ? 50  ILE B HG12 1  
ATOM 1075  H HG13 . ILE B 2 52  ? -1.042  -4.341  0.548   1.00 0.00 ? 50  ILE B HG13 1  
ATOM 1076  H HG21 . ILE B 2 52  ? -2.324  -3.988  4.129   1.00 0.00 ? 50  ILE B HG21 1  
ATOM 1077  H HG22 . ILE B 2 52  ? -2.181  -3.081  2.623   1.00 0.00 ? 50  ILE B HG22 1  
ATOM 1078  H HG23 . ILE B 2 52  ? -0.767  -3.308  3.652   1.00 0.00 ? 50  ILE B HG23 1  
ATOM 1079  H HD11 . ILE B 2 52  ? 1.260   -3.633  0.718   1.00 0.00 ? 50  ILE B HD11 1  
ATOM 1080  H HD12 . ILE B 2 52  ? 1.328   -4.186  2.391   1.00 0.00 ? 50  ILE B HD12 1  
ATOM 1081  H HD13 . ILE B 2 52  ? 0.280   -2.839  1.949   1.00 0.00 ? 50  ILE B HD13 1  
ATOM 1082  N N    . LYS B 2 53  ? -1.894  -6.537  5.573   1.00 0.00 ? 51  LYS B N    1  
ATOM 1083  C CA   . LYS B 2 53  ? -2.894  -7.203  6.391   1.00 0.00 ? 51  LYS B CA   1  
ATOM 1084  C C    . LYS B 2 53  ? -4.188  -6.411  6.364   1.00 0.00 ? 51  LYS B C    1  
ATOM 1085  O O    . LYS B 2 53  ? -5.268  -6.953  6.152   1.00 0.00 ? 51  LYS B O    1  
ATOM 1086  C CB   . LYS B 2 53  ? -2.403  -7.342  7.830   1.00 0.00 ? 51  LYS B CB   1  
ATOM 1087  C CG   . LYS B 2 53  ? -3.453  -7.888  8.780   1.00 0.00 ? 51  LYS B CG   1  
ATOM 1088  C CD   . LYS B 2 53  ? -3.398  -7.175  10.114  1.00 0.00 ? 51  LYS B CD   1  
ATOM 1089  C CE   . LYS B 2 53  ? -4.656  -7.416  10.936  1.00 0.00 ? 51  LYS B CE   1  
ATOM 1090  N NZ   . LYS B 2 53  ? -4.627  -8.740  11.617  1.00 0.00 ? 51  LYS B NZ   1  
ATOM 1091  H H    . LYS B 2 53  ? -1.324  -5.851  5.979   1.00 0.00 ? 51  LYS B H    1  
ATOM 1092  H HA   . LYS B 2 53  ? -3.065  -8.185  5.982   1.00 0.00 ? 51  LYS B HA   1  
ATOM 1093  H HB2  . LYS B 2 53  ? -1.552  -8.009  7.846   1.00 0.00 ? 51  LYS B HB2  1  
ATOM 1094  H HB3  . LYS B 2 53  ? -2.095  -6.371  8.190   1.00 0.00 ? 51  LYS B HB3  1  
ATOM 1095  H HG2  . LYS B 2 53  ? -4.430  -7.744  8.343   1.00 0.00 ? 51  LYS B HG2  1  
ATOM 1096  H HG3  . LYS B 2 53  ? -3.275  -8.942  8.934   1.00 0.00 ? 51  LYS B HG3  1  
ATOM 1097  H HD2  . LYS B 2 53  ? -2.544  -7.540  10.664  1.00 0.00 ? 51  LYS B HD2  1  
ATOM 1098  H HD3  . LYS B 2 53  ? -3.290  -6.118  9.934   1.00 0.00 ? 51  LYS B HD3  1  
ATOM 1099  H HE2  . LYS B 2 53  ? -4.742  -6.637  11.679  1.00 0.00 ? 51  LYS B HE2  1  
ATOM 1100  H HE3  . LYS B 2 53  ? -5.514  -7.376  10.277  1.00 0.00 ? 51  LYS B HE3  1  
ATOM 1101  H HZ1  . LYS B 2 53  ? -3.700  -8.902  12.046  1.00 0.00 ? 51  LYS B HZ1  1  
ATOM 1102  H HZ2  . LYS B 2 53  ? -4.821  -9.507  10.928  1.00 0.00 ? 51  LYS B HZ2  1  
ATOM 1103  H HZ3  . LYS B 2 53  ? -5.356  -8.775  12.372  1.00 0.00 ? 51  LYS B HZ3  1  
ATOM 1104  N N    . CYS B 2 54  ? -4.055  -5.118  6.550   1.00 0.00 ? 52  CYS B N    1  
ATOM 1105  C CA   . CYS B 2 54  ? -5.184  -4.228  6.569   1.00 0.00 ? 52  CYS B CA   1  
ATOM 1106  C C    . CYS B 2 54  ? -4.728  -2.838  6.172   1.00 0.00 ? 52  CYS B C    1  
ATOM 1107  O O    . CYS B 2 54  ? -3.555  -2.631  5.856   1.00 0.00 ? 52  CYS B O    1  
ATOM 1108  C CB   . CYS B 2 54  ? -5.835  -4.221  7.956   1.00 0.00 ? 52  CYS B CB   1  
ATOM 1109  S SG   . CYS B 2 54  ? -4.695  -3.960  9.332   1.00 0.00 ? 52  CYS B SG   1  
ATOM 1110  H H    . CYS B 2 54  ? -3.155  -4.738  6.653   1.00 0.00 ? 52  CYS B H    1  
ATOM 1111  H HA   . CYS B 2 54  ? -5.900  -4.582  5.843   1.00 0.00 ? 52  CYS B HA   1  
ATOM 1112  H HB2  . CYS B 2 54  ? -6.564  -3.433  7.989   1.00 0.00 ? 52  CYS B HB2  1  
ATOM 1113  H HB3  . CYS B 2 54  ? -6.329  -5.167  8.113   1.00 0.00 ? 52  CYS B HB3  1  
ATOM 1114  H HG   . CYS B 2 54  ? -5.042  -2.821  9.928   1.00 0.00 ? 52  CYS B HG   1  
ATOM 1115  N N    . GLN B 2 55  ? -5.636  -1.888  6.180   1.00 0.00 ? 53  GLN B N    1  
ATOM 1116  C CA   . GLN B 2 55  ? -5.293  -0.537  5.802   1.00 0.00 ? 53  GLN B CA   1  
ATOM 1117  C C    . GLN B 2 55  ? -6.069  0.473   6.644   1.00 0.00 ? 53  GLN B C    1  
ATOM 1118  O O    . GLN B 2 55  ? -7.229  0.236   6.994   1.00 0.00 ? 53  GLN B O    1  
ATOM 1119  C CB   . GLN B 2 55  ? -5.609  -0.313  4.329   1.00 0.00 ? 53  GLN B CB   1  
ATOM 1120  C CG   . GLN B 2 55  ? -7.098  -0.264  4.031   1.00 0.00 ? 53  GLN B CG   1  
ATOM 1121  C CD   . GLN B 2 55  ? -7.399  -0.317  2.555   1.00 0.00 ? 53  GLN B CD   1  
ATOM 1122  O OE1  . GLN B 2 55  ? -7.375  0.701   1.870   1.00 0.00 ? 53  GLN B OE1  1  
ATOM 1123  N NE2  . GLN B 2 55  ? -7.706  -1.503  2.060   1.00 0.00 ? 53  GLN B NE2  1  
ATOM 1124  H H    . GLN B 2 55  ? -6.553  -2.092  6.457   1.00 0.00 ? 53  GLN B H    1  
ATOM 1125  H HA   . GLN B 2 55  ? -4.229  -0.413  5.948   1.00 0.00 ? 53  GLN B HA   1  
ATOM 1126  H HB2  . GLN B 2 55  ? -5.169  0.626   4.024   1.00 0.00 ? 53  GLN B HB2  1  
ATOM 1127  H HB3  . GLN B 2 55  ? -5.171  -1.116  3.753   1.00 0.00 ? 53  GLN B HB3  1  
ATOM 1128  H HG2  . GLN B 2 55  ? -7.577  -1.106  4.510   1.00 0.00 ? 53  GLN B HG2  1  
ATOM 1129  H HG3  . GLN B 2 55  ? -7.502  0.653   4.435   1.00 0.00 ? 53  GLN B HG3  1  
ATOM 1130  H HE21 . GLN B 2 55  ? -7.722  -2.281  2.677   1.00 0.00 ? 53  GLN B HE21 1  
ATOM 1131  H HE22 . GLN B 2 55  ? -7.910  -1.565  1.107   1.00 0.00 ? 53  GLN B HE22 1  
ATOM 1132  N N    . LYS B 2 56  ? -5.437  1.582   6.991   1.00 0.00 ? 54  LYS B N    1  
ATOM 1133  C CA   . LYS B 2 56  ? -6.122  2.623   7.739   1.00 0.00 ? 54  LYS B CA   1  
ATOM 1134  C C    . LYS B 2 56  ? -6.267  3.858   6.878   1.00 0.00 ? 54  LYS B C    1  
ATOM 1135  O O    . LYS B 2 56  ? -5.469  4.091   5.975   1.00 0.00 ? 54  LYS B O    1  
ATOM 1136  C CB   . LYS B 2 56  ? -5.369  3.060   8.992   1.00 0.00 ? 54  LYS B CB   1  
ATOM 1137  C CG   . LYS B 2 56  ? -5.280  2.060   10.112  1.00 0.00 ? 54  LYS B CG   1  
ATOM 1138  C CD   . LYS B 2 56  ? -4.809  2.771   11.368  1.00 0.00 ? 54  LYS B CD   1  
ATOM 1139  C CE   . LYS B 2 56  ? -4.456  1.814   12.495  1.00 0.00 ? 54  LYS B CE   1  
ATOM 1140  N NZ   . LYS B 2 56  ? -3.848  0.550   11.988  1.00 0.00 ? 54  LYS B NZ   1  
ATOM 1141  H H    . LYS B 2 56  ? -4.489  1.704   6.739   1.00 0.00 ? 54  LYS B H    1  
ATOM 1142  H HA   . LYS B 2 56  ? -7.100  2.258   8.014   1.00 0.00 ? 54  LYS B HA   1  
ATOM 1143  H HB2  . LYS B 2 56  ? -4.364  3.331   8.717   1.00 0.00 ? 54  LYS B HB2  1  
ATOM 1144  H HB3  . LYS B 2 56  ? -5.861  3.939   9.384   1.00 0.00 ? 54  LYS B HB3  1  
ATOM 1145  H HG2  . LYS B 2 56  ? -6.252  1.627   10.282  1.00 0.00 ? 54  LYS B HG2  1  
ATOM 1146  H HG3  . LYS B 2 56  ? -4.567  1.293   9.849   1.00 0.00 ? 54  LYS B HG3  1  
ATOM 1147  H HD2  . LYS B 2 56  ? -3.935  3.358   11.123  1.00 0.00 ? 54  LYS B HD2  1  
ATOM 1148  H HD3  . LYS B 2 56  ? -5.597  3.435   11.701  1.00 0.00 ? 54  LYS B HD3  1  
ATOM 1149  H HE2  . LYS B 2 56  ? -3.747  2.308   13.151  1.00 0.00 ? 54  LYS B HE2  1  
ATOM 1150  H HE3  . LYS B 2 56  ? -5.352  1.584   13.051  1.00 0.00 ? 54  LYS B HE3  1  
ATOM 1151  H HZ1  . LYS B 2 56  ? -4.553  0.001   11.436  1.00 0.00 ? 54  LYS B HZ1  1  
ATOM 1152  H HZ2  . LYS B 2 56  ? -3.520  -0.035  12.779  1.00 0.00 ? 54  LYS B HZ2  1  
ATOM 1153  H HZ3  . LYS B 2 56  ? -3.036  0.766   11.370  1.00 0.00 ? 54  LYS B HZ3  1  
ATOM 1154  N N    . ILE B 2 57  ? -7.284  4.641   7.160   1.00 0.00 ? 55  ILE B N    1  
ATOM 1155  C CA   . ILE B 2 57  ? -7.491  5.892   6.469   1.00 0.00 ? 55  ILE B CA   1  
ATOM 1156  C C    . ILE B 2 57  ? -7.707  6.956   7.537   1.00 0.00 ? 55  ILE B C    1  
ATOM 1157  O O    . ILE B 2 57  ? -8.504  6.766   8.458   1.00 0.00 ? 55  ILE B O    1  
ATOM 1158  C CB   . ILE B 2 57  ? -8.674  5.854   5.450   1.00 0.00 ? 55  ILE B CB   1  
ATOM 1159  C CG1  . ILE B 2 57  ? -10.008 6.274   6.070   1.00 0.00 ? 55  ILE B CG1  1  
ATOM 1160  C CG2  . ILE B 2 57  ? -8.815  4.463   4.846   1.00 0.00 ? 55  ILE B CG2  1  
ATOM 1161  C CD1  . ILE B 2 57  ? -10.953 6.896   5.062   1.00 0.00 ? 55  ILE B CD1  1  
ATOM 1162  H H    . ILE B 2 57  ? -7.923  4.367   7.859   1.00 0.00 ? 55  ILE B H    1  
ATOM 1163  H HA   . ILE B 2 57  ? -6.580  6.124   5.932   1.00 0.00 ? 55  ILE B HA   1  
ATOM 1164  H HB   . ILE B 2 57  ? -8.435  6.535   4.647   1.00 0.00 ? 55  ILE B HB   1  
ATOM 1165  H HG12 . ILE B 2 57  ? -10.492 5.407   6.495   1.00 0.00 ? 55  ILE B HG12 1  
ATOM 1166  H HG13 . ILE B 2 57  ? -9.826  7.000   6.849   1.00 0.00 ? 55  ILE B HG13 1  
ATOM 1167  H HG21 . ILE B 2 57  ? -9.638  4.457   4.146   1.00 0.00 ? 55  ILE B HG21 1  
ATOM 1168  H HG22 . ILE B 2 57  ? -9.006  3.747   5.631   1.00 0.00 ? 55  ILE B HG22 1  
ATOM 1169  H HG23 . ILE B 2 57  ? -7.903  4.200   4.332   1.00 0.00 ? 55  ILE B HG23 1  
ATOM 1170  H HD11 . ILE B 2 57  ? -11.185 6.174   4.291   1.00 0.00 ? 55  ILE B HD11 1  
ATOM 1171  H HD12 . ILE B 2 57  ? -10.480 7.759   4.611   1.00 0.00 ? 55  ILE B HD12 1  
ATOM 1172  H HD13 . ILE B 2 57  ? -11.861 7.203   5.555   1.00 0.00 ? 55  ILE B HD13 1  
ATOM 1173  N N    . SER B 2 58  ? -6.948  8.033   7.481   1.00 0.00 ? 56  SER B N    1  
ATOM 1174  C CA   . SER B 2 58  ? -7.095  9.072   8.470   1.00 0.00 ? 56  SER B CA   1  
ATOM 1175  C C    . SER B 2 58  ? -8.169  10.035  8.004   1.00 0.00 ? 56  SER B C    1  
ATOM 1176  O O    . SER B 2 58  ? -8.059  10.638  6.916   1.00 0.00 ? 56  SER B O    1  
ATOM 1177  C CB   . SER B 2 58  ? -5.771  9.787   8.748   1.00 0.00 ? 56  SER B CB   1  
ATOM 1178  O OG   . SER B 2 58  ? -5.592  10.914  7.917   1.00 0.00 ? 56  SER B OG   1  
ATOM 1179  H H    . SER B 2 58  ? -6.296  8.138   6.753   1.00 0.00 ? 56  SER B H    1  
ATOM 1180  H HA   . SER B 2 58  ? -7.434  8.602   9.382   1.00 0.00 ? 56  SER B HA   1  
ATOM 1181  H HB2  . SER B 2 58  ? -5.747  10.102  9.769   1.00 0.00 ? 56  SER B HB2  1  
ATOM 1182  H HB3  . SER B 2 58  ? -4.958  9.099   8.574   1.00 0.00 ? 56  SER B HB3  1  
ATOM 1183  H HG   . SER B 2 58  ? -6.222  11.601  8.168   1.00 0.00 ? 56  SER B HG   1  
ATOM 1184  N N    . PRO B 2 59  ? -9.217  10.148  8.831   1.00 0.00 ? 57  PRO B N    1  
ATOM 1185  C CA   . PRO B 2 59  ? -10.399 10.979  8.578   1.00 0.00 ? 57  PRO B CA   1  
ATOM 1186  C C    . PRO B 2 59  ? -10.133 12.471  8.666   1.00 0.00 ? 57  PRO B C    1  
ATOM 1187  O O    . PRO B 2 59  ? -9.038  12.913  9.025   1.00 0.00 ? 57  PRO B O    1  
ATOM 1188  C CB   . PRO B 2 59  ? -11.356 10.562  9.698   1.00 0.00 ? 57  PRO B CB   1  
ATOM 1189  C CG   . PRO B 2 59  ? -10.455 10.154  10.807  1.00 0.00 ? 57  PRO B CG   1  
ATOM 1190  C CD   . PRO B 2 59  ? -9.306  9.469   10.137  1.00 0.00 ? 57  PRO B CD   1  
ATOM 1191  H HA   . PRO B 2 59  ? -10.847 10.749  7.623   1.00 0.00 ? 57  PRO B HA   1  
ATOM 1192  H HB2  . PRO B 2 59  ? -11.979 11.400  9.975   1.00 0.00 ? 57  PRO B HB2  1  
ATOM 1193  H HB3  . PRO B 2 59  ? -11.971 9.738   9.365   1.00 0.00 ? 57  PRO B HB3  1  
ATOM 1194  H HG2  . PRO B 2 59  ? -10.109 11.025  11.347  1.00 0.00 ? 57  PRO B HG2  1  
ATOM 1195  H HG3  . PRO B 2 59  ? -10.962 9.472   11.473  1.00 0.00 ? 57  PRO B HG3  1  
ATOM 1196  H HD2  . PRO B 2 59  ? -8.399  9.608   10.706  1.00 0.00 ? 57  PRO B HD2  1  
ATOM 1197  H HD3  . PRO B 2 59  ? -9.516  8.418   10.009  1.00 0.00 ? 57  PRO B HD3  1  
ATOM 1198  N N    . GLU B 2 60  ? -11.151 13.232  8.297   1.00 0.00 ? 58  GLU B N    1  
ATOM 1199  C CA   . GLU B 2 60  ? -11.101 14.678  8.341   1.00 0.00 ? 58  GLU B CA   1  
ATOM 1200  C C    . GLU B 2 60  ? -10.892 15.147  9.779   1.00 0.00 ? 58  GLU B C    1  
ATOM 1201  O O    . GLU B 2 60  ? -11.167 14.414  10.731  1.00 0.00 ? 58  GLU B O    1  
ATOM 1202  C CB   . GLU B 2 60  ? -12.392 15.272  7.761   1.00 0.00 ? 58  GLU B CB   1  
ATOM 1203  C CG   . GLU B 2 60  ? -12.555 15.065  6.256   1.00 0.00 ? 58  GLU B CG   1  
ATOM 1204  C CD   . GLU B 2 60  ? -12.561 13.601  5.849   1.00 0.00 ? 58  GLU B CD   1  
ATOM 1205  O OE1  . GLU B 2 60  ? -13.185 12.785  6.557   1.00 0.00 ? 58  GLU B OE1  1  
ATOM 1206  O OE2  . GLU B 2 60  ? -11.918 13.258  4.835   1.00 0.00 ? 58  GLU B OE2  1  
ATOM 1207  H H    . GLU B 2 60  ? -11.974 12.799  7.967   1.00 0.00 ? 58  GLU B H    1  
ATOM 1208  H HA   . GLU B 2 60  ? -10.261 15.001  7.743   1.00 0.00 ? 58  GLU B HA   1  
ATOM 1209  H HB2  . GLU B 2 60  ? -13.236 14.816  8.257   1.00 0.00 ? 58  GLU B HB2  1  
ATOM 1210  H HB3  . GLU B 2 60  ? -12.404 16.334  7.958   1.00 0.00 ? 58  GLU B HB3  1  
ATOM 1211  H HG2  . GLU B 2 60  ? -13.489 15.509  5.945   1.00 0.00 ? 58  GLU B HG2  1  
ATOM 1212  H HG3  . GLU B 2 60  ? -11.740 15.560  5.748   1.00 0.00 ? 58  GLU B HG3  1  
ATOM 1213  N N    . GLY B 2 61  ? -10.432 16.372  9.929   1.00 0.00 ? 59  GLY B N    1  
ATOM 1214  C CA   . GLY B 2 61  ? -10.152 16.911  11.243  1.00 0.00 ? 59  GLY B CA   1  
ATOM 1215  C C    . GLY B 2 61  ? -8.672  17.144  11.393  1.00 0.00 ? 59  GLY B C    1  
ATOM 1216  O O    . GLY B 2 61  ? -8.235  18.035  12.121  1.00 0.00 ? 59  GLY B O    1  
ATOM 1217  H H    . GLY B 2 61  ? -10.267 16.920  9.135   1.00 0.00 ? 59  GLY B H    1  
ATOM 1218  H HA2  . GLY B 2 61  ? -10.679 17.846  11.367  1.00 0.00 ? 59  GLY B HA2  1  
ATOM 1219  H HA3  . GLY B 2 61  ? -10.479 16.209  11.996  1.00 0.00 ? 59  GLY B HA3  1  
ATOM 1220  N N    . LYS B 2 62  ? -7.901  16.334  10.682  1.00 0.00 ? 60  LYS B N    1  
ATOM 1221  C CA   . LYS B 2 62  ? -6.459  16.470  10.660  1.00 0.00 ? 60  LYS B CA   1  
ATOM 1222  C C    . LYS B 2 62  ? -6.100  17.495  9.611   1.00 0.00 ? 60  LYS B C    1  
ATOM 1223  O O    . LYS B 2 62  ? -6.915  17.814  8.741   1.00 0.00 ? 60  LYS B O    1  
ATOM 1224  C CB   . LYS B 2 62  ? -5.777  15.135  10.332  1.00 0.00 ? 60  LYS B CB   1  
ATOM 1225  C CG   . LYS B 2 62  ? -5.447  14.292  11.552  1.00 0.00 ? 60  LYS B CG   1  
ATOM 1226  C CD   . LYS B 2 62  ? -4.490  13.152  11.212  1.00 0.00 ? 60  LYS B CD   1  
ATOM 1227  C CE   . LYS B 2 62  ? -3.874  12.534  12.464  1.00 0.00 ? 60  LYS B CE   1  
ATOM 1228  N NZ   . LYS B 2 62  ? -4.379  13.167  13.712  1.00 0.00 ? 60  LYS B NZ   1  
ATOM 1229  H H    . LYS B 2 62  ? -8.320  15.619  10.159  1.00 0.00 ? 60  LYS B H    1  
ATOM 1230  H HA   . LYS B 2 62  ? -6.124  16.826  11.624  1.00 0.00 ? 60  LYS B HA   1  
ATOM 1231  H HB2  . LYS B 2 62  ? -6.431  14.560  9.693   1.00 0.00 ? 60  LYS B HB2  1  
ATOM 1232  H HB3  . LYS B 2 62  ? -4.858  15.336  9.801   1.00 0.00 ? 60  LYS B HB3  1  
ATOM 1233  H HG2  . LYS B 2 62  ? -4.986  14.922  12.298  1.00 0.00 ? 60  LYS B HG2  1  
ATOM 1234  H HG3  . LYS B 2 62  ? -6.362  13.875  11.946  1.00 0.00 ? 60  LYS B HG3  1  
ATOM 1235  H HD2  . LYS B 2 62  ? -5.032  12.385  10.678  1.00 0.00 ? 60  LYS B HD2  1  
ATOM 1236  H HD3  . LYS B 2 62  ? -3.697  13.535  10.585  1.00 0.00 ? 60  LYS B HD3  1  
ATOM 1237  H HE2  . LYS B 2 62  ? -4.106  11.477  12.485  1.00 0.00 ? 60  LYS B HE2  1  
ATOM 1238  H HE3  . LYS B 2 62  ? -2.797  12.657  12.419  1.00 0.00 ? 60  LYS B HE3  1  
ATOM 1239  H HZ1  . LYS B 2 62  ? -5.427  13.172  13.705  1.00 0.00 ? 60  LYS B HZ1  1  
ATOM 1240  H HZ2  . LYS B 2 62  ? -4.033  14.146  13.785  1.00 0.00 ? 60  LYS B HZ2  1  
ATOM 1241  H HZ3  . LYS B 2 62  ? -4.056  12.625  14.547  1.00 0.00 ? 60  LYS B HZ3  1  
ATOM 1242  N N    . ALA B 2 63  ? -4.890  18.005  9.677   1.00 0.00 ? 61  ALA B N    1  
ATOM 1243  C CA   . ALA B 2 63  ? -4.445  18.992  8.714   1.00 0.00 ? 61  ALA B CA   1  
ATOM 1244  C C    . ALA B 2 63  ? -4.138  18.338  7.393   1.00 0.00 ? 61  ALA B C    1  
ATOM 1245  O O    . ALA B 2 63  ? -3.835  19.004  6.406   1.00 0.00 ? 61  ALA B O    1  
ATOM 1246  C CB   . ALA B 2 63  ? -3.221  19.702  9.227   1.00 0.00 ? 61  ALA B CB   1  
ATOM 1247  H H    . ALA B 2 63  ? -4.280  17.713  10.392  1.00 0.00 ? 61  ALA B H    1  
ATOM 1248  H HA   . ALA B 2 63  ? -5.235  19.713  8.570   1.00 0.00 ? 61  ALA B HA   1  
ATOM 1249  H HB1  . ALA B 2 63  ? -2.428  18.981  9.363   1.00 0.00 ? 61  ALA B HB1  1  
ATOM 1250  H HB2  . ALA B 2 63  ? -3.451  20.172  10.166  1.00 0.00 ? 61  ALA B HB2  1  
ATOM 1251  H HB3  . ALA B 2 63  ? -2.915  20.443  8.507   1.00 0.00 ? 61  ALA B HB3  1  
ATOM 1252  N N    . LYS B 2 64  ? -4.205  17.027  7.382   1.00 0.00 ? 62  LYS B N    1  
ATOM 1253  C CA   . LYS B 2 64  ? -3.936  16.287  6.188   1.00 0.00 ? 62  LYS B CA   1  
ATOM 1254  C C    . LYS B 2 64  ? -4.796  15.033  6.137   1.00 0.00 ? 62  LYS B C    1  
ATOM 1255  O O    . LYS B 2 64  ? -5.277  14.555  7.164   1.00 0.00 ? 62  LYS B O    1  
ATOM 1256  C CB   . LYS B 2 64  ? -2.457  15.906  6.110   1.00 0.00 ? 62  LYS B CB   1  
ATOM 1257  C CG   . LYS B 2 64  ? -2.137  14.534  6.683   1.00 0.00 ? 62  LYS B CG   1  
ATOM 1258  C CD   . LYS B 2 64  ? -2.149  14.529  8.201   1.00 0.00 ? 62  LYS B CD   1  
ATOM 1259  C CE   . LYS B 2 64  ? -0.851  15.069  8.762   1.00 0.00 ? 62  LYS B CE   1  
ATOM 1260  N NZ   . LYS B 2 64  ? -0.886  16.548  8.910   1.00 0.00 ? 62  LYS B NZ   1  
ATOM 1261  H H    . LYS B 2 64  ? -4.466  16.549  8.198   1.00 0.00 ? 62  LYS B H    1  
ATOM 1262  H HA   . LYS B 2 64  ? -4.177  16.929  5.361   1.00 0.00 ? 62  LYS B HA   1  
ATOM 1263  H HB2  . LYS B 2 64  ? -2.148  15.916  5.077   1.00 0.00 ? 62  LYS B HB2  1  
ATOM 1264  H HB3  . LYS B 2 64  ? -1.881  16.638  6.657   1.00 0.00 ? 62  LYS B HB3  1  
ATOM 1265  H HG2  . LYS B 2 64  ? -2.875  13.829  6.328   1.00 0.00 ? 62  LYS B HG2  1  
ATOM 1266  H HG3  . LYS B 2 64  ? -1.159  14.234  6.338   1.00 0.00 ? 62  LYS B HG3  1  
ATOM 1267  H HD2  . LYS B 2 64  ? -2.965  15.146  8.548   1.00 0.00 ? 62  LYS B HD2  1  
ATOM 1268  H HD3  . LYS B 2 64  ? -2.287  13.515  8.547   1.00 0.00 ? 62  LYS B HD3  1  
ATOM 1269  H HE2  . LYS B 2 64  ? -0.682  14.622  9.732   1.00 0.00 ? 62  LYS B HE2  1  
ATOM 1270  H HE3  . LYS B 2 64  ? -0.045  14.798  8.096   1.00 0.00 ? 62  LYS B HE3  1  
ATOM 1271  H HZ1  . LYS B 2 64  ? -1.357  16.979  8.095   1.00 0.00 ? 62  LYS B HZ1  1  
ATOM 1272  H HZ2  . LYS B 2 64  ? 0.090   16.925  8.973   1.00 0.00 ? 62  LYS B HZ2  1  
ATOM 1273  H HZ3  . LYS B 2 64  ? -1.406  16.807  9.782   1.00 0.00 ? 62  LYS B HZ3  1  
ATOM 1274  N N    . ILE B 2 65  ? -4.991  14.521  4.945   1.00 0.00 ? 63  ILE B N    1  
ATOM 1275  C CA   . ILE B 2 65  ? -5.744  13.302  4.749   1.00 0.00 ? 63  ILE B CA   1  
ATOM 1276  C C    . ILE B 2 65  ? -4.731  12.168  4.656   1.00 0.00 ? 63  ILE B C    1  
ATOM 1277  O O    . ILE B 2 65  ? -3.722  12.317  3.976   1.00 0.00 ? 63  ILE B O    1  
ATOM 1278  C CB   . ILE B 2 65  ? -6.605  13.396  3.472   1.00 0.00 ? 63  ILE B CB   1  
ATOM 1279  C CG1  . ILE B 2 65  ? -7.803  14.320  3.712   1.00 0.00 ? 63  ILE B CG1  1  
ATOM 1280  C CG2  . ILE B 2 65  ? -7.078  12.027  3.033   1.00 0.00 ? 63  ILE B CG2  1  
ATOM 1281  C CD1  . ILE B 2 65  ? -7.521  15.790  3.463   1.00 0.00 ? 63  ILE B CD1  1  
ATOM 1282  H H    . ILE B 2 65  ? -4.601  14.969  4.164   1.00 0.00 ? 63  ILE B H    1  
ATOM 1283  H HA   . ILE B 2 65  ? -6.386  13.148  5.604   1.00 0.00 ? 63  ILE B HA   1  
ATOM 1284  H HB   . ILE B 2 65  ? -5.993  13.809  2.683   1.00 0.00 ? 63  ILE B HB   1  
ATOM 1285  H HG12 . ILE B 2 65  ? -8.609  14.027  3.056   1.00 0.00 ? 63  ILE B HG12 1  
ATOM 1286  H HG13 . ILE B 2 65  ? -8.127  14.216  4.737   1.00 0.00 ? 63  ILE B HG13 1  
ATOM 1287  H HG21 . ILE B 2 65  ? -7.704  12.124  2.158   1.00 0.00 ? 63  ILE B HG21 1  
ATOM 1288  H HG22 . ILE B 2 65  ? -7.643  11.568  3.830   1.00 0.00 ? 63  ILE B HG22 1  
ATOM 1289  H HG23 . ILE B 2 65  ? -6.223  11.409  2.797   1.00 0.00 ? 63  ILE B HG23 1  
ATOM 1290  H HD11 . ILE B 2 65  ? -8.428  16.359  3.609   1.00 0.00 ? 63  ILE B HD11 1  
ATOM 1291  H HD12 . ILE B 2 65  ? -7.173  15.924  2.450   1.00 0.00 ? 63  ILE B HD12 1  
ATOM 1292  H HD13 . ILE B 2 65  ? -6.766  16.134  4.153   1.00 0.00 ? 63  ILE B HD13 1  
ATOM 1293  N N    . GLN B 2 66  ? -4.950  11.050  5.337   1.00 0.00 ? 64  GLN B N    1  
ATOM 1294  C CA   . GLN B 2 66  ? -3.935  9.990   5.305   1.00 0.00 ? 64  GLN B CA   1  
ATOM 1295  C C    . GLN B 2 66  ? -4.488  8.601   5.106   1.00 0.00 ? 64  GLN B C    1  
ATOM 1296  O O    . GLN B 2 66  ? -5.681  8.349   5.235   1.00 0.00 ? 64  GLN B O    1  
ATOM 1297  C CB   . GLN B 2 66  ? -3.109  9.971   6.587   1.00 0.00 ? 64  GLN B CB   1  
ATOM 1298  C CG   . GLN B 2 66  ? -2.287  11.215  6.826   1.00 0.00 ? 64  GLN B CG   1  
ATOM 1299  C CD   . GLN B 2 66  ? -1.560  11.169  8.152   1.00 0.00 ? 64  GLN B CD   1  
ATOM 1300  O OE1  . GLN B 2 66  ? -0.518  11.800  8.319   1.00 0.00 ? 64  GLN B OE1  1  
ATOM 1301  N NE2  . GLN B 2 66  ? -2.110  10.427  9.106   1.00 0.00 ? 64  GLN B NE2  1  
ATOM 1302  H H    . GLN B 2 66  ? -5.777  10.938  5.875   1.00 0.00 ? 64  GLN B H    1  
ATOM 1303  H HA   . GLN B 2 66  ? -3.271  10.210  4.483   1.00 0.00 ? 64  GLN B HA   1  
ATOM 1304  H HB2  . GLN B 2 66  ? -3.776  9.846   7.425   1.00 0.00 ? 64  GLN B HB2  1  
ATOM 1305  H HB3  . GLN B 2 66  ? -2.436  9.126   6.549   1.00 0.00 ? 64  GLN B HB3  1  
ATOM 1306  H HG2  . GLN B 2 66  ? -1.560  11.311  6.034   1.00 0.00 ? 64  GLN B HG2  1  
ATOM 1307  H HG3  . GLN B 2 66  ? -2.944  12.073  6.820   1.00 0.00 ? 64  GLN B HG3  1  
ATOM 1308  H HE21 . GLN B 2 66  ? -2.946  9.956   8.907   1.00 0.00 ? 64  GLN B HE21 1  
ATOM 1309  H HE22 . GLN B 2 66  ? -1.648  10.376  9.972   1.00 0.00 ? 64  GLN B HE22 1  
ATOM 1310  N N    . LEU B 2 67  ? -3.582  7.723   4.734   1.00 0.00 ? 65  LEU B N    1  
ATOM 1311  C CA   . LEU B 2 67  ? -3.861  6.321   4.550   1.00 0.00 ? 65  LEU B CA   1  
ATOM 1312  C C    . LEU B 2 67  ? -2.654  5.546   5.062   1.00 0.00 ? 65  LEU B C    1  
ATOM 1313  O O    . LEU B 2 67  ? -1.562  6.090   5.087   1.00 0.00 ? 65  LEU B O    1  
ATOM 1314  C CB   . LEU B 2 67  ? -4.056  6.003   3.076   1.00 0.00 ? 65  LEU B CB   1  
ATOM 1315  C CG   . LEU B 2 67  ? -4.942  4.802   2.779   1.00 0.00 ? 65  LEU B CG   1  
ATOM 1316  C CD1  . LEU B 2 67  ? -6.381  5.243   2.610   1.00 0.00 ? 65  LEU B CD1  1  
ATOM 1317  C CD2  . LEU B 2 67  ? -4.445  4.064   1.555   1.00 0.00 ? 65  LEU B CD2  1  
ATOM 1318  H H    . LEU B 2 67  ? -2.664  8.038   4.559   1.00 0.00 ? 65  LEU B H    1  
ATOM 1319  H HA   . LEU B 2 67  ? -4.744  6.068   5.124   1.00 0.00 ? 65  LEU B HA   1  
ATOM 1320  H HB2  . LEU B 2 67  ? -4.489  6.871   2.599   1.00 0.00 ? 65  LEU B HB2  1  
ATOM 1321  H HB3  . LEU B 2 67  ? -3.084  5.824   2.641   1.00 0.00 ? 65  LEU B HB3  1  
ATOM 1322  H HG   . LEU B 2 67  ? -4.901  4.123   3.618   1.00 0.00 ? 65  LEU B HG   1  
ATOM 1323  H HD11 . LEU B 2 67  ? -7.003  4.383   2.411   1.00 0.00 ? 65  LEU B HD11 1  
ATOM 1324  H HD12 . LEU B 2 67  ? -6.450  5.937   1.783   1.00 0.00 ? 65  LEU B HD12 1  
ATOM 1325  H HD13 . LEU B 2 67  ? -6.718  5.730   3.513   1.00 0.00 ? 65  LEU B HD13 1  
ATOM 1326  H HD21 . LEU B 2 67  ? -5.090  3.222   1.355   1.00 0.00 ? 65  LEU B HD21 1  
ATOM 1327  H HD22 . LEU B 2 67  ? -3.438  3.713   1.731   1.00 0.00 ? 65  LEU B HD22 1  
ATOM 1328  H HD23 . LEU B 2 67  ? -4.449  4.731   0.705   1.00 0.00 ? 65  LEU B HD23 1  
ATOM 1329  N N    . GLN B 2 68  ? -2.824  4.314   5.505   1.00 0.00 ? 66  GLN B N    1  
ATOM 1330  C CA   . GLN B 2 68  ? -1.678  3.547   5.973   1.00 0.00 ? 66  GLN B CA   1  
ATOM 1331  C C    . GLN B 2 68  ? -1.843  2.068   5.667   1.00 0.00 ? 66  GLN B C    1  
ATOM 1332  O O    . GLN B 2 68  ? -2.933  1.510   5.784   1.00 0.00 ? 66  GLN B O    1  
ATOM 1333  C CB   . GLN B 2 68  ? -1.421  3.765   7.474   1.00 0.00 ? 66  GLN B CB   1  
ATOM 1334  C CG   . GLN B 2 68  ? -2.144  2.791   8.389   1.00 0.00 ? 66  GLN B CG   1  
ATOM 1335  C CD   . GLN B 2 68  ? -1.708  2.894   9.842   1.00 0.00 ? 66  GLN B CD   1  
ATOM 1336  O OE1  . GLN B 2 68  ? -1.768  1.917   10.590  1.00 0.00 ? 66  GLN B OE1  1  
ATOM 1337  N NE2  . GLN B 2 68  ? -1.280  4.073   10.259  1.00 0.00 ? 66  GLN B NE2  1  
ATOM 1338  H H    . GLN B 2 68  ? -3.725  3.914   5.514   1.00 0.00 ? 66  GLN B H    1  
ATOM 1339  H HA   . GLN B 2 68  ? -0.816  3.903   5.427   1.00 0.00 ? 66  GLN B HA   1  
ATOM 1340  H HB2  . GLN B 2 68  ? -0.362  3.673   7.659   1.00 0.00 ? 66  GLN B HB2  1  
ATOM 1341  H HB3  . GLN B 2 68  ? -1.733  4.765   7.735   1.00 0.00 ? 66  GLN B HB3  1  
ATOM 1342  H HG2  . GLN B 2 68  ? -3.203  2.989   8.336   1.00 0.00 ? 66  GLN B HG2  1  
ATOM 1343  H HG3  . GLN B 2 68  ? -1.951  1.785   8.044   1.00 0.00 ? 66  GLN B HG3  1  
ATOM 1344  H HE21 . GLN B 2 68  ? -1.264  4.816   9.618   1.00 0.00 ? 66  GLN B HE21 1  
ATOM 1345  H HE22 . GLN B 2 68  ? -0.987  4.155   11.191  1.00 0.00 ? 66  GLN B HE22 1  
ATOM 1346  N N    . LEU B 2 69  ? -0.752  1.453   5.257   1.00 0.00 ? 67  LEU B N    1  
ATOM 1347  C CA   . LEU B 2 69  ? -0.732  0.041   4.940   1.00 0.00 ? 67  LEU B CA   1  
ATOM 1348  C C    . LEU B 2 69  ? -0.284  -0.750  6.152   1.00 0.00 ? 67  LEU B C    1  
ATOM 1349  O O    . LEU B 2 69  ? 0.894   -0.758  6.491   1.00 0.00 ? 67  LEU B O    1  
ATOM 1350  C CB   . LEU B 2 69  ? 0.230   -0.237  3.791   1.00 0.00 ? 67  LEU B CB   1  
ATOM 1351  C CG   . LEU B 2 69  ? -0.096  0.441   2.465   1.00 0.00 ? 67  LEU B CG   1  
ATOM 1352  C CD1  . LEU B 2 69  ? 0.989   0.127   1.452   1.00 0.00 ? 67  LEU B CD1  1  
ATOM 1353  C CD2  . LEU B 2 69  ? -1.456  -0.006  1.952   1.00 0.00 ? 67  LEU B CD2  1  
ATOM 1354  H H    . LEU B 2 69  ? 0.078   1.975   5.156   1.00 0.00 ? 67  LEU B H    1  
ATOM 1355  H HA   . LEU B 2 69  ? -1.729  -0.263  4.659   1.00 0.00 ? 67  LEU B HA   1  
ATOM 1356  H HB2  . LEU B 2 69  ? 1.215   0.078   4.097   1.00 0.00 ? 67  LEU B HB2  1  
ATOM 1357  H HB3  . LEU B 2 69  ? 0.250   -1.299  3.629   1.00 0.00 ? 67  LEU B HB3  1  
ATOM 1358  H HG   . LEU B 2 69  ? -0.122  1.511   2.610   1.00 0.00 ? 67  LEU B HG   1  
ATOM 1359  H HD11 . LEU B 2 69  ? 1.938   0.493   1.814   1.00 0.00 ? 67  LEU B HD11 1  
ATOM 1360  H HD12 . LEU B 2 69  ? 0.754   0.606   0.513   1.00 0.00 ? 67  LEU B HD12 1  
ATOM 1361  H HD13 . LEU B 2 69  ? 1.048   -0.942  1.306   1.00 0.00 ? 67  LEU B HD13 1  
ATOM 1362  H HD21 . LEU B 2 69  ? -1.502  -1.086  1.947   1.00 0.00 ? 67  LEU B HD21 1  
ATOM 1363  H HD22 . LEU B 2 69  ? -1.599  0.365   0.947   1.00 0.00 ? 67  LEU B HD22 1  
ATOM 1364  H HD23 . LEU B 2 69  ? -2.230  0.387   2.594   1.00 0.00 ? 67  LEU B HD23 1  
ATOM 1365  N N    . VAL B 2 70  ? -1.215  -1.398  6.807   1.00 0.00 ? 68  VAL B N    1  
ATOM 1366  C CA   . VAL B 2 70  ? -0.896  -2.188  7.977   1.00 0.00 ? 68  VAL B CA   1  
ATOM 1367  C C    . VAL B 2 70  ? -0.607  -3.614  7.547   1.00 0.00 ? 68  VAL B C    1  
ATOM 1368  O O    . VAL B 2 70  ? -1.493  -4.327  7.090   1.00 0.00 ? 68  VAL B O    1  
ATOM 1369  C CB   . VAL B 2 70  ? -2.043  -2.147  8.994   1.00 0.00 ? 68  VAL B CB   1  
ATOM 1370  C CG1  . VAL B 2 70  ? -1.584  -2.646  10.348  1.00 0.00 ? 68  VAL B CG1  1  
ATOM 1371  C CG2  . VAL B 2 70  ? -2.583  -0.734  9.101   1.00 0.00 ? 68  VAL B CG2  1  
ATOM 1372  H H    . VAL B 2 70  ? -2.144  -1.366  6.488   1.00 0.00 ? 68  VAL B H    1  
ATOM 1373  H HA   . VAL B 2 70  ? -0.009  -1.770  8.435   1.00 0.00 ? 68  VAL B HA   1  
ATOM 1374  H HB   . VAL B 2 70  ? -2.837  -2.789  8.644   1.00 0.00 ? 68  VAL B HB   1  
ATOM 1375  H HG11 . VAL B 2 70  ? -1.251  -3.668  10.260  1.00 0.00 ? 68  VAL B HG11 1  
ATOM 1376  H HG12 . VAL B 2 70  ? -2.404  -2.590  11.046  1.00 0.00 ? 68  VAL B HG12 1  
ATOM 1377  H HG13 . VAL B 2 70  ? -0.770  -2.030  10.698  1.00 0.00 ? 68  VAL B HG13 1  
ATOM 1378  H HG21 . VAL B 2 70  ? -1.792  -0.075  9.431   1.00 0.00 ? 68  VAL B HG21 1  
ATOM 1379  H HG22 . VAL B 2 70  ? -3.392  -0.708  9.812   1.00 0.00 ? 68  VAL B HG22 1  
ATOM 1380  H HG23 . VAL B 2 70  ? -2.938  -0.411  8.134   1.00 0.00 ? 68  VAL B HG23 1  
ATOM 1381  N N    . LEU B 2 71  ? 0.638   -4.019  7.679   1.00 0.00 ? 69  LEU B N    1  
ATOM 1382  C CA   . LEU B 2 71  ? 1.057   -5.342  7.248   1.00 0.00 ? 69  LEU B CA   1  
ATOM 1383  C C    . LEU B 2 71  ? 1.021   -6.356  8.374   1.00 0.00 ? 69  LEU B C    1  
ATOM 1384  O O    . LEU B 2 71  ? 1.091   -6.003  9.550   1.00 0.00 ? 69  LEU B O    1  
ATOM 1385  C CB   . LEU B 2 71  ? 2.471   -5.268  6.684   1.00 0.00 ? 69  LEU B CB   1  
ATOM 1386  C CG   . LEU B 2 71  ? 2.790   -3.973  5.946   1.00 0.00 ? 69  LEU B CG   1  
ATOM 1387  C CD1  . LEU B 2 71  ? 4.233   -3.954  5.514   1.00 0.00 ? 69  LEU B CD1  1  
ATOM 1388  C CD2  . LEU B 2 71  ? 1.888   -3.806  4.746   1.00 0.00 ? 69  LEU B CD2  1  
ATOM 1389  H H    . LEU B 2 71  ? 1.302   -3.412  8.086   1.00 0.00 ? 69  LEU B H    1  
ATOM 1390  H HA   . LEU B 2 71  ? 0.391   -5.660  6.465   1.00 0.00 ? 69  LEU B HA   1  
ATOM 1391  H HB2  . LEU B 2 71  ? 3.169   -5.377  7.501   1.00 0.00 ? 69  LEU B HB2  1  
ATOM 1392  H HB3  . LEU B 2 71  ? 2.608   -6.091  5.999   1.00 0.00 ? 69  LEU B HB3  1  
ATOM 1393  H HG   . LEU B 2 71  ? 2.623   -3.140  6.612   1.00 0.00 ? 69  LEU B HG   1  
ATOM 1394  H HD11 . LEU B 2 71  ? 4.867   -4.034  6.383   1.00 0.00 ? 69  LEU B HD11 1  
ATOM 1395  H HD12 . LEU B 2 71  ? 4.436   -3.027  4.998   1.00 0.00 ? 69  LEU B HD12 1  
ATOM 1396  H HD13 . LEU B 2 71  ? 4.416   -4.786  4.851   1.00 0.00 ? 69  LEU B HD13 1  
ATOM 1397  H HD21 . LEU B 2 71  ? 2.128   -2.882  4.244   1.00 0.00 ? 69  LEU B HD21 1  
ATOM 1398  H HD22 . LEU B 2 71  ? 0.859   -3.787  5.071   1.00 0.00 ? 69  LEU B HD22 1  
ATOM 1399  H HD23 . LEU B 2 71  ? 2.038   -4.635  4.069   1.00 0.00 ? 69  LEU B HD23 1  
ATOM 1400  N N    . HIS B 2 72  ? 0.931   -7.627  7.999   1.00 0.00 ? 70  HIS B N    1  
ATOM 1401  C CA   . HIS B 2 72  ? 0.921   -8.712  8.974   1.00 0.00 ? 70  HIS B CA   1  
ATOM 1402  C C    . HIS B 2 72  ? 2.347   -8.973  9.433   1.00 0.00 ? 70  HIS B C    1  
ATOM 1403  O O    . HIS B 2 72  ? 2.600   -9.782  10.320  1.00 0.00 ? 70  HIS B O    1  
ATOM 1404  C CB   . HIS B 2 72  ? 0.311   -10.000 8.397   1.00 0.00 ? 70  HIS B CB   1  
ATOM 1405  C CG   . HIS B 2 72  ? 0.321   -10.076 6.900   1.00 0.00 ? 70  HIS B CG   1  
ATOM 1406  N ND1  . HIS B 2 72  ? -0.773  -9.795  6.119   1.00 0.00 ? 70  HIS B ND1  1  
ATOM 1407  C CD2  . HIS B 2 72  ? 1.323   -10.390 6.033   1.00 0.00 ? 70  HIS B CD2  1  
ATOM 1408  C CE1  . HIS B 2 72  ? -0.408  -9.934  4.845   1.00 0.00 ? 70  HIS B CE1  1  
ATOM 1409  N NE2  . HIS B 2 72  ? 0.847   -10.304 4.749   1.00 0.00 ? 70  HIS B NE2  1  
ATOM 1410  H H    . HIS B 2 72  ? 0.869   -7.843  7.040   1.00 0.00 ? 70  HIS B H    1  
ATOM 1411  H HA   . HIS B 2 72  ? 0.333   -8.385  9.816   1.00 0.00 ? 70  HIS B HA   1  
ATOM 1412  H HB2  . HIS B 2 72  ? 0.864   -10.846 8.772   1.00 0.00 ? 70  HIS B HB2  1  
ATOM 1413  H HB3  . HIS B 2 72  ? -0.716  -10.077 8.726   1.00 0.00 ? 70  HIS B HB3  1  
ATOM 1414  H HD1  . HIS B 2 72  ? -1.672  -9.567  6.437   1.00 0.00 ? 70  HIS B HD1  1  
ATOM 1415  H HD2  . HIS B 2 72  ? 2.339   -10.618 6.279   1.00 0.00 ? 70  HIS B HD2  1  
ATOM 1416  H HE1  . HIS B 2 72  ? -1.019  -9.672  4.003   1.00 0.00 ? 70  HIS B HE1  1  
ATOM 1417  N N    . ALA B 2 73  ? 3.267   -8.259  8.799   1.00 0.00 ? 71  ALA B N    1  
ATOM 1418  C CA   . ALA B 2 73  ? 4.684   -8.356  9.097   1.00 0.00 ? 71  ALA B CA   1  
ATOM 1419  C C    . ALA B 2 73  ? 5.024   -7.565  10.357  1.00 0.00 ? 71  ALA B C    1  
ATOM 1420  O O    . ALA B 2 73  ? 6.153   -7.604  10.839  1.00 0.00 ? 71  ALA B O    1  
ATOM 1421  C CB   . ALA B 2 73  ? 5.481   -7.830  7.911   1.00 0.00 ? 71  ALA B CB   1  
ATOM 1422  H H    . ALA B 2 73  ? 2.978   -7.643  8.098   1.00 0.00 ? 71  ALA B H    1  
ATOM 1423  H HA   . ALA B 2 73  ? 4.933   -9.395  9.245   1.00 0.00 ? 71  ALA B HA   1  
ATOM 1424  H HB1  . ALA B 2 73  ? 5.252   -8.419  7.035   1.00 0.00 ? 71  ALA B HB1  1  
ATOM 1425  H HB2  . ALA B 2 73  ? 6.535   -7.895  8.125   1.00 0.00 ? 71  ALA B HB2  1  
ATOM 1426  H HB3  . ALA B 2 73  ? 5.213   -6.799  7.728   1.00 0.00 ? 71  ALA B HB3  1  
ATOM 1427  N N    . GLY B 2 74  ? 4.033   -6.851  10.882  1.00 0.00 ? 72  GLY B N    1  
ATOM 1428  C CA   . GLY B 2 74  ? 4.243   -6.046  12.068  1.00 0.00 ? 72  GLY B CA   1  
ATOM 1429  C C    . GLY B 2 74  ? 4.740   -4.664  11.710  1.00 0.00 ? 72  GLY B C    1  
ATOM 1430  O O    . GLY B 2 74  ? 5.318   -3.963  12.539  1.00 0.00 ? 72  GLY B O    1  
ATOM 1431  H H    . GLY B 2 74  ? 3.150   -6.874  10.460  1.00 0.00 ? 72  GLY B H    1  
ATOM 1432  H HA2  . GLY B 2 74  ? 3.310   -5.959  12.606  1.00 0.00 ? 72  GLY B HA2  1  
ATOM 1433  H HA3  . GLY B 2 74  ? 4.973   -6.530  12.701  1.00 0.00 ? 72  GLY B HA3  1  
ATOM 1434  N N    . ASP B 2 75  ? 4.496   -4.278  10.467  1.00 0.00 ? 73  ASP B N    1  
ATOM 1435  C CA   . ASP B 2 75  ? 4.925   -2.982  9.959   1.00 0.00 ? 73  ASP B CA   1  
ATOM 1436  C C    . ASP B 2 75  ? 3.742   -2.224  9.370   1.00 0.00 ? 73  ASP B C    1  
ATOM 1437  O O    . ASP B 2 75  ? 2.724   -2.828  9.018   1.00 0.00 ? 73  ASP B O    1  
ATOM 1438  C CB   . ASP B 2 75  ? 6.016   -3.172  8.898   1.00 0.00 ? 73  ASP B CB   1  
ATOM 1439  C CG   . ASP B 2 75  ? 6.432   -1.868  8.241   1.00 0.00 ? 73  ASP B CG   1  
ATOM 1440  O OD1  . ASP B 2 75  ? 6.405   -1.797  6.996   1.00 0.00 ? 73  ASP B OD1  1  
ATOM 1441  O OD2  . ASP B 2 75  ? 6.763   -0.913  8.974   1.00 0.00 ? 73  ASP B OD2  1  
ATOM 1442  H H    . ASP B 2 75  ? 4.000   -4.878  9.874   1.00 0.00 ? 73  ASP B H    1  
ATOM 1443  H HA   . ASP B 2 75  ? 5.327   -2.415  10.784  1.00 0.00 ? 73  ASP B HA   1  
ATOM 1444  H HB2  . ASP B 2 75  ? 6.887   -3.610  9.362   1.00 0.00 ? 73  ASP B HB2  1  
ATOM 1445  H HB3  . ASP B 2 75  ? 5.648   -3.838  8.132   1.00 0.00 ? 73  ASP B HB3  1  
ATOM 1446  N N    . THR B 2 76  ? 3.872   -0.911  9.273   1.00 0.00 ? 74  THR B N    1  
ATOM 1447  C CA   . THR B 2 76  ? 2.819   -0.075  8.727   1.00 0.00 ? 74  THR B CA   1  
ATOM 1448  C C    . THR B 2 76  ? 3.411   0.985   7.797   1.00 0.00 ? 74  THR B C    1  
ATOM 1449  O O    . THR B 2 76  ? 4.359   1.681   8.157   1.00 0.00 ? 74  THR B O    1  
ATOM 1450  C CB   . THR B 2 76  ? 2.034   0.632   9.851   1.00 0.00 ? 74  THR B CB   1  
ATOM 1451  O OG1  . THR B 2 76  ? 2.944   1.200   10.802  1.00 0.00 ? 74  THR B OG1  1  
ATOM 1452  C CG2  . THR B 2 76  ? 1.102   -0.337  10.562  1.00 0.00 ? 74  THR B CG2  1  
ATOM 1453  H H    . THR B 2 76  ? 4.718   -0.492  9.552   1.00 0.00 ? 74  THR B H    1  
ATOM 1454  H HA   . THR B 2 76  ? 2.132   -0.706  8.169   1.00 0.00 ? 74  THR B HA   1  
ATOM 1455  H HB   . THR B 2 76  ? 1.441   1.421   9.414   1.00 0.00 ? 74  THR B HB   1  
ATOM 1456  H HG1  . THR B 2 76  ? 3.758   1.454   10.350  1.00 0.00 ? 74  THR B HG1  1  
ATOM 1457  H HG21 . THR B 2 76  ? 0.559   0.188   11.334  1.00 0.00 ? 74  THR B HG21 1  
ATOM 1458  H HG22 . THR B 2 76  ? 1.682   -1.133  11.007  1.00 0.00 ? 74  THR B HG22 1  
ATOM 1459  H HG23 . THR B 2 76  ? 0.405   -0.754  9.852   1.00 0.00 ? 74  THR B HG23 1  
ATOM 1460  N N    . THR B 2 77  ? 2.840   1.113   6.614   1.00 0.00 ? 75  THR B N    1  
ATOM 1461  C CA   . THR B 2 77  ? 3.297   2.088   5.639   1.00 0.00 ? 75  THR B CA   1  
ATOM 1462  C C    . THR B 2 77  ? 2.307   3.249   5.555   1.00 0.00 ? 75  THR B C    1  
ATOM 1463  O O    . THR B 2 77  ? 1.263   3.131   4.918   1.00 0.00 ? 75  THR B O    1  
ATOM 1464  C CB   . THR B 2 77  ? 3.445   1.430   4.254   1.00 0.00 ? 75  THR B CB   1  
ATOM 1465  O OG1  . THR B 2 77  ? 4.041   0.133   4.395   1.00 0.00 ? 75  THR B OG1  1  
ATOM 1466  C CG2  . THR B 2 77  ? 4.295   2.291   3.332   1.00 0.00 ? 75  THR B CG2  1  
ATOM 1467  H H    . THR B 2 77  ? 2.092   0.518   6.381   1.00 0.00 ? 75  THR B H    1  
ATOM 1468  H HA   . THR B 2 77  ? 4.262   2.459   5.952   1.00 0.00 ? 75  THR B HA   1  
ATOM 1469  H HB   . THR B 2 77  ? 2.460   1.315   3.816   1.00 0.00 ? 75  THR B HB   1  
ATOM 1470  H HG1  . THR B 2 77  ? 4.608   0.120   5.176   1.00 0.00 ? 75  THR B HG1  1  
ATOM 1471  H HG21 . THR B 2 77  ? 3.834   3.260   3.220   1.00 0.00 ? 75  THR B HG21 1  
ATOM 1472  H HG22 . THR B 2 77  ? 4.373   1.814   2.366   1.00 0.00 ? 75  THR B HG22 1  
ATOM 1473  H HG23 . THR B 2 77  ? 5.281   2.406   3.757   1.00 0.00 ? 75  THR B HG23 1  
ATOM 1474  N N    . ASN B 2 78  ? 2.627   4.367   6.195   1.00 0.00 ? 76  ASN B N    1  
ATOM 1475  C CA   . ASN B 2 78  ? 1.718   5.512   6.197   1.00 0.00 ? 76  ASN B CA   1  
ATOM 1476  C C    . ASN B 2 78  ? 1.913   6.388   4.968   1.00 0.00 ? 76  ASN B C    1  
ATOM 1477  O O    . ASN B 2 78  ? 3.039   6.647   4.541   1.00 0.00 ? 76  ASN B O    1  
ATOM 1478  C CB   . ASN B 2 78  ? 1.881   6.354   7.469   1.00 0.00 ? 76  ASN B CB   1  
ATOM 1479  C CG   . ASN B 2 78  ? 1.341   5.661   8.709   1.00 0.00 ? 76  ASN B CG   1  
ATOM 1480  O OD1  . ASN B 2 78  ? 1.340   4.432   8.801   1.00 0.00 ? 76  ASN B OD1  1  
ATOM 1481  N ND2  . ASN B 2 78  ? 0.864   6.441   9.667   1.00 0.00 ? 76  ASN B ND2  1  
ATOM 1482  H H    . ASN B 2 78  ? 3.487   4.429   6.666   1.00 0.00 ? 76  ASN B H    1  
ATOM 1483  H HA   . ASN B 2 78  ? 0.712   5.122   6.174   1.00 0.00 ? 76  ASN B HA   1  
ATOM 1484  H HB2  . ASN B 2 78  ? 2.925   6.561   7.624   1.00 0.00 ? 76  ASN B HB2  1  
ATOM 1485  H HB3  . ASN B 2 78  ? 1.350   7.287   7.343   1.00 0.00 ? 76  ASN B HB3  1  
ATOM 1486  H HD21 . ASN B 2 78  ? 0.877   7.427   9.525   1.00 0.00 ? 76  ASN B HD21 1  
ATOM 1487  H HD22 . ASN B 2 78  ? 0.534   6.023   10.487  1.00 0.00 ? 76  ASN B HD22 1  
ATOM 1488  N N    . PHE B 2 79  ? 0.795   6.823   4.406   1.00 0.00 ? 77  PHE B N    1  
ATOM 1489  C CA   . PHE B 2 79  ? 0.775   7.675   3.232   1.00 0.00 ? 77  PHE B CA   1  
ATOM 1490  C C    . PHE B 2 79  ? 0.017   8.960   3.537   1.00 0.00 ? 77  PHE B C    1  
ATOM 1491  O O    . PHE B 2 79  ? -1.200  8.951   3.741   1.00 0.00 ? 77  PHE B O    1  
ATOM 1492  C CB   . PHE B 2 79  ? 0.126   6.952   2.052   1.00 0.00 ? 77  PHE B CB   1  
ATOM 1493  C CG   . PHE B 2 79  ? 1.014   5.921   1.422   1.00 0.00 ? 77  PHE B CG   1  
ATOM 1494  C CD1  . PHE B 2 79  ? 2.076   6.304   0.619   1.00 0.00 ? 77  PHE B CD1  1  
ATOM 1495  C CD2  . PHE B 2 79  ? 0.787   4.571   1.627   1.00 0.00 ? 77  PHE B CD2  1  
ATOM 1496  C CE1  . PHE B 2 79  ? 2.896   5.360   0.035   1.00 0.00 ? 77  PHE B CE1  1  
ATOM 1497  C CE2  . PHE B 2 79  ? 1.604   3.622   1.045   1.00 0.00 ? 77  PHE B CE2  1  
ATOM 1498  C CZ   . PHE B 2 79  ? 2.660   4.019   0.248   1.00 0.00 ? 77  PHE B CZ   1  
ATOM 1499  H H    . PHE B 2 79  ? -0.065  6.560   4.807   1.00 0.00 ? 77  PHE B H    1  
ATOM 1500  H HA   . PHE B 2 79  ? 1.795   7.921   2.980   1.00 0.00 ? 77  PHE B HA   1  
ATOM 1501  H HB2  . PHE B 2 79  ? -0.771  6.456   2.391   1.00 0.00 ? 77  PHE B HB2  1  
ATOM 1502  H HB3  . PHE B 2 79  ? -0.134  7.678   1.294   1.00 0.00 ? 77  PHE B HB3  1  
ATOM 1503  H HD1  . PHE B 2 79  ? 2.262   7.355   0.453   1.00 0.00 ? 77  PHE B HD1  1  
ATOM 1504  H HD2  . PHE B 2 79  ? -0.038  4.261   2.252   1.00 0.00 ? 77  PHE B HD2  1  
ATOM 1505  H HE1  . PHE B 2 79  ? 3.720   5.673   -0.589  1.00 0.00 ? 77  PHE B HE1  1  
ATOM 1506  H HE2  . PHE B 2 79  ? 1.417   2.572   1.213   1.00 0.00 ? 77  PHE B HE2  1  
ATOM 1507  H HZ   . PHE B 2 79  ? 3.299   3.279   -0.212  1.00 0.00 ? 77  PHE B HZ   1  
ATOM 1508  N N    . HIS B 2 80  ? 0.751   10.050  3.574   1.00 0.00 ? 78  HIS B N    1  
ATOM 1509  C CA   . HIS B 2 80  ? 0.207   11.366  3.859   1.00 0.00 ? 78  HIS B CA   1  
ATOM 1510  C C    . HIS B 2 80  ? -0.262  12.034  2.564   1.00 0.00 ? 78  HIS B C    1  
ATOM 1511  O O    . HIS B 2 80  ? 0.548   12.495  1.771   1.00 0.00 ? 78  HIS B O    1  
ATOM 1512  C CB   . HIS B 2 80  ? 1.310   12.188  4.552   1.00 0.00 ? 78  HIS B CB   1  
ATOM 1513  C CG   . HIS B 2 80  ? 1.010   13.635  4.836   1.00 0.00 ? 78  HIS B CG   1  
ATOM 1514  N ND1  . HIS B 2 80  ? 1.394   14.267  5.998   1.00 0.00 ? 78  HIS B ND1  1  
ATOM 1515  C CD2  . HIS B 2 80  ? 0.432   14.597  4.067   1.00 0.00 ? 78  HIS B CD2  1  
ATOM 1516  C CE1  . HIS B 2 80  ? 1.056   15.557  5.900   1.00 0.00 ? 78  HIS B CE1  1  
ATOM 1517  N NE2  . HIS B 2 80  ? 0.469   15.810  4.748   1.00 0.00 ? 78  HIS B NE2  1  
ATOM 1518  H H    . HIS B 2 80  ? 1.718   9.971   3.399   1.00 0.00 ? 78  HIS B H    1  
ATOM 1519  H HA   . HIS B 2 80  ? -0.631  11.252  4.527   1.00 0.00 ? 78  HIS B HA   1  
ATOM 1520  H HB2  . HIS B 2 80  ? 1.539   11.723  5.496   1.00 0.00 ? 78  HIS B HB2  1  
ATOM 1521  H HB3  . HIS B 2 80  ? 2.195   12.154  3.934   1.00 0.00 ? 78  HIS B HB3  1  
ATOM 1522  H HD1  . HIS B 2 80  ? 1.834   13.842  6.766   1.00 0.00 ? 78  HIS B HD1  1  
ATOM 1523  H HD2  . HIS B 2 80  ? -0.002  14.451  3.088   1.00 0.00 ? 78  HIS B HD2  1  
ATOM 1524  H HE1  . HIS B 2 80  ? 1.241   16.295  6.665   1.00 0.00 ? 78  HIS B HE1  1  
ATOM 1525  N N    . PHE B 2 81  ? -1.567  12.067  2.348   1.00 0.00 ? 79  PHE B N    1  
ATOM 1526  C CA   . PHE B 2 81  ? -2.124  12.697  1.156   1.00 0.00 ? 79  PHE B CA   1  
ATOM 1527  C C    . PHE B 2 81  ? -2.057  14.216  1.308   1.00 0.00 ? 79  PHE B C    1  
ATOM 1528  O O    . PHE B 2 81  ? -2.891  14.816  1.990   1.00 0.00 ? 79  PHE B O    1  
ATOM 1529  C CB   . PHE B 2 81  ? -3.576  12.260  0.945   1.00 0.00 ? 79  PHE B CB   1  
ATOM 1530  C CG   . PHE B 2 81  ? -3.735  10.870  0.396   1.00 0.00 ? 79  PHE B CG   1  
ATOM 1531  C CD1  . PHE B 2 81  ? -3.923  10.674  -0.958  1.00 0.00 ? 79  PHE B CD1  1  
ATOM 1532  C CD2  . PHE B 2 81  ? -3.712  9.764   1.233   1.00 0.00 ? 79  PHE B CD2  1  
ATOM 1533  C CE1  . PHE B 2 81  ? -4.087  9.404   -1.472  1.00 0.00 ? 79  PHE B CE1  1  
ATOM 1534  C CE2  . PHE B 2 81  ? -3.873  8.488   0.721   1.00 0.00 ? 79  PHE B CE2  1  
ATOM 1535  C CZ   . PHE B 2 81  ? -4.063  8.311   -0.638  1.00 0.00 ? 79  PHE B CZ   1  
ATOM 1536  H H    . PHE B 2 81  ? -2.176  11.681  3.014   1.00 0.00 ? 79  PHE B H    1  
ATOM 1537  H HA   . PHE B 2 81  ? -1.532  12.392  0.302   1.00 0.00 ? 79  PHE B HA   1  
ATOM 1538  H HB2  . PHE B 2 81  ? -4.094  12.300  1.891   1.00 0.00 ? 79  PHE B HB2  1  
ATOM 1539  H HB3  . PHE B 2 81  ? -4.050  12.945  0.257   1.00 0.00 ? 79  PHE B HB3  1  
ATOM 1540  H HD1  . PHE B 2 81  ? -3.941  11.528  -1.619  1.00 0.00 ? 79  PHE B HD1  1  
ATOM 1541  H HD2  . PHE B 2 81  ? -3.563  9.904   2.293   1.00 0.00 ? 79  PHE B HD2  1  
ATOM 1542  H HE1  . PHE B 2 81  ? -4.234  9.268   -2.533  1.00 0.00 ? 79  PHE B HE1  1  
ATOM 1543  H HE2  . PHE B 2 81  ? -3.853  7.634   1.380   1.00 0.00 ? 79  PHE B HE2  1  
ATOM 1544  H HZ   . PHE B 2 81  ? -4.200  7.315   -1.049  1.00 0.00 ? 79  PHE B HZ   1  
ATOM 1545  N N    . SER B 2 82  ? -1.063  14.834  0.686   1.00 0.00 ? 80  SER B N    1  
ATOM 1546  C CA   . SER B 2 82  ? -0.882  16.276  0.784   1.00 0.00 ? 80  SER B CA   1  
ATOM 1547  C C    . SER B 2 82  ? -1.505  17.028  -0.394  1.00 0.00 ? 80  SER B C    1  
ATOM 1548  O O    . SER B 2 82  ? -1.469  18.258  -0.433  1.00 0.00 ? 80  SER B O    1  
ATOM 1549  C CB   . SER B 2 82  ? 0.611   16.601  0.912   1.00 0.00 ? 80  SER B CB   1  
ATOM 1550  O OG   . SER B 2 82  ? 1.408   15.624  0.257   1.00 0.00 ? 80  SER B OG   1  
ATOM 1551  H H    . SER B 2 82  ? -0.428  14.312  0.146   1.00 0.00 ? 80  SER B H    1  
ATOM 1552  H HA   . SER B 2 82  ? -1.376  16.598  1.687   1.00 0.00 ? 80  SER B HA   1  
ATOM 1553  H HB2  . SER B 2 82  ? 0.806   17.563  0.465   1.00 0.00 ? 80  SER B HB2  1  
ATOM 1554  H HB3  . SER B 2 82  ? 0.882   16.628  1.958   1.00 0.00 ? 80  SER B HB3  1  
ATOM 1555  H HG   . SER B 2 82  ? 2.200   16.046  -0.120  1.00 0.00 ? 80  SER B HG   1  
ATOM 1556  N N    . ASN B 2 83  ? -2.078  16.304  -1.352  1.00 0.00 ? 81  ASN B N    1  
ATOM 1557  C CA   . ASN B 2 83  ? -2.706  16.950  -2.504  1.00 0.00 ? 81  ASN B CA   1  
ATOM 1558  C C    . ASN B 2 83  ? -4.094  17.460  -2.132  1.00 0.00 ? 81  ASN B C    1  
ATOM 1559  O O    . ASN B 2 83  ? -5.083  16.752  -2.276  1.00 0.00 ? 81  ASN B O    1  
ATOM 1560  C CB   . ASN B 2 83  ? -2.801  15.991  -3.697  1.00 0.00 ? 81  ASN B CB   1  
ATOM 1561  C CG   . ASN B 2 83  ? -3.098  16.707  -5.008  1.00 0.00 ? 81  ASN B CG   1  
ATOM 1562  O OD1  . ASN B 2 83  ? -3.530  16.089  -5.985  1.00 0.00 ? 81  ASN B OD1  1  
ATOM 1563  N ND2  . ASN B 2 83  ? -2.873  18.015  -5.048  1.00 0.00 ? 81  ASN B ND2  1  
ATOM 1564  H H    . ASN B 2 83  ? -2.066  15.326  -1.289  1.00 0.00 ? 81  ASN B H    1  
ATOM 1565  H HA   . ASN B 2 83  ? -2.092  17.795  -2.781  1.00 0.00 ? 81  ASN B HA   1  
ATOM 1566  H HB2  . ASN B 2 83  ? -1.867  15.462  -3.800  1.00 0.00 ? 81  ASN B HB2  1  
ATOM 1567  H HB3  . ASN B 2 83  ? -3.591  15.279  -3.511  1.00 0.00 ? 81  ASN B HB3  1  
ATOM 1568  H HD21 . ASN B 2 83  ? -2.526  18.457  -4.242  1.00 0.00 ? 81  ASN B HD21 1  
ATOM 1569  H HD22 . ASN B 2 83  ? -3.077  18.495  -5.877  1.00 0.00 ? 81  ASN B HD22 1  
ATOM 1570  N N    . GLU B 2 84  ? -4.146  18.708  -1.688  1.00 0.00 ? 82  GLU B N    1  
ATOM 1571  C CA   . GLU B 2 84  ? -5.388  19.364  -1.261  1.00 0.00 ? 82  GLU B CA   1  
ATOM 1572  C C    . GLU B 2 84  ? -6.544  19.163  -2.252  1.00 0.00 ? 82  GLU B C    1  
ATOM 1573  O O    . GLU B 2 84  ? -7.694  18.980  -1.847  1.00 0.00 ? 82  GLU B O    1  
ATOM 1574  C CB   . GLU B 2 84  ? -5.129  20.867  -1.041  1.00 0.00 ? 82  GLU B CB   1  
ATOM 1575  C CG   . GLU B 2 84  ? -4.829  21.668  -2.313  1.00 0.00 ? 82  GLU B CG   1  
ATOM 1576  C CD   . GLU B 2 84  ? -3.710  21.072  -3.151  1.00 0.00 ? 82  GLU B CD   1  
ATOM 1577  O OE1  . GLU B 2 84  ? -4.002  20.558  -4.253  1.00 0.00 ? 82  GLU B OE1  1  
ATOM 1578  O OE2  . GLU B 2 84  ? -2.553  21.075  -2.694  1.00 0.00 ? 82  GLU B OE2  1  
ATOM 1579  H H    . GLU B 2 84  ? -3.308  19.223  -1.645  1.00 0.00 ? 82  GLU B H    1  
ATOM 1580  H HA   . GLU B 2 84  ? -5.673  18.927  -0.317  1.00 0.00 ? 82  GLU B HA   1  
ATOM 1581  H HB2  . GLU B 2 84  ? -6.001  21.300  -0.574  1.00 0.00 ? 82  GLU B HB2  1  
ATOM 1582  H HB3  . GLU B 2 84  ? -4.288  20.976  -0.372  1.00 0.00 ? 82  GLU B HB3  1  
ATOM 1583  H HG2  . GLU B 2 84  ? -5.723  21.704  -2.916  1.00 0.00 ? 82  GLU B HG2  1  
ATOM 1584  H HG3  . GLU B 2 84  ? -4.550  22.672  -2.029  1.00 0.00 ? 82  GLU B HG3  1  
ATOM 1585  N N    . SER B 2 85  ? -6.223  19.183  -3.537  1.00 0.00 ? 83  SER B N    1  
ATOM 1586  C CA   . SER B 2 85  ? -7.205  19.025  -4.598  1.00 0.00 ? 83  SER B CA   1  
ATOM 1587  C C    . SER B 2 85  ? -8.056  17.766  -4.453  1.00 0.00 ? 83  SER B C    1  
ATOM 1588  O O    . SER B 2 85  ? -9.288  17.847  -4.356  1.00 0.00 ? 83  SER B O    1  
ATOM 1589  C CB   . SER B 2 85  ? -6.494  19.015  -5.953  1.00 0.00 ? 83  SER B CB   1  
ATOM 1590  O OG   . SER B 2 85  ? -5.783  20.224  -6.170  1.00 0.00 ? 83  SER B OG   1  
ATOM 1591  H H    . SER B 2 85  ? -5.281  19.336  -3.784  1.00 0.00 ? 83  SER B H    1  
ATOM 1592  H HA   . SER B 2 85  ? -7.865  19.869  -4.573  1.00 0.00 ? 83  SER B HA   1  
ATOM 1593  H HB2  . SER B 2 85  ? -5.794  18.193  -5.983  1.00 0.00 ? 83  SER B HB2  1  
ATOM 1594  H HB3  . SER B 2 85  ? -7.223  18.895  -6.739  1.00 0.00 ? 83  SER B HB3  1  
ATOM 1595  H HG   . SER B 2 85  ? -5.151  20.372  -5.441  1.00 0.00 ? 83  SER B HG   1  
ATOM 1596  N N    . THR B 2 86  ? -7.431  16.604  -4.442  1.00 0.00 ? 84  THR B N    1  
ATOM 1597  C CA   . THR B 2 86  ? -8.199  15.376  -4.383  1.00 0.00 ? 84  THR B CA   1  
ATOM 1598  C C    . THR B 2 86  ? -7.789  14.409  -3.270  1.00 0.00 ? 84  THR B C    1  
ATOM 1599  O O    . THR B 2 86  ? -8.300  13.304  -3.237  1.00 0.00 ? 84  THR B O    1  
ATOM 1600  C CB   . THR B 2 86  ? -8.124  14.687  -5.756  1.00 0.00 ? 84  THR B CB   1  
ATOM 1601  O OG1  . THR B 2 86  ? -6.763  14.646  -6.212  1.00 0.00 ? 84  THR B OG1  1  
ATOM 1602  C CG2  . THR B 2 86  ? -8.962  15.461  -6.762  1.00 0.00 ? 84  THR B CG2  1  
ATOM 1603  H H    . THR B 2 86  ? -6.450  16.569  -4.472  1.00 0.00 ? 84  THR B H    1  
ATOM 1604  H HA   . THR B 2 86  ? -9.231  15.649  -4.223  1.00 0.00 ? 84  THR B HA   1  
ATOM 1605  H HB   . THR B 2 86  ? -8.511  13.682  -5.674  1.00 0.00 ? 84  THR B HB   1  
ATOM 1606  H HG1  . THR B 2 86  ? -6.200  14.254  -5.514  1.00 0.00 ? 84  THR B HG1  1  
ATOM 1607  H HG21 . THR B 2 86  ? -8.932  14.968  -7.719  1.00 0.00 ? 84  THR B HG21 1  
ATOM 1608  H HG22 . THR B 2 86  ? -8.565  16.464  -6.861  1.00 0.00 ? 84  THR B HG22 1  
ATOM 1609  H HG23 . THR B 2 86  ? -9.982  15.517  -6.412  1.00 0.00 ? 84  THR B HG23 1  
ATOM 1610  N N    . ALA B 2 87  ? -6.930  14.839  -2.343  1.00 0.00 ? 85  ALA B N    1  
ATOM 1611  C CA   . ALA B 2 87  ? -6.439  13.974  -1.249  1.00 0.00 ? 85  ALA B CA   1  
ATOM 1612  C C    . ALA B 2 87  ? -7.529  13.125  -0.598  1.00 0.00 ? 85  ALA B C    1  
ATOM 1613  O O    . ALA B 2 87  ? -7.347  11.928  -0.413  1.00 0.00 ? 85  ALA B O    1  
ATOM 1614  C CB   . ALA B 2 87  ? -5.743  14.803  -0.181  1.00 0.00 ? 85  ALA B CB   1  
ATOM 1615  H H    . ALA B 2 87  ? -6.596  15.762  -2.397  1.00 0.00 ? 85  ALA B H    1  
ATOM 1616  H HA   . ALA B 2 87  ? -5.701  13.303  -1.675  1.00 0.00 ? 85  ALA B HA   1  
ATOM 1617  H HB1  . ALA B 2 87  ? -5.294  14.146  0.550   1.00 0.00 ? 85  ALA B HB1  1  
ATOM 1618  H HB2  . ALA B 2 87  ? -6.464  15.442  0.307   1.00 0.00 ? 85  ALA B HB2  1  
ATOM 1619  H HB3  . ALA B 2 87  ? -4.974  15.409  -0.638  1.00 0.00 ? 85  ALA B HB3  1  
ATOM 1620  N N    . VAL B 2 88  ? -8.644  13.743  -0.236  1.00 0.00 ? 86  VAL B N    1  
ATOM 1621  C CA   . VAL B 2 88  ? -9.748  13.019  0.392   1.00 0.00 ? 86  VAL B CA   1  
ATOM 1622  C C    . VAL B 2 88  ? -10.259 11.898  -0.525  1.00 0.00 ? 86  VAL B C    1  
ATOM 1623  O O    . VAL B 2 88  ? -10.329 10.738  -0.127  1.00 0.00 ? 86  VAL B O    1  
ATOM 1624  C CB   . VAL B 2 88  ? -10.898 13.993  0.764   1.00 0.00 ? 86  VAL B CB   1  
ATOM 1625  C CG1  . VAL B 2 88  ? -12.263 13.314  0.717   1.00 0.00 ? 86  VAL B CG1  1  
ATOM 1626  C CG2  . VAL B 2 88  ? -10.670 14.587  2.140   1.00 0.00 ? 86  VAL B CG2  1  
ATOM 1627  H H    . VAL B 2 88  ? -8.727  14.706  -0.386  1.00 0.00 ? 86  VAL B H    1  
ATOM 1628  H HA   . VAL B 2 88  ? -9.370  12.571  1.304   1.00 0.00 ? 86  VAL B HA   1  
ATOM 1629  H HB   . VAL B 2 88  ? -10.889 14.804  0.053   1.00 0.00 ? 86  VAL B HB   1  
ATOM 1630  H HG11 . VAL B 2 88  ? -12.444 12.939  -0.280  1.00 0.00 ? 86  VAL B HG11 1  
ATOM 1631  H HG12 . VAL B 2 88  ? -13.029 14.028  0.979   1.00 0.00 ? 86  VAL B HG12 1  
ATOM 1632  H HG13 . VAL B 2 88  ? -12.280 12.492  1.419   1.00 0.00 ? 86  VAL B HG13 1  
ATOM 1633  H HG21 . VAL B 2 88  ? -11.493 15.241  2.390   1.00 0.00 ? 86  VAL B HG21 1  
ATOM 1634  H HG22 . VAL B 2 88  ? -9.749  15.152  2.139   1.00 0.00 ? 86  VAL B HG22 1  
ATOM 1635  H HG23 . VAL B 2 88  ? -10.606 13.793  2.869   1.00 0.00 ? 86  VAL B HG23 1  
ATOM 1636  N N    . LYS B 2 89  ? -10.563 12.255  -1.768  1.00 0.00 ? 87  LYS B N    1  
ATOM 1637  C CA   . LYS B 2 89  ? -11.061 11.300  -2.759  1.00 0.00 ? 87  LYS B CA   1  
ATOM 1638  C C    . LYS B 2 89  ? -9.967  10.301  -3.118  1.00 0.00 ? 87  LYS B C    1  
ATOM 1639  O O    . LYS B 2 89  ? -10.239 9.133   -3.379  1.00 0.00 ? 87  LYS B O    1  
ATOM 1640  C CB   . LYS B 2 89  ? -11.520 12.058  -4.012  1.00 0.00 ? 87  LYS B CB   1  
ATOM 1641  C CG   . LYS B 2 89  ? -12.323 13.319  -3.707  1.00 0.00 ? 87  LYS B CG   1  
ATOM 1642  C CD   . LYS B 2 89  ? -11.752 14.535  -4.427  1.00 0.00 ? 87  LYS B CD   1  
ATOM 1643  C CE   . LYS B 2 89  ? -12.432 15.824  -3.984  1.00 0.00 ? 87  LYS B CE   1  
ATOM 1644  N NZ   . LYS B 2 89  ? -11.867 17.021  -4.669  1.00 0.00 ? 87  LYS B NZ   1  
ATOM 1645  H H    . LYS B 2 89  ? -10.434 13.184  -2.033  1.00 0.00 ? 87  LYS B H    1  
ATOM 1646  H HA   . LYS B 2 89  ? -11.902 10.754  -2.330  1.00 0.00 ? 87  LYS B HA   1  
ATOM 1647  H HB2  . LYS B 2 89  ? -10.649 12.346  -4.582  1.00 0.00 ? 87  LYS B HB2  1  
ATOM 1648  H HB3  . LYS B 2 89  ? -12.133 11.404  -4.612  1.00 0.00 ? 87  LYS B HB3  1  
ATOM 1649  H HG2  . LYS B 2 89  ? -13.344 13.171  -4.026  1.00 0.00 ? 87  LYS B HG2  1  
ATOM 1650  H HG3  . LYS B 2 89  ? -12.299 13.499  -2.642  1.00 0.00 ? 87  LYS B HG3  1  
ATOM 1651  H HD2  . LYS B 2 89  ? -10.697 14.607  -4.210  1.00 0.00 ? 87  LYS B HD2  1  
ATOM 1652  H HD3  . LYS B 2 89  ? -11.895 14.411  -5.490  1.00 0.00 ? 87  LYS B HD3  1  
ATOM 1653  H HE2  . LYS B 2 89  ? -13.486 15.755  -4.209  1.00 0.00 ? 87  LYS B HE2  1  
ATOM 1654  H HE3  . LYS B 2 89  ? -12.300 15.935  -2.917  1.00 0.00 ? 87  LYS B HE3  1  
ATOM 1655  H HZ1  . LYS B 2 89  ? -10.884 17.194  -4.352  1.00 0.00 ? 87  LYS B HZ1  1  
ATOM 1656  H HZ2  . LYS B 2 89  ? -12.437 17.863  -4.451  1.00 0.00 ? 87  LYS B HZ2  1  
ATOM 1657  H HZ3  . LYS B 2 89  ? -11.864 16.877  -5.698  1.00 0.00 ? 87  LYS B HZ3  1  
ATOM 1658  N N    . GLU B 2 90  ? -8.733  10.781  -3.135  1.00 0.00 ? 88  GLU B N    1  
ATOM 1659  C CA   . GLU B 2 90  ? -7.582  9.948   -3.421  1.00 0.00 ? 88  GLU B CA   1  
ATOM 1660  C C    . GLU B 2 90  ? -7.439  8.910   -2.320  1.00 0.00 ? 88  GLU B C    1  
ATOM 1661  O O    . GLU B 2 90  ? -7.280  7.726   -2.597  1.00 0.00 ? 88  GLU B O    1  
ATOM 1662  C CB   . GLU B 2 90  ? -6.329  10.817  -3.563  1.00 0.00 ? 88  GLU B CB   1  
ATOM 1663  C CG   . GLU B 2 90  ? -6.087  11.275  -4.994  1.00 0.00 ? 88  GLU B CG   1  
ATOM 1664  C CD   . GLU B 2 90  ? -5.029  12.354  -5.114  1.00 0.00 ? 88  GLU B CD   1  
ATOM 1665  O OE1  . GLU B 2 90  ? -5.221  13.444  -4.543  1.00 0.00 ? 88  GLU B OE1  1  
ATOM 1666  O OE2  . GLU B 2 90  ? -4.025  12.137  -5.824  1.00 0.00 ? 88  GLU B OE2  1  
ATOM 1667  H H    . GLU B 2 90  ? -8.591  11.736  -2.951  1.00 0.00 ? 88  GLU B H    1  
ATOM 1668  H HA   . GLU B 2 90  ? -7.766  9.438   -4.356  1.00 0.00 ? 88  GLU B HA   1  
ATOM 1669  H HB2  . GLU B 2 90  ? -6.444  11.695  -2.942  1.00 0.00 ? 88  GLU B HB2  1  
ATOM 1670  H HB3  . GLU B 2 90  ? -5.466  10.264  -3.228  1.00 0.00 ? 88  GLU B HB3  1  
ATOM 1671  H HG2  . GLU B 2 90  ? -5.774  10.425  -5.580  1.00 0.00 ? 88  GLU B HG2  1  
ATOM 1672  H HG3  . GLU B 2 90  ? -7.016  11.660  -5.393  1.00 0.00 ? 88  GLU B HG3  1  
ATOM 1673  N N    . ARG B 2 91  ? -7.536  9.365   -1.069  1.00 0.00 ? 89  ARG B N    1  
ATOM 1674  C CA   . ARG B 2 91  ? -7.475  8.481   0.093   1.00 0.00 ? 89  ARG B CA   1  
ATOM 1675  C C    . ARG B 2 91  ? -8.507  7.392   -0.077  1.00 0.00 ? 89  ARG B C    1  
ATOM 1676  O O    . ARG B 2 91  ? -8.235  6.206   0.090   1.00 0.00 ? 89  ARG B O    1  
ATOM 1677  C CB   . ARG B 2 91  ? -7.803  9.259   1.370   1.00 0.00 ? 89  ARG B CB   1  
ATOM 1678  C CG   . ARG B 2 91  ? -7.766  8.430   2.639   1.00 0.00 ? 89  ARG B CG   1  
ATOM 1679  C CD   . ARG B 2 91  ? -8.641  9.059   3.716   1.00 0.00 ? 89  ARG B CD   1  
ATOM 1680  N NE   . ARG B 2 91  ? -9.966  9.421   3.199   1.00 0.00 ? 89  ARG B NE   1  
ATOM 1681  C CZ   . ARG B 2 91  ? -10.700 10.440  3.652   1.00 0.00 ? 89  ARG B CZ   1  
ATOM 1682  N NH1  . ARG B 2 91  ? -10.272 11.188  4.661   1.00 0.00 ? 89  ARG B NH1  1  
ATOM 1683  N NH2  . ARG B 2 91  ? -11.876 10.705  3.098   1.00 0.00 ? 89  ARG B NH2  1  
ATOM 1684  H H    . ARG B 2 91  ? -7.647  10.333  -0.924  1.00 0.00 ? 89  ARG B H    1  
ATOM 1685  H HA   . ARG B 2 91  ? -6.487  8.051   0.161   1.00 0.00 ? 89  ARG B HA   1  
ATOM 1686  H HB2  . ARG B 2 91  ? -7.107  10.073  1.477   1.00 0.00 ? 89  ARG B HB2  1  
ATOM 1687  H HB3  . ARG B 2 91  ? -8.804  9.663   1.279   1.00 0.00 ? 89  ARG B HB3  1  
ATOM 1688  H HG2  . ARG B 2 91  ? -8.130  7.437   2.424   1.00 0.00 ? 89  ARG B HG2  1  
ATOM 1689  H HG3  . ARG B 2 91  ? -6.749  8.378   2.998   1.00 0.00 ? 89  ARG B HG3  1  
ATOM 1690  H HD2  . ARG B 2 91  ? -8.761  8.352   4.523   1.00 0.00 ? 89  ARG B HD2  1  
ATOM 1691  H HD3  . ARG B 2 91  ? -8.153  9.949   4.085   1.00 0.00 ? 89  ARG B HD3  1  
ATOM 1692  H HE   . ARG B 2 91  ? -10.326 8.877   2.462   1.00 0.00 ? 89  ARG B HE   1  
ATOM 1693  H HH11 . ARG B 2 91  ? -9.395  10.994  5.103   1.00 0.00 ? 89  ARG B HH11 1  
ATOM 1694  H HH12 . ARG B 2 91  ? -10.837 11.970  4.981   1.00 0.00 ? 89  ARG B HH12 1  
ATOM 1695  H HH21 . ARG B 2 91  ? -12.225 10.137  2.330   1.00 0.00 ? 89  ARG B HH21 1  
ATOM 1696  H HH22 . ARG B 2 91  ? -12.430 11.471  3.441   1.00 0.00 ? 89  ARG B HH22 1  
ATOM 1697  N N    . ASP B 2 92  ? -9.694  7.839   -0.430  1.00 0.00 ? 90  ASP B N    1  
ATOM 1698  C CA   . ASP B 2 92  ? -10.828 6.974   -0.642  1.00 0.00 ? 90  ASP B CA   1  
ATOM 1699  C C    . ASP B 2 92  ? -10.612 5.996   -1.791  1.00 0.00 ? 90  ASP B C    1  
ATOM 1700  O O    . ASP B 2 92  ? -10.861 4.812   -1.624  1.00 0.00 ? 90  ASP B O    1  
ATOM 1701  C CB   . ASP B 2 92  ? -12.079 7.829   -0.825  1.00 0.00 ? 90  ASP B CB   1  
ATOM 1702  C CG   . ASP B 2 92  ? -12.769 8.052   0.504   1.00 0.00 ? 90  ASP B CG   1  
ATOM 1703  O OD1  . ASP B 2 92  ? -12.719 9.184   1.028   1.00 0.00 ? 90  ASP B OD1  1  
ATOM 1704  O OD2  . ASP B 2 92  ? -13.321 7.071   1.051   1.00 0.00 ? 90  ASP B OD2  1  
ATOM 1705  H H    . ASP B 2 92  ? -9.816  8.809   -0.552  1.00 0.00 ? 90  ASP B H    1  
ATOM 1706  H HA   . ASP B 2 92  ? -10.951 6.395   0.261   1.00 0.00 ? 90  ASP B HA   1  
ATOM 1707  H HB2  . ASP B 2 92  ? -11.787 8.792   -1.223  1.00 0.00 ? 90  ASP B HB2  1  
ATOM 1708  H HB3  . ASP B 2 92  ? -12.761 7.361   -1.508  1.00 0.00 ? 90  ASP B HB3  1  
ATOM 1709  N N    . ALA B 2 93  ? -10.119 6.466   -2.927  1.00 0.00 ? 91  ALA B N    1  
ATOM 1710  C CA   . ALA B 2 93  ? -9.877  5.586   -4.075  1.00 0.00 ? 91  ALA B CA   1  
ATOM 1711  C C    . ALA B 2 93  ? -8.771  4.575   -3.772  1.00 0.00 ? 91  ALA B C    1  
ATOM 1712  O O    . ALA B 2 93  ? -8.889  3.406   -4.132  1.00 0.00 ? 91  ALA B O    1  
ATOM 1713  C CB   . ALA B 2 93  ? -9.537  6.402   -5.311  1.00 0.00 ? 91  ALA B CB   1  
ATOM 1714  H H    . ALA B 2 93  ? -9.924  7.428   -3.005  1.00 0.00 ? 91  ALA B H    1  
ATOM 1715  H HA   . ALA B 2 93  ? -10.796 5.031   -4.272  1.00 0.00 ? 91  ALA B HA   1  
ATOM 1716  H HB1  . ALA B 2 93  ? -9.505  5.753   -6.174  1.00 0.00 ? 91  ALA B HB1  1  
ATOM 1717  H HB2  . ALA B 2 93  ? -8.573  6.873   -5.178  1.00 0.00 ? 91  ALA B HB2  1  
ATOM 1718  H HB3  . ALA B 2 93  ? -10.290 7.162   -5.459  1.00 0.00 ? 91  ALA B HB3  1  
ATOM 1719  N N    . VAL B 2 94  ? -7.691  5.025   -3.126  1.00 0.00 ? 92  VAL B N    1  
ATOM 1720  C CA   . VAL B 2 94  ? -6.603  4.120   -2.749  1.00 0.00 ? 92  VAL B CA   1  
ATOM 1721  C C    . VAL B 2 94  ? -7.182  3.073   -1.809  1.00 0.00 ? 92  VAL B C    1  
ATOM 1722  O O    . VAL B 2 94  ? -6.930  1.880   -1.949  1.00 0.00 ? 92  VAL B O    1  
ATOM 1723  C CB   . VAL B 2 94  ? -5.444  4.862   -2.048  1.00 0.00 ? 92  VAL B CB   1  
ATOM 1724  C CG1  . VAL B 2 94  ? -4.305  3.907   -1.736  1.00 0.00 ? 92  VAL B CG1  1  
ATOM 1725  C CG2  . VAL B 2 94  ? -4.938  6.004   -2.906  1.00 0.00 ? 92  VAL B CG2  1  
ATOM 1726  H H    . VAL B 2 94  ? -7.629  5.980   -2.894  1.00 0.00 ? 92  VAL B H    1  
ATOM 1727  H HA   . VAL B 2 94  ? -6.212  3.633   -3.643  1.00 0.00 ? 92  VAL B HA   1  
ATOM 1728  H HB   . VAL B 2 94  ? -5.811  5.271   -1.118  1.00 0.00 ? 92  VAL B HB   1  
ATOM 1729  H HG11 . VAL B 2 94  ? -3.524  4.436   -1.212  1.00 0.00 ? 92  VAL B HG11 1  
ATOM 1730  H HG12 . VAL B 2 94  ? -3.911  3.504   -2.658  1.00 0.00 ? 92  VAL B HG12 1  
ATOM 1731  H HG13 . VAL B 2 94  ? -4.671  3.100   -1.118  1.00 0.00 ? 92  VAL B HG13 1  
ATOM 1732  H HG21 . VAL B 2 94  ? -5.749  6.687   -3.112  1.00 0.00 ? 92  VAL B HG21 1  
ATOM 1733  H HG22 . VAL B 2 94  ? -4.553  5.612   -3.836  1.00 0.00 ? 92  VAL B HG22 1  
ATOM 1734  H HG23 . VAL B 2 94  ? -4.151  6.527   -2.383  1.00 0.00 ? 92  VAL B HG23 1  
ATOM 1735  N N    . LYS B 2 95  ? -7.999  3.555   -0.873  1.00 0.00 ? 93  LYS B N    1  
ATOM 1736  C CA   . LYS B 2 95  ? -8.683  2.709   0.098   1.00 0.00 ? 93  LYS B CA   1  
ATOM 1737  C C    . LYS B 2 95  ? -9.570  1.706   -0.625  1.00 0.00 ? 93  LYS B C    1  
ATOM 1738  O O    . LYS B 2 95  ? -9.447  0.503   -0.439  1.00 0.00 ? 93  LYS B O    1  
ATOM 1739  C CB   . LYS B 2 95  ? -9.544  3.580   1.023   1.00 0.00 ? 93  LYS B CB   1  
ATOM 1740  C CG   . LYS B 2 95  ? -10.464 2.794   1.947   1.00 0.00 ? 93  LYS B CG   1  
ATOM 1741  C CD   . LYS B 2 95  ? -11.657 3.630   2.402   1.00 0.00 ? 93  LYS B CD   1  
ATOM 1742  C CE   . LYS B 2 95  ? -12.847 3.487   1.456   1.00 0.00 ? 93  LYS B CE   1  
ATOM 1743  N NZ   . LYS B 2 95  ? -12.850 4.520   0.385   1.00 0.00 ? 93  LYS B NZ   1  
ATOM 1744  H H    . LYS B 2 95  ? -8.142  4.526   -0.830  1.00 0.00 ? 93  LYS B H    1  
ATOM 1745  H HA   . LYS B 2 95  ? -7.943  2.184   0.680   1.00 0.00 ? 93  LYS B HA   1  
ATOM 1746  H HB2  . LYS B 2 95  ? -8.893  4.188   1.631   1.00 0.00 ? 93  LYS B HB2  1  
ATOM 1747  H HB3  . LYS B 2 95  ? -10.156 4.228   0.412   1.00 0.00 ? 93  LYS B HB3  1  
ATOM 1748  H HG2  . LYS B 2 95  ? -10.829 1.925   1.422   1.00 0.00 ? 93  LYS B HG2  1  
ATOM 1749  H HG3  . LYS B 2 95  ? -9.904  2.482   2.816   1.00 0.00 ? 93  LYS B HG3  1  
ATOM 1750  H HD2  . LYS B 2 95  ? -11.956 3.304   3.387   1.00 0.00 ? 93  LYS B HD2  1  
ATOM 1751  H HD3  . LYS B 2 95  ? -11.363 4.668   2.439   1.00 0.00 ? 93  LYS B HD3  1  
ATOM 1752  H HE2  . LYS B 2 95  ? -12.807 2.510   0.996   1.00 0.00 ? 93  LYS B HE2  1  
ATOM 1753  H HE3  . LYS B 2 95  ? -13.757 3.573   2.030   1.00 0.00 ? 93  LYS B HE3  1  
ATOM 1754  H HZ1  . LYS B 2 95  ? -11.898 4.632   -0.010  1.00 0.00 ? 93  LYS B HZ1  1  
ATOM 1755  H HZ2  . LYS B 2 95  ? -13.169 5.442   0.764   1.00 0.00 ? 93  LYS B HZ2  1  
ATOM 1756  H HZ3  . LYS B 2 95  ? -13.497 4.236   -0.392  1.00 0.00 ? 93  LYS B HZ3  1  
ATOM 1757  N N    . ASP B 2 96  ? -10.448 2.234   -1.463  1.00 0.00 ? 94  ASP B N    1  
ATOM 1758  C CA   . ASP B 2 96  ? -11.381 1.435   -2.243  1.00 0.00 ? 94  ASP B CA   1  
ATOM 1759  C C    . ASP B 2 96  ? -10.672 0.362   -3.048  1.00 0.00 ? 94  ASP B C    1  
ATOM 1760  O O    . ASP B 2 96  ? -10.991 -0.818  -2.930  1.00 0.00 ? 94  ASP B O    1  
ATOM 1761  C CB   . ASP B 2 96  ? -12.192 2.348   -3.168  1.00 0.00 ? 94  ASP B CB   1  
ATOM 1762  C CG   . ASP B 2 96  ? -13.489 2.812   -2.534  1.00 0.00 ? 94  ASP B CG   1  
ATOM 1763  O OD1  . ASP B 2 96  ? -14.460 2.033   -2.531  1.00 0.00 ? 94  ASP B OD1  1  
ATOM 1764  O OD2  . ASP B 2 96  ? -13.535 3.953   -2.025  1.00 0.00 ? 94  ASP B OD2  1  
ATOM 1765  H H    . ASP B 2 96  ? -10.470 3.212   -1.570  1.00 0.00 ? 94  ASP B H    1  
ATOM 1766  H HA   . ASP B 2 96  ? -12.058 0.955   -1.551  1.00 0.00 ? 94  ASP B HA   1  
ATOM 1767  H HB2  . ASP B 2 96  ? -11.601 3.219   -3.390  1.00 0.00 ? 94  ASP B HB2  1  
ATOM 1768  H HB3  . ASP B 2 96  ? -12.410 1.841   -4.087  1.00 0.00 ? 94  ASP B HB3  1  
ATOM 1769  N N    . LEU B 2 97  ? -9.696  0.768   -3.842  1.00 0.00 ? 95  LEU B N    1  
ATOM 1770  C CA   . LEU B 2 97  ? -8.948  -0.166  -4.670  1.00 0.00 ? 95  LEU B CA   1  
ATOM 1771  C C    . LEU B 2 97  ? -8.211  -1.183  -3.808  1.00 0.00 ? 95  LEU B C    1  
ATOM 1772  O O    . LEU B 2 97  ? -8.148  -2.347  -4.161  1.00 0.00 ? 95  LEU B O    1  
ATOM 1773  C CB   . LEU B 2 97  ? -7.965  0.586   -5.571  1.00 0.00 ? 95  LEU B CB   1  
ATOM 1774  C CG   . LEU B 2 97  ? -7.525  -0.170  -6.827  1.00 0.00 ? 95  LEU B CG   1  
ATOM 1775  C CD1  . LEU B 2 97  ? -8.720  -0.450  -7.728  1.00 0.00 ? 95  LEU B CD1  1  
ATOM 1776  C CD2  . LEU B 2 97  ? -6.464  0.618   -7.579  1.00 0.00 ? 95  LEU B CD2  1  
ATOM 1777  H H    . LEU B 2 97  ? -9.470  1.726   -3.873  1.00 0.00 ? 95  LEU B H    1  
ATOM 1778  H HA   . LEU B 2 97  ? -9.658  -0.705  -5.291  1.00 0.00 ? 95  LEU B HA   1  
ATOM 1779  H HB2  . LEU B 2 97  ? -8.428  1.513   -5.877  1.00 0.00 ? 95  LEU B HB2  1  
ATOM 1780  H HB3  . LEU B 2 97  ? -7.084  0.818   -4.993  1.00 0.00 ? 95  LEU B HB3  1  
ATOM 1781  H HG   . LEU B 2 97  ? -7.097  -1.118  -6.537  1.00 0.00 ? 95  LEU B HG   1  
ATOM 1782  H HD11 . LEU B 2 97  ? -9.433  -1.063  -7.197  1.00 0.00 ? 95  LEU B HD11 1  
ATOM 1783  H HD12 . LEU B 2 97  ? -8.387  -0.969  -8.615  1.00 0.00 ? 95  LEU B HD12 1  
ATOM 1784  H HD13 . LEU B 2 97  ? -9.185  0.483   -8.008  1.00 0.00 ? 95  LEU B HD13 1  
ATOM 1785  H HD21 . LEU B 2 97  ? -5.605  0.765   -6.942  1.00 0.00 ? 95  LEU B HD21 1  
ATOM 1786  H HD22 . LEU B 2 97  ? -6.864  1.577   -7.871  1.00 0.00 ? 95  LEU B HD22 1  
ATOM 1787  H HD23 . LEU B 2 97  ? -6.167  0.069   -8.462  1.00 0.00 ? 95  LEU B HD23 1  
ATOM 1788  N N    . LEU B 2 98  ? -7.671  -0.754  -2.676  1.00 0.00 ? 96  LEU B N    1  
ATOM 1789  C CA   . LEU B 2 98  ? -6.966  -1.669  -1.783  1.00 0.00 ? 96  LEU B CA   1  
ATOM 1790  C C    . LEU B 2 98  ? -7.955  -2.616  -1.111  1.00 0.00 ? 96  LEU B C    1  
ATOM 1791  O O    . LEU B 2 98  ? -7.700  -3.799  -1.020  1.00 0.00 ? 96  LEU B O    1  
ATOM 1792  C CB   . LEU B 2 98  ? -6.181  -0.902  -0.720  1.00 0.00 ? 96  LEU B CB   1  
ATOM 1793  C CG   . LEU B 2 98  ? -4.835  -0.344  -1.172  1.00 0.00 ? 96  LEU B CG   1  
ATOM 1794  C CD1  . LEU B 2 98  ? -4.339  0.703   -0.189  1.00 0.00 ? 96  LEU B CD1  1  
ATOM 1795  C CD2  . LEU B 2 98  ? -3.819  -1.462  -1.306  1.00 0.00 ? 96  LEU B CD2  1  
ATOM 1796  H H    . LEU B 2 98  ? -7.742  0.198   -2.434  1.00 0.00 ? 96  LEU B H    1  
ATOM 1797  H HA   . LEU B 2 98  ? -6.271  -2.263  -2.385  1.00 0.00 ? 96  LEU B HA   1  
ATOM 1798  H HB2  . LEU B 2 98  ? -6.791  -0.077  -0.381  1.00 0.00 ? 96  LEU B HB2  1  
ATOM 1799  H HB3  . LEU B 2 98  ? -6.009  -1.564  0.115   1.00 0.00 ? 96  LEU B HB3  1  
ATOM 1800  H HG   . LEU B 2 98  ? -4.950  0.124   -2.137  1.00 0.00 ? 96  LEU B HG   1  
ATOM 1801  H HD11 . LEU B 2 98  ? -4.190  0.247   0.779   1.00 0.00 ? 96  LEU B HD11 1  
ATOM 1802  H HD12 . LEU B 2 98  ? -5.070  1.493   -0.107  1.00 0.00 ? 96  LEU B HD12 1  
ATOM 1803  H HD13 . LEU B 2 98  ? -3.403  1.112   -0.541  1.00 0.00 ? 96  LEU B HD13 1  
ATOM 1804  H HD21 . LEU B 2 98  ? -3.768  -2.016  -0.380  1.00 0.00 ? 96  LEU B HD21 1  
ATOM 1805  H HD22 . LEU B 2 98  ? -2.848  -1.043  -1.526  1.00 0.00 ? 96  LEU B HD22 1  
ATOM 1806  H HD23 . LEU B 2 98  ? -4.115  -2.124  -2.106  1.00 0.00 ? 96  LEU B HD23 1  
ATOM 1807  N N    . GLN B 2 99  ? -9.093  -2.099  -0.649  1.00 0.00 ? 97  GLN B N    1  
ATOM 1808  C CA   . GLN B 2 99  ? -10.109 -2.948  -0.017  1.00 0.00 ? 97  GLN B CA   1  
ATOM 1809  C C    . GLN B 2 99  ? -10.637 -3.939  -1.044  1.00 0.00 ? 97  GLN B C    1  
ATOM 1810  O O    . GLN B 2 99  ? -11.205 -4.978  -0.718  1.00 0.00 ? 97  GLN B O    1  
ATOM 1811  C CB   . GLN B 2 99  ? -11.266 -2.114  0.541   1.00 0.00 ? 97  GLN B CB   1  
ATOM 1812  C CG   . GLN B 2 99  ? -10.872 -1.231  1.710   1.00 0.00 ? 97  GLN B CG   1  
ATOM 1813  C CD   . GLN B 2 99  ? -12.066 -0.736  2.500   1.00 0.00 ? 97  GLN B CD   1  
ATOM 1814  O OE1  . GLN B 2 99  ? -12.624 0.320   2.211   1.00 0.00 ? 97  GLN B OE1  1  
ATOM 1815  N NE2  . GLN B 2 99  ? -12.461 -1.497  3.507   1.00 0.00 ? 97  GLN B NE2  1  
ATOM 1816  H H    . GLN B 2 99  ? -9.254  -1.129  -0.729  1.00 0.00 ? 97  GLN B H    1  
ATOM 1817  H HA   . GLN B 2 99  ? -9.635  -3.493  0.788   1.00 0.00 ? 97  GLN B HA   1  
ATOM 1818  H HB2  . GLN B 2 99  ? -11.649 -1.481  -0.247  1.00 0.00 ? 97  GLN B HB2  1  
ATOM 1819  H HB3  . GLN B 2 99  ? -12.050 -2.780  0.868   1.00 0.00 ? 97  GLN B HB3  1  
ATOM 1820  H HG2  . GLN B 2 99  ? -10.232 -1.793  2.369   1.00 0.00 ? 97  GLN B HG2  1  
ATOM 1821  H HG3  . GLN B 2 99  ? -10.334 -0.375  1.327   1.00 0.00 ? 97  GLN B HG3  1  
ATOM 1822  H HE21 . GLN B 2 99  ? -11.972 -2.327  3.683   1.00 0.00 ? 97  GLN B HE21 1  
ATOM 1823  H HE22 . GLN B 2 99  ? -13.225 -1.190  4.047   1.00 0.00 ? 97  GLN B HE22 1  
ATOM 1824  N N    . GLN B 2 100 ? -10.445 -3.574  -2.295  1.00 0.00 ? 98  GLN B N    1  
ATOM 1825  C CA   . GLN B 2 100 ? -10.841 -4.380  -3.428  1.00 0.00 ? 98  GLN B CA   1  
ATOM 1826  C C    . GLN B 2 100 ? -9.764  -5.413  -3.740  1.00 0.00 ? 98  GLN B C    1  
ATOM 1827  O O    . GLN B 2 100 ? -10.023 -6.609  -3.872  1.00 0.00 ? 98  GLN B O    1  
ATOM 1828  C CB   . GLN B 2 100 ? -11.004 -3.458  -4.645  1.00 0.00 ? 98  GLN B CB   1  
ATOM 1829  C CG   . GLN B 2 100 ? -12.369 -2.806  -4.781  1.00 0.00 ? 98  GLN B CG   1  
ATOM 1830  C CD   . GLN B 2 100 ? -13.519 -3.758  -4.550  1.00 0.00 ? 98  GLN B CD   1  
ATOM 1831  O OE1  . GLN B 2 100 ? -13.453 -4.942  -4.899  1.00 0.00 ? 98  GLN B OE1  1  
ATOM 1832  N NE2  . GLN B 2 100 ? -14.579 -3.241  -3.953  1.00 0.00 ? 98  GLN B NE2  1  
ATOM 1833  H H    . GLN B 2 100 ? -10.024 -2.705  -2.465  1.00 0.00 ? 98  GLN B H    1  
ATOM 1834  H HA   . GLN B 2 100 ? -11.775 -4.869  -3.207  1.00 0.00 ? 98  GLN B HA   1  
ATOM 1835  H HB2  . GLN B 2 100 ? -10.276 -2.665  -4.558  1.00 0.00 ? 98  GLN B HB2  1  
ATOM 1836  H HB3  . GLN B 2 100 ? -10.791 -4.010  -5.542  1.00 0.00 ? 98  GLN B HB3  1  
ATOM 1837  H HG2  . GLN B 2 100 ? -12.441 -2.006  -4.062  1.00 0.00 ? 98  GLN B HG2  1  
ATOM 1838  H HG3  . GLN B 2 100 ? -12.456 -2.398  -5.778  1.00 0.00 ? 98  GLN B HG3  1  
ATOM 1839  H HE21 . GLN B 2 100 ? -14.550 -2.289  -3.703  1.00 0.00 ? 98  GLN B HE21 1  
ATOM 1840  H HE22 . GLN B 2 100 ? -15.345 -3.821  -3.783  1.00 0.00 ? 98  GLN B HE22 1  
ATOM 1841  N N    . LEU B 2 101 ? -8.560  -4.903  -3.841  1.00 0.00 ? 99  LEU B N    1  
ATOM 1842  C CA   . LEU B 2 101 ? -7.370  -5.655  -4.202  1.00 0.00 ? 99  LEU B CA   1  
ATOM 1843  C C    . LEU B 2 101 ? -6.755  -6.496  -3.076  1.00 0.00 ? 99  LEU B C    1  
ATOM 1844  O O    . LEU B 2 101 ? -6.444  -7.666  -3.288  1.00 0.00 ? 99  LEU B O    1  
ATOM 1845  C CB   . LEU B 2 101 ? -6.356  -4.636  -4.716  1.00 0.00 ? 99  LEU B CB   1  
ATOM 1846  C CG   . LEU B 2 101 ? -6.519  -4.275  -6.194  1.00 0.00 ? 99  LEU B CG   1  
ATOM 1847  C CD1  . LEU B 2 101 ? -5.719  -3.030  -6.537  1.00 0.00 ? 99  LEU B CD1  1  
ATOM 1848  C CD2  . LEU B 2 101 ? -6.107  -5.439  -7.079  1.00 0.00 ? 99  LEU B CD2  1  
ATOM 1849  H H    . LEU B 2 101 ? -8.459  -3.937  -3.679  1.00 0.00 ? 99  LEU B H    1  
ATOM 1850  H HA   . LEU B 2 101 ? -7.630  -6.309  -5.017  1.00 0.00 ? 99  LEU B HA   1  
ATOM 1851  H HB2  . LEU B 2 101 ? -6.479  -3.730  -4.136  1.00 0.00 ? 99  LEU B HB2  1  
ATOM 1852  H HB3  . LEU B 2 101 ? -5.362  -5.005  -4.549  1.00 0.00 ? 99  LEU B HB3  1  
ATOM 1853  H HG   . LEU B 2 101 ? -7.563  -4.062  -6.388  1.00 0.00 ? 99  LEU B HG   1  
ATOM 1854  H HD11 . LEU B 2 101 ? -5.996  -2.229  -5.865  1.00 0.00 ? 99  LEU B HD11 1  
ATOM 1855  H HD12 . LEU B 2 101 ? -5.930  -2.734  -7.554  1.00 0.00 ? 99  LEU B HD12 1  
ATOM 1856  H HD13 . LEU B 2 101 ? -4.665  -3.239  -6.434  1.00 0.00 ? 99  LEU B HD13 1  
ATOM 1857  H HD21 . LEU B 2 101 ? -5.035  -5.561  -7.038  1.00 0.00 ? 99  LEU B HD21 1  
ATOM 1858  H HD22 . LEU B 2 101 ? -6.409  -5.243  -8.098  1.00 0.00 ? 99  LEU B HD22 1  
ATOM 1859  H HD23 . LEU B 2 101 ? -6.584  -6.343  -6.730  1.00 0.00 ? 99  LEU B HD23 1  
ATOM 1860  N N    . LEU B 2 102 ? -6.600  -5.912  -1.895  1.00 0.00 ? 100 LEU B N    1  
ATOM 1861  C CA   . LEU B 2 102 ? -5.958  -6.591  -0.763  1.00 0.00 ? 100 LEU B CA   1  
ATOM 1862  C C    . LEU B 2 102 ? -6.515  -7.994  -0.483  1.00 0.00 ? 100 LEU B C    1  
ATOM 1863  O O    . LEU B 2 102 ? -5.768  -8.967  -0.573  1.00 0.00 ? 100 LEU B O    1  
ATOM 1864  C CB   . LEU B 2 102 ? -5.994  -5.723  0.504   1.00 0.00 ? 100 LEU B CB   1  
ATOM 1865  C CG   . LEU B 2 102 ? -5.001  -4.562  0.480   1.00 0.00 ? 100 LEU B CG   1  
ATOM 1866  C CD1  . LEU B 2 102 ? -4.987  -3.791  1.788   1.00 0.00 ? 100 LEU B CD1  1  
ATOM 1867  C CD2  . LEU B 2 102 ? -3.617  -5.067  0.179   1.00 0.00 ? 100 LEU B CD2  1  
ATOM 1868  H H    . LEU B 2 102 ? -6.946  -5.000  -1.767  1.00 0.00 ? 100 LEU B H    1  
ATOM 1869  H HA   . LEU B 2 102 ? -4.922  -6.699  -1.038  1.00 0.00 ? 100 LEU B HA   1  
ATOM 1870  H HB2  . LEU B 2 102 ? -6.992  -5.324  0.620   1.00 0.00 ? 100 LEU B HB2  1  
ATOM 1871  H HB3  . LEU B 2 102 ? -5.767  -6.347  1.355   1.00 0.00 ? 100 LEU B HB3  1  
ATOM 1872  H HG   . LEU B 2 102 ? -5.280  -3.891  -0.313  1.00 0.00 ? 100 LEU B HG   1  
ATOM 1873  H HD11 . LEU B 2 102 ? -4.300  -2.957  1.703   1.00 0.00 ? 100 LEU B HD11 1  
ATOM 1874  H HD12 . LEU B 2 102 ? -4.655  -4.442  2.586   1.00 0.00 ? 100 LEU B HD12 1  
ATOM 1875  H HD13 . LEU B 2 102 ? -5.974  -3.423  2.006   1.00 0.00 ? 100 LEU B HD13 1  
ATOM 1876  H HD21 . LEU B 2 102 ? -3.604  -5.526  -0.798  1.00 0.00 ? 100 LEU B HD21 1  
ATOM 1877  H HD22 . LEU B 2 102 ? -3.329  -5.795  0.924   1.00 0.00 ? 100 LEU B HD22 1  
ATOM 1878  H HD23 . LEU B 2 102 ? -2.922  -4.241  0.197   1.00 0.00 ? 100 LEU B HD23 1  
ATOM 1879  N N    . PRO B 2 103 ? -7.824  -8.145  -0.176  1.00 0.00 ? 101 PRO B N    1  
ATOM 1880  C CA   . PRO B 2 103 ? -8.411  -9.462  0.134   1.00 0.00 ? 101 PRO B CA   1  
ATOM 1881  C C    . PRO B 2 103 ? -8.351  -10.454 -1.028  1.00 0.00 ? 101 PRO B C    1  
ATOM 1882  O O    . PRO B 2 103 ? -8.575  -11.647 -0.839  1.00 0.00 ? 101 PRO B O    1  
ATOM 1883  C CB   . PRO B 2 103 ? -9.869  -9.141  0.473   1.00 0.00 ? 101 PRO B CB   1  
ATOM 1884  C CG   . PRO B 2 103 ? -10.132 -7.826  -0.169  1.00 0.00 ? 101 PRO B CG   1  
ATOM 1885  C CD   . PRO B 2 103 ? -8.835  -7.073  -0.105  1.00 0.00 ? 101 PRO B CD   1  
ATOM 1886  H HA   . PRO B 2 103 ? -7.936  -9.905  0.997   1.00 0.00 ? 101 PRO B HA   1  
ATOM 1887  H HB2  . PRO B 2 103 ? -10.512 -9.912  0.073   1.00 0.00 ? 101 PRO B HB2  1  
ATOM 1888  H HB3  . PRO B 2 103 ? -9.988  -9.085  1.546   1.00 0.00 ? 101 PRO B HB3  1  
ATOM 1889  H HG2  . PRO B 2 103 ? -10.431 -7.973  -1.197  1.00 0.00 ? 101 PRO B HG2  1  
ATOM 1890  H HG3  . PRO B 2 103 ? -10.900 -7.297  0.374   1.00 0.00 ? 101 PRO B HG3  1  
ATOM 1891  H HD2  . PRO B 2 103 ? -8.746  -6.401  -0.946  1.00 0.00 ? 101 PRO B HD2  1  
ATOM 1892  H HD3  . PRO B 2 103 ? -8.758  -6.532  0.825   1.00 0.00 ? 101 PRO B HD3  1  
ATOM 1893  N N    . LYS B 2 104 ? -8.061  -9.965  -2.227  1.00 0.00 ? 102 LYS B N    1  
ATOM 1894  C CA   . LYS B 2 104 ? -7.981  -10.833 -3.394  1.00 0.00 ? 102 LYS B CA   1  
ATOM 1895  C C    . LYS B 2 104 ? -6.580  -11.417 -3.560  1.00 0.00 ? 102 LYS B C    1  
ATOM 1896  O O    . LYS B 2 104 ? -6.351  -12.253 -4.433  1.00 0.00 ? 102 LYS B O    1  
ATOM 1897  C CB   . LYS B 2 104 ? -8.398  -10.080 -4.662  1.00 0.00 ? 102 LYS B CB   1  
ATOM 1898  C CG   . LYS B 2 104 ? -9.904  -9.910  -4.797  1.00 0.00 ? 102 LYS B CG   1  
ATOM 1899  C CD   . LYS B 2 104 ? -10.321 -9.700  -6.246  1.00 0.00 ? 102 LYS B CD   1  
ATOM 1900  C CE   . LYS B 2 104 ? -10.436 -8.224  -6.598  1.00 0.00 ? 102 LYS B CE   1  
ATOM 1901  N NZ   . LYS B 2 104 ? -11.523 -7.550  -5.833  1.00 0.00 ? 102 LYS B NZ   1  
ATOM 1902  H H    . LYS B 2 104 ? -7.879  -9.006  -2.325  1.00 0.00 ? 102 LYS B H    1  
ATOM 1903  H HA   . LYS B 2 104 ? -8.672  -11.648 -3.236  1.00 0.00 ? 102 LYS B HA   1  
ATOM 1904  H HB2  . LYS B 2 104 ? -7.945  -9.100  -4.652  1.00 0.00 ? 102 LYS B HB2  1  
ATOM 1905  H HB3  . LYS B 2 104 ? -8.040  -10.626 -5.524  1.00 0.00 ? 102 LYS B HB3  1  
ATOM 1906  H HG2  . LYS B 2 104 ? -10.391 -10.795 -4.419  1.00 0.00 ? 102 LYS B HG2  1  
ATOM 1907  H HG3  . LYS B 2 104 ? -10.210 -9.052  -4.216  1.00 0.00 ? 102 LYS B HG3  1  
ATOM 1908  H HD2  . LYS B 2 104 ? -9.583  -10.154 -6.890  1.00 0.00 ? 102 LYS B HD2  1  
ATOM 1909  H HD3  . LYS B 2 104 ? -11.278 -10.174 -6.405  1.00 0.00 ? 102 LYS B HD3  1  
ATOM 1910  H HE2  . LYS B 2 104 ? -9.497  -7.739  -6.373  1.00 0.00 ? 102 LYS B HE2  1  
ATOM 1911  H HE3  . LYS B 2 104 ? -10.641 -8.135  -7.654  1.00 0.00 ? 102 LYS B HE3  1  
ATOM 1912  H HZ1  . LYS B 2 104 ? -11.750 -6.631  -6.262  1.00 0.00 ? 102 LYS B HZ1  1  
ATOM 1913  H HZ2  . LYS B 2 104 ? -11.218 -7.389  -4.848  1.00 0.00 ? 102 LYS B HZ2  1  
ATOM 1914  H HZ3  . LYS B 2 104 ? -12.379 -8.140  -5.826  1.00 0.00 ? 102 LYS B HZ3  1  
ATOM 1915  N N    . PHE B 2 105 ? -5.645  -10.964 -2.734  1.00 0.00 ? 103 PHE B N    1  
ATOM 1916  C CA   . PHE B 2 105 ? -4.271  -11.450 -2.807  1.00 0.00 ? 103 PHE B CA   1  
ATOM 1917  C C    . PHE B 2 105 ? -3.773  -11.944 -1.451  1.00 0.00 ? 103 PHE B C    1  
ATOM 1918  O O    . PHE B 2 105 ? -2.905  -12.815 -1.381  1.00 0.00 ? 103 PHE B O    1  
ATOM 1919  C CB   . PHE B 2 105 ? -3.343  -10.350 -3.329  1.00 0.00 ? 103 PHE B CB   1  
ATOM 1920  C CG   . PHE B 2 105 ? -3.559  -10.019 -4.780  1.00 0.00 ? 103 PHE B CG   1  
ATOM 1921  C CD1  . PHE B 2 105 ? -3.075  -10.853 -5.775  1.00 0.00 ? 103 PHE B CD1  1  
ATOM 1922  C CD2  . PHE B 2 105 ? -4.251  -8.877  -5.149  1.00 0.00 ? 103 PHE B CD2  1  
ATOM 1923  C CE1  . PHE B 2 105 ? -3.276  -10.553 -7.109  1.00 0.00 ? 103 PHE B CE1  1  
ATOM 1924  C CE2  . PHE B 2 105 ? -4.455  -8.572  -6.480  1.00 0.00 ? 103 PHE B CE2  1  
ATOM 1925  C CZ   . PHE B 2 105 ? -3.967  -9.412  -7.462  1.00 0.00 ? 103 PHE B CZ   1  
ATOM 1926  H H    . PHE B 2 105 ? -5.881  -10.290 -2.064  1.00 0.00 ? 103 PHE B H    1  
ATOM 1927  H HA   . PHE B 2 105 ? -4.253  -12.276 -3.503  1.00 0.00 ? 103 PHE B HA   1  
ATOM 1928  H HB2  . PHE B 2 105 ? -3.508  -9.449  -2.755  1.00 0.00 ? 103 PHE B HB2  1  
ATOM 1929  H HB3  . PHE B 2 105 ? -2.318  -10.665 -3.206  1.00 0.00 ? 103 PHE B HB3  1  
ATOM 1930  H HD1  . PHE B 2 105 ? -2.533  -11.747 -5.499  1.00 0.00 ? 103 PHE B HD1  1  
ATOM 1931  H HD2  . PHE B 2 105 ? -4.634  -8.218  -4.382  1.00 0.00 ? 103 PHE B HD2  1  
ATOM 1932  H HE1  . PHE B 2 105 ? -2.893  -11.211 -7.875  1.00 0.00 ? 103 PHE B HE1  1  
ATOM 1933  H HE2  . PHE B 2 105 ? -4.997  -7.678  -6.753  1.00 0.00 ? 103 PHE B HE2  1  
ATOM 1934  H HZ   . PHE B 2 105 ? -4.126  -9.175  -8.504  1.00 0.00 ? 103 PHE B HZ   1  
ATOM 1935  N N    . LYS B 2 106 ? -4.313  -11.384 -0.380  1.00 0.00 ? 104 LYS B N    1  
ATOM 1936  C CA   . LYS B 2 106 ? -3.906  -11.766 0.968   1.00 0.00 ? 104 LYS B CA   1  
ATOM 1937  C C    . LYS B 2 106 ? -4.830  -12.831 1.546   1.00 0.00 ? 104 LYS B C    1  
ATOM 1938  O O    . LYS B 2 106 ? -5.883  -13.139 0.984   1.00 0.00 ? 104 LYS B O    1  
ATOM 1939  C CB   . LYS B 2 106 ? -3.913  -10.544 1.893   1.00 0.00 ? 104 LYS B CB   1  
ATOM 1940  C CG   . LYS B 2 106 ? -5.314  -10.048 2.221   1.00 0.00 ? 104 LYS B CG   1  
ATOM 1941  C CD   . LYS B 2 106 ? -5.297  -8.902  3.215   1.00 0.00 ? 104 LYS B CD   1  
ATOM 1942  C CE   . LYS B 2 106 ? -6.600  -8.121  3.172   1.00 0.00 ? 104 LYS B CE   1  
ATOM 1943  N NZ   . LYS B 2 106 ? -7.183  -7.930  4.522   1.00 0.00 ? 104 LYS B NZ   1  
ATOM 1944  H H    . LYS B 2 106 ? -5.004  -10.698 -0.493  1.00 0.00 ? 104 LYS B H    1  
ATOM 1945  H HA   . LYS B 2 106 ? -2.904  -12.161 0.914   1.00 0.00 ? 104 LYS B HA   1  
ATOM 1946  H HB2  . LYS B 2 106 ? -3.419  -10.804 2.818   1.00 0.00 ? 104 LYS B HB2  1  
ATOM 1947  H HB3  . LYS B 2 106 ? -3.372  -9.740  1.417   1.00 0.00 ? 104 LYS B HB3  1  
ATOM 1948  H HG2  . LYS B 2 106 ? -5.786  -9.712  1.311   1.00 0.00 ? 104 LYS B HG2  1  
ATOM 1949  H HG3  . LYS B 2 106 ? -5.884  -10.865 2.640   1.00 0.00 ? 104 LYS B HG3  1  
ATOM 1950  H HD2  . LYS B 2 106 ? -5.157  -9.299  4.209   1.00 0.00 ? 104 LYS B HD2  1  
ATOM 1951  H HD3  . LYS B 2 106 ? -4.480  -8.238  2.971   1.00 0.00 ? 104 LYS B HD3  1  
ATOM 1952  H HE2  . LYS B 2 106 ? -6.409  -7.154  2.734   1.00 0.00 ? 104 LYS B HE2  1  
ATOM 1953  H HE3  . LYS B 2 106 ? -7.306  -8.660  2.557   1.00 0.00 ? 104 LYS B HE3  1  
ATOM 1954  H HZ1  . LYS B 2 106 ? -6.460  -7.560  5.175   1.00 0.00 ? 104 LYS B HZ1  1  
ATOM 1955  H HZ2  . LYS B 2 106 ? -7.537  -8.840  4.895   1.00 0.00 ? 104 LYS B HZ2  1  
ATOM 1956  H HZ3  . LYS B 2 106 ? -7.975  -7.246  4.477   1.00 0.00 ? 104 LYS B HZ3  1  
ATOM 1957  N N    . ARG B 2 107 ? -4.422  -13.384 2.675   1.00 0.00 ? 105 ARG B N    1  
ATOM 1958  C CA   . ARG B 2 107 ? -5.201  -14.386 3.375   1.00 0.00 ? 105 ARG B CA   1  
ATOM 1959  C C    . ARG B 2 107 ? -5.065  -14.138 4.864   1.00 0.00 ? 105 ARG B C    1  
ATOM 1960  O O    . ARG B 2 107 ? -3.952  -14.007 5.369   1.00 0.00 ? 105 ARG B O    1  
ATOM 1961  C CB   . ARG B 2 107 ? -4.742  -15.808 3.026   1.00 0.00 ? 105 ARG B CB   1  
ATOM 1962  C CG   . ARG B 2 107 ? -5.805  -16.879 3.277   1.00 0.00 ? 105 ARG B CG   1  
ATOM 1963  C CD   . ARG B 2 107 ? -5.880  -17.287 4.746   1.00 0.00 ? 105 ARG B CD   1  
ATOM 1964  N NE   . ARG B 2 107 ? -7.125  -18.001 5.066   1.00 0.00 ? 105 ARG B NE   1  
ATOM 1965  C CZ   . ARG B 2 107 ? -7.659  -18.063 6.295   1.00 0.00 ? 105 ARG B CZ   1  
ATOM 1966  N NH1  . ARG B 2 107 ? -7.063  -17.477 7.320   1.00 0.00 ? 105 ARG B NH1  1  
ATOM 1967  N NH2  . ARG B 2 107 ? -8.794  -18.719 6.502   1.00 0.00 ? 105 ARG B NH2  1  
ATOM 1968  H H    . ARG B 2 107 ? -3.569  -13.095 3.064   1.00 0.00 ? 105 ARG B H    1  
ATOM 1969  H HA   . ARG B 2 107 ? -6.237  -14.262 3.091   1.00 0.00 ? 105 ARG B HA   1  
ATOM 1970  H HB2  . ARG B 2 107 ? -4.471  -15.840 1.981   1.00 0.00 ? 105 ARG B HB2  1  
ATOM 1971  H HB3  . ARG B 2 107 ? -3.873  -16.049 3.621   1.00 0.00 ? 105 ARG B HB3  1  
ATOM 1972  H HG2  . ARG B 2 107 ? -6.766  -16.493 2.976   1.00 0.00 ? 105 ARG B HG2  1  
ATOM 1973  H HG3  . ARG B 2 107 ? -5.567  -17.752 2.684   1.00 0.00 ? 105 ARG B HG3  1  
ATOM 1974  H HD2  . ARG B 2 107 ? -5.042  -17.930 4.970   1.00 0.00 ? 105 ARG B HD2  1  
ATOM 1975  H HD3  . ARG B 2 107 ? -5.821  -16.397 5.355   1.00 0.00 ? 105 ARG B HD3  1  
ATOM 1976  H HE   . ARG B 2 107 ? -7.583  -18.452 4.326   1.00 0.00 ? 105 ARG B HE   1  
ATOM 1977  H HH11 . ARG B 2 107 ? -6.194  -16.979 7.192   1.00 0.00 ? 105 ARG B HH11 1  
ATOM 1978  H HH12 . ARG B 2 107 ? -7.484  -17.519 8.247   1.00 0.00 ? 105 ARG B HH12 1  
ATOM 1979  H HH21 . ARG B 2 107 ? -9.263  -19.176 5.747   1.00 0.00 ? 105 ARG B HH21 1  
ATOM 1980  H HH22 . ARG B 2 107 ? -9.187  -18.758 7.430   1.00 0.00 ? 105 ARG B HH22 1  
ATOM 1981  N N    . LYS B 2 108 ? -6.204  -14.065 5.541   1.00 0.00 ? 106 LYS B N    1  
ATOM 1982  C CA   . LYS B 2 108 ? -6.255  -13.824 6.979   1.00 0.00 ? 106 LYS B CA   1  
ATOM 1983  C C    . LYS B 2 108 ? -5.270  -14.695 7.753   1.00 0.00 ? 106 LYS B C    1  
ATOM 1984  O O    . LYS B 2 108 ? -4.973  -15.827 7.360   1.00 0.00 ? 106 LYS B O    1  
ATOM 1985  C CB   . LYS B 2 108 ? -7.665  -14.101 7.504   1.00 0.00 ? 106 LYS B CB   1  
ATOM 1986  C CG   . LYS B 2 108 ? -8.691  -13.048 7.128   1.00 0.00 ? 106 LYS B CG   1  
ATOM 1987  C CD   . LYS B 2 108 ? -9.971  -13.210 7.935   1.00 0.00 ? 106 LYS B CD   1  
ATOM 1988  C CE   . LYS B 2 108 ? -9.947  -12.386 9.217   1.00 0.00 ? 106 LYS B CE   1  
ATOM 1989  N NZ   . LYS B 2 108 ? -8.917  -12.857 10.185  1.00 0.00 ? 106 LYS B NZ   1  
ATOM 1990  H H    . LYS B 2 108 ? -7.044  -14.154 5.052   1.00 0.00 ? 106 LYS B H    1  
ATOM 1991  H HA   . LYS B 2 108 ? -6.017  -12.787 7.153   1.00 0.00 ? 106 LYS B HA   1  
ATOM 1992  H HB2  . LYS B 2 108 ? -7.999  -15.050 7.112   1.00 0.00 ? 106 LYS B HB2  1  
ATOM 1993  H HB3  . LYS B 2 108 ? -7.626  -14.163 8.581   1.00 0.00 ? 106 LYS B HB3  1  
ATOM 1994  H HG2  . LYS B 2 108 ? -8.278  -12.069 7.319   1.00 0.00 ? 106 LYS B HG2  1  
ATOM 1995  H HG3  . LYS B 2 108 ? -8.924  -13.143 6.077   1.00 0.00 ? 106 LYS B HG3  1  
ATOM 1996  H HD2  . LYS B 2 108 ? -10.807 -12.889 7.331   1.00 0.00 ? 106 LYS B HD2  1  
ATOM 1997  H HD3  . LYS B 2 108 ? -10.091 -14.252 8.190   1.00 0.00 ? 106 LYS B HD3  1  
ATOM 1998  H HE2  . LYS B 2 108 ? -9.741  -11.358 8.963   1.00 0.00 ? 106 LYS B HE2  1  
ATOM 1999  H HE3  . LYS B 2 108 ? -10.920 -12.448 9.683   1.00 0.00 ? 106 LYS B HE3  1  
ATOM 2000  H HZ1  . LYS B 2 108 ? -9.050  -13.875 10.396  1.00 0.00 ? 106 LYS B HZ1  1  
ATOM 2001  H HZ2  . LYS B 2 108 ? -8.988  -12.316 11.072  1.00 0.00 ? 106 LYS B HZ2  1  
ATOM 2002  H HZ3  . LYS B 2 108 ? -7.958  -12.716 9.790   1.00 0.00 ? 106 LYS B HZ3  1  
ATOM 2003  N N    . ALA B 2 109 ? -4.791  -14.170 8.872   1.00 0.00 ? 107 ALA B N    1  
ATOM 2004  C CA   . ALA B 2 109 ? -3.876  -14.905 9.732   1.00 0.00 ? 107 ALA B CA   1  
ATOM 2005  C C    . ALA B 2 109 ? -4.692  -15.757 10.687  1.00 0.00 ? 107 ALA B C    1  
ATOM 2006  O O    . ALA B 2 109 ? -4.172  -16.430 11.577  1.00 0.00 ? 107 ALA B O    1  
ATOM 2007  C CB   . ALA B 2 109 ? -2.958  -13.954 10.489  1.00 0.00 ? 107 ALA B CB   1  
ATOM 2008  H H    . ALA B 2 109 ? -5.071  -13.257 9.132   1.00 0.00 ? 107 ALA B H    1  
ATOM 2009  H HA   . ALA B 2 109 ? -3.281  -15.549 9.110   1.00 0.00 ? 107 ALA B HA   1  
ATOM 2010  H HB1  . ALA B 2 109 ? -3.547  -13.335 11.150  1.00 0.00 ? 107 ALA B HB1  1  
ATOM 2011  H HB2  . ALA B 2 109 ? -2.428  -13.329 9.786   1.00 0.00 ? 107 ALA B HB2  1  
ATOM 2012  H HB3  . ALA B 2 109 ? -2.248  -14.525 11.069  1.00 0.00 ? 107 ALA B HB3  1  
ATOM 2013  N N    . ASN B 2 110 ? -5.987  -15.702 10.450  1.00 0.00 ? 108 ASN B N    1  
ATOM 2014  C CA   . ASN B 2 110 ? -6.987  -16.425 11.212  1.00 0.00 ? 108 ASN B CA   1  
ATOM 2015  C C    . ASN B 2 110 ? -8.282  -16.430 10.411  1.00 0.00 ? 108 ASN B C    1  
ATOM 2016  O O    . ASN B 2 110 ? -8.457  -17.340 9.570   1.00 0.00 ? 108 ASN B O    1  
ATOM 2017  C CB   . ASN B 2 110 ? -7.206  -15.768 12.581  1.00 0.00 ? 108 ASN B CB   1  
ATOM 2018  C CG   . ASN B 2 110 ? -8.251  -16.484 13.419  1.00 0.00 ? 108 ASN B CG   1  
ATOM 2019  O OD1  . ASN B 2 110 ? -8.384  -17.706 13.368  1.00 0.00 ? 108 ASN B OD1  1  
ATOM 2020  N ND2  . ASN B 2 110 ? -9.000  -15.723 14.202  1.00 0.00 ? 108 ASN B ND2  1  
ATOM 2021  O OXT  . ASN B 2 110 ? -9.083  -15.480 10.571  1.00 0.00 ? 108 ASN B OXT  1  
ATOM 2022  H H    . ASN B 2 110 ? -6.284  -15.142 9.708   1.00 0.00 ? 108 ASN B H    1  
ATOM 2023  H HA   . ASN B 2 110 ? -6.644  -17.440 11.346  1.00 0.00 ? 108 ASN B HA   1  
ATOM 2024  H HB2  . ASN B 2 110 ? -6.274  -15.772 13.126  1.00 0.00 ? 108 ASN B HB2  1  
ATOM 2025  H HB3  . ASN B 2 110 ? -7.526  -14.747 12.434  1.00 0.00 ? 108 ASN B HB3  1  
ATOM 2026  H HD21 . ASN B 2 110 ? -8.840  -14.757 14.197  1.00 0.00 ? 108 ASN B HD21 1  
ATOM 2027  H HD22 . ASN B 2 110 ? -9.683  -16.158 14.749  1.00 0.00 ? 108 ASN B HD22 1  
ATOM 2028  N N    . TYR A 1 1   ? 5.756   9.392   15.502  1.00 0.00 ? 392 TYR A N    2  
ATOM 2029  C CA   . TYR A 1 1   ? 5.985   8.934   16.891  1.00 0.00 ? 392 TYR A CA   2  
ATOM 2030  C C    . TYR A 1 1   ? 6.231   7.424   16.913  1.00 0.00 ? 392 TYR A C    2  
ATOM 2031  O O    . TYR A 1 1   ? 6.740   6.874   15.943  1.00 0.00 ? 392 TYR A O    2  
ATOM 2032  C CB   . TYR A 1 1   ? 4.801   9.334   17.794  1.00 0.00 ? 392 TYR A CB   2  
ATOM 2033  C CG   . TYR A 1 1   ? 3.462   8.724   17.422  1.00 0.00 ? 392 TYR A CG   2  
ATOM 2034  C CD1  . TYR A 1 1   ? 2.848   7.806   18.262  1.00 0.00 ? 392 TYR A CD1  2  
ATOM 2035  C CD2  . TYR A 1 1   ? 2.810   9.070   16.244  1.00 0.00 ? 392 TYR A CD2  2  
ATOM 2036  C CE1  . TYR A 1 1   ? 1.627   7.249   17.943  1.00 0.00 ? 392 TYR A CE1  2  
ATOM 2037  C CE2  . TYR A 1 1   ? 1.588   8.516   15.918  1.00 0.00 ? 392 TYR A CE2  2  
ATOM 2038  C CZ   . TYR A 1 1   ? 1.001   7.605   16.771  1.00 0.00 ? 392 TYR A CZ   2  
ATOM 2039  O OH   . TYR A 1 1   ? -0.214  7.050   16.456  1.00 0.00 ? 392 TYR A OH   2  
ATOM 2040  H H1   . TYR A 1 1   ? 5.150   10.231  15.491  1.00 0.00 ? 392 TYR A H1   2  
ATOM 2041  H H2   . TYR A 1 1   ? 5.301   8.635   14.943  1.00 0.00 ? 392 TYR A H2   2  
ATOM 2042  H H3   . TYR A 1 1   ? 6.671   9.633   15.050  1.00 0.00 ? 392 TYR A H3   2  
ATOM 2043  H HA   . TYR A 1 1   ? 6.878   9.425   17.253  1.00 0.00 ? 392 TYR A HA   2  
ATOM 2044  H HB2  . TYR A 1 1   ? 5.022   9.034   18.807  1.00 0.00 ? 392 TYR A HB2  2  
ATOM 2045  H HB3  . TYR A 1 1   ? 4.692   10.408  17.765  1.00 0.00 ? 392 TYR A HB3  2  
ATOM 2046  H HD1  . TYR A 1 1   ? 3.341   7.526   19.182  1.00 0.00 ? 392 TYR A HD1  2  
ATOM 2047  H HD2  . TYR A 1 1   ? 3.272   9.784   15.579  1.00 0.00 ? 392 TYR A HD2  2  
ATOM 2048  H HE1  . TYR A 1 1   ? 1.168   6.537   18.612  1.00 0.00 ? 392 TYR A HE1  2  
ATOM 2049  H HE2  . TYR A 1 1   ? 1.097   8.795   14.997  1.00 0.00 ? 392 TYR A HE2  2  
ATOM 2050  H HH   . TYR A 1 1   ? -0.380  7.162   15.507  1.00 0.00 ? 392 TYR A HH   2  
ATOM 2051  N N    . VAL A 1 2   ? 5.886   6.757   18.017  1.00 0.00 ? 393 VAL A N    2  
ATOM 2052  C CA   . VAL A 1 2   ? 6.085   5.309   18.128  1.00 0.00 ? 393 VAL A CA   2  
ATOM 2053  C C    . VAL A 1 2   ? 5.273   4.563   17.063  1.00 0.00 ? 393 VAL A C    2  
ATOM 2054  O O    . VAL A 1 2   ? 5.773   3.641   16.419  1.00 0.00 ? 393 VAL A O    2  
ATOM 2055  C CB   . VAL A 1 2   ? 5.739   4.786   19.547  1.00 0.00 ? 393 VAL A CB   2  
ATOM 2056  C CG1  . VAL A 1 2   ? 4.328   5.176   19.959  1.00 0.00 ? 393 VAL A CG1  2  
ATOM 2057  C CG2  . VAL A 1 2   ? 5.923   3.276   19.628  1.00 0.00 ? 393 VAL A CG2  2  
ATOM 2058  H H    . VAL A 1 2   ? 5.492   7.243   18.769  1.00 0.00 ? 393 VAL A H    2  
ATOM 2059  H HA   . VAL A 1 2   ? 7.135   5.115   17.948  1.00 0.00 ? 393 VAL A HA   2  
ATOM 2060  H HB   . VAL A 1 2   ? 6.426   5.241   20.246  1.00 0.00 ? 393 VAL A HB   2  
ATOM 2061  H HG11 . VAL A 1 2   ? 4.241   6.253   19.968  1.00 0.00 ? 393 VAL A HG11 2  
ATOM 2062  H HG12 . VAL A 1 2   ? 4.121   4.791   20.947  1.00 0.00 ? 393 VAL A HG12 2  
ATOM 2063  H HG13 . VAL A 1 2   ? 3.620   4.764   19.256  1.00 0.00 ? 393 VAL A HG13 2  
ATOM 2064  H HG21 . VAL A 1 2   ? 5.736   2.944   20.638  1.00 0.00 ? 393 VAL A HG21 2  
ATOM 2065  H HG22 . VAL A 1 2   ? 6.935   3.021   19.346  1.00 0.00 ? 393 VAL A HG22 2  
ATOM 2066  H HG23 . VAL A 1 2   ? 5.230   2.793   18.955  1.00 0.00 ? 393 VAL A HG23 2  
ATOM 2067  N N    . GLY A 1 3   ? 4.027   4.978   16.868  1.00 0.00 ? 394 GLY A N    2  
ATOM 2068  C CA   . GLY A 1 3   ? 3.186   4.358   15.863  1.00 0.00 ? 394 GLY A CA   2  
ATOM 2069  C C    . GLY A 1 3   ? 3.353   5.054   14.532  1.00 0.00 ? 394 GLY A C    2  
ATOM 2070  O O    . GLY A 1 3   ? 2.455   5.761   14.084  1.00 0.00 ? 394 GLY A O    2  
ATOM 2071  H H    . GLY A 1 3   ? 3.677   5.714   17.406  1.00 0.00 ? 394 GLY A H    2  
ATOM 2072  H HA2  . GLY A 1 3   ? 3.459   3.318   15.761  1.00 0.00 ? 394 GLY A HA2  2  
ATOM 2073  H HA3  . GLY A 1 3   ? 2.154   4.428   16.170  1.00 0.00 ? 394 GLY A HA3  2  
ATOM 2074  N N    . GLU A 1 4   ? 4.529   4.857   13.933  1.00 0.00 ? 395 GLU A N    2  
ATOM 2075  C CA   . GLU A 1 4   ? 4.901   5.471   12.658  1.00 0.00 ? 395 GLU A CA   2  
ATOM 2076  C C    . GLU A 1 4   ? 5.241   6.945   12.865  1.00 0.00 ? 395 GLU A C    2  
ATOM 2077  O O    . GLU A 1 4   ? 4.826   7.563   13.849  1.00 0.00 ? 395 GLU A O    2  
ATOM 2078  C CB   . GLU A 1 4   ? 3.815   5.299   11.589  1.00 0.00 ? 395 GLU A CB   2  
ATOM 2079  C CG   . GLU A 1 4   ? 4.241   4.400   10.435  1.00 0.00 ? 395 GLU A CG   2  
ATOM 2080  C CD   . GLU A 1 4   ? 5.217   5.070   9.491   1.00 0.00 ? 395 GLU A CD   2  
ATOM 2081  O OE1  . GLU A 1 4   ? 4.984   5.041   8.258   1.00 0.00 ? 395 GLU A OE1  2  
ATOM 2082  O OE2  . GLU A 1 4   ? 6.220   5.638   9.969   1.00 0.00 ? 395 GLU A OE2  2  
ATOM 2083  H H    . GLU A 1 4   ? 5.182   4.274   14.374  1.00 0.00 ? 395 GLU A H    2  
ATOM 2084  H HA   . GLU A 1 4   ? 5.797   4.971   12.319  1.00 0.00 ? 395 GLU A HA   2  
ATOM 2085  H HB2  . GLU A 1 4   ? 2.938   4.868   12.049  1.00 0.00 ? 395 GLU A HB2  2  
ATOM 2086  H HB3  . GLU A 1 4   ? 3.562   6.270   11.188  1.00 0.00 ? 395 GLU A HB3  2  
ATOM 2087  H HG2  . GLU A 1 4   ? 4.711   3.517   10.839  1.00 0.00 ? 395 GLU A HG2  2  
ATOM 2088  H HG3  . GLU A 1 4   ? 3.363   4.115   9.876   1.00 0.00 ? 395 GLU A HG3  2  
ATOM 2089  N N    . ASP A 1 5   ? 6.013   7.501   11.949  1.00 0.00 ? 396 ASP A N    2  
ATOM 2090  C CA   . ASP A 1 5   ? 6.442   8.891   12.052  1.00 0.00 ? 396 ASP A CA   2  
ATOM 2091  C C    . ASP A 1 5   ? 6.193   9.649   10.765  1.00 0.00 ? 396 ASP A C    2  
ATOM 2092  O O    . ASP A 1 5   ? 6.972   10.529  10.414  1.00 0.00 ? 396 ASP A O    2  
ATOM 2093  C CB   . ASP A 1 5   ? 7.926   8.991   12.407  1.00 0.00 ? 396 ASP A CB   2  
ATOM 2094  C CG   . ASP A 1 5   ? 8.251   10.275  13.149  1.00 0.00 ? 396 ASP A CG   2  
ATOM 2095  O OD1  . ASP A 1 5   ? 8.938   11.146  12.572  1.00 0.00 ? 396 ASP A OD1  2  
ATOM 2096  O OD2  . ASP A 1 5   ? 7.802   10.422  14.307  1.00 0.00 ? 396 ASP A OD2  2  
ATOM 2097  H H    . ASP A 1 5   ? 6.298   6.961   11.173  1.00 0.00 ? 396 ASP A H    2  
ATOM 2098  H HA   . ASP A 1 5   ? 5.867   9.353   12.840  1.00 0.00 ? 396 ASP A HA   2  
ATOM 2099  H HB2  . ASP A 1 5   ? 8.204   8.156   13.026  1.00 0.00 ? 396 ASP A HB2  2  
ATOM 2100  H HB3  . ASP A 1 5   ? 8.507   8.972   11.494  1.00 0.00 ? 396 ASP A HB3  2  
ATOM 2101  N N    . ASP A 1 6   ? 5.158   9.287   10.025  1.00 0.00 ? 397 ASP A N    2  
ATOM 2102  C CA   . ASP A 1 6   ? 4.877   9.979   8.770   1.00 0.00 ? 397 ASP A CA   2  
ATOM 2103  C C    . ASP A 1 6   ? 4.687   11.467  9.012   1.00 0.00 ? 397 ASP A C    2  
ATOM 2104  O O    . ASP A 1 6   ? 5.204   12.286  8.251   1.00 0.00 ? 397 ASP A O    2  
ATOM 2105  C CB   . ASP A 1 6   ? 3.664   9.396   8.055   1.00 0.00 ? 397 ASP A CB   2  
ATOM 2106  C CG   . ASP A 1 6   ? 3.867   9.369   6.558   1.00 0.00 ? 397 ASP A CG   2  
ATOM 2107  O OD1  . ASP A 1 6   ? 4.786   8.654   6.103   1.00 0.00 ? 397 ASP A OD1  2  
ATOM 2108  O OD2  . ASP A 1 6   ? 3.133   10.065  5.838   1.00 0.00 ? 397 ASP A OD2  2  
ATOM 2109  H H    . ASP A 1 6   ? 4.563   8.566   10.331  1.00 0.00 ? 397 ASP A H    2  
ATOM 2110  H HA   . ASP A 1 6   ? 5.744   9.856   8.139   1.00 0.00 ? 397 ASP A HA   2  
ATOM 2111  H HB2  . ASP A 1 6   ? 3.498   8.385   8.400   1.00 0.00 ? 397 ASP A HB2  2  
ATOM 2112  H HB3  . ASP A 1 6   ? 2.796   9.998   8.275   1.00 0.00 ? 397 ASP A HB3  2  
ATOM 2113  N N    . GLU A 1 7   ? 3.966   11.805  10.085  1.00 0.00 ? 398 GLU A N    2  
ATOM 2114  C CA   . GLU A 1 7   ? 3.734   13.200  10.466  1.00 0.00 ? 398 GLU A CA   2  
ATOM 2115  C C    . GLU A 1 7   ? 2.738   13.297  11.622  1.00 0.00 ? 398 GLU A C    2  
ATOM 2116  O O    . GLU A 1 7   ? 3.070   13.772  12.708  1.00 0.00 ? 398 GLU A O    2  
ATOM 2117  C CB   . GLU A 1 7   ? 3.223   14.017  9.276   1.00 0.00 ? 398 GLU A CB   2  
ATOM 2118  C CG   . GLU A 1 7   ? 3.683   15.466  9.291   1.00 0.00 ? 398 GLU A CG   2  
ATOM 2119  C CD   . GLU A 1 7   ? 3.115   16.267  8.139   1.00 0.00 ? 398 GLU A CD   2  
ATOM 2120  O OE1  . GLU A 1 7   ? 3.680   16.201  7.025   1.00 0.00 ? 398 GLU A OE1  2  
ATOM 2121  O OE2  . GLU A 1 7   ? 2.095   16.959  8.344   1.00 0.00 ? 398 GLU A OE2  2  
ATOM 2122  H H    . GLU A 1 7   ? 3.569   11.089  10.630  1.00 0.00 ? 398 GLU A H    2  
ATOM 2123  H HA   . GLU A 1 7   ? 4.679   13.612  10.791  1.00 0.00 ? 398 GLU A HA   2  
ATOM 2124  H HB2  . GLU A 1 7   ? 3.581   13.560  8.364   1.00 0.00 ? 398 GLU A HB2  2  
ATOM 2125  H HB3  . GLU A 1 7   ? 2.146   14.002  9.278   1.00 0.00 ? 398 GLU A HB3  2  
ATOM 2126  H HG2  . GLU A 1 7   ? 3.367   15.921  10.217  1.00 0.00 ? 398 GLU A HG2  2  
ATOM 2127  H HG3  . GLU A 1 7   ? 4.761   15.487  9.230   1.00 0.00 ? 398 GLU A HG3  2  
ATOM 2128  N N    . GLU A 1 8   ? 1.526   12.832  11.373  1.00 0.00 ? 399 GLU A N    2  
ATOM 2129  C CA   . GLU A 1 8   ? 0.441   12.862  12.349  1.00 0.00 ? 399 GLU A CA   2  
ATOM 2130  C C    . GLU A 1 8   ? -0.520  11.753  12.002  1.00 0.00 ? 399 GLU A C    2  
ATOM 2131  O O    . GLU A 1 8   ? -1.444  11.939  11.223  1.00 0.00 ? 399 GLU A O    2  
ATOM 2132  C CB   . GLU A 1 8   ? -0.247  14.219  12.296  1.00 0.00 ? 399 GLU A CB   2  
ATOM 2133  C CG   . GLU A 1 8   ? -1.405  14.381  13.251  1.00 0.00 ? 399 GLU A CG   2  
ATOM 2134  C CD   . GLU A 1 8   ? -2.284  15.552  12.866  1.00 0.00 ? 399 GLU A CD   2  
ATOM 2135  O OE1  . GLU A 1 8   ? -1.900  16.306  11.938  1.00 0.00 ? 399 GLU A OE1  2  
ATOM 2136  O OE2  . GLU A 1 8   ? -3.366  15.700  13.465  1.00 0.00 ? 399 GLU A OE2  2  
ATOM 2137  H H    . GLU A 1 8   ? 1.349   12.433  10.493  1.00 0.00 ? 399 GLU A H    2  
ATOM 2138  H HA   . GLU A 1 8   ? 0.835   12.689  13.333  1.00 0.00 ? 399 GLU A HA   2  
ATOM 2139  H HB2  . GLU A 1 8   ? 0.480   14.982  12.521  1.00 0.00 ? 399 GLU A HB2  2  
ATOM 2140  H HB3  . GLU A 1 8   ? -0.617  14.374  11.293  1.00 0.00 ? 399 GLU A HB3  2  
ATOM 2141  H HG2  . GLU A 1 8   ? -1.999  13.476  13.230  1.00 0.00 ? 399 GLU A HG2  2  
ATOM 2142  H HG3  . GLU A 1 8   ? -1.022  14.539  14.245  1.00 0.00 ? 399 GLU A HG3  2  
ATOM 2143  N N    . ASP A 1 9   ? -0.288  10.596  12.576  1.00 0.00 ? 400 ASP A N    2  
ATOM 2144  C CA   . ASP A 1 9   ? -1.074  9.426   12.255  1.00 0.00 ? 400 ASP A CA   2  
ATOM 2145  C C    . ASP A 1 9   ? -1.563  8.671   13.481  1.00 0.00 ? 400 ASP A C    2  
ATOM 2146  O O    . ASP A 1 9   ? -0.878  7.794   14.000  1.00 0.00 ? 400 ASP A O    2  
ATOM 2147  C CB   . ASP A 1 9   ? -0.210  8.508   11.411  1.00 0.00 ? 400 ASP A CB   2  
ATOM 2148  C CG   . ASP A 1 9   ? 1.276   8.808   11.559  1.00 0.00 ? 400 ASP A CG   2  
ATOM 2149  O OD1  . ASP A 1 9   ? 1.936   9.035   10.526  1.00 0.00 ? 400 ASP A OD1  2  
ATOM 2150  O OD2  . ASP A 1 9   ? 1.776   8.847   12.702  1.00 0.00 ? 400 ASP A OD2  2  
ATOM 2151  H H    . ASP A 1 9   ? 0.446   10.514  13.225  1.00 0.00 ? 400 ASP A H    2  
ATOM 2152  H HA   . ASP A 1 9   ? -1.924  9.741   11.670  1.00 0.00 ? 400 ASP A HA   2  
ATOM 2153  H HB2  . ASP A 1 9   ? -0.387  7.487   11.708  1.00 0.00 ? 400 ASP A HB2  2  
ATOM 2154  H HB3  . ASP A 1 9   ? -0.483  8.631   10.372  1.00 0.00 ? 400 ASP A HB3  2  
ATOM 2155  N N    . ASP A 1 10  ? -2.760  9.001   13.918  1.00 0.00 ? 401 ASP A N    2  
ATOM 2156  C CA   . ASP A 1 10  ? -3.353  8.341   15.086  1.00 0.00 ? 401 ASP A CA   2  
ATOM 2157  C C    . ASP A 1 10  ? -4.838  8.028   14.894  1.00 0.00 ? 401 ASP A C    2  
ATOM 2158  O O    . ASP A 1 10  ? -5.275  6.918   15.192  1.00 0.00 ? 401 ASP A O    2  
ATOM 2159  C CB   . ASP A 1 10  ? -3.141  9.184   16.353  1.00 0.00 ? 401 ASP A CB   2  
ATOM 2160  C CG   . ASP A 1 10  ? -3.835  10.538  16.296  1.00 0.00 ? 401 ASP A CG   2  
ATOM 2161  O OD1  . ASP A 1 10  ? -4.264  11.032  17.354  1.00 0.00 ? 401 ASP A OD1  2  
ATOM 2162  O OD2  . ASP A 1 10  ? -3.951  11.109  15.186  1.00 0.00 ? 401 ASP A OD2  2  
ATOM 2163  H H    . ASP A 1 10  ? -3.243  9.715   13.463  1.00 0.00 ? 401 ASP A H    2  
ATOM 2164  H HA   . ASP A 1 10  ? -2.841  7.394   15.203  1.00 0.00 ? 401 ASP A HA   2  
ATOM 2165  H HB2  . ASP A 1 10  ? -3.527  8.644   17.204  1.00 0.00 ? 401 ASP A HB2  2  
ATOM 2166  H HB3  . ASP A 1 10  ? -2.082  9.350   16.490  1.00 0.00 ? 401 ASP A HB3  2  
ATOM 2167  N N    . ASP A 1 11  ? -5.606  8.985   14.380  1.00 0.00 ? 402 ASP A N    2  
ATOM 2168  C CA   . ASP A 1 11  ? -7.046  8.784   14.144  1.00 0.00 ? 402 ASP A CA   2  
ATOM 2169  C C    . ASP A 1 11  ? -7.272  7.886   12.933  1.00 0.00 ? 402 ASP A C    2  
ATOM 2170  O O    . ASP A 1 11  ? -8.381  7.769   12.412  1.00 0.00 ? 402 ASP A O    2  
ATOM 2171  C CB   . ASP A 1 11  ? -7.768  10.121  13.945  1.00 0.00 ? 402 ASP A CB   2  
ATOM 2172  C CG   . ASP A 1 11  ? -7.103  11.018  12.917  1.00 0.00 ? 402 ASP A CG   2  
ATOM 2173  O OD1  . ASP A 1 11  ? -6.483  10.499  11.960  1.00 0.00 ? 402 ASP A OD1  2  
ATOM 2174  O OD2  . ASP A 1 11  ? -7.182  12.252  13.078  1.00 0.00 ? 402 ASP A OD2  2  
ATOM 2175  H H    . ASP A 1 11  ? -5.206  9.855   14.171  1.00 0.00 ? 402 ASP A H    2  
ATOM 2176  H HA   . ASP A 1 11  ? -7.453  8.293   15.016  1.00 0.00 ? 402 ASP A HA   2  
ATOM 2177  H HB2  . ASP A 1 11  ? -8.779  9.929   13.620  1.00 0.00 ? 402 ASP A HB2  2  
ATOM 2178  H HB3  . ASP A 1 11  ? -7.795  10.648  14.888  1.00 0.00 ? 402 ASP A HB3  2  
ATOM 2179  N N    . PHE A 1 12  ? -6.196  7.253   12.515  1.00 0.00 ? 403 PHE A N    2  
ATOM 2180  C CA   . PHE A 1 12  ? -6.169  6.355   11.395  1.00 0.00 ? 403 PHE A CA   2  
ATOM 2181  C C    . PHE A 1 12  ? -7.146  5.188   11.585  1.00 0.00 ? 403 PHE A C    2  
ATOM 2182  O O    . PHE A 1 12  ? -7.051  4.444   12.561  1.00 0.00 ? 403 PHE A O    2  
ATOM 2183  C CB   . PHE A 1 12  ? -4.756  5.833   11.300  1.00 0.00 ? 403 PHE A CB   2  
ATOM 2184  C CG   . PHE A 1 12  ? -3.984  6.286   10.119  1.00 0.00 ? 403 PHE A CG   2  
ATOM 2185  C CD1  . PHE A 1 12  ? -2.665  6.654   10.255  1.00 0.00 ? 403 PHE A CD1  2  
ATOM 2186  C CD2  . PHE A 1 12  ? -4.556  6.290   8.871   1.00 0.00 ? 403 PHE A CD2  2  
ATOM 2187  C CE1  . PHE A 1 12  ? -1.925  7.015   9.156   1.00 0.00 ? 403 PHE A CE1  2  
ATOM 2188  C CE2  . PHE A 1 12  ? -3.827  6.659   7.770   1.00 0.00 ? 403 PHE A CE2  2  
ATOM 2189  C CZ   . PHE A 1 12  ? -2.506  7.018   7.913   1.00 0.00 ? 403 PHE A CZ   2  
ATOM 2190  H H    . PHE A 1 12  ? -5.367  7.383   13.012  1.00 0.00 ? 403 PHE A H    2  
ATOM 2191  H HA   . PHE A 1 12  ? -6.412  6.895   10.498  1.00 0.00 ? 403 PHE A HA   2  
ATOM 2192  H HB2  . PHE A 1 12  ? -4.211  6.132   12.180  1.00 0.00 ? 403 PHE A HB2  2  
ATOM 2193  H HB3  . PHE A 1 12  ? -4.797  4.776   11.262  1.00 0.00 ? 403 PHE A HB3  2  
ATOM 2194  H HD1  . PHE A 1 12  ? -2.210  6.654   11.238  1.00 0.00 ? 403 PHE A HD1  2  
ATOM 2195  H HD2  . PHE A 1 12  ? -5.592  6.009   8.765   1.00 0.00 ? 403 PHE A HD2  2  
ATOM 2196  H HE1  . PHE A 1 12  ? -0.890  7.302   9.272   1.00 0.00 ? 403 PHE A HE1  2  
ATOM 2197  H HE2  . PHE A 1 12  ? -4.286  6.661   6.793   1.00 0.00 ? 403 PHE A HE2  2  
ATOM 2198  H HZ   . PHE A 1 12  ? -1.925  7.285   7.054   1.00 0.00 ? 403 PHE A HZ   2  
ATOM 2199  N N    . ASN A 1 13  ? -8.054  5.013   10.635  1.00 0.00 ? 404 ASN A N    2  
ATOM 2200  C CA   . ASN A 1 13  ? -9.053  3.944   10.705  1.00 0.00 ? 404 ASN A CA   2  
ATOM 2201  C C    . ASN A 1 13  ? -8.803  2.900   9.626   1.00 0.00 ? 404 ASN A C    2  
ATOM 2202  O O    . ASN A 1 13  ? -8.665  3.243   8.458   1.00 0.00 ? 404 ASN A O    2  
ATOM 2203  C CB   . ASN A 1 13  ? -10.464 4.515   10.538  1.00 0.00 ? 404 ASN A CB   2  
ATOM 2204  C CG   . ASN A 1 13  ? -11.044 5.045   11.833  1.00 0.00 ? 404 ASN A CG   2  
ATOM 2205  O OD1  . ASN A 1 13  ? -11.679 4.311   12.588  1.00 0.00 ? 404 ASN A OD1  2  
ATOM 2206  N ND2  . ASN A 1 13  ? -10.834 6.325   12.098  1.00 0.00 ? 404 ASN A ND2  2  
ATOM 2207  H H    . ASN A 1 13  ? -8.047  5.609   9.856   1.00 0.00 ? 404 ASN A H    2  
ATOM 2208  H HA   . ASN A 1 13  ? -8.974  3.475   11.674  1.00 0.00 ? 404 ASN A HA   2  
ATOM 2209  H HB2  . ASN A 1 13  ? -10.434 5.324   9.824   1.00 0.00 ? 404 ASN A HB2  2  
ATOM 2210  H HB3  . ASN A 1 13  ? -11.116 3.738   10.164  1.00 0.00 ? 404 ASN A HB3  2  
ATOM 2211  H HD21 . ASN A 1 13  ? -10.319 6.856   11.451  1.00 0.00 ? 404 ASN A HD21 2  
ATOM 2212  H HD22 . ASN A 1 13  ? -11.193 6.690   12.930  1.00 0.00 ? 404 ASN A HD22 2  
ATOM 2213  N N    . GLU A 1 14  ? -8.747  1.632   10.017  1.00 0.00 ? 405 GLU A N    2  
ATOM 2214  C CA   . GLU A 1 14  ? -8.510  0.548   9.064   1.00 0.00 ? 405 GLU A CA   2  
ATOM 2215  C C    . GLU A 1 14  ? -9.739  0.313   8.191   1.00 0.00 ? 405 GLU A C    2  
ATOM 2216  O O    . GLU A 1 14  ? -9.767  0.702   7.024   1.00 0.00 ? 405 GLU A O    2  
ATOM 2217  C CB   . GLU A 1 14  ? -8.145  -0.753  9.789   1.00 0.00 ? 405 GLU A CB   2  
ATOM 2218  C CG   . GLU A 1 14  ? -7.210  -0.558  10.970  1.00 0.00 ? 405 GLU A CG   2  
ATOM 2219  C CD   . GLU A 1 14  ? -6.151  -1.642  11.067  1.00 0.00 ? 405 GLU A CD   2  
ATOM 2220  O OE1  . GLU A 1 14  ? -4.967  -1.293  11.266  1.00 0.00 ? 405 GLU A OE1  2  
ATOM 2221  O OE2  . GLU A 1 14  ? -6.493  -2.838  10.940  1.00 0.00 ? 405 GLU A OE2  2  
ATOM 2222  H H    . GLU A 1 14  ? -8.866  1.418   10.965  1.00 0.00 ? 405 GLU A H    2  
ATOM 2223  H HA   . GLU A 1 14  ? -7.686  0.839   8.430   1.00 0.00 ? 405 GLU A HA   2  
ATOM 2224  H HB2  . GLU A 1 14  ? -9.052  -1.216  10.149  1.00 0.00 ? 405 GLU A HB2  2  
ATOM 2225  H HB3  . GLU A 1 14  ? -7.668  -1.420  9.086   1.00 0.00 ? 405 GLU A HB3  2  
ATOM 2226  H HG2  . GLU A 1 14  ? -6.718  0.397   10.866  1.00 0.00 ? 405 GLU A HG2  2  
ATOM 2227  H HG3  . GLU A 1 14  ? -7.796  -0.563  11.877  1.00 0.00 ? 405 GLU A HG3  2  
ATOM 2228  N N    . ASN A 1 15  ? -10.742 -0.339  8.778   1.00 0.00 ? 406 ASN A N    2  
ATOM 2229  C CA   . ASN A 1 15  ? -12.002 -0.660  8.097   1.00 0.00 ? 406 ASN A CA   2  
ATOM 2230  C C    . ASN A 1 15  ? -11.803 -1.785  7.080   1.00 0.00 ? 406 ASN A C    2  
ATOM 2231  O O    . ASN A 1 15  ? -12.721 -2.145  6.345   1.00 0.00 ? 406 ASN A O    2  
ATOM 2232  C CB   . ASN A 1 15  ? -12.610 0.578   7.420   1.00 0.00 ? 406 ASN A CB   2  
ATOM 2233  C CG   . ASN A 1 15  ? -14.132 0.599   7.470   1.00 0.00 ? 406 ASN A CG   2  
ATOM 2234  O OD1  . ASN A 1 15  ? -14.741 1.659   7.604   1.00 0.00 ? 406 ASN A OD1  2  
ATOM 2235  N ND2  . ASN A 1 15  ? -14.758 -0.563  7.355   1.00 0.00 ? 406 ASN A ND2  2  
ATOM 2236  H H    . ASN A 1 15  ? -10.633 -0.624  9.709   1.00 0.00 ? 406 ASN A H    2  
ATOM 2237  H HA   . ASN A 1 15  ? -12.688 -1.010  8.855   1.00 0.00 ? 406 ASN A HA   2  
ATOM 2238  H HB2  . ASN A 1 15  ? -12.243 1.466   7.913   1.00 0.00 ? 406 ASN A HB2  2  
ATOM 2239  H HB3  . ASN A 1 15  ? -12.304 0.598   6.384   1.00 0.00 ? 406 ASN A HB3  2  
ATOM 2240  H HD21 . ASN A 1 15  ? -14.213 -1.377  7.239   1.00 0.00 ? 406 ASN A HD21 2  
ATOM 2241  H HD22 . ASN A 1 15  ? -15.734 -0.567  7.389   1.00 0.00 ? 406 ASN A HD22 2  
ATOM 2242  N N    . ASP A 1 16  ? -10.594 -2.327  7.035   1.00 0.00 ? 407 ASP A N    2  
ATOM 2243  C CA   . ASP A 1 16  ? -10.278 -3.428  6.132   1.00 0.00 ? 407 ASP A CA   2  
ATOM 2244  C C    . ASP A 1 16  ? -10.042 -4.689  6.952   1.00 0.00 ? 407 ASP A C    2  
ATOM 2245  O O    . ASP A 1 16  ? -9.792  -5.775  6.419   1.00 0.00 ? 407 ASP A O    2  
ATOM 2246  C CB   . ASP A 1 16  ? -9.053  -3.098  5.277   1.00 0.00 ? 407 ASP A CB   2  
ATOM 2247  C CG   . ASP A 1 16  ? -8.909  -4.038  4.095   1.00 0.00 ? 407 ASP A CG   2  
ATOM 2248  O OD1  . ASP A 1 16  ? -9.785  -4.014  3.207   1.00 0.00 ? 407 ASP A OD1  2  
ATOM 2249  O OD2  . ASP A 1 16  ? -7.923  -4.801  4.057   1.00 0.00 ? 407 ASP A OD2  2  
ATOM 2250  H H    . ASP A 1 16  ? -9.894  -1.973  7.618   1.00 0.00 ? 407 ASP A H    2  
ATOM 2251  H HA   . ASP A 1 16  ? -11.131 -3.585  5.488   1.00 0.00 ? 407 ASP A HA   2  
ATOM 2252  H HB2  . ASP A 1 16  ? -9.142  -2.089  4.903   1.00 0.00 ? 407 ASP A HB2  2  
ATOM 2253  H HB3  . ASP A 1 16  ? -8.164  -3.176  5.886   1.00 0.00 ? 407 ASP A HB3  2  
ATOM 2254  N N    . GLU A 1 17  ? -10.137 -4.507  8.265   1.00 0.00 ? 408 GLU A N    2  
ATOM 2255  C CA   . GLU A 1 17  ? -9.971  -5.572  9.246   1.00 0.00 ? 408 GLU A CA   2  
ATOM 2256  C C    . GLU A 1 17  ? -8.688  -6.367  9.051   1.00 0.00 ? 408 GLU A C    2  
ATOM 2257  O O    . GLU A 1 17  ? -7.628  -5.808  8.774   1.00 0.00 ? 408 GLU A O    2  
ATOM 2258  C CB   . GLU A 1 17  ? -11.185 -6.496  9.222   1.00 0.00 ? 408 GLU A CB   2  
ATOM 2259  C CG   . GLU A 1 17  ? -12.283 -6.050  10.172  1.00 0.00 ? 408 GLU A CG   2  
ATOM 2260  C CD   . GLU A 1 17  ? -12.804 -4.652  9.866   1.00 0.00 ? 408 GLU A CD   2  
ATOM 2261  O OE1  . GLU A 1 17  ? -12.100 -3.666  10.191  1.00 0.00 ? 408 GLU A OE1  2  
ATOM 2262  O OE2  . GLU A 1 17  ? -13.908 -4.539  9.302   1.00 0.00 ? 408 GLU A OE2  2  
ATOM 2263  H H    . GLU A 1 17  ? -10.358 -3.612  8.594   1.00 0.00 ? 408 GLU A H    2  
ATOM 2264  H HA   . GLU A 1 17  ? -9.927  -5.102  10.216  1.00 0.00 ? 408 GLU A HA   2  
ATOM 2265  H HB2  . GLU A 1 17  ? -11.588 -6.522  8.220   1.00 0.00 ? 408 GLU A HB2  2  
ATOM 2266  H HB3  . GLU A 1 17  ? -10.874 -7.491  9.504   1.00 0.00 ? 408 GLU A HB3  2  
ATOM 2267  H HG2  . GLU A 1 17  ? -13.102 -6.748  10.101  1.00 0.00 ? 408 GLU A HG2  2  
ATOM 2268  H HG3  . GLU A 1 17  ? -11.888 -6.061  11.177  1.00 0.00 ? 408 GLU A HG3  2  
ATOM 2269  N N    . ASP A 1 18  ? -8.794  -7.675  9.216   1.00 0.00 ? 409 ASP A N    2  
ATOM 2270  C CA   . ASP A 1 18  ? -7.647  -8.550  9.088   1.00 0.00 ? 409 ASP A CA   2  
ATOM 2271  C C    . ASP A 1 18  ? -7.745  -9.396  7.826   1.00 0.00 ? 409 ASP A C    2  
ATOM 2272  O O    . ASP A 1 18  ? -8.527  -9.088  6.921   1.00 0.00 ? 409 ASP A O    2  
ATOM 2273  C CB   . ASP A 1 18  ? -7.536  -9.451  10.318  1.00 0.00 ? 409 ASP A CB   2  
ATOM 2274  C CG   . ASP A 1 18  ? -6.216  -9.278  11.039  1.00 0.00 ? 409 ASP A CG   2  
ATOM 2275  O OD1  . ASP A 1 18  ? -5.331  -10.141 10.874  1.00 0.00 ? 409 ASP A OD1  2  
ATOM 2276  O OD2  . ASP A 1 18  ? -6.059  -8.268  11.761  1.00 0.00 ? 409 ASP A OD2  2  
ATOM 2277  H H    . ASP A 1 18  ? -9.669  -8.062  9.417   1.00 0.00 ? 409 ASP A H    2  
ATOM 2278  H HA   . ASP A 1 18  ? -6.772  -7.929  9.027   1.00 0.00 ? 409 ASP A HA   2  
ATOM 2279  H HB2  . ASP A 1 18  ? -8.334  -9.213  11.006  1.00 0.00 ? 409 ASP A HB2  2  
ATOM 2280  H HB3  . ASP A 1 18  ? -7.626  -10.484 10.012  1.00 0.00 ? 409 ASP A HB3  2  
ATOM 2281  N N    . ASP A 1 19  ? -6.949  -10.451 7.770   1.00 0.00 ? 410 ASP A N    2  
ATOM 2282  C CA   . ASP A 1 19  ? -6.937  -11.356 6.630   1.00 0.00 ? 410 ASP A CA   2  
ATOM 2283  C C    . ASP A 1 19  ? -6.955  -12.800 7.112   1.00 0.00 ? 410 ASP A C    2  
ATOM 2284  O O    . ASP A 1 19  ? -7.027  -13.006 8.346   1.00 0.00 ? 410 ASP A O    2  
ATOM 2285  C CB   . ASP A 1 19  ? -5.707  -11.117 5.738   1.00 0.00 ? 410 ASP A CB   2  
ATOM 2286  C CG   . ASP A 1 19  ? -4.400  -11.028 6.510   1.00 0.00 ? 410 ASP A CG   2  
ATOM 2287  O OD1  . ASP A 1 19  ? -3.673  -10.029 6.329   1.00 0.00 ? 410 ASP A OD1  2  
ATOM 2288  O OD2  . ASP A 1 19  ? -4.091  -11.947 7.299   1.00 0.00 ? 410 ASP A OD2  2  
ATOM 2289  O OXT  . ASP A 1 19  ? -6.891  -13.717 6.263   1.00 0.00 ? 410 ASP A OXT  2  
ATOM 2290  H H    . ASP A 1 19  ? -6.356  -10.640 8.524   1.00 0.00 ? 410 ASP A H    2  
ATOM 2291  H HA   . ASP A 1 19  ? -7.833  -11.168 6.055   1.00 0.00 ? 410 ASP A HA   2  
ATOM 2292  H HB2  . ASP A 1 19  ? -5.625  -11.929 5.032   1.00 0.00 ? 410 ASP A HB2  2  
ATOM 2293  H HB3  . ASP A 1 19  ? -5.845  -10.192 5.196   1.00 0.00 ? 410 ASP A HB3  2  
ATOM 2294  N N    . MET B 2 3   ? 14.028  4.392   -13.267 1.00 0.00 ? 1   MET B N    2  
ATOM 2295  C CA   . MET B 2 3   ? 12.865  3.503   -13.044 1.00 0.00 ? 1   MET B CA   2  
ATOM 2296  C C    . MET B 2 3   ? 13.199  2.466   -11.980 1.00 0.00 ? 1   MET B C    2  
ATOM 2297  O O    . MET B 2 3   ? 14.370  2.164   -11.753 1.00 0.00 ? 1   MET B O    2  
ATOM 2298  C CB   . MET B 2 3   ? 12.476  2.811   -14.357 1.00 0.00 ? 1   MET B CB   2  
ATOM 2299  C CG   . MET B 2 3   ? 11.125  2.115   -14.312 1.00 0.00 ? 1   MET B CG   2  
ATOM 2300  S SD   . MET B 2 3   ? 9.843   3.150   -13.582 1.00 0.00 ? 1   MET B SD   2  
ATOM 2301  C CE   . MET B 2 3   ? 8.366   2.288   -14.114 1.00 0.00 ? 1   MET B CE   2  
ATOM 2302  H H    . MET B 2 3   ? 14.873  3.828   -13.481 1.00 0.00 ? 1   MET B H    2  
ATOM 2303  H HA   . MET B 2 3   ? 12.037  4.104   -12.700 1.00 0.00 ? 1   MET B HA   2  
ATOM 2304  H HB2  . MET B 2 3   ? 12.449  3.550   -15.144 1.00 0.00 ? 1   MET B HB2  2  
ATOM 2305  H HB3  . MET B 2 3   ? 13.228  2.074   -14.596 1.00 0.00 ? 1   MET B HB3  2  
ATOM 2306  H HG2  . MET B 2 3   ? 10.831  1.859   -15.318 1.00 0.00 ? 1   MET B HG2  2  
ATOM 2307  H HG3  . MET B 2 3   ? 11.218  1.213   -13.725 1.00 0.00 ? 1   MET B HG3  2  
ATOM 2308  H HE1  . MET B 2 3   ? 7.493   2.838   -13.796 1.00 0.00 ? 1   MET B HE1  2  
ATOM 2309  H HE2  . MET B 2 3   ? 8.347   1.302   -13.674 1.00 0.00 ? 1   MET B HE2  2  
ATOM 2310  H HE3  . MET B 2 3   ? 8.366   2.202   -15.190 1.00 0.00 ? 1   MET B HE3  2  
ATOM 2311  N N    . ALA B 2 4   ? 12.175  1.932   -11.324 1.00 0.00 ? 2   ALA B N    2  
ATOM 2312  C CA   . ALA B 2 4   ? 12.371  0.928   -10.287 1.00 0.00 ? 2   ALA B CA   2  
ATOM 2313  C C    . ALA B 2 4   ? 11.847  -0.426  -10.746 1.00 0.00 ? 2   ALA B C    2  
ATOM 2314  O O    . ALA B 2 4   ? 11.296  -0.544  -11.841 1.00 0.00 ? 2   ALA B O    2  
ATOM 2315  C CB   . ALA B 2 4   ? 11.682  1.350   -8.999  1.00 0.00 ? 2   ALA B CB   2  
ATOM 2316  H H    . ALA B 2 4   ? 11.262  2.211   -11.553 1.00 0.00 ? 2   ALA B H    2  
ATOM 2317  H HA   . ALA B 2 4   ? 13.431  0.848   -10.094 1.00 0.00 ? 2   ALA B HA   2  
ATOM 2318  H HB1  . ALA B 2 4   ? 11.878  0.619   -8.228  1.00 0.00 ? 2   ALA B HB1  2  
ATOM 2319  H HB2  . ALA B 2 4   ? 10.618  1.420   -9.166  1.00 0.00 ? 2   ALA B HB2  2  
ATOM 2320  H HB3  . ALA B 2 4   ? 12.061  2.312   -8.687  1.00 0.00 ? 2   ALA B HB3  2  
ATOM 2321  N N    . THR B 2 5   ? 12.006  -1.436  -9.899  1.00 0.00 ? 3   THR B N    2  
ATOM 2322  C CA   . THR B 2 5   ? 11.557  -2.786  -10.206 1.00 0.00 ? 3   THR B CA   2  
ATOM 2323  C C    . THR B 2 5   ? 10.050  -2.937  -9.981  1.00 0.00 ? 3   THR B C    2  
ATOM 2324  O O    . THR B 2 5   ? 9.600   -3.826  -9.257  1.00 0.00 ? 3   THR B O    2  
ATOM 2325  C CB   . THR B 2 5   ? 12.307  -3.807  -9.334  1.00 0.00 ? 3   THR B CB   2  
ATOM 2326  O OG1  . THR B 2 5   ? 13.446  -3.174  -8.730  1.00 0.00 ? 3   THR B OG1  2  
ATOM 2327  C CG2  . THR B 2 5   ? 12.762  -5.000  -10.162 1.00 0.00 ? 3   THR B CG2  2  
ATOM 2328  H H    . THR B 2 5   ? 12.450  -1.274  -9.040  1.00 0.00 ? 3   THR B H    2  
ATOM 2329  H HA   . THR B 2 5   ? 11.783  -2.991  -11.242 1.00 0.00 ? 3   THR B HA   2  
ATOM 2330  H HB   . THR B 2 5   ? 11.642  -4.155  -8.557  1.00 0.00 ? 3   THR B HB   2  
ATOM 2331  H HG1  . THR B 2 5   ? 14.231  -3.704  -8.893  1.00 0.00 ? 3   THR B HG1  2  
ATOM 2332  H HG21 . THR B 2 5   ? 11.900  -5.497  -10.582 1.00 0.00 ? 3   THR B HG21 2  
ATOM 2333  H HG22 . THR B 2 5   ? 13.302  -5.690  -9.531  1.00 0.00 ? 3   THR B HG22 2  
ATOM 2334  H HG23 . THR B 2 5   ? 13.407  -4.661  -10.959 1.00 0.00 ? 3   THR B HG23 2  
ATOM 2335  N N    . SER B 2 6   ? 9.285   -2.050  -10.598 1.00 0.00 ? 4   SER B N    2  
ATOM 2336  C CA   . SER B 2 6   ? 7.832   -2.055  -10.495 1.00 0.00 ? 4   SER B CA   2  
ATOM 2337  C C    . SER B 2 6   ? 7.241   -1.412  -11.744 1.00 0.00 ? 4   SER B C    2  
ATOM 2338  O O    . SER B 2 6   ? 7.389   -0.208  -11.959 1.00 0.00 ? 4   SER B O    2  
ATOM 2339  C CB   . SER B 2 6   ? 7.382   -1.295  -9.241  1.00 0.00 ? 4   SER B CB   2  
ATOM 2340  O OG   . SER B 2 6   ? 8.024   -1.799  -8.078  1.00 0.00 ? 4   SER B OG   2  
ATOM 2341  H H    . SER B 2 6   ? 9.714   -1.364  -11.155 1.00 0.00 ? 4   SER B H    2  
ATOM 2342  H HA   . SER B 2 6   ? 7.501   -3.081  -10.433 1.00 0.00 ? 4   SER B HA   2  
ATOM 2343  H HB2  . SER B 2 6   ? 7.631   -0.249  -9.348  1.00 0.00 ? 4   SER B HB2  2  
ATOM 2344  H HB3  . SER B 2 6   ? 6.314   -1.400  -9.122  1.00 0.00 ? 4   SER B HB3  2  
ATOM 2345  H HG   . SER B 2 6   ? 8.504   -2.607  -8.307  1.00 0.00 ? 4   SER B HG   2  
ATOM 2346  N N    . SER B 2 7   ? 6.607   -2.216  -12.586 1.00 0.00 ? 5   SER B N    2  
ATOM 2347  C CA   . SER B 2 7   ? 6.019   -1.716  -13.824 1.00 0.00 ? 5   SER B CA   2  
ATOM 2348  C C    . SER B 2 7   ? 4.831   -2.574  -14.245 1.00 0.00 ? 5   SER B C    2  
ATOM 2349  O O    . SER B 2 7   ? 4.713   -2.968  -15.406 1.00 0.00 ? 5   SER B O    2  
ATOM 2350  C CB   . SER B 2 7   ? 7.074   -1.695  -14.936 1.00 0.00 ? 5   SER B CB   2  
ATOM 2351  O OG   . SER B 2 7   ? 8.220   -0.957  -14.540 1.00 0.00 ? 5   SER B OG   2  
ATOM 2352  H H    . SER B 2 7   ? 6.516   -3.174  -12.363 1.00 0.00 ? 5   SER B H    2  
ATOM 2353  H HA   . SER B 2 7   ? 5.675   -0.709  -13.645 1.00 0.00 ? 5   SER B HA   2  
ATOM 2354  H HB2  . SER B 2 7   ? 7.374   -2.707  -15.165 1.00 0.00 ? 5   SER B HB2  2  
ATOM 2355  H HB3  . SER B 2 7   ? 6.653   -1.236  -15.819 1.00 0.00 ? 5   SER B HB3  2  
ATOM 2356  H HG   . SER B 2 7   ? 8.080   -0.613  -13.649 1.00 0.00 ? 5   SER B HG   2  
ATOM 2357  N N    . GLU B 2 8   ? 3.954   -2.860  -13.297 1.00 0.00 ? 6   GLU B N    2  
ATOM 2358  C CA   . GLU B 2 8   ? 2.783   -3.668  -13.559 1.00 0.00 ? 6   GLU B CA   2  
ATOM 2359  C C    . GLU B 2 8   ? 1.624   -2.771  -13.969 1.00 0.00 ? 6   GLU B C    2  
ATOM 2360  O O    . GLU B 2 8   ? 1.797   -1.556  -14.108 1.00 0.00 ? 6   GLU B O    2  
ATOM 2361  C CB   . GLU B 2 8   ? 2.415   -4.489  -12.319 1.00 0.00 ? 6   GLU B CB   2  
ATOM 2362  C CG   . GLU B 2 8   ? 3.555   -5.355  -11.788 1.00 0.00 ? 6   GLU B CG   2  
ATOM 2363  C CD   . GLU B 2 8   ? 4.656   -4.545  -11.131 1.00 0.00 ? 6   GLU B CD   2  
ATOM 2364  O OE1  . GLU B 2 8   ? 5.848   -4.817  -11.394 1.00 0.00 ? 6   GLU B OE1  2  
ATOM 2365  O OE2  . GLU B 2 8   ? 4.341   -3.615  -10.363 1.00 0.00 ? 6   GLU B OE2  2  
ATOM 2366  H H    . GLU B 2 8   ? 4.098   -2.522  -12.389 1.00 0.00 ? 6   GLU B H    2  
ATOM 2367  H HA   . GLU B 2 8   ? 3.014   -4.337  -14.374 1.00 0.00 ? 6   GLU B HA   2  
ATOM 2368  H HB2  . GLU B 2 8   ? 2.112   -3.814  -11.533 1.00 0.00 ? 6   GLU B HB2  2  
ATOM 2369  H HB3  . GLU B 2 8   ? 1.586   -5.136  -12.564 1.00 0.00 ? 6   GLU B HB3  2  
ATOM 2370  H HG2  . GLU B 2 8   ? 3.155   -6.046  -11.061 1.00 0.00 ? 6   GLU B HG2  2  
ATOM 2371  H HG3  . GLU B 2 8   ? 3.979   -5.911  -12.612 1.00 0.00 ? 6   GLU B HG3  2  
ATOM 2372  N N    . GLU B 2 9   ? 0.453   -3.360  -14.150 1.00 0.00 ? 7   GLU B N    2  
ATOM 2373  C CA   . GLU B 2 9   ? -0.726  -2.610  -14.555 1.00 0.00 ? 7   GLU B CA   2  
ATOM 2374  C C    . GLU B 2 9   ? -1.115  -1.590  -13.486 1.00 0.00 ? 7   GLU B C    2  
ATOM 2375  O O    . GLU B 2 9   ? -1.509  -1.957  -12.379 1.00 0.00 ? 7   GLU B O    2  
ATOM 2376  C CB   . GLU B 2 9   ? -1.894  -3.562  -14.826 1.00 0.00 ? 7   GLU B CB   2  
ATOM 2377  C CG   . GLU B 2 9   ? -3.021  -2.926  -15.621 1.00 0.00 ? 7   GLU B CG   2  
ATOM 2378  C CD   . GLU B 2 9   ? -2.541  -2.332  -16.931 1.00 0.00 ? 7   GLU B CD   2  
ATOM 2379  O OE1  . GLU B 2 9   ? -1.975  -1.218  -16.905 1.00 0.00 ? 7   GLU B OE1  2  
ATOM 2380  O OE2  . GLU B 2 9   ? -2.725  -2.983  -17.979 1.00 0.00 ? 7   GLU B OE2  2  
ATOM 2381  H H    . GLU B 2 9   ? 0.377   -4.326  -14.002 1.00 0.00 ? 7   GLU B H    2  
ATOM 2382  H HA   . GLU B 2 9   ? -0.486  -2.082  -15.466 1.00 0.00 ? 7   GLU B HA   2  
ATOM 2383  H HB2  . GLU B 2 9   ? -1.527  -4.414  -15.379 1.00 0.00 ? 7   GLU B HB2  2  
ATOM 2384  H HB3  . GLU B 2 9   ? -2.293  -3.901  -13.881 1.00 0.00 ? 7   GLU B HB3  2  
ATOM 2385  H HG2  . GLU B 2 9   ? -3.764  -3.680  -15.836 1.00 0.00 ? 7   GLU B HG2  2  
ATOM 2386  H HG3  . GLU B 2 9   ? -3.466  -2.141  -15.027 1.00 0.00 ? 7   GLU B HG3  2  
ATOM 2387  N N    . VAL B 2 10  ? -0.995  -0.314  -13.824 1.00 0.00 ? 8   VAL B N    2  
ATOM 2388  C CA   . VAL B 2 10  ? -1.331  0.764   -12.902 1.00 0.00 ? 8   VAL B CA   2  
ATOM 2389  C C    . VAL B 2 10  ? -2.826  1.028   -12.933 1.00 0.00 ? 8   VAL B C    2  
ATOM 2390  O O    . VAL B 2 10  ? -3.375  1.448   -13.950 1.00 0.00 ? 8   VAL B O    2  
ATOM 2391  C CB   . VAL B 2 10  ? -0.581  2.066   -13.245 1.00 0.00 ? 8   VAL B CB   2  
ATOM 2392  C CG1  . VAL B 2 10  ? -1.055  3.203   -12.350 1.00 0.00 ? 8   VAL B CG1  2  
ATOM 2393  C CG2  . VAL B 2 10  ? 0.923   1.869   -13.115 1.00 0.00 ? 8   VAL B CG2  2  
ATOM 2394  H H    . VAL B 2 10  ? -0.695  -0.091  -14.733 1.00 0.00 ? 8   VAL B H    2  
ATOM 2395  H HA   . VAL B 2 10  ? -1.048  0.463   -11.899 1.00 0.00 ? 8   VAL B HA   2  
ATOM 2396  H HB   . VAL B 2 10  ? -0.803  2.327   -14.269 1.00 0.00 ? 8   VAL B HB   2  
ATOM 2397  H HG11 . VAL B 2 10  ? -0.526  4.107   -12.605 1.00 0.00 ? 8   VAL B HG11 2  
ATOM 2398  H HG12 . VAL B 2 10  ? -0.865  2.951   -11.318 1.00 0.00 ? 8   VAL B HG12 2  
ATOM 2399  H HG13 . VAL B 2 10  ? -2.116  3.353   -12.494 1.00 0.00 ? 8   VAL B HG13 2  
ATOM 2400  H HG21 . VAL B 2 10  ? 1.162   1.575   -12.104 1.00 0.00 ? 8   VAL B HG21 2  
ATOM 2401  H HG22 . VAL B 2 10  ? 1.428   2.795   -13.349 1.00 0.00 ? 8   VAL B HG22 2  
ATOM 2402  H HG23 . VAL B 2 10  ? 1.246   1.099   -13.799 1.00 0.00 ? 8   VAL B HG23 2  
ATOM 2403  N N    . LEU B 2 11  ? -3.479  0.782   -11.814 1.00 0.00 ? 9   LEU B N    2  
ATOM 2404  C CA   . LEU B 2 11  ? -4.912  0.982   -11.722 1.00 0.00 ? 9   LEU B CA   2  
ATOM 2405  C C    . LEU B 2 11  ? -5.246  2.355   -11.153 1.00 0.00 ? 9   LEU B C    2  
ATOM 2406  O O    . LEU B 2 11  ? -6.290  2.925   -11.463 1.00 0.00 ? 9   LEU B O    2  
ATOM 2407  C CB   . LEU B 2 11  ? -5.543  -0.114  -10.861 1.00 0.00 ? 9   LEU B CB   2  
ATOM 2408  C CG   . LEU B 2 11  ? -5.205  -1.547  -11.282 1.00 0.00 ? 9   LEU B CG   2  
ATOM 2409  C CD1  . LEU B 2 11  ? -5.750  -2.542  -10.270 1.00 0.00 ? 9   LEU B CD1  2  
ATOM 2410  C CD2  . LEU B 2 11  ? -5.759  -1.843  -12.669 1.00 0.00 ? 9   LEU B CD2  2  
ATOM 2411  H H    . LEU B 2 11  ? -2.983  0.457   -11.028 1.00 0.00 ? 9   LEU B H    2  
ATOM 2412  H HA   . LEU B 2 11  ? -5.311  0.918   -12.721 1.00 0.00 ? 9   LEU B HA   2  
ATOM 2413  H HB2  . LEU B 2 11  ? -5.216  0.027   -9.841  1.00 0.00 ? 9   LEU B HB2  2  
ATOM 2414  H HB3  . LEU B 2 11  ? -6.615  0.003   -10.895 1.00 0.00 ? 9   LEU B HB3  2  
ATOM 2415  H HG   . LEU B 2 11  ? -4.131  -1.661  -11.318 1.00 0.00 ? 9   LEU B HG   2  
ATOM 2416  H HD11 . LEU B 2 11  ? -5.570  -3.546  -10.622 1.00 0.00 ? 9   LEU B HD11 2  
ATOM 2417  H HD12 . LEU B 2 11  ? -6.812  -2.386  -10.150 1.00 0.00 ? 9   LEU B HD12 2  
ATOM 2418  H HD13 . LEU B 2 11  ? -5.255  -2.398  -9.322  1.00 0.00 ? 9   LEU B HD13 2  
ATOM 2419  H HD21 . LEU B 2 11  ? -6.835  -1.759  -12.652 1.00 0.00 ? 9   LEU B HD21 2  
ATOM 2420  H HD22 . LEU B 2 11  ? -5.480  -2.844  -12.961 1.00 0.00 ? 9   LEU B HD22 2  
ATOM 2421  H HD23 . LEU B 2 11  ? -5.353  -1.135  -13.377 1.00 0.00 ? 9   LEU B HD23 2  
ATOM 2422  N N    . LEU B 2 12  ? -4.365  2.888   -10.317 1.00 0.00 ? 10  LEU B N    2  
ATOM 2423  C CA   . LEU B 2 12  ? -4.601  4.192   -9.721  1.00 0.00 ? 10  LEU B CA   2  
ATOM 2424  C C    . LEU B 2 12  ? -3.326  5.007   -9.595  1.00 0.00 ? 10  LEU B C    2  
ATOM 2425  O O    . LEU B 2 12  ? -2.273  4.483   -9.232  1.00 0.00 ? 10  LEU B O    2  
ATOM 2426  C CB   . LEU B 2 12  ? -5.216  4.030   -8.337  1.00 0.00 ? 10  LEU B CB   2  
ATOM 2427  C CG   . LEU B 2 12  ? -5.725  5.329   -7.694  1.00 0.00 ? 10  LEU B CG   2  
ATOM 2428  C CD1  . LEU B 2 12  ? -7.174  5.593   -8.044  1.00 0.00 ? 10  LEU B CD1  2  
ATOM 2429  C CD2  . LEU B 2 12  ? -5.561  5.287   -6.191  1.00 0.00 ? 10  LEU B CD2  2  
ATOM 2430  H H    . LEU B 2 12  ? -3.555  2.390   -10.088 1.00 0.00 ? 10  LEU B H    2  
ATOM 2431  H HA   . LEU B 2 12  ? -5.296  4.725   -10.348 1.00 0.00 ? 10  LEU B HA   2  
ATOM 2432  H HB2  . LEU B 2 12  ? -6.031  3.332   -8.419  1.00 0.00 ? 10  LEU B HB2  2  
ATOM 2433  H HB3  . LEU B 2 12  ? -4.468  3.604   -7.685  1.00 0.00 ? 10  LEU B HB3  2  
ATOM 2434  H HG   . LEU B 2 12  ? -5.141  6.157   -8.068  1.00 0.00 ? 10  LEU B HG   2  
ATOM 2435  H HD11 . LEU B 2 12  ? -7.523  6.451   -7.486  1.00 0.00 ? 10  LEU B HD11 2  
ATOM 2436  H HD12 . LEU B 2 12  ? -7.767  4.730   -7.784  1.00 0.00 ? 10  LEU B HD12 2  
ATOM 2437  H HD13 . LEU B 2 12  ? -7.259  5.791   -9.099  1.00 0.00 ? 10  LEU B HD13 2  
ATOM 2438  H HD21 . LEU B 2 12  ? -5.981  6.182   -5.757  1.00 0.00 ? 10  LEU B HD21 2  
ATOM 2439  H HD22 . LEU B 2 12  ? -4.510  5.226   -5.946  1.00 0.00 ? 10  LEU B HD22 2  
ATOM 2440  H HD23 . LEU B 2 12  ? -6.073  4.422   -5.796  1.00 0.00 ? 10  LEU B HD23 2  
ATOM 2441  N N    . ILE B 2 13  ? -3.435  6.289   -9.904  1.00 0.00 ? 11  ILE B N    2  
ATOM 2442  C CA   . ILE B 2 13  ? -2.320  7.207   -9.781  1.00 0.00 ? 11  ILE B CA   2  
ATOM 2443  C C    . ILE B 2 13  ? -2.709  8.328   -8.836  1.00 0.00 ? 11  ILE B C    2  
ATOM 2444  O O    . ILE B 2 13  ? -3.697  9.030   -9.066  1.00 0.00 ? 11  ILE B O    2  
ATOM 2445  C CB   . ILE B 2 13  ? -1.885  7.827   -11.124 1.00 0.00 ? 11  ILE B CB   2  
ATOM 2446  C CG1  . ILE B 2 13  ? -1.466  6.738   -12.114 1.00 0.00 ? 11  ILE B CG1  2  
ATOM 2447  C CG2  . ILE B 2 13  ? -0.741  8.813   -10.886 1.00 0.00 ? 11  ILE B CG2  2  
ATOM 2448  C CD1  . ILE B 2 13  ? -1.186  7.254   -13.510 1.00 0.00 ? 11  ILE B CD1  2  
ATOM 2449  H H    . ILE B 2 13  ? -4.296  6.629   -10.225 1.00 0.00 ? 11  ILE B H    2  
ATOM 2450  H HA   . ILE B 2 13  ? -1.483  6.665   -9.362  1.00 0.00 ? 11  ILE B HA   2  
ATOM 2451  H HB   . ILE B 2 13  ? -2.721  8.376   -11.531 1.00 0.00 ? 11  ILE B HB   2  
ATOM 2452  H HG12 . ILE B 2 13  ? -0.568  6.259   -11.753 1.00 0.00 ? 11  ILE B HG12 2  
ATOM 2453  H HG13 . ILE B 2 13  ? -2.255  6.003   -12.183 1.00 0.00 ? 11  ILE B HG13 2  
ATOM 2454  H HG21 . ILE B 2 13  ? -1.085  9.614   -10.246 1.00 0.00 ? 11  ILE B HG21 2  
ATOM 2455  H HG22 . ILE B 2 13  ? -0.411  9.220   -11.827 1.00 0.00 ? 11  ILE B HG22 2  
ATOM 2456  H HG23 . ILE B 2 13  ? 0.081   8.300   -10.406 1.00 0.00 ? 11  ILE B HG23 2  
ATOM 2457  H HD11 . ILE B 2 13  ? -2.064  7.752   -13.893 1.00 0.00 ? 11  ILE B HD11 2  
ATOM 2458  H HD12 . ILE B 2 13  ? -0.932  6.426   -14.155 1.00 0.00 ? 11  ILE B HD12 2  
ATOM 2459  H HD13 . ILE B 2 13  ? -0.363  7.951   -13.477 1.00 0.00 ? 11  ILE B HD13 2  
ATOM 2460  N N    . VAL B 2 14  ? -1.948  8.481   -7.775  1.00 0.00 ? 12  VAL B N    2  
ATOM 2461  C CA   . VAL B 2 14  ? -2.200  9.508   -6.789  1.00 0.00 ? 12  VAL B CA   2  
ATOM 2462  C C    . VAL B 2 14  ? -1.094  10.543  -6.831  1.00 0.00 ? 12  VAL B C    2  
ATOM 2463  O O    . VAL B 2 14  ? 0.049   10.226  -7.155  1.00 0.00 ? 12  VAL B O    2  
ATOM 2464  C CB   . VAL B 2 14  ? -2.292  8.919   -5.373  1.00 0.00 ? 12  VAL B CB   2  
ATOM 2465  C CG1  . VAL B 2 14  ? -2.969  9.890   -4.430  1.00 0.00 ? 12  VAL B CG1  2  
ATOM 2466  C CG2  . VAL B 2 14  ? -3.032  7.593   -5.395  1.00 0.00 ? 12  VAL B CG2  2  
ATOM 2467  H H    . VAL B 2 14  ? -1.174  7.882   -7.649  1.00 0.00 ? 12  VAL B H    2  
ATOM 2468  H HA   . VAL B 2 14  ? -3.138  9.982   -7.023  1.00 0.00 ? 12  VAL B HA   2  
ATOM 2469  H HB   . VAL B 2 14  ? -1.291  8.746   -5.016  1.00 0.00 ? 12  VAL B HB   2  
ATOM 2470  H HG11 . VAL B 2 14  ? -3.948  10.142  -4.813  1.00 0.00 ? 12  VAL B HG11 2  
ATOM 2471  H HG12 . VAL B 2 14  ? -2.373  10.788  -4.349  1.00 0.00 ? 12  VAL B HG12 2  
ATOM 2472  H HG13 . VAL B 2 14  ? -3.071  9.435   -3.456  1.00 0.00 ? 12  VAL B HG13 2  
ATOM 2473  H HG21 . VAL B 2 14  ? -4.040  7.749   -5.750  1.00 0.00 ? 12  VAL B HG21 2  
ATOM 2474  H HG22 . VAL B 2 14  ? -3.061  7.181   -4.397  1.00 0.00 ? 12  VAL B HG22 2  
ATOM 2475  H HG23 . VAL B 2 14  ? -2.520  6.907   -6.053  1.00 0.00 ? 12  VAL B HG23 2  
ATOM 2476  N N    . LYS B 2 15  ? -1.433  11.773  -6.512  1.00 0.00 ? 13  LYS B N    2  
ATOM 2477  C CA   . LYS B 2 15  ? -0.459  12.848  -6.525  1.00 0.00 ? 13  LYS B CA   2  
ATOM 2478  C C    . LYS B 2 15  ? -0.139  13.272  -5.110  1.00 0.00 ? 13  LYS B C    2  
ATOM 2479  O O    . LYS B 2 15  ? -0.756  12.779  -4.172  1.00 0.00 ? 13  LYS B O    2  
ATOM 2480  C CB   . LYS B 2 15  ? -0.969  14.050  -7.320  1.00 0.00 ? 13  LYS B CB   2  
ATOM 2481  C CG   . LYS B 2 15  ? -1.141  13.777  -8.803  1.00 0.00 ? 13  LYS B CG   2  
ATOM 2482  C CD   . LYS B 2 15  ? -2.599  13.555  -9.149  1.00 0.00 ? 13  LYS B CD   2  
ATOM 2483  C CE   . LYS B 2 15  ? -2.887  12.099  -9.468  1.00 0.00 ? 13  LYS B CE   2  
ATOM 2484  N NZ   . LYS B 2 15  ? -4.206  11.668  -8.930  1.00 0.00 ? 13  LYS B NZ   2  
ATOM 2485  H H    . LYS B 2 15  ? -2.358  11.957  -6.225  1.00 0.00 ? 13  LYS B H    2  
ATOM 2486  H HA   . LYS B 2 15  ? 0.442   12.474  -6.989  1.00 0.00 ? 13  LYS B HA   2  
ATOM 2487  H HB2  . LYS B 2 15  ? -1.926  14.350  -6.920  1.00 0.00 ? 13  LYS B HB2  2  
ATOM 2488  H HB3  . LYS B 2 15  ? -0.270  14.866  -7.204  1.00 0.00 ? 13  LYS B HB3  2  
ATOM 2489  H HG2  . LYS B 2 15  ? -0.772  14.625  -9.360  1.00 0.00 ? 13  LYS B HG2  2  
ATOM 2490  H HG3  . LYS B 2 15  ? -0.576  12.895  -9.064  1.00 0.00 ? 13  LYS B HG3  2  
ATOM 2491  H HD2  . LYS B 2 15  ? -3.203  13.851  -8.305  1.00 0.00 ? 13  LYS B HD2  2  
ATOM 2492  H HD3  . LYS B 2 15  ? -2.850  14.159  -10.005 1.00 0.00 ? 13  LYS B HD3  2  
ATOM 2493  H HE2  . LYS B 2 15  ? -2.885  11.971  -10.539 1.00 0.00 ? 13  LYS B HE2  2  
ATOM 2494  H HE3  . LYS B 2 15  ? -2.112  11.489  -9.030  1.00 0.00 ? 13  LYS B HE3  2  
ATOM 2495  H HZ1  . LYS B 2 15  ? -4.333  10.644  -9.077  1.00 0.00 ? 13  LYS B HZ1  2  
ATOM 2496  H HZ2  . LYS B 2 15  ? -4.974  12.177  -9.406  1.00 0.00 ? 13  LYS B HZ2  2  
ATOM 2497  H HZ3  . LYS B 2 15  ? -4.257  11.866  -7.901  1.00 0.00 ? 13  LYS B HZ3  2  
ATOM 2498  N N    . LYS B 2 16  ? 0.779   14.233  -5.009  1.00 0.00 ? 14  LYS B N    2  
ATOM 2499  C CA   . LYS B 2 16  ? 1.265   14.798  -3.741  1.00 0.00 ? 14  LYS B CA   2  
ATOM 2500  C C    . LYS B 2 16  ? 0.968   13.922  -2.523  1.00 0.00 ? 14  LYS B C    2  
ATOM 2501  O O    . LYS B 2 16  ? 0.063   14.201  -1.740  1.00 0.00 ? 14  LYS B O    2  
ATOM 2502  C CB   . LYS B 2 16  ? 0.659   16.182  -3.531  1.00 0.00 ? 14  LYS B CB   2  
ATOM 2503  C CG   . LYS B 2 16  ? 1.334   17.283  -4.330  1.00 0.00 ? 14  LYS B CG   2  
ATOM 2504  C CD   . LYS B 2 16  ? 0.829   18.657  -3.913  1.00 0.00 ? 14  LYS B CD   2  
ATOM 2505  C CE   . LYS B 2 16  ? 1.425   19.092  -2.583  1.00 0.00 ? 14  LYS B CE   2  
ATOM 2506  N NZ   . LYS B 2 16  ? 0.471   19.907  -1.783  1.00 0.00 ? 14  LYS B NZ   2  
ATOM 2507  H H    . LYS B 2 16  ? 1.165   14.574  -5.837  1.00 0.00 ? 14  LYS B H    2  
ATOM 2508  H HA   . LYS B 2 16  ? 2.335   14.906  -3.826  1.00 0.00 ? 14  LYS B HA   2  
ATOM 2509  H HB2  . LYS B 2 16  ? -0.379  16.146  -3.825  1.00 0.00 ? 14  LYS B HB2  2  
ATOM 2510  H HB3  . LYS B 2 16  ? 0.719   16.436  -2.484  1.00 0.00 ? 14  LYS B HB3  2  
ATOM 2511  H HG2  . LYS B 2 16  ? 2.399   17.236  -4.163  1.00 0.00 ? 14  LYS B HG2  2  
ATOM 2512  H HG3  . LYS B 2 16  ? 1.124   17.135  -5.378  1.00 0.00 ? 14  LYS B HG3  2  
ATOM 2513  H HD2  . LYS B 2 16  ? 1.104   19.376  -4.670  1.00 0.00 ? 14  LYS B HD2  2  
ATOM 2514  H HD3  . LYS B 2 16  ? -0.248  18.621  -3.822  1.00 0.00 ? 14  LYS B HD3  2  
ATOM 2515  H HE2  . LYS B 2 16  ? 1.691   18.211  -2.017  1.00 0.00 ? 14  LYS B HE2  2  
ATOM 2516  H HE3  . LYS B 2 16  ? 2.312   19.676  -2.774  1.00 0.00 ? 14  LYS B HE3  2  
ATOM 2517  H HZ1  . LYS B 2 16  ? 0.980   20.589  -1.191  1.00 0.00 ? 14  LYS B HZ1  2  
ATOM 2518  H HZ2  . LYS B 2 16  ? -0.097  19.289  -1.165  1.00 0.00 ? 14  LYS B HZ2  2  
ATOM 2519  H HZ3  . LYS B 2 16  ? -0.184  20.427  -2.409  1.00 0.00 ? 14  LYS B HZ3  2  
ATOM 2520  N N    . VAL B 2 17  ? 1.719   12.841  -2.407  1.00 0.00 ? 15  VAL B N    2  
ATOM 2521  C CA   . VAL B 2 17  ? 1.592   11.926  -1.286  1.00 0.00 ? 15  VAL B CA   2  
ATOM 2522  C C    . VAL B 2 17  ? 2.915   11.879  -0.541  1.00 0.00 ? 15  VAL B C    2  
ATOM 2523  O O    . VAL B 2 17  ? 3.946   11.558  -1.122  1.00 0.00 ? 15  VAL B O    2  
ATOM 2524  C CB   . VAL B 2 17  ? 1.199   10.497  -1.734  1.00 0.00 ? 15  VAL B CB   2  
ATOM 2525  C CG1  . VAL B 2 17  ? 1.346   9.507   -0.586  1.00 0.00 ? 15  VAL B CG1  2  
ATOM 2526  C CG2  . VAL B 2 17  ? -0.223  10.471  -2.262  1.00 0.00 ? 15  VAL B CG2  2  
ATOM 2527  H H    . VAL B 2 17  ? 2.382   12.651  -3.109  1.00 0.00 ? 15  VAL B H    2  
ATOM 2528  H HA   . VAL B 2 17  ? 0.825   12.306  -0.625  1.00 0.00 ? 15  VAL B HA   2  
ATOM 2529  H HB   . VAL B 2 17  ? 1.863   10.194  -2.533  1.00 0.00 ? 15  VAL B HB   2  
ATOM 2530  H HG11 . VAL B 2 17  ? 1.059   8.521   -0.922  1.00 0.00 ? 15  VAL B HG11 2  
ATOM 2531  H HG12 . VAL B 2 17  ? 0.709   9.809   0.233   1.00 0.00 ? 15  VAL B HG12 2  
ATOM 2532  H HG13 . VAL B 2 17  ? 2.374   9.490   -0.255  1.00 0.00 ? 15  VAL B HG13 2  
ATOM 2533  H HG21 . VAL B 2 17  ? -0.482  9.463   -2.551  1.00 0.00 ? 15  VAL B HG21 2  
ATOM 2534  H HG22 . VAL B 2 17  ? -0.301  11.123  -3.118  1.00 0.00 ? 15  VAL B HG22 2  
ATOM 2535  H HG23 . VAL B 2 17  ? -0.899  10.808  -1.489  1.00 0.00 ? 15  VAL B HG23 2  
ATOM 2536  N N    . ARG B 2 18  ? 2.881   12.215  0.732   1.00 0.00 ? 16  ARG B N    2  
ATOM 2537  C CA   . ARG B 2 18  ? 4.073   12.227  1.552   1.00 0.00 ? 16  ARG B CA   2  
ATOM 2538  C C    . ARG B 2 18  ? 4.313   10.878  2.202   1.00 0.00 ? 16  ARG B C    2  
ATOM 2539  O O    . ARG B 2 18  ? 3.391   10.238  2.696   1.00 0.00 ? 16  ARG B O    2  
ATOM 2540  C CB   . ARG B 2 18  ? 3.956   13.283  2.652   1.00 0.00 ? 16  ARG B CB   2  
ATOM 2541  C CG   . ARG B 2 18  ? 4.233   14.695  2.188   1.00 0.00 ? 16  ARG B CG   2  
ATOM 2542  C CD   . ARG B 2 18  ? 4.206   15.668  3.353   1.00 0.00 ? 16  ARG B CD   2  
ATOM 2543  N NE   . ARG B 2 18  ? 4.579   17.015  2.939   1.00 0.00 ? 16  ARG B NE   2  
ATOM 2544  C CZ   . ARG B 2 18  ? 4.629   18.064  3.755   1.00 0.00 ? 16  ARG B CZ   2  
ATOM 2545  N NH1  . ARG B 2 18  ? 4.326   17.935  5.047   1.00 0.00 ? 16  ARG B NH1  2  
ATOM 2546  N NH2  . ARG B 2 18  ? 4.985   19.248  3.274   1.00 0.00 ? 16  ARG B NH2  2  
ATOM 2547  H H    . ARG B 2 18  ? 2.019   12.458  1.140   1.00 0.00 ? 16  ARG B H    2  
ATOM 2548  H HA   . ARG B 2 18  ? 4.914   12.469  0.920   1.00 0.00 ? 16  ARG B HA   2  
ATOM 2549  H HB2  . ARG B 2 18  ? 2.956   13.254  3.053   1.00 0.00 ? 16  ARG B HB2  2  
ATOM 2550  H HB3  . ARG B 2 18  ? 4.656   13.041  3.438   1.00 0.00 ? 16  ARG B HB3  2  
ATOM 2551  H HG2  . ARG B 2 18  ? 5.207   14.729  1.725   1.00 0.00 ? 16  ARG B HG2  2  
ATOM 2552  H HG3  . ARG B 2 18  ? 3.478   14.982  1.471   1.00 0.00 ? 16  ARG B HG3  2  
ATOM 2553  H HD2  . ARG B 2 18  ? 3.206   15.692  3.763   1.00 0.00 ? 16  ARG B HD2  2  
ATOM 2554  H HD3  . ARG B 2 18  ? 4.897   15.327  4.109   1.00 0.00 ? 16  ARG B HD3  2  
ATOM 2555  H HE   . ARG B 2 18  ? 4.812   17.142  1.978   1.00 0.00 ? 16  ARG B HE   2  
ATOM 2556  H HH11 . ARG B 2 18  ? 4.056   17.036  5.425   1.00 0.00 ? 16  ARG B HH11 2  
ATOM 2557  H HH12 . ARG B 2 18  ? 4.363   18.726  5.656   1.00 0.00 ? 16  ARG B HH12 2  
ATOM 2558  H HH21 . ARG B 2 18  ? 5.216   19.344  2.301   1.00 0.00 ? 16  ARG B HH21 2  
ATOM 2559  H HH22 . ARG B 2 18  ? 5.025   20.046  3.874   1.00 0.00 ? 16  ARG B HH22 2  
ATOM 2560  N N    . GLN B 2 19  ? 5.555   10.445  2.165   1.00 0.00 ? 17  GLN B N    2  
ATOM 2561  C CA   . GLN B 2 19  ? 5.949   9.207   2.798   1.00 0.00 ? 17  GLN B CA   2  
ATOM 2562  C C    . GLN B 2 19  ? 7.174   9.472   3.645   1.00 0.00 ? 17  GLN B C    2  
ATOM 2563  O O    . GLN B 2 19  ? 8.265   9.707   3.119   1.00 0.00 ? 17  GLN B O    2  
ATOM 2564  C CB   . GLN B 2 19  ? 6.237   8.112   1.775   1.00 0.00 ? 17  GLN B CB   2  
ATOM 2565  C CG   . GLN B 2 19  ? 5.738   6.743   2.203   1.00 0.00 ? 17  GLN B CG   2  
ATOM 2566  C CD   . GLN B 2 19  ? 6.558   6.125   3.323   1.00 0.00 ? 17  GLN B CD   2  
ATOM 2567  O OE1  . GLN B 2 19  ? 7.775   6.285   3.390   1.00 0.00 ? 17  GLN B OE1  2  
ATOM 2568  N NE2  . GLN B 2 19  ? 5.885   5.436   4.229   1.00 0.00 ? 17  GLN B NE2  2  
ATOM 2569  H H    . GLN B 2 19  ? 6.228   10.969  1.676   1.00 0.00 ? 17  GLN B H    2  
ATOM 2570  H HA   . GLN B 2 19  ? 5.141   8.889   3.443   1.00 0.00 ? 17  GLN B HA   2  
ATOM 2571  H HB2  . GLN B 2 19  ? 5.758   8.371   0.841   1.00 0.00 ? 17  GLN B HB2  2  
ATOM 2572  H HB3  . GLN B 2 19  ? 7.304   8.051   1.618   1.00 0.00 ? 17  GLN B HB3  2  
ATOM 2573  H HG2  . GLN B 2 19  ? 4.718   6.838   2.542   1.00 0.00 ? 17  GLN B HG2  2  
ATOM 2574  H HG3  . GLN B 2 19  ? 5.770   6.082   1.350   1.00 0.00 ? 17  GLN B HG3  2  
ATOM 2575  H HE21 . GLN B 2 19  ? 4.904   5.377   4.130   1.00 0.00 ? 17  GLN B HE21 2  
ATOM 2576  H HE22 . GLN B 2 19  ? 6.384   4.995   4.942   1.00 0.00 ? 17  GLN B HE22 2  
ATOM 2577  N N    . LYS B 2 20  ? 6.965   9.488   4.949   1.00 0.00 ? 18  LYS B N    2  
ATOM 2578  C CA   . LYS B 2 20  ? 8.024   9.731   5.913   1.00 0.00 ? 18  LYS B CA   2  
ATOM 2579  C C    . LYS B 2 20  ? 8.604   11.134  5.748   1.00 0.00 ? 18  LYS B C    2  
ATOM 2580  O O    . LYS B 2 20  ? 9.819   11.309  5.657   1.00 0.00 ? 18  LYS B O    2  
ATOM 2581  C CB   . LYS B 2 20  ? 9.115   8.661   5.791   1.00 0.00 ? 18  LYS B CB   2  
ATOM 2582  C CG   . LYS B 2 20  ? 9.650   8.177   7.129   1.00 0.00 ? 18  LYS B CG   2  
ATOM 2583  C CD   . LYS B 2 20  ? 8.849   6.997   7.664   1.00 0.00 ? 18  LYS B CD   2  
ATOM 2584  C CE   . LYS B 2 20  ? 7.438   7.399   8.066   1.00 0.00 ? 18  LYS B CE   2  
ATOM 2585  N NZ   . LYS B 2 20  ? 6.419   6.891   7.111   1.00 0.00 ? 18  LYS B NZ   2  
ATOM 2586  H H    . LYS B 2 20  ? 6.045   9.324   5.283   1.00 0.00 ? 18  LYS B H    2  
ATOM 2587  H HA   . LYS B 2 20  ? 7.584   9.661   6.897   1.00 0.00 ? 18  LYS B HA   2  
ATOM 2588  H HB2  . LYS B 2 20  ? 8.705   7.809   5.265   1.00 0.00 ? 18  LYS B HB2  2  
ATOM 2589  H HB3  . LYS B 2 20  ? 9.936   9.063   5.222   1.00 0.00 ? 18  LYS B HB3  2  
ATOM 2590  H HG2  . LYS B 2 20  ? 10.678  7.873   7.005   1.00 0.00 ? 18  LYS B HG2  2  
ATOM 2591  H HG3  . LYS B 2 20  ? 9.597   8.989   7.842   1.00 0.00 ? 18  LYS B HG3  2  
ATOM 2592  H HD2  . LYS B 2 20  ? 8.789   6.241   6.896   1.00 0.00 ? 18  LYS B HD2  2  
ATOM 2593  H HD3  . LYS B 2 20  ? 9.358   6.593   8.527   1.00 0.00 ? 18  LYS B HD3  2  
ATOM 2594  H HE2  . LYS B 2 20  ? 7.227   6.991   9.046   1.00 0.00 ? 18  LYS B HE2  2  
ATOM 2595  H HE3  . LYS B 2 20  ? 7.378   8.475   8.105   1.00 0.00 ? 18  LYS B HE3  2  
ATOM 2596  H HZ1  . LYS B 2 20  ? 6.870   6.568   6.238   1.00 0.00 ? 18  LYS B HZ1  2  
ATOM 2597  H HZ2  . LYS B 2 20  ? 5.735   7.647   6.873   1.00 0.00 ? 18  LYS B HZ2  2  
ATOM 2598  H HZ3  . LYS B 2 20  ? 5.893   6.092   7.541   1.00 0.00 ? 18  LYS B HZ3  2  
ATOM 2599  N N    . LYS B 2 21  ? 7.707   12.124  5.702   1.00 0.00 ? 19  LYS B N    2  
ATOM 2600  C CA   . LYS B 2 21  ? 8.076   13.540  5.574   1.00 0.00 ? 19  LYS B CA   2  
ATOM 2601  C C    . LYS B 2 21  ? 8.625   13.872  4.182   1.00 0.00 ? 19  LYS B C    2  
ATOM 2602  O O    . LYS B 2 21  ? 9.376   14.833  4.023   1.00 0.00 ? 19  LYS B O    2  
ATOM 2603  C CB   . LYS B 2 21  ? 9.101   13.945  6.651   1.00 0.00 ? 19  LYS B CB   2  
ATOM 2604  C CG   . LYS B 2 21  ? 8.499   14.256  8.019   1.00 0.00 ? 19  LYS B CG   2  
ATOM 2605  C CD   . LYS B 2 21  ? 8.072   12.996  8.759   1.00 0.00 ? 19  LYS B CD   2  
ATOM 2606  C CE   . LYS B 2 21  ? 7.633   13.298  10.182  1.00 0.00 ? 19  LYS B CE   2  
ATOM 2607  N NZ   . LYS B 2 21  ? 8.776   13.289  11.134  1.00 0.00 ? 19  LYS B NZ   2  
ATOM 2608  H H    . LYS B 2 21  ? 6.755   11.893  5.750   1.00 0.00 ? 19  LYS B H    2  
ATOM 2609  H HA   . LYS B 2 21  ? 7.178   14.118  5.726   1.00 0.00 ? 19  LYS B HA   2  
ATOM 2610  H HB2  . LYS B 2 21  ? 9.809   13.138  6.775   1.00 0.00 ? 19  LYS B HB2  2  
ATOM 2611  H HB3  . LYS B 2 21  ? 9.631   14.822  6.309   1.00 0.00 ? 19  LYS B HB3  2  
ATOM 2612  H HG2  . LYS B 2 21  ? 9.236   14.773  8.614   1.00 0.00 ? 19  LYS B HG2  2  
ATOM 2613  H HG3  . LYS B 2 21  ? 7.636   14.892  7.884   1.00 0.00 ? 19  LYS B HG3  2  
ATOM 2614  H HD2  . LYS B 2 21  ? 7.243   12.543  8.233   1.00 0.00 ? 19  LYS B HD2  2  
ATOM 2615  H HD3  . LYS B 2 21  ? 8.900   12.305  8.788   1.00 0.00 ? 19  LYS B HD3  2  
ATOM 2616  H HE2  . LYS B 2 21  ? 7.164   14.266  10.204  1.00 0.00 ? 19  LYS B HE2  2  
ATOM 2617  H HE3  . LYS B 2 21  ? 6.918   12.544  10.487  1.00 0.00 ? 19  LYS B HE3  2  
ATOM 2618  H HZ1  . LYS B 2 21  ? 9.663   13.485  10.634  1.00 0.00 ? 19  LYS B HZ1  2  
ATOM 2619  H HZ2  . LYS B 2 21  ? 8.850   12.348  11.597  1.00 0.00 ? 19  LYS B HZ2  2  
ATOM 2620  H HZ3  . LYS B 2 21  ? 8.635   14.006  11.869  1.00 0.00 ? 19  LYS B HZ3  2  
ATOM 2621  N N    . GLN B 2 22  ? 8.238   13.098  3.174   1.00 0.00 ? 20  GLN B N    2  
ATOM 2622  C CA   . GLN B 2 22  ? 8.706   13.343  1.812   1.00 0.00 ? 20  GLN B CA   2  
ATOM 2623  C C    . GLN B 2 22  ? 7.559   13.255  0.810   1.00 0.00 ? 20  GLN B C    2  
ATOM 2624  O O    . GLN B 2 22  ? 6.926   12.212  0.680   1.00 0.00 ? 20  GLN B O    2  
ATOM 2625  C CB   . GLN B 2 22  ? 9.807   12.347  1.439   1.00 0.00 ? 20  GLN B CB   2  
ATOM 2626  C CG   . GLN B 2 22  ? 10.298  12.495  0.006   1.00 0.00 ? 20  GLN B CG   2  
ATOM 2627  C CD   . GLN B 2 22  ? 11.497  11.617  -0.304  1.00 0.00 ? 20  GLN B CD   2  
ATOM 2628  O OE1  . GLN B 2 22  ? 12.319  11.947  -1.168  1.00 0.00 ? 20  GLN B OE1  2  
ATOM 2629  N NE2  . GLN B 2 22  ? 11.604  10.492  0.387   1.00 0.00 ? 20  GLN B NE2  2  
ATOM 2630  H H    . GLN B 2 22  ? 7.630   12.349  3.347   1.00 0.00 ? 20  GLN B H    2  
ATOM 2631  H HA   . GLN B 2 22  ? 9.115   14.339  1.779   1.00 0.00 ? 20  GLN B HA   2  
ATOM 2632  H HB2  . GLN B 2 22  ? 10.649  12.492  2.101   1.00 0.00 ? 20  GLN B HB2  2  
ATOM 2633  H HB3  . GLN B 2 22  ? 9.429   11.343  1.565   1.00 0.00 ? 20  GLN B HB3  2  
ATOM 2634  H HG2  . GLN B 2 22  ? 9.493   12.226  -0.662  1.00 0.00 ? 20  GLN B HG2  2  
ATOM 2635  H HG3  . GLN B 2 22  ? 10.572  13.526  -0.159  1.00 0.00 ? 20  GLN B HG3  2  
ATOM 2636  H HE21 . GLN B 2 22  ? 10.911  10.288  1.052   1.00 0.00 ? 20  GLN B HE21 2  
ATOM 2637  H HE22 . GLN B 2 22  ? 12.372  9.912   0.212   1.00 0.00 ? 20  GLN B HE22 2  
ATOM 2638  N N    . ASP B 2 23  ? 7.305   14.354  0.104   1.00 0.00 ? 21  ASP B N    2  
ATOM 2639  C CA   . ASP B 2 23  ? 6.233   14.411  -0.896  1.00 0.00 ? 21  ASP B CA   2  
ATOM 2640  C C    . ASP B 2 23  ? 6.576   13.551  -2.114  1.00 0.00 ? 21  ASP B C    2  
ATOM 2641  O O    . ASP B 2 23  ? 7.751   13.313  -2.409  1.00 0.00 ? 21  ASP B O    2  
ATOM 2642  C CB   . ASP B 2 23  ? 5.986   15.860  -1.344  1.00 0.00 ? 21  ASP B CB   2  
ATOM 2643  C CG   . ASP B 2 23  ? 4.912   16.564  -0.531  1.00 0.00 ? 21  ASP B CG   2  
ATOM 2644  O OD1  . ASP B 2 23  ? 5.266   17.320  0.404   1.00 0.00 ? 21  ASP B OD1  2  
ATOM 2645  O OD2  . ASP B 2 23  ? 3.711   16.370  -0.821  1.00 0.00 ? 21  ASP B OD2  2  
ATOM 2646  H H    . ASP B 2 23  ? 7.851   15.151  0.256   1.00 0.00 ? 21  ASP B H    2  
ATOM 2647  H HA   . ASP B 2 23  ? 5.334   14.025  -0.439  1.00 0.00 ? 21  ASP B HA   2  
ATOM 2648  H HB2  . ASP B 2 23  ? 6.903   16.419  -1.247  1.00 0.00 ? 21  ASP B HB2  2  
ATOM 2649  H HB3  . ASP B 2 23  ? 5.683   15.858  -2.381  1.00 0.00 ? 21  ASP B HB3  2  
ATOM 2650  N N    . GLY B 2 24  ? 5.545   13.073  -2.804  1.00 0.00 ? 22  GLY B N    2  
ATOM 2651  C CA   . GLY B 2 24  ? 5.743   12.250  -3.984  1.00 0.00 ? 22  GLY B CA   2  
ATOM 2652  C C    . GLY B 2 24  ? 4.433   11.865  -4.650  1.00 0.00 ? 22  GLY B C    2  
ATOM 2653  O O    . GLY B 2 24  ? 3.415   12.525  -4.455  1.00 0.00 ? 22  GLY B O    2  
ATOM 2654  H H    . GLY B 2 24  ? 4.635   13.272  -2.500  1.00 0.00 ? 22  GLY B H    2  
ATOM 2655  H HA2  . GLY B 2 24  ? 6.349   12.795  -4.692  1.00 0.00 ? 22  GLY B HA2  2  
ATOM 2656  H HA3  . GLY B 2 24  ? 6.266   11.350  -3.698  1.00 0.00 ? 22  GLY B HA3  2  
ATOM 2657  N N    . ALA B 2 25  ? 4.457   10.789  -5.425  1.00 0.00 ? 23  ALA B N    2  
ATOM 2658  C CA   . ALA B 2 25  ? 3.272   10.305  -6.129  1.00 0.00 ? 23  ALA B CA   2  
ATOM 2659  C C    . ALA B 2 25  ? 3.069   8.814   -5.864  1.00 0.00 ? 23  ALA B C    2  
ATOM 2660  O O    . ALA B 2 25  ? 4.005   8.021   -5.970  1.00 0.00 ? 23  ALA B O    2  
ATOM 2661  C CB   . ALA B 2 25  ? 3.404   10.571  -7.622  1.00 0.00 ? 23  ALA B CB   2  
ATOM 2662  H H    . ALA B 2 25  ? 5.303   10.292  -5.525  1.00 0.00 ? 23  ALA B H    2  
ATOM 2663  H HA   . ALA B 2 25  ? 2.407   10.852  -5.764  1.00 0.00 ? 23  ALA B HA   2  
ATOM 2664  H HB1  . ALA B 2 25  ? 4.246   10.020  -8.014  1.00 0.00 ? 23  ALA B HB1  2  
ATOM 2665  H HB2  . ALA B 2 25  ? 3.555   11.627  -7.788  1.00 0.00 ? 23  ALA B HB2  2  
ATOM 2666  H HB3  . ALA B 2 25  ? 2.501   10.253  -8.125  1.00 0.00 ? 23  ALA B HB3  2  
ATOM 2667  N N    . LEU B 2 26  ? 1.845   8.442   -5.522  1.00 0.00 ? 24  LEU B N    2  
ATOM 2668  C CA   . LEU B 2 26  ? 1.508   7.054   -5.214  1.00 0.00 ? 24  LEU B CA   2  
ATOM 2669  C C    . LEU B 2 26  ? 0.895   6.356   -6.428  1.00 0.00 ? 24  LEU B C    2  
ATOM 2670  O O    . LEU B 2 26  ? -0.011  6.889   -7.059  1.00 0.00 ? 24  LEU B O    2  
ATOM 2671  C CB   . LEU B 2 26  ? 0.512   7.020   -4.054  1.00 0.00 ? 24  LEU B CB   2  
ATOM 2672  C CG   . LEU B 2 26  ? 0.082   5.621   -3.604  1.00 0.00 ? 24  LEU B CG   2  
ATOM 2673  C CD1  . LEU B 2 26  ? 0.975   5.080   -2.513  1.00 0.00 ? 24  LEU B CD1  2  
ATOM 2674  C CD2  . LEU B 2 26  ? -1.364  5.632   -3.146  1.00 0.00 ? 24  LEU B CD2  2  
ATOM 2675  H H    . LEU B 2 26  ? 1.136   9.118   -5.494  1.00 0.00 ? 24  LEU B H    2  
ATOM 2676  H HA   . LEU B 2 26  ? 2.409   6.534   -4.921  1.00 0.00 ? 24  LEU B HA   2  
ATOM 2677  H HB2  . LEU B 2 26  ? 0.953   7.529   -3.213  1.00 0.00 ? 24  LEU B HB2  2  
ATOM 2678  H HB3  . LEU B 2 26  ? -0.368  7.565   -4.351  1.00 0.00 ? 24  LEU B HB3  2  
ATOM 2679  H HG   . LEU B 2 26  ? 0.174   4.951   -4.440  1.00 0.00 ? 24  LEU B HG   2  
ATOM 2680  H HD11 . LEU B 2 26  ? 0.928   5.732   -1.656  1.00 0.00 ? 24  LEU B HD11 2  
ATOM 2681  H HD12 . LEU B 2 26  ? 1.988   5.019   -2.875  1.00 0.00 ? 24  LEU B HD12 2  
ATOM 2682  H HD13 . LEU B 2 26  ? 0.630   4.092   -2.233  1.00 0.00 ? 24  LEU B HD13 2  
ATOM 2683  H HD21 . LEU B 2 26  ? -1.654  4.637   -2.841  1.00 0.00 ? 24  LEU B HD21 2  
ATOM 2684  H HD22 . LEU B 2 26  ? -1.997  5.960   -3.956  1.00 0.00 ? 24  LEU B HD22 2  
ATOM 2685  H HD23 . LEU B 2 26  ? -1.471  6.308   -2.309  1.00 0.00 ? 24  LEU B HD23 2  
ATOM 2686  N N    . TYR B 2 27  ? 1.393   5.175   -6.759  1.00 0.00 ? 25  TYR B N    2  
ATOM 2687  C CA   . TYR B 2 27  ? 0.868   4.416   -7.886  1.00 0.00 ? 25  TYR B CA   2  
ATOM 2688  C C    . TYR B 2 27  ? 0.434   3.033   -7.417  1.00 0.00 ? 25  TYR B C    2  
ATOM 2689  O O    . TYR B 2 27  ? 1.189   2.330   -6.752  1.00 0.00 ? 25  TYR B O    2  
ATOM 2690  C CB   . TYR B 2 27  ? 1.916   4.271   -8.997  1.00 0.00 ? 25  TYR B CB   2  
ATOM 2691  C CG   . TYR B 2 27  ? 2.335   5.569   -9.654  1.00 0.00 ? 25  TYR B CG   2  
ATOM 2692  C CD1  . TYR B 2 27  ? 3.190   6.454   -9.010  1.00 0.00 ? 25  TYR B CD1  2  
ATOM 2693  C CD2  . TYR B 2 27  ? 1.890   5.897   -10.927 1.00 0.00 ? 25  TYR B CD2  2  
ATOM 2694  C CE1  . TYR B 2 27  ? 3.584   7.631   -9.614  1.00 0.00 ? 25  TYR B CE1  2  
ATOM 2695  C CE2  . TYR B 2 27  ? 2.280   7.074   -11.538 1.00 0.00 ? 25  TYR B CE2  2  
ATOM 2696  C CZ   . TYR B 2 27  ? 3.127   7.937   -10.877 1.00 0.00 ? 25  TYR B CZ   2  
ATOM 2697  O OH   . TYR B 2 27  ? 3.519   9.108   -11.482 1.00 0.00 ? 25  TYR B OH   2  
ATOM 2698  H H    . TYR B 2 27  ? 2.137   4.799   -6.237  1.00 0.00 ? 25  TYR B H    2  
ATOM 2699  H HA   . TYR B 2 27  ? 0.005   4.939   -8.269  1.00 0.00 ? 25  TYR B HA   2  
ATOM 2700  H HB2  . TYR B 2 27  ? 2.801   3.819   -8.583  1.00 0.00 ? 25  TYR B HB2  2  
ATOM 2701  H HB3  . TYR B 2 27  ? 1.520   3.624   -9.768  1.00 0.00 ? 25  TYR B HB3  2  
ATOM 2702  H HD1  . TYR B 2 27  ? 3.546   6.213   -8.019  1.00 0.00 ? 25  TYR B HD1  2  
ATOM 2703  H HD2  . TYR B 2 27  ? 1.226   5.219   -11.442 1.00 0.00 ? 25  TYR B HD2  2  
ATOM 2704  H HE1  . TYR B 2 27  ? 4.249   8.307   -9.096  1.00 0.00 ? 25  TYR B HE1  2  
ATOM 2705  H HE2  . TYR B 2 27  ? 1.921   7.313   -12.527 1.00 0.00 ? 25  TYR B HE2  2  
ATOM 2706  H HH   . TYR B 2 27  ? 4.423   9.314   -11.226 1.00 0.00 ? 25  TYR B HH   2  
ATOM 2707  N N    . LEU B 2 28  ? -0.787  2.652   -7.742  1.00 0.00 ? 26  LEU B N    2  
ATOM 2708  C CA   . LEU B 2 28  ? -1.296  1.351   -7.340  1.00 0.00 ? 26  LEU B CA   2  
ATOM 2709  C C    . LEU B 2 28  ? -1.404  0.422   -8.536  1.00 0.00 ? 26  LEU B C    2  
ATOM 2710  O O    . LEU B 2 28  ? -2.144  0.697   -9.481  1.00 0.00 ? 26  LEU B O    2  
ATOM 2711  C CB   . LEU B 2 28  ? -2.657  1.492   -6.659  1.00 0.00 ? 26  LEU B CB   2  
ATOM 2712  C CG   . LEU B 2 28  ? -2.735  2.595   -5.609  1.00 0.00 ? 26  LEU B CG   2  
ATOM 2713  C CD1  . LEU B 2 28  ? -4.091  2.622   -4.948  1.00 0.00 ? 26  LEU B CD1  2  
ATOM 2714  C CD2  . LEU B 2 28  ? -1.678  2.421   -4.553  1.00 0.00 ? 26  LEU B CD2  2  
ATOM 2715  H H    . LEU B 2 28  ? -1.358  3.254   -8.270  1.00 0.00 ? 26  LEU B H    2  
ATOM 2716  H HA   . LEU B 2 28  ? -0.597  0.929   -6.635  1.00 0.00 ? 26  LEU B HA   2  
ATOM 2717  H HB2  . LEU B 2 28  ? -3.398  1.691   -7.421  1.00 0.00 ? 26  LEU B HB2  2  
ATOM 2718  H HB3  . LEU B 2 28  ? -2.897  0.553   -6.183  1.00 0.00 ? 26  LEU B HB3  2  
ATOM 2719  H HG   . LEU B 2 28  ? -2.566  3.542   -6.088  1.00 0.00 ? 26  LEU B HG   2  
ATOM 2720  H HD11 . LEU B 2 28  ? -4.101  3.397   -4.194  1.00 0.00 ? 26  LEU B HD11 2  
ATOM 2721  H HD12 . LEU B 2 28  ? -4.282  1.666   -4.484  1.00 0.00 ? 26  LEU B HD12 2  
ATOM 2722  H HD13 . LEU B 2 28  ? -4.847  2.828   -5.687  1.00 0.00 ? 26  LEU B HD13 2  
ATOM 2723  H HD21 . LEU B 2 28  ? -1.761  3.226   -3.837  1.00 0.00 ? 26  LEU B HD21 2  
ATOM 2724  H HD22 . LEU B 2 28  ? -0.704  2.446   -5.015  1.00 0.00 ? 26  LEU B HD22 2  
ATOM 2725  H HD23 . LEU B 2 28  ? -1.824  1.478   -4.054  1.00 0.00 ? 26  LEU B HD23 2  
ATOM 2726  N N    . MET B 2 29  ? -0.659  -0.668  -8.492  1.00 0.00 ? 27  MET B N    2  
ATOM 2727  C CA   . MET B 2 29  ? -0.670  -1.653  -9.559  1.00 0.00 ? 27  MET B CA   2  
ATOM 2728  C C    . MET B 2 29  ? -1.574  -2.809  -9.188  1.00 0.00 ? 27  MET B C    2  
ATOM 2729  O O    . MET B 2 29  ? -1.924  -2.983  -8.025  1.00 0.00 ? 27  MET B O    2  
ATOM 2730  C CB   . MET B 2 29  ? 0.731   -2.193  -9.848  1.00 0.00 ? 27  MET B CB   2  
ATOM 2731  C CG   . MET B 2 29  ? 1.687   -1.168  -10.422 1.00 0.00 ? 27  MET B CG   2  
ATOM 2732  S SD   . MET B 2 29  ? 2.297   -0.015  -9.183  1.00 0.00 ? 27  MET B SD   2  
ATOM 2733  C CE   . MET B 2 29  ? 3.348   1.007   -10.200 1.00 0.00 ? 27  MET B CE   2  
ATOM 2734  H H    . MET B 2 29  ? -0.087  -0.825  -7.707  1.00 0.00 ? 27  MET B H    2  
ATOM 2735  H HA   . MET B 2 29  ? -1.056  -1.177  -10.449 1.00 0.00 ? 27  MET B HA   2  
ATOM 2736  H HB2  . MET B 2 29  ? 1.152   -2.572  -8.930  1.00 0.00 ? 27  MET B HB2  2  
ATOM 2737  H HB3  . MET B 2 29  ? 0.646   -3.006  -10.553 1.00 0.00 ? 27  MET B HB3  2  
ATOM 2738  H HG2  . MET B 2 29  ? 2.529   -1.686  -10.857 1.00 0.00 ? 27  MET B HG2  2  
ATOM 2739  H HG3  . MET B 2 29  ? 1.174   -0.610  -11.191 1.00 0.00 ? 27  MET B HG3  2  
ATOM 2740  H HE1  . MET B 2 29  ? 4.128   0.399   -10.631 1.00 0.00 ? 27  MET B HE1  2  
ATOM 2741  H HE2  . MET B 2 29  ? 3.788   1.784   -9.595  1.00 0.00 ? 27  MET B HE2  2  
ATOM 2742  H HE3  . MET B 2 29  ? 2.759   1.450   -10.988 1.00 0.00 ? 27  MET B HE3  2  
ATOM 2743  N N    . ALA B 2 30  ? -1.904  -3.607  -10.182 1.00 0.00 ? 28  ALA B N    2  
ATOM 2744  C CA   . ALA B 2 30  ? -2.781  -4.758  -10.024 1.00 0.00 ? 28  ALA B CA   2  
ATOM 2745  C C    . ALA B 2 30  ? -2.380  -5.667  -8.860  1.00 0.00 ? 28  ALA B C    2  
ATOM 2746  O O    . ALA B 2 30  ? -3.206  -6.012  -8.017  1.00 0.00 ? 28  ALA B O    2  
ATOM 2747  C CB   . ALA B 2 30  ? -2.793  -5.548  -11.321 1.00 0.00 ? 28  ALA B CB   2  
ATOM 2748  H H    . ALA B 2 30  ? -1.541  -3.414  -11.074 1.00 0.00 ? 28  ALA B H    2  
ATOM 2749  H HA   . ALA B 2 30  ? -3.783  -4.394  -9.850  1.00 0.00 ? 28  ALA B HA   2  
ATOM 2750  H HB1  . ALA B 2 30  ? -3.058  -4.893  -12.138 1.00 0.00 ? 28  ALA B HB1  2  
ATOM 2751  H HB2  . ALA B 2 30  ? -3.512  -6.348  -11.252 1.00 0.00 ? 28  ALA B HB2  2  
ATOM 2752  H HB3  . ALA B 2 30  ? -1.809  -5.961  -11.498 1.00 0.00 ? 28  ALA B HB3  2  
ATOM 2753  N N    . GLU B 2 31  ? -1.115  -6.050  -8.814  1.00 0.00 ? 29  GLU B N    2  
ATOM 2754  C CA   . GLU B 2 31  ? -0.634  -6.952  -7.779  1.00 0.00 ? 29  GLU B CA   2  
ATOM 2755  C C    . GLU B 2 31  ? 0.184   -6.250  -6.692  1.00 0.00 ? 29  GLU B C    2  
ATOM 2756  O O    . GLU B 2 31  ? 0.559   -6.884  -5.699  1.00 0.00 ? 29  GLU B O    2  
ATOM 2757  C CB   . GLU B 2 31  ? 0.218   -8.058  -8.416  1.00 0.00 ? 29  GLU B CB   2  
ATOM 2758  C CG   . GLU B 2 31  ? -0.243  -8.471  -9.810  1.00 0.00 ? 29  GLU B CG   2  
ATOM 2759  C CD   . GLU B 2 31  ? 0.449   -7.695  -10.922 1.00 0.00 ? 29  GLU B CD   2  
ATOM 2760  O OE1  . GLU B 2 31  ? 0.256   -6.460  -11.001 1.00 0.00 ? 29  GLU B OE1  2  
ATOM 2761  O OE2  . GLU B 2 31  ? 1.175   -8.319  -11.717 1.00 0.00 ? 29  GLU B OE2  2  
ATOM 2762  H H    . GLU B 2 31  ? -0.494  -5.754  -9.522  1.00 0.00 ? 29  GLU B H    2  
ATOM 2763  H HA   . GLU B 2 31  ? -1.495  -7.408  -7.318  1.00 0.00 ? 29  GLU B HA   2  
ATOM 2764  H HB2  . GLU B 2 31  ? 1.238   -7.713  -8.488  1.00 0.00 ? 29  GLU B HB2  2  
ATOM 2765  H HB3  . GLU B 2 31  ? 0.188   -8.930  -7.779  1.00 0.00 ? 29  GLU B HB3  2  
ATOM 2766  H HG2  . GLU B 2 31  ? -0.035  -9.522  -9.946  1.00 0.00 ? 29  GLU B HG2  2  
ATOM 2767  H HG3  . GLU B 2 31  ? -1.308  -8.304  -9.885  1.00 0.00 ? 29  GLU B HG3  2  
ATOM 2768  N N    . ARG B 2 32  ? 0.437   -4.950  -6.827  1.00 0.00 ? 30  ARG B N    2  
ATOM 2769  C CA   . ARG B 2 32  ? 1.254   -4.269  -5.823  1.00 0.00 ? 30  ARG B CA   2  
ATOM 2770  C C    . ARG B 2 32  ? 1.020   -2.771  -5.796  1.00 0.00 ? 30  ARG B C    2  
ATOM 2771  O O    . ARG B 2 32  ? 0.414   -2.206  -6.689  1.00 0.00 ? 30  ARG B O    2  
ATOM 2772  C CB   . ARG B 2 32  ? 2.747   -4.526  -6.074  1.00 0.00 ? 30  ARG B CB   2  
ATOM 2773  C CG   . ARG B 2 32  ? 3.399   -3.529  -7.027  1.00 0.00 ? 30  ARG B CG   2  
ATOM 2774  C CD   . ARG B 2 32  ? 4.913   -3.564  -6.909  1.00 0.00 ? 30  ARG B CD   2  
ATOM 2775  N NE   . ARG B 2 32  ? 5.529   -4.182  -8.076  1.00 0.00 ? 30  ARG B NE   2  
ATOM 2776  C CZ   . ARG B 2 32  ? 6.650   -4.895  -8.046  1.00 0.00 ? 30  ARG B CZ   2  
ATOM 2777  N NH1  . ARG B 2 32  ? 7.316   -5.051  -6.906  1.00 0.00 ? 30  ARG B NH1  2  
ATOM 2778  N NH2  . ARG B 2 32  ? 7.117   -5.433  -9.164  1.00 0.00 ? 30  ARG B NH2  2  
ATOM 2779  H H    . ARG B 2 32  ? 0.037   -4.439  -7.573  1.00 0.00 ? 30  ARG B H    2  
ATOM 2780  H HA   . ARG B 2 32  ? 0.995   -4.677  -4.859  1.00 0.00 ? 30  ARG B HA   2  
ATOM 2781  H HB2  . ARG B 2 32  ? 3.269   -4.477  -5.129  1.00 0.00 ? 30  ARG B HB2  2  
ATOM 2782  H HB3  . ARG B 2 32  ? 2.867   -5.517  -6.485  1.00 0.00 ? 30  ARG B HB3  2  
ATOM 2783  H HG2  . ARG B 2 32  ? 3.122   -3.773  -8.042  1.00 0.00 ? 30  ARG B HG2  2  
ATOM 2784  H HG3  . ARG B 2 32  ? 3.052   -2.532  -6.788  1.00 0.00 ? 30  ARG B HG3  2  
ATOM 2785  H HD2  . ARG B 2 32  ? 5.278   -2.553  -6.813  1.00 0.00 ? 30  ARG B HD2  2  
ATOM 2786  H HD3  . ARG B 2 32  ? 5.180   -4.130  -6.029  1.00 0.00 ? 30  ARG B HD3  2  
ATOM 2787  H HE   . ARG B 2 32  ? 5.064   -4.056  -8.950  1.00 0.00 ? 30  ARG B HE   2  
ATOM 2788  H HH11 . ARG B 2 32  ? 6.974   -4.626  -6.061  1.00 0.00 ? 30  ARG B HH11 2  
ATOM 2789  H HH12 . ARG B 2 32  ? 8.157   -5.587  -6.882  1.00 0.00 ? 30  ARG B HH12 2  
ATOM 2790  H HH21 . ARG B 2 32  ? 6.614   -5.298  -10.041 1.00 0.00 ? 30  ARG B HH21 2  
ATOM 2791  H HH22 . ARG B 2 32  ? 7.960   -5.965  -9.158  1.00 0.00 ? 30  ARG B HH22 2  
ATOM 2792  N N    . ILE B 2 33  ? 1.521   -2.146  -4.751  1.00 0.00 ? 31  ILE B N    2  
ATOM 2793  C CA   . ILE B 2 33  ? 1.423   -0.710  -4.582  1.00 0.00 ? 31  ILE B CA   2  
ATOM 2794  C C    . ILE B 2 33  ? 2.837   -0.135  -4.611  1.00 0.00 ? 31  ILE B C    2  
ATOM 2795  O O    . ILE B 2 33  ? 3.714   -0.590  -3.867  1.00 0.00 ? 31  ILE B O    2  
ATOM 2796  C CB   . ILE B 2 33  ? 0.690   -0.351  -3.262  1.00 0.00 ? 31  ILE B CB   2  
ATOM 2797  C CG1  . ILE B 2 33  ? 0.914   1.121   -2.880  1.00 0.00 ? 31  ILE B CG1  2  
ATOM 2798  C CG2  . ILE B 2 33  ? 1.101   -1.296  -2.134  1.00 0.00 ? 31  ILE B CG2  2  
ATOM 2799  C CD1  . ILE B 2 33  ? 2.030   1.349   -1.888  1.00 0.00 ? 31  ILE B CD1  2  
ATOM 2800  H H    . ILE B 2 33  ? 1.990   -2.672  -4.061  1.00 0.00 ? 31  ILE B H    2  
ATOM 2801  H HA   . ILE B 2 33  ? 0.852   -0.302  -5.415  1.00 0.00 ? 31  ILE B HA   2  
ATOM 2802  H HB   . ILE B 2 33  ? -0.367  -0.502  -3.431  1.00 0.00 ? 31  ILE B HB   2  
ATOM 2803  H HG12 . ILE B 2 33  ? 1.151   1.683   -3.771  1.00 0.00 ? 31  ILE B HG12 2  
ATOM 2804  H HG13 . ILE B 2 33  ? 0.003   1.514   -2.450  1.00 0.00 ? 31  ILE B HG13 2  
ATOM 2805  H HG21 . ILE B 2 33  ? 0.585   -1.021  -1.226  1.00 0.00 ? 31  ILE B HG21 2  
ATOM 2806  H HG22 . ILE B 2 33  ? 2.168   -1.229  -1.978  1.00 0.00 ? 31  ILE B HG22 2  
ATOM 2807  H HG23 . ILE B 2 33  ? 0.841   -2.311  -2.402  1.00 0.00 ? 31  ILE B HG23 2  
ATOM 2808  H HD11 . ILE B 2 33  ? 2.125   2.405   -1.690  1.00 0.00 ? 31  ILE B HD11 2  
ATOM 2809  H HD12 . ILE B 2 33  ? 2.954   0.971   -2.298  1.00 0.00 ? 31  ILE B HD12 2  
ATOM 2810  H HD13 . ILE B 2 33  ? 1.803   0.829   -0.970  1.00 0.00 ? 31  ILE B HD13 2  
ATOM 2811  N N    . ALA B 2 34  ? 3.072   0.831   -5.485  1.00 0.00 ? 32  ALA B N    2  
ATOM 2812  C CA   . ALA B 2 34  ? 4.388   1.435   -5.613  1.00 0.00 ? 32  ALA B CA   2  
ATOM 2813  C C    . ALA B 2 34  ? 4.309   2.955   -5.569  1.00 0.00 ? 32  ALA B C    2  
ATOM 2814  O O    . ALA B 2 34  ? 3.677   3.584   -6.412  1.00 0.00 ? 32  ALA B O    2  
ATOM 2815  C CB   . ALA B 2 34  ? 5.061   0.972   -6.897  1.00 0.00 ? 32  ALA B CB   2  
ATOM 2816  H H    . ALA B 2 34  ? 2.337   1.157   -6.057  1.00 0.00 ? 32  ALA B H    2  
ATOM 2817  H HA   . ALA B 2 34  ? 4.988   1.095   -4.781  1.00 0.00 ? 32  ALA B HA   2  
ATOM 2818  H HB1  . ALA B 2 34  ? 6.044   1.414   -6.968  1.00 0.00 ? 32  ALA B HB1  2  
ATOM 2819  H HB2  . ALA B 2 34  ? 4.466   1.278   -7.746  1.00 0.00 ? 32  ALA B HB2  2  
ATOM 2820  H HB3  . ALA B 2 34  ? 5.149   -0.104  -6.888  1.00 0.00 ? 32  ALA B HB3  2  
ATOM 2821  N N    . TRP B 2 35  ? 4.961   3.541   -4.583  1.00 0.00 ? 33  TRP B N    2  
ATOM 2822  C CA   . TRP B 2 35  ? 4.968   4.985   -4.425  1.00 0.00 ? 33  TRP B CA   2  
ATOM 2823  C C    . TRP B 2 35  ? 6.364   5.532   -4.695  1.00 0.00 ? 33  TRP B C    2  
ATOM 2824  O O    . TRP B 2 35  ? 7.361   4.987   -4.211  1.00 0.00 ? 33  TRP B O    2  
ATOM 2825  C CB   . TRP B 2 35  ? 4.478   5.363   -3.019  1.00 0.00 ? 33  TRP B CB   2  
ATOM 2826  C CG   . TRP B 2 35  ? 4.653   6.814   -2.662  1.00 0.00 ? 33  TRP B CG   2  
ATOM 2827  C CD1  . TRP B 2 35  ? 3.718   7.793   -2.801  1.00 0.00 ? 33  TRP B CD1  2  
ATOM 2828  C CD2  . TRP B 2 35  ? 5.814   7.449   -2.095  1.00 0.00 ? 33  TRP B CD2  2  
ATOM 2829  N NE1  . TRP B 2 35  ? 4.219   8.995   -2.377  1.00 0.00 ? 33  TRP B NE1  2  
ATOM 2830  C CE2  . TRP B 2 35  ? 5.501   8.812   -1.936  1.00 0.00 ? 33  TRP B CE2  2  
ATOM 2831  C CE3  . TRP B 2 35  ? 7.083   7.005   -1.711  1.00 0.00 ? 33  TRP B CE3  2  
ATOM 2832  C CZ2  . TRP B 2 35  ? 6.407   9.731   -1.413  1.00 0.00 ? 33  TRP B CZ2  2  
ATOM 2833  C CZ3  . TRP B 2 35  ? 7.981   7.919   -1.191  1.00 0.00 ? 33  TRP B CZ3  2  
ATOM 2834  C CH2  . TRP B 2 35  ? 7.639   9.270   -1.046  1.00 0.00 ? 33  TRP B CH2  2  
ATOM 2835  H H    . TRP B 2 35  ? 5.469   2.986   -3.952  1.00 0.00 ? 33  TRP B H    2  
ATOM 2836  H HA   . TRP B 2 35  ? 4.289   5.399   -5.156  1.00 0.00 ? 33  TRP B HA   2  
ATOM 2837  H HB2  . TRP B 2 35  ? 3.424   5.141   -2.954  1.00 0.00 ? 33  TRP B HB2  2  
ATOM 2838  H HB3  . TRP B 2 35  ? 4.995   4.769   -2.291  1.00 0.00 ? 33  TRP B HB3  2  
ATOM 2839  H HD1  . TRP B 2 35  ? 2.729   7.633   -3.202  1.00 0.00 ? 33  TRP B HD1  2  
ATOM 2840  H HE1  . TRP B 2 35  ? 3.733   9.848   -2.383  1.00 0.00 ? 33  TRP B HE1  2  
ATOM 2841  H HE3  . TRP B 2 35  ? 7.365   5.967   -1.816  1.00 0.00 ? 33  TRP B HE3  2  
ATOM 2842  H HZ2  . TRP B 2 35  ? 6.158   10.775  -1.295  1.00 0.00 ? 33  TRP B HZ2  2  
ATOM 2843  H HZ3  . TRP B 2 35  ? 8.966   7.593   -0.890  1.00 0.00 ? 33  TRP B HZ3  2  
ATOM 2844  H HH2  . TRP B 2 35  ? 8.373   9.952   -0.633  1.00 0.00 ? 33  TRP B HH2  2  
ATOM 2845  N N    . ALA B 2 36  ? 6.427   6.596   -5.480  1.00 0.00 ? 34  ALA B N    2  
ATOM 2846  C CA   . ALA B 2 36  ? 7.691   7.225   -5.823  1.00 0.00 ? 34  ALA B CA   2  
ATOM 2847  C C    . ALA B 2 36  ? 7.746   8.635   -5.260  1.00 0.00 ? 34  ALA B C    2  
ATOM 2848  O O    . ALA B 2 36  ? 6.774   9.383   -5.353  1.00 0.00 ? 34  ALA B O    2  
ATOM 2849  C CB   . ALA B 2 36  ? 7.881   7.252   -7.332  1.00 0.00 ? 34  ALA B CB   2  
ATOM 2850  H H    . ALA B 2 36  ? 5.593   6.985   -5.827  1.00 0.00 ? 34  ALA B H    2  
ATOM 2851  H HA   . ALA B 2 36  ? 8.488   6.638   -5.388  1.00 0.00 ? 34  ALA B HA   2  
ATOM 2852  H HB1  . ALA B 2 36  ? 8.829   7.714   -7.567  1.00 0.00 ? 34  ALA B HB1  2  
ATOM 2853  H HB2  . ALA B 2 36  ? 7.080   7.818   -7.785  1.00 0.00 ? 34  ALA B HB2  2  
ATOM 2854  H HB3  . ALA B 2 36  ? 7.869   6.241   -7.714  1.00 0.00 ? 34  ALA B HB3  2  
ATOM 2855  N N    . PRO B 2 37  ? 8.875   9.013   -4.655  1.00 0.00 ? 35  PRO B N    2  
ATOM 2856  C CA   . PRO B 2 37  ? 9.051   10.341  -4.081  1.00 0.00 ? 35  PRO B CA   2  
ATOM 2857  C C    . PRO B 2 37  ? 9.246   11.395  -5.158  1.00 0.00 ? 35  PRO B C    2  
ATOM 2858  O O    . PRO B 2 37  ? 9.778   11.104  -6.232  1.00 0.00 ? 35  PRO B O    2  
ATOM 2859  C CB   . PRO B 2 37  ? 10.321  10.216  -3.230  1.00 0.00 ? 35  PRO B CB   2  
ATOM 2860  C CG   . PRO B 2 37  ? 10.694  8.769   -3.250  1.00 0.00 ? 35  PRO B CG   2  
ATOM 2861  C CD   . PRO B 2 37  ? 10.068  8.186   -4.482  1.00 0.00 ? 35  PRO B CD   2  
ATOM 2862  H HA   . PRO B 2 37  ? 8.217   10.616  -3.454  1.00 0.00 ? 35  PRO B HA   2  
ATOM 2863  H HB2  . PRO B 2 37  ? 11.102  10.827  -3.658  1.00 0.00 ? 35  PRO B HB2  2  
ATOM 2864  H HB3  . PRO B 2 37  ? 10.112  10.551  -2.225  1.00 0.00 ? 35  PRO B HB3  2  
ATOM 2865  H HG2  . PRO B 2 37  ? 11.767  8.669   -3.294  1.00 0.00 ? 35  PRO B HG2  2  
ATOM 2866  H HG3  . PRO B 2 37  ? 10.308  8.280   -2.368  1.00 0.00 ? 35  PRO B HG3  2  
ATOM 2867  H HD2  . PRO B 2 37  ? 10.733  8.281   -5.329  1.00 0.00 ? 35  PRO B HD2  2  
ATOM 2868  H HD3  . PRO B 2 37  ? 9.802   7.151   -4.321  1.00 0.00 ? 35  PRO B HD3  2  
ATOM 2869  N N    . GLU B 2 38  ? 8.831   12.618  -4.863  1.00 0.00 ? 36  GLU B N    2  
ATOM 2870  C CA   . GLU B 2 38  ? 8.958   13.712  -5.809  1.00 0.00 ? 36  GLU B CA   2  
ATOM 2871  C C    . GLU B 2 38  ? 10.426  13.954  -6.139  1.00 0.00 ? 36  GLU B C    2  
ATOM 2872  O O    . GLU B 2 38  ? 11.279  13.997  -5.242  1.00 0.00 ? 36  GLU B O    2  
ATOM 2873  C CB   . GLU B 2 38  ? 8.319   14.984  -5.247  1.00 0.00 ? 36  GLU B CB   2  
ATOM 2874  C CG   . GLU B 2 38  ? 8.055   16.043  -6.305  1.00 0.00 ? 36  GLU B CG   2  
ATOM 2875  C CD   . GLU B 2 38  ? 7.434   15.461  -7.560  1.00 0.00 ? 36  GLU B CD   2  
ATOM 2876  O OE1  . GLU B 2 38  ? 6.190   15.450  -7.658  1.00 0.00 ? 36  GLU B OE1  2  
ATOM 2877  O OE2  . GLU B 2 38  ? 8.198   15.004  -8.440  1.00 0.00 ? 36  GLU B OE2  2  
ATOM 2878  H H    . GLU B 2 38  ? 8.420   12.789  -3.986  1.00 0.00 ? 36  GLU B H    2  
ATOM 2879  H HA   . GLU B 2 38  ? 8.442   13.429  -6.714  1.00 0.00 ? 36  GLU B HA   2  
ATOM 2880  H HB2  . GLU B 2 38  ? 7.377   14.726  -4.784  1.00 0.00 ? 36  GLU B HB2  2  
ATOM 2881  H HB3  . GLU B 2 38  ? 8.975   15.406  -4.501  1.00 0.00 ? 36  GLU B HB3  2  
ATOM 2882  H HG2  . GLU B 2 38  ? 7.380   16.782  -5.897  1.00 0.00 ? 36  GLU B HG2  2  
ATOM 2883  H HG3  . GLU B 2 38  ? 8.990   16.514  -6.567  1.00 0.00 ? 36  GLU B HG3  2  
ATOM 2884  N N    . GLY B 2 39  ? 10.714  14.090  -7.423  1.00 0.00 ? 37  GLY B N    2  
ATOM 2885  C CA   . GLY B 2 39  ? 12.074  14.314  -7.866  1.00 0.00 ? 37  GLY B CA   2  
ATOM 2886  C C    . GLY B 2 39  ? 12.881  13.031  -7.961  1.00 0.00 ? 37  GLY B C    2  
ATOM 2887  O O    . GLY B 2 39  ? 14.098  13.071  -8.132  1.00 0.00 ? 37  GLY B O    2  
ATOM 2888  H H    . GLY B 2 39  ? 9.978   14.064  -8.084  1.00 0.00 ? 37  GLY B H    2  
ATOM 2889  H HA2  . GLY B 2 39  ? 12.050  14.781  -8.838  1.00 0.00 ? 37  GLY B HA2  2  
ATOM 2890  H HA3  . GLY B 2 39  ? 12.560  14.981  -7.170  1.00 0.00 ? 37  GLY B HA3  2  
ATOM 2891  N N    . LYS B 2 40  ? 12.219  11.889  -7.816  1.00 0.00 ? 38  LYS B N    2  
ATOM 2892  C CA   . LYS B 2 40  ? 12.897  10.602  -7.903  1.00 0.00 ? 38  LYS B CA   2  
ATOM 2893  C C    . LYS B 2 40  ? 12.427  9.833   -9.132  1.00 0.00 ? 38  LYS B C    2  
ATOM 2894  O O    . LYS B 2 40  ? 11.269  9.931   -9.529  1.00 0.00 ? 38  LYS B O    2  
ATOM 2895  C CB   . LYS B 2 40  ? 12.665  9.772   -6.639  1.00 0.00 ? 38  LYS B CB   2  
ATOM 2896  C CG   . LYS B 2 40  ? 13.840  9.789   -5.669  1.00 0.00 ? 38  LYS B CG   2  
ATOM 2897  C CD   . LYS B 2 40  ? 13.541  10.628  -4.434  1.00 0.00 ? 38  LYS B CD   2  
ATOM 2898  C CE   . LYS B 2 40  ? 13.900  12.089  -4.641  1.00 0.00 ? 38  LYS B CE   2  
ATOM 2899  N NZ   . LYS B 2 40  ? 13.209  12.975  -3.664  1.00 0.00 ? 38  LYS B NZ   2  
ATOM 2900  H H    . LYS B 2 40  ? 11.247  11.912  -7.665  1.00 0.00 ? 38  LYS B H    2  
ATOM 2901  H HA   . LYS B 2 40  ? 13.954  10.797  -8.003  1.00 0.00 ? 38  LYS B HA   2  
ATOM 2902  H HB2  . LYS B 2 40  ? 11.797  10.155  -6.123  1.00 0.00 ? 38  LYS B HB2  2  
ATOM 2903  H HB3  . LYS B 2 40  ? 12.479  8.747   -6.925  1.00 0.00 ? 38  LYS B HB3  2  
ATOM 2904  H HG2  . LYS B 2 40  ? 14.054  8.777   -5.360  1.00 0.00 ? 38  LYS B HG2  2  
ATOM 2905  H HG3  . LYS B 2 40  ? 14.701  10.202  -6.173  1.00 0.00 ? 38  LYS B HG3  2  
ATOM 2906  H HD2  . LYS B 2 40  ? 12.488  10.557  -4.211  1.00 0.00 ? 38  LYS B HD2  2  
ATOM 2907  H HD3  . LYS B 2 40  ? 14.113  10.240  -3.604  1.00 0.00 ? 38  LYS B HD3  2  
ATOM 2908  H HE2  . LYS B 2 40  ? 14.967  12.205  -4.525  1.00 0.00 ? 38  LYS B HE2  2  
ATOM 2909  H HE3  . LYS B 2 40  ? 13.615  12.379  -5.642  1.00 0.00 ? 38  LYS B HE3  2  
ATOM 2910  H HZ1  . LYS B 2 40  ? 12.311  13.322  -4.073  1.00 0.00 ? 38  LYS B HZ1  2  
ATOM 2911  H HZ2  . LYS B 2 40  ? 13.809  13.791  -3.433  1.00 0.00 ? 38  LYS B HZ2  2  
ATOM 2912  H HZ3  . LYS B 2 40  ? 12.997  12.453  -2.785  1.00 0.00 ? 38  LYS B HZ3  2  
ATOM 2913  N N    . ASP B 2 41  ? 13.332  9.065   -9.721  1.00 0.00 ? 39  ASP B N    2  
ATOM 2914  C CA   . ASP B 2 41  ? 13.027  8.283   -10.917 1.00 0.00 ? 39  ASP B CA   2  
ATOM 2915  C C    . ASP B 2 41  ? 12.631  6.852   -10.563 1.00 0.00 ? 39  ASP B C    2  
ATOM 2916  O O    . ASP B 2 41  ? 12.347  6.040   -11.447 1.00 0.00 ? 39  ASP B O    2  
ATOM 2917  C CB   . ASP B 2 41  ? 14.250  8.238   -11.834 1.00 0.00 ? 39  ASP B CB   2  
ATOM 2918  C CG   . ASP B 2 41  ? 15.265  7.211   -11.369 1.00 0.00 ? 39  ASP B CG   2  
ATOM 2919  O OD1  . ASP B 2 41  ? 15.452  6.191   -12.068 1.00 0.00 ? 39  ASP B OD1  2  
ATOM 2920  O OD2  . ASP B 2 41  ? 15.855  7.402   -10.283 1.00 0.00 ? 39  ASP B OD2  2  
ATOM 2921  H H    . ASP B 2 41  ? 14.241  9.025   -9.351  1.00 0.00 ? 39  ASP B H    2  
ATOM 2922  H HA   . ASP B 2 41  ? 12.211  8.760   -11.436 1.00 0.00 ? 39  ASP B HA   2  
ATOM 2923  H HB2  . ASP B 2 41  ? 13.936  7.982   -12.836 1.00 0.00 ? 39  ASP B HB2  2  
ATOM 2924  H HB3  . ASP B 2 41  ? 14.724  9.209   -11.844 1.00 0.00 ? 39  ASP B HB3  2  
ATOM 2925  N N    . ARG B 2 42  ? 12.612  6.536   -9.280  1.00 0.00 ? 40  ARG B N    2  
ATOM 2926  C CA   . ARG B 2 42  ? 12.283  5.188   -8.848  1.00 0.00 ? 40  ARG B CA   2  
ATOM 2927  C C    . ARG B 2 42  ? 11.335  5.192   -7.659  1.00 0.00 ? 40  ARG B C    2  
ATOM 2928  O O    . ARG B 2 42  ? 11.326  6.125   -6.856  1.00 0.00 ? 40  ARG B O    2  
ATOM 2929  C CB   . ARG B 2 42  ? 13.560  4.421   -8.489  1.00 0.00 ? 40  ARG B CB   2  
ATOM 2930  C CG   . ARG B 2 42  ? 14.324  5.015   -7.314  1.00 0.00 ? 40  ARG B CG   2  
ATOM 2931  C CD   . ARG B 2 42  ? 15.696  5.518   -7.734  1.00 0.00 ? 40  ARG B CD   2  
ATOM 2932  N NE   . ARG B 2 42  ? 16.627  4.418   -7.997  1.00 0.00 ? 40  ARG B NE   2  
ATOM 2933  C CZ   . ARG B 2 42  ? 17.439  4.360   -9.058  1.00 0.00 ? 40  ARG B CZ   2  
ATOM 2934  N NH1  . ARG B 2 42  ? 17.418  5.318   -9.975  1.00 0.00 ? 40  ARG B NH1  2  
ATOM 2935  N NH2  . ARG B 2 42  ? 18.265  3.328   -9.204  1.00 0.00 ? 40  ARG B NH2  2  
ATOM 2936  H H    . ARG B 2 42  ? 12.804  7.225   -8.611  1.00 0.00 ? 40  ARG B H    2  
ATOM 2937  H HA   . ARG B 2 42  ? 11.801  4.688   -9.674  1.00 0.00 ? 40  ARG B HA   2  
ATOM 2938  H HB2  . ARG B 2 42  ? 13.297  3.404   -8.240  1.00 0.00 ? 40  ARG B HB2  2  
ATOM 2939  H HB3  . ARG B 2 42  ? 14.215  4.413   -9.348  1.00 0.00 ? 40  ARG B HB3  2  
ATOM 2940  H HG2  . ARG B 2 42  ? 13.757  5.841   -6.909  1.00 0.00 ? 40  ARG B HG2  2  
ATOM 2941  H HG3  . ARG B 2 42  ? 14.446  4.256   -6.556  1.00 0.00 ? 40  ARG B HG3  2  
ATOM 2942  H HD2  . ARG B 2 42  ? 15.589  6.111   -8.630  1.00 0.00 ? 40  ARG B HD2  2  
ATOM 2943  H HD3  . ARG B 2 42  ? 16.096  6.135   -6.942  1.00 0.00 ? 40  ARG B HD3  2  
ATOM 2944  H HE   . ARG B 2 42  ? 16.652  3.689   -7.342  1.00 0.00 ? 40  ARG B HE   2  
ATOM 2945  H HH11 . ARG B 2 42  ? 16.784  6.109   -9.882  1.00 0.00 ? 40  ARG B HH11 2  
ATOM 2946  H HH12 . ARG B 2 42  ? 18.022  5.273   -10.770 1.00 0.00 ? 40  ARG B HH12 2  
ATOM 2947  H HH21 . ARG B 2 42  ? 18.282  2.595   -8.522  1.00 0.00 ? 40  ARG B HH21 2  
ATOM 2948  H HH22 . ARG B 2 42  ? 18.874  3.280   -9.998  1.00 0.00 ? 40  ARG B HH22 2  
ATOM 2949  N N    . PHE B 2 43  ? 10.542  4.135   -7.561  1.00 0.00 ? 41  PHE B N    2  
ATOM 2950  C CA   . PHE B 2 43  ? 9.599   3.977   -6.468  1.00 0.00 ? 41  PHE B CA   2  
ATOM 2951  C C    . PHE B 2 43  ? 10.333  3.416   -5.260  1.00 0.00 ? 41  PHE B C    2  
ATOM 2952  O O    . PHE B 2 43  ? 10.947  2.353   -5.343  1.00 0.00 ? 41  PHE B O    2  
ATOM 2953  C CB   . PHE B 2 43  ? 8.462   3.022   -6.861  1.00 0.00 ? 41  PHE B CB   2  
ATOM 2954  C CG   . PHE B 2 43  ? 7.807   3.341   -8.177  1.00 0.00 ? 41  PHE B CG   2  
ATOM 2955  C CD1  . PHE B 2 43  ? 8.294   2.803   -9.358  1.00 0.00 ? 41  PHE B CD1  2  
ATOM 2956  C CD2  . PHE B 2 43  ? 6.700   4.171   -8.232  1.00 0.00 ? 41  PHE B CD2  2  
ATOM 2957  C CE1  . PHE B 2 43  ? 7.691   3.089   -10.567 1.00 0.00 ? 41  PHE B CE1  2  
ATOM 2958  C CE2  . PHE B 2 43  ? 6.093   4.461   -9.439  1.00 0.00 ? 41  PHE B CE2  2  
ATOM 2959  C CZ   . PHE B 2 43  ? 6.590   3.919   -10.608 1.00 0.00 ? 41  PHE B CZ   2  
ATOM 2960  H H    . PHE B 2 43  ? 10.596  3.437   -8.242  1.00 0.00 ? 41  PHE B H    2  
ATOM 2961  H HA   . PHE B 2 43  ? 9.192   4.946   -6.224  1.00 0.00 ? 41  PHE B HA   2  
ATOM 2962  H HB2  . PHE B 2 43  ? 8.854   2.018   -6.925  1.00 0.00 ? 41  PHE B HB2  2  
ATOM 2963  H HB3  . PHE B 2 43  ? 7.700   3.053   -6.095  1.00 0.00 ? 41  PHE B HB3  2  
ATOM 2964  H HD1  . PHE B 2 43  ? 9.157   2.153   -9.327  1.00 0.00 ? 41  PHE B HD1  2  
ATOM 2965  H HD2  . PHE B 2 43  ? 6.311   4.596   -7.319  1.00 0.00 ? 41  PHE B HD2  2  
ATOM 2966  H HE1  . PHE B 2 43  ? 8.081   2.663   -11.480 1.00 0.00 ? 41  PHE B HE1  2  
ATOM 2967  H HE2  . PHE B 2 43  ? 5.232   5.113   -9.468  1.00 0.00 ? 41  PHE B HE2  2  
ATOM 2968  H HZ   . PHE B 2 43  ? 6.117   4.144   -11.552 1.00 0.00 ? 41  PHE B HZ   2  
ATOM 2969  N N    . THR B 2 44  ? 10.294  4.135   -4.153  1.00 0.00 ? 42  THR B N    2  
ATOM 2970  C CA   . THR B 2 44  ? 10.959  3.686   -2.944  1.00 0.00 ? 42  THR B CA   2  
ATOM 2971  C C    . THR B 2 44  ? 10.041  2.770   -2.145  1.00 0.00 ? 42  THR B C    2  
ATOM 2972  O O    . THR B 2 44  ? 10.491  1.997   -1.301  1.00 0.00 ? 42  THR B O    2  
ATOM 2973  C CB   . THR B 2 44  ? 11.392  4.882   -2.082  1.00 0.00 ? 42  THR B CB   2  
ATOM 2974  O OG1  . THR B 2 44  ? 10.383  5.898   -2.130  1.00 0.00 ? 42  THR B OG1  2  
ATOM 2975  C CG2  . THR B 2 44  ? 12.715  5.447   -2.575  1.00 0.00 ? 42  THR B CG2  2  
ATOM 2976  H H    . THR B 2 44  ? 9.807   4.986   -4.145  1.00 0.00 ? 42  THR B H    2  
ATOM 2977  H HA   . THR B 2 44  ? 11.842  3.135   -3.233  1.00 0.00 ? 42  THR B HA   2  
ATOM 2978  H HB   . THR B 2 44  ? 11.513  4.550   -1.060  1.00 0.00 ? 42  THR B HB   2  
ATOM 2979  H HG1  . THR B 2 44  ? 9.889   5.898   -1.304  1.00 0.00 ? 42  THR B HG1  2  
ATOM 2980  H HG21 . THR B 2 44  ? 12.973  6.322   -1.996  1.00 0.00 ? 42  THR B HG21 2  
ATOM 2981  H HG22 . THR B 2 44  ? 12.625  5.719   -3.618  1.00 0.00 ? 42  THR B HG22 2  
ATOM 2982  H HG23 . THR B 2 44  ? 13.491  4.703   -2.465  1.00 0.00 ? 42  THR B HG23 2  
ATOM 2983  N N    . ILE B 2 45  ? 8.748   2.866   -2.425  1.00 0.00 ? 43  ILE B N    2  
ATOM 2984  C CA   . ILE B 2 45  ? 7.759   2.044   -1.754  1.00 0.00 ? 43  ILE B CA   2  
ATOM 2985  C C    . ILE B 2 45  ? 7.214   1.003   -2.719  1.00 0.00 ? 43  ILE B C    2  
ATOM 2986  O O    . ILE B 2 45  ? 6.522   1.344   -3.673  1.00 0.00 ? 43  ILE B O    2  
ATOM 2987  C CB   . ILE B 2 45  ? 6.582   2.886   -1.211  1.00 0.00 ? 43  ILE B CB   2  
ATOM 2988  C CG1  . ILE B 2 45  ? 7.084   3.948   -0.228  1.00 0.00 ? 43  ILE B CG1  2  
ATOM 2989  C CG2  . ILE B 2 45  ? 5.547   1.990   -0.546  1.00 0.00 ? 43  ILE B CG2  2  
ATOM 2990  C CD1  . ILE B 2 45  ? 7.748   3.377   1.006   1.00 0.00 ? 43  ILE B CD1  2  
ATOM 2991  H H    . ILE B 2 45  ? 8.454   3.507   -3.109  1.00 0.00 ? 43  ILE B H    2  
ATOM 2992  H HA   . ILE B 2 45  ? 8.239   1.543   -0.926  1.00 0.00 ? 43  ILE B HA   2  
ATOM 2993  H HB   . ILE B 2 45  ? 6.106   3.379   -2.047  1.00 0.00 ? 43  ILE B HB   2  
ATOM 2994  H HG12 . ILE B 2 45  ? 7.805   4.578   -0.727  1.00 0.00 ? 43  ILE B HG12 2  
ATOM 2995  H HG13 . ILE B 2 45  ? 6.248   4.552   0.095   1.00 0.00 ? 43  ILE B HG13 2  
ATOM 2996  H HG21 . ILE B 2 45  ? 6.000   1.471   0.287   1.00 0.00 ? 43  ILE B HG21 2  
ATOM 2997  H HG22 . ILE B 2 45  ? 5.181   1.269   -1.262  1.00 0.00 ? 43  ILE B HG22 2  
ATOM 2998  H HG23 . ILE B 2 45  ? 4.724   2.591   -0.189  1.00 0.00 ? 43  ILE B HG23 2  
ATOM 2999  H HD11 . ILE B 2 45  ? 8.572   2.746   0.710   1.00 0.00 ? 43  ILE B HD11 2  
ATOM 3000  H HD12 . ILE B 2 45  ? 7.029   2.793   1.562   1.00 0.00 ? 43  ILE B HD12 2  
ATOM 3001  H HD13 . ILE B 2 45  ? 8.113   4.183   1.623   1.00 0.00 ? 43  ILE B HD13 2  
ATOM 3002  N N    . SER B 2 46  ? 7.548   -0.252  -2.484  1.00 0.00 ? 44  SER B N    2  
ATOM 3003  C CA   . SER B 2 46  ? 7.078   -1.336  -3.326  1.00 0.00 ? 44  SER B CA   2  
ATOM 3004  C C    . SER B 2 46  ? 6.666   -2.508  -2.453  1.00 0.00 ? 44  SER B C    2  
ATOM 3005  O O    . SER B 2 46  ? 7.506   -3.251  -1.948  1.00 0.00 ? 44  SER B O    2  
ATOM 3006  C CB   . SER B 2 46  ? 8.166   -1.755  -4.321  1.00 0.00 ? 44  SER B CB   2  
ATOM 3007  O OG   . SER B 2 46  ? 7.629   -2.534  -5.380  1.00 0.00 ? 44  SER B OG   2  
ATOM 3008  H H    . SER B 2 46  ? 8.130   -0.459  -1.722  1.00 0.00 ? 44  SER B H    2  
ATOM 3009  H HA   . SER B 2 46  ? 6.212   -0.990  -3.869  1.00 0.00 ? 44  SER B HA   2  
ATOM 3010  H HB2  . SER B 2 46  ? 8.625   -0.871  -4.739  1.00 0.00 ? 44  SER B HB2  2  
ATOM 3011  H HB3  . SER B 2 46  ? 8.915   -2.338  -3.805  1.00 0.00 ? 44  SER B HB3  2  
ATOM 3012  H HG   . SER B 2 46  ? 7.716   -2.046  -6.212  1.00 0.00 ? 44  SER B HG   2  
ATOM 3013  N N    . HIS B 2 47  ? 5.365   -2.651  -2.260  1.00 0.00 ? 45  HIS B N    2  
ATOM 3014  C CA   . HIS B 2 47  ? 4.831   -3.726  -1.439  1.00 0.00 ? 45  HIS B CA   2  
ATOM 3015  C C    . HIS B 2 47  ? 3.747   -4.465  -2.193  1.00 0.00 ? 45  HIS B C    2  
ATOM 3016  O O    . HIS B 2 47  ? 2.985   -3.861  -2.952  1.00 0.00 ? 45  HIS B O    2  
ATOM 3017  C CB   . HIS B 2 47  ? 4.255   -3.179  -0.127  1.00 0.00 ? 45  HIS B CB   2  
ATOM 3018  C CG   . HIS B 2 47  ? 5.263   -2.507  0.756   1.00 0.00 ? 45  HIS B CG   2  
ATOM 3019  N ND1  . HIS B 2 47  ? 5.954   -3.143  1.762   1.00 0.00 ? 45  HIS B ND1  2  
ATOM 3020  C CD2  . HIS B 2 47  ? 5.687   -1.219  0.768   1.00 0.00 ? 45  HIS B CD2  2  
ATOM 3021  C CE1  . HIS B 2 47  ? 6.760   -2.242  2.340   1.00 0.00 ? 45  HIS B CE1  2  
ATOM 3022  N NE2  . HIS B 2 47  ? 6.636   -1.057  1.772   1.00 0.00 ? 45  HIS B NE2  2  
ATOM 3023  H H    . HIS B 2 47  ? 4.744   -2.022  -2.688  1.00 0.00 ? 45  HIS B H    2  
ATOM 3024  H HA   . HIS B 2 47  ? 5.634   -4.411  -1.220  1.00 0.00 ? 45  HIS B HA   2  
ATOM 3025  H HB2  . HIS B 2 47  ? 3.486   -2.458  -0.357  1.00 0.00 ? 45  HIS B HB2  2  
ATOM 3026  H HB3  . HIS B 2 47  ? 3.818   -3.995  0.428   1.00 0.00 ? 45  HIS B HB3  2  
ATOM 3027  H HD1  . HIS B 2 47  ? 5.872   -4.085  2.013   1.00 0.00 ? 45  HIS B HD1  2  
ATOM 3028  H HD2  . HIS B 2 47  ? 5.348   -0.433  0.109   1.00 0.00 ? 45  HIS B HD2  2  
ATOM 3029  H HE1  . HIS B 2 47  ? 7.425   -2.456  3.163   1.00 0.00 ? 45  HIS B HE1  2  
ATOM 3030  N N    . MET B 2 48  ? 3.679   -5.765  -1.990  1.00 0.00 ? 46  MET B N    2  
ATOM 3031  C CA   . MET B 2 48  ? 2.675   -6.574  -2.647  1.00 0.00 ? 46  MET B CA   2  
ATOM 3032  C C    . MET B 2 48  ? 1.425   -6.601  -1.786  1.00 0.00 ? 46  MET B C    2  
ATOM 3033  O O    . MET B 2 48  ? 1.511   -6.609  -0.562  1.00 0.00 ? 46  MET B O    2  
ATOM 3034  C CB   . MET B 2 48  ? 3.181   -8.001  -2.885  1.00 0.00 ? 46  MET B CB   2  
ATOM 3035  C CG   . MET B 2 48  ? 4.567   -8.072  -3.511  1.00 0.00 ? 46  MET B CG   2  
ATOM 3036  S SD   . MET B 2 48  ? 4.643   -7.316  -5.149  1.00 0.00 ? 46  MET B SD   2  
ATOM 3037  C CE   . MET B 2 48  ? 3.592   -8.419  -6.093  1.00 0.00 ? 46  MET B CE   2  
ATOM 3038  H H    . MET B 2 48  ? 4.306   -6.192  -1.363  1.00 0.00 ? 46  MET B H    2  
ATOM 3039  H HA   . MET B 2 48  ? 2.440   -6.114  -3.595  1.00 0.00 ? 46  MET B HA   2  
ATOM 3040  H HB2  . MET B 2 48  ? 3.214   -8.520  -1.939  1.00 0.00 ? 46  MET B HB2  2  
ATOM 3041  H HB3  . MET B 2 48  ? 2.489   -8.509  -3.540  1.00 0.00 ? 46  MET B HB3  2  
ATOM 3042  H HG2  . MET B 2 48  ? 5.263   -7.560  -2.863  1.00 0.00 ? 46  MET B HG2  2  
ATOM 3043  H HG3  . MET B 2 48  ? 4.854   -9.109  -3.595  1.00 0.00 ? 46  MET B HG3  2  
ATOM 3044  H HE1  . MET B 2 48  ? 3.565   -8.097  -7.123  1.00 0.00 ? 46  MET B HE1  2  
ATOM 3045  H HE2  . MET B 2 48  ? 2.593   -8.401  -5.684  1.00 0.00 ? 46  MET B HE2  2  
ATOM 3046  H HE3  . MET B 2 48  ? 3.985   -9.423  -6.040  1.00 0.00 ? 46  MET B HE3  2  
ATOM 3047  N N    . TYR B 2 49  ? 0.268   -6.606  -2.424  1.00 0.00 ? 47  TYR B N    2  
ATOM 3048  C CA   . TYR B 2 49  ? -1.009  -6.634  -1.710  1.00 0.00 ? 47  TYR B CA   2  
ATOM 3049  C C    . TYR B 2 49  ? -1.133  -7.909  -0.878  1.00 0.00 ? 47  TYR B C    2  
ATOM 3050  O O    . TYR B 2 49  ? -1.917  -7.975  0.064   1.00 0.00 ? 47  TYR B O    2  
ATOM 3051  C CB   . TYR B 2 49  ? -2.151  -6.539  -2.717  1.00 0.00 ? 47  TYR B CB   2  
ATOM 3052  C CG   . TYR B 2 49  ? -2.178  -5.218  -3.449  1.00 0.00 ? 47  TYR B CG   2  
ATOM 3053  C CD1  . TYR B 2 49  ? -2.723  -5.116  -4.717  1.00 0.00 ? 47  TYR B CD1  2  
ATOM 3054  C CD2  . TYR B 2 49  ? -1.649  -4.070  -2.867  1.00 0.00 ? 47  TYR B CD2  2  
ATOM 3055  C CE1  . TYR B 2 49  ? -2.741  -3.910  -5.384  1.00 0.00 ? 47  TYR B CE1  2  
ATOM 3056  C CE2  . TYR B 2 49  ? -1.666  -2.861  -3.530  1.00 0.00 ? 47  TYR B CE2  2  
ATOM 3057  C CZ   . TYR B 2 49  ? -2.213  -2.788  -4.790  1.00 0.00 ? 47  TYR B CZ   2  
ATOM 3058  O OH   . TYR B 2 49  ? -2.231  -1.590  -5.463  1.00 0.00 ? 47  TYR B OH   2  
ATOM 3059  H H    . TYR B 2 49  ? 0.264   -6.593  -3.408  1.00 0.00 ? 47  TYR B H    2  
ATOM 3060  H HA   . TYR B 2 49  ? -1.060  -5.767  -1.038  1.00 0.00 ? 47  TYR B HA   2  
ATOM 3061  H HB2  . TYR B 2 49  ? -2.045  -7.324  -3.449  1.00 0.00 ? 47  TYR B HB2  2  
ATOM 3062  H HB3  . TYR B 2 49  ? -3.092  -6.655  -2.200  1.00 0.00 ? 47  TYR B HB3  2  
ATOM 3063  H HD1  . TYR B 2 49  ? -3.138  -5.997  -5.183  1.00 0.00 ? 47  TYR B HD1  2  
ATOM 3064  H HD2  . TYR B 2 49  ? -1.220  -4.133  -1.878  1.00 0.00 ? 47  TYR B HD2  2  
ATOM 3065  H HE1  . TYR B 2 49  ? -3.167  -3.848  -6.373  1.00 0.00 ? 47  TYR B HE1  2  
ATOM 3066  H HE2  . TYR B 2 49  ? -1.248  -1.979  -3.061  1.00 0.00 ? 47  TYR B HE2  2  
ATOM 3067  H HH   . TYR B 2 49  ? -2.141  -1.760  -6.410  1.00 0.00 ? 47  TYR B HH   2  
ATOM 3068  N N    . ALA B 2 50  ? -0.327  -8.907  -1.219  1.00 0.00 ? 48  ALA B N    2  
ATOM 3069  C CA   . ALA B 2 50  ? -0.338  -10.180 -0.515  1.00 0.00 ? 48  ALA B CA   2  
ATOM 3070  C C    . ALA B 2 50  ? 0.342   -10.072 0.847   1.00 0.00 ? 48  ALA B C    2  
ATOM 3071  O O    . ALA B 2 50  ? 0.192   -10.957 1.684   1.00 0.00 ? 48  ALA B O    2  
ATOM 3072  C CB   . ALA B 2 50  ? 0.335   -11.251 -1.360  1.00 0.00 ? 48  ALA B CB   2  
ATOM 3073  H H    . ALA B 2 50  ? 0.302   -8.777  -1.956  1.00 0.00 ? 48  ALA B H    2  
ATOM 3074  H HA   . ALA B 2 50  ? -1.368  -10.469 -0.369  1.00 0.00 ? 48  ALA B HA   2  
ATOM 3075  H HB1  . ALA B 2 50  ? 1.371   -10.989 -1.515  1.00 0.00 ? 48  ALA B HB1  2  
ATOM 3076  H HB2  . ALA B 2 50  ? -0.165  -11.324 -2.315  1.00 0.00 ? 48  ALA B HB2  2  
ATOM 3077  H HB3  . ALA B 2 50  ? 0.277   -12.201 -0.850  1.00 0.00 ? 48  ALA B HB3  2  
ATOM 3078  N N    . ASP B 2 51  ? 1.089   -8.987  1.052   1.00 0.00 ? 49  ASP B N    2  
ATOM 3079  C CA   . ASP B 2 51  ? 1.792   -8.755  2.305   1.00 0.00 ? 49  ASP B CA   2  
ATOM 3080  C C    . ASP B 2 51  ? 1.083   -7.677  3.106   1.00 0.00 ? 49  ASP B C    2  
ATOM 3081  O O    . ASP B 2 51  ? 1.453   -7.384  4.248   1.00 0.00 ? 49  ASP B O    2  
ATOM 3082  C CB   . ASP B 2 51  ? 3.217   -8.277  2.079   1.00 0.00 ? 49  ASP B CB   2  
ATOM 3083  C CG   . ASP B 2 51  ? 3.852   -8.769  0.789   1.00 0.00 ? 49  ASP B CG   2  
ATOM 3084  O OD1  . ASP B 2 51  ? 3.885   -9.995  0.557   1.00 0.00 ? 49  ASP B OD1  2  
ATOM 3085  O OD2  . ASP B 2 51  ? 4.328   -7.913  0.003   1.00 0.00 ? 49  ASP B OD2  2  
ATOM 3086  H H    . ASP B 2 51  ? 1.178   -8.331  0.346   1.00 0.00 ? 49  ASP B H    2  
ATOM 3087  H HA   . ASP B 2 51  ? 1.805   -9.675  2.873   1.00 0.00 ? 49  ASP B HA   2  
ATOM 3088  H HB2  . ASP B 2 51  ? 3.205   -7.204  2.065   1.00 0.00 ? 49  ASP B HB2  2  
ATOM 3089  H HB3  . ASP B 2 51  ? 3.819   -8.613  2.908   1.00 0.00 ? 49  ASP B HB3  2  
ATOM 3090  N N    . ILE B 2 52  ? 0.074   -7.069  2.509   1.00 0.00 ? 50  ILE B N    2  
ATOM 3091  C CA   . ILE B 2 52  ? -0.668  -6.030  3.193   1.00 0.00 ? 50  ILE B CA   2  
ATOM 3092  C C    . ILE B 2 52  ? -1.829  -6.679  3.935   1.00 0.00 ? 50  ILE B C    2  
ATOM 3093  O O    . ILE B 2 52  ? -2.589  -7.448  3.351   1.00 0.00 ? 50  ILE B O    2  
ATOM 3094  C CB   . ILE B 2 52  ? -1.217  -4.961  2.223   1.00 0.00 ? 50  ILE B CB   2  
ATOM 3095  C CG1  . ILE B 2 52  ? -0.255  -4.718  1.051   1.00 0.00 ? 50  ILE B CG1  2  
ATOM 3096  C CG2  . ILE B 2 52  ? -1.488  -3.663  2.969   1.00 0.00 ? 50  ILE B CG2  2  
ATOM 3097  C CD1  . ILE B 2 52  ? 0.938   -3.848  1.384   1.00 0.00 ? 50  ILE B CD1  2  
ATOM 3098  H H    . ILE B 2 52  ? -0.196  -7.346  1.606   1.00 0.00 ? 50  ILE B H    2  
ATOM 3099  H HA   . ILE B 2 52  ? 0.003   -5.550  3.906   1.00 0.00 ? 50  ILE B HA   2  
ATOM 3100  H HB   . ILE B 2 52  ? -2.160  -5.318  1.834   1.00 0.00 ? 50  ILE B HB   2  
ATOM 3101  H HG12 . ILE B 2 52  ? 0.123   -5.669  0.707   1.00 0.00 ? 50  ILE B HG12 2  
ATOM 3102  H HG13 . ILE B 2 52  ? -0.797  -4.242  0.246   1.00 0.00 ? 50  ILE B HG13 2  
ATOM 3103  H HG21 . ILE B 2 52  ? -2.285  -3.817  3.681   1.00 0.00 ? 50  ILE B HG21 2  
ATOM 3104  H HG22 . ILE B 2 52  ? -1.778  -2.898  2.263   1.00 0.00 ? 50  ILE B HG22 2  
ATOM 3105  H HG23 . ILE B 2 52  ? -0.594  -3.355  3.488   1.00 0.00 ? 50  ILE B HG23 2  
ATOM 3106  H HD11 . ILE B 2 52  ? 1.573   -3.759  0.516   1.00 0.00 ? 50  ILE B HD11 2  
ATOM 3107  H HD12 . ILE B 2 52  ? 1.495   -4.294  2.194   1.00 0.00 ? 50  ILE B HD12 2  
ATOM 3108  H HD13 . ILE B 2 52  ? 0.596   -2.867  1.682   1.00 0.00 ? 50  ILE B HD13 2  
ATOM 3109  N N    . LYS B 2 53  ? -1.967  -6.371  5.209   1.00 0.00 ? 51  LYS B N    2  
ATOM 3110  C CA   . LYS B 2 53  ? -3.020  -6.951  6.020   1.00 0.00 ? 51  LYS B CA   2  
ATOM 3111  C C    . LYS B 2 53  ? -4.285  -6.131  5.882   1.00 0.00 ? 51  LYS B C    2  
ATOM 3112  O O    . LYS B 2 53  ? -5.394  -6.656  5.940   1.00 0.00 ? 51  LYS B O    2  
ATOM 3113  C CB   . LYS B 2 53  ? -2.601  -6.993  7.485   1.00 0.00 ? 51  LYS B CB   2  
ATOM 3114  C CG   . LYS B 2 53  ? -3.550  -7.794  8.353   1.00 0.00 ? 51  LYS B CG   2  
ATOM 3115  C CD   . LYS B 2 53  ? -3.635  -7.226  9.748   1.00 0.00 ? 51  LYS B CD   2  
ATOM 3116  C CE   . LYS B 2 53  ? -4.616  -6.064  9.810   1.00 0.00 ? 51  LYS B CE   2  
ATOM 3117  N NZ   . LYS B 2 53  ? -5.169  -5.856  11.174  1.00 0.00 ? 51  LYS B NZ   2  
ATOM 3118  H H    . LYS B 2 53  ? -1.375  -5.699  5.610   1.00 0.00 ? 51  LYS B H    2  
ATOM 3119  H HA   . LYS B 2 53  ? -3.203  -7.956  5.675   1.00 0.00 ? 51  LYS B HA   2  
ATOM 3120  H HB2  . LYS B 2 53  ? -1.618  -7.436  7.555   1.00 0.00 ? 51  LYS B HB2  2  
ATOM 3121  H HB3  . LYS B 2 53  ? -2.563  -5.984  7.866   1.00 0.00 ? 51  LYS B HB3  2  
ATOM 3122  H HG2  . LYS B 2 53  ? -4.534  -7.773  7.906   1.00 0.00 ? 51  LYS B HG2  2  
ATOM 3123  H HG3  . LYS B 2 53  ? -3.199  -8.813  8.407   1.00 0.00 ? 51  LYS B HG3  2  
ATOM 3124  H HD2  . LYS B 2 53  ? -3.959  -8.004  10.420  1.00 0.00 ? 51  LYS B HD2  2  
ATOM 3125  H HD3  . LYS B 2 53  ? -2.654  -6.878  10.037  1.00 0.00 ? 51  LYS B HD3  2  
ATOM 3126  H HE2  . LYS B 2 53  ? -4.107  -5.164  9.501   1.00 0.00 ? 51  LYS B HE2  2  
ATOM 3127  H HE3  . LYS B 2 53  ? -5.431  -6.264  9.129   1.00 0.00 ? 51  LYS B HE3  2  
ATOM 3128  H HZ1  . LYS B 2 53  ? -5.669  -6.722  11.492  1.00 0.00 ? 51  LYS B HZ1  2  
ATOM 3129  H HZ2  . LYS B 2 53  ? -5.843  -5.060  11.170  1.00 0.00 ? 51  LYS B HZ2  2  
ATOM 3130  H HZ3  . LYS B 2 53  ? -4.407  -5.645  11.844  1.00 0.00 ? 51  LYS B HZ3  2  
ATOM 3131  N N    . CYS B 2 54  ? -4.096  -4.831  5.714   1.00 0.00 ? 52  CYS B N    2  
ATOM 3132  C CA   . CYS B 2 54  ? -5.191  -3.901  5.569   1.00 0.00 ? 52  CYS B CA   2  
ATOM 3133  C C    . CYS B 2 54  ? -4.622  -2.512  5.356   1.00 0.00 ? 52  CYS B C    2  
ATOM 3134  O O    . CYS B 2 54  ? -3.405  -2.337  5.300   1.00 0.00 ? 52  CYS B O    2  
ATOM 3135  C CB   . CYS B 2 54  ? -6.060  -3.911  6.824   1.00 0.00 ? 52  CYS B CB   2  
ATOM 3136  S SG   . CYS B 2 54  ? -5.232  -3.265  8.293   1.00 0.00 ? 52  CYS B SG   2  
ATOM 3137  H H    . CYS B 2 54  ? -3.179  -4.478  5.695   1.00 0.00 ? 52  CYS B H    2  
ATOM 3138  H HA   . CYS B 2 54  ? -5.781  -4.189  4.712   1.00 0.00 ? 52  CYS B HA   2  
ATOM 3139  H HB2  . CYS B 2 54  ? -6.930  -3.313  6.648   1.00 0.00 ? 52  CYS B HB2  2  
ATOM 3140  H HB3  . CYS B 2 54  ? -6.362  -4.926  7.035   1.00 0.00 ? 52  CYS B HB3  2  
ATOM 3141  H HG   . CYS B 2 54  ? -6.116  -3.228  9.289   1.00 0.00 ? 52  CYS B HG   2  
ATOM 3142  N N    . GLN B 2 55  ? -5.483  -1.527  5.241   1.00 0.00 ? 53  GLN B N    2  
ATOM 3143  C CA   . GLN B 2 55  ? -5.026  -0.171  5.071   1.00 0.00 ? 53  GLN B CA   2  
ATOM 3144  C C    . GLN B 2 55  ? -5.811  0.761   5.983   1.00 0.00 ? 53  GLN B C    2  
ATOM 3145  O O    . GLN B 2 55  ? -7.008  0.577   6.182   1.00 0.00 ? 53  GLN B O    2  
ATOM 3146  C CB   . GLN B 2 55  ? -5.143  0.283   3.612   1.00 0.00 ? 53  GLN B CB   2  
ATOM 3147  C CG   . GLN B 2 55  ? -6.560  0.611   3.154   1.00 0.00 ? 53  GLN B CG   2  
ATOM 3148  C CD   . GLN B 2 55  ? -7.352  -0.616  2.753   1.00 0.00 ? 53  GLN B CD   2  
ATOM 3149  O OE1  . GLN B 2 55  ? -6.793  -1.603  2.291   1.00 0.00 ? 53  GLN B OE1  2  
ATOM 3150  N NE2  . GLN B 2 55  ? -8.663  -0.558  2.919   1.00 0.00 ? 53  GLN B NE2  2  
ATOM 3151  H H    . GLN B 2 55  ? -6.446  -1.713  5.272   1.00 0.00 ? 53  GLN B H    2  
ATOM 3152  H HA   . GLN B 2 55  ? -3.984  -0.150  5.353   1.00 0.00 ? 53  GLN B HA   2  
ATOM 3153  H HB2  . GLN B 2 55  ? -4.538  1.169   3.487   1.00 0.00 ? 53  GLN B HB2  2  
ATOM 3154  H HB3  . GLN B 2 55  ? -4.754  -0.501  2.978   1.00 0.00 ? 53  GLN B HB3  2  
ATOM 3155  H HG2  . GLN B 2 55  ? -7.079  1.105   3.962   1.00 0.00 ? 53  GLN B HG2  2  
ATOM 3156  H HG3  . GLN B 2 55  ? -6.502  1.278   2.306   1.00 0.00 ? 53  GLN B HG3  2  
ATOM 3157  H HE21 . GLN B 2 55  ? -9.048  0.261   3.287   1.00 0.00 ? 53  GLN B HE21 2  
ATOM 3158  H HE22 . GLN B 2 55  ? -9.195  -1.344  2.664   1.00 0.00 ? 53  GLN B HE22 2  
ATOM 3159  N N    . LYS B 2 56  ? -5.134  1.737   6.563   1.00 0.00 ? 54  LYS B N    2  
ATOM 3160  C CA   . LYS B 2 56  ? -5.800  2.700   7.423   1.00 0.00 ? 54  LYS B CA   2  
ATOM 3161  C C    . LYS B 2 56  ? -5.999  3.987   6.654   1.00 0.00 ? 54  LYS B C    2  
ATOM 3162  O O    . LYS B 2 56  ? -5.170  4.349   5.827   1.00 0.00 ? 54  LYS B O    2  
ATOM 3163  C CB   . LYS B 2 56  ? -4.980  3.058   8.664   1.00 0.00 ? 54  LYS B CB   2  
ATOM 3164  C CG   . LYS B 2 56  ? -4.941  2.042   9.788   1.00 0.00 ? 54  LYS B CG   2  
ATOM 3165  C CD   . LYS B 2 56  ? -4.366  2.709   11.031  1.00 0.00 ? 54  LYS B CD   2  
ATOM 3166  C CE   . LYS B 2 56  ? -4.149  1.765   12.201  1.00 0.00 ? 54  LYS B CE   2  
ATOM 3167  N NZ   . LYS B 2 56  ? -3.321  0.587   11.828  1.00 0.00 ? 54  LYS B NZ   2  
ATOM 3168  H H    . LYS B 2 56  ? -4.168  1.823   6.392   1.00 0.00 ? 54  LYS B H    2  
ATOM 3169  H HA   . LYS B 2 56  ? -6.758  2.299   7.718   1.00 0.00 ? 54  LYS B HA   2  
ATOM 3170  H HB2  . LYS B 2 56  ? -3.964  3.244   8.362   1.00 0.00 ? 54  LYS B HB2  2  
ATOM 3171  H HB3  . LYS B 2 56  ? -5.382  3.976   9.071   1.00 0.00 ? 54  LYS B HB3  2  
ATOM 3172  H HG2  . LYS B 2 56  ? -5.941  1.695   9.991   1.00 0.00 ? 54  LYS B HG2  2  
ATOM 3173  H HG3  . LYS B 2 56  ? -4.306  1.219   9.501   1.00 0.00 ? 54  LYS B HG3  2  
ATOM 3174  H HD2  . LYS B 2 56  ? -3.416  3.150   10.770  1.00 0.00 ? 54  LYS B HD2  2  
ATOM 3175  H HD3  . LYS B 2 56  ? -5.044  3.493   11.338  1.00 0.00 ? 54  LYS B HD3  2  
ATOM 3176  H HE2  . LYS B 2 56  ? -3.643  2.314   12.989  1.00 0.00 ? 54  LYS B HE2  2  
ATOM 3177  H HE3  . LYS B 2 56  ? -5.109  1.432   12.562  1.00 0.00 ? 54  LYS B HE3  2  
ATOM 3178  H HZ1  . LYS B 2 56  ? -3.926  -0.155  11.397  1.00 0.00 ? 54  LYS B HZ1  2  
ATOM 3179  H HZ2  . LYS B 2 56  ? -2.860  0.192   12.668  1.00 0.00 ? 54  LYS B HZ2  2  
ATOM 3180  H HZ3  . LYS B 2 56  ? -2.588  0.863   11.139  1.00 0.00 ? 54  LYS B HZ3  2  
ATOM 3181  N N    . ILE B 2 57  ? -7.091  4.666   6.908   1.00 0.00 ? 55  ILE B N    2  
ATOM 3182  C CA   . ILE B 2 57  ? -7.336  5.941   6.278   1.00 0.00 ? 55  ILE B CA   2  
ATOM 3183  C C    . ILE B 2 57  ? -7.565  6.957   7.387   1.00 0.00 ? 55  ILE B C    2  
ATOM 3184  O O    . ILE B 2 57  ? -8.314  6.694   8.330   1.00 0.00 ? 55  ILE B O    2  
ATOM 3185  C CB   . ILE B 2 57  ? -8.523  5.914   5.271   1.00 0.00 ? 55  ILE B CB   2  
ATOM 3186  C CG1  . ILE B 2 57  ? -9.864  6.264   5.921   1.00 0.00 ? 55  ILE B CG1  2  
ATOM 3187  C CG2  . ILE B 2 57  ? -8.624  4.544   4.616   1.00 0.00 ? 55  ILE B CG2  2  
ATOM 3188  C CD1  . ILE B 2 57  ? -10.826 6.932   4.959   1.00 0.00 ? 55  ILE B CD1  2  
ATOM 3189  H H    . ILE B 2 57  ? -7.761  4.295   7.529   1.00 0.00 ? 55  ILE B H    2  
ATOM 3190  H HA   . ILE B 2 57  ? -6.437  6.218   5.741   1.00 0.00 ? 55  ILE B HA   2  
ATOM 3191  H HB   . ILE B 2 57  ? -8.314  6.633   4.493   1.00 0.00 ? 55  ILE B HB   2  
ATOM 3192  H HG12 . ILE B 2 57  ? -10.329 5.362   6.288   1.00 0.00 ? 55  ILE B HG12 2  
ATOM 3193  H HG13 . ILE B 2 57  ? -9.693  6.940   6.746   1.00 0.00 ? 55  ILE B HG13 2  
ATOM 3194  H HG21 . ILE B 2 57  ? -8.797  3.794   5.374   1.00 0.00 ? 55  ILE B HG21 2  
ATOM 3195  H HG22 . ILE B 2 57  ? -7.701  4.326   4.098   1.00 0.00 ? 55  ILE B HG22 2  
ATOM 3196  H HG23 . ILE B 2 57  ? -9.442  4.540   3.911   1.00 0.00 ? 55  ILE B HG23 2  
ATOM 3197  H HD11 . ILE B 2 57  ? -11.748 7.164   5.468   1.00 0.00 ? 55  ILE B HD11 2  
ATOM 3198  H HD12 . ILE B 2 57  ? -11.027 6.269   4.131   1.00 0.00 ? 55  ILE B HD12 2  
ATOM 3199  H HD13 . ILE B 2 57  ? -10.383 7.846   4.584   1.00 0.00 ? 55  ILE B HD13 2  
ATOM 3200  N N    . SER B 2 58  ? -6.864  8.073   7.334   1.00 0.00 ? 56  SER B N    2  
ATOM 3201  C CA   . SER B 2 58  ? -7.023  9.081   8.353   1.00 0.00 ? 56  SER B CA   2  
ATOM 3202  C C    . SER B 2 58  ? -8.116  10.036  7.914   1.00 0.00 ? 56  SER B C    2  
ATOM 3203  O O    . SER B 2 58  ? -8.004  10.695  6.857   1.00 0.00 ? 56  SER B O    2  
ATOM 3204  C CB   . SER B 2 58  ? -5.708  9.805   8.648   1.00 0.00 ? 56  SER B CB   2  
ATOM 3205  O OG   . SER B 2 58  ? -5.544  10.958  7.851   1.00 0.00 ? 56  SER B OG   2  
ATOM 3206  H H    . SER B 2 58  ? -6.243  8.228   6.586   1.00 0.00 ? 56  SER B H    2  
ATOM 3207  H HA   . SER B 2 58  ? -7.355  8.579   9.253   1.00 0.00 ? 56  SER B HA   2  
ATOM 3208  H HB2  . SER B 2 58  ? -5.684  10.090  9.680   1.00 0.00 ? 56  SER B HB2  2  
ATOM 3209  H HB3  . SER B 2 58  ? -4.886  9.132   8.449   1.00 0.00 ? 56  SER B HB3  2  
ATOM 3210  H HG   . SER B 2 58  ? -6.116  11.661  8.186   1.00 0.00 ? 56  SER B HG   2  
ATOM 3211  N N    . PRO B 2 59  ? -9.186  10.067  8.722   1.00 0.00 ? 57  PRO B N    2  
ATOM 3212  C CA   . PRO B 2 59  ? -10.396 10.865  8.492   1.00 0.00 ? 57  PRO B CA   2  
ATOM 3213  C C    . PRO B 2 59  ? -10.193 12.366  8.619   1.00 0.00 ? 57  PRO B C    2  
ATOM 3214  O O    . PRO B 2 59  ? -9.117  12.848  8.988   1.00 0.00 ? 57  PRO B O    2  
ATOM 3215  C CB   . PRO B 2 59  ? -11.347 10.384  9.592   1.00 0.00 ? 57  PRO B CB   2  
ATOM 3216  C CG   . PRO B 2 59  ? -10.447 9.925   10.681  1.00 0.00 ? 57  PRO B CG   2  
ATOM 3217  C CD   . PRO B 2 59  ? -9.274  9.311   9.986   1.00 0.00 ? 57  PRO B CD   2  
ATOM 3218  H HA   . PRO B 2 59  ? -10.829 10.644  7.531   1.00 0.00 ? 57  PRO B HA   2  
ATOM 3219  H HB2  . PRO B 2 59  ? -11.975 11.202  9.912   1.00 0.00 ? 57  PRO B HB2  2  
ATOM 3220  H HB3  . PRO B 2 59  ? -11.958 9.576   9.218   1.00 0.00 ? 57  PRO B HB3  2  
ATOM 3221  H HG2  . PRO B 2 59  ? -10.129 10.768  11.282  1.00 0.00 ? 57  PRO B HG2  2  
ATOM 3222  H HG3  . PRO B 2 59  ? -10.945 9.191   11.295  1.00 0.00 ? 57  PRO B HG3  2  
ATOM 3223  H HD2  . PRO B 2 59  ? -8.377  9.439   10.575  1.00 0.00 ? 57  PRO B HD2  2  
ATOM 3224  H HD3  . PRO B 2 59  ? -9.455  8.264   9.796   1.00 0.00 ? 57  PRO B HD3  2  
ATOM 3225  N N    . GLU B 2 60  ? -11.246 13.090  8.270   1.00 0.00 ? 58  GLU B N    2  
ATOM 3226  C CA   . GLU B 2 60  ? -11.270 14.536  8.345   1.00 0.00 ? 58  GLU B CA   2  
ATOM 3227  C C    . GLU B 2 60  ? -11.066 14.989  9.788   1.00 0.00 ? 58  GLU B C    2  
ATOM 3228  O O    . GLU B 2 60  ? -11.284 14.228  10.731  1.00 0.00 ? 58  GLU B O    2  
ATOM 3229  C CB   . GLU B 2 60  ? -12.595 15.077  7.792   1.00 0.00 ? 58  GLU B CB   2  
ATOM 3230  C CG   . GLU B 2 60  ? -12.732 14.954  6.276   1.00 0.00 ? 58  GLU B CG   2  
ATOM 3231  C CD   . GLU B 2 60  ? -12.585 13.527  5.778   1.00 0.00 ? 58  GLU B CD   2  
ATOM 3232  O OE1  . GLU B 2 60  ? -13.171 12.615  6.393   1.00 0.00 ? 58  GLU B OE1  2  
ATOM 3233  O OE2  . GLU B 2 60  ? -11.860 13.313  4.785   1.00 0.00 ? 58  GLU B OE2  2  
ATOM 3234  H H    . GLU B 2 60  ? -12.046 12.625  7.929   1.00 0.00 ? 58  GLU B H    2  
ATOM 3235  H HA   . GLU B 2 60  ? -10.456 14.913  7.743   1.00 0.00 ? 58  GLU B HA   2  
ATOM 3236  H HB2  . GLU B 2 60  ? -13.408 14.533  8.249   1.00 0.00 ? 58  GLU B HB2  2  
ATOM 3237  H HB3  . GLU B 2 60  ? -12.679 16.121  8.055   1.00 0.00 ? 58  GLU B HB3  2  
ATOM 3238  H HG2  . GLU B 2 60  ? -13.706 15.318  5.987   1.00 0.00 ? 58  GLU B HG2  2  
ATOM 3239  H HG3  . GLU B 2 60  ? -11.971 15.562  5.810   1.00 0.00 ? 58  GLU B HG3  2  
ATOM 3240  N N    . GLY B 2 61  ? -10.672 16.235  9.949   1.00 0.00 ? 59  GLY B N    2  
ATOM 3241  C CA   . GLY B 2 61  ? -10.399 16.772  11.264  1.00 0.00 ? 59  GLY B CA   2  
ATOM 3242  C C    . GLY B 2 61  ? -8.930  17.084  11.383  1.00 0.00 ? 59  GLY B C    2  
ATOM 3243  O O    . GLY B 2 61  ? -8.525  17.990  12.107  1.00 0.00 ? 59  GLY B O    2  
ATOM 3244  H H    . GLY B 2 61  ? -10.551 16.802  9.160   1.00 0.00 ? 59  GLY B H    2  
ATOM 3245  H HA2  . GLY B 2 61  ? -10.976 17.676  11.411  1.00 0.00 ? 59  GLY B HA2  2  
ATOM 3246  H HA3  . GLY B 2 61  ? -10.670 16.045  12.014  1.00 0.00 ? 59  GLY B HA3  2  
ATOM 3247  N N    . LYS B 2 62  ? -8.139  16.324  10.641  1.00 0.00 ? 60  LYS B N    2  
ATOM 3248  C CA   . LYS B 2 62  ? -6.707  16.530  10.584  1.00 0.00 ? 60  LYS B CA   2  
ATOM 3249  C C    . LYS B 2 62  ? -6.424  17.538  9.495   1.00 0.00 ? 60  LYS B C    2  
ATOM 3250  O O    . LYS B 2 62  ? -7.200  17.668  8.547   1.00 0.00 ? 60  LYS B O    2  
ATOM 3251  C CB   . LYS B 2 62  ? -5.965  15.221  10.281  1.00 0.00 ? 60  LYS B CB   2  
ATOM 3252  C CG   . LYS B 2 62  ? -5.569  14.434  11.517  1.00 0.00 ? 60  LYS B CG   2  
ATOM 3253  C CD   . LYS B 2 62  ? -4.653  13.261  11.175  1.00 0.00 ? 60  LYS B CD   2  
ATOM 3254  C CE   . LYS B 2 62  ? -4.028  12.654  12.425  1.00 0.00 ? 60  LYS B CE   2  
ATOM 3255  N NZ   . LYS B 2 62  ? -4.744  13.061  13.662  1.00 0.00 ? 60  LYS B NZ   2  
ATOM 3256  H H    . LYS B 2 62  ? -8.535  15.597  10.116  1.00 0.00 ? 60  LYS B H    2  
ATOM 3257  H HA   . LYS B 2 62  ? -6.372  16.932  11.528  1.00 0.00 ? 60  LYS B HA   2  
ATOM 3258  H HB2  . LYS B 2 62  ? -6.601  14.594  9.672   1.00 0.00 ? 60  LYS B HB2  2  
ATOM 3259  H HB3  . LYS B 2 62  ? -5.069  15.452  9.724   1.00 0.00 ? 60  LYS B HB3  2  
ATOM 3260  H HG2  . LYS B 2 62  ? -5.054  15.092  12.200  1.00 0.00 ? 60  LYS B HG2  2  
ATOM 3261  H HG3  . LYS B 2 62  ? -6.464  14.054  11.988  1.00 0.00 ? 60  LYS B HG3  2  
ATOM 3262  H HD2  . LYS B 2 62  ? -5.225  12.500  10.670  1.00 0.00 ? 60  LYS B HD2  2  
ATOM 3263  H HD3  . LYS B 2 62  ? -3.862  13.610  10.526  1.00 0.00 ? 60  LYS B HD3  2  
ATOM 3264  H HE2  . LYS B 2 62  ? -4.050  11.576  12.341  1.00 0.00 ? 60  LYS B HE2  2  
ATOM 3265  H HE3  . LYS B 2 62  ? -2.995  12.981  12.491  1.00 0.00 ? 60  LYS B HE3  2  
ATOM 3266  H HZ1  . LYS B 2 62  ? -5.776  12.937  13.533  1.00 0.00 ? 60  LYS B HZ1  2  
ATOM 3267  H HZ2  . LYS B 2 62  ? -4.546  14.061  13.879  1.00 0.00 ? 60  LYS B HZ2  2  
ATOM 3268  H HZ3  . LYS B 2 62  ? -4.433  12.469  14.468  1.00 0.00 ? 60  LYS B HZ3  2  
ATOM 3269  N N    . ALA B 2 63  ? -5.331  18.258  9.634   1.00 0.00 ? 61  ALA B N    2  
ATOM 3270  C CA   . ALA B 2 63  ? -4.950  19.248  8.645   1.00 0.00 ? 61  ALA B CA   2  
ATOM 3271  C C    . ALA B 2 63  ? -4.614  18.577  7.333   1.00 0.00 ? 61  ALA B C    2  
ATOM 3272  O O    . ALA B 2 63  ? -4.623  19.204  6.276   1.00 0.00 ? 61  ALA B O    2  
ATOM 3273  C CB   . ALA B 2 63  ? -3.763  20.039  9.134   1.00 0.00 ? 61  ALA B CB   2  
ATOM 3274  H H    . ALA B 2 63  ? -4.768  18.125  10.426  1.00 0.00 ? 61  ALA B H    2  
ATOM 3275  H HA   . ALA B 2 63  ? -5.781  19.921  8.495   1.00 0.00 ? 61  ALA B HA   2  
ATOM 3276  H HB1  . ALA B 2 63  ? -4.012  20.521  10.063  1.00 0.00 ? 61  ALA B HB1  2  
ATOM 3277  H HB2  . ALA B 2 63  ? -3.499  20.778  8.395   1.00 0.00 ? 61  ALA B HB2  2  
ATOM 3278  H HB3  . ALA B 2 63  ? -2.930  19.367  9.286   1.00 0.00 ? 61  ALA B HB3  2  
ATOM 3279  N N    . LYS B 2 64  ? -4.314  17.296  7.414   1.00 0.00 ? 62  LYS B N    2  
ATOM 3280  C CA   . LYS B 2 64  ? -3.971  16.539  6.241   1.00 0.00 ? 62  LYS B CA   2  
ATOM 3281  C C    . LYS B 2 64  ? -4.677  15.193  6.238   1.00 0.00 ? 62  LYS B C    2  
ATOM 3282  O O    . LYS B 2 64  ? -4.871  14.577  7.286   1.00 0.00 ? 62  LYS B O    2  
ATOM 3283  C CB   . LYS B 2 64  ? -2.460  16.334  6.147   1.00 0.00 ? 62  LYS B CB   2  
ATOM 3284  C CG   . LYS B 2 64  ? -1.710  16.540  7.455   1.00 0.00 ? 62  LYS B CG   2  
ATOM 3285  C CD   . LYS B 2 64  ? -1.702  15.281  8.302   1.00 0.00 ? 62  LYS B CD   2  
ATOM 3286  C CE   . LYS B 2 64  ? -0.400  15.144  9.070   1.00 0.00 ? 62  LYS B CE   2  
ATOM 3287  N NZ   . LYS B 2 64  ? -0.119  16.335  9.915   1.00 0.00 ? 62  LYS B NZ   2  
ATOM 3288  H H    . LYS B 2 64  ? -4.345  16.848  8.282   1.00 0.00 ? 62  LYS B H    2  
ATOM 3289  H HA   . LYS B 2 64  ? -4.297  17.113  5.392   1.00 0.00 ? 62  LYS B HA   2  
ATOM 3290  H HB2  . LYS B 2 64  ? -2.269  15.324  5.811   1.00 0.00 ? 62  LYS B HB2  2  
ATOM 3291  H HB3  . LYS B 2 64  ? -2.061  17.023  5.419   1.00 0.00 ? 62  LYS B HB3  2  
ATOM 3292  H HG2  . LYS B 2 64  ? -0.690  16.817  7.234   1.00 0.00 ? 62  LYS B HG2  2  
ATOM 3293  H HG3  . LYS B 2 64  ? -2.188  17.335  8.009   1.00 0.00 ? 62  LYS B HG3  2  
ATOM 3294  H HD2  . LYS B 2 64  ? -2.521  15.325  9.005   1.00 0.00 ? 62  LYS B HD2  2  
ATOM 3295  H HD3  . LYS B 2 64  ? -1.823  14.423  7.657   1.00 0.00 ? 62  LYS B HD3  2  
ATOM 3296  H HE2  . LYS B 2 64  ? -0.461  14.271  9.703   1.00 0.00 ? 62  LYS B HE2  2  
ATOM 3297  H HE3  . LYS B 2 64  ? 0.408   15.016  8.363   1.00 0.00 ? 62  LYS B HE3  2  
ATOM 3298  H HZ1  . LYS B 2 64  ? 0.803   16.227  10.383  1.00 0.00 ? 62  LYS B HZ1  2  
ATOM 3299  H HZ2  . LYS B 2 64  ? -0.858  16.443  10.650  1.00 0.00 ? 62  LYS B HZ2  2  
ATOM 3300  H HZ3  . LYS B 2 64  ? -0.096  17.192  9.327   1.00 0.00 ? 62  LYS B HZ3  2  
ATOM 3301  N N    . ILE B 2 65  ? -5.064  14.757  5.058   1.00 0.00 ? 63  ILE B N    2  
ATOM 3302  C CA   . ILE B 2 65  ? -5.727  13.477  4.883   1.00 0.00 ? 63  ILE B CA   2  
ATOM 3303  C C    . ILE B 2 65  ? -4.653  12.403  4.755   1.00 0.00 ? 63  ILE B C    2  
ATOM 3304  O O    . ILE B 2 65  ? -3.615  12.657  4.155   1.00 0.00 ? 63  ILE B O    2  
ATOM 3305  C CB   . ILE B 2 65  ? -6.633  13.511  3.633   1.00 0.00 ? 63  ILE B CB   2  
ATOM 3306  C CG1  . ILE B 2 65  ? -7.855  14.394  3.896   1.00 0.00 ? 63  ILE B CG1  2  
ATOM 3307  C CG2  . ILE B 2 65  ? -7.066  12.116  3.227   1.00 0.00 ? 63  ILE B CG2  2  
ATOM 3308  C CD1  . ILE B 2 65  ? -7.673  15.839  3.477   1.00 0.00 ? 63  ILE B CD1  2  
ATOM 3309  H H    . ILE B 2 65  ? -4.885  15.308  4.267   1.00 0.00 ? 63  ILE B H    2  
ATOM 3310  H HA   . ILE B 2 65  ? -6.334  13.282  5.757   1.00 0.00 ? 63  ILE B HA   2  
ATOM 3311  H HB   . ILE B 2 65  ? -6.065  13.933  2.818   1.00 0.00 ? 63  ILE B HB   2  
ATOM 3312  H HG12 . ILE B 2 65  ? -8.698  13.997  3.352   1.00 0.00 ? 63  ILE B HG12 2  
ATOM 3313  H HG13 . ILE B 2 65  ? -8.077  14.380  4.952   1.00 0.00 ? 63  ILE B HG13 2  
ATOM 3314  H HG21 . ILE B 2 65  ? -7.652  11.676  4.020   1.00 0.00 ? 63  ILE B HG21 2  
ATOM 3315  H HG22 . ILE B 2 65  ? -6.192  11.507  3.046   1.00 0.00 ? 63  ILE B HG22 2  
ATOM 3316  H HG23 . ILE B 2 65  ? -7.660  12.171  2.328   1.00 0.00 ? 63  ILE B HG23 2  
ATOM 3317  H HD11 . ILE B 2 65  ? -7.531  15.889  2.407   1.00 0.00 ? 63  ILE B HD11 2  
ATOM 3318  H HD12 . ILE B 2 65  ? -6.810  16.254  3.975   1.00 0.00 ? 63  ILE B HD12 2  
ATOM 3319  H HD13 . ILE B 2 65  ? -8.553  16.405  3.749   1.00 0.00 ? 63  ILE B HD13 2  
ATOM 3320  N N    . GLN B 2 66  ? -4.862  11.215  5.314   1.00 0.00 ? 64  GLN B N    2  
ATOM 3321  C CA   . GLN B 2 66  ? -3.808  10.194  5.245   1.00 0.00 ? 64  GLN B CA   2  
ATOM 3322  C C    . GLN B 2 66  ? -4.320  8.788   5.014   1.00 0.00 ? 64  GLN B C    2  
ATOM 3323  O O    . GLN B 2 66  ? -5.506  8.499   5.150   1.00 0.00 ? 64  GLN B O    2  
ATOM 3324  C CB   . GLN B 2 66  ? -2.977  10.158  6.522   1.00 0.00 ? 64  GLN B CB   2  
ATOM 3325  C CG   . GLN B 2 66  ? -2.258  11.442  6.868   1.00 0.00 ? 64  GLN B CG   2  
ATOM 3326  C CD   . GLN B 2 66  ? -1.604  11.344  8.224   1.00 0.00 ? 64  GLN B CD   2  
ATOM 3327  O OE1  . GLN B 2 66  ? -0.600  12.002  8.495   1.00 0.00 ? 64  GLN B OE1  2  
ATOM 3328  N NE2  . GLN B 2 66  ? -2.170  10.503  9.088   1.00 0.00 ? 64  GLN B NE2  2  
ATOM 3329  H H    . GLN B 2 66  ? -5.711  11.027  5.796   1.00 0.00 ? 64  GLN B H    2  
ATOM 3330  H HA   . GLN B 2 66  ? -3.157  10.458  4.426   1.00 0.00 ? 64  GLN B HA   2  
ATOM 3331  H HB2  . GLN B 2 66  ? -3.631  9.914   7.346   1.00 0.00 ? 64  GLN B HB2  2  
ATOM 3332  H HB3  . GLN B 2 66  ? -2.238  9.376   6.426   1.00 0.00 ? 64  GLN B HB3  2  
ATOM 3333  H HG2  . GLN B 2 66  ? -1.499  11.633  6.123   1.00 0.00 ? 64  GLN B HG2  2  
ATOM 3334  H HG3  . GLN B 2 66  ? -2.970  12.254  6.880   1.00 0.00 ? 64  GLN B HG3  2  
ATOM 3335  H HE21 . GLN B 2 66  ? -2.963  10.004  8.799   1.00 0.00 ? 64  GLN B HE21 2  
ATOM 3336  H HE22 . GLN B 2 66  ? -1.776  10.427  9.984   1.00 0.00 ? 64  GLN B HE22 2  
ATOM 3337  N N    . LEU B 2 67  ? -3.392  7.936   4.613   1.00 0.00 ? 65  LEU B N    2  
ATOM 3338  C CA   . LEU B 2 67  ? -3.643  6.530   4.396   1.00 0.00 ? 65  LEU B CA   2  
ATOM 3339  C C    . LEU B 2 67  ? -2.420  5.752   4.875   1.00 0.00 ? 65  LEU B C    2  
ATOM 3340  O O    . LEU B 2 67  ? -1.340  6.311   4.921   1.00 0.00 ? 65  LEU B O    2  
ATOM 3341  C CB   . LEU B 2 67  ? -3.840  6.244   2.918   1.00 0.00 ? 65  LEU B CB   2  
ATOM 3342  C CG   . LEU B 2 67  ? -4.680  5.017   2.604   1.00 0.00 ? 65  LEU B CG   2  
ATOM 3343  C CD1  . LEU B 2 67  ? -6.139  5.400   2.448   1.00 0.00 ? 65  LEU B CD1  2  
ATOM 3344  C CD2  . LEU B 2 67  ? -4.152  4.322   1.370   1.00 0.00 ? 65  LEU B CD2  2  
ATOM 3345  H H    . LEU B 2 67  ? -2.483  8.277   4.441   1.00 0.00 ? 65  LEU B H    2  
ATOM 3346  H HA   . LEU B 2 67  ? -4.519  6.242   4.963   1.00 0.00 ? 65  LEU B HA   2  
ATOM 3347  H HB2  . LEU B 2 67  ? -4.312  7.106   2.469   1.00 0.00 ? 65  LEU B HB2  2  
ATOM 3348  H HB3  . LEU B 2 67  ? -2.867  6.114   2.470   1.00 0.00 ? 65  LEU B HB3  2  
ATOM 3349  H HG   . LEU B 2 67  ? -4.609  4.325   3.432   1.00 0.00 ? 65  LEU B HG   2  
ATOM 3350  H HD11 . LEU B 2 67  ? -6.238  6.115   1.643   1.00 0.00 ? 65  LEU B HD11 2  
ATOM 3351  H HD12 . LEU B 2 67  ? -6.495  5.843   3.366   1.00 0.00 ? 65  LEU B HD12 2  
ATOM 3352  H HD13 . LEU B 2 67  ? -6.720  4.520   2.221   1.00 0.00 ? 65  LEU B HD13 2  
ATOM 3353  H HD21 . LEU B 2 67  ? -4.748  3.446   1.165   1.00 0.00 ? 65  LEU B HD21 2  
ATOM 3354  H HD22 . LEU B 2 67  ? -3.125  4.029   1.534   1.00 0.00 ? 65  LEU B HD22 2  
ATOM 3355  H HD23 . LEU B 2 67  ? -4.202  4.997   0.528   1.00 0.00 ? 65  LEU B HD23 2  
ATOM 3356  N N    . GLN B 2 68  ? -2.572  4.502   5.279   1.00 0.00 ? 66  GLN B N    2  
ATOM 3357  C CA   . GLN B 2 68  ? -1.413  3.721   5.705   1.00 0.00 ? 66  GLN B CA   2  
ATOM 3358  C C    . GLN B 2 68  ? -1.593  2.254   5.347   1.00 0.00 ? 66  GLN B C    2  
ATOM 3359  O O    . GLN B 2 68  ? -2.704  1.733   5.363   1.00 0.00 ? 66  GLN B O    2  
ATOM 3360  C CB   . GLN B 2 68  ? -1.138  3.870   7.210   1.00 0.00 ? 66  GLN B CB   2  
ATOM 3361  C CG   . GLN B 2 68  ? -1.834  2.838   8.080   1.00 0.00 ? 66  GLN B CG   2  
ATOM 3362  C CD   . GLN B 2 68  ? -1.383  2.866   9.532   1.00 0.00 ? 66  GLN B CD   2  
ATOM 3363  O OE1  . GLN B 2 68  ? -1.378  1.839   10.211  1.00 0.00 ? 66  GLN B OE1  2  
ATOM 3364  N NE2  . GLN B 2 68  ? -1.029  4.037   10.032  1.00 0.00 ? 66  GLN B NE2  2  
ATOM 3365  H H    . GLN B 2 68  ? -3.469  4.095   5.290   1.00 0.00 ? 66  GLN B H    2  
ATOM 3366  H HA   . GLN B 2 68  ? -0.558  4.098   5.161   1.00 0.00 ? 66  GLN B HA   2  
ATOM 3367  H HB2  . GLN B 2 68  ? -0.075  3.788   7.377   1.00 0.00 ? 66  GLN B HB2  2  
ATOM 3368  H HB3  . GLN B 2 68  ? -1.465  4.851   7.524   1.00 0.00 ? 66  GLN B HB3  2  
ATOM 3369  H HG2  . GLN B 2 68  ? -2.896  3.024   8.051   1.00 0.00 ? 66  GLN B HG2  2  
ATOM 3370  H HG3  . GLN B 2 68  ? -1.633  1.856   7.678   1.00 0.00 ? 66  GLN B HG3  2  
ATOM 3371  H HE21 . GLN B 2 68  ? -1.073  4.824   9.448   1.00 0.00 ? 66  GLN B HE21 2  
ATOM 3372  H HE22 . GLN B 2 68  ? -0.722  4.071   10.963  1.00 0.00 ? 66  GLN B HE22 2  
ATOM 3373  N N    . LEU B 2 69  ? -0.496  1.604   5.019   1.00 0.00 ? 67  LEU B N    2  
ATOM 3374  C CA   . LEU B 2 69  ? -0.505  0.200   4.668   1.00 0.00 ? 67  LEU B CA   2  
ATOM 3375  C C    . LEU B 2 69  ? -0.128  -0.642  5.872   1.00 0.00 ? 67  LEU B C    2  
ATOM 3376  O O    . LEU B 2 69  ? 1.028   -0.674  6.275   1.00 0.00 ? 67  LEU B O    2  
ATOM 3377  C CB   . LEU B 2 69  ? 0.481   -0.073  3.539   1.00 0.00 ? 67  LEU B CB   2  
ATOM 3378  C CG   . LEU B 2 69  ? 0.082   0.469   2.172   1.00 0.00 ? 67  LEU B CG   2  
ATOM 3379  C CD1  . LEU B 2 69  ? 1.137   0.104   1.146   1.00 0.00 ? 67  LEU B CD1  2  
ATOM 3380  C CD2  . LEU B 2 69  ? -1.278  -0.070  1.755   1.00 0.00 ? 67  LEU B CD2  2  
ATOM 3381  H H    . LEU B 2 69  ? 0.359   2.092   5.009   1.00 0.00 ? 67  LEU B H    2  
ATOM 3382  H HA   . LEU B 2 69  ? -1.502  -0.064  4.347   1.00 0.00 ? 67  LEU B HA   2  
ATOM 3383  H HB2  . LEU B 2 69  ? 1.430   0.363   3.810   1.00 0.00 ? 67  LEU B HB2  2  
ATOM 3384  H HB3  . LEU B 2 69  ? 0.608   -1.138  3.455   1.00 0.00 ? 67  LEU B HB3  2  
ATOM 3385  H HG   . LEU B 2 69  ? 0.019   1.546   2.219   1.00 0.00 ? 67  LEU B HG   2  
ATOM 3386  H HD11 . LEU B 2 69  ? 0.851   0.495   0.180   1.00 0.00 ? 67  LEU B HD11 2  
ATOM 3387  H HD12 . LEU B 2 69  ? 1.225   -0.971  1.087   1.00 0.00 ? 67  LEU B HD12 2  
ATOM 3388  H HD13 . LEU B 2 69  ? 2.086   0.528   1.439   1.00 0.00 ? 67  LEU B HD13 2  
ATOM 3389  H HD21 . LEU B 2 69  ? -1.534  0.314   0.779   1.00 0.00 ? 67  LEU B HD21 2  
ATOM 3390  H HD22 . LEU B 2 69  ? -2.023  0.243   2.471   1.00 0.00 ? 67  LEU B HD22 2  
ATOM 3391  H HD23 . LEU B 2 69  ? -1.242  -1.149  1.720   1.00 0.00 ? 67  LEU B HD23 2  
ATOM 3392  N N    . VAL B 2 70  ? -1.101  -1.312  6.444   1.00 0.00 ? 68  VAL B N    2  
ATOM 3393  C CA   . VAL B 2 70  ? -0.862  -2.157  7.596   1.00 0.00 ? 68  VAL B CA   2  
ATOM 3394  C C    . VAL B 2 70  ? -0.568  -3.564  7.122   1.00 0.00 ? 68  VAL B C    2  
ATOM 3395  O O    . VAL B 2 70  ? -1.360  -4.148  6.396   1.00 0.00 ? 68  VAL B O    2  
ATOM 3396  C CB   . VAL B 2 70  ? -2.075  -2.164  8.534   1.00 0.00 ? 68  VAL B CB   2  
ATOM 3397  C CG1  . VAL B 2 70  ? -1.728  -2.825  9.853   1.00 0.00 ? 68  VAL B CG1  2  
ATOM 3398  C CG2  . VAL B 2 70  ? -2.564  -0.747  8.757   1.00 0.00 ? 68  VAL B CG2  2  
ATOM 3399  H H    . VAL B 2 70  ? -2.009  -1.260  6.068   1.00 0.00 ? 68  VAL B H    2  
ATOM 3400  H HA   . VAL B 2 70  ? -0.005  -1.772  8.132   1.00 0.00 ? 68  VAL B HA   2  
ATOM 3401  H HB   . VAL B 2 70  ? -2.868  -2.730  8.063   1.00 0.00 ? 68  VAL B HB   2  
ATOM 3402  H HG11 . VAL B 2 70  ? -1.427  -3.845  9.676   1.00 0.00 ? 68  VAL B HG11 2  
ATOM 3403  H HG12 . VAL B 2 70  ? -2.592  -2.809  10.499  1.00 0.00 ? 68  VAL B HG12 2  
ATOM 3404  H HG13 . VAL B 2 70  ? -0.918  -2.286  10.320  1.00 0.00 ? 68  VAL B HG13 2  
ATOM 3405  H HG21 . VAL B 2 70  ? -2.843  -0.310  7.808   1.00 0.00 ? 68  VAL B HG21 2  
ATOM 3406  H HG22 . VAL B 2 70  ? -1.772  -0.160  9.202   1.00 0.00 ? 68  VAL B HG22 2  
ATOM 3407  H HG23 . VAL B 2 70  ? -3.418  -0.759  9.415   1.00 0.00 ? 68  VAL B HG23 2  
ATOM 3408  N N    . LEU B 2 71  ? 0.567   -4.103  7.516   1.00 0.00 ? 69  LEU B N    2  
ATOM 3409  C CA   . LEU B 2 71  ? 0.959   -5.431  7.074   1.00 0.00 ? 69  LEU B CA   2  
ATOM 3410  C C    . LEU B 2 71  ? 0.861   -6.457  8.188   1.00 0.00 ? 69  LEU B C    2  
ATOM 3411  O O    . LEU B 2 71  ? 0.976   -6.125  9.369   1.00 0.00 ? 69  LEU B O    2  
ATOM 3412  C CB   . LEU B 2 71  ? 2.392   -5.397  6.551   1.00 0.00 ? 69  LEU B CB   2  
ATOM 3413  C CG   . LEU B 2 71  ? 2.780   -4.108  5.835   1.00 0.00 ? 69  LEU B CG   2  
ATOM 3414  C CD1  . LEU B 2 71  ? 4.241   -4.129  5.458   1.00 0.00 ? 69  LEU B CD1  2  
ATOM 3415  C CD2  . LEU B 2 71  ? 1.934   -3.906  4.600   1.00 0.00 ? 69  LEU B CD2  2  
ATOM 3416  H H    . LEU B 2 71  ? 1.164   -3.596  8.116   1.00 0.00 ? 69  LEU B H    2  
ATOM 3417  H HA   . LEU B 2 71  ? 0.304   -5.719  6.270   1.00 0.00 ? 69  LEU B HA   2  
ATOM 3418  H HB2  . LEU B 2 71  ? 3.063   -5.540  7.385   1.00 0.00 ? 69  LEU B HB2  2  
ATOM 3419  H HB3  . LEU B 2 71  ? 2.522   -6.218  5.861   1.00 0.00 ? 69  LEU B HB3  2  
ATOM 3420  H HG   . LEU B 2 71  ? 2.613   -3.274  6.498   1.00 0.00 ? 69  LEU B HG   2  
ATOM 3421  H HD11 . LEU B 2 71  ? 4.427   -4.965  4.803   1.00 0.00 ? 69  LEU B HD11 2  
ATOM 3422  H HD12 . LEU B 2 71  ? 4.838   -4.227  6.350   1.00 0.00 ? 69  LEU B HD12 2  
ATOM 3423  H HD13 . LEU B 2 71  ? 4.490   -3.210  4.952   1.00 0.00 ? 69  LEU B HD13 2  
ATOM 3424  H HD21 . LEU B 2 71  ? 2.097   -4.728  3.917   1.00 0.00 ? 69  LEU B HD21 2  
ATOM 3425  H HD22 . LEU B 2 71  ? 2.212   -2.979  4.123   1.00 0.00 ? 69  LEU B HD22 2  
ATOM 3426  H HD23 . LEU B 2 71  ? 0.893   -3.873  4.880   1.00 0.00 ? 69  LEU B HD23 2  
ATOM 3427  N N    . HIS B 2 72  ? 0.667   -7.713  7.799   1.00 0.00 ? 70  HIS B N    2  
ATOM 3428  C CA   . HIS B 2 72  ? 0.590   -8.814  8.757   1.00 0.00 ? 70  HIS B CA   2  
ATOM 3429  C C    . HIS B 2 72  ? 1.993   -9.146  9.243   1.00 0.00 ? 70  HIS B C    2  
ATOM 3430  O O    . HIS B 2 72  ? 2.191   -9.968  10.132  1.00 0.00 ? 70  HIS B O    2  
ATOM 3431  C CB   . HIS B 2 72  ? -0.061  -10.064 8.139   1.00 0.00 ? 70  HIS B CB   2  
ATOM 3432  C CG   . HIS B 2 72  ? 0.017   -10.118 6.643   1.00 0.00 ? 70  HIS B CG   2  
ATOM 3433  N ND1  . HIS B 2 72  ? -1.038  -9.818  5.817   1.00 0.00 ? 70  HIS B ND1  2  
ATOM 3434  C CD2  . HIS B 2 72  ? 1.062   -10.402 5.817   1.00 0.00 ? 70  HIS B CD2  2  
ATOM 3435  C CE1  . HIS B 2 72  ? -0.608  -9.911  4.559   1.00 0.00 ? 70  HIS B CE1  2  
ATOM 3436  N NE2  . HIS B 2 72  ? 0.651   -10.274 4.513   1.00 0.00 ? 70  HIS B NE2  2  
ATOM 3437  H H    . HIS B 2 72  ? 0.567   -7.907  6.840   1.00 0.00 ? 70  HIS B H    2  
ATOM 3438  H HA   . HIS B 2 72  ? -0.003  -8.479  9.593   1.00 0.00 ? 70  HIS B HA   2  
ATOM 3439  H HB2  . HIS B 2 72  ? 0.429   -10.944 8.526   1.00 0.00 ? 70  HIS B HB2  2  
ATOM 3440  H HB3  . HIS B 2 72  ? -1.105  -10.090 8.418   1.00 0.00 ? 70  HIS B HB3  2  
ATOM 3441  H HD1  . HIS B 2 72  ? -1.972  -9.631  6.099   1.00 0.00 ? 70  HIS B HD1  2  
ATOM 3442  H HD2  . HIS B 2 72  ? 2.065   -10.643 6.107   1.00 0.00 ? 70  HIS B HD2  2  
ATOM 3443  H HE1  . HIS B 2 72  ? -1.173  -9.620  3.698   1.00 0.00 ? 70  HIS B HE1  2  
ATOM 3444  N N    . ALA B 2 73  ? 2.961   -8.474  8.631   1.00 0.00 ? 71  ALA B N    2  
ATOM 3445  C CA   . ALA B 2 73  ? 4.364   -8.637  8.961   1.00 0.00 ? 71  ALA B CA   2  
ATOM 3446  C C    . ALA B 2 73  ? 4.707   -7.876  10.238  1.00 0.00 ? 71  ALA B C    2  
ATOM 3447  O O    . ALA B 2 73  ? 5.826   -7.955  10.740  1.00 0.00 ? 71  ALA B O    2  
ATOM 3448  C CB   . ALA B 2 73  ? 5.214   -8.138  7.802   1.00 0.00 ? 71  ALA B CB   2  
ATOM 3449  H H    . ALA B 2 73  ? 2.715   -7.845  7.924   1.00 0.00 ? 71  ALA B H    2  
ATOM 3450  H HA   . ALA B 2 73  ? 4.562   -9.689  9.105   1.00 0.00 ? 71  ALA B HA   2  
ATOM 3451  H HB1  . ALA B 2 73  ? 6.259   -8.278  8.031   1.00 0.00 ? 71  ALA B HB1  2  
ATOM 3452  H HB2  . ALA B 2 73  ? 5.020   -7.086  7.640   1.00 0.00 ? 71  ALA B HB2  2  
ATOM 3453  H HB3  . ALA B 2 73  ? 4.963   -8.689  6.908   1.00 0.00 ? 71  ALA B HB3  2  
ATOM 3454  N N    . GLY B 2 74  ? 3.727   -7.141  10.757  1.00 0.00 ? 72  GLY B N    2  
ATOM 3455  C CA   . GLY B 2 74  ? 3.938   -6.363  11.961  1.00 0.00 ? 72  GLY B CA   2  
ATOM 3456  C C    . GLY B 2 74  ? 4.491   -4.992  11.644  1.00 0.00 ? 72  GLY B C    2  
ATOM 3457  O O    . GLY B 2 74  ? 5.075   -4.331  12.501  1.00 0.00 ? 72  GLY B O    2  
ATOM 3458  H H    . GLY B 2 74  ? 2.852   -7.131  10.320  1.00 0.00 ? 72  GLY B H    2  
ATOM 3459  H HA2  . GLY B 2 74  ? 2.995   -6.253  12.479  1.00 0.00 ? 72  GLY B HA2  2  
ATOM 3460  H HA3  . GLY B 2 74  ? 4.634   -6.884  12.600  1.00 0.00 ? 72  GLY B HA3  2  
ATOM 3461  N N    . ASP B 2 75  ? 4.293   -4.568  10.403  1.00 0.00 ? 73  ASP B N    2  
ATOM 3462  C CA   . ASP B 2 75  ? 4.783   -3.274  9.942   1.00 0.00 ? 73  ASP B CA   2  
ATOM 3463  C C    . ASP B 2 75  ? 3.647   -2.458  9.335   1.00 0.00 ? 73  ASP B C    2  
ATOM 3464  O O    . ASP B 2 75  ? 2.608   -3.010  8.964   1.00 0.00 ? 73  ASP B O    2  
ATOM 3465  C CB   . ASP B 2 75  ? 5.906   -3.473  8.917   1.00 0.00 ? 73  ASP B CB   2  
ATOM 3466  C CG   . ASP B 2 75  ? 6.434   -2.162  8.364   1.00 0.00 ? 73  ASP B CG   2  
ATOM 3467  O OD1  . ASP B 2 75  ? 6.525   -2.033  7.127   1.00 0.00 ? 73  ASP B OD1  2  
ATOM 3468  O OD2  . ASP B 2 75  ? 6.735   -1.258  9.171   1.00 0.00 ? 73  ASP B OD2  2  
ATOM 3469  H H    . ASP B 2 75  ? 3.791   -5.134  9.782   1.00 0.00 ? 73  ASP B H    2  
ATOM 3470  H HA   . ASP B 2 75  ? 5.174   -2.744  10.796  1.00 0.00 ? 73  ASP B HA   2  
ATOM 3471  H HB2  . ASP B 2 75  ? 6.724   -3.997  9.386   1.00 0.00 ? 73  ASP B HB2  2  
ATOM 3472  H HB3  . ASP B 2 75  ? 5.531   -4.064  8.094   1.00 0.00 ? 73  ASP B HB3  2  
ATOM 3473  N N    . THR B 2 76  ? 3.846   -1.151  9.247   1.00 0.00 ? 74  THR B N    2  
ATOM 3474  C CA   . THR B 2 76  ? 2.852   -0.253  8.687   1.00 0.00 ? 74  THR B CA   2  
ATOM 3475  C C    . THR B 2 76  ? 3.537   0.838   7.860   1.00 0.00 ? 74  THR B C    2  
ATOM 3476  O O    . THR B 2 76  ? 4.482   1.475   8.321   1.00 0.00 ? 74  THR B O    2  
ATOM 3477  C CB   . THR B 2 76  ? 2.015   0.413   9.800   1.00 0.00 ? 74  THR B CB   2  
ATOM 3478  O OG1  . THR B 2 76  ? 2.875   0.897   10.839  1.00 0.00 ? 74  THR B OG1  2  
ATOM 3479  C CG2  . THR B 2 76  ? 1.013   -0.564  10.390  1.00 0.00 ? 74  THR B CG2  2  
ATOM 3480  H H    . THR B 2 76  ? 4.709   -0.780  9.543   1.00 0.00 ? 74  THR B H    2  
ATOM 3481  H HA   . THR B 2 76  ? 2.184   -0.831  8.051   1.00 0.00 ? 74  THR B HA   2  
ATOM 3482  H HB   . THR B 2 76  ? 1.474   1.245   9.373   1.00 0.00 ? 74  THR B HB   2  
ATOM 3483  H HG1  . THR B 2 76  ? 3.722   1.156   10.456  1.00 0.00 ? 74  THR B HG1  2  
ATOM 3484  H HG21 . THR B 2 76  ? 0.372   -0.941  9.606   1.00 0.00 ? 74  THR B HG21 2  
ATOM 3485  H HG22 . THR B 2 76  ? 0.413   -0.060  11.134  1.00 0.00 ? 74  THR B HG22 2  
ATOM 3486  H HG23 . THR B 2 76  ? 1.541   -1.388  10.849  1.00 0.00 ? 74  THR B HG23 2  
ATOM 3487  N N    . THR B 2 77  ? 3.049   1.054   6.652   1.00 0.00 ? 75  THR B N    2  
ATOM 3488  C CA   . THR B 2 77  ? 3.601   2.065   5.762   1.00 0.00 ? 75  THR B CA   2  
ATOM 3489  C C    . THR B 2 77  ? 2.614   3.220   5.603   1.00 0.00 ? 75  THR B C    2  
ATOM 3490  O O    . THR B 2 77  ? 1.627   3.095   4.884   1.00 0.00 ? 75  THR B O    2  
ATOM 3491  C CB   . THR B 2 77  ? 3.898   1.451   4.381   1.00 0.00 ? 75  THR B CB   2  
ATOM 3492  O OG1  . THR B 2 77  ? 4.593   0.208   4.536   1.00 0.00 ? 75  THR B OG1  2  
ATOM 3493  C CG2  . THR B 2 77  ? 4.726   2.399   3.527   1.00 0.00 ? 75  THR B CG2  2  
ATOM 3494  H H    . THR B 2 77  ? 2.298   0.504   6.339   1.00 0.00 ? 75  THR B H    2  
ATOM 3495  H HA   . THR B 2 77  ? 4.524   2.432   6.187   1.00 0.00 ? 75  THR B HA   2  
ATOM 3496  H HB   . THR B 2 77  ? 2.957   1.264   3.877   1.00 0.00 ? 75  THR B HB   2  
ATOM 3497  H HG1  . THR B 2 77  ? 4.955   0.145   5.430   1.00 0.00 ? 75  THR B HG1  2  
ATOM 3498  H HG21 . THR B 2 77  ? 4.993   1.910   2.602   1.00 0.00 ? 75  THR B HG21 2  
ATOM 3499  H HG22 . THR B 2 77  ? 5.623   2.673   4.061   1.00 0.00 ? 75  THR B HG22 2  
ATOM 3500  H HG23 . THR B 2 77  ? 4.148   3.286   3.313   1.00 0.00 ? 75  THR B HG23 2  
ATOM 3501  N N    . ASN B 2 78  ? 2.875   4.346   6.256   1.00 0.00 ? 76  ASN B N    2  
ATOM 3502  C CA   . ASN B 2 78  ? 1.952   5.478   6.183   1.00 0.00 ? 76  ASN B CA   2  
ATOM 3503  C C    . ASN B 2 78  ? 2.161   6.311   4.925   1.00 0.00 ? 76  ASN B C    2  
ATOM 3504  O O    . ASN B 2 78  ? 3.244   6.323   4.340   1.00 0.00 ? 76  ASN B O    2  
ATOM 3505  C CB   . ASN B 2 78  ? 2.067   6.366   7.425   1.00 0.00 ? 76  ASN B CB   2  
ATOM 3506  C CG   . ASN B 2 78  ? 1.541   5.693   8.678   1.00 0.00 ? 76  ASN B CG   2  
ATOM 3507  O OD1  . ASN B 2 78  ? 1.464   4.468   8.754   1.00 0.00 ? 76  ASN B OD1  2  
ATOM 3508  N ND2  . ASN B 2 78  ? 1.182   6.483   9.676   1.00 0.00 ? 76  ASN B ND2  2  
ATOM 3509  H H    . ASN B 2 78  ? 3.697   4.422   6.799   1.00 0.00 ? 76  ASN B H    2  
ATOM 3510  H HA   . ASN B 2 78  ? 0.952   5.070   6.150   1.00 0.00 ? 76  ASN B HA   2  
ATOM 3511  H HB2  . ASN B 2 78  ? 3.100   6.621   7.585   1.00 0.00 ? 76  ASN B HB2  2  
ATOM 3512  H HB3  . ASN B 2 78  ? 1.501   7.272   7.264   1.00 0.00 ? 76  ASN B HB3  2  
ATOM 3513  H HD21 . ASN B 2 78  ? 1.274   7.463   9.559   1.00 0.00 ? 76  ASN B HD21 2  
ATOM 3514  H HD22 . ASN B 2 78  ? 0.855   6.072   10.504  1.00 0.00 ? 76  ASN B HD22 2  
ATOM 3515  N N    . PHE B 2 79  ? 1.087   6.969   4.512   1.00 0.00 ? 77  PHE B N    2  
ATOM 3516  C CA   . PHE B 2 79  ? 1.066   7.828   3.339   1.00 0.00 ? 77  PHE B CA   2  
ATOM 3517  C C    . PHE B 2 79  ? 0.236   9.078   3.626   1.00 0.00 ? 77  PHE B C    2  
ATOM 3518  O O    . PHE B 2 79  ? -0.987  9.004   3.778   1.00 0.00 ? 77  PHE B O    2  
ATOM 3519  C CB   . PHE B 2 79  ? 0.457   7.094   2.140   1.00 0.00 ? 77  PHE B CB   2  
ATOM 3520  C CG   . PHE B 2 79  ? 1.334   6.025   1.563   1.00 0.00 ? 77  PHE B CG   2  
ATOM 3521  C CD1  . PHE B 2 79  ? 2.456   6.359   0.826   1.00 0.00 ? 77  PHE B CD1  2  
ATOM 3522  C CD2  . PHE B 2 79  ? 1.031   4.686   1.747   1.00 0.00 ? 77  PHE B CD2  2  
ATOM 3523  C CE1  . PHE B 2 79  ? 3.260   5.379   0.283   1.00 0.00 ? 77  PHE B CE1  2  
ATOM 3524  C CE2  . PHE B 2 79  ? 1.833   3.701   1.207   1.00 0.00 ? 77  PHE B CE2  2  
ATOM 3525  C CZ   . PHE B 2 79  ? 2.949   4.050   0.473   1.00 0.00 ? 77  PHE B CZ   2  
ATOM 3526  H H    . PHE B 2 79  ? 0.253   6.863   5.020   1.00 0.00 ? 77  PHE B H    2  
ATOM 3527  H HA   . PHE B 2 79  ? 2.078   8.115   3.107   1.00 0.00 ? 77  PHE B HA   2  
ATOM 3528  H HB2  . PHE B 2 79  ? -0.469  6.630   2.445   1.00 0.00 ? 77  PHE B HB2  2  
ATOM 3529  H HB3  . PHE B 2 79  ? 0.251   7.811   1.359   1.00 0.00 ? 77  PHE B HB3  2  
ATOM 3530  H HD1  . PHE B 2 79  ? 2.701   7.400   0.677   1.00 0.00 ? 77  PHE B HD1  2  
ATOM 3531  H HD2  . PHE B 2 79  ? 0.157   4.414   2.321   1.00 0.00 ? 77  PHE B HD2  2  
ATOM 3532  H HE1  . PHE B 2 79  ? 4.133   5.654   -0.291  1.00 0.00 ? 77  PHE B HE1  2  
ATOM 3533  H HE2  . PHE B 2 79  ? 1.588   2.661   1.357   1.00 0.00 ? 77  PHE B HE2  2  
ATOM 3534  H HZ   . PHE B 2 79  ? 3.576   3.282   0.045   1.00 0.00 ? 77  PHE B HZ   2  
ATOM 3535  N N    . HIS B 2 80  ? 0.898   10.213  3.700   1.00 0.00 ? 78  HIS B N    2  
ATOM 3536  C CA   . HIS B 2 80  ? 0.235   11.480  3.958   1.00 0.00 ? 78  HIS B CA   2  
ATOM 3537  C C    . HIS B 2 80  ? -0.245  12.080  2.636   1.00 0.00 ? 78  HIS B C    2  
ATOM 3538  O O    . HIS B 2 80  ? 0.551   12.471  1.793   1.00 0.00 ? 78  HIS B O    2  
ATOM 3539  C CB   . HIS B 2 80  ? 1.219   12.414  4.703   1.00 0.00 ? 78  HIS B CB   2  
ATOM 3540  C CG   . HIS B 2 80  ? 0.888   13.892  4.733   1.00 0.00 ? 78  HIS B CG   2  
ATOM 3541  N ND1  . HIS B 2 80  ? 1.630   14.818  5.437   1.00 0.00 ? 78  HIS B ND1  2  
ATOM 3542  C CD2  . HIS B 2 80  ? -0.086  14.608  4.111   1.00 0.00 ? 78  HIS B CD2  2  
ATOM 3543  C CE1  . HIS B 2 80  ? 1.102   16.027  5.221   1.00 0.00 ? 78  HIS B CE1  2  
ATOM 3544  N NE2  . HIS B 2 80  ? 0.061   15.956  4.422   1.00 0.00 ? 78  HIS B NE2  2  
ATOM 3545  H H    . HIS B 2 80  ? 1.878   10.200  3.592   1.00 0.00 ? 78  HIS B H    2  
ATOM 3546  H HA   . HIS B 2 80  ? -0.621  11.288  4.588   1.00 0.00 ? 78  HIS B HA   2  
ATOM 3547  H HB2  . HIS B 2 80  ? 1.285   12.087  5.726   1.00 0.00 ? 78  HIS B HB2  2  
ATOM 3548  H HB3  . HIS B 2 80  ? 2.192   12.307  4.252   1.00 0.00 ? 78  HIS B HB3  2  
ATOM 3549  H HD1  . HIS B 2 80  ? 2.408   14.626  6.008   1.00 0.00 ? 78  HIS B HD1  2  
ATOM 3550  H HD2  . HIS B 2 80  ? -0.856  14.204  3.471   1.00 0.00 ? 78  HIS B HD2  2  
ATOM 3551  H HE1  . HIS B 2 80  ? 1.482   16.944  5.646   1.00 0.00 ? 78  HIS B HE1  2  
ATOM 3552  N N    . PHE B 2 81  ? -1.554  12.135  2.458   1.00 0.00 ? 79  PHE B N    2  
ATOM 3553  C CA   . PHE B 2 81  ? -2.140  12.701  1.253   1.00 0.00 ? 79  PHE B CA   2  
ATOM 3554  C C    . PHE B 2 81  ? -2.075  14.225  1.326   1.00 0.00 ? 79  PHE B C    2  
ATOM 3555  O O    . PHE B 2 81  ? -2.968  14.869  1.879   1.00 0.00 ? 79  PHE B O    2  
ATOM 3556  C CB   . PHE B 2 81  ? -3.592  12.242  1.104   1.00 0.00 ? 79  PHE B CB   2  
ATOM 3557  C CG   . PHE B 2 81  ? -3.753  10.916  0.418   1.00 0.00 ? 79  PHE B CG   2  
ATOM 3558  C CD1  . PHE B 2 81  ? -3.517  9.725   1.090   1.00 0.00 ? 79  PHE B CD1  2  
ATOM 3559  C CD2  . PHE B 2 81  ? -4.157  10.863  -0.901  1.00 0.00 ? 79  PHE B CD2  2  
ATOM 3560  C CE1  . PHE B 2 81  ? -3.684  8.508   0.449   1.00 0.00 ? 79  PHE B CE1  2  
ATOM 3561  C CE2  . PHE B 2 81  ? -4.322  9.654   -1.542  1.00 0.00 ? 79  PHE B CE2  2  
ATOM 3562  C CZ   . PHE B 2 81  ? -4.089  8.476   -0.872  1.00 0.00 ? 79  PHE B CZ   2  
ATOM 3563  H H    . PHE B 2 81  ? -2.147  11.806  3.169   1.00 0.00 ? 79  PHE B H    2  
ATOM 3564  H HA   . PHE B 2 81  ? -1.565  12.357  0.403   1.00 0.00 ? 79  PHE B HA   2  
ATOM 3565  H HB2  . PHE B 2 81  ? -4.036  12.162  2.083   1.00 0.00 ? 79  PHE B HB2  2  
ATOM 3566  H HB3  . PHE B 2 81  ? -4.134  12.980  0.530   1.00 0.00 ? 79  PHE B HB3  2  
ATOM 3567  H HD1  . PHE B 2 81  ? -3.201  9.752   2.122   1.00 0.00 ? 79  PHE B HD1  2  
ATOM 3568  H HD2  . PHE B 2 81  ? -4.344  11.783  -1.435  1.00 0.00 ? 79  PHE B HD2  2  
ATOM 3569  H HE1  . PHE B 2 81  ? -3.497  7.587   0.980   1.00 0.00 ? 79  PHE B HE1  2  
ATOM 3570  H HE2  . PHE B 2 81  ? -4.639  9.632   -2.575  1.00 0.00 ? 79  PHE B HE2  2  
ATOM 3571  H HZ   . PHE B 2 81  ? -4.228  7.525   -1.383  1.00 0.00 ? 79  PHE B HZ   2  
ATOM 3572  N N    . SER B 2 82  ? -1.010  14.795  0.781   1.00 0.00 ? 80  SER B N    2  
ATOM 3573  C CA   . SER B 2 82  ? -0.809  16.236  0.814   1.00 0.00 ? 80  SER B CA   2  
ATOM 3574  C C    . SER B 2 82  ? -1.374  16.935  -0.423  1.00 0.00 ? 80  SER B C    2  
ATOM 3575  O O    . SER B 2 82  ? -1.133  18.124  -0.628  1.00 0.00 ? 80  SER B O    2  
ATOM 3576  C CB   . SER B 2 82  ? 0.686   16.541  0.964   1.00 0.00 ? 80  SER B CB   2  
ATOM 3577  O OG   . SER B 2 82  ? 1.479   15.521  0.372   1.00 0.00 ? 80  SER B OG   2  
ATOM 3578  H H    . SER B 2 82  ? -0.330  14.233  0.346   1.00 0.00 ? 80  SER B H    2  
ATOM 3579  H HA   . SER B 2 82  ? -1.322  16.616  1.683   1.00 0.00 ? 80  SER B HA   2  
ATOM 3580  H HB2  . SER B 2 82  ? 0.910   17.478  0.477   1.00 0.00 ? 80  SER B HB2  2  
ATOM 3581  H HB3  . SER B 2 82  ? 0.935   16.610  2.012   1.00 0.00 ? 80  SER B HB3  2  
ATOM 3582  H HG   . SER B 2 82  ? 2.274   15.914  -0.030  1.00 0.00 ? 80  SER B HG   2  
ATOM 3583  N N    . ASN B 2 83  ? -2.117  16.210  -1.250  1.00 0.00 ? 81  ASN B N    2  
ATOM 3584  C CA   . ASN B 2 83  ? -2.708  16.803  -2.448  1.00 0.00 ? 81  ASN B CA   2  
ATOM 3585  C C    . ASN B 2 83  ? -4.032  17.476  -2.105  1.00 0.00 ? 81  ASN B C    2  
ATOM 3586  O O    . ASN B 2 83  ? -5.086  16.850  -2.136  1.00 0.00 ? 81  ASN B O    2  
ATOM 3587  C CB   . ASN B 2 83  ? -2.917  15.755  -3.543  1.00 0.00 ? 81  ASN B CB   2  
ATOM 3588  C CG   . ASN B 2 83  ? -3.458  16.365  -4.827  1.00 0.00 ? 81  ASN B CG   2  
ATOM 3589  O OD1  . ASN B 2 83  ? -3.200  17.527  -5.140  1.00 0.00 ? 81  ASN B OD1  2  
ATOM 3590  N ND2  . ASN B 2 83  ? -4.219  15.588  -5.574  1.00 0.00 ? 81  ASN B ND2  2  
ATOM 3591  H H    . ASN B 2 83  ? -2.264  15.260  -1.056  1.00 0.00 ? 81  ASN B H    2  
ATOM 3592  H HA   . ASN B 2 83  ? -2.023  17.558  -2.810  1.00 0.00 ? 81  ASN B HA   2  
ATOM 3593  H HB2  . ASN B 2 83  ? -1.972  15.280  -3.763  1.00 0.00 ? 81  ASN B HB2  2  
ATOM 3594  H HB3  . ASN B 2 83  ? -3.618  15.013  -3.194  1.00 0.00 ? 81  ASN B HB3  2  
ATOM 3595  H HD21 . ASN B 2 83  ? -4.395  14.661  -5.260  1.00 0.00 ? 81  ASN B HD21 2  
ATOM 3596  H HD22 . ASN B 2 83  ? -4.579  15.953  -6.407  1.00 0.00 ? 81  ASN B HD22 2  
ATOM 3597  N N    . GLU B 2 84  ? -3.960  18.764  -1.810  1.00 0.00 ? 82  GLU B N    2  
ATOM 3598  C CA   . GLU B 2 84  ? -5.120  19.566  -1.422  1.00 0.00 ? 82  GLU B CA   2  
ATOM 3599  C C    . GLU B 2 84  ? -6.300  19.404  -2.387  1.00 0.00 ? 82  GLU B C    2  
ATOM 3600  O O    . GLU B 2 84  ? -7.462  19.468  -1.979  1.00 0.00 ? 82  GLU B O    2  
ATOM 3601  C CB   . GLU B 2 84  ? -4.715  21.044  -1.344  1.00 0.00 ? 82  GLU B CB   2  
ATOM 3602  C CG   . GLU B 2 84  ? -3.511  21.313  -0.443  1.00 0.00 ? 82  GLU B CG   2  
ATOM 3603  C CD   . GLU B 2 84  ? -2.176  21.239  -1.174  1.00 0.00 ? 82  GLU B CD   2  
ATOM 3604  O OE1  . GLU B 2 84  ? -2.094  20.565  -2.226  1.00 0.00 ? 82  GLU B OE1  2  
ATOM 3605  O OE2  . GLU B 2 84  ? -1.192  21.832  -0.688  1.00 0.00 ? 82  GLU B OE2  2  
ATOM 3606  H H    . GLU B 2 84  ? -3.081  19.214  -1.869  1.00 0.00 ? 82  GLU B H    2  
ATOM 3607  H HA   . GLU B 2 84  ? -5.429  19.241  -0.441  1.00 0.00 ? 82  GLU B HA   2  
ATOM 3608  H HB2  . GLU B 2 84  ? -4.475  21.390  -2.339  1.00 0.00 ? 82  GLU B HB2  2  
ATOM 3609  H HB3  . GLU B 2 84  ? -5.552  21.613  -0.968  1.00 0.00 ? 82  GLU B HB3  2  
ATOM 3610  H HG2  . GLU B 2 84  ? -3.612  22.300  -0.018  1.00 0.00 ? 82  GLU B HG2  2  
ATOM 3611  H HG3  . GLU B 2 84  ? -3.508  20.582  0.353   1.00 0.00 ? 82  GLU B HG3  2  
ATOM 3612  N N    . SER B 2 85  ? -5.996  19.179  -3.655  1.00 0.00 ? 83  SER B N    2  
ATOM 3613  C CA   . SER B 2 85  ? -7.014  19.037  -4.685  1.00 0.00 ? 83  SER B CA   2  
ATOM 3614  C C    . SER B 2 85  ? -7.926  17.821  -4.491  1.00 0.00 ? 83  SER B C    2  
ATOM 3615  O O    . SER B 2 85  ? -9.147  17.968  -4.344  1.00 0.00 ? 83  SER B O    2  
ATOM 3616  C CB   . SER B 2 85  ? -6.323  18.952  -6.046  1.00 0.00 ? 83  SER B CB   2  
ATOM 3617  O OG   . SER B 2 85  ? -5.027  19.530  -5.988  1.00 0.00 ? 83  SER B OG   2  
ATOM 3618  H H    . SER B 2 85  ? -5.052  19.122  -3.911  1.00 0.00 ? 83  SER B H    2  
ATOM 3619  H HA   . SER B 2 85  ? -7.630  19.914  -4.675  1.00 0.00 ? 83  SER B HA   2  
ATOM 3620  H HB2  . SER B 2 85  ? -6.230  17.917  -6.339  1.00 0.00 ? 83  SER B HB2  2  
ATOM 3621  H HB3  . SER B 2 85  ? -6.909  19.484  -6.779  1.00 0.00 ? 83  SER B HB3  2  
ATOM 3622  H HG   . SER B 2 85  ? -4.367  18.837  -5.858  1.00 0.00 ? 83  SER B HG   2  
ATOM 3623  N N    . THR B 2 86  ? -7.364  16.624  -4.491  1.00 0.00 ? 84  THR B N    2  
ATOM 3624  C CA   . THR B 2 86  ? -8.189  15.433  -4.387  1.00 0.00 ? 84  THR B CA   2  
ATOM 3625  C C    . THR B 2 86  ? -7.773  14.450  -3.293  1.00 0.00 ? 84  THR B C    2  
ATOM 3626  O O    . THR B 2 86  ? -8.276  13.339  -3.281  1.00 0.00 ? 84  THR B O    2  
ATOM 3627  C CB   . THR B 2 86  ? -8.222  14.735  -5.756  1.00 0.00 ? 84  THR B CB   2  
ATOM 3628  O OG1  . THR B 2 86  ? -6.895  14.634  -6.285  1.00 0.00 ? 84  THR B OG1  2  
ATOM 3629  C CG2  . THR B 2 86  ? -9.079  15.538  -6.722  1.00 0.00 ? 84  THR B CG2  2  
ATOM 3630  H H    . THR B 2 86  ? -6.388  16.537  -4.561  1.00 0.00 ? 84  THR B H    2  
ATOM 3631  H HA   . THR B 2 86  ? -9.200  15.755  -4.175  1.00 0.00 ? 84  THR B HA   2  
ATOM 3632  H HB   . THR B 2 86  ? -8.647  13.749  -5.644  1.00 0.00 ? 84  THR B HB   2  
ATOM 3633  H HG1  . THR B 2 86  ? -6.336  14.128  -5.667  1.00 0.00 ? 84  THR B HG1  2  
ATOM 3634  H HG21 . THR B 2 86  ? -8.772  16.577  -6.692  1.00 0.00 ? 84  THR B HG21 2  
ATOM 3635  H HG22 . THR B 2 86  ? -10.116 15.464  -6.432  1.00 0.00 ? 84  THR B HG22 2  
ATOM 3636  H HG23 . THR B 2 86  ? -8.954  15.157  -7.722  1.00 0.00 ? 84  THR B HG23 2  
ATOM 3637  N N    . ALA B 2 87  ? -6.915  14.864  -2.362  1.00 0.00 ? 85  ALA B N    2  
ATOM 3638  C CA   . ALA B 2 87  ? -6.425  13.976  -1.288  1.00 0.00 ? 85  ALA B CA   2  
ATOM 3639  C C    . ALA B 2 87  ? -7.526  13.145  -0.634  1.00 0.00 ? 85  ALA B C    2  
ATOM 3640  O O    . ALA B 2 87  ? -7.349  11.954  -0.421  1.00 0.00 ? 85  ALA B O    2  
ATOM 3641  C CB   . ALA B 2 87  ? -5.698  14.775  -0.219  1.00 0.00 ? 85  ALA B CB   2  
ATOM 3642  H H    . ALA B 2 87  ? -6.582  15.789  -2.397  1.00 0.00 ? 85  ALA B H    2  
ATOM 3643  H HA   . ALA B 2 87  ? -5.709  13.292  -1.735  1.00 0.00 ? 85  ALA B HA   2  
ATOM 3644  H HB1  . ALA B 2 87  ? -5.209  14.097  0.466   1.00 0.00 ? 85  ALA B HB1  2  
ATOM 3645  H HB2  . ALA B 2 87  ? -6.408  15.383  0.322   1.00 0.00 ? 85  ALA B HB2  2  
ATOM 3646  H HB3  . ALA B 2 87  ? -4.959  15.412  -0.683  1.00 0.00 ? 85  ALA B HB3  2  
ATOM 3647  N N    . VAL B 2 88  ? -8.648  13.770  -0.300  1.00 0.00 ? 86  VAL B N    2  
ATOM 3648  C CA   . VAL B 2 88  ? -9.759  13.056  0.329   1.00 0.00 ? 86  VAL B CA   2  
ATOM 3649  C C    . VAL B 2 88  ? -10.275 11.940  -0.589  1.00 0.00 ? 86  VAL B C    2  
ATOM 3650  O O    . VAL B 2 88  ? -10.312 10.773  -0.206  1.00 0.00 ? 86  VAL B O    2  
ATOM 3651  C CB   . VAL B 2 88  ? -10.906 14.035  0.693   1.00 0.00 ? 86  VAL B CB   2  
ATOM 3652  C CG1  . VAL B 2 88  ? -12.265 13.346  0.694   1.00 0.00 ? 86  VAL B CG1  2  
ATOM 3653  C CG2  . VAL B 2 88  ? -10.650 14.678  2.044   1.00 0.00 ? 86  VAL B CG2  2  
ATOM 3654  H H    . VAL B 2 88  ? -8.728  14.729  -0.470  1.00 0.00 ? 86  VAL B H    2  
ATOM 3655  H HA   . VAL B 2 88  ? -9.389  12.607  1.242   1.00 0.00 ? 86  VAL B HA   2  
ATOM 3656  H HB   . VAL B 2 88  ? -10.920 14.821  -0.046  1.00 0.00 ? 86  VAL B HB   2  
ATOM 3657  H HG11 . VAL B 2 88  ? -13.028 14.053  0.985   1.00 0.00 ? 86  VAL B HG11 2  
ATOM 3658  H HG12 . VAL B 2 88  ? -12.251 12.522  1.393   1.00 0.00 ? 86  VAL B HG12 2  
ATOM 3659  H HG13 . VAL B 2 88  ? -12.479 12.973  -0.298  1.00 0.00 ? 86  VAL B HG13 2  
ATOM 3660  H HG21 . VAL B 2 88  ? -9.742  15.261  1.998   1.00 0.00 ? 86  VAL B HG21 2  
ATOM 3661  H HG22 . VAL B 2 88  ? -10.547 13.909  2.795   1.00 0.00 ? 86  VAL B HG22 2  
ATOM 3662  H HG23 . VAL B 2 88  ? -11.479 15.321  2.298   1.00 0.00 ? 86  VAL B HG23 2  
ATOM 3663  N N    . LYS B 2 89  ? -10.624 12.313  -1.815  1.00 0.00 ? 87  LYS B N    2  
ATOM 3664  C CA   . LYS B 2 89  ? -11.138 11.371  -2.812  1.00 0.00 ? 87  LYS B CA   2  
ATOM 3665  C C    . LYS B 2 89  ? -10.066 10.354  -3.177  1.00 0.00 ? 87  LYS B C    2  
ATOM 3666  O O    . LYS B 2 89  ? -10.354 9.180   -3.397  1.00 0.00 ? 87  LYS B O    2  
ATOM 3667  C CB   . LYS B 2 89  ? -11.575 12.150  -4.058  1.00 0.00 ? 87  LYS B CB   2  
ATOM 3668  C CG   . LYS B 2 89  ? -12.383 13.403  -3.746  1.00 0.00 ? 87  LYS B CG   2  
ATOM 3669  C CD   . LYS B 2 89  ? -11.731 14.649  -4.333  1.00 0.00 ? 87  LYS B CD   2  
ATOM 3670  C CE   . LYS B 2 89  ? -12.402 15.925  -3.843  1.00 0.00 ? 87  LYS B CE   2  
ATOM 3671  N NZ   . LYS B 2 89  ? -11.803 17.149  -4.452  1.00 0.00 ? 87  LYS B NZ   2  
ATOM 3672  H H    . LYS B 2 89  ? -10.520 13.250  -2.065  1.00 0.00 ? 87  LYS B H    2  
ATOM 3673  H HA   . LYS B 2 89  ? -11.991 10.841  -2.389  1.00 0.00 ? 87  LYS B HA   2  
ATOM 3674  H HB2  . LYS B 2 89  ? -10.693 12.450  -4.606  1.00 0.00 ? 87  LYS B HB2  2  
ATOM 3675  H HB3  . LYS B 2 89  ? -12.175 11.507  -4.682  1.00 0.00 ? 87  LYS B HB3  2  
ATOM 3676  H HG2  . LYS B 2 89  ? -13.373 13.297  -4.164  1.00 0.00 ? 87  LYS B HG2  2  
ATOM 3677  H HG3  . LYS B 2 89  ? -12.454 13.516  -2.674  1.00 0.00 ? 87  LYS B HG3  2  
ATOM 3678  H HD2  . LYS B 2 89  ? -10.691 14.669  -4.043  1.00 0.00 ? 87  LYS B HD2  2  
ATOM 3679  H HD3  . LYS B 2 89  ? -11.804 14.607  -5.411  1.00 0.00 ? 87  LYS B HD3  2  
ATOM 3680  H HE2  . LYS B 2 89  ? -13.450 15.883  -4.097  1.00 0.00 ? 87  LYS B HE2  2  
ATOM 3681  H HE3  . LYS B 2 89  ? -12.296 15.979  -2.769  1.00 0.00 ? 87  LYS B HE3  2  
ATOM 3682  H HZ1  . LYS B 2 89  ? -11.881 17.110  -5.488  1.00 0.00 ? 87  LYS B HZ1  2  
ATOM 3683  H HZ2  . LYS B 2 89  ? -10.794 17.230  -4.195  1.00 0.00 ? 87  LYS B HZ2  2  
ATOM 3684  H HZ3  . LYS B 2 89  ? -12.300 17.998  -4.111  1.00 0.00 ? 87  LYS B HZ3  2  
ATOM 3685  N N    . GLU B 2 90  ? -8.830  10.821  -3.247  1.00 0.00 ? 88  GLU B N    2  
ATOM 3686  C CA   . GLU B 2 90  ? -7.701  9.969   -3.552  1.00 0.00 ? 88  GLU B CA   2  
ATOM 3687  C C    . GLU B 2 90  ? -7.511  8.964   -2.425  1.00 0.00 ? 88  GLU B C    2  
ATOM 3688  O O    . GLU B 2 90  ? -7.342  7.776   -2.677  1.00 0.00 ? 88  GLU B O    2  
ATOM 3689  C CB   . GLU B 2 90  ? -6.452  10.823  -3.794  1.00 0.00 ? 88  GLU B CB   2  
ATOM 3690  C CG   . GLU B 2 90  ? -6.278  11.204  -5.258  1.00 0.00 ? 88  GLU B CG   2  
ATOM 3691  C CD   . GLU B 2 90  ? -5.188  12.231  -5.485  1.00 0.00 ? 88  GLU B CD   2  
ATOM 3692  O OE1  . GLU B 2 90  ? -5.213  13.282  -4.819  1.00 0.00 ? 88  GLU B OE1  2  
ATOM 3693  O OE2  . GLU B 2 90  ? -4.318  12.005  -6.359  1.00 0.00 ? 88  GLU B OE2  2  
ATOM 3694  H H    . GLU B 2 90  ? -8.673  11.778  -3.090  1.00 0.00 ? 88  GLU B H    2  
ATOM 3695  H HA   . GLU B 2 90  ? -7.933  9.427   -4.457  1.00 0.00 ? 88  GLU B HA   2  
ATOM 3696  H HB2  . GLU B 2 90  ? -6.540  11.732  -3.216  1.00 0.00 ? 88  GLU B HB2  2  
ATOM 3697  H HB3  . GLU B 2 90  ? -5.577  10.287  -3.467  1.00 0.00 ? 88  GLU B HB3  2  
ATOM 3698  H HG2  . GLU B 2 90  ? -6.033  10.317  -5.821  1.00 0.00 ? 88  GLU B HG2  2  
ATOM 3699  H HG3  . GLU B 2 90  ? -7.212  11.610  -5.622  1.00 0.00 ? 88  GLU B HG3  2  
ATOM 3700  N N    . ARG B 2 91  ? -7.580  9.445   -1.181  1.00 0.00 ? 89  ARG B N    2  
ATOM 3701  C CA   . ARG B 2 91  ? -7.472  8.583   -0.005  1.00 0.00 ? 89  ARG B CA   2  
ATOM 3702  C C    . ARG B 2 91  ? -8.512  7.495   -0.117  1.00 0.00 ? 89  ARG B C    2  
ATOM 3703  O O    . ARG B 2 91  ? -8.240  6.313   0.076   1.00 0.00 ? 89  ARG B O    2  
ATOM 3704  C CB   . ARG B 2 91  ? -7.746  9.380   1.275   1.00 0.00 ? 89  ARG B CB   2  
ATOM 3705  C CG   . ARG B 2 91  ? -7.669  8.560   2.550   1.00 0.00 ? 89  ARG B CG   2  
ATOM 3706  C CD   . ARG B 2 91  ? -8.552  9.159   3.637   1.00 0.00 ? 89  ARG B CD   2  
ATOM 3707  N NE   . ARG B 2 91  ? -9.876  9.537   3.131   1.00 0.00 ? 89  ARG B NE   2  
ATOM 3708  C CZ   . ARG B 2 91  ? -10.614 10.537  3.622   1.00 0.00 ? 89  ARG B CZ   2  
ATOM 3709  N NH1  . ARG B 2 91  ? -10.182 11.257  4.650   1.00 0.00 ? 89  ARG B NH1  2  
ATOM 3710  N NH2  . ARG B 2 91  ? -11.795 10.816  3.087   1.00 0.00 ? 89  ARG B NH2  2  
ATOM 3711  H H    . ARG B 2 91  ? -7.700  10.414  -1.052  1.00 0.00 ? 89  ARG B H    2  
ATOM 3712  H HA   . ARG B 2 91  ? -6.483  8.151   0.029   1.00 0.00 ? 89  ARG B HA   2  
ATOM 3713  H HB2  . ARG B 2 91  ? -7.039  10.190  1.348   1.00 0.00 ? 89  ARG B HB2  2  
ATOM 3714  H HB3  . ARG B 2 91  ? -8.746  9.792   1.217   1.00 0.00 ? 89  ARG B HB3  2  
ATOM 3715  H HG2  . ARG B 2 91  ? -7.999  7.553   2.342   1.00 0.00 ? 89  ARG B HG2  2  
ATOM 3716  H HG3  . ARG B 2 91  ? -6.645  8.544   2.896   1.00 0.00 ? 89  ARG B HG3  2  
ATOM 3717  H HD2  . ARG B 2 91  ? -8.674  8.430   4.424   1.00 0.00 ? 89  ARG B HD2  2  
ATOM 3718  H HD3  . ARG B 2 91  ? -8.066  10.038  4.035   1.00 0.00 ? 89  ARG B HD3  2  
ATOM 3719  H HE   . ARG B 2 91  ? -10.237 9.019   2.377   1.00 0.00 ? 89  ARG B HE   2  
ATOM 3720  H HH11 . ARG B 2 91  ? -9.301  11.057  5.079   1.00 0.00 ? 89  ARG B HH11 2  
ATOM 3721  H HH12 . ARG B 2 91  ? -10.750 12.024  4.997   1.00 0.00 ? 89  ARG B HH12 2  
ATOM 3722  H HH21 . ARG B 2 91  ? -12.150 10.272  2.304   1.00 0.00 ? 89  ARG B HH21 2  
ATOM 3723  H HH22 . ARG B 2 91  ? -12.349 11.569  3.460   1.00 0.00 ? 89  ARG B HH22 2  
ATOM 3724  N N    . ASP B 2 92  ? -9.706  7.941   -0.446  1.00 0.00 ? 90  ASP B N    2  
ATOM 3725  C CA   . ASP B 2 92  ? -10.850 7.079   -0.610  1.00 0.00 ? 90  ASP B CA   2  
ATOM 3726  C C    . ASP B 2 92  ? -10.662 6.065   -1.731  1.00 0.00 ? 90  ASP B C    2  
ATOM 3727  O O    . ASP B 2 92  ? -10.940 4.892   -1.533  1.00 0.00 ? 90  ASP B O    2  
ATOM 3728  C CB   . ASP B 2 92  ? -12.095 7.939   -0.809  1.00 0.00 ? 90  ASP B CB   2  
ATOM 3729  C CG   . ASP B 2 92  ? -12.768 8.217   0.518   1.00 0.00 ? 90  ASP B CG   2  
ATOM 3730  O OD1  . ASP B 2 92  ? -12.679 9.360   1.012   1.00 0.00 ? 90  ASP B OD1  2  
ATOM 3731  O OD2  . ASP B 2 92  ? -13.348 7.267   1.091   1.00 0.00 ? 90  ASP B OD2  2  
ATOM 3732  H H    . ASP B 2 92  ? -9.826  8.908   -0.582  1.00 0.00 ? 90  ASP B H    2  
ATOM 3733  H HA   . ASP B 2 92  ? -10.966 6.531   0.313   1.00 0.00 ? 90  ASP B HA   2  
ATOM 3734  H HB2  . ASP B 2 92  ? -11.799 8.883   -1.245  1.00 0.00 ? 90  ASP B HB2  2  
ATOM 3735  H HB3  . ASP B 2 92  ? -12.789 7.454   -1.467  1.00 0.00 ? 90  ASP B HB3  2  
ATOM 3736  N N    . ALA B 2 93  ? -10.158 6.496   -2.876  1.00 0.00 ? 91  ALA B N    2  
ATOM 3737  C CA   . ALA B 2 93  ? -9.940  5.585   -4.001  1.00 0.00 ? 91  ALA B CA   2  
ATOM 3738  C C    . ALA B 2 93  ? -8.831  4.585   -3.690  1.00 0.00 ? 91  ALA B C    2  
ATOM 3739  O O    . ALA B 2 93  ? -8.956  3.408   -4.012  1.00 0.00 ? 91  ALA B O    2  
ATOM 3740  C CB   . ALA B 2 93  ? -9.623  6.364   -5.268  1.00 0.00 ? 91  ALA B CB   2  
ATOM 3741  H H    . ALA B 2 93  ? -9.935  7.450   -2.975  1.00 0.00 ? 91  ALA B H    2  
ATOM 3742  H HA   . ALA B 2 93  ? -10.864 5.026   -4.164  1.00 0.00 ? 91  ALA B HA   2  
ATOM 3743  H HB1  . ALA B 2 93  ? -8.649  6.822   -5.175  1.00 0.00 ? 91  ALA B HB1  2  
ATOM 3744  H HB2  . ALA B 2 93  ? -10.369 7.132   -5.415  1.00 0.00 ? 91  ALA B HB2  2  
ATOM 3745  H HB3  . ALA B 2 93  ? -9.627  5.692   -6.114  1.00 0.00 ? 91  ALA B HB3  2  
ATOM 3746  N N    . VAL B 2 94  ? -7.741  5.049   -3.073  1.00 0.00 ? 92  VAL B N    2  
ATOM 3747  C CA   . VAL B 2 94  ? -6.650  4.149   -2.694  1.00 0.00 ? 92  VAL B CA   2  
ATOM 3748  C C    . VAL B 2 94  ? -7.207  3.148   -1.693  1.00 0.00 ? 92  VAL B C    2  
ATOM 3749  O O    . VAL B 2 94  ? -6.940  1.952   -1.769  1.00 0.00 ? 92  VAL B O    2  
ATOM 3750  C CB   . VAL B 2 94  ? -5.460  4.900   -2.062  1.00 0.00 ? 92  VAL B CB   2  
ATOM 3751  C CG1  . VAL B 2 94  ? -4.303  3.948   -1.820  1.00 0.00 ? 92  VAL B CG1  2  
ATOM 3752  C CG2  . VAL B 2 94  ? -5.009  6.043   -2.948  1.00 0.00 ? 92  VAL B CG2  2  
ATOM 3753  H H    . VAL B 2 94  ? -7.676  6.009   -2.859  1.00 0.00 ? 92  VAL B H    2  
ATOM 3754  H HA   . VAL B 2 94  ? -6.296  3.622   -3.580  1.00 0.00 ? 92  VAL B HA   2  
ATOM 3755  H HB   . VAL B 2 94  ? -5.776  5.307   -1.113  1.00 0.00 ? 92  VAL B HB   2  
ATOM 3756  H HG11 . VAL B 2 94  ? -3.518  4.464   -1.288  1.00 0.00 ? 92  VAL B HG11 2  
ATOM 3757  H HG12 . VAL B 2 94  ? -3.924  3.594   -2.767  1.00 0.00 ? 92  VAL B HG12 2  
ATOM 3758  H HG13 . VAL B 2 94  ? -4.645  3.108   -1.232  1.00 0.00 ? 92  VAL B HG13 2  
ATOM 3759  H HG21 . VAL B 2 94  ? -4.227  6.599   -2.450  1.00 0.00 ? 92  VAL B HG21 2  
ATOM 3760  H HG22 . VAL B 2 94  ? -5.845  6.698   -3.146  1.00 0.00 ? 92  VAL B HG22 2  
ATOM 3761  H HG23 . VAL B 2 94  ? -4.632  5.651   -3.880  1.00 0.00 ? 92  VAL B HG23 2  
ATOM 3762  N N    . LYS B 2 95  ? -8.016  3.669   -0.772  1.00 0.00 ? 93  LYS B N    2  
ATOM 3763  C CA   . LYS B 2 95  ? -8.681  2.865   0.244   1.00 0.00 ? 93  LYS B CA   2  
ATOM 3764  C C    . LYS B 2 95  ? -9.558  1.822   -0.426  1.00 0.00 ? 93  LYS B C    2  
ATOM 3765  O O    . LYS B 2 95  ? -9.408  0.632   -0.200  1.00 0.00 ? 93  LYS B O    2  
ATOM 3766  C CB   . LYS B 2 95  ? -9.552  3.767   1.129   1.00 0.00 ? 93  LYS B CB   2  
ATOM 3767  C CG   . LYS B 2 95  ? -10.530 3.014   2.021   1.00 0.00 ? 93  LYS B CG   2  
ATOM 3768  C CD   . LYS B 2 95  ? -11.706 3.892   2.438   1.00 0.00 ? 93  LYS B CD   2  
ATOM 3769  C CE   . LYS B 2 95  ? -12.917 3.698   1.529   1.00 0.00 ? 93  LYS B CE   2  
ATOM 3770  N NZ   . LYS B 2 95  ? -12.982 4.715   0.445   1.00 0.00 ? 93  LYS B NZ   2  
ATOM 3771  H H    . LYS B 2 95  ? -8.167  4.641   -0.776  1.00 0.00 ? 93  LYS B H    2  
ATOM 3772  H HA   . LYS B 2 95  ? -7.930  2.377   0.847   1.00 0.00 ? 93  LYS B HA   2  
ATOM 3773  H HB2  . LYS B 2 95  ? -8.908  4.363   1.756   1.00 0.00 ? 93  LYS B HB2  2  
ATOM 3774  H HB3  . LYS B 2 95  ? -10.121 4.427   0.490   1.00 0.00 ? 93  LYS B HB3  2  
ATOM 3775  H HG2  . LYS B 2 95  ? -10.908 2.159   1.481   1.00 0.00 ? 93  LYS B HG2  2  
ATOM 3776  H HG3  . LYS B 2 95  ? -10.009 2.680   2.907   1.00 0.00 ? 93  LYS B HG3  2  
ATOM 3777  H HD2  . LYS B 2 95  ? -11.987 3.641   3.450   1.00 0.00 ? 93  LYS B HD2  2  
ATOM 3778  H HD3  . LYS B 2 95  ? -11.399 4.927   2.397   1.00 0.00 ? 93  LYS B HD3  2  
ATOM 3779  H HE2  . LYS B 2 95  ? -12.861 2.717   1.083   1.00 0.00 ? 93  LYS B HE2  2  
ATOM 3780  H HE3  . LYS B 2 95  ? -13.813 3.767   2.129   1.00 0.00 ? 93  LYS B HE3  2  
ATOM 3781  H HZ1  . LYS B 2 95  ? -12.051 4.828   0.000   1.00 0.00 ? 93  LYS B HZ1  2  
ATOM 3782  H HZ2  . LYS B 2 95  ? -13.287 5.642   0.825   1.00 0.00 ? 93  LYS B HZ2  2  
ATOM 3783  H HZ3  . LYS B 2 95  ? -13.663 4.415   -0.295  1.00 0.00 ? 93  LYS B HZ3  2  
ATOM 3784  N N    . ASP B 2 96  ? -10.459 2.308   -1.266  1.00 0.00 ? 94  ASP B N    2  
ATOM 3785  C CA   . ASP B 2 96  ? -11.398 1.476   -2.006  1.00 0.00 ? 94  ASP B CA   2  
ATOM 3786  C C    . ASP B 2 96  ? -10.693 0.421   -2.837  1.00 0.00 ? 94  ASP B C    2  
ATOM 3787  O O    . ASP B 2 96  ? -10.997 -0.759  -2.729  1.00 0.00 ? 94  ASP B O    2  
ATOM 3788  C CB   . ASP B 2 96  ? -12.261 2.366   -2.902  1.00 0.00 ? 94  ASP B CB   2  
ATOM 3789  C CG   . ASP B 2 96  ? -13.542 2.806   -2.222  1.00 0.00 ? 94  ASP B CG   2  
ATOM 3790  O OD1  . ASP B 2 96  ? -13.680 4.011   -1.926  1.00 0.00 ? 94  ASP B OD1  2  
ATOM 3791  O OD2  . ASP B 2 96  ? -14.401 1.944   -1.960  1.00 0.00 ? 94  ASP B OD2  2  
ATOM 3792  H H    . ASP B 2 96  ? -10.495 3.282   -1.404  1.00 0.00 ? 94  ASP B H    2  
ATOM 3793  H HA   . ASP B 2 96  ? -12.038 0.977   -1.289  1.00 0.00 ? 94  ASP B HA   2  
ATOM 3794  H HB2  . ASP B 2 96  ? -11.697 3.250   -3.148  1.00 0.00 ? 94  ASP B HB2  2  
ATOM 3795  H HB3  . ASP B 2 96  ? -12.500 1.851   -3.811  1.00 0.00 ? 94  ASP B HB3  2  
ATOM 3796  N N    . LEU B 2 97  ? -9.742  0.849   -3.650  1.00 0.00 ? 95  LEU B N    2  
ATOM 3797  C CA   . LEU B 2 97  ? -9.002  -0.064  -4.511  1.00 0.00 ? 95  LEU B CA   2  
ATOM 3798  C C    . LEU B 2 97  ? -8.229  -1.086  -3.688  1.00 0.00 ? 95  LEU B C    2  
ATOM 3799  O O    . LEU B 2 97  ? -8.216  -2.254  -4.032  1.00 0.00 ? 95  LEU B O    2  
ATOM 3800  C CB   . LEU B 2 97  ? -8.054  0.714   -5.426  1.00 0.00 ? 95  LEU B CB   2  
ATOM 3801  C CG   . LEU B 2 97  ? -7.564  -0.049  -6.657  1.00 0.00 ? 95  LEU B CG   2  
ATOM 3802  C CD1  . LEU B 2 97  ? -8.720  -0.350  -7.599  1.00 0.00 ? 95  LEU B CD1  2  
ATOM 3803  C CD2  . LEU B 2 97  ? -6.481  0.739   -7.376  1.00 0.00 ? 95  LEU B CD2  2  
ATOM 3804  H H    . LEU B 2 97  ? -9.530  1.807   -3.671  1.00 0.00 ? 95  LEU B H    2  
ATOM 3805  H HA   . LEU B 2 97  ? -9.725  -0.600  -5.120  1.00 0.00 ? 95  LEU B HA   2  
ATOM 3806  H HB2  . LEU B 2 97  ? -8.566  1.605   -5.763  1.00 0.00 ? 95  LEU B HB2  2  
ATOM 3807  H HB3  . LEU B 2 97  ? -7.192  1.012   -4.849  1.00 0.00 ? 95  LEU B HB3  2  
ATOM 3808  H HG   . LEU B 2 97  ? -7.138  -0.991  -6.342  1.00 0.00 ? 95  LEU B HG   2  
ATOM 3809  H HD11 . LEU B 2 97  ? -9.453  -0.955  -7.086  1.00 0.00 ? 95  LEU B HD11 2  
ATOM 3810  H HD12 . LEU B 2 97  ? -8.352  -0.886  -8.462  1.00 0.00 ? 95  LEU B HD12 2  
ATOM 3811  H HD13 . LEU B 2 97  ? -9.176  0.576   -7.916  1.00 0.00 ? 95  LEU B HD13 2  
ATOM 3812  H HD21 . LEU B 2 97  ? -6.132  0.178   -8.228  1.00 0.00 ? 95  LEU B HD21 2  
ATOM 3813  H HD22 . LEU B 2 97  ? -5.658  0.918   -6.700  1.00 0.00 ? 95  LEU B HD22 2  
ATOM 3814  H HD23 . LEU B 2 97  ? -6.886  1.685   -7.708  1.00 0.00 ? 95  LEU B HD23 2  
ATOM 3815  N N    . LEU B 2 98  ? -7.592  -0.657  -2.608  1.00 0.00 ? 96  LEU B N    2  
ATOM 3816  C CA   . LEU B 2 98  ? -6.856  -1.584  -1.750  1.00 0.00 ? 96  LEU B CA   2  
ATOM 3817  C C    . LEU B 2 98  ? -7.836  -2.508  -1.044  1.00 0.00 ? 96  LEU B C    2  
ATOM 3818  O O    . LEU B 2 98  ? -7.623  -3.704  -0.977  1.00 0.00 ? 96  LEU B O    2  
ATOM 3819  C CB   . LEU B 2 98  ? -6.022  -0.824  -0.717  1.00 0.00 ? 96  LEU B CB   2  
ATOM 3820  C CG   . LEU B 2 98  ? -4.678  -0.304  -1.215  1.00 0.00 ? 96  LEU B CG   2  
ATOM 3821  C CD1  . LEU B 2 98  ? -4.140  0.758   -0.271  1.00 0.00 ? 96  LEU B CD1  2  
ATOM 3822  C CD2  . LEU B 2 98  ? -3.687  -1.447  -1.345  1.00 0.00 ? 96  LEU B CD2  2  
ATOM 3823  H H    . LEU B 2 98  ? -7.615  0.300   -2.378  1.00 0.00 ? 96  LEU B H    2  
ATOM 3824  H HA   . LEU B 2 98  ? -6.199  -2.187  -2.382  1.00 0.00 ? 96  LEU B HA   2  
ATOM 3825  H HB2  . LEU B 2 98  ? -6.602  0.018   -0.370  1.00 0.00 ? 96  LEU B HB2  2  
ATOM 3826  H HB3  . LEU B 2 98  ? -5.841  -1.483  0.119   1.00 0.00 ? 96  LEU B HB3  2  
ATOM 3827  H HG   . LEU B 2 98  ? -4.807  0.143   -2.189  1.00 0.00 ? 96  LEU B HG   2  
ATOM 3828  H HD11 . LEU B 2 98  ? -3.164  1.078   -0.606  1.00 0.00 ? 96  LEU B HD11 2  
ATOM 3829  H HD12 . LEU B 2 98  ? -4.065  0.350   0.726   1.00 0.00 ? 96  LEU B HD12 2  
ATOM 3830  H HD13 . LEU B 2 98  ? -4.812  1.604   -0.264  1.00 0.00 ? 96  LEU B HD13 2  
ATOM 3831  H HD21 . LEU B 2 98  ? -3.558  -1.923  -0.384  1.00 0.00 ? 96  LEU B HD21 2  
ATOM 3832  H HD22 . LEU B 2 98  ? -2.737  -1.063  -1.688  1.00 0.00 ? 96  LEU B HD22 2  
ATOM 3833  H HD23 . LEU B 2 98  ? -4.061  -2.168  -2.056  1.00 0.00 ? 96  LEU B HD23 2  
ATOM 3834  N N    . GLN B 2 99  ? -8.926  -1.943  -0.546  1.00 0.00 ? 97  GLN B N    2  
ATOM 3835  C CA   . GLN B 2 99  ? -9.965  -2.716  0.129   1.00 0.00 ? 97  GLN B CA   2  
ATOM 3836  C C    . GLN B 2 99  ? -10.580 -3.710  -0.859  1.00 0.00 ? 97  GLN B C    2  
ATOM 3837  O O    . GLN B 2 99  ? -11.179 -4.718  -0.491  1.00 0.00 ? 97  GLN B O    2  
ATOM 3838  C CB   . GLN B 2 99  ? -11.028 -1.756  0.683   1.00 0.00 ? 97  GLN B CB   2  
ATOM 3839  C CG   . GLN B 2 99  ? -12.298 -2.428  1.166   1.00 0.00 ? 97  GLN B CG   2  
ATOM 3840  C CD   . GLN B 2 99  ? -12.698 -1.979  2.555   1.00 0.00 ? 97  GLN B CD   2  
ATOM 3841  O OE1  . GLN B 2 99  ? -13.501 -1.061  2.718   1.00 0.00 ? 97  GLN B OE1  2  
ATOM 3842  N NE2  . GLN B 2 99  ? -12.121 -2.606  3.565   1.00 0.00 ? 97  GLN B NE2  2  
ATOM 3843  H H    . GLN B 2 99  ? -9.037  -0.968  -0.625  1.00 0.00 ? 97  GLN B H    2  
ATOM 3844  H HA   . GLN B 2 99  ? -9.502  -3.257  0.945   1.00 0.00 ? 97  GLN B HA   2  
ATOM 3845  H HB2  . GLN B 2 99  ? -10.602 -1.213  1.513   1.00 0.00 ? 97  GLN B HB2  2  
ATOM 3846  H HB3  . GLN B 2 99  ? -11.294 -1.053  -0.093  1.00 0.00 ? 97  GLN B HB3  2  
ATOM 3847  H HG2  . GLN B 2 99  ? -13.098 -2.184  0.482   1.00 0.00 ? 97  GLN B HG2  2  
ATOM 3848  H HG3  . GLN B 2 99  ? -12.145 -3.496  1.175   1.00 0.00 ? 97  GLN B HG3  2  
ATOM 3849  H HE21 . GLN B 2 99  ? -11.464 -3.318  3.360   1.00 0.00 ? 97  GLN B HE21 2  
ATOM 3850  H HE22 . GLN B 2 99  ? -12.372 -2.345  4.478   1.00 0.00 ? 97  GLN B HE22 2  
ATOM 3851  N N    . GLN B 2 100 ? -10.410 -3.393  -2.129  1.00 0.00 ? 98  GLN B N    2  
ATOM 3852  C CA   . GLN B 2 100 ? -10.890 -4.212  -3.223  1.00 0.00 ? 98  GLN B CA   2  
ATOM 3853  C C    . GLN B 2 100 ? -9.861  -5.276  -3.572  1.00 0.00 ? 98  GLN B C    2  
ATOM 3854  O O    . GLN B 2 100 ? -10.154 -6.469  -3.659  1.00 0.00 ? 98  GLN B O    2  
ATOM 3855  C CB   . GLN B 2 100 ? -11.101 -3.315  -4.453  1.00 0.00 ? 98  GLN B CB   2  
ATOM 3856  C CG   . GLN B 2 100 ? -12.487 -2.707  -4.565  1.00 0.00 ? 98  GLN B CG   2  
ATOM 3857  C CD   . GLN B 2 100 ? -13.597 -3.687  -4.269  1.00 0.00 ? 98  GLN B CD   2  
ATOM 3858  O OE1  . GLN B 2 100 ? -13.513 -4.875  -4.600  1.00 0.00 ? 98  GLN B OE1  2  
ATOM 3859  N NE2  . GLN B 2 100 ? -14.643 -3.191  -3.634  1.00 0.00 ? 98  GLN B NE2  2  
ATOM 3860  H H    . GLN B 2 100 ? -9.947  -2.554  -2.339  1.00 0.00 ? 98  GLN B H    2  
ATOM 3861  H HA   . GLN B 2 100 ? -11.820 -4.672  -2.940  1.00 0.00 ? 98  GLN B HA   2  
ATOM 3862  H HB2  . GLN B 2 100 ? -10.393 -2.500  -4.395  1.00 0.00 ? 98  GLN B HB2  2  
ATOM 3863  H HB3  . GLN B 2 100 ? -10.893 -3.878  -5.347  1.00 0.00 ? 98  GLN B HB3  2  
ATOM 3864  H HG2  . GLN B 2 100 ? -12.560 -1.887  -3.866  1.00 0.00 ? 98  GLN B HG2  2  
ATOM 3865  H HG3  . GLN B 2 100 ? -12.616 -2.331  -5.569  1.00 0.00 ? 98  GLN B HG3  2  
ATOM 3866  H HE21 . GLN B 2 100 ? -14.629 -2.234  -3.398  1.00 0.00 ? 98  GLN B HE21 2  
ATOM 3867  H HE22 . GLN B 2 100 ? -15.382 -3.789  -3.419  1.00 0.00 ? 98  GLN B HE22 2  
ATOM 3868  N N    . LEU B 2 101 ? -8.655  -4.795  -3.757  1.00 0.00 ? 99  LEU B N    2  
ATOM 3869  C CA   . LEU B 2 101 ? -7.505  -5.579  -4.162  1.00 0.00 ? 99  LEU B CA   2  
ATOM 3870  C C    . LEU B 2 101 ? -6.922  -6.469  -3.066  1.00 0.00 ? 99  LEU B C    2  
ATOM 3871  O O    . LEU B 2 101 ? -6.741  -7.667  -3.277  1.00 0.00 ? 99  LEU B O    2  
ATOM 3872  C CB   . LEU B 2 101 ? -6.452  -4.586  -4.649  1.00 0.00 ? 99  LEU B CB   2  
ATOM 3873  C CG   . LEU B 2 101 ? -6.599  -4.179  -6.114  1.00 0.00 ? 99  LEU B CG   2  
ATOM 3874  C CD1  . LEU B 2 101 ? -5.795  -2.922  -6.401  1.00 0.00 ? 99  LEU B CD1  2  
ATOM 3875  C CD2  . LEU B 2 101 ? -6.169  -5.313  -7.030  1.00 0.00 ? 99  LEU B CD2  2  
ATOM 3876  H H    . LEU B 2 101 ? -8.523  -3.830  -3.616  1.00 0.00 ? 99  LEU B H    2  
ATOM 3877  H HA   . LEU B 2 101 ? -7.799  -6.197  -4.994  1.00 0.00 ? 99  LEU B HA   2  
ATOM 3878  H HB2  . LEU B 2 101 ? -6.541  -3.694  -4.045  1.00 0.00 ? 99  LEU B HB2  2  
ATOM 3879  H HB3  . LEU B 2 101 ? -5.474  -4.998  -4.492  1.00 0.00 ? 99  LEU B HB3  2  
ATOM 3880  H HG   . LEU B 2 101 ? -7.642  -3.962  -6.314  1.00 0.00 ? 99  LEU B HG   2  
ATOM 3881  H HD11 . LEU B 2 101 ? -4.768  -3.075  -6.107  1.00 0.00 ? 99  LEU B HD11 2  
ATOM 3882  H HD12 . LEU B 2 101 ? -6.210  -2.095  -5.843  1.00 0.00 ? 99  LEU B HD12 2  
ATOM 3883  H HD13 . LEU B 2 101 ? -5.839  -2.699  -7.457  1.00 0.00 ? 99  LEU B HD13 2  
ATOM 3884  H HD21 . LEU B 2 101 ? -5.108  -5.483  -6.920  1.00 0.00 ? 99  LEU B HD21 2  
ATOM 3885  H HD22 . LEU B 2 101 ? -6.386  -5.050  -8.055  1.00 0.00 ? 99  LEU B HD22 2  
ATOM 3886  H HD23 . LEU B 2 101 ? -6.706  -6.212  -6.768  1.00 0.00 ? 99  LEU B HD23 2  
ATOM 3887  N N    . LEU B 2 102 ? -6.659  -5.890  -1.905  1.00 0.00 ? 100 LEU B N    2  
ATOM 3888  C CA   . LEU B 2 102 ? -6.029  -6.605  -0.795  1.00 0.00 ? 100 LEU B CA   2  
ATOM 3889  C C    . LEU B 2 102 ? -6.691  -7.944  -0.464  1.00 0.00 ? 100 LEU B C    2  
ATOM 3890  O O    . LEU B 2 102 ? -6.020  -8.967  -0.512  1.00 0.00 ? 100 LEU B O    2  
ATOM 3891  C CB   . LEU B 2 102 ? -5.929  -5.721  0.445   1.00 0.00 ? 100 LEU B CB   2  
ATOM 3892  C CG   . LEU B 2 102 ? -4.896  -4.612  0.304   1.00 0.00 ? 100 LEU B CG   2  
ATOM 3893  C CD1  . LEU B 2 102 ? -4.750  -3.813  1.581   1.00 0.00 ? 100 LEU B CD1  2  
ATOM 3894  C CD2  . LEU B 2 102 ? -3.563  -5.188  -0.095  1.00 0.00 ? 100 LEU B CD2  2  
ATOM 3895  H H    . LEU B 2 102 ? -6.920  -4.949  -1.773  1.00 0.00 ? 100 LEU B H    2  
ATOM 3896  H HA   . LEU B 2 102 ? -5.021  -6.809  -1.115  1.00 0.00 ? 100 LEU B HA   2  
ATOM 3897  H HB2  . LEU B 2 102 ? -6.897  -5.276  0.632   1.00 0.00 ? 100 LEU B HB2  2  
ATOM 3898  H HB3  . LEU B 2 102 ? -5.657  -6.336  1.289   1.00 0.00 ? 100 LEU B HB3  2  
ATOM 3899  H HG   . LEU B 2 102 ? -5.213  -3.950  -0.481  1.00 0.00 ? 100 LEU B HG   2  
ATOM 3900  H HD11 . LEU B 2 102 ? -3.964  -3.079  1.454   1.00 0.00 ? 100 LEU B HD11 2  
ATOM 3901  H HD12 . LEU B 2 102 ? -4.491  -4.477  2.392   1.00 0.00 ? 100 LEU B HD12 2  
ATOM 3902  H HD13 . LEU B 2 102 ? -5.677  -3.312  1.803   1.00 0.00 ? 100 LEU B HD13 2  
ATOM 3903  H HD21 . LEU B 2 102 ? -3.222  -5.871  0.668   1.00 0.00 ? 100 LEU B HD21 2  
ATOM 3904  H HD22 . LEU B 2 102 ? -2.846  -4.387  -0.211  1.00 0.00 ? 100 LEU B HD22 2  
ATOM 3905  H HD23 . LEU B 2 102 ? -3.666  -5.716  -1.032  1.00 0.00 ? 100 LEU B HD23 2  
ATOM 3906  N N    . PRO B 2 103 ? -8.003  -7.984  -0.144  1.00 0.00 ? 101 PRO B N    2  
ATOM 3907  C CA   . PRO B 2 103 ? -8.699  -9.238  0.204   1.00 0.00 ? 101 PRO B CA   2  
ATOM 3908  C C    . PRO B 2 103 ? -8.572  -10.338 -0.855  1.00 0.00 ? 101 PRO B C    2  
ATOM 3909  O O    . PRO B 2 103 ? -8.832  -11.505 -0.572  1.00 0.00 ? 101 PRO B O    2  
ATOM 3910  C CB   . PRO B 2 103 ? -10.159 -8.806  0.350   1.00 0.00 ? 101 PRO B CB   2  
ATOM 3911  C CG   . PRO B 2 103 ? -10.081 -7.367  0.709   1.00 0.00 ? 101 PRO B CG   2  
ATOM 3912  C CD   . PRO B 2 103 ? -8.914  -6.825  -0.063  1.00 0.00 ? 101 PRO B CD   2  
ATOM 3913  H HA   . PRO B 2 103 ? -8.347  -9.625  1.150   1.00 0.00 ? 101 PRO B HA   2  
ATOM 3914  H HB2  . PRO B 2 103 ? -10.679 -8.956  -0.585  1.00 0.00 ? 101 PRO B HB2  2  
ATOM 3915  H HB3  . PRO B 2 103 ? -10.633 -9.383  1.131   1.00 0.00 ? 101 PRO B HB3  2  
ATOM 3916  H HG2  . PRO B 2 103 ? -10.993 -6.865  0.419   1.00 0.00 ? 101 PRO B HG2  2  
ATOM 3917  H HG3  . PRO B 2 103 ? -9.912  -7.260  1.771   1.00 0.00 ? 101 PRO B HG3  2  
ATOM 3918  H HD2  . PRO B 2 103 ? -9.226  -6.509  -1.048  1.00 0.00 ? 101 PRO B HD2  2  
ATOM 3919  H HD3  . PRO B 2 103 ? -8.453  -6.009  0.471   1.00 0.00 ? 101 PRO B HD3  2  
ATOM 3920  N N    . LYS B 2 104 ? -8.181  -9.970  -2.070  1.00 0.00 ? 102 LYS B N    2  
ATOM 3921  C CA   . LYS B 2 104 ? -8.029  -10.947 -3.141  1.00 0.00 ? 102 LYS B CA   2  
ATOM 3922  C C    . LYS B 2 104 ? -6.628  -11.560 -3.127  1.00 0.00 ? 102 LYS B C    2  
ATOM 3923  O O    . LYS B 2 104 ? -6.377  -12.569 -3.782  1.00 0.00 ? 102 LYS B O    2  
ATOM 3924  C CB   . LYS B 2 104 ? -8.297  -10.307 -4.507  1.00 0.00 ? 102 LYS B CB   2  
ATOM 3925  C CG   . LYS B 2 104 ? -9.657  -9.636  -4.621  1.00 0.00 ? 102 LYS B CG   2  
ATOM 3926  C CD   . LYS B 2 104 ? -10.067 -9.457  -6.076  1.00 0.00 ? 102 LYS B CD   2  
ATOM 3927  C CE   . LYS B 2 104 ? -10.555 -8.043  -6.359  1.00 0.00 ? 102 LYS B CE   2  
ATOM 3928  N NZ   . LYS B 2 104 ? -11.685 -7.649  -5.471  1.00 0.00 ? 102 LYS B NZ   2  
ATOM 3929  H H    . LYS B 2 104 ? -7.974  -9.027  -2.244  1.00 0.00 ? 102 LYS B H    2  
ATOM 3930  H HA   . LYS B 2 104 ? -8.750  -11.733 -2.975  1.00 0.00 ? 102 LYS B HA   2  
ATOM 3931  H HB2  . LYS B 2 104 ? -7.537  -9.563  -4.697  1.00 0.00 ? 102 LYS B HB2  2  
ATOM 3932  H HB3  . LYS B 2 104 ? -8.233  -11.072 -5.266  1.00 0.00 ? 102 LYS B HB3  2  
ATOM 3933  H HG2  . LYS B 2 104 ? -10.394 -10.249 -4.123  1.00 0.00 ? 102 LYS B HG2  2  
ATOM 3934  H HG3  . LYS B 2 104 ? -9.611  -8.667  -4.147  1.00 0.00 ? 102 LYS B HG3  2  
ATOM 3935  H HD2  . LYS B 2 104 ? -9.214  -9.664  -6.706  1.00 0.00 ? 102 LYS B HD2  2  
ATOM 3936  H HD3  . LYS B 2 104 ? -10.860 -10.154 -6.305  1.00 0.00 ? 102 LYS B HD3  2  
ATOM 3937  H HE2  . LYS B 2 104 ? -9.734  -7.359  -6.205  1.00 0.00 ? 102 LYS B HE2  2  
ATOM 3938  H HE3  . LYS B 2 104 ? -10.878 -7.989  -7.388  1.00 0.00 ? 102 LYS B HE3  2  
ATOM 3939  H HZ1  . LYS B 2 104 ? -11.323 -7.422  -4.517  1.00 0.00 ? 102 LYS B HZ1  2  
ATOM 3940  H HZ2  . LYS B 2 104 ? -12.370 -8.424  -5.393  1.00 0.00 ? 102 LYS B HZ2  2  
ATOM 3941  H HZ3  . LYS B 2 104 ? -12.168 -6.810  -5.853  1.00 0.00 ? 102 LYS B HZ3  2  
ATOM 3942  N N    . PHE B 2 105 ? -5.720  -10.942 -2.380  1.00 0.00 ? 103 PHE B N    2  
ATOM 3943  C CA   . PHE B 2 105 ? -4.343  -11.420 -2.301  1.00 0.00 ? 103 PHE B CA   2  
ATOM 3944  C C    . PHE B 2 105 ? -3.940  -11.756 -0.864  1.00 0.00 ? 103 PHE B C    2  
ATOM 3945  O O    . PHE B 2 105 ? -3.100  -12.631 -0.637  1.00 0.00 ? 103 PHE B O    2  
ATOM 3946  C CB   . PHE B 2 105 ? -3.386  -10.368 -2.872  1.00 0.00 ? 103 PHE B CB   2  
ATOM 3947  C CG   . PHE B 2 105 ? -3.678  -9.985  -4.297  1.00 0.00 ? 103 PHE B CG   2  
ATOM 3948  C CD1  . PHE B 2 105 ? -3.451  -10.876 -5.332  1.00 0.00 ? 103 PHE B CD1  2  
ATOM 3949  C CD2  . PHE B 2 105 ? -4.180  -8.730  -4.598  1.00 0.00 ? 103 PHE B CD2  2  
ATOM 3950  C CE1  . PHE B 2 105 ? -3.719  -10.522 -6.643  1.00 0.00 ? 103 PHE B CE1  2  
ATOM 3951  C CE2  . PHE B 2 105 ? -4.451  -8.370  -5.904  1.00 0.00 ? 103 PHE B CE2  2  
ATOM 3952  C CZ   . PHE B 2 105 ? -4.220  -9.267  -6.928  1.00 0.00 ? 103 PHE B CZ   2  
ATOM 3953  H H    . PHE B 2 105 ? -5.982  -10.144 -1.869  1.00 0.00 ? 103 PHE B H    2  
ATOM 3954  H HA   . PHE B 2 105 ? -4.271  -12.315 -2.899  1.00 0.00 ? 103 PHE B HA   2  
ATOM 3955  H HB2  . PHE B 2 105 ? -3.447  -9.474  -2.270  1.00 0.00 ? 103 PHE B HB2  2  
ATOM 3956  H HB3  . PHE B 2 105 ? -2.376  -10.753 -2.829  1.00 0.00 ? 103 PHE B HB3  2  
ATOM 3957  H HD1  . PHE B 2 105 ? -3.059  -11.859 -5.111  1.00 0.00 ? 103 PHE B HD1  2  
ATOM 3958  H HD2  . PHE B 2 105 ? -4.362  -8.026  -3.799  1.00 0.00 ? 103 PHE B HD2  2  
ATOM 3959  H HE1  . PHE B 2 105 ? -3.538  -11.226 -7.441  1.00 0.00 ? 103 PHE B HE1  2  
ATOM 3960  H HE2  . PHE B 2 105 ? -4.844  -7.388  -6.125  1.00 0.00 ? 103 PHE B HE2  2  
ATOM 3961  H HZ   . PHE B 2 105 ? -4.430  -8.987  -7.950  1.00 0.00 ? 103 PHE B HZ   2  
ATOM 3962  N N    . LYS B 2 106 ? -4.530  -11.062 0.101   1.00 0.00 ? 104 LYS B N    2  
ATOM 3963  C CA   . LYS B 2 106 ? -4.218  -11.286 1.509   1.00 0.00 ? 104 LYS B CA   2  
ATOM 3964  C C    . LYS B 2 106 ? -5.048  -12.434 2.082   1.00 0.00 ? 104 LYS B C    2  
ATOM 3965  O O    . LYS B 2 106 ? -6.276  -12.448 1.978   1.00 0.00 ? 104 LYS B O    2  
ATOM 3966  C CB   . LYS B 2 106 ? -4.443  -10.005 2.328   1.00 0.00 ? 104 LYS B CB   2  
ATOM 3967  C CG   . LYS B 2 106 ? -5.905  -9.598  2.462   1.00 0.00 ? 104 LYS B CG   2  
ATOM 3968  C CD   . LYS B 2 106 ? -6.090  -8.441  3.426   1.00 0.00 ? 104 LYS B CD   2  
ATOM 3969  C CE   . LYS B 2 106 ? -7.554  -8.261  3.801   1.00 0.00 ? 104 LYS B CE   2  
ATOM 3970  N NZ   . LYS B 2 106 ? -7.735  -7.243  4.868   1.00 0.00 ? 104 LYS B NZ   2  
ATOM 3971  H H    . LYS B 2 106 ? -5.194  -10.377 -0.137  1.00 0.00 ? 104 LYS B H    2  
ATOM 3972  H HA   . LYS B 2 106 ? -3.175  -11.557 1.571   1.00 0.00 ? 104 LYS B HA   2  
ATOM 3973  H HB2  . LYS B 2 106 ? -4.044  -10.153 3.321   1.00 0.00 ? 104 LYS B HB2  2  
ATOM 3974  H HB3  . LYS B 2 106 ? -3.910  -9.194  1.855   1.00 0.00 ? 104 LYS B HB3  2  
ATOM 3975  H HG2  . LYS B 2 106 ? -6.275  -9.304  1.491   1.00 0.00 ? 104 LYS B HG2  2  
ATOM 3976  H HG3  . LYS B 2 106 ? -6.470  -10.448 2.820   1.00 0.00 ? 104 LYS B HG3  2  
ATOM 3977  H HD2  . LYS B 2 106 ? -5.521  -8.638  4.324   1.00 0.00 ? 104 LYS B HD2  2  
ATOM 3978  H HD3  . LYS B 2 106 ? -5.731  -7.535  2.961   1.00 0.00 ? 104 LYS B HD3  2  
ATOM 3979  H HE2  . LYS B 2 106 ? -8.102  -7.949  2.924   1.00 0.00 ? 104 LYS B HE2  2  
ATOM 3980  H HE3  . LYS B 2 106 ? -7.942  -9.208  4.148   1.00 0.00 ? 104 LYS B HE3  2  
ATOM 3981  H HZ1  . LYS B 2 106 ? -6.877  -7.188  5.458   1.00 0.00 ? 104 LYS B HZ1  2  
ATOM 3982  H HZ2  . LYS B 2 106 ? -8.542  -7.493  5.475   1.00 0.00 ? 104 LYS B HZ2  2  
ATOM 3983  H HZ3  . LYS B 2 106 ? -7.910  -6.300  4.445   1.00 0.00 ? 104 LYS B HZ3  2  
ATOM 3984  N N    . ARG B 2 107 ? -4.359  -13.415 2.647   1.00 0.00 ? 105 ARG B N    2  
ATOM 3985  C CA   . ARG B 2 107 ? -5.002  -14.573 3.263   1.00 0.00 ? 105 ARG B CA   2  
ATOM 3986  C C    . ARG B 2 107 ? -4.108  -15.088 4.381   1.00 0.00 ? 105 ARG B C    2  
ATOM 3987  O O    . ARG B 2 107 ? -2.986  -15.524 4.124   1.00 0.00 ? 105 ARG B O    2  
ATOM 3988  C CB   . ARG B 2 107 ? -5.247  -15.716 2.261   1.00 0.00 ? 105 ARG B CB   2  
ATOM 3989  C CG   . ARG B 2 107 ? -5.775  -15.294 0.896   1.00 0.00 ? 105 ARG B CG   2  
ATOM 3990  C CD   . ARG B 2 107 ? -4.663  -15.277 -0.142  1.00 0.00 ? 105 ARG B CD   2  
ATOM 3991  N NE   . ARG B 2 107 ? -3.724  -16.377 0.064   1.00 0.00 ? 105 ARG B NE   2  
ATOM 3992  C CZ   . ARG B 2 107 ? -2.410  -16.230 0.212   1.00 0.00 ? 105 ARG B CZ   2  
ATOM 3993  N NH1  . ARG B 2 107 ? -1.846  -15.034 0.064   1.00 0.00 ? 105 ARG B NH1  2  
ATOM 3994  N NH2  . ARG B 2 107 ? -1.663  -17.285 0.513   1.00 0.00 ? 105 ARG B NH2  2  
ATOM 3995  H H    . ARG B 2 107 ? -3.381  -13.355 2.671   1.00 0.00 ? 105 ARG B H    2  
ATOM 3996  H HA   . ARG B 2 107 ? -5.945  -14.252 3.681   1.00 0.00 ? 105 ARG B HA   2  
ATOM 3997  H HB2  . ARG B 2 107 ? -4.315  -16.239 2.106   1.00 0.00 ? 105 ARG B HB2  2  
ATOM 3998  H HB3  . ARG B 2 107 ? -5.959  -16.404 2.695   1.00 0.00 ? 105 ARG B HB3  2  
ATOM 3999  H HG2  . ARG B 2 107 ? -6.537  -15.992 0.582   1.00 0.00 ? 105 ARG B HG2  2  
ATOM 4000  H HG3  . ARG B 2 107 ? -6.199  -14.303 0.973   1.00 0.00 ? 105 ARG B HG3  2  
ATOM 4001  H HD2  . ARG B 2 107 ? -5.102  -15.366 -1.126  1.00 0.00 ? 105 ARG B HD2  2  
ATOM 4002  H HD3  . ARG B 2 107 ? -4.131  -14.340 -0.069  1.00 0.00 ? 105 ARG B HD3  2  
ATOM 4003  H HE   . ARG B 2 107 ? -4.113  -17.293 0.136   1.00 0.00 ? 105 ARG B HE   2  
ATOM 4004  H HH11 . ARG B 2 107 ? -2.413  -14.231 -0.163  1.00 0.00 ? 105 ARG B HH11 2  
ATOM 4005  H HH12 . ARG B 2 107 ? -0.859  -14.924 0.180   1.00 0.00 ? 105 ARG B HH12 2  
ATOM 4006  H HH21 . ARG B 2 107 ? -2.099  -18.196 0.635   1.00 0.00 ? 105 ARG B HH21 2  
ATOM 4007  H HH22 . ARG B 2 107 ? -0.676  -17.192 0.627   1.00 0.00 ? 105 ARG B HH22 2  
ATOM 4008  N N    . LYS B 2 108 ? -4.595  -15.024 5.612   1.00 0.00 ? 106 LYS B N    2  
ATOM 4009  C CA   . LYS B 2 108 ? -3.826  -15.481 6.765   1.00 0.00 ? 106 LYS B CA   2  
ATOM 4010  C C    . LYS B 2 108 ? -3.570  -16.986 6.708   1.00 0.00 ? 106 LYS B C    2  
ATOM 4011  O O    . LYS B 2 108 ? -2.494  -17.455 7.078   1.00 0.00 ? 106 LYS B O    2  
ATOM 4012  C CB   . LYS B 2 108 ? -4.559  -15.125 8.057   1.00 0.00 ? 106 LYS B CB   2  
ATOM 4013  C CG   . LYS B 2 108 ? -3.724  -15.302 9.312   1.00 0.00 ? 106 LYS B CG   2  
ATOM 4014  C CD   . LYS B 2 108 ? -4.439  -14.755 10.539  1.00 0.00 ? 106 LYS B CD   2  
ATOM 4015  C CE   . LYS B 2 108 ? -4.184  -13.266 10.728  1.00 0.00 ? 106 LYS B CE   2  
ATOM 4016  N NZ   . LYS B 2 108 ? -4.876  -12.432 9.711   1.00 0.00 ? 106 LYS B NZ   2  
ATOM 4017  H H    . LYS B 2 108 ? -5.496  -14.635 5.757   1.00 0.00 ? 106 LYS B H    2  
ATOM 4018  H HA   . LYS B 2 108 ? -2.876  -14.967 6.752   1.00 0.00 ? 106 LYS B HA   2  
ATOM 4019  H HB2  . LYS B 2 108 ? -4.872  -14.092 8.005   1.00 0.00 ? 106 LYS B HB2  2  
ATOM 4020  H HB3  . LYS B 2 108 ? -5.436  -15.750 8.144   1.00 0.00 ? 106 LYS B HB3  2  
ATOM 4021  H HG2  . LYS B 2 108 ? -3.531  -16.354 9.459   1.00 0.00 ? 106 LYS B HG2  2  
ATOM 4022  H HG3  . LYS B 2 108 ? -2.788  -14.776 9.188   1.00 0.00 ? 106 LYS B HG3  2  
ATOM 4023  H HD2  . LYS B 2 108 ? -5.500  -14.916 10.425  1.00 0.00 ? 106 LYS B HD2  2  
ATOM 4024  H HD3  . LYS B 2 108 ? -4.087  -15.285 11.412  1.00 0.00 ? 106 LYS B HD3  2  
ATOM 4025  H HE2  . LYS B 2 108 ? -4.535  -12.978 11.708  1.00 0.00 ? 106 LYS B HE2  2  
ATOM 4026  H HE3  . LYS B 2 108 ? -3.121  -13.087 10.665  1.00 0.00 ? 106 LYS B HE3  2  
ATOM 4027  H HZ1  . LYS B 2 108 ? -5.040  -11.471 10.088  1.00 0.00 ? 106 LYS B HZ1  2  
ATOM 4028  H HZ2  . LYS B 2 108 ? -5.798  -12.855 9.453   1.00 0.00 ? 106 LYS B HZ2  2  
ATOM 4029  H HZ3  . LYS B 2 108 ? -4.296  -12.356 8.841   1.00 0.00 ? 106 LYS B HZ3  2  
ATOM 4030  N N    . ALA B 2 109 ? -4.558  -17.737 6.242   1.00 0.00 ? 107 ALA B N    2  
ATOM 4031  C CA   . ALA B 2 109 ? -4.429  -19.185 6.145   1.00 0.00 ? 107 ALA B CA   2  
ATOM 4032  C C    . ALA B 2 109 ? -5.126  -19.713 4.897   1.00 0.00 ? 107 ALA B C    2  
ATOM 4033  O O    . ALA B 2 109 ? -6.069  -20.498 4.987   1.00 0.00 ? 107 ALA B O    2  
ATOM 4034  C CB   . ALA B 2 109 ? -4.990  -19.853 7.393   1.00 0.00 ? 107 ALA B CB   2  
ATOM 4035  H H    . ALA B 2 109 ? -5.390  -17.308 5.953   1.00 0.00 ? 107 ALA B H    2  
ATOM 4036  H HA   . ALA B 2 109 ? -3.376  -19.421 6.083   1.00 0.00 ? 107 ALA B HA   2  
ATOM 4037  H HB1  . ALA B 2 109 ? -4.426  -19.537 8.257   1.00 0.00 ? 107 ALA B HB1  2  
ATOM 4038  H HB2  . ALA B 2 109 ? -4.919  -20.926 7.289   1.00 0.00 ? 107 ALA B HB2  2  
ATOM 4039  H HB3  . ALA B 2 109 ? -6.026  -19.572 7.518   1.00 0.00 ? 107 ALA B HB3  2  
ATOM 4040  N N    . ASN B 2 110 ? -4.655  -19.274 3.738   1.00 0.00 ? 108 ASN B N    2  
ATOM 4041  C CA   . ASN B 2 110 ? -5.220  -19.696 2.462   1.00 0.00 ? 108 ASN B CA   2  
ATOM 4042  C C    . ASN B 2 110 ? -4.307  -19.243 1.328   1.00 0.00 ? 108 ASN B C    2  
ATOM 4043  O O    . ASN B 2 110 ? -4.817  -18.761 0.296   1.00 0.00 ? 108 ASN B O    2  
ATOM 4044  C CB   . ASN B 2 110 ? -6.627  -19.110 2.272   1.00 0.00 ? 108 ASN B CB   2  
ATOM 4045  C CG   . ASN B 2 110 ? -7.500  -19.950 1.354   1.00 0.00 ? 108 ASN B CG   2  
ATOM 4046  O OD1  . ASN B 2 110 ? -8.462  -20.577 1.794   1.00 0.00 ? 108 ASN B OD1  2  
ATOM 4047  N ND2  . ASN B 2 110 ? -7.167  -19.975 0.075   1.00 0.00 ? 108 ASN B ND2  2  
ATOM 4048  O OXT  . ASN B 2 110 ? -3.073  -19.325 1.495   1.00 0.00 ? 108 ASN B OXT  2  
ATOM 4049  H H    . ASN B 2 110 ? -3.892  -18.658 3.735   1.00 0.00 ? 108 ASN B H    2  
ATOM 4050  H HA   . ASN B 2 110 ? -5.278  -20.774 2.460   1.00 0.00 ? 108 ASN B HA   2  
ATOM 4051  H HB2  . ASN B 2 110 ? -7.114  -19.041 3.234   1.00 0.00 ? 108 ASN B HB2  2  
ATOM 4052  H HB3  . ASN B 2 110 ? -6.541  -18.120 1.847   1.00 0.00 ? 108 ASN B HB3  2  
ATOM 4053  H HD21 . ASN B 2 110 ? -6.375  -19.452 -0.206  1.00 0.00 ? 108 ASN B HD21 2  
ATOM 4054  H HD22 . ASN B 2 110 ? -7.712  -20.508 -0.535  1.00 0.00 ? 108 ASN B HD22 2  
ATOM 4055  N N    . TYR A 1 1   ? 3.390   7.739   14.079  1.00 0.00 ? 392 TYR A N    3  
ATOM 4056  C CA   . TYR A 1 1   ? 3.758   7.207   15.415  1.00 0.00 ? 392 TYR A CA   3  
ATOM 4057  C C    . TYR A 1 1   ? 5.099   6.473   15.345  1.00 0.00 ? 392 TYR A C    3  
ATOM 4058  O O    . TYR A 1 1   ? 5.993   6.887   14.612  1.00 0.00 ? 392 TYR A O    3  
ATOM 4059  C CB   . TYR A 1 1   ? 2.660   6.267   15.941  1.00 0.00 ? 392 TYR A CB   3  
ATOM 4060  C CG   . TYR A 1 1   ? 2.085   5.328   14.897  1.00 0.00 ? 392 TYR A CG   3  
ATOM 4061  C CD1  . TYR A 1 1   ? 2.898   4.719   13.949  1.00 0.00 ? 392 TYR A CD1  3  
ATOM 4062  C CD2  . TYR A 1 1   ? 0.725   5.055   14.863  1.00 0.00 ? 392 TYR A CD2  3  
ATOM 4063  C CE1  . TYR A 1 1   ? 2.377   3.869   13.000  1.00 0.00 ? 392 TYR A CE1  3  
ATOM 4064  C CE2  . TYR A 1 1   ? 0.195   4.204   13.915  1.00 0.00 ? 392 TYR A CE2  3  
ATOM 4065  C CZ   . TYR A 1 1   ? 1.025   3.614   12.986  1.00 0.00 ? 392 TYR A CZ   3  
ATOM 4066  O OH   . TYR A 1 1   ? 0.502   2.763   12.045  1.00 0.00 ? 392 TYR A OH   3  
ATOM 4067  H H1   . TYR A 1 1   ? 2.611   7.176   13.663  1.00 0.00 ? 392 TYR A H1   3  
ATOM 4068  H H2   . TYR A 1 1   ? 4.207   7.689   13.436  1.00 0.00 ? 392 TYR A H2   3  
ATOM 4069  H H3   . TYR A 1 1   ? 3.079   8.728   14.150  1.00 0.00 ? 392 TYR A H3   3  
ATOM 4070  H HA   . TYR A 1 1   ? 3.860   8.044   16.093  1.00 0.00 ? 392 TYR A HA   3  
ATOM 4071  H HB2  . TYR A 1 1   ? 3.068   5.661   16.735  1.00 0.00 ? 392 TYR A HB2  3  
ATOM 4072  H HB3  . TYR A 1 1   ? 1.849   6.862   16.334  1.00 0.00 ? 392 TYR A HB3  3  
ATOM 4073  H HD1  . TYR A 1 1   ? 3.959   4.922   13.962  1.00 0.00 ? 392 TYR A HD1  3  
ATOM 4074  H HD2  . TYR A 1 1   ? 0.076   5.518   15.592  1.00 0.00 ? 392 TYR A HD2  3  
ATOM 4075  H HE1  . TYR A 1 1   ? 3.031   3.409   12.272  1.00 0.00 ? 392 TYR A HE1  3  
ATOM 4076  H HE2  . TYR A 1 1   ? -0.865  4.006   13.903  1.00 0.00 ? 392 TYR A HE2  3  
ATOM 4077  H HH   . TYR A 1 1   ? 1.210   2.200   11.696  1.00 0.00 ? 392 TYR A HH   3  
ATOM 4078  N N    . VAL A 1 2   ? 5.239   5.393   16.114  1.00 0.00 ? 393 VAL A N    3  
ATOM 4079  C CA   . VAL A 1 2   ? 6.468   4.606   16.112  1.00 0.00 ? 393 VAL A CA   3  
ATOM 4080  C C    . VAL A 1 2   ? 6.642   3.909   14.765  1.00 0.00 ? 393 VAL A C    3  
ATOM 4081  O O    . VAL A 1 2   ? 5.668   3.456   14.166  1.00 0.00 ? 393 VAL A O    3  
ATOM 4082  C CB   . VAL A 1 2   ? 6.479   3.556   17.245  1.00 0.00 ? 393 VAL A CB   3  
ATOM 4083  C CG1  . VAL A 1 2   ? 6.713   4.226   18.591  1.00 0.00 ? 393 VAL A CG1  3  
ATOM 4084  C CG2  . VAL A 1 2   ? 5.181   2.759   17.262  1.00 0.00 ? 393 VAL A CG2  3  
ATOM 4085  H H    . VAL A 1 2   ? 4.495   5.113   16.686  1.00 0.00 ? 393 VAL A H    3  
ATOM 4086  H HA   . VAL A 1 2   ? 7.296   5.282   16.266  1.00 0.00 ? 393 VAL A HA   3  
ATOM 4087  H HB   . VAL A 1 2   ? 7.295   2.871   17.065  1.00 0.00 ? 393 VAL A HB   3  
ATOM 4088  H HG11 . VAL A 1 2   ? 7.669   4.729   18.580  1.00 0.00 ? 393 VAL A HG11 3  
ATOM 4089  H HG12 . VAL A 1 2   ? 6.707   3.480   19.371  1.00 0.00 ? 393 VAL A HG12 3  
ATOM 4090  H HG13 . VAL A 1 2   ? 5.929   4.946   18.775  1.00 0.00 ? 393 VAL A HG13 3  
ATOM 4091  H HG21 . VAL A 1 2   ? 5.228   2.011   18.041  1.00 0.00 ? 393 VAL A HG21 3  
ATOM 4092  H HG22 . VAL A 1 2   ? 5.043   2.275   16.307  1.00 0.00 ? 393 VAL A HG22 3  
ATOM 4093  H HG23 . VAL A 1 2   ? 4.352   3.424   17.452  1.00 0.00 ? 393 VAL A HG23 3  
ATOM 4094  N N    . GLY A 1 3   ? 7.877   3.833   14.289  1.00 0.00 ? 394 GLY A N    3  
ATOM 4095  C CA   . GLY A 1 3   ? 8.132   3.214   13.002  1.00 0.00 ? 394 GLY A CA   3  
ATOM 4096  C C    . GLY A 1 3   ? 7.870   4.194   11.878  1.00 0.00 ? 394 GLY A C    3  
ATOM 4097  O O    . GLY A 1 3   ? 8.795   4.628   11.187  1.00 0.00 ? 394 GLY A O    3  
ATOM 4098  H H    . GLY A 1 3   ? 8.617   4.207   14.806  1.00 0.00 ? 394 GLY A H    3  
ATOM 4099  H HA2  . GLY A 1 3   ? 9.161   2.890   12.961  1.00 0.00 ? 394 GLY A HA2  3  
ATOM 4100  H HA3  . GLY A 1 3   ? 7.483   2.359   12.883  1.00 0.00 ? 394 GLY A HA3  3  
ATOM 4101  N N    . GLU A 1 4   ? 6.609   4.556   11.709  1.00 0.00 ? 395 GLU A N    3  
ATOM 4102  C CA   . GLU A 1 4   ? 6.224   5.517   10.698  1.00 0.00 ? 395 GLU A CA   3  
ATOM 4103  C C    . GLU A 1 4   ? 5.836   6.822   11.380  1.00 0.00 ? 395 GLU A C    3  
ATOM 4104  O O    . GLU A 1 4   ? 4.715   6.992   11.854  1.00 0.00 ? 395 GLU A O    3  
ATOM 4105  C CB   . GLU A 1 4   ? 5.085   4.988   9.827   1.00 0.00 ? 395 GLU A CB   3  
ATOM 4106  C CG   . GLU A 1 4   ? 4.881   5.789   8.549   1.00 0.00 ? 395 GLU A CG   3  
ATOM 4107  C CD   . GLU A 1 4   ? 6.171   6.335   7.977   1.00 0.00 ? 395 GLU A CD   3  
ATOM 4108  O OE1  . GLU A 1 4   ? 6.626   7.399   8.445   1.00 0.00 ? 395 GLU A OE1  3  
ATOM 4109  O OE2  . GLU A 1 4   ? 6.738   5.701   7.071   1.00 0.00 ? 395 GLU A OE2  3  
ATOM 4110  H H    . GLU A 1 4   ? 5.918   4.166   12.288  1.00 0.00 ? 395 GLU A H    3  
ATOM 4111  H HA   . GLU A 1 4   ? 7.089   5.699   10.074  1.00 0.00 ? 395 GLU A HA   3  
ATOM 4112  H HB2  . GLU A 1 4   ? 5.297   3.964   9.556   1.00 0.00 ? 395 GLU A HB2  3  
ATOM 4113  H HB3  . GLU A 1 4   ? 4.168   5.018   10.396  1.00 0.00 ? 395 GLU A HB3  3  
ATOM 4114  H HG2  . GLU A 1 4   ? 4.427   5.150   7.808   1.00 0.00 ? 395 GLU A HG2  3  
ATOM 4115  H HG3  . GLU A 1 4   ? 4.223   6.617   8.760   1.00 0.00 ? 395 GLU A HG3  3  
ATOM 4116  N N    . ASP A 1 5   ? 6.798   7.722   11.443  1.00 0.00 ? 396 ASP A N    3  
ATOM 4117  C CA   . ASP A 1 5   ? 6.635   9.016   12.085  1.00 0.00 ? 396 ASP A CA   3  
ATOM 4118  C C    . ASP A 1 5   ? 6.330   10.121  11.089  1.00 0.00 ? 396 ASP A C    3  
ATOM 4119  O O    . ASP A 1 5   ? 6.703   11.266  11.337  1.00 0.00 ? 396 ASP A O    3  
ATOM 4120  C CB   . ASP A 1 5   ? 7.929   9.387   12.811  1.00 0.00 ? 396 ASP A CB   3  
ATOM 4121  C CG   . ASP A 1 5   ? 9.123   9.428   11.869  1.00 0.00 ? 396 ASP A CG   3  
ATOM 4122  O OD1  . ASP A 1 5   ? 9.741   10.506  11.737  1.00 0.00 ? 396 ASP A OD1  3  
ATOM 4123  O OD2  . ASP A 1 5   ? 9.432   8.388   11.239  1.00 0.00 ? 396 ASP A OD2  3  
ATOM 4124  H H    . ASP A 1 5   ? 7.667   7.510   11.044  1.00 0.00 ? 396 ASP A H    3  
ATOM 4125  H HA   . ASP A 1 5   ? 5.832   8.942   12.803  1.00 0.00 ? 396 ASP A HA   3  
ATOM 4126  H HB2  . ASP A 1 5   ? 7.813   10.367  13.252  1.00 0.00 ? 396 ASP A HB2  3  
ATOM 4127  H HB3  . ASP A 1 5   ? 8.124   8.665   13.584  1.00 0.00 ? 396 ASP A HB3  3  
ATOM 4128  N N    . ASP A 1 6   ? 5.671   9.789   9.973   1.00 0.00 ? 397 ASP A N    3  
ATOM 4129  C CA   . ASP A 1 6   ? 5.357   10.785  8.937   1.00 0.00 ? 397 ASP A CA   3  
ATOM 4130  C C    . ASP A 1 6   ? 4.898   12.114  9.528   1.00 0.00 ? 397 ASP A C    3  
ATOM 4131  O O    . ASP A 1 6   ? 5.326   13.171  9.062   1.00 0.00 ? 397 ASP A O    3  
ATOM 4132  C CB   . ASP A 1 6   ? 4.323   10.282  7.934   1.00 0.00 ? 397 ASP A CB   3  
ATOM 4133  C CG   . ASP A 1 6   ? 4.307   11.160  6.694   1.00 0.00 ? 397 ASP A CG   3  
ATOM 4134  O OD1  . ASP A 1 6   ? 3.476   12.092  6.628   1.00 0.00 ? 397 ASP A OD1  3  
ATOM 4135  O OD2  . ASP A 1 6   ? 5.154   10.943  5.800   1.00 0.00 ? 397 ASP A OD2  3  
ATOM 4136  H H    . ASP A 1 6   ? 5.406   8.854   9.835   1.00 0.00 ? 397 ASP A H    3  
ATOM 4137  H HA   . ASP A 1 6   ? 6.276   10.970  8.404   1.00 0.00 ? 397 ASP A HA   3  
ATOM 4138  H HB2  . ASP A 1 6   ? 4.566   9.271   7.643   1.00 0.00 ? 397 ASP A HB2  3  
ATOM 4139  H HB3  . ASP A 1 6   ? 3.343   10.304  8.386   1.00 0.00 ? 397 ASP A HB3  3  
ATOM 4140  N N    . GLU A 1 7   ? 4.040   12.067  10.548  1.00 0.00 ? 398 GLU A N    3  
ATOM 4141  C CA   . GLU A 1 7   ? 3.585   13.288  11.209  1.00 0.00 ? 398 GLU A CA   3  
ATOM 4142  C C    . GLU A 1 7   ? 2.517   13.010  12.272  1.00 0.00 ? 398 GLU A C    3  
ATOM 4143  O O    . GLU A 1 7   ? 2.833   12.664  13.410  1.00 0.00 ? 398 GLU A O    3  
ATOM 4144  C CB   . GLU A 1 7   ? 3.047   14.297  10.194  1.00 0.00 ? 398 GLU A CB   3  
ATOM 4145  C CG   . GLU A 1 7   ? 3.500   15.721  10.462  1.00 0.00 ? 398 GLU A CG   3  
ATOM 4146  C CD   . GLU A 1 7   ? 2.718   16.733  9.655   1.00 0.00 ? 398 GLU A CD   3  
ATOM 4147  O OE1  . GLU A 1 7   ? 1.655   17.183  10.134  1.00 0.00 ? 398 GLU A OE1  3  
ATOM 4148  O OE2  . GLU A 1 7   ? 3.158   17.069  8.535   1.00 0.00 ? 398 GLU A OE2  3  
ATOM 4149  H H    . GLU A 1 7   ? 3.714   11.199  10.859  1.00 0.00 ? 398 GLU A H    3  
ATOM 4150  H HA   . GLU A 1 7   ? 4.448   13.721  11.694  1.00 0.00 ? 398 GLU A HA   3  
ATOM 4151  H HB2  . GLU A 1 7   ? 3.396   14.015  9.209   1.00 0.00 ? 398 GLU A HB2  3  
ATOM 4152  H HB3  . GLU A 1 7   ? 1.972   14.272  10.209  1.00 0.00 ? 398 GLU A HB3  3  
ATOM 4153  H HG2  . GLU A 1 7   ? 3.370   15.935  11.511  1.00 0.00 ? 398 GLU A HG2  3  
ATOM 4154  H HG3  . GLU A 1 7   ? 4.546   15.805  10.204  1.00 0.00 ? 398 GLU A HG3  3  
ATOM 4155  N N    . GLU A 1 8   ? 1.259   13.157  11.880  1.00 0.00 ? 399 GLU A N    3  
ATOM 4156  C CA   . GLU A 1 8   ? 0.124   12.973  12.778  1.00 0.00 ? 399 GLU A CA   3  
ATOM 4157  C C    . GLU A 1 8   ? -0.746  11.827  12.304  1.00 0.00 ? 399 GLU A C    3  
ATOM 4158  O O    . GLU A 1 8   ? -1.567  11.989  11.410  1.00 0.00 ? 399 GLU A O    3  
ATOM 4159  C CB   . GLU A 1 8   ? -0.678  14.262  12.818  1.00 0.00 ? 399 GLU A CB   3  
ATOM 4160  C CG   . GLU A 1 8   ? -1.768  14.288  13.862  1.00 0.00 ? 399 GLU A CG   3  
ATOM 4161  C CD   . GLU A 1 8   ? -2.611  15.542  13.758  1.00 0.00 ? 399 GLU A CD   3  
ATOM 4162  O OE1  . GLU A 1 8   ? -3.800  15.491  14.124  1.00 0.00 ? 399 GLU A OE1  3  
ATOM 4163  O OE2  . GLU A 1 8   ? -2.088  16.569  13.267  1.00 0.00 ? 399 GLU A OE2  3  
ATOM 4164  H H    . GLU A 1 8   ? 1.083   13.386  10.944  1.00 0.00 ? 399 GLU A H    3  
ATOM 4165  H HA   . GLU A 1 8   ? 0.484   12.748  13.762  1.00 0.00 ? 399 GLU A HA   3  
ATOM 4166  H HB2  . GLU A 1 8   ? -0.004  15.081  13.015  1.00 0.00 ? 399 GLU A HB2  3  
ATOM 4167  H HB3  . GLU A 1 8   ? -1.135  14.412  11.851  1.00 0.00 ? 399 GLU A HB3  3  
ATOM 4168  H HG2  . GLU A 1 8   ? -2.406  13.426  13.717  1.00 0.00 ? 399 GLU A HG2  3  
ATOM 4169  H HG3  . GLU A 1 8   ? -1.319  14.246  14.841  1.00 0.00 ? 399 GLU A HG3  3  
ATOM 4170  N N    . ASP A 1 9   ? -0.576  10.676  12.916  1.00 0.00 ? 400 ASP A N    3  
ATOM 4171  C CA   . ASP A 1 9   ? -1.318  9.496   12.522  1.00 0.00 ? 400 ASP A CA   3  
ATOM 4172  C C    . ASP A 1 9   ? -1.860  8.726   13.724  1.00 0.00 ? 400 ASP A C    3  
ATOM 4173  O O    . ASP A 1 9   ? -1.182  7.877   14.298  1.00 0.00 ? 400 ASP A O    3  
ATOM 4174  C CB   . ASP A 1 9   ? -0.413  8.602   11.679  1.00 0.00 ? 400 ASP A CB   3  
ATOM 4175  C CG   . ASP A 1 9   ? 0.920   8.288   12.346  1.00 0.00 ? 400 ASP A CG   3  
ATOM 4176  O OD1  . ASP A 1 9   ? 1.663   9.231   12.697  1.00 0.00 ? 400 ASP A OD1  3  
ATOM 4177  O OD2  . ASP A 1 9   ? 1.240   7.096   12.508  1.00 0.00 ? 400 ASP A OD2  3  
ATOM 4178  H H    . ASP A 1 9   ? 0.077   10.609  13.645  1.00 0.00 ? 400 ASP A H    3  
ATOM 4179  H HA   . ASP A 1 9   ? -2.151  9.822   11.912  1.00 0.00 ? 400 ASP A HA   3  
ATOM 4180  H HB2  . ASP A 1 9   ? -0.922  7.670   11.487  1.00 0.00 ? 400 ASP A HB2  3  
ATOM 4181  H HB3  . ASP A 1 9   ? -0.215  9.095   10.738  1.00 0.00 ? 400 ASP A HB3  3  
ATOM 4182  N N    . ASP A 1 10  ? -3.080  9.047   14.111  1.00 0.00 ? 401 ASP A N    3  
ATOM 4183  C CA   . ASP A 1 10  ? -3.719  8.386   15.253  1.00 0.00 ? 401 ASP A CA   3  
ATOM 4184  C C    . ASP A 1 10  ? -5.199  8.083   15.013  1.00 0.00 ? 401 ASP A C    3  
ATOM 4185  O O    . ASP A 1 10  ? -5.647  6.966   15.268  1.00 0.00 ? 401 ASP A O    3  
ATOM 4186  C CB   . ASP A 1 10  ? -3.537  9.217   16.533  1.00 0.00 ? 401 ASP A CB   3  
ATOM 4187  C CG   . ASP A 1 10  ? -4.228  10.572  16.474  1.00 0.00 ? 401 ASP A CG   3  
ATOM 4188  O OD1  . ASP A 1 10  ? -4.652  11.068  17.533  1.00 0.00 ? 401 ASP A OD1  3  
ATOM 4189  O OD2  . ASP A 1 10  ? -4.346  11.142  15.363  1.00 0.00 ? 401 ASP A OD2  3  
ATOM 4190  H H    . ASP A 1 10  ? -3.560  9.744   13.626  1.00 0.00 ? 401 ASP A H    3  
ATOM 4191  H HA   . ASP A 1 10  ? -3.217  7.436   15.378  1.00 0.00 ? 401 ASP A HA   3  
ATOM 4192  H HB2  . ASP A 1 10  ? -3.944  8.668   17.368  1.00 0.00 ? 401 ASP A HB2  3  
ATOM 4193  H HB3  . ASP A 1 10  ? -2.483  9.379   16.698  1.00 0.00 ? 401 ASP A HB3  3  
ATOM 4194  N N    . ASP A 1 11  ? -5.952  9.062   14.509  1.00 0.00 ? 402 ASP A N    3  
ATOM 4195  C CA   . ASP A 1 11  ? -7.385  8.882   14.231  1.00 0.00 ? 402 ASP A CA   3  
ATOM 4196  C C    . ASP A 1 11  ? -7.582  8.006   13.003  1.00 0.00 ? 402 ASP A C    3  
ATOM 4197  O O    . ASP A 1 11  ? -8.682  7.885   12.462  1.00 0.00 ? 402 ASP A O    3  
ATOM 4198  C CB   . ASP A 1 11  ? -8.085  10.232  14.023  1.00 0.00 ? 402 ASP A CB   3  
ATOM 4199  C CG   . ASP A 1 11  ? -7.409  11.110  12.983  1.00 0.00 ? 402 ASP A CG   3  
ATOM 4200  O OD1  . ASP A 1 11  ? -7.506  12.347  13.109  1.00 0.00 ? 402 ASP A OD1  3  
ATOM 4201  O OD2  . ASP A 1 11  ? -6.760  10.576  12.055  1.00 0.00 ? 402 ASP A OD2  3  
ATOM 4202  H H    . ASP A 1 11  ? -5.541  9.934   14.332  1.00 0.00 ? 402 ASP A H    3  
ATOM 4203  H HA   . ASP A 1 11  ? -7.827  8.387   15.083  1.00 0.00 ? 402 ASP A HA   3  
ATOM 4204  H HB2  . ASP A 1 11  ? -9.100  10.054  13.704  1.00 0.00 ? 402 ASP A HB2  3  
ATOM 4205  H HB3  . ASP A 1 11  ? -8.098  10.766  14.961  1.00 0.00 ? 402 ASP A HB3  3  
ATOM 4206  N N    . PHE A 1 12  ? -6.489  7.402   12.592  1.00 0.00 ? 403 PHE A N    3  
ATOM 4207  C CA   . PHE A 1 12  ? -6.428  6.530   11.462  1.00 0.00 ? 403 PHE A CA   3  
ATOM 4208  C C    . PHE A 1 12  ? -7.439  5.386   11.584  1.00 0.00 ? 403 PHE A C    3  
ATOM 4209  O O    . PHE A 1 12  ? -7.337  4.547   12.478  1.00 0.00 ? 403 PHE A O    3  
ATOM 4210  C CB   . PHE A 1 12  ? -5.019  5.992   11.416  1.00 0.00 ? 403 PHE A CB   3  
ATOM 4211  C CG   . PHE A 1 12  ? -4.225  6.416   10.242  1.00 0.00 ? 403 PHE A CG   3  
ATOM 4212  C CD1  . PHE A 1 12  ? -4.747  6.307   8.978   1.00 0.00 ? 403 PHE A CD1  3  
ATOM 4213  C CD2  . PHE A 1 12  ? -2.938  6.877   10.403  1.00 0.00 ? 403 PHE A CD2  3  
ATOM 4214  C CE1  . PHE A 1 12  ? -3.999  6.648   7.882   1.00 0.00 ? 403 PHE A CE1  3  
ATOM 4215  C CE2  . PHE A 1 12  ? -2.185  7.230   9.311   1.00 0.00 ? 403 PHE A CE2  3  
ATOM 4216  C CZ   . PHE A 1 12  ? -2.715  7.111   8.049   1.00 0.00 ? 403 PHE A CZ   3  
ATOM 4217  H H    . PHE A 1 12  ? -5.668  7.536   13.105  1.00 0.00 ? 403 PHE A H    3  
ATOM 4218  H HA   . PHE A 1 12  ? -6.622  7.095   10.569  1.00 0.00 ? 403 PHE A HA   3  
ATOM 4219  H HB2  . PHE A 1 12  ? -4.490  6.307   12.301  1.00 0.00 ? 403 PHE A HB2  3  
ATOM 4220  H HB3  . PHE A 1 12  ? -5.066  4.935   11.401  1.00 0.00 ? 403 PHE A HB3  3  
ATOM 4221  H HD1  . PHE A 1 12  ? -5.757  5.948   8.854   1.00 0.00 ? 403 PHE A HD1  3  
ATOM 4222  H HD2  . PHE A 1 12  ? -2.525  6.969   11.400  1.00 0.00 ? 403 PHE A HD2  3  
ATOM 4223  H HE1  . PHE A 1 12  ? -4.420  6.559   6.892   1.00 0.00 ? 403 PHE A HE1  3  
ATOM 4224  H HE2  . PHE A 1 12  ? -1.177  7.593   9.445   1.00 0.00 ? 403 PHE A HE2  3  
ATOM 4225  H HZ   . PHE A 1 12  ? -2.124  7.366   7.192   1.00 0.00 ? 403 PHE A HZ   3  
ATOM 4226  N N    . ASN A 1 13  ? -8.395  5.357   10.671  1.00 0.00 ? 404 ASN A N    3  
ATOM 4227  C CA   . ASN A 1 13  ? -9.436  4.331   10.664  1.00 0.00 ? 404 ASN A CA   3  
ATOM 4228  C C    . ASN A 1 13  ? -9.099  3.278   9.635   1.00 0.00 ? 404 ASN A C    3  
ATOM 4229  O O    . ASN A 1 13  ? -8.792  3.603   8.497   1.00 0.00 ? 404 ASN A O    3  
ATOM 4230  C CB   . ASN A 1 13  ? -10.801 4.951   10.353  1.00 0.00 ? 404 ASN A CB   3  
ATOM 4231  C CG   . ASN A 1 13  ? -11.532 5.423   11.595  1.00 0.00 ? 404 ASN A CG   3  
ATOM 4232  O OD1  . ASN A 1 13  ? -12.373 4.714   12.141  1.00 0.00 ? 404 ASN A OD1  3  
ATOM 4233  N ND2  . ASN A 1 13  ? -11.213 6.625   12.052  1.00 0.00 ? 404 ASN A ND2  3  
ATOM 4234  H H    . ASN A 1 13  ? -8.387  6.028   9.957   1.00 0.00 ? 404 ASN A H    3  
ATOM 4235  H HA   . ASN A 1 13  ? -9.463  3.867   11.638  1.00 0.00 ? 404 ASN A HA   3  
ATOM 4236  H HB2  . ASN A 1 13  ? -10.662 5.798   9.698   1.00 0.00 ? 404 ASN A HB2  3  
ATOM 4237  H HB3  . ASN A 1 13  ? -11.416 4.215   9.854   1.00 0.00 ? 404 ASN A HB3  3  
ATOM 4238  H HD21 . ASN A 1 13  ? -10.526 7.139   11.574  1.00 0.00 ? 404 ASN A HD21 3  
ATOM 4239  H HD22 . ASN A 1 13  ? -11.671 6.950   12.852  1.00 0.00 ? 404 ASN A HD22 3  
ATOM 4240  N N    . GLU A 1 14  ? -9.164  2.022   10.027  1.00 0.00 ? 405 GLU A N    3  
ATOM 4241  C CA   . GLU A 1 14  ? -8.812  0.940   9.128   1.00 0.00 ? 405 GLU A CA   3  
ATOM 4242  C C    . GLU A 1 14  ? -9.942  0.574   8.169   1.00 0.00 ? 405 GLU A C    3  
ATOM 4243  O O    . GLU A 1 14  ? -9.830  0.811   6.969   1.00 0.00 ? 405 GLU A O    3  
ATOM 4244  C CB   . GLU A 1 14  ? -8.371  -0.281  9.928   1.00 0.00 ? 405 GLU A CB   3  
ATOM 4245  C CG   . GLU A 1 14  ? -7.133  -0.934  9.353   1.00 0.00 ? 405 GLU A CG   3  
ATOM 4246  C CD   . GLU A 1 14  ? -6.267  -1.593  10.405  1.00 0.00 ? 405 GLU A CD   3  
ATOM 4247  O OE1  . GLU A 1 14  ? -6.451  -2.793  10.668  1.00 0.00 ? 405 GLU A OE1  3  
ATOM 4248  O OE2  . GLU A 1 14  ? -5.385  -0.905  10.958  1.00 0.00 ? 405 GLU A OE2  3  
ATOM 4249  H H    . GLU A 1 14  ? -9.461  1.814   10.937  1.00 0.00 ? 405 GLU A H    3  
ATOM 4250  H HA   . GLU A 1 14  ? -7.975  1.276   8.540   1.00 0.00 ? 405 GLU A HA   3  
ATOM 4251  H HB2  . GLU A 1 14  ? -8.158  0.021   10.944  1.00 0.00 ? 405 GLU A HB2  3  
ATOM 4252  H HB3  . GLU A 1 14  ? -9.169  -1.008  9.934   1.00 0.00 ? 405 GLU A HB3  3  
ATOM 4253  H HG2  . GLU A 1 14  ? -7.438  -1.679  8.638   1.00 0.00 ? 405 GLU A HG2  3  
ATOM 4254  H HG3  . GLU A 1 14  ? -6.550  -0.173  8.854   1.00 0.00 ? 405 GLU A HG3  3  
ATOM 4255  N N    . ASN A 1 15  ? -11.005 -0.022  8.711   1.00 0.00 ? 406 ASN A N    3  
ATOM 4256  C CA   . ASN A 1 15  ? -12.174 -0.475  7.936   1.00 0.00 ? 406 ASN A CA   3  
ATOM 4257  C C    . ASN A 1 15  ? -11.899 -1.872  7.394   1.00 0.00 ? 406 ASN A C    3  
ATOM 4258  O O    . ASN A 1 15  ? -12.815 -2.655  7.146   1.00 0.00 ? 406 ASN A O    3  
ATOM 4259  C CB   . ASN A 1 15  ? -12.560 0.492   6.803   1.00 0.00 ? 406 ASN A CB   3  
ATOM 4260  C CG   . ASN A 1 15  ? -13.887 0.139   6.150   1.00 0.00 ? 406 ASN A CG   3  
ATOM 4261  O OD1  . ASN A 1 15  ? -14.092 0.389   4.959   1.00 0.00 ? 406 ASN A OD1  3  
ATOM 4262  N ND2  . ASN A 1 15  ? -14.802 -0.436  6.919   1.00 0.00 ? 406 ASN A ND2  3  
ATOM 4263  H H    . ASN A 1 15  ? -10.998 -0.198  9.683   1.00 0.00 ? 406 ASN A H    3  
ATOM 4264  H HA   . ASN A 1 15  ? -13.002 -0.544  8.629   1.00 0.00 ? 406 ASN A HA   3  
ATOM 4265  H HB2  . ASN A 1 15  ? -12.633 1.491   7.202   1.00 0.00 ? 406 ASN A HB2  3  
ATOM 4266  H HB3  . ASN A 1 15  ? -11.790 0.469   6.045   1.00 0.00 ? 406 ASN A HB3  3  
ATOM 4267  H HD21 . ASN A 1 15  ? -14.578 -0.605  7.861   1.00 0.00 ? 406 ASN A HD21 3  
ATOM 4268  H HD22 . ASN A 1 15  ? -15.660 -0.677  6.516   1.00 0.00 ? 406 ASN A HD22 3  
ATOM 4269  N N    . ASP A 1 16  ? -10.618 -2.166  7.195   1.00 0.00 ? 407 ASP A N    3  
ATOM 4270  C CA   . ASP A 1 16  ? -10.191 -3.484  6.753   1.00 0.00 ? 407 ASP A CA   3  
ATOM 4271  C C    . ASP A 1 16  ? -10.202 -4.384  7.980   1.00 0.00 ? 407 ASP A C    3  
ATOM 4272  O O    . ASP A 1 16  ? -10.535 -5.568  7.915   1.00 0.00 ? 407 ASP A O    3  
ATOM 4273  C CB   . ASP A 1 16  ? -8.788  -3.420  6.145   1.00 0.00 ? 407 ASP A CB   3  
ATOM 4274  C CG   . ASP A 1 16  ? -8.733  -3.894  4.704   1.00 0.00 ? 407 ASP A CG   3  
ATOM 4275  O OD1  . ASP A 1 16  ? -8.557  -5.112  4.479   1.00 0.00 ? 407 ASP A OD1  3  
ATOM 4276  O OD2  . ASP A 1 16  ? -8.839  -3.042  3.794   1.00 0.00 ? 407 ASP A OD2  3  
ATOM 4277  H H    . ASP A 1 16  ? -9.945  -1.471  7.343   1.00 0.00 ? 407 ASP A H    3  
ATOM 4278  H HA   . ASP A 1 16  ? -10.898 -3.853  6.024   1.00 0.00 ? 407 ASP A HA   3  
ATOM 4279  H HB2  . ASP A 1 16  ? -8.439  -2.399  6.177   1.00 0.00 ? 407 ASP A HB2  3  
ATOM 4280  H HB3  . ASP A 1 16  ? -8.123  -4.037  6.731   1.00 0.00 ? 407 ASP A HB3  3  
ATOM 4281  N N    . GLU A 1 17  ? -9.823  -3.769  9.104   1.00 0.00 ? 408 GLU A N    3  
ATOM 4282  C CA   . GLU A 1 17  ? -9.807  -4.398  10.416  1.00 0.00 ? 408 GLU A CA   3  
ATOM 4283  C C    . GLU A 1 17  ? -8.848  -5.576  10.493  1.00 0.00 ? 408 GLU A C    3  
ATOM 4284  O O    . GLU A 1 17  ? -7.919  -5.702  9.689   1.00 0.00 ? 408 GLU A O    3  
ATOM 4285  C CB   . GLU A 1 17  ? -11.223 -4.817  10.825  1.00 0.00 ? 408 GLU A CB   3  
ATOM 4286  C CG   . GLU A 1 17  ? -11.937 -3.782  11.687  1.00 0.00 ? 408 GLU A CG   3  
ATOM 4287  C CD   . GLU A 1 17  ? -12.114 -2.440  10.995  1.00 0.00 ? 408 GLU A CD   3  
ATOM 4288  O OE1  . GLU A 1 17  ? -13.204 -2.194  10.439  1.00 0.00 ? 408 GLU A OE1  3  
ATOM 4289  O OE2  . GLU A 1 17  ? -11.167 -1.622  11.014  1.00 0.00 ? 408 GLU A OE2  3  
ATOM 4290  H H    . GLU A 1 17  ? -9.516  -2.848  9.041   1.00 0.00 ? 408 GLU A H    3  
ATOM 4291  H HA   . GLU A 1 17  ? -9.466  -3.650  11.116  1.00 0.00 ? 408 GLU A HA   3  
ATOM 4292  H HB2  . GLU A 1 17  ? -11.809 -4.981  9.932   1.00 0.00 ? 408 GLU A HB2  3  
ATOM 4293  H HB3  . GLU A 1 17  ? -11.165 -5.741  11.381  1.00 0.00 ? 408 GLU A HB3  3  
ATOM 4294  H HG2  . GLU A 1 17  ? -12.913 -4.165  11.946  1.00 0.00 ? 408 GLU A HG2  3  
ATOM 4295  H HG3  . GLU A 1 17  ? -11.362 -3.632  12.589  1.00 0.00 ? 408 GLU A HG3  3  
ATOM 4296  N N    . ASP A 1 18  ? -9.074  -6.433  11.480  1.00 0.00 ? 409 ASP A N    3  
ATOM 4297  C CA   . ASP A 1 18  ? -8.226  -7.591  11.700  1.00 0.00 ? 409 ASP A CA   3  
ATOM 4298  C C    . ASP A 1 18  ? -8.509  -8.698  10.692  1.00 0.00 ? 409 ASP A C    3  
ATOM 4299  O O    . ASP A 1 18  ? -9.072  -9.739  11.027  1.00 0.00 ? 409 ASP A O    3  
ATOM 4300  C CB   . ASP A 1 18  ? -8.389  -8.119  13.126  1.00 0.00 ? 409 ASP A CB   3  
ATOM 4301  C CG   . ASP A 1 18  ? -7.278  -9.079  13.512  1.00 0.00 ? 409 ASP A CG   3  
ATOM 4302  O OD1  . ASP A 1 18  ? -6.227  -9.080  12.831  1.00 0.00 ? 409 ASP A OD1  3  
ATOM 4303  O OD2  . ASP A 1 18  ? -7.448  -9.822  14.496  1.00 0.00 ? 409 ASP A OD2  3  
ATOM 4304  H H    . ASP A 1 18  ? -9.836  -6.283  12.072  1.00 0.00 ? 409 ASP A H    3  
ATOM 4305  H HA   . ASP A 1 18  ? -7.204  -7.268  11.568  1.00 0.00 ? 409 ASP A HA   3  
ATOM 4306  H HB2  . ASP A 1 18  ? -8.378  -7.288  13.816  1.00 0.00 ? 409 ASP A HB2  3  
ATOM 4307  H HB3  . ASP A 1 18  ? -9.332  -8.638  13.205  1.00 0.00 ? 409 ASP A HB3  3  
ATOM 4308  N N    . ASP A 1 19  ? -8.142  -8.445  9.448   1.00 0.00 ? 410 ASP A N    3  
ATOM 4309  C CA   . ASP A 1 19  ? -8.303  -9.422  8.387   1.00 0.00 ? 410 ASP A CA   3  
ATOM 4310  C C    . ASP A 1 19  ? -6.955  -9.646  7.721   1.00 0.00 ? 410 ASP A C    3  
ATOM 4311  O O    . ASP A 1 19  ? -6.697  -9.036  6.669   1.00 0.00 ? 410 ASP A O    3  
ATOM 4312  C CB   . ASP A 1 19  ? -9.344  -8.960  7.360   1.00 0.00 ? 410 ASP A CB   3  
ATOM 4313  C CG   . ASP A 1 19  ? -9.578  -9.991  6.268   1.00 0.00 ? 410 ASP A CG   3  
ATOM 4314  O OD1  . ASP A 1 19  ? -9.583  -9.610  5.077   1.00 0.00 ? 410 ASP A OD1  3  
ATOM 4315  O OD2  . ASP A 1 19  ? -9.748  -11.186 6.598   1.00 0.00 ? 410 ASP A OD2  3  
ATOM 4316  O OXT  . ASP A 1 19  ? -6.128  -10.386 8.300   1.00 0.00 ? 410 ASP A OXT  3  
ATOM 4317  H H    . ASP A 1 19  ? -7.768  -7.562  9.231   1.00 0.00 ? 410 ASP A H    3  
ATOM 4318  H HA   . ASP A 1 19  ? -8.631  -10.347 8.837   1.00 0.00 ? 410 ASP A HA   3  
ATOM 4319  H HB2  . ASP A 1 19  ? -10.282 -8.778  7.865   1.00 0.00 ? 410 ASP A HB2  3  
ATOM 4320  H HB3  . ASP A 1 19  ? -9.004  -8.044  6.900   1.00 0.00 ? 410 ASP A HB3  3  
ATOM 4321  N N    . MET B 2 3   ? 1.814   -3.212  -17.599 1.00 0.00 ? 1   MET B N    3  
ATOM 4322  C CA   . MET B 2 3   ? 2.132   -3.059  -19.034 1.00 0.00 ? 1   MET B CA   3  
ATOM 4323  C C    . MET B 2 3   ? 2.011   -4.393  -19.767 1.00 0.00 ? 1   MET B C    3  
ATOM 4324  O O    . MET B 2 3   ? 2.498   -4.533  -20.888 1.00 0.00 ? 1   MET B O    3  
ATOM 4325  C CB   . MET B 2 3   ? 3.545   -2.482  -19.210 1.00 0.00 ? 1   MET B CB   3  
ATOM 4326  C CG   . MET B 2 3   ? 4.598   -3.106  -18.301 1.00 0.00 ? 1   MET B CG   3  
ATOM 4327  S SD   . MET B 2 3   ? 5.111   -4.750  -18.834 1.00 0.00 ? 1   MET B SD   3  
ATOM 4328  C CE   . MET B 2 3   ? 6.359   -5.134  -17.608 1.00 0.00 ? 1   MET B CE   3  
ATOM 4329  H H    . MET B 2 3   ? 2.059   -2.351  -17.076 1.00 0.00 ? 1   MET B H    3  
ATOM 4330  H HA   . MET B 2 3   ? 1.418   -2.369  -19.461 1.00 0.00 ? 1   MET B HA   3  
ATOM 4331  H HB2  . MET B 2 3   ? 3.854   -2.630  -20.233 1.00 0.00 ? 1   MET B HB2  3  
ATOM 4332  H HB3  . MET B 2 3   ? 3.512   -1.421  -19.006 1.00 0.00 ? 1   MET B HB3  3  
ATOM 4333  H HG2  . MET B 2 3   ? 5.465   -2.464  -18.287 1.00 0.00 ? 1   MET B HG2  3  
ATOM 4334  H HG3  . MET B 2 3   ? 4.190   -3.178  -17.303 1.00 0.00 ? 1   MET B HG3  3  
ATOM 4335  H HE1  . MET B 2 3   ? 5.920   -5.088  -16.621 1.00 0.00 ? 1   MET B HE1  3  
ATOM 4336  H HE2  . MET B 2 3   ? 7.163   -4.417  -17.676 1.00 0.00 ? 1   MET B HE2  3  
ATOM 4337  H HE3  . MET B 2 3   ? 6.744   -6.126  -17.784 1.00 0.00 ? 1   MET B HE3  3  
ATOM 4338  N N    . ALA B 2 4   ? 1.344   -5.363  -19.142 1.00 0.00 ? 2   ALA B N    3  
ATOM 4339  C CA   . ALA B 2 4   ? 1.184   -6.682  -19.740 1.00 0.00 ? 2   ALA B CA   3  
ATOM 4340  C C    . ALA B 2 4   ? 0.012   -7.423  -19.105 1.00 0.00 ? 2   ALA B C    3  
ATOM 4341  O O    . ALA B 2 4   ? -0.990  -6.816  -18.729 1.00 0.00 ? 2   ALA B O    3  
ATOM 4342  C CB   . ALA B 2 4   ? 2.472   -7.484  -19.589 1.00 0.00 ? 2   ALA B CB   3  
ATOM 4343  H H    . ALA B 2 4   ? 0.925   -5.184  -18.268 1.00 0.00 ? 2   ALA B H    3  
ATOM 4344  H HA   . ALA B 2 4   ? 0.989   -6.550  -20.795 1.00 0.00 ? 2   ALA B HA   3  
ATOM 4345  H HB1  . ALA B 2 4   ? 2.322   -8.481  -19.979 1.00 0.00 ? 2   ALA B HB1  3  
ATOM 4346  H HB2  . ALA B 2 4   ? 2.738   -7.542  -18.544 1.00 0.00 ? 2   ALA B HB2  3  
ATOM 4347  H HB3  . ALA B 2 4   ? 3.266   -6.998  -20.137 1.00 0.00 ? 2   ALA B HB3  3  
ATOM 4348  N N    . THR B 2 5   ? 0.136   -8.736  -18.996 1.00 0.00 ? 3   THR B N    3  
ATOM 4349  C CA   . THR B 2 5   ? -0.904  -9.553  -18.402 1.00 0.00 ? 3   THR B CA   3  
ATOM 4350  C C    . THR B 2 5   ? -0.804  -9.527  -16.880 1.00 0.00 ? 3   THR B C    3  
ATOM 4351  O O    . THR B 2 5   ? -0.280  -10.461 -16.272 1.00 0.00 ? 3   THR B O    3  
ATOM 4352  C CB   . THR B 2 5   ? -0.803  -11.004 -18.900 1.00 0.00 ? 3   THR B CB   3  
ATOM 4353  O OG1  . THR B 2 5   ? 0.557   -11.297 -19.250 1.00 0.00 ? 3   THR B OG1  3  
ATOM 4354  C CG2  . THR B 2 5   ? -1.704  -11.232 -20.105 1.00 0.00 ? 3   THR B CG2  3  
ATOM 4355  H H    . THR B 2 5   ? 0.949   -9.172  -19.326 1.00 0.00 ? 3   THR B H    3  
ATOM 4356  H HA   . THR B 2 5   ? -1.861  -9.153  -18.701 1.00 0.00 ? 3   THR B HA   3  
ATOM 4357  H HB   . THR B 2 5   ? -1.114  -11.666 -18.103 1.00 0.00 ? 3   THR B HB   3  
ATOM 4358  H HG1  . THR B 2 5   ? 1.033   -11.582 -18.462 1.00 0.00 ? 3   THR B HG1  3  
ATOM 4359  H HG21 . THR B 2 5   ? -2.728  -11.023 -19.835 1.00 0.00 ? 3   THR B HG21 3  
ATOM 4360  H HG22 . THR B 2 5   ? -1.621  -12.260 -20.426 1.00 0.00 ? 3   THR B HG22 3  
ATOM 4361  H HG23 . THR B 2 5   ? -1.402  -10.578 -20.908 1.00 0.00 ? 3   THR B HG23 3  
ATOM 4362  N N    . SER B 2 6   ? -1.286  -8.434  -16.284 1.00 0.00 ? 4   SER B N    3  
ATOM 4363  C CA   . SER B 2 6   ? -1.265  -8.257  -14.834 1.00 0.00 ? 4   SER B CA   3  
ATOM 4364  C C    . SER B 2 6   ? 0.173   -8.145  -14.331 1.00 0.00 ? 4   SER B C    3  
ATOM 4365  O O    . SER B 2 6   ? 0.601   -8.874  -13.437 1.00 0.00 ? 4   SER B O    3  
ATOM 4366  C CB   . SER B 2 6   ? -2.006  -9.405  -14.138 1.00 0.00 ? 4   SER B CB   3  
ATOM 4367  O OG   . SER B 2 6   ? -3.283  -9.605  -14.726 1.00 0.00 ? 4   SER B OG   3  
ATOM 4368  H H    . SER B 2 6   ? -1.642  -7.711  -16.844 1.00 0.00 ? 4   SER B H    3  
ATOM 4369  H HA   . SER B 2 6   ? -1.776  -7.330  -14.615 1.00 0.00 ? 4   SER B HA   3  
ATOM 4370  H HB2  . SER B 2 6   ? -1.431  -10.314 -14.234 1.00 0.00 ? 4   SER B HB2  3  
ATOM 4371  H HB3  . SER B 2 6   ? -2.135  -9.168  -13.093 1.00 0.00 ? 4   SER B HB3  3  
ATOM 4372  H HG   . SER B 2 6   ? -3.322  -9.136  -15.561 1.00 0.00 ? 4   SER B HG   3  
ATOM 4373  N N    . SER B 2 7   ? 0.917   -7.230  -14.935 1.00 0.00 ? 5   SER B N    3  
ATOM 4374  C CA   . SER B 2 7   ? 2.304   -6.987  -14.573 1.00 0.00 ? 5   SER B CA   3  
ATOM 4375  C C    . SER B 2 7   ? 2.626   -5.520  -14.815 1.00 0.00 ? 5   SER B C    3  
ATOM 4376  O O    . SER B 2 7   ? 2.761   -5.093  -15.968 1.00 0.00 ? 5   SER B O    3  
ATOM 4377  C CB   . SER B 2 7   ? 3.238   -7.878  -15.396 1.00 0.00 ? 5   SER B CB   3  
ATOM 4378  O OG   . SER B 2 7   ? 2.829   -9.235  -15.341 1.00 0.00 ? 5   SER B OG   3  
ATOM 4379  H H    . SER B 2 7   ? 0.511   -6.682  -15.649 1.00 0.00 ? 5   SER B H    3  
ATOM 4380  H HA   . SER B 2 7   ? 2.425   -7.209  -13.522 1.00 0.00 ? 5   SER B HA   3  
ATOM 4381  H HB2  . SER B 2 7   ? 3.227   -7.554  -16.426 1.00 0.00 ? 5   SER B HB2  3  
ATOM 4382  H HB3  . SER B 2 7   ? 4.242   -7.801  -15.005 1.00 0.00 ? 5   SER B HB3  3  
ATOM 4383  H HG   . SER B 2 7   ? 2.093   -9.322  -14.719 1.00 0.00 ? 5   SER B HG   3  
ATOM 4384  N N    . GLU B 2 8   ? 2.722   -4.753  -13.726 1.00 0.00 ? 6   GLU B N    3  
ATOM 4385  C CA   . GLU B 2 8   ? 2.992   -3.315  -13.791 1.00 0.00 ? 6   GLU B CA   3  
ATOM 4386  C C    . GLU B 2 8   ? 1.741   -2.611  -14.302 1.00 0.00 ? 6   GLU B C    3  
ATOM 4387  O O    . GLU B 2 8   ? 1.812   -1.650  -15.074 1.00 0.00 ? 6   GLU B O    3  
ATOM 4388  C CB   . GLU B 2 8   ? 4.192   -2.979  -14.697 1.00 0.00 ? 6   GLU B CB   3  
ATOM 4389  C CG   . GLU B 2 8   ? 5.477   -3.715  -14.347 1.00 0.00 ? 6   GLU B CG   3  
ATOM 4390  C CD   . GLU B 2 8   ? 5.993   -3.378  -12.965 1.00 0.00 ? 6   GLU B CD   3  
ATOM 4391  O OE1  . GLU B 2 8   ? 5.792   -2.237  -12.512 1.00 0.00 ? 6   GLU B OE1  3  
ATOM 4392  O OE2  . GLU B 2 8   ? 6.590   -4.267  -12.323 1.00 0.00 ? 6   GLU B OE2  3  
ATOM 4393  H H    . GLU B 2 8   ? 2.586   -5.169  -12.839 1.00 0.00 ? 6   GLU B H    3  
ATOM 4394  H HA   . GLU B 2 8   ? 3.196   -2.973  -12.786 1.00 0.00 ? 6   GLU B HA   3  
ATOM 4395  H HB2  . GLU B 2 8   ? 3.933   -3.225  -15.716 1.00 0.00 ? 6   GLU B HB2  3  
ATOM 4396  H HB3  . GLU B 2 8   ? 4.384   -1.918  -14.634 1.00 0.00 ? 6   GLU B HB3  3  
ATOM 4397  H HG2  . GLU B 2 8   ? 5.292   -4.777  -14.394 1.00 0.00 ? 6   GLU B HG2  3  
ATOM 4398  H HG3  . GLU B 2 8   ? 6.234   -3.451  -15.071 1.00 0.00 ? 6   GLU B HG3  3  
ATOM 4399  N N    . GLU B 2 9   ? 0.591   -3.126  -13.886 1.00 0.00 ? 7   GLU B N    3  
ATOM 4400  C CA   . GLU B 2 9   ? -0.694  -2.577  -14.284 1.00 0.00 ? 7   GLU B CA   3  
ATOM 4401  C C    . GLU B 2 9   ? -1.129  -1.494  -13.308 1.00 0.00 ? 7   GLU B C    3  
ATOM 4402  O O    . GLU B 2 9   ? -1.623  -1.794  -12.226 1.00 0.00 ? 7   GLU B O    3  
ATOM 4403  C CB   . GLU B 2 9   ? -1.748  -3.691  -14.330 1.00 0.00 ? 7   GLU B CB   3  
ATOM 4404  C CG   . GLU B 2 9   ? -2.106  -4.153  -15.735 1.00 0.00 ? 7   GLU B CG   3  
ATOM 4405  C CD   . GLU B 2 9   ? -0.906  -4.227  -16.654 1.00 0.00 ? 7   GLU B CD   3  
ATOM 4406  O OE1  . GLU B 2 9   ? -0.742  -3.324  -17.495 1.00 0.00 ? 7   GLU B OE1  3  
ATOM 4407  O OE2  . GLU B 2 9   ? -0.102  -5.175  -16.527 1.00 0.00 ? 7   GLU B OE2  3  
ATOM 4408  H H    . GLU B 2 9   ? 0.610   -3.901  -13.279 1.00 0.00 ? 7   GLU B H    3  
ATOM 4409  H HA   . GLU B 2 9   ? -0.588  -2.146  -15.268 1.00 0.00 ? 7   GLU B HA   3  
ATOM 4410  H HB2  . GLU B 2 9   ? -1.376  -4.543  -13.782 1.00 0.00 ? 7   GLU B HB2  3  
ATOM 4411  H HB3  . GLU B 2 9   ? -2.649  -3.335  -13.853 1.00 0.00 ? 7   GLU B HB3  3  
ATOM 4412  H HG2  . GLU B 2 9   ? -2.552  -5.135  -15.676 1.00 0.00 ? 7   GLU B HG2  3  
ATOM 4413  H HG3  . GLU B 2 9   ? -2.821  -3.460  -16.158 1.00 0.00 ? 7   GLU B HG3  3  
ATOM 4414  N N    . VAL B 2 10  ? -0.960  -0.239  -13.698 1.00 0.00 ? 8   VAL B N    3  
ATOM 4415  C CA   . VAL B 2 10  ? -1.332  0.879   -12.841 1.00 0.00 ? 8   VAL B CA   3  
ATOM 4416  C C    . VAL B 2 10  ? -2.821  1.155   -12.954 1.00 0.00 ? 8   VAL B C    3  
ATOM 4417  O O    . VAL B 2 10  ? -3.320  1.516   -14.018 1.00 0.00 ? 8   VAL B O    3  
ATOM 4418  C CB   . VAL B 2 10  ? -0.561  2.164   -13.205 1.00 0.00 ? 8   VAL B CB   3  
ATOM 4419  C CG1  . VAL B 2 10  ? -1.044  3.332   -12.360 1.00 0.00 ? 8   VAL B CG1  3  
ATOM 4420  C CG2  . VAL B 2 10  ? 0.937   1.963   -13.033 1.00 0.00 ? 8   VAL B CG2  3  
ATOM 4421  H H    . VAL B 2 10  ? -0.584  -0.061  -14.583 1.00 0.00 ? 8   VAL B H    3  
ATOM 4422  H HA   . VAL B 2 10  ? -1.098  0.618   -11.817 1.00 0.00 ? 8   VAL B HA   3  
ATOM 4423  H HB   . VAL B 2 10  ? -0.755  2.395   -14.242 1.00 0.00 ? 8   VAL B HB   3  
ATOM 4424  H HG11 . VAL B 2 10  ? -2.102  3.480   -12.525 1.00 0.00 ? 8   VAL B HG11 3  
ATOM 4425  H HG12 . VAL B 2 10  ? -0.508  4.226   -12.639 1.00 0.00 ? 8   VAL B HG12 3  
ATOM 4426  H HG13 . VAL B 2 10  ? -0.872  3.117   -11.316 1.00 0.00 ? 8   VAL B HG13 3  
ATOM 4427  H HG21 . VAL B 2 10  ? 1.452   2.882   -13.268 1.00 0.00 ? 8   VAL B HG21 3  
ATOM 4428  H HG22 . VAL B 2 10  ? 1.273   1.182   -13.699 1.00 0.00 ? 8   VAL B HG22 3  
ATOM 4429  H HG23 . VAL B 2 10  ? 1.148   1.683   -12.012 1.00 0.00 ? 8   VAL B HG23 3  
ATOM 4430  N N    . LEU B 2 11  ? -3.522  0.969   -11.851 1.00 0.00 ? 9   LEU B N    3  
ATOM 4431  C CA   . LEU B 2 11  ? -4.954  1.194   -11.818 1.00 0.00 ? 9   LEU B CA   3  
ATOM 4432  C C    . LEU B 2 11  ? -5.273  2.575   -11.259 1.00 0.00 ? 9   LEU B C    3  
ATOM 4433  O O    . LEU B 2 11  ? -6.280  3.182   -11.617 1.00 0.00 ? 9   LEU B O    3  
ATOM 4434  C CB   . LEU B 2 11  ? -5.650  0.123   -10.967 1.00 0.00 ? 9   LEU B CB   3  
ATOM 4435  C CG   . LEU B 2 11  ? -5.226  -1.325  -11.238 1.00 0.00 ? 9   LEU B CG   3  
ATOM 4436  C CD1  . LEU B 2 11  ? -5.945  -2.272  -10.292 1.00 0.00 ? 9   LEU B CD1  3  
ATOM 4437  C CD2  . LEU B 2 11  ? -5.501  -1.707  -12.686 1.00 0.00 ? 9   LEU B CD2  3  
ATOM 4438  H H    . LEU B 2 11  ? -3.060  0.669   -11.034 1.00 0.00 ? 9   LEU B H    3  
ATOM 4439  H HA   . LEU B 2 11  ? -5.319  1.134   -12.829 1.00 0.00 ? 9   LEU B HA   3  
ATOM 4440  H HB2  . LEU B 2 11  ? -5.455  0.341   -9.927  1.00 0.00 ? 9   LEU B HB2  3  
ATOM 4441  H HB3  . LEU B 2 11  ? -6.714  0.198   -11.137 1.00 0.00 ? 9   LEU B HB3  3  
ATOM 4442  H HG   . LEU B 2 11  ? -4.164  -1.422  -11.061 1.00 0.00 ? 9   LEU B HG   3  
ATOM 4443  H HD11 . LEU B 2 11  ? -5.605  -3.282  -10.466 1.00 0.00 ? 9   LEU B HD11 3  
ATOM 4444  H HD12 . LEU B 2 11  ? -7.011  -2.215  -10.466 1.00 0.00 ? 9   LEU B HD12 3  
ATOM 4445  H HD13 . LEU B 2 11  ? -5.732  -1.991  -9.271  1.00 0.00 ? 9   LEU B HD13 3  
ATOM 4446  H HD21 . LEU B 2 11  ? -5.149  -2.713  -12.865 1.00 0.00 ? 9   LEU B HD21 3  
ATOM 4447  H HD22 . LEU B 2 11  ? -4.987  -1.024  -13.344 1.00 0.00 ? 9   LEU B HD22 3  
ATOM 4448  H HD23 . LEU B 2 11  ? -6.564  -1.659  -12.875 1.00 0.00 ? 9   LEU B HD23 3  
ATOM 4449  N N    . LEU B 2 12  ? -4.412  3.070   -10.379 1.00 0.00 ? 10  LEU B N    3  
ATOM 4450  C CA   . LEU B 2 12  ? -4.629  4.369   -9.766  1.00 0.00 ? 10  LEU B CA   3  
ATOM 4451  C C    . LEU B 2 12  ? -3.345  5.173   -9.644  1.00 0.00 ? 10  LEU B C    3  
ATOM 4452  O O    . LEU B 2 12  ? -2.284  4.631   -9.333  1.00 0.00 ? 10  LEU B O    3  
ATOM 4453  C CB   . LEU B 2 12  ? -5.231  4.180   -8.380  1.00 0.00 ? 10  LEU B CB   3  
ATOM 4454  C CG   . LEU B 2 12  ? -5.695  5.469   -7.691  1.00 0.00 ? 10  LEU B CG   3  
ATOM 4455  C CD1  . LEU B 2 12  ? -7.120  5.819   -8.064  1.00 0.00 ? 10  LEU B CD1  3  
ATOM 4456  C CD2  . LEU B 2 12  ? -5.573  5.343   -6.188  1.00 0.00 ? 10  LEU B CD2  3  
ATOM 4457  H H    . LEU B 2 12  ? -3.623  2.547   -10.130 1.00 0.00 ? 10  LEU B H    3  
ATOM 4458  H HA   . LEU B 2 12  ? -5.328  4.917   -10.375 1.00 0.00 ? 10  LEU B HA   3  
ATOM 4459  H HB2  . LEU B 2 12  ? -6.067  3.509   -8.473  1.00 0.00 ? 10  LEU B HB2  3  
ATOM 4460  H HB3  . LEU B 2 12  ? -4.487  3.713   -7.752  1.00 0.00 ? 10  LEU B HB3  3  
ATOM 4461  H HG   . LEU B 2 12  ? -5.060  6.281   -8.009  1.00 0.00 ? 10  LEU B HG   3  
ATOM 4462  H HD11 . LEU B 2 12  ? -7.422  6.705   -7.524  1.00 0.00 ? 10  LEU B HD11 3  
ATOM 4463  H HD12 . LEU B 2 12  ? -7.772  5.000   -7.800  1.00 0.00 ? 10  LEU B HD12 3  
ATOM 4464  H HD13 . LEU B 2 12  ? -7.181  6.005   -9.123  1.00 0.00 ? 10  LEU B HD13 3  
ATOM 4465  H HD21 . LEU B 2 12  ? -4.544  5.147   -5.925  1.00 0.00 ? 10  LEU B HD21 3  
ATOM 4466  H HD22 . LEU B 2 12  ? -6.195  4.529   -5.844  1.00 0.00 ? 10  LEU B HD22 3  
ATOM 4467  H HD23 . LEU B 2 12  ? -5.894  6.263   -5.722  1.00 0.00 ? 10  LEU B HD23 3  
ATOM 4468  N N    . ILE B 2 13  ? -3.457  6.469   -9.896  1.00 0.00 ? 11  ILE B N    3  
ATOM 4469  C CA   . ILE B 2 13  ? -2.335  7.382   -9.773  1.00 0.00 ? 11  ILE B CA   3  
ATOM 4470  C C    . ILE B 2 13  ? -2.707  8.474   -8.789  1.00 0.00 ? 11  ILE B C    3  
ATOM 4471  O O    . ILE B 2 13  ? -3.697  9.180   -8.980  1.00 0.00 ? 11  ILE B O    3  
ATOM 4472  C CB   . ILE B 2 13  ? -1.936  8.041   -11.108 1.00 0.00 ? 11  ILE B CB   3  
ATOM 4473  C CG1  . ILE B 2 13  ? -1.548  6.975   -12.138 1.00 0.00 ? 11  ILE B CG1  3  
ATOM 4474  C CG2  . ILE B 2 13  ? -0.786  9.020   -10.878 1.00 0.00 ? 11  ILE B CG2  3  
ATOM 4475  C CD1  . ILE B 2 13  ? -1.265  7.534   -13.515 1.00 0.00 ? 11  ILE B CD1  3  
ATOM 4476  H H    . ILE B 2 13  ? -4.328  6.826   -10.168 1.00 0.00 ? 11  ILE B H    3  
ATOM 4477  H HA   . ILE B 2 13  ? -1.488  6.831   -9.389  1.00 0.00 ? 11  ILE B HA   3  
ATOM 4478  H HB   . ILE B 2 13  ? -2.784  8.598   -11.477 1.00 0.00 ? 11  ILE B HB   3  
ATOM 4479  H HG12 . ILE B 2 13  ? -0.658  6.465   -11.799 1.00 0.00 ? 11  ILE B HG12 3  
ATOM 4480  H HG13 . ILE B 2 13  ? -2.354  6.261   -12.227 1.00 0.00 ? 11  ILE B HG13 3  
ATOM 4481  H HG21 . ILE B 2 13  ? -1.073  9.740   -10.124 1.00 0.00 ? 11  ILE B HG21 3  
ATOM 4482  H HG22 . ILE B 2 13  ? -0.558  9.537   -11.798 1.00 0.00 ? 11  ILE B HG22 3  
ATOM 4483  H HG23 . ILE B 2 13  ? 0.088   8.479   -10.542 1.00 0.00 ? 11  ILE B HG23 3  
ATOM 4484  H HD11 . ILE B 2 13  ? -0.449  8.239   -13.454 1.00 0.00 ? 11  ILE B HD11 3  
ATOM 4485  H HD12 . ILE B 2 13  ? -2.146  8.033   -13.888 1.00 0.00 ? 11  ILE B HD12 3  
ATOM 4486  H HD13 . ILE B 2 13  ? -0.995  6.728   -14.182 1.00 0.00 ? 11  ILE B HD13 3  
ATOM 4487  N N    . VAL B 2 14  ? -1.923  8.603   -7.743  1.00 0.00 ? 12  VAL B N    3  
ATOM 4488  C CA   . VAL B 2 14  ? -2.176  9.592   -6.724  1.00 0.00 ? 12  VAL B CA   3  
ATOM 4489  C C    . VAL B 2 14  ? -1.096  10.653  -6.755  1.00 0.00 ? 12  VAL B C    3  
ATOM 4490  O O    . VAL B 2 14  ? 0.054   10.374  -7.086  1.00 0.00 ? 12  VAL B O    3  
ATOM 4491  C CB   . VAL B 2 14  ? -2.229  8.954   -5.330  1.00 0.00 ? 12  VAL B CB   3  
ATOM 4492  C CG1  . VAL B 2 14  ? -2.896  9.882   -4.339  1.00 0.00 ? 12  VAL B CG1  3  
ATOM 4493  C CG2  . VAL B 2 14  ? -2.953  7.621   -5.384  1.00 0.00 ? 12  VAL B CG2  3  
ATOM 4494  H H    . VAL B 2 14  ? -1.126  8.028   -7.660  1.00 0.00 ? 12  VAL B H    3  
ATOM 4495  H HA   . VAL B 2 14  ? -3.130  10.051  -6.926  1.00 0.00 ? 12  VAL B HA   3  
ATOM 4496  H HB   . VAL B 2 14  ? -1.218  8.782   -5.000  1.00 0.00 ? 12  VAL B HB   3  
ATOM 4497  H HG11 . VAL B 2 14  ? -2.370  10.825  -4.315  1.00 0.00 ? 12  VAL B HG11 3  
ATOM 4498  H HG12 . VAL B 2 14  ? -2.879  9.434   -3.356  1.00 0.00 ? 12  VAL B HG12 3  
ATOM 4499  H HG13 . VAL B 2 14  ? -3.921  10.050  -4.638  1.00 0.00 ? 12  VAL B HG13 3  
ATOM 4500  H HG21 . VAL B 2 14  ? -3.952  7.770   -5.767  1.00 0.00 ? 12  VAL B HG21 3  
ATOM 4501  H HG22 . VAL B 2 14  ? -3.006  7.200   -4.391  1.00 0.00 ? 12  VAL B HG22 3  
ATOM 4502  H HG23 . VAL B 2 14  ? -2.416  6.946   -6.035  1.00 0.00 ? 12  VAL B HG23 3  
ATOM 4503  N N    . LYS B 2 15  ? -1.472  11.861  -6.410  1.00 0.00 ? 13  LYS B N    3  
ATOM 4504  C CA   . LYS B 2 15  ? -0.542  12.972  -6.411  1.00 0.00 ? 13  LYS B CA   3  
ATOM 4505  C C    . LYS B 2 15  ? -0.229  13.386  -4.991  1.00 0.00 ? 13  LYS B C    3  
ATOM 4506  O O    . LYS B 2 15  ? -0.842  12.877  -4.061  1.00 0.00 ? 13  LYS B O    3  
ATOM 4507  C CB   . LYS B 2 15  ? -1.114  14.163  -7.185  1.00 0.00 ? 13  LYS B CB   3  
ATOM 4508  C CG   . LYS B 2 15  ? -1.080  13.996  -8.699  1.00 0.00 ? 13  LYS B CG   3  
ATOM 4509  C CD   . LYS B 2 15  ? -2.063  12.936  -9.180  1.00 0.00 ? 13  LYS B CD   3  
ATOM 4510  C CE   . LYS B 2 15  ? -3.472  13.488  -9.335  1.00 0.00 ? 13  LYS B CE   3  
ATOM 4511  N NZ   . LYS B 2 15  ? -4.112  13.832  -8.029  1.00 0.00 ? 13  LYS B NZ   3  
ATOM 4512  H H    . LYS B 2 15  ? -2.403  12.005  -6.117  1.00 0.00 ? 13  LYS B H    3  
ATOM 4513  H HA   . LYS B 2 15  ? 0.369   12.644  -6.889  1.00 0.00 ? 13  LYS B HA   3  
ATOM 4514  H HB2  . LYS B 2 15  ? -2.141  14.310  -6.887  1.00 0.00 ? 13  LYS B HB2  3  
ATOM 4515  H HB3  . LYS B 2 15  ? -0.547  15.047  -6.931  1.00 0.00 ? 13  LYS B HB3  3  
ATOM 4516  H HG2  . LYS B 2 15  ? -1.333  14.939  -9.160  1.00 0.00 ? 13  LYS B HG2  3  
ATOM 4517  H HG3  . LYS B 2 15  ? -0.082  13.707  -8.994  1.00 0.00 ? 13  LYS B HG3  3  
ATOM 4518  H HD2  . LYS B 2 15  ? -1.731  12.562  -10.135 1.00 0.00 ? 13  LYS B HD2  3  
ATOM 4519  H HD3  . LYS B 2 15  ? -2.081  12.128  -8.462  1.00 0.00 ? 13  LYS B HD3  3  
ATOM 4520  H HE2  . LYS B 2 15  ? -3.423  14.375  -9.945  1.00 0.00 ? 13  LYS B HE2  3  
ATOM 4521  H HE3  . LYS B 2 15  ? -4.072  12.742  -9.836  1.00 0.00 ? 13  LYS B HE3  3  
ATOM 4522  H HZ1  . LYS B 2 15  ? -4.066  13.012  -7.376  1.00 0.00 ? 13  LYS B HZ1  3  
ATOM 4523  H HZ2  . LYS B 2 15  ? -5.110  14.081  -8.169  1.00 0.00 ? 13  LYS B HZ2  3  
ATOM 4524  H HZ3  . LYS B 2 15  ? -3.628  14.638  -7.582  1.00 0.00 ? 13  LYS B HZ3  3  
ATOM 4525  N N    . LYS B 2 16  ? 0.691   14.346  -4.877  1.00 0.00 ? 14  LYS B N    3  
ATOM 4526  C CA   . LYS B 2 16  ? 1.165   14.906  -3.602  1.00 0.00 ? 14  LYS B CA   3  
ATOM 4527  C C    . LYS B 2 16  ? 0.856   14.024  -2.394  1.00 0.00 ? 14  LYS B C    3  
ATOM 4528  O O    . LYS B 2 16  ? -0.117  14.238  -1.674  1.00 0.00 ? 14  LYS B O    3  
ATOM 4529  C CB   . LYS B 2 16  ? 0.561   16.294  -3.393  1.00 0.00 ? 14  LYS B CB   3  
ATOM 4530  C CG   . LYS B 2 16  ? 1.349   17.410  -4.052  1.00 0.00 ? 14  LYS B CG   3  
ATOM 4531  C CD   . LYS B 2 16  ? 2.158   18.191  -3.032  1.00 0.00 ? 14  LYS B CD   3  
ATOM 4532  C CE   . LYS B 2 16  ? 3.495   18.629  -3.604  1.00 0.00 ? 14  LYS B CE   3  
ATOM 4533  N NZ   . LYS B 2 16  ? 4.315   17.469  -4.031  1.00 0.00 ? 14  LYS B NZ   3  
ATOM 4534  H H    . LYS B 2 16  ? 1.097   14.679  -5.698  1.00 0.00 ? 14  LYS B H    3  
ATOM 4535  H HA   . LYS B 2 16  ? 2.236   15.012  -3.677  1.00 0.00 ? 14  LYS B HA   3  
ATOM 4536  H HB2  . LYS B 2 16  ? -0.438  16.301  -3.802  1.00 0.00 ? 14  LYS B HB2  3  
ATOM 4537  H HB3  . LYS B 2 16  ? 0.508   16.496  -2.333  1.00 0.00 ? 14  LYS B HB3  3  
ATOM 4538  H HG2  . LYS B 2 16  ? 2.022   16.982  -4.781  1.00 0.00 ? 14  LYS B HG2  3  
ATOM 4539  H HG3  . LYS B 2 16  ? 0.661   18.082  -4.545  1.00 0.00 ? 14  LYS B HG3  3  
ATOM 4540  H HD2  . LYS B 2 16  ? 1.600   19.067  -2.737  1.00 0.00 ? 14  LYS B HD2  3  
ATOM 4541  H HD3  . LYS B 2 16  ? 2.333   17.565  -2.170  1.00 0.00 ? 14  LYS B HD3  3  
ATOM 4542  H HE2  . LYS B 2 16  ? 3.316   19.267  -4.457  1.00 0.00 ? 14  LYS B HE2  3  
ATOM 4543  H HE3  . LYS B 2 16  ? 4.032   19.182  -2.848  1.00 0.00 ? 14  LYS B HE3  3  
ATOM 4544  H HZ1  . LYS B 2 16  ? 4.266   16.705  -3.316  1.00 0.00 ? 14  LYS B HZ1  3  
ATOM 4545  H HZ2  . LYS B 2 16  ? 5.314   17.756  -4.152  1.00 0.00 ? 14  LYS B HZ2  3  
ATOM 4546  H HZ3  . LYS B 2 16  ? 3.974   17.098  -4.941  1.00 0.00 ? 14  LYS B HZ3  3  
ATOM 4547  N N    . VAL B 2 17  ? 1.679   13.008  -2.224  1.00 0.00 ? 15  VAL B N    3  
ATOM 4548  C CA   . VAL B 2 17  ? 1.561   12.081  -1.110  1.00 0.00 ? 15  VAL B CA   3  
ATOM 4549  C C    . VAL B 2 17  ? 2.922   11.923  -0.453  1.00 0.00 ? 15  VAL B C    3  
ATOM 4550  O O    . VAL B 2 17  ? 3.903   11.641  -1.131  1.00 0.00 ? 15  VAL B O    3  
ATOM 4551  C CB   . VAL B 2 17  ? 1.036   10.694  -1.557  1.00 0.00 ? 15  VAL B CB   3  
ATOM 4552  C CG1  . VAL B 2 17  ? 1.277   9.644   -0.482  1.00 0.00 ? 15  VAL B CG1  3  
ATOM 4553  C CG2  . VAL B 2 17  ? -0.443  10.761  -1.891  1.00 0.00 ? 15  VAL B CG2  3  
ATOM 4554  H H    . VAL B 2 17  ? 2.399   12.873  -2.882  1.00 0.00 ? 15  VAL B H    3  
ATOM 4555  H HA   . VAL B 2 17  ? 0.867   12.501  -0.394  1.00 0.00 ? 15  VAL B HA   3  
ATOM 4556  H HB   . VAL B 2 17  ? 1.571   10.397  -2.447  1.00 0.00 ? 15  VAL B HB   3  
ATOM 4557  H HG11 . VAL B 2 17  ? 0.912   8.687   -0.824  1.00 0.00 ? 15  VAL B HG11 3  
ATOM 4558  H HG12 . VAL B 2 17  ? 0.755   9.927   0.421   1.00 0.00 ? 15  VAL B HG12 3  
ATOM 4559  H HG13 . VAL B 2 17  ? 2.335   9.574   -0.279  1.00 0.00 ? 15  VAL B HG13 3  
ATOM 4560  H HG21 . VAL B 2 17  ? -0.995  11.077  -1.018  1.00 0.00 ? 15  VAL B HG21 3  
ATOM 4561  H HG22 . VAL B 2 17  ? -0.787  9.784   -2.202  1.00 0.00 ? 15  VAL B HG22 3  
ATOM 4562  H HG23 . VAL B 2 17  ? -0.599  11.469  -2.693  1.00 0.00 ? 15  VAL B HG23 3  
ATOM 4563  N N    . ARG B 2 18  ? 2.991   12.125  0.852   1.00 0.00 ? 16  ARG B N    3  
ATOM 4564  C CA   . ARG B 2 18  ? 4.246   11.997  1.562   1.00 0.00 ? 16  ARG B CA   3  
ATOM 4565  C C    . ARG B 2 18  ? 4.398   10.611  2.167   1.00 0.00 ? 16  ARG B C    3  
ATOM 4566  O O    . ARG B 2 18  ? 3.426   9.991   2.598   1.00 0.00 ? 16  ARG B O    3  
ATOM 4567  C CB   . ARG B 2 18  ? 4.375   13.032  2.680   1.00 0.00 ? 16  ARG B CB   3  
ATOM 4568  C CG   . ARG B 2 18  ? 3.866   14.418  2.329   1.00 0.00 ? 16  ARG B CG   3  
ATOM 4569  C CD   . ARG B 2 18  ? 4.161   15.401  3.452   1.00 0.00 ? 16  ARG B CD   3  
ATOM 4570  N NE   . ARG B 2 18  ? 4.098   14.757  4.767   1.00 0.00 ? 16  ARG B NE   3  
ATOM 4571  C CZ   . ARG B 2 18  ? 3.978   15.407  5.922   1.00 0.00 ? 16  ARG B CZ   3  
ATOM 4572  N NH1  . ARG B 2 18  ? 3.913   16.730  5.953   1.00 0.00 ? 16  ARG B NH1  3  
ATOM 4573  N NH2  . ARG B 2 18  ? 3.907   14.726  7.052   1.00 0.00 ? 16  ARG B NH2  3  
ATOM 4574  H H    . ARG B 2 18  ? 2.177   12.366  1.345   1.00 0.00 ? 16  ARG B H    3  
ATOM 4575  H HA   . ARG B 2 18  ? 5.043   12.152  0.851   1.00 0.00 ? 16  ARG B HA   3  
ATOM 4576  H HB2  . ARG B 2 18  ? 3.825   12.681  3.540   1.00 0.00 ? 16  ARG B HB2  3  
ATOM 4577  H HB3  . ARG B 2 18  ? 5.417   13.116  2.949   1.00 0.00 ? 16  ARG B HB3  3  
ATOM 4578  H HG2  . ARG B 2 18  ? 4.354   14.756  1.427   1.00 0.00 ? 16  ARG B HG2  3  
ATOM 4579  H HG3  . ARG B 2 18  ? 2.799   14.373  2.172   1.00 0.00 ? 16  ARG B HG3  3  
ATOM 4580  H HD2  . ARG B 2 18  ? 5.151   15.808  3.308   1.00 0.00 ? 16  ARG B HD2  3  
ATOM 4581  H HD3  . ARG B 2 18  ? 3.434   16.199  3.417   1.00 0.00 ? 16  ARG B HD3  3  
ATOM 4582  H HE   . ARG B 2 18  ? 4.135   13.771  4.787   1.00 0.00 ? 16  ARG B HE   3  
ATOM 4583  H HH11 . ARG B 2 18  ? 3.956   17.259  5.108   1.00 0.00 ? 16  ARG B HH11 3  
ATOM 4584  H HH12 . ARG B 2 18  ? 3.798   17.206  6.841   1.00 0.00 ? 16  ARG B HH12 3  
ATOM 4585  H HH21 . ARG B 2 18  ? 3.940   13.711  7.041   1.00 0.00 ? 16  ARG B HH21 3  
ATOM 4586  H HH22 . ARG B 2 18  ? 3.815   15.212  7.928   1.00 0.00 ? 16  ARG B HH22 3  
ATOM 4587  N N    . GLN B 2 19  ? 5.627   10.139  2.175   1.00 0.00 ? 17  GLN B N    3  
ATOM 4588  C CA   . GLN B 2 19  ? 5.974   8.856   2.749   1.00 0.00 ? 17  GLN B CA   3  
ATOM 4589  C C    . GLN B 2 19  ? 7.296   9.013   3.484   1.00 0.00 ? 17  GLN B C    3  
ATOM 4590  O O    . GLN B 2 19  ? 8.334   9.233   2.858   1.00 0.00 ? 17  GLN B O    3  
ATOM 4591  C CB   . GLN B 2 19  ? 6.090   7.784   1.662   1.00 0.00 ? 17  GLN B CB   3  
ATOM 4592  C CG   . GLN B 2 19  ? 5.770   6.368   2.131   1.00 0.00 ? 17  GLN B CG   3  
ATOM 4593  C CD   . GLN B 2 19  ? 6.539   5.957   3.372   1.00 0.00 ? 17  GLN B CD   3  
ATOM 4594  O OE1  . GLN B 2 19  ? 7.690   5.532   3.292   1.00 0.00 ? 17  GLN B OE1  3  
ATOM 4595  N NE2  . GLN B 2 19  ? 5.896   6.062   4.523   1.00 0.00 ? 17  GLN B NE2  3  
ATOM 4596  H H    . GLN B 2 19  ? 6.340   10.681  1.764   1.00 0.00 ? 17  GLN B H    3  
ATOM 4597  H HA   . GLN B 2 19  ? 5.203   8.578   3.454   1.00 0.00 ? 17  GLN B HA   3  
ATOM 4598  H HB2  . GLN B 2 19  ? 5.411   8.032   0.860   1.00 0.00 ? 17  GLN B HB2  3  
ATOM 4599  H HB3  . GLN B 2 19  ? 7.100   7.790   1.277   1.00 0.00 ? 17  GLN B HB3  3  
ATOM 4600  H HG2  . GLN B 2 19  ? 4.714   6.308   2.348   1.00 0.00 ? 17  GLN B HG2  3  
ATOM 4601  H HG3  . GLN B 2 19  ? 6.010   5.679   1.333   1.00 0.00 ? 17  GLN B HG3  3  
ATOM 4602  H HE21 . GLN B 2 19  ? 4.969   6.395   4.508   1.00 0.00 ? 17  GLN B HE21 3  
ATOM 4603  H HE22 . GLN B 2 19  ? 6.372   5.806   5.353   1.00 0.00 ? 17  GLN B HE22 3  
ATOM 4604  N N    . LYS B 2 20  ? 7.243   8.943   4.807   1.00 0.00 ? 18  LYS B N    3  
ATOM 4605  C CA   . LYS B 2 20  ? 8.427   9.087   5.643   1.00 0.00 ? 18  LYS B CA   3  
ATOM 4606  C C    . LYS B 2 20  ? 8.955   10.523  5.561   1.00 0.00 ? 18  LYS B C    3  
ATOM 4607  O O    . LYS B 2 20  ? 10.126  10.765  5.262   1.00 0.00 ? 18  LYS B O    3  
ATOM 4608  C CB   . LYS B 2 20  ? 9.505   8.056   5.255   1.00 0.00 ? 18  LYS B CB   3  
ATOM 4609  C CG   . LYS B 2 20  ? 10.724  8.033   6.173   1.00 0.00 ? 18  LYS B CG   3  
ATOM 4610  C CD   . LYS B 2 20  ? 10.336  7.946   7.642   1.00 0.00 ? 18  LYS B CD   3  
ATOM 4611  C CE   . LYS B 2 20  ? 9.680   6.618   7.978   1.00 0.00 ? 18  LYS B CE   3  
ATOM 4612  N NZ   . LYS B 2 20  ? 9.001   6.663   9.295   1.00 0.00 ? 18  LYS B NZ   3  
ATOM 4613  H H    . LYS B 2 20  ? 6.372   8.800   5.239   1.00 0.00 ? 18  LYS B H    3  
ATOM 4614  H HA   . LYS B 2 20  ? 8.122   8.899   6.664   1.00 0.00 ? 18  LYS B HA   3  
ATOM 4615  H HB2  . LYS B 2 20  ? 9.060   7.073   5.266   1.00 0.00 ? 18  LYS B HB2  3  
ATOM 4616  H HB3  . LYS B 2 20  ? 9.842   8.273   4.252   1.00 0.00 ? 18  LYS B HB3  3  
ATOM 4617  H HG2  . LYS B 2 20  ? 11.333  7.177   5.924   1.00 0.00 ? 18  LYS B HG2  3  
ATOM 4618  H HG3  . LYS B 2 20  ? 11.294  8.937   6.015   1.00 0.00 ? 18  LYS B HG3  3  
ATOM 4619  H HD2  . LYS B 2 20  ? 11.225  8.057   8.245   1.00 0.00 ? 18  LYS B HD2  3  
ATOM 4620  H HD3  . LYS B 2 20  ? 9.645   8.746   7.868   1.00 0.00 ? 18  LYS B HD3  3  
ATOM 4621  H HE2  . LYS B 2 20  ? 8.946   6.389   7.216   1.00 0.00 ? 18  LYS B HE2  3  
ATOM 4622  H HE3  . LYS B 2 20  ? 10.432  5.846   7.995   1.00 0.00 ? 18  LYS B HE3  3  
ATOM 4623  H HZ1  . LYS B 2 20  ? 8.994   5.717   9.733   1.00 0.00 ? 18  LYS B HZ1  3  
ATOM 4624  H HZ2  . LYS B 2 20  ? 8.013   6.980   9.165   1.00 0.00 ? 18  LYS B HZ2  3  
ATOM 4625  H HZ3  . LYS B 2 20  ? 9.487   7.333   9.937   1.00 0.00 ? 18  LYS B HZ3  3  
ATOM 4626  N N    . LYS B 2 21  ? 8.046   11.469  5.804   1.00 0.00 ? 19  LYS B N    3  
ATOM 4627  C CA   . LYS B 2 21  ? 8.352   12.905  5.816   1.00 0.00 ? 19  LYS B CA   3  
ATOM 4628  C C    . LYS B 2 21  ? 8.833   13.425  4.451   1.00 0.00 ? 19  LYS B C    3  
ATOM 4629  O O    . LYS B 2 21  ? 9.526   14.440  4.389   1.00 0.00 ? 19  LYS B O    3  
ATOM 4630  C CB   . LYS B 2 21  ? 9.405   13.251  6.893   1.00 0.00 ? 19  LYS B CB   3  
ATOM 4631  C CG   . LYS B 2 21  ? 9.371   12.376  8.148   1.00 0.00 ? 19  LYS B CG   3  
ATOM 4632  C CD   . LYS B 2 21  ? 8.133   12.624  8.999   1.00 0.00 ? 19  LYS B CD   3  
ATOM 4633  C CE   . LYS B 2 21  ? 8.427   13.469  10.225  1.00 0.00 ? 19  LYS B CE   3  
ATOM 4634  N NZ   . LYS B 2 21  ? 9.588   12.949  10.993  1.00 0.00 ? 19  LYS B NZ   3  
ATOM 4635  H H    . LYS B 2 21  ? 7.113   11.188  5.967   1.00 0.00 ? 19  LYS B H    3  
ATOM 4636  H HA   . LYS B 2 21  ? 7.436   13.421  6.063   1.00 0.00 ? 19  LYS B HA   3  
ATOM 4637  H HB2  . LYS B 2 21  ? 10.387  13.159  6.453   1.00 0.00 ? 19  LYS B HB2  3  
ATOM 4638  H HB3  . LYS B 2 21  ? 9.259   14.277  7.197   1.00 0.00 ? 19  LYS B HB3  3  
ATOM 4639  H HG2  . LYS B 2 21  ? 9.381   11.339  7.848   1.00 0.00 ? 19  LYS B HG2  3  
ATOM 4640  H HG3  . LYS B 2 21  ? 10.249  12.586  8.741   1.00 0.00 ? 19  LYS B HG3  3  
ATOM 4641  H HD2  . LYS B 2 21  ? 7.390   13.133  8.405   1.00 0.00 ? 19  LYS B HD2  3  
ATOM 4642  H HD3  . LYS B 2 21  ? 7.734   11.671  9.326   1.00 0.00 ? 19  LYS B HD3  3  
ATOM 4643  H HE2  . LYS B 2 21  ? 8.629   14.479  9.912   1.00 0.00 ? 19  LYS B HE2  3  
ATOM 4644  H HE3  . LYS B 2 21  ? 7.551   13.459  10.864  1.00 0.00 ? 19  LYS B HE3  3  
ATOM 4645  H HZ1  . LYS B 2 21  ? 10.449  12.991  10.415  1.00 0.00 ? 19  LYS B HZ1  3  
ATOM 4646  H HZ2  . LYS B 2 21  ? 9.422   11.948  11.267  1.00 0.00 ? 19  LYS B HZ2  3  
ATOM 4647  H HZ3  . LYS B 2 21  ? 9.730   13.507  11.855  1.00 0.00 ? 19  LYS B HZ3  3  
ATOM 4648  N N    . GLN B 2 22  ? 8.454   12.762  3.360   1.00 0.00 ? 20  GLN B N    3  
ATOM 4649  C CA   . GLN B 2 22  ? 8.874   13.207  2.028   1.00 0.00 ? 20  GLN B CA   3  
ATOM 4650  C C    . GLN B 2 22  ? 7.710   13.101  1.043   1.00 0.00 ? 20  GLN B C    3  
ATOM 4651  O O    . GLN B 2 22  ? 7.035   12.081  0.980   1.00 0.00 ? 20  GLN B O    3  
ATOM 4652  C CB   . GLN B 2 22  ? 10.106  12.422  1.544   1.00 0.00 ? 20  GLN B CB   3  
ATOM 4653  C CG   . GLN B 2 22  ? 9.796   11.083  0.903   1.00 0.00 ? 20  GLN B CG   3  
ATOM 4654  C CD   . GLN B 2 22  ? 10.994  10.156  0.871   1.00 0.00 ? 20  GLN B CD   3  
ATOM 4655  O OE1  . GLN B 2 22  ? 11.806  10.197  -0.052  1.00 0.00 ? 20  GLN B OE1  3  
ATOM 4656  N NE2  . GLN B 2 22  ? 11.100  9.297   1.871   1.00 0.00 ? 20  GLN B NE2  3  
ATOM 4657  H H    . GLN B 2 22  ? 7.878   11.972  3.447   1.00 0.00 ? 20  GLN B H    3  
ATOM 4658  H HA   . GLN B 2 22  ? 9.142   14.250  2.113   1.00 0.00 ? 20  GLN B HA   3  
ATOM 4659  H HB2  . GLN B 2 22  ? 10.634  13.024  0.820   1.00 0.00 ? 20  GLN B HB2  3  
ATOM 4660  H HB3  . GLN B 2 22  ? 10.756  12.249  2.390   1.00 0.00 ? 20  GLN B HB3  3  
ATOM 4661  H HG2  . GLN B 2 22  ? 9.008   10.605  1.464   1.00 0.00 ? 20  GLN B HG2  3  
ATOM 4662  H HG3  . GLN B 2 22  ? 9.464   11.253  -0.110  1.00 0.00 ? 20  GLN B HG3  3  
ATOM 4663  H HE21 . GLN B 2 22  ? 10.401  9.309   2.565   1.00 0.00 ? 20  GLN B HE21 3  
ATOM 4664  H HE22 . GLN B 2 22  ? 11.866  8.691   1.880   1.00 0.00 ? 20  GLN B HE22 3  
ATOM 4665  N N    . ASP B 2 23  ? 7.481   14.166  0.285   1.00 0.00 ? 21  ASP B N    3  
ATOM 4666  C CA   . ASP B 2 23  ? 6.367   14.227  -0.669  1.00 0.00 ? 21  ASP B CA   3  
ATOM 4667  C C    . ASP B 2 23  ? 6.698   13.552  -2.004  1.00 0.00 ? 21  ASP B C    3  
ATOM 4668  O O    . ASP B 2 23  ? 7.864   13.458  -2.397  1.00 0.00 ? 21  ASP B O    3  
ATOM 4669  C CB   . ASP B 2 23  ? 5.972   15.687  -0.906  1.00 0.00 ? 21  ASP B CB   3  
ATOM 4670  C CG   . ASP B 2 23  ? 4.490   15.858  -1.184  1.00 0.00 ? 21  ASP B CG   3  
ATOM 4671  O OD1  . ASP B 2 23  ? 3.769   16.362  -0.299  1.00 0.00 ? 21  ASP B OD1  3  
ATOM 4672  O OD2  . ASP B 2 23  ? 4.049   15.507  -2.296  1.00 0.00 ? 21  ASP B OD2  3  
ATOM 4673  H H    . ASP B 2 23  ? 8.083   14.935  0.357   1.00 0.00 ? 21  ASP B H    3  
ATOM 4674  H HA   . ASP B 2 23  ? 5.530   13.712  -0.223  1.00 0.00 ? 21  ASP B HA   3  
ATOM 4675  H HB2  . ASP B 2 23  ? 6.223   16.268  -0.031  1.00 0.00 ? 21  ASP B HB2  3  
ATOM 4676  H HB3  . ASP B 2 23  ? 6.524   16.067  -1.753  1.00 0.00 ? 21  ASP B HB3  3  
ATOM 4677  N N    . GLY B 2 24  ? 5.657   13.079  -2.684  1.00 0.00 ? 22  GLY B N    3  
ATOM 4678  C CA   . GLY B 2 24  ? 5.809   12.419  -3.970  1.00 0.00 ? 22  GLY B CA   3  
ATOM 4679  C C    . GLY B 2 24  ? 4.466   12.034  -4.573  1.00 0.00 ? 22  GLY B C    3  
ATOM 4680  O O    . GLY B 2 24  ? 3.446   12.642  -4.257  1.00 0.00 ? 22  GLY B O    3  
ATOM 4681  H H    . GLY B 2 24  ? 4.757   13.180  -2.303  1.00 0.00 ? 22  GLY B H    3  
ATOM 4682  H HA2  . GLY B 2 24  ? 6.322   13.085  -4.649  1.00 0.00 ? 22  GLY B HA2  3  
ATOM 4683  H HA3  . GLY B 2 24  ? 6.403   11.526  -3.839  1.00 0.00 ? 22  GLY B HA3  3  
ATOM 4684  N N    . ALA B 2 25  ? 4.459   11.018  -5.431  1.00 0.00 ? 23  ALA B N    3  
ATOM 4685  C CA   . ALA B 2 25  ? 3.228   10.553  -6.069  1.00 0.00 ? 23  ALA B CA   3  
ATOM 4686  C C    . ALA B 2 25  ? 3.084   9.048   -5.892  1.00 0.00 ? 23  ALA B C    3  
ATOM 4687  O O    . ALA B 2 25  ? 4.047   8.294   -6.046  1.00 0.00 ? 23  ALA B O    3  
ATOM 4688  C CB   . ALA B 2 25  ? 3.193   10.938  -7.544  1.00 0.00 ? 23  ALA B CB   3  
ATOM 4689  H H    . ALA B 2 25  ? 5.303   10.549  -5.625  1.00 0.00 ? 23  ALA B H    3  
ATOM 4690  H HA   . ALA B 2 25  ? 2.394   11.037  -5.577  1.00 0.00 ? 23  ALA B HA   3  
ATOM 4691  H HB1  . ALA B 2 25  ? 3.292   12.010  -7.641  1.00 0.00 ? 23  ALA B HB1  3  
ATOM 4692  H HB2  . ALA B 2 25  ? 2.249   10.627  -7.972  1.00 0.00 ? 23  ALA B HB2  3  
ATOM 4693  H HB3  . ALA B 2 25  ? 4.001   10.453  -8.067  1.00 0.00 ? 23  ALA B HB3  3  
ATOM 4694  N N    . LEU B 2 26  ? 1.874   8.624   -5.566  1.00 0.00 ? 24  LEU B N    3  
ATOM 4695  C CA   . LEU B 2 26  ? 1.575   7.219   -5.323  1.00 0.00 ? 24  LEU B CA   3  
ATOM 4696  C C    . LEU B 2 26  ? 0.976   6.563   -6.571  1.00 0.00 ? 24  LEU B C    3  
ATOM 4697  O O    . LEU B 2 26  ? 0.204   7.180   -7.294  1.00 0.00 ? 24  LEU B O    3  
ATOM 4698  C CB   . LEU B 2 26  ? 0.604   7.126   -4.144  1.00 0.00 ? 24  LEU B CB   3  
ATOM 4699  C CG   . LEU B 2 26  ? 0.183   5.713   -3.744  1.00 0.00 ? 24  LEU B CG   3  
ATOM 4700  C CD1  . LEU B 2 26  ? 1.108   5.130   -2.705  1.00 0.00 ? 24  LEU B CD1  3  
ATOM 4701  C CD2  . LEU B 2 26  ? -1.243  5.713   -3.228  1.00 0.00 ? 24  LEU B CD2  3  
ATOM 4702  H H    . LEU B 2 26  ? 1.147   9.279   -5.506  1.00 0.00 ? 24  LEU B H    3  
ATOM 4703  H HA   . LEU B 2 26  ? 2.490   6.710   -5.062  1.00 0.00 ? 24  LEU B HA   3  
ATOM 4704  H HB2  . LEU B 2 26  ? 1.063   7.596   -3.291  1.00 0.00 ? 24  LEU B HB2  3  
ATOM 4705  H HB3  . LEU B 2 26  ? -0.281  7.683   -4.396  1.00 0.00 ? 24  LEU B HB3  3  
ATOM 4706  H HG   . LEU B 2 26  ? 0.242   5.079   -4.610  1.00 0.00 ? 24  LEU B HG   3  
ATOM 4707  H HD11 . LEU B 2 26  ? 1.098   5.753   -1.826  1.00 0.00 ? 24  LEU B HD11 3  
ATOM 4708  H HD12 . LEU B 2 26  ? 2.108   5.077   -3.104  1.00 0.00 ? 24  LEU B HD12 3  
ATOM 4709  H HD13 . LEU B 2 26  ? 0.768   4.136   -2.447  1.00 0.00 ? 24  LEU B HD13 3  
ATOM 4710  H HD21 . LEU B 2 26  ? -1.544  4.702   -2.999  1.00 0.00 ? 24  LEU B HD21 3  
ATOM 4711  H HD22 . LEU B 2 26  ? -1.899  6.125   -3.980  1.00 0.00 ? 24  LEU B HD22 3  
ATOM 4712  H HD23 . LEU B 2 26  ? -1.300  6.316   -2.332  1.00 0.00 ? 24  LEU B HD23 3  
ATOM 4713  N N    . TYR B 2 27  ? 1.350   5.319   -6.826  1.00 0.00 ? 25  TYR B N    3  
ATOM 4714  C CA   . TYR B 2 27  ? 0.856   4.575   -7.981  1.00 0.00 ? 25  TYR B CA   3  
ATOM 4715  C C    . TYR B 2 27  ? 0.422   3.181   -7.549  1.00 0.00 ? 25  TYR B C    3  
ATOM 4716  O O    . TYR B 2 27  ? 1.214   2.419   -7.001  1.00 0.00 ? 25  TYR B O    3  
ATOM 4717  C CB   . TYR B 2 27  ? 1.941   4.459   -9.060  1.00 0.00 ? 25  TYR B CB   3  
ATOM 4718  C CG   . TYR B 2 27  ? 2.246   5.745   -9.799  1.00 0.00 ? 25  TYR B CG   3  
ATOM 4719  C CD1  . TYR B 2 27  ? 1.820   5.930   -11.106 1.00 0.00 ? 25  TYR B CD1  3  
ATOM 4720  C CD2  . TYR B 2 27  ? 2.972   6.765   -9.196  1.00 0.00 ? 25  TYR B CD2  3  
ATOM 4721  C CE1  . TYR B 2 27  ? 2.106   7.095   -11.792 1.00 0.00 ? 25  TYR B CE1  3  
ATOM 4722  C CE2  . TYR B 2 27  ? 3.260   7.934   -9.874  1.00 0.00 ? 25  TYR B CE2  3  
ATOM 4723  C CZ   . TYR B 2 27  ? 2.824   8.093   -11.172 1.00 0.00 ? 25  TYR B CZ   3  
ATOM 4724  O OH   . TYR B 2 27  ? 3.111   9.254   -11.852 1.00 0.00 ? 25  TYR B OH   3  
ATOM 4725  H H    . TYR B 2 27  ? 1.980   4.872   -6.212  1.00 0.00 ? 25  TYR B H    3  
ATOM 4726  H HA   . TYR B 2 27  ? 0.002   5.101   -8.380  1.00 0.00 ? 25  TYR B HA   3  
ATOM 4727  H HB2  . TYR B 2 27  ? 2.856   4.127   -8.598  1.00 0.00 ? 25  TYR B HB2  3  
ATOM 4728  H HB3  . TYR B 2 27  ? 1.629   3.726   -9.790  1.00 0.00 ? 25  TYR B HB3  3  
ATOM 4729  H HD1  . TYR B 2 27  ? 1.254   5.147   -11.590 1.00 0.00 ? 25  TYR B HD1  3  
ATOM 4730  H HD2  . TYR B 2 27  ? 3.313   6.637   -8.179  1.00 0.00 ? 25  TYR B HD2  3  
ATOM 4731  H HE1  . TYR B 2 27  ? 1.765   7.220   -12.809 1.00 0.00 ? 25  TYR B HE1  3  
ATOM 4732  H HE2  . TYR B 2 27  ? 3.823   8.715   -9.386  1.00 0.00 ? 25  TYR B HE2  3  
ATOM 4733  H HH   . TYR B 2 27  ? 2.307   9.601   -12.245 1.00 0.00 ? 25  TYR B HH   3  
ATOM 4734  N N    . LEU B 2 28  ? -0.825  2.836   -7.801  1.00 0.00 ? 26  LEU B N    3  
ATOM 4735  C CA   . LEU B 2 28  ? -1.328  1.534   -7.396  1.00 0.00 ? 26  LEU B CA   3  
ATOM 4736  C C    . LEU B 2 28  ? -1.448  0.584   -8.575  1.00 0.00 ? 26  LEU B C    3  
ATOM 4737  O O    . LEU B 2 28  ? -2.161  0.863   -9.539  1.00 0.00 ? 26  LEU B O    3  
ATOM 4738  C CB   . LEU B 2 28  ? -2.687  1.668   -6.712  1.00 0.00 ? 26  LEU B CB   3  
ATOM 4739  C CG   . LEU B 2 28  ? -2.760  2.730   -5.620  1.00 0.00 ? 26  LEU B CG   3  
ATOM 4740  C CD1  . LEU B 2 28  ? -4.072  2.645   -4.880  1.00 0.00 ? 26  LEU B CD1  3  
ATOM 4741  C CD2  . LEU B 2 28  ? -1.626  2.586   -4.640  1.00 0.00 ? 26  LEU B CD2  3  
ATOM 4742  H H    . LEU B 2 28  ? -1.417  3.462   -8.277  1.00 0.00 ? 26  LEU B H    3  
ATOM 4743  H HA   . LEU B 2 28  ? -0.627  1.121   -6.689  1.00 0.00 ? 26  LEU B HA   3  
ATOM 4744  H HB2  . LEU B 2 28  ? -3.423  1.905   -7.466  1.00 0.00 ? 26  LEU B HB2  3  
ATOM 4745  H HB3  . LEU B 2 28  ? -2.941  0.714   -6.273  1.00 0.00 ? 26  LEU B HB3  3  
ATOM 4746  H HG   . LEU B 2 28  ? -2.687  3.704   -6.072  1.00 0.00 ? 26  LEU B HG   3  
ATOM 4747  H HD11 . LEU B 2 28  ? -4.091  3.400   -4.105  1.00 0.00 ? 26  LEU B HD11 3  
ATOM 4748  H HD12 . LEU B 2 28  ? -4.167  1.669   -4.431  1.00 0.00 ? 26  LEU B HD12 3  
ATOM 4749  H HD13 . LEU B 2 28  ? -4.884  2.813   -5.566  1.00 0.00 ? 26  LEU B HD13 3  
ATOM 4750  H HD21 . LEU B 2 28  ? -0.691  2.574   -5.175  1.00 0.00 ? 26  LEU B HD21 3  
ATOM 4751  H HD22 . LEU B 2 28  ? -1.747  1.665   -4.090  1.00 0.00 ? 26  LEU B HD22 3  
ATOM 4752  H HD23 . LEU B 2 28  ? -1.643  3.422   -3.955  1.00 0.00 ? 26  LEU B HD23 3  
ATOM 4753  N N    . MET B 2 29  ? -0.741  -0.531  -8.490  1.00 0.00 ? 27  MET B N    3  
ATOM 4754  C CA   . MET B 2 29  ? -0.788  -1.551  -9.522  1.00 0.00 ? 27  MET B CA   3  
ATOM 4755  C C    . MET B 2 29  ? -1.694  -2.671  -9.059  1.00 0.00 ? 27  MET B C    3  
ATOM 4756  O O    . MET B 2 29  ? -1.941  -2.814  -7.866  1.00 0.00 ? 27  MET B O    3  
ATOM 4757  C CB   . MET B 2 29  ? 0.597   -2.118  -9.834  1.00 0.00 ? 27  MET B CB   3  
ATOM 4758  C CG   . MET B 2 29  ? 1.580   -1.095  -10.367 1.00 0.00 ? 27  MET B CG   3  
ATOM 4759  S SD   . MET B 2 29  ? 2.393   -0.165  -9.059  1.00 0.00 ? 27  MET B SD   3  
ATOM 4760  C CE   . MET B 2 29  ? 3.279   1.038   -10.039 1.00 0.00 ? 27  MET B CE   3  
ATOM 4761  H H    . MET B 2 29  ? -0.175  -0.681  -7.699  1.00 0.00 ? 27  MET B H    3  
ATOM 4762  H HA   . MET B 2 29  ? -1.201  -1.110  -10.417 1.00 0.00 ? 27  MET B HA   3  
ATOM 4763  H HB2  . MET B 2 29  ? 1.006   -2.551  -8.937  1.00 0.00 ? 27  MET B HB2  3  
ATOM 4764  H HB3  . MET B 2 29  ? 0.485   -2.895  -10.576 1.00 0.00 ? 27  MET B HB3  3  
ATOM 4765  H HG2  . MET B 2 29  ? 2.333   -1.608  -10.946 1.00 0.00 ? 27  MET B HG2  3  
ATOM 4766  H HG3  . MET B 2 29  ? 1.047   -0.404  -11.004 1.00 0.00 ? 27  MET B HG3  3  
ATOM 4767  H HE1  . MET B 2 29  ? 2.571   1.669   -10.558 1.00 0.00 ? 27  MET B HE1  3  
ATOM 4768  H HE2  . MET B 2 29  ? 3.901   0.527   -10.758 1.00 0.00 ? 27  MET B HE2  3  
ATOM 4769  H HE3  . MET B 2 29  ? 3.896   1.644   -9.393  1.00 0.00 ? 27  MET B HE3  3  
ATOM 4770  N N    . ALA B 2 30  ? -2.149  -3.485  -9.989  1.00 0.00 ? 28  ALA B N    3  
ATOM 4771  C CA   . ALA B 2 30  ? -3.050  -4.587  -9.674  1.00 0.00 ? 28  ALA B CA   3  
ATOM 4772  C C    . ALA B 2 30  ? -2.393  -5.613  -8.754  1.00 0.00 ? 28  ALA B C    3  
ATOM 4773  O O    . ALA B 2 30  ? -3.076  -6.385  -8.086  1.00 0.00 ? 28  ALA B O    3  
ATOM 4774  C CB   . ALA B 2 30  ? -3.520  -5.260  -10.955 1.00 0.00 ? 28  ALA B CB   3  
ATOM 4775  H H    . ALA B 2 30  ? -1.861  -3.351  -10.918 1.00 0.00 ? 28  ALA B H    3  
ATOM 4776  H HA   . ALA B 2 30  ? -3.916  -4.176  -9.177  1.00 0.00 ? 28  ALA B HA   3  
ATOM 4777  H HB1  . ALA B 2 30  ? -4.223  -6.042  -10.715 1.00 0.00 ? 28  ALA B HB1  3  
ATOM 4778  H HB2  . ALA B 2 30  ? -2.671  -5.686  -11.469 1.00 0.00 ? 28  ALA B HB2  3  
ATOM 4779  H HB3  . ALA B 2 30  ? -3.998  -4.530  -11.593 1.00 0.00 ? 28  ALA B HB3  3  
ATOM 4780  N N    . GLU B 2 31  ? -1.068  -5.612  -8.718  1.00 0.00 ? 29  GLU B N    3  
ATOM 4781  C CA   . GLU B 2 31  ? -0.334  -6.568  -7.902  1.00 0.00 ? 29  GLU B CA   3  
ATOM 4782  C C    . GLU B 2 31  ? 0.305   -5.920  -6.673  1.00 0.00 ? 29  GLU B C    3  
ATOM 4783  O O    . GLU B 2 31  ? 0.610   -6.607  -5.687  1.00 0.00 ? 29  GLU B O    3  
ATOM 4784  C CB   . GLU B 2 31  ? 0.781   -7.209  -8.737  1.00 0.00 ? 29  GLU B CB   3  
ATOM 4785  C CG   . GLU B 2 31  ? 0.480   -7.287  -10.228 1.00 0.00 ? 29  GLU B CG   3  
ATOM 4786  C CD   . GLU B 2 31  ? 1.001   -6.073  -10.979 1.00 0.00 ? 29  GLU B CD   3  
ATOM 4787  O OE1  . GLU B 2 31  ? 0.217   -5.130  -11.218 1.00 0.00 ? 29  GLU B OE1  3  
ATOM 4788  O OE2  . GLU B 2 31  ? 2.205   -6.046  -11.306 1.00 0.00 ? 29  GLU B OE2  3  
ATOM 4789  H H    . GLU B 2 31  ? -0.574  -4.973  -9.277  1.00 0.00 ? 29  GLU B H    3  
ATOM 4790  H HA   . GLU B 2 31  ? -1.020  -7.336  -7.581  1.00 0.00 ? 29  GLU B HA   3  
ATOM 4791  H HB2  . GLU B 2 31  ? 1.685   -6.633  -8.607  1.00 0.00 ? 29  GLU B HB2  3  
ATOM 4792  H HB3  . GLU B 2 31  ? 0.952   -8.212  -8.375  1.00 0.00 ? 29  GLU B HB3  3  
ATOM 4793  H HG2  . GLU B 2 31  ? 0.946   -8.173  -10.633 1.00 0.00 ? 29  GLU B HG2  3  
ATOM 4794  H HG3  . GLU B 2 31  ? -0.590  -7.346  -10.365 1.00 0.00 ? 29  GLU B HG3  3  
ATOM 4795  N N    . ARG B 2 32  ? 0.487   -4.604  -6.696  1.00 0.00 ? 30  ARG B N    3  
ATOM 4796  C CA   . ARG B 2 32  ? 1.167   -3.948  -5.587  1.00 0.00 ? 30  ARG B CA   3  
ATOM 4797  C C    . ARG B 2 32  ? 0.915   -2.452  -5.544  1.00 0.00 ? 30  ARG B C    3  
ATOM 4798  O O    . ARG B 2 32  ? 0.414   -1.862  -6.494  1.00 0.00 ? 30  ARG B O    3  
ATOM 4799  C CB   . ARG B 2 32  ? 2.678   -4.184  -5.713  1.00 0.00 ? 30  ARG B CB   3  
ATOM 4800  C CG   . ARG B 2 32  ? 3.378   -3.171  -6.615  1.00 0.00 ? 30  ARG B CG   3  
ATOM 4801  C CD   . ARG B 2 32  ? 4.587   -3.771  -7.308  1.00 0.00 ? 30  ARG B CD   3  
ATOM 4802  N NE   . ARG B 2 32  ? 4.221   -4.459  -8.547  1.00 0.00 ? 30  ARG B NE   3  
ATOM 4803  C CZ   . ARG B 2 32  ? 4.949   -4.411  -9.663  1.00 0.00 ? 30  ARG B CZ   3  
ATOM 4804  N NH1  . ARG B 2 32  ? 6.076   -3.716  -9.701  1.00 0.00 ? 30  ARG B NH1  3  
ATOM 4805  N NH2  . ARG B 2 32  ? 4.550   -5.047  -10.752 1.00 0.00 ? 30  ARG B NH2  3  
ATOM 4806  H H    . ARG B 2 32  ? 0.114   -4.064  -7.434  1.00 0.00 ? 30  ARG B H    3  
ATOM 4807  H HA   . ARG B 2 32  ? 0.820   -4.392  -4.668  1.00 0.00 ? 30  ARG B HA   3  
ATOM 4808  H HB2  . ARG B 2 32  ? 3.123   -4.128  -4.730  1.00 0.00 ? 30  ARG B HB2  3  
ATOM 4809  H HB3  . ARG B 2 32  ? 2.844   -5.170  -6.119  1.00 0.00 ? 30  ARG B HB3  3  
ATOM 4810  H HG2  . ARG B 2 32  ? 2.681   -2.830  -7.365  1.00 0.00 ? 30  ARG B HG2  3  
ATOM 4811  H HG3  . ARG B 2 32  ? 3.700   -2.331  -6.014  1.00 0.00 ? 30  ARG B HG3  3  
ATOM 4812  H HD2  . ARG B 2 32  ? 5.283   -2.978  -7.540  1.00 0.00 ? 30  ARG B HD2  3  
ATOM 4813  H HD3  . ARG B 2 32  ? 5.057   -4.478  -6.640  1.00 0.00 ? 30  ARG B HD3  3  
ATOM 4814  H HE   . ARG B 2 32  ? 3.387   -4.975  -8.549  1.00 0.00 ? 30  ARG B HE   3  
ATOM 4815  H HH11 . ARG B 2 32  ? 6.398   -3.226  -8.895  1.00 0.00 ? 30  ARG B HH11 3  
ATOM 4816  H HH12 . ARG B 2 32  ? 6.604   -3.667  -10.567 1.00 0.00 ? 30  ARG B HH12 3  
ATOM 4817  H HH21 . ARG B 2 32  ? 3.686   -5.573  -10.760 1.00 0.00 ? 30  ARG B HH21 3  
ATOM 4818  H HH22 . ARG B 2 32  ? 5.119   -5.005  -11.587 1.00 0.00 ? 30  ARG B HH22 3  
ATOM 4819  N N    . ILE B 2 33  ? 1.291   -1.855  -4.430  1.00 0.00 ? 31  ILE B N    3  
ATOM 4820  C CA   . ILE B 2 33  ? 1.170   -0.425  -4.234  1.00 0.00 ? 31  ILE B CA   3  
ATOM 4821  C C    . ILE B 2 33  ? 2.573   0.179   -4.240  1.00 0.00 ? 31  ILE B C    3  
ATOM 4822  O O    . ILE B 2 33  ? 3.417   -0.177  -3.412  1.00 0.00 ? 31  ILE B O    3  
ATOM 4823  C CB   . ILE B 2 33  ? 0.432   -0.084  -2.914  1.00 0.00 ? 31  ILE B CB   3  
ATOM 4824  C CG1  . ILE B 2 33  ? 0.779   1.334   -2.447  1.00 0.00 ? 31  ILE B CG1  3  
ATOM 4825  C CG2  . ILE B 2 33  ? 0.752   -1.108  -1.830  1.00 0.00 ? 31  ILE B CG2  3  
ATOM 4826  C CD1  . ILE B 2 33  ? -0.083  1.827   -1.306  1.00 0.00 ? 31  ILE B CD1  3  
ATOM 4827  H H    . ILE B 2 33  ? 1.677   -2.400  -3.707  1.00 0.00 ? 31  ILE B H    3  
ATOM 4828  H HA   . ILE B 2 33  ? 0.606   -0.016  -5.064  1.00 0.00 ? 31  ILE B HA   3  
ATOM 4829  H HB   . ILE B 2 33  ? -0.629  -0.135  -3.108  1.00 0.00 ? 31  ILE B HB   3  
ATOM 4830  H HG12 . ILE B 2 33  ? 1.807   1.356   -2.117  1.00 0.00 ? 31  ILE B HG12 3  
ATOM 4831  H HG13 . ILE B 2 33  ? 0.658   2.018   -3.275  1.00 0.00 ? 31  ILE B HG13 3  
ATOM 4832  H HG21 . ILE B 2 33  ? 0.461   -2.092  -2.169  1.00 0.00 ? 31  ILE B HG21 3  
ATOM 4833  H HG22 . ILE B 2 33  ? 0.208   -0.862  -0.931  1.00 0.00 ? 31  ILE B HG22 3  
ATOM 4834  H HG23 . ILE B 2 33  ? 1.812   -1.096  -1.626  1.00 0.00 ? 31  ILE B HG23 3  
ATOM 4835  H HD11 . ILE B 2 33  ? -1.122  1.790   -1.597  1.00 0.00 ? 31  ILE B HD11 3  
ATOM 4836  H HD12 . ILE B 2 33  ? 0.189   2.845   -1.064  1.00 0.00 ? 31  ILE B HD12 3  
ATOM 4837  H HD13 . ILE B 2 33  ? 0.072   1.200   -0.441  1.00 0.00 ? 31  ILE B HD13 3  
ATOM 4838  N N    . ALA B 2 34  ? 2.834   1.049   -5.201  1.00 0.00 ? 32  ALA B N    3  
ATOM 4839  C CA   . ALA B 2 34  ? 4.136   1.680   -5.322  1.00 0.00 ? 32  ALA B CA   3  
ATOM 4840  C C    . ALA B 2 34  ? 4.018   3.188   -5.185  1.00 0.00 ? 32  ALA B C    3  
ATOM 4841  O O    . ALA B 2 34  ? 2.975   3.766   -5.462  1.00 0.00 ? 32  ALA B O    3  
ATOM 4842  C CB   . ALA B 2 34  ? 4.778   1.315   -6.652  1.00 0.00 ? 32  ALA B CB   3  
ATOM 4843  H H    . ALA B 2 34  ? 2.126   1.289   -5.842  1.00 0.00 ? 32  ALA B H    3  
ATOM 4844  H HA   . ALA B 2 34  ? 4.767   1.302   -4.530  1.00 0.00 ? 32  ALA B HA   3  
ATOM 4845  H HB1  . ALA B 2 34  ? 4.872   0.243   -6.726  1.00 0.00 ? 32  ALA B HB1  3  
ATOM 4846  H HB2  . ALA B 2 34  ? 5.757   1.768   -6.715  1.00 0.00 ? 32  ALA B HB2  3  
ATOM 4847  H HB3  . ALA B 2 34  ? 4.162   1.679   -7.461  1.00 0.00 ? 32  ALA B HB3  3  
ATOM 4848  N N    . TRP B 2 35  ? 5.075   3.821   -4.727  1.00 0.00 ? 33  TRP B N    3  
ATOM 4849  C CA   . TRP B 2 35  ? 5.078   5.261   -4.563  1.00 0.00 ? 33  TRP B CA   3  
ATOM 4850  C C    . TRP B 2 35  ? 6.477   5.811   -4.818  1.00 0.00 ? 33  TRP B C    3  
ATOM 4851  O O    . TRP B 2 35  ? 7.475   5.191   -4.439  1.00 0.00 ? 33  TRP B O    3  
ATOM 4852  C CB   . TRP B 2 35  ? 4.551   5.616   -3.164  1.00 0.00 ? 33  TRP B CB   3  
ATOM 4853  C CG   . TRP B 2 35  ? 4.722   7.051   -2.772  1.00 0.00 ? 33  TRP B CG   3  
ATOM 4854  C CD1  . TRP B 2 35  ? 3.786   8.031   -2.882  1.00 0.00 ? 33  TRP B CD1  3  
ATOM 4855  C CD2  . TRP B 2 35  ? 5.879   7.665   -2.193  1.00 0.00 ? 33  TRP B CD2  3  
ATOM 4856  N NE1  . TRP B 2 35  ? 4.286   9.218   -2.428  1.00 0.00 ? 33  TRP B NE1  3  
ATOM 4857  C CE2  . TRP B 2 35  ? 5.570   9.021   -1.995  1.00 0.00 ? 33  TRP B CE2  3  
ATOM 4858  C CE3  . TRP B 2 35  ? 7.147   7.204   -1.828  1.00 0.00 ? 33  TRP B CE3  3  
ATOM 4859  C CZ2  . TRP B 2 35  ? 6.480   9.920   -1.450  1.00 0.00 ? 33  TRP B CZ2  3  
ATOM 4860  C CZ3  . TRP B 2 35  ? 8.049   8.097   -1.286  1.00 0.00 ? 33  TRP B CZ3  3  
ATOM 4861  C CH2  . TRP B 2 35  ? 7.711   9.442   -1.101  1.00 0.00 ? 33  TRP B CH2  3  
ATOM 4862  H H    . TRP B 2 35  ? 5.882   3.308   -4.495  1.00 0.00 ? 33  TRP B H    3  
ATOM 4863  H HA   . TRP B 2 35  ? 4.408   5.674   -5.303  1.00 0.00 ? 33  TRP B HA   3  
ATOM 4864  H HB2  . TRP B 2 35  ? 3.495   5.400   -3.136  1.00 0.00 ? 33  TRP B HB2  3  
ATOM 4865  H HB3  . TRP B 2 35  ? 5.040   5.004   -2.435  1.00 0.00 ? 33  TRP B HB3  3  
ATOM 4866  H HD1  . TRP B 2 35  ? 2.797   7.880   -3.285  1.00 0.00 ? 33  TRP B HD1  3  
ATOM 4867  H HE1  . TRP B 2 35  ? 3.797   10.071  -2.410  1.00 0.00 ? 33  TRP B HE1  3  
ATOM 4868  H HE3  . TRP B 2 35  ? 7.425   6.169   -1.963  1.00 0.00 ? 33  TRP B HE3  3  
ATOM 4869  H HZ2  . TRP B 2 35  ? 6.237   10.961  -1.300  1.00 0.00 ? 33  TRP B HZ2  3  
ATOM 4870  H HZ3  . TRP B 2 35  ? 9.033   7.758   -0.996  1.00 0.00 ? 33  TRP B HZ3  3  
ATOM 4871  H HH2  . TRP B 2 35  ? 8.447   10.106  -0.674  1.00 0.00 ? 33  TRP B HH2  3  
ATOM 4872  N N    . ALA B 2 36  ? 6.551   6.958   -5.477  1.00 0.00 ? 34  ALA B N    3  
ATOM 4873  C CA   . ALA B 2 36  ? 7.830   7.579   -5.790  1.00 0.00 ? 34  ALA B CA   3  
ATOM 4874  C C    . ALA B 2 36  ? 7.879   9.012   -5.278  1.00 0.00 ? 34  ALA B C    3  
ATOM 4875  O O    . ALA B 2 36  ? 6.900   9.749   -5.392  1.00 0.00 ? 34  ALA B O    3  
ATOM 4876  C CB   . ALA B 2 36  ? 8.078   7.550   -7.290  1.00 0.00 ? 34  ALA B CB   3  
ATOM 4877  H H    . ALA B 2 36  ? 5.719   7.409   -5.753  1.00 0.00 ? 34  ALA B H    3  
ATOM 4878  H HA   . ALA B 2 36  ? 8.607   7.005   -5.307  1.00 0.00 ? 34  ALA B HA   3  
ATOM 4879  H HB1  . ALA B 2 36  ? 9.023   8.025   -7.509  1.00 0.00 ? 34  ALA B HB1  3  
ATOM 4880  H HB2  . ALA B 2 36  ? 7.284   8.079   -7.796  1.00 0.00 ? 34  ALA B HB2  3  
ATOM 4881  H HB3  . ALA B 2 36  ? 8.102   6.525   -7.631  1.00 0.00 ? 34  ALA B HB3  3  
ATOM 4882  N N    . PRO B 2 37  ? 9.017   9.419   -4.698  1.00 0.00 ? 35  PRO B N    3  
ATOM 4883  C CA   . PRO B 2 37  ? 9.197   10.773  -4.180  1.00 0.00 ? 35  PRO B CA   3  
ATOM 4884  C C    . PRO B 2 37  ? 9.238   11.797  -5.306  1.00 0.00 ? 35  PRO B C    3  
ATOM 4885  O O    . PRO B 2 37  ? 9.605   11.474  -6.440  1.00 0.00 ? 35  PRO B O    3  
ATOM 4886  C CB   . PRO B 2 37  ? 10.553  10.729  -3.456  1.00 0.00 ? 35  PRO B CB   3  
ATOM 4887  C CG   . PRO B 2 37  ? 10.921  9.285   -3.369  1.00 0.00 ? 35  PRO B CG   3  
ATOM 4888  C CD   . PRO B 2 37  ? 10.215  8.595   -4.500  1.00 0.00 ? 35  PRO B CD   3  
ATOM 4889  H HA   . PRO B 2 37  ? 8.417   11.038  -3.480  1.00 0.00 ? 35  PRO B HA   3  
ATOM 4890  H HB2  . PRO B 2 37  ? 11.282  11.286  -4.025  1.00 0.00 ? 35  PRO B HB2  3  
ATOM 4891  H HB3  . PRO B 2 37  ? 10.451  11.167  -2.474  1.00 0.00 ? 35  PRO B HB3  3  
ATOM 4892  H HG2  . PRO B 2 37  ? 11.991  9.174   -3.474  1.00 0.00 ? 35  PRO B HG2  3  
ATOM 4893  H HG3  . PRO B 2 37  ? 10.596  8.880   -2.422  1.00 0.00 ? 35  PRO B HG3  3  
ATOM 4894  H HD2  . PRO B 2 37  ? 10.833  8.593   -5.385  1.00 0.00 ? 35  PRO B HD2  3  
ATOM 4895  H HD3  . PRO B 2 37  ? 9.948   7.587   -4.220  1.00 0.00 ? 35  PRO B HD3  3  
ATOM 4896  N N    . GLU B 2 38  ? 8.860   13.025  -4.994  1.00 0.00 ? 36  GLU B N    3  
ATOM 4897  C CA   . GLU B 2 38  ? 8.855   14.088  -5.982  1.00 0.00 ? 36  GLU B CA   3  
ATOM 4898  C C    . GLU B 2 38  ? 10.279  14.382  -6.437  1.00 0.00 ? 36  GLU B C    3  
ATOM 4899  O O    . GLU B 2 38  ? 11.124  14.796  -5.645  1.00 0.00 ? 36  GLU B O    3  
ATOM 4900  C CB   . GLU B 2 38  ? 8.207   15.344  -5.403  1.00 0.00 ? 36  GLU B CB   3  
ATOM 4901  C CG   . GLU B 2 38  ? 7.695   16.310  -6.457  1.00 0.00 ? 36  GLU B CG   3  
ATOM 4902  C CD   . GLU B 2 38  ? 6.470   17.066  -5.990  1.00 0.00 ? 36  GLU B CD   3  
ATOM 4903  O OE1  . GLU B 2 38  ? 6.616   17.996  -5.171  1.00 0.00 ? 36  GLU B OE1  3  
ATOM 4904  O OE2  . GLU B 2 38  ? 5.348   16.715  -6.418  1.00 0.00 ? 36  GLU B OE2  3  
ATOM 4905  H H    . GLU B 2 38  ? 8.580   13.225  -4.071  1.00 0.00 ? 36  GLU B H    3  
ATOM 4906  H HA   . GLU B 2 38  ? 8.279   13.752  -6.831  1.00 0.00 ? 36  GLU B HA   3  
ATOM 4907  H HB2  . GLU B 2 38  ? 7.374   15.049  -4.781  1.00 0.00 ? 36  GLU B HB2  3  
ATOM 4908  H HB3  . GLU B 2 38  ? 8.932   15.861  -4.794  1.00 0.00 ? 36  GLU B HB3  3  
ATOM 4909  H HG2  . GLU B 2 38  ? 8.475   17.021  -6.686  1.00 0.00 ? 36  GLU B HG2  3  
ATOM 4910  H HG3  . GLU B 2 38  ? 7.442   15.753  -7.347  1.00 0.00 ? 36  GLU B HG3  3  
ATOM 4911  N N    . GLY B 2 39  ? 10.541  14.138  -7.713  1.00 0.00 ? 37  GLY B N    3  
ATOM 4912  C CA   . GLY B 2 39  ? 11.863  14.372  -8.253  1.00 0.00 ? 37  GLY B CA   3  
ATOM 4913  C C    . GLY B 2 39  ? 12.668  13.093  -8.388  1.00 0.00 ? 37  GLY B C    3  
ATOM 4914  O O    . GLY B 2 39  ? 13.842  13.126  -8.754  1.00 0.00 ? 37  GLY B O    3  
ATOM 4915  H H    . GLY B 2 39  ? 9.831   13.796  -8.293  1.00 0.00 ? 37  GLY B H    3  
ATOM 4916  H HA2  . GLY B 2 39  ? 11.768  14.830  -9.227  1.00 0.00 ? 37  GLY B HA2  3  
ATOM 4917  H HA3  . GLY B 2 39  ? 12.393  15.050  -7.599  1.00 0.00 ? 37  GLY B HA3  3  
ATOM 4918  N N    . LYS B 2 40  ? 12.043  11.961  -8.085  1.00 0.00 ? 38  LYS B N    3  
ATOM 4919  C CA   . LYS B 2 40  ? 12.724  10.679  -8.186  1.00 0.00 ? 38  LYS B CA   3  
ATOM 4920  C C    . LYS B 2 40  ? 12.405  9.988   -9.501  1.00 0.00 ? 38  LYS B C    3  
ATOM 4921  O O    . LYS B 2 40  ? 11.287  10.052  -10.007 1.00 0.00 ? 38  LYS B O    3  
ATOM 4922  C CB   . LYS B 2 40  ? 12.370  9.768   -7.012  1.00 0.00 ? 38  LYS B CB   3  
ATOM 4923  C CG   . LYS B 2 40  ? 13.557  9.448   -6.109  1.00 0.00 ? 38  LYS B CG   3  
ATOM 4924  C CD   . LYS B 2 40  ? 14.653  8.698   -6.856  1.00 0.00 ? 38  LYS B CD   3  
ATOM 4925  C CE   . LYS B 2 40  ? 15.838  9.603   -7.180  1.00 0.00 ? 38  LYS B CE   3  
ATOM 4926  N NZ   . LYS B 2 40  ? 16.868  8.910   -8.007  1.00 0.00 ? 38  LYS B NZ   3  
ATOM 4927  H H    . LYS B 2 40  ? 11.108  11.988  -7.786  1.00 0.00 ? 38  LYS B H    3  
ATOM 4928  H HA   . LYS B 2 40  ? 13.785  10.870  -8.161  1.00 0.00 ? 38  LYS B HA   3  
ATOM 4929  H HB2  . LYS B 2 40  ? 11.609  10.250  -6.414  1.00 0.00 ? 38  LYS B HB2  3  
ATOM 4930  H HB3  . LYS B 2 40  ? 11.976  8.839   -7.397  1.00 0.00 ? 38  LYS B HB3  3  
ATOM 4931  H HG2  . LYS B 2 40  ? 13.965  10.372  -5.729  1.00 0.00 ? 38  LYS B HG2  3  
ATOM 4932  H HG3  . LYS B 2 40  ? 13.213  8.839   -5.286  1.00 0.00 ? 38  LYS B HG3  3  
ATOM 4933  H HD2  . LYS B 2 40  ? 14.998  7.879   -6.240  1.00 0.00 ? 38  LYS B HD2  3  
ATOM 4934  H HD3  . LYS B 2 40  ? 14.245  8.309   -7.778  1.00 0.00 ? 38  LYS B HD3  3  
ATOM 4935  H HE2  . LYS B 2 40  ? 15.477  10.465  -7.721  1.00 0.00 ? 38  LYS B HE2  3  
ATOM 4936  H HE3  . LYS B 2 40  ? 16.290  9.925   -6.253  1.00 0.00 ? 38  LYS B HE3  3  
ATOM 4937  H HZ1  . LYS B 2 40  ? 17.818  9.232   -7.744  1.00 0.00 ? 38  LYS B HZ1  3  
ATOM 4938  H HZ2  . LYS B 2 40  ? 16.715  9.120   -9.025  1.00 0.00 ? 38  LYS B HZ2  3  
ATOM 4939  H HZ3  . LYS B 2 40  ? 16.807  7.883   -7.874  1.00 0.00 ? 38  LYS B HZ3  3  
ATOM 4940  N N    . ASP B 2 41  ? 13.417  9.324   -10.028 1.00 0.00 ? 39  ASP B N    3  
ATOM 4941  C CA   . ASP B 2 41  ? 13.335  8.598   -11.288 1.00 0.00 ? 39  ASP B CA   3  
ATOM 4942  C C    . ASP B 2 41  ? 12.754  7.204   -11.092 1.00 0.00 ? 39  ASP B C    3  
ATOM 4943  O O    . ASP B 2 41  ? 12.363  6.543   -12.052 1.00 0.00 ? 39  ASP B O    3  
ATOM 4944  C CB   . ASP B 2 41  ? 14.741  8.475   -11.879 1.00 0.00 ? 39  ASP B CB   3  
ATOM 4945  C CG   . ASP B 2 41  ? 15.791  8.318   -10.793 1.00 0.00 ? 39  ASP B CG   3  
ATOM 4946  O OD1  . ASP B 2 41  ? 15.794  7.281   -10.093 1.00 0.00 ? 39  ASP B OD1  3  
ATOM 4947  O OD2  . ASP B 2 41  ? 16.585  9.257   -10.583 1.00 0.00 ? 39  ASP B OD2  3  
ATOM 4948  H H    . ASP B 2 41  ? 14.271  9.331   -9.557  1.00 0.00 ? 39  ASP B H    3  
ATOM 4949  H HA   . ASP B 2 41  ? 12.710  9.156   -11.968 1.00 0.00 ? 39  ASP B HA   3  
ATOM 4950  H HB2  . ASP B 2 41  ? 14.782  7.612   -12.527 1.00 0.00 ? 39  ASP B HB2  3  
ATOM 4951  H HB3  . ASP B 2 41  ? 14.968  9.364   -12.450 1.00 0.00 ? 39  ASP B HB3  3  
ATOM 4952  N N    . ARG B 2 42  ? 12.695  6.759   -9.846  1.00 0.00 ? 40  ARG B N    3  
ATOM 4953  C CA   . ARG B 2 42  ? 12.184  5.435   -9.551  1.00 0.00 ? 40  ARG B CA   3  
ATOM 4954  C C    . ARG B 2 42  ? 11.370  5.426   -8.265  1.00 0.00 ? 40  ARG B C    3  
ATOM 4955  O O    . ARG B 2 42  ? 11.545  6.285   -7.398  1.00 0.00 ? 40  ARG B O    3  
ATOM 4956  C CB   . ARG B 2 42  ? 13.346  4.440   -9.450  1.00 0.00 ? 40  ARG B CB   3  
ATOM 4957  C CG   . ARG B 2 42  ? 14.249  4.662   -8.245  1.00 0.00 ? 40  ARG B CG   3  
ATOM 4958  C CD   . ARG B 2 42  ? 14.092  3.550   -7.217  1.00 0.00 ? 40  ARG B CD   3  
ATOM 4959  N NE   . ARG B 2 42  ? 14.678  2.287   -7.674  1.00 0.00 ? 40  ARG B NE   3  
ATOM 4960  C CZ   . ARG B 2 42  ? 14.223  1.081   -7.321  1.00 0.00 ? 40  ARG B CZ   3  
ATOM 4961  N NH1  . ARG B 2 42  ? 13.139  0.966   -6.561  1.00 0.00 ? 40  ARG B NH1  3  
ATOM 4962  N NH2  . ARG B 2 42  ? 14.846  -0.014  -7.749  1.00 0.00 ? 40  ARG B NH2  3  
ATOM 4963  H H    . ARG B 2 42  ? 12.990  7.336   -9.117  1.00 0.00 ? 40  ARG B H    3  
ATOM 4964  H HA   . ARG B 2 42  ? 11.545  5.138   -10.368 1.00 0.00 ? 40  ARG B HA   3  
ATOM 4965  H HB2  . ARG B 2 42  ? 12.944  3.443   -9.390  1.00 0.00 ? 40  ARG B HB2  3  
ATOM 4966  H HB3  . ARG B 2 42  ? 13.949  4.525   -10.341 1.00 0.00 ? 40  ARG B HB3  3  
ATOM 4967  H HG2  . ARG B 2 42  ? 15.276  4.687   -8.577  1.00 0.00 ? 40  ARG B HG2  3  
ATOM 4968  H HG3  . ARG B 2 42  ? 13.994  5.605   -7.784  1.00 0.00 ? 40  ARG B HG3  3  
ATOM 4969  H HD2  . ARG B 2 42  ? 14.582  3.851   -6.302  1.00 0.00 ? 40  ARG B HD2  3  
ATOM 4970  H HD3  . ARG B 2 42  ? 13.039  3.400   -7.027  1.00 0.00 ? 40  ARG B HD3  3  
ATOM 4971  H HE   . ARG B 2 42  ? 15.460  2.347   -8.264  1.00 0.00 ? 40  ARG B HE   3  
ATOM 4972  H HH11 . ARG B 2 42  ? 12.647  1.792   -6.249  1.00 0.00 ? 40  ARG B HH11 3  
ATOM 4973  H HH12 . ARG B 2 42  ? 12.803  0.064   -6.290  1.00 0.00 ? 40  ARG B HH12 3  
ATOM 4974  H HH21 . ARG B 2 42  ? 15.654  0.062   -8.336  1.00 0.00 ? 40  ARG B HH21 3  
ATOM 4975  H HH22 . ARG B 2 42  ? 14.511  -0.921  -7.484  1.00 0.00 ? 40  ARG B HH22 3  
ATOM 4976  N N    . PHE B 2 43  ? 10.488  4.442   -8.151  1.00 0.00 ? 41  PHE B N    3  
ATOM 4977  C CA   . PHE B 2 43  ? 9.641   4.296   -6.977  1.00 0.00 ? 41  PHE B CA   3  
ATOM 4978  C C    . PHE B 2 43  ? 10.448  3.735   -5.813  1.00 0.00 ? 41  PHE B C    3  
ATOM 4979  O O    . PHE B 2 43  ? 11.182  2.757   -5.971  1.00 0.00 ? 41  PHE B O    3  
ATOM 4980  C CB   . PHE B 2 43  ? 8.463   3.358   -7.275  1.00 0.00 ? 41  PHE B CB   3  
ATOM 4981  C CG   . PHE B 2 43  ? 7.683   3.715   -8.510  1.00 0.00 ? 41  PHE B CG   3  
ATOM 4982  C CD1  . PHE B 2 43  ? 8.014   3.166   -9.739  1.00 0.00 ? 41  PHE B CD1  3  
ATOM 4983  C CD2  . PHE B 2 43  ? 6.615   4.594   -8.440  1.00 0.00 ? 41  PHE B CD2  3  
ATOM 4984  C CE1  . PHE B 2 43  ? 7.294   3.488   -10.875 1.00 0.00 ? 41  PHE B CE1  3  
ATOM 4985  C CE2  . PHE B 2 43  ? 5.895   4.920   -9.571  1.00 0.00 ? 41  PHE B CE2  3  
ATOM 4986  C CZ   . PHE B 2 43  ? 6.233   4.368   -10.790 1.00 0.00 ? 41  PHE B CZ   3  
ATOM 4987  H H    . PHE B 2 43  ? 10.403  3.795   -8.881  1.00 0.00 ? 41  PHE B H    3  
ATOM 4988  H HA   . PHE B 2 43  ? 9.263   5.270   -6.710  1.00 0.00 ? 41  PHE B HA   3  
ATOM 4989  H HB2  . PHE B 2 43  ? 8.838   2.354   -7.402  1.00 0.00 ? 41  PHE B HB2  3  
ATOM 4990  H HB3  . PHE B 2 43  ? 7.783   3.375   -6.436  1.00 0.00 ? 41  PHE B HB3  3  
ATOM 4991  H HD1  . PHE B 2 43  ? 8.844   2.479   -9.807  1.00 0.00 ? 41  PHE B HD1  3  
ATOM 4992  H HD2  . PHE B 2 43  ? 6.349   5.027   -7.487  1.00 0.00 ? 41  PHE B HD2  3  
ATOM 4993  H HE1  . PHE B 2 43  ? 7.563   3.055   -11.827 1.00 0.00 ? 41  PHE B HE1  3  
ATOM 4994  H HE2  . PHE B 2 43  ? 5.064   5.609   -9.503  1.00 0.00 ? 41  PHE B HE2  3  
ATOM 4995  H HZ   . PHE B 2 43  ? 5.668   4.623   -11.675 1.00 0.00 ? 41  PHE B HZ   3  
ATOM 4996  N N    . THR B 2 44  ? 10.330  4.363   -4.657  1.00 0.00 ? 42  THR B N    3  
ATOM 4997  C CA   . THR B 2 44  ? 11.034  3.906   -3.471  1.00 0.00 ? 42  THR B CA   3  
ATOM 4998  C C    . THR B 2 44  ? 10.145  2.960   -2.678  1.00 0.00 ? 42  THR B C    3  
ATOM 4999  O O    . THR B 2 44  ? 10.620  2.057   -1.993  1.00 0.00 ? 42  THR B O    3  
ATOM 5000  C CB   . THR B 2 44  ? 11.441  5.091   -2.581  1.00 0.00 ? 42  THR B CB   3  
ATOM 5001  O OG1  . THR B 2 44  ? 10.400  6.076   -2.588  1.00 0.00 ? 42  THR B OG1  3  
ATOM 5002  C CG2  . THR B 2 44  ? 12.739  5.716   -3.072  1.00 0.00 ? 42  THR B CG2  3  
ATOM 5003  H H    . THR B 2 44  ? 9.753   5.155   -4.594  1.00 0.00 ? 42  THR B H    3  
ATOM 5004  H HA   . THR B 2 44  ? 11.927  3.382   -3.783  1.00 0.00 ? 42  THR B HA   3  
ATOM 5005  H HB   . THR B 2 44  ? 11.587  4.735   -1.571  1.00 0.00 ? 42  THR B HB   3  
ATOM 5006  H HG1  . THR B 2 44  ? 10.223  6.362   -1.685  1.00 0.00 ? 42  THR B HG1  3  
ATOM 5007  H HG21 . THR B 2 44  ? 12.983  6.570   -2.456  1.00 0.00 ? 42  THR B HG21 3  
ATOM 5008  H HG22 . THR B 2 44  ? 12.622  6.034   -4.096  1.00 0.00 ? 42  THR B HG22 3  
ATOM 5009  H HG23 . THR B 2 44  ? 13.535  4.988   -3.008  1.00 0.00 ? 42  THR B HG23 3  
ATOM 5010  N N    . ILE B 2 45  ? 8.846   3.178   -2.801  1.00 0.00 ? 43  ILE B N    3  
ATOM 5011  C CA   . ILE B 2 45  ? 7.859   2.369   -2.113  1.00 0.00 ? 43  ILE B CA   3  
ATOM 5012  C C    . ILE B 2 45  ? 7.316   1.291   -3.041  1.00 0.00 ? 43  ILE B C    3  
ATOM 5013  O O    . ILE B 2 45  ? 6.846   1.590   -4.137  1.00 0.00 ? 43  ILE B O    3  
ATOM 5014  C CB   . ILE B 2 45  ? 6.693   3.246   -1.600  1.00 0.00 ? 43  ILE B CB   3  
ATOM 5015  C CG1  . ILE B 2 45  ? 7.148   4.087   -0.404  1.00 0.00 ? 43  ILE B CG1  3  
ATOM 5016  C CG2  . ILE B 2 45  ? 5.484   2.399   -1.231  1.00 0.00 ? 43  ILE B CG2  3  
ATOM 5017  C CD1  . ILE B 2 45  ? 7.684   3.268   0.750   1.00 0.00 ? 43  ILE B CD1  3  
ATOM 5018  H H    . ILE B 2 45  ? 8.539   3.910   -3.379  1.00 0.00 ? 43  ILE B H    3  
ATOM 5019  H HA   . ILE B 2 45  ? 8.336   1.901   -1.264  1.00 0.00 ? 43  ILE B HA   3  
ATOM 5020  H HB   . ILE B 2 45  ? 6.399   3.909   -2.399  1.00 0.00 ? 43  ILE B HB   3  
ATOM 5021  H HG12 . ILE B 2 45  ? 7.929   4.759   -0.723  1.00 0.00 ? 43  ILE B HG12 3  
ATOM 5022  H HG13 . ILE B 2 45  ? 6.309   4.663   -0.041  1.00 0.00 ? 43  ILE B HG13 3  
ATOM 5023  H HG21 . ILE B 2 45  ? 5.744   1.734   -0.421  1.00 0.00 ? 43  ILE B HG21 3  
ATOM 5024  H HG22 . ILE B 2 45  ? 5.176   1.820   -2.088  1.00 0.00 ? 43  ILE B HG22 3  
ATOM 5025  H HG23 . ILE B 2 45  ? 4.674   3.044   -0.921  1.00 0.00 ? 43  ILE B HG23 3  
ATOM 5026  H HD11 . ILE B 2 45  ? 6.920   2.588   1.094   1.00 0.00 ? 43  ILE B HD11 3  
ATOM 5027  H HD12 . ILE B 2 45  ? 7.968   3.928   1.557   1.00 0.00 ? 43  ILE B HD12 3  
ATOM 5028  H HD13 . ILE B 2 45  ? 8.547   2.708   0.424   1.00 0.00 ? 43  ILE B HD13 3  
ATOM 5029  N N    . SER B 2 46  ? 7.427   0.046   -2.614  1.00 0.00 ? 44  SER B N    3  
ATOM 5030  C CA   . SER B 2 46  ? 6.928   -1.080  -3.383  1.00 0.00 ? 44  SER B CA   3  
ATOM 5031  C C    . SER B 2 46  ? 6.464   -2.174  -2.430  1.00 0.00 ? 44  SER B C    3  
ATOM 5032  O O    . SER B 2 46  ? 7.280   -2.906  -1.871  1.00 0.00 ? 44  SER B O    3  
ATOM 5033  C CB   . SER B 2 46  ? 8.015   -1.613  -4.321  1.00 0.00 ? 44  SER B CB   3  
ATOM 5034  O OG   . SER B 2 46  ? 7.516   -2.645  -5.158  1.00 0.00 ? 44  SER B OG   3  
ATOM 5035  H H    . SER B 2 46  ? 7.856   -0.125  -1.750  1.00 0.00 ? 44  SER B H    3  
ATOM 5036  H HA   . SER B 2 46  ? 6.085   -0.741  -3.967  1.00 0.00 ? 44  SER B HA   3  
ATOM 5037  H HB2  . SER B 2 46  ? 8.376   -0.808  -4.944  1.00 0.00 ? 44  SER B HB2  3  
ATOM 5038  H HB3  . SER B 2 46  ? 8.832   -2.007  -3.735  1.00 0.00 ? 44  SER B HB3  3  
ATOM 5039  H HG   . SER B 2 46  ? 7.588   -3.488  -4.699  1.00 0.00 ? 44  SER B HG   3  
ATOM 5040  N N    . HIS B 2 47  ? 5.160   -2.273  -2.228  1.00 0.00 ? 45  HIS B N    3  
ATOM 5041  C CA   . HIS B 2 47  ? 4.614   -3.279  -1.327  1.00 0.00 ? 45  HIS B CA   3  
ATOM 5042  C C    . HIS B 2 47  ? 3.586   -4.140  -2.039  1.00 0.00 ? 45  HIS B C    3  
ATOM 5043  O O    . HIS B 2 47  ? 2.662   -3.624  -2.668  1.00 0.00 ? 45  HIS B O    3  
ATOM 5044  C CB   . HIS B 2 47  ? 3.960   -2.625  -0.107  1.00 0.00 ? 45  HIS B CB   3  
ATOM 5045  C CG   . HIS B 2 47  ? 4.836   -1.656  0.623   1.00 0.00 ? 45  HIS B CG   3  
ATOM 5046  N ND1  . HIS B 2 47  ? 5.836   -2.023  1.497   1.00 0.00 ? 45  HIS B ND1  3  
ATOM 5047  C CD2  . HIS B 2 47  ? 4.846   -0.302  0.590   1.00 0.00 ? 45  HIS B CD2  3  
ATOM 5048  C CE1  . HIS B 2 47  ? 6.410   -0.904  1.955   1.00 0.00 ? 45  HIS B CE1  3  
ATOM 5049  N NE2  . HIS B 2 47  ? 5.847   0.168   1.433   1.00 0.00 ? 45  HIS B NE2  3  
ATOM 5050  H H    . HIS B 2 47  ? 4.548   -1.657  -2.692  1.00 0.00 ? 45  HIS B H    3  
ATOM 5051  H HA   . HIS B 2 47  ? 5.428   -3.907  -0.997  1.00 0.00 ? 45  HIS B HA   3  
ATOM 5052  H HB2  . HIS B 2 47  ? 3.077   -2.091  -0.426  1.00 0.00 ? 45  HIS B HB2  3  
ATOM 5053  H HB3  . HIS B 2 47  ? 3.669   -3.399  0.590   1.00 0.00 ? 45  HIS B HB3  3  
ATOM 5054  H HD1  . HIS B 2 47  ? 6.078   -2.938  1.746   1.00 0.00 ? 45  HIS B HD1  3  
ATOM 5055  H HD2  . HIS B 2 47  ? 4.178   0.324   0.011   1.00 0.00 ? 45  HIS B HD2  3  
ATOM 5056  H HE1  . HIS B 2 47  ? 7.229   -0.882  2.659   1.00 0.00 ? 45  HIS B HE1  3  
ATOM 5057  N N    . MET B 2 48  ? 3.747   -5.450  -1.945  1.00 0.00 ? 46  MET B N    3  
ATOM 5058  C CA   . MET B 2 48  ? 2.813   -6.374  -2.564  1.00 0.00 ? 46  MET B CA   3  
ATOM 5059  C C    . MET B 2 48  ? 1.574   -6.496  -1.702  1.00 0.00 ? 46  MET B C    3  
ATOM 5060  O O    . MET B 2 48  ? 1.673   -6.541  -0.480  1.00 0.00 ? 46  MET B O    3  
ATOM 5061  C CB   . MET B 2 48  ? 3.445   -7.756  -2.758  1.00 0.00 ? 46  MET B CB   3  
ATOM 5062  C CG   . MET B 2 48  ? 4.130   -7.948  -4.100  1.00 0.00 ? 46  MET B CG   3  
ATOM 5063  S SD   . MET B 2 48  ? 5.207   -6.580  -4.562  1.00 0.00 ? 46  MET B SD   3  
ATOM 5064  C CE   . MET B 2 48  ? 5.521   -6.994  -6.274  1.00 0.00 ? 46  MET B CE   3  
ATOM 5065  H H    . MET B 2 48  ? 4.504   -5.807  -1.432  1.00 0.00 ? 46  MET B H    3  
ATOM 5066  H HA   . MET B 2 48  ? 2.533   -5.972  -3.526  1.00 0.00 ? 46  MET B HA   3  
ATOM 5067  H HB2  . MET B 2 48  ? 4.179   -7.914  -1.981  1.00 0.00 ? 46  MET B HB2  3  
ATOM 5068  H HB3  . MET B 2 48  ? 2.673   -8.505  -2.664  1.00 0.00 ? 46  MET B HB3  3  
ATOM 5069  H HG2  . MET B 2 48  ? 4.723   -8.849  -4.058  1.00 0.00 ? 46  MET B HG2  3  
ATOM 5070  H HG3  . MET B 2 48  ? 3.370   -8.059  -4.860  1.00 0.00 ? 46  MET B HG3  3  
ATOM 5071  H HE1  . MET B 2 48  ? 6.182   -6.258  -6.706  1.00 0.00 ? 46  MET B HE1  3  
ATOM 5072  H HE2  . MET B 2 48  ? 4.587   -7.002  -6.818  1.00 0.00 ? 46  MET B HE2  3  
ATOM 5073  H HE3  . MET B 2 48  ? 5.978   -7.970  -6.331  1.00 0.00 ? 46  MET B HE3  3  
ATOM 5074  N N    . TYR B 2 49  ? 0.413   -6.547  -2.338  1.00 0.00 ? 47  TYR B N    3  
ATOM 5075  C CA   . TYR B 2 49  ? -0.856  -6.674  -1.617  1.00 0.00 ? 47  TYR B CA   3  
ATOM 5076  C C    . TYR B 2 49  ? -0.867  -7.945  -0.772  1.00 0.00 ? 47  TYR B C    3  
ATOM 5077  O O    . TYR B 2 49  ? -1.568  -8.029  0.231   1.00 0.00 ? 47  TYR B O    3  
ATOM 5078  C CB   . TYR B 2 49  ? -2.009  -6.701  -2.617  1.00 0.00 ? 47  TYR B CB   3  
ATOM 5079  C CG   . TYR B 2 49  ? -2.163  -5.413  -3.389  1.00 0.00 ? 47  TYR B CG   3  
ATOM 5080  C CD1  . TYR B 2 49  ? -1.776  -4.201  -2.834  1.00 0.00 ? 47  TYR B CD1  3  
ATOM 5081  C CD2  . TYR B 2 49  ? -2.703  -5.407  -4.665  1.00 0.00 ? 47  TYR B CD2  3  
ATOM 5082  C CE1  . TYR B 2 49  ? -1.925  -3.020  -3.527  1.00 0.00 ? 47  TYR B CE1  3  
ATOM 5083  C CE2  . TYR B 2 49  ? -2.852  -4.229  -5.366  1.00 0.00 ? 47  TYR B CE2  3  
ATOM 5084  C CZ   . TYR B 2 49  ? -2.463  -3.037  -4.791  1.00 0.00 ? 47  TYR B CZ   3  
ATOM 5085  O OH   . TYR B 2 49  ? -2.612  -1.861  -5.484  1.00 0.00 ? 47  TYR B OH   3  
ATOM 5086  H H    . TYR B 2 49  ? 0.402   -6.501  -3.323  1.00 0.00 ? 47  TYR B H    3  
ATOM 5087  H HA   . TYR B 2 49  ? -0.980  -5.807  -0.956  1.00 0.00 ? 47  TYR B HA   3  
ATOM 5088  H HB2  . TYR B 2 49  ? -1.846  -7.498  -3.326  1.00 0.00 ? 47  TYR B HB2  3  
ATOM 5089  H HB3  . TYR B 2 49  ? -2.931  -6.882  -2.083  1.00 0.00 ? 47  TYR B HB3  3  
ATOM 5090  H HD1  . TYR B 2 49  ? -1.350  -4.192  -1.842  1.00 0.00 ? 47  TYR B HD1  3  
ATOM 5091  H HD2  . TYR B 2 49  ? -3.005  -6.343  -5.114  1.00 0.00 ? 47  TYR B HD2  3  
ATOM 5092  H HE1  . TYR B 2 49  ? -1.617  -2.088  -3.077  1.00 0.00 ? 47  TYR B HE1  3  
ATOM 5093  H HE2  . TYR B 2 49  ? -3.276  -4.241  -6.359  1.00 0.00 ? 47  TYR B HE2  3  
ATOM 5094  H HH   . TYR B 2 49  ? -2.432  -2.022  -6.422  1.00 0.00 ? 47  TYR B HH   3  
ATOM 5095  N N    . ALA B 2 50  ? -0.058  -8.917  -1.175  1.00 0.00 ? 48  ALA B N    3  
ATOM 5096  C CA   . ALA B 2 50  ? 0.039   -10.188 -0.470  1.00 0.00 ? 48  ALA B CA   3  
ATOM 5097  C C    . ALA B 2 50  ? 0.802   -10.044 0.844   1.00 0.00 ? 48  ALA B C    3  
ATOM 5098  O O    . ALA B 2 50  ? 0.845   -10.976 1.638   1.00 0.00 ? 48  ALA B O    3  
ATOM 5099  C CB   . ALA B 2 50  ? 0.711   -11.227 -1.356  1.00 0.00 ? 48  ALA B CB   3  
ATOM 5100  H H    . ALA B 2 50  ? 0.493   -8.774  -1.969  1.00 0.00 ? 48  ALA B H    3  
ATOM 5101  H HA   . ALA B 2 50  ? -0.963  -10.527 -0.258  1.00 0.00 ? 48  ALA B HA   3  
ATOM 5102  H HB1  . ALA B 2 50  ? 1.721   -10.914 -1.576  1.00 0.00 ? 48  ALA B HB1  3  
ATOM 5103  H HB2  . ALA B 2 50  ? 0.156   -11.326 -2.278  1.00 0.00 ? 48  ALA B HB2  3  
ATOM 5104  H HB3  . ALA B 2 50  ? 0.732   -12.177 -0.844  1.00 0.00 ? 48  ALA B HB3  3  
ATOM 5105  N N    . ASP B 2 51  ? 1.401   -8.873  1.053   1.00 0.00 ? 49  ASP B N    3  
ATOM 5106  C CA   . ASP B 2 51  ? 2.167   -8.575  2.256   1.00 0.00 ? 49  ASP B CA   3  
ATOM 5107  C C    . ASP B 2 51  ? 1.450   -7.531  3.091   1.00 0.00 ? 49  ASP B C    3  
ATOM 5108  O O    . ASP B 2 51  ? 1.818   -7.265  4.239   1.00 0.00 ? 49  ASP B O    3  
ATOM 5109  C CB   . ASP B 2 51  ? 3.541   -8.057  1.889   1.00 0.00 ? 49  ASP B CB   3  
ATOM 5110  C CG   . ASP B 2 51  ? 4.559   -9.165  1.727   1.00 0.00 ? 49  ASP B CG   3  
ATOM 5111  O OD1  . ASP B 2 51  ? 5.309   -9.431  2.690   1.00 0.00 ? 49  ASP B OD1  3  
ATOM 5112  O OD2  . ASP B 2 51  ? 4.592   -9.799  0.649   1.00 0.00 ? 49  ASP B OD2  3  
ATOM 5113  H H    . ASP B 2 51  ? 1.327   -8.184  0.375   1.00 0.00 ? 49  ASP B H    3  
ATOM 5114  H HA   . ASP B 2 51  ? 2.269   -9.482  2.833   1.00 0.00 ? 49  ASP B HA   3  
ATOM 5115  H HB2  . ASP B 2 51  ? 3.460   -7.522  0.962   1.00 0.00 ? 49  ASP B HB2  3  
ATOM 5116  H HB3  . ASP B 2 51  ? 3.877   -7.387  2.663   1.00 0.00 ? 49  ASP B HB3  3  
ATOM 5117  N N    . ILE B 2 52  ? 0.420   -6.941  2.514   1.00 0.00 ? 50  ILE B N    3  
ATOM 5118  C CA   . ILE B 2 52  ? -0.365  -5.949  3.216   1.00 0.00 ? 50  ILE B CA   3  
ATOM 5119  C C    . ILE B 2 52  ? -1.515  -6.677  3.892   1.00 0.00 ? 50  ILE B C    3  
ATOM 5120  O O    . ILE B 2 52  ? -2.204  -7.470  3.255   1.00 0.00 ? 50  ILE B O    3  
ATOM 5121  C CB   . ILE B 2 52  ? -0.955  -4.877  2.273   1.00 0.00 ? 50  ILE B CB   3  
ATOM 5122  C CG1  . ILE B 2 52  ? -0.039  -4.619  1.070   1.00 0.00 ? 50  ILE B CG1  3  
ATOM 5123  C CG2  . ILE B 2 52  ? -1.216  -3.589  3.033   1.00 0.00 ? 50  ILE B CG2  3  
ATOM 5124  C CD1  . ILE B 2 52  ? 1.125   -3.701  1.358   1.00 0.00 ? 50  ILE B CD1  3  
ATOM 5125  H H    . ILE B 2 52  ? 0.162   -7.205  1.605   1.00 0.00 ? 50  ILE B H    3  
ATOM 5126  H HA   . ILE B 2 52  ? 0.270   -5.468  3.961   1.00 0.00 ? 50  ILE B HA   3  
ATOM 5127  H HB   . ILE B 2 52  ? -1.905  -5.243  1.912   1.00 0.00 ? 50  ILE B HB   3  
ATOM 5128  H HG12 . ILE B 2 52  ? 0.364   -5.560  0.729   1.00 0.00 ? 50  ILE B HG12 3  
ATOM 5129  H HG13 . ILE B 2 52  ? -0.622  -4.177  0.276   1.00 0.00 ? 50  ILE B HG13 3  
ATOM 5130  H HG21 . ILE B 2 52  ? -0.290  -3.226  3.453   1.00 0.00 ? 50  ILE B HG21 3  
ATOM 5131  H HG22 . ILE B 2 52  ? -1.923  -3.777  3.827   1.00 0.00 ? 50  ILE B HG22 3  
ATOM 5132  H HG23 . ILE B 2 52  ? -1.620  -2.850  2.357   1.00 0.00 ? 50  ILE B HG23 3  
ATOM 5133  H HD11 . ILE B 2 52  ? 0.754   -2.727  1.640   1.00 0.00 ? 50  ILE B HD11 3  
ATOM 5134  H HD12 . ILE B 2 52  ? 1.737   -3.611  0.473   1.00 0.00 ? 50  ILE B HD12 3  
ATOM 5135  H HD13 . ILE B 2 52  ? 1.714   -4.109  2.165   1.00 0.00 ? 50  ILE B HD13 3  
ATOM 5136  N N    . LYS B 2 53  ? -1.726  -6.434  5.168   1.00 0.00 ? 51  LYS B N    3  
ATOM 5137  C CA   . LYS B 2 53  ? -2.795  -7.107  5.877   1.00 0.00 ? 51  LYS B CA   3  
ATOM 5138  C C    . LYS B 2 53  ? -4.074  -6.299  5.779   1.00 0.00 ? 51  LYS B C    3  
ATOM 5139  O O    . LYS B 2 53  ? -5.140  -6.824  5.483   1.00 0.00 ? 51  LYS B O    3  
ATOM 5140  C CB   . LYS B 2 53  ? -2.423  -7.313  7.339   1.00 0.00 ? 51  LYS B CB   3  
ATOM 5141  C CG   . LYS B 2 53  ? -3.506  -8.010  8.134   1.00 0.00 ? 51  LYS B CG   3  
ATOM 5142  C CD   . LYS B 2 53  ? -3.549  -7.493  9.552   1.00 0.00 ? 51  LYS B CD   3  
ATOM 5143  C CE   . LYS B 2 53  ? -4.933  -7.655  10.160  1.00 0.00 ? 51  LYS B CE   3  
ATOM 5144  N NZ   . LYS B 2 53  ? -5.235  -9.081  10.461  1.00 0.00 ? 51  LYS B NZ   3  
ATOM 5145  H H    . LYS B 2 53  ? -1.183  -5.764  5.635   1.00 0.00 ? 51  LYS B H    3  
ATOM 5146  H HA   . LYS B 2 53  ? -2.944  -8.072  5.418   1.00 0.00 ? 51  LYS B HA   3  
ATOM 5147  H HB2  . LYS B 2 53  ? -1.524  -7.910  7.391   1.00 0.00 ? 51  LYS B HB2  3  
ATOM 5148  H HB3  . LYS B 2 53  ? -2.234  -6.351  7.791   1.00 0.00 ? 51  LYS B HB3  3  
ATOM 5149  H HG2  . LYS B 2 53  ? -4.461  -7.827  7.663   1.00 0.00 ? 51  LYS B HG2  3  
ATOM 5150  H HG3  . LYS B 2 53  ? -3.306  -9.071  8.150   1.00 0.00 ? 51  LYS B HG3  3  
ATOM 5151  H HD2  . LYS B 2 53  ? -2.834  -8.047  10.141  1.00 0.00 ? 51  LYS B HD2  3  
ATOM 5152  H HD3  . LYS B 2 53  ? -3.283  -6.447  9.546   1.00 0.00 ? 51  LYS B HD3  3  
ATOM 5153  H HE2  . LYS B 2 53  ? -4.986  -7.079  11.072  1.00 0.00 ? 51  LYS B HE2  3  
ATOM 5154  H HE3  . LYS B 2 53  ? -5.667  -7.281  9.458   1.00 0.00 ? 51  LYS B HE3  3  
ATOM 5155  H HZ1  . LYS B 2 53  ? -4.360  -9.600  10.653  1.00 0.00 ? 51  LYS B HZ1  3  
ATOM 5156  H HZ2  . LYS B 2 53  ? -5.723  -9.531  9.652   1.00 0.00 ? 51  LYS B HZ2  3  
ATOM 5157  H HZ3  . LYS B 2 53  ? -5.852  -9.145  11.308  1.00 0.00 ? 51  LYS B HZ3  3  
ATOM 5158  N N    . CYS B 2 54  ? -3.943  -5.012  6.013   1.00 0.00 ? 52  CYS B N    3  
ATOM 5159  C CA   . CYS B 2 54  ? -5.055  -4.103  5.973   1.00 0.00 ? 52  CYS B CA   3  
ATOM 5160  C C    . CYS B 2 54  ? -4.532  -2.708  5.690   1.00 0.00 ? 52  CYS B C    3  
ATOM 5161  O O    . CYS B 2 54  ? -3.333  -2.523  5.482   1.00 0.00 ? 52  CYS B O    3  
ATOM 5162  C CB   . CYS B 2 54  ? -5.807  -4.149  7.301   1.00 0.00 ? 52  CYS B CB   3  
ATOM 5163  S SG   . CYS B 2 54  ? -4.747  -4.246  8.760   1.00 0.00 ? 52  CYS B SG   3  
ATOM 5164  H H    . CYS B 2 54  ? -3.055  -4.650  6.215   1.00 0.00 ? 52  CYS B H    3  
ATOM 5165  H HA   . CYS B 2 54  ? -5.714  -4.407  5.173   1.00 0.00 ? 52  CYS B HA   3  
ATOM 5166  H HB2  . CYS B 2 54  ? -6.411  -3.262  7.394   1.00 0.00 ? 52  CYS B HB2  3  
ATOM 5167  H HB3  . CYS B 2 54  ? -6.447  -5.018  7.304   1.00 0.00 ? 52  CYS B HB3  3  
ATOM 5168  H HG   . CYS B 2 54  ? -5.420  -3.712  9.782   1.00 0.00 ? 52  CYS B HG   3  
ATOM 5169  N N    . GLN B 2 55  ? -5.408  -1.730  5.659   1.00 0.00 ? 53  GLN B N    3  
ATOM 5170  C CA   . GLN B 2 55  ? -4.989  -0.373  5.394   1.00 0.00 ? 53  GLN B CA   3  
ATOM 5171  C C    . GLN B 2 55  ? -5.854  0.618   6.163   1.00 0.00 ? 53  GLN B C    3  
ATOM 5172  O O    . GLN B 2 55  ? -7.048  0.392   6.333   1.00 0.00 ? 53  GLN B O    3  
ATOM 5173  C CB   . GLN B 2 55  ? -5.049  -0.097  3.894   1.00 0.00 ? 53  GLN B CB   3  
ATOM 5174  C CG   . GLN B 2 55  ? -6.251  -0.720  3.195   1.00 0.00 ? 53  GLN B CG   3  
ATOM 5175  C CD   . GLN B 2 55  ? -7.432  0.221   3.072   1.00 0.00 ? 53  GLN B CD   3  
ATOM 5176  O OE1  . GLN B 2 55  ? -7.269  1.435   2.944   1.00 0.00 ? 53  GLN B OE1  3  
ATOM 5177  N NE2  . GLN B 2 55  ? -8.632  -0.335  3.108   1.00 0.00 ? 53  GLN B NE2  3  
ATOM 5178  H H    . GLN B 2 55  ? -6.356  -1.919  5.819   1.00 0.00 ? 53  GLN B H    3  
ATOM 5179  H HA   . GLN B 2 55  ? -3.963  -0.284  5.716   1.00 0.00 ? 53  GLN B HA   3  
ATOM 5180  H HB2  . GLN B 2 55  ? -5.075  0.972   3.739   1.00 0.00 ? 53  GLN B HB2  3  
ATOM 5181  H HB3  . GLN B 2 55  ? -4.153  -0.499  3.443   1.00 0.00 ? 53  GLN B HB3  3  
ATOM 5182  H HG2  . GLN B 2 55  ? -5.953  -1.025  2.204   1.00 0.00 ? 53  GLN B HG2  3  
ATOM 5183  H HG3  . GLN B 2 55  ? -6.561  -1.590  3.757   1.00 0.00 ? 53  GLN B HG3  3  
ATOM 5184  H HE21 . GLN B 2 55  ? -8.689  -1.319  3.217   1.00 0.00 ? 53  GLN B HE21 3  
ATOM 5185  H HE22 . GLN B 2 55  ? -9.412  0.245   3.026   1.00 0.00 ? 53  GLN B HE22 3  
ATOM 5186  N N    . LYS B 2 56  ? -5.253  1.697   6.651   1.00 0.00 ? 54  LYS B N    3  
ATOM 5187  C CA   . LYS B 2 56  ? -6.005  2.706   7.382   1.00 0.00 ? 54  LYS B CA   3  
ATOM 5188  C C    . LYS B 2 56  ? -6.132  3.966   6.550   1.00 0.00 ? 54  LYS B C    3  
ATOM 5189  O O    . LYS B 2 56  ? -5.320  4.224   5.665   1.00 0.00 ? 54  LYS B O    3  
ATOM 5190  C CB   . LYS B 2 56  ? -5.324  3.134   8.684   1.00 0.00 ? 54  LYS B CB   3  
ATOM 5191  C CG   . LYS B 2 56  ? -5.227  2.112   9.794   1.00 0.00 ? 54  LYS B CG   3  
ATOM 5192  C CD   . LYS B 2 56  ? -4.786  2.823   11.067  1.00 0.00 ? 54  LYS B CD   3  
ATOM 5193  C CE   . LYS B 2 56  ? -4.523  1.895   12.242  1.00 0.00 ? 54  LYS B CE   3  
ATOM 5194  N NZ   . LYS B 2 56  ? -3.666  0.738   11.868  1.00 0.00 ? 54  LYS B NZ   3  
ATOM 5195  H H    . LYS B 2 56  ? -4.290  1.831   6.494   1.00 0.00 ? 54  LYS B H    3  
ATOM 5196  H HA   . LYS B 2 56  ? -6.987  2.316   7.599   1.00 0.00 ? 54  LYS B HA   3  
ATOM 5197  H HB2  . LYS B 2 56  ? -4.322  3.457   8.456   1.00 0.00 ? 54  LYS B HB2  3  
ATOM 5198  H HB3  . LYS B 2 56  ? -5.867  3.983   9.072   1.00 0.00 ? 54  LYS B HB3  3  
ATOM 5199  H HG2  . LYS B 2 56  ? -6.190  1.654   9.947   1.00 0.00 ? 54  LYS B HG2  3  
ATOM 5200  H HG3  . LYS B 2 56  ? -4.492  1.367   9.530   1.00 0.00 ? 54  LYS B HG3  3  
ATOM 5201  H HD2  . LYS B 2 56  ? -3.879  3.367   10.853  1.00 0.00 ? 54  LYS B HD2  3  
ATOM 5202  H HD3  . LYS B 2 56  ? -5.559  3.527   11.346  1.00 0.00 ? 54  LYS B HD3  3  
ATOM 5203  H HE2  . LYS B 2 56  ? -4.023  2.463   13.018  1.00 0.00 ? 54  LYS B HE2  3  
ATOM 5204  H HE3  . LYS B 2 56  ? -5.467  1.534   12.618  1.00 0.00 ? 54  LYS B HE3  3  
ATOM 5205  H HZ1  . LYS B 2 56  ? -2.871  1.054   11.268  1.00 0.00 ? 54  LYS B HZ1  3  
ATOM 5206  H HZ2  . LYS B 2 56  ? -4.232  0.031   11.337  1.00 0.00 ? 54  LYS B HZ2  3  
ATOM 5207  H HZ3  . LYS B 2 56  ? -3.286  0.283   12.718  1.00 0.00 ? 54  LYS B HZ3  3  
ATOM 5208  N N    . ILE B 2 57  ? -7.146  4.748   6.853   1.00 0.00 ? 55  ILE B N    3  
ATOM 5209  C CA   . ILE B 2 57  ? -7.359  6.022   6.207   1.00 0.00 ? 55  ILE B CA   3  
ATOM 5210  C C    . ILE B 2 57  ? -7.625  7.043   7.308   1.00 0.00 ? 55  ILE B C    3  
ATOM 5211  O O    . ILE B 2 57  ? -8.406  6.782   8.227   1.00 0.00 ? 55  ILE B O    3  
ATOM 5212  C CB   . ILE B 2 57  ? -8.523  5.999   5.167   1.00 0.00 ? 55  ILE B CB   3  
ATOM 5213  C CG1  . ILE B 2 57  ? -9.874  6.370   5.783   1.00 0.00 ? 55  ILE B CG1  3  
ATOM 5214  C CG2  . ILE B 2 57  ? -8.626  4.628   4.519   1.00 0.00 ? 55  ILE B CG2  3  
ATOM 5215  C CD1  . ILE B 2 57  ? -10.843 6.955   4.775   1.00 0.00 ? 55  ILE B CD1  3  
ATOM 5216  H H    . ILE B 2 57  ? -7.791  4.448   7.535   1.00 0.00 ? 55  ILE B H    3  
ATOM 5217  H HA   . ILE B 2 57  ? -6.443  6.291   5.696   1.00 0.00 ? 55  ILE B HA   3  
ATOM 5218  H HB   . ILE B 2 57  ? -8.285  6.711   4.391   1.00 0.00 ? 55  ILE B HB   3  
ATOM 5219  H HG12 . ILE B 2 57  ? -10.327 5.485   6.206   1.00 0.00 ? 55  ILE B HG12 3  
ATOM 5220  H HG13 . ILE B 2 57  ? -9.721  7.100   6.564   1.00 0.00 ? 55  ILE B HG13 3  
ATOM 5221  H HG21 . ILE B 2 57  ? -7.699  4.396   4.015   1.00 0.00 ? 55  ILE B HG21 3  
ATOM 5222  H HG22 . ILE B 2 57  ? -9.435  4.628   3.804   1.00 0.00 ? 55  ILE B HG22 3  
ATOM 5223  H HG23 . ILE B 2 57  ? -8.817  3.884   5.279   1.00 0.00 ? 55  ILE B HG23 3  
ATOM 5224  H HD11 . ILE B 2 57  ? -11.788 7.158   5.255   1.00 0.00 ? 55  ILE B HD11 3  
ATOM 5225  H HD12 . ILE B 2 57  ? -10.990 6.252   3.967   1.00 0.00 ? 55  ILE B HD12 3  
ATOM 5226  H HD13 . ILE B 2 57  ? -10.434 7.876   4.379   1.00 0.00 ? 55  ILE B HD13 3  
ATOM 5227  N N    . SER B 2 58  ? -6.929  8.163   7.279   1.00 0.00 ? 56  SER B N    3  
ATOM 5228  C CA   . SER B 2 58  ? -7.132  9.167   8.297   1.00 0.00 ? 56  SER B CA   3  
ATOM 5229  C C    . SER B 2 58  ? -8.230  10.101  7.831   1.00 0.00 ? 56  SER B C    3  
ATOM 5230  O O    . SER B 2 58  ? -8.105  10.765  6.779   1.00 0.00 ? 56  SER B O    3  
ATOM 5231  C CB   . SER B 2 58  ? -5.838  9.915   8.625   1.00 0.00 ? 56  SER B CB   3  
ATOM 5232  O OG   . SER B 2 58  ? -5.674  11.069  7.834   1.00 0.00 ? 56  SER B OG   3  
ATOM 5233  H H    . SER B 2 58  ? -6.288  8.326   6.552   1.00 0.00 ? 56  SER B H    3  
ATOM 5234  H HA   . SER B 2 58  ? -7.476  8.657   9.186   1.00 0.00 ? 56  SER B HA   3  
ATOM 5235  H HB2  . SER B 2 58  ? -5.847  10.201  9.657   1.00 0.00 ? 56  SER B HB2  3  
ATOM 5236  H HB3  . SER B 2 58  ? -5.000  9.257   8.449   1.00 0.00 ? 56  SER B HB3  3  
ATOM 5237  H HG   . SER B 2 58  ? -6.300  11.747  8.122   1.00 0.00 ? 56  SER B HG   3  
ATOM 5238  N N    . PRO B 2 59  ? -9.319  10.113  8.618   1.00 0.00 ? 57  PRO B N    3  
ATOM 5239  C CA   . PRO B 2 59  ? -10.542 10.886  8.365   1.00 0.00 ? 57  PRO B CA   3  
ATOM 5240  C C    . PRO B 2 59  ? -10.391 12.386  8.554   1.00 0.00 ? 57  PRO B C    3  
ATOM 5241  O O    . PRO B 2 59  ? -9.343  12.879  8.977   1.00 0.00 ? 57  PRO B O    3  
ATOM 5242  C CB   . PRO B 2 59  ? -11.514 10.337  9.411   1.00 0.00 ? 57  PRO B CB   3  
ATOM 5243  C CG   . PRO B 2 59  ? -10.635 9.934   10.538  1.00 0.00 ? 57  PRO B CG   3  
ATOM 5244  C CD   . PRO B 2 59  ? -9.415  9.363   9.887   1.00 0.00 ? 57  PRO B CD   3  
ATOM 5245  H HA   . PRO B 2 59  ? -10.935 10.686  7.381   1.00 0.00 ? 57  PRO B HA   3  
ATOM 5246  H HB2  . PRO B 2 59  ? -12.210 11.110  9.704   1.00 0.00 ? 57  PRO B HB2  3  
ATOM 5247  H HB3  . PRO B 2 59  ? -12.051 9.492   9.006   1.00 0.00 ? 57  PRO B HB3  3  
ATOM 5248  H HG2  . PRO B 2 59  ? -10.372 10.798  11.133  1.00 0.00 ? 57  PRO B HG2  3  
ATOM 5249  H HG3  . PRO B 2 59  ? -11.121 9.187   11.147  1.00 0.00 ? 57  PRO B HG3  3  
ATOM 5250  H HD2  . PRO B 2 59  ? -8.545  9.532   10.503  1.00 0.00 ? 57  PRO B HD2  3  
ATOM 5251  H HD3  . PRO B 2 59  ? -9.548  8.307   9.700   1.00 0.00 ? 57  PRO B HD3  3  
ATOM 5252  N N    . GLU B 2 60  ? -11.455 13.096  8.194   1.00 0.00 ? 58  GLU B N    3  
ATOM 5253  C CA   . GLU B 2 60  ? -11.514 14.540  8.328   1.00 0.00 ? 58  GLU B CA   3  
ATOM 5254  C C    . GLU B 2 60  ? -11.310 14.940  9.787   1.00 0.00 ? 58  GLU B C    3  
ATOM 5255  O O    . GLU B 2 60  ? -11.512 14.141  10.702  1.00 0.00 ? 58  GLU B O    3  
ATOM 5256  C CB   . GLU B 2 60  ? -12.858 15.077  7.822   1.00 0.00 ? 58  GLU B CB   3  
ATOM 5257  C CG   . GLU B 2 60  ? -13.372 14.391  6.561   1.00 0.00 ? 58  GLU B CG   3  
ATOM 5258  C CD   . GLU B 2 60  ? -12.295 14.191  5.512   1.00 0.00 ? 58  GLU B CD   3  
ATOM 5259  O OE1  . GLU B 2 60  ? -11.983 13.020  5.200   1.00 0.00 ? 58  GLU B OE1  3  
ATOM 5260  O OE2  . GLU B 2 60  ? -11.756 15.195  5.011   1.00 0.00 ? 58  GLU B OE2  3  
ATOM 5261  H H    . GLU B 2 60  ? -12.223 12.629  7.813   1.00 0.00 ? 58  GLU B H    3  
ATOM 5262  H HA   . GLU B 2 60  ? -10.717 14.963  7.733   1.00 0.00 ? 58  GLU B HA   3  
ATOM 5263  H HB2  . GLU B 2 60  ? -13.597 14.947  8.599   1.00 0.00 ? 58  GLU B HB2  3  
ATOM 5264  H HB3  . GLU B 2 60  ? -12.753 16.131  7.612   1.00 0.00 ? 58  GLU B HB3  3  
ATOM 5265  H HG2  . GLU B 2 60  ? -13.771 13.424  6.832   1.00 0.00 ? 58  GLU B HG2  3  
ATOM 5266  H HG3  . GLU B 2 60  ? -14.160 14.995  6.136   1.00 0.00 ? 58  GLU B HG3  3  
ATOM 5267  N N    . GLY B 2 61  ? -10.947 16.189  9.994   1.00 0.00 ? 59  GLY B N    3  
ATOM 5268  C CA   . GLY B 2 61  ? -10.679 16.683  11.329  1.00 0.00 ? 59  GLY B CA   3  
ATOM 5269  C C    . GLY B 2 61  ? -9.219  17.031  11.454  1.00 0.00 ? 59  GLY B C    3  
ATOM 5270  O O    . GLY B 2 61  ? -8.837  17.923  12.210  1.00 0.00 ? 59  GLY B O    3  
ATOM 5271  H H    . GLY B 2 61  ? -10.844 16.789  9.226   1.00 0.00 ? 59  GLY B H    3  
ATOM 5272  H HA2  . GLY B 2 61  ? -11.278 17.564  11.513  1.00 0.00 ? 59  GLY B HA2  3  
ATOM 5273  H HA3  . GLY B 2 61  ? -10.926 15.921  12.051  1.00 0.00 ? 59  GLY B HA3  3  
ATOM 5274  N N    . LYS B 2 62  ? -8.407  16.322  10.688  1.00 0.00 ? 60  LYS B N    3  
ATOM 5275  C CA   . LYS B 2 62  ? -6.986  16.581  10.634  1.00 0.00 ? 60  LYS B CA   3  
ATOM 5276  C C    . LYS B 2 62  ? -6.743  17.565  9.514   1.00 0.00 ? 60  LYS B C    3  
ATOM 5277  O O    . LYS B 2 62  ? -7.496  17.602  8.541   1.00 0.00 ? 60  LYS B O    3  
ATOM 5278  C CB   . LYS B 2 62  ? -6.184  15.296  10.381  1.00 0.00 ? 60  LYS B CB   3  
ATOM 5279  C CG   . LYS B 2 62  ? -5.761  14.568  11.647  1.00 0.00 ? 60  LYS B CG   3  
ATOM 5280  C CD   . LYS B 2 62  ? -4.879  13.358  11.342  1.00 0.00 ? 60  LYS B CD   3  
ATOM 5281  C CE   . LYS B 2 62  ? -4.310  12.738  12.611  1.00 0.00 ? 60  LYS B CE   3  
ATOM 5282  N NZ   . LYS B 2 62  ? -5.094  13.110  13.820  1.00 0.00 ? 60  LYS B NZ   3  
ATOM 5283  H H    . LYS B 2 62  ? -8.780  15.600  10.141  1.00 0.00 ? 60  LYS B H    3  
ATOM 5284  H HA   . LYS B 2 62  ? -6.677  17.031  11.567  1.00 0.00 ? 60  LYS B HA   3  
ATOM 5285  H HB2  . LYS B 2 62  ? -6.787  14.622  9.792   1.00 0.00 ? 60  LYS B HB2  3  
ATOM 5286  H HB3  . LYS B 2 62  ? -5.294  15.547  9.822   1.00 0.00 ? 60  LYS B HB3  3  
ATOM 5287  H HG2  . LYS B 2 62  ? -5.208  15.252  12.275  1.00 0.00 ? 60  LYS B HG2  3  
ATOM 5288  H HG3  . LYS B 2 62  ? -6.645  14.235  12.169  1.00 0.00 ? 60  LYS B HG3  3  
ATOM 5289  H HD2  . LYS B 2 62  ? -5.468  12.613  10.828  1.00 0.00 ? 60  LYS B HD2  3  
ATOM 5290  H HD3  . LYS B 2 62  ? -4.060  13.669  10.710  1.00 0.00 ? 60  LYS B HD3  3  
ATOM 5291  H HE2  . LYS B 2 62  ? -4.312  11.662  12.507  1.00 0.00 ? 60  LYS B HE2  3  
ATOM 5292  H HE3  . LYS B 2 62  ? -3.289  13.079  12.735  1.00 0.00 ? 60  LYS B HE3  3  
ATOM 5293  H HZ1  . LYS B 2 62  ? -4.837  12.485  14.620  1.00 0.00 ? 60  LYS B HZ1  3  
ATOM 5294  H HZ2  . LYS B 2 62  ? -6.117  13.008  13.628  1.00 0.00 ? 60  LYS B HZ2  3  
ATOM 5295  H HZ3  . LYS B 2 62  ? -4.893  14.100  14.086  1.00 0.00 ? 60  LYS B HZ3  3  
ATOM 5296  N N    . ALA B 2 63  ? -5.709  18.369  9.648   1.00 0.00 ? 61  ALA B N    3  
ATOM 5297  C CA   . ALA B 2 63  ? -5.378  19.348  8.626   1.00 0.00 ? 61  ALA B CA   3  
ATOM 5298  C C    . ALA B 2 63  ? -4.853  18.667  7.382   1.00 0.00 ? 61  ALA B C    3  
ATOM 5299  O O    . ALA B 2 63  ? -4.580  19.311  6.373   1.00 0.00 ? 61  ALA B O    3  
ATOM 5300  C CB   . ALA B 2 63  ? -4.341  20.309  9.146   1.00 0.00 ? 61  ALA B CB   3  
ATOM 5301  H H    . ALA B 2 63  ? -5.160  18.312  10.457  1.00 0.00 ? 61  ALA B H    3  
ATOM 5302  H HA   . ALA B 2 63  ? -6.271  19.901  8.376   1.00 0.00 ? 61  ALA B HA   3  
ATOM 5303  H HB1  . ALA B 2 63  ? -3.411  19.779  9.292   1.00 0.00 ? 61  ALA B HB1  3  
ATOM 5304  H HB2  . ALA B 2 63  ? -4.675  20.720  10.085  1.00 0.00 ? 61  ALA B HB2  3  
ATOM 5305  H HB3  . ALA B 2 63  ? -4.198  21.099  8.429   1.00 0.00 ? 61  ALA B HB3  3  
ATOM 5306  N N    . LYS B 2 64  ? -4.707  17.363  7.468   1.00 0.00 ? 62  LYS B N    3  
ATOM 5307  C CA   . LYS B 2 64  ? -4.206  16.598  6.365   1.00 0.00 ? 62  LYS B CA   3  
ATOM 5308  C C    . LYS B 2 64  ? -4.930  15.264  6.261   1.00 0.00 ? 62  LYS B C    3  
ATOM 5309  O O    . LYS B 2 64  ? -5.283  14.658  7.274   1.00 0.00 ? 62  LYS B O    3  
ATOM 5310  C CB   . LYS B 2 64  ? -2.709  16.359  6.527   1.00 0.00 ? 62  LYS B CB   3  
ATOM 5311  C CG   . LYS B 2 64  ? -2.332  15.748  7.867   1.00 0.00 ? 62  LYS B CG   3  
ATOM 5312  C CD   . LYS B 2 64  ? -1.713  16.779  8.792   1.00 0.00 ? 62  LYS B CD   3  
ATOM 5313  C CE   . LYS B 2 64  ? -1.432  16.193  10.162  1.00 0.00 ? 62  LYS B CE   3  
ATOM 5314  N NZ   . LYS B 2 64  ? -0.776  17.176  11.062  1.00 0.00 ? 62  LYS B NZ   3  
ATOM 5315  H H    . LYS B 2 64  ? -4.967  16.902  8.291   1.00 0.00 ? 62  LYS B H    3  
ATOM 5316  H HA   . LYS B 2 64  ? -4.375  17.177  5.475   1.00 0.00 ? 62  LYS B HA   3  
ATOM 5317  H HB2  . LYS B 2 64  ? -2.376  15.693  5.746   1.00 0.00 ? 62  LYS B HB2  3  
ATOM 5318  H HB3  . LYS B 2 64  ? -2.193  17.301  6.429   1.00 0.00 ? 62  LYS B HB3  3  
ATOM 5319  H HG2  . LYS B 2 64  ? -3.220  15.349  8.333   1.00 0.00 ? 62  LYS B HG2  3  
ATOM 5320  H HG3  . LYS B 2 64  ? -1.621  14.951  7.702   1.00 0.00 ? 62  LYS B HG3  3  
ATOM 5321  H HD2  . LYS B 2 64  ? -0.785  17.125  8.362   1.00 0.00 ? 62  LYS B HD2  3  
ATOM 5322  H HD3  . LYS B 2 64  ? -2.395  17.610  8.897   1.00 0.00 ? 62  LYS B HD3  3  
ATOM 5323  H HE2  . LYS B 2 64  ? -2.367  15.881  10.605  1.00 0.00 ? 62  LYS B HE2  3  
ATOM 5324  H HE3  . LYS B 2 64  ? -0.786  15.335  10.047  1.00 0.00 ? 62  LYS B HE3  3  
ATOM 5325  H HZ1  . LYS B 2 64  ? -1.147  18.127  10.885  1.00 0.00 ? 62  LYS B HZ1  3  
ATOM 5326  H HZ2  . LYS B 2 64  ? 0.259   17.182  10.895  1.00 0.00 ? 62  LYS B HZ2  3  
ATOM 5327  H HZ3  . LYS B 2 64  ? -0.960  16.922  12.063  1.00 0.00 ? 62  LYS B HZ3  3  
ATOM 5328  N N    . ILE B 2 65  ? -5.149  14.822  5.040   1.00 0.00 ? 63  ILE B N    3  
ATOM 5329  C CA   . ILE B 2 65  ? -5.802  13.551  4.785   1.00 0.00 ? 63  ILE B CA   3  
ATOM 5330  C C    . ILE B 2 65  ? -4.722  12.478  4.698   1.00 0.00 ? 63  ILE B C    3  
ATOM 5331  O O    . ILE B 2 65  ? -3.684  12.710  4.090   1.00 0.00 ? 63  ILE B O    3  
ATOM 5332  C CB   . ILE B 2 65  ? -6.618  13.617  3.475   1.00 0.00 ? 63  ILE B CB   3  
ATOM 5333  C CG1  . ILE B 2 65  ? -7.859  14.491  3.674   1.00 0.00 ? 63  ILE B CG1  3  
ATOM 5334  C CG2  . ILE B 2 65  ? -7.017  12.232  3.003   1.00 0.00 ? 63  ILE B CG2  3  
ATOM 5335  C CD1  . ILE B 2 65  ? -7.696  15.916  3.189   1.00 0.00 ? 63  ILE B CD1  3  
ATOM 5336  H H    . ILE B 2 65  ? -4.847  15.360  4.280   1.00 0.00 ? 63  ILE B H    3  
ATOM 5337  H HA   . ILE B 2 65  ? -6.466  13.330  5.609   1.00 0.00 ? 63  ILE B HA   3  
ATOM 5338  H HB   . ILE B 2 65  ? -5.995  14.062  2.714   1.00 0.00 ? 63  ILE B HB   3  
ATOM 5339  H HG12 . ILE B 2 65  ? -8.687  14.054  3.136   1.00 0.00 ? 63  ILE B HG12 3  
ATOM 5340  H HG13 . ILE B 2 65  ? -8.101  14.524  4.726   1.00 0.00 ? 63  ILE B HG13 3  
ATOM 5341  H HG21 . ILE B 2 65  ? -7.612  11.750  3.764   1.00 0.00 ? 63  ILE B HG21 3  
ATOM 5342  H HG22 . ILE B 2 65  ? -6.129  11.646  2.816   1.00 0.00 ? 63  ILE B HG22 3  
ATOM 5343  H HG23 . ILE B 2 65  ? -7.594  12.313  2.093   1.00 0.00 ? 63  ILE B HG23 3  
ATOM 5344  H HD11 . ILE B 2 65  ? -8.604  16.468  3.384   1.00 0.00 ? 63  ILE B HD11 3  
ATOM 5345  H HD12 . ILE B 2 65  ? -7.498  15.915  2.128   1.00 0.00 ? 63  ILE B HD12 3  
ATOM 5346  H HD13 . ILE B 2 65  ? -6.872  16.382  3.709   1.00 0.00 ? 63  ILE B HD13 3  
ATOM 5347  N N    . GLN B 2 66  ? -4.926  11.315  5.309   1.00 0.00 ? 64  GLN B N    3  
ATOM 5348  C CA   . GLN B 2 66  ? -3.867  10.297  5.281   1.00 0.00 ? 64  GLN B CA   3  
ATOM 5349  C C    . GLN B 2 66  ? -4.375  8.889   5.044   1.00 0.00 ? 64  GLN B C    3  
ATOM 5350  O O    . GLN B 2 66  ? -5.563  8.606   5.139   1.00 0.00 ? 64  GLN B O    3  
ATOM 5351  C CB   . GLN B 2 66  ? -3.065  10.287  6.581   1.00 0.00 ? 64  GLN B CB   3  
ATOM 5352  C CG   . GLN B 2 66  ? -2.491  11.626  6.991   1.00 0.00 ? 64  GLN B CG   3  
ATOM 5353  C CD   . GLN B 2 66  ? -1.913  11.580  8.387   1.00 0.00 ? 64  GLN B CD   3  
ATOM 5354  O OE1  . GLN B 2 66  ? -0.987  12.324  8.711   1.00 0.00 ? 64  GLN B OE1  3  
ATOM 5355  N NE2  . GLN B 2 66  ? -2.453  10.694  9.223   1.00 0.00 ? 64  GLN B NE2  3  
ATOM 5356  H H    . GLN B 2 66  ? -5.775  11.143  5.797   1.00 0.00 ? 64  GLN B H    3  
ATOM 5357  H HA   . GLN B 2 66  ? -3.197  10.554  4.476   1.00 0.00 ? 64  GLN B HA   3  
ATOM 5358  H HB2  . GLN B 2 66  ? -3.708  9.944   7.378   1.00 0.00 ? 64  GLN B HB2  3  
ATOM 5359  H HB3  . GLN B 2 66  ? -2.247  9.589   6.473   1.00 0.00 ? 64  GLN B HB3  3  
ATOM 5360  H HG2  . GLN B 2 66  ? -1.707  11.899  6.298   1.00 0.00 ? 64  GLN B HG2  3  
ATOM 5361  H HG3  . GLN B 2 66  ? -3.274  12.369  6.962   1.00 0.00 ? 64  GLN B HG3  3  
ATOM 5362  H HE21 . GLN B 2 66  ? -3.184  10.127  8.893   1.00 0.00 ? 64  GLN B HE21 3  
ATOM 5363  H HE22 . GLN B 2 66  ? -2.106  10.654  10.142  1.00 0.00 ? 64  GLN B HE22 3  
ATOM 5364  N N    . LEU B 2 67  ? -3.441  8.032   4.675   1.00 0.00 ? 65  LEU B N    3  
ATOM 5365  C CA   . LEU B 2 67  ? -3.693  6.624   4.453   1.00 0.00 ? 65  LEU B CA   3  
ATOM 5366  C C    . LEU B 2 67  ? -2.500  5.842   4.992   1.00 0.00 ? 65  LEU B C    3  
ATOM 5367  O O    . LEU B 2 67  ? -1.423  6.401   5.106   1.00 0.00 ? 65  LEU B O    3  
ATOM 5368  C CB   . LEU B 2 67  ? -3.827  6.329   2.970   1.00 0.00 ? 65  LEU B CB   3  
ATOM 5369  C CG   . LEU B 2 67  ? -4.617  5.074   2.635   1.00 0.00 ? 65  LEU B CG   3  
ATOM 5370  C CD1  . LEU B 2 67  ? -6.081  5.409   2.430   1.00 0.00 ? 65  LEU B CD1  3  
ATOM 5371  C CD2  . LEU B 2 67  ? -4.031  4.386   1.424   1.00 0.00 ? 65  LEU B CD2  3  
ATOM 5372  H H    . LEU B 2 67  ? -2.528  8.367   4.527   1.00 0.00 ? 65  LEU B H    3  
ATOM 5373  H HA   . LEU B 2 67  ? -4.595  6.346   4.983   1.00 0.00 ? 65  LEU B HA   3  
ATOM 5374  H HB2  . LEU B 2 67  ? -4.308  7.174   2.501   1.00 0.00 ? 65  LEU B HB2  3  
ATOM 5375  H HB3  . LEU B 2 67  ? -2.835  6.225   2.556   1.00 0.00 ? 65  LEU B HB3  3  
ATOM 5376  H HG   . LEU B 2 67  ? -4.552  4.390   3.469   1.00 0.00 ? 65  LEU B HG   3  
ATOM 5377  H HD11 . LEU B 2 67  ? -6.481  5.845   3.334   1.00 0.00 ? 65  LEU B HD11 3  
ATOM 5378  H HD12 . LEU B 2 67  ? -6.628  4.509   2.191   1.00 0.00 ? 65  LEU B HD12 3  
ATOM 5379  H HD13 . LEU B 2 67  ? -6.179  6.115   1.617   1.00 0.00 ? 65  LEU B HD13 3  
ATOM 5380  H HD21 . LEU B 2 67  ? -3.001  4.126   1.621   1.00 0.00 ? 65  LEU B HD21 3  
ATOM 5381  H HD22 . LEU B 2 67  ? -4.079  5.050   0.573   1.00 0.00 ? 65  LEU B HD22 3  
ATOM 5382  H HD23 . LEU B 2 67  ? -4.594  3.489   1.212   1.00 0.00 ? 65  LEU B HD23 3  
ATOM 5383  N N    . GLN B 2 68  ? -2.679  4.592   5.384   1.00 0.00 ? 66  GLN B N    3  
ATOM 5384  C CA   . GLN B 2 68  ? -1.547  3.811   5.870   1.00 0.00 ? 66  GLN B CA   3  
ATOM 5385  C C    . GLN B 2 68  ? -1.696  2.339   5.506   1.00 0.00 ? 66  GLN B C    3  
ATOM 5386  O O    . GLN B 2 68  ? -2.797  1.796   5.496   1.00 0.00 ? 66  GLN B O    3  
ATOM 5387  C CB   . GLN B 2 68  ? -1.356  3.971   7.384   1.00 0.00 ? 66  GLN B CB   3  
ATOM 5388  C CG   . GLN B 2 68  ? -2.109  2.952   8.217   1.00 0.00 ? 66  GLN B CG   3  
ATOM 5389  C CD   . GLN B 2 68  ? -1.688  2.941   9.673   1.00 0.00 ? 66  GLN B CD   3  
ATOM 5390  O OE1  . GLN B 2 68  ? -1.722  1.900   10.326  1.00 0.00 ? 66  GLN B OE1  3  
ATOM 5391  N NE2  . GLN B 2 68  ? -1.320  4.094   10.203  1.00 0.00 ? 66  GLN B NE2  3  
ATOM 5392  H H    . GLN B 2 68  ? -3.577  4.186   5.341   1.00 0.00 ? 66  GLN B H    3  
ATOM 5393  H HA   . GLN B 2 68  ? -0.665  4.189   5.373   1.00 0.00 ? 66  GLN B HA   3  
ATOM 5394  H HB2  . GLN B 2 68  ? -0.304  3.881   7.612   1.00 0.00 ? 66  GLN B HB2  3  
ATOM 5395  H HB3  . GLN B 2 68  ? -1.692  4.957   7.673   1.00 0.00 ? 66  GLN B HB3  3  
ATOM 5396  H HG2  . GLN B 2 68  ? -3.163  3.179   8.169   1.00 0.00 ? 66  GLN B HG2  3  
ATOM 5397  H HG3  . GLN B 2 68  ? -1.935  1.971   7.802   1.00 0.00 ? 66  GLN B HG3  3  
ATOM 5398  H HE21 . GLN B 2 68  ? -1.339  4.893   9.638   1.00 0.00 ? 66  GLN B HE21 3  
ATOM 5399  H HE22 . GLN B 2 68  ? -1.020  4.097   11.140  1.00 0.00 ? 66  GLN B HE22 3  
ATOM 5400  N N    . LEU B 2 69  ? -0.579  1.713   5.195   1.00 0.00 ? 67  LEU B N    3  
ATOM 5401  C CA   . LEU B 2 69  ? -0.547  0.305   4.843   1.00 0.00 ? 67  LEU B CA   3  
ATOM 5402  C C    . LEU B 2 69  ? -0.197  -0.529  6.059   1.00 0.00 ? 67  LEU B C    3  
ATOM 5403  O O    . LEU B 2 69  ? 0.931   -0.494  6.531   1.00 0.00 ? 67  LEU B O    3  
ATOM 5404  C CB   . LEU B 2 69  ? 0.499   0.050   3.763   1.00 0.00 ? 67  LEU B CB   3  
ATOM 5405  C CG   . LEU B 2 69  ? 0.179   0.596   2.378   1.00 0.00 ? 67  LEU B CG   3  
ATOM 5406  C CD1  . LEU B 2 69  ? 1.339   0.316   1.439   1.00 0.00 ? 67  LEU B CD1  3  
ATOM 5407  C CD2  . LEU B 2 69  ? -1.106  -0.017  1.844   1.00 0.00 ? 67  LEU B CD2  3  
ATOM 5408  H H    . LEU B 2 69  ? 0.265   2.220   5.194   1.00 0.00 ? 67  LEU B H    3  
ATOM 5409  H HA   . LEU B 2 69  ? -1.521  0.020   4.477   1.00 0.00 ? 67  LEU B HA   3  
ATOM 5410  H HB2  . LEU B 2 69  ? 1.429   0.488   4.089   1.00 0.00 ? 67  LEU B HB2  3  
ATOM 5411  H HB3  . LEU B 2 69  ? 0.637   -1.014  3.680   1.00 0.00 ? 67  LEU B HB3  3  
ATOM 5412  H HG   . LEU B 2 69  ? 0.045   1.666   2.439   1.00 0.00 ? 67  LEU B HG   3  
ATOM 5413  H HD11 . LEU B 2 69  ? 2.238   0.768   1.833   1.00 0.00 ? 67  LEU B HD11 3  
ATOM 5414  H HD12 . LEU B 2 69  ? 1.124   0.733   0.466   1.00 0.00 ? 67  LEU B HD12 3  
ATOM 5415  H HD13 . LEU B 2 69  ? 1.481   -0.751  1.351   1.00 0.00 ? 67  LEU B HD13 3  
ATOM 5416  H HD21 . LEU B 2 69  ? -1.917  0.196   2.525   1.00 0.00 ? 67  LEU B HD21 3  
ATOM 5417  H HD22 . LEU B 2 69  ? -0.984  -1.087  1.753   1.00 0.00 ? 67  LEU B HD22 3  
ATOM 5418  H HD23 . LEU B 2 69  ? -1.329  0.403   0.875   1.00 0.00 ? 67  LEU B HD23 3  
ATOM 5419  N N    . VAL B 2 70  ? -1.152  -1.273  6.568   1.00 0.00 ? 68  VAL B N    3  
ATOM 5420  C CA   . VAL B 2 70  ? -0.907  -2.113  7.725   1.00 0.00 ? 68  VAL B CA   3  
ATOM 5421  C C    . VAL B 2 70  ? -0.573  -3.517  7.255   1.00 0.00 ? 68  VAL B C    3  
ATOM 5422  O O    . VAL B 2 70  ? -1.428  -4.236  6.753   1.00 0.00 ? 68  VAL B O    3  
ATOM 5423  C CB   . VAL B 2 70  ? -2.116  -2.134  8.669   1.00 0.00 ? 68  VAL B CB   3  
ATOM 5424  C CG1  . VAL B 2 70  ? -1.727  -2.698  10.021  1.00 0.00 ? 68  VAL B CG1  3  
ATOM 5425  C CG2  . VAL B 2 70  ? -2.680  -0.734  8.818   1.00 0.00 ? 68  VAL B CG2  3  
ATOM 5426  H H    . VAL B 2 70  ? -2.040  -1.280  6.147   1.00 0.00 ? 68  VAL B H    3  
ATOM 5427  H HA   . VAL B 2 70  ? -0.057  -1.709  8.258   1.00 0.00 ? 68  VAL B HA   3  
ATOM 5428  H HB   . VAL B 2 70  ? -2.879  -2.766  8.240   1.00 0.00 ? 68  VAL B HB   3  
ATOM 5429  H HG11 . VAL B 2 70  ? -1.334  -3.695  9.894   1.00 0.00 ? 68  VAL B HG11 3  
ATOM 5430  H HG12 . VAL B 2 70  ? -2.595  -2.729  10.660  1.00 0.00 ? 68  VAL B HG12 3  
ATOM 5431  H HG13 . VAL B 2 70  ? -0.972  -2.067  10.466  1.00 0.00 ? 68  VAL B HG13 3  
ATOM 5432  H HG21 . VAL B 2 70  ? -3.040  -0.388  7.860   1.00 0.00 ? 68  VAL B HG21 3  
ATOM 5433  H HG22 . VAL B 2 70  ? -1.901  -0.070  9.170   1.00 0.00 ? 68  VAL B HG22 3  
ATOM 5434  H HG23 . VAL B 2 70  ? -3.492  -0.745  9.528   1.00 0.00 ? 68  VAL B HG23 3  
ATOM 5435  N N    . LEU B 2 71  ? 0.677   -3.897  7.403   1.00 0.00 ? 69  LEU B N    3  
ATOM 5436  C CA   . LEU B 2 71  ? 1.134   -5.195  6.940   1.00 0.00 ? 69  LEU B CA   3  
ATOM 5437  C C    . LEU B 2 71  ? 1.042   -6.249  8.024   1.00 0.00 ? 69  LEU B C    3  
ATOM 5438  O O    . LEU B 2 71  ? 1.065   -5.939  9.213   1.00 0.00 ? 69  LEU B O    3  
ATOM 5439  C CB   . LEU B 2 71  ? 2.577   -5.087  6.463   1.00 0.00 ? 69  LEU B CB   3  
ATOM 5440  C CG   . LEU B 2 71  ? 2.934   -3.748  5.834   1.00 0.00 ? 69  LEU B CG   3  
ATOM 5441  C CD1  . LEU B 2 71  ? 4.404   -3.688  5.508   1.00 0.00 ? 69  LEU B CD1  3  
ATOM 5442  C CD2  . LEU B 2 71  ? 2.116   -3.512  4.585   1.00 0.00 ? 69  LEU B CD2  3  
ATOM 5443  H H    . LEU B 2 71  ? 1.317   -3.290  7.848   1.00 0.00 ? 69  LEU B H    3  
ATOM 5444  H HA   . LEU B 2 71  ? 0.517   -5.486  6.109   1.00 0.00 ? 69  LEU B HA   3  
ATOM 5445  H HB2  . LEU B 2 71  ? 3.230   -5.254  7.308   1.00 0.00 ? 69  LEU B HB2  3  
ATOM 5446  H HB3  . LEU B 2 71  ? 2.754   -5.862  5.732   1.00 0.00 ? 69  LEU B HB3  3  
ATOM 5447  H HG   . LEU B 2 71  ? 2.710   -2.959  6.537   1.00 0.00 ? 69  LEU B HG   3  
ATOM 5448  H HD11 . LEU B 2 71  ? 4.975   -3.835  6.409   1.00 0.00 ? 69  LEU B HD11 3  
ATOM 5449  H HD12 . LEU B 2 71  ? 4.634   -2.724  5.083   1.00 0.00 ? 69  LEU B HD12 3  
ATOM 5450  H HD13 . LEU B 2 71  ? 4.641   -4.464  4.796   1.00 0.00 ? 69  LEU B HD13 3  
ATOM 5451  H HD21 . LEU B 2 71  ? 2.370   -2.551  4.165   1.00 0.00 ? 69  LEU B HD21 3  
ATOM 5452  H HD22 . LEU B 2 71  ? 1.066   -3.534  4.835   1.00 0.00 ? 69  LEU B HD22 3  
ATOM 5453  H HD23 . LEU B 2 71  ? 2.332   -4.288  3.865   1.00 0.00 ? 69  LEU B HD23 3  
ATOM 5454  N N    . HIS B 2 72  ? 0.956   -7.507  7.604   1.00 0.00 ? 70  HIS B N    3  
ATOM 5455  C CA   . HIS B 2 72  ? 0.898   -8.616  8.548   1.00 0.00 ? 70  HIS B CA   3  
ATOM 5456  C C    . HIS B 2 72  ? 2.305   -8.923  9.035   1.00 0.00 ? 70  HIS B C    3  
ATOM 5457  O O    . HIS B 2 72  ? 2.528   -9.837  9.821   1.00 0.00 ? 70  HIS B O    3  
ATOM 5458  C CB   . HIS B 2 72  ? 0.258   -9.872  7.934   1.00 0.00 ? 70  HIS B CB   3  
ATOM 5459  C CG   . HIS B 2 72  ? 0.374   -9.970  6.443   1.00 0.00 ? 70  HIS B CG   3  
ATOM 5460  N ND1  . HIS B 2 72  ? -0.628  -9.601  5.579   1.00 0.00 ? 70  HIS B ND1  3  
ATOM 5461  C CD2  . HIS B 2 72  ? 1.397   -10.403 5.659   1.00 0.00 ? 70  HIS B CD2  3  
ATOM 5462  C CE1  . HIS B 2 72  ? -0.192  -9.814  4.336   1.00 0.00 ? 70  HIS B CE1  3  
ATOM 5463  N NE2  . HIS B 2 72  ? 1.023   -10.308 4.339   1.00 0.00 ? 70  HIS B NE2  3  
ATOM 5464  H H    . HIS B 2 72  ? 0.935   -7.693  6.637   1.00 0.00 ? 70  HIS B H    3  
ATOM 5465  H HA   . HIS B 2 72  ? 0.301   -8.289  9.385   1.00 0.00 ? 70  HIS B HA   3  
ATOM 5466  H HB2  . HIS B 2 72  ? 0.731   -10.746 8.356   1.00 0.00 ? 70  HIS B HB2  3  
ATOM 5467  H HB3  . HIS B 2 72  ? -0.793  -9.887  8.185   1.00 0.00 ? 70  HIS B HB3  3  
ATOM 5468  H HD1  . HIS B 2 72  ? -1.510  -9.253  5.825   1.00 0.00 ? 70  HIS B HD1  3  
ATOM 5469  H HD2  . HIS B 2 72  ? 2.366   -10.718 5.986   1.00 0.00 ? 70  HIS B HD2  3  
ATOM 5470  H HE1  . HIS B 2 72  ? -0.717  -9.519  3.446   1.00 0.00 ? 70  HIS B HE1  3  
ATOM 5471  N N    . ALA B 2 73  ? 3.246   -8.132  8.536   1.00 0.00 ? 71  ALA B N    3  
ATOM 5472  C CA   . ALA B 2 73  ? 4.646   -8.253  8.892   1.00 0.00 ? 71  ALA B CA   3  
ATOM 5473  C C    . ALA B 2 73  ? 4.920   -7.533  10.206  1.00 0.00 ? 71  ALA B C    3  
ATOM 5474  O O    . ALA B 2 73  ? 6.011   -7.627  10.764  1.00 0.00 ? 71  ALA B O    3  
ATOM 5475  C CB   . ALA B 2 73  ? 5.504   -7.671  7.776   1.00 0.00 ? 71  ALA B CB   3  
ATOM 5476  H H    . ALA B 2 73  ? 2.983   -7.440  7.897   1.00 0.00 ? 71  ALA B H    3  
ATOM 5477  H HA   . ALA B 2 73  ? 4.883   -9.301  8.999   1.00 0.00 ? 71  ALA B HA   3  
ATOM 5478  H HB1  . ALA B 2 73  ? 5.225   -8.124  6.834   1.00 0.00 ? 71  ALA B HB1  3  
ATOM 5479  H HB2  . ALA B 2 73  ? 6.545   -7.871  7.978   1.00 0.00 ? 71  ALA B HB2  3  
ATOM 5480  H HB3  . ALA B 2 73  ? 5.346   -6.603  7.721   1.00 0.00 ? 71  ALA B HB3  3  
ATOM 5481  N N    . GLY B 2 74  ? 3.913   -6.814  10.692  1.00 0.00 ? 72  GLY B N    3  
ATOM 5482  C CA   . GLY B 2 74  ? 4.051   -6.076  11.931  1.00 0.00 ? 72  GLY B CA   3  
ATOM 5483  C C    . GLY B 2 74  ? 4.511   -4.656  11.689  1.00 0.00 ? 72  GLY B C    3  
ATOM 5484  O O    . GLY B 2 74  ? 4.978   -3.980  12.604  1.00 0.00 ? 72  GLY B O    3  
ATOM 5485  H H    . GLY B 2 74  ? 3.065   -6.789  10.205  1.00 0.00 ? 72  GLY B H    3  
ATOM 5486  H HA2  . GLY B 2 74  ? 3.097   -6.056  12.436  1.00 0.00 ? 72  GLY B HA2  3  
ATOM 5487  H HA3  . GLY B 2 74  ? 4.773   -6.576  12.559  1.00 0.00 ? 72  GLY B HA3  3  
ATOM 5488  N N    . ASP B 2 75  ? 4.365   -4.205  10.451  1.00 0.00 ? 73  ASP B N    3  
ATOM 5489  C CA   . ASP B 2 75  ? 4.779   -2.858  10.069  1.00 0.00 ? 73  ASP B CA   3  
ATOM 5490  C C    . ASP B 2 75  ? 3.629   -2.108  9.407   1.00 0.00 ? 73  ASP B C    3  
ATOM 5491  O O    . ASP B 2 75  ? 2.674   -2.720  8.923   1.00 0.00 ? 73  ASP B O    3  
ATOM 5492  C CB   . ASP B 2 75  ? 5.984   -2.923  9.122   1.00 0.00 ? 73  ASP B CB   3  
ATOM 5493  C CG   . ASP B 2 75  ? 6.415   -1.555  8.626   1.00 0.00 ? 73  ASP B CG   3  
ATOM 5494  O OD1  . ASP B 2 75  ? 6.585   -0.645  9.466   1.00 0.00 ? 73  ASP B OD1  3  
ATOM 5495  O OD2  . ASP B 2 75  ? 6.566   -1.389  7.399   1.00 0.00 ? 73  ASP B OD2  3  
ATOM 5496  H H    . ASP B 2 75  ? 3.957   -4.787  9.778   1.00 0.00 ? 73  ASP B H    3  
ATOM 5497  H HA   . ASP B 2 75  ? 5.065   -2.333  10.964  1.00 0.00 ? 73  ASP B HA   3  
ATOM 5498  H HB2  . ASP B 2 75  ? 6.817   -3.375  9.639   1.00 0.00 ? 73  ASP B HB2  3  
ATOM 5499  H HB3  . ASP B 2 75  ? 5.727   -3.531  8.266   1.00 0.00 ? 73  ASP B HB3  3  
ATOM 5500  N N    . THR B 2 76  ? 3.721   -0.787  9.399   1.00 0.00 ? 74  THR B N    3  
ATOM 5501  C CA   . THR B 2 76  ? 2.705   0.053   8.792   1.00 0.00 ? 74  THR B CA   3  
ATOM 5502  C C    . THR B 2 76  ? 3.367   1.147   7.955   1.00 0.00 ? 74  THR B C    3  
ATOM 5503  O O    . THR B 2 76  ? 4.267   1.841   8.426   1.00 0.00 ? 74  THR B O    3  
ATOM 5504  C CB   . THR B 2 76  ? 1.807   0.711   9.859   1.00 0.00 ? 74  THR B CB   3  
ATOM 5505  O OG1  . THR B 2 76  ? 2.613   1.307   10.884  1.00 0.00 ? 74  THR B OG1  3  
ATOM 5506  C CG2  . THR B 2 76  ? 0.863   -0.303  10.485  1.00 0.00 ? 74  THR B CG2  3  
ATOM 5507  H H    . THR B 2 76  ? 4.520   -0.362  9.788   1.00 0.00 ? 74  THR B H    3  
ATOM 5508  H HA   . THR B 2 76  ? 2.083   -0.571  8.152   1.00 0.00 ? 74  THR B HA   3  
ATOM 5509  H HB   . THR B 2 76  ? 1.216   1.481   9.384   1.00 0.00 ? 74  THR B HB   3  
ATOM 5510  H HG1  . THR B 2 76  ? 3.496   1.482   10.531  1.00 0.00 ? 74  THR B HG1  3  
ATOM 5511  H HG21 . THR B 2 76  ? 0.233   0.191   11.210  1.00 0.00 ? 74  THR B HG21 3  
ATOM 5512  H HG22 . THR B 2 76  ? 1.438   -1.076  10.975  1.00 0.00 ? 74  THR B HG22 3  
ATOM 5513  H HG23 . THR B 2 76  ? 0.247   -0.746  9.715   1.00 0.00 ? 74  THR B HG23 3  
ATOM 5514  N N    . THR B 2 77  ? 2.907   1.306   6.727   1.00 0.00 ? 75  THR B N    3  
ATOM 5515  C CA   . THR B 2 77  ? 3.446   2.308   5.823   1.00 0.00 ? 75  THR B CA   3  
ATOM 5516  C C    . THR B 2 77  ? 2.446   3.446   5.634   1.00 0.00 ? 75  THR B C    3  
ATOM 5517  O O    . THR B 2 77  ? 1.474   3.308   4.895   1.00 0.00 ? 75  THR B O    3  
ATOM 5518  C CB   . THR B 2 77  ? 3.770   1.671   4.459   1.00 0.00 ? 75  THR B CB   3  
ATOM 5519  O OG1  . THR B 2 77  ? 4.342   0.370   4.658   1.00 0.00 ? 75  THR B OG1  3  
ATOM 5520  C CG2  . THR B 2 77  ? 4.732   2.542   3.666   1.00 0.00 ? 75  THR B CG2  3  
ATOM 5521  H H    . THR B 2 77  ? 2.189   0.715   6.412   1.00 0.00 ? 75  THR B H    3  
ATOM 5522  H HA   . THR B 2 77  ? 4.358   2.698   6.249   1.00 0.00 ? 75  THR B HA   3  
ATOM 5523  H HB   . THR B 2 77  ? 2.848   1.565   3.899   1.00 0.00 ? 75  THR B HB   3  
ATOM 5524  H HG1  . THR B 2 77  ? 4.956   0.397   5.404   1.00 0.00 ? 75  THR B HG1  3  
ATOM 5525  H HG21 . THR B 2 77  ? 5.641   2.681   4.231   1.00 0.00 ? 75  THR B HG21 3  
ATOM 5526  H HG22 . THR B 2 77  ? 4.275   3.502   3.475   1.00 0.00 ? 75  THR B HG22 3  
ATOM 5527  H HG23 . THR B 2 77  ? 4.961   2.061   2.727   1.00 0.00 ? 75  THR B HG23 3  
ATOM 5528  N N    . ASN B 2 78  ? 2.678   4.568   6.297   1.00 0.00 ? 76  ASN B N    3  
ATOM 5529  C CA   . ASN B 2 78  ? 1.760   5.701   6.207   1.00 0.00 ? 76  ASN B CA   3  
ATOM 5530  C C    . ASN B 2 78  ? 2.015   6.536   4.959   1.00 0.00 ? 76  ASN B C    3  
ATOM 5531  O O    . ASN B 2 78  ? 3.155   6.729   4.537   1.00 0.00 ? 76  ASN B O    3  
ATOM 5532  C CB   . ASN B 2 78  ? 1.853   6.602   7.446   1.00 0.00 ? 76  ASN B CB   3  
ATOM 5533  C CG   . ASN B 2 78  ? 1.362   5.931   8.718   1.00 0.00 ? 76  ASN B CG   3  
ATOM 5534  O OD1  . ASN B 2 78  ? 1.419   4.711   8.859   1.00 0.00 ? 76  ASN B OD1  3  
ATOM 5535  N ND2  . ASN B 2 78  ? 0.872   6.729   9.655   1.00 0.00 ? 76  ASN B ND2  3  
ATOM 5536  H H    . ASN B 2 78  ? 3.482   4.639   6.856   1.00 0.00 ? 76  ASN B H    3  
ATOM 5537  H HA   . ASN B 2 78  ? 0.759   5.300   6.148   1.00 0.00 ? 76  ASN B HA   3  
ATOM 5538  H HB2  . ASN B 2 78  ? 2.880   6.892   7.593   1.00 0.00 ? 76  ASN B HB2  3  
ATOM 5539  H HB3  . ASN B 2 78  ? 1.258   7.488   7.279   1.00 0.00 ? 76  ASN B HB3  3  
ATOM 5540  H HD21 . ASN B 2 78  ? 0.845   7.694   9.479   1.00 0.00 ? 76  ASN B HD21 3  
ATOM 5541  H HD22 . ASN B 2 78  ? 0.578   6.328   10.507  1.00 0.00 ? 76  ASN B HD22 3  
ATOM 5542  N N    . PHE B 2 79  ? 0.927   7.017   4.383   1.00 0.00 ? 77  PHE B N    3  
ATOM 5543  C CA   . PHE B 2 79  ? 0.946   7.849   3.197   1.00 0.00 ? 77  PHE B CA   3  
ATOM 5544  C C    . PHE B 2 79  ? 0.159   9.124   3.467   1.00 0.00 ? 77  PHE B C    3  
ATOM 5545  O O    . PHE B 2 79  ? -1.050  9.086   3.705   1.00 0.00 ? 77  PHE B O    3  
ATOM 5546  C CB   . PHE B 2 79  ? 0.340   7.101   2.009   1.00 0.00 ? 77  PHE B CB   3  
ATOM 5547  C CG   . PHE B 2 79  ? 1.255   6.070   1.420   1.00 0.00 ? 77  PHE B CG   3  
ATOM 5548  C CD1  . PHE B 2 79  ? 2.319   6.452   0.622   1.00 0.00 ? 77  PHE B CD1  3  
ATOM 5549  C CD2  . PHE B 2 79  ? 1.052   4.722   1.663   1.00 0.00 ? 77  PHE B CD2  3  
ATOM 5550  C CE1  . PHE B 2 79  ? 3.164   5.509   0.076   1.00 0.00 ? 77  PHE B CE1  3  
ATOM 5551  C CE2  . PHE B 2 79  ? 1.896   3.774   1.118   1.00 0.00 ? 77  PHE B CE2  3  
ATOM 5552  C CZ   . PHE B 2 79  ? 2.953   4.169   0.323   1.00 0.00 ? 77  PHE B CZ   3  
ATOM 5553  H H    . PHE B 2 79  ? 0.053   6.801   4.782   1.00 0.00 ? 77  PHE B H    3  
ATOM 5554  H HA   . PHE B 2 79  ? 1.973   8.104   2.976   1.00 0.00 ? 77  PHE B HA   3  
ATOM 5555  H HB2  . PHE B 2 79  ? -0.562  6.601   2.329   1.00 0.00 ? 77  PHE B HB2  3  
ATOM 5556  H HB3  . PHE B 2 79  ? 0.095   7.812   1.232   1.00 0.00 ? 77  PHE B HB3  3  
ATOM 5557  H HD1  . PHE B 2 79  ? 2.486   7.500   0.427   1.00 0.00 ? 77  PHE B HD1  3  
ATOM 5558  H HD2  . PHE B 2 79  ? 0.225   4.413   2.285   1.00 0.00 ? 77  PHE B HD2  3  
ATOM 5559  H HE1  . PHE B 2 79  ? 3.991   5.820   -0.546  1.00 0.00 ? 77  PHE B HE1  3  
ATOM 5560  H HE2  . PHE B 2 79  ? 1.729   2.725   1.314   1.00 0.00 ? 77  PHE B HE2  3  
ATOM 5561  H HZ   . PHE B 2 79  ? 3.613   3.430   -0.106  1.00 0.00 ? 77  PHE B HZ   3  
ATOM 5562  N N    . HIS B 2 80  ? 0.856   10.239  3.448   1.00 0.00 ? 78  HIS B N    3  
ATOM 5563  C CA   . HIS B 2 80  ? 0.257   11.536  3.708   1.00 0.00 ? 78  HIS B CA   3  
ATOM 5564  C C    . HIS B 2 80  ? -0.306  12.140  2.428   1.00 0.00 ? 78  HIS B C    3  
ATOM 5565  O O    . HIS B 2 80  ? 0.444   12.525  1.542   1.00 0.00 ? 78  HIS B O    3  
ATOM 5566  C CB   . HIS B 2 80  ? 1.325   12.454  4.298   1.00 0.00 ? 78  HIS B CB   3  
ATOM 5567  C CG   . HIS B 2 80  ? 0.836   13.776  4.803   1.00 0.00 ? 78  HIS B CG   3  
ATOM 5568  N ND1  . HIS B 2 80  ? 0.999   14.194  6.101   1.00 0.00 ? 78  HIS B ND1  3  
ATOM 5569  C CD2  . HIS B 2 80  ? 0.248   14.809  4.148   1.00 0.00 ? 78  HIS B CD2  3  
ATOM 5570  C CE1  . HIS B 2 80  ? 0.525   15.438  6.195   1.00 0.00 ? 78  HIS B CE1  3  
ATOM 5571  N NE2  . HIS B 2 80  ? 0.057   15.861  5.037   1.00 0.00 ? 78  HIS B NE2  3  
ATOM 5572  H H    . HIS B 2 80  ? 1.819   10.191  3.247   1.00 0.00 ? 78  HIS B H    3  
ATOM 5573  H HA   . HIS B 2 80  ? -0.540  11.409  4.425   1.00 0.00 ? 78  HIS B HA   3  
ATOM 5574  H HB2  . HIS B 2 80  ? 1.800   11.948  5.124   1.00 0.00 ? 78  HIS B HB2  3  
ATOM 5575  H HB3  . HIS B 2 80  ? 2.066   12.648  3.536   1.00 0.00 ? 78  HIS B HB3  3  
ATOM 5576  H HD1  . HIS B 2 80  ? 1.401   13.670  6.829   1.00 0.00 ? 78  HIS B HD1  3  
ATOM 5577  H HD2  . HIS B 2 80  ? -0.036  14.821  3.105   1.00 0.00 ? 78  HIS B HD2  3  
ATOM 5578  H HE1  . HIS B 2 80  ? 0.524   16.023  7.104   1.00 0.00 ? 78  HIS B HE1  3  
ATOM 5579  N N    . PHE B 2 81  ? -1.620  12.223  2.337   1.00 0.00 ? 79  PHE B N    3  
ATOM 5580  C CA   . PHE B 2 81  ? -2.268  12.792  1.166   1.00 0.00 ? 79  PHE B CA   3  
ATOM 5581  C C    . PHE B 2 81  ? -2.268  14.318  1.270   1.00 0.00 ? 79  PHE B C    3  
ATOM 5582  O O    . PHE B 2 81  ? -3.167  14.909  1.872   1.00 0.00 ? 79  PHE B O    3  
ATOM 5583  C CB   . PHE B 2 81  ? -3.700  12.272  1.049   1.00 0.00 ? 79  PHE B CB   3  
ATOM 5584  C CG   . PHE B 2 81  ? -3.812  10.932  0.382   1.00 0.00 ? 79  PHE B CG   3  
ATOM 5585  C CD1  . PHE B 2 81  ? -3.507  9.763   1.064   1.00 0.00 ? 79  PHE B CD1  3  
ATOM 5586  C CD2  . PHE B 2 81  ? -4.232  10.843  -0.929  1.00 0.00 ? 79  PHE B CD2  3  
ATOM 5587  C CE1  . PHE B 2 81  ? -3.622  8.531   0.441   1.00 0.00 ? 79  PHE B CE1  3  
ATOM 5588  C CE2  . PHE B 2 81  ? -4.346  9.619   -1.552  1.00 0.00 ? 79  PHE B CE2  3  
ATOM 5589  C CZ   . PHE B 2 81  ? -4.044  8.462   -0.873  1.00 0.00 ? 79  PHE B CZ   3  
ATOM 5590  H H    . PHE B 2 81  ? -2.174  11.917  3.087   1.00 0.00 ? 79  PHE B H    3  
ATOM 5591  H HA   . PHE B 2 81  ? -1.706  12.492  0.290   1.00 0.00 ? 79  PHE B HA   3  
ATOM 5592  H HB2  . PHE B 2 81  ? -4.123  12.185  2.038   1.00 0.00 ? 79  PHE B HB2  3  
ATOM 5593  H HB3  . PHE B 2 81  ? -4.284  12.978  0.477   1.00 0.00 ? 79  PHE B HB3  3  
ATOM 5594  H HD1  . PHE B 2 81  ? -3.178  9.818   2.091   1.00 0.00 ? 79  PHE B HD1  3  
ATOM 5595  H HD2  . PHE B 2 81  ? -4.472  11.746  -1.470  1.00 0.00 ? 79  PHE B HD2  3  
ATOM 5596  H HE1  . PHE B 2 81  ? -3.382  7.628   0.981   1.00 0.00 ? 79  PHE B HE1  3  
ATOM 5597  H HE2  . PHE B 2 81  ? -4.676  9.568   -2.579  1.00 0.00 ? 79  PHE B HE2  3  
ATOM 5598  H HZ   . PHE B 2 81  ? -4.143  7.503   -1.372  1.00 0.00 ? 79  PHE B HZ   3  
ATOM 5599  N N    . SER B 2 82  ? -1.256  14.945  0.692   1.00 0.00 ? 80  SER B N    3  
ATOM 5600  C CA   . SER B 2 82  ? -1.117  16.394  0.742   1.00 0.00 ? 80  SER B CA   3  
ATOM 5601  C C    . SER B 2 82  ? -1.681  17.085  -0.504  1.00 0.00 ? 80  SER B C    3  
ATOM 5602  O O    . SER B 2 82  ? -1.573  18.304  -0.642  1.00 0.00 ? 80  SER B O    3  
ATOM 5603  C CB   . SER B 2 82  ? 0.360   16.751  0.938   1.00 0.00 ? 80  SER B CB   3  
ATOM 5604  O OG   . SER B 2 82  ? 1.204   15.761  0.367   1.00 0.00 ? 80  SER B OG   3  
ATOM 5605  H H    . SER B 2 82  ? -0.572  14.422  0.215   1.00 0.00 ? 80  SER B H    3  
ATOM 5606  H HA   . SER B 2 82  ? -1.668  16.741  1.602   1.00 0.00 ? 80  SER B HA   3  
ATOM 5607  H HB2  . SER B 2 82  ? 0.566   17.698  0.462   1.00 0.00 ? 80  SER B HB2  3  
ATOM 5608  H HB3  . SER B 2 82  ? 0.574   16.825  1.995   1.00 0.00 ? 80  SER B HB3  3  
ATOM 5609  H HG   . SER B 2 82  ? 2.055   16.158  0.110   1.00 0.00 ? 80  SER B HG   3  
ATOM 5610  N N    . ASN B 2 83  ? -2.284  16.320  -1.411  1.00 0.00 ? 81  ASN B N    3  
ATOM 5611  C CA   . ASN B 2 83  ? -2.858  16.906  -2.623  1.00 0.00 ? 81  ASN B CA   3  
ATOM 5612  C C    . ASN B 2 83  ? -4.241  17.482  -2.330  1.00 0.00 ? 81  ASN B C    3  
ATOM 5613  O O    . ASN B 2 83  ? -5.251  16.801  -2.453  1.00 0.00 ? 81  ASN B O    3  
ATOM 5614  C CB   . ASN B 2 83  ? -2.939  15.871  -3.753  1.00 0.00 ? 81  ASN B CB   3  
ATOM 5615  C CG   . ASN B 2 83  ? -3.318  16.482  -5.098  1.00 0.00 ? 81  ASN B CG   3  
ATOM 5616  O OD1  . ASN B 2 83  ? -3.777  15.783  -6.005  1.00 0.00 ? 81  ASN B OD1  3  
ATOM 5617  N ND2  . ASN B 2 83  ? -3.126  17.784  -5.249  1.00 0.00 ? 81  ASN B ND2  3  
ATOM 5618  H H    . ASN B 2 83  ? -2.336  15.352  -1.268  1.00 0.00 ? 81  ASN B H    3  
ATOM 5619  H HA   . ASN B 2 83  ? -2.210  17.713  -2.933  1.00 0.00 ? 81  ASN B HA   3  
ATOM 5620  H HB2  . ASN B 2 83  ? -1.979  15.389  -3.858  1.00 0.00 ? 81  ASN B HB2  3  
ATOM 5621  H HB3  . ASN B 2 83  ? -3.681  15.128  -3.496  1.00 0.00 ? 81  ASN B HB3  3  
ATOM 5622  H HD21 . ASN B 2 83  ? -2.746  18.299  -4.498  1.00 0.00 ? 81  ASN B HD21 3  
ATOM 5623  H HD22 . ASN B 2 83  ? -3.398  18.198  -6.096  1.00 0.00 ? 81  ASN B HD22 3  
ATOM 5624  N N    . GLU B 2 84  ? -4.257  18.756  -1.973  1.00 0.00 ? 82  GLU B N    3  
ATOM 5625  C CA   . GLU B 2 84  ? -5.481  19.490  -1.630  1.00 0.00 ? 82  GLU B CA   3  
ATOM 5626  C C    . GLU B 2 84  ? -6.638  19.235  -2.604  1.00 0.00 ? 82  GLU B C    3  
ATOM 5627  O O    . GLU B 2 84  ? -7.791  19.096  -2.187  1.00 0.00 ? 82  GLU B O    3  
ATOM 5628  C CB   . GLU B 2 84  ? -5.194  21.002  -1.574  1.00 0.00 ? 82  GLU B CB   3  
ATOM 5629  C CG   . GLU B 2 84  ? -3.879  21.437  -2.225  1.00 0.00 ? 82  GLU B CG   3  
ATOM 5630  C CD   . GLU B 2 84  ? -3.732  20.975  -3.666  1.00 0.00 ? 82  GLU B CD   3  
ATOM 5631  O OE1  . GLU B 2 84  ? -4.571  21.354  -4.510  1.00 0.00 ? 82  GLU B OE1  3  
ATOM 5632  O OE2  . GLU B 2 84  ? -2.790  20.201  -3.944  1.00 0.00 ? 82  GLU B OE2  3  
ATOM 5633  H H    . GLU B 2 84  ? -3.402  19.240  -1.948  1.00 0.00 ? 82  GLU B H    3  
ATOM 5634  H HA   . GLU B 2 84  ? -5.786  19.165  -0.647  1.00 0.00 ? 82  GLU B HA   3  
ATOM 5635  H HB2  . GLU B 2 84  ? -6.000  21.522  -2.070  1.00 0.00 ? 82  GLU B HB2  3  
ATOM 5636  H HB3  . GLU B 2 84  ? -5.172  21.307  -0.538  1.00 0.00 ? 82  GLU B HB3  3  
ATOM 5637  H HG2  . GLU B 2 84  ? -3.827  22.514  -2.207  1.00 0.00 ? 82  GLU B HG2  3  
ATOM 5638  H HG3  . GLU B 2 84  ? -3.060  21.031  -1.649  1.00 0.00 ? 82  GLU B HG3  3  
ATOM 5639  N N    . SER B 2 85  ? -6.323  19.162  -3.886  1.00 0.00 ? 83  SER B N    3  
ATOM 5640  C CA   . SER B 2 85  ? -7.321  18.963  -4.925  1.00 0.00 ? 83  SER B CA   3  
ATOM 5641  C C    . SER B 2 85  ? -8.149  17.689  -4.749  1.00 0.00 ? 83  SER B C    3  
ATOM 5642  O O    . SER B 2 85  ? -9.380  17.753  -4.627  1.00 0.00 ? 83  SER B O    3  
ATOM 5643  C CB   . SER B 2 85  ? -6.636  18.956  -6.294  1.00 0.00 ? 83  SER B CB   3  
ATOM 5644  O OG   . SER B 2 85  ? -5.276  19.352  -6.192  1.00 0.00 ? 83  SER B OG   3  
ATOM 5645  H H    . SER B 2 85  ? -5.380  19.259  -4.149  1.00 0.00 ? 83  SER B H    3  
ATOM 5646  H HA   . SER B 2 85  ? -7.998  19.794  -4.897  1.00 0.00 ? 83  SER B HA   3  
ATOM 5647  H HB2  . SER B 2 85  ? -6.677  17.960  -6.709  1.00 0.00 ? 83  SER B HB2  3  
ATOM 5648  H HB3  . SER B 2 85  ? -7.149  19.642  -6.952  1.00 0.00 ? 83  SER B HB3  3  
ATOM 5649  H HG   . SER B 2 85  ? -5.209  20.183  -5.683  1.00 0.00 ? 83  SER B HG   3  
ATOM 5650  N N    . THR B 2 86  ? -7.508  16.532  -4.735  1.00 0.00 ? 84  THR B N    3  
ATOM 5651  C CA   . THR B 2 86  ? -8.259  15.292  -4.653  1.00 0.00 ? 84  THR B CA   3  
ATOM 5652  C C    . THR B 2 86  ? -7.826  14.335  -3.539  1.00 0.00 ? 84  THR B C    3  
ATOM 5653  O O    . THR B 2 86  ? -8.321  13.219  -3.498  1.00 0.00 ? 84  THR B O    3  
ATOM 5654  C CB   . THR B 2 86  ? -8.198  14.592  -6.020  1.00 0.00 ? 84  THR B CB   3  
ATOM 5655  O OG1  . THR B 2 86  ? -6.847  14.568  -6.504  1.00 0.00 ? 84  THR B OG1  3  
ATOM 5656  C CG2  . THR B 2 86  ? -9.067  15.346  -7.016  1.00 0.00 ? 84  THR B CG2  3  
ATOM 5657  H H    . THR B 2 86  ? -6.524  16.511  -4.783  1.00 0.00 ? 84  THR B H    3  
ATOM 5658  H HA   . THR B 2 86  ? -9.293  15.553  -4.480  1.00 0.00 ? 84  THR B HA   3  
ATOM 5659  H HB   . THR B 2 86  ? -8.569  13.583  -5.921  1.00 0.00 ? 84  THR B HB   3  
ATOM 5660  H HG1  . THR B 2 86  ? -6.266  14.163  -5.828  1.00 0.00 ? 84  THR B HG1  3  
ATOM 5661  H HG21 . THR B 2 86  ? -8.716  16.368  -7.092  1.00 0.00 ? 84  THR B HG21 3  
ATOM 5662  H HG22 . THR B 2 86  ? -10.090 15.346  -6.673  1.00 0.00 ? 84  THR B HG22 3  
ATOM 5663  H HG23 . THR B 2 86  ? -9.006  14.873  -7.982  1.00 0.00 ? 84  THR B HG23 3  
ATOM 5664  N N    . ALA B 2 87  ? -6.969  14.780  -2.619  1.00 0.00 ? 85  ALA B N    3  
ATOM 5665  C CA   . ALA B 2 87  ? -6.463  13.924  -1.525  1.00 0.00 ? 85  ALA B CA   3  
ATOM 5666  C C    . ALA B 2 87  ? -7.546  13.084  -0.852  1.00 0.00 ? 85  ALA B C    3  
ATOM 5667  O O    . ALA B 2 87  ? -7.349  11.898  -0.626  1.00 0.00 ? 85  ALA B O    3  
ATOM 5668  C CB   . ALA B 2 87  ? -5.756  14.761  -0.470  1.00 0.00 ? 85  ALA B CB   3  
ATOM 5669  H H    . ALA B 2 87  ? -6.647  15.707  -2.678  1.00 0.00 ? 85  ALA B H    3  
ATOM 5670  H HA   . ALA B 2 87  ? -5.731  13.249  -1.955  1.00 0.00 ? 85  ALA B HA   3  
ATOM 5671  H HB1  . ALA B 2 87  ? -5.024  15.396  -0.946  1.00 0.00 ? 85  ALA B HB1  3  
ATOM 5672  H HB2  . ALA B 2 87  ? -5.261  14.108  0.234   1.00 0.00 ? 85  ALA B HB2  3  
ATOM 5673  H HB3  . ALA B 2 87  ? -6.479  15.371  0.050   1.00 0.00 ? 85  ALA B HB3  3  
ATOM 5674  N N    . VAL B 2 88  ? -8.673  13.697  -0.516  1.00 0.00 ? 86  VAL B N    3  
ATOM 5675  C CA   . VAL B 2 88  ? -9.768  12.973  0.133   1.00 0.00 ? 86  VAL B CA   3  
ATOM 5676  C C    . VAL B 2 88  ? -10.267 11.829  -0.758  1.00 0.00 ? 86  VAL B C    3  
ATOM 5677  O O    . VAL B 2 88  ? -10.290 10.672  -0.344  1.00 0.00 ? 86  VAL B O    3  
ATOM 5678  C CB   . VAL B 2 88  ? -10.932 13.936  0.483   1.00 0.00 ? 86  VAL B CB   3  
ATOM 5679  C CG1  . VAL B 2 88  ? -12.283 13.231  0.463   1.00 0.00 ? 86  VAL B CG1  3  
ATOM 5680  C CG2  . VAL B 2 88  ? -10.702 14.577  1.838   1.00 0.00 ? 86  VAL B CG2  3  
ATOM 5681  H H    . VAL B 2 88  ? -8.768  14.653  -0.694  1.00 0.00 ? 86  VAL B H    3  
ATOM 5682  H HA   . VAL B 2 88  ? -9.384  12.550  1.053   1.00 0.00 ? 86  VAL B HA   3  
ATOM 5683  H HB   . VAL B 2 88  ? -10.945 14.726  -0.254  1.00 0.00 ? 86  VAL B HB   3  
ATOM 5684  H HG11 . VAL B 2 88  ? -12.502 12.903  -0.542  1.00 0.00 ? 86  VAL B HG11 3  
ATOM 5685  H HG12 . VAL B 2 88  ? -13.052 13.915  0.795   1.00 0.00 ? 86  VAL B HG12 3  
ATOM 5686  H HG13 . VAL B 2 88  ? -12.253 12.376  1.123   1.00 0.00 ? 86  VAL B HG13 3  
ATOM 5687  H HG21 . VAL B 2 88  ? -11.558 15.181  2.102   1.00 0.00 ? 86  VAL B HG21 3  
ATOM 5688  H HG22 . VAL B 2 88  ? -9.821  15.200  1.796   1.00 0.00 ? 86  VAL B HG22 3  
ATOM 5689  H HG23 . VAL B 2 88  ? -10.562 13.806  2.582   1.00 0.00 ? 86  VAL B HG23 3  
ATOM 5690  N N    . LYS B 2 89  ? -10.618 12.164  -1.995  1.00 0.00 ? 87  LYS B N    3  
ATOM 5691  C CA   . LYS B 2 89  ? -11.118 11.186  -2.962  1.00 0.00 ? 87  LYS B CA   3  
ATOM 5692  C C    . LYS B 2 89  ? -10.023 10.186  -3.307  1.00 0.00 ? 87  LYS B C    3  
ATOM 5693  O O    . LYS B 2 89  ? -10.287 9.008   -3.526  1.00 0.00 ? 87  LYS B O    3  
ATOM 5694  C CB   . LYS B 2 89  ? -11.589 11.917  -4.226  1.00 0.00 ? 87  LYS B CB   3  
ATOM 5695  C CG   . LYS B 2 89  ? -12.437 13.151  -3.943  1.00 0.00 ? 87  LYS B CG   3  
ATOM 5696  C CD   . LYS B 2 89  ? -11.814 14.406  -4.540  1.00 0.00 ? 87  LYS B CD   3  
ATOM 5697  C CE   . LYS B 2 89  ? -12.511 15.669  -4.052  1.00 0.00 ? 87  LYS B CE   3  
ATOM 5698  N NZ   . LYS B 2 89  ? -11.979 16.899  -4.710  1.00 0.00 ? 87  LYS B NZ   3  
ATOM 5699  H H    . LYS B 2 89  ? -10.524 13.094  -2.272  1.00 0.00 ? 87  LYS B H    3  
ATOM 5700  H HA   . LYS B 2 89  ? -11.953 10.646  -2.516  1.00 0.00 ? 87  LYS B HA   3  
ATOM 5701  H HB2  . LYS B 2 89  ? -10.719 12.231  -4.788  1.00 0.00 ? 87  LYS B HB2  3  
ATOM 5702  H HB3  . LYS B 2 89  ? -12.169 11.238  -4.829  1.00 0.00 ? 87  LYS B HB3  3  
ATOM 5703  H HG2  . LYS B 2 89  ? -13.418 13.008  -4.372  1.00 0.00 ? 87  LYS B HG2  3  
ATOM 5704  H HG3  . LYS B 2 89  ? -12.525 13.276  -2.874  1.00 0.00 ? 87  LYS B HG3  3  
ATOM 5705  H HD2  . LYS B 2 89  ? -10.774 14.450  -4.256  1.00 0.00 ? 87  LYS B HD2  3  
ATOM 5706  H HD3  . LYS B 2 89  ? -11.893 14.356  -5.617  1.00 0.00 ? 87  LYS B HD3  3  
ATOM 5707  H HE2  . LYS B 2 89  ? -13.567 15.588  -4.267  1.00 0.00 ? 87  LYS B HE2  3  
ATOM 5708  H HE3  . LYS B 2 89  ? -12.369 15.752  -2.984  1.00 0.00 ? 87  LYS B HE3  3  
ATOM 5709  H HZ1  . LYS B 2 89  ? -10.969 17.031  -4.473  1.00 0.00 ? 87  LYS B HZ1  3  
ATOM 5710  H HZ2  . LYS B 2 89  ? -12.507 17.734  -4.387  1.00 0.00 ? 87  LYS B HZ2  3  
ATOM 5711  H HZ3  . LYS B 2 89  ? -12.072 16.822  -5.742  1.00 0.00 ? 87  LYS B HZ3  3  
ATOM 5712  N N    . GLU B 2 90  ? -8.795  10.676  -3.362  1.00 0.00 ? 88  GLU B N    3  
ATOM 5713  C CA   . GLU B 2 90  ? -7.644  9.845   -3.645  1.00 0.00 ? 88  GLU B CA   3  
ATOM 5714  C C    . GLU B 2 90  ? -7.458  8.851   -2.507  1.00 0.00 ? 88  GLU B C    3  
ATOM 5715  O O    . GLU B 2 90  ? -7.300  7.658   -2.741  1.00 0.00 ? 88  GLU B O    3  
ATOM 5716  C CB   . GLU B 2 90  ? -6.408  10.723  -3.848  1.00 0.00 ? 88  GLU B CB   3  
ATOM 5717  C CG   . GLU B 2 90  ? -6.209  11.130  -5.300  1.00 0.00 ? 88  GLU B CG   3  
ATOM 5718  C CD   . GLU B 2 90  ? -5.153  12.201  -5.479  1.00 0.00 ? 88  GLU B CD   3  
ATOM 5719  O OE1  . GLU B 2 90  ? -5.302  13.289  -4.895  1.00 0.00 ? 88  GLU B OE1  3  
ATOM 5720  O OE2  . GLU B 2 90  ? -4.188  11.974  -6.240  1.00 0.00 ? 88  GLU B OE2  3  
ATOM 5721  H H    . GLU B 2 90  ? -8.659  11.638  -3.212  1.00 0.00 ? 88  GLU B H    3  
ATOM 5722  H HA   . GLU B 2 90  ? -7.840  9.299   -4.554  1.00 0.00 ? 88  GLU B HA   3  
ATOM 5723  H HB2  . GLU B 2 90  ? -6.520  11.622  -3.257  1.00 0.00 ? 88  GLU B HB2  3  
ATOM 5724  H HB3  . GLU B 2 90  ? -5.531  10.194  -3.514  1.00 0.00 ? 88  GLU B HB3  3  
ATOM 5725  H HG2  . GLU B 2 90  ? -5.912  10.260  -5.866  1.00 0.00 ? 88  GLU B HG2  3  
ATOM 5726  H HG3  . GLU B 2 90  ? -7.147  11.503  -5.685  1.00 0.00 ? 88  GLU B HG3  3  
ATOM 5727  N N    . ARG B 2 91  ? -7.518  9.356   -1.273  1.00 0.00 ? 89  ARG B N    3  
ATOM 5728  C CA   . ARG B 2 91  ? -7.408  8.523   -0.078  1.00 0.00 ? 89  ARG B CA   3  
ATOM 5729  C C    . ARG B 2 91  ? -8.442  7.426   -0.159  1.00 0.00 ? 89  ARG B C    3  
ATOM 5730  O O    . ARG B 2 91  ? -8.161  6.249   0.054   1.00 0.00 ? 89  ARG B O    3  
ATOM 5731  C CB   . ARG B 2 91  ? -7.686  9.356   1.177   1.00 0.00 ? 89  ARG B CB   3  
ATOM 5732  C CG   . ARG B 2 91  ? -7.605  8.575   2.475   1.00 0.00 ? 89  ARG B CG   3  
ATOM 5733  C CD   . ARG B 2 91  ? -8.472  9.216   3.550   1.00 0.00 ? 89  ARG B CD   3  
ATOM 5734  N NE   . ARG B 2 91  ? -9.804  9.569   3.045   1.00 0.00 ? 89  ARG B NE   3  
ATOM 5735  C CZ   . ARG B 2 91  ? -10.556 10.558  3.535   1.00 0.00 ? 89  ARG B CZ   3  
ATOM 5736  N NH1  . ARG B 2 91  ? -10.127 11.292  4.554   1.00 0.00 ? 89  ARG B NH1  3  
ATOM 5737  N NH2  . ARG B 2 91  ? -11.749 10.808  3.009   1.00 0.00 ? 89  ARG B NH2  3  
ATOM 5738  H H    . ARG B 2 91  ? -7.630  10.328  -1.165  1.00 0.00 ? 89  ARG B H    3  
ATOM 5739  H HA   . ARG B 2 91  ? -6.417  8.097   -0.032  1.00 0.00 ? 89  ARG B HA   3  
ATOM 5740  H HB2  . ARG B 2 91  ? -6.981  10.171  1.226   1.00 0.00 ? 89  ARG B HB2  3  
ATOM 5741  H HB3  . ARG B 2 91  ? -8.686  9.762   1.105   1.00 0.00 ? 89  ARG B HB3  3  
ATOM 5742  H HG2  . ARG B 2 91  ? -7.948  7.566   2.302   1.00 0.00 ? 89  ARG B HG2  3  
ATOM 5743  H HG3  . ARG B 2 91  ? -6.579  8.558   2.813   1.00 0.00 ? 89  ARG B HG3  3  
ATOM 5744  H HD2  . ARG B 2 91  ? -8.580  8.520   4.369   1.00 0.00 ? 89  ARG B HD2  3  
ATOM 5745  H HD3  . ARG B 2 91  ? -7.980  10.111  3.902   1.00 0.00 ? 89  ARG B HD3  3  
ATOM 5746  H HE   . ARG B 2 91  ? -10.158 9.040   2.295   1.00 0.00 ? 89  ARG B HE   3  
ATOM 5747  H HH11 . ARG B 2 91  ? -9.236  11.111  4.974   1.00 0.00 ? 89  ARG B HH11 3  
ATOM 5748  H HH12 . ARG B 2 91  ? -10.706 12.050  4.910   1.00 0.00 ? 89  ARG B HH12 3  
ATOM 5749  H HH21 . ARG B 2 91  ? -12.098 10.251  2.232   1.00 0.00 ? 89  ARG B HH21 3  
ATOM 5750  H HH22 . ARG B 2 91  ? -12.315 11.550  3.382   1.00 0.00 ? 89  ARG B HH22 3  
ATOM 5751  N N    . ASP B 2 92  ? -9.643  7.855   -0.486  1.00 0.00 ? 90  ASP B N    3  
ATOM 5752  C CA   . ASP B 2 92  ? -10.775 6.977   -0.618  1.00 0.00 ? 90  ASP B CA   3  
ATOM 5753  C C    . ASP B 2 92  ? -10.584 5.948   -1.724  1.00 0.00 ? 90  ASP B C    3  
ATOM 5754  O O    . ASP B 2 92  ? -10.821 4.771   -1.499  1.00 0.00 ? 90  ASP B O    3  
ATOM 5755  C CB   . ASP B 2 92  ? -12.037 7.815   -0.807  1.00 0.00 ? 90  ASP B CB   3  
ATOM 5756  C CG   . ASP B 2 92  ? -12.687 8.105   0.530   1.00 0.00 ? 90  ASP B CG   3  
ATOM 5757  O OD1  . ASP B 2 92  ? -12.625 9.264   0.993   1.00 0.00 ? 90  ASP B OD1  3  
ATOM 5758  O OD2  . ASP B 2 92  ? -13.216 7.152   1.145   1.00 0.00 ? 90  ASP B OD2  3  
ATOM 5759  H H    . ASP B 2 92  ? -9.772  8.819   -0.646  1.00 0.00 ? 90  ASP B H    3  
ATOM 5760  H HA   . ASP B 2 92  ? -10.868 6.441   0.315   1.00 0.00 ? 90  ASP B HA   3  
ATOM 5761  H HB2  . ASP B 2 92  ? -11.764 8.756   -1.264  1.00 0.00 ? 90  ASP B HB2  3  
ATOM 5762  H HB3  . ASP B 2 92  ? -12.738 7.308   -1.441  1.00 0.00 ? 90  ASP B HB3  3  
ATOM 5763  N N    . ALA B 2 93  ? -10.114 6.370   -2.890  1.00 0.00 ? 91  ALA B N    3  
ATOM 5764  C CA   . ALA B 2 93  ? -9.896  5.445   -4.003  1.00 0.00 ? 91  ALA B CA   3  
ATOM 5765  C C    . ALA B 2 93  ? -8.783  4.450   -3.678  1.00 0.00 ? 91  ALA B C    3  
ATOM 5766  O O    . ALA B 2 93  ? -8.897  3.273   -4.007  1.00 0.00 ? 91  ALA B O    3  
ATOM 5767  C CB   . ALA B 2 93  ? -9.580  6.208   -5.280  1.00 0.00 ? 91  ALA B CB   3  
ATOM 5768  H H    . ALA B 2 93  ? -9.914  7.326   -3.009  1.00 0.00 ? 91  ALA B H    3  
ATOM 5769  H HA   . ALA B 2 93  ? -10.817 4.882   -4.158  1.00 0.00 ? 91  ALA B HA   3  
ATOM 5770  H HB1  . ALA B 2 93  ? -10.393 6.883   -5.507  1.00 0.00 ? 91  ALA B HB1  3  
ATOM 5771  H HB2  . ALA B 2 93  ? -9.456  5.509   -6.094  1.00 0.00 ? 91  ALA B HB2  3  
ATOM 5772  H HB3  . ALA B 2 93  ? -8.669  6.771   -5.147  1.00 0.00 ? 91  ALA B HB3  3  
ATOM 5773  N N    . VAL B 2 94  ? -7.707  4.920   -3.043  1.00 0.00 ? 92  VAL B N    3  
ATOM 5774  C CA   . VAL B 2 94  ? -6.615  4.026   -2.651  1.00 0.00 ? 92  VAL B CA   3  
ATOM 5775  C C    . VAL B 2 94  ? -7.176  3.022   -1.651  1.00 0.00 ? 92  VAL B C    3  
ATOM 5776  O O    . VAL B 2 94  ? -6.917  1.826   -1.738  1.00 0.00 ? 92  VAL B O    3  
ATOM 5777  C CB   . VAL B 2 94  ? -5.431  4.780   -2.009  1.00 0.00 ? 92  VAL B CB   3  
ATOM 5778  C CG1  . VAL B 2 94  ? -4.285  3.824   -1.728  1.00 0.00 ? 92  VAL B CG1  3  
ATOM 5779  C CG2  . VAL B 2 94  ? -4.950  5.903   -2.906  1.00 0.00 ? 92  VAL B CG2  3  
ATOM 5780  H H    . VAL B 2 94  ? -7.648  5.879   -2.829  1.00 0.00 ? 92  VAL B H    3  
ATOM 5781  H HA   . VAL B 2 94  ? -6.252  3.499   -3.532  1.00 0.00 ? 92  VAL B HA   3  
ATOM 5782  H HB   . VAL B 2 94  ? -5.762  5.207   -1.075  1.00 0.00 ? 92  VAL B HB   3  
ATOM 5783  H HG11 . VAL B 2 94  ? -4.628  3.031   -1.077  1.00 0.00 ? 92  VAL B HG11 3  
ATOM 5784  H HG12 . VAL B 2 94  ? -3.479  4.359   -1.249  1.00 0.00 ? 92  VAL B HG12 3  
ATOM 5785  H HG13 . VAL B 2 94  ? -3.934  3.399   -2.657  1.00 0.00 ? 92  VAL B HG13 3  
ATOM 5786  H HG21 . VAL B 2 94  ? -4.605  5.494   -3.843  1.00 0.00 ? 92  VAL B HG21 3  
ATOM 5787  H HG22 . VAL B 2 94  ? -4.139  6.428   -2.423  1.00 0.00 ? 92  VAL B HG22 3  
ATOM 5788  H HG23 . VAL B 2 94  ? -5.763  6.589   -3.092  1.00 0.00 ? 92  VAL B HG23 3  
ATOM 5789  N N    . LYS B 2 95  ? -7.977  3.544   -0.721  1.00 0.00 ? 93  LYS B N    3  
ATOM 5790  C CA   . LYS B 2 95  ? -8.639  2.732   0.295   1.00 0.00 ? 93  LYS B CA   3  
ATOM 5791  C C    . LYS B 2 95  ? -9.517  1.690   -0.378  1.00 0.00 ? 93  LYS B C    3  
ATOM 5792  O O    . LYS B 2 95  ? -9.378  0.495   -0.141  1.00 0.00 ? 93  LYS B O    3  
ATOM 5793  C CB   . LYS B 2 95  ? -9.511  3.625   1.187   1.00 0.00 ? 93  LYS B CB   3  
ATOM 5794  C CG   . LYS B 2 95  ? -10.439 2.854   2.119   1.00 0.00 ? 93  LYS B CG   3  
ATOM 5795  C CD   . LYS B 2 95  ? -11.604 3.714   2.596   1.00 0.00 ? 93  LYS B CD   3  
ATOM 5796  C CE   . LYS B 2 95  ? -12.817 3.591   1.679   1.00 0.00 ? 93  LYS B CE   3  
ATOM 5797  N NZ   . LYS B 2 95  ? -12.790 4.578   0.568   1.00 0.00 ? 93  LYS B NZ   3  
ATOM 5798  H H    . LYS B 2 95  ? -8.124  4.515   -0.716  1.00 0.00 ? 93  LYS B H    3  
ATOM 5799  H HA   . LYS B 2 95  ? -7.887  2.243   0.894   1.00 0.00 ? 93  LYS B HA   3  
ATOM 5800  H HB2  . LYS B 2 95  ? -8.869  4.250   1.788   1.00 0.00 ? 93  LYS B HB2  3  
ATOM 5801  H HB3  . LYS B 2 95  ? -10.119 4.256   0.555   1.00 0.00 ? 93  LYS B HB3  3  
ATOM 5802  H HG2  . LYS B 2 95  ? -10.832 1.997   1.590   1.00 0.00 ? 93  LYS B HG2  3  
ATOM 5803  H HG3  . LYS B 2 95  ? -9.873  2.521   2.977   1.00 0.00 ? 93  LYS B HG3  3  
ATOM 5804  H HD2  . LYS B 2 95  ? -11.886 3.399   3.590   1.00 0.00 ? 93  LYS B HD2  3  
ATOM 5805  H HD3  . LYS B 2 95  ? -11.288 4.745   2.622   1.00 0.00 ? 93  LYS B HD3  3  
ATOM 5806  H HE2  . LYS B 2 95  ? -12.835 2.596   1.261   1.00 0.00 ? 93  LYS B HE2  3  
ATOM 5807  H HE3  . LYS B 2 95  ? -13.710 3.748   2.266   1.00 0.00 ? 93  LYS B HE3  3  
ATOM 5808  H HZ1  . LYS B 2 95  ? -13.436 4.278   -0.201  1.00 0.00 ? 93  LYS B HZ1  3  
ATOM 5809  H HZ2  . LYS B 2 95  ? -11.832 4.652   0.175   1.00 0.00 ? 93  LYS B HZ2  3  
ATOM 5810  H HZ3  . LYS B 2 95  ? -13.089 5.523   0.907   1.00 0.00 ? 93  LYS B HZ3  3  
ATOM 5811  N N    . ASP B 2 96  ? -10.410 2.180   -1.226  1.00 0.00 ? 94  ASP B N    3  
ATOM 5812  C CA   . ASP B 2 96  ? -11.337 1.349   -1.978  1.00 0.00 ? 94  ASP B CA   3  
ATOM 5813  C C    . ASP B 2 96  ? -10.610 0.268   -2.752  1.00 0.00 ? 94  ASP B C    3  
ATOM 5814  O O    . ASP B 2 96  ? -10.904 -0.911  -2.610  1.00 0.00 ? 94  ASP B O    3  
ATOM 5815  C CB   . ASP B 2 96  ? -12.147 2.228   -2.944  1.00 0.00 ? 94  ASP B CB   3  
ATOM 5816  C CG   . ASP B 2 96  ? -13.451 2.723   -2.348  1.00 0.00 ? 94  ASP B CG   3  
ATOM 5817  O OD1  . ASP B 2 96  ? -13.465 3.833   -1.774  1.00 0.00 ? 94  ASP B OD1  3  
ATOM 5818  O OD2  . ASP B 2 96  ? -14.462 2.006   -2.458  1.00 0.00 ? 94  ASP B OD2  3  
ATOM 5819  H H    . ASP B 2 96  ? -10.447 3.154   -1.360  1.00 0.00 ? 94  ASP B H    3  
ATOM 5820  H HA   . ASP B 2 96  ? -12.011 0.880   -1.273  1.00 0.00 ? 94  ASP B HA   3  
ATOM 5821  H HB2  . ASP B 2 96  ? -11.552 3.090   -3.198  1.00 0.00 ? 94  ASP B HB2  3  
ATOM 5822  H HB3  . ASP B 2 96  ? -12.357 1.683   -3.843  1.00 0.00 ? 94  ASP B HB3  3  
ATOM 5823  N N    . LEU B 2 97  ? -9.637  0.678   -3.543  1.00 0.00 ? 95  LEU B N    3  
ATOM 5824  C CA   . LEU B 2 97  ? -8.865  -0.245  -4.355  1.00 0.00 ? 95  LEU B CA   3  
ATOM 5825  C C    . LEU B 2 97  ? -8.120  -1.253  -3.489  1.00 0.00 ? 95  LEU B C    3  
ATOM 5826  O O    . LEU B 2 97  ? -8.081  -2.424  -3.819  1.00 0.00 ? 95  LEU B O    3  
ATOM 5827  C CB   . LEU B 2 97  ? -7.883  0.533   -5.236  1.00 0.00 ? 95  LEU B CB   3  
ATOM 5828  C CG   . LEU B 2 97  ? -7.436  -0.180  -6.511  1.00 0.00 ? 95  LEU B CG   3  
ATOM 5829  C CD1  . LEU B 2 97  ? -8.625  -0.444  -7.421  1.00 0.00 ? 95  LEU B CD1  3  
ATOM 5830  C CD2  . LEU B 2 97  ? -6.382  0.641   -7.237  1.00 0.00 ? 95  LEU B CD2  3  
ATOM 5831  H H    . LEU B 2 97  ? -9.430  1.637   -3.580  1.00 0.00 ? 95  LEU B H    3  
ATOM 5832  H HA   . LEU B 2 97  ? -9.556  -0.791  -4.990  1.00 0.00 ? 95  LEU B HA   3  
ATOM 5833  H HB2  . LEU B 2 97  ? -8.350  1.467   -5.519  1.00 0.00 ? 95  LEU B HB2  3  
ATOM 5834  H HB3  . LEU B 2 97  ? -7.004  0.756   -4.649  1.00 0.00 ? 95  LEU B HB3  3  
ATOM 5835  H HG   . LEU B 2 97  ? -6.997  -1.130  -6.247  1.00 0.00 ? 95  LEU B HG   3  
ATOM 5836  H HD11 . LEU B 2 97  ? -9.093  0.493   -7.684  1.00 0.00 ? 95  LEU B HD11 3  
ATOM 5837  H HD12 . LEU B 2 97  ? -9.339  -1.071  -6.908  1.00 0.00 ? 95  LEU B HD12 3  
ATOM 5838  H HD13 . LEU B 2 97  ? -8.289  -0.943  -8.319  1.00 0.00 ? 95  LEU B HD13 3  
ATOM 5839  H HD21 . LEU B 2 97  ? -5.532  0.792   -6.588  1.00 0.00 ? 95  LEU B HD21 3  
ATOM 5840  H HD22 . LEU B 2 97  ? -6.799  1.599   -7.514  1.00 0.00 ? 95  LEU B HD22 3  
ATOM 5841  H HD23 . LEU B 2 97  ? -6.067  0.116   -8.126  1.00 0.00 ? 95  LEU B HD23 3  
ATOM 5842  N N    . LEU B 2 98  ? -7.556  -0.809  -2.375  1.00 0.00 ? 96  LEU B N    3  
ATOM 5843  C CA   . LEU B 2 98  ? -6.823  -1.709  -1.487  1.00 0.00 ? 96  LEU B CA   3  
ATOM 5844  C C    . LEU B 2 98  ? -7.773  -2.655  -0.764  1.00 0.00 ? 96  LEU B C    3  
ATOM 5845  O O    . LEU B 2 98  ? -7.541  -3.850  -0.738  1.00 0.00 ? 96  LEU B O    3  
ATOM 5846  C CB   . LEU B 2 98  ? -6.009  -0.921  -0.461  1.00 0.00 ? 96  LEU B CB   3  
ATOM 5847  C CG   . LEU B 2 98  ? -4.703  -0.325  -0.980  1.00 0.00 ? 96  LEU B CG   3  
ATOM 5848  C CD1  . LEU B 2 98  ? -4.190  0.740   -0.026  1.00 0.00 ? 96  LEU B CD1  3  
ATOM 5849  C CD2  . LEU B 2 98  ? -3.659  -1.411  -1.163  1.00 0.00 ? 96  LEU B CD2  3  
ATOM 5850  H H    . LEU B 2 98  ? -7.636  0.143   -2.140  1.00 0.00 ? 96  LEU B H    3  
ATOM 5851  H HA   . LEU B 2 98  ? -6.143  -2.306  -2.103  1.00 0.00 ? 96  LEU B HA   3  
ATOM 5852  H HB2  . LEU B 2 98  ? -6.624  -0.115  -0.090  1.00 0.00 ? 96  LEU B HB2  3  
ATOM 5853  H HB3  . LEU B 2 98  ? -5.775  -1.579  0.361   1.00 0.00 ? 96  LEU B HB3  3  
ATOM 5854  H HG   . LEU B 2 98  ? -4.881  0.136   -1.940  1.00 0.00 ? 96  LEU B HG   3  
ATOM 5855  H HD11 . LEU B 2 98  ? -4.020  0.301   0.946   1.00 0.00 ? 96  LEU B HD11 3  
ATOM 5856  H HD12 . LEU B 2 98  ? -4.921  1.530   0.058   1.00 0.00 ? 96  LEU B HD12 3  
ATOM 5857  H HD13 . LEU B 2 98  ? -3.263  1.146   -0.405  1.00 0.00 ? 96  LEU B HD13 3  
ATOM 5858  H HD21 . LEU B 2 98  ? -4.007  -2.126  -1.895  1.00 0.00 ? 96  LEU B HD21 3  
ATOM 5859  H HD22 . LEU B 2 98  ? -3.492  -1.912  -0.221  1.00 0.00 ? 96  LEU B HD22 3  
ATOM 5860  H HD23 . LEU B 2 98  ? -2.735  -0.968  -1.504  1.00 0.00 ? 96  LEU B HD23 3  
ATOM 5861  N N    . GLN B 2 99  ? -8.852  -2.128  -0.193  1.00 0.00 ? 97  GLN B N    3  
ATOM 5862  C CA   . GLN B 2 99  ? -9.823  -2.970  0.513   1.00 0.00 ? 97  GLN B CA   3  
ATOM 5863  C C    . GLN B 2 99  ? -10.469 -3.947  -0.468  1.00 0.00 ? 97  GLN B C    3  
ATOM 5864  O O    . GLN B 2 99  ? -11.077 -4.943  -0.083  1.00 0.00 ? 97  GLN B O    3  
ATOM 5865  C CB   . GLN B 2 99  ? -10.874 -2.118  1.239   1.00 0.00 ? 97  GLN B CB   3  
ATOM 5866  C CG   . GLN B 2 99  ? -11.887 -1.431  0.343   1.00 0.00 ? 97  GLN B CG   3  
ATOM 5867  C CD   . GLN B 2 99  ? -12.774 -0.477  1.124   1.00 0.00 ? 97  GLN B CD   3  
ATOM 5868  O OE1  . GLN B 2 99  ? -13.208 0.548   0.610   1.00 0.00 ? 97  GLN B OE1  3  
ATOM 5869  N NE2  . GLN B 2 99  ? -13.041 -0.808  2.380   1.00 0.00 ? 97  GLN B NE2  3  
ATOM 5870  H H    . GLN B 2 99  ? -9.001  -1.156  -0.241  1.00 0.00 ? 97  GLN B H    3  
ATOM 5871  H HA   . GLN B 2 99  ? -9.270  -3.542  1.247   1.00 0.00 ? 97  GLN B HA   3  
ATOM 5872  H HB2  . GLN B 2 99  ? -11.416 -2.749  1.922   1.00 0.00 ? 97  GLN B HB2  3  
ATOM 5873  H HB3  . GLN B 2 99  ? -10.361 -1.353  1.805   1.00 0.00 ? 97  GLN B HB3  3  
ATOM 5874  H HG2  . GLN B 2 99  ? -11.360 -0.872  -0.418  1.00 0.00 ? 97  GLN B HG2  3  
ATOM 5875  H HG3  . GLN B 2 99  ? -12.508 -2.181  -0.122  1.00 0.00 ? 97  GLN B HG3  3  
ATOM 5876  H HE21 . GLN B 2 99  ? -12.656 -1.639  2.732   1.00 0.00 ? 97  GLN B HE21 3  
ATOM 5877  H HE22 . GLN B 2 99  ? -13.610 -0.207  2.909   1.00 0.00 ? 97  GLN B HE22 3  
ATOM 5878  N N    . GLN B 2 100 ? -10.337 -3.621  -1.740  1.00 0.00 ? 98  GLN B N    3  
ATOM 5879  C CA   . GLN B 2 100 ? -10.833 -4.435  -2.832  1.00 0.00 ? 98  GLN B CA   3  
ATOM 5880  C C    . GLN B 2 100 ? -9.792  -5.459  -3.261  1.00 0.00 ? 98  GLN B C    3  
ATOM 5881  O O    . GLN B 2 100 ? -10.072 -6.648  -3.420  1.00 0.00 ? 98  GLN B O    3  
ATOM 5882  C CB   . GLN B 2 100 ? -11.141 -3.519  -4.019  1.00 0.00 ? 98  GLN B CB   3  
ATOM 5883  C CG   . GLN B 2 100 ? -12.570 -3.017  -4.054  1.00 0.00 ? 98  GLN B CG   3  
ATOM 5884  C CD   . GLN B 2 100 ? -13.372 -3.630  -5.182  1.00 0.00 ? 98  GLN B CD   3  
ATOM 5885  O OE1  . GLN B 2 100 ? -13.109 -4.758  -5.609  1.00 0.00 ? 98  GLN B OE1  3  
ATOM 5886  N NE2  . GLN B 2 100 ? -14.351 -2.889  -5.675  1.00 0.00 ? 98  GLN B NE2  3  
ATOM 5887  H H    . GLN B 2 100 ? -9.893  -2.772  -1.955  1.00 0.00 ? 98  GLN B H    3  
ATOM 5888  H HA   . GLN B 2 100 ? -11.732 -4.935  -2.517  1.00 0.00 ? 98  GLN B HA   3  
ATOM 5889  H HB2  . GLN B 2 100 ? -10.495 -2.655  -3.947  1.00 0.00 ? 98  GLN B HB2  3  
ATOM 5890  H HB3  . GLN B 2 100 ? -10.918 -4.030  -4.941  1.00 0.00 ? 98  GLN B HB3  3  
ATOM 5891  H HG2  . GLN B 2 100 ? -13.049 -3.262  -3.118  1.00 0.00 ? 98  GLN B HG2  3  
ATOM 5892  H HG3  . GLN B 2 100 ? -12.557 -1.944  -4.182  1.00 0.00 ? 98  GLN B HG3  3  
ATOM 5893  H HE21 . GLN B 2 100 ? -14.499 -1.998  -5.285  1.00 0.00 ? 98  GLN B HE21 3  
ATOM 5894  H HE22 . GLN B 2 100 ? -14.888 -3.257  -6.405  1.00 0.00 ? 98  GLN B HE22 3  
ATOM 5895  N N    . LEU B 2 101 ? -8.594  -4.959  -3.446  1.00 0.00 ? 99  LEU B N    3  
ATOM 5896  C CA   . LEU B 2 101 ? -7.455  -5.727  -3.915  1.00 0.00 ? 99  LEU B CA   3  
ATOM 5897  C C    . LEU B 2 101 ? -6.778  -6.579  -2.841  1.00 0.00 ? 99  LEU B C    3  
ATOM 5898  O O    . LEU B 2 101 ? -6.526  -7.760  -3.065  1.00 0.00 ? 99  LEU B O    3  
ATOM 5899  C CB   . LEU B 2 101 ? -6.466  -4.733  -4.510  1.00 0.00 ? 99  LEU B CB   3  
ATOM 5900  C CG   . LEU B 2 101 ? -6.667  -4.469  -6.002  1.00 0.00 ? 99  LEU B CG   3  
ATOM 5901  C CD1  . LEU B 2 101 ? -5.932  -3.207  -6.424  1.00 0.00 ? 99  LEU B CD1  3  
ATOM 5902  C CD2  . LEU B 2 101 ? -6.206  -5.661  -6.827  1.00 0.00 ? 99  LEU B CD2  3  
ATOM 5903  H H    . LEU B 2 101 ? -8.464  -3.998  -3.274  1.00 0.00 ? 99  LEU B H    3  
ATOM 5904  H HA   . LEU B 2 101 ? -7.799  -6.376  -4.704  1.00 0.00 ? 99  LEU B HA   3  
ATOM 5905  H HB2  . LEU B 2 101 ? -6.590  -3.794  -3.986  1.00 0.00 ? 99  LEU B HB2  3  
ATOM 5906  H HB3  . LEU B 2 101 ? -5.464  -5.078  -4.341  1.00 0.00 ? 99  LEU B HB3  3  
ATOM 5907  H HG   . LEU B 2 101 ? -7.727  -4.317  -6.189  1.00 0.00 ? 99  LEU B HG   3  
ATOM 5908  H HD11 . LEU B 2 101 ? -6.314  -2.366  -5.864  1.00 0.00 ? 99  LEU B HD11 3  
ATOM 5909  H HD12 . LEU B 2 101 ? -6.086  -3.036  -7.479  1.00 0.00 ? 99  LEU B HD12 3  
ATOM 5910  H HD13 . LEU B 2 101 ? -4.877  -3.321  -6.226  1.00 0.00 ? 99  LEU B HD13 3  
ATOM 5911  H HD21 . LEU B 2 101 ? -5.153  -5.830  -6.658  1.00 0.00 ? 99  LEU B HD21 3  
ATOM 5912  H HD22 . LEU B 2 101 ? -6.376  -5.462  -7.875  1.00 0.00 ? 99  LEU B HD22 3  
ATOM 5913  H HD23 . LEU B 2 101 ? -6.762  -6.539  -6.532  1.00 0.00 ? 99  LEU B HD23 3  
ATOM 5914  N N    . LEU B 2 102 ? -6.511  -5.990  -1.685  1.00 0.00 ? 100 LEU B N    3  
ATOM 5915  C CA   . LEU B 2 102 ? -5.812  -6.678  -0.596  1.00 0.00 ? 100 LEU B CA   3  
ATOM 5916  C C    . LEU B 2 102 ? -6.397  -8.054  -0.254  1.00 0.00 ? 100 LEU B C    3  
ATOM 5917  O O    . LEU B 2 102 ? -5.661  -9.035  -0.262  1.00 0.00 ? 100 LEU B O    3  
ATOM 5918  C CB   . LEU B 2 102 ? -5.728  -5.794  0.649   1.00 0.00 ? 100 LEU B CB   3  
ATOM 5919  C CG   . LEU B 2 102 ? -4.701  -4.676  0.518   1.00 0.00 ? 100 LEU B CG   3  
ATOM 5920  C CD1  . LEU B 2 102 ? -4.547  -3.893  1.811   1.00 0.00 ? 100 LEU B CD1  3  
ATOM 5921  C CD2  . LEU B 2 102 ? -3.368  -5.242  0.096   1.00 0.00 ? 100 LEU B CD2  3  
ATOM 5922  H H    . LEU B 2 102 ? -6.808  -5.062  -1.544  1.00 0.00 ? 100 LEU B H    3  
ATOM 5923  H HA   . LEU B 2 102 ? -4.803  -6.827  -0.944  1.00 0.00 ? 100 LEU B HA   3  
ATOM 5924  H HB2  . LEU B 2 102 ? -6.699  -5.355  0.829   1.00 0.00 ? 100 LEU B HB2  3  
ATOM 5925  H HB3  . LEU B 2 102 ? -5.459  -6.409  1.494   1.00 0.00 ? 100 LEU B HB3  3  
ATOM 5926  H HG   . LEU B 2 102 ? -5.026  -4.001  -0.254  1.00 0.00 ? 100 LEU B HG   3  
ATOM 5927  H HD11 . LEU B 2 102 ? -3.747  -3.172  1.698   1.00 0.00 ? 100 LEU B HD11 3  
ATOM 5928  H HD12 . LEU B 2 102 ? -4.302  -4.571  2.615   1.00 0.00 ? 100 LEU B HD12 3  
ATOM 5929  H HD13 . LEU B 2 102 ? -5.465  -3.380  2.035   1.00 0.00 ? 100 LEU B HD13 3  
ATOM 5930  H HD21 . LEU B 2 102 ? -2.973  -5.861  0.889   1.00 0.00 ? 100 LEU B HD21 3  
ATOM 5931  H HD22 . LEU B 2 102 ? -2.682  -4.433  -0.105  1.00 0.00 ? 100 LEU B HD22 3  
ATOM 5932  H HD23 . LEU B 2 102 ? -3.496  -5.836  -0.795  1.00 0.00 ? 100 LEU B HD23 3  
ATOM 5933  N N    . PRO B 2 103 ? -7.714  -8.171  0.031   1.00 0.00 ? 101 PRO B N    3  
ATOM 5934  C CA   . PRO B 2 103 ? -8.334  -9.463  0.378   1.00 0.00 ? 101 PRO B CA   3  
ATOM 5935  C C    . PRO B 2 103 ? -8.150  -10.534 -0.699  1.00 0.00 ? 101 PRO B C    3  
ATOM 5936  O O    . PRO B 2 103 ? -8.296  -11.723 -0.427  1.00 0.00 ? 101 PRO B O    3  
ATOM 5937  C CB   . PRO B 2 103 ? -9.822  -9.129  0.541   1.00 0.00 ? 101 PRO B CB   3  
ATOM 5938  C CG   . PRO B 2 103 ? -10.002 -7.809  -0.121  1.00 0.00 ? 101 PRO B CG   3  
ATOM 5939  C CD   . PRO B 2 103 ? -8.703  -7.082  0.060   1.00 0.00 ? 101 PRO B CD   3  
ATOM 5940  H HA   . PRO B 2 103 ? -7.948  -9.837  1.315   1.00 0.00 ? 101 PRO B HA   3  
ATOM 5941  H HB2  . PRO B 2 103 ? -10.418 -9.893  0.065   1.00 0.00 ? 101 PRO B HB2  3  
ATOM 5942  H HB3  . PRO B 2 103 ? -10.068 -9.078  1.592   1.00 0.00 ? 101 PRO B HB3  3  
ATOM 5943  H HG2  . PRO B 2 103 ? -10.210 -7.949  -1.172  1.00 0.00 ? 101 PRO B HG2  3  
ATOM 5944  H HG3  . PRO B 2 103 ? -10.805 -7.265  0.353   1.00 0.00 ? 101 PRO B HG3  3  
ATOM 5945  H HD2  . PRO B 2 103 ? -8.541  -6.388  -0.753  1.00 0.00 ? 101 PRO B HD2  3  
ATOM 5946  H HD3  . PRO B 2 103 ? -8.684  -6.567  1.009   1.00 0.00 ? 101 PRO B HD3  3  
ATOM 5947  N N    . LYS B 2 104 ? -7.825  -10.113 -1.916  1.00 0.00 ? 102 LYS B N    3  
ATOM 5948  C CA   . LYS B 2 104 ? -7.628  -11.047 -3.016  1.00 0.00 ? 102 LYS B CA   3  
ATOM 5949  C C    . LYS B 2 104 ? -6.187  -11.550 -3.065  1.00 0.00 ? 102 LYS B C    3  
ATOM 5950  O O    . LYS B 2 104 ? -5.864  -12.457 -3.830  1.00 0.00 ? 102 LYS B O    3  
ATOM 5951  C CB   . LYS B 2 104 ? -8.005  -10.393 -4.351  1.00 0.00 ? 102 LYS B CB   3  
ATOM 5952  C CG   . LYS B 2 104 ? -9.495  -10.117 -4.497  1.00 0.00 ? 102 LYS B CG   3  
ATOM 5953  C CD   . LYS B 2 104 ? -9.885  -9.885  -5.950  1.00 0.00 ? 102 LYS B CD   3  
ATOM 5954  C CE   . LYS B 2 104 ? -9.708  -8.431  -6.363  1.00 0.00 ? 102 LYS B CE   3  
ATOM 5955  N NZ   . LYS B 2 104 ? -10.774 -7.556  -5.798  1.00 0.00 ? 102 LYS B NZ   3  
ATOM 5956  H H    . LYS B 2 104 ? -7.695  -9.153  -2.072  1.00 0.00 ? 102 LYS B H    3  
ATOM 5957  H HA   . LYS B 2 104 ? -8.280  -11.892 -2.849  1.00 0.00 ? 102 LYS B HA   3  
ATOM 5958  H HB2  . LYS B 2 104 ? -7.476  -9.455  -4.440  1.00 0.00 ? 102 LYS B HB2  3  
ATOM 5959  H HB3  . LYS B 2 104 ? -7.701  -11.046 -5.156  1.00 0.00 ? 102 LYS B HB3  3  
ATOM 5960  H HG2  . LYS B 2 104 ? -10.047 -10.964 -4.119  1.00 0.00 ? 102 LYS B HG2  3  
ATOM 5961  H HG3  . LYS B 2 104 ? -9.745  -9.237  -3.921  1.00 0.00 ? 102 LYS B HG3  3  
ATOM 5962  H HD2  . LYS B 2 104 ? -9.264  -10.503 -6.581  1.00 0.00 ? 102 LYS B HD2  3  
ATOM 5963  H HD3  . LYS B 2 104 ? -10.920 -10.164 -6.080  1.00 0.00 ? 102 LYS B HD3  3  
ATOM 5964  H HE2  . LYS B 2 104 ? -8.748  -8.085  -6.011  1.00 0.00 ? 102 LYS B HE2  3  
ATOM 5965  H HE3  . LYS B 2 104 ? -9.739  -8.370  -7.441  1.00 0.00 ? 102 LYS B HE3  3  
ATOM 5966  H HZ1  . LYS B 2 104 ? -11.707 -7.996  -5.927  1.00 0.00 ? 102 LYS B HZ1  3  
ATOM 5967  H HZ2  . LYS B 2 104 ? -10.772 -6.633  -6.274  1.00 0.00 ? 102 LYS B HZ2  3  
ATOM 5968  H HZ3  . LYS B 2 104 ? -10.611 -7.405  -4.777  1.00 0.00 ? 102 LYS B HZ3  3  
ATOM 5969  N N    . PHE B 2 105 ? -5.321  -10.953 -2.251  1.00 0.00 ? 103 PHE B N    3  
ATOM 5970  C CA   . PHE B 2 105 ? -3.916  -11.345 -2.210  1.00 0.00 ? 103 PHE B CA   3  
ATOM 5971  C C    . PHE B 2 105 ? -3.480  -11.704 -0.789  1.00 0.00 ? 103 PHE B C    3  
ATOM 5972  O O    . PHE B 2 105 ? -2.355  -12.157 -0.577  1.00 0.00 ? 103 PHE B O    3  
ATOM 5973  C CB   . PHE B 2 105 ? -3.025  -10.214 -2.740  1.00 0.00 ? 103 PHE B CB   3  
ATOM 5974  C CG   . PHE B 2 105 ? -3.217  -9.901  -4.198  1.00 0.00 ? 103 PHE B CG   3  
ATOM 5975  C CD1  . PHE B 2 105 ? -4.138  -8.947  -4.596  1.00 0.00 ? 103 PHE B CD1  3  
ATOM 5976  C CD2  . PHE B 2 105 ? -2.470  -10.550 -5.169  1.00 0.00 ? 103 PHE B CD2  3  
ATOM 5977  C CE1  . PHE B 2 105 ? -4.314  -8.647  -5.931  1.00 0.00 ? 103 PHE B CE1  3  
ATOM 5978  C CE2  . PHE B 2 105 ? -2.642  -10.254 -6.509  1.00 0.00 ? 103 PHE B CE2  3  
ATOM 5979  C CZ   . PHE B 2 105 ? -3.565  -9.300  -6.889  1.00 0.00 ? 103 PHE B CZ   3  
ATOM 5980  H H    . PHE B 2 105 ? -5.633  -10.228 -1.669  1.00 0.00 ? 103 PHE B H    3  
ATOM 5981  H HA   . PHE B 2 105 ? -3.794  -12.212 -2.842  1.00 0.00 ? 103 PHE B HA   3  
ATOM 5982  H HB2  . PHE B 2 105 ? -3.235  -9.314  -2.182  1.00 0.00 ? 103 PHE B HB2  3  
ATOM 5983  H HB3  . PHE B 2 105 ? -1.990  -10.486 -2.591  1.00 0.00 ? 103 PHE B HB3  3  
ATOM 5984  H HD1  . PHE B 2 105 ? -4.724  -8.435  -3.849  1.00 0.00 ? 103 PHE B HD1  3  
ATOM 5985  H HD2  . PHE B 2 105 ? -1.747  -11.296 -4.870  1.00 0.00 ? 103 PHE B HD2  3  
ATOM 5986  H HE1  . PHE B 2 105 ? -5.037  -7.900  -6.226  1.00 0.00 ? 103 PHE B HE1  3  
ATOM 5987  H HE2  . PHE B 2 105 ? -2.055  -10.767 -7.256  1.00 0.00 ? 103 PHE B HE2  3  
ATOM 5988  H HZ   . PHE B 2 105 ? -3.701  -9.063  -7.935  1.00 0.00 ? 103 PHE B HZ   3  
ATOM 5989  N N    . LYS B 2 106 ? -4.370  -11.492 0.178   1.00 0.00 ? 104 LYS B N    3  
ATOM 5990  C CA   . LYS B 2 106 ? -4.074  -11.779 1.581   1.00 0.00 ? 104 LYS B CA   3  
ATOM 5991  C C    . LYS B 2 106 ? -3.726  -13.252 1.786   1.00 0.00 ? 104 LYS B C    3  
ATOM 5992  O O    . LYS B 2 106 ? -4.591  -14.126 1.702   1.00 0.00 ? 104 LYS B O    3  
ATOM 5993  C CB   . LYS B 2 106 ? -5.260  -11.398 2.473   1.00 0.00 ? 104 LYS B CB   3  
ATOM 5994  C CG   . LYS B 2 106 ? -5.421  -9.898  2.673   1.00 0.00 ? 104 LYS B CG   3  
ATOM 5995  C CD   . LYS B 2 106 ? -6.625  -9.581  3.544   1.00 0.00 ? 104 LYS B CD   3  
ATOM 5996  C CE   . LYS B 2 106 ? -6.972  -8.098  3.506   1.00 0.00 ? 104 LYS B CE   3  
ATOM 5997  N NZ   . LYS B 2 106 ? -7.832  -7.701  4.650   1.00 0.00 ? 104 LYS B NZ   3  
ATOM 5998  H H    . LYS B 2 106 ? -5.248  -11.131 -0.058  1.00 0.00 ? 104 LYS B H    3  
ATOM 5999  H HA   . LYS B 2 106 ? -3.220  -11.183 1.865   1.00 0.00 ? 104 LYS B HA   3  
ATOM 6000  H HB2  . LYS B 2 106 ? -6.167  -11.776 2.025   1.00 0.00 ? 104 LYS B HB2  3  
ATOM 6001  H HB3  . LYS B 2 106 ? -5.129  -11.856 3.441   1.00 0.00 ? 104 LYS B HB3  3  
ATOM 6002  H HG2  . LYS B 2 106 ? -4.532  -9.512  3.149   1.00 0.00 ? 104 LYS B HG2  3  
ATOM 6003  H HG3  . LYS B 2 106 ? -5.550  -9.427  1.709   1.00 0.00 ? 104 LYS B HG3  3  
ATOM 6004  H HD2  . LYS B 2 106 ? -7.473  -10.146 3.189   1.00 0.00 ? 104 LYS B HD2  3  
ATOM 6005  H HD3  . LYS B 2 106 ? -6.404  -9.863  4.563   1.00 0.00 ? 104 LYS B HD3  3  
ATOM 6006  H HE2  . LYS B 2 106 ? -6.058  -7.526  3.540   1.00 0.00 ? 104 LYS B HE2  3  
ATOM 6007  H HE3  . LYS B 2 106 ? -7.494  -7.888  2.584   1.00 0.00 ? 104 LYS B HE3  3  
ATOM 6008  H HZ1  . LYS B 2 106 ? -8.705  -8.279  4.664   1.00 0.00 ? 104 LYS B HZ1  3  
ATOM 6009  H HZ2  . LYS B 2 106 ? -8.093  -6.690  4.581   1.00 0.00 ? 104 LYS B HZ2  3  
ATOM 6010  H HZ3  . LYS B 2 106 ? -7.320  -7.856  5.549   1.00 0.00 ? 104 LYS B HZ3  3  
ATOM 6011  N N    . ARG B 2 107 ? -2.456  -13.517 2.063   1.00 0.00 ? 105 ARG B N    3  
ATOM 6012  C CA   . ARG B 2 107 ? -1.984  -14.878 2.283   1.00 0.00 ? 105 ARG B CA   3  
ATOM 6013  C C    . ARG B 2 107 ? -2.293  -15.342 3.708   1.00 0.00 ? 105 ARG B C    3  
ATOM 6014  O O    . ARG B 2 107 ? -1.392  -15.605 4.506   1.00 0.00 ? 105 ARG B O    3  
ATOM 6015  C CB   . ARG B 2 107 ? -0.479  -14.977 1.994   1.00 0.00 ? 105 ARG B CB   3  
ATOM 6016  C CG   . ARG B 2 107 ? 0.366   -13.962 2.753   1.00 0.00 ? 105 ARG B CG   3  
ATOM 6017  C CD   . ARG B 2 107 ? 1.849   -14.157 2.479   1.00 0.00 ? 105 ARG B CD   3  
ATOM 6018  N NE   . ARG B 2 107 ? 2.682   -13.303 3.325   1.00 0.00 ? 105 ARG B NE   3  
ATOM 6019  C CZ   . ARG B 2 107 ? 3.472   -12.333 2.859   1.00 0.00 ? 105 ARG B CZ   3  
ATOM 6020  N NH1  . ARG B 2 107 ? 3.552   -12.107 1.553   1.00 0.00 ? 105 ARG B NH1  3  
ATOM 6021  N NH2  . ARG B 2 107 ? 4.182   -11.589 3.698   1.00 0.00 ? 105 ARG B NH2  3  
ATOM 6022  H H    . ARG B 2 107 ? -1.816  -12.777 2.114   1.00 0.00 ? 105 ARG B H    3  
ATOM 6023  H HA   . ARG B 2 107 ? -2.512  -15.520 1.593   1.00 0.00 ? 105 ARG B HA   3  
ATOM 6024  H HB2  . ARG B 2 107 ? -0.138  -15.966 2.259   1.00 0.00 ? 105 ARG B HB2  3  
ATOM 6025  H HB3  . ARG B 2 107 ? -0.320  -14.824 0.936   1.00 0.00 ? 105 ARG B HB3  3  
ATOM 6026  H HG2  . ARG B 2 107 ? 0.082   -12.968 2.444   1.00 0.00 ? 105 ARG B HG2  3  
ATOM 6027  H HG3  . ARG B 2 107 ? 0.186   -14.078 3.811   1.00 0.00 ? 105 ARG B HG3  3  
ATOM 6028  H HD2  . ARG B 2 107 ? 2.104   -15.190 2.667   1.00 0.00 ? 105 ARG B HD2  3  
ATOM 6029  H HD3  . ARG B 2 107 ? 2.045   -13.923 1.444   1.00 0.00 ? 105 ARG B HD3  3  
ATOM 6030  H HE   . ARG B 2 107 ? 2.640   -13.452 4.294   1.00 0.00 ? 105 ARG B HE   3  
ATOM 6031  H HH11 . ARG B 2 107 ? 3.026   -12.661 0.914   1.00 0.00 ? 105 ARG B HH11 3  
ATOM 6032  H HH12 . ARG B 2 107 ? 4.134   -11.350 1.201   1.00 0.00 ? 105 ARG B HH12 3  
ATOM 6033  H HH21 . ARG B 2 107 ? 4.134   -11.750 4.680   1.00 0.00 ? 105 ARG B HH21 3  
ATOM 6034  H HH22 . ARG B 2 107 ? 4.766   -10.835 3.339   1.00 0.00 ? 105 ARG B HH22 3  
ATOM 6035  N N    . LYS B 2 108 ? -3.575  -15.437 4.022   1.00 0.00 ? 106 LYS B N    3  
ATOM 6036  C CA   . LYS B 2 108 ? -4.006  -15.866 5.341   1.00 0.00 ? 106 LYS B CA   3  
ATOM 6037  C C    . LYS B 2 108 ? -4.747  -17.195 5.246   1.00 0.00 ? 106 LYS B C    3  
ATOM 6038  O O    . LYS B 2 108 ? -5.443  -17.457 4.268   1.00 0.00 ? 106 LYS B O    3  
ATOM 6039  C CB   . LYS B 2 108 ? -4.890  -14.796 5.995   1.00 0.00 ? 106 LYS B CB   3  
ATOM 6040  C CG   . LYS B 2 108 ? -6.195  -14.521 5.257   1.00 0.00 ? 106 LYS B CG   3  
ATOM 6041  C CD   . LYS B 2 108 ? -6.812  -13.194 5.680   1.00 0.00 ? 106 LYS B CD   3  
ATOM 6042  C CE   . LYS B 2 108 ? -7.126  -13.163 7.169   1.00 0.00 ? 106 LYS B CE   3  
ATOM 6043  N NZ   . LYS B 2 108 ? -8.575  -13.352 7.442   1.00 0.00 ? 106 LYS B NZ   3  
ATOM 6044  H H    . LYS B 2 108 ? -4.252  -15.219 3.343   1.00 0.00 ? 106 LYS B H    3  
ATOM 6045  H HA   . LYS B 2 108 ? -3.122  -16.007 5.946   1.00 0.00 ? 106 LYS B HA   3  
ATOM 6046  H HB2  . LYS B 2 108 ? -5.133  -15.113 6.998   1.00 0.00 ? 106 LYS B HB2  3  
ATOM 6047  H HB3  . LYS B 2 108 ? -4.333  -13.872 6.047   1.00 0.00 ? 106 LYS B HB3  3  
ATOM 6048  H HG2  . LYS B 2 108 ? -5.998  -14.493 4.196   1.00 0.00 ? 106 LYS B HG2  3  
ATOM 6049  H HG3  . LYS B 2 108 ? -6.893  -15.318 5.473   1.00 0.00 ? 106 LYS B HG3  3  
ATOM 6050  H HD2  . LYS B 2 108 ? -6.118  -12.400 5.454   1.00 0.00 ? 106 LYS B HD2  3  
ATOM 6051  H HD3  . LYS B 2 108 ? -7.727  -13.042 5.125   1.00 0.00 ? 106 LYS B HD3  3  
ATOM 6052  H HE2  . LYS B 2 108 ? -6.574  -13.953 7.655   1.00 0.00 ? 106 LYS B HE2  3  
ATOM 6053  H HE3  . LYS B 2 108 ? -6.815  -12.209 7.567   1.00 0.00 ? 106 LYS B HE3  3  
ATOM 6054  H HZ1  . LYS B 2 108 ? -8.750  -13.318 8.465   1.00 0.00 ? 106 LYS B HZ1  3  
ATOM 6055  H HZ2  . LYS B 2 108 ? -8.895  -14.280 7.082   1.00 0.00 ? 106 LYS B HZ2  3  
ATOM 6056  H HZ3  . LYS B 2 108 ? -9.133  -12.592 6.980   1.00 0.00 ? 106 LYS B HZ3  3  
ATOM 6057  N N    . ALA B 2 109 ? -4.586  -18.033 6.260   1.00 0.00 ? 107 ALA B N    3  
ATOM 6058  C CA   . ALA B 2 109 ? -5.240  -19.336 6.285   1.00 0.00 ? 107 ALA B CA   3  
ATOM 6059  C C    . ALA B 2 109 ? -6.454  -19.306 7.202   1.00 0.00 ? 107 ALA B C    3  
ATOM 6060  O O    . ALA B 2 109 ? -6.938  -20.344 7.651   1.00 0.00 ? 107 ALA B O    3  
ATOM 6061  C CB   . ALA B 2 109 ? -4.259  -20.414 6.723   1.00 0.00 ? 107 ALA B CB   3  
ATOM 6062  H H    . ALA B 2 109 ? -4.015  -17.771 7.012   1.00 0.00 ? 107 ALA B H    3  
ATOM 6063  H HA   . ALA B 2 109 ? -5.568  -19.560 5.282   1.00 0.00 ? 107 ALA B HA   3  
ATOM 6064  H HB1  . ALA B 2 109 ? -3.364  -20.353 6.121   1.00 0.00 ? 107 ALA B HB1  3  
ATOM 6065  H HB2  . ALA B 2 109 ? -4.712  -21.386 6.597   1.00 0.00 ? 107 ALA B HB2  3  
ATOM 6066  H HB3  . ALA B 2 109 ? -4.004  -20.268 7.763   1.00 0.00 ? 107 ALA B HB3  3  
ATOM 6067  N N    . ASN B 2 110 ? -6.933  -18.099 7.455   1.00 0.00 ? 108 ASN B N    3  
ATOM 6068  C CA   . ASN B 2 110 ? -8.087  -17.867 8.312   1.00 0.00 ? 108 ASN B CA   3  
ATOM 6069  C C    . ASN B 2 110 ? -8.456  -16.391 8.257   1.00 0.00 ? 108 ASN B C    3  
ATOM 6070  O O    . ASN B 2 110 ? -9.095  -15.974 7.273   1.00 0.00 ? 108 ASN B O    3  
ATOM 6071  C CB   . ASN B 2 110 ? -7.790  -18.281 9.761   1.00 0.00 ? 108 ASN B CB   3  
ATOM 6072  C CG   . ASN B 2 110 ? -9.027  -18.265 10.646  1.00 0.00 ? 108 ASN B CG   3  
ATOM 6073  O OD1  . ASN B 2 110 ? -9.656  -19.297 10.878  1.00 0.00 ? 108 ASN B OD1  3  
ATOM 6074  N ND2  . ASN B 2 110 ? -9.390  -17.092 11.136  1.00 0.00 ? 108 ASN B ND2  3  
ATOM 6075  O OXT  . ASN B 2 110 ? -8.063  -15.641 9.177   1.00 0.00 ? 108 ASN B OXT  3  
ATOM 6076  H H    . ASN B 2 110 ? -6.505  -17.331 7.030   1.00 0.00 ? 108 ASN B H    3  
ATOM 6077  H HA   . ASN B 2 110 ? -8.913  -18.453 7.933   1.00 0.00 ? 108 ASN B HA   3  
ATOM 6078  H HB2  . ASN B 2 110 ? -7.383  -19.281 9.766   1.00 0.00 ? 108 ASN B HB2  3  
ATOM 6079  H HB3  . ASN B 2 110 ? -7.064  -17.600 10.180  1.00 0.00 ? 108 ASN B HB3  3  
ATOM 6080  H HD21 . ASN B 2 110 ? -8.846  -16.304 10.898  1.00 0.00 ? 108 ASN B HD21 3  
ATOM 6081  H HD22 . ASN B 2 110 ? -10.181 -17.054 11.708  1.00 0.00 ? 108 ASN B HD22 3  
ATOM 6082  N N    . TYR A 1 1   ? 10.179  9.050   16.223  1.00 0.00 ? 392 TYR A N    4  
ATOM 6083  C CA   . TYR A 1 1   ? 9.774   8.453   17.514  1.00 0.00 ? 392 TYR A CA   4  
ATOM 6084  C C    . TYR A 1 1   ? 9.672   6.938   17.392  1.00 0.00 ? 392 TYR A C    4  
ATOM 6085  O O    . TYR A 1 1   ? 10.489  6.217   17.959  1.00 0.00 ? 392 TYR A O    4  
ATOM 6086  C CB   . TYR A 1 1   ? 8.446   9.048   18.018  1.00 0.00 ? 392 TYR A CB   4  
ATOM 6087  C CG   . TYR A 1 1   ? 7.579   9.677   16.944  1.00 0.00 ? 392 TYR A CG   4  
ATOM 6088  C CD1  . TYR A 1 1   ? 6.511   8.981   16.391  1.00 0.00 ? 392 TYR A CD1  4  
ATOM 6089  C CD2  . TYR A 1 1   ? 7.827   10.968  16.490  1.00 0.00 ? 392 TYR A CD2  4  
ATOM 6090  C CE1  . TYR A 1 1   ? 5.717   9.553   15.414  1.00 0.00 ? 392 TYR A CE1  4  
ATOM 6091  C CE2  . TYR A 1 1   ? 7.038   11.545  15.514  1.00 0.00 ? 392 TYR A CE2  4  
ATOM 6092  C CZ   . TYR A 1 1   ? 5.986   10.834  14.979  1.00 0.00 ? 392 TYR A CZ   4  
ATOM 6093  O OH   . TYR A 1 1   ? 5.201   11.407  14.005  1.00 0.00 ? 392 TYR A OH   4  
ATOM 6094  H H1   . TYR A 1 1   ? 11.133  8.734   15.967  1.00 0.00 ? 392 TYR A H1   4  
ATOM 6095  H H2   . TYR A 1 1   ? 10.169  10.084  16.283  1.00 0.00 ? 392 TYR A H2   4  
ATOM 6096  H H3   . TYR A 1 1   ? 9.516   8.753   15.465  1.00 0.00 ? 392 TYR A H3   4  
ATOM 6097  H HA   . TYR A 1 1   ? 10.548  8.680   18.234  1.00 0.00 ? 392 TYR A HA   4  
ATOM 6098  H HB2  . TYR A 1 1   ? 7.868   8.265   18.484  1.00 0.00 ? 392 TYR A HB2  4  
ATOM 6099  H HB3  . TYR A 1 1   ? 8.663   9.809   18.754  1.00 0.00 ? 392 TYR A HB3  4  
ATOM 6100  H HD1  . TYR A 1 1   ? 6.305   7.978   16.732  1.00 0.00 ? 392 TYR A HD1  4  
ATOM 6101  H HD2  . TYR A 1 1   ? 8.652   11.522  16.910  1.00 0.00 ? 392 TYR A HD2  4  
ATOM 6102  H HE1  . TYR A 1 1   ? 4.892   8.996   14.997  1.00 0.00 ? 392 TYR A HE1  4  
ATOM 6103  H HE2  . TYR A 1 1   ? 7.249   12.547  15.173  1.00 0.00 ? 392 TYR A HE2  4  
ATOM 6104  H HH   . TYR A 1 1   ? 4.293   11.106  14.105  1.00 0.00 ? 392 TYR A HH   4  
ATOM 6105  N N    . VAL A 1 2   ? 8.688   6.459   16.639  1.00 0.00 ? 393 VAL A N    4  
ATOM 6106  C CA   . VAL A 1 2   ? 8.497   5.029   16.454  1.00 0.00 ? 393 VAL A CA   4  
ATOM 6107  C C    . VAL A 1 2   ? 7.460   4.771   15.364  1.00 0.00 ? 393 VAL A C    4  
ATOM 6108  O O    . VAL A 1 2   ? 6.479   5.504   15.248  1.00 0.00 ? 393 VAL A O    4  
ATOM 6109  C CB   . VAL A 1 2   ? 8.070   4.333   17.774  1.00 0.00 ? 393 VAL A CB   4  
ATOM 6110  C CG1  . VAL A 1 2   ? 6.711   4.831   18.252  1.00 0.00 ? 393 VAL A CG1  4  
ATOM 6111  C CG2  . VAL A 1 2   ? 8.068   2.819   17.615  1.00 0.00 ? 393 VAL A CG2  4  
ATOM 6112  H H    . VAL A 1 2   ? 8.077   7.082   16.184  1.00 0.00 ? 393 VAL A H    4  
ATOM 6113  H HA   . VAL A 1 2   ? 9.441   4.612   16.138  1.00 0.00 ? 393 VAL A HA   4  
ATOM 6114  H HB   . VAL A 1 2   ? 8.799   4.586   18.532  1.00 0.00 ? 393 VAL A HB   4  
ATOM 6115  H HG11 . VAL A 1 2   ? 6.436   4.311   19.157  1.00 0.00 ? 393 VAL A HG11 4  
ATOM 6116  H HG12 . VAL A 1 2   ? 5.971   4.643   17.490  1.00 0.00 ? 393 VAL A HG12 4  
ATOM 6117  H HG13 . VAL A 1 2   ? 6.765   5.891   18.449  1.00 0.00 ? 393 VAL A HG13 4  
ATOM 6118  H HG21 . VAL A 1 2   ? 9.071   2.477   17.403  1.00 0.00 ? 393 VAL A HG21 4  
ATOM 6119  H HG22 . VAL A 1 2   ? 7.415   2.544   16.799  1.00 0.00 ? 393 VAL A HG22 4  
ATOM 6120  H HG23 . VAL A 1 2   ? 7.716   2.361   18.527  1.00 0.00 ? 393 VAL A HG23 4  
ATOM 6121  N N    . GLY A 1 3   ? 7.692   3.738   14.560  1.00 0.00 ? 394 GLY A N    4  
ATOM 6122  C CA   . GLY A 1 3   ? 6.777   3.417   13.484  1.00 0.00 ? 394 GLY A CA   4  
ATOM 6123  C C    . GLY A 1 3   ? 6.843   4.453   12.386  1.00 0.00 ? 394 GLY A C    4  
ATOM 6124  O O    . GLY A 1 3   ? 7.867   4.589   11.711  1.00 0.00 ? 394 GLY A O    4  
ATOM 6125  H H    . GLY A 1 3   ? 8.496   3.196   14.694  1.00 0.00 ? 394 GLY A H    4  
ATOM 6126  H HA2  . GLY A 1 3   ? 7.035   2.450   13.077  1.00 0.00 ? 394 GLY A HA2  4  
ATOM 6127  H HA3  . GLY A 1 3   ? 5.772   3.382   13.874  1.00 0.00 ? 394 GLY A HA3  4  
ATOM 6128  N N    . GLU A 1 4   ? 5.762   5.193   12.210  1.00 0.00 ? 395 GLU A N    4  
ATOM 6129  C CA   . GLU A 1 4   ? 5.730   6.232   11.205  1.00 0.00 ? 395 GLU A CA   4  
ATOM 6130  C C    . GLU A 1 4   ? 5.956   7.577   11.868  1.00 0.00 ? 395 GLU A C    4  
ATOM 6131  O O    . GLU A 1 4   ? 5.506   7.808   12.986  1.00 0.00 ? 395 GLU A O    4  
ATOM 6132  C CB   . GLU A 1 4   ? 4.414   6.237   10.434  1.00 0.00 ? 395 GLU A CB   4  
ATOM 6133  C CG   . GLU A 1 4   ? 4.482   7.089   9.179   1.00 0.00 ? 395 GLU A CG   4  
ATOM 6134  C CD   . GLU A 1 4   ? 5.649   6.711   8.297   1.00 0.00 ? 395 GLU A CD   4  
ATOM 6135  O OE1  . GLU A 1 4   ? 6.766   7.200   8.558   1.00 0.00 ? 395 GLU A OE1  4  
ATOM 6136  O OE2  . GLU A 1 4   ? 5.460   5.916   7.358   1.00 0.00 ? 395 GLU A OE2  4  
ATOM 6137  H H    . GLU A 1 4   ? 4.981   5.050   12.780  1.00 0.00 ? 395 GLU A H    4  
ATOM 6138  H HA   . GLU A 1 4   ? 6.541   6.047   10.515  1.00 0.00 ? 395 GLU A HA   4  
ATOM 6139  H HB2  . GLU A 1 4   ? 4.168   5.224   10.149  1.00 0.00 ? 395 GLU A HB2  4  
ATOM 6140  H HB3  . GLU A 1 4   ? 3.633   6.627   11.069  1.00 0.00 ? 395 GLU A HB3  4  
ATOM 6141  H HG2  . GLU A 1 4   ? 3.571   6.965   8.618   1.00 0.00 ? 395 GLU A HG2  4  
ATOM 6142  H HG3  . GLU A 1 4   ? 4.594   8.126   9.468   1.00 0.00 ? 395 GLU A HG3  4  
ATOM 6143  N N    . ASP A 1 5   ? 6.650   8.458   11.170  1.00 0.00 ? 396 ASP A N    4  
ATOM 6144  C CA   . ASP A 1 5   ? 6.967   9.774   11.704  1.00 0.00 ? 396 ASP A CA   4  
ATOM 6145  C C    . ASP A 1 5   ? 6.719   10.838  10.652  1.00 0.00 ? 396 ASP A C    4  
ATOM 6146  O O    . ASP A 1 5   ? 7.389   11.871  10.639  1.00 0.00 ? 396 ASP A O    4  
ATOM 6147  C CB   . ASP A 1 5   ? 8.437   9.848   12.152  1.00 0.00 ? 396 ASP A CB   4  
ATOM 6148  C CG   . ASP A 1 5   ? 8.909   8.616   12.902  1.00 0.00 ? 396 ASP A CG   4  
ATOM 6149  O OD1  . ASP A 1 5   ? 8.816   8.597   14.146  1.00 0.00 ? 396 ASP A OD1  4  
ATOM 6150  O OD2  . ASP A 1 5   ? 9.400   7.671   12.247  1.00 0.00 ? 396 ASP A OD2  4  
ATOM 6151  H H    . ASP A 1 5   ? 6.935   8.227   10.259  1.00 0.00 ? 396 ASP A H    4  
ATOM 6152  H HA   . ASP A 1 5   ? 6.327   9.957   12.552  1.00 0.00 ? 396 ASP A HA   4  
ATOM 6153  H HB2  . ASP A 1 5   ? 9.062   9.972   11.280  1.00 0.00 ? 396 ASP A HB2  4  
ATOM 6154  H HB3  . ASP A 1 5   ? 8.561   10.707  12.797  1.00 0.00 ? 396 ASP A HB3  4  
ATOM 6155  N N    . ASP A 1 6   ? 5.765   10.585  9.758   1.00 0.00 ? 397 ASP A N    4  
ATOM 6156  C CA   . ASP A 1 6   ? 5.466   11.532  8.688   1.00 0.00 ? 397 ASP A CA   4  
ATOM 6157  C C    . ASP A 1 6   ? 4.991   12.866  9.243   1.00 0.00 ? 397 ASP A C    4  
ATOM 6158  O O    . ASP A 1 6   ? 5.276   13.910  8.656   1.00 0.00 ? 397 ASP A O    4  
ATOM 6159  C CB   . ASP A 1 6   ? 4.439   10.982  7.702   1.00 0.00 ? 397 ASP A CB   4  
ATOM 6160  C CG   . ASP A 1 6   ? 4.533   11.689  6.361   1.00 0.00 ? 397 ASP A CG   4  
ATOM 6161  O OD1  . ASP A 1 6   ? 5.272   11.194  5.481   1.00 0.00 ? 397 ASP A OD1  4  
ATOM 6162  O OD2  . ASP A 1 6   ? 3.897   12.753  6.193   1.00 0.00 ? 397 ASP A OD2  4  
ATOM 6163  H H    . ASP A 1 6   ? 5.248   9.754   9.826   1.00 0.00 ? 397 ASP A H    4  
ATOM 6164  H HA   . ASP A 1 6   ? 6.390   11.707  8.155   1.00 0.00 ? 397 ASP A HA   4  
ATOM 6165  H HB2  . ASP A 1 6   ? 4.617   9.927   7.551   1.00 0.00 ? 397 ASP A HB2  4  
ATOM 6166  H HB3  . ASP A 1 6   ? 3.447   11.128  8.100   1.00 0.00 ? 397 ASP A HB3  4  
ATOM 6167  N N    . GLU A 1 7   ? 4.270   12.833  10.367  1.00 0.00 ? 398 GLU A N    4  
ATOM 6168  C CA   . GLU A 1 7   ? 3.789   14.054  11.016  1.00 0.00 ? 398 GLU A CA   4  
ATOM 6169  C C    . GLU A 1 7   ? 2.787   13.736  12.131  1.00 0.00 ? 398 GLU A C    4  
ATOM 6170  O O    . GLU A 1 7   ? 3.085   13.915  13.310  1.00 0.00 ? 398 GLU A O    4  
ATOM 6171  C CB   . GLU A 1 7   ? 3.154   15.004  9.999   1.00 0.00 ? 398 GLU A CB   4  
ATOM 6172  C CG   . GLU A 1 7   ? 3.760   16.399  10.007  1.00 0.00 ? 398 GLU A CG   4  
ATOM 6173  C CD   . GLU A 1 7   ? 3.672   17.078  8.654   1.00 0.00 ? 398 GLU A CD   4  
ATOM 6174  O OE1  . GLU A 1 7   ? 4.718   17.208  7.984   1.00 0.00 ? 398 GLU A OE1  4  
ATOM 6175  O OE2  . GLU A 1 7   ? 2.556   17.478  8.258   1.00 0.00 ? 398 GLU A OE2  4  
ATOM 6176  H H    . GLU A 1 7   ? 4.050   11.961  10.764  1.00 0.00 ? 398 GLU A H    4  
ATOM 6177  H HA   . GLU A 1 7   ? 4.650   14.540  11.452  1.00 0.00 ? 398 GLU A HA   4  
ATOM 6178  H HB2  . GLU A 1 7   ? 3.289   14.588  9.010   1.00 0.00 ? 398 GLU A HB2  4  
ATOM 6179  H HB3  . GLU A 1 7   ? 2.102   15.088  10.207  1.00 0.00 ? 398 GLU A HB3  4  
ATOM 6180  H HG2  . GLU A 1 7   ? 3.234   17.002  10.731  1.00 0.00 ? 398 GLU A HG2  4  
ATOM 6181  H HG3  . GLU A 1 7   ? 4.800   16.323  10.288  1.00 0.00 ? 398 GLU A HG3  4  
ATOM 6182  N N    . GLU A 1 8   ? 1.604   13.268  11.749  1.00 0.00 ? 399 GLU A N    4  
ATOM 6183  C CA   . GLU A 1 8   ? 0.552   12.924  12.705  1.00 0.00 ? 399 GLU A CA   4  
ATOM 6184  C C    . GLU A 1 8   ? -0.272  11.781  12.169  1.00 0.00 ? 399 GLU A C    4  
ATOM 6185  O O    . GLU A 1 8   ? -0.957  11.918  11.160  1.00 0.00 ? 399 GLU A O    4  
ATOM 6186  C CB   . GLU A 1 8   ? -0.368  14.110  12.990  1.00 0.00 ? 399 GLU A CB   4  
ATOM 6187  C CG   . GLU A 1 8   ? -0.485  15.072  11.830  1.00 0.00 ? 399 GLU A CG   4  
ATOM 6188  C CD   . GLU A 1 8   ? -1.660  16.022  11.943  1.00 0.00 ? 399 GLU A CD   4  
ATOM 6189  O OE1  . GLU A 1 8   ? -1.706  16.991  11.151  1.00 0.00 ? 399 GLU A OE1  4  
ATOM 6190  O OE2  . GLU A 1 8   ? -2.537  15.793  12.800  1.00 0.00 ? 399 GLU A OE2  4  
ATOM 6191  H H    . GLU A 1 8   ? 1.438   13.119  10.793  1.00 0.00 ? 399 GLU A H    4  
ATOM 6192  H HA   . GLU A 1 8   ? 1.018   12.611  13.623  1.00 0.00 ? 399 GLU A HA   4  
ATOM 6193  H HB2  . GLU A 1 8   ? -1.355  13.731  13.214  1.00 0.00 ? 399 GLU A HB2  4  
ATOM 6194  H HB3  . GLU A 1 8   ? 0.008   14.646  13.843  1.00 0.00 ? 399 GLU A HB3  4  
ATOM 6195  H HG2  . GLU A 1 8   ? 0.420   15.657  11.774  1.00 0.00 ? 399 GLU A HG2  4  
ATOM 6196  H HG3  . GLU A 1 8   ? -0.595  14.500  10.919  1.00 0.00 ? 399 GLU A HG3  4  
ATOM 6197  N N    . ASP A 1 9   ? -0.212  10.656  12.841  1.00 0.00 ? 400 ASP A N    4  
ATOM 6198  C CA   . ASP A 1 9   ? -0.945  9.491   12.403  1.00 0.00 ? 400 ASP A CA   4  
ATOM 6199  C C    . ASP A 1 9   ? -1.541  8.774   13.604  1.00 0.00 ? 400 ASP A C    4  
ATOM 6200  O O    . ASP A 1 9   ? -0.929  7.862   14.159  1.00 0.00 ? 400 ASP A O    4  
ATOM 6201  C CB   . ASP A 1 9   ? -0.016  8.544   11.653  1.00 0.00 ? 400 ASP A CB   4  
ATOM 6202  C CG   . ASP A 1 9   ? 0.779   9.220   10.550  1.00 0.00 ? 400 ASP A CG   4  
ATOM 6203  O OD1  . ASP A 1 9   ? 0.399   9.065   9.372   1.00 0.00 ? 400 ASP A OD1  4  
ATOM 6204  O OD2  . ASP A 1 9   ? 1.792   9.884   10.859  1.00 0.00 ? 400 ASP A OD2  4  
ATOM 6205  H H    . ASP A 1 9   ? 0.341   10.604  13.647  1.00 0.00 ? 400 ASP A H    4  
ATOM 6206  H HA   . ASP A 1 9   ? -1.734  9.825   11.740  1.00 0.00 ? 400 ASP A HA   4  
ATOM 6207  H HB2  . ASP A 1 9   ? 0.678   8.112   12.355  1.00 0.00 ? 400 ASP A HB2  4  
ATOM 6208  H HB3  . ASP A 1 9   ? -0.611  7.758   11.212  1.00 0.00 ? 400 ASP A HB3  4  
ATOM 6209  N N    . ASP A 1 10  ? -2.732  9.184   14.006  1.00 0.00 ? 401 ASP A N    4  
ATOM 6210  C CA   . ASP A 1 10  ? -3.378  8.594   15.182  1.00 0.00 ? 401 ASP A CA   4  
ATOM 6211  C C    . ASP A 1 10  ? -4.868  8.350   14.982  1.00 0.00 ? 401 ASP A C    4  
ATOM 6212  O O    . ASP A 1 10  ? -5.355  7.258   15.271  1.00 0.00 ? 401 ASP A O    4  
ATOM 6213  C CB   . ASP A 1 10  ? -3.150  9.476   16.417  1.00 0.00 ? 401 ASP A CB   4  
ATOM 6214  C CG   . ASP A 1 10  ? -3.169  10.963  16.097  1.00 0.00 ? 401 ASP A CG   4  
ATOM 6215  O OD1  . ASP A 1 10  ? -3.986  11.390  15.249  1.00 0.00 ? 401 ASP A OD1  4  
ATOM 6216  O OD2  . ASP A 1 10  ? -2.359  11.707  16.680  1.00 0.00 ? 401 ASP A OD2  4  
ATOM 6217  H H    . ASP A 1 10  ? -3.185  9.888   13.505  1.00 0.00 ? 401 ASP A H    4  
ATOM 6218  H HA   . ASP A 1 10  ? -2.912  7.635   15.346  1.00 0.00 ? 401 ASP A HA   4  
ATOM 6219  H HB2  . ASP A 1 10  ? -3.925  9.276   17.141  1.00 0.00 ? 401 ASP A HB2  4  
ATOM 6220  H HB3  . ASP A 1 10  ? -2.190  9.233   16.850  1.00 0.00 ? 401 ASP A HB3  4  
ATOM 6221  N N    . ASP A 1 11  ? -5.593  9.353   14.488  1.00 0.00 ? 402 ASP A N    4  
ATOM 6222  C CA   . ASP A 1 11  ? -7.037  9.222   14.239  1.00 0.00 ? 402 ASP A CA   4  
ATOM 6223  C C    . ASP A 1 11  ? -7.299  8.246   13.098  1.00 0.00 ? 402 ASP A C    4  
ATOM 6224  O O    . ASP A 1 11  ? -8.428  8.075   12.642  1.00 0.00 ? 402 ASP A O    4  
ATOM 6225  C CB   . ASP A 1 11  ? -7.672  10.581  13.920  1.00 0.00 ? 402 ASP A CB   4  
ATOM 6226  C CG   . ASP A 1 11  ? -6.889  11.382  12.897  1.00 0.00 ? 402 ASP A CG   4  
ATOM 6227  O OD1  . ASP A 1 11  ? -6.452  10.806  11.876  1.00 0.00 ? 402 ASP A OD1  4  
ATOM 6228  O OD2  . ASP A 1 11  ? -6.701  12.594  13.124  1.00 0.00 ? 402 ASP A OD2  4  
ATOM 6229  H H    . ASP A 1 11  ? -5.155  10.213  14.309  1.00 0.00 ? 402 ASP A H    4  
ATOM 6230  H HA   . ASP A 1 11  ? -7.488  8.829   15.138  1.00 0.00 ? 402 ASP A HA   4  
ATOM 6231  H HB2  . ASP A 1 11  ? -8.667  10.421  13.533  1.00 0.00 ? 402 ASP A HB2  4  
ATOM 6232  H HB3  . ASP A 1 11  ? -7.735  11.160  14.830  1.00 0.00 ? 402 ASP A HB3  4  
ATOM 6233  N N    . PHE A 1 12  ? -6.228  7.614   12.663  1.00 0.00 ? 403 PHE A N    4  
ATOM 6234  C CA   . PHE A 1 12  ? -6.237  6.640   11.614  1.00 0.00 ? 403 PHE A CA   4  
ATOM 6235  C C    . PHE A 1 12  ? -7.202  5.500   11.941  1.00 0.00 ? 403 PHE A C    4  
ATOM 6236  O O    . PHE A 1 12  ? -7.031  4.797   12.935  1.00 0.00 ? 403 PHE A O    4  
ATOM 6237  C CB   . PHE A 1 12  ? -4.824  6.115   11.504  1.00 0.00 ? 403 PHE A CB   4  
ATOM 6238  C CG   . PHE A 1 12  ? -4.094  6.504   10.277  1.00 0.00 ? 403 PHE A CG   4  
ATOM 6239  C CD1  . PHE A 1 12  ? -4.659  6.306   9.042   1.00 0.00 ? 403 PHE A CD1  4  
ATOM 6240  C CD2  . PHE A 1 12  ? -2.819  7.018   10.359  1.00 0.00 ? 403 PHE A CD2  4  
ATOM 6241  C CE1  . PHE A 1 12  ? -3.968  6.609   7.900   1.00 0.00 ? 403 PHE A CE1  4  
ATOM 6242  C CE2  . PHE A 1 12  ? -2.123  7.335   9.220   1.00 0.00 ? 403 PHE A CE2  4  
ATOM 6243  C CZ   . PHE A 1 12  ? -2.696  7.126   7.989   1.00 0.00 ? 403 PHE A CZ   4  
ATOM 6244  H H    . PHE A 1 12  ? -5.376  7.801   13.099  1.00 0.00 ? 403 PHE A H    4  
ATOM 6245  H HA   . PHE A 1 12  ? -6.523  7.111   10.690  1.00 0.00 ? 403 PHE A HA   4  
ATOM 6246  H HB2  . PHE A 1 12  ? -4.252  6.461   12.348  1.00 0.00 ? 403 PHE A HB2  4  
ATOM 6247  H HB3  . PHE A 1 12  ? -4.862  5.057   11.525  1.00 0.00 ? 403 PHE A HB3  4  
ATOM 6248  H HD1  . PHE A 1 12  ? -5.658  5.903   8.977   1.00 0.00 ? 403 PHE A HD1  4  
ATOM 6249  H HD2  . PHE A 1 12  ? -2.371  7.180   11.332  1.00 0.00 ? 403 PHE A HD2  4  
ATOM 6250  H HE1  . PHE A 1 12  ? -4.421  6.446   6.935   1.00 0.00 ? 403 PHE A HE1  4  
ATOM 6251  H HE2  . PHE A 1 12  ? -1.124  7.738   9.293   1.00 0.00 ? 403 PHE A HE2  4  
ATOM 6252  H HZ   . PHE A 1 12  ? -2.149  7.353   7.097   1.00 0.00 ? 403 PHE A HZ   4  
ATOM 6253  N N    . ASN A 1 13  ? -8.188  5.306   11.085  1.00 0.00 ? 404 ASN A N    4  
ATOM 6254  C CA   . ASN A 1 13  ? -9.197  4.270   11.291  1.00 0.00 ? 404 ASN A CA   4  
ATOM 6255  C C    . ASN A 1 13  ? -8.957  3.092   10.363  1.00 0.00 ? 404 ASN A C    4  
ATOM 6256  O O    . ASN A 1 13  ? -8.749  3.276   9.167   1.00 0.00 ? 404 ASN A O    4  
ATOM 6257  C CB   . ASN A 1 13  ? -10.600 4.833   11.041  1.00 0.00 ? 404 ASN A CB   4  
ATOM 6258  C CG   . ASN A 1 13  ? -11.209 5.482   12.269  1.00 0.00 ? 404 ASN A CG   4  
ATOM 6259  O OD1  . ASN A 1 13  ? -11.916 4.838   13.041  1.00 0.00 ? 404 ASN A OD1  4  
ATOM 6260  N ND2  . ASN A 1 13  ? -10.941 6.765   12.459  1.00 0.00 ? 404 ASN A ND2  4  
ATOM 6261  H H    . ASN A 1 13  ? -8.233  5.860   10.278  1.00 0.00 ? 404 ASN A H    4  
ATOM 6262  H HA   . ASN A 1 13  ? -9.127  3.933   12.313  1.00 0.00 ? 404 ASN A HA   4  
ATOM 6263  H HB2  . ASN A 1 13  ? -10.547 5.574   10.259  1.00 0.00 ? 404 ASN A HB2  4  
ATOM 6264  H HB3  . ASN A 1 13  ? -11.249 4.029   10.724  1.00 0.00 ? 404 ASN A HB3  4  
ATOM 6265  H HD21 . ASN A 1 13  ? -10.368 7.223   11.806  1.00 0.00 ? 404 ASN A HD21 4  
ATOM 6266  H HD22 . ASN A 1 13  ? -11.319 7.205   13.245  1.00 0.00 ? 404 ASN A HD22 4  
ATOM 6267  N N    . GLU A 1 14  ? -8.979  1.887   10.911  1.00 0.00 ? 405 GLU A N    4  
ATOM 6268  C CA   . GLU A 1 14  ? -8.770  0.688   10.111  1.00 0.00 ? 405 GLU A CA   4  
ATOM 6269  C C    . GLU A 1 14  ? -9.746  -0.412  10.496  1.00 0.00 ? 405 GLU A C    4  
ATOM 6270  O O    . GLU A 1 14  ? -10.726 -0.177  11.204  1.00 0.00 ? 405 GLU A O    4  
ATOM 6271  C CB   . GLU A 1 14  ? -7.342  0.167   10.256  1.00 0.00 ? 405 GLU A CB   4  
ATOM 6272  C CG   . GLU A 1 14  ? -6.955  -0.201  11.676  1.00 0.00 ? 405 GLU A CG   4  
ATOM 6273  C CD   . GLU A 1 14  ? -5.743  -1.109  11.724  1.00 0.00 ? 405 GLU A CD   4  
ATOM 6274  O OE1  . GLU A 1 14  ? -5.604  -1.967  10.834  1.00 0.00 ? 405 GLU A OE1  4  
ATOM 6275  O OE2  . GLU A 1 14  ? -4.914  -0.945  12.641  1.00 0.00 ? 405 GLU A OE2  4  
ATOM 6276  H H    . GLU A 1 14  ? -9.149  1.799   11.872  1.00 0.00 ? 405 GLU A H    4  
ATOM 6277  H HA   . GLU A 1 14  ? -8.936  0.953   9.080   1.00 0.00 ? 405 GLU A HA   4  
ATOM 6278  H HB2  . GLU A 1 14  ? -7.230  -0.712  9.638   1.00 0.00 ? 405 GLU A HB2  4  
ATOM 6279  H HB3  . GLU A 1 14  ? -6.660  0.928   9.906   1.00 0.00 ? 405 GLU A HB3  4  
ATOM 6280  H HG2  . GLU A 1 14  ? -6.728  0.707   12.217  1.00 0.00 ? 405 GLU A HG2  4  
ATOM 6281  H HG3  . GLU A 1 14  ? -7.786  -0.702  12.145  1.00 0.00 ? 405 GLU A HG3  4  
ATOM 6282  N N    . ASN A 1 15  ? -9.453  -1.613  10.029  1.00 0.00 ? 406 ASN A N    4  
ATOM 6283  C CA   . ASN A 1 15  ? -10.268 -2.780  10.301  1.00 0.00 ? 406 ASN A CA   4  
ATOM 6284  C C    . ASN A 1 15  ? -9.349  -3.961  10.584  1.00 0.00 ? 406 ASN A C    4  
ATOM 6285  O O    . ASN A 1 15  ? -8.241  -4.018  10.061  1.00 0.00 ? 406 ASN A O    4  
ATOM 6286  C CB   . ASN A 1 15  ? -11.179 -3.074  9.103   1.00 0.00 ? 406 ASN A CB   4  
ATOM 6287  C CG   . ASN A 1 15  ? -12.129 -4.232  9.342   1.00 0.00 ? 406 ASN A CG   4  
ATOM 6288  O OD1  . ASN A 1 15  ? -12.539 -4.498  10.473  1.00 0.00 ? 406 ASN A OD1  4  
ATOM 6289  N ND2  . ASN A 1 15  ? -12.484 -4.932  8.276   1.00 0.00 ? 406 ASN A ND2  4  
ATOM 6290  H H    . ASN A 1 15  ? -8.640  -1.725  9.488   1.00 0.00 ? 406 ASN A H    4  
ATOM 6291  H HA   . ASN A 1 15  ? -10.871 -2.579  11.174  1.00 0.00 ? 406 ASN A HA   4  
ATOM 6292  H HB2  . ASN A 1 15  ? -11.767 -2.195  8.886   1.00 0.00 ? 406 ASN A HB2  4  
ATOM 6293  H HB3  . ASN A 1 15  ? -10.566 -3.308  8.246   1.00 0.00 ? 406 ASN A HB3  4  
ATOM 6294  H HD21 . ASN A 1 15  ? -12.109 -4.663  7.393   1.00 0.00 ? 406 ASN A HD21 4  
ATOM 6295  H HD22 . ASN A 1 15  ? -13.098 -5.681  8.396   1.00 0.00 ? 406 ASN A HD22 4  
ATOM 6296  N N    . ASP A 1 16  ? -9.807  -4.902  11.398  1.00 0.00 ? 407 ASP A N    4  
ATOM 6297  C CA   . ASP A 1 16  ? -9.001  -6.072  11.755  1.00 0.00 ? 407 ASP A CA   4  
ATOM 6298  C C    . ASP A 1 16  ? -9.009  -7.118  10.640  1.00 0.00 ? 407 ASP A C    4  
ATOM 6299  O O    . ASP A 1 16  ? -8.645  -8.272  10.854  1.00 0.00 ? 407 ASP A O    4  
ATOM 6300  C CB   . ASP A 1 16  ? -9.489  -6.689  13.067  1.00 0.00 ? 407 ASP A CB   4  
ATOM 6301  C CG   . ASP A 1 16  ? -8.450  -7.604  13.697  1.00 0.00 ? 407 ASP A CG   4  
ATOM 6302  O OD1  . ASP A 1 16  ? -7.254  -7.487  13.340  1.00 0.00 ? 407 ASP A OD1  4  
ATOM 6303  O OD2  . ASP A 1 16  ? -8.826  -8.436  14.543  1.00 0.00 ? 407 ASP A OD2  4  
ATOM 6304  H H    . ASP A 1 16  ? -10.713 -4.816  11.764  1.00 0.00 ? 407 ASP A H    4  
ATOM 6305  H HA   . ASP A 1 16  ? -7.984  -5.732  11.892  1.00 0.00 ? 407 ASP A HA   4  
ATOM 6306  H HB2  . ASP A 1 16  ? -9.718  -5.900  13.767  1.00 0.00 ? 407 ASP A HB2  4  
ATOM 6307  H HB3  . ASP A 1 16  ? -10.382 -7.267  12.876  1.00 0.00 ? 407 ASP A HB3  4  
ATOM 6308  N N    . GLU A 1 17  ? -9.460  -6.707  9.460   1.00 0.00 ? 408 GLU A N    4  
ATOM 6309  C CA   . GLU A 1 17  ? -9.530  -7.581  8.293   1.00 0.00 ? 408 GLU A CA   4  
ATOM 6310  C C    . GLU A 1 17  ? -8.203  -8.302  8.042   1.00 0.00 ? 408 GLU A C    4  
ATOM 6311  O O    . GLU A 1 17  ? -7.262  -7.732  7.499   1.00 0.00 ? 408 GLU A O    4  
ATOM 6312  C CB   . GLU A 1 17  ? -9.937  -6.769  7.054   1.00 0.00 ? 408 GLU A CB   4  
ATOM 6313  C CG   . GLU A 1 17  ? -9.231  -5.422  6.942   1.00 0.00 ? 408 GLU A CG   4  
ATOM 6314  C CD   . GLU A 1 17  ? -9.891  -4.481  5.951   1.00 0.00 ? 408 GLU A CD   4  
ATOM 6315  O OE1  . GLU A 1 17  ? -11.134 -4.357  5.986   1.00 0.00 ? 408 GLU A OE1  4  
ATOM 6316  O OE2  . GLU A 1 17  ? -9.168  -3.849  5.152   1.00 0.00 ? 408 GLU A OE2  4  
ATOM 6317  H H    . GLU A 1 17  ? -9.742  -5.775  9.367   1.00 0.00 ? 408 GLU A H    4  
ATOM 6318  H HA   . GLU A 1 17  ? -10.291 -8.322  8.486   1.00 0.00 ? 408 GLU A HA   4  
ATOM 6319  H HB2  . GLU A 1 17  ? -9.708  -7.345  6.169   1.00 0.00 ? 408 GLU A HB2  4  
ATOM 6320  H HB3  . GLU A 1 17  ? -11.002 -6.591  7.090   1.00 0.00 ? 408 GLU A HB3  4  
ATOM 6321  H HG2  . GLU A 1 17  ? -9.233  -4.950  7.913   1.00 0.00 ? 408 GLU A HG2  4  
ATOM 6322  H HG3  . GLU A 1 17  ? -8.211  -5.592  6.629   1.00 0.00 ? 408 GLU A HG3  4  
ATOM 6323  N N    . ASP A 1 18  ? -8.125  -9.547  8.493   1.00 0.00 ? 409 ASP A N    4  
ATOM 6324  C CA   . ASP A 1 18  ? -6.933  -10.364 8.295   1.00 0.00 ? 409 ASP A CA   4  
ATOM 6325  C C    . ASP A 1 18  ? -7.123  -11.186 7.032   1.00 0.00 ? 409 ASP A C    4  
ATOM 6326  O O    . ASP A 1 18  ? -6.208  -11.333 6.222   1.00 0.00 ? 409 ASP A O    4  
ATOM 6327  C CB   . ASP A 1 18  ? -6.701  -11.287 9.500   1.00 0.00 ? 409 ASP A CB   4  
ATOM 6328  C CG   . ASP A 1 18  ? -5.240  -11.376 9.908   1.00 0.00 ? 409 ASP A CG   4  
ATOM 6329  O OD1  . ASP A 1 18  ? -4.833  -10.637 10.828  1.00 0.00 ? 409 ASP A OD1  4  
ATOM 6330  O OD2  . ASP A 1 18  ? -4.498  -12.192 9.318   1.00 0.00 ? 409 ASP A OD2  4  
ATOM 6331  H H    . ASP A 1 18  ? -8.881  -9.920  8.986   1.00 0.00 ? 409 ASP A H    4  
ATOM 6332  H HA   . ASP A 1 18  ? -6.085  -9.707  8.172   1.00 0.00 ? 409 ASP A HA   4  
ATOM 6333  H HB2  . ASP A 1 18  ? -7.266  -10.916 10.342  1.00 0.00 ? 409 ASP A HB2  4  
ATOM 6334  H HB3  . ASP A 1 18  ? -7.048  -12.281 9.253   1.00 0.00 ? 409 ASP A HB3  4  
ATOM 6335  N N    . ASP A 1 19  ? -8.344  -11.699 6.891   1.00 0.00 ? 410 ASP A N    4  
ATOM 6336  C CA   . ASP A 1 19  ? -8.760  -12.498 5.739   1.00 0.00 ? 410 ASP A CA   4  
ATOM 6337  C C    . ASP A 1 19  ? -7.855  -13.712 5.533   1.00 0.00 ? 410 ASP A C    4  
ATOM 6338  O O    . ASP A 1 19  ? -7.444  -13.981 4.383   1.00 0.00 ? 410 ASP A O    4  
ATOM 6339  C CB   . ASP A 1 19  ? -8.801  -11.622 4.482   1.00 0.00 ? 410 ASP A CB   4  
ATOM 6340  C CG   . ASP A 1 19  ? -9.928  -12.007 3.546   1.00 0.00 ? 410 ASP A CG   4  
ATOM 6341  O OD1  . ASP A 1 19  ? -10.986 -12.450 4.033   1.00 0.00 ? 410 ASP A OD1  4  
ATOM 6342  O OD2  . ASP A 1 19  ? -9.748  -11.890 2.314   1.00 0.00 ? 410 ASP A OD2  4  
ATOM 6343  O OXT  . ASP A 1 19  ? -7.556  -14.400 6.530   1.00 0.00 ? 410 ASP A OXT  4  
ATOM 6344  H H    . ASP A 1 19  ? -8.994  -11.539 7.599   1.00 0.00 ? 410 ASP A H    4  
ATOM 6345  H HA   . ASP A 1 19  ? -9.759  -12.853 5.940   1.00 0.00 ? 410 ASP A HA   4  
ATOM 6346  H HB2  . ASP A 1 19  ? -8.935  -10.591 4.771   1.00 0.00 ? 410 ASP A HB2  4  
ATOM 6347  H HB3  . ASP A 1 19  ? -7.866  -11.722 3.950   1.00 0.00 ? 410 ASP A HB3  4  
ATOM 6348  N N    . MET B 2 3   ? 7.966   -4.221  -10.301 1.00 0.00 ? 1   MET B N    4  
ATOM 6349  C CA   . MET B 2 3   ? 9.161   -3.346  -10.222 1.00 0.00 ? 1   MET B CA   4  
ATOM 6350  C C    . MET B 2 3   ? 9.927   -3.391  -11.537 1.00 0.00 ? 1   MET B C    4  
ATOM 6351  O O    . MET B 2 3   ? 10.458  -2.384  -11.998 1.00 0.00 ? 1   MET B O    4  
ATOM 6352  C CB   . MET B 2 3   ? 10.066  -3.773  -9.067  1.00 0.00 ? 1   MET B CB   4  
ATOM 6353  C CG   . MET B 2 3   ? 10.947  -2.650  -8.550  1.00 0.00 ? 1   MET B CG   4  
ATOM 6354  S SD   . MET B 2 3   ? 9.988   -1.260  -7.916  1.00 0.00 ? 1   MET B SD   4  
ATOM 6355  C CE   . MET B 2 3   ? 11.301  -0.175  -7.361  1.00 0.00 ? 1   MET B CE   4  
ATOM 6356  H H    . MET B 2 3   ? 8.243   -5.198  -10.525 1.00 0.00 ? 1   MET B H    4  
ATOM 6357  H HA   . MET B 2 3   ? 8.824   -2.333  -10.053 1.00 0.00 ? 1   MET B HA   4  
ATOM 6358  H HB2  . MET B 2 3   ? 9.450   -4.125  -8.253  1.00 0.00 ? 1   MET B HB2  4  
ATOM 6359  H HB3  . MET B 2 3   ? 10.703  -4.580  -9.401  1.00 0.00 ? 1   MET B HB3  4  
ATOM 6360  H HG2  . MET B 2 3   ? 11.569  -3.034  -7.754  1.00 0.00 ? 1   MET B HG2  4  
ATOM 6361  H HG3  . MET B 2 3   ? 11.574  -2.299  -9.358  1.00 0.00 ? 1   MET B HG3  4  
ATOM 6362  H HE1  . MET B 2 3   ? 10.872  0.711   -6.915  1.00 0.00 ? 1   MET B HE1  4  
ATOM 6363  H HE2  . MET B 2 3   ? 11.915  0.107   -8.203  1.00 0.00 ? 1   MET B HE2  4  
ATOM 6364  H HE3  . MET B 2 3   ? 11.907  -0.689  -6.629  1.00 0.00 ? 1   MET B HE3  4  
ATOM 6365  N N    . ALA B 2 4   ? 9.980   -4.576  -12.122 1.00 0.00 ? 2   ALA B N    4  
ATOM 6366  C CA   . ALA B 2 4   ? 10.644  -4.792  -13.394 1.00 0.00 ? 2   ALA B CA   4  
ATOM 6367  C C    . ALA B 2 4   ? 9.904   -5.896  -14.123 1.00 0.00 ? 2   ALA B C    4  
ATOM 6368  O O    . ALA B 2 4   ? 10.226  -7.075  -13.964 1.00 0.00 ? 2   ALA B O    4  
ATOM 6369  C CB   . ALA B 2 4   ? 12.108  -5.159  -13.188 1.00 0.00 ? 2   ALA B CB   4  
ATOM 6370  H H    . ALA B 2 4   ? 9.549   -5.340  -11.688 1.00 0.00 ? 2   ALA B H    4  
ATOM 6371  H HA   . ALA B 2 4   ? 10.588  -3.879  -13.970 1.00 0.00 ? 2   ALA B HA   4  
ATOM 6372  H HB1  . ALA B 2 4   ? 12.551  -5.416  -14.138 1.00 0.00 ? 2   ALA B HB1  4  
ATOM 6373  H HB2  . ALA B 2 4   ? 12.177  -6.004  -12.519 1.00 0.00 ? 2   ALA B HB2  4  
ATOM 6374  H HB3  . ALA B 2 4   ? 12.633  -4.318  -12.761 1.00 0.00 ? 2   ALA B HB3  4  
ATOM 6375  N N    . THR B 2 5   ? 8.875   -5.509  -14.873 1.00 0.00 ? 3   THR B N    4  
ATOM 6376  C CA   . THR B 2 5   ? 8.043   -6.463  -15.596 1.00 0.00 ? 3   THR B CA   4  
ATOM 6377  C C    . THR B 2 5   ? 7.313   -7.341  -14.579 1.00 0.00 ? 3   THR B C    4  
ATOM 6378  O O    . THR B 2 5   ? 7.045   -8.520  -14.808 1.00 0.00 ? 3   THR B O    4  
ATOM 6379  C CB   . THR B 2 5   ? 8.872   -7.336  -16.566 1.00 0.00 ? 3   THR B CB   4  
ATOM 6380  O OG1  . THR B 2 5   ? 9.966   -6.574  -17.097 1.00 0.00 ? 3   THR B OG1  4  
ATOM 6381  C CG2  . THR B 2 5   ? 8.011   -7.846  -17.713 1.00 0.00 ? 3   THR B CG2  4  
ATOM 6382  H H    . THR B 2 5   ? 8.664   -4.555  -14.933 1.00 0.00 ? 3   THR B H    4  
ATOM 6383  H HA   . THR B 2 5   ? 7.313   -5.906  -16.167 1.00 0.00 ? 3   THR B HA   4  
ATOM 6384  H HB   . THR B 2 5   ? 9.263   -8.184  -16.022 1.00 0.00 ? 3   THR B HB   4  
ATOM 6385  H HG1  . THR B 2 5   ? 10.753  -6.743  -16.572 1.00 0.00 ? 3   THR B HG1  4  
ATOM 6386  H HG21 . THR B 2 5   ? 8.619   -8.431  -18.388 1.00 0.00 ? 3   THR B HG21 4  
ATOM 6387  H HG22 . THR B 2 5   ? 7.588   -7.007  -18.246 1.00 0.00 ? 3   THR B HG22 4  
ATOM 6388  H HG23 . THR B 2 5   ? 7.216   -8.462  -17.322 1.00 0.00 ? 3   THR B HG23 4  
ATOM 6389  N N    . SER B 2 6   ? 6.991   -6.730  -13.445 1.00 0.00 ? 4   SER B N    4  
ATOM 6390  C CA   . SER B 2 6   ? 6.319   -7.411  -12.353 1.00 0.00 ? 4   SER B CA   4  
ATOM 6391  C C    . SER B 2 6   ? 5.338   -6.461  -11.675 1.00 0.00 ? 4   SER B C    4  
ATOM 6392  O O    . SER B 2 6   ? 5.714   -5.730  -10.754 1.00 0.00 ? 4   SER B O    4  
ATOM 6393  C CB   . SER B 2 6   ? 7.360   -7.908  -11.347 1.00 0.00 ? 4   SER B CB   4  
ATOM 6394  O OG   . SER B 2 6   ? 8.549   -7.124  -11.421 1.00 0.00 ? 4   SER B OG   4  
ATOM 6395  H H    . SER B 2 6   ? 7.200   -5.769  -13.346 1.00 0.00 ? 4   SER B H    4  
ATOM 6396  H HA   . SER B 2 6   ? 5.778   -8.253  -12.757 1.00 0.00 ? 4   SER B HA   4  
ATOM 6397  H HB2  . SER B 2 6   ? 6.957   -7.838  -10.347 1.00 0.00 ? 4   SER B HB2  4  
ATOM 6398  H HB3  . SER B 2 6   ? 7.607   -8.937  -11.565 1.00 0.00 ? 4   SER B HB3  4  
ATOM 6399  H HG   . SER B 2 6   ? 9.077   -7.426  -12.174 1.00 0.00 ? 4   SER B HG   4  
ATOM 6400  N N    . SER B 2 7   ? 4.092   -6.474  -12.144 1.00 0.00 ? 5   SER B N    4  
ATOM 6401  C CA   . SER B 2 7   ? 3.054   -5.600  -11.612 1.00 0.00 ? 5   SER B CA   4  
ATOM 6402  C C    . SER B 2 7   ? 3.454   -4.143  -11.827 1.00 0.00 ? 5   SER B C    4  
ATOM 6403  O O    . SER B 2 7   ? 3.865   -3.444  -10.894 1.00 0.00 ? 5   SER B O    4  
ATOM 6404  C CB   . SER B 2 7   ? 2.804   -5.891  -10.129 1.00 0.00 ? 5   SER B CB   4  
ATOM 6405  O OG   . SER B 2 7   ? 2.749   -7.288  -9.888  1.00 0.00 ? 5   SER B OG   4  
ATOM 6406  H H    . SER B 2 7   ? 3.864   -7.089  -12.869 1.00 0.00 ? 5   SER B H    4  
ATOM 6407  H HA   . SER B 2 7   ? 2.146   -5.794  -12.167 1.00 0.00 ? 5   SER B HA   4  
ATOM 6408  H HB2  . SER B 2 7   ? 3.606   -5.469  -9.541  1.00 0.00 ? 5   SER B HB2  4  
ATOM 6409  H HB3  . SER B 2 7   ? 1.866   -5.448  -9.830  1.00 0.00 ? 5   SER B HB3  4  
ATOM 6410  H HG   . SER B 2 7   ? 1.925   -7.641  -10.238 1.00 0.00 ? 5   SER B HG   4  
ATOM 6411  N N    . GLU B 2 8   ? 3.338   -3.703  -13.072 1.00 0.00 ? 6   GLU B N    4  
ATOM 6412  C CA   . GLU B 2 8   ? 3.705   -2.348  -13.458 1.00 0.00 ? 6   GLU B CA   4  
ATOM 6413  C C    . GLU B 2 8   ? 2.497   -1.624  -14.015 1.00 0.00 ? 6   GLU B C    4  
ATOM 6414  O O    . GLU B 2 8   ? 2.568   -0.471  -14.444 1.00 0.00 ? 6   GLU B O    4  
ATOM 6415  C CB   . GLU B 2 8   ? 4.829   -2.378  -14.501 1.00 0.00 ? 6   GLU B CB   4  
ATOM 6416  C CG   . GLU B 2 8   ? 6.193   -1.979  -13.960 1.00 0.00 ? 6   GLU B CG   4  
ATOM 6417  C CD   . GLU B 2 8   ? 6.651   -2.852  -12.810 1.00 0.00 ? 6   GLU B CD   4  
ATOM 6418  O OE1  . GLU B 2 8   ? 6.548   -2.411  -11.649 1.00 0.00 ? 6   GLU B OE1  4  
ATOM 6419  O OE2  . GLU B 2 8   ? 7.131   -3.980  -13.056 1.00 0.00 ? 6   GLU B OE2  4  
ATOM 6420  H H    . GLU B 2 8   ? 2.955   -4.303  -13.748 1.00 0.00 ? 6   GLU B H    4  
ATOM 6421  H HA   . GLU B 2 8   ? 4.039   -1.835  -12.580 1.00 0.00 ? 6   GLU B HA   4  
ATOM 6422  H HB2  . GLU B 2 8   ? 4.905   -3.381  -14.897 1.00 0.00 ? 6   GLU B HB2  4  
ATOM 6423  H HB3  . GLU B 2 8   ? 4.574   -1.705  -15.305 1.00 0.00 ? 6   GLU B HB3  4  
ATOM 6424  H HG2  . GLU B 2 8   ? 6.917   -2.055  -14.757 1.00 0.00 ? 6   GLU B HG2  4  
ATOM 6425  H HG3  . GLU B 2 8   ? 6.143   -0.956  -13.618 1.00 0.00 ? 6   GLU B HG3  4  
ATOM 6426  N N    . GLU B 2 9   ? 1.391   -2.323  -13.990 1.00 0.00 ? 7   GLU B N    4  
ATOM 6427  C CA   . GLU B 2 9   ? 0.129   -1.805  -14.480 1.00 0.00 ? 7   GLU B CA   4  
ATOM 6428  C C    . GLU B 2 9   ? -0.523  -0.937  -13.409 1.00 0.00 ? 7   GLU B C    4  
ATOM 6429  O O    . GLU B 2 9   ? -1.116  -1.431  -12.450 1.00 0.00 ? 7   GLU B O    4  
ATOM 6430  C CB   . GLU B 2 9   ? -0.799  -2.954  -14.934 1.00 0.00 ? 7   GLU B CB   4  
ATOM 6431  C CG   . GLU B 2 9   ? -1.193  -3.963  -13.850 1.00 0.00 ? 7   GLU B CG   4  
ATOM 6432  C CD   . GLU B 2 9   ? -0.011  -4.622  -13.163 1.00 0.00 ? 7   GLU B CD   4  
ATOM 6433  O OE1  . GLU B 2 9   ? 0.906   -5.095  -13.868 1.00 0.00 ? 7   GLU B OE1  4  
ATOM 6434  O OE2  . GLU B 2 9   ? 0.018   -4.641  -11.915 1.00 0.00 ? 7   GLU B OE2  4  
ATOM 6435  H H    . GLU B 2 9   ? 1.423   -3.227  -13.610 1.00 0.00 ? 7   GLU B H    4  
ATOM 6436  H HA   . GLU B 2 9   ? 0.349   -1.179  -15.333 1.00 0.00 ? 7   GLU B HA   4  
ATOM 6437  H HB2  . GLU B 2 9   ? -1.706  -2.523  -15.327 1.00 0.00 ? 7   GLU B HB2  4  
ATOM 6438  H HB3  . GLU B 2 9   ? -0.304  -3.495  -15.727 1.00 0.00 ? 7   GLU B HB3  4  
ATOM 6439  H HG2  . GLU B 2 9   ? -1.776  -3.449  -13.101 1.00 0.00 ? 7   GLU B HG2  4  
ATOM 6440  H HG3  . GLU B 2 9   ? -1.800  -4.733  -14.303 1.00 0.00 ? 7   GLU B HG3  4  
ATOM 6441  N N    . VAL B 2 10  ? -0.404  0.367   -13.578 1.00 0.00 ? 8   VAL B N    4  
ATOM 6442  C CA   . VAL B 2 10  ? -0.955  1.309   -12.620 1.00 0.00 ? 8   VAL B CA   4  
ATOM 6443  C C    . VAL B 2 10  ? -2.431  1.538   -12.867 1.00 0.00 ? 8   VAL B C    4  
ATOM 6444  O O    . VAL B 2 10  ? -2.831  2.040   -13.916 1.00 0.00 ? 8   VAL B O    4  
ATOM 6445  C CB   . VAL B 2 10  ? -0.225  2.663   -12.674 1.00 0.00 ? 8   VAL B CB   4  
ATOM 6446  C CG1  . VAL B 2 10  ? -0.876  3.649   -11.720 1.00 0.00 ? 8   VAL B CG1  4  
ATOM 6447  C CG2  . VAL B 2 10  ? 1.252   2.491   -12.354 1.00 0.00 ? 8   VAL B CG2  4  
ATOM 6448  H H    . VAL B 2 10  ? 0.067   0.705   -14.366 1.00 0.00 ? 8   VAL B H    4  
ATOM 6449  H HA   . VAL B 2 10  ? -0.829  0.897   -11.629 1.00 0.00 ? 8   VAL B HA   4  
ATOM 6450  H HB   . VAL B 2 10  ? -0.311  3.056   -13.676 1.00 0.00 ? 8   VAL B HB   4  
ATOM 6451  H HG11 . VAL B 2 10  ? -1.849  3.925   -12.100 1.00 0.00 ? 8   VAL B HG11 4  
ATOM 6452  H HG12 . VAL B 2 10  ? -0.260  4.529   -11.633 1.00 0.00 ? 8   VAL B HG12 4  
ATOM 6453  H HG13 . VAL B 2 10  ? -0.990  3.188   -10.750 1.00 0.00 ? 8   VAL B HG13 4  
ATOM 6454  H HG21 . VAL B 2 10  ? 1.362   2.098   -11.354 1.00 0.00 ? 8   VAL B HG21 4  
ATOM 6455  H HG22 . VAL B 2 10  ? 1.749   3.447   -12.424 1.00 0.00 ? 8   VAL B HG22 4  
ATOM 6456  H HG23 . VAL B 2 10  ? 1.695   1.803   -13.061 1.00 0.00 ? 8   VAL B HG23 4  
ATOM 6457  N N    . LEU B 2 11  ? -3.232  1.151   -11.893 1.00 0.00 ? 9   LEU B N    4  
ATOM 6458  C CA   . LEU B 2 11  ? -4.668  1.321   -11.978 1.00 0.00 ? 9   LEU B CA   4  
ATOM 6459  C C    . LEU B 2 11  ? -5.076  2.657   -11.370 1.00 0.00 ? 9   LEU B C    4  
ATOM 6460  O O    . LEU B 2 11  ? -6.027  3.294   -11.818 1.00 0.00 ? 9   LEU B O    4  
ATOM 6461  C CB   . LEU B 2 11  ? -5.390  0.178   -11.255 1.00 0.00 ? 9   LEU B CB   4  
ATOM 6462  C CG   . LEU B 2 11  ? -4.912  -1.235  -11.604 1.00 0.00 ? 9   LEU B CG   4  
ATOM 6463  C CD1  . LEU B 2 11  ? -5.655  -2.266  -10.769 1.00 0.00 ? 9   LEU B CD1  4  
ATOM 6464  C CD2  . LEU B 2 11  ? -5.099  -1.516  -13.088 1.00 0.00 ? 9   LEU B CD2  4  
ATOM 6465  H H    . LEU B 2 11  ? -2.840  0.727   -11.092 1.00 0.00 ? 9   LEU B H    4  
ATOM 6466  H HA   . LEU B 2 11  ? -4.938  1.314   -13.020 1.00 0.00 ? 9   LEU B HA   4  
ATOM 6467  H HB2  . LEU B 2 11  ? -5.267  0.322   -10.192 1.00 0.00 ? 9   LEU B HB2  4  
ATOM 6468  H HB3  . LEU B 2 11  ? -6.443  0.243   -11.488 1.00 0.00 ? 9   LEU B HB3  4  
ATOM 6469  H HG   . LEU B 2 11  ? -3.859  -1.320  -11.376 1.00 0.00 ? 9   LEU B HG   4  
ATOM 6470  H HD11 . LEU B 2 11  ? -5.474  -2.079  -9.720  1.00 0.00 ? 9   LEU B HD11 4  
ATOM 6471  H HD12 . LEU B 2 11  ? -5.305  -3.256  -11.023 1.00 0.00 ? 9   LEU B HD12 4  
ATOM 6472  H HD13 . LEU B 2 11  ? -6.714  -2.197  -10.969 1.00 0.00 ? 9   LEU B HD13 4  
ATOM 6473  H HD21 . LEU B 2 11  ? -6.150  -1.475  -13.333 1.00 0.00 ? 9   LEU B HD21 4  
ATOM 6474  H HD22 . LEU B 2 11  ? -4.714  -2.497  -13.321 1.00 0.00 ? 9   LEU B HD22 4  
ATOM 6475  H HD23 . LEU B 2 11  ? -4.566  -0.774  -13.665 1.00 0.00 ? 9   LEU B HD23 4  
ATOM 6476  N N    . LEU B 2 12  ? -4.346  3.077   -10.345 1.00 0.00 ? 10  LEU B N    4  
ATOM 6477  C CA   . LEU B 2 12  ? -4.638  4.330   -9.669  1.00 0.00 ? 10  LEU B CA   4  
ATOM 6478  C C    . LEU B 2 12  ? -3.394  5.187   -9.496  1.00 0.00 ? 10  LEU B C    4  
ATOM 6479  O O    . LEU B 2 12  ? -2.379  4.722   -8.977  1.00 0.00 ? 10  LEU B O    4  
ATOM 6480  C CB   . LEU B 2 12  ? -5.237  4.047   -8.300  1.00 0.00 ? 10  LEU B CB   4  
ATOM 6481  C CG   . LEU B 2 12  ? -5.648  5.292   -7.511  1.00 0.00 ? 10  LEU B CG   4  
ATOM 6482  C CD1  . LEU B 2 12  ? -7.084  5.682   -7.796  1.00 0.00 ? 10  LEU B CD1  4  
ATOM 6483  C CD2  . LEU B 2 12  ? -5.459  5.069   -6.027  1.00 0.00 ? 10  LEU B CD2  4  
ATOM 6484  H H    . LEU B 2 12  ? -3.604  2.524   -10.026 1.00 0.00 ? 10  LEU B H    4  
ATOM 6485  H HA   . LEU B 2 12  ? -5.357  4.873   -10.257 1.00 0.00 ? 10  LEU B HA   4  
ATOM 6486  H HB2  . LEU B 2 12  ? -6.097  3.416   -8.438  1.00 0.00 ? 10  LEU B HB2  4  
ATOM 6487  H HB3  . LEU B 2 12  ? -4.506  3.506   -7.719  1.00 0.00 ? 10  LEU B HB3  4  
ATOM 6488  H HG   . LEU B 2 12  ? -5.017  6.116   -7.808  1.00 0.00 ? 10  LEU B HG   4  
ATOM 6489  H HD11 . LEU B 2 12  ? -7.734  4.851   -7.564  1.00 0.00 ? 10  LEU B HD11 4  
ATOM 6490  H HD12 . LEU B 2 12  ? -7.187  5.949   -8.834  1.00 0.00 ? 10  LEU B HD12 4  
ATOM 6491  H HD13 . LEU B 2 12  ? -7.351  6.529   -7.176  1.00 0.00 ? 10  LEU B HD13 4  
ATOM 6492  H HD21 . LEU B 2 12  ? -6.065  4.234   -5.709  1.00 0.00 ? 10  LEU B HD21 4  
ATOM 6493  H HD22 . LEU B 2 12  ? -5.757  5.956   -5.489  1.00 0.00 ? 10  LEU B HD22 4  
ATOM 6494  H HD23 . LEU B 2 12  ? -4.419  4.857   -5.824  1.00 0.00 ? 10  LEU B HD23 4  
ATOM 6495  N N    . ILE B 2 13  ? -3.479  6.435   -9.933  1.00 0.00 ? 11  ILE B N    4  
ATOM 6496  C CA   . ILE B 2 13  ? -2.375  7.367   -9.783  1.00 0.00 ? 11  ILE B CA   4  
ATOM 6497  C C    . ILE B 2 13  ? -2.750  8.424   -8.761  1.00 0.00 ? 11  ILE B C    4  
ATOM 6498  O O    . ILE B 2 13  ? -3.773  9.097   -8.894  1.00 0.00 ? 11  ILE B O    4  
ATOM 6499  C CB   . ILE B 2 13  ? -1.987  8.070   -11.099 1.00 0.00 ? 11  ILE B CB   4  
ATOM 6500  C CG1  . ILE B 2 13  ? -1.631  7.043   -12.176 1.00 0.00 ? 11  ILE B CG1  4  
ATOM 6501  C CG2  . ILE B 2 13  ? -0.815  9.014   -10.845 1.00 0.00 ? 11  ILE B CG2  4  
ATOM 6502  C CD1  . ILE B 2 13  ? -1.363  7.653   -13.535 1.00 0.00 ? 11  ILE B CD1  4  
ATOM 6503  H H    . ILE B 2 13  ? -4.307  6.740   -10.359 1.00 0.00 ? 11  ILE B H    4  
ATOM 6504  H HA   . ILE B 2 13  ? -1.518  6.815   -9.421  1.00 0.00 ? 11  ILE B HA   4  
ATOM 6505  H HB   . ILE B 2 13  ? -2.829  8.660   -11.431 1.00 0.00 ? 11  ILE B HB   4  
ATOM 6506  H HG12 . ILE B 2 13  ? -0.743  6.508   -11.875 1.00 0.00 ? 11  ILE B HG12 4  
ATOM 6507  H HG13 . ILE B 2 13  ? -2.447  6.342   -12.281 1.00 0.00 ? 11  ILE B HG13 4  
ATOM 6508  H HG21 . ILE B 2 13  ? 0.045   8.442   -10.524 1.00 0.00 ? 11  ILE B HG21 4  
ATOM 6509  H HG22 . ILE B 2 13  ? -1.082  9.719   -10.070 1.00 0.00 ? 11  ILE B HG22 4  
ATOM 6510  H HG23 . ILE B 2 13  ? -0.574  9.547   -11.751 1.00 0.00 ? 11  ILE B HG23 4  
ATOM 6511  H HD11 . ILE B 2 13  ? -0.533  8.341   -13.464 1.00 0.00 ? 11  ILE B HD11 4  
ATOM 6512  H HD12 . ILE B 2 13  ? -2.243  8.183   -13.871 1.00 0.00 ? 11  ILE B HD12 4  
ATOM 6513  H HD13 . ILE B 2 13  ? -1.124  6.871   -14.241 1.00 0.00 ? 11  ILE B HD13 4  
ATOM 6514  N N    . VAL B 2 14  ? -1.925  8.557   -7.746  1.00 0.00 ? 12  VAL B N    4  
ATOM 6515  C CA   . VAL B 2 14  ? -2.153  9.515   -6.691  1.00 0.00 ? 12  VAL B CA   4  
ATOM 6516  C C    . VAL B 2 14  ? -1.045  10.547  -6.703  1.00 0.00 ? 12  VAL B C    4  
ATOM 6517  O O    . VAL B 2 14  ? 0.085   10.251  -7.090  1.00 0.00 ? 12  VAL B O    4  
ATOM 6518  C CB   . VAL B 2 14  ? -2.212  8.827   -5.320  1.00 0.00 ? 12  VAL B CB   4  
ATOM 6519  C CG1  . VAL B 2 14  ? -2.812  9.748   -4.282  1.00 0.00 ? 12  VAL B CG1  4  
ATOM 6520  C CG2  . VAL B 2 14  ? -3.005  7.536   -5.409  1.00 0.00 ? 12  VAL B CG2  4  
ATOM 6521  H H    . VAL B 2 14  ? -1.112  8.000   -7.712  1.00 0.00 ? 12  VAL B H    4  
ATOM 6522  H HA   . VAL B 2 14  ? -3.096  10.002  -6.872  1.00 0.00 ? 12  VAL B HA   4  
ATOM 6523  H HB   . VAL B 2 14  ? -1.204  8.591   -5.018  1.00 0.00 ? 12  VAL B HB   4  
ATOM 6524  H HG11 . VAL B 2 14  ? -2.882  9.230   -3.337  1.00 0.00 ? 12  VAL B HG11 4  
ATOM 6525  H HG12 . VAL B 2 14  ? -3.800  10.053  -4.599  1.00 0.00 ? 12  VAL B HG12 4  
ATOM 6526  H HG13 . VAL B 2 14  ? -2.187  10.621  -4.169  1.00 0.00 ? 12  VAL B HG13 4  
ATOM 6527  H HG21 . VAL B 2 14  ? -3.115  7.112   -4.421  1.00 0.00 ? 12  VAL B HG21 4  
ATOM 6528  H HG22 . VAL B 2 14  ? -2.483  6.836   -6.045  1.00 0.00 ? 12  VAL B HG22 4  
ATOM 6529  H HG23 . VAL B 2 14  ? -3.980  7.740   -5.823  1.00 0.00 ? 12  VAL B HG23 4  
ATOM 6530  N N    . LYS B 2 15  ? -1.360  11.748  -6.282  1.00 0.00 ? 13  LYS B N    4  
ATOM 6531  C CA   . LYS B 2 15  ? -0.383  12.819  -6.285  1.00 0.00 ? 13  LYS B CA   4  
ATOM 6532  C C    . LYS B 2 15  ? -0.073  13.283  -4.881  1.00 0.00 ? 13  LYS B C    4  
ATOM 6533  O O    . LYS B 2 15  ? -0.703  12.832  -3.931  1.00 0.00 ? 13  LYS B O    4  
ATOM 6534  C CB   . LYS B 2 15  ? -0.887  13.985  -7.123  1.00 0.00 ? 13  LYS B CB   4  
ATOM 6535  C CG   . LYS B 2 15  ? -1.012  13.639  -8.591  1.00 0.00 ? 13  LYS B CG   4  
ATOM 6536  C CD   . LYS B 2 15  ? -2.281  14.210  -9.196  1.00 0.00 ? 13  LYS B CD   4  
ATOM 6537  C CE   . LYS B 2 15  ? -3.528  13.470  -8.723  1.00 0.00 ? 13  LYS B CE   4  
ATOM 6538  N NZ   . LYS B 2 15  ? -4.090  14.038  -7.463  1.00 0.00 ? 13  LYS B NZ   4  
ATOM 6539  H H    . LYS B 2 15  ? -2.267  11.911  -5.927  1.00 0.00 ? 13  LYS B H    4  
ATOM 6540  H HA   . LYS B 2 15  ? 0.523   12.437  -6.730  1.00 0.00 ? 13  LYS B HA   4  
ATOM 6541  H HB2  . LYS B 2 15  ? -1.858  14.286  -6.759  1.00 0.00 ? 13  LYS B HB2  4  
ATOM 6542  H HB3  . LYS B 2 15  ? -0.199  14.812  -7.026  1.00 0.00 ? 13  LYS B HB3  4  
ATOM 6543  H HG2  . LYS B 2 15  ? -0.161  14.043  -9.118  1.00 0.00 ? 13  LYS B HG2  4  
ATOM 6544  H HG3  . LYS B 2 15  ? -1.025  12.564  -8.695  1.00 0.00 ? 13  LYS B HG3  4  
ATOM 6545  H HD2  . LYS B 2 15  ? -2.360  15.244  -8.911  1.00 0.00 ? 13  LYS B HD2  4  
ATOM 6546  H HD3  . LYS B 2 15  ? -2.212  14.131  -10.270 1.00 0.00 ? 13  LYS B HD3  4  
ATOM 6547  H HE2  . LYS B 2 15  ? -4.279  13.530  -9.497  1.00 0.00 ? 13  LYS B HE2  4  
ATOM 6548  H HE3  . LYS B 2 15  ? -3.271  12.433  -8.557  1.00 0.00 ? 13  LYS B HE3  4  
ATOM 6549  H HZ1  . LYS B 2 15  ? -3.590  14.913  -7.199  1.00 0.00 ? 13  LYS B HZ1  4  
ATOM 6550  H HZ2  . LYS B 2 15  ? -3.986  13.348  -6.681  1.00 0.00 ? 13  LYS B HZ2  4  
ATOM 6551  H HZ3  . LYS B 2 15  ? -5.100  14.251  -7.580  1.00 0.00 ? 13  LYS B HZ3  4  
ATOM 6552  N N    . LYS B 2 16  ? 0.854   14.243  -4.807  1.00 0.00 ? 14  LYS B N    4  
ATOM 6553  C CA   . LYS B 2 16  ? 1.348   14.836  -3.551  1.00 0.00 ? 14  LYS B CA   4  
ATOM 6554  C C    . LYS B 2 16  ? 1.054   13.977  -2.322  1.00 0.00 ? 14  LYS B C    4  
ATOM 6555  O O    . LYS B 2 16  ? 0.216   14.318  -1.486  1.00 0.00 ? 14  LYS B O    4  
ATOM 6556  C CB   . LYS B 2 16  ? 0.750   16.233  -3.365  1.00 0.00 ? 14  LYS B CB   4  
ATOM 6557  C CG   . LYS B 2 16  ? 1.569   17.336  -4.009  1.00 0.00 ? 14  LYS B CG   4  
ATOM 6558  C CD   . LYS B 2 16  ? 2.267   18.190  -2.963  1.00 0.00 ? 14  LYS B CD   4  
ATOM 6559  C CE   . LYS B 2 16  ? 3.625   18.664  -3.450  1.00 0.00 ? 14  LYS B CE   4  
ATOM 6560  N NZ   . LYS B 2 16  ? 4.519   17.524  -3.770  1.00 0.00 ? 14  LYS B NZ   4  
ATOM 6561  H H    . LYS B 2 16  ? 1.240   14.562  -5.649  1.00 0.00 ? 14  LYS B H    4  
ATOM 6562  H HA   . LYS B 2 16  ? 2.418   14.935  -3.644  1.00 0.00 ? 14  LYS B HA   4  
ATOM 6563  H HB2  . LYS B 2 16  ? -0.236  16.249  -3.801  1.00 0.00 ? 14  LYS B HB2  4  
ATOM 6564  H HB3  . LYS B 2 16  ? 0.672   16.441  -2.308  1.00 0.00 ? 14  LYS B HB3  4  
ATOM 6565  H HG2  . LYS B 2 16  ? 2.314   16.892  -4.652  1.00 0.00 ? 14  LYS B HG2  4  
ATOM 6566  H HG3  . LYS B 2 16  ? 0.913   17.963  -4.593  1.00 0.00 ? 14  LYS B HG3  4  
ATOM 6567  H HD2  . LYS B 2 16  ? 1.653   19.051  -2.747  1.00 0.00 ? 14  LYS B HD2  4  
ATOM 6568  H HD3  . LYS B 2 16  ? 2.400   17.604  -2.065  1.00 0.00 ? 14  LYS B HD3  4  
ATOM 6569  H HE2  . LYS B 2 16  ? 3.488   19.263  -4.338  1.00 0.00 ? 14  LYS B HE2  4  
ATOM 6570  H HE3  . LYS B 2 16  ? 4.082   19.264  -2.678  1.00 0.00 ? 14  LYS B HE3  4  
ATOM 6571  H HZ1  . LYS B 2 16  ? 5.495   17.860  -3.931  1.00 0.00 ? 14  LYS B HZ1  4  
ATOM 6572  H HZ2  . LYS B 2 16  ? 4.199   17.044  -4.639  1.00 0.00 ? 14  LYS B HZ2  4  
ATOM 6573  H HZ3  . LYS B 2 16  ? 4.523   16.833  -2.986  1.00 0.00 ? 14  LYS B HZ3  4  
ATOM 6574  N N    . VAL B 2 17  ? 1.747   12.853  -2.243  1.00 0.00 ? 15  VAL B N    4  
ATOM 6575  C CA   . VAL B 2 17  ? 1.611   11.924  -1.136  1.00 0.00 ? 15  VAL B CA   4  
ATOM 6576  C C    . VAL B 2 17  ? 2.951   11.793  -0.432  1.00 0.00 ? 15  VAL B C    4  
ATOM 6577  O O    . VAL B 2 17  ? 3.976   11.606  -1.081  1.00 0.00 ? 15  VAL B O    4  
ATOM 6578  C CB   . VAL B 2 17  ? 1.135   10.529  -1.611  1.00 0.00 ? 15  VAL B CB   4  
ATOM 6579  C CG1  . VAL B 2 17  ? 1.397   9.464   -0.554  1.00 0.00 ? 15  VAL B CG1  4  
ATOM 6580  C CG2  . VAL B 2 17  ? -0.341  10.558  -1.958  1.00 0.00 ? 15  VAL B CG2  4  
ATOM 6581  H H    . VAL B 2 17  ? 2.389   12.645  -2.960  1.00 0.00 ? 15  VAL B H    4  
ATOM 6582  H HA   . VAL B 2 17  ? 0.883   12.324  -0.444  1.00 0.00 ? 15  VAL B HA   4  
ATOM 6583  H HB   . VAL B 2 17  ? 1.686   10.265  -2.504  1.00 0.00 ? 15  VAL B HB   4  
ATOM 6584  H HG11 . VAL B 2 17  ? 1.064   8.505   -0.919  1.00 0.00 ? 15  VAL B HG11 4  
ATOM 6585  H HG12 . VAL B 2 17  ? 0.860   9.714   0.348   1.00 0.00 ? 15  VAL B HG12 4  
ATOM 6586  H HG13 . VAL B 2 17  ? 2.456   9.421   -0.343  1.00 0.00 ? 15  VAL B HG13 4  
ATOM 6587  H HG21 . VAL B 2 17  ? -0.506  11.248  -2.772  1.00 0.00 ? 15  VAL B HG21 4  
ATOM 6588  H HG22 . VAL B 2 17  ? -0.908  10.875  -1.096  1.00 0.00 ? 15  VAL B HG22 4  
ATOM 6589  H HG23 . VAL B 2 17  ? -0.661  9.569   -2.255  1.00 0.00 ? 15  VAL B HG23 4  
ATOM 6590  N N    . ARG B 2 18  ? 2.942   11.910  0.881   1.00 0.00 ? 16  ARG B N    4  
ATOM 6591  C CA   . ARG B 2 18  ? 4.158   11.812  1.653   1.00 0.00 ? 16  ARG B CA   4  
ATOM 6592  C C    . ARG B 2 18  ? 4.283   10.451  2.315   1.00 0.00 ? 16  ARG B C    4  
ATOM 6593  O O    . ARG B 2 18  ? 3.303   9.881   2.797   1.00 0.00 ? 16  ARG B O    4  
ATOM 6594  C CB   . ARG B 2 18  ? 4.217   12.921  2.698   1.00 0.00 ? 16  ARG B CB   4  
ATOM 6595  C CG   . ARG B 2 18  ? 4.233   14.306  2.087   1.00 0.00 ? 16  ARG B CG   4  
ATOM 6596  C CD   . ARG B 2 18  ? 4.325   15.385  3.146   1.00 0.00 ? 16  ARG B CD   4  
ATOM 6597  N NE   . ARG B 2 18  ? 4.275   16.718  2.558   1.00 0.00 ? 16  ARG B NE   4  
ATOM 6598  C CZ   . ARG B 2 18  ? 4.097   17.834  3.255   1.00 0.00 ? 16  ARG B CZ   4  
ATOM 6599  N NH1  . ARG B 2 18  ? 3.968   17.784  4.580   1.00 0.00 ? 16  ARG B NH1  4  
ATOM 6600  N NH2  . ARG B 2 18  ? 4.054   19.001  2.624   1.00 0.00 ? 16  ARG B NH2  4  
ATOM 6601  H H    . ARG B 2 18  ? 2.092   12.067  1.344   1.00 0.00 ? 16  ARG B H    4  
ATOM 6602  H HA   . ARG B 2 18  ? 4.987   11.937  0.972   1.00 0.00 ? 16  ARG B HA   4  
ATOM 6603  H HB2  . ARG B 2 18  ? 3.355   12.842  3.342   1.00 0.00 ? 16  ARG B HB2  4  
ATOM 6604  H HB3  . ARG B 2 18  ? 5.113   12.799  3.288   1.00 0.00 ? 16  ARG B HB3  4  
ATOM 6605  H HG2  . ARG B 2 18  ? 5.085   14.389  1.430   1.00 0.00 ? 16  ARG B HG2  4  
ATOM 6606  H HG3  . ARG B 2 18  ? 3.324   14.448  1.519   1.00 0.00 ? 16  ARG B HG3  4  
ATOM 6607  H HD2  . ARG B 2 18  ? 3.498   15.270  3.832   1.00 0.00 ? 16  ARG B HD2  4  
ATOM 6608  H HD3  . ARG B 2 18  ? 5.256   15.269  3.681   1.00 0.00 ? 16  ARG B HD3  4  
ATOM 6609  H HE   . ARG B 2 18  ? 4.374   16.780  1.568   1.00 0.00 ? 16  ARG B HE   4  
ATOM 6610  H HH11 . ARG B 2 18  ? 4.006   16.901  5.055   1.00 0.00 ? 16  ARG B HH11 4  
ATOM 6611  H HH12 . ARG B 2 18  ? 3.829   18.621  5.109   1.00 0.00 ? 16  ARG B HH12 4  
ATOM 6612  H HH21 . ARG B 2 18  ? 4.156   19.031  1.625   1.00 0.00 ? 16  ARG B HH21 4  
ATOM 6613  H HH22 . ARG B 2 18  ? 3.915   19.848  3.135   1.00 0.00 ? 16  ARG B HH22 4  
ATOM 6614  N N    . GLN B 2 19  ? 5.496   9.931   2.295   1.00 0.00 ? 17  GLN B N    4  
ATOM 6615  C CA   . GLN B 2 19  ? 5.810   8.651   2.895   1.00 0.00 ? 17  GLN B CA   4  
ATOM 6616  C C    . GLN B 2 19  ? 7.100   8.788   3.692   1.00 0.00 ? 17  GLN B C    4  
ATOM 6617  O O    . GLN B 2 19  ? 8.171   8.969   3.110   1.00 0.00 ? 17  GLN B O    4  
ATOM 6618  C CB   . GLN B 2 19  ? 5.970   7.578   1.810   1.00 0.00 ? 17  GLN B CB   4  
ATOM 6619  C CG   . GLN B 2 19  ? 5.633   6.160   2.259   1.00 0.00 ? 17  GLN B CG   4  
ATOM 6620  C CD   . GLN B 2 19  ? 6.309   5.760   3.556   1.00 0.00 ? 17  GLN B CD   4  
ATOM 6621  O OE1  . GLN B 2 19  ? 7.466   5.341   3.566   1.00 0.00 ? 17  GLN B OE1  4  
ATOM 6622  N NE2  . GLN B 2 19  ? 5.581   5.872   4.652   1.00 0.00 ? 17  GLN B NE2  4  
ATOM 6623  H H    . GLN B 2 19  ? 6.214   10.434  1.850   1.00 0.00 ? 17  GLN B H    4  
ATOM 6624  H HA   . GLN B 2 19  ? 5.005   8.377   3.561   1.00 0.00 ? 17  GLN B HA   4  
ATOM 6625  H HB2  . GLN B 2 19  ? 5.324   7.828   0.982   1.00 0.00 ? 17  GLN B HB2  4  
ATOM 6626  H HB3  . GLN B 2 19  ? 6.993   7.588   1.466   1.00 0.00 ? 17  GLN B HB3  4  
ATOM 6627  H HG2  . GLN B 2 19  ? 4.565   6.086   2.395   1.00 0.00 ? 17  GLN B HG2  4  
ATOM 6628  H HG3  . GLN B 2 19  ? 5.941   5.472   1.484   1.00 0.00 ? 17  GLN B HG3  4  
ATOM 6629  H HE21 . GLN B 2 19  ? 4.656   6.201   4.562   1.00 0.00 ? 17  GLN B HE21 4  
ATOM 6630  H HE22 . GLN B 2 19  ? 5.988   5.630   5.516   1.00 0.00 ? 17  GLN B HE22 4  
ATOM 6631  N N    . LYS B 2 20  ? 6.984   8.738   5.014   1.00 0.00 ? 18  LYS B N    4  
ATOM 6632  C CA   . LYS B 2 20  ? 8.137   8.850   5.903   1.00 0.00 ? 18  LYS B CA   4  
ATOM 6633  C C    . LYS B 2 20  ? 8.795   10.224  5.773   1.00 0.00 ? 18  LYS B C    4  
ATOM 6634  O O    . LYS B 2 20  ? 10.023  10.332  5.749   1.00 0.00 ? 18  LYS B O    4  
ATOM 6635  C CB   . LYS B 2 20  ? 9.152   7.735   5.610   1.00 0.00 ? 18  LYS B CB   4  
ATOM 6636  C CG   . LYS B 2 20  ? 9.473   6.852   6.808   1.00 0.00 ? 18  LYS B CG   4  
ATOM 6637  C CD   . LYS B 2 20  ? 10.332  7.576   7.835   1.00 0.00 ? 18  LYS B CD   4  
ATOM 6638  C CE   . LYS B 2 20  ? 9.528   7.961   9.067   1.00 0.00 ? 18  LYS B CE   4  
ATOM 6639  N NZ   . LYS B 2 20  ? 9.043   6.769   9.813   1.00 0.00 ? 18  LYS B NZ   4  
ATOM 6640  H H    . LYS B 2 20  ? 6.091   8.632   5.408   1.00 0.00 ? 18  LYS B H    4  
ATOM 6641  H HA   . LYS B 2 20  ? 7.779   8.737   6.917   1.00 0.00 ? 18  LYS B HA   4  
ATOM 6642  H HB2  . LYS B 2 20  ? 8.757   7.107   4.826   1.00 0.00 ? 18  LYS B HB2  4  
ATOM 6643  H HB3  . LYS B 2 20  ? 10.071  8.185   5.267   1.00 0.00 ? 18  LYS B HB3  4  
ATOM 6644  H HG2  . LYS B 2 20  ? 8.549   6.551   7.278   1.00 0.00 ? 18  LYS B HG2  4  
ATOM 6645  H HG3  . LYS B 2 20  ? 10.003  5.976   6.463   1.00 0.00 ? 18  LYS B HG3  4  
ATOM 6646  H HD2  . LYS B 2 20  ? 11.141  6.925   8.135   1.00 0.00 ? 18  LYS B HD2  4  
ATOM 6647  H HD3  . LYS B 2 20  ? 10.735  8.470   7.385   1.00 0.00 ? 18  LYS B HD3  4  
ATOM 6648  H HE2  . LYS B 2 20  ? 10.146  8.555   9.719   1.00 0.00 ? 18  LYS B HE2  4  
ATOM 6649  H HE3  . LYS B 2 20  ? 8.672   8.545   8.752   1.00 0.00 ? 18  LYS B HE3  4  
ATOM 6650  H HZ1  . LYS B 2 20  ? 9.027   6.971   10.842  1.00 0.00 ? 18  LYS B HZ1  4  
ATOM 6651  H HZ2  . LYS B 2 20  ? 9.662   5.956   9.640   1.00 0.00 ? 18  LYS B HZ2  4  
ATOM 6652  H HZ3  . LYS B 2 20  ? 8.074   6.529   9.504   1.00 0.00 ? 18  LYS B HZ3  4  
ATOM 6653  N N    . LYS B 2 21  ? 7.957   11.263  5.683   1.00 0.00 ? 19  LYS B N    4  
ATOM 6654  C CA   . LYS B 2 21  ? 8.408   12.656  5.571   1.00 0.00 ? 19  LYS B CA   4  
ATOM 6655  C C    . LYS B 2 21  ? 8.963   12.957  4.176   1.00 0.00 ? 19  LYS B C    4  
ATOM 6656  O O    . LYS B 2 21  ? 9.793   13.853  4.011   1.00 0.00 ? 19  LYS B O    4  
ATOM 6657  C CB   . LYS B 2 21  ? 9.460   12.987  6.643   1.00 0.00 ? 19  LYS B CB   4  
ATOM 6658  C CG   . LYS B 2 21  ? 9.153   14.241  7.450   1.00 0.00 ? 19  LYS B CG   4  
ATOM 6659  C CD   . LYS B 2 21  ? 8.112   13.974  8.527   1.00 0.00 ? 19  LYS B CD   4  
ATOM 6660  C CE   . LYS B 2 21  ? 7.849   15.197  9.384   1.00 0.00 ? 19  LYS B CE   4  
ATOM 6661  N NZ   . LYS B 2 21  ? 7.076   16.229  8.642   1.00 0.00 ? 19  LYS B NZ   4  
ATOM 6662  H H    . LYS B 2 21  ? 6.982   11.084  5.677   1.00 0.00 ? 19  LYS B H    4  
ATOM 6663  H HA   . LYS B 2 21  ? 7.545   13.285  5.732   1.00 0.00 ? 19  LYS B HA   4  
ATOM 6664  H HB2  . LYS B 2 21  ? 9.529   12.155  7.328   1.00 0.00 ? 19  LYS B HB2  4  
ATOM 6665  H HB3  . LYS B 2 21  ? 10.416  13.121  6.160   1.00 0.00 ? 19  LYS B HB3  4  
ATOM 6666  H HG2  . LYS B 2 21  ? 10.062  14.586  7.921   1.00 0.00 ? 19  LYS B HG2  4  
ATOM 6667  H HG3  . LYS B 2 21  ? 8.781   15.004  6.783   1.00 0.00 ? 19  LYS B HG3  4  
ATOM 6668  H HD2  . LYS B 2 21  ? 7.183   13.686  8.054   1.00 0.00 ? 19  LYS B HD2  4  
ATOM 6669  H HD3  . LYS B 2 21  ? 8.454   13.171  9.162   1.00 0.00 ? 19  LYS B HD3  4  
ATOM 6670  H HE2  . LYS B 2 21  ? 7.281   14.891  10.253  1.00 0.00 ? 19  LYS B HE2  4  
ATOM 6671  H HE3  . LYS B 2 21  ? 8.792   15.614  9.698   1.00 0.00 ? 19  LYS B HE3  4  
ATOM 6672  H HZ1  . LYS B 2 21  ? 7.558   16.471  7.756   1.00 0.00 ? 19  LYS B HZ1  4  
ATOM 6673  H HZ2  . LYS B 2 21  ? 6.979   17.088  9.215   1.00 0.00 ? 19  LYS B HZ2  4  
ATOM 6674  H HZ3  . LYS B 2 21  ? 6.120   15.871  8.418   1.00 0.00 ? 19  LYS B HZ3  4  
ATOM 6675  N N    . GLN B 2 22  ? 8.486   12.229  3.173   1.00 0.00 ? 20  GLN B N    4  
ATOM 6676  C CA   . GLN B 2 22  ? 8.940   12.431  1.798   1.00 0.00 ? 20  GLN B CA   4  
ATOM 6677  C C    . GLN B 2 22  ? 7.748   12.672  0.887   1.00 0.00 ? 20  GLN B C    4  
ATOM 6678  O O    . GLN B 2 22  ? 6.846   11.851  0.828   1.00 0.00 ? 20  GLN B O    4  
ATOM 6679  C CB   . GLN B 2 22  ? 9.719   11.218  1.290   1.00 0.00 ? 20  GLN B CB   4  
ATOM 6680  C CG   . GLN B 2 22  ? 10.862  10.789  2.190   1.00 0.00 ? 20  GLN B CG   4  
ATOM 6681  C CD   . GLN B 2 22  ? 11.422  9.443   1.789   1.00 0.00 ? 20  GLN B CD   4  
ATOM 6682  O OE1  . GLN B 2 22  ? 12.395  9.356   1.042   1.00 0.00 ? 20  GLN B OE1  4  
ATOM 6683  N NE2  . GLN B 2 22  ? 10.789  8.382   2.258   1.00 0.00 ? 20  GLN B NE2  4  
ATOM 6684  H H    . GLN B 2 22  ? 7.802   11.548  3.357   1.00 0.00 ? 20  GLN B H    4  
ATOM 6685  H HA   . GLN B 2 22  ? 9.581   13.301  1.780   1.00 0.00 ? 20  GLN B HA   4  
ATOM 6686  H HB2  . GLN B 2 22  ? 9.038   10.386  1.194   1.00 0.00 ? 20  GLN B HB2  4  
ATOM 6687  H HB3  . GLN B 2 22  ? 10.125  11.451  0.317   1.00 0.00 ? 20  GLN B HB3  4  
ATOM 6688  H HG2  . GLN B 2 22  ? 11.649  11.525  2.131   1.00 0.00 ? 20  GLN B HG2  4  
ATOM 6689  H HG3  . GLN B 2 22  ? 10.502  10.727  3.207   1.00 0.00 ? 20  GLN B HG3  4  
ATOM 6690  H HE21 . GLN B 2 22  ? 9.998   8.528   2.827   1.00 0.00 ? 20  GLN B HE21 4  
ATOM 6691  H HE22 . GLN B 2 22  ? 11.130  7.499   2.021   1.00 0.00 ? 20  GLN B HE22 4  
ATOM 6692  N N    . ASP B 2 23  ? 7.757   13.785  0.173   1.00 0.00 ? 21  ASP B N    4  
ATOM 6693  C CA   . ASP B 2 23  ? 6.658   14.130  -0.728  1.00 0.00 ? 21  ASP B CA   4  
ATOM 6694  C C    . ASP B 2 23  ? 6.856   13.482  -2.099  1.00 0.00 ? 21  ASP B C    4  
ATOM 6695  O O    . ASP B 2 23  ? 7.979   13.432  -2.608  1.00 0.00 ? 21  ASP B O    4  
ATOM 6696  C CB   . ASP B 2 23  ? 6.567   15.650  -0.876  1.00 0.00 ? 21  ASP B CB   4  
ATOM 6697  C CG   . ASP B 2 23  ? 5.137   16.151  -0.931  1.00 0.00 ? 21  ASP B CG   4  
ATOM 6698  O OD1  . ASP B 2 23  ? 4.395   15.738  -1.847  1.00 0.00 ? 21  ASP B OD1  4  
ATOM 6699  O OD2  . ASP B 2 23  ? 4.760   16.977  -0.069  1.00 0.00 ? 21  ASP B OD2  4  
ATOM 6700  H H    . ASP B 2 23  ? 8.523   14.387  0.242   1.00 0.00 ? 21  ASP B H    4  
ATOM 6701  H HA   . ASP B 2 23  ? 5.741   13.760  -0.294  1.00 0.00 ? 21  ASP B HA   4  
ATOM 6702  H HB2  . ASP B 2 23  ? 7.057   16.116  -0.033  1.00 0.00 ? 21  ASP B HB2  4  
ATOM 6703  H HB3  . ASP B 2 23  ? 7.068   15.946  -1.786  1.00 0.00 ? 21  ASP B HB3  4  
ATOM 6704  N N    . GLY B 2 24  ? 5.776   12.975  -2.690  1.00 0.00 ? 22  GLY B N    4  
ATOM 6705  C CA   . GLY B 2 24  ? 5.869   12.337  -3.994  1.00 0.00 ? 22  GLY B CA   4  
ATOM 6706  C C    . GLY B 2 24  ? 4.517   11.970  -4.588  1.00 0.00 ? 22  GLY B C    4  
ATOM 6707  O O    . GLY B 2 24  ? 3.501   12.582  -4.266  1.00 0.00 ? 22  GLY B O    4  
ATOM 6708  H H    . GLY B 2 24  ? 4.907   13.030  -2.233  1.00 0.00 ? 22  GLY B H    4  
ATOM 6709  H HA2  . GLY B 2 24  ? 6.373   13.009  -4.672  1.00 0.00 ? 22  GLY B HA2  4  
ATOM 6710  H HA3  . GLY B 2 24  ? 6.460   11.437  -3.896  1.00 0.00 ? 22  GLY B HA3  4  
ATOM 6711  N N    . ALA B 2 25  ? 4.512   10.956  -5.447  1.00 0.00 ? 23  ALA B N    4  
ATOM 6712  C CA   . ALA B 2 25  ? 3.297   10.489  -6.111  1.00 0.00 ? 23  ALA B CA   4  
ATOM 6713  C C    . ALA B 2 25  ? 3.137   8.987   -5.901  1.00 0.00 ? 23  ALA B C    4  
ATOM 6714  O O    . ALA B 2 25  ? 4.106   8.230   -5.991  1.00 0.00 ? 23  ALA B O    4  
ATOM 6715  C CB   . ALA B 2 25  ? 3.349   10.815  -7.597  1.00 0.00 ? 23  ALA B CB   4  
ATOM 6716  H H    . ALA B 2 25  ? 5.358   10.485  -5.629  1.00 0.00 ? 23  ALA B H    4  
ATOM 6717  H HA   . ALA B 2 25  ? 2.441   11.001  -5.680  1.00 0.00 ? 23  ALA B HA   4  
ATOM 6718  H HB1  . ALA B 2 25  ? 2.438   10.480  -8.070  1.00 0.00 ? 23  ALA B HB1  4  
ATOM 6719  H HB2  . ALA B 2 25  ? 4.193   10.315  -8.047  1.00 0.00 ? 23  ALA B HB2  4  
ATOM 6720  H HB3  . ALA B 2 25  ? 3.451   11.882  -7.727  1.00 0.00 ? 23  ALA B HB3  4  
ATOM 6721  N N    . LEU B 2 26  ? 1.916   8.567   -5.625  1.00 0.00 ? 24  LEU B N    4  
ATOM 6722  C CA   . LEU B 2 26  ? 1.611   7.165   -5.366  1.00 0.00 ? 24  LEU B CA   4  
ATOM 6723  C C    . LEU B 2 26  ? 0.980   6.511   -6.598  1.00 0.00 ? 24  LEU B C    4  
ATOM 6724  O O    . LEU B 2 26  ? 0.209   7.139   -7.312  1.00 0.00 ? 24  LEU B O    4  
ATOM 6725  C CB   . LEU B 2 26  ? 0.665   7.079   -4.167  1.00 0.00 ? 24  LEU B CB   4  
ATOM 6726  C CG   . LEU B 2 26  ? 0.208   5.672   -3.795  1.00 0.00 ? 24  LEU B CG   4  
ATOM 6727  C CD1  . LEU B 2 26  ? 1.139   5.032   -2.794  1.00 0.00 ? 24  LEU B CD1  4  
ATOM 6728  C CD2  . LEU B 2 26  ? -1.208  5.701   -3.251  1.00 0.00 ? 24  LEU B CD2  4  
ATOM 6729  H H    . LEU B 2 26  ? 1.183   9.219   -5.619  1.00 0.00 ? 24  LEU B H    4  
ATOM 6730  H HA   . LEU B 2 26  ? 2.527   6.648   -5.125  1.00 0.00 ? 24  LEU B HA   4  
ATOM 6731  H HB2  . LEU B 2 26  ? 1.162   7.511   -3.314  1.00 0.00 ? 24  LEU B HB2  4  
ATOM 6732  H HB3  . LEU B 2 26  ? -0.206  7.672   -4.384  1.00 0.00 ? 24  LEU B HB3  4  
ATOM 6733  H HG   . LEU B 2 26  ? 0.230   5.060   -4.678  1.00 0.00 ? 24  LEU B HG   4  
ATOM 6734  H HD11 . LEU B 2 26  ? 2.124   4.951   -3.221  1.00 0.00 ? 24  LEU B HD11 4  
ATOM 6735  H HD12 . LEU B 2 26  ? 0.770   4.046   -2.547  1.00 0.00 ? 24  LEU B HD12 4  
ATOM 6736  H HD13 . LEU B 2 26  ? 1.177   5.636   -1.902  1.00 0.00 ? 24  LEU B HD13 4  
ATOM 6737  H HD21 . LEU B 2 26  ? -1.875  6.097   -4.002  1.00 0.00 ? 24  LEU B HD21 4  
ATOM 6738  H HD22 . LEU B 2 26  ? -1.242  6.330   -2.372  1.00 0.00 ? 24  LEU B HD22 4  
ATOM 6739  H HD23 . LEU B 2 26  ? -1.516  4.700   -2.987  1.00 0.00 ? 24  LEU B HD23 4  
ATOM 6740  N N    . TYR B 2 27  ? 1.326   5.257   -6.857  1.00 0.00 ? 25  TYR B N    4  
ATOM 6741  C CA   . TYR B 2 27  ? 0.784   4.526   -7.999  1.00 0.00 ? 25  TYR B CA   4  
ATOM 6742  C C    . TYR B 2 27  ? 0.404   3.109   -7.575  1.00 0.00 ? 25  TYR B C    4  
ATOM 6743  O O    . TYR B 2 27  ? 1.249   2.346   -7.112  1.00 0.00 ? 25  TYR B O    4  
ATOM 6744  C CB   . TYR B 2 27  ? 1.806   4.450   -9.143  1.00 0.00 ? 25  TYR B CB   4  
ATOM 6745  C CG   . TYR B 2 27  ? 2.433   5.771   -9.530  1.00 0.00 ? 25  TYR B CG   4  
ATOM 6746  C CD1  . TYR B 2 27  ? 1.878   6.561   -10.527 1.00 0.00 ? 25  TYR B CD1  4  
ATOM 6747  C CD2  . TYR B 2 27  ? 3.591   6.220   -8.906  1.00 0.00 ? 25  TYR B CD2  4  
ATOM 6748  C CE1  . TYR B 2 27  ? 2.457   7.761   -10.891 1.00 0.00 ? 25  TYR B CE1  4  
ATOM 6749  C CE2  . TYR B 2 27  ? 4.174   7.419   -9.262  1.00 0.00 ? 25  TYR B CE2  4  
ATOM 6750  C CZ   . TYR B 2 27  ? 3.604   8.185   -10.255 1.00 0.00 ? 25  TYR B CZ   4  
ATOM 6751  O OH   . TYR B 2 27  ? 4.184   9.380   -10.616 1.00 0.00 ? 25  TYR B OH   4  
ATOM 6752  H H    . TYR B 2 27  ? 1.965   4.800   -6.260  1.00 0.00 ? 25  TYR B H    4  
ATOM 6753  H HA   . TYR B 2 27  ? -0.101  5.043   -8.341  1.00 0.00 ? 25  TYR B HA   4  
ATOM 6754  H HB2  . TYR B 2 27  ? 2.602   3.788   -8.854  1.00 0.00 ? 25  TYR B HB2  4  
ATOM 6755  H HB3  . TYR B 2 27  ? 1.317   4.049   -10.019 1.00 0.00 ? 25  TYR B HB3  4  
ATOM 6756  H HD1  . TYR B 2 27  ? 0.977   6.228   -11.021 1.00 0.00 ? 25  TYR B HD1  4  
ATOM 6757  H HD2  . TYR B 2 27  ? 4.036   5.616   -8.129  1.00 0.00 ? 25  TYR B HD2  4  
ATOM 6758  H HE1  . TYR B 2 27  ? 2.011   8.363   -11.669 1.00 0.00 ? 25  TYR B HE1  4  
ATOM 6759  H HE2  . TYR B 2 27  ? 5.073   7.752   -8.764  1.00 0.00 ? 25  TYR B HE2  4  
ATOM 6760  H HH   . TYR B 2 27  ? 5.139   9.283   -10.620 1.00 0.00 ? 25  TYR B HH   4  
ATOM 6761  N N    . LEU B 2 28  ? -0.859  2.753   -7.731  1.00 0.00 ? 26  LEU B N    4  
ATOM 6762  C CA   . LEU B 2 28  ? -1.310  1.424   -7.338  1.00 0.00 ? 26  LEU B CA   4  
ATOM 6763  C C    . LEU B 2 28  ? -1.423  0.500   -8.543  1.00 0.00 ? 26  LEU B C    4  
ATOM 6764  O O    . LEU B 2 28  ? -2.166  0.783   -9.483  1.00 0.00 ? 26  LEU B O    4  
ATOM 6765  C CB   . LEU B 2 28  ? -2.657  1.490   -6.617  1.00 0.00 ? 26  LEU B CB   4  
ATOM 6766  C CG   . LEU B 2 28  ? -2.760  2.546   -5.518  1.00 0.00 ? 26  LEU B CG   4  
ATOM 6767  C CD1  . LEU B 2 28  ? -4.028  2.368   -4.717  1.00 0.00 ? 26  LEU B CD1  4  
ATOM 6768  C CD2  . LEU B 2 28  ? -1.579  2.493   -4.586  1.00 0.00 ? 26  LEU B CD2  4  
ATOM 6769  H H    . LEU B 2 28  ? -1.499  3.388   -8.122  1.00 0.00 ? 26  LEU B H    4  
ATOM 6770  H HA   . LEU B 2 28  ? -0.577  1.020   -6.659  1.00 0.00 ? 26  LEU B HA   4  
ATOM 6771  H HB2  . LEU B 2 28  ? -3.424  1.690   -7.352  1.00 0.00 ? 26  LEU B HB2  4  
ATOM 6772  H HB3  . LEU B 2 28  ? -2.852  0.524   -6.175  1.00 0.00 ? 26  LEU B HB3  4  
ATOM 6773  H HG   . LEU B 2 28  ? -2.776  3.518   -5.975  1.00 0.00 ? 26  LEU B HG   4  
ATOM 6774  H HD11 . LEU B 2 28  ? -4.879  2.400   -5.377  1.00 0.00 ? 26  LEU B HD11 4  
ATOM 6775  H HD12 . LEU B 2 28  ? -4.102  3.166   -3.990  1.00 0.00 ? 26  LEU B HD12 4  
ATOM 6776  H HD13 . LEU B 2 28  ? -3.998  1.418   -4.207  1.00 0.00 ? 26  LEU B HD13 4  
ATOM 6777  H HD21 . LEU B 2 28  ? -1.599  1.566   -4.038  1.00 0.00 ? 26  LEU B HD21 4  
ATOM 6778  H HD22 . LEU B 2 28  ? -1.639  3.324   -3.896  1.00 0.00 ? 26  LEU B HD22 4  
ATOM 6779  H HD23 . LEU B 2 28  ? -0.669  2.563   -5.158  1.00 0.00 ? 26  LEU B HD23 4  
ATOM 6780  N N    . MET B 2 29  ? -0.677  -0.594  -8.507  1.00 0.00 ? 27  MET B N    4  
ATOM 6781  C CA   . MET B 2 29  ? -0.694  -1.583  -9.575  1.00 0.00 ? 27  MET B CA   4  
ATOM 6782  C C    . MET B 2 29  ? -1.644  -2.713  -9.204  1.00 0.00 ? 27  MET B C    4  
ATOM 6783  O O    . MET B 2 29  ? -2.024  -2.846  -8.044  1.00 0.00 ? 27  MET B O    4  
ATOM 6784  C CB   . MET B 2 29  ? 0.701   -2.146  -9.836  1.00 0.00 ? 27  MET B CB   4  
ATOM 6785  C CG   . MET B 2 29  ? 1.683   -1.126  -10.384 1.00 0.00 ? 27  MET B CG   4  
ATOM 6786  S SD   . MET B 2 29  ? 2.570   -0.239  -9.089  1.00 0.00 ? 27  MET B SD   4  
ATOM 6787  C CE   . MET B 2 29  ? 3.584   0.854   -10.078 1.00 0.00 ? 27  MET B CE   4  
ATOM 6788  H H    . MET B 2 29  ? -0.101  -0.753  -7.724  1.00 0.00 ? 27  MET B H    4  
ATOM 6789  H HA   . MET B 2 29  ? -1.053  -1.104  -10.474 1.00 0.00 ? 27  MET B HA   4  
ATOM 6790  H HB2  . MET B 2 29  ? 1.098   -2.536  -8.911  1.00 0.00 ? 27  MET B HB2  4  
ATOM 6791  H HB3  . MET B 2 29  ? 0.617   -2.949  -10.549 1.00 0.00 ? 27  MET B HB3  4  
ATOM 6792  H HG2  . MET B 2 29  ? 2.403   -1.638  -11.005 1.00 0.00 ? 27  MET B HG2  4  
ATOM 6793  H HG3  . MET B 2 29  ? 1.139   -0.410  -10.982 1.00 0.00 ? 27  MET B HG3  4  
ATOM 6794  H HE1  . MET B 2 29  ? 2.950   1.497   -10.668 1.00 0.00 ? 27  MET B HE1  4  
ATOM 6795  H HE2  . MET B 2 29  ? 4.213   0.270   -10.731 1.00 0.00 ? 27  MET B HE2  4  
ATOM 6796  H HE3  . MET B 2 29  ? 4.201   1.457   -9.427  1.00 0.00 ? 27  MET B HE3  4  
ATOM 6797  N N    . ALA B 2 30  ? -1.976  -3.551  -10.175 1.00 0.00 ? 28  ALA B N    4  
ATOM 6798  C CA   . ALA B 2 30  ? -2.918  -4.652  -9.970  1.00 0.00 ? 28  ALA B CA   4  
ATOM 6799  C C    . ALA B 2 30  ? -2.525  -5.576  -8.819  1.00 0.00 ? 28  ALA B C    4  
ATOM 6800  O O    . ALA B 2 30  ? -3.388  -6.051  -8.088  1.00 0.00 ? 28  ALA B O    4  
ATOM 6801  C CB   . ALA B 2 30  ? -3.076  -5.454  -11.252 1.00 0.00 ? 28  ALA B CB   4  
ATOM 6802  H H    . ALA B 2 30  ? -1.553  -3.445  -11.058 1.00 0.00 ? 28  ALA B H    4  
ATOM 6803  H HA   . ALA B 2 30  ? -3.880  -4.216  -9.741  1.00 0.00 ? 28  ALA B HA   4  
ATOM 6804  H HB1  . ALA B 2 30  ? -3.858  -6.187  -11.124 1.00 0.00 ? 28  ALA B HB1  4  
ATOM 6805  H HB2  . ALA B 2 30  ? -2.146  -5.955  -11.479 1.00 0.00 ? 28  ALA B HB2  4  
ATOM 6806  H HB3  . ALA B 2 30  ? -3.334  -4.790  -12.063 1.00 0.00 ? 28  ALA B HB3  4  
ATOM 6807  N N    . GLU B 2 31  ? -1.235  -5.825  -8.647  1.00 0.00 ? 29  GLU B N    4  
ATOM 6808  C CA   . GLU B 2 31  ? -0.792  -6.722  -7.584  1.00 0.00 ? 29  GLU B CA   4  
ATOM 6809  C C    . GLU B 2 31  ? 0.072   -6.030  -6.531  1.00 0.00 ? 29  GLU B C    4  
ATOM 6810  O O    . GLU B 2 31  ? 0.459   -6.658  -5.541  1.00 0.00 ? 29  GLU B O    4  
ATOM 6811  C CB   . GLU B 2 31  ? -0.013  -7.894  -8.179  1.00 0.00 ? 29  GLU B CB   4  
ATOM 6812  C CG   . GLU B 2 31  ? -0.888  -9.059  -8.606  1.00 0.00 ? 29  GLU B CG   4  
ATOM 6813  C CD   . GLU B 2 31  ? -0.348  -10.391 -8.129  1.00 0.00 ? 29  GLU B CD   4  
ATOM 6814  O OE1  . GLU B 2 31  ? 0.179   -10.454 -6.996  1.00 0.00 ? 29  GLU B OE1  4  
ATOM 6815  O OE2  . GLU B 2 31  ? -0.453  -11.386 -8.874  1.00 0.00 ? 29  GLU B OE2  4  
ATOM 6816  H H    . GLU B 2 31  ? -0.579  -5.416  -9.248  1.00 0.00 ? 29  GLU B H    4  
ATOM 6817  H HA   . GLU B 2 31  ? -1.673  -7.111  -7.100  1.00 0.00 ? 29  GLU B HA   4  
ATOM 6818  H HB2  . GLU B 2 31  ? 0.532   -7.546  -9.044  1.00 0.00 ? 29  GLU B HB2  4  
ATOM 6819  H HB3  . GLU B 2 31  ? 0.691   -8.252  -7.442  1.00 0.00 ? 29  GLU B HB3  4  
ATOM 6820  H HG2  . GLU B 2 31  ? -1.877  -8.919  -8.196  1.00 0.00 ? 29  GLU B HG2  4  
ATOM 6821  H HG3  . GLU B 2 31  ? -0.944  -9.074  -9.685  1.00 0.00 ? 29  GLU B HG3  4  
ATOM 6822  N N    . ARG B 2 32  ? 0.342   -4.740  -6.685  1.00 0.00 ? 30  ARG B N    4  
ATOM 6823  C CA   . ARG B 2 32  ? 1.205   -4.074  -5.716  1.00 0.00 ? 30  ARG B CA   4  
ATOM 6824  C C    . ARG B 2 32  ? 0.991   -2.574  -5.676  1.00 0.00 ? 30  ARG B C    4  
ATOM 6825  O O    . ARG B 2 32  ? 0.489   -1.979  -6.617  1.00 0.00 ? 30  ARG B O    4  
ATOM 6826  C CB   . ARG B 2 32  ? 2.678   -4.363  -6.025  1.00 0.00 ? 30  ARG B CB   4  
ATOM 6827  C CG   . ARG B 2 32  ? 3.201   -3.652  -7.264  1.00 0.00 ? 30  ARG B CG   4  
ATOM 6828  C CD   . ARG B 2 32  ? 4.708   -3.802  -7.396  1.00 0.00 ? 30  ARG B CD   4  
ATOM 6829  N NE   . ARG B 2 32  ? 5.256   -2.966  -8.469  1.00 0.00 ? 30  ARG B NE   4  
ATOM 6830  C CZ   . ARG B 2 32  ? 6.182   -2.024  -8.279  1.00 0.00 ? 30  ARG B CZ   4  
ATOM 6831  N NH1  . ARG B 2 32  ? 6.669   -1.798  -7.065  1.00 0.00 ? 30  ARG B NH1  4  
ATOM 6832  N NH2  . ARG B 2 32  ? 6.637   -1.323  -9.308  1.00 0.00 ? 30  ARG B NH2  4  
ATOM 6833  H H    . ARG B 2 32  ? -0.075  -4.226  -7.417  1.00 0.00 ? 30  ARG B H    4  
ATOM 6834  H HA   . ARG B 2 32  ? 0.975   -4.479  -4.742  1.00 0.00 ? 30  ARG B HA   4  
ATOM 6835  H HB2  . ARG B 2 32  ? 3.277   -4.054  -5.181  1.00 0.00 ? 30  ARG B HB2  4  
ATOM 6836  H HB3  . ARG B 2 32  ? 2.801   -5.427  -6.168  1.00 0.00 ? 30  ARG B HB3  4  
ATOM 6837  H HG2  . ARG B 2 32  ? 2.728   -4.075  -8.136  1.00 0.00 ? 30  ARG B HG2  4  
ATOM 6838  H HG3  . ARG B 2 32  ? 2.957   -2.602  -7.192  1.00 0.00 ? 30  ARG B HG3  4  
ATOM 6839  H HD2  . ARG B 2 32  ? 5.168   -3.515  -6.463  1.00 0.00 ? 30  ARG B HD2  4  
ATOM 6840  H HD3  . ARG B 2 32  ? 4.936   -4.837  -7.607  1.00 0.00 ? 30  ARG B HD3  4  
ATOM 6841  H HE   . ARG B 2 32  ? 4.907   -3.121  -9.384  1.00 0.00 ? 30  ARG B HE   4  
ATOM 6842  H HH11 . ARG B 2 32  ? 6.345   -2.334  -6.282  1.00 0.00 ? 30  ARG B HH11 4  
ATOM 6843  H HH12 . ARG B 2 32  ? 7.368   -1.095  -6.925  1.00 0.00 ? 30  ARG B HH12 4  
ATOM 6844  H HH21 . ARG B 2 32  ? 6.289   -1.507  -10.245 1.00 0.00 ? 30  ARG B HH21 4  
ATOM 6845  H HH22 . ARG B 2 32  ? 7.323   -0.607  -9.168  1.00 0.00 ? 30  ARG B HH22 4  
ATOM 6846  N N    . ILE B 2 33  ? 1.387   -1.982  -4.568  1.00 0.00 ? 31  ILE B N    4  
ATOM 6847  C CA   . ILE B 2 33  ? 1.283   -0.551  -4.374  1.00 0.00 ? 31  ILE B CA   4  
ATOM 6848  C C    . ILE B 2 33  ? 2.686   0.047   -4.378  1.00 0.00 ? 31  ILE B C    4  
ATOM 6849  O O    . ILE B 2 33  ? 3.548   -0.359  -3.589  1.00 0.00 ? 31  ILE B O    4  
ATOM 6850  C CB   . ILE B 2 33  ? 0.547   -0.205  -3.053  1.00 0.00 ? 31  ILE B CB   4  
ATOM 6851  C CG1  . ILE B 2 33  ? 0.933   1.195   -2.563  1.00 0.00 ? 31  ILE B CG1  4  
ATOM 6852  C CG2  . ILE B 2 33  ? 0.830   -1.253  -1.982  1.00 0.00 ? 31  ILE B CG2  4  
ATOM 6853  C CD1  . ILE B 2 33  ? 0.068   1.699   -1.432  1.00 0.00 ? 31  ILE B CD1  4  
ATOM 6854  H H    . ILE B 2 33  ? 1.778   -2.530  -3.850  1.00 0.00 ? 31  ILE B H    4  
ATOM 6855  H HA   . ILE B 2 33  ? 0.716   -0.134  -5.202  1.00 0.00 ? 31  ILE B HA   4  
ATOM 6856  H HB   . ILE B 2 33  ? -0.514  -0.222  -3.253  1.00 0.00 ? 31  ILE B HB   4  
ATOM 6857  H HG12 . ILE B 2 33  ? 1.954   1.178   -2.214  1.00 0.00 ? 31  ILE B HG12 4  
ATOM 6858  H HG13 . ILE B 2 33  ? 0.848   1.893   -3.383  1.00 0.00 ? 31  ILE B HG13 4  
ATOM 6859  H HG21 . ILE B 2 33  ? 1.893   -1.297  -1.792  1.00 0.00 ? 31  ILE B HG21 4  
ATOM 6860  H HG22 . ILE B 2 33  ? 0.486   -2.218  -2.321  1.00 0.00 ? 31  ILE B HG22 4  
ATOM 6861  H HG23 . ILE B 2 33  ? 0.313   -0.987  -1.072  1.00 0.00 ? 31  ILE B HG23 4  
ATOM 6862  H HD11 . ILE B 2 33  ? 0.416   2.672   -1.120  1.00 0.00 ? 31  ILE B HD11 4  
ATOM 6863  H HD12 . ILE B 2 33  ? 0.130   1.011   -0.599  1.00 0.00 ? 31  ILE B HD12 4  
ATOM 6864  H HD13 . ILE B 2 33  ? -0.956  1.770   -1.765  1.00 0.00 ? 31  ILE B HD13 4  
ATOM 6865  N N    . ALA B 2 34  ? 2.928   0.974   -5.289  1.00 0.00 ? 32  ALA B N    4  
ATOM 6866  C CA   . ALA B 2 34  ? 4.227   1.610   -5.395  1.00 0.00 ? 32  ALA B CA   4  
ATOM 6867  C C    . ALA B 2 34  ? 4.099   3.115   -5.256  1.00 0.00 ? 32  ALA B C    4  
ATOM 6868  O O    . ALA B 2 34  ? 3.072   3.696   -5.591  1.00 0.00 ? 32  ALA B O    4  
ATOM 6869  C CB   . ALA B 2 34  ? 4.887   1.254   -6.717  1.00 0.00 ? 32  ALA B CB   4  
ATOM 6870  H H    . ALA B 2 34  ? 2.209   1.249   -5.904  1.00 0.00 ? 32  ALA B H    4  
ATOM 6871  H HA   . ALA B 2 34  ? 4.849   1.235   -4.596  1.00 0.00 ? 32  ALA B HA   4  
ATOM 6872  H HB1  . ALA B 2 34  ? 4.278   1.616   -7.533  1.00 0.00 ? 32  ALA B HB1  4  
ATOM 6873  H HB2  . ALA B 2 34  ? 4.990   0.183   -6.792  1.00 0.00 ? 32  ALA B HB2  4  
ATOM 6874  H HB3  . ALA B 2 34  ? 5.864   1.714   -6.767  1.00 0.00 ? 32  ALA B HB3  4  
ATOM 6875  N N    . TRP B 2 35  ? 5.133   3.743   -4.743  1.00 0.00 ? 33  TRP B N    4  
ATOM 6876  C CA   . TRP B 2 35  ? 5.129   5.180   -4.567  1.00 0.00 ? 33  TRP B CA   4  
ATOM 6877  C C    . TRP B 2 35  ? 6.539   5.721   -4.760  1.00 0.00 ? 33  TRP B C    4  
ATOM 6878  O O    . TRP B 2 35  ? 7.515   5.098   -4.334  1.00 0.00 ? 33  TRP B O    4  
ATOM 6879  C CB   . TRP B 2 35  ? 4.552   5.530   -3.187  1.00 0.00 ? 33  TRP B CB   4  
ATOM 6880  C CG   . TRP B 2 35  ? 4.749   6.953   -2.762  1.00 0.00 ? 33  TRP B CG   4  
ATOM 6881  C CD1  . TRP B 2 35  ? 3.854   7.967   -2.906  1.00 0.00 ? 33  TRP B CD1  4  
ATOM 6882  C CD2  . TRP B 2 35  ? 5.895   7.522   -2.114  1.00 0.00 ? 33  TRP B CD2  4  
ATOM 6883  N NE1  . TRP B 2 35  ? 4.369   9.131   -2.410  1.00 0.00 ? 33  TRP B NE1  4  
ATOM 6884  C CE2  . TRP B 2 35  ? 5.622   8.887   -1.914  1.00 0.00 ? 33  TRP B CE2  4  
ATOM 6885  C CE3  . TRP B 2 35  ? 7.125   7.014   -1.690  1.00 0.00 ? 33  TRP B CE3  4  
ATOM 6886  C CZ2  . TRP B 2 35  ? 6.532   9.746   -1.309  1.00 0.00 ? 33  TRP B CZ2  4  
ATOM 6887  C CZ3  . TRP B 2 35  ? 8.027   7.869   -1.087  1.00 0.00 ? 33  TRP B CZ3  4  
ATOM 6888  C CH2  . TRP B 2 35  ? 7.726   9.222   -0.902  1.00 0.00 ? 33  TRP B CH2  4  
ATOM 6889  H H    . TRP B 2 35  ? 5.924   3.227   -4.476  1.00 0.00 ? 33  TRP B H    4  
ATOM 6890  H HA   . TRP B 2 35  ? 4.492   5.602   -5.331  1.00 0.00 ? 33  TRP B HA   4  
ATOM 6891  H HB2  . TRP B 2 35  ? 3.491   5.344   -3.207  1.00 0.00 ? 33  TRP B HB2  4  
ATOM 6892  H HB3  . TRP B 2 35  ? 4.990   4.891   -2.446  1.00 0.00 ? 33  TRP B HB3  4  
ATOM 6893  H HD1  . TRP B 2 35  ? 2.883   7.856   -3.362  1.00 0.00 ? 33  TRP B HD1  4  
ATOM 6894  H HE1  . TRP B 2 35  ? 3.910   9.999   -2.405  1.00 0.00 ? 33  TRP B HE1  4  
ATOM 6895  H HE3  . TRP B 2 35  ? 7.375   5.973   -1.823  1.00 0.00 ? 33  TRP B HE3  4  
ATOM 6896  H HZ2  . TRP B 2 35  ? 6.315   10.793  -1.159  1.00 0.00 ? 33  TRP B HZ2  4  
ATOM 6897  H HZ3  . TRP B 2 35  ? 8.981   7.493   -0.750  1.00 0.00 ? 33  TRP B HZ3  4  
ATOM 6898  H HH2  . TRP B 2 35  ? 8.460   9.854   -0.428  1.00 0.00 ? 33  TRP B HH2  4  
ATOM 6899  N N    . ALA B 2 36  ? 6.644   6.861   -5.424  1.00 0.00 ? 34  ALA B N    4  
ATOM 6900  C CA   . ALA B 2 36  ? 7.933   7.481   -5.680  1.00 0.00 ? 34  ALA B CA   4  
ATOM 6901  C C    . ALA B 2 36  ? 7.899   8.954   -5.302  1.00 0.00 ? 34  ALA B C    4  
ATOM 6902  O O    . ALA B 2 36  ? 6.917   9.644   -5.575  1.00 0.00 ? 34  ALA B O    4  
ATOM 6903  C CB   . ALA B 2 36  ? 8.313   7.323   -7.146  1.00 0.00 ? 34  ALA B CB   4  
ATOM 6904  H H    . ALA B 2 36  ? 5.826   7.310   -5.740  1.00 0.00 ? 34  ALA B H    4  
ATOM 6905  H HA   . ALA B 2 36  ? 8.675   6.977   -5.079  1.00 0.00 ? 34  ALA B HA   4  
ATOM 6906  H HB1  . ALA B 2 36  ? 7.588   7.834   -7.763  1.00 0.00 ? 34  ALA B HB1  4  
ATOM 6907  H HB2  . ALA B 2 36  ? 8.329   6.274   -7.402  1.00 0.00 ? 34  ALA B HB2  4  
ATOM 6908  H HB3  . ALA B 2 36  ? 9.291   7.750   -7.311  1.00 0.00 ? 34  ALA B HB3  4  
ATOM 6909  N N    . PRO B 2 37  ? 8.960   9.450   -4.650  1.00 0.00 ? 35  PRO B N    4  
ATOM 6910  C CA   . PRO B 2 37  ? 9.049   10.852  -4.246  1.00 0.00 ? 35  PRO B CA   4  
ATOM 6911  C C    . PRO B 2 37  ? 9.087   11.782  -5.456  1.00 0.00 ? 35  PRO B C    4  
ATOM 6912  O O    . PRO B 2 37  ? 9.395   11.358  -6.573  1.00 0.00 ? 35  PRO B O    4  
ATOM 6913  C CB   . PRO B 2 37  ? 10.364  10.935  -3.458  1.00 0.00 ? 35  PRO B CB   4  
ATOM 6914  C CG   . PRO B 2 37  ? 10.719  9.522   -3.136  1.00 0.00 ? 35  PRO B CG   4  
ATOM 6915  C CD   . PRO B 2 37  ? 10.149  8.689   -4.247  1.00 0.00 ? 35  PRO B CD   4  
ATOM 6916  H HA   . PRO B 2 37  ? 8.223   11.130  -3.607  1.00 0.00 ? 35  PRO B HA   4  
ATOM 6917  H HB2  . PRO B 2 37  ? 11.121  11.402  -4.069  1.00 0.00 ? 35  PRO B HB2  4  
ATOM 6918  H HB3  . PRO B 2 37  ? 10.210  11.515  -2.560  1.00 0.00 ? 35  PRO B HB3  4  
ATOM 6919  H HG2  . PRO B 2 37  ? 11.793  9.414   -3.099  1.00 0.00 ? 35  PRO B HG2  4  
ATOM 6920  H HG3  . PRO B 2 37  ? 10.279  9.238   -2.192  1.00 0.00 ? 35  PRO B HG3  4  
ATOM 6921  H HD2  . PRO B 2 37  ? 10.853  8.610   -5.062  1.00 0.00 ? 35  PRO B HD2  4  
ATOM 6922  H HD3  . PRO B 2 37  ? 9.875   7.710   -3.884  1.00 0.00 ? 35  PRO B HD3  4  
ATOM 6923  N N    . GLU B 2 38  ? 8.777   13.047  -5.229  1.00 0.00 ? 36  GLU B N    4  
ATOM 6924  C CA   . GLU B 2 38  ? 8.756   14.037  -6.293  1.00 0.00 ? 36  GLU B CA   4  
ATOM 6925  C C    . GLU B 2 38  ? 10.121  14.159  -6.966  1.00 0.00 ? 36  GLU B C    4  
ATOM 6926  O O    . GLU B 2 38  ? 11.159  14.254  -6.298  1.00 0.00 ? 36  GLU B O    4  
ATOM 6927  C CB   . GLU B 2 38  ? 8.314   15.389  -5.741  1.00 0.00 ? 36  GLU B CB   4  
ATOM 6928  C CG   . GLU B 2 38  ? 7.464   16.191  -6.710  1.00 0.00 ? 36  GLU B CG   4  
ATOM 6929  C CD   . GLU B 2 38  ? 6.351   16.939  -6.009  1.00 0.00 ? 36  GLU B CD   4  
ATOM 6930  O OE1  . GLU B 2 38  ? 5.171   16.561  -6.181  1.00 0.00 ? 36  GLU B OE1  4  
ATOM 6931  O OE2  . GLU B 2 38  ? 6.649   17.893  -5.258  1.00 0.00 ? 36  GLU B OE2  4  
ATOM 6932  H H    . GLU B 2 38  ? 8.548   13.327  -4.311  1.00 0.00 ? 36  GLU B H    4  
ATOM 6933  H HA   . GLU B 2 38  ? 8.038   13.710  -7.030  1.00 0.00 ? 36  GLU B HA   4  
ATOM 6934  H HB2  . GLU B 2 38  ? 7.741   15.227  -4.840  1.00 0.00 ? 36  GLU B HB2  4  
ATOM 6935  H HB3  . GLU B 2 38  ? 9.191   15.971  -5.499  1.00 0.00 ? 36  GLU B HB3  4  
ATOM 6936  H HG2  . GLU B 2 38  ? 8.094   16.906  -7.219  1.00 0.00 ? 36  GLU B HG2  4  
ATOM 6937  H HG3  . GLU B 2 38  ? 7.027   15.517  -7.431  1.00 0.00 ? 36  GLU B HG3  4  
ATOM 6938  N N    . GLY B 2 39  ? 10.113  14.119  -8.293  1.00 0.00 ? 37  GLY B N    4  
ATOM 6939  C CA   . GLY B 2 39  ? 11.337  14.243  -9.058  1.00 0.00 ? 37  GLY B CA   4  
ATOM 6940  C C    . GLY B 2 39  ? 12.233  13.024  -8.948  1.00 0.00 ? 37  GLY B C    4  
ATOM 6941  O O    . GLY B 2 39  ? 13.458  13.149  -8.979  1.00 0.00 ? 37  GLY B O    4  
ATOM 6942  H H    . GLY B 2 39  ? 9.257   14.007  -8.761  1.00 0.00 ? 37  GLY B H    4  
ATOM 6943  H HA2  . GLY B 2 39  ? 11.084  14.392  -10.097 1.00 0.00 ? 37  GLY B HA2  4  
ATOM 6944  H HA3  . GLY B 2 39  ? 11.881  15.106  -8.706  1.00 0.00 ? 37  GLY B HA3  4  
ATOM 6945  N N    . LYS B 2 40  ? 11.639  11.856  -8.751  1.00 0.00 ? 38  LYS B N    4  
ATOM 6946  C CA   . LYS B 2 40  ? 12.408  10.622  -8.652  1.00 0.00 ? 38  LYS B CA   4  
ATOM 6947  C C    . LYS B 2 40  ? 12.103  9.709   -9.831  1.00 0.00 ? 38  LYS B C    4  
ATOM 6948  O O    . LYS B 2 40  ? 10.987  9.701   -10.347 1.00 0.00 ? 38  LYS B O    4  
ATOM 6949  C CB   . LYS B 2 40  ? 12.130  9.908   -7.329  1.00 0.00 ? 38  LYS B CB   4  
ATOM 6950  C CG   . LYS B 2 40  ? 12.574  10.705  -6.113  1.00 0.00 ? 38  LYS B CG   4  
ATOM 6951  C CD   . LYS B 2 40  ? 14.054  11.046  -6.170  1.00 0.00 ? 38  LYS B CD   4  
ATOM 6952  C CE   . LYS B 2 40  ? 14.351  12.359  -5.460  1.00 0.00 ? 38  LYS B CE   4  
ATOM 6953  N NZ   . LYS B 2 40  ? 13.801  13.529  -6.199  1.00 0.00 ? 38  LYS B NZ   4  
ATOM 6954  H H    . LYS B 2 40  ? 10.660  11.817  -8.679  1.00 0.00 ? 38  LYS B H    4  
ATOM 6955  H HA   . LYS B 2 40  ? 13.454  10.888  -8.689  1.00 0.00 ? 38  LYS B HA   4  
ATOM 6956  H HB2  . LYS B 2 40  ? 11.067  9.727   -7.247  1.00 0.00 ? 38  LYS B HB2  4  
ATOM 6957  H HB3  . LYS B 2 40  ? 12.650  8.962   -7.326  1.00 0.00 ? 38  LYS B HB3  4  
ATOM 6958  H HG2  . LYS B 2 40  ? 12.007  11.622  -6.068  1.00 0.00 ? 38  LYS B HG2  4  
ATOM 6959  H HG3  . LYS B 2 40  ? 12.383  10.120  -5.224  1.00 0.00 ? 38  LYS B HG3  4  
ATOM 6960  H HD2  . LYS B 2 40  ? 14.615  10.256  -5.694  1.00 0.00 ? 38  LYS B HD2  4  
ATOM 6961  H HD3  . LYS B 2 40  ? 14.353  11.130  -7.205  1.00 0.00 ? 38  LYS B HD3  4  
ATOM 6962  H HE2  . LYS B 2 40  ? 13.911  12.327  -4.475  1.00 0.00 ? 38  LYS B HE2  4  
ATOM 6963  H HE3  . LYS B 2 40  ? 15.422  12.470  -5.371  1.00 0.00 ? 38  LYS B HE3  4  
ATOM 6964  H HZ1  . LYS B 2 40  ? 12.767  13.590  -6.062  1.00 0.00 ? 38  LYS B HZ1  4  
ATOM 6965  H HZ2  . LYS B 2 40  ? 13.997  13.434  -7.219  1.00 0.00 ? 38  LYS B HZ2  4  
ATOM 6966  H HZ3  . LYS B 2 40  ? 14.236  14.408  -5.855  1.00 0.00 ? 38  LYS B HZ3  4  
ATOM 6967  N N    . ASP B 2 41  ? 13.104  8.949   -10.246 1.00 0.00 ? 39  ASP B N    4  
ATOM 6968  C CA   . ASP B 2 41  ? 12.969  8.029   -11.371 1.00 0.00 ? 39  ASP B CA   4  
ATOM 6969  C C    . ASP B 2 41  ? 12.658  6.617   -10.889 1.00 0.00 ? 39  ASP B C    4  
ATOM 6970  O O    . ASP B 2 41  ? 12.237  5.761   -11.666 1.00 0.00 ? 39  ASP B O    4  
ATOM 6971  C CB   . ASP B 2 41  ? 14.267  8.017   -12.188 1.00 0.00 ? 39  ASP B CB   4  
ATOM 6972  C CG   . ASP B 2 41  ? 15.436  7.414   -11.423 1.00 0.00 ? 39  ASP B CG   4  
ATOM 6973  O OD1  . ASP B 2 41  ? 15.514  7.605   -10.185 1.00 0.00 ? 39  ASP B OD1  4  
ATOM 6974  O OD2  . ASP B 2 41  ? 16.286  6.749   -12.050 1.00 0.00 ? 39  ASP B OD2  4  
ATOM 6975  H H    . ASP B 2 41  ? 13.970  9.004   -9.788  1.00 0.00 ? 39  ASP B H    4  
ATOM 6976  H HA   . ASP B 2 41  ? 12.162  8.378   -11.995 1.00 0.00 ? 39  ASP B HA   4  
ATOM 6977  H HB2  . ASP B 2 41  ? 14.113  7.437   -13.086 1.00 0.00 ? 39  ASP B HB2  4  
ATOM 6978  H HB3  . ASP B 2 41  ? 14.523  9.030   -12.460 1.00 0.00 ? 39  ASP B HB3  4  
ATOM 6979  N N    . ARG B 2 42  ? 12.856  6.382   -9.603  1.00 0.00 ? 40  ARG B N    4  
ATOM 6980  C CA   . ARG B 2 42  ? 12.621  5.069   -9.029  1.00 0.00 ? 40  ARG B CA   4  
ATOM 6981  C C    . ARG B 2 42  ? 11.635  5.136   -7.871  1.00 0.00 ? 40  ARG B C    4  
ATOM 6982  O O    . ARG B 2 42  ? 11.590  6.121   -7.131  1.00 0.00 ? 40  ARG B O    4  
ATOM 6983  C CB   . ARG B 2 42  ? 13.944  4.462   -8.559  1.00 0.00 ? 40  ARG B CB   4  
ATOM 6984  C CG   . ARG B 2 42  ? 14.701  5.333   -7.566  1.00 0.00 ? 40  ARG B CG   4  
ATOM 6985  C CD   . ARG B 2 42  ? 16.203  5.139   -7.688  1.00 0.00 ? 40  ARG B CD   4  
ATOM 6986  N NE   . ARG B 2 42  ? 16.687  5.488   -9.023  1.00 0.00 ? 40  ARG B NE   4  
ATOM 6987  C CZ   . ARG B 2 42  ? 17.739  4.929   -9.614  1.00 0.00 ? 40  ARG B CZ   4  
ATOM 6988  N NH1  . ARG B 2 42  ? 18.478  4.033   -8.964  1.00 0.00 ? 40  ARG B NH1  4  
ATOM 6989  N NH2  . ARG B 2 42  ? 18.053  5.273   -10.855 1.00 0.00 ? 40  ARG B NH2  4  
ATOM 6990  H H    . ARG B 2 42  ? 13.163  7.110   -9.027  1.00 0.00 ? 40  ARG B H    4  
ATOM 6991  H HA   . ARG B 2 42  ? 12.205  4.441   -9.802  1.00 0.00 ? 40  ARG B HA   4  
ATOM 6992  H HB2  . ARG B 2 42  ? 13.744  3.511   -8.090  1.00 0.00 ? 40  ARG B HB2  4  
ATOM 6993  H HB3  . ARG B 2 42  ? 14.578  4.304   -9.419  1.00 0.00 ? 40  ARG B HB3  4  
ATOM 6994  H HG2  . ARG B 2 42  ? 14.467  6.370   -7.758  1.00 0.00 ? 40  ARG B HG2  4  
ATOM 6995  H HG3  . ARG B 2 42  ? 14.393  5.072   -6.564  1.00 0.00 ? 40  ARG B HG3  4  
ATOM 6996  H HD2  . ARG B 2 42  ? 16.696  5.766   -6.959  1.00 0.00 ? 40  ARG B HD2  4  
ATOM 6997  H HD3  . ARG B 2 42  ? 16.437  4.102   -7.489  1.00 0.00 ? 40  ARG B HD3  4  
ATOM 6998  H HE   . ARG B 2 42  ? 16.174  6.185   -9.523  1.00 0.00 ? 40  ARG B HE   4  
ATOM 6999  H HH11 . ARG B 2 42  ? 18.243  3.776   -8.026  1.00 0.00 ? 40  ARG B HH11 4  
ATOM 7000  H HH12 . ARG B 2 42  ? 19.269  3.613   -9.410  1.00 0.00 ? 40  ARG B HH12 4  
ATOM 7001  H HH21 . ARG B 2 42  ? 17.483  5.962   -11.349 1.00 0.00 ? 40  ARG B HH21 4  
ATOM 7002  H HH22 . ARG B 2 42  ? 18.841  4.868   -11.313 1.00 0.00 ? 40  ARG B HH22 4  
ATOM 7003  N N    . PHE B 2 43  ? 10.847  4.080   -7.727  1.00 0.00 ? 41  PHE B N    4  
ATOM 7004  C CA   . PHE B 2 43  ? 9.863   3.993   -6.658  1.00 0.00 ? 41  PHE B CA   4  
ATOM 7005  C C    . PHE B 2 43  ? 10.529  3.498   -5.383  1.00 0.00 ? 41  PHE B C    4  
ATOM 7006  O O    . PHE B 2 43  ? 11.120  2.419   -5.367  1.00 0.00 ? 41  PHE B O    4  
ATOM 7007  C CB   . PHE B 2 43  ? 8.726   3.037   -7.040  1.00 0.00 ? 41  PHE B CB   4  
ATOM 7008  C CG   . PHE B 2 43  ? 8.116   3.309   -8.386  1.00 0.00 ? 41  PHE B CG   4  
ATOM 7009  C CD1  . PHE B 2 43  ? 7.110   4.249   -8.529  1.00 0.00 ? 41  PHE B CD1  4  
ATOM 7010  C CD2  . PHE B 2 43  ? 8.546   2.617   -9.508  1.00 0.00 ? 41  PHE B CD2  4  
ATOM 7011  C CE1  . PHE B 2 43  ? 6.544   4.495   -9.765  1.00 0.00 ? 41  PHE B CE1  4  
ATOM 7012  C CE2  . PHE B 2 43  ? 7.984   2.860   -10.746 1.00 0.00 ? 41  PHE B CE2  4  
ATOM 7013  C CZ   . PHE B 2 43  ? 6.981   3.801   -10.875 1.00 0.00 ? 41  PHE B CZ   4  
ATOM 7014  H H    . PHE B 2 43  ? 10.932  3.335   -8.355  1.00 0.00 ? 41  PHE B H    4  
ATOM 7015  H HA   . PHE B 2 43  ? 9.459   4.980   -6.489  1.00 0.00 ? 41  PHE B HA   4  
ATOM 7016  H HB2  . PHE B 2 43  ? 9.106   2.027   -7.049  1.00 0.00 ? 41  PHE B HB2  4  
ATOM 7017  H HB3  . PHE B 2 43  ? 7.943   3.111   -6.299  1.00 0.00 ? 41  PHE B HB3  4  
ATOM 7018  H HD1  . PHE B 2 43  ? 6.768   4.794   -7.662  1.00 0.00 ? 41  PHE B HD1  4  
ATOM 7019  H HD2  . PHE B 2 43  ? 9.330   1.880   -9.408  1.00 0.00 ? 41  PHE B HD2  4  
ATOM 7020  H HE1  . PHE B 2 43  ? 5.759   5.232   -9.862  1.00 0.00 ? 41  PHE B HE1  4  
ATOM 7021  H HE2  . PHE B 2 43  ? 8.328   2.315   -11.613 1.00 0.00 ? 41  PHE B HE2  4  
ATOM 7022  H HZ   . PHE B 2 43  ? 6.540   3.992   -11.843 1.00 0.00 ? 41  PHE B HZ   4  
ATOM 7023  N N    . THR B 2 44  ? 10.445  4.285   -4.324  1.00 0.00 ? 42  THR B N    4  
ATOM 7024  C CA   . THR B 2 44  ? 11.039  3.909   -3.052  1.00 0.00 ? 42  THR B CA   4  
ATOM 7025  C C    . THR B 2 44  ? 10.095  3.003   -2.272  1.00 0.00 ? 42  THR B C    4  
ATOM 7026  O O    . THR B 2 44  ? 10.510  2.266   -1.380  1.00 0.00 ? 42  THR B O    4  
ATOM 7027  C CB   . THR B 2 44  ? 11.371  5.153   -2.215  1.00 0.00 ? 42  THR B CB   4  
ATOM 7028  O OG1  . THR B 2 44  ? 10.383  6.165   -2.449  1.00 0.00 ? 42  THR B OG1  4  
ATOM 7029  C CG2  . THR B 2 44  ? 12.751  5.692   -2.567  1.00 0.00 ? 42  THR B CG2  4  
ATOM 7030  H H    . THR B 2 44  ? 9.972   5.142   -4.395  1.00 0.00 ? 42  THR B H    4  
ATOM 7031  H HA   . THR B 2 44  ? 11.956  3.374   -3.253  1.00 0.00 ? 42  THR B HA   4  
ATOM 7032  H HB   . THR B 2 44  ? 11.360  4.881   -1.170  1.00 0.00 ? 42  THR B HB   4  
ATOM 7033  H HG1  . THR B 2 44  ? 9.920   6.355   -1.626  1.00 0.00 ? 42  THR B HG1  4  
ATOM 7034  H HG21 . THR B 2 44  ? 13.506  5.014   -2.199  1.00 0.00 ? 42  THR B HG21 4  
ATOM 7035  H HG22 . THR B 2 44  ? 12.885  6.662   -2.111  1.00 0.00 ? 42  THR B HG22 4  
ATOM 7036  H HG23 . THR B 2 44  ? 12.839  5.783   -3.639  1.00 0.00 ? 42  THR B HG23 4  
ATOM 7037  N N    . ILE B 2 45  ? 8.818   3.069   -2.622  1.00 0.00 ? 43  ILE B N    4  
ATOM 7038  C CA   . ILE B 2 45  ? 7.804   2.261   -1.971  1.00 0.00 ? 43  ILE B CA   4  
ATOM 7039  C C    . ILE B 2 45  ? 7.352   1.133   -2.885  1.00 0.00 ? 43  ILE B C    4  
ATOM 7040  O O    . ILE B 2 45  ? 6.947   1.368   -4.026  1.00 0.00 ? 43  ILE B O    4  
ATOM 7041  C CB   . ILE B 2 45  ? 6.587   3.121   -1.553  1.00 0.00 ? 43  ILE B CB   4  
ATOM 7042  C CG1  . ILE B 2 45  ? 6.927   3.947   -0.311  1.00 0.00 ? 43  ILE B CG1  4  
ATOM 7043  C CG2  . ILE B 2 45  ? 5.360   2.256   -1.301  1.00 0.00 ? 43  ILE B CG2  4  
ATOM 7044  C CD1  . ILE B 2 45  ? 7.416   3.120   0.859   1.00 0.00 ? 43  ILE B CD1  4  
ATOM 7045  H H    . ILE B 2 45  ? 8.552   3.680   -3.343  1.00 0.00 ? 43  ILE B H    4  
ATOM 7046  H HA   . ILE B 2 45  ? 8.241   1.835   -1.079  1.00 0.00 ? 43  ILE B HA   4  
ATOM 7047  H HB   . ILE B 2 45  ? 6.357   3.792   -2.367  1.00 0.00 ? 43  ILE B HB   4  
ATOM 7048  H HG12 . ILE B 2 45  ? 7.703   4.656   -0.560  1.00 0.00 ? 43  ILE B HG12 4  
ATOM 7049  H HG13 . ILE B 2 45  ? 6.045   4.483   0.008   1.00 0.00 ? 43  ILE B HG13 4  
ATOM 7050  H HG21 . ILE B 2 45  ? 5.572   1.549   -0.512  1.00 0.00 ? 43  ILE B HG21 4  
ATOM 7051  H HG22 . ILE B 2 45  ? 5.105   1.720   -2.204  1.00 0.00 ? 43  ILE B HG22 4  
ATOM 7052  H HG23 . ILE B 2 45  ? 4.530   2.883   -1.010  1.00 0.00 ? 43  ILE B HG23 4  
ATOM 7053  H HD11 . ILE B 2 45  ? 7.597   3.765   1.707   1.00 0.00 ? 43  ILE B HD11 4  
ATOM 7054  H HD12 . ILE B 2 45  ? 8.333   2.618   0.587   1.00 0.00 ? 43  ILE B HD12 4  
ATOM 7055  H HD13 . ILE B 2 45  ? 6.668   2.385   1.120   1.00 0.00 ? 43  ILE B HD13 4  
ATOM 7056  N N    . SER B 2 46  ? 7.454   -0.087  -2.388  1.00 0.00 ? 44  SER B N    4  
ATOM 7057  C CA   . SER B 2 46  ? 7.047   -1.258  -3.139  1.00 0.00 ? 44  SER B CA   4  
ATOM 7058  C C    . SER B 2 46  ? 6.521   -2.323  -2.189  1.00 0.00 ? 44  SER B C    4  
ATOM 7059  O O    . SER B 2 46  ? 7.295   -3.018  -1.532  1.00 0.00 ? 44  SER B O    4  
ATOM 7060  C CB   . SER B 2 46  ? 8.223   -1.803  -3.956  1.00 0.00 ? 44  SER B CB   4  
ATOM 7061  O OG   . SER B 2 46  ? 7.836   -2.936  -4.719  1.00 0.00 ? 44  SER B OG   4  
ATOM 7062  H H    . SER B 2 46  ? 7.815   -0.206  -1.484  1.00 0.00 ? 44  SER B H    4  
ATOM 7063  H HA   . SER B 2 46  ? 6.253   -0.965  -3.809  1.00 0.00 ? 44  SER B HA   4  
ATOM 7064  H HB2  . SER B 2 46  ? 8.576   -1.037  -4.630  1.00 0.00 ? 44  SER B HB2  4  
ATOM 7065  H HB3  . SER B 2 46  ? 9.020   -2.090  -3.287  1.00 0.00 ? 44  SER B HB3  4  
ATOM 7066  H HG   . SER B 2 46  ? 7.980   -3.734  -4.195  1.00 0.00 ? 44  SER B HG   4  
ATOM 7067  N N    . HIS B 2 47  ? 5.205   -2.438  -2.108  1.00 0.00 ? 45  HIS B N    4  
ATOM 7068  C CA   . HIS B 2 47  ? 4.581   -3.426  -1.239  1.00 0.00 ? 45  HIS B CA   4  
ATOM 7069  C C    . HIS B 2 47  ? 3.549   -4.212  -2.019  1.00 0.00 ? 45  HIS B C    4  
ATOM 7070  O O    . HIS B 2 47  ? 2.815   -3.646  -2.830  1.00 0.00 ? 45  HIS B O    4  
ATOM 7071  C CB   . HIS B 2 47  ? 3.907   -2.762  -0.033  1.00 0.00 ? 45  HIS B CB   4  
ATOM 7072  C CG   . HIS B 2 47  ? 4.788   -1.812  0.715   1.00 0.00 ? 45  HIS B CG   4  
ATOM 7073  N ND1  . HIS B 2 47  ? 5.703   -2.196  1.669   1.00 0.00 ? 45  HIS B ND1  4  
ATOM 7074  C CD2  . HIS B 2 47  ? 4.892   -0.465  0.616   1.00 0.00 ? 45  HIS B CD2  4  
ATOM 7075  C CE1  . HIS B 2 47  ? 6.325   -1.095  2.108   1.00 0.00 ? 45  HIS B CE1  4  
ATOM 7076  N NE2  . HIS B 2 47  ? 5.870   -0.017  1.497   1.00 0.00 ? 45  HIS B NE2  4  
ATOM 7077  H H    . HIS B 2 47  ? 4.634   -1.843  -2.644  1.00 0.00 ? 45  HIS B H    4  
ATOM 7078  H HA   . HIS B 2 47  ? 5.350   -4.101  -0.892  1.00 0.00 ? 45  HIS B HA   4  
ATOM 7079  H HB2  . HIS B 2 47  ? 3.043   -2.211  -0.373  1.00 0.00 ? 45  HIS B HB2  4  
ATOM 7080  H HB3  . HIS B 2 47  ? 3.585   -3.529  0.656   1.00 0.00 ? 45  HIS B HB3  4  
ATOM 7081  H HD1  . HIS B 2 47  ? 5.865   -3.111  1.981   1.00 0.00 ? 45  HIS B HD1  4  
ATOM 7082  H HD2  . HIS B 2 47  ? 4.304   0.171   -0.035  1.00 0.00 ? 45  HIS B HD2  4  
ATOM 7083  H HE1  . HIS B 2 47  ? 7.097   -1.088  2.862   1.00 0.00 ? 45  HIS B HE1  4  
ATOM 7084  N N    . MET B 2 48  ? 3.497   -5.509  -1.792  1.00 0.00 ? 46  MET B N    4  
ATOM 7085  C CA   . MET B 2 48  ? 2.534   -6.347  -2.474  1.00 0.00 ? 46  MET B CA   4  
ATOM 7086  C C    . MET B 2 48  ? 1.288   -6.455  -1.618  1.00 0.00 ? 46  MET B C    4  
ATOM 7087  O O    . MET B 2 48  ? 1.380   -6.509  -0.395  1.00 0.00 ? 46  MET B O    4  
ATOM 7088  C CB   . MET B 2 48  ? 3.107   -7.745  -2.738  1.00 0.00 ? 46  MET B CB   4  
ATOM 7089  C CG   . MET B 2 48  ? 4.430   -7.743  -3.488  1.00 0.00 ? 46  MET B CG   4  
ATOM 7090  S SD   . MET B 2 48  ? 4.259   -7.245  -5.216  1.00 0.00 ? 46  MET B SD   4  
ATOM 7091  C CE   . MET B 2 48  ? 3.233   -8.571  -5.852  1.00 0.00 ? 46  MET B CE   4  
ATOM 7092  H H    . MET B 2 48  ? 4.106   -5.915  -1.132  1.00 0.00 ? 46  MET B H    4  
ATOM 7093  H HA   . MET B 2 48  ? 2.281   -5.878  -3.413  1.00 0.00 ? 46  MET B HA   4  
ATOM 7094  H HB2  . MET B 2 48  ? 3.257   -8.243  -1.792  1.00 0.00 ? 46  MET B HB2  4  
ATOM 7095  H HB3  . MET B 2 48  ? 2.390   -8.308  -3.319  1.00 0.00 ? 46  MET B HB3  4  
ATOM 7096  H HG2  . MET B 2 48  ? 5.105   -7.058  -2.998  1.00 0.00 ? 46  MET B HG2  4  
ATOM 7097  H HG3  . MET B 2 48  ? 4.847   -8.740  -3.456  1.00 0.00 ? 46  MET B HG3  4  
ATOM 7098  H HE1  . MET B 2 48  ? 3.041   -8.405  -6.902  1.00 0.00 ? 46  MET B HE1  4  
ATOM 7099  H HE2  . MET B 2 48  ? 2.296   -8.592  -5.315  1.00 0.00 ? 46  MET B HE2  4  
ATOM 7100  H HE3  . MET B 2 48  ? 3.743   -9.514  -5.724  1.00 0.00 ? 46  MET B HE3  4  
ATOM 7101  N N    . TYR B 2 49  ? 0.125   -6.474  -2.253  1.00 0.00 ? 47  TYR B N    4  
ATOM 7102  C CA   . TYR B 2 49  ? -1.145  -6.595  -1.530  1.00 0.00 ? 47  TYR B CA   4  
ATOM 7103  C C    . TYR B 2 49  ? -1.160  -7.889  -0.725  1.00 0.00 ? 47  TYR B C    4  
ATOM 7104  O O    . TYR B 2 49  ? -1.881  -8.018  0.259   1.00 0.00 ? 47  TYR B O    4  
ATOM 7105  C CB   . TYR B 2 49  ? -2.304  -6.579  -2.525  1.00 0.00 ? 47  TYR B CB   4  
ATOM 7106  C CG   . TYR B 2 49  ? -2.356  -5.315  -3.347  1.00 0.00 ? 47  TYR B CG   4  
ATOM 7107  C CD1  . TYR B 2 49  ? -2.025  -4.090  -2.785  1.00 0.00 ? 47  TYR B CD1  4  
ATOM 7108  C CD2  . TYR B 2 49  ? -2.727  -5.346  -4.679  1.00 0.00 ? 47  TYR B CD2  4  
ATOM 7109  C CE1  . TYR B 2 49  ? -2.061  -2.931  -3.530  1.00 0.00 ? 47  TYR B CE1  4  
ATOM 7110  C CE2  . TYR B 2 49  ? -2.765  -4.190  -5.431  1.00 0.00 ? 47  TYR B CE2  4  
ATOM 7111  C CZ   . TYR B 2 49  ? -2.432  -2.986  -4.850  1.00 0.00 ? 47  TYR B CZ   4  
ATOM 7112  O OH   . TYR B 2 49  ? -2.465  -1.832  -5.596  1.00 0.00 ? 47  TYR B OH   4  
ATOM 7113  H H    . TYR B 2 49  ? 0.116   -6.411  -3.238  1.00 0.00 ? 47  TYR B H    4  
ATOM 7114  H HA   . TYR B 2 49  ? -1.252  -5.746  -0.844  1.00 0.00 ? 47  TYR B HA   4  
ATOM 7115  H HB2  . TYR B 2 49  ? -2.204  -7.414  -3.202  1.00 0.00 ? 47  TYR B HB2  4  
ATOM 7116  H HB3  . TYR B 2 49  ? -3.236  -6.665  -1.986  1.00 0.00 ? 47  TYR B HB3  4  
ATOM 7117  H HD1  . TYR B 2 49  ? -1.733  -4.050  -1.746  1.00 0.00 ? 47  TYR B HD1  4  
ATOM 7118  H HD2  . TYR B 2 49  ? -2.988  -6.292  -5.132  1.00 0.00 ? 47  TYR B HD2  4  
ATOM 7119  H HE1  . TYR B 2 49  ? -1.799  -1.988  -3.075  1.00 0.00 ? 47  TYR B HE1  4  
ATOM 7120  H HE2  . TYR B 2 49  ? -3.058  -4.232  -6.470  1.00 0.00 ? 47  TYR B HE2  4  
ATOM 7121  H HH   . TYR B 2 49  ? -2.432  -2.061  -6.536  1.00 0.00 ? 47  TYR B HH   4  
ATOM 7122  N N    . ALA B 2 50  ? -0.314  -8.821  -1.141  1.00 0.00 ? 48  ALA B N    4  
ATOM 7123  C CA   . ALA B 2 50  ? -0.197  -10.116 -0.497  1.00 0.00 ? 48  ALA B CA   4  
ATOM 7124  C C    . ALA B 2 50  ? 0.405   -10.012 0.900   1.00 0.00 ? 48  ALA B C    4  
ATOM 7125  O O    . ALA B 2 50  ? 0.193   -10.899 1.726   1.00 0.00 ? 48  ALA B O    4  
ATOM 7126  C CB   . ALA B 2 50  ? 0.640   -11.040 -1.363  1.00 0.00 ? 48  ALA B CB   4  
ATOM 7127  H H    . ALA B 2 50  ? 0.260   -8.626  -1.907  1.00 0.00 ? 48  ALA B H    4  
ATOM 7128  H HA   . ALA B 2 50  ? -1.189  -10.539 -0.421  1.00 0.00 ? 48  ALA B HA   4  
ATOM 7129  H HB1  . ALA B 2 50  ? 0.208   -11.093 -2.354  1.00 0.00 ? 48  ALA B HB1  4  
ATOM 7130  H HB2  . ALA B 2 50  ? 0.655   -12.028 -0.925  1.00 0.00 ? 48  ALA B HB2  4  
ATOM 7131  H HB3  . ALA B 2 50  ? 1.647   -10.658 -1.430  1.00 0.00 ? 48  ALA B HB3  4  
ATOM 7132  N N    . ASP B 2 51  ? 1.145   -8.933  1.157   1.00 0.00 ? 49  ASP B N    4  
ATOM 7133  C CA   . ASP B 2 51  ? 1.788   -8.715  2.446   1.00 0.00 ? 49  ASP B CA   4  
ATOM 7134  C C    . ASP B 2 51  ? 1.013   -7.701  3.270   1.00 0.00 ? 49  ASP B C    4  
ATOM 7135  O O    . ASP B 2 51  ? 1.278   -7.514  4.463   1.00 0.00 ? 49  ASP B O    4  
ATOM 7136  C CB   . ASP B 2 51  ? 3.200   -8.176  2.282   1.00 0.00 ? 49  ASP B CB   4  
ATOM 7137  C CG   . ASP B 2 51  ? 3.889   -8.605  0.998   1.00 0.00 ? 49  ASP B CG   4  
ATOM 7138  O OD1  . ASP B 2 51  ? 4.100   -9.819  0.800   1.00 0.00 ? 49  ASP B OD1  4  
ATOM 7139  O OD2  . ASP B 2 51  ? 4.227   -7.712  0.184   1.00 0.00 ? 49  ASP B OD2  4  
ATOM 7140  H H    . ASP B 2 51  ? 1.272   -8.269  0.461   1.00 0.00 ? 49  ASP B H    4  
ATOM 7141  H HA   . ASP B 2 51  ? 1.823   -9.657  2.979   1.00 0.00 ? 49  ASP B HA   4  
ATOM 7142  H HB2  . ASP B 2 51  ? 3.149   -7.104  2.299   1.00 0.00 ? 49  ASP B HB2  4  
ATOM 7143  H HB3  . ASP B 2 51  ? 3.789   -8.515  3.118   1.00 0.00 ? 49  ASP B HB3  4  
ATOM 7144  N N    . ILE B 2 52  ? 0.062   -7.033  2.645   1.00 0.00 ? 50  ILE B N    4  
ATOM 7145  C CA   . ILE B 2 52  ? -0.736  -6.049  3.351   1.00 0.00 ? 50  ILE B CA   4  
ATOM 7146  C C    . ILE B 2 52  ? -1.901  -6.771  4.011   1.00 0.00 ? 50  ILE B C    4  
ATOM 7147  O O    . ILE B 2 52  ? -2.559  -7.589  3.373   1.00 0.00 ? 50  ILE B O    4  
ATOM 7148  C CB   . ILE B 2 52  ? -1.301  -4.952  2.419   1.00 0.00 ? 50  ILE B CB   4  
ATOM 7149  C CG1  . ILE B 2 52  ? -0.374  -4.689  1.223   1.00 0.00 ? 50  ILE B CG1  4  
ATOM 7150  C CG2  . ILE B 2 52  ? -1.549  -3.671  3.199   1.00 0.00 ? 50  ILE B CG2  4  
ATOM 7151  C CD1  . ILE B 2 52  ? 0.791   -3.767  1.512   1.00 0.00 ? 50  ILE B CD1  4  
ATOM 7152  H H    . ILE B 2 52  ? -0.134  -7.236  1.704   1.00 0.00 ? 50  ILE B H    4  
ATOM 7153  H HA   . ILE B 2 52  ? -0.108  -5.584  4.111   1.00 0.00 ? 50  ILE B HA   4  
ATOM 7154  H HB   . ILE B 2 52  ? -2.255  -5.297  2.049   1.00 0.00 ? 50  ILE B HB   4  
ATOM 7155  H HG12 . ILE B 2 52  ? 0.033   -5.628  0.882   1.00 0.00 ? 50  ILE B HG12 4  
ATOM 7156  H HG13 . ILE B 2 52  ? -0.954  -4.247  0.424   1.00 0.00 ? 50  ILE B HG13 4  
ATOM 7157  H HG21 . ILE B 2 52  ? -2.233  -3.871  4.011   1.00 0.00 ? 50  ILE B HG21 4  
ATOM 7158  H HG22 . ILE B 2 52  ? -1.978  -2.929  2.541   1.00 0.00 ? 50  ILE B HG22 4  
ATOM 7159  H HG23 . ILE B 2 52  ? -0.614  -3.305  3.596   1.00 0.00 ? 50  ILE B HG23 4  
ATOM 7160  H HD11 . ILE B 2 52  ? 1.410   -4.200  2.284   1.00 0.00 ? 50  ILE B HD11 4  
ATOM 7161  H HD12 . ILE B 2 52  ? 0.419   -2.809  1.844   1.00 0.00 ? 50  ILE B HD12 4  
ATOM 7162  H HD13 . ILE B 2 52  ? 1.376   -3.634  0.613   1.00 0.00 ? 50  ILE B HD13 4  
ATOM 7163  N N    . LYS B 2 53  ? -2.153  -6.498  5.278   1.00 0.00 ? 51  LYS B N    4  
ATOM 7164  C CA   . LYS B 2 53  ? -3.245  -7.159  5.971   1.00 0.00 ? 51  LYS B CA   4  
ATOM 7165  C C    . LYS B 2 53  ? -4.505  -6.318  5.874   1.00 0.00 ? 51  LYS B C    4  
ATOM 7166  O O    . LYS B 2 53  ? -5.539  -6.763  5.387   1.00 0.00 ? 51  LYS B O    4  
ATOM 7167  C CB   . LYS B 2 53  ? -2.906  -7.386  7.444   1.00 0.00 ? 51  LYS B CB   4  
ATOM 7168  C CG   . LYS B 2 53  ? -4.062  -7.979  8.231   1.00 0.00 ? 51  LYS B CG   4  
ATOM 7169  C CD   . LYS B 2 53  ? -3.901  -7.766  9.724   1.00 0.00 ? 51  LYS B CD   4  
ATOM 7170  C CE   . LYS B 2 53  ? -5.249  -7.528  10.396  1.00 0.00 ? 51  LYS B CE   4  
ATOM 7171  N NZ   . LYS B 2 53  ? -5.356  -8.231  11.702  1.00 0.00 ? 51  LYS B NZ   4  
ATOM 7172  H H    . LYS B 2 53  ? -1.626  -5.817  5.747   1.00 0.00 ? 51  LYS B H    4  
ATOM 7173  H HA   . LYS B 2 53  ? -3.409  -8.115  5.499   1.00 0.00 ? 51  LYS B HA   4  
ATOM 7174  H HB2  . LYS B 2 53  ? -2.065  -8.060  7.511   1.00 0.00 ? 51  LYS B HB2  4  
ATOM 7175  H HB3  . LYS B 2 53  ? -2.638  -6.441  7.893   1.00 0.00 ? 51  LYS B HB3  4  
ATOM 7176  H HG2  . LYS B 2 53  ? -4.980  -7.508  7.912   1.00 0.00 ? 51  LYS B HG2  4  
ATOM 7177  H HG3  . LYS B 2 53  ? -4.113  -9.039  8.031   1.00 0.00 ? 51  LYS B HG3  4  
ATOM 7178  H HD2  . LYS B 2 53  ? -3.442  -8.645  10.153  1.00 0.00 ? 51  LYS B HD2  4  
ATOM 7179  H HD3  . LYS B 2 53  ? -3.267  -6.908  9.888   1.00 0.00 ? 51  LYS B HD3  4  
ATOM 7180  H HE2  . LYS B 2 53  ? -5.374  -6.468  10.556  1.00 0.00 ? 51  LYS B HE2  4  
ATOM 7181  H HE3  . LYS B 2 53  ? -6.029  -7.886  9.739   1.00 0.00 ? 51  LYS B HE3  4  
ATOM 7182  H HZ1  . LYS B 2 53  ? -5.296  -9.266  11.555  1.00 0.00 ? 51  LYS B HZ1  4  
ATOM 7183  H HZ2  . LYS B 2 53  ? -6.270  -8.006  12.164  1.00 0.00 ? 51  LYS B HZ2  4  
ATOM 7184  H HZ3  . LYS B 2 53  ? -4.588  -7.936  12.331  1.00 0.00 ? 51  LYS B HZ3  4  
ATOM 7185  N N    . CYS B 2 54  ? -4.374  -5.082  6.310   1.00 0.00 ? 52  CYS B N    4  
ATOM 7186  C CA   . CYS B 2 54  ? -5.464  -4.144  6.335   1.00 0.00 ? 52  CYS B CA   4  
ATOM 7187  C C    . CYS B 2 54  ? -4.927  -2.765  6.022   1.00 0.00 ? 52  CYS B C    4  
ATOM 7188  O O    . CYS B 2 54  ? -3.738  -2.603  5.739   1.00 0.00 ? 52  CYS B O    4  
ATOM 7189  C CB   . CYS B 2 54  ? -6.135  -4.160  7.708   1.00 0.00 ? 52  CYS B CB   4  
ATOM 7190  S SG   . CYS B 2 54  ? -4.980  -4.272  9.095   1.00 0.00 ? 52  CYS B SG   4  
ATOM 7191  H H    . CYS B 2 54  ? -3.493  -4.772  6.603   1.00 0.00 ? 52  CYS B H    4  
ATOM 7192  H HA   . CYS B 2 54  ? -6.180  -4.431  5.580   1.00 0.00 ? 52  CYS B HA   4  
ATOM 7193  H HB2  . CYS B 2 54  ? -6.701  -3.252  7.830   1.00 0.00 ? 52  CYS B HB2  4  
ATOM 7194  H HB3  . CYS B 2 54  ? -6.802  -5.007  7.764   1.00 0.00 ? 52  CYS B HB3  4  
ATOM 7195  H HG   . CYS B 2 54  ? -5.293  -3.310  9.965   1.00 0.00 ? 52  CYS B HG   4  
ATOM 7196  N N    . GLN B 2 55  ? -5.782  -1.773  6.053   1.00 0.00 ? 53  GLN B N    4  
ATOM 7197  C CA   . GLN B 2 55  ? -5.355  -0.429  5.760   1.00 0.00 ? 53  GLN B CA   4  
ATOM 7198  C C    . GLN B 2 55  ? -6.064  0.574   6.671   1.00 0.00 ? 53  GLN B C    4  
ATOM 7199  O O    . GLN B 2 55  ? -7.217  0.362   7.045   1.00 0.00 ? 53  GLN B O    4  
ATOM 7200  C CB   . GLN B 2 55  ? -5.661  -0.115  4.304   1.00 0.00 ? 53  GLN B CB   4  
ATOM 7201  C CG   . GLN B 2 55  ? -7.145  0.070   4.030   1.00 0.00 ? 53  GLN B CG   4  
ATOM 7202  C CD   . GLN B 2 55  ? -7.507  -0.156  2.586   1.00 0.00 ? 53  GLN B CD   4  
ATOM 7203  O OE1  . GLN B 2 55  ? -7.415  0.750   1.767   1.00 0.00 ? 53  GLN B OE1  4  
ATOM 7204  N NE2  . GLN B 2 55  ? -7.935  -1.366  2.265   1.00 0.00 ? 53  GLN B NE2  4  
ATOM 7205  H H    . GLN B 2 55  ? -6.722  -1.946  6.286   1.00 0.00 ? 53  GLN B H    4  
ATOM 7206  H HA   . GLN B 2 55  ? -4.286  -0.383  5.905   1.00 0.00 ? 53  GLN B HA   4  
ATOM 7207  H HB2  . GLN B 2 55  ? -5.143  0.792   4.029   1.00 0.00 ? 53  GLN B HB2  4  
ATOM 7208  H HB3  . GLN B 2 55  ? -5.300  -0.935  3.695   1.00 0.00 ? 53  GLN B HB3  4  
ATOM 7209  H HG2  . GLN B 2 55  ? -7.700  -0.628  4.636   1.00 0.00 ? 53  GLN B HG2  4  
ATOM 7210  H HG3  . GLN B 2 55  ? -7.423  1.079   4.302   1.00 0.00 ? 53  GLN B HG3  4  
ATOM 7211  H HE21 . GLN B 2 55  ? -7.992  -2.043  2.976   1.00 0.00 ? 53  GLN B HE21 4  
ATOM 7212  H HE22 . GLN B 2 55  ? -8.182  -1.537  1.333   1.00 0.00 ? 53  GLN B HE22 4  
ATOM 7213  N N    . LYS B 2 56  ? -5.383  1.649   7.049   1.00 0.00 ? 54  LYS B N    4  
ATOM 7214  C CA   . LYS B 2 56  ? -6.013  2.670   7.870   1.00 0.00 ? 54  LYS B CA   4  
ATOM 7215  C C    . LYS B 2 56  ? -6.275  3.890   7.022   1.00 0.00 ? 54  LYS B C    4  
ATOM 7216  O O    . LYS B 2 56  ? -5.511  4.186   6.107   1.00 0.00 ? 54  LYS B O    4  
ATOM 7217  C CB   . LYS B 2 56  ? -5.142  3.149   9.033   1.00 0.00 ? 54  LYS B CB   4  
ATOM 7218  C CG   . LYS B 2 56  ? -4.875  2.171   10.148  1.00 0.00 ? 54  LYS B CG   4  
ATOM 7219  C CD   . LYS B 2 56  ? -4.437  2.940   11.383  1.00 0.00 ? 54  LYS B CD   4  
ATOM 7220  C CE   . LYS B 2 56  ? -4.246  2.057   12.600  1.00 0.00 ? 54  LYS B CE   4  
ATOM 7221  N NZ   . LYS B 2 56  ? -3.249  0.976   12.363  1.00 0.00 ? 54  LYS B NZ   4  
ATOM 7222  H H    . LYS B 2 56  ? -4.450  1.770   6.754   1.00 0.00 ? 54  LYS B H    4  
ATOM 7223  H HA   . LYS B 2 56  ? -6.947  2.284   8.249   1.00 0.00 ? 54  LYS B HA   4  
ATOM 7224  H HB2  . LYS B 2 56  ? -4.190  3.464   8.643   1.00 0.00 ? 54  LYS B HB2  4  
ATOM 7225  H HB3  . LYS B 2 56  ? -5.627  4.008   9.472   1.00 0.00 ? 54  LYS B HB3  4  
ATOM 7226  H HG2  . LYS B 2 56  ? -5.775  1.619   10.364  1.00 0.00 ? 54  LYS B HG2  4  
ATOM 7227  H HG3  . LYS B 2 56  ? -4.085  1.497   9.850   1.00 0.00 ? 54  LYS B HG3  4  
ATOM 7228  H HD2  . LYS B 2 56  ? -3.505  3.439   11.165  1.00 0.00 ? 54  LYS B HD2  4  
ATOM 7229  H HD3  . LYS B 2 56  ? -5.191  3.686   11.605  1.00 0.00 ? 54  LYS B HD3  4  
ATOM 7230  H HE2  . LYS B 2 56  ? -3.907  2.674   13.420  1.00 0.00 ? 54  LYS B HE2  4  
ATOM 7231  H HE3  . LYS B 2 56  ? -5.196  1.614   12.855  1.00 0.00 ? 54  LYS B HE3  4  
ATOM 7232  H HZ1  . LYS B 2 56  ? -2.596  0.910   13.166  1.00 0.00 ? 54  LYS B HZ1  4  
ATOM 7233  H HZ2  . LYS B 2 56  ? -2.704  1.167   11.497  1.00 0.00 ? 54  LYS B HZ2  4  
ATOM 7234  H HZ3  . LYS B 2 56  ? -3.744  0.055   12.258  1.00 0.00 ? 54  LYS B HZ3  4  
ATOM 7235  N N    . ILE B 2 57  ? -7.343  4.593   7.314   1.00 0.00 ? 55  ILE B N    4  
ATOM 7236  C CA   . ILE B 2 57  ? -7.635  5.817   6.612   1.00 0.00 ? 55  ILE B CA   4  
ATOM 7237  C C    . ILE B 2 57  ? -7.840  6.903   7.663   1.00 0.00 ? 55  ILE B C    4  
ATOM 7238  O O    . ILE B 2 57  ? -8.623  6.733   8.601   1.00 0.00 ? 55  ILE B O    4  
ATOM 7239  C CB   . ILE B 2 57  ? -8.848  5.700   5.637   1.00 0.00 ? 55  ILE B CB   4  
ATOM 7240  C CG1  . ILE B 2 57  ? -10.184 6.063   6.288   1.00 0.00 ? 55  ILE B CG1  4  
ATOM 7241  C CG2  . ILE B 2 57  ? -8.932  4.293   5.062   1.00 0.00 ? 55  ILE B CG2  4  
ATOM 7242  C CD1  . ILE B 2 57  ? -11.171 6.653   5.298   1.00 0.00 ? 55  ILE B CD1  4  
ATOM 7243  H H    . ILE B 2 57  ? -7.958  4.276   8.016   1.00 0.00 ? 55  ILE B H    4  
ATOM 7244  H HA   . ILE B 2 57  ? -6.757  6.072   6.031   1.00 0.00 ? 55  ILE B HA   4  
ATOM 7245  H HB   . ILE B 2 57  ? -8.669  6.375   4.814   1.00 0.00 ? 55  ILE B HB   4  
ATOM 7246  H HG12 . ILE B 2 57  ? -10.627 5.175   6.715   1.00 0.00 ? 55  ILE B HG12 4  
ATOM 7247  H HG13 . ILE B 2 57  ? -10.016 6.791   7.068   1.00 0.00 ? 55  ILE B HG13 4  
ATOM 7248  H HG21 . ILE B 2 57  ? -8.027  4.074   4.512   1.00 0.00 ? 55  ILE B HG21 4  
ATOM 7249  H HG22 . ILE B 2 57  ? -9.781  4.225   4.397   1.00 0.00 ? 55  ILE B HG22 4  
ATOM 7250  H HG23 . ILE B 2 57  ? -9.045  3.581   5.865   1.00 0.00 ? 55  ILE B HG23 4  
ATOM 7251  H HD11 . ILE B 2 57  ? -10.749 7.551   4.862   1.00 0.00 ? 55  ILE B HD11 4  
ATOM 7252  H HD12 . ILE B 2 57  ? -12.092 6.897   5.802   1.00 0.00 ? 55  ILE B HD12 4  
ATOM 7253  H HD13 . ILE B 2 57  ? -11.367 5.937   4.513   1.00 0.00 ? 55  ILE B HD13 4  
ATOM 7254  N N    . SER B 2 58  ? -7.070  7.973   7.571   1.00 0.00 ? 56  SER B N    4  
ATOM 7255  C CA   . SER B 2 58  ? -7.179  9.043   8.536   1.00 0.00 ? 56  SER B CA   4  
ATOM 7256  C C    . SER B 2 58  ? -8.221  10.034  8.057   1.00 0.00 ? 56  SER B C    4  
ATOM 7257  O O    . SER B 2 58  ? -8.107  10.605  6.956   1.00 0.00 ? 56  SER B O    4  
ATOM 7258  C CB   . SER B 2 58  ? -5.826  9.716   8.788   1.00 0.00 ? 56  SER B CB   4  
ATOM 7259  O OG   . SER B 2 58  ? -5.608  10.809  7.925   1.00 0.00 ? 56  SER B OG   4  
ATOM 7260  H H    . SER B 2 58  ? -6.432  8.054   6.826   1.00 0.00 ? 56  SER B H    4  
ATOM 7261  H HA   . SER B 2 58  ? -7.528  8.604   9.460   1.00 0.00 ? 56  SER B HA   4  
ATOM 7262  H HB2  . SER B 2 58  ? -5.787  10.065  9.801   1.00 0.00 ? 56  SER B HB2  4  
ATOM 7263  H HB3  . SER B 2 58  ? -5.039  8.993   8.632   1.00 0.00 ? 56  SER B HB3  4  
ATOM 7264  H HG   . SER B 2 58  ? -6.061  11.587  8.274   1.00 0.00 ? 56  SER B HG   4  
ATOM 7265  N N    . PRO B 2 59  ? -9.254  10.206  8.889   1.00 0.00 ? 57  PRO B N    4  
ATOM 7266  C CA   . PRO B 2 59  ? -10.396 11.081  8.620   1.00 0.00 ? 57  PRO B CA   4  
ATOM 7267  C C    . PRO B 2 59  ? -10.059 12.562  8.649   1.00 0.00 ? 57  PRO B C    4  
ATOM 7268  O O    . PRO B 2 59  ? -8.946  12.969  8.993   1.00 0.00 ? 57  PRO B O    4  
ATOM 7269  C CB   . PRO B 2 59  ? -11.360 10.752  9.765   1.00 0.00 ? 57  PRO B CB   4  
ATOM 7270  C CG   . PRO B 2 59  ? -10.471 10.316  10.872  1.00 0.00 ? 57  PRO B CG   4  
ATOM 7271  C CD   . PRO B 2 59  ? -9.370  9.554   10.205  1.00 0.00 ? 57  PRO B CD   4  
ATOM 7272  H HA   . PRO B 2 59  ? -10.866 10.838  7.679   1.00 0.00 ? 57  PRO B HA   4  
ATOM 7273  H HB2  . PRO B 2 59  ? -11.925 11.634  10.031  1.00 0.00 ? 57  PRO B HB2  4  
ATOM 7274  H HB3  . PRO B 2 59  ? -12.031 9.963   9.462   1.00 0.00 ? 57  PRO B HB3  4  
ATOM 7275  H HG2  . PRO B 2 59  ? -10.070 11.176  11.391  1.00 0.00 ? 57  PRO B HG2  4  
ATOM 7276  H HG3  . PRO B 2 59  ? -11.008 9.676   11.556  1.00 0.00 ? 57  PRO B HG3  4  
ATOM 7277  H HD2  . PRO B 2 59  ? -8.451  9.649   10.765  1.00 0.00 ? 57  PRO B HD2  4  
ATOM 7278  H HD3  . PRO B 2 59  ? -9.643  8.514   10.096  1.00 0.00 ? 57  PRO B HD3  4  
ATOM 7279  N N    . GLU B 2 60  ? -11.045 13.349  8.259   1.00 0.00 ? 58  GLU B N    4  
ATOM 7280  C CA   . GLU B 2 60  ? -10.940 14.792  8.237   1.00 0.00 ? 58  GLU B CA   4  
ATOM 7281  C C    . GLU B 2 60  ? -10.713 15.326  9.650   1.00 0.00 ? 58  GLU B C    4  
ATOM 7282  O O    . GLU B 2 60  ? -10.996 14.650  10.640  1.00 0.00 ? 58  GLU B O    4  
ATOM 7283  C CB   . GLU B 2 60  ? -12.199 15.403  7.611   1.00 0.00 ? 58  GLU B CB   4  
ATOM 7284  C CG   . GLU B 2 60  ? -12.289 15.215  6.097   1.00 0.00 ? 58  GLU B CG   4  
ATOM 7285  C CD   . GLU B 2 60  ? -12.142 13.764  5.665   1.00 0.00 ? 58  GLU B CD   4  
ATOM 7286  O OE1  . GLU B 2 60  ? -11.245 13.469  4.846   1.00 0.00 ? 58  GLU B OE1  4  
ATOM 7287  O OE2  . GLU B 2 60  ? -12.904 12.913  6.169   1.00 0.00 ? 58  GLU B OE2  4  
ATOM 7288  H H    . GLU B 2 60  ? -11.882 12.936  7.951   1.00 0.00 ? 58  GLU B H    4  
ATOM 7289  H HA   . GLU B 2 60  ? -10.087 15.049  7.628   1.00 0.00 ? 58  GLU B HA   4  
ATOM 7290  H HB2  . GLU B 2 60  ? -13.068 14.946  8.060   1.00 0.00 ? 58  GLU B HB2  4  
ATOM 7291  H HB3  . GLU B 2 60  ? -12.213 16.462  7.821   1.00 0.00 ? 58  GLU B HB3  4  
ATOM 7292  H HG2  . GLU B 2 60  ? -13.249 15.575  5.760   1.00 0.00 ? 58  GLU B HG2  4  
ATOM 7293  H HG3  . GLU B 2 60  ? -11.506 15.793  5.630   1.00 0.00 ? 58  GLU B HG3  4  
ATOM 7294  N N    . GLY B 2 61  ? -10.226 16.548  9.731   1.00 0.00 ? 59  GLY B N    4  
ATOM 7295  C CA   . GLY B 2 61  ? -9.914  17.153  11.010  1.00 0.00 ? 59  GLY B CA   4  
ATOM 7296  C C    . GLY B 2 61  ? -8.428  17.390  11.114  1.00 0.00 ? 59  GLY B C    4  
ATOM 7297  O O    . GLY B 2 61  ? -7.978  18.315  11.787  1.00 0.00 ? 59  GLY B O    4  
ATOM 7298  H H    . GLY B 2 61  ? -10.062 17.051  8.906   1.00 0.00 ? 59  GLY B H    4  
ATOM 7299  H HA2  . GLY B 2 61  ? -10.437 18.095  11.098  1.00 0.00 ? 59  GLY B HA2  4  
ATOM 7300  H HA3  . GLY B 2 61  ? -10.224 16.493  11.805  1.00 0.00 ? 59  GLY B HA3  4  
ATOM 7301  N N    . LYS B 2 62  ? -7.669  16.547  10.429  1.00 0.00 ? 60  LYS B N    4  
ATOM 7302  C CA   . LYS B 2 62  ? -6.230  16.703  10.356  1.00 0.00 ? 60  LYS B CA   4  
ATOM 7303  C C    . LYS B 2 62  ? -5.943  17.668  9.230   1.00 0.00 ? 60  LYS B C    4  
ATOM 7304  O O    . LYS B 2 62  ? -6.799  17.899  8.373   1.00 0.00 ? 60  LYS B O    4  
ATOM 7305  C CB   . LYS B 2 62  ? -5.524  15.364  10.084  1.00 0.00 ? 60  LYS B CB   4  
ATOM 7306  C CG   . LYS B 2 62  ? -5.132  14.593  11.335  1.00 0.00 ? 60  LYS B CG   4  
ATOM 7307  C CD   . LYS B 2 62  ? -4.197  13.428  11.010  1.00 0.00 ? 60  LYS B CD   4  
ATOM 7308  C CE   . LYS B 2 62  ? -3.605  12.795  12.267  1.00 0.00 ? 60  LYS B CE   4  
ATOM 7309  N NZ   . LYS B 2 62  ? -4.218  13.338  13.509  1.00 0.00 ? 60  LYS B NZ   4  
ATOM 7310  H H    . LYS B 2 62  ? -8.092  15.798  9.961   1.00 0.00 ? 60  LYS B H    4  
ATOM 7311  H HA   . LYS B 2 62  ? -5.871  17.130  11.281  1.00 0.00 ? 60  LYS B HA   4  
ATOM 7312  H HB2  . LYS B 2 62  ? -6.181  14.740  9.498   1.00 0.00 ? 60  LYS B HB2  4  
ATOM 7313  H HB3  . LYS B 2 62  ? -4.627  15.558  9.513   1.00 0.00 ? 60  LYS B HB3  4  
ATOM 7314  H HG2  . LYS B 2 62  ? -4.631  15.263  12.018  1.00 0.00 ? 60  LYS B HG2  4  
ATOM 7315  H HG3  . LYS B 2 62  ? -6.027  14.205  11.801  1.00 0.00 ? 60  LYS B HG3  4  
ATOM 7316  H HD2  . LYS B 2 62  ? -4.751  12.674  10.473  1.00 0.00 ? 60  LYS B HD2  4  
ATOM 7317  H HD3  . LYS B 2 62  ? -3.389  13.791  10.391  1.00 0.00 ? 60  LYS B HD3  4  
ATOM 7318  H HE2  . LYS B 2 62  ? -3.767  11.726  12.233  1.00 0.00 ? 60  LYS B HE2  4  
ATOM 7319  H HE3  . LYS B 2 62  ? -2.539  12.989  12.287  1.00 0.00 ? 60  LYS B HE3  4  
ATOM 7320  H HZ1  . LYS B 2 62  ? -5.263  13.308  13.429  1.00 0.00 ? 60  LYS B HZ1  4  
ATOM 7321  H HZ2  . LYS B 2 62  ? -3.914  14.322  13.658  1.00 0.00 ? 60  LYS B HZ2  4  
ATOM 7322  H HZ3  . LYS B 2 62  ? -3.930  12.762  14.334  1.00 0.00 ? 60  LYS B HZ3  4  
ATOM 7323  N N    . ALA B 2 63  ? -4.759  18.239  9.227   1.00 0.00 ? 61  ALA B N    4  
ATOM 7324  C CA   . ALA B 2 63  ? -4.384  19.175  8.184   1.00 0.00 ? 61  ALA B CA   4  
ATOM 7325  C C    . ALA B 2 63  ? -4.246  18.464  6.861   1.00 0.00 ? 61  ALA B C    4  
ATOM 7326  O O    . ALA B 2 63  ? -4.234  19.084  5.800   1.00 0.00 ? 61  ALA B O    4  
ATOM 7327  C CB   . ALA B 2 63  ? -3.089  19.854  8.541   1.00 0.00 ? 61  ALA B CB   4  
ATOM 7328  H H    . ALA B 2 63  ? -4.120  18.032  9.944   1.00 0.00 ? 61  ALA B H    4  
ATOM 7329  H HA   . ALA B 2 63  ? -5.159  19.921  8.097   1.00 0.00 ? 61  ALA B HA   4  
ATOM 7330  H HB1  . ALA B 2 63  ? -3.224  20.424  9.444   1.00 0.00 ? 61  ALA B HB1  4  
ATOM 7331  H HB2  . ALA B 2 63  ? -2.795  20.505  7.734   1.00 0.00 ? 61  ALA B HB2  4  
ATOM 7332  H HB3  . ALA B 2 63  ? -2.330  19.101  8.697   1.00 0.00 ? 61  ALA B HB3  4  
ATOM 7333  N N    . LYS B 2 64  ? -4.139  17.157  6.936   1.00 0.00 ? 62  LYS B N    4  
ATOM 7334  C CA   . LYS B 2 64  ? -4.008  16.356  5.758   1.00 0.00 ? 62  LYS B CA   4  
ATOM 7335  C C    . LYS B 2 64  ? -4.822  15.088  5.889   1.00 0.00 ? 62  LYS B C    4  
ATOM 7336  O O    . LYS B 2 64  ? -5.031  14.580  6.991   1.00 0.00 ? 62  LYS B O    4  
ATOM 7337  C CB   . LYS B 2 64  ? -2.552  15.981  5.503   1.00 0.00 ? 62  LYS B CB   4  
ATOM 7338  C CG   . LYS B 2 64  ? -1.886  15.292  6.675   1.00 0.00 ? 62  LYS B CG   4  
ATOM 7339  C CD   . LYS B 2 64  ? -1.114  16.281  7.518   1.00 0.00 ? 62  LYS B CD   4  
ATOM 7340  C CE   . LYS B 2 64  ? -0.309  15.585  8.593   1.00 0.00 ? 62  LYS B CE   4  
ATOM 7341  N NZ   . LYS B 2 64  ? 0.418   16.568  9.431   1.00 0.00 ? 62  LYS B NZ   4  
ATOM 7342  H H    . LYS B 2 64  ? -4.168  16.720  7.812   1.00 0.00 ? 62  LYS B H    4  
ATOM 7343  H HA   . LYS B 2 64  ? -4.372  16.941  4.933   1.00 0.00 ? 62  LYS B HA   4  
ATOM 7344  H HB2  . LYS B 2 64  ? -2.509  15.314  4.655   1.00 0.00 ? 62  LYS B HB2  4  
ATOM 7345  H HB3  . LYS B 2 64  ? -1.995  16.876  5.277   1.00 0.00 ? 62  LYS B HB3  4  
ATOM 7346  H HG2  . LYS B 2 64  ? -2.644  14.826  7.287   1.00 0.00 ? 62  LYS B HG2  4  
ATOM 7347  H HG3  . LYS B 2 64  ? -1.206  14.539  6.302   1.00 0.00 ? 62  LYS B HG3  4  
ATOM 7348  H HD2  . LYS B 2 64  ? -0.440  16.833  6.880   1.00 0.00 ? 62  LYS B HD2  4  
ATOM 7349  H HD3  . LYS B 2 64  ? -1.810  16.961  7.986   1.00 0.00 ? 62  LYS B HD3  4  
ATOM 7350  H HE2  . LYS B 2 64  ? -0.981  15.012  9.220   1.00 0.00 ? 62  LYS B HE2  4  
ATOM 7351  H HE3  . LYS B 2 64  ? 0.402   14.918  8.128   1.00 0.00 ? 62  LYS B HE3  4  
ATOM 7352  H HZ1  . LYS B 2 64  ? 0.986   16.074  10.144  1.00 0.00 ? 62  LYS B HZ1  4  
ATOM 7353  H HZ2  . LYS B 2 64  ? -0.260  17.193  9.919   1.00 0.00 ? 62  LYS B HZ2  4  
ATOM 7354  H HZ3  . LYS B 2 64  ? 1.056   17.151  8.837   1.00 0.00 ? 62  LYS B HZ3  4  
ATOM 7355  N N    . ILE B 2 65  ? -5.280  14.593  4.768   1.00 0.00 ? 63  ILE B N    4  
ATOM 7356  C CA   . ILE B 2 65  ? -6.029  13.360  4.731   1.00 0.00 ? 63  ILE B CA   4  
ATOM 7357  C C    . ILE B 2 65  ? -5.007  12.243  4.566   1.00 0.00 ? 63  ILE B C    4  
ATOM 7358  O O    . ILE B 2 65  ? -4.087  12.381  3.768   1.00 0.00 ? 63  ILE B O    4  
ATOM 7359  C CB   . ILE B 2 65  ? -7.052  13.384  3.577   1.00 0.00 ? 63  ILE B CB   4  
ATOM 7360  C CG1  . ILE B 2 65  ? -8.154  14.407  3.869   1.00 0.00 ? 63  ILE B CG1  4  
ATOM 7361  C CG2  . ILE B 2 65  ? -7.655  12.015  3.364   1.00 0.00 ? 63  ILE B CG2  4  
ATOM 7362  C CD1  . ILE B 2 65  ? -7.855  15.808  3.372   1.00 0.00 ? 63  ILE B CD1  4  
ATOM 7363  H H    . ILE B 2 65  ? -5.092  15.061  3.929   1.00 0.00 ? 63  ILE B H    4  
ATOM 7364  H HA   . ILE B 2 65  ? -6.549  13.243  5.673   1.00 0.00 ? 63  ILE B HA   4  
ATOM 7365  H HB   . ILE B 2 65  ? -6.536  13.669  2.674   1.00 0.00 ? 63  ILE B HB   4  
ATOM 7366  H HG12 . ILE B 2 65  ? -9.068  14.081  3.396   1.00 0.00 ? 63  ILE B HG12 4  
ATOM 7367  H HG13 . ILE B 2 65  ? -8.310  14.461  4.937   1.00 0.00 ? 63  ILE B HG13 4  
ATOM 7368  H HG21 . ILE B 2 65  ? -8.364  12.057  2.551   1.00 0.00 ? 63  ILE B HG21 4  
ATOM 7369  H HG22 . ILE B 2 65  ? -8.158  11.699  4.266   1.00 0.00 ? 63  ILE B HG22 4  
ATOM 7370  H HG23 . ILE B 2 65  ? -6.873  11.310  3.122   1.00 0.00 ? 63  ILE B HG23 4  
ATOM 7371  H HD11 . ILE B 2 65  ? -6.985  16.196  3.881   1.00 0.00 ? 63  ILE B HD11 4  
ATOM 7372  H HD12 . ILE B 2 65  ? -8.702  16.448  3.570   1.00 0.00 ? 63  ILE B HD12 4  
ATOM 7373  H HD13 . ILE B 2 65  ? -7.668  15.782  2.309   1.00 0.00 ? 63  ILE B HD13 4  
ATOM 7374  N N    . GLN B 2 66  ? -5.114  11.154  5.311   1.00 0.00 ? 64  GLN B N    4  
ATOM 7375  C CA   . GLN B 2 66  ? -4.076  10.124  5.211   1.00 0.00 ? 64  GLN B CA   4  
ATOM 7376  C C    . GLN B 2 66  ? -4.610  8.708   5.104   1.00 0.00 ? 64  GLN B C    4  
ATOM 7377  O O    . GLN B 2 66  ? -5.775  8.431   5.369   1.00 0.00 ? 64  GLN B O    4  
ATOM 7378  C CB   . GLN B 2 66  ? -3.127  10.193  6.408   1.00 0.00 ? 64  GLN B CB   4  
ATOM 7379  C CG   . GLN B 2 66  ? -2.628  11.587  6.733   1.00 0.00 ? 64  GLN B CG   4  
ATOM 7380  C CD   . GLN B 2 66  ? -1.982  11.659  8.100   1.00 0.00 ? 64  GLN B CD   4  
ATOM 7381  O OE1  . GLN B 2 66  ? -1.113  12.495  8.343   1.00 0.00 ? 64  GLN B OE1  4  
ATOM 7382  N NE2  . GLN B 2 66  ? -2.410  10.786  9.005   1.00 0.00 ? 64  GLN B NE2  4  
ATOM 7383  H H    . GLN B 2 66  ? -5.879  11.039  5.933   1.00 0.00 ? 64  GLN B H    4  
ATOM 7384  H HA   . GLN B 2 66  ? -3.505  10.333  4.320   1.00 0.00 ? 64  GLN B HA   4  
ATOM 7385  H HB2  . GLN B 2 66  ? -3.641  9.811   7.278   1.00 0.00 ? 64  GLN B HB2  4  
ATOM 7386  H HB3  . GLN B 2 66  ? -2.271  9.567   6.206   1.00 0.00 ? 64  GLN B HB3  4  
ATOM 7387  H HG2  . GLN B 2 66  ? -1.900  11.879  5.991   1.00 0.00 ? 64  GLN B HG2  4  
ATOM 7388  H HG3  . GLN B 2 66  ? -3.463  12.272  6.707   1.00 0.00 ? 64  GLN B HG3  4  
ATOM 7389  H HE21 . GLN B 2 66  ? -3.113  10.154  8.746   1.00 0.00 ? 64  GLN B HE21 4  
ATOM 7390  H HE22 . GLN B 2 66  ? -1.992  10.801  9.894   1.00 0.00 ? 64  GLN B HE22 4  
ATOM 7391  N N    . LEU B 2 67  ? -3.726  7.831   4.664   1.00 0.00 ? 65  LEU B N    4  
ATOM 7392  C CA   . LEU B 2 67  ? -4.002  6.418   4.524   1.00 0.00 ? 65  LEU B CA   4  
ATOM 7393  C C    . LEU B 2 67  ? -2.766  5.650   4.979   1.00 0.00 ? 65  LEU B C    4  
ATOM 7394  O O    . LEU B 2 67  ? -1.680  6.200   4.943   1.00 0.00 ? 65  LEU B O    4  
ATOM 7395  C CB   . LEU B 2 67  ? -4.267  6.072   3.069   1.00 0.00 ? 65  LEU B CB   4  
ATOM 7396  C CG   . LEU B 2 67  ? -5.191  4.890   2.837   1.00 0.00 ? 65  LEU B CG   4  
ATOM 7397  C CD1  . LEU B 2 67  ? -6.626  5.362   2.710   1.00 0.00 ? 65  LEU B CD1  4  
ATOM 7398  C CD2  . LEU B 2 67  ? -4.752  4.116   1.614   1.00 0.00 ? 65  LEU B CD2  4  
ATOM 7399  H H    . LEU B 2 67  ? -2.829  8.154   4.411   1.00 0.00 ? 65  LEU B H    4  
ATOM 7400  H HA   . LEU B 2 67  ? -4.853  6.163   5.142   1.00 0.00 ? 65  LEU B HA   4  
ATOM 7401  H HB2  . LEU B 2 67  ? -4.700  6.939   2.591   1.00 0.00 ? 65  LEU B HB2  4  
ATOM 7402  H HB3  . LEU B 2 67  ? -3.319  5.862   2.599   1.00 0.00 ? 65  LEU B HB3  4  
ATOM 7403  H HG   . LEU B 2 67  ? -5.135  4.228   3.689   1.00 0.00 ? 65  LEU B HG   4  
ATOM 7404  H HD11 . LEU B 2 67  ? -6.925  5.858   3.621   1.00 0.00 ? 65  LEU B HD11 4  
ATOM 7405  H HD12 . LEU B 2 67  ? -7.270  4.516   2.530   1.00 0.00 ? 65  LEU B HD12 4  
ATOM 7406  H HD13 . LEU B 2 67  ? -6.703  6.055   1.883   1.00 0.00 ? 65  LEU B HD13 4  
ATOM 7407  H HD21 . LEU B 2 67  ? -4.789  4.761   0.749   1.00 0.00 ? 65  LEU B HD21 4  
ATOM 7408  H HD22 . LEU B 2 67  ? -5.409  3.273   1.465   1.00 0.00 ? 65  LEU B HD22 4  
ATOM 7409  H HD23 . LEU B 2 67  ? -3.740  3.765   1.757   1.00 0.00 ? 65  LEU B HD23 4  
ATOM 7410  N N    . GLN B 2 68  ? -2.905  4.421   5.445   1.00 0.00 ? 66  GLN B N    4  
ATOM 7411  C CA   . GLN B 2 68  ? -1.730  3.658   5.849   1.00 0.00 ? 66  GLN B CA   4  
ATOM 7412  C C    . GLN B 2 68  ? -1.925  2.176   5.561   1.00 0.00 ? 66  GLN B C    4  
ATOM 7413  O O    . GLN B 2 68  ? -3.033  1.652   5.654   1.00 0.00 ? 66  GLN B O    4  
ATOM 7414  C CB   . GLN B 2 68  ? -1.385  3.875   7.331   1.00 0.00 ? 66  GLN B CB   4  
ATOM 7415  C CG   . GLN B 2 68  ? -2.034  2.884   8.278   1.00 0.00 ? 66  GLN B CG   4  
ATOM 7416  C CD   . GLN B 2 68  ? -1.542  3.008   9.711   1.00 0.00 ? 66  GLN B CD   4  
ATOM 7417  O OE1  . GLN B 2 68  ? -1.487  2.023   10.446  1.00 0.00 ? 66  GLN B OE1  4  
ATOM 7418  N NE2  . GLN B 2 68  ? -1.206  4.216   10.128  1.00 0.00 ? 66  GLN B NE2  4  
ATOM 7419  H H    . GLN B 2 68  ? -3.803  4.020   5.514   1.00 0.00 ? 66  GLN B H    4  
ATOM 7420  H HA   . GLN B 2 68  ? -0.901  4.009   5.250   1.00 0.00 ? 66  GLN B HA   4  
ATOM 7421  H HB2  . GLN B 2 68  ? -0.316  3.806   7.454   1.00 0.00 ? 66  GLN B HB2  4  
ATOM 7422  H HB3  . GLN B 2 68  ? -1.704  4.868   7.616   1.00 0.00 ? 66  GLN B HB3  4  
ATOM 7423  H HG2  . GLN B 2 68  ? -3.100  3.046   8.270   1.00 0.00 ? 66  GLN B HG2  4  
ATOM 7424  H HG3  . GLN B 2 68  ? -1.823  1.883   7.928   1.00 0.00 ? 66  GLN B HG3  4  
ATOM 7425  H HE21 . GLN B 2 68  ? -1.289  4.965   9.499   1.00 0.00 ? 66  GLN B HE21 4  
ATOM 7426  H HE22 . GLN B 2 68  ? -0.878  4.313   11.045  1.00 0.00 ? 66  GLN B HE22 4  
ATOM 7427  N N    . LEU B 2 69  ? -0.840  1.520   5.201   1.00 0.00 ? 67  LEU B N    4  
ATOM 7428  C CA   . LEU B 2 69  ? -0.852  0.102   4.897   1.00 0.00 ? 67  LEU B CA   4  
ATOM 7429  C C    . LEU B 2 69  ? -0.468  -0.705  6.122   1.00 0.00 ? 67  LEU B C    4  
ATOM 7430  O O    . LEU B 2 69  ? 0.683   -0.689  6.538   1.00 0.00 ? 67  LEU B O    4  
ATOM 7431  C CB   . LEU B 2 69  ? 0.146   -0.205  3.785   1.00 0.00 ? 67  LEU B CB   4  
ATOM 7432  C CG   . LEU B 2 69  ? -0.155  0.418   2.428   1.00 0.00 ? 67  LEU B CG   4  
ATOM 7433  C CD1  . LEU B 2 69  ? 0.953   0.073   1.447   1.00 0.00 ? 67  LEU B CD1  4  
ATOM 7434  C CD2  . LEU B 2 69  ? -1.501  -0.057  1.906   1.00 0.00 ? 67  LEU B CD2  4  
ATOM 7435  H H    . LEU B 2 69  ? 0.010   2.012   5.131   1.00 0.00 ? 67  LEU B H    4  
ATOM 7436  H HA   . LEU B 2 69  ? -1.845  -0.175  4.578   1.00 0.00 ? 67  LEU B HA   4  
ATOM 7437  H HB2  . LEU B 2 69  ? 1.119   0.141   4.104   1.00 0.00 ? 67  LEU B HB2  4  
ATOM 7438  H HB3  . LEU B 2 69  ? 0.190   -1.272  3.663   1.00 0.00 ? 67  LEU B HB3  4  
ATOM 7439  H HG   . LEU B 2 69  ? -0.192  1.493   2.529   1.00 0.00 ? 67  LEU B HG   4  
ATOM 7440  H HD11 . LEU B 2 69  ? 1.891   0.462   1.814   1.00 0.00 ? 67  LEU B HD11 4  
ATOM 7441  H HD12 . LEU B 2 69  ? 0.731   0.512   0.486   1.00 0.00 ? 67  LEU B HD12 4  
ATOM 7442  H HD13 . LEU B 2 69  ? 1.022   -0.999  1.346   1.00 0.00 ? 67  LEU B HD13 4  
ATOM 7443  H HD21 . LEU B 2 69  ? -1.697  0.398   0.947   1.00 0.00 ? 67  LEU B HD21 4  
ATOM 7444  H HD22 . LEU B 2 69  ? -2.277  0.224   2.604   1.00 0.00 ? 67  LEU B HD22 4  
ATOM 7445  H HD23 . LEU B 2 69  ? -1.486  -1.132  1.798   1.00 0.00 ? 67  LEU B HD23 4  
ATOM 7446  N N    . VAL B 2 70  ? -1.419  -1.402  6.703   1.00 0.00 ? 68  VAL B N    4  
ATOM 7447  C CA   . VAL B 2 70  ? -1.136  -2.216  7.867   1.00 0.00 ? 68  VAL B CA   4  
ATOM 7448  C C    . VAL B 2 70  ? -0.873  -3.641  7.415   1.00 0.00 ? 68  VAL B C    4  
ATOM 7449  O O    . VAL B 2 70  ? -1.776  -4.348  6.978   1.00 0.00 ? 68  VAL B O    4  
ATOM 7450  C CB   . VAL B 2 70  ? -2.288  -2.176  8.883   1.00 0.00 ? 68  VAL B CB   4  
ATOM 7451  C CG1  . VAL B 2 70  ? -1.855  -2.793  10.198  1.00 0.00 ? 68  VAL B CG1  4  
ATOM 7452  C CG2  . VAL B 2 70  ? -2.749  -0.745  9.090   1.00 0.00 ? 68  VAL B CG2  4  
ATOM 7453  H H    . VAL B 2 70  ? -2.330  -1.390  6.331   1.00 0.00 ? 68  VAL B H    4  
ATOM 7454  H HA   . VAL B 2 70  ? -0.243  -1.826  8.340   1.00 0.00 ? 68  VAL B HA   4  
ATOM 7455  H HB   . VAL B 2 70  ? -3.115  -2.749  8.492   1.00 0.00 ? 68  VAL B HB   4  
ATOM 7456  H HG11 . VAL B 2 70  ? -2.667  -2.734  10.907  1.00 0.00 ? 68  VAL B HG11 4  
ATOM 7457  H HG12 . VAL B 2 70  ? -1.002  -2.252  10.581  1.00 0.00 ? 68  VAL B HG12 4  
ATOM 7458  H HG13 . VAL B 2 70  ? -1.585  -3.825  10.039  1.00 0.00 ? 68  VAL B HG13 4  
ATOM 7459  H HG21 . VAL B 2 70  ? -1.922  -0.151  9.454   1.00 0.00 ? 68  VAL B HG21 4  
ATOM 7460  H HG22 . VAL B 2 70  ? -3.550  -0.725  9.812   1.00 0.00 ? 68  VAL B HG22 4  
ATOM 7461  H HG23 . VAL B 2 70  ? -3.096  -0.340  8.152   1.00 0.00 ? 68  VAL B HG23 4  
ATOM 7462  N N    . LEU B 2 71  ? 0.375   -4.054  7.502   1.00 0.00 ? 69  LEU B N    4  
ATOM 7463  C CA   . LEU B 2 71  ? 0.772   -5.375  7.048   1.00 0.00 ? 69  LEU B CA   4  
ATOM 7464  C C    . LEU B 2 71  ? 0.639   -6.417  8.140   1.00 0.00 ? 69  LEU B C    4  
ATOM 7465  O O    . LEU B 2 71  ? 0.695   -6.101  9.327   1.00 0.00 ? 69  LEU B O    4  
ATOM 7466  C CB   . LEU B 2 71  ? 2.218   -5.340  6.567   1.00 0.00 ? 69  LEU B CB   4  
ATOM 7467  C CG   . LEU B 2 71  ? 2.633   -4.038  5.897   1.00 0.00 ? 69  LEU B CG   4  
ATOM 7468  C CD1  . LEU B 2 71  ? 4.107   -4.052  5.578   1.00 0.00 ? 69  LEU B CD1  4  
ATOM 7469  C CD2  . LEU B 2 71  ? 1.832   -3.813  4.638   1.00 0.00 ? 69  LEU B CD2  4  
ATOM 7470  H H    . LEU B 2 71  ? 1.054   -3.456  7.897   1.00 0.00 ? 69  LEU B H    4  
ATOM 7471  H HA   . LEU B 2 71  ? 0.138   -5.648  6.221   1.00 0.00 ? 69  LEU B HA   4  
ATOM 7472  H HB2  . LEU B 2 71  ? 2.864   -5.510  7.416   1.00 0.00 ? 69  LEU B HB2  4  
ATOM 7473  H HB3  . LEU B 2 71  ? 2.360   -6.144  5.860   1.00 0.00 ? 69  LEU B HB3  4  
ATOM 7474  H HG   . LEU B 2 71  ? 2.438   -3.217  6.570   1.00 0.00 ? 69  LEU B HG   4  
ATOM 7475  H HD11 . LEU B 2 71  ? 4.668   -4.136  6.495   1.00 0.00 ? 69  LEU B HD11 4  
ATOM 7476  H HD12 . LEU B 2 71  ? 4.369   -3.135  5.073   1.00 0.00 ? 69  LEU B HD12 4  
ATOM 7477  H HD13 . LEU B 2 71  ? 4.324   -4.894  4.939   1.00 0.00 ? 69  LEU B HD13 4  
ATOM 7478  H HD21 . LEU B 2 71  ? 0.779   -3.877  4.866   1.00 0.00 ? 69  LEU B HD21 4  
ATOM 7479  H HD22 . LEU B 2 71  ? 2.090   -4.568  3.910   1.00 0.00 ? 69  LEU B HD22 4  
ATOM 7480  H HD23 . LEU B 2 71  ? 2.056   -2.836  4.240   1.00 0.00 ? 69  LEU B HD23 4  
ATOM 7481  N N    . HIS B 2 72  ? 0.489   -7.670  7.728   1.00 0.00 ? 70  HIS B N    4  
ATOM 7482  C CA   . HIS B 2 72  ? 0.387   -8.771  8.677   1.00 0.00 ? 70  HIS B CA   4  
ATOM 7483  C C    . HIS B 2 72  ? 1.780   -9.130  9.172   1.00 0.00 ? 70  HIS B C    4  
ATOM 7484  O O    . HIS B 2 72  ? 1.960   -10.013 10.005  1.00 0.00 ? 70  HIS B O    4  
ATOM 7485  C CB   . HIS B 2 72  ? -0.291  -10.006 8.062   1.00 0.00 ? 70  HIS B CB   4  
ATOM 7486  C CG   . HIS B 2 72  ? -0.150  -10.120 6.576   1.00 0.00 ? 70  HIS B CG   4  
ATOM 7487  N ND1  . HIS B 2 72  ? -1.149  -9.789  5.692   1.00 0.00 ? 70  HIS B ND1  4  
ATOM 7488  C CD2  . HIS B 2 72  ? 0.896   -10.533 5.811   1.00 0.00 ? 70  HIS B CD2  4  
ATOM 7489  C CE1  . HIS B 2 72  ? -0.687  -10.002 4.459   1.00 0.00 ? 70  HIS B CE1  4  
ATOM 7490  N NE2  . HIS B 2 72  ? 0.540   -10.463 4.485   1.00 0.00 ? 70  HIS B NE2  4  
ATOM 7491  H H    . HIS B 2 72  ? 0.447   -7.859  6.763   1.00 0.00 ? 70  HIS B H    4  
ATOM 7492  H HA   . HIS B 2 72  ? -0.203  -8.421  9.510   1.00 0.00 ? 70  HIS B HA   4  
ATOM 7493  H HB2  . HIS B 2 72  ? 0.138   -10.895 8.500   1.00 0.00 ? 70  HIS B HB2  4  
ATOM 7494  H HB3  . HIS B 2 72  ? -1.346  -9.975  8.294   1.00 0.00 ? 70  HIS B HB3  4  
ATOM 7495  H HD1  . HIS B 2 72  ? -2.047  -9.465  5.922   1.00 0.00 ? 70  HIS B HD1  4  
ATOM 7496  H HD2  . HIS B 2 72  ? 1.872   -10.811 6.154   1.00 0.00 ? 70  HIS B HD2  4  
ATOM 7497  H HE1  . HIS B 2 72  ? -1.203  -9.729  3.558   1.00 0.00 ? 70  HIS B HE1  4  
ATOM 7498  N N    . ALA B 2 73  ? 2.760   -8.416  8.631   1.00 0.00 ? 71  ALA B N    4  
ATOM 7499  C CA   . ALA B 2 73  ? 4.156   -8.601  8.982   1.00 0.00 ? 71  ALA B CA   4  
ATOM 7500  C C    . ALA B 2 73  ? 4.489   -7.853  10.268  1.00 0.00 ? 71  ALA B C    4  
ATOM 7501  O O    . ALA B 2 73  ? 5.592   -7.967  10.798  1.00 0.00 ? 71  ALA B O    4  
ATOM 7502  C CB   . ALA B 2 73  ? 5.032   -8.104  7.840   1.00 0.00 ? 71  ALA B CB   4  
ATOM 7503  H H    . ALA B 2 73  ? 2.530   -7.739  7.964   1.00 0.00 ? 71  ALA B H    4  
ATOM 7504  H HA   . ALA B 2 73  ? 4.338   -9.655  9.121   1.00 0.00 ? 71  ALA B HA   4  
ATOM 7505  H HB1  . ALA B 2 73  ? 6.071   -8.244  8.093   1.00 0.00 ? 71  ALA B HB1  4  
ATOM 7506  H HB2  . ALA B 2 73  ? 4.841   -7.053  7.670   1.00 0.00 ? 71  ALA B HB2  4  
ATOM 7507  H HB3  . ALA B 2 73  ? 4.802   -8.659  6.941   1.00 0.00 ? 71  ALA B HB3  4  
ATOM 7508  N N    . GLY B 2 74  ? 3.521   -7.087  10.762  1.00 0.00 ? 72  GLY B N    4  
ATOM 7509  C CA   . GLY B 2 74  ? 3.726   -6.319  11.973  1.00 0.00 ? 72  GLY B CA   4  
ATOM 7510  C C    . GLY B 2 74  ? 4.283   -4.944  11.672  1.00 0.00 ? 72  GLY B C    4  
ATOM 7511  O O    . GLY B 2 74  ? 4.854   -4.290  12.541  1.00 0.00 ? 72  GLY B O    4  
ATOM 7512  H H    . GLY B 2 74  ? 2.657   -7.052  10.303  1.00 0.00 ? 72  GLY B H    4  
ATOM 7513  H HA2  . GLY B 2 74  ? 2.782   -6.213  12.487  1.00 0.00 ? 72  GLY B HA2  4  
ATOM 7514  H HA3  . GLY B 2 74  ? 4.419   -6.846  12.611  1.00 0.00 ? 72  GLY B HA3  4  
ATOM 7515  N N    . ASP B 2 75  ? 4.098   -4.509  10.433  1.00 0.00 ? 73  ASP B N    4  
ATOM 7516  C CA   . ASP B 2 75  ? 4.591   -3.209  9.986   1.00 0.00 ? 73  ASP B CA   4  
ATOM 7517  C C    . ASP B 2 75  ? 3.455   -2.394  9.376   1.00 0.00 ? 73  ASP B C    4  
ATOM 7518  O O    . ASP B 2 75  ? 2.421   -2.951  8.996   1.00 0.00 ? 73  ASP B O    4  
ATOM 7519  C CB   . ASP B 2 75  ? 5.723   -3.399  8.966   1.00 0.00 ? 73  ASP B CB   4  
ATOM 7520  C CG   . ASP B 2 75  ? 6.230   -2.088  8.397   1.00 0.00 ? 73  ASP B CG   4  
ATOM 7521  O OD1  . ASP B 2 75  ? 6.371   -1.993  7.160   1.00 0.00 ? 73  ASP B OD1  4  
ATOM 7522  O OD2  . ASP B 2 75  ? 6.469   -1.149  9.187   1.00 0.00 ? 73  ASP B OD2  4  
ATOM 7523  H H    . ASP B 2 75  ? 3.602   -5.069  9.803   1.00 0.00 ? 73  ASP B H    4  
ATOM 7524  H HA   . ASP B 2 75  ? 4.976   -2.683  10.848  1.00 0.00 ? 73  ASP B HA   4  
ATOM 7525  H HB2  . ASP B 2 75  ? 6.549   -3.904  9.444   1.00 0.00 ? 73  ASP B HB2  4  
ATOM 7526  H HB3  . ASP B 2 75  ? 5.361   -4.008  8.149   1.00 0.00 ? 73  ASP B HB3  4  
ATOM 7527  N N    . THR B 2 76  ? 3.644   -1.085  9.288   1.00 0.00 ? 74  THR B N    4  
ATOM 7528  C CA   . THR B 2 76  ? 2.639   -0.200  8.725   1.00 0.00 ? 74  THR B CA   4  
ATOM 7529  C C    . THR B 2 76  ? 3.295   0.851   7.825   1.00 0.00 ? 74  THR B C    4  
ATOM 7530  O O    . THR B 2 76  ? 4.257   1.506   8.225   1.00 0.00 ? 74  THR B O    4  
ATOM 7531  C CB   . THR B 2 76  ? 1.848   0.524   9.835   1.00 0.00 ? 74  THR B CB   4  
ATOM 7532  O OG1  . THR B 2 76  ? 2.750   1.059   10.811  1.00 0.00 ? 74  THR B OG1  4  
ATOM 7533  C CG2  . THR B 2 76  ? 0.866   -0.417  10.514  1.00 0.00 ? 74  THR B CG2  4  
ATOM 7534  H H    . THR B 2 76  ? 4.503   -0.707  9.582   1.00 0.00 ? 74  THR B H    4  
ATOM 7535  H HA   . THR B 2 76  ? 1.943   -0.798  8.142   1.00 0.00 ? 74  THR B HA   4  
ATOM 7536  H HB   . THR B 2 76  ? 1.293   1.335   9.387   1.00 0.00 ? 74  THR B HB   4  
ATOM 7537  H HG1  . THR B 2 76  ? 3.618   1.188   10.404  1.00 0.00 ? 74  THR B HG1  4  
ATOM 7538  H HG21 . THR B 2 76  ? 1.402   -1.256  10.931  1.00 0.00 ? 74  THR B HG21 4  
ATOM 7539  H HG22 . THR B 2 76  ? 0.149   -0.773  9.788   1.00 0.00 ? 74  THR B HG22 4  
ATOM 7540  H HG23 . THR B 2 76  ? 0.349   0.110   11.302  1.00 0.00 ? 74  THR B HG23 4  
ATOM 7541  N N    . THR B 2 77  ? 2.760   1.019   6.628   1.00 0.00 ? 75  THR B N    4  
ATOM 7542  C CA   . THR B 2 77  ? 3.279   1.990   5.675   1.00 0.00 ? 75  THR B CA   4  
ATOM 7543  C C    . THR B 2 77  ? 2.284   3.136   5.505   1.00 0.00 ? 75  THR B C    4  
ATOM 7544  O O    . THR B 2 77  ? 1.279   2.990   4.813   1.00 0.00 ? 75  THR B O    4  
ATOM 7545  C CB   . THR B 2 77  ? 3.529   1.322   4.311   1.00 0.00 ? 75  THR B CB   4  
ATOM 7546  O OG1  . THR B 2 77  ? 4.170   0.054   4.503   1.00 0.00 ? 75  THR B OG1  4  
ATOM 7547  C CG2  . THR B 2 77  ? 4.389   2.209   3.422   1.00 0.00 ? 75  THR B CG2  4  
ATOM 7548  H H    . THR B 2 77  ? 1.997   0.458   6.368   1.00 0.00 ? 75  THR B H    4  
ATOM 7549  H HA   . THR B 2 77  ? 4.214   2.377   6.051   1.00 0.00 ? 75  THR B HA   4  
ATOM 7550  H HB   . THR B 2 77  ? 2.574   1.160   3.823   1.00 0.00 ? 75  THR B HB   4  
ATOM 7551  H HG1  . THR B 2 77  ? 4.726   0.089   5.292   1.00 0.00 ? 75  THR B HG1  4  
ATOM 7552  H HG21 . THR B 2 77  ? 4.571   1.709   2.482   1.00 0.00 ? 75  THR B HG21 4  
ATOM 7553  H HG22 . THR B 2 77  ? 5.332   2.404   3.913   1.00 0.00 ? 75  THR B HG22 4  
ATOM 7554  H HG23 . THR B 2 77  ? 3.878   3.142   3.241   1.00 0.00 ? 75  THR B HG23 4  
ATOM 7555  N N    . ASN B 2 78  ? 2.558   4.274   6.124   1.00 0.00 ? 76  ASN B N    4  
ATOM 7556  C CA   . ASN B 2 78  ? 1.638   5.405   6.056   1.00 0.00 ? 76  ASN B CA   4  
ATOM 7557  C C    . ASN B 2 78  ? 1.823   6.225   4.786   1.00 0.00 ? 76  ASN B C    4  
ATOM 7558  O O    . ASN B 2 78  ? 2.930   6.382   4.278   1.00 0.00 ? 76  ASN B O    4  
ATOM 7559  C CB   . ASN B 2 78  ? 1.786   6.309   7.283   1.00 0.00 ? 76  ASN B CB   4  
ATOM 7560  C CG   . ASN B 2 78  ? 1.344   5.636   8.571   1.00 0.00 ? 76  ASN B CG   4  
ATOM 7561  O OD1  . ASN B 2 78  ? 1.456   4.420   8.730   1.00 0.00 ? 76  ASN B OD1  4  
ATOM 7562  N ND2  . ASN B 2 78  ? 0.829   6.421   9.503   1.00 0.00 ? 76  ASN B ND2  4  
ATOM 7563  H H    . ASN B 2 78  ? 3.399   4.363   6.630   1.00 0.00 ? 76  ASN B H    4  
ATOM 7564  H HA   . ASN B 2 78  ? 0.638   5.001   6.051   1.00 0.00 ? 76  ASN B HA   4  
ATOM 7565  H HB2  . ASN B 2 78  ? 2.818   6.599   7.387   1.00 0.00 ? 76  ASN B HB2  4  
ATOM 7566  H HB3  . ASN B 2 78  ? 1.183   7.195   7.139   1.00 0.00 ? 76  ASN B HB3  4  
ATOM 7567  H HD21 . ASN B 2 78  ? 0.756   7.398   9.310   1.00 0.00 ? 76  ASN B HD21 4  
ATOM 7568  H HD22 . ASN B 2 78  ? 0.553   6.019   10.350  1.00 0.00 ? 76  ASN B HD22 4  
ATOM 7569  N N    . PHE B 2 79  ? 0.709   6.729   4.282   1.00 0.00 ? 77  PHE B N    4  
ATOM 7570  C CA   . PHE B 2 79  ? 0.678   7.547   3.086   1.00 0.00 ? 77  PHE B CA   4  
ATOM 7571  C C    . PHE B 2 79  ? -0.109  8.821   3.360   1.00 0.00 ? 77  PHE B C    4  
ATOM 7572  O O    . PHE B 2 79  ? -1.337  8.806   3.487   1.00 0.00 ? 77  PHE B O    4  
ATOM 7573  C CB   . PHE B 2 79  ? 0.072   6.772   1.918   1.00 0.00 ? 77  PHE B CB   4  
ATOM 7574  C CG   . PHE B 2 79  ? 1.031   5.783   1.325   1.00 0.00 ? 77  PHE B CG   4  
ATOM 7575  C CD1  . PHE B 2 79  ? 2.121   6.222   0.593   1.00 0.00 ? 77  PHE B CD1  4  
ATOM 7576  C CD2  . PHE B 2 79  ? 0.851   4.423   1.506   1.00 0.00 ? 77  PHE B CD2  4  
ATOM 7577  C CE1  . PHE B 2 79  ? 3.013   5.323   0.049   1.00 0.00 ? 77  PHE B CE1  4  
ATOM 7578  C CE2  . PHE B 2 79  ? 1.742   3.520   0.963   1.00 0.00 ? 77  PHE B CE2  4  
ATOM 7579  C CZ   . PHE B 2 79  ? 2.823   3.971   0.233   1.00 0.00 ? 77  PHE B CZ   4  
ATOM 7580  H H    . PHE B 2 79  ? -0.141  6.543   4.742   1.00 0.00 ? 77  PHE B H    4  
ATOM 7581  H HA   . PHE B 2 79  ? 1.693   7.812   2.841   1.00 0.00 ? 77  PHE B HA   4  
ATOM 7582  H HB2  . PHE B 2 79  ? -0.798  6.232   2.260   1.00 0.00 ? 77  PHE B HB2  4  
ATOM 7583  H HB3  . PHE B 2 79  ? -0.218  7.465   1.141   1.00 0.00 ? 77  PHE B HB3  4  
ATOM 7584  H HD1  . PHE B 2 79  ? 2.269   7.281   0.447   1.00 0.00 ? 77  PHE B HD1  4  
ATOM 7585  H HD2  . PHE B 2 79  ? 0.006   4.071   2.077   1.00 0.00 ? 77  PHE B HD2  4  
ATOM 7586  H HE1  . PHE B 2 79  ? 3.858   5.679   -0.521  1.00 0.00 ? 77  PHE B HE1  4  
ATOM 7587  H HE2  . PHE B 2 79  ? 1.592   2.460   1.108   1.00 0.00 ? 77  PHE B HE2  4  
ATOM 7588  H HZ   . PHE B 2 79  ? 3.521   3.267   -0.196  1.00 0.00 ? 77  PHE B HZ   4  
ATOM 7589  N N    . HIS B 2 80  ? 0.618   9.911   3.457   1.00 0.00 ? 78  HIS B N    4  
ATOM 7590  C CA   . HIS B 2 80  ? 0.058   11.219  3.746   1.00 0.00 ? 78  HIS B CA   4  
ATOM 7591  C C    . HIS B 2 80  ? -0.388  11.912  2.456   1.00 0.00 ? 78  HIS B C    4  
ATOM 7592  O O    . HIS B 2 80  ? 0.431   12.265  1.616   1.00 0.00 ? 78  HIS B O    4  
ATOM 7593  C CB   . HIS B 2 80  ? 1.145   12.008  4.505   1.00 0.00 ? 78  HIS B CB   4  
ATOM 7594  C CG   . HIS B 2 80  ? 1.002   13.505  4.604   1.00 0.00 ? 78  HIS B CG   4  
ATOM 7595  N ND1  . HIS B 2 80  ? 1.877   14.278  5.333   1.00 0.00 ? 78  HIS B ND1  4  
ATOM 7596  C CD2  . HIS B 2 80  ? 0.120   14.372  4.047   1.00 0.00 ? 78  HIS B CD2  4  
ATOM 7597  C CE1  . HIS B 2 80  ? 1.513   15.555  5.201   1.00 0.00 ? 78  HIS B CE1  4  
ATOM 7598  N NE2  . HIS B 2 80  ? 0.452   15.671  4.430   1.00 0.00 ? 78  HIS B NE2  4  
ATOM 7599  H H    . HIS B 2 80  ? 1.594   9.837   3.329   1.00 0.00 ? 78  HIS B H    4  
ATOM 7600  H HA   . HIS B 2 80  ? -0.798  11.084  4.390   1.00 0.00 ? 78  HIS B HA   4  
ATOM 7601  H HB2  . HIS B 2 80  ? 1.186   11.634  5.516   1.00 0.00 ? 78  HIS B HB2  4  
ATOM 7602  H HB3  . HIS B 2 80  ? 2.096   11.804  4.033   1.00 0.00 ? 78  HIS B HB3  4  
ATOM 7603  H HD1  . HIS B 2 80  ? 2.650   13.936  5.855   1.00 0.00 ? 78  HIS B HD1  4  
ATOM 7604  H HD2  . HIS B 2 80  ? -0.711  14.110  3.409   1.00 0.00 ? 78  HIS B HD2  4  
ATOM 7605  H HE1  . HIS B 2 80  ? 2.025   16.386  5.665   1.00 0.00 ? 78  HIS B HE1  4  
ATOM 7606  N N    . PHE B 2 81  ? -1.695  12.089  2.302   1.00 0.00 ? 79  PHE B N    4  
ATOM 7607  C CA   . PHE B 2 81  ? -2.249  12.753  1.126   1.00 0.00 ? 79  PHE B CA   4  
ATOM 7608  C C    . PHE B 2 81  ? -2.201  14.266  1.326   1.00 0.00 ? 79  PHE B C    4  
ATOM 7609  O O    . PHE B 2 81  ? -3.090  14.846  1.952   1.00 0.00 ? 79  PHE B O    4  
ATOM 7610  C CB   . PHE B 2 81  ? -3.700  12.322  0.888   1.00 0.00 ? 79  PHE B CB   4  
ATOM 7611  C CG   . PHE B 2 81  ? -3.867  10.915  0.391   1.00 0.00 ? 79  PHE B CG   4  
ATOM 7612  C CD1  . PHE B 2 81  ? -3.977  9.848   1.271   1.00 0.00 ? 79  PHE B CD1  4  
ATOM 7613  C CD2  . PHE B 2 81  ? -3.941  10.663  -0.963  1.00 0.00 ? 79  PHE B CD2  4  
ATOM 7614  C CE1  . PHE B 2 81  ? -4.159  8.560   0.800   1.00 0.00 ? 79  PHE B CE1  4  
ATOM 7615  C CE2  . PHE B 2 81  ? -4.117  9.381   -1.437  1.00 0.00 ? 79  PHE B CE2  4  
ATOM 7616  C CZ   . PHE B 2 81  ? -4.228  8.329   -0.560  1.00 0.00 ? 79  PHE B CZ   4  
ATOM 7617  H H    . PHE B 2 81  ? -2.307  11.779  3.006   1.00 0.00 ? 79  PHE B H    4  
ATOM 7618  H HA   . PHE B 2 81  ? -1.651  12.483  0.268   1.00 0.00 ? 79  PHE B HA   4  
ATOM 7619  H HB2  . PHE B 2 81  ? -4.245  12.406  1.815   1.00 0.00 ? 79  PHE B HB2  4  
ATOM 7620  H HB3  . PHE B 2 81  ? -4.143  12.985  0.158   1.00 0.00 ? 79  PHE B HB3  4  
ATOM 7621  H HD1  . PHE B 2 81  ? -3.923  10.031  2.335   1.00 0.00 ? 79  PHE B HD1  4  
ATOM 7622  H HD2  . PHE B 2 81  ? -3.854  11.485  -1.660  1.00 0.00 ? 79  PHE B HD2  4  
ATOM 7623  H HE1  . PHE B 2 81  ? -4.244  7.737   1.493   1.00 0.00 ? 79  PHE B HE1  4  
ATOM 7624  H HE2  . PHE B 2 81  ? -4.171  9.202   -2.499  1.00 0.00 ? 79  PHE B HE2  4  
ATOM 7625  H HZ   . PHE B 2 81  ? -4.378  7.323   -0.943  1.00 0.00 ? 79  PHE B HZ   4  
ATOM 7626  N N    . SER B 2 82  ? -1.164  14.899  0.806   1.00 0.00 ? 80  SER B N    4  
ATOM 7627  C CA   . SER B 2 82  ? -1.002  16.340  0.946   1.00 0.00 ? 80  SER B CA   4  
ATOM 7628  C C    . SER B 2 82  ? -1.577  17.105  -0.248  1.00 0.00 ? 80  SER B C    4  
ATOM 7629  O O    . SER B 2 82  ? -1.434  18.324  -0.337  1.00 0.00 ? 80  SER B O    4  
ATOM 7630  C CB   . SER B 2 82  ? 0.479   16.681  1.142   1.00 0.00 ? 80  SER B CB   4  
ATOM 7631  O OG   . SER B 2 82  ? 1.316   15.737  0.493   1.00 0.00 ? 80  SER B OG   4  
ATOM 7632  H H    . SER B 2 82  ? -0.481  14.386  0.321   1.00 0.00 ? 80  SER B H    4  
ATOM 7633  H HA   . SER B 2 82  ? -1.541  16.639  1.833   1.00 0.00 ? 80  SER B HA   4  
ATOM 7634  H HB2  . SER B 2 82  ? 0.676   17.659  0.730   1.00 0.00 ? 80  SER B HB2  4  
ATOM 7635  H HB3  . SER B 2 82  ? 0.708   16.682  2.197   1.00 0.00 ? 80  SER B HB3  4  
ATOM 7636  H HG   . SER B 2 82  ? 0.883   15.416  -0.309  1.00 0.00 ? 80  SER B HG   4  
ATOM 7637  N N    . ASN B 2 83  ? -2.226  16.397  -1.165  1.00 0.00 ? 81  ASN B N    4  
ATOM 7638  C CA   . ASN B 2 83  ? -2.818  17.045  -2.331  1.00 0.00 ? 81  ASN B CA   4  
ATOM 7639  C C    . ASN B 2 83  ? -4.228  17.522  -2.003  1.00 0.00 ? 81  ASN B C    4  
ATOM 7640  O O    . ASN B 2 83  ? -5.196  16.792  -2.178  1.00 0.00 ? 81  ASN B O    4  
ATOM 7641  C CB   . ASN B 2 83  ? -2.846  16.095  -3.535  1.00 0.00 ? 81  ASN B CB   4  
ATOM 7642  C CG   . ASN B 2 83  ? -3.214  16.792  -4.839  1.00 0.00 ? 81  ASN B CG   4  
ATOM 7643  O OD1  . ASN B 2 83  ? -3.598  16.142  -5.814  1.00 0.00 ? 81  ASN B OD1  4  
ATOM 7644  N ND2  . ASN B 2 83  ? -3.099  18.113  -4.879  1.00 0.00 ? 81  ASN B ND2  4  
ATOM 7645  H H    . ASN B 2 83  ? -2.308  15.426  -1.057  1.00 0.00 ? 81  ASN B H    4  
ATOM 7646  H HA   . ASN B 2 83  ? -2.210  17.904  -2.575  1.00 0.00 ? 81  ASN B HA   4  
ATOM 7647  H HB2  . ASN B 2 83  ? -1.873  15.646  -3.653  1.00 0.00 ? 81  ASN B HB2  4  
ATOM 7648  H HB3  . ASN B 2 83  ? -3.573  15.317  -3.349  1.00 0.00 ? 81  ASN B HB3  4  
ATOM 7649  H HD21 . ASN B 2 83  ? -2.779  18.586  -4.077  1.00 0.00 ? 81  ASN B HD21 4  
ATOM 7650  H HD22 . ASN B 2 83  ? -3.361  18.577  -5.704  1.00 0.00 ? 81  ASN B HD22 4  
ATOM 7651  N N    . GLU B 2 84  ? -4.318  18.764  -1.547  1.00 0.00 ? 82  GLU B N    4  
ATOM 7652  C CA   . GLU B 2 84  ? -5.586  19.394  -1.162  1.00 0.00 ? 82  GLU B CA   4  
ATOM 7653  C C    . GLU B 2 84  ? -6.700  19.169  -2.189  1.00 0.00 ? 82  GLU B C    4  
ATOM 7654  O O    . GLU B 2 84  ? -7.855  18.937  -1.824  1.00 0.00 ? 82  GLU B O    4  
ATOM 7655  C CB   . GLU B 2 84  ? -5.394  20.907  -0.949  1.00 0.00 ? 82  GLU B CB   4  
ATOM 7656  C CG   . GLU B 2 84  ? -4.117  21.491  -1.561  1.00 0.00 ? 82  GLU B CG   4  
ATOM 7657  C CD   . GLU B 2 84  ? -3.946  21.164  -3.035  1.00 0.00 ? 82  GLU B CD   4  
ATOM 7658  O OE1  . GLU B 2 84  ? -4.790  21.591  -3.850  1.00 0.00 ? 82  GLU B OE1  4  
ATOM 7659  O OE2  . GLU B 2 84  ? -2.980  20.446  -3.371  1.00 0.00 ? 82  GLU B OE2  4  
ATOM 7660  H H    . GLU B 2 84  ? -3.494  19.294  -1.477  1.00 0.00 ? 82  GLU B H    4  
ATOM 7661  H HA   . GLU B 2 84  ? -5.894  18.955  -0.225  1.00 0.00 ? 82  GLU B HA   4  
ATOM 7662  H HB2  . GLU B 2 84  ? -6.236  21.425  -1.383  1.00 0.00 ? 82  GLU B HB2  4  
ATOM 7663  H HB3  . GLU B 2 84  ? -5.376  21.105  0.113   1.00 0.00 ? 82  GLU B HB3  4  
ATOM 7664  H HG2  . GLU B 2 84  ? -4.143  22.565  -1.452  1.00 0.00 ? 82  GLU B HG2  4  
ATOM 7665  H HG3  . GLU B 2 84  ? -3.267  21.099  -1.020  1.00 0.00 ? 82  GLU B HG3  4  
ATOM 7666  N N    . SER B 2 85  ? -6.338  19.227  -3.463  1.00 0.00 ? 83  SER B N    4  
ATOM 7667  C CA   . SER B 2 85  ? -7.279  19.061  -4.559  1.00 0.00 ? 83  SER B CA   4  
ATOM 7668  C C    . SER B 2 85  ? -8.125  17.795  -4.441  1.00 0.00 ? 83  SER B C    4  
ATOM 7669  O O    . SER B 2 85  ? -9.360  17.864  -4.385  1.00 0.00 ? 83  SER B O    4  
ATOM 7670  C CB   . SER B 2 85  ? -6.522  19.057  -5.889  1.00 0.00 ? 83  SER B CB   4  
ATOM 7671  O OG   . SER B 2 85  ? -5.276  19.730  -5.779  1.00 0.00 ? 83  SER B OG   4  
ATOM 7672  H H    . SER B 2 85  ? -5.393  19.402  -3.678  1.00 0.00 ? 83  SER B H    4  
ATOM 7673  H HA   . SER B 2 85  ? -7.947  19.901  -4.555  1.00 0.00 ? 83  SER B HA   4  
ATOM 7674  H HB2  . SER B 2 85  ? -6.338  18.037  -6.192  1.00 0.00 ? 83  SER B HB2  4  
ATOM 7675  H HB3  . SER B 2 85  ? -7.119  19.553  -6.640  1.00 0.00 ? 83  SER B HB3  4  
ATOM 7676  H HG   . SER B 2 85  ? -5.351  20.476  -5.154  1.00 0.00 ? 83  SER B HG   4  
ATOM 7677  N N    . THR B 2 86  ? -7.489  16.638  -4.405  1.00 0.00 ? 84  THR B N    4  
ATOM 7678  C CA   . THR B 2 86  ? -8.243  15.401  -4.366  1.00 0.00 ? 84  THR B CA   4  
ATOM 7679  C C    . THR B 2 86  ? -7.858  14.442  -3.238  1.00 0.00 ? 84  THR B C    4  
ATOM 7680  O O    . THR B 2 86  ? -8.349  13.327  -3.224  1.00 0.00 ? 84  THR B O    4  
ATOM 7681  C CB   . THR B 2 86  ? -8.119  14.707  -5.732  1.00 0.00 ? 84  THR B CB   4  
ATOM 7682  O OG1  . THR B 2 86  ? -6.743  14.654  -6.137  1.00 0.00 ? 84  THR B OG1  4  
ATOM 7683  C CG2  . THR B 2 86  ? -8.913  15.486  -6.771  1.00 0.00 ? 84  THR B CG2  4  
ATOM 7684  H H    . THR B 2 86  ? -6.505  16.615  -4.405  1.00 0.00 ? 84  THR B H    4  
ATOM 7685  H HA   . THR B 2 86  ? -9.283  15.663  -4.239  1.00 0.00 ? 84  THR B HA   4  
ATOM 7686  H HB   . THR B 2 86  ? -8.518  13.707  -5.662  1.00 0.00 ? 84  THR B HB   4  
ATOM 7687  H HG1  . THR B 2 86  ? -6.207  14.265  -5.416  1.00 0.00 ? 84  THR B HG1  4  
ATOM 7688  H HG21 . THR B 2 86  ? -8.583  16.518  -6.769  1.00 0.00 ? 84  THR B HG21 4  
ATOM 7689  H HG22 . THR B 2 86  ? -9.963  15.448  -6.526  1.00 0.00 ? 84  THR B HG22 4  
ATOM 7690  H HG23 . THR B 2 86  ? -8.750  15.061  -7.747  1.00 0.00 ? 84  THR B HG23 4  
ATOM 7691  N N    . ALA B 2 87  ? -7.043  14.885  -2.280  1.00 0.00 ? 85  ALA B N    4  
ATOM 7692  C CA   . ALA B 2 87  ? -6.582  14.025  -1.168  1.00 0.00 ? 85  ALA B CA   4  
ATOM 7693  C C    . ALA B 2 87  ? -7.698  13.191  -0.542  1.00 0.00 ? 85  ALA B C    4  
ATOM 7694  O O    . ALA B 2 87  ? -7.532  11.993  -0.337  1.00 0.00 ? 85  ALA B O    4  
ATOM 7695  C CB   . ALA B 2 87  ? -5.908  14.858  -0.088  1.00 0.00 ? 85  ALA B CB   4  
ATOM 7696  H H    . ALA B 2 87  ? -6.721  15.813  -2.320  1.00 0.00 ? 85  ALA B H    4  
ATOM 7697  H HA   . ALA B 2 87  ? -5.839  13.345  -1.571  1.00 0.00 ? 85  ALA B HA   4  
ATOM 7698  H HB1  . ALA B 2 87  ? -5.180  15.515  -0.541  1.00 0.00 ? 85  ALA B HB1  4  
ATOM 7699  H HB2  . ALA B 2 87  ? -5.413  14.203  0.614   1.00 0.00 ? 85  ALA B HB2  4  
ATOM 7700  H HB3  . ALA B 2 87  ? -6.651  15.446  0.430   1.00 0.00 ? 85  ALA B HB3  4  
ATOM 7701  N N    . VAL B 2 88  ? -8.819  13.824  -0.223  1.00 0.00 ? 86  VAL B N    4  
ATOM 7702  C CA   . VAL B 2 88  ? -9.953  13.121  0.376   1.00 0.00 ? 86  VAL B CA   4  
ATOM 7703  C C    . VAL B 2 88  ? -10.421 11.973  -0.532  1.00 0.00 ? 86  VAL B C    4  
ATOM 7704  O O    . VAL B 2 88  ? -10.509 10.822  -0.108  1.00 0.00 ? 86  VAL B O    4  
ATOM 7705  C CB   . VAL B 2 88  ? -11.120 14.099  0.649   1.00 0.00 ? 86  VAL B CB   4  
ATOM 7706  C CG1  . VAL B 2 88  ? -12.454 13.371  0.755   1.00 0.00 ? 86  VAL B CG1  4  
ATOM 7707  C CG2  . VAL B 2 88  ? -10.866 14.899  1.912   1.00 0.00 ? 86  VAL B CG2  4  
ATOM 7708  H H    . VAL B 2 88  ? -8.884  14.786  -0.384  1.00 0.00 ? 86  VAL B H    4  
ATOM 7709  H HA   . VAL B 2 88  ? -9.628  12.708  1.320   1.00 0.00 ? 86  VAL B HA   4  
ATOM 7710  H HB   . VAL B 2 88  ? -11.169 14.796  -0.172  1.00 0.00 ? 86  VAL B HB   4  
ATOM 7711  H HG11 . VAL B 2 88  ? -12.629 12.804  -0.147  1.00 0.00 ? 86  VAL B HG11 4  
ATOM 7712  H HG12 . VAL B 2 88  ? -13.248 14.090  0.887   1.00 0.00 ? 86  VAL B HG12 4  
ATOM 7713  H HG13 . VAL B 2 88  ? -12.432 12.701  1.603   1.00 0.00 ? 86  VAL B HG13 4  
ATOM 7714  H HG21 . VAL B 2 88  ? -10.012 15.543  1.765   1.00 0.00 ? 86  VAL B HG21 4  
ATOM 7715  H HG22 . VAL B 2 88  ? -10.671 14.223  2.732   1.00 0.00 ? 86  VAL B HG22 4  
ATOM 7716  H HG23 . VAL B 2 88  ? -11.733 15.500  2.139   1.00 0.00 ? 86  VAL B HG23 4  
ATOM 7717  N N    . LYS B 2 89  ? -10.669 12.298  -1.796  1.00 0.00 ? 87  LYS B N    4  
ATOM 7718  C CA   . LYS B 2 89  ? -11.124 11.319  -2.785  1.00 0.00 ? 87  LYS B CA   4  
ATOM 7719  C C    . LYS B 2 89  ? -10.009 10.326  -3.097  1.00 0.00 ? 87  LYS B C    4  
ATOM 7720  O O    . LYS B 2 89  ? -10.266 9.157   -3.368  1.00 0.00 ? 87  LYS B O    4  
ATOM 7721  C CB   . LYS B 2 89  ? -11.555 12.051  -4.063  1.00 0.00 ? 87  LYS B CB   4  
ATOM 7722  C CG   . LYS B 2 89  ? -12.402 13.292  -3.801  1.00 0.00 ? 87  LYS B CG   4  
ATOM 7723  C CD   . LYS B 2 89  ? -11.772 14.542  -4.402  1.00 0.00 ? 87  LYS B CD   4  
ATOM 7724  C CE   . LYS B 2 89  ? -12.533 15.803  -4.009  1.00 0.00 ? 87  LYS B CE   4  
ATOM 7725  N NZ   . LYS B 2 89  ? -11.957 17.029  -4.635  1.00 0.00 ? 87  LYS B NZ   4  
ATOM 7726  H H    . LYS B 2 89  ? -10.525 13.221  -2.078  1.00 0.00 ? 87  LYS B H    4  
ATOM 7727  H HA   . LYS B 2 89  ? -11.971 10.771  -2.374  1.00 0.00 ? 87  LYS B HA   4  
ATOM 7728  H HB2  . LYS B 2 89  ? -10.671 12.357  -4.604  1.00 0.00 ? 87  LYS B HB2  4  
ATOM 7729  H HB3  . LYS B 2 89  ? -12.128 11.374  -4.677  1.00 0.00 ? 87  LYS B HB3  4  
ATOM 7730  H HG2  . LYS B 2 89  ? -13.379 13.147  -4.239  1.00 0.00 ? 87  LYS B HG2  4  
ATOM 7731  H HG3  . LYS B 2 89  ? -12.502 13.427  -2.733  1.00 0.00 ? 87  LYS B HG3  4  
ATOM 7732  H HD2  . LYS B 2 89  ? -10.754 14.625  -4.052  1.00 0.00 ? 87  LYS B HD2  4  
ATOM 7733  H HD3  . LYS B 2 89  ? -11.777 14.452  -5.479  1.00 0.00 ? 87  LYS B HD3  4  
ATOM 7734  H HE2  . LYS B 2 89  ? -13.561 15.699  -4.324  1.00 0.00 ? 87  LYS B HE2  4  
ATOM 7735  H HE3  . LYS B 2 89  ? -12.497 15.907  -2.934  1.00 0.00 ? 87  LYS B HE3  4  
ATOM 7736  H HZ1  . LYS B 2 89  ? -11.946 16.932  -5.670  1.00 0.00 ? 87  LYS B HZ1  4  
ATOM 7737  H HZ2  . LYS B 2 89  ? -10.978 17.184  -4.303  1.00 0.00 ? 87  LYS B HZ2  4  
ATOM 7738  H HZ3  . LYS B 2 89  ? -12.529 17.861  -4.383  1.00 0.00 ? 87  LYS B HZ3  4  
ATOM 7739  N N    . GLU B 2 90  ? -8.777  10.806  -3.063  1.00 0.00 ? 88  GLU B N    4  
ATOM 7740  C CA   . GLU B 2 90  ? -7.615  9.970   -3.305  1.00 0.00 ? 88  GLU B CA   4  
ATOM 7741  C C    . GLU B 2 90  ? -7.500  8.945   -2.185  1.00 0.00 ? 88  GLU B C    4  
ATOM 7742  O O    . GLU B 2 90  ? -7.270  7.766   -2.441  1.00 0.00 ? 88  GLU B O    4  
ATOM 7743  C CB   . GLU B 2 90  ? -6.357  10.836  -3.431  1.00 0.00 ? 88  GLU B CB   4  
ATOM 7744  C CG   . GLU B 2 90  ? -6.078  11.264  -4.865  1.00 0.00 ? 88  GLU B CG   4  
ATOM 7745  C CD   . GLU B 2 90  ? -5.036  12.360  -4.979  1.00 0.00 ? 88  GLU B CD   4  
ATOM 7746  O OE1  . GLU B 2 90  ? -4.016  12.151  -5.673  1.00 0.00 ? 88  GLU B OE1  4  
ATOM 7747  O OE2  . GLU B 2 90  ? -5.250  13.450  -4.419  1.00 0.00 ? 88  GLU B OE2  4  
ATOM 7748  H H    . GLU B 2 90  ? -8.642  11.761  -2.876  1.00 0.00 ? 88  GLU B H    4  
ATOM 7749  H HA   . GLU B 2 90  ? -7.775  9.447   -4.236  1.00 0.00 ? 88  GLU B HA   4  
ATOM 7750  H HB2  . GLU B 2 90  ? -6.487  11.726  -2.832  1.00 0.00 ? 88  GLU B HB2  4  
ATOM 7751  H HB3  . GLU B 2 90  ? -5.506  10.289  -3.063  1.00 0.00 ? 88  GLU B HB3  4  
ATOM 7752  H HG2  . GLU B 2 90  ? -5.731  10.405  -5.418  1.00 0.00 ? 88  GLU B HG2  4  
ATOM 7753  H HG3  . GLU B 2 90  ? -7.000  11.620  -5.303  1.00 0.00 ? 88  GLU B HG3  4  
ATOM 7754  N N    . ARG B 2 91  ? -7.700  9.398   -0.947  1.00 0.00 ? 89  ARG B N    4  
ATOM 7755  C CA   . ARG B 2 91  ? -7.676  8.516   0.215   1.00 0.00 ? 89  ARG B CA   4  
ATOM 7756  C C    . ARG B 2 91  ? -8.717  7.439   0.012   1.00 0.00 ? 89  ARG B C    4  
ATOM 7757  O O    . ARG B 2 91  ? -8.479  6.262   0.252   1.00 0.00 ? 89  ARG B O    4  
ATOM 7758  C CB   . ARG B 2 91  ? -8.011  9.299   1.490   1.00 0.00 ? 89  ARG B CB   4  
ATOM 7759  C CG   . ARG B 2 91  ? -7.642  8.603   2.784   1.00 0.00 ? 89  ARG B CG   4  
ATOM 7760  C CD   . ARG B 2 91  ? -8.862  8.413   3.677   1.00 0.00 ? 89  ARG B CD   4  
ATOM 7761  N NE   . ARG B 2 91  ? -9.603  9.658   3.925   1.00 0.00 ? 89  ARG B NE   4  
ATOM 7762  C CZ   . ARG B 2 91  ? -10.784 9.948   3.363   1.00 0.00 ? 89  ARG B CZ   4  
ATOM 7763  N NH1  . ARG B 2 91  ? -11.338 9.090   2.516   1.00 0.00 ? 89  ARG B NH1  4  
ATOM 7764  N NH2  . ARG B 2 91  ? -11.413 11.083  3.646   1.00 0.00 ? 89  ARG B NH2  4  
ATOM 7765  H H    . ARG B 2 91  ? -7.858  10.361  -0.813  1.00 0.00 ? 89  ARG B H    4  
ATOM 7766  H HA   . ARG B 2 91  ? -6.695  8.071   0.299   1.00 0.00 ? 89  ARG B HA   4  
ATOM 7767  H HB2  . ARG B 2 91  ? -7.493  10.238  1.463   1.00 0.00 ? 89  ARG B HB2  4  
ATOM 7768  H HB3  . ARG B 2 91  ? -9.080  9.481   1.514   1.00 0.00 ? 89  ARG B HB3  4  
ATOM 7769  H HG2  . ARG B 2 91  ? -7.221  7.635   2.555   1.00 0.00 ? 89  ARG B HG2  4  
ATOM 7770  H HG3  . ARG B 2 91  ? -6.912  9.202   3.308   1.00 0.00 ? 89  ARG B HG3  4  
ATOM 7771  H HD2  . ARG B 2 91  ? -9.526  7.708   3.203   1.00 0.00 ? 89  ARG B HD2  4  
ATOM 7772  H HD3  . ARG B 2 91  ? -8.533  8.010   4.623   1.00 0.00 ? 89  ARG B HD3  4  
ATOM 7773  H HE   . ARG B 2 91  ? -9.204  10.305  4.552   1.00 0.00 ? 89  ARG B HE   4  
ATOM 7774  H HH11 . ARG B 2 91  ? -10.882 8.233   2.301   1.00 0.00 ? 89  ARG B HH11 4  
ATOM 7775  H HH12 . ARG B 2 91  ? -12.223 9.311   2.066   1.00 0.00 ? 89  ARG B HH12 4  
ATOM 7776  H HH21 . ARG B 2 91  ? -11.011 11.753  4.291   1.00 0.00 ? 89  ARG B HH21 4  
ATOM 7777  H HH22 . ARG B 2 91  ? -12.299 11.284  3.226   1.00 0.00 ? 89  ARG B HH22 4  
ATOM 7778  N N    . ASP B 2 92  ? -9.871  7.880   -0.454  1.00 0.00 ? 90  ASP B N    4  
ATOM 7779  C CA   . ASP B 2 92  ? -10.993 7.007   -0.724  1.00 0.00 ? 90  ASP B CA   4  
ATOM 7780  C C    . ASP B 2 92  ? -10.715 6.023   -1.848  1.00 0.00 ? 90  ASP B C    4  
ATOM 7781  O O    . ASP B 2 92  ? -11.010 4.846   -1.704  1.00 0.00 ? 90  ASP B O    4  
ATOM 7782  C CB   . ASP B 2 92  ? -12.242 7.843   -1.000  1.00 0.00 ? 90  ASP B CB   4  
ATOM 7783  C CG   . ASP B 2 92  ? -13.033 8.074   0.267   1.00 0.00 ? 90  ASP B CG   4  
ATOM 7784  O OD1  . ASP B 2 92  ? -13.260 9.243   0.634   1.00 0.00 ? 90  ASP B OD1  4  
ATOM 7785  O OD2  . ASP B 2 92  ? -13.388 7.068   0.925   1.00 0.00 ? 90  ASP B OD2  4  
ATOM 7786  H H    . ASP B 2 92  ? -9.973  8.844   -0.623  1.00 0.00 ? 90  ASP B H    4  
ATOM 7787  H HA   . ASP B 2 92  ? -11.167 6.434   0.177   1.00 0.00 ? 90  ASP B HA   4  
ATOM 7788  H HB2  . ASP B 2 92  ? -11.937 8.804   -1.391  1.00 0.00 ? 90  ASP B HB2  4  
ATOM 7789  H HB3  . ASP B 2 92  ? -12.866 7.356   -1.725  1.00 0.00 ? 90  ASP B HB3  4  
ATOM 7790  N N    . ALA B 2 93  ? -10.130 6.485   -2.942  1.00 0.00 ? 91  ALA B N    4  
ATOM 7791  C CA   . ALA B 2 93  ? -9.828  5.609   -4.075  1.00 0.00 ? 91  ALA B CA   4  
ATOM 7792  C C    . ALA B 2 93  ? -8.738  4.597   -3.724  1.00 0.00 ? 91  ALA B C    4  
ATOM 7793  O O    . ALA B 2 93  ? -8.865  3.420   -4.053  1.00 0.00 ? 91  ALA B O    4  
ATOM 7794  C CB   . ALA B 2 93  ? -9.430  6.432   -5.288  1.00 0.00 ? 91  ALA B CB   4  
ATOM 7795  H H    . ALA B 2 93  ? -9.908  7.443   -2.998  1.00 0.00 ? 91  ALA B H    4  
ATOM 7796  H HA   . ALA B 2 93  ? -10.735 5.056   -4.321  1.00 0.00 ? 91  ALA B HA   4  
ATOM 7797  H HB1  . ALA B 2 93  ? -8.499  6.943   -5.086  1.00 0.00 ? 91  ALA B HB1  4  
ATOM 7798  H HB2  . ALA B 2 93  ? -10.200 7.159   -5.500  1.00 0.00 ? 91  ALA B HB2  4  
ATOM 7799  H HB3  . ALA B 2 93  ? -9.305  5.781   -6.140  1.00 0.00 ? 91  ALA B HB3  4  
ATOM 7800  N N    . VAL B 2 94  ? -7.663  5.051   -3.073  1.00 0.00 ? 92  VAL B N    4  
ATOM 7801  C CA   . VAL B 2 94  ? -6.592  4.140   -2.657  1.00 0.00 ? 92  VAL B CA   4  
ATOM 7802  C C    . VAL B 2 94  ? -7.198  3.116   -1.703  1.00 0.00 ? 92  VAL B C    4  
ATOM 7803  O O    . VAL B 2 94  ? -6.945  1.918   -1.810  1.00 0.00 ? 92  VAL B O    4  
ATOM 7804  C CB   . VAL B 2 94  ? -5.432  4.883   -1.958  1.00 0.00 ? 92  VAL B CB   4  
ATOM 7805  C CG1  . VAL B 2 94  ? -4.303  3.923   -1.628  1.00 0.00 ? 92  VAL B CG1  4  
ATOM 7806  C CG2  . VAL B 2 94  ? -4.908  6.008   -2.830  1.00 0.00 ? 92  VAL B CG2  4  
ATOM 7807  H H    . VAL B 2 94  ? -7.592  6.010   -2.864  1.00 0.00 ? 92  VAL B H    4  
ATOM 7808  H HA   . VAL B 2 94  ? -6.194  3.630   -3.535  1.00 0.00 ? 92  VAL B HA   4  
ATOM 7809  H HB   . VAL B 2 94  ? -5.801  5.309   -1.036  1.00 0.00 ? 92  VAL B HB   4  
ATOM 7810  H HG11 . VAL B 2 94  ? -3.938  3.470   -2.538  1.00 0.00 ? 92  VAL B HG11 4  
ATOM 7811  H HG12 . VAL B 2 94  ? -4.669  3.152   -0.965  1.00 0.00 ? 92  VAL B HG12 4  
ATOM 7812  H HG13 . VAL B 2 94  ? -3.502  4.461   -1.146  1.00 0.00 ? 92  VAL B HG13 4  
ATOM 7813  H HG21 . VAL B 2 94  ? -5.710  6.699   -3.048  1.00 0.00 ? 92  VAL B HG21 4  
ATOM 7814  H HG22 . VAL B 2 94  ? -4.522  5.600   -3.752  1.00 0.00 ? 92  VAL B HG22 4  
ATOM 7815  H HG23 . VAL B 2 94  ? -4.118  6.528   -2.308  1.00 0.00 ? 92  VAL B HG23 4  
ATOM 7816  N N    . LYS B 2 95  ? -8.038  3.619   -0.796  1.00 0.00 ? 93  LYS B N    4  
ATOM 7817  C CA   . LYS B 2 95  ? -8.747  2.794   0.176   1.00 0.00 ? 93  LYS B CA   4  
ATOM 7818  C C    . LYS B 2 95  ? -9.612  1.774   -0.547  1.00 0.00 ? 93  LYS B C    4  
ATOM 7819  O O    . LYS B 2 95  ? -9.510  0.573   -0.322  1.00 0.00 ? 93  LYS B O    4  
ATOM 7820  C CB   . LYS B 2 95  ? -9.641  3.684   1.049   1.00 0.00 ? 93  LYS B CB   4  
ATOM 7821  C CG   . LYS B 2 95  ? -10.576 2.923   1.975   1.00 0.00 ? 93  LYS B CG   4  
ATOM 7822  C CD   . LYS B 2 95  ? -11.717 3.809   2.466   1.00 0.00 ? 93  LYS B CD   4  
ATOM 7823  C CE   . LYS B 2 95  ? -12.979 3.630   1.628   1.00 0.00 ? 93  LYS B CE   4  
ATOM 7824  N NZ   . LYS B 2 95  ? -12.976 4.471   0.397   1.00 0.00 ? 93  LYS B NZ   4  
ATOM 7825  H H    . LYS B 2 95  ? -8.181  4.590   -0.779  1.00 0.00 ? 93  LYS B H    4  
ATOM 7826  H HA   . LYS B 2 95  ? -8.023  2.285   0.795   1.00 0.00 ? 93  LYS B HA   4  
ATOM 7827  H HB2  . LYS B 2 95  ? -9.015  4.323   1.651   1.00 0.00 ? 93  LYS B HB2  4  
ATOM 7828  H HB3  . LYS B 2 95  ? -10.243 4.303   0.400   1.00 0.00 ? 93  LYS B HB3  4  
ATOM 7829  H HG2  . LYS B 2 95  ? -10.992 2.082   1.440   1.00 0.00 ? 93  LYS B HG2  4  
ATOM 7830  H HG3  . LYS B 2 95  ? -10.015 2.569   2.828   1.00 0.00 ? 93  LYS B HG3  4  
ATOM 7831  H HD2  . LYS B 2 95  ? -11.940 3.554   3.490   1.00 0.00 ? 93  LYS B HD2  4  
ATOM 7832  H HD3  . LYS B 2 95  ? -11.403 4.842   2.411   1.00 0.00 ? 93  LYS B HD3  4  
ATOM 7833  H HE2  . LYS B 2 95  ? -13.056 2.593   1.338   1.00 0.00 ? 93  LYS B HE2  4  
ATOM 7834  H HE3  . LYS B 2 95  ? -13.834 3.897   2.232   1.00 0.00 ? 93  LYS B HE3  4  
ATOM 7835  H HZ1  . LYS B 2 95  ? -13.583 4.030   -0.337  1.00 0.00 ? 93  LYS B HZ1  4  
ATOM 7836  H HZ2  . LYS B 2 95  ? -12.014 4.556   0.020   1.00 0.00 ? 93  LYS B HZ2  4  
ATOM 7837  H HZ3  . LYS B 2 95  ? -13.345 5.428   0.608   1.00 0.00 ? 93  LYS B HZ3  4  
ATOM 7838  N N    . ASP B 2 96  ? -10.459 2.293   -1.419  1.00 0.00 ? 94  ASP B N    4  
ATOM 7839  C CA   . ASP B 2 96  ? -11.376 1.495   -2.218  1.00 0.00 ? 94  ASP B CA   4  
ATOM 7840  C C    . ASP B 2 96  ? -10.644 0.409   -2.985  1.00 0.00 ? 94  ASP B C    4  
ATOM 7841  O O    . ASP B 2 96  ? -10.964 -0.768  -2.860  1.00 0.00 ? 94  ASP B O    4  
ATOM 7842  C CB   . ASP B 2 96  ? -12.123 2.413   -3.192  1.00 0.00 ? 94  ASP B CB   4  
ATOM 7843  C CG   . ASP B 2 96  ? -13.424 2.941   -2.617  1.00 0.00 ? 94  ASP B CG   4  
ATOM 7844  O OD1  . ASP B 2 96  ? -13.664 2.748   -1.404  1.00 0.00 ? 94  ASP B OD1  4  
ATOM 7845  O OD2  . ASP B 2 96  ? -14.197 3.559   -3.370  1.00 0.00 ? 94  ASP B OD2  4  
ATOM 7846  H H    . ASP B 2 96  ? -10.472 3.269   -1.535  1.00 0.00 ? 94  ASP B H    4  
ATOM 7847  H HA   . ASP B 2 96  ? -12.090 1.031   -1.550  1.00 0.00 ? 94  ASP B HA   4  
ATOM 7848  H HB2  . ASP B 2 96  ? -11.492 3.260   -3.415  1.00 0.00 ? 94  ASP B HB2  4  
ATOM 7849  H HB3  . ASP B 2 96  ? -12.329 1.889   -4.104  1.00 0.00 ? 94  ASP B HB3  4  
ATOM 7850  N N    . LEU B 2 97  ? -9.643  0.810   -3.750  1.00 0.00 ? 95  LEU B N    4  
ATOM 7851  C CA   . LEU B 2 97  ? -8.869  -0.122  -4.554  1.00 0.00 ? 95  LEU B CA   4  
ATOM 7852  C C    . LEU B 2 97  ? -8.157  -1.148  -3.682  1.00 0.00 ? 95  LEU B C    4  
ATOM 7853  O O    . LEU B 2 97  ? -8.141  -2.317  -4.016  1.00 0.00 ? 95  LEU B O    4  
ATOM 7854  C CB   . LEU B 2 97  ? -7.858  0.634   -5.419  1.00 0.00 ? 95  LEU B CB   4  
ATOM 7855  C CG   . LEU B 2 97  ? -7.432  -0.088  -6.699  1.00 0.00 ? 95  LEU B CG   4  
ATOM 7856  C CD1  . LEU B 2 97  ? -8.621  -0.282  -7.627  1.00 0.00 ? 95  LEU B CD1  4  
ATOM 7857  C CD2  . LEU B 2 97  ? -6.327  0.682   -7.404  1.00 0.00 ? 95  LEU B CD2  4  
ATOM 7858  H H    . LEU B 2 97  ? -9.416  1.767   -3.774  1.00 0.00 ? 95  LEU B H    4  
ATOM 7859  H HA   . LEU B 2 97  ? -9.559  -0.654  -5.201  1.00 0.00 ? 95  LEU B HA   4  
ATOM 7860  H HB2  . LEU B 2 97  ? -8.291  1.584   -5.694  1.00 0.00 ? 95  LEU B HB2  4  
ATOM 7861  H HB3  . LEU B 2 97  ? -6.974  0.818   -4.826  1.00 0.00 ? 95  LEU B HB3  4  
ATOM 7862  H HG   . LEU B 2 97  ? -7.047  -1.065  -6.441  1.00 0.00 ? 95  LEU B HG   4  
ATOM 7863  H HD11 . LEU B 2 97  ? -8.296  -0.779  -8.530  1.00 0.00 ? 95  LEU B HD11 4  
ATOM 7864  H HD12 . LEU B 2 97  ? -9.044  0.680   -7.877  1.00 0.00 ? 95  LEU B HD12 4  
ATOM 7865  H HD13 . LEU B 2 97  ? -9.368  -0.886  -7.132  1.00 0.00 ? 95  LEU B HD13 4  
ATOM 7866  H HD21 . LEU B 2 97  ? -5.461  0.740   -6.760  1.00 0.00 ? 95  LEU B HD21 4  
ATOM 7867  H HD22 . LEU B 2 97  ? -6.672  1.679   -7.632  1.00 0.00 ? 95  LEU B HD22 4  
ATOM 7868  H HD23 . LEU B 2 97  ? -6.062  0.174   -8.319  1.00 0.00 ? 95  LEU B HD23 4  
ATOM 7869  N N    . LEU B 2 98  ? -7.588  -0.722  -2.562  1.00 0.00 ? 96  LEU B N    4  
ATOM 7870  C CA   . LEU B 2 98  ? -6.892  -1.649  -1.667  1.00 0.00 ? 96  LEU B CA   4  
ATOM 7871  C C    . LEU B 2 98  ? -7.891  -2.582  -0.995  1.00 0.00 ? 96  LEU B C    4  
ATOM 7872  O O    . LEU B 2 98  ? -7.666  -3.775  -0.921  1.00 0.00 ? 96  LEU B O    4  
ATOM 7873  C CB   . LEU B 2 98  ? -6.107  -0.893  -0.595  1.00 0.00 ? 96  LEU B CB   4  
ATOM 7874  C CG   . LEU B 2 98  ? -4.780  -0.288  -1.043  1.00 0.00 ? 96  LEU B CG   4  
ATOM 7875  C CD1  . LEU B 2 98  ? -4.363  0.821   -0.092  1.00 0.00 ? 96  LEU B CD1  4  
ATOM 7876  C CD2  . LEU B 2 98  ? -3.706  -1.358  -1.109  1.00 0.00 ? 96  LEU B CD2  4  
ATOM 7877  H H    . LEU B 2 98  ? -7.643  0.231   -2.326  1.00 0.00 ? 96  LEU B H    4  
ATOM 7878  H HA   . LEU B 2 98  ? -6.202  -2.250  -2.268  1.00 0.00 ? 96  LEU B HA   4  
ATOM 7879  H HB2  . LEU B 2 98  ? -6.732  -0.094  -0.223  1.00 0.00 ? 96  LEU B HB2  4  
ATOM 7880  H HB3  . LEU B 2 98  ? -5.907  -1.575  0.219   1.00 0.00 ? 96  LEU B HB3  4  
ATOM 7881  H HG   . LEU B 2 98  ? -4.898  0.136   -2.030  1.00 0.00 ? 96  LEU B HG   4  
ATOM 7882  H HD11 . LEU B 2 98  ? -4.293  0.429   0.912   1.00 0.00 ? 96  LEU B HD11 4  
ATOM 7883  H HD12 . LEU B 2 98  ? -5.096  1.615   -0.118  1.00 0.00 ? 96  LEU B HD12 4  
ATOM 7884  H HD13 . LEU B 2 98  ? -3.401  1.211   -0.393  1.00 0.00 ? 96  LEU B HD13 4  
ATOM 7885  H HD21 . LEU B 2 98  ? -3.997  -2.118  -1.819  1.00 0.00 ? 96  LEU B HD21 4  
ATOM 7886  H HD22 . LEU B 2 98  ? -3.583  -1.806  -0.133  1.00 0.00 ? 96  LEU B HD22 4  
ATOM 7887  H HD23 . LEU B 2 98  ? -2.773  -0.913  -1.421  1.00 0.00 ? 96  LEU B HD23 4  
ATOM 7888  N N    . GLN B 2 99  ? -8.999  -2.032  -0.516  1.00 0.00 ? 97  GLN B N    4  
ATOM 7889  C CA   . GLN B 2 99  ? -10.042 -2.832  0.131   1.00 0.00 ? 97  GLN B CA   4  
ATOM 7890  C C    . GLN B 2 99  ? -10.602 -3.834  -0.879  1.00 0.00 ? 97  GLN B C    4  
ATOM 7891  O O    . GLN B 2 99  ? -11.128 -4.888  -0.533  1.00 0.00 ? 97  GLN B O    4  
ATOM 7892  C CB   . GLN B 2 99  ? -11.141 -1.903  0.668   1.00 0.00 ? 97  GLN B CB   4  
ATOM 7893  C CG   . GLN B 2 99  ? -12.408 -2.608  1.126   1.00 0.00 ? 97  GLN B CG   4  
ATOM 7894  C CD   . GLN B 2 99  ? -12.200 -3.483  2.353   1.00 0.00 ? 97  GLN B CD   4  
ATOM 7895  O OE1  . GLN B 2 99  ? -12.861 -4.507  2.511   1.00 0.00 ? 97  GLN B OE1  4  
ATOM 7896  N NE2  . GLN B 2 99  ? -11.293 -3.079  3.232   1.00 0.00 ? 97  GLN B NE2  4  
ATOM 7897  H H    . GLN B 2 99  ? -9.129  -1.056  -0.604  1.00 0.00 ? 97  GLN B H    4  
ATOM 7898  H HA   . GLN B 2 99  ? -9.589  -3.371  0.953   1.00 0.00 ? 97  GLN B HA   4  
ATOM 7899  H HB2  . GLN B 2 99  ? -10.745 -1.352  1.508   1.00 0.00 ? 97  GLN B HB2  4  
ATOM 7900  H HB3  . GLN B 2 99  ? -11.409 -1.202  -0.109  1.00 0.00 ? 97  GLN B HB3  4  
ATOM 7901  H HG2  . GLN B 2 99  ? -13.150 -1.859  1.360   1.00 0.00 ? 97  GLN B HG2  4  
ATOM 7902  H HG3  . GLN B 2 99  ? -12.767 -3.226  0.317   1.00 0.00 ? 97  GLN B HG3  4  
ATOM 7903  H HE21 . GLN B 2 99  ? -10.809 -2.252  3.053   1.00 0.00 ? 97  GLN B HE21 4  
ATOM 7904  H HE22 . GLN B 2 99  ? -11.141 -3.636  4.038   1.00 0.00 ? 97  GLN B HE22 4  
ATOM 7905  N N    . GLN B 2 100 ? -10.455 -3.476  -2.137  1.00 0.00 ? 98  GLN B N    4  
ATOM 7906  C CA   . GLN B 2 100 ? -10.887 -4.287  -3.254  1.00 0.00 ? 98  GLN B CA   4  
ATOM 7907  C C    . GLN B 2 100 ? -9.828  -5.315  -3.634  1.00 0.00 ? 98  GLN B C    4  
ATOM 7908  O O    . GLN B 2 100 ? -10.117 -6.477  -3.897  1.00 0.00 ? 98  GLN B O    4  
ATOM 7909  C CB   . GLN B 2 100 ? -11.119 -3.363  -4.446  1.00 0.00 ? 98  GLN B CB   4  
ATOM 7910  C CG   . GLN B 2 100 ? -12.534 -2.840  -4.556  1.00 0.00 ? 98  GLN B CG   4  
ATOM 7911  C CD   . GLN B 2 100 ? -13.252 -3.375  -5.777  1.00 0.00 ? 98  GLN B CD   4  
ATOM 7912  O OE1  . GLN B 2 100 ? -12.977 -4.485  -6.240  1.00 0.00 ? 98  GLN B OE1  4  
ATOM 7913  N NE2  . GLN B 2 100 ? -14.170 -2.585  -6.310  1.00 0.00 ? 98  GLN B NE2  4  
ATOM 7914  H H    . GLN B 2 100 ? -10.049 -2.602  -2.325  1.00 0.00 ? 98  GLN B H    4  
ATOM 7915  H HA   . GLN B 2 100 ? -11.806 -4.785  -2.997  1.00 0.00 ? 98  GLN B HA   4  
ATOM 7916  H HB2  . GLN B 2 100 ? -10.462 -2.510  -4.339  1.00 0.00 ? 98  GLN B HB2  4  
ATOM 7917  H HB3  . GLN B 2 100 ? -10.859 -3.877  -5.353  1.00 0.00 ? 98  GLN B HB3  4  
ATOM 7918  H HG2  . GLN B 2 100 ? -13.083 -3.131  -3.674  1.00 0.00 ? 98  GLN B HG2  4  
ATOM 7919  H HG3  . GLN B 2 100 ? -12.499 -1.761  -4.619  1.00 0.00 ? 98  GLN B HG3  4  
ATOM 7920  H HE21 . GLN B 2 100 ? -14.329 -1.711  -5.888  1.00 0.00 ? 98  GLN B HE21 4  
ATOM 7921  H HE22 . GLN B 2 100 ? -14.652 -2.902  -7.100  1.00 0.00 ? 98  GLN B HE22 4  
ATOM 7922  N N    . LEU B 2 101 ? -8.610  -4.839  -3.681  1.00 0.00 ? 99  LEU B N    4  
ATOM 7923  C CA   . LEU B 2 101 ? -7.446  -5.613  -4.082  1.00 0.00 ? 99  LEU B CA   4  
ATOM 7924  C C    . LEU B 2 101 ? -6.851  -6.511  -2.989  1.00 0.00 ? 99  LEU B C    4  
ATOM 7925  O O    . LEU B 2 101 ? -6.591  -7.686  -3.238  1.00 0.00 ? 99  LEU B O    4  
ATOM 7926  C CB   . LEU B 2 101 ? -6.404  -4.612  -4.577  1.00 0.00 ? 99  LEU B CB   4  
ATOM 7927  C CG   . LEU B 2 101 ? -6.594  -4.174  -6.033  1.00 0.00 ? 99  LEU B CG   4  
ATOM 7928  C CD1  . LEU B 2 101 ? -5.702  -2.991  -6.362  1.00 0.00 ? 99  LEU B CD1  4  
ATOM 7929  C CD2  . LEU B 2 101 ? -6.326  -5.328  -6.983  1.00 0.00 ? 99  LEU B CD2  4  
ATOM 7930  H H    . LEU B 2 101 ? -8.481  -3.889  -3.462  1.00 0.00 ? 99  LEU B H    4  
ATOM 7931  H HA   . LEU B 2 101 ? -7.737  -6.233  -4.915  1.00 0.00 ? 99  LEU B HA   4  
ATOM 7932  H HB2  . LEU B 2 101 ? -6.473  -3.731  -3.953  1.00 0.00 ? 99  LEU B HB2  4  
ATOM 7933  H HB3  . LEU B 2 101 ? -5.423  -5.028  -4.458  1.00 0.00 ? 99  LEU B HB3  4  
ATOM 7934  H HG   . LEU B 2 101 ? -7.621  -3.862  -6.171  1.00 0.00 ? 99  LEU B HG   4  
ATOM 7935  H HD11 . LEU B 2 101 ? -5.824  -2.726  -7.402  1.00 0.00 ? 99  LEU B HD11 4  
ATOM 7936  H HD12 . LEU B 2 101 ? -4.672  -3.253  -6.175  1.00 0.00 ? 99  LEU B HD12 4  
ATOM 7937  H HD13 . LEU B 2 101 ? -5.977  -2.150  -5.742  1.00 0.00 ? 99  LEU B HD13 4  
ATOM 7938  H HD21 . LEU B 2 101 ? -5.308  -5.667  -6.861  1.00 0.00 ? 99  LEU B HD21 4  
ATOM 7939  H HD22 . LEU B 2 101 ? -6.476  -4.998  -8.001  1.00 0.00 ? 99  LEU B HD22 4  
ATOM 7940  H HD23 . LEU B 2 101 ? -7.003  -6.140  -6.764  1.00 0.00 ? 99  LEU B HD23 4  
ATOM 7941  N N    . LEU B 2 102 ? -6.664  -5.968  -1.792  1.00 0.00 ? 100 LEU B N    4  
ATOM 7942  C CA   . LEU B 2 102 ? -6.038  -6.699  -0.682  1.00 0.00 ? 100 LEU B CA   4  
ATOM 7943  C C    . LEU B 2 102 ? -6.643  -8.090  -0.421  1.00 0.00 ? 100 LEU B C    4  
ATOM 7944  O O    . LEU B 2 102 ? -5.916  -9.082  -0.465  1.00 0.00 ? 100 LEU B O    4  
ATOM 7945  C CB   . LEU B 2 102 ? -6.024  -5.851  0.597   1.00 0.00 ? 100 LEU B CB   4  
ATOM 7946  C CG   . LEU B 2 102 ? -5.018  -4.701  0.546   1.00 0.00 ? 100 LEU B CG   4  
ATOM 7947  C CD1  . LEU B 2 102 ? -4.945  -3.939  1.861   1.00 0.00 ? 100 LEU B CD1  4  
ATOM 7948  C CD2  . LEU B 2 102 ? -3.653  -5.226  0.186   1.00 0.00 ? 100 LEU B CD2  4  
ATOM 7949  H H    . LEU B 2 102 ? -6.973  -5.047  -1.636  1.00 0.00 ? 100 LEU B H    4  
ATOM 7950  H HA   . LEU B 2 102 ? -5.009  -6.840  -0.971  1.00 0.00 ? 100 LEU B HA   4  
ATOM 7951  H HB2  . LEU B 2 102 ? -7.013  -5.441  0.750   1.00 0.00 ? 100 LEU B HB2  4  
ATOM 7952  H HB3  . LEU B 2 102 ? -5.776  -6.486  1.432   1.00 0.00 ? 100 LEU B HB3  4  
ATOM 7953  H HG   . LEU B 2 102 ? -5.318  -4.020  -0.229  1.00 0.00 ? 100 LEU B HG   4  
ATOM 7954  H HD11 . LEU B 2 102 ? -4.648  -4.613  2.652   1.00 0.00 ? 100 LEU B HD11 4  
ATOM 7955  H HD12 . LEU B 2 102 ? -5.907  -3.513  2.089   1.00 0.00 ? 100 LEU B HD12 4  
ATOM 7956  H HD13 . LEU B 2 102 ? -4.210  -3.148  1.774   1.00 0.00 ? 100 LEU B HD13 4  
ATOM 7957  H HD21 . LEU B 2 102 ? -3.706  -5.755  -0.754  1.00 0.00 ? 100 LEU B HD21 4  
ATOM 7958  H HD22 . LEU B 2 102 ? -3.311  -5.897  0.959   1.00 0.00 ? 100 LEU B HD22 4  
ATOM 7959  H HD23 . LEU B 2 102 ? -2.963  -4.401  0.094   1.00 0.00 ? 100 LEU B HD23 4  
ATOM 7960  N N    . PRO B 2 103 ? -7.967  -8.205  -0.166  1.00 0.00 ? 101 PRO B N    4  
ATOM 7961  C CA   . PRO B 2 103 ? -8.611  -9.507  0.106   1.00 0.00 ? 101 PRO B CA   4  
ATOM 7962  C C    . PRO B 2 103 ? -8.423  -10.539 -1.003  1.00 0.00 ? 101 PRO B C    4  
ATOM 7963  O O    . PRO B 2 103 ? -8.538  -11.741 -0.772  1.00 0.00 ? 101 PRO B O    4  
ATOM 7964  C CB   . PRO B 2 103 ? -10.094 -9.153  0.251   1.00 0.00 ? 101 PRO B CB   4  
ATOM 7965  C CG   . PRO B 2 103 ? -10.101 -7.717  0.636   1.00 0.00 ? 101 PRO B CG   4  
ATOM 7966  C CD   . PRO B 2 103 ? -8.940  -7.100  -0.087  1.00 0.00 ? 101 PRO B CD   4  
ATOM 7967  H HA   . PRO B 2 103 ? -8.259  -9.931  1.027   1.00 0.00 ? 101 PRO B HA   4  
ATOM 7968  H HB2  . PRO B 2 103 ? -10.598 -9.314  -0.691  1.00 0.00 ? 101 PRO B HB2  4  
ATOM 7969  H HB3  . PRO B 2 103 ? -10.541 -9.769  1.017   1.00 0.00 ? 101 PRO B HB3  4  
ATOM 7970  H HG2  . PRO B 2 103 ? -11.027 -7.257  0.325   1.00 0.00 ? 101 PRO B HG2  4  
ATOM 7971  H HG3  . PRO B 2 103 ? -9.972  -7.621  1.704   1.00 0.00 ? 101 PRO B HG3  4  
ATOM 7972  H HD2  . PRO B 2 103 ? -9.237  -6.776  -1.074  1.00 0.00 ? 101 PRO B HD2  4  
ATOM 7973  H HD3  . PRO B 2 103 ? -8.537  -6.273  0.479   1.00 0.00 ? 101 PRO B HD3  4  
ATOM 7974  N N    . LYS B 2 104 ? -8.144  -10.081 -2.209  1.00 0.00 ? 102 LYS B N    4  
ATOM 7975  C CA   . LYS B 2 104 ? -7.965  -10.991 -3.325  1.00 0.00 ? 102 LYS B CA   4  
ATOM 7976  C C    . LYS B 2 104 ? -6.521  -11.473 -3.472  1.00 0.00 ? 102 LYS B C    4  
ATOM 7977  O O    . LYS B 2 104 ? -6.252  -12.399 -4.236  1.00 0.00 ? 102 LYS B O    4  
ATOM 7978  C CB   . LYS B 2 104 ? -8.478  -10.352 -4.610  1.00 0.00 ? 102 LYS B CB   4  
ATOM 7979  C CG   . LYS B 2 104 ? -9.982  -10.513 -4.759  1.00 0.00 ? 102 LYS B CG   4  
ATOM 7980  C CD   . LYS B 2 104 ? -10.685 -9.194  -5.038  1.00 0.00 ? 102 LYS B CD   4  
ATOM 7981  C CE   . LYS B 2 104 ? -10.223 -8.557  -6.339  1.00 0.00 ? 102 LYS B CE   4  
ATOM 7982  N NZ   . LYS B 2 104 ? -10.727 -7.161  -6.469  1.00 0.00 ? 102 LYS B NZ   4  
ATOM 7983  H H    . LYS B 2 104 ? -8.039  -9.115  -2.348  1.00 0.00 ? 102 LYS B H    4  
ATOM 7984  H HA   . LYS B 2 104 ? -8.577  -11.857 -3.119  1.00 0.00 ? 102 LYS B HA   4  
ATOM 7985  H HB2  . LYS B 2 104 ? -8.241  -9.297  -4.600  1.00 0.00 ? 102 LYS B HB2  4  
ATOM 7986  H HB3  . LYS B 2 104 ? -7.998  -10.818 -5.456  1.00 0.00 ? 102 LYS B HB3  4  
ATOM 7987  H HG2  . LYS B 2 104 ? -10.181 -11.194 -5.567  1.00 0.00 ? 102 LYS B HG2  4  
ATOM 7988  H HG3  . LYS B 2 104 ? -10.371 -10.926 -3.836  1.00 0.00 ? 102 LYS B HG3  4  
ATOM 7989  H HD2  . LYS B 2 104 ? -11.748 -9.373  -5.098  1.00 0.00 ? 102 LYS B HD2  4  
ATOM 7990  H HD3  . LYS B 2 104 ? -10.481 -8.513  -4.224  1.00 0.00 ? 102 LYS B HD3  4  
ATOM 7991  H HE2  . LYS B 2 104 ? -9.144  -8.546  -6.359  1.00 0.00 ? 102 LYS B HE2  4  
ATOM 7992  H HE3  . LYS B 2 104 ? -10.596 -9.144  -7.167  1.00 0.00 ? 102 LYS B HE3  4  
ATOM 7993  H HZ1  . LYS B 2 104 ? -10.281 -6.691  -7.282  1.00 0.00 ? 102 LYS B HZ1  4  
ATOM 7994  H HZ2  . LYS B 2 104 ? -10.502 -6.622  -5.604  1.00 0.00 ? 102 LYS B HZ2  4  
ATOM 7995  H HZ3  . LYS B 2 104 ? -11.759 -7.161  -6.601  1.00 0.00 ? 102 LYS B HZ3  4  
ATOM 7996  N N    . PHE B 2 105 ? -5.592  -10.859 -2.746  1.00 0.00 ? 103 PHE B N    4  
ATOM 7997  C CA   . PHE B 2 105 ? -4.189  -11.263 -2.828  1.00 0.00 ? 103 PHE B CA   4  
ATOM 7998  C C    . PHE B 2 105 ? -3.608  -11.559 -1.453  1.00 0.00 ? 103 PHE B C    4  
ATOM 7999  O O    . PHE B 2 105 ? -2.408  -11.775 -1.323  1.00 0.00 ? 103 PHE B O    4  
ATOM 8000  C CB   . PHE B 2 105 ? -3.340  -10.183 -3.508  1.00 0.00 ? 103 PHE B CB   4  
ATOM 8001  C CG   . PHE B 2 105 ? -3.769  -9.860  -4.910  1.00 0.00 ? 103 PHE B CG   4  
ATOM 8002  C CD1  . PHE B 2 105 ? -4.342  -8.635  -5.204  1.00 0.00 ? 103 PHE B CD1  4  
ATOM 8003  C CD2  . PHE B 2 105 ? -3.598  -10.778 -5.935  1.00 0.00 ? 103 PHE B CD2  4  
ATOM 8004  C CE1  . PHE B 2 105 ? -4.737  -8.330  -6.491  1.00 0.00 ? 103 PHE B CE1  4  
ATOM 8005  C CE2  . PHE B 2 105 ? -3.992  -10.478 -7.226  1.00 0.00 ? 103 PHE B CE2  4  
ATOM 8006  C CZ   . PHE B 2 105 ? -4.563  -9.251  -7.504  1.00 0.00 ? 103 PHE B CZ   4  
ATOM 8007  H H    . PHE B 2 105 ? -5.851  -10.121 -2.149  1.00 0.00 ? 103 PHE B H    4  
ATOM 8008  H HA   . PHE B 2 105 ? -4.143  -12.163 -3.422  1.00 0.00 ? 103 PHE B HA   4  
ATOM 8009  H HB2  . PHE B 2 105 ? -3.390  -9.276  -2.925  1.00 0.00 ? 103 PHE B HB2  4  
ATOM 8010  H HB3  . PHE B 2 105 ? -2.312  -10.519 -3.544  1.00 0.00 ? 103 PHE B HB3  4  
ATOM 8011  H HD1  . PHE B 2 105 ? -4.479  -7.911  -4.415  1.00 0.00 ? 103 PHE B HD1  4  
ATOM 8012  H HD2  . PHE B 2 105 ? -3.152  -11.737 -5.717  1.00 0.00 ? 103 PHE B HD2  4  
ATOM 8013  H HE1  . PHE B 2 105 ? -5.184  -7.371  -6.706  1.00 0.00 ? 103 PHE B HE1  4  
ATOM 8014  H HE2  . PHE B 2 105 ? -3.854  -11.202 -8.015  1.00 0.00 ? 103 PHE B HE2  4  
ATOM 8015  H HZ   . PHE B 2 105 ? -4.872  -9.011  -8.512  1.00 0.00 ? 103 PHE B HZ   4  
ATOM 8016  N N    . LYS B 2 106 ? -4.452  -11.575 -0.433  1.00 0.00 ? 104 LYS B N    4  
ATOM 8017  C CA   . LYS B 2 106 ? -3.996  -11.830 0.931   1.00 0.00 ? 104 LYS B CA   4  
ATOM 8018  C C    . LYS B 2 106 ? -3.222  -13.145 1.041   1.00 0.00 ? 104 LYS B C    4  
ATOM 8019  O O    . LYS B 2 106 ? -3.675  -14.192 0.577   1.00 0.00 ? 104 LYS B O    4  
ATOM 8020  C CB   . LYS B 2 106 ? -5.175  -11.826 1.916   1.00 0.00 ? 104 LYS B CB   4  
ATOM 8021  C CG   . LYS B 2 106 ? -6.465  -12.430 1.371   1.00 0.00 ? 104 LYS B CG   4  
ATOM 8022  C CD   . LYS B 2 106 ? -6.436  -13.952 1.382   1.00 0.00 ? 104 LYS B CD   4  
ATOM 8023  C CE   . LYS B 2 106 ? -7.796  -14.545 1.061   1.00 0.00 ? 104 LYS B CE   4  
ATOM 8024  N NZ   . LYS B 2 106 ? -8.774  -14.283 2.144   1.00 0.00 ? 104 LYS B NZ   4  
ATOM 8025  H H    . LYS B 2 106 ? -5.403  -11.405 -0.597  1.00 0.00 ? 104 LYS B H    4  
ATOM 8026  H HA   . LYS B 2 106 ? -3.328  -11.025 1.198   1.00 0.00 ? 104 LYS B HA   4  
ATOM 8027  H HB2  . LYS B 2 106 ? -4.891  -12.384 2.796   1.00 0.00 ? 104 LYS B HB2  4  
ATOM 8028  H HB3  . LYS B 2 106 ? -5.380  -10.804 2.205   1.00 0.00 ? 104 LYS B HB3  4  
ATOM 8029  H HG2  . LYS B 2 106 ? -7.292  -12.096 1.978   1.00 0.00 ? 104 LYS B HG2  4  
ATOM 8030  H HG3  . LYS B 2 106 ? -6.605  -12.091 0.355   1.00 0.00 ? 104 LYS B HG3  4  
ATOM 8031  H HD2  . LYS B 2 106 ? -5.725  -14.293 0.646   1.00 0.00 ? 104 LYS B HD2  4  
ATOM 8032  H HD3  . LYS B 2 106 ? -6.129  -14.287 2.362   1.00 0.00 ? 104 LYS B HD3  4  
ATOM 8033  H HE2  . LYS B 2 106 ? -8.160  -14.104 0.145   1.00 0.00 ? 104 LYS B HE2  4  
ATOM 8034  H HE3  . LYS B 2 106 ? -7.690  -15.611 0.932   1.00 0.00 ? 104 LYS B HE3  4  
ATOM 8035  H HZ1  . LYS B 2 106 ? -9.531  -14.988 2.131   1.00 0.00 ? 104 LYS B HZ1  4  
ATOM 8036  H HZ2  . LYS B 2 106 ? -9.199  -13.332 2.024   1.00 0.00 ? 104 LYS B HZ2  4  
ATOM 8037  H HZ3  . LYS B 2 106 ? -8.295  -14.313 3.077   1.00 0.00 ? 104 LYS B HZ3  4  
ATOM 8038  N N    . ARG B 2 107 ? -2.027  -13.063 1.627   1.00 0.00 ? 105 ARG B N    4  
ATOM 8039  C CA   . ARG B 2 107 ? -1.166  -14.229 1.848   1.00 0.00 ? 105 ARG B CA   4  
ATOM 8040  C C    . ARG B 2 107 ? -0.810  -14.945 0.541   1.00 0.00 ? 105 ARG B C    4  
ATOM 8041  O O    . ARG B 2 107 ? -0.435  -16.119 0.552   1.00 0.00 ? 105 ARG B O    4  
ATOM 8042  C CB   . ARG B 2 107 ? -1.841  -15.215 2.812   1.00 0.00 ? 105 ARG B CB   4  
ATOM 8043  C CG   . ARG B 2 107 ? -2.538  -14.549 3.990   1.00 0.00 ? 105 ARG B CG   4  
ATOM 8044  C CD   . ARG B 2 107 ? -3.226  -15.570 4.881   1.00 0.00 ? 105 ARG B CD   4  
ATOM 8045  N NE   . ARG B 2 107 ? -4.312  -14.980 5.665   1.00 0.00 ? 105 ARG B NE   4  
ATOM 8046  C CZ   . ARG B 2 107 ? -4.141  -14.297 6.798   1.00 0.00 ? 105 ARG B CZ   4  
ATOM 8047  N NH1  . ARG B 2 107 ? -2.925  -14.056 7.273   1.00 0.00 ? 105 ARG B NH1  4  
ATOM 8048  N NH2  . ARG B 2 107 ? -5.192  -13.848 7.456   1.00 0.00 ? 105 ARG B NH2  4  
ATOM 8049  H H    . ARG B 2 107 ? -1.701  -12.179 1.912   1.00 0.00 ? 105 ARG B H    4  
ATOM 8050  H HA   . ARG B 2 107 ? -0.253  -13.876 2.303   1.00 0.00 ? 105 ARG B HA   4  
ATOM 8051  H HB2  . ARG B 2 107 ? -2.577  -15.787 2.266   1.00 0.00 ? 105 ARG B HB2  4  
ATOM 8052  H HB3  . ARG B 2 107 ? -1.092  -15.890 3.200   1.00 0.00 ? 105 ARG B HB3  4  
ATOM 8053  H HG2  . ARG B 2 107 ? -1.804  -14.014 4.574   1.00 0.00 ? 105 ARG B HG2  4  
ATOM 8054  H HG3  . ARG B 2 107 ? -3.276  -13.856 3.614   1.00 0.00 ? 105 ARG B HG3  4  
ATOM 8055  H HD2  . ARG B 2 107 ? -3.629  -16.356 4.261   1.00 0.00 ? 105 ARG B HD2  4  
ATOM 8056  H HD3  . ARG B 2 107 ? -2.493  -15.987 5.558   1.00 0.00 ? 105 ARG B HD3  4  
ATOM 8057  H HE   . ARG B 2 107 ? -5.233  -15.111 5.331   1.00 0.00 ? 105 ARG B HE   4  
ATOM 8058  H HH11 . ARG B 2 107 ? -2.118  -14.385 6.786   1.00 0.00 ? 105 ARG B HH11 4  
ATOM 8059  H HH12 . ARG B 2 107 ? -2.818  -13.531 8.124   1.00 0.00 ? 105 ARG B HH12 4  
ATOM 8060  H HH21 . ARG B 2 107 ? -6.130  -14.025 7.108   1.00 0.00 ? 105 ARG B HH21 4  
ATOM 8061  H HH22 . ARG B 2 107 ? -5.066  -13.304 8.301   1.00 0.00 ? 105 ARG B HH22 4  
ATOM 8062  N N    . LYS B 2 108 ? -0.916  -14.241 -0.579  1.00 0.00 ? 106 LYS B N    4  
ATOM 8063  C CA   . LYS B 2 108 ? -0.599  -14.826 -1.875  1.00 0.00 ? 106 LYS B CA   4  
ATOM 8064  C C    . LYS B 2 108 ? 0.902   -14.759 -2.128  1.00 0.00 ? 106 LYS B C    4  
ATOM 8065  O O    . LYS B 2 108 ? 1.384   -13.887 -2.849  1.00 0.00 ? 106 LYS B O    4  
ATOM 8066  C CB   . LYS B 2 108 ? -1.365  -14.108 -2.994  1.00 0.00 ? 106 LYS B CB   4  
ATOM 8067  C CG   . LYS B 2 108 ? -1.613  -14.964 -4.231  1.00 0.00 ? 106 LYS B CG   4  
ATOM 8068  C CD   . LYS B 2 108 ? -0.540  -14.759 -5.294  1.00 0.00 ? 106 LYS B CD   4  
ATOM 8069  C CE   . LYS B 2 108 ? -0.510  -13.323 -5.796  1.00 0.00 ? 106 LYS B CE   4  
ATOM 8070  N NZ   . LYS B 2 108 ? 0.494   -13.122 -6.876  1.00 0.00 ? 106 LYS B NZ   4  
ATOM 8071  H H    . LYS B 2 108 ? -1.217  -13.307 -0.535  1.00 0.00 ? 106 LYS B H    4  
ATOM 8072  H HA   . LYS B 2 108 ? -0.900  -15.863 -1.852  1.00 0.00 ? 106 LYS B HA   4  
ATOM 8073  H HB2  . LYS B 2 108 ? -2.321  -13.787 -2.609  1.00 0.00 ? 106 LYS B HB2  4  
ATOM 8074  H HB3  . LYS B 2 108 ? -0.799  -13.238 -3.295  1.00 0.00 ? 106 LYS B HB3  4  
ATOM 8075  H HG2  . LYS B 2 108 ? -1.619  -16.004 -3.940  1.00 0.00 ? 106 LYS B HG2  4  
ATOM 8076  H HG3  . LYS B 2 108 ? -2.574  -14.702 -4.649  1.00 0.00 ? 106 LYS B HG3  4  
ATOM 8077  H HD2  . LYS B 2 108 ? 0.422   -15.000 -4.869  1.00 0.00 ? 106 LYS B HD2  4  
ATOM 8078  H HD3  . LYS B 2 108 ? -0.743  -15.417 -6.125  1.00 0.00 ? 106 LYS B HD3  4  
ATOM 8079  H HE2  . LYS B 2 108 ? -1.487  -13.069 -6.176  1.00 0.00 ? 106 LYS B HE2  4  
ATOM 8080  H HE3  . LYS B 2 108 ? -0.269  -12.672 -4.967  1.00 0.00 ? 106 LYS B HE3  4  
ATOM 8081  H HZ1  . LYS B 2 108 ? 1.433   -13.477 -6.575  1.00 0.00 ? 106 LYS B HZ1  4  
ATOM 8082  H HZ2  . LYS B 2 108 ? 0.575   -12.102 -7.102  1.00 0.00 ? 106 LYS B HZ2  4  
ATOM 8083  H HZ3  . LYS B 2 108 ? 0.205   -13.626 -7.735  1.00 0.00 ? 106 LYS B HZ3  4  
ATOM 8084  N N    . ALA B 2 109 ? 1.636   -15.677 -1.517  1.00 0.00 ? 107 ALA B N    4  
ATOM 8085  C CA   . ALA B 2 109 ? 3.085   -15.733 -1.666  1.00 0.00 ? 107 ALA B CA   4  
ATOM 8086  C C    . ALA B 2 109 ? 3.474   -16.437 -2.965  1.00 0.00 ? 107 ALA B C    4  
ATOM 8087  O O    . ALA B 2 109 ? 4.231   -17.407 -2.955  1.00 0.00 ? 107 ALA B O    4  
ATOM 8088  C CB   . ALA B 2 109 ? 3.708   -16.434 -0.468  1.00 0.00 ? 107 ALA B CB   4  
ATOM 8089  H H    . ALA B 2 109 ? 1.190   -16.337 -0.943  1.00 0.00 ? 107 ALA B H    4  
ATOM 8090  H HA   . ALA B 2 109 ? 3.456   -14.719 -1.694  1.00 0.00 ? 107 ALA B HA   4  
ATOM 8091  H HB1  . ALA B 2 109 ? 3.387   -15.947 0.442   1.00 0.00 ? 107 ALA B HB1  4  
ATOM 8092  H HB2  . ALA B 2 109 ? 4.784   -16.386 -0.542  1.00 0.00 ? 107 ALA B HB2  4  
ATOM 8093  H HB3  . ALA B 2 109 ? 3.395   -17.468 -0.453  1.00 0.00 ? 107 ALA B HB3  4  
ATOM 8094  N N    . ASN B 2 110 ? 2.946   -15.931 -4.071  1.00 0.00 ? 108 ASN B N    4  
ATOM 8095  C CA   . ASN B 2 110 ? 3.206   -16.481 -5.394  1.00 0.00 ? 108 ASN B CA   4  
ATOM 8096  C C    . ASN B 2 110 ? 2.575   -15.565 -6.436  1.00 0.00 ? 108 ASN B C    4  
ATOM 8097  O O    . ASN B 2 110 ? 1.813   -16.054 -7.297  1.00 0.00 ? 108 ASN B O    4  
ATOM 8098  C CB   . ASN B 2 110 ? 2.636   -17.903 -5.521  1.00 0.00 ? 108 ASN B CB   4  
ATOM 8099  C CG   . ASN B 2 110 ? 3.299   -18.708 -6.626  1.00 0.00 ? 108 ASN B CG   4  
ATOM 8100  O OD1  . ASN B 2 110 ? 4.070   -19.632 -6.366  1.00 0.00 ? 108 ASN B OD1  4  
ATOM 8101  N ND2  . ASN B 2 110 ? 3.013   -18.356 -7.868  1.00 0.00 ? 108 ASN B ND2  4  
ATOM 8102  O OXT  . ASN B 2 110 ? 2.796   -14.341 -6.346  1.00 0.00 ? 108 ASN B OXT  4  
ATOM 8103  H H    . ASN B 2 110 ? 2.370   -15.140 -3.999  1.00 0.00 ? 108 ASN B H    4  
ATOM 8104  H HA   . ASN B 2 110 ? 4.276   -16.506 -5.546  1.00 0.00 ? 108 ASN B HA   4  
ATOM 8105  H HB2  . ASN B 2 110 ? 2.780   -18.425 -4.587  1.00 0.00 ? 108 ASN B HB2  4  
ATOM 8106  H HB3  . ASN B 2 110 ? 1.578   -17.839 -5.733  1.00 0.00 ? 108 ASN B HB3  4  
ATOM 8107  H HD21 . ASN B 2 110 ? 2.394   -17.594 -7.999  1.00 0.00 ? 108 ASN B HD21 4  
ATOM 8108  H HD22 . ASN B 2 110 ? 3.423   -18.857 -8.598  1.00 0.00 ? 108 ASN B HD22 4  
ATOM 8109  N N    . TYR A 1 1   ? 1.980   9.231   15.497  1.00 0.00 ? 392 TYR A N    5  
ATOM 8110  C CA   . TYR A 1 1   ? 3.407   8.855   15.538  1.00 0.00 ? 392 TYR A CA   5  
ATOM 8111  C C    . TYR A 1 1   ? 3.562   7.415   16.020  1.00 0.00 ? 392 TYR A C    5  
ATOM 8112  O O    . TYR A 1 1   ? 4.086   7.154   17.104  1.00 0.00 ? 392 TYR A O    5  
ATOM 8113  C CB   . TYR A 1 1   ? 4.192   9.825   16.438  1.00 0.00 ? 392 TYR A CB   5  
ATOM 8114  C CG   . TYR A 1 1   ? 5.670   9.502   16.571  1.00 0.00 ? 392 TYR A CG   5  
ATOM 8115  C CD1  . TYR A 1 1   ? 6.369   9.830   17.725  1.00 0.00 ? 392 TYR A CD1  5  
ATOM 8116  C CD2  . TYR A 1 1   ? 6.360   8.857   15.550  1.00 0.00 ? 392 TYR A CD2  5  
ATOM 8117  C CE1  . TYR A 1 1   ? 7.711   9.527   17.857  1.00 0.00 ? 392 TYR A CE1  5  
ATOM 8118  C CE2  . TYR A 1 1   ? 7.701   8.551   15.676  1.00 0.00 ? 392 TYR A CE2  5  
ATOM 8119  C CZ   . TYR A 1 1   ? 8.372   8.888   16.830  1.00 0.00 ? 392 TYR A CZ   5  
ATOM 8120  O OH   . TYR A 1 1   ? 9.707   8.583   16.958  1.00 0.00 ? 392 TYR A OH   5  
ATOM 8121  H H1   . TYR A 1 1   ? 1.565   9.174   16.445  1.00 0.00 ? 392 TYR A H1   5  
ATOM 8122  H H2   . TYR A 1 1   ? 1.464   8.576   14.862  1.00 0.00 ? 392 TYR A H2   5  
ATOM 8123  H H3   . TYR A 1 1   ? 1.874   10.197  15.131  1.00 0.00 ? 392 TYR A H3   5  
ATOM 8124  H HA   . TYR A 1 1   ? 3.797   8.920   14.531  1.00 0.00 ? 392 TYR A HA   5  
ATOM 8125  H HB2  . TYR A 1 1   ? 4.110   10.822  16.033  1.00 0.00 ? 392 TYR A HB2  5  
ATOM 8126  H HB3  . TYR A 1 1   ? 3.759   9.810   17.429  1.00 0.00 ? 392 TYR A HB3  5  
ATOM 8127  H HD1  . TYR A 1 1   ? 5.850   10.331  18.528  1.00 0.00 ? 392 TYR A HD1  5  
ATOM 8128  H HD2  . TYR A 1 1   ? 5.832   8.594   14.646  1.00 0.00 ? 392 TYR A HD2  5  
ATOM 8129  H HE1  . TYR A 1 1   ? 8.237   9.790   18.762  1.00 0.00 ? 392 TYR A HE1  5  
ATOM 8130  H HE2  . TYR A 1 1   ? 8.217   8.051   14.869  1.00 0.00 ? 392 TYR A HE2  5  
ATOM 8131  H HH   . TYR A 1 1   ? 10.138  8.666   16.102  1.00 0.00 ? 392 TYR A HH   5  
ATOM 8132  N N    . VAL A 1 2   ? 3.060   6.484   15.229  1.00 0.00 ? 393 VAL A N    5  
ATOM 8133  C CA   . VAL A 1 2   ? 3.166   5.072   15.547  1.00 0.00 ? 393 VAL A CA   5  
ATOM 8134  C C    . VAL A 1 2   ? 3.637   4.321   14.312  1.00 0.00 ? 393 VAL A C    5  
ATOM 8135  O O    . VAL A 1 2   ? 2.947   4.297   13.293  1.00 0.00 ? 393 VAL A O    5  
ATOM 8136  C CB   . VAL A 1 2   ? 1.826   4.475   16.039  1.00 0.00 ? 393 VAL A CB   5  
ATOM 8137  C CG1  . VAL A 1 2   ? 1.993   3.010   16.417  1.00 0.00 ? 393 VAL A CG1  5  
ATOM 8138  C CG2  . VAL A 1 2   ? 1.273   5.268   17.216  1.00 0.00 ? 393 VAL A CG2  5  
ATOM 8139  H H    . VAL A 1 2   ? 2.587   6.753   14.400  1.00 0.00 ? 393 VAL A H    5  
ATOM 8140  H HA   . VAL A 1 2   ? 3.910   4.969   16.323  1.00 0.00 ? 393 VAL A HA   5  
ATOM 8141  H HB   . VAL A 1 2   ? 1.113   4.533   15.230  1.00 0.00 ? 393 VAL A HB   5  
ATOM 8142  H HG11 . VAL A 1 2   ? 2.744   2.921   17.188  1.00 0.00 ? 393 VAL A HG11 5  
ATOM 8143  H HG12 . VAL A 1 2   ? 2.301   2.448   15.548  1.00 0.00 ? 393 VAL A HG12 5  
ATOM 8144  H HG13 . VAL A 1 2   ? 1.054   2.624   16.782  1.00 0.00 ? 393 VAL A HG13 5  
ATOM 8145  H HG21 . VAL A 1 2   ? 0.365   4.801   17.570  1.00 0.00 ? 393 VAL A HG21 5  
ATOM 8146  H HG22 . VAL A 1 2   ? 1.058   6.278   16.901  1.00 0.00 ? 393 VAL A HG22 5  
ATOM 8147  H HG23 . VAL A 1 2   ? 2.003   5.287   18.012  1.00 0.00 ? 393 VAL A HG23 5  
ATOM 8148  N N    . GLY A 1 3   ? 4.820   3.729   14.399  1.00 0.00 ? 394 GLY A N    5  
ATOM 8149  C CA   . GLY A 1 3   ? 5.379   3.024   13.262  1.00 0.00 ? 394 GLY A CA   5  
ATOM 8150  C C    . GLY A 1 3   ? 6.038   4.007   12.323  1.00 0.00 ? 394 GLY A C    5  
ATOM 8151  O O    . GLY A 1 3   ? 7.231   3.920   12.041  1.00 0.00 ? 394 GLY A O    5  
ATOM 8152  H H    . GLY A 1 3   ? 5.320   3.775   15.237  1.00 0.00 ? 394 GLY A H    5  
ATOM 8153  H HA2  . GLY A 1 3   ? 6.111   2.309   13.609  1.00 0.00 ? 394 GLY A HA2  5  
ATOM 8154  H HA3  . GLY A 1 3   ? 4.590   2.506   12.738  1.00 0.00 ? 394 GLY A HA3  5  
ATOM 8155  N N    . GLU A 1 4   ? 5.244   4.963   11.868  1.00 0.00 ? 395 GLU A N    5  
ATOM 8156  C CA   . GLU A 1 4   ? 5.714   6.013   10.991  1.00 0.00 ? 395 GLU A CA   5  
ATOM 8157  C C    . GLU A 1 4   ? 5.676   7.335   11.748  1.00 0.00 ? 395 GLU A C    5  
ATOM 8158  O O    . GLU A 1 4   ? 4.829   7.535   12.622  1.00 0.00 ? 395 GLU A O    5  
ATOM 8159  C CB   . GLU A 1 4   ? 4.848   6.089   9.730   1.00 0.00 ? 395 GLU A CB   5  
ATOM 8160  C CG   . GLU A 1 4   ? 5.345   7.095   8.703   1.00 0.00 ? 395 GLU A CG   5  
ATOM 8161  C CD   . GLU A 1 4   ? 6.754   6.805   8.246   1.00 0.00 ? 395 GLU A CD   5  
ATOM 8162  O OE1  . GLU A 1 4   ? 6.927   6.293   7.124   1.00 0.00 ? 395 GLU A OE1  5  
ATOM 8163  O OE2  . GLU A 1 4   ? 7.694   7.097   9.011   1.00 0.00 ? 395 GLU A OE2  5  
ATOM 8164  H H    . GLU A 1 4   ? 4.299   4.962   12.140  1.00 0.00 ? 395 GLU A H    5  
ATOM 8165  H HA   . GLU A 1 4   ? 6.735   5.791   10.716  1.00 0.00 ? 395 GLU A HA   5  
ATOM 8166  H HB2  . GLU A 1 4   ? 4.826   5.114   9.264   1.00 0.00 ? 395 GLU A HB2  5  
ATOM 8167  H HB3  . GLU A 1 4   ? 3.842   6.364   10.013  1.00 0.00 ? 395 GLU A HB3  5  
ATOM 8168  H HG2  . GLU A 1 4   ? 4.694   7.074   7.846   1.00 0.00 ? 395 GLU A HG2  5  
ATOM 8169  H HG3  . GLU A 1 4   ? 5.326   8.081   9.147   1.00 0.00 ? 395 GLU A HG3  5  
ATOM 8170  N N    . ASP A 1 5   ? 6.594   8.229   11.428  1.00 0.00 ? 396 ASP A N    5  
ATOM 8171  C CA   . ASP A 1 5   ? 6.657   9.521   12.097  1.00 0.00 ? 396 ASP A CA   5  
ATOM 8172  C C    . ASP A 1 5   ? 6.226   10.644  11.177  1.00 0.00 ? 396 ASP A C    5  
ATOM 8173  O O    . ASP A 1 5   ? 6.679   11.773  11.331  1.00 0.00 ? 396 ASP A O    5  
ATOM 8174  C CB   . ASP A 1 5   ? 8.051   9.809   12.659  1.00 0.00 ? 396 ASP A CB   5  
ATOM 8175  C CG   . ASP A 1 5   ? 9.150   9.841   11.611  1.00 0.00 ? 396 ASP A CG   5  
ATOM 8176  O OD1  . ASP A 1 5   ? 9.873   8.837   11.482  1.00 0.00 ? 396 ASP A OD1  5  
ATOM 8177  O OD2  . ASP A 1 5   ? 9.308   10.878  10.928  1.00 0.00 ? 396 ASP A OD2  5  
ATOM 8178  H H    . ASP A 1 5   ? 7.244   8.017   10.718  1.00 0.00 ? 396 ASP A H    5  
ATOM 8179  H HA   . ASP A 1 5   ? 5.961   9.482   12.922  1.00 0.00 ? 396 ASP A HA   5  
ATOM 8180  H HB2  . ASP A 1 5   ? 8.029   10.767  13.153  1.00 0.00 ? 396 ASP A HB2  5  
ATOM 8181  H HB3  . ASP A 1 5   ? 8.292   9.046   13.383  1.00 0.00 ? 396 ASP A HB3  5  
ATOM 8182  N N    . ASP A 1 6   ? 5.327   10.335  10.243  1.00 0.00 ? 397 ASP A N    5  
ATOM 8183  C CA   . ASP A 1 6   ? 4.815   11.316  9.269   1.00 0.00 ? 397 ASP A CA   5  
ATOM 8184  C C    . ASP A 1 6   ? 4.020   12.457  9.928   1.00 0.00 ? 397 ASP A C    5  
ATOM 8185  O O    . ASP A 1 6   ? 3.243   13.141  9.257   1.00 0.00 ? 397 ASP A O    5  
ATOM 8186  C CB   . ASP A 1 6   ? 3.967   10.636  8.194   1.00 0.00 ? 397 ASP A CB   5  
ATOM 8187  C CG   . ASP A 1 6   ? 4.255   11.201  6.813   1.00 0.00 ? 397 ASP A CG   5  
ATOM 8188  O OD1  . ASP A 1 6   ? 4.919   10.513  6.013   1.00 0.00 ? 397 ASP A OD1  5  
ATOM 8189  O OD2  . ASP A 1 6   ? 3.844   12.349  6.535   1.00 0.00 ? 397 ASP A OD2  5  
ATOM 8190  H H    . ASP A 1 6   ? 4.990   9.415   10.205  1.00 0.00 ? 397 ASP A H    5  
ATOM 8191  H HA   . ASP A 1 6   ? 5.678   11.754  8.787   1.00 0.00 ? 397 ASP A HA   5  
ATOM 8192  H HB2  . ASP A 1 6   ? 4.181   9.578   8.185   1.00 0.00 ? 397 ASP A HB2  5  
ATOM 8193  H HB3  . ASP A 1 6   ? 2.920   10.789  8.416   1.00 0.00 ? 397 ASP A HB3  5  
ATOM 8194  N N    . GLU A 1 7   ? 4.198   12.602  11.248  1.00 0.00 ? 398 GLU A N    5  
ATOM 8195  C CA   . GLU A 1 7   ? 3.578   13.637  12.086  1.00 0.00 ? 398 GLU A CA   5  
ATOM 8196  C C    . GLU A 1 7   ? 2.317   13.132  12.772  1.00 0.00 ? 398 GLU A C    5  
ATOM 8197  O O    . GLU A 1 7   ? 2.332   12.797  13.958  1.00 0.00 ? 398 GLU A O    5  
ATOM 8198  C CB   . GLU A 1 7   ? 3.244   14.921  11.317  1.00 0.00 ? 398 GLU A CB   5  
ATOM 8199  C CG   . GLU A 1 7   ? 4.443   15.723  10.851  1.00 0.00 ? 398 GLU A CG   5  
ATOM 8200  C CD   . GLU A 1 7   ? 4.069   16.664  9.725   1.00 0.00 ? 398 GLU A CD   5  
ATOM 8201  O OE1  . GLU A 1 7   ? 2.898   17.105  9.682   1.00 0.00 ? 398 GLU A OE1  5  
ATOM 8202  O OE2  . GLU A 1 7   ? 4.933   16.935  8.865   1.00 0.00 ? 398 GLU A OE2  5  
ATOM 8203  H H    . GLU A 1 7   ? 4.794   11.965  11.689  1.00 0.00 ? 398 GLU A H    5  
ATOM 8204  H HA   . GLU A 1 7   ? 4.302   13.883  12.847  1.00 0.00 ? 398 GLU A HA   5  
ATOM 8205  H HB2  . GLU A 1 7   ? 2.665   14.658  10.447  1.00 0.00 ? 398 GLU A HB2  5  
ATOM 8206  H HB3  . GLU A 1 7   ? 2.646   15.554  11.954  1.00 0.00 ? 398 GLU A HB3  5  
ATOM 8207  H HG2  . GLU A 1 7   ? 4.822   16.303  11.679  1.00 0.00 ? 398 GLU A HG2  5  
ATOM 8208  H HG3  . GLU A 1 7   ? 5.206   15.044  10.500  1.00 0.00 ? 398 GLU A HG3  5  
ATOM 8209  N N    . GLU A 1 8   ? 1.234   13.067  12.015  1.00 0.00 ? 399 GLU A N    5  
ATOM 8210  C CA   . GLU A 1 8   ? -0.052  12.648  12.548  1.00 0.00 ? 399 GLU A CA   5  
ATOM 8211  C C    . GLU A 1 8   ? -0.440  11.282  12.035  1.00 0.00 ? 399 GLU A C    5  
ATOM 8212  O O    . GLU A 1 8   ? -0.175  10.950  10.881  1.00 0.00 ? 399 GLU A O    5  
ATOM 8213  C CB   . GLU A 1 8   ? -1.127  13.642  12.148  1.00 0.00 ? 399 GLU A CB   5  
ATOM 8214  C CG   . GLU A 1 8   ? -1.635  14.488  13.289  1.00 0.00 ? 399 GLU A CG   5  
ATOM 8215  C CD   . GLU A 1 8   ? -2.297  15.757  12.799  1.00 0.00 ? 399 GLU A CD   5  
ATOM 8216  O OE1  . GLU A 1 8   ? -3.520  15.896  12.988  1.00 0.00 ? 399 GLU A OE1  5  
ATOM 8217  O OE2  . GLU A 1 8   ? -1.595  16.602  12.194  1.00 0.00 ? 399 GLU A OE2  5  
ATOM 8218  H H    . GLU A 1 8   ? 1.308   13.269  11.060  1.00 0.00 ? 399 GLU A H    5  
ATOM 8219  H HA   . GLU A 1 8   ? 0.020   12.617  13.624  1.00 0.00 ? 399 GLU A HA   5  
ATOM 8220  H HB2  . GLU A 1 8   ? -0.726  14.301  11.393  1.00 0.00 ? 399 GLU A HB2  5  
ATOM 8221  H HB3  . GLU A 1 8   ? -1.964  13.101  11.731  1.00 0.00 ? 399 GLU A HB3  5  
ATOM 8222  H HG2  . GLU A 1 8   ? -2.358  13.910  13.847  1.00 0.00 ? 399 GLU A HG2  5  
ATOM 8223  H HG3  . GLU A 1 8   ? -0.805  14.746  13.925  1.00 0.00 ? 399 GLU A HG3  5  
ATOM 8224  N N    . ASP A 1 9   ? -1.082  10.504  12.895  1.00 0.00 ? 400 ASP A N    5  
ATOM 8225  C CA   . ASP A 1 9   ? -1.531  9.170   12.537  1.00 0.00 ? 400 ASP A CA   5  
ATOM 8226  C C    . ASP A 1 9   ? -2.184  8.497   13.741  1.00 0.00 ? 400 ASP A C    5  
ATOM 8227  O O    . ASP A 1 9   ? -1.591  7.648   14.398  1.00 0.00 ? 400 ASP A O    5  
ATOM 8228  C CB   . ASP A 1 9   ? -0.374  8.307   12.014  1.00 0.00 ? 400 ASP A CB   5  
ATOM 8229  C CG   . ASP A 1 9   ? 0.868   8.341   12.895  1.00 0.00 ? 400 ASP A CG   5  
ATOM 8230  O OD1  . ASP A 1 9   ? 1.645   9.310   12.805  1.00 0.00 ? 400 ASP A OD1  5  
ATOM 8231  O OD2  . ASP A 1 9   ? 1.073   7.403   13.687  1.00 0.00 ? 400 ASP A OD2  5  
ATOM 8232  H H    . ASP A 1 9   ? -1.262  10.839  13.803  1.00 0.00 ? 400 ASP A H    5  
ATOM 8233  H HA   . ASP A 1 9   ? -2.269  9.295   11.750  1.00 0.00 ? 400 ASP A HA   5  
ATOM 8234  H HB2  . ASP A 1 9   ? -0.709  7.286   11.942  1.00 0.00 ? 400 ASP A HB2  5  
ATOM 8235  H HB3  . ASP A 1 9   ? -0.101  8.660   11.029  1.00 0.00 ? 400 ASP A HB3  5  
ATOM 8236  N N    . ASP A 1 10  ? -3.409  8.884   14.030  1.00 0.00 ? 401 ASP A N    5  
ATOM 8237  C CA   . ASP A 1 10  ? -4.111  8.342   15.195  1.00 0.00 ? 401 ASP A CA   5  
ATOM 8238  C C    . ASP A 1 10  ? -5.575  8.041   14.911  1.00 0.00 ? 401 ASP A C    5  
ATOM 8239  O O    . ASP A 1 10  ? -6.028  6.920   15.129  1.00 0.00 ? 401 ASP A O    5  
ATOM 8240  C CB   . ASP A 1 10  ? -3.980  9.315   16.368  1.00 0.00 ? 401 ASP A CB   5  
ATOM 8241  C CG   . ASP A 1 10  ? -3.924  10.759  15.901  1.00 0.00 ? 401 ASP A CG   5  
ATOM 8242  O OD1  . ASP A 1 10  ? -4.992  11.386  15.770  1.00 0.00 ? 401 ASP A OD1  5  
ATOM 8243  O OD2  . ASP A 1 10  ? -2.812  11.258  15.620  1.00 0.00 ? 401 ASP A OD2  5  
ATOM 8244  H H    . ASP A 1 10  ? -3.853  9.532   13.453  1.00 0.00 ? 401 ASP A H    5  
ATOM 8245  H HA   . ASP A 1 10  ? -3.629  7.410   15.450  1.00 0.00 ? 401 ASP A HA   5  
ATOM 8246  H HB2  . ASP A 1 10  ? -4.831  9.199   17.024  1.00 0.00 ? 401 ASP A HB2  5  
ATOM 8247  H HB3  . ASP A 1 10  ? -3.075  9.095   16.914  1.00 0.00 ? 401 ASP A HB3  5  
ATOM 8248  N N    . ASP A 1 11  ? -6.311  9.035   14.418  1.00 0.00 ? 402 ASP A N    5  
ATOM 8249  C CA   . ASP A 1 11  ? -7.734  8.866   14.085  1.00 0.00 ? 402 ASP A CA   5  
ATOM 8250  C C    . ASP A 1 11  ? -7.895  7.967   12.864  1.00 0.00 ? 402 ASP A C    5  
ATOM 8251  O O    . ASP A 1 11  ? -8.973  7.849   12.286  1.00 0.00 ? 402 ASP A O    5  
ATOM 8252  C CB   . ASP A 1 11  ? -8.401  10.219  13.822  1.00 0.00 ? 402 ASP A CB   5  
ATOM 8253  C CG   . ASP A 1 11  ? -7.568  11.122  12.935  1.00 0.00 ? 402 ASP A CG   5  
ATOM 8254  O OD1  . ASP A 1 11  ? -6.997  10.633  11.934  1.00 0.00 ? 402 ASP A OD1  5  
ATOM 8255  O OD2  . ASP A 1 11  ? -7.461  12.324  13.253  1.00 0.00 ? 402 ASP A OD2  5  
ATOM 8256  H H    . ASP A 1 11  ? -5.898  9.913   14.288  1.00 0.00 ? 402 ASP A H    5  
ATOM 8257  H HA   . ASP A 1 11  ? -8.216  8.394   14.928  1.00 0.00 ? 402 ASP A HA   5  
ATOM 8258  H HB2  . ASP A 1 11  ? -9.353  10.055  13.339  1.00 0.00 ? 402 ASP A HB2  5  
ATOM 8259  H HB3  . ASP A 1 11  ? -8.563  10.721  14.765  1.00 0.00 ? 402 ASP A HB3  5  
ATOM 8260  N N    . PHE A 1 12  ? -6.795  7.338   12.501  1.00 0.00 ? 403 PHE A N    5  
ATOM 8261  C CA   . PHE A 1 12  ? -6.711  6.433   11.394  1.00 0.00 ? 403 PHE A CA   5  
ATOM 8262  C C    . PHE A 1 12  ? -7.725  5.297   11.541  1.00 0.00 ? 403 PHE A C    5  
ATOM 8263  O O    . PHE A 1 12  ? -7.740  4.602   12.553  1.00 0.00 ? 403 PHE A O    5  
ATOM 8264  C CB   . PHE A 1 12  ? -5.308  5.875   11.401  1.00 0.00 ? 403 PHE A CB   5  
ATOM 8265  C CG   . PHE A 1 12  ? -4.422  6.345   10.305  1.00 0.00 ? 403 PHE A CG   5  
ATOM 8266  C CD1  . PHE A 1 12  ? -3.148  6.795   10.585  1.00 0.00 ? 403 PHE A CD1  5  
ATOM 8267  C CD2  . PHE A 1 12  ? -4.838  6.285   8.997   1.00 0.00 ? 403 PHE A CD2  5  
ATOM 8268  C CE1  . PHE A 1 12  ? -2.304  7.177   9.569   1.00 0.00 ? 403 PHE A CE1  5  
ATOM 8269  C CE2  . PHE A 1 12  ? -4.004  6.674   7.979   1.00 0.00 ? 403 PHE A CE2  5  
ATOM 8270  C CZ   . PHE A 1 12  ? -2.733  7.117   8.265   1.00 0.00 ? 403 PHE A CZ   5  
ATOM 8271  H H    . PHE A 1 12  ? -5.992  7.471   13.038  1.00 0.00 ? 403 PHE A H    5  
ATOM 8272  H HA   . PHE A 1 12  ? -6.880  6.970   10.477  1.00 0.00 ? 403 PHE A HA   5  
ATOM 8273  H HB2  . PHE A 1 12  ? -4.835  6.130   12.336  1.00 0.00 ? 403 PHE A HB2  5  
ATOM 8274  H HB3  . PHE A 1 12  ? -5.376  4.819   11.326  1.00 0.00 ? 403 PHE A HB3  5  
ATOM 8275  H HD1  . PHE A 1 12  ? -2.814  6.845   11.613  1.00 0.00 ? 403 PHE A HD1  5  
ATOM 8276  H HD2  . PHE A 1 12  ? -5.836  5.938   8.774   1.00 0.00 ? 403 PHE A HD2  5  
ATOM 8277  H HE1  . PHE A 1 12  ? -1.309  7.527   9.798   1.00 0.00 ? 403 PHE A HE1  5  
ATOM 8278  H HE2  . PHE A 1 12  ? -4.343  6.623   6.954   1.00 0.00 ? 403 PHE A HE2  5  
ATOM 8279  H HZ   . PHE A 1 12  ? -2.072  7.402   7.470   1.00 0.00 ? 403 PHE A HZ   5  
ATOM 8280  N N    . ASN A 1 13  ? -8.544  5.098   10.524  1.00 0.00 ? 404 ASN A N    5  
ATOM 8281  C CA   . ASN A 1 13  ? -9.574  4.060   10.551  1.00 0.00 ? 404 ASN A CA   5  
ATOM 8282  C C    . ASN A 1 13  ? -9.266  2.970   9.536   1.00 0.00 ? 404 ASN A C    5  
ATOM 8283  O O    . ASN A 1 13  ? -9.131  3.254   8.347   1.00 0.00 ? 404 ASN A O    5  
ATOM 8284  C CB   . ASN A 1 13  ? -10.946 4.665   10.232  1.00 0.00 ? 404 ASN A CB   5  
ATOM 8285  C CG   . ASN A 1 13  ? -11.658 5.220   11.450  1.00 0.00 ? 404 ASN A CG   5  
ATOM 8286  O OD1  . ASN A 1 13  ? -12.461 4.536   12.080  1.00 0.00 ? 404 ASN A OD1  5  
ATOM 8287  N ND2  . ASN A 1 13  ? -11.376 6.471   11.784  1.00 0.00 ? 404 ASN A ND2  5  
ATOM 8288  H H    . ASN A 1 13  ? -8.448  5.654   9.721   1.00 0.00 ? 404 ASN A H    5  
ATOM 8289  H HA   . ASN A 1 13  ? -9.595  3.630   11.539  1.00 0.00 ? 404 ASN A HA   5  
ATOM 8290  H HB2  . ASN A 1 13  ? -10.819 5.467   9.521   1.00 0.00 ? 404 ASN A HB2  5  
ATOM 8291  H HB3  . ASN A 1 13  ? -11.571 3.901   9.791   1.00 0.00 ? 404 ASN A HB3  5  
ATOM 8292  H HD21 . ASN A 1 13  ? -10.728 6.966   11.238  1.00 0.00 ? 404 ASN A HD21 5  
ATOM 8293  H HD22 . ASN A 1 13  ? -11.819 6.849   12.569  1.00 0.00 ? 404 ASN A HD22 5  
ATOM 8294  N N    . GLU A 1 14  ? -9.148  1.731   9.994   1.00 0.00 ? 405 GLU A N    5  
ATOM 8295  C CA   . GLU A 1 14  ? -8.864  0.621   9.091   1.00 0.00 ? 405 GLU A CA   5  
ATOM 8296  C C    . GLU A 1 14  ? -10.095 -0.257  8.898   1.00 0.00 ? 405 GLU A C    5  
ATOM 8297  O O    . GLU A 1 14  ? -10.251 -0.888  7.853   1.00 0.00 ? 405 GLU A O    5  
ATOM 8298  C CB   . GLU A 1 14  ? -7.693  -0.223  9.596   1.00 0.00 ? 405 GLU A CB   5  
ATOM 8299  C CG   . GLU A 1 14  ? -7.560  -0.259  11.106  1.00 0.00 ? 405 GLU A CG   5  
ATOM 8300  C CD   . GLU A 1 14  ? -6.234  -0.840  11.551  1.00 0.00 ? 405 GLU A CD   5  
ATOM 8301  O OE1  . GLU A 1 14  ? -6.061  -1.100  12.754  1.00 0.00 ? 405 GLU A OE1  5  
ATOM 8302  O OE2  . GLU A 1 14  ? -5.329  -0.978  10.702  1.00 0.00 ? 405 GLU A OE2  5  
ATOM 8303  H H    . GLU A 1 14  ? -9.254  1.557   10.956  1.00 0.00 ? 405 GLU A H    5  
ATOM 8304  H HA   . GLU A 1 14  ? -8.593  1.047   8.137   1.00 0.00 ? 405 GLU A HA   5  
ATOM 8305  H HB2  . GLU A 1 14  ? -7.821  -1.236  9.245   1.00 0.00 ? 405 GLU A HB2  5  
ATOM 8306  H HB3  . GLU A 1 14  ? -6.777  0.176   9.186   1.00 0.00 ? 405 GLU A HB3  5  
ATOM 8307  H HG2  . GLU A 1 14  ? -7.637  0.751   11.484  1.00 0.00 ? 405 GLU A HG2  5  
ATOM 8308  H HG3  . GLU A 1 14  ? -8.357  -0.859  11.514  1.00 0.00 ? 405 GLU A HG3  5  
ATOM 8309  N N    . ASN A 1 15  ? -10.939 -0.311  9.933   1.00 0.00 ? 406 ASN A N    5  
ATOM 8310  C CA   . ASN A 1 15  ? -12.179 -1.101  9.936   1.00 0.00 ? 406 ASN A CA   5  
ATOM 8311  C C    . ASN A 1 15  ? -11.876 -2.572  10.204  1.00 0.00 ? 406 ASN A C    5  
ATOM 8312  O O    . ASN A 1 15  ? -12.639 -3.258  10.883  1.00 0.00 ? 406 ASN A O    5  
ATOM 8313  C CB   . ASN A 1 15  ? -12.972 -0.937  8.632   1.00 0.00 ? 406 ASN A CB   5  
ATOM 8314  C CG   . ASN A 1 15  ? -14.355 -1.567  8.699   1.00 0.00 ? 406 ASN A CG   5  
ATOM 8315  O OD1  . ASN A 1 15  ? -14.869 -2.067  7.702   1.00 0.00 ? 406 ASN A OD1  5  
ATOM 8316  N ND2  . ASN A 1 15  ? -14.977 -1.534  9.870   1.00 0.00 ? 406 ASN A ND2  5  
ATOM 8317  H H    . ASN A 1 15  ? -10.698 0.172   10.759  1.00 0.00 ? 406 ASN A H    5  
ATOM 8318  H HA   . ASN A 1 15  ? -12.784 -0.733  10.754  1.00 0.00 ? 406 ASN A HA   5  
ATOM 8319  H HB2  . ASN A 1 15  ? -13.088 0.115   8.419   1.00 0.00 ? 406 ASN A HB2  5  
ATOM 8320  H HB3  . ASN A 1 15  ? -12.424 -1.403  7.826   1.00 0.00 ? 406 ASN A HB3  5  
ATOM 8321  H HD21 . ASN A 1 15  ? -14.521 -1.110  10.627  1.00 0.00 ? 406 ASN A HD21 5  
ATOM 8322  H HD22 . ASN A 1 15  ? -15.863 -1.944  9.932   1.00 0.00 ? 406 ASN A HD22 5  
ATOM 8323  N N    . ASP A 1 16  ? -10.763 -3.046  9.663   1.00 0.00 ? 407 ASP A N    5  
ATOM 8324  C CA   . ASP A 1 16  ? -10.335 -4.425  9.865   1.00 0.00 ? 407 ASP A CA   5  
ATOM 8325  C C    . ASP A 1 16  ? -9.693  -4.558  11.240  1.00 0.00 ? 407 ASP A C    5  
ATOM 8326  O O    . ASP A 1 16  ? -9.865  -5.570  11.921  1.00 0.00 ? 407 ASP A O    5  
ATOM 8327  C CB   . ASP A 1 16  ? -9.345  -4.841  8.770   1.00 0.00 ? 407 ASP A CB   5  
ATOM 8328  C CG   . ASP A 1 16  ? -8.603  -6.129  9.090   1.00 0.00 ? 407 ASP A CG   5  
ATOM 8329  O OD1  . ASP A 1 16  ? -9.199  -7.213  8.950   1.00 0.00 ? 407 ASP A OD1  5  
ATOM 8330  O OD2  . ASP A 1 16  ? -7.411  -6.056  9.463   1.00 0.00 ? 407 ASP A OD2  5  
ATOM 8331  H H    . ASP A 1 16  ? -10.216 -2.454  9.105   1.00 0.00 ? 407 ASP A H    5  
ATOM 8332  H HA   . ASP A 1 16  ? -11.207 -5.058  9.820   1.00 0.00 ? 407 ASP A HA   5  
ATOM 8333  H HB2  . ASP A 1 16  ? -9.884  -4.983  7.846   1.00 0.00 ? 407 ASP A HB2  5  
ATOM 8334  H HB3  . ASP A 1 16  ? -8.617  -4.053  8.636   1.00 0.00 ? 407 ASP A HB3  5  
ATOM 8335  N N    . GLU A 1 17  ? -8.991  -3.493  11.647  1.00 0.00 ? 408 GLU A N    5  
ATOM 8336  C CA   . GLU A 1 17  ? -8.301  -3.432  12.938  1.00 0.00 ? 408 GLU A CA   5  
ATOM 8337  C C    . GLU A 1 17  ? -7.409  -4.653  13.119  1.00 0.00 ? 408 GLU A C    5  
ATOM 8338  O O    . GLU A 1 17  ? -6.333  -4.742  12.526  1.00 0.00 ? 408 GLU A O    5  
ATOM 8339  C CB   . GLU A 1 17  ? -9.307  -3.341  14.092  1.00 0.00 ? 408 GLU A CB   5  
ATOM 8340  C CG   . GLU A 1 17  ? -10.528 -2.491  13.780  1.00 0.00 ? 408 GLU A CG   5  
ATOM 8341  C CD   . GLU A 1 17  ? -10.214 -1.007  13.669  1.00 0.00 ? 408 GLU A CD   5  
ATOM 8342  O OE1  . GLU A 1 17  ? -9.812  -0.409  14.686  1.00 0.00 ? 408 GLU A OE1  5  
ATOM 8343  O OE2  . GLU A 1 17  ? -10.388 -0.436  12.566  1.00 0.00 ? 408 GLU A OE2  5  
ATOM 8344  H H    . GLU A 1 17  ? -8.943  -2.716  11.059  1.00 0.00 ? 408 GLU A H    5  
ATOM 8345  H HA   . GLU A 1 17  ? -7.682  -2.547  12.940  1.00 0.00 ? 408 GLU A HA   5  
ATOM 8346  H HB2  . GLU A 1 17  ? -9.645  -4.338  14.336  1.00 0.00 ? 408 GLU A HB2  5  
ATOM 8347  H HB3  . GLU A 1 17  ? -8.811  -2.921  14.954  1.00 0.00 ? 408 GLU A HB3  5  
ATOM 8348  H HG2  . GLU A 1 17  ? -10.944 -2.824  12.841  1.00 0.00 ? 408 GLU A HG2  5  
ATOM 8349  H HG3  . GLU A 1 17  ? -11.254 -2.635  14.565  1.00 0.00 ? 408 GLU A HG3  5  
ATOM 8350  N N    . ASP A 1 18  ? -7.882  -5.590  13.928  1.00 0.00 ? 409 ASP A N    5  
ATOM 8351  C CA   . ASP A 1 18  ? -7.188  -6.836  14.200  1.00 0.00 ? 409 ASP A CA   5  
ATOM 8352  C C    . ASP A 1 18  ? -8.032  -7.674  15.141  1.00 0.00 ? 409 ASP A C    5  
ATOM 8353  O O    . ASP A 1 18  ? -8.819  -7.125  15.917  1.00 0.00 ? 409 ASP A O    5  
ATOM 8354  C CB   . ASP A 1 18  ? -5.798  -6.603  14.806  1.00 0.00 ? 409 ASP A CB   5  
ATOM 8355  C CG   . ASP A 1 18  ? -4.739  -7.471  14.153  1.00 0.00 ? 409 ASP A CG   5  
ATOM 8356  O OD1  . ASP A 1 18  ? -3.554  -7.349  14.522  1.00 0.00 ? 409 ASP A OD1  5  
ATOM 8357  O OD2  . ASP A 1 18  ? -5.091  -8.260  13.243  1.00 0.00 ? 409 ASP A OD2  5  
ATOM 8358  H H    . ASP A 1 18  ? -8.749  -5.443  14.356  1.00 0.00 ? 409 ASP A H    5  
ATOM 8359  H HA   . ASP A 1 18  ? -7.088  -7.357  13.263  1.00 0.00 ? 409 ASP A HA   5  
ATOM 8360  H HB2  . ASP A 1 18  ? -5.522  -5.567  14.672  1.00 0.00 ? 409 ASP A HB2  5  
ATOM 8361  H HB3  . ASP A 1 18  ? -5.828  -6.832  15.860  1.00 0.00 ? 409 ASP A HB3  5  
ATOM 8362  N N    . ASP A 1 19  ? -7.879  -8.985  15.071  1.00 0.00 ? 410 ASP A N    5  
ATOM 8363  C CA   . ASP A 1 19  ? -8.650  -9.890  15.916  1.00 0.00 ? 410 ASP A CA   5  
ATOM 8364  C C    . ASP A 1 19  ? -7.750  -11.009 16.429  1.00 0.00 ? 410 ASP A C    5  
ATOM 8365  O O    . ASP A 1 19  ? -7.512  -11.073 17.656  1.00 0.00 ? 410 ASP A O    5  
ATOM 8366  C CB   . ASP A 1 19  ? -9.834  -10.473 15.132  1.00 0.00 ? 410 ASP A CB   5  
ATOM 8367  C CG   . ASP A 1 19  ? -10.880 -11.133 16.020  1.00 0.00 ? 410 ASP A CG   5  
ATOM 8368  O OD1  . ASP A 1 19  ? -11.150 -12.343 15.831  1.00 0.00 ? 410 ASP A OD1  5  
ATOM 8369  O OD2  . ASP A 1 19  ? -11.462 -10.436 16.883  1.00 0.00 ? 410 ASP A OD2  5  
ATOM 8370  O OXT  . ASP A 1 19  ? -7.246  -11.789 15.589  1.00 0.00 ? 410 ASP A OXT  5  
ATOM 8371  H H    . ASP A 1 19  ? -7.220  -9.361  14.450  1.00 0.00 ? 410 ASP A H    5  
ATOM 8372  H HA   . ASP A 1 19  ? -9.023  -9.321  16.756  1.00 0.00 ? 410 ASP A HA   5  
ATOM 8373  H HB2  . ASP A 1 19  ? -10.313 -9.679  14.579  1.00 0.00 ? 410 ASP A HB2  5  
ATOM 8374  H HB3  . ASP A 1 19  ? -9.463  -11.212 14.436  1.00 0.00 ? 410 ASP A HB3  5  
ATOM 8375  N N    . MET B 2 3   ? 2.541   -0.821  -16.777 1.00 0.00 ? 1   MET B N    5  
ATOM 8376  C CA   . MET B 2 3   ? 3.680   -0.809  -17.724 1.00 0.00 ? 1   MET B CA   5  
ATOM 8377  C C    . MET B 2 3   ? 3.758   -2.119  -18.503 1.00 0.00 ? 1   MET B C    5  
ATOM 8378  O O    . MET B 2 3   ? 4.726   -2.361  -19.223 1.00 0.00 ? 1   MET B O    5  
ATOM 8379  C CB   . MET B 2 3   ? 4.991   -0.578  -16.966 1.00 0.00 ? 1   MET B CB   5  
ATOM 8380  C CG   . MET B 2 3   ? 5.122   0.821   -16.389 1.00 0.00 ? 1   MET B CG   5  
ATOM 8381  S SD   . MET B 2 3   ? 6.699   1.093   -15.561 1.00 0.00 ? 1   MET B SD   5  
ATOM 8382  C CE   . MET B 2 3   ? 6.536   0.012   -14.139 1.00 0.00 ? 1   MET B CE   5  
ATOM 8383  H H    . MET B 2 3   ? 2.426   0.111   -16.339 1.00 0.00 ? 1   MET B H    5  
ATOM 8384  H HA   . MET B 2 3   ? 3.530   0.001   -18.423 1.00 0.00 ? 1   MET B HA   5  
ATOM 8385  H HB2  . MET B 2 3   ? 5.051   -1.287  -16.153 1.00 0.00 ? 1   MET B HB2  5  
ATOM 8386  H HB3  . MET B 2 3   ? 5.817   -0.745  -17.641 1.00 0.00 ? 1   MET B HB3  5  
ATOM 8387  H HG2  . MET B 2 3   ? 5.027   1.537   -17.192 1.00 0.00 ? 1   MET B HG2  5  
ATOM 8388  H HG3  . MET B 2 3   ? 4.324   0.977   -15.676 1.00 0.00 ? 1   MET B HG3  5  
ATOM 8389  H HE1  . MET B 2 3   ? 7.432   0.068   -13.537 1.00 0.00 ? 1   MET B HE1  5  
ATOM 8390  H HE2  . MET B 2 3   ? 6.391   -1.005  -14.474 1.00 0.00 ? 1   MET B HE2  5  
ATOM 8391  H HE3  . MET B 2 3   ? 5.685   0.320   -13.548 1.00 0.00 ? 1   MET B HE3  5  
ATOM 8392  N N    . ALA B 2 4   ? 2.724   -2.944  -18.373 1.00 0.00 ? 2   ALA B N    5  
ATOM 8393  C CA   . ALA B 2 4   ? 2.659   -4.233  -19.047 1.00 0.00 ? 2   ALA B CA   5  
ATOM 8394  C C    . ALA B 2 4   ? 1.295   -4.862  -18.806 1.00 0.00 ? 2   ALA B C    5  
ATOM 8395  O O    . ALA B 2 4   ? 0.858   -4.980  -17.662 1.00 0.00 ? 2   ALA B O    5  
ATOM 8396  C CB   . ALA B 2 4   ? 3.764   -5.162  -18.559 1.00 0.00 ? 2   ALA B CB   5  
ATOM 8397  H H    . ALA B 2 4   ? 1.953   -2.667  -17.825 1.00 0.00 ? 2   ALA B H    5  
ATOM 8398  H HA   . ALA B 2 4   ? 2.791   -4.067  -20.107 1.00 0.00 ? 2   ALA B HA   5  
ATOM 8399  H HB1  . ALA B 2 4   ? 4.726   -4.697  -18.722 1.00 0.00 ? 2   ALA B HB1  5  
ATOM 8400  H HB2  . ALA B 2 4   ? 3.719   -6.093  -19.103 1.00 0.00 ? 2   ALA B HB2  5  
ATOM 8401  H HB3  . ALA B 2 4   ? 3.633   -5.356  -17.504 1.00 0.00 ? 2   ALA B HB3  5  
ATOM 8402  N N    . THR B 2 5   ? 0.627   -5.264  -19.879 1.00 0.00 ? 3   THR B N    5  
ATOM 8403  C CA   . THR B 2 5   ? -0.694  -5.875  -19.782 1.00 0.00 ? 3   THR B CA   5  
ATOM 8404  C C    . THR B 2 5   ? -0.611  -7.321  -19.281 1.00 0.00 ? 3   THR B C    5  
ATOM 8405  O O    . THR B 2 5   ? -1.153  -8.242  -19.891 1.00 0.00 ? 3   THR B O    5  
ATOM 8406  C CB   . THR B 2 5   ? -1.396  -5.839  -21.150 1.00 0.00 ? 3   THR B CB   5  
ATOM 8407  O OG1  . THR B 2 5   ? -0.844  -4.775  -21.939 1.00 0.00 ? 3   THR B OG1  5  
ATOM 8408  C CG2  . THR B 2 5   ? -2.894  -5.628  -20.988 1.00 0.00 ? 3   THR B CG2  5  
ATOM 8409  H H    . THR B 2 5   ? 1.026   -5.143  -20.766 1.00 0.00 ? 3   THR B H    5  
ATOM 8410  H HA   . THR B 2 5   ? -1.281  -5.295  -19.086 1.00 0.00 ? 3   THR B HA   5  
ATOM 8411  H HB   . THR B 2 5   ? -1.228  -6.781  -21.655 1.00 0.00 ? 3   THR B HB   5  
ATOM 8412  H HG1  . THR B 2 5   ? -1.058  -3.931  -21.530 1.00 0.00 ? 3   THR B HG1  5  
ATOM 8413  H HG21 . THR B 2 5   ? -3.074  -4.671  -20.521 1.00 0.00 ? 3   THR B HG21 5  
ATOM 8414  H HG22 . THR B 2 5   ? -3.302  -6.413  -20.367 1.00 0.00 ? 3   THR B HG22 5  
ATOM 8415  H HG23 . THR B 2 5   ? -3.369  -5.653  -21.957 1.00 0.00 ? 3   THR B HG23 5  
ATOM 8416  N N    . SER B 2 6   ? 0.077   -7.502  -18.164 1.00 0.00 ? 4   SER B N    5  
ATOM 8417  C CA   . SER B 2 6   ? 0.253   -8.809  -17.550 1.00 0.00 ? 4   SER B CA   5  
ATOM 8418  C C    . SER B 2 6   ? 0.595   -8.631  -16.074 1.00 0.00 ? 4   SER B C    5  
ATOM 8419  O O    . SER B 2 6   ? 0.017   -9.283  -15.204 1.00 0.00 ? 4   SER B O    5  
ATOM 8420  C CB   . SER B 2 6   ? 1.369   -9.594  -18.254 1.00 0.00 ? 4   SER B CB   5  
ATOM 8421  O OG   . SER B 2 6   ? 1.138   -9.678  -19.650 1.00 0.00 ? 4   SER B OG   5  
ATOM 8422  H H    . SER B 2 6   ? 0.474   -6.716  -17.725 1.00 0.00 ? 4   SER B H    5  
ATOM 8423  H HA   . SER B 2 6   ? -0.677  -9.351  -17.635 1.00 0.00 ? 4   SER B HA   5  
ATOM 8424  H HB2  . SER B 2 6   ? 2.313   -9.097  -18.089 1.00 0.00 ? 4   SER B HB2  5  
ATOM 8425  H HB3  . SER B 2 6   ? 1.412   -10.594 -17.848 1.00 0.00 ? 4   SER B HB3  5  
ATOM 8426  H HG   . SER B 2 6   ? 0.255   -9.337  -19.850 1.00 0.00 ? 4   SER B HG   5  
ATOM 8427  N N    . SER B 2 7   ? 1.539   -7.736  -15.808 1.00 0.00 ? 5   SER B N    5  
ATOM 8428  C CA   . SER B 2 7   ? 1.979   -7.441  -14.452 1.00 0.00 ? 5   SER B CA   5  
ATOM 8429  C C    . SER B 2 7   ? 2.563   -6.032  -14.406 1.00 0.00 ? 5   SER B C    5  
ATOM 8430  O O    . SER B 2 7   ? 3.008   -5.518  -15.435 1.00 0.00 ? 5   SER B O    5  
ATOM 8431  C CB   . SER B 2 7   ? 3.028   -8.461  -13.993 1.00 0.00 ? 5   SER B CB   5  
ATOM 8432  O OG   . SER B 2 7   ? 2.580   -9.792  -14.202 1.00 0.00 ? 5   SER B OG   5  
ATOM 8433  H H    . SER B 2 7   ? 1.958   -7.253  -16.549 1.00 0.00 ? 5   SER B H    5  
ATOM 8434  H HA   . SER B 2 7   ? 1.120   -7.490  -13.799 1.00 0.00 ? 5   SER B HA   5  
ATOM 8435  H HB2  . SER B 2 7   ? 3.940   -8.311  -14.551 1.00 0.00 ? 5   SER B HB2  5  
ATOM 8436  H HB3  . SER B 2 7   ? 3.224   -8.322  -12.940 1.00 0.00 ? 5   SER B HB3  5  
ATOM 8437  H HG   . SER B 2 7   ? 1.621   -9.789  -14.319 1.00 0.00 ? 5   SER B HG   5  
ATOM 8438  N N    . GLU B 2 8   ? 2.530   -5.411  -13.227 1.00 0.00 ? 6   GLU B N    5  
ATOM 8439  C CA   . GLU B 2 8   ? 3.059   -4.068  -13.031 1.00 0.00 ? 6   GLU B CA   5  
ATOM 8440  C C    . GLU B 2 8   ? 2.213   -3.052  -13.779 1.00 0.00 ? 6   GLU B C    5  
ATOM 8441  O O    . GLU B 2 8   ? 2.729   -2.145  -14.440 1.00 0.00 ? 6   GLU B O    5  
ATOM 8442  C CB   . GLU B 2 8   ? 4.528   -3.968  -13.460 1.00 0.00 ? 6   GLU B CB   5  
ATOM 8443  C CG   . GLU B 2 8   ? 5.472   -3.663  -12.308 1.00 0.00 ? 6   GLU B CG   5  
ATOM 8444  C CD   . GLU B 2 8   ? 4.904   -2.626  -11.359 1.00 0.00 ? 6   GLU B CD   5  
ATOM 8445  O OE1  . GLU B 2 8   ? 4.442   -3.013  -10.264 1.00 0.00 ? 6   GLU B OE1  5  
ATOM 8446  O OE2  . GLU B 2 8   ? 4.903   -1.431  -11.714 1.00 0.00 ? 6   GLU B OE2  5  
ATOM 8447  H H    . GLU B 2 8   ? 2.106   -5.863  -12.460 1.00 0.00 ? 6   GLU B H    5  
ATOM 8448  H HA   . GLU B 2 8   ? 2.993   -3.849  -11.975 1.00 0.00 ? 6   GLU B HA   5  
ATOM 8449  H HB2  . GLU B 2 8   ? 4.828   -4.905  -13.905 1.00 0.00 ? 6   GLU B HB2  5  
ATOM 8450  H HB3  . GLU B 2 8   ? 4.626   -3.182  -14.195 1.00 0.00 ? 6   GLU B HB3  5  
ATOM 8451  H HG2  . GLU B 2 8   ? 5.653   -4.573  -11.756 1.00 0.00 ? 6   GLU B HG2  5  
ATOM 8452  H HG3  . GLU B 2 8   ? 6.404   -3.293  -12.709 1.00 0.00 ? 6   GLU B HG3  5  
ATOM 8453  N N    . GLU B 2 9   ? 0.904   -3.222  -13.694 1.00 0.00 ? 7   GLU B N    5  
ATOM 8454  C CA   . GLU B 2 9   ? -0.008  -2.303  -14.338 1.00 0.00 ? 7   GLU B CA   5  
ATOM 8455  C C    . GLU B 2 9   ? -0.663  -1.427  -13.289 1.00 0.00 ? 7   GLU B C    5  
ATOM 8456  O O    . GLU B 2 9   ? -1.298  -1.919  -12.356 1.00 0.00 ? 7   GLU B O    5  
ATOM 8457  C CB   . GLU B 2 9   ? -1.056  -3.032  -15.176 1.00 0.00 ? 7   GLU B CB   5  
ATOM 8458  C CG   . GLU B 2 9   ? -1.509  -2.210  -16.373 1.00 0.00 ? 7   GLU B CG   5  
ATOM 8459  C CD   . GLU B 2 9   ? -0.373  -1.384  -16.951 1.00 0.00 ? 7   GLU B CD   5  
ATOM 8460  O OE1  . GLU B 2 9   ? 0.330   -1.876  -17.856 1.00 0.00 ? 7   GLU B OE1  5  
ATOM 8461  O OE2  . GLU B 2 9   ? -0.137  -0.257  -16.468 1.00 0.00 ? 7   GLU B OE2  5  
ATOM 8462  H H    . GLU B 2 9   ? 0.547   -3.978  -13.178 1.00 0.00 ? 7   GLU B H    5  
ATOM 8463  H HA   . GLU B 2 9   ? 0.580   -1.671  -14.988 1.00 0.00 ? 7   GLU B HA   5  
ATOM 8464  H HB2  . GLU B 2 9   ? -0.637  -3.961  -15.535 1.00 0.00 ? 7   GLU B HB2  5  
ATOM 8465  H HB3  . GLU B 2 9   ? -1.918  -3.242  -14.561 1.00 0.00 ? 7   GLU B HB3  5  
ATOM 8466  H HG2  . GLU B 2 9   ? -1.877  -2.878  -17.138 1.00 0.00 ? 7   GLU B HG2  5  
ATOM 8467  H HG3  . GLU B 2 9   ? -2.299  -1.544  -16.060 1.00 0.00 ? 7   GLU B HG3  5  
ATOM 8468  N N    . VAL B 2 10  ? -0.497  -0.130  -13.457 1.00 0.00 ? 8   VAL B N    5  
ATOM 8469  C CA   . VAL B 2 10  ? -1.019  0.845   -12.519 1.00 0.00 ? 8   VAL B CA   5  
ATOM 8470  C C    . VAL B 2 10  ? -2.479  1.150   -12.786 1.00 0.00 ? 8   VAL B C    5  
ATOM 8471  O O    . VAL B 2 10  ? -2.848  1.580   -13.876 1.00 0.00 ? 8   VAL B O    5  
ATOM 8472  C CB   . VAL B 2 10  ? -0.212  2.148   -12.588 1.00 0.00 ? 8   VAL B CB   5  
ATOM 8473  C CG1  . VAL B 2 10  ? -0.723  3.143   -11.560 1.00 0.00 ? 8   VAL B CG1  5  
ATOM 8474  C CG2  . VAL B 2 10  ? 1.264   1.853   -12.389 1.00 0.00 ? 8   VAL B CG2  5  
ATOM 8475  H H    . VAL B 2 10  ? -0.033  0.186   -14.262 1.00 0.00 ? 8   VAL B H    5  
ATOM 8476  H HA   . VAL B 2 10  ? -0.922  0.444   -11.519 1.00 0.00 ? 8   VAL B HA   5  
ATOM 8477  H HB   . VAL B 2 10  ? -0.344  2.579   -13.570 1.00 0.00 ? 8   VAL B HB   5  
ATOM 8478  H HG11 . VAL B 2 10  ? -1.772  3.339   -11.743 1.00 0.00 ? 8   VAL B HG11 5  
ATOM 8479  H HG12 . VAL B 2 10  ? -0.167  4.063   -11.638 1.00 0.00 ? 8   VAL B HG12 5  
ATOM 8480  H HG13 . VAL B 2 10  ? -0.604  2.730   -10.570 1.00 0.00 ? 8   VAL B HG13 5  
ATOM 8481  H HG21 . VAL B 2 10  ? 1.409   1.371   -11.432 1.00 0.00 ? 8   VAL B HG21 5  
ATOM 8482  H HG22 . VAL B 2 10  ? 1.826   2.773   -12.417 1.00 0.00 ? 8   VAL B HG22 5  
ATOM 8483  H HG23 . VAL B 2 10  ? 1.609   1.195   -13.175 1.00 0.00 ? 8   VAL B HG23 5  
ATOM 8484  N N    . LEU B 2 11  ? -3.304  0.922   -11.782 1.00 0.00 ? 9   LEU B N    5  
ATOM 8485  C CA   . LEU B 2 11  ? -4.725  1.182   -11.900 1.00 0.00 ? 9   LEU B CA   5  
ATOM 8486  C C    . LEU B 2 11  ? -5.069  2.540   -11.305 1.00 0.00 ? 9   LEU B C    5  
ATOM 8487  O O    . LEU B 2 11  ? -6.005  3.205   -11.745 1.00 0.00 ? 9   LEU B O    5  
ATOM 8488  C CB   . LEU B 2 11  ? -5.535  0.090   -11.197 1.00 0.00 ? 9   LEU B CB   5  
ATOM 8489  C CG   . LEU B 2 11  ? -5.075  -1.346  -11.458 1.00 0.00 ? 9   LEU B CG   5  
ATOM 8490  C CD1  . LEU B 2 11  ? -5.830  -2.313  -10.559 1.00 0.00 ? 9   LEU B CD1  5  
ATOM 8491  C CD2  . LEU B 2 11  ? -5.271  -1.716  -12.921 1.00 0.00 ? 9   LEU B CD2  5  
ATOM 8492  H H    . LEU B 2 11  ? -2.946  0.562   -10.937 1.00 0.00 ? 9   LEU B H    5  
ATOM 8493  H HA   . LEU B 2 11  ? -4.968  1.190   -12.949 1.00 0.00 ? 9   LEU B HA   5  
ATOM 8494  H HB2  . LEU B 2 11  ? -5.492  0.270   -10.132 1.00 0.00 ? 9   LEU B HB2  5  
ATOM 8495  H HB3  . LEU B 2 11  ? -6.564  0.177   -11.516 1.00 0.00 ? 9   LEU B HB3  5  
ATOM 8496  H HG   . LEU B 2 11  ? -4.023  -1.428  -11.228 1.00 0.00 ? 9   LEU B HG   5  
ATOM 8497  H HD11 . LEU B 2 11  ? -5.474  -3.318  -10.733 1.00 0.00 ? 9   LEU B HD11 5  
ATOM 8498  H HD12 . LEU B 2 11  ? -6.885  -2.262  -10.781 1.00 0.00 ? 9   LEU B HD12 5  
ATOM 8499  H HD13 . LEU B 2 11  ? -5.665  -2.047  -9.525  1.00 0.00 ? 9   LEU B HD13 5  
ATOM 8500  H HD21 . LEU B 2 11  ? -6.324  -1.685  -13.163 1.00 0.00 ? 9   LEU B HD21 5  
ATOM 8501  H HD22 . LEU B 2 11  ? -4.892  -2.712  -13.094 1.00 0.00 ? 9   LEU B HD22 5  
ATOM 8502  H HD23 . LEU B 2 11  ? -4.737  -1.014  -13.544 1.00 0.00 ? 9   LEU B HD23 5  
ATOM 8503  N N    . LEU B 2 12  ? -4.307  2.949   -10.303 1.00 0.00 ? 10  LEU B N    5  
ATOM 8504  C CA   . LEU B 2 12  ? -4.546  4.222   -9.645  1.00 0.00 ? 10  LEU B CA   5  
ATOM 8505  C C    . LEU B 2 12  ? -3.269  5.031   -9.499  1.00 0.00 ? 10  LEU B C    5  
ATOM 8506  O O    . LEU B 2 12  ? -2.266  4.535   -8.988  1.00 0.00 ? 10  LEU B O    5  
ATOM 8507  C CB   . LEU B 2 12  ? -5.148  3.991   -8.267  1.00 0.00 ? 10  LEU B CB   5  
ATOM 8508  C CG   . LEU B 2 12  ? -5.575  5.266   -7.534  1.00 0.00 ? 10  LEU B CG   5  
ATOM 8509  C CD1  . LEU B 2 12  ? -6.979  5.683   -7.918  1.00 0.00 ? 10  LEU B CD1  5  
ATOM 8510  C CD2  . LEU B 2 12  ? -5.484  5.078   -6.035  1.00 0.00 ? 10  LEU B CD2  5  
ATOM 8511  H H    . LEU B 2 12  ? -3.573  2.380   -9.993  1.00 0.00 ? 10  LEU B H    5  
ATOM 8512  H HA   . LEU B 2 12  ? -5.246  4.783   -10.239 1.00 0.00 ? 10  LEU B HA   5  
ATOM 8513  H HB2  . LEU B 2 12  ? -6.004  3.346   -8.381  1.00 0.00 ? 10  LEU B HB2  5  
ATOM 8514  H HB3  . LEU B 2 12  ? -4.416  3.482   -7.658  1.00 0.00 ? 10  LEU B HB3  5  
ATOM 8515  H HG   . LEU B 2 12  ? -4.907  6.066   -7.810  1.00 0.00 ? 10  LEU B HG   5  
ATOM 8516  H HD11 . LEU B 2 12  ? -7.245  6.579   -7.374  1.00 0.00 ? 10  LEU B HD11 5  
ATOM 8517  H HD12 . LEU B 2 12  ? -7.670  4.893   -7.665  1.00 0.00 ? 10  LEU B HD12 5  
ATOM 8518  H HD13 . LEU B 2 12  ? -7.021  5.877   -8.976  1.00 0.00 ? 10  LEU B HD13 5  
ATOM 8519  H HD21 . LEU B 2 12  ? -5.834  5.970   -5.538  1.00 0.00 ? 10  LEU B HD21 5  
ATOM 8520  H HD22 . LEU B 2 12  ? -4.457  4.890   -5.758  1.00 0.00 ? 10  LEU B HD22 5  
ATOM 8521  H HD23 . LEU B 2 12  ? -6.096  4.238   -5.740  1.00 0.00 ? 10  LEU B HD23 5  
ATOM 8522  N N    . ILE B 2 13  ? -3.309  6.270   -9.958  1.00 0.00 ? 11  ILE B N    5  
ATOM 8523  C CA   . ILE B 2 13  ? -2.172  7.161   -9.835  1.00 0.00 ? 11  ILE B CA   5  
ATOM 8524  C C    . ILE B 2 13  ? -2.519  8.268   -8.861  1.00 0.00 ? 11  ILE B C    5  
ATOM 8525  O O    . ILE B 2 13  ? -3.483  9.008   -9.061  1.00 0.00 ? 11  ILE B O    5  
ATOM 8526  C CB   . ILE B 2 13  ? -1.740  7.787   -11.175 1.00 0.00 ? 11  ILE B CB   5  
ATOM 8527  C CG1  . ILE B 2 13  ? -1.377  6.692   -12.182 1.00 0.00 ? 11  ILE B CG1  5  
ATOM 8528  C CG2  . ILE B 2 13  ? -0.558  8.727   -10.947 1.00 0.00 ? 11  ILE B CG2  5  
ATOM 8529  C CD1  . ILE B 2 13  ? -1.054  7.215   -13.565 1.00 0.00 ? 11  ILE B CD1  5  
ATOM 8530  H H    . ILE B 2 13  ? -4.130  6.599   -10.381 1.00 0.00 ? 11  ILE B H    5  
ATOM 8531  H HA   . ILE B 2 13  ? -1.342  6.591   -9.438  1.00 0.00 ? 11  ILE B HA   5  
ATOM 8532  H HB   . ILE B 2 13  ? -2.564  8.369   -11.561 1.00 0.00 ? 11  ILE B HB   5  
ATOM 8533  H HG12 . ILE B 2 13  ? -0.511  6.156   -11.823 1.00 0.00 ? 11  ILE B HG12 5  
ATOM 8534  H HG13 . ILE B 2 13  ? -2.207  6.007   -12.272 1.00 0.00 ? 11  ILE B HG13 5  
ATOM 8535  H HG21 . ILE B 2 13  ? -0.795  9.414   -10.145 1.00 0.00 ? 11  ILE B HG21 5  
ATOM 8536  H HG22 . ILE B 2 13  ? -0.357  9.284   -11.848 1.00 0.00 ? 11  ILE B HG22 5  
ATOM 8537  H HG23 . ILE B 2 13  ? 0.314   8.150   -10.677 1.00 0.00 ? 11  ILE B HG23 5  
ATOM 8538  H HD11 . ILE B 2 13  ? -1.936  7.667   -13.993 1.00 0.00 ? 11  ILE B HD11 5  
ATOM 8539  H HD12 . ILE B 2 13  ? -0.728  6.398   -14.192 1.00 0.00 ? 11  ILE B HD12 5  
ATOM 8540  H HD13 . ILE B 2 13  ? -0.269  7.952   -13.496 1.00 0.00 ? 11  ILE B HD13 5  
ATOM 8541  N N    . VAL B 2 14  ? -1.739  8.367   -7.810  1.00 0.00 ? 12  VAL B N    5  
ATOM 8542  C CA   . VAL B 2 14  ? -1.952  9.359   -6.788  1.00 0.00 ? 12  VAL B CA   5  
ATOM 8543  C C    . VAL B 2 14  ? -0.830  10.375  -6.838  1.00 0.00 ? 12  VAL B C    5  
ATOM 8544  O O    . VAL B 2 14  ? 0.296   10.052  -7.212  1.00 0.00 ? 12  VAL B O    5  
ATOM 8545  C CB   . VAL B 2 14  ? -2.011  8.710   -5.397  1.00 0.00 ? 12  VAL B CB   5  
ATOM 8546  C CG1  . VAL B 2 14  ? -2.594  9.662   -4.378  1.00 0.00 ? 12  VAL B CG1  5  
ATOM 8547  C CG2  . VAL B 2 14  ? -2.819  7.423   -5.446  1.00 0.00 ? 12  VAL B CG2  5  
ATOM 8548  H H    . VAL B 2 14  ? -0.965  7.763   -7.726  1.00 0.00 ? 12  VAL B H    5  
ATOM 8549  H HA   . VAL B 2 14  ? -2.890  9.852   -6.979  1.00 0.00 ? 12  VAL B HA   5  
ATOM 8550  H HB   . VAL B 2 14  ? -1.006  8.470   -5.095  1.00 0.00 ? 12  VAL B HB   5  
ATOM 8551  H HG11 . VAL B 2 14  ? -3.605  9.918   -4.662  1.00 0.00 ? 12  VAL B HG11 5  
ATOM 8552  H HG12 . VAL B 2 14  ? -1.994  10.559  -4.337  1.00 0.00 ? 12  VAL B HG12 5  
ATOM 8553  H HG13 . VAL B 2 14  ? -2.604  9.190   -3.406  1.00 0.00 ? 12  VAL B HG13 5  
ATOM 8554  H HG21 . VAL B 2 14  ? -2.340  6.723   -6.115  1.00 0.00 ? 12  VAL B HG21 5  
ATOM 8555  H HG22 . VAL B 2 14  ? -3.815  7.637   -5.803  1.00 0.00 ? 12  VAL B HG22 5  
ATOM 8556  H HG23 . VAL B 2 14  ? -2.875  6.995   -4.456  1.00 0.00 ? 12  VAL B HG23 5  
ATOM 8557  N N    . LYS B 2 15  ? -1.133  11.593  -6.462  1.00 0.00 ? 13  LYS B N    5  
ATOM 8558  C CA   . LYS B 2 15  ? -0.148  12.655  -6.494  1.00 0.00 ? 13  LYS B CA   5  
ATOM 8559  C C    . LYS B 2 15  ? 0.144   13.159  -5.101  1.00 0.00 ? 13  LYS B C    5  
ATOM 8560  O O    . LYS B 2 15  ? -0.517  12.751  -4.152  1.00 0.00 ? 13  LYS B O    5  
ATOM 8561  C CB   . LYS B 2 15  ? -0.631  13.801  -7.373  1.00 0.00 ? 13  LYS B CB   5  
ATOM 8562  C CG   . LYS B 2 15  ? -0.719  13.425  -8.838  1.00 0.00 ? 13  LYS B CG   5  
ATOM 8563  C CD   . LYS B 2 15  ? -1.984  13.963  -9.481  1.00 0.00 ? 13  LYS B CD   5  
ATOM 8564  C CE   . LYS B 2 15  ? -3.232  13.234  -8.995  1.00 0.00 ? 13  LYS B CE   5  
ATOM 8565  N NZ   . LYS B 2 15  ? -3.782  13.818  -7.736  1.00 0.00 ? 13  LYS B NZ   5  
ATOM 8566  H H    . LYS B 2 15  ? -2.042  11.777  -6.121  1.00 0.00 ? 13  LYS B H    5  
ATOM 8567  H HA   . LYS B 2 15  ? 0.760   12.251  -6.914  1.00 0.00 ? 13  LYS B HA   5  
ATOM 8568  H HB2  . LYS B 2 15  ? -1.611  14.108  -7.040  1.00 0.00 ? 13  LYS B HB2  5  
ATOM 8569  H HB3  . LYS B 2 15  ? 0.053   14.630  -7.275  1.00 0.00 ? 13  LYS B HB3  5  
ATOM 8570  H HG2  . LYS B 2 15  ? 0.137   13.833  -9.354  1.00 0.00 ? 13  LYS B HG2  5  
ATOM 8571  H HG3  . LYS B 2 15  ? -0.712  12.347  -8.920  1.00 0.00 ? 13  LYS B HG3  5  
ATOM 8572  H HD2  . LYS B 2 15  ? -2.074  15.009  -9.240  1.00 0.00 ? 13  LYS B HD2  5  
ATOM 8573  H HD3  . LYS B 2 15  ? -1.902  13.842  -10.550 1.00 0.00 ? 13  LYS B HD3  5  
ATOM 8574  H HE2  . LYS B 2 15  ? -3.987  13.290  -9.764  1.00 0.00 ? 13  LYS B HE2  5  
ATOM 8575  H HE3  . LYS B 2 15  ? -2.978  12.198  -8.817  1.00 0.00 ? 13  LYS B HE3  5  
ATOM 8576  H HZ1  . LYS B 2 15  ? -4.778  14.086  -7.864  1.00 0.00 ? 13  LYS B HZ1  5  
ATOM 8577  H HZ2  . LYS B 2 15  ? -3.243  14.661  -7.455  1.00 0.00 ? 13  LYS B HZ2  5  
ATOM 8578  H HZ3  . LYS B 2 15  ? -3.726  13.115  -6.960  1.00 0.00 ? 13  LYS B HZ3  5  
ATOM 8579  N N    . LYS B 2 16  ? 1.090   14.096  -5.036  1.00 0.00 ? 14  LYS B N    5  
ATOM 8580  C CA   . LYS B 2 16  ? 1.566   14.721  -3.796  1.00 0.00 ? 14  LYS B CA   5  
ATOM 8581  C C    . LYS B 2 16  ? 1.218   13.924  -2.538  1.00 0.00 ? 14  LYS B C    5  
ATOM 8582  O O    . LYS B 2 16  ? 0.337   14.296  -1.765  1.00 0.00 ? 14  LYS B O    5  
ATOM 8583  C CB   . LYS B 2 16  ? 1.001   16.132  -3.683  1.00 0.00 ? 14  LYS B CB   5  
ATOM 8584  C CG   . LYS B 2 16  ? 1.793   17.174  -4.453  1.00 0.00 ? 14  LYS B CG   5  
ATOM 8585  C CD   . LYS B 2 16  ? 1.565   18.570  -3.892  1.00 0.00 ? 14  LYS B CD   5  
ATOM 8586  C CE   . LYS B 2 16  ? 2.491   18.865  -2.719  1.00 0.00 ? 14  LYS B CE   5  
ATOM 8587  N NZ   . LYS B 2 16  ? 2.288   17.921  -1.587  1.00 0.00 ? 14  LYS B NZ   5  
ATOM 8588  H H    . LYS B 2 16  ? 1.508   14.374  -5.878  1.00 0.00 ? 14  LYS B H    5  
ATOM 8589  H HA   . LYS B 2 16  ? 2.641   14.791  -3.864  1.00 0.00 ? 14  LYS B HA   5  
ATOM 8590  H HB2  . LYS B 2 16  ? -0.009  16.128  -4.063  1.00 0.00 ? 14  LYS B HB2  5  
ATOM 8591  H HB3  . LYS B 2 16  ? 0.985   16.419  -2.641  1.00 0.00 ? 14  LYS B HB3  5  
ATOM 8592  H HG2  . LYS B 2 16  ? 2.844   16.937  -4.387  1.00 0.00 ? 14  LYS B HG2  5  
ATOM 8593  H HG3  . LYS B 2 16  ? 1.482   17.156  -5.488  1.00 0.00 ? 14  LYS B HG3  5  
ATOM 8594  H HD2  . LYS B 2 16  ? 1.749   19.294  -4.673  1.00 0.00 ? 14  LYS B HD2  5  
ATOM 8595  H HD3  . LYS B 2 16  ? 0.541   18.650  -3.560  1.00 0.00 ? 14  LYS B HD3  5  
ATOM 8596  H HE2  . LYS B 2 16  ? 3.514   18.789  -3.058  1.00 0.00 ? 14  LYS B HE2  5  
ATOM 8597  H HE3  . LYS B 2 16  ? 2.302   19.871  -2.376  1.00 0.00 ? 14  LYS B HE3  5  
ATOM 8598  H HZ1  . LYS B 2 16  ? 1.275   17.835  -1.364  1.00 0.00 ? 14  LYS B HZ1  5  
ATOM 8599  H HZ2  . LYS B 2 16  ? 2.793   18.258  -0.743  1.00 0.00 ? 14  LYS B HZ2  5  
ATOM 8600  H HZ3  . LYS B 2 16  ? 2.661   16.973  -1.838  1.00 0.00 ? 14  LYS B HZ3  5  
ATOM 8601  N N    . VAL B 2 17  ? 1.915   12.816  -2.367  1.00 0.00 ? 15  VAL B N    5  
ATOM 8602  C CA   . VAL B 2 17  ? 1.730   11.944  -1.222  1.00 0.00 ? 15  VAL B CA   5  
ATOM 8603  C C    . VAL B 2 17  ? 3.033   11.841  -0.444  1.00 0.00 ? 15  VAL B C    5  
ATOM 8604  O O    . VAL B 2 17  ? 4.069   11.491  -1.001  1.00 0.00 ? 15  VAL B O    5  
ATOM 8605  C CB   . VAL B 2 17  ? 1.263   10.533  -1.653  1.00 0.00 ? 15  VAL B CB   5  
ATOM 8606  C CG1  . VAL B 2 17  ? 1.480   9.514   -0.541  1.00 0.00 ? 15  VAL B CG1  5  
ATOM 8607  C CG2  . VAL B 2 17  ? -0.201  10.557  -2.050  1.00 0.00 ? 15  VAL B CG2  5  
ATOM 8608  H H    . VAL B 2 17  ? 2.584   12.574  -3.047  1.00 0.00 ? 15  VAL B H    5  
ATOM 8609  H HA   . VAL B 2 17  ? 0.973   12.380  -0.586  1.00 0.00 ? 15  VAL B HA   5  
ATOM 8610  H HB   . VAL B 2 17  ? 1.842   10.228  -2.517  1.00 0.00 ? 15  VAL B HB   5  
ATOM 8611  H HG11 . VAL B 2 17  ? 0.849   9.759   0.301   1.00 0.00 ? 15  VAL B HG11 5  
ATOM 8612  H HG12 . VAL B 2 17  ? 2.515   9.531   -0.232  1.00 0.00 ? 15  VAL B HG12 5  
ATOM 8613  H HG13 . VAL B 2 17  ? 1.230   8.527   -0.903  1.00 0.00 ? 15  VAL B HG13 5  
ATOM 8614  H HG21 . VAL B 2 17  ? -0.495  9.581   -2.406  1.00 0.00 ? 15  VAL B HG21 5  
ATOM 8615  H HG22 . VAL B 2 17  ? -0.349  11.287  -2.833  1.00 0.00 ? 15  VAL B HG22 5  
ATOM 8616  H HG23 . VAL B 2 17  ? -0.801  10.824  -1.192  1.00 0.00 ? 15  VAL B HG23 5  
ATOM 8617  N N    . ARG B 2 18  ? 2.972   12.157  0.833   1.00 0.00 ? 16  ARG B N    5  
ATOM 8618  C CA   . ARG B 2 18  ? 4.132   12.106  1.696   1.00 0.00 ? 16  ARG B CA   5  
ATOM 8619  C C    . ARG B 2 18  ? 4.288   10.734  2.328   1.00 0.00 ? 16  ARG B C    5  
ATOM 8620  O O    . ARG B 2 18  ? 3.400   10.250  3.023   1.00 0.00 ? 16  ARG B O    5  
ATOM 8621  C CB   . ARG B 2 18  ? 4.027   13.157  2.800   1.00 0.00 ? 16  ARG B CB   5  
ATOM 8622  C CG   . ARG B 2 18  ? 4.631   14.501  2.441   1.00 0.00 ? 16  ARG B CG   5  
ATOM 8623  C CD   . ARG B 2 18  ? 4.466   15.503  3.574   1.00 0.00 ? 16  ARG B CD   5  
ATOM 8624  N NE   . ARG B 2 18  ? 4.428   14.851  4.884   1.00 0.00 ? 16  ARG B NE   5  
ATOM 8625  C CZ   . ARG B 2 18  ? 4.587   15.484  6.044   1.00 0.00 ? 16  ARG B CZ   5  
ATOM 8626  N NH1  . ARG B 2 18  ? 4.838   16.785  6.083   1.00 0.00 ? 16  ARG B NH1  5  
ATOM 8627  N NH2  . ARG B 2 18  ? 4.487   14.809  7.172   1.00 0.00 ? 16  ARG B NH2  5  
ATOM 8628  H H    . ARG B 2 18  ? 2.105   12.424  1.215   1.00 0.00 ? 16  ARG B H    5  
ATOM 8629  H HA   . ARG B 2 18  ? 5.004   12.315  1.095   1.00 0.00 ? 16  ARG B HA   5  
ATOM 8630  H HB2  . ARG B 2 18  ? 2.984   13.309  3.036   1.00 0.00 ? 16  ARG B HB2  5  
ATOM 8631  H HB3  . ARG B 2 18  ? 4.532   12.784  3.680   1.00 0.00 ? 16  ARG B HB3  5  
ATOM 8632  H HG2  . ARG B 2 18  ? 5.683   14.371  2.239   1.00 0.00 ? 16  ARG B HG2  5  
ATOM 8633  H HG3  . ARG B 2 18  ? 4.137   14.883  1.560   1.00 0.00 ? 16  ARG B HG3  5  
ATOM 8634  H HD2  . ARG B 2 18  ? 5.296   16.192  3.549   1.00 0.00 ? 16  ARG B HD2  5  
ATOM 8635  H HD3  . ARG B 2 18  ? 3.544   16.045  3.425   1.00 0.00 ? 16  ARG B HD3  5  
ATOM 8636  H HE   . ARG B 2 18  ? 4.251   13.879  4.900   1.00 0.00 ? 16  ARG B HE   5  
ATOM 8637  H HH11 . ARG B 2 18  ? 4.913   17.312  5.238   1.00 0.00 ? 16  ARG B HH11 5  
ATOM 8638  H HH12 . ARG B 2 18  ? 4.949   17.247  6.977   1.00 0.00 ? 16  ARG B HH12 5  
ATOM 8639  H HH21 . ARG B 2 18  ? 4.289   13.812  7.155   1.00 0.00 ? 16  ARG B HH21 5  
ATOM 8640  H HH22 . ARG B 2 18  ? 4.602   15.283  8.054   1.00 0.00 ? 16  ARG B HH22 5  
ATOM 8641  N N    . GLN B 2 19  ? 5.409   10.110  2.058   1.00 0.00 ? 17  GLN B N    5  
ATOM 8642  C CA   . GLN B 2 19  ? 5.726   8.819   2.627   1.00 0.00 ? 17  GLN B CA   5  
ATOM 8643  C C    . GLN B 2 19  ? 7.007   8.969   3.418   1.00 0.00 ? 17  GLN B C    5  
ATOM 8644  O O    . GLN B 2 19  ? 8.052   9.295   2.847   1.00 0.00 ? 17  GLN B O    5  
ATOM 8645  C CB   . GLN B 2 19  ? 5.885   7.760   1.535   1.00 0.00 ? 17  GLN B CB   5  
ATOM 8646  C CG   . GLN B 2 19  ? 6.455   6.436   2.028   1.00 0.00 ? 17  GLN B CG   5  
ATOM 8647  C CD   . GLN B 2 19  ? 5.618   5.798   3.122   1.00 0.00 ? 17  GLN B CD   5  
ATOM 8648  O OE1  . GLN B 2 19  ? 4.617   5.147   2.847   1.00 0.00 ? 17  GLN B OE1  5  
ATOM 8649  N NE2  . GLN B 2 19  ? 6.042   5.955   4.366   1.00 0.00 ? 17  GLN B NE2  5  
ATOM 8650  H H    . GLN B 2 19  ? 6.056   10.537  1.451   1.00 0.00 ? 17  GLN B H    5  
ATOM 8651  H HA   . GLN B 2 19  ? 4.925   8.537   3.295   1.00 0.00 ? 17  GLN B HA   5  
ATOM 8652  H HB2  . GLN B 2 19  ? 4.917   7.567   1.097   1.00 0.00 ? 17  GLN B HB2  5  
ATOM 8653  H HB3  . GLN B 2 19  ? 6.543   8.147   0.772   1.00 0.00 ? 17  GLN B HB3  5  
ATOM 8654  H HG2  . GLN B 2 19  ? 6.508   5.750   1.196   1.00 0.00 ? 17  GLN B HG2  5  
ATOM 8655  H HG3  . GLN B 2 19  ? 7.450   6.608   2.412   1.00 0.00 ? 17  GLN B HG3  5  
ATOM 8656  H HE21 . GLN B 2 19  ? 6.864   6.464   4.518   1.00 0.00 ? 17  GLN B HE21 5  
ATOM 8657  H HE22 . GLN B 2 19  ? 5.510   5.563   5.088   1.00 0.00 ? 17  GLN B HE22 5  
ATOM 8658  N N    . LYS B 2 20  ? 6.908   8.784   4.731   1.00 0.00 ? 18  LYS B N    5  
ATOM 8659  C CA   . LYS B 2 20  ? 8.056   8.913   5.618   1.00 0.00 ? 18  LYS B CA   5  
ATOM 8660  C C    . LYS B 2 20  ? 8.471   10.386  5.682   1.00 0.00 ? 18  LYS B C    5  
ATOM 8661  O O    . LYS B 2 20  ? 9.656   10.719  5.730   1.00 0.00 ? 18  LYS B O    5  
ATOM 8662  C CB   . LYS B 2 20  ? 9.207   8.015   5.133   1.00 0.00 ? 18  LYS B CB   5  
ATOM 8663  C CG   . LYS B 2 20  ? 9.942   7.269   6.239   1.00 0.00 ? 18  LYS B CG   5  
ATOM 8664  C CD   . LYS B 2 20  ? 10.909  8.168   6.988   1.00 0.00 ? 18  LYS B CD   5  
ATOM 8665  C CE   . LYS B 2 20  ? 10.306  8.664   8.290   1.00 0.00 ? 18  LYS B CE   5  
ATOM 8666  N NZ   . LYS B 2 20  ? 10.164  7.570   9.282   1.00 0.00 ? 18  LYS B NZ   5  
ATOM 8667  H H    . LYS B 2 20  ? 6.028   8.572   5.117   1.00 0.00 ? 18  LYS B H    5  
ATOM 8668  H HA   . LYS B 2 20  ? 7.747   8.595   6.604   1.00 0.00 ? 18  LYS B HA   5  
ATOM 8669  H HB2  . LYS B 2 20  ? 8.803   7.283   4.451   1.00 0.00 ? 18  LYS B HB2  5  
ATOM 8670  H HB3  . LYS B 2 20  ? 9.921   8.626   4.606   1.00 0.00 ? 18  LYS B HB3  5  
ATOM 8671  H HG2  . LYS B 2 20  ? 9.217   6.880   6.937   1.00 0.00 ? 18  LYS B HG2  5  
ATOM 8672  H HG3  . LYS B 2 20  ? 10.494  6.451   5.799   1.00 0.00 ? 18  LYS B HG3  5  
ATOM 8673  H HD2  . LYS B 2 20  ? 11.808  7.612   7.208   1.00 0.00 ? 18  LYS B HD2  5  
ATOM 8674  H HD3  . LYS B 2 20  ? 11.152  9.017   6.367   1.00 0.00 ? 18  LYS B HD3  5  
ATOM 8675  H HE2  . LYS B 2 20  ? 10.940  9.433   8.702   1.00 0.00 ? 18  LYS B HE2  5  
ATOM 8676  H HE3  . LYS B 2 20  ? 9.327   9.078   8.082   1.00 0.00 ? 18  LYS B HE3  5  
ATOM 8677  H HZ1  . LYS B 2 20  ? 10.944  6.896   9.194   1.00 0.00 ? 18  LYS B HZ1  5  
ATOM 8678  H HZ2  . LYS B 2 20  ? 9.257   7.067   9.129   1.00 0.00 ? 18  LYS B HZ2  5  
ATOM 8679  H HZ3  . LYS B 2 20  ? 10.162  7.966   10.252  1.00 0.00 ? 18  LYS B HZ3  5  
ATOM 8680  N N    . LYS B 2 21  ? 7.454   11.255  5.674   1.00 0.00 ? 19  LYS B N    5  
ATOM 8681  C CA   . LYS B 2 21  ? 7.626   12.707  5.731   1.00 0.00 ? 19  LYS B CA   5  
ATOM 8682  C C    . LYS B 2 21  ? 8.267   13.244  4.445   1.00 0.00 ? 19  LYS B C    5  
ATOM 8683  O O    . LYS B 2 21  ? 8.863   14.321  4.438   1.00 0.00 ? 19  LYS B O    5  
ATOM 8684  C CB   . LYS B 2 21  ? 8.446   13.117  6.966   1.00 0.00 ? 19  LYS B CB   5  
ATOM 8685  C CG   . LYS B 2 21  ? 7.782   14.203  7.806   1.00 0.00 ? 19  LYS B CG   5  
ATOM 8686  C CD   . LYS B 2 21  ? 7.283   13.670  9.146   1.00 0.00 ? 19  LYS B CD   5  
ATOM 8687  C CE   . LYS B 2 21  ? 8.152   14.135  10.300  1.00 0.00 ? 19  LYS B CE   5  
ATOM 8688  N NZ   . LYS B 2 21  ? 9.440   13.395  10.354  1.00 0.00 ? 19  LYS B NZ   5  
ATOM 8689  H H    . LYS B 2 21  ? 6.532   10.894  5.634   1.00 0.00 ? 19  LYS B H    5  
ATOM 8690  H HA   . LYS B 2 21  ? 6.640   13.139  5.818   1.00 0.00 ? 19  LYS B HA   5  
ATOM 8691  H HB2  . LYS B 2 21  ? 8.592   12.249  7.590   1.00 0.00 ? 19  LYS B HB2  5  
ATOM 8692  H HB3  . LYS B 2 21  ? 9.409   13.482  6.640   1.00 0.00 ? 19  LYS B HB3  5  
ATOM 8693  H HG2  . LYS B 2 21  ? 8.500   14.987  7.991   1.00 0.00 ? 19  LYS B HG2  5  
ATOM 8694  H HG3  . LYS B 2 21  ? 6.944   14.606  7.255   1.00 0.00 ? 19  LYS B HG3  5  
ATOM 8695  H HD2  . LYS B 2 21  ? 6.273   14.015  9.316   1.00 0.00 ? 19  LYS B HD2  5  
ATOM 8696  H HD3  . LYS B 2 21  ? 7.290   12.587  9.124   1.00 0.00 ? 19  LYS B HD3  5  
ATOM 8697  H HE2  . LYS B 2 21  ? 8.351   15.189  10.181  1.00 0.00 ? 19  LYS B HE2  5  
ATOM 8698  H HE3  . LYS B 2 21  ? 7.612   13.973  11.224  1.00 0.00 ? 19  LYS B HE3  5  
ATOM 8699  H HZ1  . LYS B 2 21  ? 10.048  13.785  11.097  1.00 0.00 ? 19  LYS B HZ1  5  
ATOM 8700  H HZ2  . LYS B 2 21  ? 9.931   13.464  9.443   1.00 0.00 ? 19  LYS B HZ2  5  
ATOM 8701  H HZ3  . LYS B 2 21  ? 9.262   12.381  10.564  1.00 0.00 ? 19  LYS B HZ3  5  
ATOM 8702  N N    . GLN B 2 22  ? 8.116   12.496  3.356   1.00 0.00 ? 20  GLN B N    5  
ATOM 8703  C CA   . GLN B 2 22  ? 8.667   12.886  2.060   1.00 0.00 ? 20  GLN B CA   5  
ATOM 8704  C C    . GLN B 2 22  ? 7.571   12.882  0.994   1.00 0.00 ? 20  GLN B C    5  
ATOM 8705  O O    . GLN B 2 22  ? 6.950   11.854  0.750   1.00 0.00 ? 20  GLN B O    5  
ATOM 8706  C CB   . GLN B 2 22  ? 9.793   11.928  1.667   1.00 0.00 ? 20  GLN B CB   5  
ATOM 8707  C CG   . GLN B 2 22  ? 10.389  12.204  0.297   1.00 0.00 ? 20  GLN B CG   5  
ATOM 8708  C CD   . GLN B 2 22  ? 11.374  11.134  -0.137  1.00 0.00 ? 20  GLN B CD   5  
ATOM 8709  O OE1  . GLN B 2 22  ? 12.318  11.406  -0.878  1.00 0.00 ? 20  GLN B OE1  5  
ATOM 8710  N NE2  . GLN B 2 22  ? 11.159  9.908   0.318   1.00 0.00 ? 20  GLN B NE2  5  
ATOM 8711  H H    . GLN B 2 22  ? 7.625   11.650  3.427   1.00 0.00 ? 20  GLN B H    5  
ATOM 8712  H HA   . GLN B 2 22  ? 9.067   13.885  2.153   1.00 0.00 ? 20  GLN B HA   5  
ATOM 8713  H HB2  . GLN B 2 22  ? 10.584  12.001  2.399   1.00 0.00 ? 20  GLN B HB2  5  
ATOM 8714  H HB3  . GLN B 2 22  ? 9.406   10.919  1.669   1.00 0.00 ? 20  GLN B HB3  5  
ATOM 8715  H HG2  . GLN B 2 22  ? 9.589   12.249  -0.426  1.00 0.00 ? 20  GLN B HG2  5  
ATOM 8716  H HG3  . GLN B 2 22  ? 10.901  13.154  0.328   1.00 0.00 ? 20  GLN B HG3  5  
ATOM 8717  H HE21 . GLN B 2 22  ? 10.385  9.759   0.903   1.00 0.00 ? 20  GLN B HE21 5  
ATOM 8718  H HE22 . GLN B 2 22  ? 11.780  9.203   0.050   1.00 0.00 ? 20  GLN B HE22 5  
ATOM 8719  N N    . ASP B 2 23  ? 7.341   14.031  0.365   1.00 0.00 ? 21  ASP B N    5  
ATOM 8720  C CA   . ASP B 2 23  ? 6.299   14.166  -0.662  1.00 0.00 ? 21  ASP B CA   5  
ATOM 8721  C C    . ASP B 2 23  ? 6.669   13.423  -1.949  1.00 0.00 ? 21  ASP B C    5  
ATOM 8722  O O    . ASP B 2 23  ? 7.851   13.228  -2.248  1.00 0.00 ? 21  ASP B O    5  
ATOM 8723  C CB   . ASP B 2 23  ? 6.046   15.646  -0.967  1.00 0.00 ? 21  ASP B CB   5  
ATOM 8724  C CG   . ASP B 2 23  ? 4.573   16.013  -0.916  1.00 0.00 ? 21  ASP B CG   5  
ATOM 8725  O OD1  . ASP B 2 23  ? 4.132   16.615  0.089   1.00 0.00 ? 21  ASP B OD1  5  
ATOM 8726  O OD2  . ASP B 2 23  ? 3.843   15.720  -1.881  1.00 0.00 ? 21  ASP B OD2  5  
ATOM 8727  H H    . ASP B 2 23  ? 7.891   14.810  0.587   1.00 0.00 ? 21  ASP B H    5  
ATOM 8728  H HA   . ASP B 2 23  ? 5.392   13.734  -0.265  1.00 0.00 ? 21  ASP B HA   5  
ATOM 8729  H HB2  . ASP B 2 23  ? 6.572   16.250  -0.243  1.00 0.00 ? 21  ASP B HB2  5  
ATOM 8730  H HB3  . ASP B 2 23  ? 6.420   15.871  -1.956  1.00 0.00 ? 21  ASP B HB3  5  
ATOM 8731  N N    . GLY B 2 24  ? 5.651   13.008  -2.702  1.00 0.00 ? 22  GLY B N    5  
ATOM 8732  C CA   . GLY B 2 24  ? 5.873   12.286  -3.944  1.00 0.00 ? 22  GLY B CA   5  
ATOM 8733  C C    . GLY B 2 24  ? 4.577   11.866  -4.621  1.00 0.00 ? 22  GLY B C    5  
ATOM 8734  O O    . GLY B 2 24  ? 3.535   12.469  -4.400  1.00 0.00 ? 22  GLY B O    5  
ATOM 8735  H H    . GLY B 2 24  ? 4.733   13.196  -2.411  1.00 0.00 ? 22  GLY B H    5  
ATOM 8736  H HA2  . GLY B 2 24  ? 6.430   12.920  -4.621  1.00 0.00 ? 22  GLY B HA2  5  
ATOM 8737  H HA3  . GLY B 2 24  ? 6.457   11.403  -3.734  1.00 0.00 ? 22  GLY B HA3  5  
ATOM 8738  N N    . ALA B 2 25  ? 4.637   10.814  -5.427  1.00 0.00 ? 23  ALA B N    5  
ATOM 8739  C CA   . ALA B 2 25  ? 3.465   10.312  -6.142  1.00 0.00 ? 23  ALA B CA   5  
ATOM 8740  C C    . ALA B 2 25  ? 3.292   8.818   -5.895  1.00 0.00 ? 23  ALA B C    5  
ATOM 8741  O O    . ALA B 2 25  ? 4.247   8.043   -5.993  1.00 0.00 ? 23  ALA B O    5  
ATOM 8742  C CB   . ALA B 2 25  ? 3.592   10.596  -7.631  1.00 0.00 ? 23  ALA B CB   5  
ATOM 8743  H H    . ALA B 2 25  ? 5.498   10.347  -5.538  1.00 0.00 ? 23  ALA B H    5  
ATOM 8744  H HA   . ALA B 2 25  ? 2.585   10.832  -5.770  1.00 0.00 ? 23  ALA B HA   5  
ATOM 8745  H HB1  . ALA B 2 25  ? 4.409   10.021  -8.040  1.00 0.00 ? 23  ALA B HB1  5  
ATOM 8746  H HB2  . ALA B 2 25  ? 3.782   11.649  -7.781  1.00 0.00 ? 23  ALA B HB2  5  
ATOM 8747  H HB3  . ALA B 2 25  ? 2.673   10.322  -8.128  1.00 0.00 ? 23  ALA B HB3  5  
ATOM 8748  N N    . LEU B 2 26  ? 2.072   8.423   -5.578  1.00 0.00 ? 24  LEU B N    5  
ATOM 8749  C CA   . LEU B 2 26  ? 1.751   7.030   -5.295  1.00 0.00 ? 24  LEU B CA   5  
ATOM 8750  C C    . LEU B 2 26  ? 1.132   6.362   -6.523  1.00 0.00 ? 24  LEU B C    5  
ATOM 8751  O O    . LEU B 2 26  ? 0.388   6.989   -7.265  1.00 0.00 ? 24  LEU B O    5  
ATOM 8752  C CB   . LEU B 2 26  ? 0.786   6.965   -4.110  1.00 0.00 ? 24  LEU B CB   5  
ATOM 8753  C CG   . LEU B 2 26  ? 0.339   5.561   -3.711  1.00 0.00 ? 24  LEU B CG   5  
ATOM 8754  C CD1  . LEU B 2 26  ? 1.254   4.960   -2.672  1.00 0.00 ? 24  LEU B CD1  5  
ATOM 8755  C CD2  . LEU B 2 26  ? -1.091  5.579   -3.205  1.00 0.00 ? 24  LEU B CD2  5  
ATOM 8756  H H    . LEU B 2 26  ? 1.351   9.087   -5.557  1.00 0.00 ? 24  LEU B H    5  
ATOM 8757  H HA   . LEU B 2 26  ? 2.662   6.513   -5.033  1.00 0.00 ? 24  LEU B HA   5  
ATOM 8758  H HB2  . LEU B 2 26  ? 1.260   7.427   -3.261  1.00 0.00 ? 24  LEU B HB2  5  
ATOM 8759  H HB3  . LEU B 2 26  ? -0.089  7.542   -4.359  1.00 0.00 ? 24  LEU B HB3  5  
ATOM 8760  H HG   . LEU B 2 26  ? 0.394   4.927   -4.576  1.00 0.00 ? 24  LEU B HG   5  
ATOM 8761  H HD11 . LEU B 2 26  ? 2.239   4.831   -3.091  1.00 0.00 ? 24  LEU B HD11 5  
ATOM 8762  H HD12 . LEU B 2 26  ? 0.862   3.999   -2.368  1.00 0.00 ? 24  LEU B HD12 5  
ATOM 8763  H HD13 . LEU B 2 26  ? 1.304   5.614   -1.816  1.00 0.00 ? 24  LEU B HD13 5  
ATOM 8764  H HD21 . LEU B 2 26  ? -1.745  5.941   -3.987  1.00 0.00 ? 24  LEU B HD21 5  
ATOM 8765  H HD22 . LEU B 2 26  ? -1.162  6.233   -2.348  1.00 0.00 ? 24  LEU B HD22 5  
ATOM 8766  H HD23 . LEU B 2 26  ? -1.388  4.580   -2.922  1.00 0.00 ? 24  LEU B HD23 5  
ATOM 8767  N N    . TYR B 2 27  ? 1.455   5.099   -6.744  1.00 0.00 ? 25  TYR B N    5  
ATOM 8768  C CA   . TYR B 2 27  ? 0.923   4.351   -7.878  1.00 0.00 ? 25  TYR B CA   5  
ATOM 8769  C C    . TYR B 2 27  ? 0.458   2.977   -7.411  1.00 0.00 ? 25  TYR B C    5  
ATOM 8770  O O    . TYR B 2 27  ? 1.225   2.226   -6.815  1.00 0.00 ? 25  TYR B O    5  
ATOM 8771  C CB   . TYR B 2 27  ? 1.985   4.186   -8.976  1.00 0.00 ? 25  TYR B CB   5  
ATOM 8772  C CG   . TYR B 2 27  ? 2.514   5.484   -9.549  1.00 0.00 ? 25  TYR B CG   5  
ATOM 8773  C CD1  . TYR B 2 27  ? 2.040   5.974   -10.758 1.00 0.00 ? 25  TYR B CD1  5  
ATOM 8774  C CD2  . TYR B 2 27  ? 3.498   6.209   -8.888  1.00 0.00 ? 25  TYR B CD2  5  
ATOM 8775  C CE1  . TYR B 2 27  ? 2.530   7.152   -11.290 1.00 0.00 ? 25  TYR B CE1  5  
ATOM 8776  C CE2  . TYR B 2 27  ? 3.990   7.388   -9.412  1.00 0.00 ? 25  TYR B CE2  5  
ATOM 8777  C CZ   . TYR B 2 27  ? 3.504   7.854   -10.613 1.00 0.00 ? 25  TYR B CZ   5  
ATOM 8778  O OH   . TYR B 2 27  ? 3.993   9.027   -11.140 1.00 0.00 ? 25  TYR B OH   5  
ATOM 8779  H H    . TYR B 2 27  ? 2.073   4.645   -6.124  1.00 0.00 ? 25  TYR B H    5  
ATOM 8780  H HA   . TYR B 2 27  ? 0.078   4.893   -8.270  1.00 0.00 ? 25  TYR B HA   5  
ATOM 8781  H HB2  . TYR B 2 27  ? 2.823   3.647   -8.571  1.00 0.00 ? 25  TYR B HB2  5  
ATOM 8782  H HB3  . TYR B 2 27  ? 1.560   3.615   -9.788  1.00 0.00 ? 25  TYR B HB3  5  
ATOM 8783  H HD1  . TYR B 2 27  ? 1.276   5.424   -11.285 1.00 0.00 ? 25  TYR B HD1  5  
ATOM 8784  H HD2  . TYR B 2 27  ? 3.878   5.840   -7.946  1.00 0.00 ? 25  TYR B HD2  5  
ATOM 8785  H HE1  . TYR B 2 27  ? 2.148   7.517   -12.232 1.00 0.00 ? 25  TYR B HE1  5  
ATOM 8786  H HE2  . TYR B 2 27  ? 4.753   7.937   -8.880  1.00 0.00 ? 25  TYR B HE2  5  
ATOM 8787  H HH   . TYR B 2 27  ? 4.930   9.103   -10.937 1.00 0.00 ? 25  TYR B HH   5  
ATOM 8788  N N    . LEU B 2 28  ? -0.793  2.648   -7.671  1.00 0.00 ? 26  LEU B N    5  
ATOM 8789  C CA   . LEU B 2 28  ? -1.326  1.362   -7.250  1.00 0.00 ? 26  LEU B CA   5  
ATOM 8790  C C    . LEU B 2 28  ? -1.464  0.410   -8.424  1.00 0.00 ? 26  LEU B C    5  
ATOM 8791  O O    . LEU B 2 28  ? -2.308  0.609   -9.299  1.00 0.00 ? 26  LEU B O    5  
ATOM 8792  C CB   . LEU B 2 28  ? -2.680  1.532   -6.563  1.00 0.00 ? 26  LEU B CB   5  
ATOM 8793  C CG   . LEU B 2 28  ? -2.708  2.558   -5.434  1.00 0.00 ? 26  LEU B CG   5  
ATOM 8794  C CD1  . LEU B 2 28  ? -3.985  2.445   -4.638  1.00 0.00 ? 26  LEU B CD1  5  
ATOM 8795  C CD2  . LEU B 2 28  ? -1.531  2.391   -4.512  1.00 0.00 ? 26  LEU B CD2  5  
ATOM 8796  H H    . LEU B 2 28  ? -1.370  3.278   -8.158  1.00 0.00 ? 26  LEU B H    5  
ATOM 8797  H HA   . LEU B 2 28  ? -0.632  0.939   -6.540  1.00 0.00 ? 26  LEU B HA   5  
ATOM 8798  H HB2  . LEU B 2 28  ? -3.402  1.828   -7.309  1.00 0.00 ? 26  LEU B HB2  5  
ATOM 8799  H HB3  . LEU B 2 28  ? -2.976  0.576   -6.158  1.00 0.00 ? 26  LEU B HB3  5  
ATOM 8800  H HG   . LEU B 2 28  ? -2.656  3.544   -5.858  1.00 0.00 ? 26  LEU B HG   5  
ATOM 8801  H HD11 . LEU B 2 28  ? -3.973  3.181   -3.845  1.00 0.00 ? 26  LEU B HD11 5  
ATOM 8802  H HD12 . LEU B 2 28  ? -4.051  1.457   -4.208  1.00 0.00 ? 26  LEU B HD12 5  
ATOM 8803  H HD13 . LEU B 2 28  ? -4.829  2.621   -5.282  1.00 0.00 ? 26  LEU B HD13 5  
ATOM 8804  H HD21 . LEU B 2 28  ? -1.581  3.142   -3.737  1.00 0.00 ? 26  LEU B HD21 5  
ATOM 8805  H HD22 . LEU B 2 28  ? -0.618  2.510   -5.074  1.00 0.00 ? 26  LEU B HD22 5  
ATOM 8806  H HD23 . LEU B 2 28  ? -1.563  1.411   -4.067  1.00 0.00 ? 26  LEU B HD23 5  
ATOM 8807  N N    . MET B 2 29  ? -0.627  -0.612  -8.441  1.00 0.00 ? 27  MET B N    5  
ATOM 8808  C CA   . MET B 2 29  ? -0.660  -1.615  -9.488  1.00 0.00 ? 27  MET B CA   5  
ATOM 8809  C C    . MET B 2 29  ? -1.608  -2.726  -9.087  1.00 0.00 ? 27  MET B C    5  
ATOM 8810  O O    . MET B 2 29  ? -1.923  -2.881  -7.912  1.00 0.00 ? 27  MET B O    5  
ATOM 8811  C CB   . MET B 2 29  ? 0.726   -2.201  -9.754  1.00 0.00 ? 27  MET B CB   5  
ATOM 8812  C CG   . MET B 2 29  ? 1.744   -1.187  -10.243 1.00 0.00 ? 27  MET B CG   5  
ATOM 8813  S SD   . MET B 2 29  ? 2.335   -0.096  -8.938  1.00 0.00 ? 27  MET B SD   5  
ATOM 8814  C CE   . MET B 2 29  ? 3.476   0.915   -9.873  1.00 0.00 ? 27  MET B CE   5  
ATOM 8815  H H    . MET B 2 29  ? 0.034   -0.703  -7.717  1.00 0.00 ? 27  MET B H    5  
ATOM 8816  H HA   . MET B 2 29  ? -1.027  -1.148  -10.392 1.00 0.00 ? 27  MET B HA   5  
ATOM 8817  H HB2  . MET B 2 29  ? 1.096   -2.644  -8.844  1.00 0.00 ? 27  MET B HB2  5  
ATOM 8818  H HB3  . MET B 2 29  ? 0.633   -2.972  -10.504 1.00 0.00 ? 27  MET B HB3  5  
ATOM 8819  H HG2  . MET B 2 29  ? 2.588   -1.718  -10.656 1.00 0.00 ? 27  MET B HG2  5  
ATOM 8820  H HG3  . MET B 2 29  ? 1.287   -0.586  -11.016 1.00 0.00 ? 27  MET B HG3  5  
ATOM 8821  H HE1  . MET B 2 29  ? 2.932   1.461   -10.630 1.00 0.00 ? 27  MET B HE1  5  
ATOM 8822  H HE2  . MET B 2 29  ? 4.212   0.282   -10.345 1.00 0.00 ? 27  MET B HE2  5  
ATOM 8823  H HE3  . MET B 2 29  ? 3.967   1.610   -9.211  1.00 0.00 ? 27  MET B HE3  5  
ATOM 8824  N N    . ALA B 2 30  ? -2.020  -3.519  -10.057 1.00 0.00 ? 28  ALA B N    5  
ATOM 8825  C CA   . ALA B 2 30  ? -2.962  -4.609  -9.824  1.00 0.00 ? 28  ALA B CA   5  
ATOM 8826  C C    . ALA B 2 30  ? -2.450  -5.636  -8.813  1.00 0.00 ? 28  ALA B C    5  
ATOM 8827  O O    . ALA B 2 30  ? -3.241  -6.341  -8.190  1.00 0.00 ? 28  ALA B O    5  
ATOM 8828  C CB   . ALA B 2 30  ? -3.291  -5.294  -11.141 1.00 0.00 ? 28  ALA B CB   5  
ATOM 8829  H H    . ALA B 2 30  ? -1.673  -3.373  -10.964 1.00 0.00 ? 28  ALA B H    5  
ATOM 8830  H HA   . ALA B 2 30  ? -3.875  -4.177  -9.443  1.00 0.00 ? 28  ALA B HA   5  
ATOM 8831  H HB1  . ALA B 2 30  ? -3.640  -4.559  -11.852 1.00 0.00 ? 28  ALA B HB1  5  
ATOM 8832  H HB2  . ALA B 2 30  ? -4.060  -6.034  -10.980 1.00 0.00 ? 28  ALA B HB2  5  
ATOM 8833  H HB3  . ALA B 2 30  ? -2.404  -5.775  -11.527 1.00 0.00 ? 28  ALA B HB3  5  
ATOM 8834  N N    . GLU B 2 31  ? -1.138  -5.725  -8.644  1.00 0.00 ? 29  GLU B N    5  
ATOM 8835  C CA   . GLU B 2 31  ? -0.576  -6.701  -7.721  1.00 0.00 ? 29  GLU B CA   5  
ATOM 8836  C C    . GLU B 2 31  ? 0.164   -6.051  -6.550  1.00 0.00 ? 29  GLU B C    5  
ATOM 8837  O O    . GLU B 2 31  ? 0.460   -6.719  -5.549  1.00 0.00 ? 29  GLU B O    5  
ATOM 8838  C CB   . GLU B 2 31  ? 0.396   -7.622  -8.465  1.00 0.00 ? 29  GLU B CB   5  
ATOM 8839  C CG   . GLU B 2 31  ? 0.064   -7.825  -9.935  1.00 0.00 ? 29  GLU B CG   5  
ATOM 8840  C CD   . GLU B 2 31  ? 0.852   -6.890  -10.835 1.00 0.00 ? 29  GLU B CD   5  
ATOM 8841  O OE1  . GLU B 2 31  ? 1.999   -7.234  -11.195 1.00 0.00 ? 29  GLU B OE1  5  
ATOM 8842  O OE2  . GLU B 2 31  ? 0.343   -5.800  -11.169 1.00 0.00 ? 29  GLU B OE2  5  
ATOM 8843  H H    . GLU B 2 31  ? -0.541  -5.151  -9.169  1.00 0.00 ? 29  GLU B H    5  
ATOM 8844  H HA   . GLU B 2 31  ? -1.387  -7.297  -7.333  1.00 0.00 ? 29  GLU B HA   5  
ATOM 8845  H HB2  . GLU B 2 31  ? 1.387   -7.200  -8.400  1.00 0.00 ? 29  GLU B HB2  5  
ATOM 8846  H HB3  . GLU B 2 31  ? 0.397   -8.589  -7.981  1.00 0.00 ? 29  GLU B HB3  5  
ATOM 8847  H HG2  . GLU B 2 31  ? 0.296   -8.844  -10.208 1.00 0.00 ? 29  GLU B HG2  5  
ATOM 8848  H HG3  . GLU B 2 31  ? -0.990  -7.643  -10.084 1.00 0.00 ? 29  GLU B HG3  5  
ATOM 8849  N N    . ARG B 2 32  ? 0.434   -4.752  -6.630  1.00 0.00 ? 30  ARG B N    5  
ATOM 8850  C CA   . ARG B 2 32  ? 1.199   -4.106  -5.569  1.00 0.00 ? 30  ARG B CA   5  
ATOM 8851  C C    . ARG B 2 32  ? 1.006   -2.600  -5.540  1.00 0.00 ? 30  ARG B C    5  
ATOM 8852  O O    . ARG B 2 32  ? 0.483   -2.008  -6.474  1.00 0.00 ? 30  ARG B O    5  
ATOM 8853  C CB   . ARG B 2 32  ? 2.690   -4.418  -5.744  1.00 0.00 ? 30  ARG B CB   5  
ATOM 8854  C CG   . ARG B 2 32  ? 3.334   -3.711  -6.930  1.00 0.00 ? 30  ARG B CG   5  
ATOM 8855  C CD   . ARG B 2 32  ? 4.609   -4.413  -7.373  1.00 0.00 ? 30  ARG B CD   5  
ATOM 8856  N NE   . ARG B 2 32  ? 4.376   -5.832  -7.649  1.00 0.00 ? 30  ARG B NE   5  
ATOM 8857  C CZ   . ARG B 2 32  ? 3.877   -6.293  -8.796  1.00 0.00 ? 30  ARG B CZ   5  
ATOM 8858  N NH1  . ARG B 2 32  ? 3.653   -5.472  -9.811  1.00 0.00 ? 30  ARG B NH1  5  
ATOM 8859  N NH2  . ARG B 2 32  ? 3.630   -7.588  -8.944  1.00 0.00 ? 30  ARG B NH2  5  
ATOM 8860  H H    . ARG B 2 32  ? 0.076   -4.215  -7.377  1.00 0.00 ? 30  ARG B H    5  
ATOM 8861  H HA   . ARG B 2 32  ? 0.869   -4.516  -4.628  1.00 0.00 ? 30  ARG B HA   5  
ATOM 8862  H HB2  . ARG B 2 32  ? 3.214   -4.120  -4.847  1.00 0.00 ? 30  ARG B HB2  5  
ATOM 8863  H HB3  . ARG B 2 32  ? 2.808   -5.483  -5.880  1.00 0.00 ? 30  ARG B HB3  5  
ATOM 8864  H HG2  . ARG B 2 32  ? 2.636   -3.702  -7.754  1.00 0.00 ? 30  ARG B HG2  5  
ATOM 8865  H HG3  . ARG B 2 32  ? 3.572   -2.696  -6.646  1.00 0.00 ? 30  ARG B HG3  5  
ATOM 8866  H HD2  . ARG B 2 32  ? 4.976   -3.937  -8.269  1.00 0.00 ? 30  ARG B HD2  5  
ATOM 8867  H HD3  . ARG B 2 32  ? 5.347   -4.324  -6.588  1.00 0.00 ? 30  ARG B HD3  5  
ATOM 8868  H HE   . ARG B 2 32  ? 4.575   -6.468  -6.925  1.00 0.00 ? 30  ARG B HE   5  
ATOM 8869  H HH11 . ARG B 2 32  ? 3.866   -4.481  -9.734  1.00 0.00 ? 30  ARG B HH11 5  
ATOM 8870  H HH12 . ARG B 2 32  ? 3.253   -5.827  -10.663 1.00 0.00 ? 30  ARG B HH12 5  
ATOM 8871  H HH21 . ARG B 2 32  ? 3.817   -8.228  -8.199  1.00 0.00 ? 30  ARG B HH21 5  
ATOM 8872  H HH22 . ARG B 2 32  ? 3.234   -7.926  -9.810  1.00 0.00 ? 30  ARG B HH22 5  
ATOM 8873  N N    . ILE B 2 33  ? 1.444   -2.000  -4.450  1.00 0.00 ? 31  ILE B N    5  
ATOM 8874  C CA   . ILE B 2 33  ? 1.366   -0.565  -4.265  1.00 0.00 ? 31  ILE B CA   5  
ATOM 8875  C C    . ILE B 2 33  ? 2.779   0.010   -4.272  1.00 0.00 ? 31  ILE B C    5  
ATOM 8876  O O    . ILE B 2 33  ? 3.621   -0.373  -3.452  1.00 0.00 ? 31  ILE B O    5  
ATOM 8877  C CB   . ILE B 2 33  ? 0.642   -0.193  -2.944  1.00 0.00 ? 31  ILE B CB   5  
ATOM 8878  C CG1  . ILE B 2 33  ? 1.031   1.219   -2.490  1.00 0.00 ? 31  ILE B CG1  5  
ATOM 8879  C CG2  . ILE B 2 33  ? 0.943   -1.215  -1.854  1.00 0.00 ? 31  ILE B CG2  5  
ATOM 8880  C CD1  . ILE B 2 33  ? 0.216   1.729   -1.322  1.00 0.00 ? 31  ILE B CD1  5  
ATOM 8881  H H    . ILE B 2 33  ? 1.851   -2.546  -3.740  1.00 0.00 ? 31  ILE B H    5  
ATOM 8882  H HA   . ILE B 2 33  ? 0.807   -0.143  -5.094  1.00 0.00 ? 31  ILE B HA   5  
ATOM 8883  H HB   . ILE B 2 33  ? -0.420  -0.216  -3.133  1.00 0.00 ? 31  ILE B HB   5  
ATOM 8884  H HG12 . ILE B 2 33  ? 2.069   1.222   -2.194  1.00 0.00 ? 31  ILE B HG12 5  
ATOM 8885  H HG13 . ILE B 2 33  ? 0.895   1.905   -3.314  1.00 0.00 ? 31  ILE B HG13 5  
ATOM 8886  H HG21 . ILE B 2 33  ? 0.497   -0.892  -0.924  1.00 0.00 ? 31  ILE B HG21 5  
ATOM 8887  H HG22 . ILE B 2 33  ? 2.012   -1.305  -1.729  1.00 0.00 ? 31  ILE B HG22 5  
ATOM 8888  H HG23 . ILE B 2 33  ? 0.531   -2.173  -2.137  1.00 0.00 ? 31  ILE B HG23 5  
ATOM 8889  H HD11 . ILE B 2 33  ? 0.566   2.710   -1.041  1.00 0.00 ? 31  ILE B HD11 5  
ATOM 8890  H HD12 . ILE B 2 33  ? 0.327   1.054   -0.486  1.00 0.00 ? 31  ILE B HD12 5  
ATOM 8891  H HD13 . ILE B 2 33  ? -0.824  1.784   -1.605  1.00 0.00 ? 31  ILE B HD13 5  
ATOM 8892  N N    . ALA B 2 34  ? 3.047   0.892   -5.216  1.00 0.00 ? 32  ALA B N    5  
ATOM 8893  C CA   . ALA B 2 34  ? 4.353   1.509   -5.330  1.00 0.00 ? 32  ALA B CA   5  
ATOM 8894  C C    . ALA B 2 34  ? 4.238   3.016   -5.192  1.00 0.00 ? 32  ALA B C    5  
ATOM 8895  O O    . ALA B 2 34  ? 3.203   3.597   -5.492  1.00 0.00 ? 32  ALA B O    5  
ATOM 8896  C CB   . ALA B 2 34  ? 5.002   1.142   -6.656  1.00 0.00 ? 32  ALA B CB   5  
ATOM 8897  H H    . ALA B 2 34  ? 2.341   1.147   -5.855  1.00 0.00 ? 32  ALA B H    5  
ATOM 8898  H HA   . ALA B 2 34  ? 4.975   1.129   -4.532  1.00 0.00 ? 32  ALA B HA   5  
ATOM 8899  H HB1  . ALA B 2 34  ? 5.164   0.076   -6.694  1.00 0.00 ? 32  ALA B HB1  5  
ATOM 8900  H HB2  . ALA B 2 34  ? 5.948   1.654   -6.748  1.00 0.00 ? 32  ALA B HB2  5  
ATOM 8901  H HB3  . ALA B 2 34  ? 4.353   1.437   -7.467  1.00 0.00 ? 32  ALA B HB3  5  
ATOM 8902  N N    . TRP B 2 35  ? 5.287   3.647   -4.713  1.00 0.00 ? 33  TRP B N    5  
ATOM 8903  C CA   . TRP B 2 35  ? 5.283   5.086   -4.545  1.00 0.00 ? 33  TRP B CA   5  
ATOM 8904  C C    . TRP B 2 35  ? 6.683   5.639   -4.784  1.00 0.00 ? 33  TRP B C    5  
ATOM 8905  O O    . TRP B 2 35  ? 7.678   5.029   -4.383  1.00 0.00 ? 33  TRP B O    5  
ATOM 8906  C CB   . TRP B 2 35  ? 4.741   5.445   -3.150  1.00 0.00 ? 33  TRP B CB   5  
ATOM 8907  C CG   . TRP B 2 35  ? 4.920   6.880   -2.752  1.00 0.00 ? 33  TRP B CG   5  
ATOM 8908  C CD1  . TRP B 2 35  ? 3.981   7.861   -2.837  1.00 0.00 ? 33  TRP B CD1  5  
ATOM 8909  C CD2  . TRP B 2 35  ? 6.091   7.496   -2.196  1.00 0.00 ? 33  TRP B CD2  5  
ATOM 8910  N NE1  . TRP B 2 35  ? 4.491   9.048   -2.390  1.00 0.00 ? 33  TRP B NE1  5  
ATOM 8911  C CE2  . TRP B 2 35  ? 5.785   8.852   -1.986  1.00 0.00 ? 33  TRP B CE2  5  
ATOM 8912  C CE3  . TRP B 2 35  ? 7.367   7.036   -1.859  1.00 0.00 ? 33  TRP B CE3  5  
ATOM 8913  C CZ2  . TRP B 2 35  ? 6.708   9.750   -1.458  1.00 0.00 ? 33  TRP B CZ2  5  
ATOM 8914  C CZ3  . TRP B 2 35  ? 8.281   7.927   -1.333  1.00 0.00 ? 33  TRP B CZ3  5  
ATOM 8915  C CH2  . TRP B 2 35  ? 7.948   9.272   -1.137  1.00 0.00 ? 33  TRP B CH2  5  
ATOM 8916  H H    . TRP B 2 35  ? 6.086   3.134   -4.465  1.00 0.00 ? 33  TRP B H    5  
ATOM 8917  H HA   . TRP B 2 35  ? 4.621   5.498   -5.293  1.00 0.00 ? 33  TRP B HA   5  
ATOM 8918  H HB2  . TRP B 2 35  ? 3.684   5.237   -3.135  1.00 0.00 ? 33  TRP B HB2  5  
ATOM 8919  H HB3  . TRP B 2 35  ? 5.214   4.827   -2.415  1.00 0.00 ? 33  TRP B HB3  5  
ATOM 8920  H HD1  . TRP B 2 35  ? 2.983   7.712   -3.217  1.00 0.00 ? 33  TRP B HD1  5  
ATOM 8921  H HE1  . TRP B 2 35  ? 4.003   9.901   -2.358  1.00 0.00 ? 33  TRP B HE1  5  
ATOM 8922  H HE3  . TRP B 2 35  ? 7.643   6.001   -2.003  1.00 0.00 ? 33  TRP B HE3  5  
ATOM 8923  H HZ2  . TRP B 2 35  ? 6.466   10.790  -1.299  1.00 0.00 ? 33  TRP B HZ2  5  
ATOM 8924  H HZ3  . TRP B 2 35  ? 9.272   7.589   -1.067  1.00 0.00 ? 33  TRP B HZ3  5  
ATOM 8925  H HH2  . TRP B 2 35  ? 8.694   9.935   -0.723  1.00 0.00 ? 33  TRP B HH2  5  
ATOM 8926  N N    . ALA B 2 36  ? 6.751   6.775   -5.457  1.00 0.00 ? 34  ALA B N    5  
ATOM 8927  C CA   . ALA B 2 36  ? 8.020   7.415   -5.762  1.00 0.00 ? 34  ALA B CA   5  
ATOM 8928  C C    . ALA B 2 36  ? 8.025   8.846   -5.249  1.00 0.00 ? 34  ALA B C    5  
ATOM 8929  O O    . ALA B 2 36  ? 6.992   9.511   -5.268  1.00 0.00 ? 34  ALA B O    5  
ATOM 8930  C CB   . ALA B 2 36  ? 8.271   7.396   -7.263  1.00 0.00 ? 34  ALA B CB   5  
ATOM 8931  H H    . ALA B 2 36  ? 5.917   7.211   -5.749  1.00 0.00 ? 34  ALA B H    5  
ATOM 8932  H HA   . ALA B 2 36  ? 8.808   6.859   -5.276  1.00 0.00 ? 34  ALA B HA   5  
ATOM 8933  H HB1  . ALA B 2 36  ? 8.181   6.385   -7.631  1.00 0.00 ? 34  ALA B HB1  5  
ATOM 8934  H HB2  . ALA B 2 36  ? 9.266   7.766   -7.466  1.00 0.00 ? 34  ALA B HB2  5  
ATOM 8935  H HB3  . ALA B 2 36  ? 7.546   8.026   -7.757  1.00 0.00 ? 34  ALA B HB3  5  
ATOM 8936  N N    . PRO B 2 37  ? 9.176   9.331   -4.760  1.00 0.00 ? 35  PRO B N    5  
ATOM 8937  C CA   . PRO B 2 37  ? 9.301   10.700  -4.255  1.00 0.00 ? 35  PRO B CA   5  
ATOM 8938  C C    . PRO B 2 37  ? 9.025   11.731  -5.347  1.00 0.00 ? 35  PRO B C    5  
ATOM 8939  O O    . PRO B 2 37  ? 9.105   11.420  -6.538  1.00 0.00 ? 35  PRO B O    5  
ATOM 8940  C CB   . PRO B 2 37  ? 10.756  10.790  -3.783  1.00 0.00 ? 35  PRO B CB   5  
ATOM 8941  C CG   . PRO B 2 37  ? 11.204  9.377   -3.627  1.00 0.00 ? 35  PRO B CG   5  
ATOM 8942  C CD   . PRO B 2 37  ? 10.439  8.586   -4.647  1.00 0.00 ? 35  PRO B CD   5  
ATOM 8943  H HA   . PRO B 2 37  ? 8.635   10.875  -3.421  1.00 0.00 ? 35  PRO B HA   5  
ATOM 8944  H HB2  . PRO B 2 37  ? 11.343  11.310  -4.525  1.00 0.00 ? 35  PRO B HB2  5  
ATOM 8945  H HB3  . PRO B 2 37  ? 10.800  11.323  -2.845  1.00 0.00 ? 35  PRO B HB3  5  
ATOM 8946  H HG2  . PRO B 2 37  ? 12.265  9.306   -3.816  1.00 0.00 ? 35  PRO B HG2  5  
ATOM 8947  H HG3  . PRO B 2 37  ? 10.975  9.027   -2.631  1.00 0.00 ? 35  PRO B HG3  5  
ATOM 8948  H HD2  . PRO B 2 37  ? 10.966  8.571   -5.590  1.00 0.00 ? 35  PRO B HD2  5  
ATOM 8949  H HD3  . PRO B 2 37  ? 10.262  7.582   -4.293  1.00 0.00 ? 35  PRO B HD3  5  
ATOM 8950  N N    . GLU B 2 38  ? 8.706   12.952  -4.940  1.00 0.00 ? 36  GLU B N    5  
ATOM 8951  C CA   . GLU B 2 38  ? 8.404   14.018  -5.885  1.00 0.00 ? 36  GLU B CA   5  
ATOM 8952  C C    . GLU B 2 38  ? 9.562   14.251  -6.850  1.00 0.00 ? 36  GLU B C    5  
ATOM 8953  O O    . GLU B 2 38  ? 10.724  14.383  -6.439  1.00 0.00 ? 36  GLU B O    5  
ATOM 8954  C CB   . GLU B 2 38  ? 8.060   15.312  -5.144  1.00 0.00 ? 36  GLU B CB   5  
ATOM 8955  C CG   . GLU B 2 38  ? 7.390   16.356  -6.027  1.00 0.00 ? 36  GLU B CG   5  
ATOM 8956  C CD   . GLU B 2 38  ? 6.265   15.776  -6.865  1.00 0.00 ? 36  GLU B CD   5  
ATOM 8957  O OE1  . GLU B 2 38  ? 6.563   15.141  -7.902  1.00 0.00 ? 36  GLU B OE1  5  
ATOM 8958  O OE2  . GLU B 2 38  ? 5.089   15.953  -6.488  1.00 0.00 ? 36  GLU B OE2  5  
ATOM 8959  H H    . GLU B 2 38  ? 8.656   13.137  -3.976  1.00 0.00 ? 36  GLU B H    5  
ATOM 8960  H HA   . GLU B 2 38  ? 7.542   13.709  -6.457  1.00 0.00 ? 36  GLU B HA   5  
ATOM 8961  H HB2  . GLU B 2 38  ? 7.393   15.080  -4.327  1.00 0.00 ? 36  GLU B HB2  5  
ATOM 8962  H HB3  . GLU B 2 38  ? 8.969   15.738  -4.745  1.00 0.00 ? 36  GLU B HB3  5  
ATOM 8963  H HG2  . GLU B 2 38  ? 6.985   17.134  -5.398  1.00 0.00 ? 36  GLU B HG2  5  
ATOM 8964  H HG3  . GLU B 2 38  ? 8.133   16.778  -6.688  1.00 0.00 ? 36  GLU B HG3  5  
ATOM 8965  N N    . GLY B 2 39  ? 9.233   14.293  -8.134  1.00 0.00 ? 37  GLY B N    5  
ATOM 8966  C CA   . GLY B 2 39  ? 10.230  14.503  -9.164  1.00 0.00 ? 37  GLY B CA   5  
ATOM 8967  C C    . GLY B 2 39  ? 11.220  13.357  -9.275  1.00 0.00 ? 37  GLY B C    5  
ATOM 8968  O O    . GLY B 2 39  ? 12.383  13.574  -9.616  1.00 0.00 ? 37  GLY B O    5  
ATOM 8969  H H    . GLY B 2 39  ? 8.280   14.210  -8.383  1.00 0.00 ? 37  GLY B H    5  
ATOM 8970  H HA2  . GLY B 2 39  ? 9.728   14.621  -10.114 1.00 0.00 ? 37  GLY B HA2  5  
ATOM 8971  H HA3  . GLY B 2 39  ? 10.771  15.410  -8.943  1.00 0.00 ? 37  GLY B HA3  5  
ATOM 8972  N N    . LYS B 2 40  ? 10.782  12.148  -8.951  1.00 0.00 ? 38  LYS B N    5  
ATOM 8973  C CA   . LYS B 2 40  ? 11.648  10.976  -9.030  1.00 0.00 ? 38  LYS B CA   5  
ATOM 8974  C C    . LYS B 2 40  ? 11.172  10.023  -10.118 1.00 0.00 ? 38  LYS B C    5  
ATOM 8975  O O    . LYS B 2 40  ? 9.982   9.964   -10.428 1.00 0.00 ? 38  LYS B O    5  
ATOM 8976  C CB   . LYS B 2 40  ? 11.707  10.243  -7.688  1.00 0.00 ? 38  LYS B CB   5  
ATOM 8977  C CG   . LYS B 2 40  ? 13.012  10.445  -6.925  1.00 0.00 ? 38  LYS B CG   5  
ATOM 8978  C CD   . LYS B 2 40  ? 13.047  11.786  -6.207  1.00 0.00 ? 38  LYS B CD   5  
ATOM 8979  C CE   . LYS B 2 40  ? 13.837  12.822  -6.987  1.00 0.00 ? 38  LYS B CE   5  
ATOM 8980  N NZ   . LYS B 2 40  ? 13.413  14.208  -6.650  1.00 0.00 ? 38  LYS B NZ   5  
ATOM 8981  H H    . LYS B 2 40  ? 9.849   12.035  -8.658  1.00 0.00 ? 38  LYS B H    5  
ATOM 8982  H HA   . LYS B 2 40  ? 12.641  11.317  -9.285  1.00 0.00 ? 38  LYS B HA   5  
ATOM 8983  H HB2  . LYS B 2 40  ? 10.896  10.594  -7.067  1.00 0.00 ? 38  LYS B HB2  5  
ATOM 8984  H HB3  . LYS B 2 40  ? 11.580  9.185   -7.864  1.00 0.00 ? 38  LYS B HB3  5  
ATOM 8985  H HG2  . LYS B 2 40  ? 13.115  9.657   -6.195  1.00 0.00 ? 38  LYS B HG2  5  
ATOM 8986  H HG3  . LYS B 2 40  ? 13.834  10.399  -7.625  1.00 0.00 ? 38  LYS B HG3  5  
ATOM 8987  H HD2  . LYS B 2 40  ? 12.035  12.142  -6.081  1.00 0.00 ? 38  LYS B HD2  5  
ATOM 8988  H HD3  . LYS B 2 40  ? 13.505  11.651  -5.238  1.00 0.00 ? 38  LYS B HD3  5  
ATOM 8989  H HE2  . LYS B 2 40  ? 14.885  12.709  -6.753  1.00 0.00 ? 38  LYS B HE2  5  
ATOM 8990  H HE3  . LYS B 2 40  ? 13.684  12.654  -8.044  1.00 0.00 ? 38  LYS B HE3  5  
ATOM 8991  H HZ1  . LYS B 2 40  ? 13.763  14.873  -7.368  1.00 0.00 ? 38  LYS B HZ1  5  
ATOM 8992  H HZ2  . LYS B 2 40  ? 13.790  14.484  -5.723  1.00 0.00 ? 38  LYS B HZ2  5  
ATOM 8993  H HZ3  . LYS B 2 40  ? 12.369  14.265  -6.619  1.00 0.00 ? 38  LYS B HZ3  5  
ATOM 8994  N N    . ASP B 2 41  ? 12.110  9.284   -10.687 1.00 0.00 ? 39  ASP B N    5  
ATOM 8995  C CA   . ASP B 2 41  ? 11.817  8.327   -11.749 1.00 0.00 ? 39  ASP B CA   5  
ATOM 8996  C C    . ASP B 2 41  ? 11.707  6.911   -11.194 1.00 0.00 ? 39  ASP B C    5  
ATOM 8997  O O    . ASP B 2 41  ? 11.081  6.040   -11.796 1.00 0.00 ? 39  ASP B O    5  
ATOM 8998  C CB   . ASP B 2 41  ? 12.925  8.375   -12.809 1.00 0.00 ? 39  ASP B CB   5  
ATOM 8999  C CG   . ASP B 2 41  ? 14.276  7.928   -12.267 1.00 0.00 ? 39  ASP B CG   5  
ATOM 9000  O OD1  . ASP B 2 41  ? 14.573  8.201   -11.079 1.00 0.00 ? 39  ASP B OD1  5  
ATOM 9001  O OD2  . ASP B 2 41  ? 15.050  7.303   -13.020 1.00 0.00 ? 39  ASP B OD2  5  
ATOM 9002  H H    . ASP B 2 41  ? 13.042  9.387   -10.396 1.00 0.00 ? 39  ASP B H    5  
ATOM 9003  H HA   . ASP B 2 41  ? 10.879  8.604   -12.203 1.00 0.00 ? 39  ASP B HA   5  
ATOM 9004  H HB2  . ASP B 2 41  ? 12.657  7.727   -13.629 1.00 0.00 ? 39  ASP B HB2  5  
ATOM 9005  H HB3  . ASP B 2 41  ? 13.021  9.387   -13.174 1.00 0.00 ? 39  ASP B HB3  5  
ATOM 9006  N N    . ARG B 2 42  ? 12.309  6.689   -10.035 1.00 0.00 ? 40  ARG B N    5  
ATOM 9007  C CA   . ARG B 2 42  ? 12.306  5.374   -9.412  1.00 0.00 ? 40  ARG B CA   5  
ATOM 9008  C C    . ARG B 2 42  ? 11.414  5.339   -8.177  1.00 0.00 ? 40  ARG B C    5  
ATOM 9009  O O    . ARG B 2 42  ? 11.376  6.290   -7.393  1.00 0.00 ? 40  ARG B O    5  
ATOM 9010  C CB   . ARG B 2 42  ? 13.735  4.967   -9.044  1.00 0.00 ? 40  ARG B CB   5  
ATOM 9011  C CG   . ARG B 2 42  ? 14.481  6.011   -8.226  1.00 0.00 ? 40  ARG B CG   5  
ATOM 9012  C CD   . ARG B 2 42  ? 15.956  6.050   -8.591  1.00 0.00 ? 40  ARG B CD   5  
ATOM 9013  N NE   . ARG B 2 42  ? 16.154  6.350   -10.010 1.00 0.00 ? 40  ARG B NE   5  
ATOM 9014  C CZ   . ARG B 2 42  ? 17.138  5.856   -10.757 1.00 0.00 ? 40  ARG B CZ   5  
ATOM 9015  N NH1  . ARG B 2 42  ? 18.076  5.088   -10.209 1.00 0.00 ? 40  ARG B NH1  5  
ATOM 9016  N NH2  . ARG B 2 42  ? 17.183  6.137   -12.053 1.00 0.00 ? 40  ARG B NH2  5  
ATOM 9017  H H    . ARG B 2 42  ? 12.765  7.430   -9.589  1.00 0.00 ? 40  ARG B H    5  
ATOM 9018  H HA   . ARG B 2 42  ? 11.920  4.671   -10.134 1.00 0.00 ? 40  ARG B HA   5  
ATOM 9019  H HB2  . ARG B 2 42  ? 13.700  4.053   -8.472  1.00 0.00 ? 40  ARG B HB2  5  
ATOM 9020  H HB3  . ARG B 2 42  ? 14.290  4.791   -9.953  1.00 0.00 ? 40  ARG B HB3  5  
ATOM 9021  H HG2  . ARG B 2 42  ? 14.047  6.981   -8.416  1.00 0.00 ? 40  ARG B HG2  5  
ATOM 9022  H HG3  . ARG B 2 42  ? 14.383  5.770   -7.177  1.00 0.00 ? 40  ARG B HG3  5  
ATOM 9023  H HD2  . ARG B 2 42  ? 16.441  6.812   -7.998  1.00 0.00 ? 40  ARG B HD2  5  
ATOM 9024  H HD3  . ARG B 2 42  ? 16.393  5.087   -8.369  1.00 0.00 ? 40  ARG B HD3  5  
ATOM 9025  H HE   . ARG B 2 42  ? 15.487  6.955   -10.443 1.00 0.00 ? 40  ARG B HE   5  
ATOM 9026  H HH11 . ARG B 2 42  ? 18.044  4.879   -9.232  1.00 0.00 ? 40  ARG B HH11 5  
ATOM 9027  H HH12 . ARG B 2 42  ? 18.816  4.717   -10.772 1.00 0.00 ? 40  ARG B HH12 5  
ATOM 9028  H HH21 . ARG B 2 42  ? 16.460  6.725   -12.471 1.00 0.00 ? 40  ARG B HH21 5  
ATOM 9029  H HH22 . ARG B 2 42  ? 17.915  5.777   -12.627 1.00 0.00 ? 40  ARG B HH22 5  
ATOM 9030  N N    . PHE B 2 43  ? 10.705  4.230   -8.011  1.00 0.00 ? 41  PHE B N    5  
ATOM 9031  C CA   . PHE B 2 43  ? 9.815   4.048   -6.875  1.00 0.00 ? 41  PHE B CA   5  
ATOM 9032  C C    . PHE B 2 43  ? 10.598  3.530   -5.678  1.00 0.00 ? 41  PHE B C    5  
ATOM 9033  O O    . PHE B 2 43  ? 11.276  2.508   -5.769  1.00 0.00 ? 41  PHE B O    5  
ATOM 9034  C CB   . PHE B 2 43  ? 8.692   3.063   -7.221  1.00 0.00 ? 41  PHE B CB   5  
ATOM 9035  C CG   . PHE B 2 43  ? 8.003   3.353   -8.526  1.00 0.00 ? 41  PHE B CG   5  
ATOM 9036  C CD1  . PHE B 2 43  ? 8.317   2.626   -9.664  1.00 0.00 ? 41  PHE B CD1  5  
ATOM 9037  C CD2  . PHE B 2 43  ? 7.044   4.347   -8.615  1.00 0.00 ? 41  PHE B CD2  5  
ATOM 9038  C CE1  . PHE B 2 43  ? 7.687   2.888   -10.866 1.00 0.00 ? 41  PHE B CE1  5  
ATOM 9039  C CE2  . PHE B 2 43  ? 6.411   4.613   -9.814  1.00 0.00 ? 41  PHE B CE2  5  
ATOM 9040  C CZ   . PHE B 2 43  ? 6.733   3.883   -10.940 1.00 0.00 ? 41  PHE B CZ   5  
ATOM 9041  H H    . PHE B 2 43  ? 10.787  3.512   -8.671  1.00 0.00 ? 41  PHE B H    5  
ATOM 9042  H HA   . PHE B 2 43  ? 9.384   5.007   -6.628  1.00 0.00 ? 41  PHE B HA   5  
ATOM 9043  H HB2  . PHE B 2 43  ? 9.105   2.067   -7.280  1.00 0.00 ? 41  PHE B HB2  5  
ATOM 9044  H HB3  . PHE B 2 43  ? 7.948   3.091   -6.438  1.00 0.00 ? 41  PHE B HB3  5  
ATOM 9045  H HD1  . PHE B 2 43  ? 9.063   1.848   -9.606  1.00 0.00 ? 41  PHE B HD1  5  
ATOM 9046  H HD2  . PHE B 2 43  ? 6.790   4.920   -7.735  1.00 0.00 ? 41  PHE B HD2  5  
ATOM 9047  H HE1  . PHE B 2 43  ? 7.941   2.315   -11.745 1.00 0.00 ? 41  PHE B HE1  5  
ATOM 9048  H HE2  . PHE B 2 43  ? 5.665   5.392   -9.870  1.00 0.00 ? 41  PHE B HE2  5  
ATOM 9049  H HZ   . PHE B 2 43  ? 6.238   4.090   -11.877 1.00 0.00 ? 41  PHE B HZ   5  
ATOM 9050  N N    . THR B 2 44  ? 10.512  4.239   -4.565  1.00 0.00 ? 42  THR B N    5  
ATOM 9051  C CA   . THR B 2 44  ? 11.211  3.842   -3.354  1.00 0.00 ? 42  THR B CA   5  
ATOM 9052  C C    . THR B 2 44  ? 10.313  2.979   -2.475  1.00 0.00 ? 42  THR B C    5  
ATOM 9053  O O    . THR B 2 44  ? 10.770  2.336   -1.533  1.00 0.00 ? 42  THR B O    5  
ATOM 9054  C CB   . THR B 2 44  ? 11.673  5.078   -2.565  1.00 0.00 ? 42  THR B CB   5  
ATOM 9055  O OG1  . THR B 2 44  ? 10.662  6.094   -2.627  1.00 0.00 ? 42  THR B OG1  5  
ATOM 9056  C CG2  . THR B 2 44  ? 12.981  5.618   -3.129  1.00 0.00 ? 42  THR B CG2  5  
ATOM 9057  H H    . THR B 2 44  ? 9.967   5.055   -4.555  1.00 0.00 ? 42  THR B H    5  
ATOM 9058  H HA   . THR B 2 44  ? 12.083  3.271   -3.639  1.00 0.00 ? 42  THR B HA   5  
ATOM 9059  H HB   . THR B 2 44  ? 11.829  4.794   -1.535  1.00 0.00 ? 42  THR B HB   5  
ATOM 9060  H HG1  . THR B 2 44  ? 9.992   5.921   -1.960  1.00 0.00 ? 42  THR B HG1  5  
ATOM 9061  H HG21 . THR B 2 44  ? 13.230  6.545   -2.636  1.00 0.00 ? 42  THR B HG21 5  
ATOM 9062  H HG22 . THR B 2 44  ? 12.870  5.791   -4.189  1.00 0.00 ? 42  THR B HG22 5  
ATOM 9063  H HG23 . THR B 2 44  ? 13.768  4.898   -2.962  1.00 0.00 ? 42  THR B HG23 5  
ATOM 9064  N N    . ILE B 2 45  ? 9.028   2.978   -2.796  1.00 0.00 ? 43  ILE B N    5  
ATOM 9065  C CA   . ILE B 2 45  ? 8.051   2.200   -2.057  1.00 0.00 ? 43  ILE B CA   5  
ATOM 9066  C C    . ILE B 2 45  ? 7.477   1.103   -2.942  1.00 0.00 ? 43  ILE B C    5  
ATOM 9067  O O    . ILE B 2 45  ? 7.000   1.379   -4.041  1.00 0.00 ? 43  ILE B O    5  
ATOM 9068  C CB   . ILE B 2 45  ? 6.903   3.097   -1.535  1.00 0.00 ? 43  ILE B CB   5  
ATOM 9069  C CG1  . ILE B 2 45  ? 7.394   3.983   -0.389  1.00 0.00 ? 43  ILE B CG1  5  
ATOM 9070  C CG2  . ILE B 2 45  ? 5.708   2.263   -1.091  1.00 0.00 ? 43  ILE B CG2  5  
ATOM 9071  C CD1  . ILE B 2 45  ? 7.890   3.209   0.814   1.00 0.00 ? 43  ILE B CD1  5  
ATOM 9072  H H    . ILE B 2 45  ? 8.729   3.517   -3.560  1.00 0.00 ? 43  ILE B H    5  
ATOM 9073  H HA   . ILE B 2 45  ? 8.548   1.750   -1.209  1.00 0.00 ? 43  ILE B HA   5  
ATOM 9074  H HB   . ILE B 2 45  ? 6.578   3.729   -2.350  1.00 0.00 ? 43  ILE B HB   5  
ATOM 9075  H HG12 . ILE B 2 45  ? 8.209   4.598   -0.743  1.00 0.00 ? 43  ILE B HG12 5  
ATOM 9076  H HG13 . ILE B 2 45  ? 6.586   4.620   -0.064  1.00 0.00 ? 43  ILE B HG13 5  
ATOM 9077  H HG21 . ILE B 2 45  ? 6.023   1.558   -0.337  1.00 0.00 ? 43  ILE B HG21 5  
ATOM 9078  H HG22 . ILE B 2 45  ? 5.307   1.728   -1.939  1.00 0.00 ? 43  ILE B HG22 5  
ATOM 9079  H HG23 . ILE B 2 45  ? 4.948   2.911   -0.682  1.00 0.00 ? 43  ILE B HG23 5  
ATOM 9080  H HD11 . ILE B 2 45  ? 7.090   2.594   1.200   1.00 0.00 ? 43  ILE B HD11 5  
ATOM 9081  H HD12 . ILE B 2 45  ? 8.214   3.901   1.578   1.00 0.00 ? 43  ILE B HD12 5  
ATOM 9082  H HD13 . ILE B 2 45  ? 8.718   2.581   0.522   1.00 0.00 ? 43  ILE B HD13 5  
ATOM 9083  N N    . SER B 2 46  ? 7.565   -0.134  -2.480  1.00 0.00 ? 44  SER B N    5  
ATOM 9084  C CA   . SER B 2 46  ? 7.040   -1.265  -3.217  1.00 0.00 ? 44  SER B CA   5  
ATOM 9085  C C    . SER B 2 46  ? 6.548   -2.332  -2.245  1.00 0.00 ? 44  SER B C    5  
ATOM 9086  O O    . SER B 2 46  ? 7.345   -3.048  -1.640  1.00 0.00 ? 44  SER B O    5  
ATOM 9087  C CB   . SER B 2 46  ? 8.117   -1.837  -4.141  1.00 0.00 ? 44  SER B CB   5  
ATOM 9088  O OG   . SER B 2 46  ? 7.555   -2.700  -5.118  1.00 0.00 ? 44  SER B OG   5  
ATOM 9089  H H    . SER B 2 46  ? 8.006   -0.294  -1.620  1.00 0.00 ? 44  SER B H    5  
ATOM 9090  H HA   . SER B 2 46  ? 6.207   -0.922  -3.811  1.00 0.00 ? 44  SER B HA   5  
ATOM 9091  H HB2  . SER B 2 46  ? 8.622   -1.027  -4.644  1.00 0.00 ? 44  SER B HB2  5  
ATOM 9092  H HB3  . SER B 2 46  ? 8.828   -2.393  -3.550  1.00 0.00 ? 44  SER B HB3  5  
ATOM 9093  H HG   . SER B 2 46  ? 7.393   -2.205  -5.925  1.00 0.00 ? 44  SER B HG   5  
ATOM 9094  N N    . HIS B 2 47  ? 5.238   -2.409  -2.072  1.00 0.00 ? 45  HIS B N    5  
ATOM 9095  C CA   . HIS B 2 47  ? 4.642   -3.393  -1.176  1.00 0.00 ? 45  HIS B CA   5  
ATOM 9096  C C    . HIS B 2 47  ? 3.624   -4.224  -1.933  1.00 0.00 ? 45  HIS B C    5  
ATOM 9097  O O    . HIS B 2 47  ? 2.843   -3.689  -2.720  1.00 0.00 ? 45  HIS B O    5  
ATOM 9098  C CB   . HIS B 2 47  ? 3.956   -2.711  0.013   1.00 0.00 ? 45  HIS B CB   5  
ATOM 9099  C CG   . HIS B 2 47  ? 4.852   -1.816  0.812   1.00 0.00 ? 45  HIS B CG   5  
ATOM 9100  N ND1  . HIS B 2 47  ? 5.732   -2.261  1.772   1.00 0.00 ? 45  HIS B ND1  5  
ATOM 9101  C CD2  . HIS B 2 47  ? 4.993   -0.468  0.770   1.00 0.00 ? 45  HIS B CD2  5  
ATOM 9102  C CE1  . HIS B 2 47  ? 6.368   -1.195  2.273   1.00 0.00 ? 45  HIS B CE1  5  
ATOM 9103  N NE2  . HIS B 2 47  ? 5.956   -0.082  1.697   1.00 0.00 ? 45  HIS B NE2  5  
ATOM 9104  H H    . HIS B 2 47  ? 4.651   -1.790  -2.563  1.00 0.00 ? 45  HIS B H    5  
ATOM 9105  H HA   . HIS B 2 47  ? 5.428   -4.038  -0.815  1.00 0.00 ? 45  HIS B HA   5  
ATOM 9106  H HB2  . HIS B 2 47  ? 3.135   -2.112  -0.351  1.00 0.00 ? 45  HIS B HB2  5  
ATOM 9107  H HB3  . HIS B 2 47  ? 3.569   -3.471  0.677   1.00 0.00 ? 45  HIS B HB3  5  
ATOM 9108  H HD1  . HIS B 2 47  ? 5.864   -3.194  2.047   1.00 0.00 ? 45  HIS B HD1  5  
ATOM 9109  H HD2  . HIS B 2 47  ? 4.441   0.208   0.131   1.00 0.00 ? 45  HIS B HD2  5  
ATOM 9110  H HE1  . HIS B 2 47  ? 7.121   -1.240  3.047   1.00 0.00 ? 45  HIS B HE1  5  
ATOM 9111  N N    . MET B 2 48  ? 3.623   -5.525  -1.706  1.00 0.00 ? 46  MET B N    5  
ATOM 9112  C CA   . MET B 2 48  ? 2.683   -6.398  -2.379  1.00 0.00 ? 46  MET B CA   5  
ATOM 9113  C C    . MET B 2 48  ? 1.414   -6.497  -1.557  1.00 0.00 ? 46  MET B C    5  
ATOM 9114  O O    . MET B 2 48  ? 1.473   -6.587  -0.334  1.00 0.00 ? 46  MET B O    5  
ATOM 9115  C CB   . MET B 2 48  ? 3.284   -7.791  -2.584  1.00 0.00 ? 46  MET B CB   5  
ATOM 9116  C CG   . MET B 2 48  ? 4.416   -7.833  -3.598  1.00 0.00 ? 46  MET B CG   5  
ATOM 9117  S SD   . MET B 2 48  ? 3.827   -7.931  -5.304  1.00 0.00 ? 46  MET B SD   5  
ATOM 9118  C CE   . MET B 2 48  ? 2.827   -9.417  -5.229  1.00 0.00 ? 46  MET B CE   5  
ATOM 9119  H H    . MET B 2 48  ? 4.249   -5.908  -1.045  1.00 0.00 ? 46  MET B H    5  
ATOM 9120  H HA   . MET B 2 48  ? 2.450   -5.964  -3.340  1.00 0.00 ? 46  MET B HA   5  
ATOM 9121  H HB2  . MET B 2 48  ? 3.665   -8.148  -1.639  1.00 0.00 ? 46  MET B HB2  5  
ATOM 9122  H HB3  . MET B 2 48  ? 2.504   -8.459  -2.922  1.00 0.00 ? 46  MET B HB3  5  
ATOM 9123  H HG2  . MET B 2 48  ? 5.010   -6.937  -3.490  1.00 0.00 ? 46  MET B HG2  5  
ATOM 9124  H HG3  . MET B 2 48  ? 5.033   -8.697  -3.393  1.00 0.00 ? 46  MET B HG3  5  
ATOM 9125  H HE1  . MET B 2 48  ? 3.430   -10.240 -4.876  1.00 0.00 ? 46  MET B HE1  5  
ATOM 9126  H HE2  . MET B 2 48  ? 2.449   -9.646  -6.214  1.00 0.00 ? 46  MET B HE2  5  
ATOM 9127  H HE3  . MET B 2 48  ? 1.999   -9.260  -4.553  1.00 0.00 ? 46  MET B HE3  5  
ATOM 9128  N N    . TYR B 2 49  ? 0.264   -6.474  -2.222  1.00 0.00 ? 47  TYR B N    5  
ATOM 9129  C CA   . TYR B 2 49  ? -1.026  -6.570  -1.531  1.00 0.00 ? 47  TYR B CA   5  
ATOM 9130  C C    . TYR B 2 49  ? -1.088  -7.846  -0.698  1.00 0.00 ? 47  TYR B C    5  
ATOM 9131  O O    . TYR B 2 49  ? -1.811  -7.927  0.295   1.00 0.00 ? 47  TYR B O    5  
ATOM 9132  C CB   . TYR B 2 49  ? -2.162  -6.554  -2.550  1.00 0.00 ? 47  TYR B CB   5  
ATOM 9133  C CG   . TYR B 2 49  ? -2.246  -5.269  -3.337  1.00 0.00 ? 47  TYR B CG   5  
ATOM 9134  C CD1  . TYR B 2 49  ? -2.724  -5.263  -4.637  1.00 0.00 ? 47  TYR B CD1  5  
ATOM 9135  C CD2  . TYR B 2 49  ? -1.846  -4.060  -2.780  1.00 0.00 ? 47  TYR B CD2  5  
ATOM 9136  C CE1  . TYR B 2 49  ? -2.799  -4.094  -5.361  1.00 0.00 ? 47  TYR B CE1  5  
ATOM 9137  C CE2  . TYR B 2 49  ? -1.921  -2.885  -3.499  1.00 0.00 ? 47  TYR B CE2  5  
ATOM 9138  C CZ   . TYR B 2 49  ? -2.399  -2.907  -4.788  1.00 0.00 ? 47  TYR B CZ   5  
ATOM 9139  O OH   . TYR B 2 49  ? -2.473  -1.740  -5.509  1.00 0.00 ? 47  TYR B OH   5  
ATOM 9140  H H    . TYR B 2 49  ? 0.280   -6.393  -3.204  1.00 0.00 ? 47  TYR B H    5  
ATOM 9141  H HA   . TYR B 2 49  ? -1.137  -5.709  -0.864  1.00 0.00 ? 47  TYR B HA   5  
ATOM 9142  H HB2  . TYR B 2 49  ? -2.020  -7.364  -3.251  1.00 0.00 ? 47  TYR B HB2  5  
ATOM 9143  H HB3  . TYR B 2 49  ? -3.101  -6.692  -2.034  1.00 0.00 ? 47  TYR B HB3  5  
ATOM 9144  H HD1  . TYR B 2 49  ? -3.039  -6.194  -5.085  1.00 0.00 ? 47  TYR B HD1  5  
ATOM 9145  H HD2  . TYR B 2 49  ? -1.472  -4.047  -1.768  1.00 0.00 ? 47  TYR B HD2  5  
ATOM 9146  H HE1  . TYR B 2 49  ? -3.174  -4.110  -6.374  1.00 0.00 ? 47  TYR B HE1  5  
ATOM 9147  H HE2  . TYR B 2 49  ? -1.606  -1.956  -3.049  1.00 0.00 ? 47  TYR B HE2  5  
ATOM 9148  H HH   . TYR B 2 49  ? -2.299  -1.934  -6.441  1.00 0.00 ? 47  TYR B HH   5  
ATOM 9149  N N    . ALA B 2 50  ? -0.296  -8.829  -1.097  1.00 0.00 ? 48  ALA B N    5  
ATOM 9150  C CA   . ALA B 2 50  ? -0.241  -10.103 -0.405  1.00 0.00 ? 48  ALA B CA   5  
ATOM 9151  C C    . ALA B 2 50  ? 0.294   -9.948  1.018   1.00 0.00 ? 48  ALA B C    5  
ATOM 9152  O O    . ALA B 2 50  ? -0.159  -10.651 1.914   1.00 0.00 ? 48  ALA B O    5  
ATOM 9153  C CB   . ALA B 2 50  ? 0.617   -11.086 -1.188  1.00 0.00 ? 48  ALA B CB   5  
ATOM 9154  H H    . ALA B 2 50  ? 0.275   -8.690  -1.878  1.00 0.00 ? 48  ALA B H    5  
ATOM 9155  H HA   . ALA B 2 50  ? -1.245  -10.500 -0.360  1.00 0.00 ? 48  ALA B HA   5  
ATOM 9156  H HB1  . ALA B 2 50  ? 1.649   -10.768 -1.156  1.00 0.00 ? 48  ALA B HB1  5  
ATOM 9157  H HB2  . ALA B 2 50  ? 0.282   -11.117 -2.215  1.00 0.00 ? 48  ALA B HB2  5  
ATOM 9158  H HB3  . ALA B 2 50  ? 0.528   -12.069 -0.750  1.00 0.00 ? 48  ALA B HB3  5  
ATOM 9159  N N    . ASP B 2 51  ? 1.204   -8.988  1.220   1.00 0.00 ? 49  ASP B N    5  
ATOM 9160  C CA   . ASP B 2 51  ? 1.830   -8.749  2.520   1.00 0.00 ? 49  ASP B CA   5  
ATOM 9161  C C    . ASP B 2 51  ? 1.059   -7.720  3.332   1.00 0.00 ? 49  ASP B C    5  
ATOM 9162  O O    . ASP B 2 51  ? 1.310   -7.536  4.527   1.00 0.00 ? 49  ASP B O    5  
ATOM 9163  C CB   . ASP B 2 51  ? 3.240   -8.211  2.357   1.00 0.00 ? 49  ASP B CB   5  
ATOM 9164  C CG   . ASP B 2 51  ? 3.936   -8.663  1.085   1.00 0.00 ? 49  ASP B CG   5  
ATOM 9165  O OD1  . ASP B 2 51  ? 4.054   -9.885  0.863   1.00 0.00 ? 49  ASP B OD1  5  
ATOM 9166  O OD2  . ASP B 2 51  ? 4.358   -7.781  0.301   1.00 0.00 ? 49  ASP B OD2  5  
ATOM 9167  H H    . ASP B 2 51  ? 1.470   -8.426  0.476   1.00 0.00 ? 49  ASP B H    5  
ATOM 9168  H HA   . ASP B 2 51  ? 1.866   -9.681  3.063   1.00 0.00 ? 49  ASP B HA   5  
ATOM 9169  H HB2  . ASP B 2 51  ? 3.188   -7.138  2.355   1.00 0.00 ? 49  ASP B HB2  5  
ATOM 9170  H HB3  . ASP B 2 51  ? 3.825   -8.533  3.203   1.00 0.00 ? 49  ASP B HB3  5  
ATOM 9171  N N    . ILE B 2 52  ? 0.133   -7.037  2.697   1.00 0.00 ? 50  ILE B N    5  
ATOM 9172  C CA   . ILE B 2 52  ? -0.650  -6.036  3.395   1.00 0.00 ? 50  ILE B CA   5  
ATOM 9173  C C    . ILE B 2 52  ? -1.805  -6.726  4.110   1.00 0.00 ? 50  ILE B C    5  
ATOM 9174  O O    . ILE B 2 52  ? -2.450  -7.608  3.538   1.00 0.00 ? 50  ILE B O    5  
ATOM 9175  C CB   . ILE B 2 52  ? -1.222  -4.964  2.440   1.00 0.00 ? 50  ILE B CB   5  
ATOM 9176  C CG1  . ILE B 2 52  ? -0.289  -4.716  1.246   1.00 0.00 ? 50  ILE B CG1  5  
ATOM 9177  C CG2  . ILE B 2 52  ? -1.476  -3.671  3.194   1.00 0.00 ? 50  ILE B CG2  5  
ATOM 9178  C CD1  . ILE B 2 52  ? 0.937   -3.890  1.567   1.00 0.00 ? 50  ILE B CD1  5  
ATOM 9179  H H    . ILE B 2 52  ? -0.040  -7.223  1.750   1.00 0.00 ? 50  ILE B H    5  
ATOM 9180  H HA   . ILE B 2 52  ? -0.004  -5.549  4.125   1.00 0.00 ? 50  ILE B HA   5  
ATOM 9181  H HB   . ILE B 2 52  ? -2.172  -5.323  2.073   1.00 0.00 ? 50  ILE B HB   5  
ATOM 9182  H HG12 . ILE B 2 52  ? 0.049   -5.666  0.863   1.00 0.00 ? 50  ILE B HG12 5  
ATOM 9183  H HG13 . ILE B 2 52  ? -0.842  -4.200  0.473   1.00 0.00 ? 50  ILE B HG13 5  
ATOM 9184  H HG21 . ILE B 2 52  ? -1.904  -2.943  2.519   1.00 0.00 ? 50  ILE B HG21 5  
ATOM 9185  H HG22 . ILE B 2 52  ? -0.543  -3.295  3.585   1.00 0.00 ? 50  ILE B HG22 5  
ATOM 9186  H HG23 . ILE B 2 52  ? -2.161  -3.857  4.006   1.00 0.00 ? 50  ILE B HG23 5  
ATOM 9187  H HD11 . ILE B 2 52  ? 0.633   -2.917  1.925   1.00 0.00 ? 50  ILE B HD11 5  
ATOM 9188  H HD12 . ILE B 2 52  ? 1.536   -3.774  0.677   1.00 0.00 ? 50  ILE B HD12 5  
ATOM 9189  H HD13 . ILE B 2 52  ? 1.518   -4.388  2.330   1.00 0.00 ? 50  ILE B HD13 5  
ATOM 9190  N N    . LYS B 2 53  ? -2.060  -6.357  5.353   1.00 0.00 ? 51  LYS B N    5  
ATOM 9191  C CA   . LYS B 2 53  ? -3.146  -6.960  6.107   1.00 0.00 ? 51  LYS B CA   5  
ATOM 9192  C C    . LYS B 2 53  ? -4.419  -6.187  5.815   1.00 0.00 ? 51  LYS B C    5  
ATOM 9193  O O    . LYS B 2 53  ? -5.457  -6.760  5.493   1.00 0.00 ? 51  LYS B O    5  
ATOM 9194  C CB   . LYS B 2 53  ? -2.848  -6.936  7.612   1.00 0.00 ? 51  LYS B CB   5  
ATOM 9195  C CG   . LYS B 2 53  ? -3.874  -7.683  8.452   1.00 0.00 ? 51  LYS B CG   5  
ATOM 9196  C CD   . LYS B 2 53  ? -3.517  -7.656  9.932   1.00 0.00 ? 51  LYS B CD   5  
ATOM 9197  C CE   . LYS B 2 53  ? -4.181  -6.491  10.656  1.00 0.00 ? 51  LYS B CE   5  
ATOM 9198  N NZ   . LYS B 2 53  ? -5.557  -6.820  11.101  1.00 0.00 ? 51  LYS B NZ   5  
ATOM 9199  H H    . LYS B 2 53  ? -1.542  -5.627  5.760   1.00 0.00 ? 51  LYS B H    5  
ATOM 9200  H HA   . LYS B 2 53  ? -3.254  -7.984  5.779   1.00 0.00 ? 51  LYS B HA   5  
ATOM 9201  H HB2  . LYS B 2 53  ? -1.880  -7.382  7.781   1.00 0.00 ? 51  LYS B HB2  5  
ATOM 9202  H HB3  . LYS B 2 53  ? -2.823  -5.909  7.944   1.00 0.00 ? 51  LYS B HB3  5  
ATOM 9203  H HG2  . LYS B 2 53  ? -4.841  -7.221  8.316   1.00 0.00 ? 51  LYS B HG2  5  
ATOM 9204  H HG3  . LYS B 2 53  ? -3.916  -8.710  8.121   1.00 0.00 ? 51  LYS B HG3  5  
ATOM 9205  H HD2  . LYS B 2 53  ? -3.844  -8.578  10.387  1.00 0.00 ? 51  LYS B HD2  5  
ATOM 9206  H HD3  . LYS B 2 53  ? -2.445  -7.564  10.030  1.00 0.00 ? 51  LYS B HD3  5  
ATOM 9207  H HE2  . LYS B 2 53  ? -3.588  -6.237  11.522  1.00 0.00 ? 51  LYS B HE2  5  
ATOM 9208  H HE3  . LYS B 2 53  ? -4.223  -5.644  9.989   1.00 0.00 ? 51  LYS B HE3  5  
ATOM 9209  H HZ1  . LYS B 2 53  ? -5.545  -7.671  11.709  1.00 0.00 ? 51  LYS B HZ1  5  
ATOM 9210  H HZ2  . LYS B 2 53  ? -6.182  -6.989  10.281  1.00 0.00 ? 51  LYS B HZ2  5  
ATOM 9211  H HZ3  . LYS B 2 53  ? -5.948  -6.027  11.653  1.00 0.00 ? 51  LYS B HZ3  5  
ATOM 9212  N N    . CYS B 2 54  ? -4.290  -4.874  5.899   1.00 0.00 ? 52  CYS B N    5  
ATOM 9213  C CA   . CYS B 2 54  ? -5.373  -3.952  5.663   1.00 0.00 ? 52  CYS B CA   5  
ATOM 9214  C C    . CYS B 2 54  ? -4.792  -2.555  5.548   1.00 0.00 ? 52  CYS B C    5  
ATOM 9215  O O    . CYS B 2 54  ? -3.573  -2.384  5.606   1.00 0.00 ? 52  CYS B O    5  
ATOM 9216  C CB   . CYS B 2 54  ? -6.374  -4.021  6.807   1.00 0.00 ? 52  CYS B CB   5  
ATOM 9217  S SG   . CYS B 2 54  ? -5.626  -3.994  8.452   1.00 0.00 ? 52  CYS B SG   5  
ATOM 9218  H H    . CYS B 2 54  ? -3.418  -4.499  6.139   1.00 0.00 ? 52  CYS B H    5  
ATOM 9219  H HA   . CYS B 2 54  ? -5.856  -4.220  4.735   1.00 0.00 ? 52  CYS B HA   5  
ATOM 9220  H HB2  . CYS B 2 54  ? -7.043  -3.182  6.737   1.00 0.00 ? 52  CYS B HB2  5  
ATOM 9221  H HB3  . CYS B 2 54  ? -6.936  -4.935  6.718   1.00 0.00 ? 52  CYS B HB3  5  
ATOM 9222  H HG   . CYS B 2 54  ? -6.363  -4.780  9.236   1.00 0.00 ? 52  CYS B HG   5  
ATOM 9223  N N    . GLN B 2 55  ? -5.631  -1.558  5.375   1.00 0.00 ? 53  GLN B N    5  
ATOM 9224  C CA   . GLN B 2 55  ? -5.140  -0.204  5.268   1.00 0.00 ? 53  GLN B CA   5  
ATOM 9225  C C    . GLN B 2 55  ? -5.984  0.743   6.119   1.00 0.00 ? 53  GLN B C    5  
ATOM 9226  O O    . GLN B 2 55  ? -7.197  0.559   6.238   1.00 0.00 ? 53  GLN B O    5  
ATOM 9227  C CB   . GLN B 2 55  ? -5.123  0.252   3.805   1.00 0.00 ? 53  GLN B CB   5  
ATOM 9228  C CG   . GLN B 2 55  ? -6.482  0.670   3.248   1.00 0.00 ? 53  GLN B CG   5  
ATOM 9229  C CD   . GLN B 2 55  ? -7.395  -0.504  2.945   1.00 0.00 ? 53  GLN B CD   5  
ATOM 9230  O OE1  . GLN B 2 55  ? -6.939  -1.597  2.618   1.00 0.00 ? 53  GLN B OE1  5  
ATOM 9231  N NE2  . GLN B 2 55  ? -8.695  -0.283  3.050   1.00 0.00 ? 53  GLN B NE2  5  
ATOM 9232  H H    . GLN B 2 55  ? -6.593  -1.731  5.326   1.00 0.00 ? 53  GLN B H    5  
ATOM 9233  H HA   . GLN B 2 55  ? -4.123  -0.207  5.634   1.00 0.00 ? 53  GLN B HA   5  
ATOM 9234  H HB2  . GLN B 2 55  ? -4.454  1.097   3.721   1.00 0.00 ? 53  GLN B HB2  5  
ATOM 9235  H HB3  . GLN B 2 55  ? -4.743  -0.560  3.200   1.00 0.00 ? 53  GLN B HB3  5  
ATOM 9236  H HG2  . GLN B 2 55  ? -6.971  1.305   3.971   1.00 0.00 ? 53  GLN B HG2  5  
ATOM 9237  H HG3  . GLN B 2 55  ? -6.323  1.228   2.336   1.00 0.00 ? 53  GLN B HG3  5  
ATOM 9238  H HE21 . GLN B 2 55  ? -8.992  0.610   3.315   1.00 0.00 ? 53  GLN B HE21 5  
ATOM 9239  H HE22 . GLN B 2 55  ? -9.306  -1.022  2.852   1.00 0.00 ? 53  GLN B HE22 5  
ATOM 9240  N N    . LYS B 2 56  ? -5.351  1.744   6.721   1.00 0.00 ? 54  LYS B N    5  
ATOM 9241  C CA   . LYS B 2 56  ? -6.076  2.712   7.526   1.00 0.00 ? 54  LYS B CA   5  
ATOM 9242  C C    . LYS B 2 56  ? -6.254  3.985   6.729   1.00 0.00 ? 54  LYS B C    5  
ATOM 9243  O O    . LYS B 2 56  ? -5.407  4.325   5.908   1.00 0.00 ? 54  LYS B O    5  
ATOM 9244  C CB   . LYS B 2 56  ? -5.324  3.114   8.795   1.00 0.00 ? 54  LYS B CB   5  
ATOM 9245  C CG   . LYS B 2 56  ? -5.189  2.077   9.884   1.00 0.00 ? 54  LYS B CG   5  
ATOM 9246  C CD   . LYS B 2 56  ? -4.784  2.770   11.178  1.00 0.00 ? 54  LYS B CD   5  
ATOM 9247  C CE   . LYS B 2 56  ? -4.646  1.828   12.360  1.00 0.00 ? 54  LYS B CE   5  
ATOM 9248  N NZ   . LYS B 2 56  ? -3.756  0.671   12.063  1.00 0.00 ? 54  LYS B NZ   5  
ATOM 9249  H H    . LYS B 2 56  ? -4.375  1.846   6.604   1.00 0.00 ? 54  LYS B H    5  
ATOM 9250  H HA   . LYS B 2 56  ? -7.041  2.303   7.784   1.00 0.00 ? 54  LYS B HA   5  
ATOM 9251  H HB2  . LYS B 2 56  ? -4.329  3.421   8.517   1.00 0.00 ? 54  LYS B HB2  5  
ATOM 9252  H HB3  . LYS B 2 56  ? -5.834  3.966   9.224   1.00 0.00 ? 54  LYS B HB3  5  
ATOM 9253  H HG2  . LYS B 2 56  ? -6.135  1.577   10.020  1.00 0.00 ? 54  LYS B HG2  5  
ATOM 9254  H HG3  . LYS B 2 56  ? -4.425  1.368   9.606   1.00 0.00 ? 54  LYS B HG3  5  
ATOM 9255  H HD2  . LYS B 2 56  ? -3.837  3.263   11.020  1.00 0.00 ? 54  LYS B HD2  5  
ATOM 9256  H HD3  . LYS B 2 56  ? -5.532  3.516   11.413  1.00 0.00 ? 54  LYS B HD3  5  
ATOM 9257  H HE2  . LYS B 2 56  ? -4.233  2.384   13.192  1.00 0.00 ? 54  LYS B HE2  5  
ATOM 9258  H HE3  . LYS B 2 56  ? -5.627  1.466   12.627  1.00 0.00 ? 54  LYS B HE3  5  
ATOM 9259  H HZ1  . LYS B 2 56  ? -4.252  -0.008  11.432  1.00 0.00 ? 54  LYS B HZ1  5  
ATOM 9260  H HZ2  . LYS B 2 56  ? -3.504  0.179   12.941  1.00 0.00 ? 54  LYS B HZ2  5  
ATOM 9261  H HZ3  . LYS B 2 56  ? -2.886  0.994   11.591  1.00 0.00 ? 54  LYS B HZ3  5  
ATOM 9262  N N    . ILE B 2 57  ? -7.342  4.682   6.961   1.00 0.00 ? 55  ILE B N    5  
ATOM 9263  C CA   . ILE B 2 57  ? -7.567  5.949   6.305   1.00 0.00 ? 55  ILE B CA   5  
ATOM 9264  C C    . ILE B 2 57  ? -7.835  6.982   7.390   1.00 0.00 ? 55  ILE B C    5  
ATOM 9265  O O    . ILE B 2 57  ? -8.636  6.744   8.295   1.00 0.00 ? 55  ILE B O    5  
ATOM 9266  C CB   . ILE B 2 57  ? -8.725  5.904   5.261   1.00 0.00 ? 55  ILE B CB   5  
ATOM 9267  C CG1  . ILE B 2 57  ? -10.083 6.268   5.862   1.00 0.00 ? 55  ILE B CG1  5  
ATOM 9268  C CG2  . ILE B 2 57  ? -8.812  4.523   4.632   1.00 0.00 ? 55  ILE B CG2  5  
ATOM 9269  C CD1  . ILE B 2 57  ? -10.979 7.003   4.885   1.00 0.00 ? 55  ILE B CD1  5  
ATOM 9270  H H    . ILE B 2 57  ? -8.023  4.327   7.580   1.00 0.00 ? 55  ILE B H    5  
ATOM 9271  H HA   . ILE B 2 57  ? -6.652  6.218   5.792   1.00 0.00 ? 55  ILE B HA   5  
ATOM 9272  H HB   . ILE B 2 57  ? -8.490  6.608   4.476   1.00 0.00 ? 55  ILE B HB   5  
ATOM 9273  H HG12 . ILE B 2 57  ? -10.593 5.366   6.168   1.00 0.00 ? 55  ILE B HG12 5  
ATOM 9274  H HG13 . ILE B 2 57  ? -9.935  6.904   6.723   1.00 0.00 ? 55  ILE B HG13 5  
ATOM 9275  H HG21 . ILE B 2 57  ? -7.879  4.292   4.139   1.00 0.00 ? 55  ILE B HG21 5  
ATOM 9276  H HG22 . ILE B 2 57  ? -9.615  4.506   3.910   1.00 0.00 ? 55  ILE B HG22 5  
ATOM 9277  H HG23 . ILE B 2 57  ? -9.003  3.788   5.400   1.00 0.00 ? 55  ILE B HG23 5  
ATOM 9278  H HD11 . ILE B 2 57  ? -11.923 7.226   5.353   1.00 0.00 ? 55  ILE B HD11 5  
ATOM 9279  H HD12 . ILE B 2 57  ? -11.143 6.388   4.012   1.00 0.00 ? 55  ILE B HD12 5  
ATOM 9280  H HD13 . ILE B 2 57  ? -10.500 7.926   4.585   1.00 0.00 ? 55  ILE B HD13 5  
ATOM 9281  N N    . SER B 2 58  ? -7.111  8.085   7.362   1.00 0.00 ? 56  SER B N    5  
ATOM 9282  C CA   . SER B 2 58  ? -7.301  9.110   8.362   1.00 0.00 ? 56  SER B CA   5  
ATOM 9283  C C    . SER B 2 58  ? -8.332  10.100  7.849   1.00 0.00 ? 56  SER B C    5  
ATOM 9284  O O    . SER B 2 58  ? -8.117  10.775  6.819   1.00 0.00 ? 56  SER B O    5  
ATOM 9285  C CB   . SER B 2 58  ? -5.980  9.790   8.731   1.00 0.00 ? 56  SER B CB   5  
ATOM 9286  O OG   . SER B 2 58  ? -5.722  10.920  7.930   1.00 0.00 ? 56  SER B OG   5  
ATOM 9287  H H    . SER B 2 58  ? -6.450  8.220   6.646   1.00 0.00 ? 56  SER B H    5  
ATOM 9288  H HA   . SER B 2 58  ? -7.702  8.627   9.242   1.00 0.00 ? 56  SER B HA   5  
ATOM 9289  H HB2  . SER B 2 58  ? -6.013  10.095  9.758   1.00 0.00 ? 56  SER B HB2  5  
ATOM 9290  H HB3  . SER B 2 58  ? -5.172  9.084   8.599   1.00 0.00 ? 56  SER B HB3  5  
ATOM 9291  H HG   . SER B 2 58  ? -6.334  11.628  8.169   1.00 0.00 ? 56  SER B HG   5  
ATOM 9292  N N    . PRO B 2 59  ? -9.467  10.147  8.565   1.00 0.00 ? 57  PRO B N    5  
ATOM 9293  C CA   . PRO B 2 59  ? -10.629 10.988  8.252   1.00 0.00 ? 57  PRO B CA   5  
ATOM 9294  C C    . PRO B 2 59  ? -10.376 12.478  8.412   1.00 0.00 ? 57  PRO B C    5  
ATOM 9295  O O    . PRO B 2 59  ? -9.310  12.908  8.862   1.00 0.00 ? 57  PRO B O    5  
ATOM 9296  C CB   . PRO B 2 59  ? -11.679 10.531  9.269   1.00 0.00 ? 57  PRO B CB   5  
ATOM 9297  C CG   . PRO B 2 59  ? -10.881 10.027  10.415  1.00 0.00 ? 57  PRO B CG   5  
ATOM 9298  C CD   . PRO B 2 59  ? -9.690  9.367   9.796   1.00 0.00 ? 57  PRO B CD   5  
ATOM 9299  H HA   . PRO B 2 59  ? -10.993 10.793  7.257   1.00 0.00 ? 57  PRO B HA   5  
ATOM 9300  H HB2  . PRO B 2 59  ? -12.299 11.369  9.553   1.00 0.00 ? 57  PRO B HB2  5  
ATOM 9301  H HB3  . PRO B 2 59  ? -12.289 9.751   8.838   1.00 0.00 ? 57  PRO B HB3  5  
ATOM 9302  H HG2  . PRO B 2 59  ? -10.571 10.849  11.044  1.00 0.00 ? 57  PRO B HG2  5  
ATOM 9303  H HG3  . PRO B 2 59  ? -11.454 9.310   10.983  1.00 0.00 ? 57  PRO B HG3  5  
ATOM 9304  H HD2  . PRO B 2 59  ? -8.837  9.434   10.456  1.00 0.00 ? 57  PRO B HD2  5  
ATOM 9305  H HD3  . PRO B 2 59  ? -9.909  8.335   9.563   1.00 0.00 ? 57  PRO B HD3  5  
ATOM 9306  N N    . GLU B 2 60  ? -11.368 13.253  7.997   1.00 0.00 ? 58  GLU B N    5  
ATOM 9307  C CA   . GLU B 2 60  ? -11.323 14.698  8.091   1.00 0.00 ? 58  GLU B CA   5  
ATOM 9308  C C    . GLU B 2 60  ? -11.154 15.124  9.545   1.00 0.00 ? 58  GLU B C    5  
ATOM 9309  O O    . GLU B 2 60  ? -11.457 14.369  10.469  1.00 0.00 ? 58  GLU B O    5  
ATOM 9310  C CB   . GLU B 2 60  ? -12.599 15.311  7.497   1.00 0.00 ? 58  GLU B CB   5  
ATOM 9311  C CG   . GLU B 2 60  ? -12.700 15.196  5.978   1.00 0.00 ? 58  GLU B CG   5  
ATOM 9312  C CD   . GLU B 2 60  ? -12.607 13.764  5.481   1.00 0.00 ? 58  GLU B CD   5  
ATOM 9313  O OE1  . GLU B 2 60  ? -13.261 12.883  6.075   1.00 0.00 ? 58  GLU B OE1  5  
ATOM 9314  O OE2  . GLU B 2 60  ? -11.857 13.513  4.518   1.00 0.00 ? 58  GLU B OE2  5  
ATOM 9315  H H    . GLU B 2 60  ? -12.165 12.830  7.598   1.00 0.00 ? 58  GLU B H    5  
ATOM 9316  H HA   . GLU B 2 60  ? -10.470 15.041  7.525   1.00 0.00 ? 58  GLU B HA   5  
ATOM 9317  H HB2  . GLU B 2 60  ? -13.455 14.815  7.929   1.00 0.00 ? 58  GLU B HB2  5  
ATOM 9318  H HB3  . GLU B 2 60  ? -12.634 16.358  7.760   1.00 0.00 ? 58  GLU B HB3  5  
ATOM 9319  H HG2  . GLU B 2 60  ? -13.647 15.608  5.662   1.00 0.00 ? 58  GLU B HG2  5  
ATOM 9320  H HG3  . GLU B 2 60  ? -11.897 15.768  5.535   1.00 0.00 ? 58  GLU B HG3  5  
ATOM 9321  N N    . GLY B 2 61  ? -10.697 16.344  9.738   1.00 0.00 ? 59  GLY B N    5  
ATOM 9322  C CA   . GLY B 2 61  ? -10.452 16.849  11.070  1.00 0.00 ? 59  GLY B CA   5  
ATOM 9323  C C    . GLY B 2 61  ? -8.974  17.070  11.261  1.00 0.00 ? 59  GLY B C    5  
ATOM 9324  O O    . GLY B 2 61  ? -8.550  17.940  12.019  1.00 0.00 ? 59  GLY B O    5  
ATOM 9325  H H    . GLY B 2 61  ? -10.513 16.913  8.963   1.00 0.00 ? 59  GLY B H    5  
ATOM 9326  H HA2  . GLY B 2 61  ? -10.977 17.784  11.203  1.00 0.00 ? 59  GLY B HA2  5  
ATOM 9327  H HA3  . GLY B 2 61  ? -10.801 16.132  11.798  1.00 0.00 ? 59  GLY B HA3  5  
ATOM 9328  N N    . LYS B 2 62  ? -8.193  16.270  10.548  1.00 0.00 ? 60  LYS B N    5  
ATOM 9329  C CA   . LYS B 2 62  ? -6.750  16.392  10.563  1.00 0.00 ? 60  LYS B CA   5  
ATOM 9330  C C    . LYS B 2 62  ? -6.356  17.407  9.517   1.00 0.00 ? 60  LYS B C    5  
ATOM 9331  O O    . LYS B 2 62  ? -7.080  17.608  8.538   1.00 0.00 ? 60  LYS B O    5  
ATOM 9332  C CB   . LYS B 2 62  ? -6.074  15.046  10.261  1.00 0.00 ? 60  LYS B CB   5  
ATOM 9333  C CG   . LYS B 2 62  ? -5.793  14.209  11.496  1.00 0.00 ? 60  LYS B CG   5  
ATOM 9334  C CD   . LYS B 2 62  ? -4.787  13.093  11.221  1.00 0.00 ? 60  LYS B CD   5  
ATOM 9335  C CE   . LYS B 2 62  ? -4.365  12.393  12.506  1.00 0.00 ? 60  LYS B CE   5  
ATOM 9336  N NZ   . LYS B 2 62  ? -4.966  13.032  13.709  1.00 0.00 ? 60  LYS B NZ   5  
ATOM 9337  H H    . LYS B 2 62  ? -8.606  15.574  9.996   1.00 0.00 ? 60  LYS B H    5  
ATOM 9338  H HA   . LYS B 2 62  ? -6.439  16.749  11.534  1.00 0.00 ? 60  LYS B HA   5  
ATOM 9339  H HB2  . LYS B 2 62  ? -6.714  14.475  9.605   1.00 0.00 ? 60  LYS B HB2  5  
ATOM 9340  H HB3  . LYS B 2 62  ? -5.136  15.234  9.759   1.00 0.00 ? 60  LYS B HB3  5  
ATOM 9341  H HG2  . LYS B 2 62  ? -5.397  14.850  12.268  1.00 0.00 ? 60  LYS B HG2  5  
ATOM 9342  H HG3  . LYS B 2 62  ? -6.719  13.768  11.834  1.00 0.00 ? 60  LYS B HG3  5  
ATOM 9343  H HD2  . LYS B 2 62  ? -5.235  12.364  10.562  1.00 0.00 ? 60  LYS B HD2  5  
ATOM 9344  H HD3  . LYS B 2 62  ? -3.909  13.513  10.751  1.00 0.00 ? 60  LYS B HD3  5  
ATOM 9345  H HE2  . LYS B 2 62  ? -4.683  11.360  12.460  1.00 0.00 ? 60  LYS B HE2  5  
ATOM 9346  H HE3  . LYS B 2 62  ? -3.287  12.431  12.586  1.00 0.00 ? 60  LYS B HE3  5  
ATOM 9347  H HZ1  . LYS B 2 62  ? -6.011  13.020  13.630  1.00 0.00 ? 60  LYS B HZ1  5  
ATOM 9348  H HZ2  . LYS B 2 62  ? -4.645  14.018  13.793  1.00 0.00 ? 60  LYS B HZ2  5  
ATOM 9349  H HZ3  . LYS B 2 62  ? -4.693  12.510  14.574  1.00 0.00 ? 60  LYS B HZ3  5  
ATOM 9350  N N    . ALA B 2 63  ? -5.226  18.052  9.722   1.00 0.00 ? 61  ALA B N    5  
ATOM 9351  C CA   . ALA B 2 63  ? -4.745  19.044  8.777   1.00 0.00 ? 61  ALA B CA   5  
ATOM 9352  C C    . ALA B 2 63  ? -4.358  18.388  7.473   1.00 0.00 ? 61  ALA B C    5  
ATOM 9353  O O    . ALA B 2 63  ? -4.203  19.049  6.448   1.00 0.00 ? 61  ALA B O    5  
ATOM 9354  C CB   . ALA B 2 63  ? -3.557  19.775  9.352   1.00 0.00 ? 61  ALA B CB   5  
ATOM 9355  H H    . ALA B 2 63  ? -4.705  17.863  10.531  1.00 0.00 ? 61  ALA B H    5  
ATOM 9356  H HA   . ALA B 2 63  ? -5.536  19.754  8.592   1.00 0.00 ? 61  ALA B HA   5  
ATOM 9357  H HB1  . ALA B 2 63  ? -3.846  20.261  10.269  1.00 0.00 ? 61  ALA B HB1  5  
ATOM 9358  H HB2  . ALA B 2 63  ? -3.213  20.508  8.640   1.00 0.00 ? 61  ALA B HB2  5  
ATOM 9359  H HB3  . ALA B 2 63  ? -2.768  19.063  9.550   1.00 0.00 ? 61  ALA B HB3  5  
ATOM 9360  N N    . LYS B 2 64  ? -4.198  17.083  7.521   1.00 0.00 ? 62  LYS B N    5  
ATOM 9361  C CA   . LYS B 2 64  ? -3.829  16.341  6.352   1.00 0.00 ? 62  LYS B CA   5  
ATOM 9362  C C    . LYS B 2 64  ? -4.616  15.042  6.262   1.00 0.00 ? 62  LYS B C    5  
ATOM 9363  O O    . LYS B 2 64  ? -4.835  14.366  7.268   1.00 0.00 ? 62  LYS B O    5  
ATOM 9364  C CB   . LYS B 2 64  ? -2.331  16.041  6.359   1.00 0.00 ? 62  LYS B CB   5  
ATOM 9365  C CG   . LYS B 2 64  ? -1.855  15.299  7.598   1.00 0.00 ? 62  LYS B CG   5  
ATOM 9366  C CD   . LYS B 2 64  ? -1.015  16.190  8.494   1.00 0.00 ? 62  LYS B CD   5  
ATOM 9367  C CE   . LYS B 2 64  ? -0.278  15.378  9.545   1.00 0.00 ? 62  LYS B CE   5  
ATOM 9368  N NZ   . LYS B 2 64  ? 0.452   16.249  10.506  1.00 0.00 ? 62  LYS B NZ   5  
ATOM 9369  H H    . LYS B 2 64  ? -4.349  16.608  8.364   1.00 0.00 ? 62  LYS B H    5  
ATOM 9370  H HA   . LYS B 2 64  ? -4.056  16.960  5.501   1.00 0.00 ? 62  LYS B HA   5  
ATOM 9371  H HB2  . LYS B 2 64  ? -2.094  15.437  5.496   1.00 0.00 ? 62  LYS B HB2  5  
ATOM 9372  H HB3  . LYS B 2 64  ? -1.789  16.972  6.296   1.00 0.00 ? 62  LYS B HB3  5  
ATOM 9373  H HG2  . LYS B 2 64  ? -2.717  14.959  8.153   1.00 0.00 ? 62  LYS B HG2  5  
ATOM 9374  H HG3  . LYS B 2 64  ? -1.263  14.449  7.291   1.00 0.00 ? 62  LYS B HG3  5  
ATOM 9375  H HD2  . LYS B 2 64  ? -0.292  16.715  7.887   1.00 0.00 ? 62  LYS B HD2  5  
ATOM 9376  H HD3  . LYS B 2 64  ? -1.661  16.902  8.988   1.00 0.00 ? 62  LYS B HD3  5  
ATOM 9377  H HE2  . LYS B 2 64  ? -0.998  14.779  10.091  1.00 0.00 ? 62  LYS B HE2  5  
ATOM 9378  H HE3  . LYS B 2 64  ? 0.427   14.722  9.054   1.00 0.00 ? 62  LYS B HE3  5  
ATOM 9379  H HZ1  . LYS B 2 64  ? 1.136   16.860  10.002  1.00 0.00 ? 62  LYS B HZ1  5  
ATOM 9380  H HZ2  . LYS B 2 64  ? 0.971   15.669  11.190  1.00 0.00 ? 62  LYS B HZ2  5  
ATOM 9381  H HZ3  . LYS B 2 64  ? -0.226  16.851  11.027  1.00 0.00 ? 62  LYS B HZ3  5  
ATOM 9382  N N    . ILE B 2 65  ? -5.057  14.715  5.062   1.00 0.00 ? 63  ILE B N    5  
ATOM 9383  C CA   . ILE B 2 65  ? -5.780  13.480  4.825   1.00 0.00 ? 63  ILE B CA   5  
ATOM 9384  C C    . ILE B 2 65  ? -4.744  12.370  4.717   1.00 0.00 ? 63  ILE B C    5  
ATOM 9385  O O    . ILE B 2 65  ? -3.759  12.527  4.003   1.00 0.00 ? 63  ILE B O    5  
ATOM 9386  C CB   . ILE B 2 65  ? -6.629  13.579  3.539   1.00 0.00 ? 63  ILE B CB   5  
ATOM 9387  C CG1  . ILE B 2 65  ? -7.838  14.488  3.774   1.00 0.00 ? 63  ILE B CG1  5  
ATOM 9388  C CG2  . ILE B 2 65  ? -7.080  12.209  3.074   1.00 0.00 ? 63  ILE B CG2  5  
ATOM 9389  C CD1  . ILE B 2 65  ? -7.601  15.940  3.411   1.00 0.00 ? 63  ILE B CD1  5  
ATOM 9390  H H    . ILE B 2 65  ? -4.878  15.314  4.310   1.00 0.00 ? 63  ILE B H    5  
ATOM 9391  H HA   . ILE B 2 65  ? -6.428  13.291  5.670   1.00 0.00 ? 63  ILE B HA   5  
ATOM 9392  H HB   . ILE B 2 65  ? -6.014  14.008  2.763   1.00 0.00 ? 63  ILE B HB   5  
ATOM 9393  H HG12 . ILE B 2 65  ? -8.666  14.132  3.181   1.00 0.00 ? 63  ILE B HG12 5  
ATOM 9394  H HG13 . ILE B 2 65  ? -8.109  14.448  4.819   1.00 0.00 ? 63  ILE B HG13 5  
ATOM 9395  H HG21 . ILE B 2 65  ? -6.216  11.608  2.829   1.00 0.00 ? 63  ILE B HG21 5  
ATOM 9396  H HG22 . ILE B 2 65  ? -7.707  12.313  2.201   1.00 0.00 ? 63  ILE B HG22 5  
ATOM 9397  H HG23 . ILE B 2 65  ? -7.640  11.727  3.863   1.00 0.00 ? 63  ILE B HG23 5  
ATOM 9398  H HD11 . ILE B 2 65  ? -7.371  16.014  2.359   1.00 0.00 ? 63  ILE B HD11 5  
ATOM 9399  H HD12 . ILE B 2 65  ? -6.776  16.326  3.988   1.00 0.00 ? 63  ILE B HD12 5  
ATOM 9400  H HD13 . ILE B 2 65  ? -8.491  16.514  3.626   1.00 0.00 ? 63  ILE B HD13 5  
ATOM 9401  N N    . GLN B 2 66  ? -4.925  11.256  5.413   1.00 0.00 ? 64  GLN B N    5  
ATOM 9402  C CA   . GLN B 2 66  ? -3.886  10.223  5.379   1.00 0.00 ? 64  GLN B CA   5  
ATOM 9403  C C    . GLN B 2 66  ? -4.411  8.816   5.180   1.00 0.00 ? 64  GLN B C    5  
ATOM 9404  O O    . GLN B 2 66  ? -5.598  8.540   5.317   1.00 0.00 ? 64  GLN B O    5  
ATOM 9405  C CB   . GLN B 2 66  ? -3.064  10.245  6.669   1.00 0.00 ? 64  GLN B CB   5  
ATOM 9406  C CG   . GLN B 2 66  ? -2.704  11.632  7.167   1.00 0.00 ? 64  GLN B CG   5  
ATOM 9407  C CD   . GLN B 2 66  ? -2.308  11.629  8.627   1.00 0.00 ? 64  GLN B CD   5  
ATOM 9408  O OE1  . GLN B 2 66  ? -1.563  12.495  9.079   1.00 0.00 ? 64  GLN B OE1  5  
ATOM 9409  N NE2  . GLN B 2 66  ? -2.806  10.651  9.377   1.00 0.00 ? 64  GLN B NE2  5  
ATOM 9410  H H    . GLN B 2 66  ? -5.744  11.127  5.962   1.00 0.00 ? 64  GLN B H    5  
ATOM 9411  H HA   . GLN B 2 66  ? -3.227  10.458  4.559   1.00 0.00 ? 64  GLN B HA   5  
ATOM 9412  H HB2  . GLN B 2 66  ? -3.631  9.751   7.445   1.00 0.00 ? 64  GLN B HB2  5  
ATOM 9413  H HB3  . GLN B 2 66  ? -2.148  9.696   6.504   1.00 0.00 ? 64  GLN B HB3  5  
ATOM 9414  H HG2  . GLN B 2 66  ? -1.876  12.008  6.584   1.00 0.00 ? 64  GLN B HG2  5  
ATOM 9415  H HG3  . GLN B 2 66  ? -3.559  12.281  7.039   1.00 0.00 ? 64  GLN B HG3  5  
ATOM 9416  H HE21 . GLN B 2 66  ? -3.402  9.997   8.952   1.00 0.00 ? 64  GLN B HE21 5  
ATOM 9417  H HE22 . GLN B 2 66  ? -2.549  10.615  10.321  1.00 0.00 ? 64  GLN B HE22 5  
ATOM 9418  N N    . LEU B 2 67  ? -3.492  7.947   4.797   1.00 0.00 ? 65  LEU B N    5  
ATOM 9419  C CA   . LEU B 2 67  ? -3.755  6.538   4.606   1.00 0.00 ? 65  LEU B CA   5  
ATOM 9420  C C    . LEU B 2 67  ? -2.555  5.766   5.139   1.00 0.00 ? 65  LEU B C    5  
ATOM 9421  O O    . LEU B 2 67  ? -1.472  6.321   5.212   1.00 0.00 ? 65  LEU B O    5  
ATOM 9422  C CB   . LEU B 2 67  ? -3.918  6.207   3.131   1.00 0.00 ? 65  LEU B CB   5  
ATOM 9423  C CG   . LEU B 2 67  ? -4.787  4.992   2.839   1.00 0.00 ? 65  LEU B CG   5  
ATOM 9424  C CD1  . LEU B 2 67  ? -6.228  5.409   2.636   1.00 0.00 ? 65  LEU B CD1  5  
ATOM 9425  C CD2  . LEU B 2 67  ? -4.259  4.231   1.643   1.00 0.00 ? 65  LEU B CD2  5  
ATOM 9426  H H    . LEU B 2 67  ? -2.580  8.274   4.618   1.00 0.00 ? 65  LEU B H    5  
ATOM 9427  H HA   . LEU B 2 67  ? -4.646  6.271   5.158   1.00 0.00 ? 65  LEU B HA   5  
ATOM 9428  H HB2  . LEU B 2 67  ? -4.353  7.065   2.640   1.00 0.00 ? 65  LEU B HB2  5  
ATOM 9429  H HB3  . LEU B 2 67  ? -2.938  6.034   2.716   1.00 0.00 ? 65  LEU B HB3  5  
ATOM 9430  H HG   . LEU B 2 67  ? -4.755  4.330   3.694   1.00 0.00 ? 65  LEU B HG   5  
ATOM 9431  H HD11 . LEU B 2 67  ? -6.284  6.125   1.828   1.00 0.00 ? 65  LEU B HD11 5  
ATOM 9432  H HD12 . LEU B 2 67  ? -6.605  5.860   3.542   1.00 0.00 ? 65  LEU B HD12 5  
ATOM 9433  H HD13 . LEU B 2 67  ? -6.823  4.543   2.390   1.00 0.00 ? 65  LEU B HD13 5  
ATOM 9434  H HD21 . LEU B 2 67  ? -4.293  4.866   0.770   1.00 0.00 ? 65  LEU B HD21 5  
ATOM 9435  H HD22 . LEU B 2 67  ? -4.869  3.355   1.475   1.00 0.00 ? 65  LEU B HD22 5  
ATOM 9436  H HD23 . LEU B 2 67  ? -3.239  3.930   1.830   1.00 0.00 ? 65  LEU B HD23 5  
ATOM 9437  N N    . GLN B 2 68  ? -2.728  4.527   5.562   1.00 0.00 ? 66  GLN B N    5  
ATOM 9438  C CA   . GLN B 2 68  ? -1.588  3.755   6.039   1.00 0.00 ? 66  GLN B CA   5  
ATOM 9439  C C    . GLN B 2 68  ? -1.753  2.287   5.682   1.00 0.00 ? 66  GLN B C    5  
ATOM 9440  O O    . GLN B 2 68  ? -2.854  1.747   5.711   1.00 0.00 ? 66  GLN B O    5  
ATOM 9441  C CB   . GLN B 2 68  ? -1.371  3.926   7.551   1.00 0.00 ? 66  GLN B CB   5  
ATOM 9442  C CG   . GLN B 2 68  ? -2.095  2.909   8.416   1.00 0.00 ? 66  GLN B CG   5  
ATOM 9443  C CD   . GLN B 2 68  ? -1.710  2.989   9.883   1.00 0.00 ? 66  GLN B CD   5  
ATOM 9444  O OE1  . GLN B 2 68  ? -1.703  1.982   10.590  1.00 0.00 ? 66  GLN B OE1  5  
ATOM 9445  N NE2  . GLN B 2 68  ? -1.413  4.185   10.362  1.00 0.00 ? 66  GLN B NE2  5  
ATOM 9446  H H    . GLN B 2 68  ? -3.627  4.125   5.551   1.00 0.00 ? 66  GLN B H    5  
ATOM 9447  H HA   . GLN B 2 68  ? -0.715  4.129   5.524   1.00 0.00 ? 66  GLN B HA   5  
ATOM 9448  H HB2  . GLN B 2 68  ? -0.316  3.849   7.761   1.00 0.00 ? 66  GLN B HB2  5  
ATOM 9449  H HB3  . GLN B 2 68  ? -1.709  4.911   7.838   1.00 0.00 ? 66  GLN B HB3  5  
ATOM 9450  H HG2  . GLN B 2 68  ? -3.158  3.080   8.332   1.00 0.00 ? 66  GLN B HG2  5  
ATOM 9451  H HG3  . GLN B 2 68  ? -1.862  1.919   8.052   1.00 0.00 ? 66  GLN B HG3  5  
ATOM 9452  H HE21 . GLN B 2 68  ? -1.455  4.951   9.753   1.00 0.00 ? 66  GLN B HE21 5  
ATOM 9453  H HE22 . GLN B 2 68  ? -1.155  4.256   11.305  1.00 0.00 ? 66  GLN B HE22 5  
ATOM 9454  N N    . LEU B 2 69  ? -0.650  1.658   5.331   1.00 0.00 ? 67  LEU B N    5  
ATOM 9455  C CA   . LEU B 2 69  ? -0.637  0.256   4.970   1.00 0.00 ? 67  LEU B CA   5  
ATOM 9456  C C    . LEU B 2 69  ? -0.301  -0.588  6.181   1.00 0.00 ? 67  LEU B C    5  
ATOM 9457  O O    . LEU B 2 69  ? 0.838   -0.606  6.629   1.00 0.00 ? 67  LEU B O    5  
ATOM 9458  C CB   . LEU B 2 69  ? 0.407   -0.005  3.890   1.00 0.00 ? 67  LEU B CB   5  
ATOM 9459  C CG   . LEU B 2 69  ? 0.065   0.490   2.489   1.00 0.00 ? 67  LEU B CG   5  
ATOM 9460  C CD1  . LEU B 2 69  ? 1.179   0.112   1.529   1.00 0.00 ? 67  LEU B CD1  5  
ATOM 9461  C CD2  . LEU B 2 69  ? -1.263  -0.088  2.024   1.00 0.00 ? 67  LEU B CD2  5  
ATOM 9462  H H    . LEU B 2 69  ? 0.196   2.162   5.307   1.00 0.00 ? 67  LEU B H    5  
ATOM 9463  H HA   . LEU B 2 69  ? -1.614  -0.013  4.601   1.00 0.00 ? 67  LEU B HA   5  
ATOM 9464  H HB2  . LEU B 2 69  ? 1.328   0.468   4.196   1.00 0.00 ? 67  LEU B HB2  5  
ATOM 9465  H HB3  . LEU B 2 69  ? 0.573   -1.066  3.840   1.00 0.00 ? 67  LEU B HB3  5  
ATOM 9466  H HG   . LEU B 2 69  ? -0.018  1.567   2.502   1.00 0.00 ? 67  LEU B HG   5  
ATOM 9467  H HD11 . LEU B 2 69  ? 2.096   0.594   1.834   1.00 0.00 ? 67  LEU B HD11 5  
ATOM 9468  H HD12 . LEU B 2 69  ? 0.919   0.434   0.532   1.00 0.00 ? 67  LEU B HD12 5  
ATOM 9469  H HD13 . LEU B 2 69  ? 1.316   -0.960  1.538   1.00 0.00 ? 67  LEU B HD13 5  
ATOM 9470  H HD21 . LEU B 2 69  ? -2.043  0.200   2.713   1.00 0.00 ? 67  LEU B HD21 5  
ATOM 9471  H HD22 . LEU B 2 69  ? -1.193  -1.166  1.989   1.00 0.00 ? 67  LEU B HD22 5  
ATOM 9472  H HD23 . LEU B 2 69  ? -1.494  0.288   1.038   1.00 0.00 ? 67  LEU B HD23 5  
ATOM 9473  N N    . VAL B 2 70  ? -1.283  -1.275  6.715   1.00 0.00 ? 68  VAL B N    5  
ATOM 9474  C CA   . VAL B 2 70  ? -1.059  -2.117  7.869   1.00 0.00 ? 68  VAL B CA   5  
ATOM 9475  C C    . VAL B 2 70  ? -0.784  -3.530  7.399   1.00 0.00 ? 68  VAL B C    5  
ATOM 9476  O O    . VAL B 2 70  ? -1.648  -4.182  6.823   1.00 0.00 ? 68  VAL B O    5  
ATOM 9477  C CB   . VAL B 2 70  ? -2.264  -2.092  8.817   1.00 0.00 ? 68  VAL B CB   5  
ATOM 9478  C CG1  . VAL B 2 70  ? -1.901  -2.706  10.156  1.00 0.00 ? 68  VAL B CG1  5  
ATOM 9479  C CG2  . VAL B 2 70  ? -2.746  -0.665  8.994   1.00 0.00 ? 68  VAL B CG2  5  
ATOM 9480  H H    . VAL B 2 70  ? -2.181  -1.237  6.313   1.00 0.00 ? 68  VAL B H    5  
ATOM 9481  H HA   . VAL B 2 70  ? -0.191  -1.743  8.398   1.00 0.00 ? 68  VAL B HA   5  
ATOM 9482  H HB   . VAL B 2 70  ? -3.061  -2.672  8.379   1.00 0.00 ? 68  VAL B HB   5  
ATOM 9483  H HG11 . VAL B 2 70  ? -1.096  -2.138  10.601  1.00 0.00 ? 68  VAL B HG11 5  
ATOM 9484  H HG12 . VAL B 2 70  ? -1.583  -3.725  10.007  1.00 0.00 ? 68  VAL B HG12 5  
ATOM 9485  H HG13 . VAL B 2 70  ? -2.761  -2.685  10.805  1.00 0.00 ? 68  VAL B HG13 5  
ATOM 9486  H HG21 . VAL B 2 70  ? -3.011  -0.255  8.031   1.00 0.00 ? 68  VAL B HG21 5  
ATOM 9487  H HG22 . VAL B 2 70  ? -1.955  -0.071  9.431   1.00 0.00 ? 68  VAL B HG22 5  
ATOM 9488  H HG23 . VAL B 2 70  ? -3.607  -0.652  9.642   1.00 0.00 ? 68  VAL B HG23 5  
ATOM 9489  N N    . LEU B 2 71  ? 0.427   -3.995  7.627   1.00 0.00 ? 69  LEU B N    5  
ATOM 9490  C CA   . LEU B 2 71  ? 0.827   -5.317  7.177   1.00 0.00 ? 69  LEU B CA   5  
ATOM 9491  C C    . LEU B 2 71  ? 0.735   -6.347  8.284   1.00 0.00 ? 69  LEU B C    5  
ATOM 9492  O O    . LEU B 2 71  ? 0.757   -6.010  9.467   1.00 0.00 ? 69  LEU B O    5  
ATOM 9493  C CB   . LEU B 2 71  ? 2.259   -5.270  6.655   1.00 0.00 ? 69  LEU B CB   5  
ATOM 9494  C CG   . LEU B 2 71  ? 2.658   -3.943  6.022   1.00 0.00 ? 69  LEU B CG   5  
ATOM 9495  C CD1  . LEU B 2 71  ? 4.130   -3.935  5.688   1.00 0.00 ? 69  LEU B CD1  5  
ATOM 9496  C CD2  . LEU B 2 71  ? 1.842   -3.679  4.778   1.00 0.00 ? 69  LEU B CD2  5  
ATOM 9497  H H    . LEU B 2 71  ? 1.077   -3.433  8.117   1.00 0.00 ? 69  LEU B H    5  
ATOM 9498  H HA   . LEU B 2 71  ? 0.175   -5.604  6.371   1.00 0.00 ? 69  LEU B HA   5  
ATOM 9499  H HB2  . LEU B 2 71  ? 2.928   -5.470  7.481   1.00 0.00 ? 69  LEU B HB2  5  
ATOM 9500  H HB3  . LEU B 2 71  ? 2.379   -6.048  5.917   1.00 0.00 ? 69  LEU B HB3  5  
ATOM 9501  H HG   . LEU B 2 71  ? 2.465   -3.147  6.725   1.00 0.00 ? 69  LEU B HG   5  
ATOM 9502  H HD11 . LEU B 2 71  ? 4.701   -4.131  6.582   1.00 0.00 ? 69  LEU B HD11 5  
ATOM 9503  H HD12 . LEU B 2 71  ? 4.398   -2.968  5.289   1.00 0.00 ? 69  LEU B HD12 5  
ATOM 9504  H HD13 . LEU B 2 71  ? 4.331   -4.699  4.953   1.00 0.00 ? 69  LEU B HD13 5  
ATOM 9505  H HD21 . LEU B 2 71  ? 2.018   -4.468  4.062   1.00 0.00 ? 69  LEU B HD21 5  
ATOM 9506  H HD22 . LEU B 2 71  ? 2.134   -2.732  4.352   1.00 0.00 ? 69  LEU B HD22 5  
ATOM 9507  H HD23 . LEU B 2 71  ? 0.795   -3.653  5.037   1.00 0.00 ? 69  LEU B HD23 5  
ATOM 9508  N N    . HIS B 2 72  ? 0.652   -7.613  7.892   1.00 0.00 ? 70  HIS B N    5  
ATOM 9509  C CA   . HIS B 2 72  ? 0.595   -8.707  8.856   1.00 0.00 ? 70  HIS B CA   5  
ATOM 9510  C C    . HIS B 2 72  ? 2.006   -9.018  9.330   1.00 0.00 ? 70  HIS B C    5  
ATOM 9511  O O    . HIS B 2 72  ? 2.231   -9.905  10.147  1.00 0.00 ? 70  HIS B O    5  
ATOM 9512  C CB   . HIS B 2 72  ? -0.054  -9.968  8.263   1.00 0.00 ? 70  HIS B CB   5  
ATOM 9513  C CG   . HIS B 2 72  ? 0.028   -10.070 6.771   1.00 0.00 ? 70  HIS B CG   5  
ATOM 9514  N ND1  . HIS B 2 72  ? -1.006  -9.733  5.931   1.00 0.00 ? 70  HIS B ND1  5  
ATOM 9515  C CD2  . HIS B 2 72  ? 1.040   -10.486 5.960   1.00 0.00 ? 70  HIS B CD2  5  
ATOM 9516  C CE1  . HIS B 2 72  ? -0.597  -9.950  4.680   1.00 0.00 ? 70  HIS B CE1  5  
ATOM 9517  N NE2  . HIS B 2 72  ? 0.624   -10.415 4.651   1.00 0.00 ? 70  HIS B NE2  5  
ATOM 9518  H H    . HIS B 2 72  ? 0.638   -7.819  6.930   1.00 0.00 ? 70  HIS B H    5  
ATOM 9519  H HA   . HIS B 2 72  ? 0.009   -8.367  9.695   1.00 0.00 ? 70  HIS B HA   5  
ATOM 9520  H HB2  . HIS B 2 72  ? 0.432   -10.838 8.678   1.00 0.00 ? 70  HIS B HB2  5  
ATOM 9521  H HB3  . HIS B 2 72  ? -1.098  -9.984  8.539   1.00 0.00 ? 70  HIS B HB3  5  
ATOM 9522  H HD1  . HIS B 2 72  ? -1.886  -9.398  6.201   1.00 0.00 ? 70  HIS B HD1  5  
ATOM 9523  H HD2  . HIS B 2 72  ? 2.029   -10.763 6.257   1.00 0.00 ? 70  HIS B HD2  5  
ATOM 9524  H HE1  . HIS B 2 72  ? -1.152  -9.685  3.796   1.00 0.00 ? 70  HIS B HE1  5  
ATOM 9525  N N    . ALA B 2 73  ? 2.948   -8.260  8.789   1.00 0.00 ? 71  ALA B N    5  
ATOM 9526  C CA   . ALA B 2 73  ? 4.353   -8.394  9.119   1.00 0.00 ? 71  ALA B CA   5  
ATOM 9527  C C    . ALA B 2 73  ? 4.675   -7.638  10.402  1.00 0.00 ? 71  ALA B C    5  
ATOM 9528  O O    . ALA B 2 73  ? 5.800   -7.679  10.894  1.00 0.00 ? 71  ALA B O    5  
ATOM 9529  C CB   . ALA B 2 73  ? 5.191   -7.861  7.965   1.00 0.00 ? 71  ALA B CB   5  
ATOM 9530  H H    . ALA B 2 73  ? 2.683   -7.581  8.137   1.00 0.00 ? 71  ALA B H    5  
ATOM 9531  H HA   . ALA B 2 73  ? 4.576   -9.442  9.251   1.00 0.00 ? 71  ALA B HA   5  
ATOM 9532  H HB1  . ALA B 2 73  ? 4.991   -8.441  7.076   1.00 0.00 ? 71  ALA B HB1  5  
ATOM 9533  H HB2  . ALA B 2 73  ? 6.238   -7.931  8.215   1.00 0.00 ? 71  ALA B HB2  5  
ATOM 9534  H HB3  . ALA B 2 73  ? 4.932   -6.827  7.782   1.00 0.00 ? 71  ALA B HB3  5  
ATOM 9535  N N    . GLY B 2 74  ? 3.671   -6.951  10.938  1.00 0.00 ? 72  GLY B N    5  
ATOM 9536  C CA   . GLY B 2 74  ? 3.861   -6.179  12.149  1.00 0.00 ? 72  GLY B CA   5  
ATOM 9537  C C    . GLY B 2 74  ? 4.385   -4.794  11.843  1.00 0.00 ? 72  GLY B C    5  
ATOM 9538  O O    . GLY B 2 74  ? 4.937   -4.121  12.710  1.00 0.00 ? 72  GLY B O    5  
ATOM 9539  H H    . GLY B 2 74  ? 2.792   -6.975  10.509  1.00 0.00 ? 72  GLY B H    5  
ATOM 9540  H HA2  . GLY B 2 74  ? 2.915   -6.094  12.665  1.00 0.00 ? 72  GLY B HA2  5  
ATOM 9541  H HA3  . GLY B 2 74  ? 4.567   -6.690  12.786  1.00 0.00 ? 72  GLY B HA3  5  
ATOM 9542  N N    . ASP B 2 75  ? 4.194   -4.373  10.601  1.00 0.00 ? 73  ASP B N    5  
ATOM 9543  C CA   . ASP B 2 75  ? 4.658   -3.068  10.148  1.00 0.00 ? 73  ASP B CA   5  
ATOM 9544  C C    . ASP B 2 75  ? 3.511   -2.277  9.530   1.00 0.00 ? 73  ASP B C    5  
ATOM 9545  O O    . ASP B 2 75  ? 2.509   -2.856  9.098   1.00 0.00 ? 73  ASP B O    5  
ATOM 9546  C CB   . ASP B 2 75  ? 5.795   -3.240  9.132   1.00 0.00 ? 73  ASP B CB   5  
ATOM 9547  C CG   . ASP B 2 75  ? 6.239   -1.924  8.520   1.00 0.00 ? 73  ASP B CG   5  
ATOM 9548  O OD1  . ASP B 2 75  ? 6.540   -0.987  9.287   1.00 0.00 ? 73  ASP B OD1  5  
ATOM 9549  O OD2  . ASP B 2 75  ? 6.272   -1.827  7.275   1.00 0.00 ? 73  ASP B OD2  5  
ATOM 9550  H H    . ASP B 2 75  ? 3.716   -4.950  9.973   1.00 0.00 ? 73  ASP B H    5  
ATOM 9551  H HA   . ASP B 2 75  ? 5.029   -2.531  11.006  1.00 0.00 ? 73  ASP B HA   5  
ATOM 9552  H HB2  . ASP B 2 75  ? 6.645   -3.688  9.625   1.00 0.00 ? 73  ASP B HB2  5  
ATOM 9553  H HB3  . ASP B 2 75  ? 5.462   -3.891  8.337   1.00 0.00 ? 73  ASP B HB3  5  
ATOM 9554  N N    . THR B 2 76  ? 3.654   -0.961  9.504   1.00 0.00 ? 74  THR B N    5  
ATOM 9555  C CA   . THR B 2 76  ? 2.648   -0.084  8.937   1.00 0.00 ? 74  THR B CA   5  
ATOM 9556  C C    . THR B 2 76  ? 3.321   1.003   8.096   1.00 0.00 ? 74  THR B C    5  
ATOM 9557  O O    . THR B 2 76  ? 4.247   1.669   8.556   1.00 0.00 ? 74  THR B O    5  
ATOM 9558  C CB   . THR B 2 76  ? 1.806   0.587   10.041  1.00 0.00 ? 74  THR B CB   5  
ATOM 9559  O OG1  . THR B 2 76  ? 2.666   1.138   11.045  1.00 0.00 ? 74  THR B OG1  5  
ATOM 9560  C CG2  . THR B 2 76  ? 0.848   -0.404  10.684  1.00 0.00 ? 74  THR B CG2  5  
ATOM 9561  H H    . THR B 2 76  ? 4.485   -0.567  9.855   1.00 0.00 ? 74  THR B H    5  
ATOM 9562  H HA   . THR B 2 76  ? 1.988   -0.680  8.309   1.00 0.00 ? 74  THR B HA   5  
ATOM 9563  H HB   . THR B 2 76  ? 1.228   1.382   9.595   1.00 0.00 ? 74  THR B HB   5  
ATOM 9564  H HG1  . THR B 2 76  ? 3.493   1.422   10.635  1.00 0.00 ? 74  THR B HG1  5  
ATOM 9565  H HG21 . THR B 2 76  ? 1.410   -1.227  11.103  1.00 0.00 ? 74  THR B HG21 5  
ATOM 9566  H HG22 . THR B 2 76  ? 0.163   -0.779  9.938   1.00 0.00 ? 74  THR B HG22 5  
ATOM 9567  H HG23 . THR B 2 76  ? 0.292   0.089   11.468  1.00 0.00 ? 74  THR B HG23 5  
ATOM 9568  N N    . THR B 2 77  ? 2.833   1.192   6.884   1.00 0.00 ? 75  THR B N    5  
ATOM 9569  C CA   . THR B 2 77  ? 3.377   2.186   5.971   1.00 0.00 ? 75  THR B CA   5  
ATOM 9570  C C    . THR B 2 77  ? 2.405   3.361   5.830   1.00 0.00 ? 75  THR B C    5  
ATOM 9571  O O    . THR B 2 77  ? 1.384   3.242   5.159   1.00 0.00 ? 75  THR B O    5  
ATOM 9572  C CB   . THR B 2 77  ? 3.626   1.536   4.597   1.00 0.00 ? 75  THR B CB   5  
ATOM 9573  O OG1  . THR B 2 77  ? 3.974   0.153   4.777   1.00 0.00 ? 75  THR B OG1  5  
ATOM 9574  C CG2  . THR B 2 77  ? 4.738   2.246   3.848   1.00 0.00 ? 75  THR B CG2  5  
ATOM 9575  H H    . THR B 2 77  ? 2.088   0.628   6.581   1.00 0.00 ? 75  THR B H    5  
ATOM 9576  H HA   . THR B 2 77  ? 4.318   2.540   6.367   1.00 0.00 ? 75  THR B HA   5  
ATOM 9577  H HB   . THR B 2 77  ? 2.715   1.593   4.014   1.00 0.00 ? 75  THR B HB   5  
ATOM 9578  H HG1  . THR B 2 77  ? 4.612   0.073   5.498   1.00 0.00 ? 75  THR B HG1  5  
ATOM 9579  H HG21 . THR B 2 77  ? 4.935   1.730   2.920   1.00 0.00 ? 75  THR B HG21 5  
ATOM 9580  H HG22 . THR B 2 77  ? 5.634   2.251   4.453   1.00 0.00 ? 75  THR B HG22 5  
ATOM 9581  H HG23 . THR B 2 77  ? 4.441   3.262   3.638   1.00 0.00 ? 75  THR B HG23 5  
ATOM 9582  N N    . ASN B 2 78  ? 2.714   4.498   6.446   1.00 0.00 ? 76  ASN B N    5  
ATOM 9583  C CA   . ASN B 2 78  ? 1.804   5.645   6.399   1.00 0.00 ? 76  ASN B CA   5  
ATOM 9584  C C    . ASN B 2 78  ? 2.021   6.511   5.168   1.00 0.00 ? 76  ASN B C    5  
ATOM 9585  O O    . ASN B 2 78  ? 3.132   6.938   4.876   1.00 0.00 ? 76  ASN B O    5  
ATOM 9586  C CB   . ASN B 2 78  ? 1.926   6.512   7.659   1.00 0.00 ? 76  ASN B CB   5  
ATOM 9587  C CG   . ASN B 2 78  ? 1.342   5.855   8.898   1.00 0.00 ? 76  ASN B CG   5  
ATOM 9588  O OD1  . ASN B 2 78  ? 1.307   4.632   9.012   1.00 0.00 ? 76  ASN B OD1  5  
ATOM 9589  N ND2  . ASN B 2 78  ? 0.878   6.667   9.838   1.00 0.00 ? 76  ASN B ND2  5  
ATOM 9590  H H    . ASN B 2 78  ? 3.574   4.579   6.917   1.00 0.00 ? 76  ASN B H    5  
ATOM 9591  H HA   . ASN B 2 78  ? 0.799   5.250   6.358   1.00 0.00 ? 76  ASN B HA   5  
ATOM 9592  H HB2  . ASN B 2 78  ? 2.965   6.720   7.844   1.00 0.00 ? 76  ASN B HB2  5  
ATOM 9593  H HB3  . ASN B 2 78  ? 1.404   7.443   7.493   1.00 0.00 ? 76  ASN B HB3  5  
ATOM 9594  H HD21 . ASN B 2 78  ? 0.930   7.637   9.685   1.00 0.00 ? 76  ASN B HD21 5  
ATOM 9595  H HD22 . ASN B 2 78  ? 0.514   6.270   10.658  1.00 0.00 ? 76  ASN B HD22 5  
ATOM 9596  N N    . PHE B 2 79  ? 0.927   6.769   4.467   1.00 0.00 ? 77  PHE B N    5  
ATOM 9597  C CA   . PHE B 2 79  ? 0.926   7.596   3.276   1.00 0.00 ? 77  PHE B CA   5  
ATOM 9598  C C    . PHE B 2 79  ? 0.120   8.863   3.540   1.00 0.00 ? 77  PHE B C    5  
ATOM 9599  O O    . PHE B 2 79  ? -1.105  8.827   3.679   1.00 0.00 ? 77  PHE B O    5  
ATOM 9600  C CB   . PHE B 2 79  ? 0.336   6.834   2.090   1.00 0.00 ? 77  PHE B CB   5  
ATOM 9601  C CG   . PHE B 2 79  ? 1.281   5.833   1.492   1.00 0.00 ? 77  PHE B CG   5  
ATOM 9602  C CD1  . PHE B 2 79  ? 2.306   6.246   0.660   1.00 0.00 ? 77  PHE B CD1  5  
ATOM 9603  C CD2  . PHE B 2 79  ? 1.141   4.481   1.760   1.00 0.00 ? 77  PHE B CD2  5  
ATOM 9604  C CE1  . PHE B 2 79  ? 3.177   5.330   0.105   1.00 0.00 ? 77  PHE B CE1  5  
ATOM 9605  C CE2  . PHE B 2 79  ? 2.010   3.561   1.207   1.00 0.00 ? 77  PHE B CE2  5  
ATOM 9606  C CZ   . PHE B 2 79  ? 3.029   3.986   0.378   1.00 0.00 ? 77  PHE B CZ   5  
ATOM 9607  H H    . PHE B 2 79  ? 0.073   6.392   4.774   1.00 0.00 ? 77  PHE B H    5  
ATOM 9608  H HA   . PHE B 2 79  ? 1.948   7.867   3.055   1.00 0.00 ? 77  PHE B HA   5  
ATOM 9609  H HB2  . PHE B 2 79  ? -0.547  6.304   2.413   1.00 0.00 ? 77  PHE B HB2  5  
ATOM 9610  H HB3  . PHE B 2 79  ? 0.065   7.539   1.317   1.00 0.00 ? 77  PHE B HB3  5  
ATOM 9611  H HD1  . PHE B 2 79  ? 2.424   7.298   0.445   1.00 0.00 ? 77  PHE B HD1  5  
ATOM 9612  H HD2  . PHE B 2 79  ? 0.344   4.149   2.409   1.00 0.00 ? 77  PHE B HD2  5  
ATOM 9613  H HE1  . PHE B 2 79  ? 3.972   5.666   -0.544  1.00 0.00 ? 77  PHE B HE1  5  
ATOM 9614  H HE2  . PHE B 2 79  ? 1.891   2.509   1.424   1.00 0.00 ? 77  PHE B HE2  5  
ATOM 9615  H HZ   . PHE B 2 79  ? 3.708   3.269   -0.058  1.00 0.00 ? 77  PHE B HZ   5  
ATOM 9616  N N    . HIS B 2 80  ? 0.822   9.968   3.614   1.00 0.00 ? 78  HIS B N    5  
ATOM 9617  C CA   . HIS B 2 80  ? 0.230   11.266  3.877   1.00 0.00 ? 78  HIS B CA   5  
ATOM 9618  C C    . HIS B 2 80  ? -0.230  11.905  2.570   1.00 0.00 ? 78  HIS B C    5  
ATOM 9619  O O    . HIS B 2 80  ? 0.580   12.239  1.718   1.00 0.00 ? 78  HIS B O    5  
ATOM 9620  C CB   . HIS B 2 80  ? 1.299   12.116  4.586   1.00 0.00 ? 78  HIS B CB   5  
ATOM 9621  C CG   . HIS B 2 80  ? 0.986   13.566  4.831   1.00 0.00 ? 78  HIS B CG   5  
ATOM 9622  N ND1  . HIS B 2 80  ? 1.467   14.255  5.920   1.00 0.00 ? 78  HIS B ND1  5  
ATOM 9623  C CD2  . HIS B 2 80  ? 0.311   14.477  4.084   1.00 0.00 ? 78  HIS B CD2  5  
ATOM 9624  C CE1  . HIS B 2 80  ? 1.088   15.530  5.803   1.00 0.00 ? 78  HIS B CE1  5  
ATOM 9625  N NE2  . HIS B 2 80  ? 0.385   15.720  4.705   1.00 0.00 ? 78  HIS B NE2  5  
ATOM 9626  H H    . HIS B 2 80  ? 1.799   9.916   3.482   1.00 0.00 ? 78  HIS B H    5  
ATOM 9627  H HA   . HIS B 2 80  ? -0.617  11.133  4.533   1.00 0.00 ? 78  HIS B HA   5  
ATOM 9628  H HB2  . HIS B 2 80  ? 1.501   11.673  5.546   1.00 0.00 ? 78  HIS B HB2  5  
ATOM 9629  H HB3  . HIS B 2 80  ? 2.204   12.073  3.997   1.00 0.00 ? 78  HIS B HB3  5  
ATOM 9630  H HD1  . HIS B 2 80  ? 2.005   13.874  6.650   1.00 0.00 ? 78  HIS B HD1  5  
ATOM 9631  H HD2  . HIS B 2 80  ? -0.205  14.279  3.156   1.00 0.00 ? 78  HIS B HD2  5  
ATOM 9632  H HE1  . HIS B 2 80  ? 1.326   16.306  6.515   1.00 0.00 ? 78  HIS B HE1  5  
ATOM 9633  N N    . PHE B 2 81  ? -1.529  12.065  2.404   1.00 0.00 ? 79  PHE B N    5  
ATOM 9634  C CA   . PHE B 2 81  ? -2.066  12.672  1.195   1.00 0.00 ? 79  PHE B CA   5  
ATOM 9635  C C    . PHE B 2 81  ? -1.949  14.191  1.285   1.00 0.00 ? 79  PHE B C    5  
ATOM 9636  O O    . PHE B 2 81  ? -2.837  14.862  1.816   1.00 0.00 ? 79  PHE B O    5  
ATOM 9637  C CB   . PHE B 2 81  ? -3.526  12.265  0.996   1.00 0.00 ? 79  PHE B CB   5  
ATOM 9638  C CG   . PHE B 2 81  ? -3.701  10.897  0.407   1.00 0.00 ? 79  PHE B CG   5  
ATOM 9639  C CD1  . PHE B 2 81  ? -3.785  10.735  -0.961  1.00 0.00 ? 79  PHE B CD1  5  
ATOM 9640  C CD2  . PHE B 2 81  ? -3.791  9.774   1.216   1.00 0.00 ? 79  PHE B CD2  5  
ATOM 9641  C CE1  . PHE B 2 81  ? -3.957  9.485   -1.515  1.00 0.00 ? 79  PHE B CE1  5  
ATOM 9642  C CE2  . PHE B 2 81  ? -3.961  8.517   0.662   1.00 0.00 ? 79  PHE B CE2  5  
ATOM 9643  C CZ   . PHE B 2 81  ? -4.045  8.375   -0.709  1.00 0.00 ? 79  PHE B CZ   5  
ATOM 9644  H H    . PHE B 2 81  ? -2.146  11.791  3.117   1.00 0.00 ? 79  PHE B H    5  
ATOM 9645  H HA   . PHE B 2 81  ? -1.481  12.319  0.356   1.00 0.00 ? 79  PHE B HA   5  
ATOM 9646  H HB2  . PHE B 2 81  ? -4.028  12.279  1.952   1.00 0.00 ? 79  PHE B HB2  5  
ATOM 9647  H HB3  . PHE B 2 81  ? -4.003  12.976  0.337   1.00 0.00 ? 79  PHE B HB3  5  
ATOM 9648  H HD1  . PHE B 2 81  ? -3.715  11.602  -1.602  1.00 0.00 ? 79  PHE B HD1  5  
ATOM 9649  H HD2  . PHE B 2 81  ? -3.726  9.887   2.288   1.00 0.00 ? 79  PHE B HD2  5  
ATOM 9650  H HE1  . PHE B 2 81  ? -4.021  9.377   -2.588  1.00 0.00 ? 79  PHE B HE1  5  
ATOM 9651  H HE2  . PHE B 2 81  ? -4.030  7.650   1.301   1.00 0.00 ? 79  PHE B HE2  5  
ATOM 9652  H HZ   . PHE B 2 81  ? -4.187  7.395   -1.155  1.00 0.00 ? 79  PHE B HZ   5  
ATOM 9653  N N    . SER B 2 82  ? -0.851  14.728  0.773   1.00 0.00 ? 80  SER B N    5  
ATOM 9654  C CA   . SER B 2 82  ? -0.608  16.161  0.821   1.00 0.00 ? 80  SER B CA   5  
ATOM 9655  C C    . SER B 2 82  ? -1.007  16.852  -0.484  1.00 0.00 ? 80  SER B C    5  
ATOM 9656  O O    . SER B 2 82  ? -0.436  17.883  -0.849  1.00 0.00 ? 80  SER B O    5  
ATOM 9657  C CB   . SER B 2 82  ? 0.867   16.426  1.142   1.00 0.00 ? 80  SER B CB   5  
ATOM 9658  O OG   . SER B 2 82  ? 1.698   15.385  0.651   1.00 0.00 ? 80  SER B OG   5  
ATOM 9659  H H    . SER B 2 82  ? -0.184  14.146  0.348   1.00 0.00 ? 80  SER B H    5  
ATOM 9660  H HA   . SER B 2 82  ? -1.212  16.565  1.620   1.00 0.00 ? 80  SER B HA   5  
ATOM 9661  H HB2  . SER B 2 82  ? 1.170   17.356  0.684   1.00 0.00 ? 80  SER B HB2  5  
ATOM 9662  H HB3  . SER B 2 82  ? 0.993   16.495  2.213   1.00 0.00 ? 80  SER B HB3  5  
ATOM 9663  H HG   . SER B 2 82  ? 2.577   15.741  0.446   1.00 0.00 ? 80  SER B HG   5  
ATOM 9664  N N    . ASN B 2 83  ? -1.971  16.277  -1.196  1.00 0.00 ? 81  ASN B N    5  
ATOM 9665  C CA   . ASN B 2 83  ? -2.452  16.871  -2.438  1.00 0.00 ? 81  ASN B CA   5  
ATOM 9666  C C    . ASN B 2 83  ? -3.835  17.466  -2.211  1.00 0.00 ? 81  ASN B C    5  
ATOM 9667  O O    . ASN B 2 83  ? -4.847  16.797  -2.385  1.00 0.00 ? 81  ASN B O    5  
ATOM 9668  C CB   . ASN B 2 83  ? -2.492  15.842  -3.575  1.00 0.00 ? 81  ASN B CB   5  
ATOM 9669  C CG   . ASN B 2 83  ? -2.743  16.477  -4.939  1.00 0.00 ? 81  ASN B CG   5  
ATOM 9670  O OD1  . ASN B 2 83  ? -3.190  15.813  -5.877  1.00 0.00 ? 81  ASN B OD1  5  
ATOM 9671  N ND2  . ASN B 2 83  ? -2.459  17.766  -5.067  1.00 0.00 ? 81  ASN B ND2  5  
ATOM 9672  H H    . ASN B 2 83  ? -2.362  15.435  -0.882  1.00 0.00 ? 81  ASN B H    5  
ATOM 9673  H HA   . ASN B 2 83  ? -1.773  17.668  -2.706  1.00 0.00 ? 81  ASN B HA   5  
ATOM 9674  H HB2  . ASN B 2 83  ? -1.547  15.321  -3.612  1.00 0.00 ? 81  ASN B HB2  5  
ATOM 9675  H HB3  . ASN B 2 83  ? -3.282  15.132  -3.379  1.00 0.00 ? 81  ASN B HB3  5  
ATOM 9676  H HD21 . ASN B 2 83  ? -2.104  18.249  -4.289  1.00 0.00 ? 81  ASN B HD21 5  
ATOM 9677  H HD22 . ASN B 2 83  ? -2.627  18.195  -5.933  1.00 0.00 ? 81  ASN B HD22 5  
ATOM 9678  N N    . GLU B 2 84  ? -3.848  18.737  -1.848  1.00 0.00 ? 82  GLU B N    5  
ATOM 9679  C CA   . GLU B 2 84  ? -5.072  19.489  -1.554  1.00 0.00 ? 82  GLU B CA   5  
ATOM 9680  C C    . GLU B 2 84  ? -6.181  19.278  -2.596  1.00 0.00 ? 82  GLU B C    5  
ATOM 9681  O O    . GLU B 2 84  ? -7.364  19.233  -2.253  1.00 0.00 ? 82  GLU B O    5  
ATOM 9682  C CB   . GLU B 2 84  ? -4.737  20.989  -1.427  1.00 0.00 ? 82  GLU B CB   5  
ATOM 9683  C CG   . GLU B 2 84  ? -4.254  21.664  -2.718  1.00 0.00 ? 82  GLU B CG   5  
ATOM 9684  C CD   . GLU B 2 84  ? -3.165  20.887  -3.443  1.00 0.00 ? 82  GLU B CD   5  
ATOM 9685  O OE1  . GLU B 2 84  ? -2.074  20.699  -2.865  1.00 0.00 ? 82  GLU B OE1  5  
ATOM 9686  O OE2  . GLU B 2 84  ? -3.423  20.417  -4.572  1.00 0.00 ? 82  GLU B OE2  5  
ATOM 9687  H H    . GLU B 2 84  ? -2.987  19.214  -1.790  1.00 0.00 ? 82  GLU B H    5  
ATOM 9688  H HA   . GLU B 2 84  ? -5.437  19.144  -0.600  1.00 0.00 ? 82  GLU B HA   5  
ATOM 9689  H HB2  . GLU B 2 84  ? -5.621  21.510  -1.092  1.00 0.00 ? 82  GLU B HB2  5  
ATOM 9690  H HB3  . GLU B 2 84  ? -3.964  21.104  -0.681  1.00 0.00 ? 82  GLU B HB3  5  
ATOM 9691  H HG2  . GLU B 2 84  ? -5.094  21.774  -3.385  1.00 0.00 ? 82  GLU B HG2  5  
ATOM 9692  H HG3  . GLU B 2 84  ? -3.868  22.643  -2.469  1.00 0.00 ? 82  GLU B HG3  5  
ATOM 9693  N N    . SER B 2 85  ? -5.790  19.134  -3.852  1.00 0.00 ? 83  SER B N    5  
ATOM 9694  C CA   . SER B 2 85  ? -6.730  18.946  -4.945  1.00 0.00 ? 83  SER B CA   5  
ATOM 9695  C C    . SER B 2 85  ? -7.619  17.713  -4.783  1.00 0.00 ? 83  SER B C    5  
ATOM 9696  O O    . SER B 2 85  ? -8.852  17.829  -4.728  1.00 0.00 ? 83  SER B O    5  
ATOM 9697  C CB   . SER B 2 85  ? -5.959  18.854  -6.264  1.00 0.00 ? 83  SER B CB   5  
ATOM 9698  O OG   . SER B 2 85  ? -5.221  20.040  -6.511  1.00 0.00 ? 83  SER B OG   5  
ATOM 9699  H H    . SER B 2 85  ? -4.828  19.180  -4.057  1.00 0.00 ? 83  SER B H    5  
ATOM 9700  H HA   . SER B 2 85  ? -7.369  19.807  -4.990  1.00 0.00 ? 83  SER B HA   5  
ATOM 9701  H HB2  . SER B 2 85  ? -5.272  18.023  -6.217  1.00 0.00 ? 83  SER B HB2  5  
ATOM 9702  H HB3  . SER B 2 85  ? -6.655  18.701  -7.075  1.00 0.00 ? 83  SER B HB3  5  
ATOM 9703  H HG   . SER B 2 85  ? -4.605  20.206  -5.774  1.00 0.00 ? 83  SER B HG   5  
ATOM 9704  N N    . THR B 2 86  ? -7.028  16.534  -4.704  1.00 0.00 ? 84  THR B N    5  
ATOM 9705  C CA   . THR B 2 86  ? -7.830  15.327  -4.629  1.00 0.00 ? 84  THR B CA   5  
ATOM 9706  C C    . THR B 2 86  ? -7.486  14.386  -3.471  1.00 0.00 ? 84  THR B C    5  
ATOM 9707  O O    . THR B 2 86  ? -8.027  13.293  -3.420  1.00 0.00 ? 84  THR B O    5  
ATOM 9708  C CB   . THR B 2 86  ? -7.731  14.591  -5.977  1.00 0.00 ? 84  THR B CB   5  
ATOM 9709  O OG1  . THR B 2 86  ? -6.361  14.510  -6.391  1.00 0.00 ? 84  THR B OG1  5  
ATOM 9710  C CG2  . THR B 2 86  ? -8.523  15.348  -7.032  1.00 0.00 ? 84  THR B CG2  5  
ATOM 9711  H H    . THR B 2 86  ? -6.047  16.473  -4.694  1.00 0.00 ? 84  THR B H    5  
ATOM 9712  H HA   . THR B 2 86  ? -8.861  15.631  -4.512  1.00 0.00 ? 84  THR B HA   5  
ATOM 9713  H HB   . THR B 2 86  ? -8.141  13.598  -5.873  1.00 0.00 ? 84  THR B HB   5  
ATOM 9714  H HG1  . THR B 2 86  ? -5.827  14.117  -5.671  1.00 0.00 ? 84  THR B HG1  5  
ATOM 9715  H HG21 . THR B 2 86  ? -9.542  15.471  -6.698  1.00 0.00 ? 84  THR B HG21 5  
ATOM 9716  H HG22 . THR B 2 86  ? -8.507  14.801  -7.959  1.00 0.00 ? 84  THR B HG22 5  
ATOM 9717  H HG23 . THR B 2 86  ? -8.076  16.324  -7.181  1.00 0.00 ? 84  THR B HG23 5  
ATOM 9718  N N    . ALA B 2 87  ? -6.650  14.824  -2.530  1.00 0.00 ? 85  ALA B N    5  
ATOM 9719  C CA   . ALA B 2 87  ? -6.214  13.987  -1.391  1.00 0.00 ? 85  ALA B CA   5  
ATOM 9720  C C    . ALA B 2 87  ? -7.340  13.172  -0.756  1.00 0.00 ? 85  ALA B C    5  
ATOM 9721  O O    . ALA B 2 87  ? -7.189  11.976  -0.542  1.00 0.00 ? 85  ALA B O    5  
ATOM 9722  C CB   . ALA B 2 87  ? -5.552  14.844  -0.323  1.00 0.00 ? 85  ALA B CB   5  
ATOM 9723  H H    . ALA B 2 87  ? -6.294  15.738  -2.602  1.00 0.00 ? 85  ALA B H    5  
ATOM 9724  H HA   . ALA B 2 87  ? -5.469  13.293  -1.765  1.00 0.00 ? 85  ALA B HA   5  
ATOM 9725  H HB1  . ALA B 2 87  ? -4.761  15.428  -0.771  1.00 0.00 ? 85  ALA B HB1  5  
ATOM 9726  H HB2  . ALA B 2 87  ? -5.138  14.206  0.443   1.00 0.00 ? 85  ALA B HB2  5  
ATOM 9727  H HB3  . ALA B 2 87  ? -6.285  15.505  0.114   1.00 0.00 ? 85  ALA B HB3  5  
ATOM 9728  N N    . VAL B 2 88  ? -8.451  13.822  -0.433  1.00 0.00 ? 86  VAL B N    5  
ATOM 9729  C CA   . VAL B 2 88  ? -9.588  13.134  0.178   1.00 0.00 ? 86  VAL B CA   5  
ATOM 9730  C C    . VAL B 2 88  ? -10.085 11.990  -0.718  1.00 0.00 ? 86  VAL B C    5  
ATOM 9731  O O    . VAL B 2 88  ? -10.176 10.842  -0.285  1.00 0.00 ? 86  VAL B O    5  
ATOM 9732  C CB   . VAL B 2 88  ? -10.735 14.136  0.472   1.00 0.00 ? 86  VAL B CB   5  
ATOM 9733  C CG1  . VAL B 2 88  ? -12.107 13.476  0.394   1.00 0.00 ? 86  VAL B CG1  5  
ATOM 9734  C CG2  . VAL B 2 88  ? -10.548 14.776  1.835   1.00 0.00 ? 86  VAL B CG2  5  
ATOM 9735  H H    . VAL B 2 88  ? -8.506  14.783  -0.601  1.00 0.00 ? 86  VAL B H    5  
ATOM 9736  H HA   . VAL B 2 88  ? -9.252  12.714  1.119   1.00 0.00 ? 86  VAL B HA   5  
ATOM 9737  H HB   . VAL B 2 88  ? -10.687 14.923  -0.266  1.00 0.00 ? 86  VAL B HB   5  
ATOM 9738  H HG11 . VAL B 2 88  ? -12.871 14.208  0.614   1.00 0.00 ? 86  VAL B HG11 5  
ATOM 9739  H HG12 . VAL B 2 88  ? -12.162 12.672  1.113   1.00 0.00 ? 86  VAL B HG12 5  
ATOM 9740  H HG13 . VAL B 2 88  ? -12.261 13.082  -0.600  1.00 0.00 ? 86  VAL B HG13 5  
ATOM 9741  H HG21 . VAL B 2 88  ? -9.602  15.295  1.862   1.00 0.00 ? 86  VAL B HG21 5  
ATOM 9742  H HG22 . VAL B 2 88  ? -10.561 14.010  2.596   1.00 0.00 ? 86  VAL B HG22 5  
ATOM 9743  H HG23 . VAL B 2 88  ? -11.349 15.477  2.016   1.00 0.00 ? 86  VAL B HG23 5  
ATOM 9744  N N    . LYS B 2 89  ? -10.358 12.313  -1.976  1.00 0.00 ? 87  LYS B N    5  
ATOM 9745  C CA   . LYS B 2 89  ? -10.844 11.337  -2.952  1.00 0.00 ? 87  LYS B CA   5  
ATOM 9746  C C    . LYS B 2 89  ? -9.761  10.306  -3.247  1.00 0.00 ? 87  LYS B C    5  
ATOM 9747  O O    . LYS B 2 89  ? -10.046 9.133   -3.468  1.00 0.00 ? 87  LYS B O    5  
ATOM 9748  C CB   . LYS B 2 89  ? -11.244 12.067  -4.241  1.00 0.00 ? 87  LYS B CB   5  
ATOM 9749  C CG   . LYS B 2 89  ? -12.039 13.346  -4.001  1.00 0.00 ? 87  LYS B CG   5  
ATOM 9750  C CD   . LYS B 2 89  ? -11.392 14.544  -4.688  1.00 0.00 ? 87  LYS B CD   5  
ATOM 9751  C CE   . LYS B 2 89  ? -12.069 15.853  -4.303  1.00 0.00 ? 87  LYS B CE   5  
ATOM 9752  N NZ   . LYS B 2 89  ? -11.445 17.031  -4.976  1.00 0.00 ? 87  LYS B NZ   5  
ATOM 9753  H H    . LYS B 2 89  ? -10.210 13.233  -2.263  1.00 0.00 ? 87  LYS B H    5  
ATOM 9754  H HA   . LYS B 2 89  ? -11.709 10.822  -2.536  1.00 0.00 ? 87  LYS B HA   5  
ATOM 9755  H HB2  . LYS B 2 89  ? -10.346 12.329  -4.783  1.00 0.00 ? 87  LYS B HB2  5  
ATOM 9756  H HB3  . LYS B 2 89  ? -11.840 11.406  -4.848  1.00 0.00 ? 87  LYS B HB3  5  
ATOM 9757  H HG2  . LYS B 2 89  ? -13.038 13.216  -4.392  1.00 0.00 ? 87  LYS B HG2  5  
ATOM 9758  H HG3  . LYS B 2 89  ? -12.087 13.534  -2.938  1.00 0.00 ? 87  LYS B HG3  5  
ATOM 9759  H HD2  . LYS B 2 89  ? -10.353 14.592  -4.400  1.00 0.00 ? 87  LYS B HD2  5  
ATOM 9760  H HD3  . LYS B 2 89  ? -11.463 14.414  -5.758  1.00 0.00 ? 87  LYS B HD3  5  
ATOM 9761  H HE2  . LYS B 2 89  ? -13.110 15.800  -4.583  1.00 0.00 ? 87  LYS B HE2  5  
ATOM 9762  H HE3  . LYS B 2 89  ? -11.993 15.980  -3.233  1.00 0.00 ? 87  LYS B HE3  5  
ATOM 9763  H HZ1  . LYS B 2 89  ? -10.458 17.156  -4.654  1.00 0.00 ? 87  LYS B HZ1  5  
ATOM 9764  H HZ2  . LYS B 2 89  ? -11.979 17.896  -4.753  1.00 0.00 ? 87  LYS B HZ2  5  
ATOM 9765  H HZ3  . LYS B 2 89  ? -11.444 16.897  -6.007  1.00 0.00 ? 87  LYS B HZ3  5  
ATOM 9766  N N    . GLU B 2 90  ? -8.520  10.765  -3.252  1.00 0.00 ? 88  GLU B N    5  
ATOM 9767  C CA   . GLU B 2 90  ? -7.377  9.905   -3.484  1.00 0.00 ? 88  GLU B CA   5  
ATOM 9768  C C    . GLU B 2 90  ? -7.268  8.905   -2.342  1.00 0.00 ? 88  GLU B C    5  
ATOM 9769  O O    . GLU B 2 90  ? -7.094  7.712   -2.571  1.00 0.00 ? 88  GLU B O    5  
ATOM 9770  C CB   . GLU B 2 90  ? -6.112  10.752  -3.634  1.00 0.00 ? 88  GLU B CB   5  
ATOM 9771  C CG   . GLU B 2 90  ? -5.837  11.149  -5.076  1.00 0.00 ? 88  GLU B CG   5  
ATOM 9772  C CD   . GLU B 2 90  ? -4.766  12.211  -5.211  1.00 0.00 ? 88  GLU B CD   5  
ATOM 9773  O OE1  . GLU B 2 90  ? -3.773  11.976  -5.930  1.00 0.00 ? 88  GLU B OE1  5  
ATOM 9774  O OE2  . GLU B 2 90  ? -4.932  13.303  -4.637  1.00 0.00 ? 88  GLU B OE2  5  
ATOM 9775  H H    . GLU B 2 90  ? -8.366  11.723  -3.099  1.00 0.00 ? 88  GLU B H    5  
ATOM 9776  H HA   . GLU B 2 90  ? -7.550  9.364   -4.402  1.00 0.00 ? 88  GLU B HA   5  
ATOM 9777  H HB2  . GLU B 2 90  ? -6.229  11.655  -3.051  1.00 0.00 ? 88  GLU B HB2  5  
ATOM 9778  H HB3  . GLU B 2 90  ? -5.264  10.204  -3.259  1.00 0.00 ? 88  GLU B HB3  5  
ATOM 9779  H HG2  . GLU B 2 90  ? -5.520  10.274  -5.620  1.00 0.00 ? 88  GLU B HG2  5  
ATOM 9780  H HG3  . GLU B 2 90  ? -6.753  11.526  -5.508  1.00 0.00 ? 88  GLU B HG3  5  
ATOM 9781  N N    . ARG B 2 91  ? -7.409  9.401   -1.112  1.00 0.00 ? 89  ARG B N    5  
ATOM 9782  C CA   . ARG B 2 91  ? -7.382  8.557   0.080   1.00 0.00 ? 89  ARG B CA   5  
ATOM 9783  C C    . ARG B 2 91  ? -8.425  7.478   -0.073  1.00 0.00 ? 89  ARG B C    5  
ATOM 9784  O O    . ARG B 2 91  ? -8.174  6.296   0.143   1.00 0.00 ? 89  ARG B O    5  
ATOM 9785  C CB   . ARG B 2 91  ? -7.720  9.380   1.326   1.00 0.00 ? 89  ARG B CB   5  
ATOM 9786  C CG   . ARG B 2 91  ? -7.710  8.588   2.621   1.00 0.00 ? 89  ARG B CG   5  
ATOM 9787  C CD   . ARG B 2 91  ? -8.620  9.233   3.657   1.00 0.00 ? 89  ARG B CD   5  
ATOM 9788  N NE   . ARG B 2 91  ? -9.917  9.614   3.087   1.00 0.00 ? 89  ARG B NE   5  
ATOM 9789  C CZ   . ARG B 2 91  ? -10.640 10.659  3.497   1.00 0.00 ? 89  ARG B CZ   5  
ATOM 9790  N NH1  . ARG B 2 91  ? -10.222 11.420  4.500   1.00 0.00 ? 89  ARG B NH1  5  
ATOM 9791  N NH2  . ARG B 2 91  ? -11.794 10.941  2.906   1.00 0.00 ? 89  ARG B NH2  5  
ATOM 9792  H H    . ARG B 2 91  ? -7.527  10.373  -1.002  1.00 0.00 ? 89  ARG B H    5  
ATOM 9793  H HA   . ARG B 2 91  ? -6.401  8.116   0.179   1.00 0.00 ? 89  ARG B HA   5  
ATOM 9794  H HB2  . ARG B 2 91  ? -7.017  10.192  1.419   1.00 0.00 ? 89  ARG B HB2  5  
ATOM 9795  H HB3  . ARG B 2 91  ? -8.715  9.791   1.207   1.00 0.00 ? 89  ARG B HB3  5  
ATOM 9796  H HG2  . ARG B 2 91  ? -8.058  7.584   2.423   1.00 0.00 ? 89  ARG B HG2  5  
ATOM 9797  H HG3  . ARG B 2 91  ? -6.702  8.555   3.008   1.00 0.00 ? 89  ARG B HG3  5  
ATOM 9798  H HD2  . ARG B 2 91  ? -8.783  8.531   4.461   1.00 0.00 ? 89  ARG B HD2  5  
ATOM 9799  H HD3  . ARG B 2 91  ? -8.133  10.117  4.044   1.00 0.00 ? 89  ARG B HD3  5  
ATOM 9800  H HE   . ARG B 2 91  ? -10.266 9.064   2.351   1.00 0.00 ? 89  ARG B HE   5  
ATOM 9801  H HH11 . ARG B 2 91  ? -9.362  11.218  4.969   1.00 0.00 ? 89  ARG B HH11 5  
ATOM 9802  H HH12 . ARG B 2 91  ? -10.776 12.221  4.785   1.00 0.00 ? 89  ARG B HH12 5  
ATOM 9803  H HH21 . ARG B 2 91  ? -12.135 10.366  2.139   1.00 0.00 ? 89  ARG B HH21 5  
ATOM 9804  H HH22 . ARG B 2 91  ? -12.339 11.727  3.219   1.00 0.00 ? 89  ARG B HH22 5  
ATOM 9805  N N    . ASP B 2 92  ? -9.596  7.929   -0.468  1.00 0.00 ? 90  ASP B N    5  
ATOM 9806  C CA   . ASP B 2 92  ? -10.739 7.076   -0.675  1.00 0.00 ? 90  ASP B CA   5  
ATOM 9807  C C    . ASP B 2 92  ? -10.516 6.047   -1.776  1.00 0.00 ? 90  ASP B C    5  
ATOM 9808  O O    . ASP B 2 92  ? -10.816 4.878   -1.577  1.00 0.00 ? 90  ASP B O    5  
ATOM 9809  C CB   . ASP B 2 92  ? -11.967 7.947   -0.933  1.00 0.00 ? 90  ASP B CB   5  
ATOM 9810  C CG   . ASP B 2 92  ? -12.696 8.241   0.360   1.00 0.00 ? 90  ASP B CG   5  
ATOM 9811  O OD1  . ASP B 2 92  ? -12.572 9.369   0.879   1.00 0.00 ? 90  ASP B OD1  5  
ATOM 9812  O OD2  . ASP B 2 92  ? -13.359 7.316   0.883   1.00 0.00 ? 90  ASP B OD2  5  
ATOM 9813  H H    . ASP B 2 92  ? -9.698  8.895   -0.627  1.00 0.00 ? 90  ASP B H    5  
ATOM 9814  H HA   . ASP B 2 92  ? -10.900 6.539   0.248   1.00 0.00 ? 90  ASP B HA   5  
ATOM 9815  H HB2  . ASP B 2 92  ? -11.641 8.885   -1.360  1.00 0.00 ? 90  ASP B HB2  5  
ATOM 9816  H HB3  . ASP B 2 92  ? -12.635 7.465   -1.618  1.00 0.00 ? 90  ASP B HB3  5  
ATOM 9817  N N    . ALA B 2 93  ? -9.965  6.460   -2.905  1.00 0.00 ? 91  ALA B N    5  
ATOM 9818  C CA   . ALA B 2 93  ? -9.711  5.534   -4.011  1.00 0.00 ? 91  ALA B CA   5  
ATOM 9819  C C    . ALA B 2 93  ? -8.626  4.522   -3.648  1.00 0.00 ? 91  ALA B C    5  
ATOM 9820  O O    . ALA B 2 93  ? -8.759  3.340   -3.960  1.00 0.00 ? 91  ALA B O    5  
ATOM 9821  C CB   . ALA B 2 93  ? -9.336  6.302   -5.269  1.00 0.00 ? 91  ALA B CB   5  
ATOM 9822  H H    . ALA B 2 93  ? -9.733  7.411   -3.008  1.00 0.00 ? 91  ALA B H    5  
ATOM 9823  H HA   . ALA B 2 93  ? -10.634 4.985   -4.207  1.00 0.00 ? 91  ALA B HA   5  
ATOM 9824  H HB1  . ALA B 2 93  ? -9.182  5.607   -6.081  1.00 0.00 ? 91  ALA B HB1  5  
ATOM 9825  H HB2  . ALA B 2 93  ? -8.428  6.858   -5.093  1.00 0.00 ? 91  ALA B HB2  5  
ATOM 9826  H HB3  . ALA B 2 93  ? -10.133 6.984   -5.525  1.00 0.00 ? 91  ALA B HB3  5  
ATOM 9827  N N    . VAL B 2 94  ? -7.551  4.976   -2.999  1.00 0.00 ? 92  VAL B N    5  
ATOM 9828  C CA   . VAL B 2 94  ? -6.485  4.067   -2.573  1.00 0.00 ? 92  VAL B CA   5  
ATOM 9829  C C    . VAL B 2 94  ? -7.091  3.083   -1.581  1.00 0.00 ? 92  VAL B C    5  
ATOM 9830  O O    . VAL B 2 94  ? -6.844  1.883   -1.635  1.00 0.00 ? 92  VAL B O    5  
ATOM 9831  C CB   . VAL B 2 94  ? -5.307  4.815   -1.911  1.00 0.00 ? 92  VAL B CB   5  
ATOM 9832  C CG1  . VAL B 2 94  ? -4.188  3.850   -1.564  1.00 0.00 ? 92  VAL B CG1  5  
ATOM 9833  C CG2  . VAL B 2 94  ? -4.780  5.906   -2.823  1.00 0.00 ? 92  VAL B CG2  5  
ATOM 9834  H H    . VAL B 2 94  ? -7.480  5.937   -2.792  1.00 0.00 ? 92  VAL B H    5  
ATOM 9835  H HA   . VAL B 2 94  ? -6.107  3.525   -3.441  1.00 0.00 ? 92  VAL B HA   5  
ATOM 9836  H HB   . VAL B 2 94  ? -5.660  5.273   -0.999  1.00 0.00 ? 92  VAL B HB   5  
ATOM 9837  H HG11 . VAL B 2 94  ? -3.825  3.381   -2.466  1.00 0.00 ? 92  VAL B HG11 5  
ATOM 9838  H HG12 . VAL B 2 94  ? -4.561  3.094   -0.889  1.00 0.00 ? 92  VAL B HG12 5  
ATOM 9839  H HG13 . VAL B 2 94  ? -3.382  4.389   -1.089  1.00 0.00 ? 92  VAL B HG13 5  
ATOM 9840  H HG21 . VAL B 2 94  ? -3.952  6.407   -2.343  1.00 0.00 ? 92  VAL B HG21 5  
ATOM 9841  H HG22 . VAL B 2 94  ? -5.566  6.619   -3.022  1.00 0.00 ? 92  VAL B HG22 5  
ATOM 9842  H HG23 . VAL B 2 94  ? -4.446  5.469   -3.753  1.00 0.00 ? 92  VAL B HG23 5  
ATOM 9843  N N    . LYS B 2 95  ? -7.924  3.629   -0.696  1.00 0.00 ? 93  LYS B N    5  
ATOM 9844  C CA   . LYS B 2 95  ? -8.640  2.853   0.309   1.00 0.00 ? 93  LYS B CA   5  
ATOM 9845  C C    . LYS B 2 95  ? -9.511  1.812   -0.373  1.00 0.00 ? 93  LYS B C    5  
ATOM 9846  O O    . LYS B 2 95  ? -9.438  0.623   -0.078  1.00 0.00 ? 93  LYS B O    5  
ATOM 9847  C CB   . LYS B 2 95  ? -9.535  3.789   1.132   1.00 0.00 ? 93  LYS B CB   5  
ATOM 9848  C CG   . LYS B 2 95  ? -10.608 3.077   1.950   1.00 0.00 ? 93  LYS B CG   5  
ATOM 9849  C CD   . LYS B 2 95  ? -11.805 3.983   2.219   1.00 0.00 ? 93  LYS B CD   5  
ATOM 9850  C CE   . LYS B 2 95  ? -12.939 3.744   1.224   1.00 0.00 ? 93  LYS B CE   5  
ATOM 9851  N NZ   . LYS B 2 95  ? -12.995 4.790   0.166   1.00 0.00 ? 93  LYS B NZ   5  
ATOM 9852  H H    . LYS B 2 95  ? -8.057  4.603   -0.718  1.00 0.00 ? 93  LYS B H    5  
ATOM 9853  H HA   . LYS B 2 95  ? -7.925  2.368   0.954   1.00 0.00 ? 93  LYS B HA   5  
ATOM 9854  H HB2  . LYS B 2 95  ? -8.916  4.360   1.804   1.00 0.00 ? 93  LYS B HB2  5  
ATOM 9855  H HB3  . LYS B 2 95  ? -10.029 4.470   0.454   1.00 0.00 ? 93  LYS B HB3  5  
ATOM 9856  H HG2  . LYS B 2 95  ? -10.944 2.209   1.403   1.00 0.00 ? 93  LYS B HG2  5  
ATOM 9857  H HG3  . LYS B 2 95  ? -10.181 2.769   2.893   1.00 0.00 ? 93  LYS B HG3  5  
ATOM 9858  H HD2  . LYS B 2 95  ? -12.173 3.790   3.216   1.00 0.00 ? 93  LYS B HD2  5  
ATOM 9859  H HD3  . LYS B 2 95  ? -11.487 5.013   2.146   1.00 0.00 ? 93  LYS B HD3  5  
ATOM 9860  H HE2  . LYS B 2 95  ? -12.789 2.782   0.756   1.00 0.00 ? 93  LYS B HE2  5  
ATOM 9861  H HE3  . LYS B 2 95  ? -13.875 3.738   1.762   1.00 0.00 ? 93  LYS B HE3  5  
ATOM 9862  H HZ1  . LYS B 2 95  ? -13.669 4.511   -0.586  1.00 0.00 ? 93  LYS B HZ1  5  
ATOM 9863  H HZ2  . LYS B 2 95  ? -12.060 4.912   -0.269  1.00 0.00 ? 93  LYS B HZ2  5  
ATOM 9864  H HZ3  . LYS B 2 95  ? -13.302 5.707   0.570   1.00 0.00 ? 93  LYS B HZ3  5  
ATOM 9865  N N    . ASP B 2 96  ? -10.329 2.299   -1.291  1.00 0.00 ? 94  ASP B N    5  
ATOM 9866  C CA   . ASP B 2 96  ? -11.251 1.476   -2.053  1.00 0.00 ? 94  ASP B CA   5  
ATOM 9867  C C    . ASP B 2 96  ? -10.537 0.382   -2.818  1.00 0.00 ? 94  ASP B C    5  
ATOM 9868  O O    . ASP B 2 96  ? -10.847 -0.789  -2.654  1.00 0.00 ? 94  ASP B O    5  
ATOM 9869  C CB   . ASP B 2 96  ? -12.060 2.359   -3.002  1.00 0.00 ? 94  ASP B CB   5  
ATOM 9870  C CG   . ASP B 2 96  ? -13.352 2.826   -2.369  1.00 0.00 ? 94  ASP B CG   5  
ATOM 9871  O OD1  . ASP B 2 96  ? -14.140 1.965   -1.933  1.00 0.00 ? 94  ASP B OD1  5  
ATOM 9872  O OD2  . ASP B 2 96  ? -13.566 4.052   -2.270  1.00 0.00 ? 94  ASP B OD2  5  
ATOM 9873  H H    . ASP B 2 96  ? -10.310 3.265   -1.473  1.00 0.00 ? 94  ASP B H    5  
ATOM 9874  H HA   . ASP B 2 96  ? -11.929 1.015   -1.352  1.00 0.00 ? 94  ASP B HA   5  
ATOM 9875  H HB2  . ASP B 2 96  ? -11.474 3.228   -3.247  1.00 0.00 ? 94  ASP B HB2  5  
ATOM 9876  H HB3  . ASP B 2 96  ? -12.280 1.826   -3.905  1.00 0.00 ? 94  ASP B HB3  5  
ATOM 9877  N N    . LEU B 2 97  ? -9.565  0.762   -3.623  1.00 0.00 ? 95  LEU B N    5  
ATOM 9878  C CA   . LEU B 2 97  ? -8.819  -0.196  -4.422  1.00 0.00 ? 95  LEU B CA   5  
ATOM 9879  C C    . LEU B 2 97  ? -8.103  -1.211  -3.537  1.00 0.00 ? 95  LEU B C    5  
ATOM 9880  O O    . LEU B 2 97  ? -8.082  -2.389  -3.855  1.00 0.00 ? 95  LEU B O    5  
ATOM 9881  C CB   . LEU B 2 97  ? -7.816  0.535   -5.320  1.00 0.00 ? 95  LEU B CB   5  
ATOM 9882  C CG   . LEU B 2 97  ? -7.375  -0.227  -6.569  1.00 0.00 ? 95  LEU B CG   5  
ATOM 9883  C CD1  . LEU B 2 97  ? -8.567  -0.529  -7.464  1.00 0.00 ? 95  LEU B CD1  5  
ATOM 9884  C CD2  . LEU B 2 97  ? -6.323  0.564   -7.330  1.00 0.00 ? 95  LEU B CD2  5  
ATOM 9885  H H    . LEU B 2 97  ? -9.338  1.717   -3.682  1.00 0.00 ? 95  LEU B H    5  
ATOM 9886  H HA   . LEU B 2 97  ? -9.531  -0.734  -5.044  1.00 0.00 ? 95  LEU B HA   5  
ATOM 9887  H HB2  . LEU B 2 97  ? -8.262  1.468   -5.633  1.00 0.00 ? 95  LEU B HB2  5  
ATOM 9888  H HB3  . LEU B 2 97  ? -6.937  0.757   -4.733  1.00 0.00 ? 95  LEU B HB3  5  
ATOM 9889  H HG   . LEU B 2 97  ? -6.934  -1.167  -6.271  1.00 0.00 ? 95  LEU B HG   5  
ATOM 9890  H HD11 . LEU B 2 97  ? -8.228  -1.024  -8.363  1.00 0.00 ? 95  LEU B HD11 5  
ATOM 9891  H HD12 . LEU B 2 97  ? -9.064  0.394   -7.727  1.00 0.00 ? 95  LEU B HD12 5  
ATOM 9892  H HD13 . LEU B 2 97  ? -9.258  -1.173  -6.939  1.00 0.00 ? 95  LEU B HD13 5  
ATOM 9893  H HD21 . LEU B 2 97  ? -6.045  0.027   -8.225  1.00 0.00 ? 95  LEU B HD21 5  
ATOM 9894  H HD22 . LEU B 2 97  ? -5.451  0.701   -6.707  1.00 0.00 ? 95  LEU B HD22 5  
ATOM 9895  H HD23 . LEU B 2 97  ? -6.726  1.530   -7.602  1.00 0.00 ? 95  LEU B HD23 5  
ATOM 9896  N N    . LEU B 2 98  ? -7.535  -0.765  -2.426  1.00 0.00 ? 96  LEU B N    5  
ATOM 9897  C CA   . LEU B 2 98  ? -6.841  -1.676  -1.516  1.00 0.00 ? 96  LEU B CA   5  
ATOM 9898  C C    . LEU B 2 98  ? -7.833  -2.596  -0.813  1.00 0.00 ? 96  LEU B C    5  
ATOM 9899  O O    . LEU B 2 98  ? -7.613  -3.794  -0.745  1.00 0.00 ? 96  LEU B O    5  
ATOM 9900  C CB   . LEU B 2 98  ? -6.035  -0.899  -0.475  1.00 0.00 ? 96  LEU B CB   5  
ATOM 9901  C CG   . LEU B 2 98  ? -4.681  -0.377  -0.947  1.00 0.00 ? 96  LEU B CG   5  
ATOM 9902  C CD1  . LEU B 2 98  ? -4.178  0.708   -0.011  1.00 0.00 ? 96  LEU B CD1  5  
ATOM 9903  C CD2  . LEU B 2 98  ? -3.676  -1.510  -1.025  1.00 0.00 ? 96  LEU B CD2  5  
ATOM 9904  H H    . LEU B 2 98  ? -7.575  0.194   -2.211  1.00 0.00 ? 96  LEU B H    5  
ATOM 9905  H HA   . LEU B 2 98  ? -6.162  -2.294  -2.113  1.00 0.00 ? 96  LEU B HA   5  
ATOM 9906  H HB2  . LEU B 2 98  ? -6.629  -0.056  -0.152  1.00 0.00 ? 96  LEU B HB2  5  
ATOM 9907  H HB3  . LEU B 2 98  ? -5.870  -1.545  0.374   1.00 0.00 ? 96  LEU B HB3  5  
ATOM 9908  H HG   . LEU B 2 98  ? -4.788  0.049   -1.933  1.00 0.00 ? 96  LEU B HG   5  
ATOM 9909  H HD11 . LEU B 2 98  ? -4.068  0.305   0.985   1.00 0.00 ? 96  LEU B HD11 5  
ATOM 9910  H HD12 . LEU B 2 98  ? -4.886  1.524   0.007   1.00 0.00 ? 96  LEU B HD12 5  
ATOM 9911  H HD13 . LEU B 2 98  ? -3.222  1.069   -0.360  1.00 0.00 ? 96  LEU B HD13 5  
ATOM 9912  H HD21 . LEU B 2 98  ? -3.558  -1.955  -0.047  1.00 0.00 ? 96  LEU B HD21 5  
ATOM 9913  H HD22 . LEU B 2 98  ? -2.725  -1.126  -1.363  1.00 0.00 ? 96  LEU B HD22 5  
ATOM 9914  H HD23 . LEU B 2 98  ? -4.029  -2.259  -1.721  1.00 0.00 ? 96  LEU B HD23 5  
ATOM 9915  N N    . GLN B 2 99  ? -8.935  -2.043  -0.305  1.00 0.00 ? 97  GLN B N    5  
ATOM 9916  C CA   . GLN B 2 99  ? -9.945  -2.861  0.373   1.00 0.00 ? 97  GLN B CA   5  
ATOM 9917  C C    . GLN B 2 99  ? -10.577 -3.824  -0.627  1.00 0.00 ? 97  GLN B C    5  
ATOM 9918  O O    . GLN B 2 99  ? -11.203 -4.816  -0.262  1.00 0.00 ? 97  GLN B O    5  
ATOM 9919  C CB   . GLN B 2 99  ? -11.017 -1.988  1.046   1.00 0.00 ? 97  GLN B CB   5  
ATOM 9920  C CG   . GLN B 2 99  ? -12.084 -1.450  0.102   1.00 0.00 ? 97  GLN B CG   5  
ATOM 9921  C CD   . GLN B 2 99  ? -13.208 -0.747  0.837   1.00 0.00 ? 97  GLN B CD   5  
ATOM 9922  O OE1  . GLN B 2 99  ? -13.494 -1.052  1.992   1.00 0.00 ? 97  GLN B OE1  5  
ATOM 9923  N NE2  . GLN B 2 99  ? -13.861 0.197   0.177   1.00 0.00 ? 97  GLN B NE2  5  
ATOM 9924  H H    . GLN B 2 99  ? -9.072  -1.071  -0.384  1.00 0.00 ? 97  GLN B H    5  
ATOM 9925  H HA   . GLN B 2 99  ? -9.436  -3.441  1.132   1.00 0.00 ? 97  GLN B HA   5  
ATOM 9926  H HB2  . GLN B 2 99  ? -11.510 -2.574  1.807   1.00 0.00 ? 97  GLN B HB2  5  
ATOM 9927  H HB3  . GLN B 2 99  ? -10.529 -1.146  1.518   1.00 0.00 ? 97  GLN B HB3  5  
ATOM 9928  H HG2  . GLN B 2 99  ? -11.624 -0.748  -0.578  1.00 0.00 ? 97  GLN B HG2  5  
ATOM 9929  H HG3  . GLN B 2 99  ? -12.498 -2.274  -0.459  1.00 0.00 ? 97  GLN B HG3  5  
ATOM 9930  H HE21 . GLN B 2 99  ? -13.591 0.400   -0.749  1.00 0.00 ? 97  GLN B HE21 5  
ATOM 9931  H HE22 . GLN B 2 99  ? -14.595 0.653   0.633   1.00 0.00 ? 97  GLN B HE22 5  
ATOM 9932  N N    . GLN B 2 100 ? -10.403 -3.492  -1.895  1.00 0.00 ? 98  GLN B N    5  
ATOM 9933  C CA   . GLN B 2 100 ? -10.893 -4.286  -3.003  1.00 0.00 ? 98  GLN B CA   5  
ATOM 9934  C C    . GLN B 2 100 ? -9.893  -5.383  -3.339  1.00 0.00 ? 98  GLN B C    5  
ATOM 9935  O O    . GLN B 2 100 ? -10.221 -6.560  -3.435  1.00 0.00 ? 98  GLN B O    5  
ATOM 9936  C CB   . GLN B 2 100 ? -11.029 -3.381  -4.238  1.00 0.00 ? 98  GLN B CB   5  
ATOM 9937  C CG   . GLN B 2 100 ? -12.366 -2.675  -4.375  1.00 0.00 ? 98  GLN B CG   5  
ATOM 9938  C CD   . GLN B 2 100 ? -13.552 -3.603  -4.294  1.00 0.00 ? 98  GLN B CD   5  
ATOM 9939  O OE1  . GLN B 2 100 ? -13.493 -4.762  -4.712  1.00 0.00 ? 98  GLN B OE1  5  
ATOM 9940  N NE2  . GLN B 2 100 ? -14.642 -3.089  -3.755  1.00 0.00 ? 98  GLN B NE2  5  
ATOM 9941  H H    . GLN B 2 100 ? -9.930  -2.656  -2.093  1.00 0.00 ? 98  GLN B H    5  
ATOM 9942  H HA   . GLN B 2 100 ? -11.848 -4.712  -2.748  1.00 0.00 ? 98  GLN B HA   5  
ATOM 9943  H HB2  . GLN B 2 100 ? -10.267 -2.619  -4.175  1.00 0.00 ? 98  GLN B HB2  5  
ATOM 9944  H HB3  . GLN B 2 100 ? -10.850 -3.961  -5.128  1.00 0.00 ? 98  GLN B HB3  5  
ATOM 9945  H HG2  . GLN B 2 100 ? -12.451 -1.945  -3.584  1.00 0.00 ? 98  GLN B HG2  5  
ATOM 9946  H HG3  . GLN B 2 100 ? -12.390 -2.168  -5.330  1.00 0.00 ? 98  GLN B HG3  5  
ATOM 9947  H HE21 . GLN B 2 100 ? -14.607 -2.155  -3.448  1.00 0.00 ? 98  GLN B HE21 5  
ATOM 9948  H HE22 . GLN B 2 100 ? -15.432 -3.654  -3.681  1.00 0.00 ? 98  GLN B HE22 5  
ATOM 9949  N N    . LEU B 2 101 ? -8.667  -4.942  -3.497  1.00 0.00 ? 99  LEU B N    5  
ATOM 9950  C CA   . LEU B 2 101 ? -7.541  -5.764  -3.901  1.00 0.00 ? 99  LEU B CA   5  
ATOM 9951  C C    . LEU B 2 101 ? -6.927  -6.636  -2.798  1.00 0.00 ? 99  LEU B C    5  
ATOM 9952  O O    . LEU B 2 101 ? -6.681  -7.821  -3.019  1.00 0.00 ? 99  LEU B O    5  
ATOM 9953  C CB   . LEU B 2 101 ? -6.498  -4.804  -4.462  1.00 0.00 ? 99  LEU B CB   5  
ATOM 9954  C CG   . LEU B 2 101 ? -6.627  -4.544  -5.965  1.00 0.00 ? 99  LEU B CG   5  
ATOM 9955  C CD1  . LEU B 2 101 ? -5.878  -3.281  -6.357  1.00 0.00 ? 99  LEU B CD1  5  
ATOM 9956  C CD2  . LEU B 2 101 ? -6.128  -5.737  -6.762  1.00 0.00 ? 99  LEU B CD2  5  
ATOM 9957  H H    . LEU B 2 101 ? -8.503  -3.984  -3.346  1.00 0.00 ? 99  LEU B H    5  
ATOM 9958  H HA   . LEU B 2 101 ? -7.872  -6.404  -4.702  1.00 0.00 ? 99  LEU B HA   5  
ATOM 9959  H HB2  . LEU B 2 101 ? -6.618  -3.857  -3.951  1.00 0.00 ? 99  LEU B HB2  5  
ATOM 9960  H HB3  . LEU B 2 101 ? -5.514  -5.173  -4.248  1.00 0.00 ? 99  LEU B HB3  5  
ATOM 9961  H HG   . LEU B 2 101 ? -7.675  -4.397  -6.203  1.00 0.00 ? 99  LEU B HG   5  
ATOM 9962  H HD11 . LEU B 2 101 ? -6.356  -2.423  -5.902  1.00 0.00 ? 99  LEU B HD11 5  
ATOM 9963  H HD12 . LEU B 2 101 ? -5.894  -3.172  -7.431  1.00 0.00 ? 99  LEU B HD12 5  
ATOM 9964  H HD13 . LEU B 2 101 ? -4.858  -3.346  -6.015  1.00 0.00 ? 99  LEU B HD13 5  
ATOM 9965  H HD21 . LEU B 2 101 ? -5.073  -5.878  -6.577  1.00 0.00 ? 99  LEU B HD21 5  
ATOM 9966  H HD22 . LEU B 2 101 ? -6.289  -5.560  -7.815  1.00 0.00 ? 99  LEU B HD22 5  
ATOM 9967  H HD23 . LEU B 2 101 ? -6.667  -6.622  -6.459  1.00 0.00 ? 99  LEU B HD23 5  
ATOM 9968  N N    . LEU B 2 102 ? -6.701  -6.065  -1.626  1.00 0.00 ? 100 LEU B N    5  
ATOM 9969  C CA   . LEU B 2 102 ? -6.050  -6.776  -0.519  1.00 0.00 ? 100 LEU B CA   5  
ATOM 9970  C C    . LEU B 2 102 ? -6.670  -8.142  -0.169  1.00 0.00 ? 100 LEU B C    5  
ATOM 9971  O O    . LEU B 2 102 ? -5.941  -9.134  -0.086  1.00 0.00 ? 100 LEU B O    5  
ATOM 9972  C CB   . LEU B 2 102 ? -5.965  -5.883  0.722   1.00 0.00 ? 100 LEU B CB   5  
ATOM 9973  C CG   . LEU B 2 102 ? -4.934  -4.766  0.587   1.00 0.00 ? 100 LEU B CG   5  
ATOM 9974  C CD1  . LEU B 2 102 ? -4.781  -3.967  1.870   1.00 0.00 ? 100 LEU B CD1  5  
ATOM 9975  C CD2  . LEU B 2 102 ? -3.600  -5.337  0.180   1.00 0.00 ? 100 LEU B CD2  5  
ATOM 9976  H H    . LEU B 2 102 ? -6.997  -5.136  -1.486  1.00 0.00 ? 100 LEU B H    5  
ATOM 9977  H HA   . LEU B 2 102 ? -5.038  -6.951  -0.843  1.00 0.00 ? 100 LEU B HA   5  
ATOM 9978  H HB2  . LEU B 2 102 ? -6.936  -5.442  0.897   1.00 0.00 ? 100 LEU B HB2  5  
ATOM 9979  H HB3  . LEU B 2 102 ? -5.698  -6.494  1.572   1.00 0.00 ? 100 LEU B HB3  5  
ATOM 9980  H HG   . LEU B 2 102 ? -5.253  -4.102  -0.195  1.00 0.00 ? 100 LEU B HG   5  
ATOM 9981  H HD11 . LEU B 2 102 ? -4.042  -3.190  1.721   1.00 0.00 ? 100 LEU B HD11 5  
ATOM 9982  H HD12 . LEU B 2 102 ? -4.452  -4.621  2.665   1.00 0.00 ? 100 LEU B HD12 5  
ATOM 9983  H HD13 . LEU B 2 102 ? -5.724  -3.520  2.136   1.00 0.00 ? 100 LEU B HD13 5  
ATOM 9984  H HD21 . LEU B 2 102 ? -3.232  -5.987  0.960   1.00 0.00 ? 100 LEU B HD21 5  
ATOM 9985  H HD22 . LEU B 2 102 ? -2.897  -4.532  0.020   1.00 0.00 ? 100 LEU B HD22 5  
ATOM 9986  H HD23 . LEU B 2 102 ? -3.714  -5.902  -0.734  1.00 0.00 ? 100 LEU B HD23 5  
ATOM 9987  N N    . PRO B 2 103 ? -8.002  -8.236  0.043   1.00 0.00 ? 101 PRO B N    5  
ATOM 9988  C CA   . PRO B 2 103 ? -8.652  -9.509  0.406   1.00 0.00 ? 101 PRO B CA   5  
ATOM 9989  C C    . PRO B 2 103 ? -8.634  -10.566 -0.703  1.00 0.00 ? 101 PRO B C    5  
ATOM 9990  O O    . PRO B 2 103 ? -8.687  -11.761 -0.417  1.00 0.00 ? 101 PRO B O    5  
ATOM 9991  C CB   . PRO B 2 103 ? -10.092 -9.100  0.718   1.00 0.00 ? 101 PRO B CB   5  
ATOM 9992  C CG   . PRO B 2 103 ? -10.300 -7.841  -0.045  1.00 0.00 ? 101 PRO B CG   5  
ATOM 9993  C CD   . PRO B 2 103 ? -8.978  -7.132  -0.029  1.00 0.00 ? 101 PRO B CD   5  
ATOM 9994  H HA   . PRO B 2 103 ? -8.205  -9.930  1.296   1.00 0.00 ? 101 PRO B HA   5  
ATOM 9995  H HB2  . PRO B 2 103 ? -10.768 -9.876  0.393   1.00 0.00 ? 101 PRO B HB2  5  
ATOM 9996  H HB3  . PRO B 2 103 ? -10.203 -8.939  1.780   1.00 0.00 ? 101 PRO B HB3  5  
ATOM 9997  H HG2  . PRO B 2 103 ? -10.590 -8.071  -1.060  1.00 0.00 ? 101 PRO B HG2  5  
ATOM 9998  H HG3  . PRO B 2 103 ? -11.057 -7.238  0.436   1.00 0.00 ? 101 PRO B HG3  5  
ATOM 9999  H HD2  . PRO B 2 103 ? -8.846  -6.557  -0.934  1.00 0.00 ? 101 PRO B HD2  5  
ATOM 10000 H HD3  . PRO B 2 103 ? -8.902  -6.493  0.839   1.00 0.00 ? 101 PRO B HD3  5  
ATOM 10001 N N    . LYS B 2 104 ? -8.538  -10.134 -1.955  1.00 0.00 ? 102 LYS B N    5  
ATOM 10002 C CA   . LYS B 2 104 ? -8.539  -11.066 -3.088  1.00 0.00 ? 102 LYS B CA   5  
ATOM 10003 C C    . LYS B 2 104 ? -7.330  -11.988 -3.062  1.00 0.00 ? 102 LYS B C    5  
ATOM 10004 O O    . LYS B 2 104 ? -7.401  -13.138 -3.492  1.00 0.00 ? 102 LYS B O    5  
ATOM 10005 C CB   . LYS B 2 104 ? -8.560  -10.309 -4.414  1.00 0.00 ? 102 LYS B CB   5  
ATOM 10006 C CG   . LYS B 2 104 ? -9.783  -9.436  -4.596  1.00 0.00 ? 102 LYS B CG   5  
ATOM 10007 C CD   . LYS B 2 104 ? -9.984  -9.059  -6.053  1.00 0.00 ? 102 LYS B CD   5  
ATOM 10008 C CE   . LYS B 2 104 ? -10.724 -7.741  -6.186  1.00 0.00 ? 102 LYS B CE   5  
ATOM 10009 N NZ   . LYS B 2 104 ? -11.949 -7.697  -5.336  1.00 0.00 ? 102 LYS B NZ   5  
ATOM 10010 H H    . LYS B 2 104 ? -8.461  -9.173  -2.126  1.00 0.00 ? 102 LYS B H    5  
ATOM 10011 H HA   . LYS B 2 104 ? -9.433  -11.667 -3.016  1.00 0.00 ? 102 LYS B HA   5  
ATOM 10012 H HB2  . LYS B 2 104 ? -7.684  -9.681  -4.471  1.00 0.00 ? 102 LYS B HB2  5  
ATOM 10013 H HB3  . LYS B 2 104 ? -8.532  -11.024 -5.223  1.00 0.00 ? 102 LYS B HB3  5  
ATOM 10014 H HG2  . LYS B 2 104 ? -10.653 -9.973  -4.251  1.00 0.00 ? 102 LYS B HG2  5  
ATOM 10015 H HG3  . LYS B 2 104 ? -9.660  -8.534  -4.014  1.00 0.00 ? 102 LYS B HG3  5  
ATOM 10016 H HD2  . LYS B 2 104 ? -9.019  -8.969  -6.528  1.00 0.00 ? 102 LYS B HD2  5  
ATOM 10017 H HD3  . LYS B 2 104 ? -10.557 -9.835  -6.539  1.00 0.00 ? 102 LYS B HD3  5  
ATOM 10018 H HE2  . LYS B 2 104 ? -10.058 -6.944  -5.886  1.00 0.00 ? 102 LYS B HE2  5  
ATOM 10019 H HE3  . LYS B 2 104 ? -11.002 -7.604  -7.219  1.00 0.00 ? 102 LYS B HE3  5  
ATOM 10020 H HZ1  . LYS B 2 104 ? -11.685 -7.578  -4.330  1.00 0.00 ? 102 LYS B HZ1  5  
ATOM 10021 H HZ2  . LYS B 2 104 ? -12.488 -8.590  -5.423  1.00 0.00 ? 102 LYS B HZ2  5  
ATOM 10022 H HZ3  . LYS B 2 104 ? -12.561 -6.907  -5.616  1.00 0.00 ? 102 LYS B HZ3  5  
ATOM 10023 N N    . PHE B 2 105 ? -6.222  -11.486 -2.545  1.00 0.00 ? 103 PHE B N    5  
ATOM 10024 C CA   . PHE B 2 105 ? -4.996  -12.265 -2.482  1.00 0.00 ? 103 PHE B CA   5  
ATOM 10025 C C    . PHE B 2 105 ? -4.903  -13.008 -1.152  1.00 0.00 ? 103 PHE B C    5  
ATOM 10026 O O    . PHE B 2 105 ? -3.839  -13.483 -0.749  1.00 0.00 ? 103 PHE B O    5  
ATOM 10027 C CB   . PHE B 2 105 ? -3.796  -11.345 -2.715  1.00 0.00 ? 103 PHE B CB   5  
ATOM 10028 C CG   . PHE B 2 105 ? -3.976  -10.493 -3.944  1.00 0.00 ? 103 PHE B CG   5  
ATOM 10029 C CD1  . PHE B 2 105 ? -4.149  -11.082 -5.188  1.00 0.00 ? 103 PHE B CD1  5  
ATOM 10030 C CD2  . PHE B 2 105 ? -4.004  -9.112  -3.853  1.00 0.00 ? 103 PHE B CD2  5  
ATOM 10031 C CE1  . PHE B 2 105 ? -4.346  -10.308 -6.317  1.00 0.00 ? 103 PHE B CE1  5  
ATOM 10032 C CE2  . PHE B 2 105 ? -4.197  -8.334  -4.981  1.00 0.00 ? 103 PHE B CE2  5  
ATOM 10033 C CZ   . PHE B 2 105 ? -4.369  -8.933  -6.212  1.00 0.00 ? 103 PHE B CZ   5  
ATOM 10034 H H    . PHE B 2 105 ? -6.229  -10.569 -2.198  1.00 0.00 ? 103 PHE B H    5  
ATOM 10035 H HA   . PHE B 2 105 ? -5.034  -12.994 -3.277  1.00 0.00 ? 103 PHE B HA   5  
ATOM 10036 H HB2  . PHE B 2 105 ? -3.676  -10.690 -1.864  1.00 0.00 ? 103 PHE B HB2  5  
ATOM 10037 H HB3  . PHE B 2 105 ? -2.905  -11.940 -2.843  1.00 0.00 ? 103 PHE B HB3  5  
ATOM 10038 H HD1  . PHE B 2 105 ? -4.130  -12.158 -5.273  1.00 0.00 ? 103 PHE B HD1  5  
ATOM 10039 H HD2  . PHE B 2 105 ? -3.871  -8.642  -2.891  1.00 0.00 ? 103 PHE B HD2  5  
ATOM 10040 H HE1  . PHE B 2 105 ? -4.484  -10.778 -7.278  1.00 0.00 ? 103 PHE B HE1  5  
ATOM 10041 H HE2  . PHE B 2 105 ? -4.221  -7.257  -4.897  1.00 0.00 ? 103 PHE B HE2  5  
ATOM 10042 H HZ   . PHE B 2 105 ? -4.523  -8.326  -7.092  1.00 0.00 ? 103 PHE B HZ   5  
ATOM 10043 N N    . LYS B 2 106 ? -6.045  -13.109 -0.489  1.00 0.00 ? 104 LYS B N    5  
ATOM 10044 C CA   . LYS B 2 106 ? -6.166  -13.801 0.783   1.00 0.00 ? 104 LYS B CA   5  
ATOM 10045 C C    . LYS B 2 106 ? -7.019  -15.047 0.584   1.00 0.00 ? 104 LYS B C    5  
ATOM 10046 O O    . LYS B 2 106 ? -7.417  -15.356 -0.539  1.00 0.00 ? 104 LYS B O    5  
ATOM 10047 C CB   . LYS B 2 106 ? -6.788  -12.893 1.848   1.00 0.00 ? 104 LYS B CB   5  
ATOM 10048 C CG   . LYS B 2 106 ? -5.771  -12.205 2.747   1.00 0.00 ? 104 LYS B CG   5  
ATOM 10049 C CD   . LYS B 2 106 ? -4.803  -11.347 1.949   1.00 0.00 ? 104 LYS B CD   5  
ATOM 10050 C CE   . LYS B 2 106 ? -3.855  -10.584 2.856   1.00 0.00 ? 104 LYS B CE   5  
ATOM 10051 N NZ   . LYS B 2 106 ? -2.856  -9.803  2.083   1.00 0.00 ? 104 LYS B NZ   5  
ATOM 10052 H H    . LYS B 2 106 ? -6.851  -12.705 -0.880  1.00 0.00 ? 104 LYS B H    5  
ATOM 10053 H HA   . LYS B 2 106 ? -5.176  -14.099 1.099   1.00 0.00 ? 104 LYS B HA   5  
ATOM 10054 H HB2  . LYS B 2 106 ? -7.373  -12.131 1.356   1.00 0.00 ? 104 LYS B HB2  5  
ATOM 10055 H HB3  . LYS B 2 106 ? -7.441  -13.488 2.471   1.00 0.00 ? 104 LYS B HB3  5  
ATOM 10056 H HG2  . LYS B 2 106 ? -6.295  -11.576 3.451   1.00 0.00 ? 104 LYS B HG2  5  
ATOM 10057 H HG3  . LYS B 2 106 ? -5.212  -12.959 3.283   1.00 0.00 ? 104 LYS B HG3  5  
ATOM 10058 H HD2  . LYS B 2 106 ? -4.225  -11.985 1.298   1.00 0.00 ? 104 LYS B HD2  5  
ATOM 10059 H HD3  . LYS B 2 106 ? -5.368  -10.641 1.358   1.00 0.00 ? 104 LYS B HD3  5  
ATOM 10060 H HE2  . LYS B 2 106 ? -4.431  -9.908  3.469   1.00 0.00 ? 104 LYS B HE2  5  
ATOM 10061 H HE3  . LYS B 2 106 ? -3.337  -11.289 3.489   1.00 0.00 ? 104 LYS B HE3  5  
ATOM 10062 H HZ1  . LYS B 2 106 ? -1.991  -10.368 1.934   1.00 0.00 ? 104 LYS B HZ1  5  
ATOM 10063 H HZ2  . LYS B 2 106 ? -2.602  -8.933  2.600   1.00 0.00 ? 104 LYS B HZ2  5  
ATOM 10064 H HZ3  . LYS B 2 106 ? -3.246  -9.535  1.158   1.00 0.00 ? 104 LYS B HZ3  5  
ATOM 10065 N N    . ARG B 2 107 ? -7.276  -15.785 1.650   1.00 0.00 ? 105 ARG B N    5  
ATOM 10066 C CA   . ARG B 2 107 ? -8.087  -16.990 1.544   1.00 0.00 ? 105 ARG B CA   5  
ATOM 10067 C C    . ARG B 2 107 ? -9.567  -16.664 1.730   1.00 0.00 ? 105 ARG B C    5  
ATOM 10068 O O    . ARG B 2 107 ? -10.281 -17.344 2.462   1.00 0.00 ? 105 ARG B O    5  
ATOM 10069 C CB   . ARG B 2 107 ? -7.624  -18.040 2.556   1.00 0.00 ? 105 ARG B CB   5  
ATOM 10070 C CG   . ARG B 2 107 ? -6.957  -19.253 1.916   1.00 0.00 ? 105 ARG B CG   5  
ATOM 10071 C CD   . ARG B 2 107 ? -5.571  -18.925 1.366   1.00 0.00 ? 105 ARG B CD   5  
ATOM 10072 N NE   . ARG B 2 107 ? -5.624  -18.012 0.221   1.00 0.00 ? 105 ARG B NE   5  
ATOM 10073 C CZ   . ARG B 2 107 ? -4.552  -17.537 -0.415  1.00 0.00 ? 105 ARG B CZ   5  
ATOM 10074 N NH1  . ARG B 2 107 ? -3.333  -17.942 -0.069  1.00 0.00 ? 105 ARG B NH1  5  
ATOM 10075 N NH2  . ARG B 2 107 ? -4.704  -16.661 -1.402  1.00 0.00 ? 105 ARG B NH2  5  
ATOM 10076 H H    . ARG B 2 107 ? -6.931  -15.509 2.524   1.00 0.00 ? 105 ARG B H    5  
ATOM 10077 H HA   . ARG B 2 107 ? -7.950  -17.385 0.548   1.00 0.00 ? 105 ARG B HA   5  
ATOM 10078 H HB2  . ARG B 2 107 ? -6.917  -17.584 3.234   1.00 0.00 ? 105 ARG B HB2  5  
ATOM 10079 H HB3  . ARG B 2 107 ? -8.480  -18.383 3.119   1.00 0.00 ? 105 ARG B HB3  5  
ATOM 10080 H HG2  . ARG B 2 107 ? -6.860  -20.030 2.658   1.00 0.00 ? 105 ARG B HG2  5  
ATOM 10081 H HG3  . ARG B 2 107 ? -7.581  -19.605 1.106   1.00 0.00 ? 105 ARG B HG3  5  
ATOM 10082 H HD2  . ARG B 2 107 ? -4.987  -18.468 2.150   1.00 0.00 ? 105 ARG B HD2  5  
ATOM 10083 H HD3  . ARG B 2 107 ? -5.095  -19.845 1.057   1.00 0.00 ? 105 ARG B HD3  5  
ATOM 10084 H HE   . ARG B 2 107 ? -6.515  -17.716 -0.074  1.00 0.00 ? 105 ARG B HE   5  
ATOM 10085 H HH11 . ARG B 2 107 ? -3.214  -18.606 0.671   1.00 0.00 ? 105 ARG B HH11 5  
ATOM 10086 H HH12 . ARG B 2 107 ? -2.528  -17.584 -0.547  1.00 0.00 ? 105 ARG B HH12 5  
ATOM 10087 H HH21 . ARG B 2 107 ? -5.625  -16.355 -1.669  1.00 0.00 ? 105 ARG B HH21 5  
ATOM 10088 H HH22 . ARG B 2 107 ? -3.904  -16.293 -1.881  1.00 0.00 ? 105 ARG B HH22 5  
ATOM 10089 N N    . LYS B 2 108 ? -10.014 -15.618 1.045   1.00 0.00 ? 106 LYS B N    5  
ATOM 10090 C CA   . LYS B 2 108 ? -11.398 -15.179 1.108   1.00 0.00 ? 106 LYS B CA   5  
ATOM 10091 C C    . LYS B 2 108 ? -11.743 -14.395 -0.151  1.00 0.00 ? 106 LYS B C    5  
ATOM 10092 O O    . LYS B 2 108 ? -11.235 -13.297 -0.357  1.00 0.00 ? 106 LYS B O    5  
ATOM 10093 C CB   . LYS B 2 108 ? -11.629 -14.311 2.356   1.00 0.00 ? 106 LYS B CB   5  
ATOM 10094 C CG   . LYS B 2 108 ? -13.099 -14.049 2.670   1.00 0.00 ? 106 LYS B CG   5  
ATOM 10095 C CD   . LYS B 2 108 ? -13.617 -12.804 1.962   1.00 0.00 ? 106 LYS B CD   5  
ATOM 10096 C CE   . LYS B 2 108 ? -15.127 -12.676 2.084   1.00 0.00 ? 106 LYS B CE   5  
ATOM 10097 N NZ   . LYS B 2 108 ? -15.703 -11.829 1.004   1.00 0.00 ? 106 LYS B NZ   5  
ATOM 10098 H H    . LYS B 2 108 ? -9.389  -15.127 0.466   1.00 0.00 ? 106 LYS B H    5  
ATOM 10099 H HA   . LYS B 2 108 ? -12.027 -16.056 1.162   1.00 0.00 ? 106 LYS B HA   5  
ATOM 10100 H HB2  . LYS B 2 108 ? -11.186 -14.803 3.208   1.00 0.00 ? 106 LYS B HB2  5  
ATOM 10101 H HB3  . LYS B 2 108 ? -11.141 -13.358 2.209   1.00 0.00 ? 106 LYS B HB3  5  
ATOM 10102 H HG2  . LYS B 2 108 ? -13.681 -14.899 2.350   1.00 0.00 ? 106 LYS B HG2  5  
ATOM 10103 H HG3  . LYS B 2 108 ? -13.209 -13.916 3.736   1.00 0.00 ? 106 LYS B HG3  5  
ATOM 10104 H HD2  . LYS B 2 108 ? -13.157 -11.933 2.404   1.00 0.00 ? 106 LYS B HD2  5  
ATOM 10105 H HD3  . LYS B 2 108 ? -13.353 -12.861 0.916   1.00 0.00 ? 106 LYS B HD3  5  
ATOM 10106 H HE2  . LYS B 2 108 ? -15.564 -13.662 2.027   1.00 0.00 ? 106 LYS B HE2  5  
ATOM 10107 H HE3  . LYS B 2 108 ? -15.362 -12.235 3.042   1.00 0.00 ? 106 LYS B HE3  5  
ATOM 10108 H HZ1  . LYS B 2 108 ? -15.310 -10.861 1.052   1.00 0.00 ? 106 LYS B HZ1  5  
ATOM 10109 H HZ2  . LYS B 2 108 ? -16.735 -11.774 1.099   1.00 0.00 ? 106 LYS B HZ2  5  
ATOM 10110 H HZ3  . LYS B 2 108 ? -15.471 -12.235 0.069   1.00 0.00 ? 106 LYS B HZ3  5  
ATOM 10111 N N    . ALA B 2 109 ? -12.591 -14.971 -0.994  1.00 0.00 ? 107 ALA B N    5  
ATOM 10112 C CA   . ALA B 2 109 ? -13.003 -14.318 -2.233  1.00 0.00 ? 107 ALA B CA   5  
ATOM 10113 C C    . ALA B 2 109 ? -13.693 -12.992 -1.935  1.00 0.00 ? 107 ALA B C    5  
ATOM 10114 O O    . ALA B 2 109 ? -14.722 -12.956 -1.250  1.00 0.00 ? 107 ALA B O    5  
ATOM 10115 C CB   . ALA B 2 109 ? -13.922 -15.231 -3.032  1.00 0.00 ? 107 ALA B CB   5  
ATOM 10116 H H    . ALA B 2 109 ? -12.945 -15.857 -0.782  1.00 0.00 ? 107 ALA B H    5  
ATOM 10117 H HA   . ALA B 2 109 ? -12.118 -14.129 -2.822  1.00 0.00 ? 107 ALA B HA   5  
ATOM 10118 H HB1  . ALA B 2 109 ? -14.817 -15.429 -2.460  1.00 0.00 ? 107 ALA B HB1  5  
ATOM 10119 H HB2  . ALA B 2 109 ? -13.414 -16.160 -3.240  1.00 0.00 ? 107 ALA B HB2  5  
ATOM 10120 H HB3  . ALA B 2 109 ? -14.187 -14.749 -3.961  1.00 0.00 ? 107 ALA B HB3  5  
ATOM 10121 N N    . ASN B 2 110 ? -13.118 -11.909 -2.433  1.00 0.00 ? 108 ASN B N    5  
ATOM 10122 C CA   . ASN B 2 110 ? -13.663 -10.576 -2.217  1.00 0.00 ? 108 ASN B CA   5  
ATOM 10123 C C    . ASN B 2 110 ? -13.112 -9.615  -3.265  1.00 0.00 ? 108 ASN B C    5  
ATOM 10124 O O    . ASN B 2 110 ? -13.269 -9.895  -4.472  1.00 0.00 ? 108 ASN B O    5  
ATOM 10125 C CB   . ASN B 2 110 ? -13.297 -10.079 -0.814  1.00 0.00 ? 108 ASN B CB   5  
ATOM 10126 C CG   . ASN B 2 110 ? -14.228 -8.993  -0.309  1.00 0.00 ? 108 ASN B CG   5  
ATOM 10127 O OD1  . ASN B 2 110 ? -15.162 -9.265  0.449   1.00 0.00 ? 108 ASN B OD1  5  
ATOM 10128 N ND2  . ASN B 2 110 ? -13.984 -7.763  -0.726  1.00 0.00 ? 108 ASN B ND2  5  
ATOM 10129 O OXT  . ASN B 2 110 ? -12.507 -8.593  -2.882  1.00 0.00 ? 108 ASN B OXT  5  
ATOM 10130 H H    . ASN B 2 110 ? -12.303 -12.004 -2.970  1.00 0.00 ? 108 ASN B H    5  
ATOM 10131 H HA   . ASN B 2 110 ? -14.736 -10.629 -2.311  1.00 0.00 ? 108 ASN B HA   5  
ATOM 10132 H HB2  . ASN B 2 110 ? -13.340 -10.910 -0.125  1.00 0.00 ? 108 ASN B HB2  5  
ATOM 10133 H HB3  . ASN B 2 110 ? -12.291 -9.687  -0.831  1.00 0.00 ? 108 ASN B HB3  5  
ATOM 10134 H HD21 . ASN B 2 110 ? -13.223 -7.626  -1.341  1.00 0.00 ? 108 ASN B HD21 5  
ATOM 10135 H HD22 . ASN B 2 110 ? -14.562 -7.040  -0.411  1.00 0.00 ? 108 ASN B HD22 5  
ATOM 10136 N N    . TYR A 1 1   ? 1.118   9.090   16.049  1.00 0.00 ? 392 TYR A N    6  
ATOM 10137 C CA   . TYR A 1 1   ? 1.285   8.130   17.168  1.00 0.00 ? 392 TYR A CA   6  
ATOM 10138 C C    . TYR A 1 1   ? 2.722   7.624   17.226  1.00 0.00 ? 392 TYR A C    6  
ATOM 10139 O O    . TYR A 1 1   ? 3.538   7.960   16.374  1.00 0.00 ? 392 TYR A O    6  
ATOM 10140 C CB   . TYR A 1 1   ? 0.314   6.947   17.014  1.00 0.00 ? 392 TYR A CB   6  
ATOM 10141 C CG   . TYR A 1 1   ? 0.809   5.842   16.096  1.00 0.00 ? 392 TYR A CG   6  
ATOM 10142 C CD1  . TYR A 1 1   ? 1.067   4.570   16.587  1.00 0.00 ? 392 TYR A CD1  6  
ATOM 10143 C CD2  . TYR A 1 1   ? 1.017   6.072   14.744  1.00 0.00 ? 392 TYR A CD2  6  
ATOM 10144 C CE1  . TYR A 1 1   ? 1.514   3.564   15.754  1.00 0.00 ? 392 TYR A CE1  6  
ATOM 10145 C CE2  . TYR A 1 1   ? 1.465   5.075   13.905  1.00 0.00 ? 392 TYR A CE2  6  
ATOM 10146 C CZ   . TYR A 1 1   ? 1.712   3.820   14.415  1.00 0.00 ? 392 TYR A CZ   6  
ATOM 10147 O OH   . TYR A 1 1   ? 2.148   2.814   13.587  1.00 0.00 ? 392 TYR A OH   6  
ATOM 10148 H H1   . TYR A 1 1   ? 0.167   9.527   16.087  1.00 0.00 ? 392 TYR A H1   6  
ATOM 10149 H H2   . TYR A 1 1   ? 1.230   8.603   15.128  1.00 0.00 ? 392 TYR A H2   6  
ATOM 10150 H H3   . TYR A 1 1   ? 1.833   9.839   16.112  1.00 0.00 ? 392 TYR A H3   6  
ATOM 10151 H HA   . TYR A 1 1   ? 1.065   8.649   18.090  1.00 0.00 ? 392 TYR A HA   6  
ATOM 10152 H HB2  . TYR A 1 1   ? 0.137   6.512   17.985  1.00 0.00 ? 392 TYR A HB2  6  
ATOM 10153 H HB3  . TYR A 1 1   ? -0.622  7.313   16.615  1.00 0.00 ? 392 TYR A HB3  6  
ATOM 10154 H HD1  . TYR A 1 1   ? 0.913   4.371   17.637  1.00 0.00 ? 392 TYR A HD1  6  
ATOM 10155 H HD2  . TYR A 1 1   ? 0.822   7.058   14.345  1.00 0.00 ? 392 TYR A HD2  6  
ATOM 10156 H HE1  . TYR A 1 1   ? 1.714   2.584   16.154  1.00 0.00 ? 392 TYR A HE1  6  
ATOM 10157 H HE2  . TYR A 1 1   ? 1.625   5.284   12.854  1.00 0.00 ? 392 TYR A HE2  6  
ATOM 10158 H HH   . TYR A 1 1   ? 2.747   3.174   12.924  1.00 0.00 ? 392 TYR A HH   6  
ATOM 10159 N N    . VAL A 1 2   ? 3.028   6.816   18.234  1.00 0.00 ? 393 VAL A N    6  
ATOM 10160 C CA   . VAL A 1 2   ? 4.366   6.260   18.382  1.00 0.00 ? 393 VAL A CA   6  
ATOM 10161 C C    . VAL A 1 2   ? 4.423   4.876   17.747  1.00 0.00 ? 393 VAL A C    6  
ATOM 10162 O O    . VAL A 1 2   ? 3.970   3.892   18.326  1.00 0.00 ? 393 VAL A O    6  
ATOM 10163 C CB   . VAL A 1 2   ? 4.790   6.170   19.865  1.00 0.00 ? 393 VAL A CB   6  
ATOM 10164 C CG1  . VAL A 1 2   ? 6.257   5.787   19.986  1.00 0.00 ? 393 VAL A CG1  6  
ATOM 10165 C CG2  . VAL A 1 2   ? 4.517   7.485   20.582  1.00 0.00 ? 393 VAL A CG2  6  
ATOM 10166 H H    . VAL A 1 2   ? 2.339   6.579   18.887  1.00 0.00 ? 393 VAL A H    6  
ATOM 10167 H HA   . VAL A 1 2   ? 5.060   6.912   17.863  1.00 0.00 ? 393 VAL A HA   6  
ATOM 10168 H HB   . VAL A 1 2   ? 4.201   5.400   20.339  1.00 0.00 ? 393 VAL A HB   6  
ATOM 10169 H HG11 . VAL A 1 2   ? 6.423   4.836   19.500  1.00 0.00 ? 393 VAL A HG11 6  
ATOM 10170 H HG12 . VAL A 1 2   ? 6.524   5.710   21.030  1.00 0.00 ? 393 VAL A HG12 6  
ATOM 10171 H HG13 . VAL A 1 2   ? 6.867   6.545   19.514  1.00 0.00 ? 393 VAL A HG13 6  
ATOM 10172 H HG21 . VAL A 1 2   ? 4.804   7.397   21.619  1.00 0.00 ? 393 VAL A HG21 6  
ATOM 10173 H HG22 . VAL A 1 2   ? 3.464   7.718   20.518  1.00 0.00 ? 393 VAL A HG22 6  
ATOM 10174 H HG23 . VAL A 1 2   ? 5.088   8.273   20.115  1.00 0.00 ? 393 VAL A HG23 6  
ATOM 10175 N N    . GLY A 1 3   ? 4.957   4.831   16.541  1.00 0.00 ? 394 GLY A N    6  
ATOM 10176 C CA   . GLY A 1 3   ? 5.078   3.593   15.796  1.00 0.00 ? 394 GLY A CA   6  
ATOM 10177 C C    . GLY A 1 3   ? 5.506   3.897   14.385  1.00 0.00 ? 394 GLY A C    6  
ATOM 10178 O O    . GLY A 1 3   ? 6.400   3.262   13.832  1.00 0.00 ? 394 GLY A O    6  
ATOM 10179 H H    . GLY A 1 3   ? 5.283   5.665   16.136  1.00 0.00 ? 394 GLY A H    6  
ATOM 10180 H HA2  . GLY A 1 3   ? 5.814   2.958   16.269  1.00 0.00 ? 394 GLY A HA2  6  
ATOM 10181 H HA3  . GLY A 1 3   ? 4.123   3.089   15.778  1.00 0.00 ? 394 GLY A HA3  6  
ATOM 10182 N N    . GLU A 1 4   ? 4.851   4.895   13.819  1.00 0.00 ? 395 GLU A N    6  
ATOM 10183 C CA   . GLU A 1 4   ? 5.158   5.376   12.490  1.00 0.00 ? 395 GLU A CA   6  
ATOM 10184 C C    . GLU A 1 4   ? 5.616   6.811   12.640  1.00 0.00 ? 395 GLU A C    6  
ATOM 10185 O O    . GLU A 1 4   ? 5.480   7.387   13.720  1.00 0.00 ? 395 GLU A O    6  
ATOM 10186 C CB   . GLU A 1 4   ? 3.939   5.288   11.566  1.00 0.00 ? 395 GLU A CB   6  
ATOM 10187 C CG   . GLU A 1 4   ? 4.123   4.320   10.405  1.00 0.00 ? 395 GLU A CG   6  
ATOM 10188 C CD   . GLU A 1 4   ? 4.951   4.901   9.272   1.00 0.00 ? 395 GLU A CD   6  
ATOM 10189 O OE1  . GLU A 1 4   ? 4.546   4.763   8.096   1.00 0.00 ? 395 GLU A OE1  6  
ATOM 10190 O OE2  . GLU A 1 4   ? 6.017   5.490   9.541   1.00 0.00 ? 395 GLU A OE2  6  
ATOM 10191 H H    . GLU A 1 4   ? 4.139   5.338   14.322  1.00 0.00 ? 395 GLU A H    6  
ATOM 10192 H HA   . GLU A 1 4   ? 5.967   4.781   12.090  1.00 0.00 ? 395 GLU A HA   6  
ATOM 10193 H HB2  . GLU A 1 4   ? 3.086   4.966   12.143  1.00 0.00 ? 395 GLU A HB2  6  
ATOM 10194 H HB3  . GLU A 1 4   ? 3.739   6.268   11.161  1.00 0.00 ? 395 GLU A HB3  6  
ATOM 10195 H HG2  . GLU A 1 4   ? 4.617   3.433   10.770  1.00 0.00 ? 395 GLU A HG2  6  
ATOM 10196 H HG3  . GLU A 1 4   ? 3.149   4.054   10.019  1.00 0.00 ? 395 GLU A HG3  6  
ATOM 10197 N N    . ASP A 1 5   ? 6.152   7.388   11.589  1.00 0.00 ? 396 ASP A N    6  
ATOM 10198 C CA   . ASP A 1 5   ? 6.639   8.755   11.666  1.00 0.00 ? 396 ASP A CA   6  
ATOM 10199 C C    . ASP A 1 5   ? 6.221   9.560   10.445  1.00 0.00 ? 396 ASP A C    6  
ATOM 10200 O O    . ASP A 1 5   ? 6.966   10.396  9.964   1.00 0.00 ? 396 ASP A O    6  
ATOM 10201 C CB   . ASP A 1 5   ? 8.163   8.795   11.846  1.00 0.00 ? 396 ASP A CB   6  
ATOM 10202 C CG   . ASP A 1 5   ? 8.708   10.200  12.070  1.00 0.00 ? 396 ASP A CG   6  
ATOM 10203 O OD1  . ASP A 1 5   ? 8.192   10.922  12.948  1.00 0.00 ? 396 ASP A OD1  6  
ATOM 10204 O OD2  . ASP A 1 5   ? 9.647   10.601  11.343  1.00 0.00 ? 396 ASP A OD2  6  
ATOM 10205 H H    . ASP A 1 5   ? 6.224   6.887   10.742  1.00 0.00 ? 396 ASP A H    6  
ATOM 10206 H HA   . ASP A 1 5   ? 6.175   9.193   12.539  1.00 0.00 ? 396 ASP A HA   6  
ATOM 10207 H HB2  . ASP A 1 5   ? 8.431   8.195   12.698  1.00 0.00 ? 396 ASP A HB2  6  
ATOM 10208 H HB3  . ASP A 1 5   ? 8.629   8.390   10.962  1.00 0.00 ? 396 ASP A HB3  6  
ATOM 10209 N N    . ASP A 1 6   ? 5.070   9.252   9.878   1.00 0.00 ? 397 ASP A N    6  
ATOM 10210 C CA   . ASP A 1 6   ? 4.610   10.000  8.713   1.00 0.00 ? 397 ASP A CA   6  
ATOM 10211 C C    . ASP A 1 6   ? 4.441   11.478  9.056   1.00 0.00 ? 397 ASP A C    6  
ATOM 10212 O O    . ASP A 1 6   ? 4.833   12.341  8.275   1.00 0.00 ? 397 ASP A O    6  
ATOM 10213 C CB   . ASP A 1 6   ? 3.299   9.440   8.170   1.00 0.00 ? 397 ASP A CB   6  
ATOM 10214 C CG   . ASP A 1 6   ? 2.787   10.241  6.993   1.00 0.00 ? 397 ASP A CG   6  
ATOM 10215 O OD1  . ASP A 1 6   ? 1.683   10.822  7.103   1.00 0.00 ? 397 ASP A OD1  6  
ATOM 10216 O OD2  . ASP A 1 6   ? 3.494   10.307  5.966   1.00 0.00 ? 397 ASP A OD2  6  
ATOM 10217 H H    . ASP A 1 6   ? 4.520   8.528   10.247  1.00 0.00 ? 397 ASP A H    6  
ATOM 10218 H HA   . ASP A 1 6   ? 5.373   9.918   7.954   1.00 0.00 ? 397 ASP A HA   6  
ATOM 10219 H HB2  . ASP A 1 6   ? 3.453   8.419   7.850   1.00 0.00 ? 397 ASP A HB2  6  
ATOM 10220 H HB3  . ASP A 1 6   ? 2.554   9.461   8.951   1.00 0.00 ? 397 ASP A HB3  6  
ATOM 10221 N N    . GLU A 1 7   ? 3.865   11.738  10.235  1.00 0.00 ? 398 GLU A N    6  
ATOM 10222 C CA   . GLU A 1 7   ? 3.631   13.092  10.759  1.00 0.00 ? 398 GLU A CA   6  
ATOM 10223 C C    . GLU A 1 7   ? 2.644   13.000  11.924  1.00 0.00 ? 398 GLU A C    6  
ATOM 10224 O O    . GLU A 1 7   ? 3.043   12.943  13.086  1.00 0.00 ? 398 GLU A O    6  
ATOM 10225 C CB   . GLU A 1 7   ? 3.093   14.040  9.678   1.00 0.00 ? 398 GLU A CB   6  
ATOM 10226 C CG   . GLU A 1 7   ? 4.053   15.159  9.292   1.00 0.00 ? 398 GLU A CG   6  
ATOM 10227 C CD   . GLU A 1 7   ? 4.200   15.313  7.784   1.00 0.00 ? 398 GLU A CD   6  
ATOM 10228 O OE1  . GLU A 1 7   ? 3.234   15.008  7.048   1.00 0.00 ? 398 GLU A OE1  6  
ATOM 10229 O OE2  . GLU A 1 7   ? 5.280   15.741  7.329   1.00 0.00 ? 398 GLU A OE2  6  
ATOM 10230 H H    . GLU A 1 7   ? 3.580   10.973  10.785  1.00 0.00 ? 398 GLU A H    6  
ATOM 10231 H HA   . GLU A 1 7   ? 4.574   13.471  11.132  1.00 0.00 ? 398 GLU A HA   6  
ATOM 10232 H HB2  . GLU A 1 7   ? 2.882   13.462  8.790   1.00 0.00 ? 398 GLU A HB2  6  
ATOM 10233 H HB3  . GLU A 1 7   ? 2.179   14.486  10.032  1.00 0.00 ? 398 GLU A HB3  6  
ATOM 10234 H HG2  . GLU A 1 7   ? 3.685   16.088  9.697   1.00 0.00 ? 398 GLU A HG2  6  
ATOM 10235 H HG3  . GLU A 1 7   ? 5.024   14.943  9.713   1.00 0.00 ? 398 GLU A HG3  6  
ATOM 10236 N N    . GLU A 1 8   ? 1.358   12.984  11.601  1.00 0.00 ? 399 GLU A N    6  
ATOM 10237 C CA   . GLU A 1 8   ? 0.308   12.835  12.598  1.00 0.00 ? 399 GLU A CA   6  
ATOM 10238 C C    . GLU A 1 8   ? -0.565  11.670  12.177  1.00 0.00 ? 399 GLU A C    6  
ATOM 10239 O O    . GLU A 1 8   ? -1.282  11.741  11.190  1.00 0.00 ? 399 GLU A O    6  
ATOM 10240 C CB   . GLU A 1 8   ? -0.518  14.117  12.786  1.00 0.00 ? 399 GLU A CB   6  
ATOM 10241 C CG   . GLU A 1 8   ? -1.003  14.774  11.503  1.00 0.00 ? 399 GLU A CG   6  
ATOM 10242 C CD   . GLU A 1 8   ? -2.146  15.743  11.756  1.00 0.00 ? 399 GLU A CD   6  
ATOM 10243 O OE1  . GLU A 1 8   ? -2.412  16.601  10.888  1.00 0.00 ? 399 GLU A OE1  6  
ATOM 10244 O OE2  . GLU A 1 8   ? -2.787  15.638  12.826  1.00 0.00 ? 399 GLU A OE2  6  
ATOM 10245 H H    . GLU A 1 8   ? 1.104   13.064  10.661  1.00 0.00 ? 399 GLU A H    6  
ATOM 10246 H HA   . GLU A 1 8   ? 0.776   12.579  13.536  1.00 0.00 ? 399 GLU A HA   6  
ATOM 10247 H HB2  . GLU A 1 8   ? -1.386  13.876  13.380  1.00 0.00 ? 399 GLU A HB2  6  
ATOM 10248 H HB3  . GLU A 1 8   ? 0.082   14.833  13.324  1.00 0.00 ? 399 GLU A HB3  6  
ATOM 10249 H HG2  . GLU A 1 8   ? -0.182  15.315  11.055  1.00 0.00 ? 399 GLU A HG2  6  
ATOM 10250 H HG3  . GLU A 1 8   ? -1.343  14.005  10.824  1.00 0.00 ? 399 GLU A HG3  6  
ATOM 10251 N N    . ASP A 1 9   ? -0.476  10.587  12.913  1.00 0.00 ? 400 ASP A N    6  
ATOM 10252 C CA   . ASP A 1 9   ? -1.206  9.376   12.580  1.00 0.00 ? 400 ASP A CA   6  
ATOM 10253 C C    . ASP A 1 9   ? -1.811  8.745   13.816  1.00 0.00 ? 400 ASP A C    6  
ATOM 10254 O O    . ASP A 1 9   ? -1.210  7.878   14.438  1.00 0.00 ? 400 ASP A O    6  
ATOM 10255 C CB   . ASP A 1 9   ? -0.247  8.391   11.922  1.00 0.00 ? 400 ASP A CB   6  
ATOM 10256 C CG   . ASP A 1 9   ? 1.205   8.673   12.277  1.00 0.00 ? 400 ASP A CG   6  
ATOM 10257 O OD1  . ASP A 1 9   ? 1.997   8.952   11.354  1.00 0.00 ? 400 ASP A OD1  6  
ATOM 10258 O OD2  . ASP A 1 9   ? 1.543   8.638   13.481  1.00 0.00 ? 400 ASP A OD2  6  
ATOM 10259 H H    . ASP A 1 9   ? 0.103   10.594  13.705  1.00 0.00 ? 400 ASP A H    6  
ATOM 10260 H HA   . ASP A 1 9   ? -1.992  9.630   11.885  1.00 0.00 ? 400 ASP A HA   6  
ATOM 10261 H HB2  . ASP A 1 9   ? -0.490  7.390   12.245  1.00 0.00 ? 400 ASP A HB2  6  
ATOM 10262 H HB3  . ASP A 1 9   ? -0.356  8.455   10.849  1.00 0.00 ? 400 ASP A HB3  6  
ATOM 10263 N N    . ASP A 1 10  ? -3.002  9.172   14.176  1.00 0.00 ? 401 ASP A N    6  
ATOM 10264 C CA   . ASP A 1 10  ? -3.640  8.641   15.379  1.00 0.00 ? 401 ASP A CA   6  
ATOM 10265 C C    . ASP A 1 10  ? -5.125  8.376   15.191  1.00 0.00 ? 401 ASP A C    6  
ATOM 10266 O O    . ASP A 1 10  ? -5.598  7.283   15.496  1.00 0.00 ? 401 ASP A O    6  
ATOM 10267 C CB   . ASP A 1 10  ? -3.417  9.590   16.567  1.00 0.00 ? 401 ASP A CB   6  
ATOM 10268 C CG   . ASP A 1 10  ? -2.374  10.657  16.273  1.00 0.00 ? 401 ASP A CG   6  
ATOM 10269 O OD1  . ASP A 1 10  ? -1.173  10.412  16.544  1.00 0.00 ? 401 ASP A OD1  6  
ATOM 10270 O OD2  . ASP A 1 10  ? -2.750  11.729  15.740  1.00 0.00 ? 401 ASP A OD2  6  
ATOM 10271 H H    . ASP A 1 10  ? -3.451  9.845   13.632  1.00 0.00 ? 401 ASP A H    6  
ATOM 10272 H HA   . ASP A 1 10  ? -3.168  7.694   15.589  1.00 0.00 ? 401 ASP A HA   6  
ATOM 10273 H HB2  . ASP A 1 10  ? -4.347  10.080  16.807  1.00 0.00 ? 401 ASP A HB2  6  
ATOM 10274 H HB3  . ASP A 1 10  ? -3.087  9.015   17.420  1.00 0.00 ? 401 ASP A HB3  6  
ATOM 10275 N N    . ASP A 1 11  ? -5.859  9.357   14.678  1.00 0.00 ? 402 ASP A N    6  
ATOM 10276 C CA   . ASP A 1 11  ? -7.301  9.204   14.447  1.00 0.00 ? 402 ASP A CA   6  
ATOM 10277 C C    . ASP A 1 11  ? -7.550  8.296   13.250  1.00 0.00 ? 402 ASP A C    6  
ATOM 10278 O O    . ASP A 1 11  ? -8.661  8.212   12.725  1.00 0.00 ? 402 ASP A O    6  
ATOM 10279 C CB   . ASP A 1 11  ? -7.959  10.566  14.218  1.00 0.00 ? 402 ASP A CB   6  
ATOM 10280 C CG   . ASP A 1 11  ? -7.081  11.492  13.414  1.00 0.00 ? 402 ASP A CG   6  
ATOM 10281 O OD1  . ASP A 1 11  ? -6.849  11.208  12.222  1.00 0.00 ? 402 ASP A OD1  6  
ATOM 10282 O OD2  . ASP A 1 11  ? -6.586  12.486  13.989  1.00 0.00 ? 402 ASP A OD2  6  
ATOM 10283 H H    . ASP A 1 11  ? -5.432  10.206  14.449  1.00 0.00 ? 402 ASP A H    6  
ATOM 10284 H HA   . ASP A 1 11  ? -7.729  8.749   15.326  1.00 0.00 ? 402 ASP A HA   6  
ATOM 10285 H HB2  . ASP A 1 11  ? -8.887  10.425  13.684  1.00 0.00 ? 402 ASP A HB2  6  
ATOM 10286 H HB3  . ASP A 1 11  ? -8.163  11.027  15.173  1.00 0.00 ? 402 ASP A HB3  6  
ATOM 10287 N N    . PHE A 1 12  ? -6.492  7.613   12.843  1.00 0.00 ? 403 PHE A N    6  
ATOM 10288 C CA   . PHE A 1 12  ? -6.515  6.687   11.747  1.00 0.00 ? 403 PHE A CA   6  
ATOM 10289 C C    . PHE A 1 12  ? -7.570  5.613   11.989  1.00 0.00 ? 403 PHE A C    6  
ATOM 10290 O O    . PHE A 1 12  ? -7.571  4.955   13.029  1.00 0.00 ? 403 PHE A O    6  
ATOM 10291 C CB   . PHE A 1 12  ? -5.146  6.051   11.660  1.00 0.00 ? 403 PHE A CB   6  
ATOM 10292 C CG   . PHE A 1 12  ? -4.327  6.451   10.484  1.00 0.00 ? 403 PHE A CG   6  
ATOM 10293 C CD1  . PHE A 1 12  ? -3.046  6.931   10.650  1.00 0.00 ? 403 PHE A CD1  6  
ATOM 10294 C CD2  . PHE A 1 12  ? -4.824  6.294   9.212   1.00 0.00 ? 403 PHE A CD2  6  
ATOM 10295 C CE1  . PHE A 1 12  ? -2.273  7.244   9.556   1.00 0.00 ? 403 PHE A CE1  6  
ATOM 10296 C CE2  . PHE A 1 12  ? -4.062  6.612   8.115   1.00 0.00 ? 403 PHE A CE2  6  
ATOM 10297 C CZ   . PHE A 1 12  ? -2.781  7.085   8.288   1.00 0.00 ? 403 PHE A CZ   6  
ATOM 10298 H H    . PHE A 1 12  ? -5.655  7.722   13.332  1.00 0.00 ? 403 PHE A H    6  
ATOM 10299 H HA   . PHE A 1 12  ? -6.727  7.215   10.837  1.00 0.00 ? 403 PHE A HA   6  
ATOM 10300 H HB2  . PHE A 1 12  ? -4.585  6.294   12.547  1.00 0.00 ? 403 PHE A HB2  6  
ATOM 10301 H HB3  . PHE A 1 12  ? -5.277  4.995   11.610  1.00 0.00 ? 403 PHE A HB3  6  
ATOM 10302 H HD1  . PHE A 1 12  ? -2.647  7.056   11.650  1.00 0.00 ? 403 PHE A HD1  6  
ATOM 10303 H HD2  . PHE A 1 12  ? -5.827  5.923   9.081   1.00 0.00 ? 403 PHE A HD2  6  
ATOM 10304 H HE1  . PHE A 1 12  ? -1.269  7.616   9.693   1.00 0.00 ? 403 PHE A HE1  6  
ATOM 10305 H HE2  . PHE A 1 12  ? -4.464  6.483   7.121   1.00 0.00 ? 403 PHE A HE2  6  
ATOM 10306 H HZ   . PHE A 1 12  ? -2.176  7.318   7.434   1.00 0.00 ? 403 PHE A HZ   6  
ATOM 10307 N N    . ASN A 1 13  ? -8.443  5.422   11.022  1.00 0.00 ? 404 ASN A N    6  
ATOM 10308 C CA   . ASN A 1 13  ? -9.517  4.446   11.148  1.00 0.00 ? 404 ASN A CA   6  
ATOM 10309 C C    . ASN A 1 13  ? -9.168  3.165   10.428  1.00 0.00 ? 404 ASN A C    6  
ATOM 10310 O O    . ASN A 1 13  ? -8.739  3.188   9.275   1.00 0.00 ? 404 ASN A O    6  
ATOM 10311 C CB   . ASN A 1 13  ? -10.827 5.024   10.608  1.00 0.00 ? 404 ASN A CB   6  
ATOM 10312 C CG   . ASN A 1 13  ? -11.684 5.637   11.699  1.00 0.00 ? 404 ASN A CG   6  
ATOM 10313 O OD1  . ASN A 1 13  ? -12.651 5.033   12.156  1.00 0.00 ? 404 ASN A OD1  6  
ATOM 10314 N ND2  . ASN A 1 13  ? -11.326 6.836   12.136  1.00 0.00 ? 404 ASN A ND2  6  
ATOM 10315 H H    . ASN A 1 13  ? -8.351  5.930   10.190  1.00 0.00 ? 404 ASN A H    6  
ATOM 10316 H HA   . ASN A 1 13  ? -9.637  4.220   12.194  1.00 0.00 ? 404 ASN A HA   6  
ATOM 10317 H HB2  . ASN A 1 13  ? -10.602 5.789   9.880   1.00 0.00 ? 404 ASN A HB2  6  
ATOM 10318 H HB3  . ASN A 1 13  ? -11.391 4.235   10.131  1.00 0.00 ? 404 ASN A HB3  6  
ATOM 10319 H HD21 . ASN A 1 13  ? -10.535 7.261   11.740  1.00 0.00 ? 404 ASN A HD21 6  
ATOM 10320 H HD22 . ASN A 1 13  ? -11.864 7.249   12.842  1.00 0.00 ? 404 ASN A HD22 6  
ATOM 10321 N N    . GLU A 1 14  ? -9.353  2.051   11.116  1.00 0.00 ? 405 GLU A N    6  
ATOM 10322 C CA   . GLU A 1 14  ? -9.038  0.753   10.556  1.00 0.00 ? 405 GLU A CA   6  
ATOM 10323 C C    . GLU A 1 14  ? -10.126 -0.265  10.852  1.00 0.00 ? 405 GLU A C    6  
ATOM 10324 O O    . GLU A 1 14  ? -10.585 -0.375  11.989  1.00 0.00 ? 405 GLU A O    6  
ATOM 10325 C CB   . GLU A 1 14  ? -7.723  0.251   11.132  1.00 0.00 ? 405 GLU A CB   6  
ATOM 10326 C CG   . GLU A 1 14  ? -7.006  -0.708  10.213  1.00 0.00 ? 405 GLU A CG   6  
ATOM 10327 C CD   . GLU A 1 14  ? -5.952  -1.517  10.932  1.00 0.00 ? 405 GLU A CD   6  
ATOM 10328 O OE1  . GLU A 1 14  ? -4.997  -0.911  11.460  1.00 0.00 ? 405 GLU A OE1  6  
ATOM 10329 O OE2  . GLU A 1 14  ? -6.074  -2.751  10.966  1.00 0.00 ? 405 GLU A OE2  6  
ATOM 10330 H H    . GLU A 1 14  ? -9.714  2.105   12.026  1.00 0.00 ? 405 GLU A H    6  
ATOM 10331 H HA   . GLU A 1 14  ? -8.935  0.862   9.488   1.00 0.00 ? 405 GLU A HA   6  
ATOM 10332 H HB2  . GLU A 1 14  ? -7.076  1.095   11.317  1.00 0.00 ? 405 GLU A HB2  6  
ATOM 10333 H HB3  . GLU A 1 14  ? -7.920  -0.255  12.066  1.00 0.00 ? 405 GLU A HB3  6  
ATOM 10334 H HG2  . GLU A 1 14  ? -7.731  -1.381  9.784   1.00 0.00 ? 405 GLU A HG2  6  
ATOM 10335 H HG3  . GLU A 1 14  ? -6.532  -0.139  9.428   1.00 0.00 ? 405 GLU A HG3  6  
ATOM 10336 N N    . ASN A 1 15  ? -10.523 -0.998  9.816   1.00 0.00 ? 406 ASN A N    6  
ATOM 10337 C CA   . ASN A 1 15  ? -11.539 -2.044  9.925   1.00 0.00 ? 406 ASN A CA   6  
ATOM 10338 C C    . ASN A 1 15  ? -11.834 -2.606  8.553   1.00 0.00 ? 406 ASN A C    6  
ATOM 10339 O O    . ASN A 1 15  ? -12.988 -2.774  8.160   1.00 0.00 ? 406 ASN A O    6  
ATOM 10340 C CB   . ASN A 1 15  ? -12.834 -1.521  10.567  1.00 0.00 ? 406 ASN A CB   6  
ATOM 10341 C CG   . ASN A 1 15  ? -13.658 -2.623  11.214  1.00 0.00 ? 406 ASN A CG   6  
ATOM 10342 O OD1  . ASN A 1 15  ? -13.547 -2.877  12.411  1.00 0.00 ? 406 ASN A OD1  6  
ATOM 10343 N ND2  . ASN A 1 15  ? -14.488 -3.289  10.426  1.00 0.00 ? 406 ASN A ND2  6  
ATOM 10344 H H    . ASN A 1 15  ? -10.120 -0.826  8.940   1.00 0.00 ? 406 ASN A H    6  
ATOM 10345 H HA   . ASN A 1 15  ? -11.128 -2.847  10.527  1.00 0.00 ? 406 ASN A HA   6  
ATOM 10346 H HB2  . ASN A 1 15  ? -12.582 -0.795  11.325  1.00 0.00 ? 406 ASN A HB2  6  
ATOM 10347 H HB3  . ASN A 1 15  ? -13.436 -1.046  9.807   1.00 0.00 ? 406 ASN A HB3  6  
ATOM 10348 H HD21 . ASN A 1 15  ? -14.523 -3.040  9.475   1.00 0.00 ? 406 ASN A HD21 6  
ATOM 10349 H HD22 . ASN A 1 15  ? -15.030 -4.000  10.822  1.00 0.00 ? 406 ASN A HD22 6  
ATOM 10350 N N    . ASP A 1 16  ? -10.773 -2.875  7.817   1.00 0.00 ? 407 ASP A N    6  
ATOM 10351 C CA   . ASP A 1 16  ? -10.900 -3.447  6.492   1.00 0.00 ? 407 ASP A CA   6  
ATOM 10352 C C    . ASP A 1 16  ? -11.190 -4.929  6.647   1.00 0.00 ? 407 ASP A C    6  
ATOM 10353 O O    . ASP A 1 16  ? -11.975 -5.515  5.905   1.00 0.00 ? 407 ASP A O    6  
ATOM 10354 C CB   . ASP A 1 16  ? -9.607  -3.239  5.698   1.00 0.00 ? 407 ASP A CB   6  
ATOM 10355 C CG   . ASP A 1 16  ? -9.846  -3.141  4.204   1.00 0.00 ? 407 ASP A CG   6  
ATOM 10356 O OD1  . ASP A 1 16  ? -10.926 -3.556  3.744   1.00 0.00 ? 407 ASP A OD1  6  
ATOM 10357 O OD2  . ASP A 1 16  ? -8.958  -2.624  3.493   1.00 0.00 ? 407 ASP A OD2  6  
ATOM 10358 H H    . ASP A 1 16  ? -9.882  -2.694  8.178   1.00 0.00 ? 407 ASP A H    6  
ATOM 10359 H HA   . ASP A 1 16  ? -11.724 -2.968  5.986   1.00 0.00 ? 407 ASP A HA   6  
ATOM 10360 H HB2  . ASP A 1 16  ? -9.135  -2.325  6.026   1.00 0.00 ? 407 ASP A HB2  6  
ATOM 10361 H HB3  . ASP A 1 16  ? -8.941  -4.069  5.883   1.00 0.00 ? 407 ASP A HB3  6  
ATOM 10362 N N    . GLU A 1 17  ? -10.578 -5.506  7.678   1.00 0.00 ? 408 GLU A N    6  
ATOM 10363 C CA   . GLU A 1 17  ? -10.718 -6.916  7.985   1.00 0.00 ? 408 GLU A CA   6  
ATOM 10364 C C    . GLU A 1 17  ? -9.929  -7.248  9.240   1.00 0.00 ? 408 GLU A C    6  
ATOM 10365 O O    . GLU A 1 17  ? -9.433  -6.357  9.929   1.00 0.00 ? 408 GLU A O    6  
ATOM 10366 C CB   . GLU A 1 17  ? -10.143 -7.749  6.845   1.00 0.00 ? 408 GLU A CB   6  
ATOM 10367 C CG   . GLU A 1 17  ? -8.656  -7.498  6.663   1.00 0.00 ? 408 GLU A CG   6  
ATOM 10368 C CD   . GLU A 1 17  ? -7.826  -8.762  6.812   1.00 0.00 ? 408 GLU A CD   6  
ATOM 10369 O OE1  . GLU A 1 17  ? -7.304  -9.010  7.926   1.00 0.00 ? 408 GLU A OE1  6  
ATOM 10370 O OE2  . GLU A 1 17  ? -7.709  -9.523  5.831   1.00 0.00 ? 408 GLU A OE2  6  
ATOM 10371 H H    . GLU A 1 17  ? -10.004 -4.959  8.255   1.00 0.00 ? 408 GLU A H    6  
ATOM 10372 H HA   . GLU A 1 17  ? -11.761 -7.150  8.125   1.00 0.00 ? 408 GLU A HA   6  
ATOM 10373 H HB2  . GLU A 1 17  ? -10.292 -8.798  7.064   1.00 0.00 ? 408 GLU A HB2  6  
ATOM 10374 H HB3  . GLU A 1 17  ? -10.651 -7.497  5.927   1.00 0.00 ? 408 GLU A HB3  6  
ATOM 10375 H HG2  . GLU A 1 17  ? -8.492  -7.075  5.686   1.00 0.00 ? 408 GLU A HG2  6  
ATOM 10376 H HG3  . GLU A 1 17  ? -8.341  -6.784  7.418   1.00 0.00 ? 408 GLU A HG3  6  
ATOM 10377 N N    . ASP A 1 18  ? -9.816  -8.540  9.496   1.00 0.00 ? 409 ASP A N    6  
ATOM 10378 C CA   . ASP A 1 18  ? -9.045  -9.074  10.602  1.00 0.00 ? 409 ASP A CA   6  
ATOM 10379 C C    . ASP A 1 18  ? -9.052  -10.585 10.498  1.00 0.00 ? 409 ASP A C    6  
ATOM 10380 O O    . ASP A 1 18  ? -9.509  -11.298 11.389  1.00 0.00 ? 409 ASP A O    6  
ATOM 10381 C CB   . ASP A 1 18  ? -9.542  -8.621  11.970  1.00 0.00 ? 409 ASP A CB   6  
ATOM 10382 C CG   . ASP A 1 18  ? -8.511  -8.910  13.046  1.00 0.00 ? 409 ASP A CG   6  
ATOM 10383 O OD1  . ASP A 1 18  ? -8.881  -8.952  14.236  1.00 0.00 ? 409 ASP A OD1  6  
ATOM 10384 O OD2  . ASP A 1 18  ? -7.324  -9.099  12.685  1.00 0.00 ? 409 ASP A OD2  6  
ATOM 10385 H H    . ASP A 1 18  ? -10.270 -9.173  8.903   1.00 0.00 ? 409 ASP A H    6  
ATOM 10386 H HA   . ASP A 1 18  ? -8.026  -8.735  10.472  1.00 0.00 ? 409 ASP A HA   6  
ATOM 10387 H HB2  . ASP A 1 18  ? -9.726  -7.557  11.946  1.00 0.00 ? 409 ASP A HB2  6  
ATOM 10388 H HB3  . ASP A 1 18  ? -10.452 -9.144  12.213  1.00 0.00 ? 409 ASP A HB3  6  
ATOM 10389 N N    . ASP A 1 19  ? -8.568  -11.053 9.362   1.00 0.00 ? 410 ASP A N    6  
ATOM 10390 C CA   . ASP A 1 19  ? -8.496  -12.472 9.078   1.00 0.00 ? 410 ASP A CA   6  
ATOM 10391 C C    . ASP A 1 19  ? -7.042  -12.914 9.115   1.00 0.00 ? 410 ASP A C    6  
ATOM 10392 O O    . ASP A 1 19  ? -6.229  -12.352 8.342   1.00 0.00 ? 410 ASP A O    6  
ATOM 10393 C CB   . ASP A 1 19  ? -9.130  -12.768 7.712   1.00 0.00 ? 410 ASP A CB   6  
ATOM 10394 C CG   . ASP A 1 19  ? -8.746  -14.125 7.148   1.00 0.00 ? 410 ASP A CG   6  
ATOM 10395 O OD1  . ASP A 1 19  ? -9.185  -15.151 7.701   1.00 0.00 ? 410 ASP A OD1  6  
ATOM 10396 O OD2  . ASP A 1 19  ? -8.025  -14.154 6.124   1.00 0.00 ? 410 ASP A OD2  6  
ATOM 10397 O OXT  . ASP A 1 19  ? -6.703  -13.775 9.946   1.00 0.00 ? 410 ASP A OXT  6  
ATOM 10398 H H    . ASP A 1 19  ? -8.226  -10.417 8.692   1.00 0.00 ? 410 ASP A H    6  
ATOM 10399 H HA   . ASP A 1 19  ? -9.044  -12.993 9.846   1.00 0.00 ? 410 ASP A HA   6  
ATOM 10400 H HB2  . ASP A 1 19  ? -10.205 -12.737 7.811   1.00 0.00 ? 410 ASP A HB2  6  
ATOM 10401 H HB3  . ASP A 1 19  ? -8.820  -12.008 7.010   1.00 0.00 ? 410 ASP A HB3  6  
ATOM 10402 N N    . MET B 2 3   ? -2.115  -7.770  -13.465 1.00 0.00 ? 1   MET B N    6  
ATOM 10403 C CA   . MET B 2 3   ? -2.660  -9.123  -13.211 1.00 0.00 ? 1   MET B CA   6  
ATOM 10404 C C    . MET B 2 3   ? -3.893  -9.391  -14.071 1.00 0.00 ? 1   MET B C    6  
ATOM 10405 O O    . MET B 2 3   ? -4.386  -10.517 -14.115 1.00 0.00 ? 1   MET B O    6  
ATOM 10406 C CB   . MET B 2 3   ? -3.008  -9.310  -11.726 1.00 0.00 ? 1   MET B CB   6  
ATOM 10407 C CG   . MET B 2 3   ? -4.344  -8.703  -11.312 1.00 0.00 ? 1   MET B CG   6  
ATOM 10408 S SD   . MET B 2 3   ? -5.210  -9.700  -10.075 1.00 0.00 ? 1   MET B SD   6  
ATOM 10409 C CE   . MET B 2 3   ? -5.597  -11.163 -11.037 1.00 0.00 ? 1   MET B CE   6  
ATOM 10410 H H    . MET B 2 3   ? -2.881  -7.061  -13.474 1.00 0.00 ? 1   MET B H    6  
ATOM 10411 H HA   . MET B 2 3   ? -1.897  -9.840  -13.481 1.00 0.00 ? 1   MET B HA   6  
ATOM 10412 H HB2  . MET B 2 3   ? -3.038  -10.367 -11.508 1.00 0.00 ? 1   MET B HB2  6  
ATOM 10413 H HB3  . MET B 2 3   ? -2.231  -8.854  -11.129 1.00 0.00 ? 1   MET B HB3  6  
ATOM 10414 H HG2  . MET B 2 3   ? -4.166  -7.722  -10.899 1.00 0.00 ? 1   MET B HG2  6  
ATOM 10415 H HG3  . MET B 2 3   ? -4.971  -8.616  -12.186 1.00 0.00 ? 1   MET B HG3  6  
ATOM 10416 H HE1  . MET B 2 3   ? -4.680  -11.664 -11.316 1.00 0.00 ? 1   MET B HE1  6  
ATOM 10417 H HE2  . MET B 2 3   ? -6.136  -10.877 -11.927 1.00 0.00 ? 1   MET B HE2  6  
ATOM 10418 H HE3  . MET B 2 3   ? -6.206  -11.832 -10.446 1.00 0.00 ? 1   MET B HE3  6  
ATOM 10419 N N    . ALA B 2 4   ? -4.396  -8.363  -14.751 1.00 0.00 ? 2   ALA B N    6  
ATOM 10420 C CA   . ALA B 2 4   ? -5.572  -8.519  -15.597 1.00 0.00 ? 2   ALA B CA   6  
ATOM 10421 C C    . ALA B 2 4   ? -5.185  -9.090  -16.954 1.00 0.00 ? 2   ALA B C    6  
ATOM 10422 O O    . ALA B 2 4   ? -5.777  -10.058 -17.425 1.00 0.00 ? 2   ALA B O    6  
ATOM 10423 C CB   . ALA B 2 4   ? -6.286  -7.186  -15.760 1.00 0.00 ? 2   ALA B CB   6  
ATOM 10424 H H    . ALA B 2 4   ? -3.962  -7.478  -14.695 1.00 0.00 ? 2   ALA B H    6  
ATOM 10425 H HA   . ALA B 2 4   ? -6.247  -9.206  -15.105 1.00 0.00 ? 2   ALA B HA   6  
ATOM 10426 H HB1  . ALA B 2 4   ? -5.617  -6.474  -16.222 1.00 0.00 ? 2   ALA B HB1  6  
ATOM 10427 H HB2  . ALA B 2 4   ? -6.590  -6.819  -14.791 1.00 0.00 ? 2   ALA B HB2  6  
ATOM 10428 H HB3  . ALA B 2 4   ? -7.157  -7.319  -16.385 1.00 0.00 ? 2   ALA B HB3  6  
ATOM 10429 N N    . THR B 2 5   ? -4.195  -8.478  -17.581 1.00 0.00 ? 3   THR B N    6  
ATOM 10430 C CA   . THR B 2 5   ? -3.714  -8.927  -18.877 1.00 0.00 ? 3   THR B CA   6  
ATOM 10431 C C    . THR B 2 5   ? -2.194  -9.066  -18.860 1.00 0.00 ? 3   THR B C    6  
ATOM 10432 O O    . THR B 2 5   ? -1.621  -9.906  -19.556 1.00 0.00 ? 3   THR B O    6  
ATOM 10433 C CB   . THR B 2 5   ? -4.137  -7.950  -19.993 1.00 0.00 ? 3   THR B CB   6  
ATOM 10434 O OG1  . THR B 2 5   ? -5.508  -7.575  -19.810 1.00 0.00 ? 3   THR B OG1  6  
ATOM 10435 C CG2  . THR B 2 5   ? -3.962  -8.579  -21.369 1.00 0.00 ? 3   THR B CG2  6  
ATOM 10436 H H    . THR B 2 5   ? -3.775  -7.687  -17.161 1.00 0.00 ? 3   THR B H    6  
ATOM 10437 H HA   . THR B 2 5   ? -4.154  -9.892  -19.082 1.00 0.00 ? 3   THR B HA   6  
ATOM 10438 H HB   . THR B 2 5   ? -3.516  -7.067  -19.933 1.00 0.00 ? 3   THR B HB   6  
ATOM 10439 H HG1  . THR B 2 5   ? -5.894  -8.115  -19.114 1.00 0.00 ? 3   THR B HG1  6  
ATOM 10440 H HG21 . THR B 2 5   ? -4.291  -7.884  -22.127 1.00 0.00 ? 3   THR B HG21 6  
ATOM 10441 H HG22 . THR B 2 5   ? -4.549  -9.483  -21.429 1.00 0.00 ? 3   THR B HG22 6  
ATOM 10442 H HG23 . THR B 2 5   ? -2.920  -8.816  -21.526 1.00 0.00 ? 3   THR B HG23 6  
ATOM 10443 N N    . SER B 2 6   ? -1.545  -8.237  -18.055 1.00 0.00 ? 4   SER B N    6  
ATOM 10444 C CA   . SER B 2 6   ? -0.098  -8.256  -17.933 1.00 0.00 ? 4   SER B CA   6  
ATOM 10445 C C    . SER B 2 6   ? 0.317   -7.783  -16.540 1.00 0.00 ? 4   SER B C    6  
ATOM 10446 O O    . SER B 2 6   ? -0.443  -7.925  -15.579 1.00 0.00 ? 4   SER B O    6  
ATOM 10447 C CB   . SER B 2 6   ? 0.530   -7.370  -19.014 1.00 0.00 ? 4   SER B CB   6  
ATOM 10448 O OG   . SER B 2 6   ? 0.184   -7.829  -20.311 1.00 0.00 ? 4   SER B OG   6  
ATOM 10449 H H    . SER B 2 6   ? -2.058  -7.580  -17.524 1.00 0.00 ? 4   SER B H    6  
ATOM 10450 H HA   . SER B 2 6   ? 0.235   -9.274  -18.071 1.00 0.00 ? 4   SER B HA   6  
ATOM 10451 H HB2  . SER B 2 6   ? 0.174   -6.357  -18.898 1.00 0.00 ? 4   SER B HB2  6  
ATOM 10452 H HB3  . SER B 2 6   ? 1.605   -7.389  -18.913 1.00 0.00 ? 4   SER B HB3  6  
ATOM 10453 H HG   . SER B 2 6   ? -0.374  -8.614  -20.233 1.00 0.00 ? 4   SER B HG   6  
ATOM 10454 N N    . SER B 2 7   ? 1.516   -7.234  -16.433 1.00 0.00 ? 5   SER B N    6  
ATOM 10455 C CA   . SER B 2 7   ? 2.020   -6.739  -15.165 1.00 0.00 ? 5   SER B CA   6  
ATOM 10456 C C    . SER B 2 7   ? 2.243   -5.233  -15.247 1.00 0.00 ? 5   SER B C    6  
ATOM 10457 O O    . SER B 2 7   ? 2.158   -4.653  -16.332 1.00 0.00 ? 5   SER B O    6  
ATOM 10458 C CB   . SER B 2 7   ? 3.327   -7.449  -14.810 1.00 0.00 ? 5   SER B CB   6  
ATOM 10459 O OG   . SER B 2 7   ? 3.222   -8.849  -15.019 1.00 0.00 ? 5   SER B OG   6  
ATOM 10460 H H    . SER B 2 7   ? 2.080   -7.156  -17.228 1.00 0.00 ? 5   SER B H    6  
ATOM 10461 H HA   . SER B 2 7   ? 1.282   -6.948  -14.404 1.00 0.00 ? 5   SER B HA   6  
ATOM 10462 H HB2  . SER B 2 7   ? 4.124   -7.065  -15.431 1.00 0.00 ? 5   SER B HB2  6  
ATOM 10463 H HB3  . SER B 2 7   ? 3.562   -7.269  -13.772 1.00 0.00 ? 5   SER B HB3  6  
ATOM 10464 H HG   . SER B 2 7   ? 3.778   -9.307  -14.383 1.00 0.00 ? 5   SER B HG   6  
ATOM 10465 N N    . GLU B 2 8   ? 2.502   -4.612  -14.095 1.00 0.00 ? 6   GLU B N    6  
ATOM 10466 C CA   . GLU B 2 8   ? 2.755   -3.172  -14.002 1.00 0.00 ? 6   GLU B CA   6  
ATOM 10467 C C    . GLU B 2 8   ? 1.504   -2.384  -14.367 1.00 0.00 ? 6   GLU B C    6  
ATOM 10468 O O    . GLU B 2 8   ? 1.576   -1.228  -14.787 1.00 0.00 ? 6   GLU B O    6  
ATOM 10469 C CB   . GLU B 2 8   ? 3.933   -2.739  -14.896 1.00 0.00 ? 6   GLU B CB   6  
ATOM 10470 C CG   . GLU B 2 8   ? 5.168   -3.633  -14.805 1.00 0.00 ? 6   GLU B CG   6  
ATOM 10471 C CD   . GLU B 2 8   ? 5.463   -4.103  -13.395 1.00 0.00 ? 6   GLU B CD   6  
ATOM 10472 O OE1  . GLU B 2 8   ? 6.041   -3.329  -12.607 1.00 0.00 ? 6   GLU B OE1  6  
ATOM 10473 O OE2  . GLU B 2 8   ? 5.102   -5.253  -13.065 1.00 0.00 ? 6   GLU B OE2  6  
ATOM 10474 H H    . GLU B 2 8   ? 2.519   -5.141  -13.270 1.00 0.00 ? 6   GLU B H    6  
ATOM 10475 H HA   . GLU B 2 8   ? 3.002   -2.955  -12.974 1.00 0.00 ? 6   GLU B HA   6  
ATOM 10476 H HB2  . GLU B 2 8   ? 3.601   -2.735  -15.923 1.00 0.00 ? 6   GLU B HB2  6  
ATOM 10477 H HB3  . GLU B 2 8   ? 4.223   -1.736  -14.621 1.00 0.00 ? 6   GLU B HB3  6  
ATOM 10478 H HG2  . GLU B 2 8   ? 5.013   -4.500  -15.428 1.00 0.00 ? 6   GLU B HG2  6  
ATOM 10479 H HG3  . GLU B 2 8   ? 6.022   -3.079  -15.169 1.00 0.00 ? 6   GLU B HG3  6  
ATOM 10480 N N    . GLU B 2 9   ? 0.354   -3.017  -14.187 1.00 0.00 ? 7   GLU B N    6  
ATOM 10481 C CA   . GLU B 2 9   ? -0.918  -2.387  -14.497 1.00 0.00 ? 7   GLU B CA   6  
ATOM 10482 C C    . GLU B 2 9   ? -1.265  -1.345  -13.447 1.00 0.00 ? 7   GLU B C    6  
ATOM 10483 O O    . GLU B 2 9   ? -1.721  -1.684  -12.357 1.00 0.00 ? 7   GLU B O    6  
ATOM 10484 C CB   . GLU B 2 9   ? -2.031  -3.436  -14.559 1.00 0.00 ? 7   GLU B CB   6  
ATOM 10485 C CG   . GLU B 2 9   ? -1.937  -4.357  -15.761 1.00 0.00 ? 7   GLU B CG   6  
ATOM 10486 C CD   . GLU B 2 9   ? -2.790  -5.603  -15.612 1.00 0.00 ? 7   GLU B CD   6  
ATOM 10487 O OE1  . GLU B 2 9   ? -2.849  -6.409  -16.561 1.00 0.00 ? 7   GLU B OE1  6  
ATOM 10488 O OE2  . GLU B 2 9   ? -3.388  -5.802  -14.533 1.00 0.00 ? 7   GLU B OE2  6  
ATOM 10489 H H    . GLU B 2 9   ? 0.364   -3.929  -13.834 1.00 0.00 ? 7   GLU B H    6  
ATOM 10490 H HA   . GLU B 2 9   ? -0.831  -1.904  -15.458 1.00 0.00 ? 7   GLU B HA   6  
ATOM 10491 H HB2  . GLU B 2 9   ? -1.990  -4.040  -13.666 1.00 0.00 ? 7   GLU B HB2  6  
ATOM 10492 H HB3  . GLU B 2 9   ? -2.984  -2.928  -14.596 1.00 0.00 ? 7   GLU B HB3  6  
ATOM 10493 H HG2  . GLU B 2 9   ? -2.266  -3.817  -16.635 1.00 0.00 ? 7   GLU B HG2  6  
ATOM 10494 H HG3  . GLU B 2 9   ? -0.907  -4.655  -15.887 1.00 0.00 ? 7   GLU B HG3  6  
ATOM 10495 N N    . VAL B 2 10  ? -1.046  -0.084  -13.775 1.00 0.00 ? 8   VAL B N    6  
ATOM 10496 C CA   . VAL B 2 10  ? -1.358  0.999   -12.859 1.00 0.00 ? 8   VAL B CA   6  
ATOM 10497 C C    . VAL B 2 10  ? -2.830  1.342   -12.963 1.00 0.00 ? 8   VAL B C    6  
ATOM 10498 O O    . VAL B 2 10  ? -3.276  1.923   -13.951 1.00 0.00 ? 8   VAL B O    6  
ATOM 10499 C CB   . VAL B 2 10  ? -0.528  2.264   -13.141 1.00 0.00 ? 8   VAL B CB   6  
ATOM 10500 C CG1  . VAL B 2 10  ? -1.017  3.414   -12.276 1.00 0.00 ? 8   VAL B CG1  6  
ATOM 10501 C CG2  . VAL B 2 10  ? 0.952   2.005   -12.907 1.00 0.00 ? 8   VAL B CG2  6  
ATOM 10502 H H    . VAL B 2 10  ? -0.664  0.124   -14.653 1.00 0.00 ? 8   VAL B H    6  
ATOM 10503 H HA   . VAL B 2 10  ? -1.142  0.666   -11.851 1.00 0.00 ? 8   VAL B HA   6  
ATOM 10504 H HB   . VAL B 2 10  ? -0.667  2.538   -14.177 1.00 0.00 ? 8   VAL B HB   6  
ATOM 10505 H HG11 . VAL B 2 10  ? -1.055  3.096   -11.244 1.00 0.00 ? 8   VAL B HG11 6  
ATOM 10506 H HG12 . VAL B 2 10  ? -2.008  3.708   -12.597 1.00 0.00 ? 8   VAL B HG12 6  
ATOM 10507 H HG13 . VAL B 2 10  ? -0.344  4.251   -12.371 1.00 0.00 ? 8   VAL B HG13 6  
ATOM 10508 H HG21 . VAL B 2 10  ? 1.518   2.887   -13.169 1.00 0.00 ? 8   VAL B HG21 6  
ATOM 10509 H HG22 . VAL B 2 10  ? 1.273   1.176   -13.521 1.00 0.00 ? 8   VAL B HG22 6  
ATOM 10510 H HG23 . VAL B 2 10  ? 1.115   1.767   -11.866 1.00 0.00 ? 8   VAL B HG23 6  
ATOM 10511 N N    . LEU B 2 11  ? -3.582  0.956   -11.955 1.00 0.00 ? 9   LEU B N    6  
ATOM 10512 C CA   . LEU B 2 11  ? -5.008  1.219   -11.940 1.00 0.00 ? 9   LEU B CA   6  
ATOM 10513 C C    . LEU B 2 11  ? -5.319  2.579   -11.322 1.00 0.00 ? 9   LEU B C    6  
ATOM 10514 O O    . LEU B 2 11  ? -6.317  3.210   -11.664 1.00 0.00 ? 9   LEU B O    6  
ATOM 10515 C CB   . LEU B 2 11  ? -5.746  0.117   -11.174 1.00 0.00 ? 9   LEU B CB   6  
ATOM 10516 C CG   . LEU B 2 11  ? -5.319  -1.315  -11.507 1.00 0.00 ? 9   LEU B CG   6  
ATOM 10517 C CD1  . LEU B 2 11  ? -6.007  -2.303  -10.580 1.00 0.00 ? 9   LEU B CD1  6  
ATOM 10518 C CD2  . LEU B 2 11  ? -5.628  -1.645  -12.962 1.00 0.00 ? 9   LEU B CD2  6  
ATOM 10519 H H    . LEU B 2 11  ? -3.170  0.465   -11.209 1.00 0.00 ? 9   LEU B H    6  
ATOM 10520 H HA   . LEU B 2 11  ? -5.343  1.224   -12.962 1.00 0.00 ? 9   LEU B HA   6  
ATOM 10521 H HB2  . LEU B 2 11  ? -5.589  0.279   -10.117 1.00 0.00 ? 9   LEU B HB2  6  
ATOM 10522 H HB3  . LEU B 2 11  ? -6.801  0.210   -11.381 1.00 0.00 ? 9   LEU B HB3  6  
ATOM 10523 H HG   . LEU B 2 11  ? -4.252  -1.409  -11.362 1.00 0.00 ? 9   LEU B HG   6  
ATOM 10524 H HD11 . LEU B 2 11  ? -7.077  -2.244  -10.720 1.00 0.00 ? 9   LEU B HD11 6  
ATOM 10525 H HD12 . LEU B 2 11  ? -5.764  -2.063  -9.555  1.00 0.00 ? 9   LEU B HD12 6  
ATOM 10526 H HD13 . LEU B 2 11  ? -5.669  -3.304  -10.805 1.00 0.00 ? 9   LEU B HD13 6  
ATOM 10527 H HD21 . LEU B 2 11  ? -5.294  -2.647  -13.181 1.00 0.00 ? 9   LEU B HD21 6  
ATOM 10528 H HD22 . LEU B 2 11  ? -5.116  -0.945  -13.605 1.00 0.00 ? 9   LEU B HD22 6  
ATOM 10529 H HD23 . LEU B 2 11  ? -6.692  -1.575  -13.128 1.00 0.00 ? 9   LEU B HD23 6  
ATOM 10530 N N    . LEU B 2 12  ? -4.469  3.030   -10.412 1.00 0.00 ? 10  LEU B N    6  
ATOM 10531 C CA   . LEU B 2 12  ? -4.685  4.308   -9.753  1.00 0.00 ? 10  LEU B CA   6  
ATOM 10532 C C    . LEU B 2 12  ? -3.410  5.134   -9.666  1.00 0.00 ? 10  LEU B C    6  
ATOM 10533 O O    . LEU B 2 12  ? -2.341  4.612   -9.347  1.00 0.00 ? 10  LEU B O    6  
ATOM 10534 C CB   . LEU B 2 12  ? -5.216  4.070   -8.346  1.00 0.00 ? 10  LEU B CB   6  
ATOM 10535 C CG   . LEU B 2 12  ? -5.630  5.334   -7.588  1.00 0.00 ? 10  LEU B CG   6  
ATOM 10536 C CD1  . LEU B 2 12  ? -7.088  5.672   -7.821  1.00 0.00 ? 10  LEU B CD1  6  
ATOM 10537 C CD2  . LEU B 2 12  ? -5.364  5.178   -6.108  1.00 0.00 ? 10  LEU B CD2  6  
ATOM 10538 H H    . LEU B 2 12  ? -3.691  2.489   -10.167 1.00 0.00 ? 10  LEU B H    6  
ATOM 10539 H HA   . LEU B 2 12  ? -5.423  4.857   -10.317 1.00 0.00 ? 10  LEU B HA   6  
ATOM 10540 H HB2  . LEU B 2 12  ? -6.065  3.410   -8.420  1.00 0.00 ? 10  LEU B HB2  6  
ATOM 10541 H HB3  . LEU B 2 12  ? -4.447  3.572   -7.776  1.00 0.00 ? 10  LEU B HB3  6  
ATOM 10542 H HG   . LEU B 2 12  ? -5.039  6.162   -7.946  1.00 0.00 ? 10  LEU B HG   6  
ATOM 10543 H HD11 . LEU B 2 12  ? -7.314  6.617   -7.349  1.00 0.00 ? 10  LEU B HD11 6  
ATOM 10544 H HD12 . LEU B 2 12  ? -7.707  4.899   -7.388  1.00 0.00 ? 10  LEU B HD12 6  
ATOM 10545 H HD13 . LEU B 2 12  ? -7.279  5.741   -8.879  1.00 0.00 ? 10  LEU B HD13 6  
ATOM 10546 H HD21 . LEU B 2 12  ? -4.314  4.989   -5.948  1.00 0.00 ? 10  LEU B HD21 6  
ATOM 10547 H HD22 . LEU B 2 12  ? -5.942  4.349   -5.724  1.00 0.00 ? 10  LEU B HD22 6  
ATOM 10548 H HD23 . LEU B 2 12  ? -5.650  6.084   -5.593  1.00 0.00 ? 10  LEU B HD23 6  
ATOM 10549 N N    . ILE B 2 13  ? -3.534  6.424   -9.947  1.00 0.00 ? 11  ILE B N    6  
ATOM 10550 C CA   . ILE B 2 13  ? -2.410  7.342   -9.857  1.00 0.00 ? 11  ILE B CA   6  
ATOM 10551 C C    . ILE B 2 13  ? -2.748  8.451   -8.877  1.00 0.00 ? 11  ILE B C    6  
ATOM 10552 O O    . ILE B 2 13  ? -3.720  9.185   -9.061  1.00 0.00 ? 11  ILE B O    6  
ATOM 10553 C CB   . ILE B 2 13  ? -2.028  7.976   -11.211 1.00 0.00 ? 11  ILE B CB   6  
ATOM 10554 C CG1  . ILE B 2 13  ? -1.691  6.894   -12.239 1.00 0.00 ? 11  ILE B CG1  6  
ATOM 10555 C CG2  . ILE B 2 13  ? -0.846  8.921   -11.017 1.00 0.00 ? 11  ILE B CG2  6  
ATOM 10556 C CD1  . ILE B 2 13  ? -1.433  7.432   -13.631 1.00 0.00 ? 11  ILE B CD1  6  
ATOM 10557 H H    . ILE B 2 13  ? -4.409  6.773   -10.216 1.00 0.00 ? 11  ILE B H    6  
ATOM 10558 H HA   . ILE B 2 13  ? -1.559  6.791   -9.483  1.00 0.00 ? 11  ILE B HA   6  
ATOM 10559 H HB   . ILE B 2 13  ? -2.868  8.556   -11.564 1.00 0.00 ? 11  ILE B HB   6  
ATOM 10560 H HG12 . ILE B 2 13  ? -0.803  6.369   -11.920 1.00 0.00 ? 11  ILE B HG12 6  
ATOM 10561 H HG13 . ILE B 2 13  ? -2.514  6.196   -12.299 1.00 0.00 ? 11  ILE B HG13 6  
ATOM 10562 H HG21 . ILE B 2 13  ? -1.156  9.771   -10.426 1.00 0.00 ? 11  ILE B HG21 6  
ATOM 10563 H HG22 . ILE B 2 13  ? -0.490  9.259   -11.977 1.00 0.00 ? 11  ILE B HG22 6  
ATOM 10564 H HG23 . ILE B 2 13  ? -0.051  8.400   -10.502 1.00 0.00 ? 11  ILE B HG23 6  
ATOM 10565 H HD11 . ILE B 2 13  ? -2.317  7.938   -13.991 1.00 0.00 ? 11  ILE B HD11 6  
ATOM 10566 H HD12 . ILE B 2 13  ? -1.192  6.613   -14.293 1.00 0.00 ? 11  ILE B HD12 6  
ATOM 10567 H HD13 . ILE B 2 13  ? -0.607  8.126   -13.601 1.00 0.00 ? 11  ILE B HD13 6  
ATOM 10568 N N    . VAL B 2 14  ? -1.949  8.559   -7.837  1.00 0.00 ? 12  VAL B N    6  
ATOM 10569 C CA   . VAL B 2 14  ? -2.143  9.556   -6.810  1.00 0.00 ? 12  VAL B CA   6  
ATOM 10570 C C    . VAL B 2 14  ? -1.029  10.582  -6.885  1.00 0.00 ? 12  VAL B C    6  
ATOM 10571 O O    . VAL B 2 14  ? 0.091   10.264  -7.283  1.00 0.00 ? 12  VAL B O    6  
ATOM 10572 C CB   . VAL B 2 14  ? -2.167  8.917   -5.415  1.00 0.00 ? 12  VAL B CB   6  
ATOM 10573 C CG1  . VAL B 2 14  ? -2.765  9.865   -4.399  1.00 0.00 ? 12  VAL B CG1  6  
ATOM 10574 C CG2  . VAL B 2 14  ? -2.943  7.613   -5.445  1.00 0.00 ? 12  VAL B CG2  6  
ATOM 10575 H H    . VAL B 2 14  ? -1.178  7.949   -7.763  1.00 0.00 ? 12  VAL B H    6  
ATOM 10576 H HA   . VAL B 2 14  ? -3.088  10.045  -6.983  1.00 0.00 ? 12  VAL B HA   6  
ATOM 10577 H HB   . VAL B 2 14  ? -1.153  8.705   -5.122  1.00 0.00 ? 12  VAL B HB   6  
ATOM 10578 H HG11 . VAL B 2 14  ? -2.215  10.794  -4.404  1.00 0.00 ? 12  VAL B HG11 6  
ATOM 10579 H HG12 . VAL B 2 14  ? -2.711  9.420   -3.415  1.00 0.00 ? 12  VAL B HG12 6  
ATOM 10580 H HG13 . VAL B 2 14  ? -3.798  10.057  -4.650  1.00 0.00 ? 12  VAL B HG13 6  
ATOM 10581 H HG21 . VAL B 2 14  ? -3.974  7.813   -5.696  1.00 0.00 ? 12  VAL B HG21 6  
ATOM 10582 H HG22 . VAL B 2 14  ? -2.893  7.140   -4.476  1.00 0.00 ? 12  VAL B HG22 6  
ATOM 10583 H HG23 . VAL B 2 14  ? -2.513  6.958   -6.188  1.00 0.00 ? 12  VAL B HG23 6  
ATOM 10584 N N    . LYS B 2 15  ? -1.329  11.801  -6.501  1.00 0.00 ? 13  LYS B N    6  
ATOM 10585 C CA   . LYS B 2 15  ? -0.347  12.868  -6.561  1.00 0.00 ? 13  LYS B CA   6  
ATOM 10586 C C    . LYS B 2 15  ? -0.023  13.397  -5.184  1.00 0.00 ? 13  LYS B C    6  
ATOM 10587 O O    . LYS B 2 15  ? -0.667  13.017  -4.211  1.00 0.00 ? 13  LYS B O    6  
ATOM 10588 C CB   . LYS B 2 15  ? -0.851  13.996  -7.448  1.00 0.00 ? 13  LYS B CB   6  
ATOM 10589 C CG   . LYS B 2 15  ? -0.963  13.596  -8.901  1.00 0.00 ? 13  LYS B CG   6  
ATOM 10590 C CD   . LYS B 2 15  ? -2.244  14.118  -9.520  1.00 0.00 ? 13  LYS B CD   6  
ATOM 10591 C CE   . LYS B 2 15  ? -3.466  13.333  -9.053  1.00 0.00 ? 13  LYS B CE   6  
ATOM 10592 N NZ   . LYS B 2 15  ? -4.068  13.897  -7.811  1.00 0.00 ? 13  LYS B NZ   6  
ATOM 10593 H H    . LYS B 2 15  ? -2.229  11.982  -6.135  1.00 0.00 ? 13  LYS B H    6  
ATOM 10594 H HA   . LYS B 2 15  ? 0.552   12.460  -6.994  1.00 0.00 ? 13  LYS B HA   6  
ATOM 10595 H HB2  . LYS B 2 15  ? -1.827  14.304  -7.103  1.00 0.00 ? 13  LYS B HB2  6  
ATOM 10596 H HB3  . LYS B 2 15  ? -0.170  14.831  -7.375  1.00 0.00 ? 13  LYS B HB3  6  
ATOM 10597 H HG2  . LYS B 2 15  ? -0.122  14.002  -9.443  1.00 0.00 ? 13  LYS B HG2  6  
ATOM 10598 H HG3  . LYS B 2 15  ? -0.953  12.518  -8.969  1.00 0.00 ? 13  LYS B HG3  6  
ATOM 10599 H HD2  . LYS B 2 15  ? -2.363  15.151  -9.237  1.00 0.00 ? 13  LYS B HD2  6  
ATOM 10600 H HD3  . LYS B 2 15  ? -2.163  14.039  -10.592 1.00 0.00 ? 13  LYS B HD3  6  
ATOM 10601 H HE2  . LYS B 2 15  ? -4.206  13.349  -9.838  1.00 0.00 ? 13  LYS B HE2  6  
ATOM 10602 H HE3  . LYS B 2 15  ? -3.166  12.312  -8.864  1.00 0.00 ? 13  LYS B HE3  6  
ATOM 10603 H HZ1  . LYS B 2 15  ? -3.959  13.219  -7.019  1.00 0.00 ? 13  LYS B HZ1  6  
ATOM 10604 H HZ2  . LYS B 2 15  ? -5.082  14.081  -7.949  1.00 0.00 ? 13  LYS B HZ2  6  
ATOM 10605 H HZ3  . LYS B 2 15  ? -3.601  14.791  -7.547  1.00 0.00 ? 13  LYS B HZ3  6  
ATOM 10606 N N    . LYS B 2 16  ? 0.940   14.324  -5.160  1.00 0.00 ? 14  LYS B N    6  
ATOM 10607 C CA   . LYS B 2 16  ? 1.454   14.967  -3.939  1.00 0.00 ? 14  LYS B CA   6  
ATOM 10608 C C    . LYS B 2 16  ? 1.115   14.200  -2.665  1.00 0.00 ? 14  LYS B C    6  
ATOM 10609 O O    . LYS B 2 16  ? 0.277   14.618  -1.866  1.00 0.00 ? 14  LYS B O    6  
ATOM 10610 C CB   . LYS B 2 16  ? 0.939   16.404  -3.835  1.00 0.00 ? 14  LYS B CB   6  
ATOM 10611 C CG   . LYS B 2 16  ? 1.841   17.418  -4.514  1.00 0.00 ? 14  LYS B CG   6  
ATOM 10612 C CD   . LYS B 2 16  ? 2.220   18.546  -3.568  1.00 0.00 ? 14  LYS B CD   6  
ATOM 10613 C CE   . LYS B 2 16  ? 3.636   19.035  -3.824  1.00 0.00 ? 14  LYS B CE   6  
ATOM 10614 N NZ   . LYS B 2 16  ? 4.651   18.010  -3.467  1.00 0.00 ? 14  LYS B NZ   6  
ATOM 10615 H H    . LYS B 2 16  ? 1.341   14.580  -6.016  1.00 0.00 ? 14  LYS B H    6  
ATOM 10616 H HA   . LYS B 2 16  ? 2.529   15.002  -4.029  1.00 0.00 ? 14  LYS B HA   6  
ATOM 10617 H HB2  . LYS B 2 16  ? -0.039  16.459  -4.291  1.00 0.00 ? 14  LYS B HB2  6  
ATOM 10618 H HB3  . LYS B 2 16  ? 0.854   16.670  -2.792  1.00 0.00 ? 14  LYS B HB3  6  
ATOM 10619 H HG2  . LYS B 2 16  ? 2.741   16.920  -4.843  1.00 0.00 ? 14  LYS B HG2  6  
ATOM 10620 H HG3  . LYS B 2 16  ? 1.323   17.832  -5.366  1.00 0.00 ? 14  LYS B HG3  6  
ATOM 10621 H HD2  . LYS B 2 16  ? 1.535   19.369  -3.711  1.00 0.00 ? 14  LYS B HD2  6  
ATOM 10622 H HD3  . LYS B 2 16  ? 2.149   18.190  -2.551  1.00 0.00 ? 14  LYS B HD3  6  
ATOM 10623 H HE2  . LYS B 2 16  ? 3.736   19.277  -4.872  1.00 0.00 ? 14  LYS B HE2  6  
ATOM 10624 H HE3  . LYS B 2 16  ? 3.809   19.924  -3.233  1.00 0.00 ? 14  LYS B HE3  6  
ATOM 10625 H HZ1  . LYS B 2 16  ? 4.617   17.804  -2.441  1.00 0.00 ? 14  LYS B HZ1  6  
ATOM 10626 H HZ2  . LYS B 2 16  ? 5.604   18.343  -3.712  1.00 0.00 ? 14  LYS B HZ2  6  
ATOM 10627 H HZ3  . LYS B 2 16  ? 4.474   17.122  -3.993  1.00 0.00 ? 14  LYS B HZ3  6  
ATOM 10628 N N    . VAL B 2 17  ? 1.768   13.063  -2.510  1.00 0.00 ? 15  VAL B N    6  
ATOM 10629 C CA   . VAL B 2 17  ? 1.593   12.210  -1.356  1.00 0.00 ? 15  VAL B CA   6  
ATOM 10630 C C    . VAL B 2 17  ? 2.894   12.161  -0.573  1.00 0.00 ? 15  VAL B C    6  
ATOM 10631 O O    . VAL B 2 17  ? 3.934   11.795  -1.112  1.00 0.00 ? 15  VAL B O    6  
ATOM 10632 C CB   . VAL B 2 17  ? 1.169   10.776  -1.768  1.00 0.00 ? 15  VAL B CB   6  
ATOM 10633 C CG1  . VAL B 2 17  ? 1.436   9.773   -0.653  1.00 0.00 ? 15  VAL B CG1  6  
ATOM 10634 C CG2  . VAL B 2 17  ? -0.298  10.747  -2.147  1.00 0.00 ? 15  VAL B CG2  6  
ATOM 10635 H H    . VAL B 2 17  ? 2.404   12.787  -3.211  1.00 0.00 ? 15  VAL B H    6  
ATOM 10636 H HA   . VAL B 2 17  ? 0.818   12.635  -0.733  1.00 0.00 ? 15  VAL B HA   6  
ATOM 10637 H HB   . VAL B 2 17  ? 1.747   10.486  -2.636  1.00 0.00 ? 15  VAL B HB   6  
ATOM 10638 H HG11 . VAL B 2 17  ? 2.496   9.737   -0.448  1.00 0.00 ? 15  VAL B HG11 6  
ATOM 10639 H HG12 . VAL B 2 17  ? 1.094   8.796   -0.959  1.00 0.00 ? 15  VAL B HG12 6  
ATOM 10640 H HG13 . VAL B 2 17  ? 0.907   10.077  0.238   1.00 0.00 ? 15  VAL B HG13 6  
ATOM 10641 H HG21 . VAL B 2 17  ? -0.896  11.039  -1.296  1.00 0.00 ? 15  VAL B HG21 6  
ATOM 10642 H HG22 . VAL B 2 17  ? -0.571  9.747   -2.452  1.00 0.00 ? 15  VAL B HG22 6  
ATOM 10643 H HG23 . VAL B 2 17  ? -0.473  11.434  -2.962  1.00 0.00 ? 15  VAL B HG23 6  
ATOM 10644 N N    . ARG B 2 18  ? 2.834   12.558  0.681   1.00 0.00 ? 16  ARG B N    6  
ATOM 10645 C CA   . ARG B 2 18  ? 4.004   12.560  1.533   1.00 0.00 ? 16  ARG B CA   6  
ATOM 10646 C C    . ARG B 2 18  ? 4.107   11.254  2.300   1.00 0.00 ? 16  ARG B C    6  
ATOM 10647 O O    . ARG B 2 18  ? 3.196   10.876  3.021   1.00 0.00 ? 16  ARG B O    6  
ATOM 10648 C CB   . ARG B 2 18  ? 3.962   13.741  2.508   1.00 0.00 ? 16  ARG B CB   6  
ATOM 10649 C CG   . ARG B 2 18  ? 4.302   15.068  1.855   1.00 0.00 ? 16  ARG B CG   6  
ATOM 10650 C CD   . ARG B 2 18  ? 4.039   16.252  2.775   1.00 0.00 ? 16  ARG B CD   6  
ATOM 10651 N NE   . ARG B 2 18  ? 4.827   16.201  4.012   1.00 0.00 ? 16  ARG B NE   6  
ATOM 10652 C CZ   . ARG B 2 18  ? 6.081   16.640  4.124   1.00 0.00 ? 16  ARG B CZ   6  
ATOM 10653 N NH1  . ARG B 2 18  ? 6.747   17.078  3.060   1.00 0.00 ? 16  ARG B NH1  6  
ATOM 10654 N NH2  . ARG B 2 18  ? 6.677   16.626  5.310   1.00 0.00 ? 16  ARG B NH2  6  
ATOM 10655 H H    . ARG B 2 18  ? 1.969   12.844  1.050   1.00 0.00 ? 16  ARG B H    6  
ATOM 10656 H HA   . ARG B 2 18  ? 4.873   12.659  0.900   1.00 0.00 ? 16  ARG B HA   6  
ATOM 10657 H HB2  . ARG B 2 18  ? 2.970   13.812  2.930   1.00 0.00 ? 16  ARG B HB2  6  
ATOM 10658 H HB3  . ARG B 2 18  ? 4.671   13.562  3.302   1.00 0.00 ? 16  ARG B HB3  6  
ATOM 10659 H HG2  . ARG B 2 18  ? 5.349   15.065  1.586   1.00 0.00 ? 16  ARG B HG2  6  
ATOM 10660 H HG3  . ARG B 2 18  ? 3.704   15.179  0.962   1.00 0.00 ? 16  ARG B HG3  6  
ATOM 10661 H HD2  . ARG B 2 18  ? 4.286   17.160  2.246   1.00 0.00 ? 16  ARG B HD2  6  
ATOM 10662 H HD3  . ARG B 2 18  ? 2.990   16.263  3.029   1.00 0.00 ? 16  ARG B HD3  6  
ATOM 10663 H HE   . ARG B 2 18  ? 4.380   15.845  4.815   1.00 0.00 ? 16  ARG B HE   6  
ATOM 10664 H HH11 . ARG B 2 18  ? 6.309   17.081  2.142   1.00 0.00 ? 16  ARG B HH11 6  
ATOM 10665 H HH12 . ARG B 2 18  ? 7.686   17.403  3.153   1.00 0.00 ? 16  ARG B HH12 6  
ATOM 10666 H HH21 . ARG B 2 18  ? 6.176   16.282  6.126   1.00 0.00 ? 16  ARG B HH21 6  
ATOM 10667 H HH22 . ARG B 2 18  ? 7.617   16.947  5.406   1.00 0.00 ? 16  ARG B HH22 6  
ATOM 10668 N N    . GLN B 2 19  ? 5.201   10.552  2.109   1.00 0.00 ? 17  GLN B N    6  
ATOM 10669 C CA   . GLN B 2 19  ? 5.426   9.308   2.814   1.00 0.00 ? 17  GLN B CA   6  
ATOM 10670 C C    . GLN B 2 19  ? 6.595   9.501   3.759   1.00 0.00 ? 17  GLN B C    6  
ATOM 10671 O O    . GLN B 2 19  ? 7.750   9.545   3.326   1.00 0.00 ? 17  GLN B O    6  
ATOM 10672 C CB   . GLN B 2 19  ? 5.702   8.164   1.831   1.00 0.00 ? 17  GLN B CB   6  
ATOM 10673 C CG   . GLN B 2 19  ? 5.490   6.775   2.421   1.00 0.00 ? 17  GLN B CG   6  
ATOM 10674 C CD   . GLN B 2 19  ? 6.726   6.216   3.103   1.00 0.00 ? 17  GLN B CD   6  
ATOM 10675 O OE1  . GLN B 2 19  ? 6.630   5.441   4.056   1.00 0.00 ? 17  GLN B OE1  6  
ATOM 10676 N NE2  . GLN B 2 19  ? 7.899   6.600   2.622   1.00 0.00 ? 17  GLN B NE2  6  
ATOM 10677 H H    . GLN B 2 19  ? 5.881   10.881  1.478   1.00 0.00 ? 17  GLN B H    6  
ATOM 10678 H HA   . GLN B 2 19  ? 4.540   9.083   3.388   1.00 0.00 ? 17  GLN B HA   6  
ATOM 10679 H HB2  . GLN B 2 19  ? 5.045   8.272   0.980   1.00 0.00 ? 17  GLN B HB2  6  
ATOM 10680 H HB3  . GLN B 2 19  ? 6.725   8.236   1.494   1.00 0.00 ? 17  GLN B HB3  6  
ATOM 10681 H HG2  . GLN B 2 19  ? 4.693   6.826   3.147   1.00 0.00 ? 17  GLN B HG2  6  
ATOM 10682 H HG3  . GLN B 2 19  ? 5.204   6.103   1.624   1.00 0.00 ? 17  GLN B HG3  6  
ATOM 10683 H HE21 . GLN B 2 19  ? 7.907   7.221   1.863   1.00 0.00 ? 17  GLN B HE21 6  
ATOM 10684 H HE22 . GLN B 2 19  ? 8.710   6.252   3.044   1.00 0.00 ? 17  GLN B HE22 6  
ATOM 10685 N N    . LYS B 2 20  ? 6.280   9.654   5.040   1.00 0.00 ? 18  LYS B N    6  
ATOM 10686 C CA   . LYS B 2 20  ? 7.288   9.856   6.075   1.00 0.00 ? 18  LYS B CA   6  
ATOM 10687 C C    . LYS B 2 20  ? 8.044   11.168  5.858   1.00 0.00 ? 18  LYS B C    6  
ATOM 10688 O O    . LYS B 2 20  ? 9.268   11.180  5.720   1.00 0.00 ? 18  LYS B O    6  
ATOM 10689 C CB   . LYS B 2 20  ? 8.264   8.674   6.133   1.00 0.00 ? 18  LYS B CB   6  
ATOM 10690 C CG   . LYS B 2 20  ? 7.648   7.404   6.696   1.00 0.00 ? 18  LYS B CG   6  
ATOM 10691 C CD   . LYS B 2 20  ? 8.603   6.226   6.589   1.00 0.00 ? 18  LYS B CD   6  
ATOM 10692 C CE   . LYS B 2 20  ? 8.029   4.976   7.239   1.00 0.00 ? 18  LYS B CE   6  
ATOM 10693 N NZ   . LYS B 2 20  ? 6.713   4.593   6.658   1.00 0.00 ? 18  LYS B NZ   6  
ATOM 10694 H H    . LYS B 2 20  ? 5.326   9.648   5.298   1.00 0.00 ? 18  LYS B H    6  
ATOM 10695 H HA   . LYS B 2 20  ? 6.767   9.918   7.020   1.00 0.00 ? 18  LYS B HA   6  
ATOM 10696 H HB2  . LYS B 2 20  ? 8.618   8.464   5.135   1.00 0.00 ? 18  LYS B HB2  6  
ATOM 10697 H HB3  . LYS B 2 20  ? 9.105   8.947   6.754   1.00 0.00 ? 18  LYS B HB3  6  
ATOM 10698 H HG2  . LYS B 2 20  ? 7.403   7.563   7.736   1.00 0.00 ? 18  LYS B HG2  6  
ATOM 10699 H HG3  . LYS B 2 20  ? 6.748   7.176   6.143   1.00 0.00 ? 18  LYS B HG3  6  
ATOM 10700 H HD2  . LYS B 2 20  ? 8.793   6.021   5.547   1.00 0.00 ? 18  LYS B HD2  6  
ATOM 10701 H HD3  . LYS B 2 20  ? 9.530   6.483   7.082   1.00 0.00 ? 18  LYS B HD3  6  
ATOM 10702 H HE2  . LYS B 2 20  ? 8.723   4.163   7.099   1.00 0.00 ? 18  LYS B HE2  6  
ATOM 10703 H HE3  . LYS B 2 20  ? 7.904   5.163   8.296   1.00 0.00 ? 18  LYS B HE3  6  
ATOM 10704 H HZ1  . LYS B 2 20  ? 6.618   4.976   5.692   1.00 0.00 ? 18  LYS B HZ1  6  
ATOM 10705 H HZ2  . LYS B 2 20  ? 5.934   4.970   7.251   1.00 0.00 ? 18  LYS B HZ2  6  
ATOM 10706 H HZ3  . LYS B 2 20  ? 6.626   3.560   6.621   1.00 0.00 ? 18  LYS B HZ3  6  
ATOM 10707 N N    . LYS B 2 21  ? 7.284   12.264  5.798   1.00 0.00 ? 19  LYS B N    6  
ATOM 10708 C CA   . LYS B 2 21  ? 7.833   13.617  5.638   1.00 0.00 ? 19  LYS B CA   6  
ATOM 10709 C C    . LYS B 2 21  ? 8.459   13.844  4.256   1.00 0.00 ? 19  LYS B C    6  
ATOM 10710 O O    . LYS B 2 21  ? 9.265   14.759  4.083   1.00 0.00 ? 19  LYS B O    6  
ATOM 10711 C CB   . LYS B 2 21  ? 8.873   13.927  6.733   1.00 0.00 ? 19  LYS B CB   6  
ATOM 10712 C CG   . LYS B 2 21  ? 8.283   14.222  8.112   1.00 0.00 ? 19  LYS B CG   6  
ATOM 10713 C CD   . LYS B 2 21  ? 7.736   12.965  8.770   1.00 0.00 ? 19  LYS B CD   6  
ATOM 10714 C CE   . LYS B 2 21  ? 7.430   13.162  10.244  1.00 0.00 ? 19  LYS B CE   6  
ATOM 10715 N NZ   . LYS B 2 21  ? 8.639   13.012  11.094  1.00 0.00 ? 19  LYS B NZ   6  
ATOM 10716 H H    . LYS B 2 21  ? 6.312   12.158  5.862   1.00 0.00 ? 19  LYS B H    6  
ATOM 10717 H HA   . LYS B 2 21  ? 7.010   14.308  5.749   1.00 0.00 ? 19  LYS B HA   6  
ATOM 10718 H HB2  . LYS B 2 21  ? 9.534   13.078  6.829   1.00 0.00 ? 19  LYS B HB2  6  
ATOM 10719 H HB3  . LYS B 2 21  ? 9.453   14.784  6.425   1.00 0.00 ? 19  LYS B HB3  6  
ATOM 10720 H HG2  . LYS B 2 21  ? 9.056   14.638  8.741   1.00 0.00 ? 19  LYS B HG2  6  
ATOM 10721 H HG3  . LYS B 2 21  ? 7.483   14.938  8.002   1.00 0.00 ? 19  LYS B HG3  6  
ATOM 10722 H HD2  . LYS B 2 21  ? 6.823   12.679  8.269   1.00 0.00 ? 19  LYS B HD2  6  
ATOM 10723 H HD3  . LYS B 2 21  ? 8.462   12.172  8.669   1.00 0.00 ? 19  LYS B HD3  6  
ATOM 10724 H HE2  . LYS B 2 21  ? 7.013   14.141  10.388  1.00 0.00 ? 19  LYS B HE2  6  
ATOM 10725 H HE3  . LYS B 2 21  ? 6.703   12.413  10.540  1.00 0.00 ? 19  LYS B HE3  6  
ATOM 10726 H HZ1  . LYS B 2 21  ? 8.382   13.097  12.099  1.00 0.00 ? 19  LYS B HZ1  6  
ATOM 10727 H HZ2  . LYS B 2 21  ? 9.342   13.735  10.861  1.00 0.00 ? 19  LYS B HZ2  6  
ATOM 10728 H HZ3  . LYS B 2 21  ? 9.067   12.063  10.946  1.00 0.00 ? 19  LYS B HZ3  6  
ATOM 10729 N N    . GLN B 2 22  ? 8.077   13.042  3.268   1.00 0.00 ? 20  GLN B N    6  
ATOM 10730 C CA   . GLN B 2 22  ? 8.632   13.195  1.923   1.00 0.00 ? 20  GLN B CA   6  
ATOM 10731 C C    . GLN B 2 22  ? 7.543   13.157  0.851   1.00 0.00 ? 20  GLN B C    6  
ATOM 10732 O O    . GLN B 2 22  ? 6.806   12.183  0.743   1.00 0.00 ? 20  GLN B O    6  
ATOM 10733 C CB   . GLN B 2 22  ? 9.672   12.107  1.656   1.00 0.00 ? 20  GLN B CB   6  
ATOM 10734 C CG   . GLN B 2 22  ? 10.186  12.105  0.228   1.00 0.00 ? 20  GLN B CG   6  
ATOM 10735 C CD   . GLN B 2 22  ? 11.562  11.484  0.094   1.00 0.00 ? 20  GLN B CD   6  
ATOM 10736 O OE1  . GLN B 2 22  ? 12.334  11.846  -0.799  1.00 0.00 ? 20  GLN B OE1  6  
ATOM 10737 N NE2  . GLN B 2 22  ? 11.881  10.549  0.976   1.00 0.00 ? 20  GLN B NE2  6  
ATOM 10738 H H    . GLN B 2 22  ? 7.422   12.335  3.443   1.00 0.00 ? 20  GLN B H    6  
ATOM 10739 H HA   . GLN B 2 22  ? 9.120   14.157  1.881   1.00 0.00 ? 20  GLN B HA   6  
ATOM 10740 H HB2  . GLN B 2 22  ? 10.513  12.256  2.319   1.00 0.00 ? 20  GLN B HB2  6  
ATOM 10741 H HB3  . GLN B 2 22  ? 9.230   11.143  1.859   1.00 0.00 ? 20  GLN B HB3  6  
ATOM 10742 H HG2  . GLN B 2 22  ? 9.495   11.544  -0.384  1.00 0.00 ? 20  GLN B HG2  6  
ATOM 10743 H HG3  . GLN B 2 22  ? 10.229  13.125  -0.123  1.00 0.00 ? 20  GLN B HG3  6  
ATOM 10744 H HE21 . GLN B 2 22  ? 11.217  10.312  1.659   1.00 0.00 ? 20  GLN B HE21 6  
ATOM 10745 H HE22 . GLN B 2 22  ? 12.766  10.137  0.915   1.00 0.00 ? 20  GLN B HE22 6  
ATOM 10746 N N    . ASP B 2 23  ? 7.468   14.220  0.054   1.00 0.00 ? 21  ASP B N    6  
ATOM 10747 C CA   . ASP B 2 23  ? 6.474   14.343  -1.020  1.00 0.00 ? 21  ASP B CA   6  
ATOM 10748 C C    . ASP B 2 23  ? 6.756   13.378  -2.172  1.00 0.00 ? 21  ASP B C    6  
ATOM 10749 O O    . ASP B 2 23  ? 7.903   12.981  -2.400  1.00 0.00 ? 21  ASP B O    6  
ATOM 10750 C CB   . ASP B 2 23  ? 6.457   15.777  -1.563  1.00 0.00 ? 21  ASP B CB   6  
ATOM 10751 C CG   . ASP B 2 23  ? 5.819   16.768  -0.610  1.00 0.00 ? 21  ASP B CG   6  
ATOM 10752 O OD1  . ASP B 2 23  ? 4.751   17.318  -0.950  1.00 0.00 ? 21  ASP B OD1  6  
ATOM 10753 O OD2  . ASP B 2 23  ? 6.387   17.004  0.477   1.00 0.00 ? 21  ASP B OD2  6  
ATOM 10754 H H    . ASP B 2 23  ? 8.098   14.957  0.193   1.00 0.00 ? 21  ASP B H    6  
ATOM 10755 H HA   . ASP B 2 23  ? 5.505   14.115  -0.603  1.00 0.00 ? 21  ASP B HA   6  
ATOM 10756 H HB2  . ASP B 2 23  ? 7.471   16.094  -1.750  1.00 0.00 ? 21  ASP B HB2  6  
ATOM 10757 H HB3  . ASP B 2 23  ? 5.905   15.794  -2.491  1.00 0.00 ? 21  ASP B HB3  6  
ATOM 10758 N N    . GLY B 2 24  ? 5.702   13.004  -2.896  1.00 0.00 ? 22  GLY B N    6  
ATOM 10759 C CA   . GLY B 2 24  ? 5.840   12.103  -4.027  1.00 0.00 ? 22  GLY B CA   6  
ATOM 10760 C C    . GLY B 2 24  ? 4.507   11.771  -4.679  1.00 0.00 ? 22  GLY B C    6  
ATOM 10761 O O    . GLY B 2 24  ? 3.487   12.371  -4.358  1.00 0.00 ? 22  GLY B O    6  
ATOM 10762 H H    . GLY B 2 24  ? 4.811   13.332  -2.649  1.00 0.00 ? 22  GLY B H    6  
ATOM 10763 H HA2  . GLY B 2 24  ? 6.482   12.565  -4.762  1.00 0.00 ? 22  GLY B HA2  6  
ATOM 10764 H HA3  . GLY B 2 24  ? 6.300   11.186  -3.688  1.00 0.00 ? 22  GLY B HA3  6  
ATOM 10765 N N    . ALA B 2 25  ? 4.520   10.813  -5.593  1.00 0.00 ? 23  ALA B N    6  
ATOM 10766 C CA   . ALA B 2 25  ? 3.314   10.380  -6.296  1.00 0.00 ? 23  ALA B CA   6  
ATOM 10767 C C    . ALA B 2 25  ? 3.104   8.887   -6.069  1.00 0.00 ? 23  ALA B C    6  
ATOM 10768 O O    . ALA B 2 25  ? 4.033   8.091   -6.222  1.00 0.00 ? 23  ALA B O    6  
ATOM 10769 C CB   . ALA B 2 25  ? 3.423   10.685  -7.783  1.00 0.00 ? 23  ALA B CB   6  
ATOM 10770 H H    . ALA B 2 25  ? 5.374   10.365  -5.797  1.00 0.00 ? 23  ALA B H    6  
ATOM 10771 H HA   . ALA B 2 25  ? 2.459   10.927  -5.898  1.00 0.00 ? 23  ALA B HA   6  
ATOM 10772 H HB1  . ALA B 2 25  ? 4.272   10.162  -8.196  1.00 0.00 ? 23  ALA B HB1  6  
ATOM 10773 H HB2  . ALA B 2 25  ? 3.550   11.748  -7.925  1.00 0.00 ? 23  ALA B HB2  6  
ATOM 10774 H HB3  . ALA B 2 25  ? 2.521   10.361  -8.282  1.00 0.00 ? 23  ALA B HB3  6  
ATOM 10775 N N    . LEU B 2 26  ? 1.892   8.513   -5.707  1.00 0.00 ? 24  LEU B N    6  
ATOM 10776 C CA   . LEU B 2 26  ? 1.561   7.122   -5.430  1.00 0.00 ? 24  LEU B CA   6  
ATOM 10777 C C    . LEU B 2 26  ? 0.918   6.469   -6.655  1.00 0.00 ? 24  LEU B C    6  
ATOM 10778 O O    . LEU B 2 26  ? 0.117   7.085   -7.343  1.00 0.00 ? 24  LEU B O    6  
ATOM 10779 C CB   . LEU B 2 26  ? 0.617   7.061   -4.227  1.00 0.00 ? 24  LEU B CB   6  
ATOM 10780 C CG   . LEU B 2 26  ? 0.174   5.658   -3.816  1.00 0.00 ? 24  LEU B CG   6  
ATOM 10781 C CD1  . LEU B 2 26  ? 1.107   5.055   -2.793  1.00 0.00 ? 24  LEU B CD1  6  
ATOM 10782 C CD2  . LEU B 2 26  ? -1.245  5.681   -3.279  1.00 0.00 ? 24  LEU B CD2  6  
ATOM 10783 H H    . LEU B 2 26  ? 1.185   9.190   -5.645  1.00 0.00 ? 24  LEU B H    6  
ATOM 10784 H HA   . LEU B 2 26  ? 2.471   6.593   -5.188  1.00 0.00 ? 24  LEU B HA   6  
ATOM 10785 H HB2  . LEU B 2 26  ? 1.112   7.519   -3.387  1.00 0.00 ? 24  LEU B HB2  6  
ATOM 10786 H HB3  . LEU B 2 26  ? -0.259  7.642   -4.456  1.00 0.00 ? 24  LEU B HB3  6  
ATOM 10787 H HG   . LEU B 2 26  ? 0.207   5.021   -4.680  1.00 0.00 ? 24  LEU B HG   6  
ATOM 10788 H HD11 . LEU B 2 26  ? 2.108   5.036   -3.188  1.00 0.00 ? 24  LEU B HD11 6  
ATOM 10789 H HD12 . LEU B 2 26  ? 0.784   4.045   -2.574  1.00 0.00 ? 24  LEU B HD12 6  
ATOM 10790 H HD13 . LEU B 2 26  ? 1.079   5.644   -1.892  1.00 0.00 ? 24  LEU B HD13 6  
ATOM 10791 H HD21 . LEU B 2 26  ? -1.914  6.036   -4.048  1.00 0.00 ? 24  LEU B HD21 6  
ATOM 10792 H HD22 . LEU B 2 26  ? -1.296  6.343   -2.426  1.00 0.00 ? 24  LEU B HD22 6  
ATOM 10793 H HD23 . LEU B 2 26  ? -1.535  4.686   -2.980  1.00 0.00 ? 24  LEU B HD23 6  
ATOM 10794 N N    . TYR B 2 27  ? 1.289   5.230   -6.936  1.00 0.00 ? 25  TYR B N    6  
ATOM 10795 C CA   . TYR B 2 27  ? 0.749   4.498   -8.077  1.00 0.00 ? 25  TYR B CA   6  
ATOM 10796 C C    . TYR B 2 27  ? 0.329   3.101   -7.636  1.00 0.00 ? 25  TYR B C    6  
ATOM 10797 O O    . TYR B 2 27  ? 1.142   2.339   -7.115  1.00 0.00 ? 25  TYR B O    6  
ATOM 10798 C CB   . TYR B 2 27  ? 1.790   4.386   -9.199  1.00 0.00 ? 25  TYR B CB   6  
ATOM 10799 C CG   . TYR B 2 27  ? 2.315   5.709   -9.716  1.00 0.00 ? 25  TYR B CG   6  
ATOM 10800 C CD1  . TYR B 2 27  ? 1.787   6.287   -10.862 1.00 0.00 ? 25  TYR B CD1  6  
ATOM 10801 C CD2  . TYR B 2 27  ? 3.349   6.371   -9.065  1.00 0.00 ? 25  TYR B CD2  6  
ATOM 10802 C CE1  . TYR B 2 27  ? 2.273   7.489   -11.344 1.00 0.00 ? 25  TYR B CE1  6  
ATOM 10803 C CE2  . TYR B 2 27  ? 3.838   7.572   -9.538  1.00 0.00 ? 25  TYR B CE2  6  
ATOM 10804 C CZ   . TYR B 2 27  ? 3.298   8.126   -10.678 1.00 0.00 ? 25  TYR B CZ   6  
ATOM 10805 O OH   . TYR B 2 27  ? 3.784   9.321   -11.153 1.00 0.00 ? 25  TYR B OH   6  
ATOM 10806 H H    . TYR B 2 27  ? 1.942   4.779   -6.350  1.00 0.00 ? 25  TYR B H    6  
ATOM 10807 H HA   . TYR B 2 27  ? -0.117  5.031   -8.439  1.00 0.00 ? 25  TYR B HA   6  
ATOM 10808 H HB2  . TYR B 2 27  ? 2.634   3.825   -8.836  1.00 0.00 ? 25  TYR B HB2  6  
ATOM 10809 H HB3  . TYR B 2 27  ? 1.349   3.858   -10.033 1.00 0.00 ? 25  TYR B HB3  6  
ATOM 10810 H HD1  . TYR B 2 27  ? 0.983   5.787   -11.381 1.00 0.00 ? 25  TYR B HD1  6  
ATOM 10811 H HD2  . TYR B 2 27  ? 3.770   5.935   -8.172  1.00 0.00 ? 25  TYR B HD2  6  
ATOM 10812 H HE1  . TYR B 2 27  ? 1.849   7.923   -12.237 1.00 0.00 ? 25  TYR B HE1  6  
ATOM 10813 H HE2  . TYR B 2 27  ? 4.640   8.071   -9.016  1.00 0.00 ? 25  TYR B HE2  6  
ATOM 10814 H HH   . TYR B 2 27  ? 4.739   9.342   -11.053 1.00 0.00 ? 25  TYR B HH   6  
ATOM 10815 N N    . LEU B 2 28  ? -0.929  2.756   -7.844  1.00 0.00 ? 26  LEU B N    6  
ATOM 10816 C CA   . LEU B 2 28  ? -1.418  1.447   -7.431  1.00 0.00 ? 26  LEU B CA   6  
ATOM 10817 C C    . LEU B 2 28  ? -1.528  0.494   -8.615  1.00 0.00 ? 26  LEU B C    6  
ATOM 10818 O O    . LEU B 2 28  ? -2.301  0.733   -9.544  1.00 0.00 ? 26  LEU B O    6  
ATOM 10819 C CB   . LEU B 2 28  ? -2.777  1.564   -6.737  1.00 0.00 ? 26  LEU B CB   6  
ATOM 10820 C CG   . LEU B 2 28  ? -2.849  2.586   -5.600  1.00 0.00 ? 26  LEU B CG   6  
ATOM 10821 C CD1  . LEU B 2 28  ? -4.092  2.381   -4.769  1.00 0.00 ? 26  LEU B CD1  6  
ATOM 10822 C CD2  . LEU B 2 28  ? -1.640  2.502   -4.704  1.00 0.00 ? 26  LEU B CD2  6  
ATOM 10823 H H    . LEU B 2 28  ? -1.538  3.386   -8.292  1.00 0.00 ? 26  LEU B H    6  
ATOM 10824 H HA   . LEU B 2 28  ? -0.709  1.046   -6.727  1.00 0.00 ? 26  LEU B HA   6  
ATOM 10825 H HB2  . LEU B 2 28  ? -3.514  1.833   -7.480  1.00 0.00 ? 26  LEU B HB2  6  
ATOM 10826 H HB3  . LEU B 2 28  ? -3.035  0.596   -6.334  1.00 0.00 ? 26  LEU B HB3  6  
ATOM 10827 H HG   . LEU B 2 28  ? -2.880  3.575   -6.023  1.00 0.00 ? 26  LEU B HG   6  
ATOM 10828 H HD11 . LEU B 2 28  ? -4.961  2.422   -5.403  1.00 0.00 ? 26  LEU B HD11 6  
ATOM 10829 H HD12 . LEU B 2 28  ? -4.150  3.161   -4.021  1.00 0.00 ? 26  LEU B HD12 6  
ATOM 10830 H HD13 . LEU B 2 28  ? -4.040  1.420   -4.279  1.00 0.00 ? 26  LEU B HD13 6  
ATOM 10831 H HD21 . LEU B 2 28  ? -1.580  1.513   -4.278  1.00 0.00 ? 26  LEU B HD21 6  
ATOM 10832 H HD22 . LEU B 2 28  ? -1.737  3.231   -3.912  1.00 0.00 ? 26  LEU B HD22 6  
ATOM 10833 H HD23 . LEU B 2 28  ? -0.752  2.707   -5.278  1.00 0.00 ? 26  LEU B HD23 6  
ATOM 10834 N N    . MET B 2 29  ? -0.743  -0.576  -8.580  1.00 0.00 ? 27  MET B N    6  
ATOM 10835 C CA   . MET B 2 29  ? -0.769  -1.584  -9.630  1.00 0.00 ? 27  MET B CA   6  
ATOM 10836 C C    . MET B 2 29  ? -1.714  -2.697  -9.232  1.00 0.00 ? 27  MET B C    6  
ATOM 10837 O O    . MET B 2 29  ? -2.024  -2.860  -8.058  1.00 0.00 ? 27  MET B O    6  
ATOM 10838 C CB   . MET B 2 29  ? 0.615   -2.174  -9.898  1.00 0.00 ? 27  MET B CB   6  
ATOM 10839 C CG   . MET B 2 29  ? 1.637   -1.163  -10.375 1.00 0.00 ? 27  MET B CG   6  
ATOM 10840 S SD   . MET B 2 29  ? 2.432   -0.289  -9.018  1.00 0.00 ? 27  MET B SD   6  
ATOM 10841 C CE   . MET B 2 29  ? 3.200   1.051   -9.915  1.00 0.00 ? 27  MET B CE   6  
ATOM 10842 H H    . MET B 2 29  ? -0.136  -0.701  -7.815  1.00 0.00 ? 27  MET B H    6  
ATOM 10843 H HA   . MET B 2 29  ? -1.135  -1.120  -10.536 1.00 0.00 ? 27  MET B HA   6  
ATOM 10844 H HB2  . MET B 2 29  ? 0.981   -2.627  -8.990  1.00 0.00 ? 27  MET B HB2  6  
ATOM 10845 H HB3  . MET B 2 29  ? 0.519   -2.937  -10.655 1.00 0.00 ? 27  MET B HB3  6  
ATOM 10846 H HG2  . MET B 2 29  ? 2.397   -1.679  -10.944 1.00 0.00 ? 27  MET B HG2  6  
ATOM 10847 H HG3  . MET B 2 29  ? 1.142   -0.442  -11.008 1.00 0.00 ? 27  MET B HG3  6  
ATOM 10848 H HE1  . MET B 2 29  ? 3.704   1.706   -9.221  1.00 0.00 ? 27  MET B HE1  6  
ATOM 10849 H HE2  . MET B 2 29  ? 2.442   1.606   -10.449 1.00 0.00 ? 27  MET B HE2  6  
ATOM 10850 H HE3  . MET B 2 29  ? 3.915   0.649   -10.618 1.00 0.00 ? 27  MET B HE3  6  
ATOM 10851 N N    . ALA B 2 30  ? -2.122  -3.491  -10.204 1.00 0.00 ? 28  ALA B N    6  
ATOM 10852 C CA   . ALA B 2 30  ? -3.057  -4.587  -9.976  1.00 0.00 ? 28  ALA B CA   6  
ATOM 10853 C C    . ALA B 2 30  ? -2.515  -5.653  -9.025  1.00 0.00 ? 28  ALA B C    6  
ATOM 10854 O O    . ALA B 2 30  ? -3.250  -6.554  -8.636  1.00 0.00 ? 28  ALA B O    6  
ATOM 10855 C CB   . ALA B 2 30  ? -3.443  -5.217  -11.302 1.00 0.00 ? 28  ALA B CB   6  
ATOM 10856 H H    . ALA B 2 30  ? -1.786  -3.332  -11.112 1.00 0.00 ? 28  ALA B H    6  
ATOM 10857 H HA   . ALA B 2 30  ? -3.952  -4.169  -9.542  1.00 0.00 ? 28  ALA B HA   6  
ATOM 10858 H HB1  . ALA B 2 30  ? -4.280  -5.883  -11.154 1.00 0.00 ? 28  ALA B HB1  6  
ATOM 10859 H HB2  . ALA B 2 30  ? -2.604  -5.776  -11.693 1.00 0.00 ? 28  ALA B HB2  6  
ATOM 10860 H HB3  . ALA B 2 30  ? -3.718  -4.443  -12.004 1.00 0.00 ? 28  ALA B HB3  6  
ATOM 10861 N N    . GLU B 2 31  ? -1.238  -5.574  -8.664  1.00 0.00 ? 29  GLU B N    6  
ATOM 10862 C CA   . GLU B 2 31  ? -0.650  -6.558  -7.761  1.00 0.00 ? 29  GLU B CA   6  
ATOM 10863 C C    . GLU B 2 31  ? 0.061   -5.905  -6.575  1.00 0.00 ? 29  GLU B C    6  
ATOM 10864 O O    . GLU B 2 31  ? 0.317   -6.560  -5.554  1.00 0.00 ? 29  GLU B O    6  
ATOM 10865 C CB   . GLU B 2 31  ? 0.357   -7.448  -8.504  1.00 0.00 ? 29  GLU B CB   6  
ATOM 10866 C CG   . GLU B 2 31  ? -0.042  -7.806  -9.927  1.00 0.00 ? 29  GLU B CG   6  
ATOM 10867 C CD   . GLU B 2 31  ? 0.346   -6.735  -10.926 1.00 0.00 ? 29  GLU B CD   6  
ATOM 10868 O OE1  . GLU B 2 31  ? -0.237  -6.712  -12.028 1.00 0.00 ? 29  GLU B OE1  6  
ATOM 10869 O OE2  . GLU B 2 31  ? 1.225   -5.908  -10.603 1.00 0.00 ? 29  GLU B OE2  6  
ATOM 10870 H H    . GLU B 2 31  ? -0.681  -4.854  -9.024  1.00 0.00 ? 29  GLU B H    6  
ATOM 10871 H HA   . GLU B 2 31  ? -1.448  -7.179  -7.386  1.00 0.00 ? 29  GLU B HA   6  
ATOM 10872 H HB2  . GLU B 2 31  ? 1.305   -6.932  -8.543  1.00 0.00 ? 29  GLU B HB2  6  
ATOM 10873 H HB3  . GLU B 2 31  ? 0.483   -8.365  -7.947  1.00 0.00 ? 29  GLU B HB3  6  
ATOM 10874 H HG2  . GLU B 2 31  ? 0.446   -8.729  -10.203 1.00 0.00 ? 29  GLU B HG2  6  
ATOM 10875 H HG3  . GLU B 2 31  ? -1.113  -7.941  -9.963  1.00 0.00 ? 29  GLU B HG3  6  
ATOM 10876 N N    . ARG B 2 32  ? 0.347   -4.612  -6.669  1.00 0.00 ? 30  ARG B N    6  
ATOM 10877 C CA   . ARG B 2 32  ? 1.084   -3.956  -5.598  1.00 0.00 ? 30  ARG B CA   6  
ATOM 10878 C C    . ARG B 2 32  ? 0.876   -2.453  -5.588  1.00 0.00 ? 30  ARG B C    6  
ATOM 10879 O O    . ARG B 2 32  ? 0.475   -1.861  -6.584  1.00 0.00 ? 30  ARG B O    6  
ATOM 10880 C CB   . ARG B 2 32  ? 2.583   -4.255  -5.749  1.00 0.00 ? 30  ARG B CB   6  
ATOM 10881 C CG   . ARG B 2 32  ? 3.329   -3.251  -6.622  1.00 0.00 ? 30  ARG B CG   6  
ATOM 10882 C CD   . ARG B 2 32  ? 4.379   -3.926  -7.483  1.00 0.00 ? 30  ARG B CD   6  
ATOM 10883 N NE   . ARG B 2 32  ? 3.788   -4.570  -8.653  1.00 0.00 ? 30  ARG B NE   6  
ATOM 10884 C CZ   . ARG B 2 32  ? 4.329   -4.543  -9.869  1.00 0.00 ? 30  ARG B CZ   6  
ATOM 10885 N NH1  . ARG B 2 32  ? 5.474   -3.904  -10.082 1.00 0.00 ? 30  ARG B NH1  6  
ATOM 10886 N NH2  . ARG B 2 32  ? 3.720   -5.140  -10.879 1.00 0.00 ? 30  ARG B NH2  6  
ATOM 10887 H H    . ARG B 2 32  ? 0.013   -4.083  -7.430  1.00 0.00 ? 30  ARG B H    6  
ATOM 10888 H HA   . ARG B 2 32  ? 0.742   -4.362  -4.660  1.00 0.00 ? 30  ARG B HA   6  
ATOM 10889 H HB2  . ARG B 2 32  ? 3.037   -4.253  -4.769  1.00 0.00 ? 30  ARG B HB2  6  
ATOM 10890 H HB3  . ARG B 2 32  ? 2.699   -5.235  -6.186  1.00 0.00 ? 30  ARG B HB3  6  
ATOM 10891 H HG2  . ARG B 2 32  ? 2.619   -2.753  -7.268  1.00 0.00 ? 30  ARG B HG2  6  
ATOM 10892 H HG3  . ARG B 2 32  ? 3.811   -2.521  -5.987  1.00 0.00 ? 30  ARG B HG3  6  
ATOM 10893 H HD2  . ARG B 2 32  ? 5.090   -3.183  -7.812  1.00 0.00 ? 30  ARG B HD2  6  
ATOM 10894 H HD3  . ARG B 2 32  ? 4.887   -4.673  -6.890  1.00 0.00 ? 30  ARG B HD3  6  
ATOM 10895 H HE   . ARG B 2 32  ? 2.937   -5.044  -8.529  1.00 0.00 ? 30  ARG B HE   6  
ATOM 10896 H HH11 . ARG B 2 32  ? 5.942   -3.444  -9.331  1.00 0.00 ? 30  ARG B HH11 6  
ATOM 10897 H HH12 . ARG B 2 32  ? 5.865   -3.862  -11.022 1.00 0.00 ? 30  ARG B HH12 6  
ATOM 10898 H HH21 . ARG B 2 32  ? 2.832   -5.609  -10.738 1.00 0.00 ? 30  ARG B HH21 6  
ATOM 10899 H HH22 . ARG B 2 32  ? 4.154   -5.149  -11.797 1.00 0.00 ? 30  ARG B HH22 6  
ATOM 10900 N N    . ILE B 2 33  ? 1.166   -1.854  -4.450  1.00 0.00 ? 31  ILE B N    6  
ATOM 10901 C CA   . ILE B 2 33  ? 1.066   -0.420  -4.281  1.00 0.00 ? 31  ILE B CA   6  
ATOM 10902 C C    . ILE B 2 33  ? 2.474   0.163   -4.273  1.00 0.00 ? 31  ILE B C    6  
ATOM 10903 O O    . ILE B 2 33  ? 3.305   -0.199  -3.434  1.00 0.00 ? 31  ILE B O    6  
ATOM 10904 C CB   . ILE B 2 33  ? 0.313   -0.038  -2.978  1.00 0.00 ? 31  ILE B CB   6  
ATOM 10905 C CG1  . ILE B 2 33  ? 0.722   1.363   -2.507  1.00 0.00 ? 31  ILE B CG1  6  
ATOM 10906 C CG2  . ILE B 2 33  ? 0.558   -1.067  -1.882  1.00 0.00 ? 31  ILE B CG2  6  
ATOM 10907 C CD1  . ILE B 2 33  ? -0.085  1.870   -1.332  1.00 0.00 ? 31  ILE B CD1  6  
ATOM 10908 H H    . ILE B 2 33  ? 1.476   -2.400  -3.691  1.00 0.00 ? 31  ILE B H    6  
ATOM 10909 H HA   . ILE B 2 33  ? 0.521   -0.019  -5.126  1.00 0.00 ? 31  ILE B HA   6  
ATOM 10910 H HB   . ILE B 2 33  ? -0.745  -0.036  -3.196  1.00 0.00 ? 31  ILE B HB   6  
ATOM 10911 H HG12 . ILE B 2 33  ? 1.760   1.347   -2.211  1.00 0.00 ? 31  ILE B HG12 6  
ATOM 10912 H HG13 . ILE B 2 33  ? 0.596   2.060   -3.323  1.00 0.00 ? 31  ILE B HG13 6  
ATOM 10913 H HG21 . ILE B 2 33  ? 0.022   -0.779  -0.990  1.00 0.00 ? 31  ILE B HG21 6  
ATOM 10914 H HG22 . ILE B 2 33  ? 1.615   -1.120  -1.665  1.00 0.00 ? 31  ILE B HG22 6  
ATOM 10915 H HG23 . ILE B 2 33  ? 0.211   -2.035  -2.212  1.00 0.00 ? 31  ILE B HG23 6  
ATOM 10916 H HD11 . ILE B 2 33  ? 0.293   2.835   -1.027  1.00 0.00 ? 31  ILE B HD11 6  
ATOM 10917 H HD12 . ILE B 2 33  ? 0.001   1.174   -0.512  1.00 0.00 ? 31  ILE B HD12 6  
ATOM 10918 H HD13 . ILE B 2 33  ? -1.121  1.962   -1.621  1.00 0.00 ? 31  ILE B HD13 6  
ATOM 10919 N N    . ALA B 2 34  ? 2.752   1.025   -5.233  1.00 0.00 ? 32  ALA B N    6  
ATOM 10920 C CA   . ALA B 2 34  ? 4.058   1.644   -5.337  1.00 0.00 ? 32  ALA B CA   6  
ATOM 10921 C C    . ALA B 2 34  ? 3.941   3.151   -5.209  1.00 0.00 ? 32  ALA B C    6  
ATOM 10922 O O    . ALA B 2 34  ? 2.897   3.728   -5.485  1.00 0.00 ? 32  ALA B O    6  
ATOM 10923 C CB   . ALA B 2 34  ? 4.722   1.268   -6.653  1.00 0.00 ? 32  ALA B CB   6  
ATOM 10924 H H    . ALA B 2 34  ? 2.056   1.266   -5.886  1.00 0.00 ? 32  ALA B H    6  
ATOM 10925 H HA   . ALA B 2 34  ? 4.672   1.269   -4.530  1.00 0.00 ? 32  ALA B HA   6  
ATOM 10926 H HB1  . ALA B 2 34  ? 5.739   1.633   -6.660  1.00 0.00 ? 32  ALA B HB1  6  
ATOM 10927 H HB2  . ALA B 2 34  ? 4.174   1.713   -7.471  1.00 0.00 ? 32  ALA B HB2  6  
ATOM 10928 H HB3  . ALA B 2 34  ? 4.723   0.194   -6.761  1.00 0.00 ? 32  ALA B HB3  6  
ATOM 10929 N N    . TRP B 2 35  ? 5.004   3.785   -4.766  1.00 0.00 ? 33  TRP B N    6  
ATOM 10930 C CA   . TRP B 2 35  ? 5.009   5.224   -4.607  1.00 0.00 ? 33  TRP B CA   6  
ATOM 10931 C C    . TRP B 2 35  ? 6.402   5.771   -4.892  1.00 0.00 ? 33  TRP B C    6  
ATOM 10932 O O    . TRP B 2 35  ? 7.401   5.268   -4.370  1.00 0.00 ? 33  TRP B O    6  
ATOM 10933 C CB   . TRP B 2 35  ? 4.513   5.584   -3.200  1.00 0.00 ? 33  TRP B CB   6  
ATOM 10934 C CG   . TRP B 2 35  ? 4.696   7.019   -2.805  1.00 0.00 ? 33  TRP B CG   6  
ATOM 10935 C CD1  . TRP B 2 35  ? 3.797   8.025   -2.980  1.00 0.00 ? 33  TRP B CD1  6  
ATOM 10936 C CD2  . TRP B 2 35  ? 5.829   7.605   -2.150  1.00 0.00 ? 33  TRP B CD2  6  
ATOM 10937 N NE1  . TRP B 2 35  ? 4.297   9.200   -2.489  1.00 0.00 ? 33  TRP B NE1  6  
ATOM 10938 C CE2  . TRP B 2 35  ? 5.545   8.970   -1.972  1.00 0.00 ? 33  TRP B CE2  6  
ATOM 10939 C CE3  . TRP B 2 35  ? 7.056   7.110   -1.701  1.00 0.00 ? 33  TRP B CE3  6  
ATOM 10940 C CZ2  . TRP B 2 35  ? 6.440   9.844   -1.363  1.00 0.00 ? 33  TRP B CZ2  6  
ATOM 10941 C CZ3  . TRP B 2 35  ? 7.944   7.979   -1.095  1.00 0.00 ? 33  TRP B CZ3  6  
ATOM 10942 C CH2  . TRP B 2 35  ? 7.632   9.332   -0.930  1.00 0.00 ? 33  TRP B CH2  6  
ATOM 10943 H H    . TRP B 2 35  ? 5.810   3.271   -4.537  1.00 0.00 ? 33  TRP B H    6  
ATOM 10944 H HA   . TRP B 2 35  ? 4.325   5.634   -5.336  1.00 0.00 ? 33  TRP B HA   6  
ATOM 10945 H HB2  . TRP B 2 35  ? 3.458   5.373   -3.150  1.00 0.00 ? 33  TRP B HB2  6  
ATOM 10946 H HB3  . TRP B 2 35  ? 5.011   4.969   -2.480  1.00 0.00 ? 33  TRP B HB3  6  
ATOM 10947 H HD1  . TRP B 2 35  ? 2.834   7.901   -3.450  1.00 0.00 ? 33  TRP B HD1  6  
ATOM 10948 H HE1  . TRP B 2 35  ? 3.831   10.064  -2.504  1.00 0.00 ? 33  TRP B HE1  6  
ATOM 10949 H HE3  . TRP B 2 35  ? 7.315   6.069   -1.818  1.00 0.00 ? 33  TRP B HE3  6  
ATOM 10950 H HZ2  . TRP B 2 35  ? 6.214   10.892  -1.229  1.00 0.00 ? 33  TRP B HZ2  6  
ATOM 10951 H HZ3  . TRP B 2 35  ? 8.896   7.612   -0.741  1.00 0.00 ? 33  TRP B HZ3  6  
ATOM 10952 H HH2  . TRP B 2 35  ? 8.356   9.976   -0.453  1.00 0.00 ? 33  TRP B HH2  6  
ATOM 10953 N N    . ALA B 2 36  ? 6.463   6.779   -5.749  1.00 0.00 ? 34  ALA B N    6  
ATOM 10954 C CA   . ALA B 2 36  ? 7.723   7.396   -6.122  1.00 0.00 ? 34  ALA B CA   6  
ATOM 10955 C C    . ALA B 2 36  ? 7.818   8.794   -5.539  1.00 0.00 ? 34  ALA B C    6  
ATOM 10956 O O    . ALA B 2 36  ? 6.965   9.641   -5.801  1.00 0.00 ? 34  ALA B O    6  
ATOM 10957 C CB   . ALA B 2 36  ? 7.868   7.445   -7.635  1.00 0.00 ? 34  ALA B CB   6  
ATOM 10958 H H    . ALA B 2 36  ? 5.626   7.135   -6.128  1.00 0.00 ? 34  ALA B H    6  
ATOM 10959 H HA   . ALA B 2 36  ? 8.524   6.790   -5.723  1.00 0.00 ? 34  ALA B HA   6  
ATOM 10960 H HB1  . ALA B 2 36  ? 7.791   6.445   -8.036  1.00 0.00 ? 34  ALA B HB1  6  
ATOM 10961 H HB2  . ALA B 2 36  ? 8.830   7.862   -7.891  1.00 0.00 ? 34  ALA B HB2  6  
ATOM 10962 H HB3  . ALA B 2 36  ? 7.085   8.060   -8.052  1.00 0.00 ? 34  ALA B HB3  6  
ATOM 10963 N N    . PRO B 2 37  ? 8.852   9.051   -4.733  1.00 0.00 ? 35  PRO B N    6  
ATOM 10964 C CA   . PRO B 2 37  ? 9.055   10.355  -4.111  1.00 0.00 ? 35  PRO B CA   6  
ATOM 10965 C C    . PRO B 2 37  ? 9.430   11.419  -5.135  1.00 0.00 ? 35  PRO B C    6  
ATOM 10966 O O    . PRO B 2 37  ? 10.218  11.166  -6.051  1.00 0.00 ? 35  PRO B O    6  
ATOM 10967 C CB   . PRO B 2 37  ? 10.205  10.114  -3.133  1.00 0.00 ? 35  PRO B CB   6  
ATOM 10968 C CG   . PRO B 2 37  ? 10.931  8.931   -3.672  1.00 0.00 ? 35  PRO B CG   6  
ATOM 10969 C CD   . PRO B 2 37  ? 9.903   8.088   -4.372  1.00 0.00 ? 35  PRO B CD   6  
ATOM 10970 H HA   . PRO B 2 37  ? 8.176   10.674  -3.569  1.00 0.00 ? 35  PRO B HA   6  
ATOM 10971 H HB2  . PRO B 2 37  ? 10.840  10.987  -3.101  1.00 0.00 ? 35  PRO B HB2  6  
ATOM 10972 H HB3  . PRO B 2 37  ? 9.806   9.917   -2.148  1.00 0.00 ? 35  PRO B HB3  6  
ATOM 10973 H HG2  . PRO B 2 37  ? 11.689  9.254   -4.370  1.00 0.00 ? 35  PRO B HG2  6  
ATOM 10974 H HG3  . PRO B 2 37  ? 11.380  8.376   -2.860  1.00 0.00 ? 35  PRO B HG3  6  
ATOM 10975 H HD2  . PRO B 2 37  ? 10.328  7.633   -5.255  1.00 0.00 ? 35  PRO B HD2  6  
ATOM 10976 H HD3  . PRO B 2 37  ? 9.519   7.331   -3.704  1.00 0.00 ? 35  PRO B HD3  6  
ATOM 10977 N N    . GLU B 2 38  ? 8.870   12.608  -4.968  1.00 0.00 ? 36  GLU B N    6  
ATOM 10978 C CA   . GLU B 2 38  ? 9.129   13.715  -5.873  1.00 0.00 ? 36  GLU B CA   6  
ATOM 10979 C C    . GLU B 2 38  ? 10.620  14.026  -5.928  1.00 0.00 ? 36  GLU B C    6  
ATOM 10980 O O    . GLU B 2 38  ? 11.298  14.098  -4.894  1.00 0.00 ? 36  GLU B O    6  
ATOM 10981 C CB   . GLU B 2 38  ? 8.329   14.950  -5.446  1.00 0.00 ? 36  GLU B CB   6  
ATOM 10982 C CG   . GLU B 2 38  ? 6.877   14.916  -5.901  1.00 0.00 ? 36  GLU B CG   6  
ATOM 10983 C CD   . GLU B 2 38  ? 6.038   16.020  -5.286  1.00 0.00 ? 36  GLU B CD   6  
ATOM 10984 O OE1  . GLU B 2 38  ? 6.494   17.181  -5.264  1.00 0.00 ? 36  GLU B OE1  6  
ATOM 10985 O OE2  . GLU B 2 38  ? 4.911   15.733  -4.820  1.00 0.00 ? 36  GLU B OE2  6  
ATOM 10986 H H    . GLU B 2 38  ? 8.270   12.749  -4.200  1.00 0.00 ? 36  GLU B H    6  
ATOM 10987 H HA   . GLU B 2 38  ? 8.804   13.413  -6.858  1.00 0.00 ? 36  GLU B HA   6  
ATOM 10988 H HB2  . GLU B 2 38  ? 8.346   15.020  -4.368  1.00 0.00 ? 36  GLU B HB2  6  
ATOM 10989 H HB3  . GLU B 2 38  ? 8.796   15.829  -5.864  1.00 0.00 ? 36  GLU B HB3  6  
ATOM 10990 H HG2  . GLU B 2 38  ? 6.848   15.022  -6.974  1.00 0.00 ? 36  GLU B HG2  6  
ATOM 10991 H HG3  . GLU B 2 38  ? 6.448   13.963  -5.624  1.00 0.00 ? 36  GLU B HG3  6  
ATOM 10992 N N    . GLY B 2 39  ? 11.132  14.161  -7.140  1.00 0.00 ? 37  GLY B N    6  
ATOM 10993 C CA   . GLY B 2 39  ? 12.537  14.450  -7.327  1.00 0.00 ? 37  GLY B CA   6  
ATOM 10994 C C    . GLY B 2 39  ? 13.345  13.199  -7.608  1.00 0.00 ? 37  GLY B C    6  
ATOM 10995 O O    . GLY B 2 39  ? 14.533  13.277  -7.904  1.00 0.00 ? 37  GLY B O    6  
ATOM 10996 H H    . GLY B 2 39  ? 10.547  14.061  -7.921  1.00 0.00 ? 37  GLY B H    6  
ATOM 10997 H HA2  . GLY B 2 39  ? 12.645  15.132  -8.158  1.00 0.00 ? 37  GLY B HA2  6  
ATOM 10998 H HA3  . GLY B 2 39  ? 12.920  14.921  -6.434  1.00 0.00 ? 37  GLY B HA3  6  
ATOM 10999 N N    . LYS B 2 40  ? 12.703  12.042  -7.490  1.00 0.00 ? 38  LYS B N    6  
ATOM 11000 C CA   . LYS B 2 40  ? 13.372  10.771  -7.740  1.00 0.00 ? 38  LYS B CA   6  
ATOM 11001 C C    . LYS B 2 40  ? 12.790  10.093  -8.974  1.00 0.00 ? 38  LYS B C    6  
ATOM 11002 O O    . LYS B 2 40  ? 11.628  10.307  -9.321  1.00 0.00 ? 38  LYS B O    6  
ATOM 11003 C CB   . LYS B 2 40  ? 13.265  9.851   -6.520  1.00 0.00 ? 38  LYS B CB   6  
ATOM 11004 C CG   . LYS B 2 40  ? 14.428  9.992   -5.544  1.00 0.00 ? 38  LYS B CG   6  
ATOM 11005 C CD   . LYS B 2 40  ? 14.436  11.354  -4.861  1.00 0.00 ? 38  LYS B CD   6  
ATOM 11006 C CE   . LYS B 2 40  ? 13.339  11.458  -3.815  1.00 0.00 ? 38  LYS B CE   6  
ATOM 11007 N NZ   . LYS B 2 40  ? 13.195  12.838  -3.278  1.00 0.00 ? 38  LYS B NZ   6  
ATOM 11008 H H    . LYS B 2 40  ? 11.752  12.040  -7.244  1.00 0.00 ? 38  LYS B H    6  
ATOM 11009 H HA   . LYS B 2 40  ? 14.415  10.981  -7.926  1.00 0.00 ? 38  LYS B HA   6  
ATOM 11010 H HB2  . LYS B 2 40  ? 12.350  10.077  -5.992  1.00 0.00 ? 38  LYS B HB2  6  
ATOM 11011 H HB3  . LYS B 2 40  ? 13.232  8.826   -6.859  1.00 0.00 ? 38  LYS B HB3  6  
ATOM 11012 H HG2  . LYS B 2 40  ? 14.344  9.225   -4.788  1.00 0.00 ? 38  LYS B HG2  6  
ATOM 11013 H HG3  . LYS B 2 40  ? 15.354  9.866   -6.084  1.00 0.00 ? 38  LYS B HG3  6  
ATOM 11014 H HD2  . LYS B 2 40  ? 15.392  11.500  -4.380  1.00 0.00 ? 38  LYS B HD2  6  
ATOM 11015 H HD3  . LYS B 2 40  ? 14.286  12.121  -5.606  1.00 0.00 ? 38  LYS B HD3  6  
ATOM 11016 H HE2  . LYS B 2 40  ? 12.403  11.161  -4.266  1.00 0.00 ? 38  LYS B HE2  6  
ATOM 11017 H HE3  . LYS B 2 40  ? 13.573  10.787  -3.002  1.00 0.00 ? 38  LYS B HE3  6  
ATOM 11018 H HZ1  . LYS B 2 40  ? 12.780  12.803  -2.320  1.00 0.00 ? 38  LYS B HZ1  6  
ATOM 11019 H HZ2  . LYS B 2 40  ? 12.565  13.400  -3.894  1.00 0.00 ? 38  LYS B HZ2  6  
ATOM 11020 H HZ3  . LYS B 2 40  ? 14.122  13.304  -3.227  1.00 0.00 ? 38  LYS B HZ3  6  
ATOM 11021 N N    . ASP B 2 41  ? 13.606  9.278   -9.625  1.00 0.00 ? 39  ASP B N    6  
ATOM 11022 C CA   . ASP B 2 41  ? 13.205  8.566   -10.835 1.00 0.00 ? 39  ASP B CA   6  
ATOM 11023 C C    . ASP B 2 41  ? 12.770  7.138   -10.521 1.00 0.00 ? 39  ASP B C    6  
ATOM 11024 O O    . ASP B 2 41  ? 12.263  6.427   -11.387 1.00 0.00 ? 39  ASP B O    6  
ATOM 11025 C CB   . ASP B 2 41  ? 14.376  8.529   -11.824 1.00 0.00 ? 39  ASP B CB   6  
ATOM 11026 C CG   . ASP B 2 41  ? 15.538  7.687   -11.319 1.00 0.00 ? 39  ASP B CG   6  
ATOM 11027 O OD1  . ASP B 2 41  ? 15.799  7.690   -10.091 1.00 0.00 ? 39  ASP B OD1  6  
ATOM 11028 O OD2  . ASP B 2 41  ? 16.199  7.015   -12.138 1.00 0.00 ? 39  ASP B OD2  6  
ATOM 11029 H H    . ASP B 2 41  ? 14.521  9.149   -9.289  1.00 0.00 ? 39  ASP B H    6  
ATOM 11030 H HA   . ASP B 2 41  ? 12.380  9.098   -11.282 1.00 0.00 ? 39  ASP B HA   6  
ATOM 11031 H HB2  . ASP B 2 41  ? 14.035  8.112   -12.760 1.00 0.00 ? 39  ASP B HB2  6  
ATOM 11032 H HB3  . ASP B 2 41  ? 14.729  9.536   -11.992 1.00 0.00 ? 39  ASP B HB3  6  
ATOM 11033 N N    . ARG B 2 42  ? 12.959  6.723   -9.279  1.00 0.00 ? 40  ARG B N    6  
ATOM 11034 C CA   . ARG B 2 42  ? 12.610  5.372   -8.876  1.00 0.00 ? 40  ARG B CA   6  
ATOM 11035 C C    . ARG B 2 42  ? 11.649  5.361   -7.696  1.00 0.00 ? 40  ARG B C    6  
ATOM 11036 O O    . ARG B 2 42  ? 11.635  6.283   -6.877  1.00 0.00 ? 40  ARG B O    6  
ATOM 11037 C CB   . ARG B 2 42  ? 13.878  4.584   -8.533  1.00 0.00 ? 40  ARG B CB   6  
ATOM 11038 C CG   . ARG B 2 42  ? 14.795  5.294   -7.549  1.00 0.00 ? 40  ARG B CG   6  
ATOM 11039 C CD   . ARG B 2 42  ? 16.255  4.975   -7.828  1.00 0.00 ? 40  ARG B CD   6  
ATOM 11040 N NE   . ARG B 2 42  ? 16.642  5.360   -9.186  1.00 0.00 ? 40  ARG B NE   6  
ATOM 11041 C CZ   . ARG B 2 42  ? 17.457  4.658   -9.969  1.00 0.00 ? 40  ARG B CZ   6  
ATOM 11042 N NH1  . ARG B 2 42  ? 18.043  3.555   -9.513  1.00 0.00 ? 40  ARG B NH1  6  
ATOM 11043 N NH2  . ARG B 2 42  ? 17.685  5.066   -11.211 1.00 0.00 ? 40  ARG B NH2  6  
ATOM 11044 H H    . ARG B 2 42  ? 13.330  7.343   -8.619  1.00 0.00 ? 40  ARG B H    6  
ATOM 11045 H HA   . ARG B 2 42  ? 12.126  4.897   -9.716  1.00 0.00 ? 40  ARG B HA   6  
ATOM 11046 H HB2  . ARG B 2 42  ? 13.592  3.635   -8.105  1.00 0.00 ? 40  ARG B HB2  6  
ATOM 11047 H HB3  . ARG B 2 42  ? 14.431  4.406   -9.443  1.00 0.00 ? 40  ARG B HB3  6  
ATOM 11048 H HG2  . ARG B 2 42  ? 14.647  6.361   -7.637  1.00 0.00 ? 40  ARG B HG2  6  
ATOM 11049 H HG3  . ARG B 2 42  ? 14.550  4.975   -6.546  1.00 0.00 ? 40  ARG B HG3  6  
ATOM 11050 H HD2  . ARG B 2 42  ? 16.869  5.511   -7.121  1.00 0.00 ? 40  ARG B HD2  6  
ATOM 11051 H HD3  . ARG B 2 42  ? 16.408  3.912   -7.707  1.00 0.00 ? 40  ARG B HD3  6  
ATOM 11052 H HE   . ARG B 2 42  ? 16.246  6.204   -9.547  1.00 0.00 ? 40  ARG B HE   6  
ATOM 11053 H HH11 . ARG B 2 42  ? 17.874  3.248   -8.575  1.00 0.00 ? 40  ARG B HH11 6  
ATOM 11054 H HH12 . ARG B 2 42  ? 18.656  3.029   -10.103 1.00 0.00 ? 40  ARG B HH12 6  
ATOM 11055 H HH21 . ARG B 2 42  ? 17.230  5.912   -11.559 1.00 0.00 ? 40  ARG B HH21 6  
ATOM 11056 H HH22 . ARG B 2 42  ? 18.294  4.555   -11.812 1.00 0.00 ? 40  ARG B HH22 6  
ATOM 11057 N N    . PHE B 2 43  ? 10.850  4.307   -7.624  1.00 0.00 ? 41  PHE B N    6  
ATOM 11058 C CA   . PHE B 2 43  ? 9.878   4.138   -6.554  1.00 0.00 ? 41  PHE B CA   6  
ATOM 11059 C C    . PHE B 2 43  ? 10.565  3.587   -5.312  1.00 0.00 ? 41  PHE B C    6  
ATOM 11060 O O    . PHE B 2 43  ? 11.177  2.522   -5.360  1.00 0.00 ? 41  PHE B O    6  
ATOM 11061 C CB   . PHE B 2 43  ? 8.767   3.169   -6.982  1.00 0.00 ? 41  PHE B CB   6  
ATOM 11062 C CG   . PHE B 2 43  ? 8.041   3.560   -8.240  1.00 0.00 ? 41  PHE B CG   6  
ATOM 11063 C CD1  . PHE B 2 43  ? 6.790   4.149   -8.175  1.00 0.00 ? 41  PHE B CD1  6  
ATOM 11064 C CD2  . PHE B 2 43  ? 8.603   3.327   -9.487  1.00 0.00 ? 41  PHE B CD2  6  
ATOM 11065 C CE1  . PHE B 2 43  ? 6.113   4.500   -9.326  1.00 0.00 ? 41  PHE B CE1  6  
ATOM 11066 C CE2  . PHE B 2 43  ? 7.930   3.679   -10.643 1.00 0.00 ? 41  PHE B CE2  6  
ATOM 11067 C CZ   . PHE B 2 43  ? 6.683   4.266   -10.561 1.00 0.00 ? 41  PHE B CZ   6  
ATOM 11068 H H    . PHE B 2 43  ? 10.918  3.616   -8.313  1.00 0.00 ? 41  PHE B H    6  
ATOM 11069 H HA   . PHE B 2 43  ? 9.448   5.101   -6.328  1.00 0.00 ? 41  PHE B HA   6  
ATOM 11070 H HB2  . PHE B 2 43  ? 9.200   2.193   -7.145  1.00 0.00 ? 41  PHE B HB2  6  
ATOM 11071 H HB3  . PHE B 2 43  ? 8.039   3.101   -6.187  1.00 0.00 ? 41  PHE B HB3  6  
ATOM 11072 H HD1  . PHE B 2 43  ? 6.341   4.336   -7.211  1.00 0.00 ? 41  PHE B HD1  6  
ATOM 11073 H HD2  . PHE B 2 43  ? 9.578   2.868   -9.552  1.00 0.00 ? 41  PHE B HD2  6  
ATOM 11074 H HE1  . PHE B 2 43  ? 5.137   4.959   -9.260  1.00 0.00 ? 41  PHE B HE1  6  
ATOM 11075 H HE2  . PHE B 2 43  ? 8.379   3.494   -11.607 1.00 0.00 ? 41  PHE B HE2  6  
ATOM 11076 H HZ   . PHE B 2 43  ? 6.154   4.541   -11.462 1.00 0.00 ? 41  PHE B HZ   6  
ATOM 11077 N N    . THR B 2 44  ? 10.474  4.310   -4.209  1.00 0.00 ? 42  THR B N    6  
ATOM 11078 C CA   . THR B 2 44  ? 11.083  3.863   -2.966  1.00 0.00 ? 42  THR B CA   6  
ATOM 11079 C C    . THR B 2 44  ? 10.081  3.050   -2.154  1.00 0.00 ? 42  THR B C    6  
ATOM 11080 O O    . THR B 2 44  ? 10.427  2.427   -1.151  1.00 0.00 ? 42  THR B O    6  
ATOM 11081 C CB   . THR B 2 44  ? 11.586  5.051   -2.129  1.00 0.00 ? 42  THR B CB   6  
ATOM 11082 O OG1  . THR B 2 44  ? 10.588  6.079   -2.094  1.00 0.00 ? 42  THR B OG1  6  
ATOM 11083 C CG2  . THR B 2 44  ? 12.878  5.610   -2.708  1.00 0.00 ? 42  THR B CG2  6  
ATOM 11084 H H    . THR B 2 44  ? 9.995   5.166   -4.228  1.00 0.00 ? 42  THR B H    6  
ATOM 11085 H HA   . THR B 2 44  ? 11.927  3.235   -3.213  1.00 0.00 ? 42  THR B HA   6  
ATOM 11086 H HB   . THR B 2 44  ? 11.777  4.709   -1.122  1.00 0.00 ? 42  THR B HB   6  
ATOM 11087 H HG1  . THR B 2 44  ? 9.925   5.858   -1.434  1.00 0.00 ? 42  THR B HG1  6  
ATOM 11088 H HG21 . THR B 2 44  ? 13.237  6.414   -2.082  1.00 0.00 ? 42  THR B HG21 6  
ATOM 11089 H HG22 . THR B 2 44  ? 12.694  5.985   -3.704  1.00 0.00 ? 42  THR B HG22 6  
ATOM 11090 H HG23 . THR B 2 44  ? 13.622  4.828   -2.750  1.00 0.00 ? 42  THR B HG23 6  
ATOM 11091 N N    . ILE B 2 45  ? 8.834   3.073   -2.601  1.00 0.00 ? 43  ILE B N    6  
ATOM 11092 C CA   . ILE B 2 45  ? 7.767   2.344   -1.942  1.00 0.00 ? 43  ILE B CA   6  
ATOM 11093 C C    . ILE B 2 45  ? 7.197   1.289   -2.878  1.00 0.00 ? 43  ILE B C    6  
ATOM 11094 O O    . ILE B 2 45  ? 6.731   1.609   -3.972  1.00 0.00 ? 43  ILE B O    6  
ATOM 11095 C CB   . ILE B 2 45  ? 6.634   3.294   -1.483  1.00 0.00 ? 43  ILE B CB   6  
ATOM 11096 C CG1  . ILE B 2 45  ? 7.081   4.109   -0.266  1.00 0.00 ? 43  ILE B CG1  6  
ATOM 11097 C CG2  . ILE B 2 45  ? 5.361   2.518   -1.169  1.00 0.00 ? 43  ILE B CG2  6  
ATOM 11098 C CD1  . ILE B 2 45  ? 7.384   3.270   0.956   1.00 0.00 ? 43  ILE B CD1  6  
ATOM 11099 H H    . ILE B 2 45  ? 8.627   3.594   -3.405  1.00 0.00 ? 43  ILE B H    6  
ATOM 11100 H HA   . ILE B 2 45  ? 8.180   1.856   -1.070  1.00 0.00 ? 43  ILE B HA   6  
ATOM 11101 H HB   . ILE B 2 45  ? 6.416   3.970   -2.295  1.00 0.00 ? 43  ILE B HB   6  
ATOM 11102 H HG12 . ILE B 2 45  ? 7.976   4.657   -0.518  1.00 0.00 ? 43  ILE B HG12 6  
ATOM 11103 H HG13 . ILE B 2 45  ? 6.300   4.808   -0.003  1.00 0.00 ? 43  ILE B HG13 6  
ATOM 11104 H HG21 . ILE B 2 45  ? 5.041   1.980   -2.048  1.00 0.00 ? 43  ILE B HG21 6  
ATOM 11105 H HG22 . ILE B 2 45  ? 4.585   3.207   -0.866  1.00 0.00 ? 43  ILE B HG22 6  
ATOM 11106 H HG23 . ILE B 2 45  ? 5.553   1.820   -0.368  1.00 0.00 ? 43  ILE B HG23 6  
ATOM 11107 H HD11 . ILE B 2 45  ? 7.708   3.912   1.761   1.00 0.00 ? 43  ILE B HD11 6  
ATOM 11108 H HD12 . ILE B 2 45  ? 8.165   2.563   0.721   1.00 0.00 ? 43  ILE B HD12 6  
ATOM 11109 H HD13 . ILE B 2 45  ? 6.493   2.737   1.256   1.00 0.00 ? 43  ILE B HD13 6  
ATOM 11110 N N    . SER B 2 46  ? 7.280   0.037   -2.461  1.00 0.00 ? 44  SER B N    6  
ATOM 11111 C CA   . SER B 2 46  ? 6.759   -1.068  -3.241  1.00 0.00 ? 44  SER B CA   6  
ATOM 11112 C C    . SER B 2 46  ? 6.269   -2.162  -2.300  1.00 0.00 ? 44  SER B C    6  
ATOM 11113 O O    . SER B 2 46  ? 7.064   -2.920  -1.747  1.00 0.00 ? 44  SER B O    6  
ATOM 11114 C CB   . SER B 2 46  ? 7.838   -1.613  -4.185  1.00 0.00 ? 44  SER B CB   6  
ATOM 11115 O OG   . SER B 2 46  ? 7.319   -2.614  -5.047  1.00 0.00 ? 44  SER B OG   6  
ATOM 11116 H H    . SER B 2 46  ? 7.704   -0.150  -1.598  1.00 0.00 ? 44  SER B H    6  
ATOM 11117 H HA   . SER B 2 46  ? 5.925   -0.705  -3.824  1.00 0.00 ? 44  SER B HA   6  
ATOM 11118 H HB2  . SER B 2 46  ? 8.225   -0.805  -4.787  1.00 0.00 ? 44  SER B HB2  6  
ATOM 11119 H HB3  . SER B 2 46  ? 8.640   -2.040  -3.600  1.00 0.00 ? 44  SER B HB3  6  
ATOM 11120 H HG   . SER B 2 46  ? 7.868   -3.400  -4.986  1.00 0.00 ? 44  SER B HG   6  
ATOM 11121 N N    . HIS B 2 47  ? 4.961   -2.228  -2.106  1.00 0.00 ? 45  HIS B N    6  
ATOM 11122 C CA   . HIS B 2 47  ? 4.376   -3.230  -1.225  1.00 0.00 ? 45  HIS B CA   6  
ATOM 11123 C C    . HIS B 2 47  ? 3.309   -4.010  -1.970  1.00 0.00 ? 45  HIS B C    6  
ATOM 11124 O O    . HIS B 2 47  ? 2.471   -3.425  -2.651  1.00 0.00 ? 45  HIS B O    6  
ATOM 11125 C CB   . HIS B 2 47  ? 3.748   -2.580  0.016   1.00 0.00 ? 45  HIS B CB   6  
ATOM 11126 C CG   . HIS B 2 47  ? 4.649   -1.628  0.742   1.00 0.00 ? 45  HIS B CG   6  
ATOM 11127 N ND1  . HIS B 2 47  ? 5.552   -2.005  1.712   1.00 0.00 ? 45  HIS B ND1  6  
ATOM 11128 C CD2  . HIS B 2 47  ? 4.774   -0.285  0.615   1.00 0.00 ? 45  HIS B CD2  6  
ATOM 11129 C CE1  . HIS B 2 47  ? 6.186   -0.903  2.132   1.00 0.00 ? 45  HIS B CE1  6  
ATOM 11130 N NE2  . HIS B 2 47  ? 5.751   0.168   1.496   1.00 0.00 ? 45  HIS B NE2  6  
ATOM 11131 H H    . HIS B 2 47  ? 4.372   -1.587  -2.565  1.00 0.00 ? 45  HIS B H    6  
ATOM 11132 H HA   . HIS B 2 47  ? 5.158   -3.907  -0.917  1.00 0.00 ? 45  HIS B HA   6  
ATOM 11133 H HB2  . HIS B 2 47  ? 2.868   -2.033  -0.284  1.00 0.00 ? 45  HIS B HB2  6  
ATOM 11134 H HB3  . HIS B 2 47  ? 3.458   -3.357  0.709   1.00 0.00 ? 45  HIS B HB3  6  
ATOM 11135 H HD1  . HIS B 2 47  ? 5.695   -2.915  2.048   1.00 0.00 ? 45  HIS B HD1  6  
ATOM 11136 H HD2  . HIS B 2 47  ? 4.200   0.346   -0.052  1.00 0.00 ? 45  HIS B HD2  6  
ATOM 11137 H HE1  . HIS B 2 47  ? 6.953   -0.892  2.894   1.00 0.00 ? 45  HIS B HE1  6  
ATOM 11138 N N    . MET B 2 48  ? 3.341   -5.322  -1.862  1.00 0.00 ? 46  MET B N    6  
ATOM 11139 C CA   . MET B 2 48  ? 2.348   -6.143  -2.526  1.00 0.00 ? 46  MET B CA   6  
ATOM 11140 C C    . MET B 2 48  ? 1.131   -6.284  -1.632  1.00 0.00 ? 46  MET B C    6  
ATOM 11141 O O    . MET B 2 48  ? 1.264   -6.371  -0.415  1.00 0.00 ? 46  MET B O    6  
ATOM 11142 C CB   . MET B 2 48  ? 2.909   -7.527  -2.868  1.00 0.00 ? 46  MET B CB   6  
ATOM 11143 C CG   . MET B 2 48  ? 3.938   -7.510  -3.985  1.00 0.00 ? 46  MET B CG   6  
ATOM 11144 S SD   . MET B 2 48  ? 4.153   -9.127  -4.756  1.00 0.00 ? 46  MET B SD   6  
ATOM 11145 C CE   . MET B 2 48  ? 2.570   -9.331  -5.569  1.00 0.00 ? 46  MET B CE   6  
ATOM 11146 H H    . MET B 2 48  ? 4.034   -5.749  -1.312  1.00 0.00 ? 46  MET B H    6  
ATOM 11147 H HA   . MET B 2 48  ? 2.058   -5.643  -3.438  1.00 0.00 ? 46  MET B HA   6  
ATOM 11148 H HB2  . MET B 2 48  ? 3.374   -7.941  -1.986  1.00 0.00 ? 46  MET B HB2  6  
ATOM 11149 H HB3  . MET B 2 48  ? 2.094   -8.167  -3.169  1.00 0.00 ? 46  MET B HB3  6  
ATOM 11150 H HG2  . MET B 2 48  ? 3.618   -6.807  -4.740  1.00 0.00 ? 46  MET B HG2  6  
ATOM 11151 H HG3  . MET B 2 48  ? 4.886   -7.192  -3.577  1.00 0.00 ? 46  MET B HG3  6  
ATOM 11152 H HE1  . MET B 2 48  ? 2.403   -8.505  -6.245  1.00 0.00 ? 46  MET B HE1  6  
ATOM 11153 H HE2  . MET B 2 48  ? 1.785   -9.354  -4.829  1.00 0.00 ? 46  MET B HE2  6  
ATOM 11154 H HE3  . MET B 2 48  ? 2.568   -10.258 -6.125  1.00 0.00 ? 46  MET B HE3  6  
ATOM 11155 N N    . TYR B 2 49  ? -0.050  -6.301  -2.235  1.00 0.00 ? 47  TYR B N    6  
ATOM 11156 C CA   . TYR B 2 49  ? -1.303  -6.443  -1.480  1.00 0.00 ? 47  TYR B CA   6  
ATOM 11157 C C    . TYR B 2 49  ? -1.300  -7.759  -0.709  1.00 0.00 ? 47  TYR B C    6  
ATOM 11158 O O    . TYR B 2 49  ? -1.987  -7.908  0.296   1.00 0.00 ? 47  TYR B O    6  
ATOM 11159 C CB   . TYR B 2 49  ? -2.483  -6.405  -2.446  1.00 0.00 ? 47  TYR B CB   6  
ATOM 11160 C CG   . TYR B 2 49  ? -2.498  -5.174  -3.316  1.00 0.00 ? 47  TYR B CG   6  
ATOM 11161 C CD1  . TYR B 2 49  ? -2.760  -5.260  -4.672  1.00 0.00 ? 47  TYR B CD1  6  
ATOM 11162 C CD2  . TYR B 2 49  ? -2.240  -3.923  -2.776  1.00 0.00 ? 47  TYR B CD2  6  
ATOM 11163 C CE1  . TYR B 2 49  ? -2.766  -4.133  -5.467  1.00 0.00 ? 47  TYR B CE1  6  
ATOM 11164 C CE2  . TYR B 2 49  ? -2.245  -2.791  -3.563  1.00 0.00 ? 47  TYR B CE2  6  
ATOM 11165 C CZ   . TYR B 2 49  ? -2.509  -2.901  -4.906  1.00 0.00 ? 47  TYR B CZ   6  
ATOM 11166 O OH   . TYR B 2 49  ? -2.518  -1.773  -5.693  1.00 0.00 ? 47  TYR B OH   6  
ATOM 11167 H H    . TYR B 2 49  ? -0.089  -6.220  -3.217  1.00 0.00 ? 47  TYR B H    6  
ATOM 11168 H HA   . TYR B 2 49  ? -1.397  -5.610  -0.768  1.00 0.00 ? 47  TYR B HA   6  
ATOM 11169 H HB2  . TYR B 2 49  ? -2.439  -7.269  -3.093  1.00 0.00 ? 47  TYR B HB2  6  
ATOM 11170 H HB3  . TYR B 2 49  ? -3.404  -6.427  -1.883  1.00 0.00 ? 47  TYR B HB3  6  
ATOM 11171 H HD1  . TYR B 2 49  ? -2.962  -6.227  -5.108  1.00 0.00 ? 47  TYR B HD1  6  
ATOM 11172 H HD2  . TYR B 2 49  ? -2.031  -3.841  -1.719  1.00 0.00 ? 47  TYR B HD2  6  
ATOM 11173 H HE1  . TYR B 2 49  ? -2.973  -4.220  -6.523  1.00 0.00 ? 47  TYR B HE1  6  
ATOM 11174 H HE2  . TYR B 2 49  ? -2.044  -1.827  -3.122  1.00 0.00 ? 47  TYR B HE2  6  
ATOM 11175 H HH   . TYR B 2 49  ? -2.508  -2.036  -6.624  1.00 0.00 ? 47  TYR B HH   6  
ATOM 11176 N N    . ALA B 2 50  ? -0.480  -8.693  -1.176  1.00 0.00 ? 48  ALA B N    6  
ATOM 11177 C CA   . ALA B 2 50  ? -0.359  -10.006 -0.562  1.00 0.00 ? 48  ALA B CA   6  
ATOM 11178 C C    . ALA B 2 50  ? 0.434   -9.949  0.741   1.00 0.00 ? 48  ALA B C    6  
ATOM 11179 O O    . ALA B 2 50  ? 0.583   -10.962 1.419   1.00 0.00 ? 48  ALA B O    6  
ATOM 11180 C CB   . ALA B 2 50  ? 0.299   -10.970 -1.538  1.00 0.00 ? 48  ALA B CB   6  
ATOM 11181 H H    . ALA B 2 50  ? 0.068   -8.487  -1.959  1.00 0.00 ? 48  ALA B H    6  
ATOM 11182 H HA   . ALA B 2 50  ? -1.353  -10.370 -0.352  1.00 0.00 ? 48  ALA B HA   6  
ATOM 11183 H HB1  . ALA B 2 50  ? -0.296  -11.030 -2.438  1.00 0.00 ? 48  ALA B HB1  6  
ATOM 11184 H HB2  . ALA B 2 50  ? 0.369   -11.947 -1.086  1.00 0.00 ? 48  ALA B HB2  6  
ATOM 11185 H HB3  . ALA B 2 50  ? 1.288   -10.614 -1.784  1.00 0.00 ? 48  ALA B HB3  6  
ATOM 11186 N N    . ASP B 2 51  ? 0.938   -8.767  1.074   1.00 0.00 ? 49  ASP B N    6  
ATOM 11187 C CA   . ASP B 2 51  ? 1.713   -8.558  2.289   1.00 0.00 ? 49  ASP B CA   6  
ATOM 11188 C C    . ASP B 2 51  ? 1.017   -7.548  3.185   1.00 0.00 ? 49  ASP B C    6  
ATOM 11189 O O    . ASP B 2 51  ? 1.389   -7.359  4.346   1.00 0.00 ? 49  ASP B O    6  
ATOM 11190 C CB   . ASP B 2 51  ? 3.100   -8.044  1.959   1.00 0.00 ? 49  ASP B CB   6  
ATOM 11191 C CG   . ASP B 2 51  ? 3.916   -9.020  1.137   1.00 0.00 ? 49  ASP B CG   6  
ATOM 11192 O OD1  . ASP B 2 51  ? 4.590   -9.885  1.731   1.00 0.00 ? 49  ASP B OD1  6  
ATOM 11193 O OD2  . ASP B 2 51  ? 3.879   -8.936  -0.111  1.00 0.00 ? 49  ASP B OD2  6  
ATOM 11194 H H    . ASP B 2 51  ? 0.792   -8.010  0.483   1.00 0.00 ? 49  ASP B H    6  
ATOM 11195 H HA   . ASP B 2 51  ? 1.794   -9.501  2.812   1.00 0.00 ? 49  ASP B HA   6  
ATOM 11196 H HB2  . ASP B 2 51  ? 2.996   -7.130  1.405   1.00 0.00 ? 49  ASP B HB2  6  
ATOM 11197 H HB3  . ASP B 2 51  ? 3.620   -7.849  2.880   1.00 0.00 ? 49  ASP B HB3  6  
ATOM 11198 N N    . ILE B 2 52  ? -0.004  -6.905  2.647   1.00 0.00 ? 50  ILE B N    6  
ATOM 11199 C CA   . ILE B 2 52  ? -0.765  -5.932  3.405   1.00 0.00 ? 50  ILE B CA   6  
ATOM 11200 C C    . ILE B 2 52  ? -1.942  -6.655  4.049   1.00 0.00 ? 50  ILE B C    6  
ATOM 11201 O O    . ILE B 2 52  ? -2.674  -7.362  3.362   1.00 0.00 ? 50  ILE B O    6  
ATOM 11202 C CB   . ILE B 2 52  ? -1.319  -4.800  2.509   1.00 0.00 ? 50  ILE B CB   6  
ATOM 11203 C CG1  . ILE B 2 52  ? -0.394  -4.518  1.317   1.00 0.00 ? 50  ILE B CG1  6  
ATOM 11204 C CG2  . ILE B 2 52  ? -1.549  -3.539  3.322   1.00 0.00 ? 50  ILE B CG2  6  
ATOM 11205 C CD1  . ILE B 2 52  ? 0.847   -3.724  1.655   1.00 0.00 ? 50  ILE B CD1  6  
ATOM 11206 H H    . ILE B 2 52  ? -0.275  -7.115  1.727   1.00 0.00 ? 50  ILE B H    6  
ATOM 11207 H HA   . ILE B 2 52  ? -0.119  -5.504  4.170   1.00 0.00 ? 50  ILE B HA   6  
ATOM 11208 H HB   . ILE B 2 52  ? -2.278  -5.122  2.133   1.00 0.00 ? 50  ILE B HB   6  
ATOM 11209 H HG12 . ILE B 2 52  ? -0.073  -5.457  0.893   1.00 0.00 ? 50  ILE B HG12 6  
ATOM 11210 H HG13 . ILE B 2 52  ? -0.946  -3.966  0.571   1.00 0.00 ? 50  ILE B HG13 6  
ATOM 11211 H HG21 . ILE B 2 52  ? -0.658  -3.305  3.884   1.00 0.00 ? 50  ILE B HG21 6  
ATOM 11212 H HG22 . ILE B 2 52  ? -2.374  -3.696  4.000   1.00 0.00 ? 50  ILE B HG22 6  
ATOM 11213 H HG23 . ILE B 2 52  ? -1.781  -2.721  2.656   1.00 0.00 ? 50  ILE B HG23 6  
ATOM 11214 H HD11 . ILE B 2 52  ? 1.460   -3.619  0.771   1.00 0.00 ? 50  ILE B HD11 6  
ATOM 11215 H HD12 . ILE B 2 52  ? 1.407   -4.239  2.422   1.00 0.00 ? 50  ILE B HD12 6  
ATOM 11216 H HD13 . ILE B 2 52  ? 0.563   -2.746  2.013   1.00 0.00 ? 50  ILE B HD13 6  
ATOM 11217 N N    . LYS B 2 53  ? -2.124  -6.515  5.353   1.00 0.00 ? 51  LYS B N    6  
ATOM 11218 C CA   . LYS B 2 53  ? -3.227  -7.196  6.012   1.00 0.00 ? 51  LYS B CA   6  
ATOM 11219 C C    . LYS B 2 53  ? -4.480  -6.341  5.948   1.00 0.00 ? 51  LYS B C    6  
ATOM 11220 O O    . LYS B 2 53  ? -5.549  -6.799  5.556   1.00 0.00 ? 51  LYS B O    6  
ATOM 11221 C CB   . LYS B 2 53  ? -2.904  -7.508  7.475   1.00 0.00 ? 51  LYS B CB   6  
ATOM 11222 C CG   . LYS B 2 53  ? -4.058  -8.184  8.207   1.00 0.00 ? 51  LYS B CG   6  
ATOM 11223 C CD   . LYS B 2 53  ? -3.814  -8.253  9.704   1.00 0.00 ? 51  LYS B CD   6  
ATOM 11224 C CE   . LYS B 2 53  ? -5.109  -8.119  10.491  1.00 0.00 ? 51  LYS B CE   6  
ATOM 11225 N NZ   . LYS B 2 53  ? -5.978  -9.317  10.353  1.00 0.00 ? 51  LYS B NZ   6  
ATOM 11226 H H    . LYS B 2 53  ? -1.539  -5.921  5.869   1.00 0.00 ? 51  LYS B H    6  
ATOM 11227 H HA   . LYS B 2 53  ? -3.397  -8.124  5.486   1.00 0.00 ? 51  LYS B HA   6  
ATOM 11228 H HB2  . LYS B 2 53  ? -2.046  -8.163  7.514   1.00 0.00 ? 51  LYS B HB2  6  
ATOM 11229 H HB3  . LYS B 2 53  ? -2.669  -6.587  7.987   1.00 0.00 ? 51  LYS B HB3  6  
ATOM 11230 H HG2  . LYS B 2 53  ? -4.962  -7.622  8.028   1.00 0.00 ? 51  LYS B HG2  6  
ATOM 11231 H HG3  . LYS B 2 53  ? -4.175  -9.187  7.824   1.00 0.00 ? 51  LYS B HG3  6  
ATOM 11232 H HD2  . LYS B 2 53  ? -3.363  -9.205  9.940   1.00 0.00 ? 51  LYS B HD2  6  
ATOM 11233 H HD3  . LYS B 2 53  ? -3.148  -7.454  9.987   1.00 0.00 ? 51  LYS B HD3  6  
ATOM 11234 H HE2  . LYS B 2 53  ? -4.867  -7.981  11.534  1.00 0.00 ? 51  LYS B HE2  6  
ATOM 11235 H HE3  . LYS B 2 53  ? -5.644  -7.252  10.130  1.00 0.00 ? 51  LYS B HE3  6  
ATOM 11236 H HZ1  . LYS B 2 53  ? -6.643  -9.366  11.162  1.00 0.00 ? 51  LYS B HZ1  6  
ATOM 11237 H HZ2  . LYS B 2 53  ? -5.404  -10.182 10.337  1.00 0.00 ? 51  LYS B HZ2  6  
ATOM 11238 H HZ3  . LYS B 2 53  ? -6.528  -9.260  9.464   1.00 0.00 ? 51  LYS B HZ3  6  
ATOM 11239 N N    . CYS B 2 54  ? -4.319  -5.088  6.325   1.00 0.00 ? 52  CYS B N    6  
ATOM 11240 C CA   . CYS B 2 54  ? -5.403  -4.144  6.354   1.00 0.00 ? 52  CYS B CA   6  
ATOM 11241 C C    . CYS B 2 54  ? -4.859  -2.752  6.094   1.00 0.00 ? 52  CYS B C    6  
ATOM 11242 O O    . CYS B 2 54  ? -3.665  -2.583  5.843   1.00 0.00 ? 52  CYS B O    6  
ATOM 11243 C CB   . CYS B 2 54  ? -6.101  -4.215  7.708   1.00 0.00 ? 52  CYS B CB   6  
ATOM 11244 S SG   . CYS B 2 54  ? -4.993  -4.602  9.082   1.00 0.00 ? 52  CYS B SG   6  
ATOM 11245 H H    . CYS B 2 54  ? -3.430  -4.778  6.589   1.00 0.00 ? 52  CYS B H    6  
ATOM 11246 H HA   . CYS B 2 54  ? -6.103  -4.405  5.574   1.00 0.00 ? 52  CYS B HA   6  
ATOM 11247 H HB2  . CYS B 2 54  ? -6.566  -3.264  7.916   1.00 0.00 ? 52  CYS B HB2  6  
ATOM 11248 H HB3  . CYS B 2 54  ? -6.856  -4.982  7.669   1.00 0.00 ? 52  CYS B HB3  6  
ATOM 11249 H HG   . CYS B 2 54  ? -5.362  -3.854  10.122  1.00 0.00 ? 52  CYS B HG   6  
ATOM 11250 N N    . GLN B 2 55  ? -5.717  -1.758  6.138   1.00 0.00 ? 53  GLN B N    6  
ATOM 11251 C CA   . GLN B 2 55  ? -5.292  -0.399  5.886   1.00 0.00 ? 53  GLN B CA   6  
ATOM 11252 C C    . GLN B 2 55  ? -6.062  0.587   6.765   1.00 0.00 ? 53  GLN B C    6  
ATOM 11253 O O    . GLN B 2 55  ? -7.228  0.354   7.090   1.00 0.00 ? 53  GLN B O    6  
ATOM 11254 C CB   . GLN B 2 55  ? -5.535  -0.072  4.421   1.00 0.00 ? 53  GLN B CB   6  
ATOM 11255 C CG   . GLN B 2 55  ? -6.992  -0.231  4.031   1.00 0.00 ? 53  GLN B CG   6  
ATOM 11256 C CD   . GLN B 2 55  ? -7.312  0.314   2.664   1.00 0.00 ? 53  GLN B CD   6  
ATOM 11257 O OE1  . GLN B 2 55  ? -6.744  1.311   2.222   1.00 0.00 ? 53  GLN B OE1  6  
ATOM 11258 N NE2  . GLN B 2 55  ? -8.227  -0.348  1.984   1.00 0.00 ? 53  GLN B NE2  6  
ATOM 11259 H H    . GLN B 2 55  ? -6.659  -1.937  6.341   1.00 0.00 ? 53  GLN B H    6  
ATOM 11260 H HA   . GLN B 2 55  ? -4.232  -0.333  6.087   1.00 0.00 ? 53  GLN B HA   6  
ATOM 11261 H HB2  . GLN B 2 55  ? -5.230  0.947   4.228   1.00 0.00 ? 53  GLN B HB2  6  
ATOM 11262 H HB3  . GLN B 2 55  ? -4.944  -0.747  3.816   1.00 0.00 ? 53  GLN B HB3  6  
ATOM 11263 H HG2  . GLN B 2 55  ? -7.239  -1.281  4.046   1.00 0.00 ? 53  GLN B HG2  6  
ATOM 11264 H HG3  . GLN B 2 55  ? -7.600  0.287   4.759   1.00 0.00 ? 53  GLN B HG3  6  
ATOM 11265 H HE21 . GLN B 2 55  ? -8.633  -1.149  2.410   1.00 0.00 ? 53  GLN B HE21 6  
ATOM 11266 H HE22 . GLN B 2 55  ? -8.472  -0.023  1.095   1.00 0.00 ? 53  GLN B HE22 6  
ATOM 11267 N N    . LYS B 2 56  ? -5.412  1.670   7.169   1.00 0.00 ? 54  LYS B N    6  
ATOM 11268 C CA   . LYS B 2 56  ? -6.078  2.693   7.959   1.00 0.00 ? 54  LYS B CA   6  
ATOM 11269 C C    . LYS B 2 56  ? -6.268  3.927   7.101   1.00 0.00 ? 54  LYS B C    6  
ATOM 11270 O O    . LYS B 2 56  ? -5.433  4.220   6.250   1.00 0.00 ? 54  LYS B O    6  
ATOM 11271 C CB   . LYS B 2 56  ? -5.258  3.144   9.171   1.00 0.00 ? 54  LYS B CB   6  
ATOM 11272 C CG   . LYS B 2 56  ? -5.123  2.169   10.319  1.00 0.00 ? 54  LYS B CG   6  
ATOM 11273 C CD   . LYS B 2 56  ? -4.649  2.919   11.556  1.00 0.00 ? 54  LYS B CD   6  
ATOM 11274 C CE   . LYS B 2 56  ? -4.288  2.008   12.720  1.00 0.00 ? 54  LYS B CE   6  
ATOM 11275 N NZ   . LYS B 2 56  ? -3.407  0.883   12.307  1.00 0.00 ? 54  LYS B NZ   6  
ATOM 11276 H H    . LYS B 2 56  ? -4.467  1.793   6.920   1.00 0.00 ? 54  LYS B H    6  
ATOM 11277 H HA   . LYS B 2 56  ? -7.038  2.320   8.282   1.00 0.00 ? 54  LYS B HA   6  
ATOM 11278 H HB2  . LYS B 2 56  ? -4.264  3.386   8.837   1.00 0.00 ? 54  LYS B HB2  6  
ATOM 11279 H HB3  . LYS B 2 56  ? -5.711  4.045   9.558   1.00 0.00 ? 54  LYS B HB3  6  
ATOM 11280 H HG2  . LYS B 2 56  ? -6.081  1.715   10.515  1.00 0.00 ? 54  LYS B HG2  6  
ATOM 11281 H HG3  . LYS B 2 56  ? -4.397  1.414   10.060  1.00 0.00 ? 54  LYS B HG3  6  
ATOM 11282 H HD2  . LYS B 2 56  ? -3.778  3.500   11.291  1.00 0.00 ? 54  LYS B HD2  6  
ATOM 11283 H HD3  . LYS B 2 56  ? -5.437  3.592   11.869  1.00 0.00 ? 54  LYS B HD3  6  
ATOM 11284 H HE2  . LYS B 2 56  ? -3.773  2.600   13.468  1.00 0.00 ? 54  LYS B HE2  6  
ATOM 11285 H HE3  . LYS B 2 56  ? -5.197  1.613   13.147  1.00 0.00 ? 54  LYS B HE3  6  
ATOM 11286 H HZ1  . LYS B 2 56  ? -3.976  0.136   11.835  1.00 0.00 ? 54  LYS B HZ1  6  
ATOM 11287 H HZ2  . LYS B 2 56  ? -2.938  0.469   13.134  1.00 0.00 ? 54  LYS B HZ2  6  
ATOM 11288 H HZ3  . LYS B 2 56  ? -2.679  1.219   11.639  1.00 0.00 ? 54  LYS B HZ3  6  
ATOM 11289 N N    . ILE B 2 57  ? -7.349  4.645   7.308   1.00 0.00 ? 55  ILE B N    6  
ATOM 11290 C CA   . ILE B 2 57  ? -7.559  5.882   6.584   1.00 0.00 ? 55  ILE B CA   6  
ATOM 11291 C C    . ILE B 2 57  ? -7.789  6.978   7.616   1.00 0.00 ? 55  ILE B C    6  
ATOM 11292 O O    . ILE B 2 57  ? -8.575  6.801   8.550   1.00 0.00 ? 55  ILE B O    6  
ATOM 11293 C CB   . ILE B 2 57  ? -8.717  5.813   5.541   1.00 0.00 ? 55  ILE B CB   6  
ATOM 11294 C CG1  . ILE B 2 57  ? -10.068 6.235   6.119   1.00 0.00 ? 55  ILE B CG1  6  
ATOM 11295 C CG2  . ILE B 2 57  ? -8.829  4.408   4.967   1.00 0.00 ? 55  ILE B CG2  6  
ATOM 11296 C CD1  . ILE B 2 57  ? -10.923 6.982   5.112   1.00 0.00 ? 55  ILE B CD1  6  
ATOM 11297 H H    . ILE B 2 57  ? -8.023  4.337   7.957   1.00 0.00 ? 55  ILE B H    6  
ATOM 11298 H HA   . ILE B 2 57  ? -6.639  6.103   6.056   1.00 0.00 ? 55  ILE B HA   6  
ATOM 11299 H HB   . ILE B 2 57  ? -8.464  6.478   4.727   1.00 0.00 ? 55  ILE B HB   6  
ATOM 11300 H HG12 . ILE B 2 57  ? -10.612 5.357   6.435   1.00 0.00 ? 55  ILE B HG12 6  
ATOM 11301 H HG13 . ILE B 2 57  ? -9.908  6.883   6.968   1.00 0.00 ? 55  ILE B HG13 6  
ATOM 11302 H HG21 . ILE B 2 57  ? -9.662  4.365   4.282   1.00 0.00 ? 55  ILE B HG21 6  
ATOM 11303 H HG22 . ILE B 2 57  ? -8.985  3.702   5.769   1.00 0.00 ? 55  ILE B HG22 6  
ATOM 11304 H HG23 . ILE B 2 57  ? -7.918  4.160   4.441   1.00 0.00 ? 55  ILE B HG23 6  
ATOM 11305 H HD11 . ILE B 2 57  ? -11.106 6.351   4.255   1.00 0.00 ? 55  ILE B HD11 6  
ATOM 11306 H HD12 . ILE B 2 57  ? -10.402 7.874   4.791   1.00 0.00 ? 55  ILE B HD12 6  
ATOM 11307 H HD13 . ILE B 2 57  ? -11.861 7.259   5.564   1.00 0.00 ? 55  ILE B HD13 6  
ATOM 11308 N N    . SER B 2 58  ? -7.053  8.070   7.510   1.00 0.00 ? 56  SER B N    6  
ATOM 11309 C CA   . SER B 2 58  ? -7.194  9.145   8.467   1.00 0.00 ? 56  SER B CA   6  
ATOM 11310 C C    . SER B 2 58  ? -8.236  10.129  7.966   1.00 0.00 ? 56  SER B C    6  
ATOM 11311 O O    . SER B 2 58  ? -8.088  10.730  6.880   1.00 0.00 ? 56  SER B O    6  
ATOM 11312 C CB   . SER B 2 58  ? -5.857  9.829   8.750   1.00 0.00 ? 56  SER B CB   6  
ATOM 11313 O OG   . SER B 2 58  ? -5.625  10.918  7.887   1.00 0.00 ? 56  SER B OG   6  
ATOM 11314 H H    . SER B 2 58  ? -6.419  8.165   6.764   1.00 0.00 ? 56  SER B H    6  
ATOM 11315 H HA   . SER B 2 58  ? -7.560  8.707   9.386   1.00 0.00 ? 56  SER B HA   6  
ATOM 11316 H HB2  . SER B 2 58  ? -5.844  10.181  9.761   1.00 0.00 ? 56  SER B HB2  6  
ATOM 11317 H HB3  . SER B 2 58  ? -5.060  9.111   8.616   1.00 0.00 ? 56  SER B HB3  6  
ATOM 11318 H HG   . SER B 2 58  ? -5.792  11.744  8.359   1.00 0.00 ? 56  SER B HG   6  
ATOM 11319 N N    . PRO B 2 59  ? -9.300  10.262  8.771   1.00 0.00 ? 57  PRO B N    6  
ATOM 11320 C CA   . PRO B 2 59  ? -10.464 11.112  8.500   1.00 0.00 ? 57  PRO B CA   6  
ATOM 11321 C C    . PRO B 2 59  ? -10.184 12.601  8.620   1.00 0.00 ? 57  PRO B C    6  
ATOM 11322 O O    . PRO B 2 59  ? -9.096  13.026  9.019   1.00 0.00 ? 57  PRO B O    6  
ATOM 11323 C CB   . PRO B 2 59  ? -11.456 10.692  9.588   1.00 0.00 ? 57  PRO B CB   6  
ATOM 11324 C CG   . PRO B 2 59  ? -10.589 10.265  10.717  1.00 0.00 ? 57  PRO B CG   6  
ATOM 11325 C CD   . PRO B 2 59  ? -9.429  9.577   10.073  1.00 0.00 ? 57  PRO B CD   6  
ATOM 11326 H HA   . PRO B 2 59  ? -10.887 10.906  7.529   1.00 0.00 ? 57  PRO B HA   6  
ATOM 11327 H HB2  . PRO B 2 59  ? -12.078 11.534  9.858   1.00 0.00 ? 57  PRO B HB2  6  
ATOM 11328 H HB3  . PRO B 2 59  ? -12.070 9.880   9.230   1.00 0.00 ? 57  PRO B HB3  6  
ATOM 11329 H HG2  . PRO B 2 59  ? -10.250 11.126  11.277  1.00 0.00 ? 57  PRO B HG2  6  
ATOM 11330 H HG3  . PRO B 2 59  ? -11.119 9.579   11.362  1.00 0.00 ? 57  PRO B HG3  6  
ATOM 11331 H HD2  . PRO B 2 59  ? -8.536  9.708   10.667  1.00 0.00 ? 57  PRO B HD2  6  
ATOM 11332 H HD3  . PRO B 2 59  ? -9.641  8.527   9.936   1.00 0.00 ? 57  PRO B HD3  6  
ATOM 11333 N N    . GLU B 2 60  ? -11.183 13.378  8.238   1.00 0.00 ? 58  GLU B N    6  
ATOM 11334 C CA   . GLU B 2 60  ? -11.121 14.823  8.305   1.00 0.00 ? 58  GLU B CA   6  
ATOM 11335 C C    . GLU B 2 60  ? -10.934 15.266  9.755   1.00 0.00 ? 58  GLU B C    6  
ATOM 11336 O O    . GLU B 2 60  ? -11.236 14.524  10.690  1.00 0.00 ? 58  GLU B O    6  
ATOM 11337 C CB   . GLU B 2 60  ? -12.394 15.438  7.709   1.00 0.00 ? 58  GLU B CB   6  
ATOM 11338 C CG   . GLU B 2 60  ? -12.515 15.271  6.194   1.00 0.00 ? 58  GLU B CG   6  
ATOM 11339 C CD   . GLU B 2 60  ? -12.492 13.818  5.748   1.00 0.00 ? 58  GLU B CD   6  
ATOM 11340 O OE1  . GLU B 2 60  ? -11.778 13.502  4.775   1.00 0.00 ? 58  GLU B OE1  6  
ATOM 11341 O OE2  . GLU B 2 60  ? -13.161 12.984  6.391   1.00 0.00 ? 58  GLU B OE2  6  
ATOM 11342 H H    . GLU B 2 60  ? -12.001 12.958  7.879   1.00 0.00 ? 58  GLU B H    6  
ATOM 11343 H HA   . GLU B 2 60  ? -10.266 15.146  7.728   1.00 0.00 ? 58  GLU B HA   6  
ATOM 11344 H HB2  . GLU B 2 60  ? -13.253 14.972  8.169   1.00 0.00 ? 58  GLU B HB2  6  
ATOM 11345 H HB3  . GLU B 2 60  ? -12.406 16.494  7.933   1.00 0.00 ? 58  GLU B HB3  6  
ATOM 11346 H HG2  . GLU B 2 60  ? -13.447 15.712  5.872   1.00 0.00 ? 58  GLU B HG2  6  
ATOM 11347 H HG3  . GLU B 2 60  ? -11.693 15.789  5.722   1.00 0.00 ? 58  GLU B HG3  6  
ATOM 11348 N N    . GLY B 2 61  ? -10.464 16.485  9.932   1.00 0.00 ? 59  GLY B N    6  
ATOM 11349 C CA   . GLY B 2 61  ? -10.200 17.000  11.259  1.00 0.00 ? 59  GLY B CA   6  
ATOM 11350 C C    . GLY B 2 61  ? -8.719  17.219  11.435  1.00 0.00 ? 59  GLY B C    6  
ATOM 11351 O O    . GLY B 2 61  ? -8.288  18.095  12.183  1.00 0.00 ? 59  GLY B O    6  
ATOM 11352 H H    . GLY B 2 61  ? -10.282 17.045  9.149   1.00 0.00 ? 59  GLY B H    6  
ATOM 11353 H HA2  . GLY B 2 61  ? -10.723 17.937  11.391  1.00 0.00 ? 59  GLY B HA2  6  
ATOM 11354 H HA3  . GLY B 2 61  ? -10.544 16.290  11.995  1.00 0.00 ? 59  GLY B HA3  6  
ATOM 11355 N N    . LYS B 2 62  ? -7.945  16.415  10.721  1.00 0.00 ? 60  LYS B N    6  
ATOM 11356 C CA   . LYS B 2 62  ? -6.500  16.537  10.719  1.00 0.00 ? 60  LYS B CA   6  
ATOM 11357 C C    . LYS B 2 62  ? -6.121  17.536  9.650   1.00 0.00 ? 60  LYS B C    6  
ATOM 11358 O O    . LYS B 2 62  ? -6.938  17.871  8.787   1.00 0.00 ? 60  LYS B O    6  
ATOM 11359 C CB   . LYS B 2 62  ? -5.826  15.191  10.429  1.00 0.00 ? 60  LYS B CB   6  
ATOM 11360 C CG   . LYS B 2 62  ? -5.515  14.365  11.666  1.00 0.00 ? 60  LYS B CG   6  
ATOM 11361 C CD   . LYS B 2 62  ? -4.594  13.195  11.329  1.00 0.00 ? 60  LYS B CD   6  
ATOM 11362 C CE   . LYS B 2 62  ? -3.852  12.665  12.553  1.00 0.00 ? 60  LYS B CE   6  
ATOM 11363 N NZ   . LYS B 2 62  ? -4.111  13.470  13.774  1.00 0.00 ? 60  LYS B NZ   6  
ATOM 11364 H H    . LYS B 2 62  ? -8.363  15.714  10.179  1.00 0.00 ? 60  LYS B H    6  
ATOM 11365 H HA   . LYS B 2 62  ? -6.177  16.911  11.679  1.00 0.00 ? 60  LYS B HA   6  
ATOM 11366 H HB2  . LYS B 2 62  ? -6.476  14.608  9.792   1.00 0.00 ? 60  LYS B HB2  6  
ATOM 11367 H HB3  . LYS B 2 62  ? -4.900  15.375  9.905   1.00 0.00 ? 60  LYS B HB3  6  
ATOM 11368 H HG2  . LYS B 2 62  ? -5.030  14.994  12.398  1.00 0.00 ? 60  LYS B HG2  6  
ATOM 11369 H HG3  . LYS B 2 62  ? -6.438  13.979  12.072  1.00 0.00 ? 60  LYS B HG3  6  
ATOM 11370 H HD2  . LYS B 2 62  ? -5.185  12.395  10.912  1.00 0.00 ? 60  LYS B HD2  6  
ATOM 11371 H HD3  . LYS B 2 62  ? -3.870  13.524  10.598  1.00 0.00 ? 60  LYS B HD3  6  
ATOM 11372 H HE2  . LYS B 2 62  ? -4.161  11.647  12.734  1.00 0.00 ? 60  LYS B HE2  6  
ATOM 11373 H HE3  . LYS B 2 62  ? -2.789  12.679  12.345  1.00 0.00 ? 60  LYS B HE3  6  
ATOM 11374 H HZ1  . LYS B 2 62  ? -3.586  13.073  14.584  1.00 0.00 ? 60  LYS B HZ1  6  
ATOM 11375 H HZ2  . LYS B 2 62  ? -5.132  13.458  13.995  1.00 0.00 ? 60  LYS B HZ2  6  
ATOM 11376 H HZ3  . LYS B 2 62  ? -3.803  14.458  13.621  1.00 0.00 ? 60  LYS B HZ3  6  
ATOM 11377 N N    . ALA B 2 63  ? -4.898  18.011  9.698   1.00 0.00 ? 61  ALA B N    6  
ATOM 11378 C CA   . ALA B 2 63  ? -4.436  18.970  8.718   1.00 0.00 ? 61  ALA B CA   6  
ATOM 11379 C C    . ALA B 2 63  ? -4.044  18.258  7.447   1.00 0.00 ? 61  ALA B C    6  
ATOM 11380 O O    . ALA B 2 63  ? -3.888  18.872  6.392   1.00 0.00 ? 61  ALA B O    6  
ATOM 11381 C CB   . ALA B 2 63  ? -3.261  19.744  9.264   1.00 0.00 ? 61  ALA B CB   6  
ATOM 11382 H H    . ALA B 2 63  ? -4.280  17.699  10.400  1.00 0.00 ? 61  ALA B H    6  
ATOM 11383 H HA   . ALA B 2 63  ? -5.239  19.659  8.503   1.00 0.00 ? 61  ALA B HA   6  
ATOM 11384 H HB1  . ALA B 2 63  ? -2.934  20.461  8.528   1.00 0.00 ? 61  ALA B HB1  6  
ATOM 11385 H HB2  . ALA B 2 63  ? -2.457  19.056  9.482   1.00 0.00 ? 61  ALA B HB2  6  
ATOM 11386 H HB3  . ALA B 2 63  ? -3.556  20.254  10.165  1.00 0.00 ? 61  ALA B HB3  6  
ATOM 11387 N N    . LYS B 2 64  ? -3.894  16.956  7.559   1.00 0.00 ? 62  LYS B N    6  
ATOM 11388 C CA   . LYS B 2 64  ? -3.512  16.155  6.432   1.00 0.00 ? 62  LYS B CA   6  
ATOM 11389 C C    . LYS B 2 64  ? -4.382  14.910  6.313   1.00 0.00 ? 62  LYS B C    6  
ATOM 11390 O O    . LYS B 2 64  ? -4.592  14.192  7.289   1.00 0.00 ? 62  LYS B O    6  
ATOM 11391 C CB   . LYS B 2 64  ? -2.041  15.746  6.548   1.00 0.00 ? 62  LYS B CB   6  
ATOM 11392 C CG   . LYS B 2 64  ? -1.477  15.838  7.957   1.00 0.00 ? 62  LYS B CG   6  
ATOM 11393 C CD   . LYS B 2 64  ? -0.032  15.374  8.011   1.00 0.00 ? 62  LYS B CD   6  
ATOM 11394 C CE   . LYS B 2 64  ? 0.061   13.859  8.075   1.00 0.00 ? 62  LYS B CE   6  
ATOM 11395 N NZ   . LYS B 2 64  ? 1.211   13.339  7.297   1.00 0.00 ? 62  LYS B NZ   6  
ATOM 11396 H H    . LYS B 2 64  ? -4.046  16.526  8.428   1.00 0.00 ? 62  LYS B H    6  
ATOM 11397 H HA   . LYS B 2 64  ? -3.635  16.763  5.554   1.00 0.00 ? 62  LYS B HA   6  
ATOM 11398 H HB2  . LYS B 2 64  ? -1.938  14.725  6.212   1.00 0.00 ? 62  LYS B HB2  6  
ATOM 11399 H HB3  . LYS B 2 64  ? -1.453  16.386  5.907   1.00 0.00 ? 62  LYS B HB3  6  
ATOM 11400 H HG2  . LYS B 2 64  ? -1.528  16.865  8.289   1.00 0.00 ? 62  LYS B HG2  6  
ATOM 11401 H HG3  . LYS B 2 64  ? -2.070  15.217  8.613   1.00 0.00 ? 62  LYS B HG3  6  
ATOM 11402 H HD2  . LYS B 2 64  ? 0.480   15.719  7.126   1.00 0.00 ? 62  LYS B HD2  6  
ATOM 11403 H HD3  . LYS B 2 64  ? 0.438   15.792  8.889   1.00 0.00 ? 62  LYS B HD3  6  
ATOM 11404 H HE2  . LYS B 2 64  ? 0.173   13.561  9.107   1.00 0.00 ? 62  LYS B HE2  6  
ATOM 11405 H HE3  . LYS B 2 64  ? -0.852  13.439  7.677   1.00 0.00 ? 62  LYS B HE3  6  
ATOM 11406 H HZ1  . LYS B 2 64  ? 1.037   13.463  6.284   1.00 0.00 ? 62  LYS B HZ1  6  
ATOM 11407 H HZ2  . LYS B 2 64  ? 1.355   12.319  7.488   1.00 0.00 ? 62  LYS B HZ2  6  
ATOM 11408 H HZ3  . LYS B 2 64  ? 2.084   13.856  7.549   1.00 0.00 ? 62  LYS B HZ3  6  
ATOM 11409 N N    . ILE B 2 65  ? -4.914  14.681  5.124   1.00 0.00 ? 63  ILE B N    6  
ATOM 11410 C CA   . ILE B 2 65  ? -5.714  13.495  4.868   1.00 0.00 ? 63  ILE B CA   6  
ATOM 11411 C C    . ILE B 2 65  ? -4.739  12.340  4.689   1.00 0.00 ? 63  ILE B C    6  
ATOM 11412 O O    . ILE B 2 65  ? -3.790  12.459  3.917   1.00 0.00 ? 63  ILE B O    6  
ATOM 11413 C CB   . ILE B 2 65  ? -6.598  13.676  3.614   1.00 0.00 ? 63  ILE B CB   6  
ATOM 11414 C CG1  . ILE B 2 65  ? -7.715  14.681  3.903   1.00 0.00 ? 63  ILE B CG1  6  
ATOM 11415 C CG2  . ILE B 2 65  ? -7.181  12.350  3.157   1.00 0.00 ? 63  ILE B CG2  6  
ATOM 11416 C CD1  . ILE B 2 65  ? -7.470  16.059  3.321   1.00 0.00 ? 63  ILE B CD1  6  
ATOM 11417 H H    . ILE B 2 65  ? -4.757  15.319  4.398   1.00 0.00 ? 63  ILE B H    6  
ATOM 11418 H HA   . ILE B 2 65  ? -6.343  13.309  5.728   1.00 0.00 ? 63  ILE B HA   6  
ATOM 11419 H HB   . ILE B 2 65  ? -5.978  14.060  2.818   1.00 0.00 ? 63  ILE B HB   6  
ATOM 11420 H HG12 . ILE B 2 65  ? -8.640  14.310  3.489   1.00 0.00 ? 63  ILE B HG12 6  
ATOM 11421 H HG13 . ILE B 2 65  ? -7.823  14.788  4.973   1.00 0.00 ? 63  ILE B HG13 6  
ATOM 11422 H HG21 . ILE B 2 65  ? -6.380  11.668  2.915   1.00 0.00 ? 63  ILE B HG21 6  
ATOM 11423 H HG22 . ILE B 2 65  ? -7.795  12.509  2.284   1.00 0.00 ? 63  ILE B HG22 6  
ATOM 11424 H HG23 . ILE B 2 65  ? -7.783  11.931  3.949   1.00 0.00 ? 63  ILE B HG23 6  
ATOM 11425 H HD11 . ILE B 2 65  ? -8.288  16.713  3.588   1.00 0.00 ? 63  ILE B HD11 6  
ATOM 11426 H HD12 . ILE B 2 65  ? -7.404  15.988  2.245   1.00 0.00 ? 63  ILE B HD12 6  
ATOM 11427 H HD13 . ILE B 2 65  ? -6.547  16.458  3.714   1.00 0.00 ? 63  ILE B HD13 6  
ATOM 11428 N N    . GLN B 2 66  ? -4.934  11.228  5.383   1.00 0.00 ? 64  GLN B N    6  
ATOM 11429 C CA   . GLN B 2 66  ? -3.944  10.153  5.292   1.00 0.00 ? 64  GLN B CA   6  
ATOM 11430 C C    . GLN B 2 66  ? -4.522  8.768   5.134   1.00 0.00 ? 64  GLN B C    6  
ATOM 11431 O O    . GLN B 2 66  ? -5.707  8.522   5.334   1.00 0.00 ? 64  GLN B O    6  
ATOM 11432 C CB   . GLN B 2 66  ? -3.044  10.116  6.524   1.00 0.00 ? 64  GLN B CB   6  
ATOM 11433 C CG   . GLN B 2 66  ? -2.478  11.453  6.946   1.00 0.00 ? 64  GLN B CG   6  
ATOM 11434 C CD   . GLN B 2 66  ? -2.572  11.643  8.443   1.00 0.00 ? 64  GLN B CD   6  
ATOM 11435 O OE1  . GLN B 2 66  ? -2.600  12.765  8.933   1.00 0.00 ? 64  GLN B OE1  6  
ATOM 11436 N NE2  . GLN B 2 66  ? -2.640  10.539  9.181   1.00 0.00 ? 64  GLN B NE2  6  
ATOM 11437 H H    . GLN B 2 66  ? -5.735  11.127  5.967   1.00 0.00 ? 64  GLN B H    6  
ATOM 11438 H HA   . GLN B 2 66  ? -3.324  10.361  4.434   1.00 0.00 ? 64  GLN B HA   6  
ATOM 11439 H HB2  . GLN B 2 66  ? -3.614  9.722   7.352   1.00 0.00 ? 64  GLN B HB2  6  
ATOM 11440 H HB3  . GLN B 2 66  ? -2.217  9.450   6.325   1.00 0.00 ? 64  GLN B HB3  6  
ATOM 11441 H HG2  . GLN B 2 66  ? -1.441  11.504  6.651   1.00 0.00 ? 64  GLN B HG2  6  
ATOM 11442 H HG3  . GLN B 2 66  ? -3.036  12.240  6.460   1.00 0.00 ? 64  GLN B HG3  6  
ATOM 11443 H HE21 . GLN B 2 66  ? -2.629  9.673   8.724   1.00 0.00 ? 64  GLN B HE21 6  
ATOM 11444 H HE22 . GLN B 2 66  ? -2.689  10.639  10.154  1.00 0.00 ? 64  GLN B HE22 6  
ATOM 11445 N N    . LEU B 2 67  ? -3.640  7.886   4.718   1.00 0.00 ? 65  LEU B N    6  
ATOM 11446 C CA   . LEU B 2 67  ? -3.926  6.483   4.555   1.00 0.00 ? 65  LEU B CA   6  
ATOM 11447 C C    . LEU B 2 67  ? -2.716  5.721   5.077   1.00 0.00 ? 65  LEU B C    6  
ATOM 11448 O O    . LEU B 2 67  ? -1.627  6.274   5.102   1.00 0.00 ? 65  LEU B O    6  
ATOM 11449 C CB   . LEU B 2 67  ? -4.124  6.144   3.086   1.00 0.00 ? 65  LEU B CB   6  
ATOM 11450 C CG   . LEU B 2 67  ? -4.995  4.930   2.812   1.00 0.00 ? 65  LEU B CG   6  
ATOM 11451 C CD1  . LEU B 2 67  ? -6.443  5.348   2.647   1.00 0.00 ? 65  LEU B CD1  6  
ATOM 11452 C CD2  . LEU B 2 67  ? -4.487  4.188   1.594   1.00 0.00 ? 65  LEU B CD2  6  
ATOM 11453 H H    . LEU B 2 67  ? -2.731  8.200   4.501   1.00 0.00 ? 65  LEU B H    6  
ATOM 11454 H HA   . LEU B 2 67  ? -4.807  6.236   5.133   1.00 0.00 ? 65  LEU B HA   6  
ATOM 11455 H HB2  . LEU B 2 67  ? -4.570  6.999   2.600   1.00 0.00 ? 65  LEU B HB2  6  
ATOM 11456 H HB3  . LEU B 2 67  ? -3.152  5.970   2.648   1.00 0.00 ? 65  LEU B HB3  6  
ATOM 11457 H HG   . LEU B 2 67  ? -4.937  4.260   3.658   1.00 0.00 ? 65  LEU B HG   6  
ATOM 11458 H HD11 . LEU B 2 67  ? -6.528  6.019   1.802   1.00 0.00 ? 65  LEU B HD11 6  
ATOM 11459 H HD12 . LEU B 2 67  ? -6.778  5.854   3.540   1.00 0.00 ? 65  LEU B HD12 6  
ATOM 11460 H HD13 . LEU B 2 67  ? -7.055  4.476   2.475   1.00 0.00 ? 65  LEU B HD13 6  
ATOM 11461 H HD21 . LEU B 2 67  ? -3.458  3.899   1.753   1.00 0.00 ? 65  LEU B HD21 6  
ATOM 11462 H HD22 . LEU B 2 67  ? -4.550  4.832   0.729   1.00 0.00 ? 65  LEU B HD22 6  
ATOM 11463 H HD23 . LEU B 2 67  ? -5.088  3.306   1.432   1.00 0.00 ? 65  LEU B HD23 6  
ATOM 11464 N N    . GLN B 2 68  ? -2.880  4.496   5.538   1.00 0.00 ? 66  GLN B N    6  
ATOM 11465 C CA   . GLN B 2 68  ? -1.729  3.740   6.007   1.00 0.00 ? 66  GLN B CA   6  
ATOM 11466 C C    . GLN B 2 68  ? -1.911  2.262   5.708   1.00 0.00 ? 66  GLN B C    6  
ATOM 11467 O O    . GLN B 2 68  ? -3.010  1.722   5.820   1.00 0.00 ? 66  GLN B O    6  
ATOM 11468 C CB   . GLN B 2 68  ? -1.463  3.960   7.505   1.00 0.00 ? 66  GLN B CB   6  
ATOM 11469 C CG   . GLN B 2 68  ? -2.151  2.969   8.425   1.00 0.00 ? 66  GLN B CG   6  
ATOM 11470 C CD   . GLN B 2 68  ? -1.692  3.072   9.869   1.00 0.00 ? 66  GLN B CD   6  
ATOM 11471 O OE1  . GLN B 2 68  ? -1.647  2.077   10.589  1.00 0.00 ? 66  GLN B OE1  6  
ATOM 11472 N NE2  . GLN B 2 68  ? -1.372  4.275   10.312  1.00 0.00 ? 66  GLN B NE2  6  
ATOM 11473 H H    . GLN B 2 68  ? -3.779  4.093   5.563   1.00 0.00 ? 66  GLN B H    6  
ATOM 11474 H HA   . GLN B 2 68  ? -0.871  4.091   5.451   1.00 0.00 ? 66  GLN B HA   6  
ATOM 11475 H HB2  . GLN B 2 68  ? -0.403  3.899   7.684   1.00 0.00 ? 66  GLN B HB2  6  
ATOM 11476 H HB3  . GLN B 2 68  ? -1.801  4.952   7.770   1.00 0.00 ? 66  GLN B HB3  6  
ATOM 11477 H HG2  . GLN B 2 68  ? -3.215  3.148   8.391   1.00 0.00 ? 66  GLN B HG2  6  
ATOM 11478 H HG3  . GLN B 2 68  ? -1.947  1.969   8.069   1.00 0.00 ? 66  GLN B HG3  6  
ATOM 11479 H HE21 . GLN B 2 68  ? -1.446  5.032   9.694   1.00 0.00 ? 66  GLN B HE21 6  
ATOM 11480 H HE22 . GLN B 2 68  ? -1.067  4.360   11.239  1.00 0.00 ? 66  GLN B HE22 6  
ATOM 11481 N N    . LEU B 2 69  ? -0.831  1.625   5.318   1.00 0.00 ? 67  LEU B N    6  
ATOM 11482 C CA   . LEU B 2 69  ? -0.841  0.215   4.999   1.00 0.00 ? 67  LEU B CA   6  
ATOM 11483 C C    . LEU B 2 69  ? -0.442  -0.604  6.209   1.00 0.00 ? 67  LEU B C    6  
ATOM 11484 O O    . LEU B 2 69  ? 0.703   -0.555  6.642   1.00 0.00 ? 67  LEU B O    6  
ATOM 11485 C CB   . LEU B 2 69  ? 0.139   -0.073  3.868   1.00 0.00 ? 67  LEU B CB   6  
ATOM 11486 C CG   . LEU B 2 69  ? -0.203  0.548   2.518   1.00 0.00 ? 67  LEU B CG   6  
ATOM 11487 C CD1  . LEU B 2 69  ? 0.894   0.234   1.515   1.00 0.00 ? 67  LEU B CD1  6  
ATOM 11488 C CD2  . LEU B 2 69  ? -1.548  0.042   2.019   1.00 0.00 ? 67  LEU B CD2  6  
ATOM 11489 H H    . LEU B 2 69  ? 0.013   2.126   5.234   1.00 0.00 ? 67  LEU B H    6  
ATOM 11490 H HA   . LEU B 2 69  ? -1.838  -0.060  4.690   1.00 0.00 ? 67  LEU B HA   6  
ATOM 11491 H HB2  . LEU B 2 69  ? 1.111   0.289   4.167   1.00 0.00 ? 67  LEU B HB2  6  
ATOM 11492 H HB3  . LEU B 2 69  ? 0.199   -1.139  3.742   1.00 0.00 ? 67  LEU B HB3  6  
ATOM 11493 H HG   . LEU B 2 69  ? -0.263  1.622   2.624   1.00 0.00 ? 67  LEU B HG   6  
ATOM 11494 H HD11 . LEU B 2 69  ? 0.651   0.683   0.564   1.00 0.00 ? 67  LEU B HD11 6  
ATOM 11495 H HD12 . LEU B 2 69  ? 0.977   -0.837  1.397   1.00 0.00 ? 67  LEU B HD12 6  
ATOM 11496 H HD13 . LEU B 2 69  ? 1.832   0.631   1.871   1.00 0.00 ? 67  LEU B HD13 6  
ATOM 11497 H HD21 . LEU B 2 69  ? -1.495  -1.025  1.861   1.00 0.00 ? 67  LEU B HD21 6  
ATOM 11498 H HD22 . LEU B 2 69  ? -1.796  0.533   1.089   1.00 0.00 ? 67  LEU B HD22 6  
ATOM 11499 H HD23 . LEU B 2 69  ? -2.309  0.258   2.755   1.00 0.00 ? 67  LEU B HD23 6  
ATOM 11500 N N    . VAL B 2 70  ? -1.379  -1.342  6.760   1.00 0.00 ? 68  VAL B N    6  
ATOM 11501 C CA   . VAL B 2 70  ? -1.091  -2.180  7.905   1.00 0.00 ? 68  VAL B CA   6  
ATOM 11502 C C    . VAL B 2 70  ? -0.796  -3.582  7.410   1.00 0.00 ? 68  VAL B C    6  
ATOM 11503 O O    . VAL B 2 70  ? -1.697  -4.333  7.040   1.00 0.00 ? 68  VAL B O    6  
ATOM 11504 C CB   . VAL B 2 70  ? -2.255  -2.190  8.907   1.00 0.00 ? 68  VAL B CB   6  
ATOM 11505 C CG1  . VAL B 2 70  ? -1.832  -2.856  10.202  1.00 0.00 ? 68  VAL B CG1  6  
ATOM 11506 C CG2  . VAL B 2 70  ? -2.725  -0.769  9.164   1.00 0.00 ? 68  VAL B CG2  6  
ATOM 11507 H H    . VAL B 2 70  ? -2.285  -1.342  6.377   1.00 0.00 ? 68  VAL B H    6  
ATOM 11508 H HA   . VAL B 2 70  ? -0.211  -1.787  8.397   1.00 0.00 ? 68  VAL B HA   6  
ATOM 11509 H HB   . VAL B 2 70  ? -3.074  -2.751  8.482   1.00 0.00 ? 68  VAL B HB   6  
ATOM 11510 H HG11 . VAL B 2 70  ? -1.451  -3.843  9.989   1.00 0.00 ? 68  VAL B HG11 6  
ATOM 11511 H HG12 . VAL B 2 70  ? -2.683  -2.929  10.861  1.00 0.00 ? 68  VAL B HG12 6  
ATOM 11512 H HG13 . VAL B 2 70  ? -1.060  -2.263  10.671  1.00 0.00 ? 68  VAL B HG13 6  
ATOM 11513 H HG21 . VAL B 2 70  ? -1.912  -0.195  9.589   1.00 0.00 ? 68  VAL B HG21 6  
ATOM 11514 H HG22 . VAL B 2 70  ? -3.555  -0.783  9.852   1.00 0.00 ? 68  VAL B HG22 6  
ATOM 11515 H HG23 . VAL B 2 70  ? -3.031  -0.318  8.232   1.00 0.00 ? 68  VAL B HG23 6  
ATOM 11516 N N    . LEU B 2 71  ? 0.473   -3.922  7.385   1.00 0.00 ? 69  LEU B N    6  
ATOM 11517 C CA   . LEU B 2 71  ? 0.906   -5.205  6.867   1.00 0.00 ? 69  LEU B CA   6  
ATOM 11518 C C    . LEU B 2 71  ? 0.813   -6.295  7.909   1.00 0.00 ? 69  LEU B C    6  
ATOM 11519 O O    . LEU B 2 71  ? 0.913   -6.035  9.107   1.00 0.00 ? 69  LEU B O    6  
ATOM 11520 C CB   . LEU B 2 71  ? 2.341   -5.106  6.363   1.00 0.00 ? 69  LEU B CB   6  
ATOM 11521 C CG   . LEU B 2 71  ? 2.727   -3.734  5.826   1.00 0.00 ? 69  LEU B CG   6  
ATOM 11522 C CD1  . LEU B 2