data_5GPY
# 
_entry.id   5GPY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.321 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5GPY         
WWPDB D_1300001263 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5GPY 
_pdbx_database_status.recvd_initial_deposition_date   2016-08-05 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Obita, T.'     1 
'Miwa, K.'      2 
'Kojima, R.'    3 
'Ohkuma, Y.'    4 
'Tamura, Y.'    5 
'Mizuguchi, M.' 6 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_id_ASTM           JMOBAK 
_citation.journal_id_CSD            0070 
_citation.journal_id_ISSN           1089-8638 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            428 
_citation.language                  ? 
_citation.page_first                4258 
_citation.page_last                 4266 
_citation.title                     'Crystal Structure of Human General Transcription Factor TFIIE at Atomic Resolution' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2016.09.008 
_citation.pdbx_database_id_PubMed   27639436 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Miwa, K.'      1 ? 
primary 'Kojima, R.'    2 ? 
primary 'Obita, T.'     3 ? 
primary 'Ohkuma, Y.'    4 ? 
primary 'Tamura, Y.'    5 ? 
primary 'Mizuguchi, M.' 6 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5GPY 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     51.520 
_cell.length_a_esd                 ? 
_cell.length_b                     69.200 
_cell.length_b_esd                 ? 
_cell.length_c                     116.530 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5GPY 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'General transcription factor IIE subunit 1'       25542.270 1  ? ? 'UNP residues 1-217'   ? 
2 polymer     man 'Transcription initiation factor IIE subunit beta' 12528.278 1  ? ? 'UNP residues 141-244' ? 
3 non-polymer syn 'ZINC ION'                                         65.409    1  ? ? ?                      ? 
4 water       nat water                                              18.015    77 ? ? ?                      ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'General transcription factor IIE 56 kDa subunit,Transcription initiation factor IIE subunit alpha,TFIIE-alpha' 
2 'TFIIE-beta,General transcription factor IIE subunit 2'                                                         
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GSHMADPDVLTEVPAALKRLAKYVIRGFYGIEHALALDILIRNSCVKEEDMLELLKFDRKQLRSVLNNLKGDKFIKCRMR
VETAADGKTTRHNYYFINYRTLVNVVKYKLDHMRRRIETDERDSTNRASFKCPVCSSTFTDLEANQLFDPMTGTFRCTFC
HTEVEEDESAMPKKDARTLLARFNEQIEPIYALLRETEDVNLAYEILEPEPTEIPALKQS
;
;GSHMADPDVLTEVPAALKRLAKYVIRGFYGIEHALALDILIRNSCVKEEDMLELLKFDRKQLRSVLNNLKGDKFIKCRMR
VETAADGKTTRHNYYFINYRTLVNVVKYKLDHMRRRIETDERDSTNRASFKCPVCSSTFTDLEANQLFDPMTGTFRCTFC
HTEVEEDESAMPKKDARTLLARFNEQIEPIYALLRETEDVNLAYEILEPEPTEIPALKQS
;
A ? 
2 'polypeptide(L)' no no 
;GSHMPKYNVRDKKALLRLLDQHDQRGLGGILLEDIEEALPNSQKAVKALGDQILFVNRPDKKKILFFNDKSCQFSVDEEF
QKLWRSVTVDSMDEEKIEEYLKRQGISS
;
;GSHMPKYNVRDKKALLRLLDQHDQRGLGGILLEDIEEALPNSQKAVKALGDQILFVNRPDKKKILFFNDKSCQFSVDEEF
QKLWRSVTVDSMDEEKIEEYLKRQGISS
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   HIS n 
1 4   MET n 
1 5   ALA n 
1 6   ASP n 
1 7   PRO n 
1 8   ASP n 
1 9   VAL n 
1 10  LEU n 
1 11  THR n 
1 12  GLU n 
1 13  VAL n 
1 14  PRO n 
1 15  ALA n 
1 16  ALA n 
1 17  LEU n 
1 18  LYS n 
1 19  ARG n 
1 20  LEU n 
1 21  ALA n 
1 22  LYS n 
1 23  TYR n 
1 24  VAL n 
1 25  ILE n 
1 26  ARG n 
1 27  GLY n 
1 28  PHE n 
1 29  TYR n 
1 30  GLY n 
1 31  ILE n 
1 32  GLU n 
1 33  HIS n 
1 34  ALA n 
1 35  LEU n 
1 36  ALA n 
1 37  LEU n 
1 38  ASP n 
1 39  ILE n 
1 40  LEU n 
1 41  ILE n 
1 42  ARG n 
1 43  ASN n 
1 44  SER n 
1 45  CYS n 
1 46  VAL n 
1 47  LYS n 
1 48  GLU n 
1 49  GLU n 
1 50  ASP n 
1 51  MET n 
1 52  LEU n 
1 53  GLU n 
1 54  LEU n 
1 55  LEU n 
1 56  LYS n 
1 57  PHE n 
1 58  ASP n 
1 59  ARG n 
1 60  LYS n 
1 61  GLN n 
1 62  LEU n 
1 63  ARG n 
1 64  SER n 
1 65  VAL n 
1 66  LEU n 
1 67  ASN n 
1 68  ASN n 
1 69  LEU n 
1 70  LYS n 
1 71  GLY n 
1 72  ASP n 
1 73  LYS n 
1 74  PHE n 
1 75  ILE n 
1 76  LYS n 
1 77  CYS n 
1 78  ARG n 
1 79  MET n 
1 80  ARG n 
1 81  VAL n 
1 82  GLU n 
1 83  THR n 
1 84  ALA n 
1 85  ALA n 
1 86  ASP n 
1 87  GLY n 
1 88  LYS n 
1 89  THR n 
1 90  THR n 
1 91  ARG n 
1 92  HIS n 
1 93  ASN n 
1 94  TYR n 
1 95  TYR n 
1 96  PHE n 
1 97  ILE n 
1 98  ASN n 
1 99  TYR n 
1 100 ARG n 
1 101 THR n 
1 102 LEU n 
1 103 VAL n 
1 104 ASN n 
1 105 VAL n 
1 106 VAL n 
1 107 LYS n 
1 108 TYR n 
1 109 LYS n 
1 110 LEU n 
1 111 ASP n 
1 112 HIS n 
1 113 MET n 
1 114 ARG n 
1 115 ARG n 
1 116 ARG n 
1 117 ILE n 
1 118 GLU n 
1 119 THR n 
1 120 ASP n 
1 121 GLU n 
1 122 ARG n 
1 123 ASP n 
1 124 SER n 
1 125 THR n 
1 126 ASN n 
1 127 ARG n 
1 128 ALA n 
1 129 SER n 
1 130 PHE n 
1 131 LYS n 
1 132 CYS n 
1 133 PRO n 
1 134 VAL n 
1 135 CYS n 
1 136 SER n 
1 137 SER n 
1 138 THR n 
1 139 PHE n 
1 140 THR n 
1 141 ASP n 
1 142 LEU n 
1 143 GLU n 
1 144 ALA n 
1 145 ASN n 
1 146 GLN n 
1 147 LEU n 
1 148 PHE n 
1 149 ASP n 
1 150 PRO n 
1 151 MET n 
1 152 THR n 
1 153 GLY n 
1 154 THR n 
1 155 PHE n 
1 156 ARG n 
1 157 CYS n 
1 158 THR n 
1 159 PHE n 
1 160 CYS n 
1 161 HIS n 
1 162 THR n 
1 163 GLU n 
1 164 VAL n 
1 165 GLU n 
1 166 GLU n 
1 167 ASP n 
1 168 GLU n 
1 169 SER n 
1 170 ALA n 
1 171 MET n 
1 172 PRO n 
1 173 LYS n 
1 174 LYS n 
1 175 ASP n 
1 176 ALA n 
1 177 ARG n 
1 178 THR n 
1 179 LEU n 
1 180 LEU n 
1 181 ALA n 
1 182 ARG n 
1 183 PHE n 
1 184 ASN n 
1 185 GLU n 
1 186 GLN n 
1 187 ILE n 
1 188 GLU n 
1 189 PRO n 
1 190 ILE n 
1 191 TYR n 
1 192 ALA n 
1 193 LEU n 
1 194 LEU n 
1 195 ARG n 
1 196 GLU n 
1 197 THR n 
1 198 GLU n 
1 199 ASP n 
1 200 VAL n 
1 201 ASN n 
1 202 LEU n 
1 203 ALA n 
1 204 TYR n 
1 205 GLU n 
1 206 ILE n 
1 207 LEU n 
1 208 GLU n 
1 209 PRO n 
1 210 GLU n 
1 211 PRO n 
1 212 THR n 
1 213 GLU n 
1 214 ILE n 
1 215 PRO n 
1 216 ALA n 
1 217 LEU n 
1 218 LYS n 
1 219 GLN n 
1 220 SER n 
2 1   GLY n 
2 2   SER n 
2 3   HIS n 
2 4   MET n 
2 5   PRO n 
2 6   LYS n 
2 7   TYR n 
2 8   ASN n 
2 9   VAL n 
2 10  ARG n 
2 11  ASP n 
2 12  LYS n 
2 13  LYS n 
2 14  ALA n 
2 15  LEU n 
2 16  LEU n 
2 17  ARG n 
2 18  LEU n 
2 19  LEU n 
2 20  ASP n 
2 21  GLN n 
2 22  HIS n 
2 23  ASP n 
2 24  GLN n 
2 25  ARG n 
2 26  GLY n 
2 27  LEU n 
2 28  GLY n 
2 29  GLY n 
2 30  ILE n 
2 31  LEU n 
2 32  LEU n 
2 33  GLU n 
2 34  ASP n 
2 35  ILE n 
2 36  GLU n 
2 37  GLU n 
2 38  ALA n 
2 39  LEU n 
2 40  PRO n 
2 41  ASN n 
2 42  SER n 
2 43  GLN n 
2 44  LYS n 
2 45  ALA n 
2 46  VAL n 
2 47  LYS n 
2 48  ALA n 
2 49  LEU n 
2 50  GLY n 
2 51  ASP n 
2 52  GLN n 
2 53  ILE n 
2 54  LEU n 
2 55  PHE n 
2 56  VAL n 
2 57  ASN n 
2 58  ARG n 
2 59  PRO n 
2 60  ASP n 
2 61  LYS n 
2 62  LYS n 
2 63  LYS n 
2 64  ILE n 
2 65  LEU n 
2 66  PHE n 
2 67  PHE n 
2 68  ASN n 
2 69  ASP n 
2 70  LYS n 
2 71  SER n 
2 72  CYS n 
2 73  GLN n 
2 74  PHE n 
2 75  SER n 
2 76  VAL n 
2 77  ASP n 
2 78  GLU n 
2 79  GLU n 
2 80  PHE n 
2 81  GLN n 
2 82  LYS n 
2 83  LEU n 
2 84  TRP n 
2 85  ARG n 
2 86  SER n 
2 87  VAL n 
2 88  THR n 
2 89  VAL n 
2 90  ASP n 
2 91  SER n 
2 92  MET n 
2 93  ASP n 
2 94  GLU n 
2 95  GLU n 
2 96  LYS n 
2 97  ILE n 
2 98  GLU n 
2 99  GLU n 
2 100 TYR n 
2 101 LEU n 
2 102 LYS n 
2 103 ARG n 
2 104 GLN n 
2 105 GLY n 
2 106 ILE n 
2 107 SER n 
2 108 SER n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 220 Human ? 'GTF2E1, TF2E1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 
562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 108 Human ? 'GTF2E2, TF2E2' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 
562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP T2EA_HUMAN P29083 ? 1 
;MADPDVLTEVPAALKRLAKYVIRGFYGIEHALALDILIRNSCVKEEDMLELLKFDRKQLRSVLNNLKGDKFIKCRMRVET
AADGKTTRHNYYFINYRTLVNVVKYKLDHMRRRIETDERDSTNRASFKCPVCSSTFTDLEANQLFDPMTGTFRCTFCHTE
VEEDESAMPKKDARTLLARFNEQIEPIYALLRETEDVNLAYEILEPEPTEIPALKQS
;
1   
2 UNP T2EB_HUMAN P29084 ? 2 
;PKYNVRDKKALLRLLDQHDQRGLGGILLEDIEEALPNSQKAVKALGDQILFVNRPDKKKILFFNDKSCQFSVDEEFQKLW
RSVTVDSMDEEKIEEYLKRQGISS
;
141 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5GPY A 4 ? 220 ? P29083 1   ? 217 ? 1   217 
2 2 5GPY B 5 ? 108 ? P29084 141 ? 244 ? 141 244 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5GPY GLY A 1 ? UNP P29083 ? ? 'expression tag' -2  1 
1 5GPY SER A 2 ? UNP P29083 ? ? 'expression tag' -1  2 
1 5GPY HIS A 3 ? UNP P29083 ? ? 'expression tag' 0   3 
2 5GPY GLY B 1 ? UNP P29084 ? ? 'expression tag' 137 4 
2 5GPY SER B 2 ? UNP P29084 ? ? 'expression tag' 138 5 
2 5GPY HIS B 3 ? UNP P29084 ? ? 'expression tag' 139 6 
2 5GPY MET B 4 ? UNP P29084 ? ? 'expression tag' 140 7 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5GPY 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.73 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         55 
_exptl_crystal.description                 'THE ENTRY CONTAINS FRIEDEL PAIRS IN F_PLUS/MINUS COLUMNS.' 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              8.9 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '12% PEG3350' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RAYONIX MX-225' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-10-02 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.282446 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL26B1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.282446 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL26B1 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5GPY 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.10 
_reflns.d_resolution_low                 59.5 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       24970 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.9 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.5 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            6.3 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.10 
_reflns_shell.d_res_low                   2.21 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.4 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        100.0 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.752 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             3.5 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  'SF FILE CONTAINS FRIEDEL PAIRS UNDER I/F_MINUS AND I/F_PLUS COLUMNS.' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5GPY 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.100 
_refine.ls_d_res_low                             41.325 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     24970 
_refine.ls_number_reflns_R_free                  1291 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.78 
_refine.ls_percent_reflns_R_free                 5.17 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2007 
_refine.ls_R_factor_R_free                       0.2372 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1985 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 27.21 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.26 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2290 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             77 
_refine_hist.number_atoms_total               2368 
_refine_hist.d_res_high                       2.100 
_refine_hist.d_res_low                        41.325 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.008  ? 2324 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.006  ? 3118 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 14.382 ? 903  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.040  ? 346  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.004  ? 403  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.1000 2.1841  . . 150 2572 100.00 . . . 0.3080 . 0.2942 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1841 2.2835  . . 139 2569 100.00 . . . 0.3663 . 0.2742 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2835 2.4039  . . 138 2605 100.00 . . . 0.2980 . 0.2555 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4039 2.5544  . . 144 2604 100.00 . . . 0.2801 . 0.2328 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5544 2.7516  . . 155 2592 100.00 . . . 0.2471 . 0.2198 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7516 3.0285  . . 132 2650 100.00 . . . 0.3106 . 0.2271 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0285 3.4665  . . 137 2654 100.00 . . . 0.2514 . 0.2026 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4665 4.3667  . . 142 2665 100.00 . . . 0.1985 . 0.1654 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.3667 41.3326 . . 154 2768 99.00  . . . 0.1951 . 0.1716 . . . . . . . . . . 
# 
_struct.entry_id                     5GPY 
_struct.title                        'Crystal structure of the human TFIIE complex' 
_struct.pdbx_descriptor              'General transcription factor IIE subunit 1, Transcription initiation factor IIE subunit beta' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5GPY 
_struct_keywords.text            'general transcription factor, RNA Polymerase II, TRANSCRIPTION' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 PRO A 14  ? TYR A 29  ? PRO A 11  TYR A 26  1 ? 16 
HELX_P HELX_P2  AA2 GLY A 30  ? ASN A 43  ? GLY A 27  ASN A 40  1 ? 14 
HELX_P HELX_P3  AA3 GLU A 48  ? LYS A 56  ? GLU A 45  LYS A 53  1 ? 9  
HELX_P HELX_P4  AA4 ASP A 58  ? ASP A 72  ? ASP A 55  ASP A 69  1 ? 15 
HELX_P HELX_P5  AA5 ASN A 98  ? ASN A 126 ? ASN A 95  ASN A 123 1 ? 29 
HELX_P HELX_P6  AA6 THR A 140 ? GLN A 146 ? THR A 137 GLN A 143 1 ? 7  
HELX_P HELX_P7  AA7 LEU A 179 ? THR A 197 ? LEU A 176 THR A 194 1 ? 19 
HELX_P HELX_P8  AA8 ASP B 11  ? GLY B 26  ? ASP B 147 GLY B 162 1 ? 16 
HELX_P HELX_P9  AA9 LEU B 32  ? LEU B 39  ? LEU B 168 LEU B 175 1 ? 8  
HELX_P HELX_P10 AB1 ASN B 41  ? LEU B 49  ? ASN B 177 LEU B 185 1 ? 9  
HELX_P HELX_P11 AB2 ASP B 77  ? SER B 86  ? ASP B 213 SER B 222 1 ? 10 
HELX_P HELX_P12 AB3 ASP B 93  ? GLY B 105 ? ASP B 229 GLY B 241 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A CYS 132 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 129 A ZN 301 1_555 ? ? ? ? ? ? ? 2.441 ? 
metalc2 metalc ? ? A CYS 135 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 132 A ZN 301 1_555 ? ? ? ? ? ? ? 2.291 ? 
metalc3 metalc ? ? A CYS 157 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 154 A ZN 301 1_555 ? ? ? ? ? ? ? 2.405 ? 
metalc4 metalc ? ? A CYS 160 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 157 A ZN 301 1_555 ? ? ? ? ? ? ? 2.383 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 3 ? 
AA3 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 46  ? LYS A 47  ? VAL A 43  LYS A 44  
AA1 2 THR A 89  ? ILE A 97  ? THR A 86  ILE A 94  
AA1 3 ILE A 75  ? THR A 83  ? ILE A 72  THR A 80  
AA2 1 THR A 138 ? PHE A 139 ? THR A 135 PHE A 136 
AA2 2 PHE A 130 ? LYS A 131 ? PHE A 127 LYS A 128 
AA2 3 GLU A 165 ? GLU A 166 ? GLU A 162 GLU A 163 
AA3 1 ILE B 30  ? LEU B 31  ? ILE B 166 LEU B 167 
AA3 2 LYS B 63  ? PHE B 67  ? LYS B 199 PHE B 203 
AA3 3 ILE B 53  ? ASN B 57  ? ILE B 189 ASN B 193 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N VAL A 46  ? N VAL A 43  O TYR A 95  ? O TYR A 92  
AA1 2 3 O THR A 90  ? O THR A 87  N GLU A 82  ? N GLU A 79  
AA2 1 2 O PHE A 139 ? O PHE A 136 N PHE A 130 ? N PHE A 127 
AA2 2 3 N LYS A 131 ? N LYS A 128 O GLU A 165 ? O GLU A 162 
AA3 1 2 N ILE B 30  ? N ILE B 166 O LEU B 65  ? O LEU B 201 
AA3 2 3 O PHE B 66  ? O PHE B 202 N LEU B 54  ? N LEU B 190 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    ZN 
_struct_site.pdbx_auth_seq_id     301 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'binding site for residue ZN A 301' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 CYS A 132 ? CYS A 129 . ? 1_555 ? 
2 AC1 4 CYS A 135 ? CYS A 132 . ? 1_555 ? 
3 AC1 4 CYS A 157 ? CYS A 154 . ? 1_555 ? 
4 AC1 4 CYS A 160 ? CYS A 157 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5GPY 
_atom_sites.fract_transf_matrix[1][1]   0.019410 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014451 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008581 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . VAL A 1 13  ? 60.969 13.518 21.050  1.00 74.91  ?  10  VAL A N   1 
ATOM   2    C  CA  . VAL A 1 13  ? 59.857 13.358 21.989  1.00 73.87  ?  10  VAL A CA  1 
ATOM   3    C  C   . VAL A 1 13  ? 59.436 11.900 22.120  1.00 72.59  ?  10  VAL A C   1 
ATOM   4    O  O   . VAL A 1 13  ? 59.048 11.276 21.136  1.00 75.37  ?  10  VAL A O   1 
ATOM   5    C  CB  . VAL A 1 13  ? 58.626 14.191 21.567  1.00 66.90  ?  10  VAL A CB  1 
ATOM   6    C  CG1 . VAL A 1 13  ? 57.428 13.869 22.461  1.00 63.74  ?  10  VAL A CG1 1 
ATOM   7    C  CG2 . VAL A 1 13  ? 58.945 15.676 21.615  1.00 61.16  ?  10  VAL A CG2 1 
ATOM   8    N  N   . PRO A 1 14  ? 59.512 11.356 23.344  1.00 69.32  ?  11  PRO A N   1 
ATOM   9    C  CA  . PRO A 1 14  ? 59.137 9.969  23.643  1.00 69.77  ?  11  PRO A CA  1 
ATOM   10   C  C   . PRO A 1 14  ? 57.735 9.635  23.152  1.00 68.09  ?  11  PRO A C   1 
ATOM   11   O  O   . PRO A 1 14  ? 56.826 10.453 23.301  1.00 65.18  ?  11  PRO A O   1 
ATOM   12   C  CB  . PRO A 1 14  ? 59.210 9.909  25.170  1.00 71.19  ?  11  PRO A CB  1 
ATOM   13   C  CG  . PRO A 1 14  ? 60.222 10.937 25.526  1.00 74.20  ?  11  PRO A CG  1 
ATOM   14   C  CD  . PRO A 1 14  ? 60.017 12.057 24.536  1.00 71.82  ?  11  PRO A CD  1 
ATOM   15   N  N   . ALA A 1 15  ? 57.570 8.448  22.576  1.00 69.05  ?  12  ALA A N   1 
ATOM   16   C  CA  . ALA A 1 15  ? 56.297 8.039  21.992  1.00 62.53  ?  12  ALA A CA  1 
ATOM   17   C  C   . ALA A 1 15  ? 55.169 8.036  23.024  1.00 61.05  ?  12  ALA A C   1 
ATOM   18   O  O   . ALA A 1 15  ? 54.020 8.359  22.699  1.00 62.68  ?  12  ALA A O   1 
ATOM   19   C  CB  . ALA A 1 15  ? 56.429 6.662  21.347  1.00 58.82  ?  12  ALA A CB  1 
ATOM   20   N  N   . ALA A 1 16  ? 55.505 7.679  24.262  1.00 57.33  ?  13  ALA A N   1 
ATOM   21   C  CA  . ALA A 1 16  ? 54.517 7.577  25.338  1.00 62.35  ?  13  ALA A CA  1 
ATOM   22   C  C   . ALA A 1 16  ? 53.949 8.940  25.738  1.00 60.72  ?  13  ALA A C   1 
ATOM   23   O  O   . ALA A 1 16  ? 52.791 9.036  26.124  1.00 62.40  ?  13  ALA A O   1 
ATOM   24   C  CB  . ALA A 1 16  ? 55.127 6.884  26.552  1.00 65.67  ?  13  ALA A CB  1 
ATOM   25   N  N   . LEU A 1 17  ? 54.772 9.983  25.653  1.00 61.18  ?  14  LEU A N   1 
ATOM   26   C  CA  . LEU A 1 17  ? 54.314 11.354 25.867  1.00 52.77  ?  14  LEU A CA  1 
ATOM   27   C  C   . LEU A 1 17  ? 53.330 11.766 24.797  1.00 49.79  ?  14  LEU A C   1 
ATOM   28   O  O   . LEU A 1 17  ? 52.327 12.425 25.072  1.00 45.82  ?  14  LEU A O   1 
ATOM   29   C  CB  . LEU A 1 17  ? 55.490 12.331 25.863  1.00 53.20  ?  14  LEU A CB  1 
ATOM   30   C  CG  . LEU A 1 17  ? 56.210 12.533 27.183  1.00 60.63  ?  14  LEU A CG  1 
ATOM   31   C  CD1 . LEU A 1 17  ? 57.308 13.564 27.025  1.00 62.19  ?  14  LEU A CD1 1 
ATOM   32   C  CD2 . LEU A 1 17  ? 55.206 12.956 28.244  1.00 64.37  ?  14  LEU A CD2 1 
ATOM   33   N  N   . LYS A 1 18  ? 53.640 11.398 23.558  1.00 46.63  ?  15  LYS A N   1 
ATOM   34   C  CA  . LYS A 1 18  ? 52.789 11.759 22.439  1.00 44.61  ?  15  LYS A CA  1 
ATOM   35   C  C   . LYS A 1 18  ? 51.448 11.076 22.613  1.00 38.72  ?  15  LYS A C   1 
ATOM   36   O  O   . LYS A 1 18  ? 50.402 11.689 22.416  1.00 37.64  ?  15  LYS A O   1 
ATOM   37   C  CB  . LYS A 1 18  ? 53.429 11.362 21.102  1.00 47.45  ?  15  LYS A CB  1 
ATOM   38   C  CG  . LYS A 1 18  ? 54.461 12.353 20.588  1.00 55.50  ?  15  LYS A CG  1 
ATOM   39   C  CD  . LYS A 1 18  ? 55.280 11.761 19.441  1.00 58.06  ?  15  LYS A CD  1 
ATOM   40   C  CE  . LYS A 1 18  ? 56.184 12.812 18.806  1.00 61.69  ?  15  LYS A CE  1 
ATOM   41   N  NZ  . LYS A 1 18  ? 57.250 12.193 17.958  1.00 68.51  ?  15  LYS A NZ  1 
ATOM   42   N  N   . ARG A 1 19  ? 51.485 9.806  22.999  1.00 39.44  ?  16  ARG A N   1 
ATOM   43   C  CA  . ARG A 1 19  ? 50.262 9.029  23.127  1.00 42.15  ?  16  ARG A CA  1 
ATOM   44   C  C   . ARG A 1 19  ? 49.411 9.556  24.276  1.00 43.95  ?  16  ARG A C   1 
ATOM   45   O  O   . ARG A 1 19  ? 48.202 9.667  24.143  1.00 42.23  ?  16  ARG A O   1 
ATOM   46   C  CB  . ARG A 1 19  ? 50.577 7.550  23.335  1.00 53.93  ?  16  ARG A CB  1 
ATOM   47   C  CG  . ARG A 1 19  ? 49.413 6.631  22.981  1.00 64.62  ?  16  ARG A CG  1 
ATOM   48   C  CD  . ARG A 1 19  ? 49.790 5.156  23.078  1.00 75.86  ?  16  ARG A CD  1 
ATOM   49   N  NE  . ARG A 1 19  ? 50.912 4.815  22.210  1.00 88.73  ?  16  ARG A NE  1 
ATOM   50   C  CZ  . ARG A 1 19  ? 52.138 4.524  22.642  1.00 98.18  ?  16  ARG A CZ  1 
ATOM   51   N  NH1 . ARG A 1 19  ? 52.408 4.527  23.942  1.00 97.18  ?  16  ARG A NH1 1 
ATOM   52   N  NH2 . ARG A 1 19  ? 53.094 4.223  21.769  1.00 103.45 ?  16  ARG A NH2 1 
ATOM   53   N  N   . LEU A 1 20  ? 50.043 9.882  25.401  1.00 45.17  ?  17  LEU A N   1 
ATOM   54   C  CA  . LEU A 1 20  ? 49.309 10.479 26.510  1.00 44.53  ?  17  LEU A CA  1 
ATOM   55   C  C   . LEU A 1 20  ? 48.529 11.694 26.046  1.00 36.77  ?  17  LEU A C   1 
ATOM   56   O  O   . LEU A 1 20  ? 47.320 11.776 26.259  1.00 37.12  ?  17  LEU A O   1 
ATOM   57   C  CB  . LEU A 1 20  ? 50.247 10.874 27.666  1.00 47.19  ?  17  LEU A CB  1 
ATOM   58   C  CG  . LEU A 1 20  ? 49.588 11.673 28.802  1.00 43.34  ?  17  LEU A CG  1 
ATOM   59   C  CD1 . LEU A 1 20  ? 48.619 10.800 29.580  1.00 40.07  ?  17  LEU A CD1 1 
ATOM   60   C  CD2 . LEU A 1 20  ? 50.642 12.260 29.728  1.00 41.00  ?  17  LEU A CD2 1 
ATOM   61   N  N   . ALA A 1 21  ? 49.216 12.630 25.400  1.00 35.07  ?  18  ALA A N   1 
ATOM   62   C  CA  . ALA A 1 21  ? 48.571 13.833 24.909  1.00 36.01  ?  18  ALA A CA  1 
ATOM   63   C  C   . ALA A 1 21  ? 47.449 13.518 23.916  1.00 41.84  ?  18  ALA A C   1 
ATOM   64   O  O   . ALA A 1 21  ? 46.386 14.157 23.957  1.00 34.62  ?  18  ALA A O   1 
ATOM   65   C  CB  . ALA A 1 21  ? 49.575 14.741 24.266  1.00 36.17  ?  18  ALA A CB  1 
ATOM   66   N  N   . LYS A 1 22  ? 47.668 12.539 23.038  1.00 42.57  ?  19  LYS A N   1 
ATOM   67   C  CA  . LYS A 1 22  ? 46.645 12.192 22.038  1.00 46.40  ?  19  LYS A CA  1 
ATOM   68   C  C   . LYS A 1 22  ? 45.405 11.583 22.698  1.00 44.87  ?  19  LYS A C   1 
ATOM   69   O  O   . LYS A 1 22  ? 44.270 11.890 22.332  1.00 43.42  ?  19  LYS A O   1 
ATOM   70   C  CB  . LYS A 1 22  ? 47.202 11.220 20.989  1.00 46.50  ?  19  LYS A CB  1 
ATOM   71   C  CG  . LYS A 1 22  ? 48.432 11.726 20.254  1.00 50.55  ?  19  LYS A CG  1 
ATOM   72   C  CD  . LYS A 1 22  ? 48.198 11.965 18.783  1.00 55.87  ?  19  LYS A CD  1 
ATOM   73   C  CE  . LYS A 1 22  ? 48.386 10.726 17.946  1.00 60.92  ?  19  LYS A CE  1 
ATOM   74   N  NZ  . LYS A 1 22  ? 48.329 11.114 16.506  1.00 63.38  ?  19  LYS A NZ  1 
ATOM   75   N  N   . TYR A 1 23  ? 45.629 10.700 23.659  1.00 42.15  ?  20  TYR A N   1 
ATOM   76   C  CA  . TYR A 1 23  ? 44.525 10.090 24.393  1.00 46.93  ?  20  TYR A CA  1 
ATOM   77   C  C   . TYR A 1 23  ? 43.731 11.148 25.160  1.00 42.42  ?  20  TYR A C   1 
ATOM   78   O  O   . TYR A 1 23  ? 42.496 11.215 25.066  1.00 39.05  ?  20  TYR A O   1 
ATOM   79   C  CB  . TYR A 1 23  ? 45.045 9.026  25.364  1.00 47.16  ?  20  TYR A CB  1 
ATOM   80   C  CG  . TYR A 1 23  ? 45.151 7.623  24.794  1.00 50.91  ?  20  TYR A CG  1 
ATOM   81   C  CD1 . TYR A 1 23  ? 45.765 7.378  23.563  1.00 49.58  ?  20  TYR A CD1 1 
ATOM   82   C  CD2 . TYR A 1 23  ? 44.660 6.540  25.506  1.00 59.62  ?  20  TYR A CD2 1 
ATOM   83   C  CE1 . TYR A 1 23  ? 45.865 6.092  23.062  1.00 49.91  ?  20  TYR A CE1 1 
ATOM   84   C  CE2 . TYR A 1 23  ? 44.756 5.259  25.012  1.00 65.51  ?  20  TYR A CE2 1 
ATOM   85   C  CZ  . TYR A 1 23  ? 45.355 5.039  23.791  1.00 59.21  ?  20  TYR A CZ  1 
ATOM   86   O  OH  . TYR A 1 23  ? 45.438 3.750  23.328  1.00 64.27  ?  20  TYR A OH  1 
ATOM   87   N  N   . VAL A 1 24  ? 44.444 11.978 25.912  1.00 39.78  ?  21  VAL A N   1 
ATOM   88   C  CA  . VAL A 1 24  ? 43.775 12.951 26.772  1.00 41.91  ?  21  VAL A CA  1 
ATOM   89   C  C   . VAL A 1 24  ? 42.989 13.976 25.921  1.00 38.82  ?  21  VAL A C   1 
ATOM   90   O  O   . VAL A 1 24  ? 41.857 14.333 26.244  1.00 35.25  ?  21  VAL A O   1 
ATOM   91   C  CB  . VAL A 1 24  ? 44.784 13.658 27.702  1.00 38.33  ?  21  VAL A CB  1 
ATOM   92   C  CG1 . VAL A 1 24  ? 44.188 14.933 28.267  1.00 36.02  ?  21  VAL A CG1 1 
ATOM   93   C  CG2 . VAL A 1 24  ? 45.264 12.689 28.836  1.00 31.11  ?  21  VAL A CG2 1 
ATOM   94   N  N   . ILE A 1 25  ? 43.555 14.408 24.805  1.00 30.04  ?  22  ILE A N   1 
ATOM   95   C  CA  . ILE A 1 25  ? 42.866 15.412 24.001  1.00 29.00  ?  22  ILE A CA  1 
ATOM   96   C  C   . ILE A 1 25  ? 41.584 14.825 23.414  1.00 33.41  ?  22  ILE A C   1 
ATOM   97   O  O   . ILE A 1 25  ? 40.589 15.533 23.272  1.00 39.26  ?  22  ILE A O   1 
ATOM   98   C  CB  . ILE A 1 25  ? 43.778 15.983 22.866  1.00 48.03  ?  22  ILE A CB  1 
ATOM   99   C  CG1 . ILE A 1 25  ? 43.262 17.342 22.387  1.00 46.66  ?  22  ILE A CG1 1 
ATOM   100  C  CG2 . ILE A 1 25  ? 43.958 14.998 21.711  1.00 47.49  ?  22  ILE A CG2 1 
ATOM   101  C  CD1 . ILE A 1 25  ? 43.321 18.387 23.473  1.00 54.17  ?  22  ILE A CD1 1 
ATOM   102  N  N   . ARG A 1 26  ? 41.584 13.531 23.107  1.00 36.96  ?  23  ARG A N   1 
ATOM   103  C  CA  . ARG A 1 26  ? 40.410 12.913 22.491  1.00 42.02  ?  23  ARG A CA  1 
ATOM   104  C  C   . ARG A 1 26  ? 39.327 12.673 23.530  1.00 42.40  ?  23  ARG A C   1 
ATOM   105  O  O   . ARG A 1 26  ? 38.132 12.827 23.261  1.00 44.67  ?  23  ARG A O   1 
ATOM   106  C  CB  . ARG A 1 26  ? 40.789 11.596 21.803  1.00 41.16  ?  23  ARG A CB  1 
ATOM   107  C  CG  . ARG A 1 26  ? 41.357 11.796 20.418  1.00 48.51  ?  23  ARG A CG  1 
ATOM   108  C  CD  . ARG A 1 26  ? 42.267 10.655 19.985  1.00 55.76  ?  23  ARG A CD  1 
ATOM   109  N  NE  . ARG A 1 26  ? 42.782 10.931 18.645  1.00 53.14  ?  23  ARG A NE  1 
ATOM   110  C  CZ  . ARG A 1 26  ? 43.744 11.815 18.384  1.00 48.83  ?  23  ARG A CZ  1 
ATOM   111  N  NH1 . ARG A 1 26  ? 44.121 12.015 17.134  1.00 45.44  ?  23  ARG A NH1 1 
ATOM   112  N  NH2 . ARG A 1 26  ? 44.317 12.516 19.372  1.00 39.80  ?  23  ARG A NH2 1 
ATOM   113  N  N   . GLY A 1 27  ? 39.757 12.278 24.721  1.00 41.14  ?  24  GLY A N   1 
ATOM   114  C  CA  . GLY A 1 27  ? 38.829 11.955 25.793  1.00 46.66  ?  24  GLY A CA  1 
ATOM   115  C  C   . GLY A 1 27  ? 38.093 13.144 26.390  1.00 42.07  ?  24  GLY A C   1 
ATOM   116  O  O   . GLY A 1 27  ? 36.913 13.027 26.757  1.00 45.32  ?  24  GLY A O   1 
ATOM   117  N  N   . PHE A 1 28  ? 38.773 14.286 26.482  1.00 38.95  ?  25  PHE A N   1 
ATOM   118  C  CA  . PHE A 1 28  ? 38.258 15.399 27.282  1.00 40.70  ?  25  PHE A CA  1 
ATOM   119  C  C   . PHE A 1 28  ? 38.064 16.717 26.528  1.00 43.65  ?  25  PHE A C   1 
ATOM   120  O  O   . PHE A 1 28  ? 37.565 17.679 27.109  1.00 48.65  ?  25  PHE A O   1 
ATOM   121  C  CB  . PHE A 1 28  ? 39.181 15.620 28.490  1.00 39.32  ?  25  PHE A CB  1 
ATOM   122  C  CG  . PHE A 1 28  ? 39.230 14.449 29.413  1.00 39.26  ?  25  PHE A CG  1 
ATOM   123  C  CD1 . PHE A 1 28  ? 38.186 14.206 30.296  1.00 39.24  ?  25  PHE A CD1 1 
ATOM   124  C  CD2 . PHE A 1 28  ? 40.300 13.564 29.378  1.00 39.49  ?  25  PHE A CD2 1 
ATOM   125  C  CE1 . PHE A 1 28  ? 38.205 13.105 31.144  1.00 42.62  ?  25  PHE A CE1 1 
ATOM   126  C  CE2 . PHE A 1 28  ? 40.334 12.470 30.225  1.00 41.66  ?  25  PHE A CE2 1 
ATOM   127  C  CZ  . PHE A 1 28  ? 39.284 12.241 31.112  1.00 42.99  ?  25  PHE A CZ  1 
ATOM   128  N  N   . TYR A 1 29  ? 38.428 16.749 25.242  1.00 33.28  ?  26  TYR A N   1 
ATOM   129  C  CA  . TYR A 1 29  ? 38.255 17.935 24.394  1.00 38.75  ?  26  TYR A CA  1 
ATOM   130  C  C   . TYR A 1 29  ? 37.579 17.516 23.068  1.00 44.87  ?  26  TYR A C   1 
ATOM   131  O  O   . TYR A 1 29  ? 37.498 16.331 22.757  1.00 51.44  ?  26  TYR A O   1 
ATOM   132  C  CB  . TYR A 1 29  ? 39.618 18.630 24.144  1.00 30.79  ?  26  TYR A CB  1 
ATOM   133  C  CG  . TYR A 1 29  ? 40.315 19.056 25.437  1.00 36.04  ?  26  TYR A CG  1 
ATOM   134  C  CD1 . TYR A 1 29  ? 41.003 18.135 26.225  1.00 33.79  ?  26  TYR A CD1 1 
ATOM   135  C  CD2 . TYR A 1 29  ? 40.280 20.379 25.869  1.00 42.48  ?  26  TYR A CD2 1 
ATOM   136  C  CE1 . TYR A 1 29  ? 41.634 18.527 27.433  1.00 37.42  ?  26  TYR A CE1 1 
ATOM   137  C  CE2 . TYR A 1 29  ? 40.899 20.773 27.064  1.00 45.76  ?  26  TYR A CE2 1 
ATOM   138  C  CZ  . TYR A 1 29  ? 41.569 19.842 27.838  1.00 42.16  ?  26  TYR A CZ  1 
ATOM   139  O  OH  . TYR A 1 29  ? 42.171 20.244 29.012  1.00 49.05  ?  26  TYR A OH  1 
ATOM   140  N  N   . GLY A 1 30  ? 37.069 18.470 22.302  1.00 46.15  ?  27  GLY A N   1 
ATOM   141  C  CA  . GLY A 1 30  ? 36.412 18.158 21.029  1.00 43.64  ?  27  GLY A CA  1 
ATOM   142  C  C   . GLY A 1 30  ? 37.301 17.642 19.887  1.00 36.73  ?  27  GLY A C   1 
ATOM   143  O  O   . GLY A 1 30  ? 38.528 17.589 20.000  1.00 38.95  ?  27  GLY A O   1 
ATOM   144  N  N   . ILE A 1 31  ? 36.663 17.224 18.792  1.00 46.34  ?  28  ILE A N   1 
ATOM   145  C  CA  . ILE A 1 31  ? 37.373 16.836 17.569  1.00 35.59  ?  28  ILE A CA  1 
ATOM   146  C  C   . ILE A 1 31  ? 38.332 17.943 17.143  1.00 34.15  ?  28  ILE A C   1 
ATOM   147  O  O   . ILE A 1 31  ? 39.479 17.687 16.770  1.00 34.80  ?  28  ILE A O   1 
ATOM   148  C  CB  . ILE A 1 31  ? 36.392 16.541 16.406  1.00 47.46  ?  28  ILE A CB  1 
ATOM   149  C  CG1 . ILE A 1 31  ? 35.509 15.337 16.724  1.00 59.56  ?  28  ILE A CG1 1 
ATOM   150  C  CG2 . ILE A 1 31  ? 37.157 16.279 15.122  1.00 52.03  ?  28  ILE A CG2 1 
ATOM   151  C  CD1 . ILE A 1 31  ? 36.227 14.008 16.624  1.00 64.91  ?  28  ILE A CD1 1 
ATOM   152  N  N   . GLU A 1 32  ? 37.849 19.182 17.206  1.00 32.40  ?  29  GLU A N   1 
ATOM   153  C  CA  . GLU A 1 32  ? 38.619 20.335 16.750  1.00 40.42  ?  29  GLU A CA  1 
ATOM   154  C  C   . GLU A 1 32  ? 39.937 20.450 17.463  1.00 39.64  ?  29  GLU A C   1 
ATOM   155  O  O   . GLU A 1 32  ? 40.945 20.822 16.869  1.00 32.05  ?  29  GLU A O   1 
ATOM   156  C  CB  . GLU A 1 32  ? 37.826 21.626 16.953  1.00 44.35  ?  29  GLU A CB  1 
ATOM   157  C  CG  . GLU A 1 32  ? 36.548 21.690 16.170  1.00 52.07  ?  29  GLU A CG  1 
ATOM   158  C  CD  . GLU A 1 32  ? 35.496 22.484 16.900  1.00 70.71  ?  29  GLU A CD  1 
ATOM   159  O  OE1 . GLU A 1 32  ? 35.154 22.090 18.039  1.00 81.39  ?  29  GLU A OE1 1 
ATOM   160  O  OE2 . GLU A 1 32  ? 35.025 23.502 16.349  1.00 67.74  ?  29  GLU A OE2 1 
ATOM   161  N  N   . HIS A 1 33  ? 39.911 20.150 18.757  1.00 32.91  ?  30  HIS A N   1 
ATOM   162  C  CA  . HIS A 1 33  ? 41.092 20.240 19.596  1.00 31.57  ?  30  HIS A CA  1 
ATOM   163  C  C   . HIS A 1 33  ? 42.066 19.135 19.236  1.00 31.97  ?  30  HIS A C   1 
ATOM   164  O  O   . HIS A 1 33  ? 43.277 19.348 19.212  1.00 30.31  ?  30  HIS A O   1 
ATOM   165  C  CB  . HIS A 1 33  ? 40.701 20.160 21.084  1.00 32.20  ?  30  HIS A CB  1 
ATOM   166  C  CG  . HIS A 1 33  ? 39.819 21.292 21.538  1.00 34.72  ?  30  HIS A CG  1 
ATOM   167  N  ND1 . HIS A 1 33  ? 38.515 21.429 21.125  1.00 40.38  ?  30  HIS A ND1 1 
ATOM   168  C  CD2 . HIS A 1 33  ? 40.071 22.344 22.355  1.00 34.56  ?  30  HIS A CD2 1 
ATOM   169  C  CE1 . HIS A 1 33  ? 37.994 22.519 21.666  1.00 39.26  ?  30  HIS A CE1 1 
ATOM   170  N  NE2 . HIS A 1 33  ? 38.914 23.087 22.420  1.00 41.46  ?  30  HIS A NE2 1 
ATOM   171  N  N   . ALA A 1 34  ? 41.533 17.947 18.970  1.00 26.73  ?  31  ALA A N   1 
ATOM   172  C  CA  . ALA A 1 34  ? 42.373 16.802 18.642  1.00 27.04  ?  31  ALA A CA  1 
ATOM   173  C  C   . ALA A 1 34  ? 43.130 17.051 17.346  1.00 34.18  ?  31  ALA A C   1 
ATOM   174  O  O   . ALA A 1 34  ? 44.335 16.769 17.264  1.00 31.51  ?  31  ALA A O   1 
ATOM   175  C  CB  . ALA A 1 34  ? 41.529 15.520 18.531  1.00 24.89  ?  31  ALA A CB  1 
ATOM   176  N  N   . LEU A 1 35  ? 42.425 17.576 16.339  1.00 29.01  ?  32  LEU A N   1 
ATOM   177  C  CA  . LEU A 1 35  ? 43.026 17.822 15.028  1.00 26.87  ?  32  LEU A CA  1 
ATOM   178  C  C   . LEU A 1 35  ? 44.057 18.918 15.082  1.00 29.85  ?  32  LEU A C   1 
ATOM   179  O  O   . LEU A 1 35  ? 45.118 18.801 14.460  1.00 32.21  ?  32  LEU A O   1 
ATOM   180  C  CB  . LEU A 1 35  ? 41.953 18.178 13.987  1.00 27.92  ?  32  LEU A CB  1 
ATOM   181  C  CG  . LEU A 1 35  ? 40.941 17.053 13.764  1.00 32.29  ?  32  LEU A CG  1 
ATOM   182  C  CD1 . LEU A 1 35  ? 39.751 17.563 12.944  1.00 36.19  ?  32  LEU A CD1 1 
ATOM   183  C  CD2 . LEU A 1 35  ? 41.592 15.852 13.082  1.00 38.83  ?  32  LEU A CD2 1 
ATOM   184  N  N   . ALA A 1 36  ? 43.766 19.978 15.838  1.00 30.96  ?  33  ALA A N   1 
ATOM   185  C  CA  . ALA A 1 36  ? 44.768 21.026 16.047  1.00 32.32  ?  33  ALA A CA  1 
ATOM   186  C  C   . ALA A 1 36  ? 46.001 20.442 16.717  1.00 36.47  ?  33  ALA A C   1 
ATOM   187  O  O   . ALA A 1 36  ? 47.132 20.687 16.286  1.00 31.74  ?  33  ALA A O   1 
ATOM   188  C  CB  . ALA A 1 36  ? 44.195 22.183 16.882  1.00 30.63  ?  33  ALA A CB  1 
ATOM   189  N  N   . LEU A 1 37  ? 45.800 19.657 17.773  1.00 36.13  ?  34  LEU A N   1 
ATOM   190  C  CA  . LEU A 1 37  ? 46.950 19.092 18.484  1.00 32.37  ?  34  LEU A CA  1 
ATOM   191  C  C   . LEU A 1 37  ? 47.782 18.127 17.611  1.00 31.94  ?  34  LEU A C   1 
ATOM   192  O  O   . LEU A 1 37  ? 48.986 18.019 17.800  1.00 34.73  ?  34  LEU A O   1 
ATOM   193  C  CB  . LEU A 1 37  ? 46.493 18.370 19.756  1.00 36.05  ?  34  LEU A CB  1 
ATOM   194  C  CG  . LEU A 1 37  ? 47.621 18.207 20.794  1.00 39.02  ?  34  LEU A CG  1 
ATOM   195  C  CD1 . LEU A 1 37  ? 47.847 19.528 21.515  1.00 33.78  ?  34  LEU A CD1 1 
ATOM   196  C  CD2 . LEU A 1 37  ? 47.310 17.102 21.775  1.00 40.33  ?  34  LEU A CD2 1 
ATOM   197  N  N   . ASP A 1 38  ? 47.142 17.423 16.674  1.00 28.67  ?  35  ASP A N   1 
ATOM   198  C  CA  . ASP A 1 38  ? 47.845 16.502 15.774  1.00 35.46  ?  35  ASP A CA  1 
ATOM   199  C  C   . ASP A 1 38  ? 48.977 17.191 15.009  1.00 33.19  ?  35  ASP A C   1 
ATOM   200  O  O   . ASP A 1 38  ? 50.018 16.598 14.724  1.00 30.54  ?  35  ASP A O   1 
ATOM   201  C  CB  . ASP A 1 38  ? 46.883 15.897 14.751  1.00 40.72  ?  35  ASP A CB  1 
ATOM   202  C  CG  . ASP A 1 38  ? 46.185 14.658 15.246  1.00 44.83  ?  35  ASP A CG  1 
ATOM   203  O  OD1 . ASP A 1 38  ? 46.618 14.079 16.273  1.00 47.52  ?  35  ASP A OD1 1 
ATOM   204  O  OD2 . ASP A 1 38  ? 45.197 14.259 14.586  1.00 47.74  ?  35  ASP A OD2 1 
ATOM   205  N  N   . ILE A 1 39  ? 48.740 18.446 14.666  1.00 32.78  ?  36  ILE A N   1 
ATOM   206  C  CA  . ILE A 1 39  ? 49.681 19.249 13.910  1.00 34.12  ?  36  ILE A CA  1 
ATOM   207  C  C   . ILE A 1 39  ? 50.895 19.550 14.765  1.00 36.90  ?  36  ILE A C   1 
ATOM   208  O  O   . ILE A 1 39  ? 52.042 19.475 14.309  1.00 35.53  ?  36  ILE A O   1 
ATOM   209  C  CB  . ILE A 1 39  ? 48.993 20.541 13.438  1.00 35.29  ?  36  ILE A CB  1 
ATOM   210  C  CG1 . ILE A 1 39  ? 47.874 20.171 12.454  1.00 34.88  ?  36  ILE A CG1 1 
ATOM   211  C  CG2 . ILE A 1 39  ? 49.983 21.529 12.815  1.00 28.45  ?  36  ILE A CG2 1 
ATOM   212  C  CD1 . ILE A 1 39  ? 47.062 21.353 11.952  1.00 28.80  ?  36  ILE A CD1 1 
ATOM   213  N  N   . LEU A 1 40  ? 50.627 19.868 16.024  1.00 30.62  ?  37  LEU A N   1 
ATOM   214  C  CA  . LEU A 1 40  ? 51.669 20.177 16.987  1.00 31.89  ?  37  LEU A CA  1 
ATOM   215  C  C   . LEU A 1 40  ? 52.411 18.919 17.422  1.00 34.67  ?  37  LEU A C   1 
ATOM   216  O  O   . LEU A 1 40  ? 53.486 18.996 18.006  1.00 43.72  ?  37  LEU A O   1 
ATOM   217  C  CB  . LEU A 1 40  ? 51.052 20.897 18.200  1.00 33.20  ?  37  LEU A CB  1 
ATOM   218  C  CG  . LEU A 1 40  ? 50.436 22.258 17.819  1.00 35.57  ?  37  LEU A CG  1 
ATOM   219  C  CD1 . LEU A 1 40  ? 50.059 23.056 19.060  1.00 42.23  ?  37  LEU A CD1 1 
ATOM   220  C  CD2 . LEU A 1 40  ? 51.424 23.077 16.948  1.00 29.22  ?  37  LEU A CD2 1 
ATOM   221  N  N   . ILE A 1 41  ? 51.837 17.752 17.148  1.00 35.62  ?  38  ILE A N   1 
ATOM   222  C  CA  . ILE A 1 41  ? 52.555 16.512 17.387  1.00 40.05  ?  38  ILE A CA  1 
ATOM   223  C  C   . ILE A 1 41  ? 53.439 16.179 16.186  1.00 46.54  ?  38  ILE A C   1 
ATOM   224  O  O   . ILE A 1 41  ? 54.580 15.777 16.357  1.00 52.95  ?  38  ILE A O   1 
ATOM   225  C  CB  . ILE A 1 41  ? 51.582 15.367 17.723  1.00 41.19  ?  38  ILE A CB  1 
ATOM   226  C  CG1 . ILE A 1 41  ? 51.140 15.540 19.185  1.00 44.82  ?  38  ILE A CG1 1 
ATOM   227  C  CG2 . ILE A 1 41  ? 52.259 14.022 17.547  1.00 39.10  ?  38  ILE A CG2 1 
ATOM   228  C  CD1 . ILE A 1 41  ? 49.838 14.925 19.534  1.00 50.77  ?  38  ILE A CD1 1 
ATOM   229  N  N   . ARG A 1 42  ? 52.921 16.379 14.977  1.00 42.66  ?  39  ARG A N   1 
ATOM   230  C  CA  . ARG A 1 42  ? 53.715 16.215 13.753  1.00 44.75  ?  39  ARG A CA  1 
ATOM   231  C  C   . ARG A 1 42  ? 54.937 17.119 13.717  1.00 38.93  ?  39  ARG A C   1 
ATOM   232  O  O   . ARG A 1 42  ? 56.006 16.719 13.274  1.00 38.66  ?  39  ARG A O   1 
ATOM   233  C  CB  . ARG A 1 42  ? 52.871 16.520 12.504  1.00 45.06  ?  39  ARG A CB  1 
ATOM   234  C  CG  . ARG A 1 42  ? 52.160 15.340 11.899  1.00 42.81  ?  39  ARG A CG  1 
ATOM   235  C  CD  . ARG A 1 42  ? 51.381 15.774 10.659  1.00 45.51  ?  39  ARG A CD  1 
ATOM   236  N  NE  . ARG A 1 42  ? 52.266 16.274 9.609   1.00 42.40  ?  39  ARG A NE  1 
ATOM   237  C  CZ  . ARG A 1 42  ? 52.829 15.508 8.682   1.00 42.33  ?  39  ARG A CZ  1 
ATOM   238  N  NH1 . ARG A 1 42  ? 52.601 14.195 8.664   1.00 42.38  ?  39  ARG A NH1 1 
ATOM   239  N  NH2 . ARG A 1 42  ? 53.626 16.053 7.775   1.00 44.35  ?  39  ARG A NH2 1 
ATOM   240  N  N   . ASN A 1 43  ? 54.755 18.364 14.141  1.00 38.84  ?  40  ASN A N   1 
ATOM   241  C  CA  . ASN A 1 43  ? 55.807 19.373 14.052  1.00 42.95  ?  40  ASN A CA  1 
ATOM   242  C  C   . ASN A 1 43  ? 56.039 20.014 15.420  1.00 47.37  ?  40  ASN A C   1 
ATOM   243  O  O   . ASN A 1 43  ? 55.087 20.258 16.149  1.00 49.73  ?  40  ASN A O   1 
ATOM   244  C  CB  . ASN A 1 43  ? 55.424 20.438 13.022  1.00 42.19  ?  40  ASN A CB  1 
ATOM   245  C  CG  . ASN A 1 43  ? 54.803 19.838 11.751  1.00 45.28  ?  40  ASN A CG  1 
ATOM   246  O  OD1 . ASN A 1 43  ? 55.513 19.309 10.896  1.00 43.09  ?  40  ASN A OD1 1 
ATOM   247  N  ND2 . ASN A 1 43  ? 53.473 19.925 11.633  1.00 43.00  ?  40  ASN A ND2 1 
ATOM   248  N  N   . SER A 1 44  ? 57.286 20.302 15.770  1.00 55.05  ?  41  SER A N   1 
ATOM   249  C  CA  . SER A 1 44  ? 57.570 20.825 17.105  1.00 60.47  ?  41  SER A CA  1 
ATOM   250  C  C   . SER A 1 44  ? 56.881 22.172 17.319  1.00 57.29  ?  41  SER A C   1 
ATOM   251  O  O   . SER A 1 44  ? 56.163 22.363 18.291  1.00 58.86  ?  41  SER A O   1 
ATOM   252  C  CB  . SER A 1 44  ? 59.077 20.961 17.329  1.00 63.98  ?  41  SER A CB  1 
ATOM   253  O  OG  . SER A 1 44  ? 59.571 22.133 16.710  1.00 71.42  ?  41  SER A OG  1 
ATOM   254  N  N   . CYS A 1 45  ? 57.069 23.078 16.372  1.00 52.90  ?  42  CYS A N   1 
ATOM   255  C  CA  . CYS A 1 45  ? 56.634 24.459 16.504  1.00 46.43  ?  42  CYS A CA  1 
ATOM   256  C  C   . CYS A 1 45  ? 55.870 24.890 15.237  1.00 48.84  ?  42  CYS A C   1 
ATOM   257  O  O   . CYS A 1 45  ? 56.419 24.785 14.144  1.00 43.36  ?  42  CYS A O   1 
ATOM   258  C  CB  . CYS A 1 45  ? 57.870 25.332 16.730  1.00 45.32  ?  42  CYS A CB  1 
ATOM   259  S  SG  . CYS A 1 45  ? 57.558 26.959 17.336  1.00 86.63  ?  42  CYS A SG  1 
ATOM   260  N  N   . VAL A 1 46  ? 54.618 25.345 15.357  1.00 38.46  ?  43  VAL A N   1 
ATOM   261  C  CA  . VAL A 1 46  ? 53.854 25.739 14.160  1.00 35.99  ?  43  VAL A CA  1 
ATOM   262  C  C   . VAL A 1 46  ? 53.147 27.101 14.266  1.00 39.60  ?  43  VAL A C   1 
ATOM   263  O  O   . VAL A 1 46  ? 52.506 27.413 15.276  1.00 40.04  ?  43  VAL A O   1 
ATOM   264  C  CB  . VAL A 1 46  ? 52.790 24.682 13.811  1.00 36.05  ?  43  VAL A CB  1 
ATOM   265  C  CG1 . VAL A 1 46  ? 52.148 24.985 12.444  1.00 28.54  ?  43  VAL A CG1 1 
ATOM   266  C  CG2 . VAL A 1 46  ? 53.419 23.299 13.793  1.00 32.96  ?  43  VAL A CG2 1 
ATOM   267  N  N   . LYS A 1 47  ? 53.287 27.905 13.217  1.00 35.55  ?  44  LYS A N   1 
ATOM   268  C  CA  . LYS A 1 47  ? 52.563 29.179 13.054  1.00 42.62  ?  44  LYS A CA  1 
ATOM   269  C  C   . LYS A 1 47  ? 51.053 28.990 13.065  1.00 37.78  ?  44  LYS A C   1 
ATOM   270  O  O   . LYS A 1 47  ? 50.540 28.081 12.425  1.00 38.50  ?  44  LYS A O   1 
ATOM   271  C  CB  . LYS A 1 47  ? 52.941 29.858 11.731  1.00 43.20  ?  44  LYS A CB  1 
ATOM   272  C  CG  . LYS A 1 47  ? 54.120 30.778 11.771  1.00 58.22  ?  44  LYS A CG  1 
ATOM   273  C  CD  . LYS A 1 47  ? 54.486 31.270 10.357  1.00 70.87  ?  44  LYS A CD  1 
ATOM   274  C  CE  . LYS A 1 47  ? 55.527 30.367 9.691   1.00 76.79  ?  44  LYS A CE  1 
ATOM   275  N  NZ  . LYS A 1 47  ? 56.014 30.901 8.377   1.00 84.64  ?  44  LYS A NZ  1 
ATOM   276  N  N   . GLU A 1 48  ? 50.341 29.865 13.768  1.00 43.02  ?  45  GLU A N   1 
ATOM   277  C  CA  . GLU A 1 48  ? 48.880 29.803 13.808  1.00 38.84  ?  45  GLU A CA  1 
ATOM   278  C  C   . GLU A 1 48  ? 48.288 29.881 12.397  1.00 34.09  ?  45  GLU A C   1 
ATOM   279  O  O   . GLU A 1 48  ? 47.351 29.152 12.062  1.00 38.29  ?  45  GLU A O   1 
ATOM   280  C  CB  . GLU A 1 48  ? 48.319 30.930 14.688  1.00 37.58  ?  45  GLU A CB  1 
ATOM   281  C  CG  . GLU A 1 48  ? 46.795 30.960 14.726  1.00 37.77  ?  45  GLU A CG  1 
ATOM   282  C  CD  . GLU A 1 48  ? 46.253 31.968 15.719  1.00 46.49  ?  45  GLU A CD  1 
ATOM   283  O  OE1 . GLU A 1 48  ? 47.004 32.872 16.129  1.00 52.06  ?  45  GLU A OE1 1 
ATOM   284  O  OE2 . GLU A 1 48  ? 45.073 31.854 16.106  1.00 49.26  ?  45  GLU A OE2 1 
ATOM   285  N  N   . GLU A 1 49  ? 48.849 30.762 11.576  1.00 36.52  ?  46  GLU A N   1 
ATOM   286  C  CA  . GLU A 1 49  ? 48.450 30.899 10.174  1.00 38.37  ?  46  GLU A CA  1 
ATOM   287  C  C   . GLU A 1 49  ? 48.580 29.593 9.393   1.00 39.93  ?  46  GLU A C   1 
ATOM   288  O  O   . GLU A 1 49  ? 47.690 29.225 8.619   1.00 38.37  ?  46  GLU A O   1 
ATOM   289  C  CB  . GLU A 1 49  ? 49.284 31.989 9.499   1.00 48.08  ?  46  GLU A CB  1 
ATOM   290  C  CG  . GLU A 1 49  ? 48.580 33.319 9.422   1.00 63.98  ?  46  GLU A CG  1 
ATOM   291  C  CD  . GLU A 1 49  ? 47.326 33.253 8.576   1.00 76.42  ?  46  GLU A CD  1 
ATOM   292  O  OE1 . GLU A 1 49  ? 47.391 32.689 7.462   1.00 82.92  ?  46  GLU A OE1 1 
ATOM   293  O  OE2 . GLU A 1 49  ? 46.275 33.755 9.027   1.00 79.31  ?  46  GLU A OE2 1 
ATOM   294  N  N   . ASP A 1 50  ? 49.690 28.887 9.586   1.00 37.28  ?  47  ASP A N   1 
ATOM   295  C  CA  . ASP A 1 50  ? 49.846 27.591 8.934   1.00 32.51  ?  47  ASP A CA  1 
ATOM   296  C  C   . ASP A 1 50  ? 48.816 26.614 9.448   1.00 35.56  ?  47  ASP A C   1 
ATOM   297  O  O   . ASP A 1 50  ? 48.231 25.873 8.660   1.00 36.52  ?  47  ASP A O   1 
ATOM   298  C  CB  . ASP A 1 50  ? 51.248 27.033 9.141   1.00 31.59  ?  47  ASP A CB  1 
ATOM   299  C  CG  . ASP A 1 50  ? 52.260 27.739 8.301   1.00 39.25  ?  47  ASP A CG  1 
ATOM   300  O  OD1 . ASP A 1 50  ? 51.816 28.418 7.347   1.00 39.77  ?  47  ASP A OD1 1 
ATOM   301  O  OD2 . ASP A 1 50  ? 53.482 27.624 8.585   1.00 41.71  ?  47  ASP A OD2 1 
ATOM   302  N  N   . MET A 1 51  ? 48.580 26.606 10.767  1.00 33.97  ?  48  MET A N   1 
ATOM   303  C  CA  . MET A 1 51  ? 47.562 25.719 11.316  1.00 28.14  ?  48  MET A CA  1 
ATOM   304  C  C   . MET A 1 51  ? 46.197 26.052 10.708  1.00 28.84  ?  48  MET A C   1 
ATOM   305  O  O   . MET A 1 51  ? 45.382 25.178 10.434  1.00 32.46  ?  48  MET A O   1 
ATOM   306  C  CB  . MET A 1 51  ? 47.488 25.831 12.849  1.00 33.33  ?  48  MET A CB  1 
ATOM   307  C  CG  . MET A 1 51  ? 48.746 25.395 13.587  1.00 40.16  ?  48  MET A CG  1 
ATOM   308  S  SD  . MET A 1 51  ? 48.552 25.570 15.390  1.00 41.01  ?  48  MET A SD  1 
ATOM   309  C  CE  . MET A 1 51  ? 47.351 24.286 15.652  1.00 25.79  ?  48  MET A CE  1 
ATOM   310  N  N   . LEU A 1 52  ? 45.953 27.338 10.520  1.00 31.79  ?  49  LEU A N   1 
ATOM   311  C  CA  . LEU A 1 52  ? 44.674 27.801 10.027  1.00 33.91  ?  49  LEU A CA  1 
ATOM   312  C  C   . LEU A 1 52  ? 44.436 27.270 8.621   1.00 35.85  ?  49  LEU A C   1 
ATOM   313  O  O   . LEU A 1 52  ? 43.391 26.696 8.332   1.00 38.33  ?  49  LEU A O   1 
ATOM   314  C  CB  . LEU A 1 52  ? 44.635 29.324 10.054  1.00 35.93  ?  49  LEU A CB  1 
ATOM   315  C  CG  . LEU A 1 52  ? 43.354 29.993 9.573   1.00 38.83  ?  49  LEU A CG  1 
ATOM   316  C  CD1 . LEU A 1 52  ? 42.183 29.691 10.484  1.00 35.68  ?  49  LEU A CD1 1 
ATOM   317  C  CD2 . LEU A 1 52  ? 43.582 31.483 9.460   1.00 37.31  ?  49  LEU A CD2 1 
ATOM   318  N  N   . GLU A 1 53  ? 45.435 27.413 7.763   1.00 34.12  ?  50  GLU A N   1 
ATOM   319  C  CA  . GLU A 1 53  ? 45.298 26.968 6.387   1.00 34.99  ?  50  GLU A CA  1 
ATOM   320  C  C   . GLU A 1 53  ? 45.180 25.462 6.299   1.00 34.64  ?  50  GLU A C   1 
ATOM   321  O  O   . GLU A 1 53  ? 44.475 24.942 5.444   1.00 38.21  ?  50  GLU A O   1 
ATOM   322  C  CB  . GLU A 1 53  ? 46.475 27.450 5.562   1.00 38.83  ?  50  GLU A CB  1 
ATOM   323  C  CG  . GLU A 1 53  ? 46.539 28.942 5.398   1.00 45.15  ?  50  GLU A CG  1 
ATOM   324  C  CD  . GLU A 1 53  ? 47.745 29.370 4.585   1.00 52.57  ?  50  GLU A CD  1 
ATOM   325  O  OE1 . GLU A 1 53  ? 48.186 28.580 3.717   1.00 48.24  ?  50  GLU A OE1 1 
ATOM   326  O  OE2 . GLU A 1 53  ? 48.252 30.487 4.832   1.00 59.58  ?  50  GLU A OE2 1 
ATOM   327  N  N   . LEU A 1 54  ? 45.861 24.756 7.189   1.00 33.39  ?  51  LEU A N   1 
ATOM   328  C  CA  . LEU A 1 54  ? 45.810 23.296 7.148   1.00 35.23  ?  51  LEU A CA  1 
ATOM   329  C  C   . LEU A 1 54  ? 44.441 22.796 7.562   1.00 34.77  ?  51  LEU A C   1 
ATOM   330  O  O   . LEU A 1 54  ? 43.885 21.920 6.922   1.00 38.43  ?  51  LEU A O   1 
ATOM   331  C  CB  . LEU A 1 54  ? 46.880 22.670 8.060   1.00 34.46  ?  51  LEU A CB  1 
ATOM   332  C  CG  . LEU A 1 54  ? 48.324 22.789 7.566   1.00 41.49  ?  51  LEU A CG  1 
ATOM   333  C  CD1 . LEU A 1 54  ? 49.309 22.489 8.693   1.00 39.03  ?  51  LEU A CD1 1 
ATOM   334  C  CD2 . LEU A 1 54  ? 48.574 21.878 6.370   1.00 42.15  ?  51  LEU A CD2 1 
ATOM   335  N  N   . LEU A 1 55  ? 43.901 23.357 8.638   1.00 34.65  ?  52  LEU A N   1 
ATOM   336  C  CA  . LEU A 1 55  ? 42.652 22.853 9.203   1.00 29.73  ?  52  LEU A CA  1 
ATOM   337  C  C   . LEU A 1 55  ? 41.387 23.338 8.481   1.00 34.90  ?  52  LEU A C   1 
ATOM   338  O  O   . LEU A 1 55  ? 40.360 22.672 8.545   1.00 34.69  ?  52  LEU A O   1 
ATOM   339  C  CB  . LEU A 1 55  ? 42.569 23.243 10.671  1.00 29.61  ?  52  LEU A CB  1 
ATOM   340  C  CG  . LEU A 1 55  ? 43.626 22.672 11.624  1.00 32.23  ?  52  LEU A CG  1 
ATOM   341  C  CD1 . LEU A 1 55  ? 43.679 23.523 12.893  1.00 30.90  ?  52  LEU A CD1 1 
ATOM   342  C  CD2 . LEU A 1 55  ? 43.252 21.241 11.960  1.00 28.29  ?  52  LEU A CD2 1 
ATOM   343  N  N   . LYS A 1 56  ? 41.467 24.504 7.826   1.00 31.08  ?  53  LYS A N   1 
ATOM   344  C  CA  . LYS A 1 56  ? 40.331 25.138 7.126   1.00 31.95  ?  53  LYS A CA  1 
ATOM   345  C  C   . LYS A 1 56  ? 39.260 25.625 8.098   1.00 35.05  ?  53  LYS A C   1 
ATOM   346  O  O   . LYS A 1 56  ? 38.107 25.864 7.711   1.00 36.46  ?  53  LYS A O   1 
ATOM   347  C  CB  . LYS A 1 56  ? 39.696 24.182 6.121   1.00 36.30  ?  53  LYS A CB  1 
ATOM   348  C  CG  . LYS A 1 56  ? 40.693 23.412 5.290   1.00 46.51  ?  53  LYS A CG  1 
ATOM   349  C  CD  . LYS A 1 56  ? 41.196 24.267 4.199   1.00 44.87  ?  53  LYS A CD  1 
ATOM   350  C  CE  . LYS A 1 56  ? 41.237 23.506 2.891   1.00 49.01  ?  53  LYS A CE  1 
ATOM   351  N  NZ  . LYS A 1 56  ? 41.452 24.477 1.779   1.00 49.02  ?  53  LYS A NZ  1 
ATOM   352  N  N   . PHE A 1 57  ? 39.646 25.756 9.363   1.00 33.42  ?  54  PHE A N   1 
ATOM   353  C  CA  . PHE A 1 57  ? 38.791 26.352 10.369  1.00 35.15  ?  54  PHE A CA  1 
ATOM   354  C  C   . PHE A 1 57  ? 38.566 27.812 10.047  1.00 37.40  ?  54  PHE A C   1 
ATOM   355  O  O   . PHE A 1 57  ? 39.365 28.428 9.344   1.00 40.32  ?  54  PHE A O   1 
ATOM   356  C  CB  . PHE A 1 57  ? 39.408 26.252 11.769  1.00 33.79  ?  54  PHE A CB  1 
ATOM   357  C  CG  . PHE A 1 57  ? 39.433 24.869 12.341  1.00 34.51  ?  54  PHE A CG  1 
ATOM   358  C  CD1 . PHE A 1 57  ? 38.984 23.782 11.619  1.00 31.66  ?  54  PHE A CD1 1 
ATOM   359  C  CD2 . PHE A 1 57  ? 39.899 24.664 13.633  1.00 39.26  ?  54  PHE A CD2 1 
ATOM   360  C  CE1 . PHE A 1 57  ? 39.020 22.510 12.163  1.00 30.62  ?  54  PHE A CE1 1 
ATOM   361  C  CE2 . PHE A 1 57  ? 39.923 23.401 14.188  1.00 36.88  ?  54  PHE A CE2 1 
ATOM   362  C  CZ  . PHE A 1 57  ? 39.486 22.322 13.461  1.00 35.23  ?  54  PHE A CZ  1 
ATOM   363  N  N   . ASP A 1 58  ? 37.490 28.375 10.583  1.00 43.88  ?  55  ASP A N   1 
ATOM   364  C  CA  . ASP A 1 58  ? 37.327 29.820 10.619  1.00 43.25  ?  55  ASP A CA  1 
ATOM   365  C  C   . ASP A 1 58  ? 38.391 30.397 11.564  1.00 42.60  ?  55  ASP A C   1 
ATOM   366  O  O   . ASP A 1 58  ? 38.881 29.699 12.453  1.00 41.52  ?  55  ASP A O   1 
ATOM   367  C  CB  . ASP A 1 58  ? 35.905 30.169 11.063  1.00 55.87  ?  55  ASP A CB  1 
ATOM   368  C  CG  . ASP A 1 58  ? 35.762 31.605 11.513  1.00 67.54  ?  55  ASP A CG  1 
ATOM   369  O  OD1 . ASP A 1 58  ? 35.641 32.500 10.650  1.00 64.98  ?  55  ASP A OD1 1 
ATOM   370  O  OD2 . ASP A 1 58  ? 35.766 31.833 12.742  1.00 73.71  ?  55  ASP A OD2 1 
ATOM   371  N  N   . ARG A 1 59  ? 38.772 31.654 11.363  1.00 47.39  ?  56  ARG A N   1 
ATOM   372  C  CA  . ARG A 1 59  ? 39.809 32.297 12.185  1.00 42.88  ?  56  ARG A CA  1 
ATOM   373  C  C   . ARG A 1 59  ? 39.474 32.335 13.696  1.00 45.78  ?  56  ARG A C   1 
ATOM   374  O  O   . ARG A 1 59  ? 40.289 31.928 14.537  1.00 45.94  ?  56  ARG A O   1 
ATOM   375  C  CB  . ARG A 1 59  ? 40.052 33.715 11.660  1.00 53.82  ?  56  ARG A CB  1 
ATOM   376  C  CG  . ARG A 1 59  ? 41.328 34.367 12.149  1.00 60.72  ?  56  ARG A CG  1 
ATOM   377  C  CD  . ARG A 1 59  ? 41.654 35.622 11.348  1.00 65.28  ?  56  ARG A CD  1 
ATOM   378  N  NE  . ARG A 1 59  ? 42.080 35.304 9.987   1.00 69.26  ?  56  ARG A NE  1 
ATOM   379  C  CZ  . ARG A 1 59  ? 43.336 35.036 9.637   1.00 67.93  ?  56  ARG A CZ  1 
ATOM   380  N  NH1 . ARG A 1 59  ? 44.299 35.051 10.547  1.00 68.86  ?  56  ARG A NH1 1 
ATOM   381  N  NH2 . ARG A 1 59  ? 43.630 34.753 8.377   1.00 59.38  ?  56  ARG A NH2 1 
ATOM   382  N  N   . LYS A 1 60  ? 38.284 32.819 14.038  1.00 46.71  ?  57  LYS A N   1 
ATOM   383  C  CA  . LYS A 1 60  ? 37.844 32.853 15.428  1.00 51.24  ?  57  LYS A CA  1 
ATOM   384  C  C   . LYS A 1 60  ? 37.686 31.446 15.985  1.00 53.63  ?  57  LYS A C   1 
ATOM   385  O  O   . LYS A 1 60  ? 37.997 31.192 17.155  1.00 51.96  ?  57  LYS A O   1 
ATOM   386  C  CB  . LYS A 1 60  ? 36.529 33.615 15.567  1.00 57.14  ?  57  LYS A CB  1 
ATOM   387  C  CG  . LYS A 1 60  ? 36.538 34.994 14.936  1.00 68.75  ?  57  LYS A CG  1 
ATOM   388  C  CD  . LYS A 1 60  ? 35.283 35.771 15.298  1.00 78.89  ?  57  LYS A CD  1 
ATOM   389  C  CE  . LYS A 1 60  ? 34.791 36.600 14.125  1.00 83.97  ?  57  LYS A CE  1 
ATOM   390  N  NZ  . LYS A 1 60  ? 34.355 35.727 13.005  1.00 85.02  ?  57  LYS A NZ  1 
ATOM   391  N  N   . GLN A 1 61  ? 37.209 30.527 15.151  1.00 50.38  ?  58  GLN A N   1 
ATOM   392  C  CA  . GLN A 1 61  ? 37.075 29.130 15.573  1.00 47.35  ?  58  GLN A CA  1 
ATOM   393  C  C   . GLN A 1 61  ? 38.410 28.531 16.012  1.00 46.55  ?  58  GLN A C   1 
ATOM   394  O  O   . GLN A 1 61  ? 38.486 27.863 17.037  1.00 42.81  ?  58  GLN A O   1 
ATOM   395  C  CB  . GLN A 1 61  ? 36.485 28.288 14.448  1.00 43.88  ?  58  GLN A CB  1 
ATOM   396  C  CG  . GLN A 1 61  ? 36.329 26.797 14.753  1.00 35.65  ?  58  GLN A CG  1 
ATOM   397  C  CD  . GLN A 1 61  ? 35.788 26.045 13.540  1.00 42.52  ?  58  GLN A CD  1 
ATOM   398  O  OE1 . GLN A 1 61  ? 35.873 26.534 12.412  1.00 46.86  ?  58  GLN A OE1 1 
ATOM   399  N  NE2 . GLN A 1 61  ? 35.207 24.871 13.770  1.00 45.34  ?  58  GLN A NE2 1 
ATOM   400  N  N   . LEU A 1 62  ? 39.465 28.762 15.234  1.00 47.38  ?  59  LEU A N   1 
ATOM   401  C  CA  . LEU A 1 62  ? 40.771 28.213 15.593  1.00 41.10  ?  59  LEU A CA  1 
ATOM   402  C  C   . LEU A 1 62  ? 41.323 28.884 16.840  1.00 40.05  ?  59  LEU A C   1 
ATOM   403  O  O   . LEU A 1 62  ? 41.791 28.205 17.748  1.00 38.92  ?  59  LEU A O   1 
ATOM   404  C  CB  . LEU A 1 62  ? 41.772 28.353 14.443  1.00 34.03  ?  59  LEU A CB  1 
ATOM   405  C  CG  . LEU A 1 62  ? 43.215 27.974 14.807  1.00 36.01  ?  59  LEU A CG  1 
ATOM   406  C  CD1 . LEU A 1 62  ? 43.317 26.549 15.354  1.00 31.33  ?  59  LEU A CD1 1 
ATOM   407  C  CD2 . LEU A 1 62  ? 44.125 28.121 13.594  1.00 35.86  ?  59  LEU A CD2 1 
ATOM   408  N  N   . ARG A 1 63  ? 41.278 30.214 16.864  1.00 41.00  ?  60  ARG A N   1 
ATOM   409  C  CA  . ARG A 1 63  ? 41.802 31.004 17.972  1.00 40.15  ?  60  ARG A CA  1 
ATOM   410  C  C   . ARG A 1 63  ? 41.171 30.564 19.295  1.00 44.61  ?  60  ARG A C   1 
ATOM   411  O  O   . ARG A 1 63  ? 41.856 30.422 20.310  1.00 40.12  ?  60  ARG A O   1 
ATOM   412  C  CB  . ARG A 1 63  ? 41.555 32.501 17.713  1.00 43.44  ?  60  ARG A CB  1 
ATOM   413  C  CG  . ARG A 1 63  ? 41.778 33.412 18.915  1.00 55.54  ?  60  ARG A CG  1 
ATOM   414  C  CD  . ARG A 1 63  ? 43.208 33.317 19.448  1.00 57.76  ?  60  ARG A CD  1 
ATOM   415  N  NE  . ARG A 1 63  ? 44.199 33.575 18.407  1.00 56.40  ?  60  ARG A NE  1 
ATOM   416  C  CZ  . ARG A 1 63  ? 44.689 34.777 18.127  1.00 56.79  ?  60  ARG A CZ  1 
ATOM   417  N  NH1 . ARG A 1 63  ? 44.277 35.835 18.802  1.00 60.75  ?  60  ARG A NH1 1 
ATOM   418  N  NH2 . ARG A 1 63  ? 45.588 34.923 17.169  1.00 59.50  ?  60  ARG A NH2 1 
ATOM   419  N  N   . SER A 1 64  ? 39.867 30.313 19.262  1.00 42.54  ?  61  SER A N   1 
ATOM   420  C  CA  . SER A 1 64  ? 39.147 29.813 20.424  1.00 48.12  ?  61  SER A CA  1 
ATOM   421  C  C   . SER A 1 64  ? 39.635 28.430 20.859  1.00 47.28  ?  61  SER A C   1 
ATOM   422  O  O   . SER A 1 64  ? 39.770 28.151 22.057  1.00 38.96  ?  61  SER A O   1 
ATOM   423  C  CB  . SER A 1 64  ? 37.650 29.778 20.128  1.00 53.03  ?  61  SER A CB  1 
ATOM   424  O  OG  . SER A 1 64  ? 36.968 29.059 21.125  1.00 59.98  ?  61  SER A OG  1 
ATOM   425  N  N   . VAL A 1 65  ? 39.914 27.557 19.897  1.00 39.29  ?  62  VAL A N   1 
ATOM   426  C  CA  . VAL A 1 65  ? 40.461 26.250 20.243  1.00 34.09  ?  62  VAL A CA  1 
ATOM   427  C  C   . VAL A 1 65  ? 41.857 26.423 20.863  1.00 40.32  ?  62  VAL A C   1 
ATOM   428  O  O   . VAL A 1 65  ? 42.178 25.844 21.905  1.00 40.32  ?  62  VAL A O   1 
ATOM   429  C  CB  . VAL A 1 65  ? 40.515 25.315 19.015  1.00 33.39  ?  62  VAL A CB  1 
ATOM   430  C  CG1 . VAL A 1 65  ? 41.339 24.099 19.316  1.00 37.34  ?  62  VAL A CG1 1 
ATOM   431  C  CG2 . VAL A 1 65  ? 39.109 24.923 18.599  1.00 36.35  ?  62  VAL A CG2 1 
ATOM   432  N  N   . LEU A 1 66  ? 42.684 27.248 20.244  1.00 38.14  ?  63  LEU A N   1 
ATOM   433  C  CA  . LEU A 1 66  ? 44.028 27.441 20.761  1.00 40.70  ?  63  LEU A CA  1 
ATOM   434  C  C   . LEU A 1 66  ? 43.974 28.109 22.137  1.00 43.63  ?  63  LEU A C   1 
ATOM   435  O  O   . LEU A 1 66  ? 44.777 27.798 23.007  1.00 44.21  ?  63  LEU A O   1 
ATOM   436  C  CB  . LEU A 1 66  ? 44.874 28.268 19.782  1.00 37.21  ?  63  LEU A CB  1 
ATOM   437  C  CG  . LEU A 1 66  ? 45.198 27.569 18.450  1.00 41.78  ?  63  LEU A CG  1 
ATOM   438  C  CD1 . LEU A 1 66  ? 45.791 28.555 17.437  1.00 41.58  ?  63  LEU A CD1 1 
ATOM   439  C  CD2 . LEU A 1 66  ? 46.150 26.377 18.636  1.00 36.25  ?  63  LEU A CD2 1 
ATOM   440  N  N   . ASN A 1 67  ? 43.016 29.010 22.337  1.00 43.53  ?  64  ASN A N   1 
ATOM   441  C  CA  . ASN A 1 67  ? 42.908 29.731 23.601  1.00 45.68  ?  64  ASN A CA  1 
ATOM   442  C  C   . ASN A 1 67  ? 42.581 28.780 24.746  1.00 47.33  ?  64  ASN A C   1 
ATOM   443  O  O   . ASN A 1 67  ? 43.057 28.930 25.876  1.00 45.37  ?  64  ASN A O   1 
ATOM   444  C  CB  . ASN A 1 67  ? 41.843 30.827 23.509  1.00 49.93  ?  64  ASN A CB  1 
ATOM   445  C  CG  . ASN A 1 67  ? 42.386 32.119 22.934  1.00 54.57  ?  64  ASN A CG  1 
ATOM   446  O  OD1 . ASN A 1 67  ? 43.587 32.246 22.713  1.00 54.93  ?  64  ASN A OD1 1 
ATOM   447  N  ND2 . ASN A 1 67  ? 41.500 33.084 22.682  1.00 52.48  ?  64  ASN A ND2 1 
ATOM   448  N  N   . ASN A 1 68  ? 41.755 27.801 24.426  1.00 43.71  ?  65  ASN A N   1 
ATOM   449  C  CA  . ASN A 1 68  ? 41.340 26.783 25.356  1.00 44.71  ?  65  ASN A CA  1 
ATOM   450  C  C   . ASN A 1 68  ? 42.503 25.868 25.731  1.00 45.76  ?  65  ASN A C   1 
ATOM   451  O  O   . ASN A 1 68  ? 42.705 25.551 26.910  1.00 41.99  ?  65  ASN A O   1 
ATOM   452  C  CB  . ASN A 1 68  ? 40.191 25.981 24.745  1.00 49.36  ?  65  ASN A CB  1 
ATOM   453  C  CG  . ASN A 1 68  ? 39.459 25.137 25.762  1.00 68.85  ?  65  ASN A CG  1 
ATOM   454  O  OD1 . ASN A 1 68  ? 39.452 23.908 25.672  1.00 74.81  ?  65  ASN A OD1 1 
ATOM   455  N  ND2 . ASN A 1 68  ? 38.832 25.789 26.740  1.00 71.65  ?  65  ASN A ND2 1 
ATOM   456  N  N   . LEU A 1 69  ? 43.272 25.444 24.732  1.00 39.30  ?  66  LEU A N   1 
ATOM   457  C  CA  . LEU A 1 69  ? 44.402 24.570 24.996  1.00 37.22  ?  66  LEU A CA  1 
ATOM   458  C  C   . LEU A 1 69  ? 45.527 25.282 25.742  1.00 41.81  ?  66  LEU A C   1 
ATOM   459  O  O   . LEU A 1 69  ? 46.266 24.664 26.517  1.00 44.33  ?  66  LEU A O   1 
ATOM   460  C  CB  . LEU A 1 69  ? 44.917 23.978 23.701  1.00 38.10  ?  66  LEU A CB  1 
ATOM   461  C  CG  . LEU A 1 69  ? 43.916 22.994 23.090  1.00 44.59  ?  66  LEU A CG  1 
ATOM   462  C  CD1 . LEU A 1 69  ? 44.492 22.342 21.873  1.00 43.99  ?  66  LEU A CD1 1 
ATOM   463  C  CD2 . LEU A 1 69  ? 43.526 21.947 24.125  1.00 46.56  ?  66  LEU A CD2 1 
ATOM   464  N  N   . LYS A 1 70  ? 45.651 26.585 25.516  1.00 45.92  ?  67  LYS A N   1 
ATOM   465  C  CA  . LYS A 1 70  ? 46.647 27.399 26.207  1.00 47.55  ?  67  LYS A CA  1 
ATOM   466  C  C   . LYS A 1 70  ? 46.230 27.658 27.664  1.00 46.10  ?  67  LYS A C   1 
ATOM   467  O  O   . LYS A 1 70  ? 47.062 27.746 28.573  1.00 51.23  ?  67  LYS A O   1 
ATOM   468  C  CB  . LYS A 1 70  ? 46.839 28.715 25.451  1.00 55.30  ?  67  LYS A CB  1 
ATOM   469  C  CG  . LYS A 1 70  ? 48.068 29.495 25.846  1.00 66.82  ?  67  LYS A CG  1 
ATOM   470  C  CD  . LYS A 1 70  ? 48.029 30.902 25.262  1.00 76.53  ?  67  LYS A CD  1 
ATOM   471  C  CE  . LYS A 1 70  ? 47.682 30.901 23.780  1.00 75.32  ?  67  LYS A CE  1 
ATOM   472  N  NZ  . LYS A 1 70  ? 47.807 32.269 23.196  1.00 81.99  ?  67  LYS A NZ  1 
ATOM   473  N  N   . GLY A 1 71  ? 44.929 27.777 27.885  1.00 42.17  ?  68  GLY A N   1 
ATOM   474  C  CA  . GLY A 1 71  ? 44.408 27.993 29.216  1.00 44.12  ?  68  GLY A CA  1 
ATOM   475  C  C   . GLY A 1 71  ? 44.586 26.773 30.102  1.00 50.72  ?  68  GLY A C   1 
ATOM   476  O  O   . GLY A 1 71  ? 44.825 26.892 31.313  1.00 50.41  ?  68  GLY A O   1 
ATOM   477  N  N   . ASP A 1 72  ? 44.451 25.596 29.500  1.00 38.60  ?  69  ASP A N   1 
ATOM   478  C  CA  . ASP A 1 72  ? 44.635 24.332 30.210  1.00 37.78  ?  69  ASP A CA  1 
ATOM   479  C  C   . ASP A 1 72  ? 46.106 23.929 30.194  1.00 41.15  ?  69  ASP A C   1 
ATOM   480  O  O   . ASP A 1 72  ? 46.462 22.804 30.549  1.00 41.30  ?  69  ASP A O   1 
ATOM   481  C  CB  . ASP A 1 72  ? 43.768 23.237 29.591  1.00 40.68  ?  69  ASP A CB  1 
ATOM   482  C  CG  . ASP A 1 72  ? 42.327 23.324 30.036  1.00 45.19  ?  69  ASP A CG  1 
ATOM   483  O  OD1 . ASP A 1 72  ? 41.982 24.338 30.673  1.00 47.42  ?  69  ASP A OD1 1 
ATOM   484  O  OD2 . ASP A 1 72  ? 41.545 22.386 29.760  1.00 46.78  ?  69  ASP A OD2 1 
ATOM   485  N  N   . LYS A 1 73  ? 46.945 24.870 29.768  1.00 40.57  ?  70  LYS A N   1 
ATOM   486  C  CA  . LYS A 1 73  ? 48.388 24.708 29.738  1.00 40.31  ?  70  LYS A CA  1 
ATOM   487  C  C   . LYS A 1 73  ? 48.913 23.539 28.896  1.00 40.06  ?  70  LYS A C   1 
ATOM   488  O  O   . LYS A 1 73  ? 50.039 23.099 29.097  1.00 42.45  ?  70  LYS A O   1 
ATOM   489  C  CB  . LYS A 1 73  ? 48.886 24.577 31.173  1.00 45.32  ?  70  LYS A CB  1 
ATOM   490  C  CG  . LYS A 1 73  ? 48.514 25.755 32.010  1.00 48.24  ?  70  LYS A CG  1 
ATOM   491  C  CD  . LYS A 1 73  ? 48.865 25.536 33.464  1.00 52.28  ?  70  LYS A CD  1 
ATOM   492  C  CE  . LYS A 1 73  ? 48.897 26.851 34.202  1.00 56.52  ?  70  LYS A CE  1 
ATOM   493  N  NZ  . LYS A 1 73  ? 47.646 27.632 34.037  1.00 66.09  ?  70  LYS A NZ  1 
ATOM   494  N  N   . PHE A 1 74  ? 48.121 23.039 27.952  1.00 42.69  ?  71  PHE A N   1 
ATOM   495  C  CA  . PHE A 1 74  ? 48.608 21.976 27.067  1.00 41.19  ?  71  PHE A CA  1 
ATOM   496  C  C   . PHE A 1 74  ? 49.584 22.514 26.028  1.00 43.61  ?  71  PHE A C   1 
ATOM   497  O  O   . PHE A 1 74  ? 50.498 21.812 25.587  1.00 44.15  ?  71  PHE A O   1 
ATOM   498  C  CB  . PHE A 1 74  ? 47.467 21.281 26.329  1.00 42.23  ?  71  PHE A CB  1 
ATOM   499  C  CG  . PHE A 1 74  ? 46.720 20.278 27.143  1.00 48.34  ?  71  PHE A CG  1 
ATOM   500  C  CD1 . PHE A 1 74  ? 46.758 20.301 28.522  1.00 51.67  ?  71  PHE A CD1 1 
ATOM   501  C  CD2 . PHE A 1 74  ? 45.961 19.303 26.514  1.00 50.26  ?  71  PHE A CD2 1 
ATOM   502  C  CE1 . PHE A 1 74  ? 46.046 19.367 29.266  1.00 54.92  ?  71  PHE A CE1 1 
ATOM   503  C  CE2 . PHE A 1 74  ? 45.253 18.358 27.254  1.00 54.80  ?  71  PHE A CE2 1 
ATOM   504  C  CZ  . PHE A 1 74  ? 45.293 18.395 28.634  1.00 51.69  ?  71  PHE A CZ  1 
ATOM   505  N  N   . ILE A 1 75  ? 49.352 23.741 25.579  1.00 45.77  ?  72  ILE A N   1 
ATOM   506  C  CA  . ILE A 1 75  ? 50.196 24.308 24.538  1.00 40.05  ?  72  ILE A CA  1 
ATOM   507  C  C   . ILE A 1 75  ? 50.609 25.681 24.984  1.00 43.48  ?  72  ILE A C   1 
ATOM   508  O  O   . ILE A 1 75  ? 49.916 26.320 25.789  1.00 34.61  ?  72  ILE A O   1 
ATOM   509  C  CB  . ILE A 1 75  ? 49.493 24.380 23.158  1.00 41.77  ?  72  ILE A CB  1 
ATOM   510  C  CG1 . ILE A 1 75  ? 48.473 25.521 23.111  1.00 33.61  ?  72  ILE A CG1 1 
ATOM   511  C  CG2 . ILE A 1 75  ? 48.866 23.050 22.821  1.00 33.75  ?  72  ILE A CG2 1 
ATOM   512  C  CD1 . ILE A 1 75  ? 47.622 25.529 21.842  1.00 39.94  ?  72  ILE A CD1 1 
ATOM   513  N  N   . LYS A 1 76  ? 51.770 26.101 24.504  1.00 39.83  ?  73  LYS A N   1 
ATOM   514  C  CA  . LYS A 1 76  ? 52.257 27.444 24.756  1.00 41.79  ?  73  LYS A CA  1 
ATOM   515  C  C   . LYS A 1 76  ? 52.427 28.158 23.433  1.00 49.20  ?  73  LYS A C   1 
ATOM   516  O  O   . LYS A 1 76  ? 52.286 27.554 22.360  1.00 51.61  ?  73  LYS A O   1 
ATOM   517  C  CB  . LYS A 1 76  ? 53.575 27.422 25.536  1.00 45.07  ?  73  LYS A CB  1 
ATOM   518  C  CG  . LYS A 1 76  ? 53.385 27.201 27.048  1.00 55.22  ?  73  LYS A CG  1 
ATOM   519  C  CD  . LYS A 1 76  ? 54.653 27.417 27.874  1.00 66.46  ?  73  LYS A CD  1 
ATOM   520  C  CE  . LYS A 1 76  ? 54.349 27.234 29.369  1.00 78.10  ?  73  LYS A CE  1 
ATOM   521  N  NZ  . LYS A 1 76  ? 55.489 27.596 30.267  1.00 86.87  ?  73  LYS A NZ  1 
ATOM   522  N  N   . CYS A 1 77  ? 52.735 29.443 23.529  1.00 50.41  ?  74  CYS A N   1 
ATOM   523  C  CA  . CYS A 1 77  ? 52.803 30.341 22.391  1.00 50.18  ?  74  CYS A CA  1 
ATOM   524  C  C   . CYS A 1 77  ? 54.072 31.175 22.507  1.00 49.01  ?  74  CYS A C   1 
ATOM   525  O  O   . CYS A 1 77  ? 54.407 31.632 23.594  1.00 47.79  ?  74  CYS A O   1 
ATOM   526  C  CB  . CYS A 1 77  ? 51.558 31.234 22.365  1.00 54.83  ?  74  CYS A CB  1 
ATOM   527  S  SG  . CYS A 1 77  ? 51.560 32.508 21.110  1.00 79.90  ?  74  CYS A SG  1 
ATOM   528  N  N   . ARG A 1 78  ? 54.796 31.333 21.408  1.00 45.61  ?  75  ARG A N   1 
ATOM   529  C  CA  . ARG A 1 78  ? 55.889 32.292 21.340  1.00 52.83  ?  75  ARG A CA  1 
ATOM   530  C  C   . ARG A 1 78  ? 55.705 33.202 20.131  1.00 54.93  ?  75  ARG A C   1 
ATOM   531  O  O   . ARG A 1 78  ? 55.521 32.738 19.019  1.00 45.65  ?  75  ARG A O   1 
ATOM   532  C  CB  . ARG A 1 78  ? 57.239 31.588 21.271  1.00 54.10  ?  75  ARG A CB  1 
ATOM   533  C  CG  . ARG A 1 78  ? 57.759 31.219 22.638  1.00 73.34  ?  75  ARG A CG  1 
ATOM   534  C  CD  . ARG A 1 78  ? 59.271 31.186 22.675  1.00 83.87  ?  75  ARG A CD  1 
ATOM   535  N  NE  . ARG A 1 78  ? 59.755 30.076 23.487  1.00 94.40  ?  75  ARG A NE  1 
ATOM   536  C  CZ  . ARG A 1 78  ? 60.728 29.250 23.119  1.00 106.74 ?  75  ARG A CZ  1 
ATOM   537  N  NH1 . ARG A 1 78  ? 61.331 29.414 21.948  1.00 110.39 ?  75  ARG A NH1 1 
ATOM   538  N  NH2 . ARG A 1 78  ? 61.105 28.263 23.923  1.00 110.90 ?  75  ARG A NH2 1 
ATOM   539  N  N   . MET A 1 79  ? 55.727 34.505 20.359  1.00 56.91  ?  76  MET A N   1 
ATOM   540  C  CA  . MET A 1 79  ? 55.559 35.449 19.273  1.00 54.21  ?  76  MET A CA  1 
ATOM   541  C  C   . MET A 1 79  ? 56.886 35.655 18.568  1.00 53.43  ?  76  MET A C   1 
ATOM   542  O  O   . MET A 1 79  ? 57.939 35.664 19.200  1.00 50.07  ?  76  MET A O   1 
ATOM   543  C  CB  . MET A 1 79  ? 55.031 36.787 19.791  1.00 59.90  ?  76  MET A CB  1 
ATOM   544  C  CG  . MET A 1 79  ? 53.576 36.792 20.229  1.00 54.84  ?  76  MET A CG  1 
ATOM   545  S  SD  . MET A 1 79  ? 53.006 38.501 20.356  1.00 95.37  ?  76  MET A SD  1 
ATOM   546  C  CE  . MET A 1 79  ? 53.326 39.100 18.713  1.00 57.83  ?  76  MET A CE  1 
ATOM   547  N  N   . ARG A 1 80  ? 56.840 35.784 17.250  1.00 51.32  ?  77  ARG A N   1 
ATOM   548  C  CA  . ARG A 1 80  ? 57.992 36.267 16.513  1.00 58.77  ?  77  ARG A CA  1 
ATOM   549  C  C   . ARG A 1 80  ? 57.601 37.568 15.839  1.00 51.54  ?  77  ARG A C   1 
ATOM   550  O  O   . ARG A 1 80  ? 56.560 37.666 15.192  1.00 47.90  ?  77  ARG A O   1 
ATOM   551  C  CB  . ARG A 1 80  ? 58.499 35.220 15.511  1.00 64.81  ?  77  ARG A CB  1 
ATOM   552  C  CG  . ARG A 1 80  ? 59.403 34.191 16.200  1.00 74.22  ?  77  ARG A CG  1 
ATOM   553  C  CD  . ARG A 1 80  ? 59.762 32.998 15.335  1.00 82.95  ?  77  ARG A CD  1 
ATOM   554  N  NE  . ARG A 1 80  ? 60.205 33.388 14.000  1.00 92.41  ?  77  ARG A NE  1 
ATOM   555  C  CZ  . ARG A 1 80  ? 60.577 32.523 13.061  1.00 95.58  ?  77  ARG A CZ  1 
ATOM   556  N  NH1 . ARG A 1 80  ? 60.564 31.222 13.317  1.00 96.61  ?  77  ARG A NH1 1 
ATOM   557  N  NH2 . ARG A 1 80  ? 60.962 32.958 11.869  1.00 95.81  ?  77  ARG A NH2 1 
ATOM   558  N  N   . VAL A 1 81  ? 58.430 38.578 16.053  1.00 45.90  ?  78  VAL A N   1 
ATOM   559  C  CA  . VAL A 1 81  ? 58.175 39.911 15.551  1.00 44.08  ?  78  VAL A CA  1 
ATOM   560  C  C   . VAL A 1 81  ? 59.355 40.282 14.659  1.00 44.85  ?  78  VAL A C   1 
ATOM   561  O  O   . VAL A 1 81  ? 60.517 40.245 15.090  1.00 42.03  ?  78  VAL A O   1 
ATOM   562  C  CB  . VAL A 1 81  ? 57.977 40.916 16.704  1.00 47.71  ?  78  VAL A CB  1 
ATOM   563  C  CG1 . VAL A 1 81  ? 57.673 42.309 16.181  1.00 45.08  ?  78  VAL A CG1 1 
ATOM   564  C  CG2 . VAL A 1 81  ? 56.849 40.432 17.623  1.00 46.40  ?  78  VAL A CG2 1 
ATOM   565  N  N   . GLU A 1 82  ? 59.038 40.579 13.401  1.00 44.07  ?  79  GLU A N   1 
ATOM   566  C  CA  . GLU A 1 82  ? 60.016 40.785 12.330  1.00 45.46  ?  79  GLU A CA  1 
ATOM   567  C  C   . GLU A 1 82  ? 59.567 41.912 11.430  1.00 43.25  ?  79  GLU A C   1 
ATOM   568  O  O   . GLU A 1 82  ? 58.394 42.281 11.427  1.00 41.81  ?  79  GLU A O   1 
ATOM   569  C  CB  . GLU A 1 82  ? 60.189 39.538 11.466  1.00 49.20  ?  79  GLU A CB  1 
ATOM   570  C  CG  . GLU A 1 82  ? 60.532 38.265 12.197  1.00 67.15  ?  79  GLU A CG  1 
ATOM   571  C  CD  . GLU A 1 82  ? 60.493 37.054 11.280  1.00 73.75  ?  79  GLU A CD  1 
ATOM   572  O  OE1 . GLU A 1 82  ? 60.385 35.920 11.793  1.00 79.78  ?  79  GLU A OE1 1 
ATOM   573  O  OE2 . GLU A 1 82  ? 60.564 37.239 10.047  1.00 72.65  ?  79  GLU A OE2 1 
ATOM   574  N  N   . THR A 1 83  ? 60.494 42.446 10.646  1.00 46.11  ?  80  THR A N   1 
ATOM   575  C  CA  . THR A 1 83  ? 60.123 43.348 9.564   1.00 48.58  ?  80  THR A CA  1 
ATOM   576  C  C   . THR A 1 83  ? 59.856 42.525 8.317   1.00 50.00  ?  80  THR A C   1 
ATOM   577  O  O   . THR A 1 83  ? 60.714 41.760 7.906   1.00 50.54  ?  80  THR A O   1 
ATOM   578  C  CB  . THR A 1 83  ? 61.222 44.366 9.268   1.00 48.35  ?  80  THR A CB  1 
ATOM   579  O  OG1 . THR A 1 83  ? 61.422 45.200 10.416  1.00 41.91  ?  80  THR A OG1 1 
ATOM   580  C  CG2 . THR A 1 83  ? 60.835 45.213 8.071   1.00 49.66  ?  80  THR A CG2 1 
ATOM   581  N  N   . ALA A 1 84  ? 58.671 42.671 7.726   1.00 49.16  ?  81  ALA A N   1 
ATOM   582  C  CA  . ALA A 1 84  ? 58.311 41.906 6.543   1.00 48.50  ?  81  ALA A CA  1 
ATOM   583  C  C   . ALA A 1 84  ? 58.948 42.492 5.299   1.00 55.44  ?  81  ALA A C   1 
ATOM   584  O  O   . ALA A 1 84  ? 59.593 43.545 5.348   1.00 55.47  ?  81  ALA A O   1 
ATOM   585  C  CB  . ALA A 1 84  ? 56.798 41.850 6.362   1.00 45.86  ?  81  ALA A CB  1 
ATOM   586  N  N   . ALA A 1 85  ? 58.735 41.814 4.177   1.00 58.43  ?  82  ALA A N   1 
ATOM   587  C  CA  . ALA A 1 85  ? 59.300 42.249 2.906   1.00 58.02  ?  82  ALA A CA  1 
ATOM   588  C  C   . ALA A 1 85  ? 58.750 43.614 2.492   1.00 56.65  ?  82  ALA A C   1 
ATOM   589  O  O   . ALA A 1 85  ? 59.469 44.436 1.926   1.00 55.03  ?  82  ALA A O   1 
ATOM   590  C  CB  . ALA A 1 85  ? 59.026 41.217 1.836   1.00 59.80  ?  82  ALA A CB  1 
ATOM   591  N  N   . ASP A 1 86  ? 57.479 43.868 2.787   1.00 57.15  ?  83  ASP A N   1 
ATOM   592  C  CA  . ASP A 1 86  ? 56.903 45.169 2.461   1.00 57.67  ?  83  ASP A CA  1 
ATOM   593  C  C   . ASP A 1 86  ? 57.249 46.230 3.507   1.00 55.41  ?  83  ASP A C   1 
ATOM   594  O  O   . ASP A 1 86  ? 56.706 47.328 3.483   1.00 59.44  ?  83  ASP A O   1 
ATOM   595  C  CB  . ASP A 1 86  ? 55.382 45.060 2.288   1.00 61.10  ?  83  ASP A CB  1 
ATOM   596  C  CG  . ASP A 1 86  ? 54.657 44.718 3.573   1.00 67.08  ?  83  ASP A CG  1 
ATOM   597  O  OD1 . ASP A 1 86  ? 55.313 44.511 4.616   1.00 70.08  ?  83  ASP A OD1 1 
ATOM   598  O  OD2 . ASP A 1 86  ? 53.409 44.638 3.530   1.00 69.30  ?  83  ASP A OD2 1 
ATOM   599  N  N   . GLY A 1 87  ? 58.146 45.900 4.431   1.00 53.09  ?  84  GLY A N   1 
ATOM   600  C  CA  . GLY A 1 87  ? 58.618 46.875 5.400   1.00 51.55  ?  84  GLY A CA  1 
ATOM   601  C  C   . GLY A 1 87  ? 57.789 47.013 6.665   1.00 48.30  ?  84  GLY A C   1 
ATOM   602  O  O   . GLY A 1 87  ? 58.193 47.689 7.617   1.00 46.70  ?  84  GLY A O   1 
ATOM   603  N  N   . LYS A 1 88  ? 56.623 46.384 6.688   1.00 45.79  ?  85  LYS A N   1 
ATOM   604  C  CA  . LYS A 1 88  ? 55.748 46.520 7.843   1.00 49.31  ?  85  LYS A CA  1 
ATOM   605  C  C   . LYS A 1 88  ? 56.189 45.565 8.933   1.00 49.77  ?  85  LYS A C   1 
ATOM   606  O  O   . LYS A 1 88  ? 56.982 44.653 8.696   1.00 51.57  ?  85  LYS A O   1 
ATOM   607  C  CB  . LYS A 1 88  ? 54.288 46.276 7.450   1.00 46.61  ?  85  LYS A CB  1 
ATOM   608  C  CG  . LYS A 1 88  ? 53.773 47.354 6.480   1.00 58.92  ?  85  LYS A CG  1 
ATOM   609  C  CD  . LYS A 1 88  ? 52.313 47.155 6.114   1.00 66.55  ?  85  LYS A CD  1 
ATOM   610  C  CE  . LYS A 1 88  ? 51.428 47.182 7.350   1.00 73.76  ?  85  LYS A CE  1 
ATOM   611  N  NZ  . LYS A 1 88  ? 50.013 46.798 7.056   1.00 80.06  ?  85  LYS A NZ  1 
ATOM   612  N  N   . THR A 1 89  ? 55.692 45.791 10.139  1.00 48.48  ?  86  THR A N   1 
ATOM   613  C  CA  . THR A 1 89  ? 56.032 44.922 11.245  1.00 47.34  ?  86  THR A CA  1 
ATOM   614  C  C   . THR A 1 89  ? 55.078 43.747 11.222  1.00 50.01  ?  86  THR A C   1 
ATOM   615  O  O   . THR A 1 89  ? 53.878 43.906 11.005  1.00 44.44  ?  86  THR A O   1 
ATOM   616  C  CB  . THR A 1 89  ? 55.972 45.659 12.600  1.00 44.93  ?  86  THR A CB  1 
ATOM   617  O  OG1 . THR A 1 89  ? 57.063 46.596 12.677  1.00 41.32  ?  86  THR A OG1 1 
ATOM   618  C  CG2 . THR A 1 89  ? 56.063 44.663 13.753  1.00 39.95  ?  86  THR A CG2 1 
ATOM   619  N  N   . THR A 1 90  ? 55.644 42.570 11.446  1.00 49.49  ?  87  THR A N   1 
ATOM   620  C  CA  . THR A 1 90  ? 54.954 41.303 11.364  1.00 45.67  ?  87  THR A CA  1 
ATOM   621  C  C   . THR A 1 90  ? 54.941 40.609 12.727  1.00 46.76  ?  87  THR A C   1 
ATOM   622  O  O   . THR A 1 90  ? 55.974 40.534 13.381  1.00 53.44  ?  87  THR A O   1 
ATOM   623  C  CB  . THR A 1 90  ? 55.649 40.414 10.320  1.00 43.77  ?  87  THR A CB  1 
ATOM   624  O  OG1 . THR A 1 90  ? 55.172 40.745 9.003   1.00 54.97  ?  87  THR A OG1 1 
ATOM   625  C  CG2 . THR A 1 90  ? 55.388 38.977 10.591  1.00 50.18  ?  87  THR A CG2 1 
ATOM   626  N  N   . ARG A 1 91  ? 53.781 40.108 13.151  1.00 45.21  ?  88  ARG A N   1 
ATOM   627  C  CA  . ARG A 1 91  ? 53.661 39.384 14.421  1.00 51.37  ?  88  ARG A CA  1 
ATOM   628  C  C   . ARG A 1 91  ? 53.112 37.967 14.226  1.00 57.21  ?  88  ARG A C   1 
ATOM   629  O  O   . ARG A 1 91  ? 51.910 37.785 14.102  1.00 60.90  ?  88  ARG A O   1 
ATOM   630  C  CB  . ARG A 1 91  ? 52.753 40.153 15.388  1.00 57.42  ?  88  ARG A CB  1 
ATOM   631  C  CG  . ARG A 1 91  ? 53.306 41.498 15.844  1.00 65.66  ?  88  ARG A CG  1 
ATOM   632  C  CD  . ARG A 1 91  ? 52.301 42.247 16.703  1.00 72.59  ?  88  ARG A CD  1 
ATOM   633  N  NE  . ARG A 1 91  ? 51.142 42.688 15.931  1.00 79.34  ?  88  ARG A NE  1 
ATOM   634  C  CZ  . ARG A 1 91  ? 50.161 43.438 16.424  1.00 86.81  ?  88  ARG A CZ  1 
ATOM   635  N  NH1 . ARG A 1 91  ? 50.194 43.827 17.695  1.00 88.21  ?  88  ARG A NH1 1 
ATOM   636  N  NH2 . ARG A 1 91  ? 49.146 43.797 15.648  1.00 90.37  ?  88  ARG A NH2 1 
ATOM   637  N  N   . HIS A 1 92  ? 53.991 36.971 14.192  1.00 57.83  ?  89  HIS A N   1 
ATOM   638  C  CA  . HIS A 1 92  ? 53.578 35.567 14.086  1.00 57.46  ?  89  HIS A CA  1 
ATOM   639  C  C   . HIS A 1 92  ? 53.476 34.883 15.439  1.00 44.94  ?  89  HIS A C   1 
ATOM   640  O  O   . HIS A 1 92  ? 54.391 35.004 16.242  1.00 43.66  ?  89  HIS A O   1 
ATOM   641  C  CB  . HIS A 1 92  ? 54.569 34.743 13.256  1.00 67.68  ?  89  HIS A CB  1 
ATOM   642  C  CG  . HIS A 1 92  ? 54.792 35.240 11.866  1.00 78.43  ?  89  HIS A CG  1 
ATOM   643  N  ND1 . HIS A 1 92  ? 56.050 35.328 11.305  1.00 79.72  ?  89  HIS A ND1 1 
ATOM   644  C  CD2 . HIS A 1 92  ? 53.920 35.628 10.905  1.00 80.09  ?  89  HIS A CD2 1 
ATOM   645  C  CE1 . HIS A 1 92  ? 55.942 35.765 10.064  1.00 85.20  ?  89  HIS A CE1 1 
ATOM   646  N  NE2 . HIS A 1 92  ? 54.662 35.960 9.799   1.00 87.28  ?  89  HIS A NE2 1 
ATOM   647  N  N   . ASN A 1 93  ? 52.423 34.103 15.663  1.00 42.36  ?  90  ASN A N   1 
ATOM   648  C  CA  . ASN A 1 93  ? 52.327 33.271 16.870  1.00 44.48  ?  90  ASN A CA  1 
ATOM   649  C  C   . ASN A 1 93  ? 52.647 31.799 16.597  1.00 43.18  ?  90  ASN A C   1 
ATOM   650  O  O   . ASN A 1 93  ? 51.902 31.115 15.888  1.00 46.90  ?  90  ASN A O   1 
ATOM   651  C  CB  . ASN A 1 93  ? 50.933 33.377 17.473  1.00 53.27  ?  90  ASN A CB  1 
ATOM   652  C  CG  . ASN A 1 93  ? 50.518 34.800 17.716  1.00 62.68  ?  90  ASN A CG  1 
ATOM   653  O  OD1 . ASN A 1 93  ? 50.997 35.443 18.641  1.00 64.68  ?  90  ASN A OD1 1 
ATOM   654  N  ND2 . ASN A 1 93  ? 49.630 35.309 16.874  1.00 70.63  ?  90  ASN A ND2 1 
ATOM   655  N  N   . TYR A 1 94  ? 53.759 31.324 17.148  1.00 39.41  ?  91  TYR A N   1 
ATOM   656  C  CA  . TYR A 1 94  ? 54.190 29.941 16.966  1.00 45.76  ?  91  TYR A CA  1 
ATOM   657  C  C   . TYR A 1 94  ? 53.746 29.110 18.158  1.00 46.85  ?  91  TYR A C   1 
ATOM   658  O  O   . TYR A 1 94  ? 54.064 29.444 19.295  1.00 46.18  ?  91  TYR A O   1 
ATOM   659  C  CB  . TYR A 1 94  ? 55.716 29.853 16.801  1.00 47.59  ?  91  TYR A CB  1 
ATOM   660  C  CG  . TYR A 1 94  ? 56.219 30.311 15.448  1.00 46.89  ?  91  TYR A CG  1 
ATOM   661  C  CD1 . TYR A 1 94  ? 56.300 31.664 15.145  1.00 48.30  ?  91  TYR A CD1 1 
ATOM   662  C  CD2 . TYR A 1 94  ? 56.624 29.393 14.477  1.00 50.90  ?  91  TYR A CD2 1 
ATOM   663  C  CE1 . TYR A 1 94  ? 56.756 32.098 13.907  1.00 52.64  ?  91  TYR A CE1 1 
ATOM   664  C  CE2 . TYR A 1 94  ? 57.084 29.821 13.223  1.00 46.08  ?  91  TYR A CE2 1 
ATOM   665  C  CZ  . TYR A 1 94  ? 57.150 31.179 12.953  1.00 53.74  ?  91  TYR A CZ  1 
ATOM   666  O  OH  . TYR A 1 94  ? 57.604 31.644 11.734  1.00 59.42  ?  91  TYR A OH  1 
ATOM   667  N  N   . TYR A 1 95  ? 53.010 28.034 17.905  1.00 40.92  ?  92  TYR A N   1 
ATOM   668  C  CA  . TYR A 1 95  ? 52.516 27.200 18.996  1.00 43.52  ?  92  TYR A CA  1 
ATOM   669  C  C   . TYR A 1 95  ? 53.304 25.900 19.124  1.00 43.70  ?  92  TYR A C   1 
ATOM   670  O  O   . TYR A 1 95  ? 53.868 25.402 18.149  1.00 36.43  ?  92  TYR A O   1 
ATOM   671  C  CB  . TYR A 1 95  ? 51.035 26.899 18.800  1.00 41.97  ?  92  TYR A CB  1 
ATOM   672  C  CG  . TYR A 1 95  ? 50.155 28.054 19.185  1.00 46.93  ?  92  TYR A CG  1 
ATOM   673  C  CD1 . TYR A 1 95  ? 49.880 29.077 18.288  1.00 45.05  ?  92  TYR A CD1 1 
ATOM   674  C  CD2 . TYR A 1 95  ? 49.592 28.120 20.449  1.00 47.01  ?  92  TYR A CD2 1 
ATOM   675  C  CE1 . TYR A 1 95  ? 49.079 30.141 18.648  1.00 42.94  ?  92  TYR A CE1 1 
ATOM   676  C  CE2 . TYR A 1 95  ? 48.784 29.174 20.816  1.00 49.99  ?  92  TYR A CE2 1 
ATOM   677  C  CZ  . TYR A 1 95  ? 48.526 30.176 19.911  1.00 50.52  ?  92  TYR A CZ  1 
ATOM   678  O  OH  . TYR A 1 95  ? 47.724 31.221 20.286  1.00 53.92  ?  92  TYR A OH  1 
ATOM   679  N  N   . PHE A 1 96  ? 53.356 25.361 20.338  1.00 38.13  ?  93  PHE A N   1 
ATOM   680  C  CA  . PHE A 1 96  ? 54.009 24.079 20.561  1.00 38.27  ?  93  PHE A CA  1 
ATOM   681  C  C   . PHE A 1 96  ? 53.420 23.396 21.776  1.00 39.03  ?  93  PHE A C   1 
ATOM   682  O  O   . PHE A 1 96  ? 52.838 24.049 22.640  1.00 37.33  ?  93  PHE A O   1 
ATOM   683  C  CB  . PHE A 1 96  ? 55.521 24.258 20.727  1.00 37.11  ?  93  PHE A CB  1 
ATOM   684  C  CG  . PHE A 1 96  ? 55.912 25.213 21.827  1.00 51.30  ?  93  PHE A CG  1 
ATOM   685  C  CD1 . PHE A 1 96  ? 56.081 26.565 21.562  1.00 47.53  ?  93  PHE A CD1 1 
ATOM   686  C  CD2 . PHE A 1 96  ? 56.130 24.756 23.120  1.00 52.00  ?  93  PHE A CD2 1 
ATOM   687  C  CE1 . PHE A 1 96  ? 56.450 27.442 22.562  1.00 49.87  ?  93  PHE A CE1 1 
ATOM   688  C  CE2 . PHE A 1 96  ? 56.502 25.635 24.132  1.00 52.65  ?  93  PHE A CE2 1 
ATOM   689  C  CZ  . PHE A 1 96  ? 56.661 26.981 23.853  1.00 48.50  ?  93  PHE A CZ  1 
ATOM   690  N  N   . ILE A 1 97  ? 53.556 22.078 21.840  1.00 35.75  ?  94  ILE A N   1 
ATOM   691  C  CA  . ILE A 1 97  ? 53.072 21.363 23.004  1.00 38.82  ?  94  ILE A CA  1 
ATOM   692  C  C   . ILE A 1 97  ? 54.123 21.450 24.096  1.00 44.37  ?  94  ILE A C   1 
ATOM   693  O  O   . ILE A 1 97  ? 55.322 21.272 23.849  1.00 43.75  ?  94  ILE A O   1 
ATOM   694  C  CB  . ILE A 1 97  ? 52.765 19.903 22.703  1.00 42.74  ?  94  ILE A CB  1 
ATOM   695  C  CG1 . ILE A 1 97  ? 51.728 19.797 21.607  1.00 42.91  ?  94  ILE A CG1 1 
ATOM   696  C  CG2 . ILE A 1 97  ? 52.230 19.201 23.928  1.00 45.51  ?  94  ILE A CG2 1 
ATOM   697  C  CD1 . ILE A 1 97  ? 51.597 18.392 21.104  1.00 46.25  ?  94  ILE A CD1 1 
ATOM   698  N  N   . ASN A 1 98  ? 53.663 21.745 25.303  1.00 43.04  ?  95  ASN A N   1 
ATOM   699  C  CA  . ASN A 1 98  ? 54.545 21.872 26.454  1.00 44.49  ?  95  ASN A CA  1 
ATOM   700  C  C   . ASN A 1 98  ? 54.307 20.668 27.345  1.00 46.35  ?  95  ASN A C   1 
ATOM   701  O  O   . ASN A 1 98  ? 53.395 20.676 28.183  1.00 40.30  ?  95  ASN A O   1 
ATOM   702  C  CB  . ASN A 1 98  ? 54.266 23.186 27.189  1.00 49.37  ?  95  ASN A CB  1 
ATOM   703  C  CG  . ASN A 1 98  ? 55.354 23.555 28.153  1.00 60.35  ?  95  ASN A CG  1 
ATOM   704  O  OD1 . ASN A 1 98  ? 55.286 23.214 29.326  1.00 61.35  ?  95  ASN A OD1 1 
ATOM   705  N  ND2 . ASN A 1 98  ? 56.360 24.273 27.673  1.00 63.91  ?  95  ASN A ND2 1 
ATOM   706  N  N   . TYR A 1 99  ? 55.087 19.617 27.123  1.00 45.07  ?  96  TYR A N   1 
ATOM   707  C  CA  . TYR A 1 99  ? 54.782 18.326 27.717  1.00 50.34  ?  96  TYR A CA  1 
ATOM   708  C  C   . TYR A 1 99  ? 54.907 18.302 29.247  1.00 55.54  ?  96  TYR A C   1 
ATOM   709  O  O   . TYR A 1 99  ? 54.154 17.594 29.924  1.00 54.47  ?  96  TYR A O   1 
ATOM   710  C  CB  . TYR A 1 99  ? 55.662 17.245 27.084  1.00 50.35  ?  96  TYR A CB  1 
ATOM   711  C  CG  . TYR A 1 99  ? 55.185 16.850 25.701  1.00 52.58  ?  96  TYR A CG  1 
ATOM   712  C  CD1 . TYR A 1 99  ? 54.071 16.028 25.533  1.00 45.69  ?  96  TYR A CD1 1 
ATOM   713  C  CD2 . TYR A 1 99  ? 55.834 17.311 24.563  1.00 49.03  ?  96  TYR A CD2 1 
ATOM   714  C  CE1 . TYR A 1 99  ? 53.625 15.677 24.258  1.00 48.54  ?  96  TYR A CE1 1 
ATOM   715  C  CE2 . TYR A 1 99  ? 55.398 16.967 23.300  1.00 54.30  ?  96  TYR A CE2 1 
ATOM   716  C  CZ  . TYR A 1 99  ? 54.296 16.151 23.153  1.00 50.14  ?  96  TYR A CZ  1 
ATOM   717  O  OH  . TYR A 1 99  ? 53.880 15.810 21.887  1.00 61.14  ?  96  TYR A OH  1 
ATOM   718  N  N   . ARG A 1 100 ? 55.809 19.095 29.809  1.00 57.37  ?  97  ARG A N   1 
ATOM   719  C  CA  . ARG A 1 100 ? 55.943 19.066 31.257  1.00 57.44  ?  97  ARG A CA  1 
ATOM   720  C  C   . ARG A 1 100 ? 54.704 19.692 31.913  1.00 55.68  ?  97  ARG A C   1 
ATOM   721  O  O   . ARG A 1 100 ? 54.165 19.154 32.883  1.00 45.12  ?  97  ARG A O   1 
ATOM   722  C  CB  . ARG A 1 100 ? 57.224 19.766 31.717  1.00 64.65  ?  97  ARG A CB  1 
ATOM   723  C  CG  . ARG A 1 100 ? 57.464 19.610 33.218  1.00 67.67  ?  97  ARG A CG  1 
ATOM   724  C  CD  . ARG A 1 100 ? 58.853 20.057 33.660  1.00 80.92  ?  97  ARG A CD  1 
ATOM   725  N  NE  . ARG A 1 100 ? 59.611 18.943 34.232  1.00 91.74  ?  97  ARG A NE  1 
ATOM   726  C  CZ  . ARG A 1 100 ? 60.505 19.064 35.209  1.00 100.82 ?  97  ARG A CZ  1 
ATOM   727  N  NH1 . ARG A 1 100 ? 60.757 20.255 35.735  1.00 103.67 ?  97  ARG A NH1 1 
ATOM   728  N  NH2 . ARG A 1 100 ? 61.141 17.992 35.666  1.00 104.64 ?  97  ARG A NH2 1 
ATOM   729  N  N   . THR A 1 101 ? 54.214 20.798 31.369  1.00 56.94  ?  98  THR A N   1 
ATOM   730  C  CA  . THR A 1 101 ? 53.003 21.388 31.920  1.00 58.15  ?  98  THR A CA  1 
ATOM   731  C  C   . THR A 1 101 ? 51.755 20.541 31.619  1.00 54.13  ?  98  THR A C   1 
ATOM   732  O  O   . THR A 1 101 ? 50.824 20.498 32.433  1.00 50.43  ?  98  THR A O   1 
ATOM   733  C  CB  . THR A 1 101 ? 52.797 22.808 31.400  1.00 70.67  ?  98  THR A CB  1 
ATOM   734  O  OG1 . THR A 1 101 ? 54.054 23.490 31.394  1.00 86.24  ?  98  THR A OG1 1 
ATOM   735  C  CG2 . THR A 1 101 ? 51.868 23.559 32.314  1.00 72.46  ?  98  THR A CG2 1 
ATOM   736  N  N   . LEU A 1 102 ? 51.737 19.862 30.467  1.00 46.10  ?  99  LEU A N   1 
ATOM   737  C  CA  . LEU A 1 102 ? 50.580 19.045 30.088  1.00 45.66  ?  99  LEU A CA  1 
ATOM   738  C  C   . LEU A 1 102 ? 50.405 17.878 31.049  1.00 46.34  ?  99  LEU A C   1 
ATOM   739  O  O   . LEU A 1 102 ? 49.299 17.602 31.502  1.00 43.69  ?  99  LEU A O   1 
ATOM   740  C  CB  . LEU A 1 102 ? 50.706 18.531 28.631  1.00 42.49  ?  99  LEU A CB  1 
ATOM   741  C  CG  . LEU A 1 102 ? 49.559 17.713 28.021  1.00 39.54  ?  99  LEU A CG  1 
ATOM   742  C  CD1 . LEU A 1 102 ? 49.567 17.790 26.500  1.00 46.11  ?  99  LEU A CD1 1 
ATOM   743  C  CD2 . LEU A 1 102 ? 49.605 16.248 28.436  1.00 39.32  ?  99  LEU A CD2 1 
ATOM   744  N  N   . VAL A 1 103 ? 51.497 17.183 31.340  1.00 42.70  ?  100 VAL A N   1 
ATOM   745  C  CA  . VAL A 1 103 ? 51.461 16.058 32.246  1.00 40.45  ?  100 VAL A CA  1 
ATOM   746  C  C   . VAL A 1 103 ? 51.009 16.479 33.652  1.00 46.59  ?  100 VAL A C   1 
ATOM   747  O  O   . VAL A 1 103 ? 50.252 15.766 34.307  1.00 45.01  ?  100 VAL A O   1 
ATOM   748  C  CB  . VAL A 1 103 ? 52.837 15.384 32.322  1.00 42.73  ?  100 VAL A CB  1 
ATOM   749  C  CG1 . VAL A 1 103 ? 52.895 14.350 33.466  1.00 39.30  ?  100 VAL A CG1 1 
ATOM   750  C  CG2 . VAL A 1 103 ? 53.175 14.748 30.982  1.00 44.43  ?  100 VAL A CG2 1 
ATOM   751  N  N   . ASN A 1 104 ? 51.465 17.642 34.107  1.00 46.66  ?  101 ASN A N   1 
ATOM   752  C  CA  . ASN A 1 104 ? 51.069 18.143 35.420  1.00 52.16  ?  101 ASN A CA  1 
ATOM   753  C  C   . ASN A 1 104 ? 49.581 18.481 35.518  1.00 49.87  ?  101 ASN A C   1 
ATOM   754  O  O   . ASN A 1 104 ? 48.934 18.151 36.523  1.00 44.24  ?  101 ASN A O   1 
ATOM   755  C  CB  . ASN A 1 104 ? 51.896 19.371 35.789  1.00 50.19  ?  101 ASN A CB  1 
ATOM   756  C  CG  . ASN A 1 104 ? 53.180 19.008 36.499  1.00 52.45  ?  101 ASN A CG  1 
ATOM   757  O  OD1 . ASN A 1 104 ? 53.518 17.833 36.628  1.00 49.33  ?  101 ASN A OD1 1 
ATOM   758  N  ND2 . ASN A 1 104 ? 53.904 20.014 36.958  1.00 58.32  ?  101 ASN A ND2 1 
ATOM   759  N  N   . VAL A 1 105 ? 49.044 19.129 34.482  1.00 43.00  ?  102 VAL A N   1 
ATOM   760  C  CA  . VAL A 1 105 ? 47.635 19.522 34.480  1.00 39.37  ?  102 VAL A CA  1 
ATOM   761  C  C   . VAL A 1 105 ? 46.779 18.273 34.471  1.00 39.90  ?  102 VAL A C   1 
ATOM   762  O  O   . VAL A 1 105 ? 45.761 18.205 35.171  1.00 40.53  ?  102 VAL A O   1 
ATOM   763  C  CB  . VAL A 1 105 ? 47.273 20.424 33.277  1.00 37.94  ?  102 VAL A CB  1 
ATOM   764  C  CG1 . VAL A 1 105 ? 45.769 20.454 33.052  1.00 35.82  ?  102 VAL A CG1 1 
ATOM   765  C  CG2 . VAL A 1 105 ? 47.771 21.836 33.506  1.00 40.67  ?  102 VAL A CG2 1 
ATOM   766  N  N   . VAL A 1 106 ? 47.214 17.275 33.702  1.00 39.07  ?  103 VAL A N   1 
ATOM   767  C  CA  . VAL A 1 106 ? 46.498 16.008 33.622  1.00 38.25  ?  103 VAL A CA  1 
ATOM   768  C  C   . VAL A 1 106 ? 46.430 15.347 35.019  1.00 44.84  ?  103 VAL A C   1 
ATOM   769  O  O   . VAL A 1 106 ? 45.360 14.918 35.464  1.00 39.90  ?  103 VAL A O   1 
ATOM   770  C  CB  . VAL A 1 106 ? 47.153 15.044 32.619  1.00 36.01  ?  103 VAL A CB  1 
ATOM   771  C  CG1 . VAL A 1 106 ? 46.525 13.669 32.723  1.00 33.77  ?  103 VAL A CG1 1 
ATOM   772  C  CG2 . VAL A 1 106 ? 47.019 15.587 31.163  1.00 34.61  ?  103 VAL A CG2 1 
ATOM   773  N  N   . LYS A 1 107 ? 47.565 15.285 35.711  1.00 42.56  ?  104 LYS A N   1 
ATOM   774  C  CA  . LYS A 1 107 ? 47.589 14.709 37.048  1.00 45.38  ?  104 LYS A CA  1 
ATOM   775  C  C   . LYS A 1 107 ? 46.718 15.536 37.987  1.00 43.94  ?  104 LYS A C   1 
ATOM   776  O  O   . LYS A 1 107 ? 45.964 14.990 38.786  1.00 45.04  ?  104 LYS A O   1 
ATOM   777  C  CB  . LYS A 1 107 ? 49.020 14.616 37.585  1.00 42.99  ?  104 LYS A CB  1 
ATOM   778  C  CG  . LYS A 1 107 ? 49.905 13.676 36.781  1.00 49.67  ?  104 LYS A CG  1 
ATOM   779  C  CD  . LYS A 1 107 ? 50.938 12.973 37.633  1.00 60.58  ?  104 LYS A CD  1 
ATOM   780  C  CE  . LYS A 1 107 ? 52.233 13.753 37.724  1.00 63.63  ?  104 LYS A CE  1 
ATOM   781  N  NZ  . LYS A 1 107 ? 53.246 12.953 38.480  1.00 65.04  ?  104 LYS A NZ  1 
ATOM   782  N  N   . TYR A 1 108 ? 46.811 16.856 37.863  1.00 41.21  ?  105 TYR A N   1 
ATOM   783  C  CA  . TYR A 1 108 ? 46.054 17.764 38.720  1.00 42.31  ?  105 TYR A CA  1 
ATOM   784  C  C   . TYR A 1 108 ? 44.542 17.537 38.553  1.00 42.11  ?  105 TYR A C   1 
ATOM   785  O  O   . TYR A 1 108 ? 43.805 17.367 39.534  1.00 40.67  ?  105 TYR A O   1 
ATOM   786  C  CB  . TYR A 1 108 ? 46.432 19.220 38.415  1.00 39.35  ?  105 TYR A CB  1 
ATOM   787  C  CG  . TYR A 1 108 ? 45.746 20.244 39.297  1.00 41.45  ?  105 TYR A CG  1 
ATOM   788  C  CD1 . TYR A 1 108 ? 44.519 20.783 38.940  1.00 43.49  ?  105 TYR A CD1 1 
ATOM   789  C  CD2 . TYR A 1 108 ? 46.329 20.673 40.491  1.00 42.45  ?  105 TYR A CD2 1 
ATOM   790  C  CE1 . TYR A 1 108 ? 43.884 21.728 39.747  1.00 43.68  ?  105 TYR A CE1 1 
ATOM   791  C  CE2 . TYR A 1 108 ? 45.699 21.613 41.305  1.00 42.05  ?  105 TYR A CE2 1 
ATOM   792  C  CZ  . TYR A 1 108 ? 44.480 22.127 40.927  1.00 46.01  ?  105 TYR A CZ  1 
ATOM   793  O  OH  . TYR A 1 108 ? 43.862 23.060 41.717  1.00 44.09  ?  105 TYR A OH  1 
ATOM   794  N  N   . LYS A 1 109 ? 44.093 17.510 37.303  1.00 35.66  ?  106 LYS A N   1 
ATOM   795  C  CA  . LYS A 1 109 ? 42.692 17.308 37.008  1.00 38.46  ?  106 LYS A CA  1 
ATOM   796  C  C   . LYS A 1 109 ? 42.213 15.922 37.411  1.00 39.51  ?  106 LYS A C   1 
ATOM   797  O  O   . LYS A 1 109 ? 41.122 15.798 37.943  1.00 38.49  ?  106 LYS A O   1 
ATOM   798  C  CB  . LYS A 1 109 ? 42.417 17.548 35.513  1.00 39.98  ?  106 LYS A CB  1 
ATOM   799  C  CG  . LYS A 1 109 ? 42.255 19.026 35.172  1.00 41.29  ?  106 LYS A CG  1 
ATOM   800  C  CD  . LYS A 1 109 ? 42.255 19.266 33.672  1.00 45.10  ?  106 LYS A CD  1 
ATOM   801  C  CE  . LYS A 1 109 ? 41.881 20.697 33.335  1.00 44.71  ?  106 LYS A CE  1 
ATOM   802  N  NZ  . LYS A 1 109 ? 40.421 20.947 33.449  1.00 44.86  ?  106 LYS A NZ  1 
ATOM   803  N  N   . LEU A 1 110 ? 43.008 14.882 37.175  1.00 31.94  ?  107 LEU A N   1 
ATOM   804  C  CA  . LEU A 1 110 ? 42.537 13.542 37.510  1.00 34.11  ?  107 LEU A CA  1 
ATOM   805  C  C   . LEU A 1 110 ? 42.472 13.348 39.043  1.00 43.21  ?  107 LEU A C   1 
ATOM   806  O  O   . LEU A 1 110 ? 41.668 12.558 39.559  1.00 36.76  ?  107 LEU A O   1 
ATOM   807  C  CB  . LEU A 1 110 ? 43.422 12.469 36.875  1.00 32.58  ?  107 LEU A CB  1 
ATOM   808  C  CG  . LEU A 1 110 ? 43.466 12.371 35.334  1.00 37.52  ?  107 LEU A CG  1 
ATOM   809  C  CD1 . LEU A 1 110 ? 44.304 11.183 34.918  1.00 33.79  ?  107 LEU A CD1 1 
ATOM   810  C  CD2 . LEU A 1 110 ? 42.076 12.254 34.723  1.00 34.21  ?  107 LEU A CD2 1 
ATOM   811  N  N   . ASP A 1 111 ? 43.317 14.069 39.770  1.00 34.85  ?  108 ASP A N   1 
ATOM   812  C  CA  . ASP A 1 111 ? 43.374 13.875 41.207  1.00 34.48  ?  108 ASP A CA  1 
ATOM   813  C  C   . ASP A 1 111 ? 42.140 14.528 41.801  1.00 39.51  ?  108 ASP A C   1 
ATOM   814  O  O   . ASP A 1 111 ? 41.471 13.930 42.620  1.00 37.51  ?  108 ASP A O   1 
ATOM   815  C  CB  . ASP A 1 111 ? 44.654 14.450 41.794  1.00 34.39  ?  108 ASP A CB  1 
ATOM   816  C  CG  . ASP A 1 111 ? 44.893 13.997 43.227  1.00 43.68  ?  108 ASP A CG  1 
ATOM   817  O  OD1 . ASP A 1 111 ? 45.113 12.780 43.451  1.00 39.57  ?  108 ASP A OD1 1 
ATOM   818  O  OD2 . ASP A 1 111 ? 44.876 14.864 44.127  1.00 48.77  ?  108 ASP A OD2 1 
ATOM   819  N  N   . HIS A 1 112 ? 41.803 15.726 41.331  1.00 36.73  ?  109 HIS A N   1 
ATOM   820  C  CA  . HIS A 1 112 ? 40.613 16.421 41.810  1.00 38.67  ?  109 HIS A CA  1 
ATOM   821  C  C   . HIS A 1 112 ? 39.317 15.736 41.387  1.00 38.54  ?  109 HIS A C   1 
ATOM   822  O  O   . HIS A 1 112 ? 38.351 15.700 42.141  1.00 40.64  ?  109 HIS A O   1 
ATOM   823  C  CB  . HIS A 1 112 ? 40.613 17.870 41.326  1.00 41.91  ?  109 HIS A CB  1 
ATOM   824  C  CG  . HIS A 1 112 ? 41.437 18.780 42.184  1.00 37.65  ?  109 HIS A CG  1 
ATOM   825  N  ND1 . HIS A 1 112 ? 41.017 19.214 43.420  1.00 45.18  ?  109 HIS A ND1 1 
ATOM   826  C  CD2 . HIS A 1 112 ? 42.672 19.304 41.997  1.00 37.55  ?  109 HIS A CD2 1 
ATOM   827  C  CE1 . HIS A 1 112 ? 41.954 19.979 43.957  1.00 44.14  ?  109 HIS A CE1 1 
ATOM   828  N  NE2 . HIS A 1 112 ? 42.969 20.043 43.115  1.00 44.46  ?  109 HIS A NE2 1 
ATOM   829  N  N   . MET A 1 113 ? 39.287 15.180 40.189  1.00 35.10  ?  110 MET A N   1 
ATOM   830  C  CA  . MET A 1 113 ? 38.093 14.449 39.767  1.00 38.58  ?  110 MET A CA  1 
ATOM   831  C  C   . MET A 1 113 ? 37.827 13.255 40.691  1.00 41.07  ?  110 MET A C   1 
ATOM   832  O  O   . MET A 1 113 ? 36.702 13.059 41.168  1.00 42.31  ?  110 MET A O   1 
ATOM   833  C  CB  . MET A 1 113 ? 38.231 13.981 38.320  1.00 33.62  ?  110 MET A CB  1 
ATOM   834  C  CG  . MET A 1 113 ? 38.223 15.105 37.292  1.00 40.93  ?  110 MET A CG  1 
ATOM   835  S  SD  . MET A 1 113 ? 38.881 14.523 35.705  1.00 39.86  ?  110 MET A SD  1 
ATOM   836  C  CE  . MET A 1 113 ? 37.533 13.463 35.179  1.00 34.62  ?  110 MET A CE  1 
ATOM   837  N  N   . ARG A 1 114 ? 38.868 12.472 40.959  1.00 38.07  ?  111 ARG A N   1 
ATOM   838  C  CA  . ARG A 1 114 ? 38.736 11.334 41.853  1.00 38.51  ?  111 ARG A CA  1 
ATOM   839  C  C   . ARG A 1 114 ? 38.205 11.784 43.223  1.00 43.59  ?  111 ARG A C   1 
ATOM   840  O  O   . ARG A 1 114 ? 37.229 11.238 43.736  1.00 38.08  ?  111 ARG A O   1 
ATOM   841  C  CB  . ARG A 1 114 ? 40.071 10.617 42.033  1.00 41.44  ?  111 ARG A CB  1 
ATOM   842  C  CG  . ARG A 1 114 ? 39.916 9.269  42.720  1.00 39.33  ?  111 ARG A CG  1 
ATOM   843  C  CD  . ARG A 1 114 ? 41.225 8.704  43.246  1.00 38.81  ?  111 ARG A CD  1 
ATOM   844  N  NE  . ARG A 1 114 ? 41.738 9.424  44.414  1.00 39.37  ?  111 ARG A NE  1 
ATOM   845  C  CZ  . ARG A 1 114 ? 42.774 10.257 44.377  1.00 42.53  ?  111 ARG A CZ  1 
ATOM   846  N  NH1 . ARG A 1 114 ? 43.411 10.499 43.230  1.00 37.35  ?  111 ARG A NH1 1 
ATOM   847  N  NH2 . ARG A 1 114 ? 43.179 10.860 45.480  1.00 41.04  ?  111 ARG A NH2 1 
ATOM   848  N  N   . ARG A 1 115 ? 38.836 12.807 43.782  1.00 38.72  ?  112 ARG A N   1 
ATOM   849  C  CA  . ARG A 1 115 ? 38.476 13.326 45.083  1.00 45.62  ?  112 ARG A CA  1 
ATOM   850  C  C   . ARG A 1 115 ? 37.055 13.884 45.149  1.00 47.46  ?  112 ARG A C   1 
ATOM   851  O  O   . ARG A 1 115 ? 36.409 13.854 46.212  1.00 45.29  ?  112 ARG A O   1 
ATOM   852  C  CB  . ARG A 1 115 ? 39.489 14.395 45.504  1.00 44.24  ?  112 ARG A CB  1 
ATOM   853  C  CG  . ARG A 1 115 ? 40.848 13.806 45.848  1.00 44.19  ?  112 ARG A CG  1 
ATOM   854  C  CD  . ARG A 1 115 ? 41.859 14.862 46.237  1.00 39.39  ?  112 ARG A CD  1 
ATOM   855  N  NE  . ARG A 1 115 ? 43.146 14.239 46.515  1.00 43.18  ?  112 ARG A NE  1 
ATOM   856  C  CZ  . ARG A 1 115 ? 43.512 13.802 47.714  1.00 45.29  ?  112 ARG A CZ  1 
ATOM   857  N  NH1 . ARG A 1 115 ? 42.692 13.947 48.762  1.00 48.55  ?  112 ARG A NH1 1 
ATOM   858  N  NH2 . ARG A 1 115 ? 44.701 13.247 47.876  1.00 45.09  ?  112 ARG A NH2 1 
ATOM   859  N  N   . ARG A 1 116 ? 36.565 14.403 44.033  1.00 43.94  ?  113 ARG A N   1 
ATOM   860  C  CA  . ARG A 1 116 ? 35.207 14.927 44.006  1.00 44.70  ?  113 ARG A CA  1 
ATOM   861  C  C   . ARG A 1 116 ? 34.210 13.767 44.040  1.00 46.47  ?  113 ARG A C   1 
ATOM   862  O  O   . ARG A 1 116 ? 33.176 13.813 44.726  1.00 44.58  ?  113 ARG A O   1 
ATOM   863  C  CB  . ARG A 1 116 ? 34.993 15.802 42.782  1.00 41.97  ?  113 ARG A CB  1 
ATOM   864  C  CG  . ARG A 1 116 ? 33.536 16.182 42.532  1.00 53.69  ?  113 ARG A CG  1 
ATOM   865  C  CD  . ARG A 1 116 ? 32.882 16.803 43.758  1.00 65.42  ?  113 ARG A CD  1 
ATOM   866  N  NE  . ARG A 1 116 ? 33.178 18.224 43.873  1.00 71.51  ?  113 ARG A NE  1 
ATOM   867  C  CZ  . ARG A 1 116 ? 32.648 19.022 44.792  1.00 74.75  ?  113 ARG A CZ  1 
ATOM   868  N  NH1 . ARG A 1 116 ? 31.789 18.534 45.682  1.00 74.55  ?  113 ARG A NH1 1 
ATOM   869  N  NH2 . ARG A 1 116 ? 32.978 20.307 44.813  1.00 77.70  ?  113 ARG A NH2 1 
ATOM   870  N  N   . ILE A 1 117 ? 34.546 12.724 43.298  1.00 40.14  ?  114 ILE A N   1 
ATOM   871  C  CA  . ILE A 1 117 ? 33.755 11.508 43.268  1.00 40.02  ?  114 ILE A CA  1 
ATOM   872  C  C   . ILE A 1 117 ? 33.730 10.844 44.647  1.00 49.42  ?  114 ILE A C   1 
ATOM   873  O  O   . ILE A 1 117 ? 32.671 10.437 45.132  1.00 48.74  ?  114 ILE A O   1 
ATOM   874  C  CB  . ILE A 1 117 ? 34.304 10.543 42.216  1.00 42.89  ?  114 ILE A CB  1 
ATOM   875  C  CG1 . ILE A 1 117 ? 34.102 11.154 40.810  1.00 44.46  ?  114 ILE A CG1 1 
ATOM   876  C  CG2 . ILE A 1 117 ? 33.619 9.187  42.318  1.00 45.38  ?  114 ILE A CG2 1 
ATOM   877  C  CD1 . ILE A 1 117 ? 34.813 10.397 39.695  1.00 42.09  ?  114 ILE A CD1 1 
ATOM   878  N  N   . GLU A 1 118 ? 34.901 10.749 45.269  1.00 41.45  ?  115 GLU A N   1 
ATOM   879  C  CA  . GLU A 1 118 ? 35.027 10.168 46.595  1.00 46.52  ?  115 GLU A CA  1 
ATOM   880  C  C   . GLU A 1 118 ? 34.187 10.953 47.597  1.00 51.58  ?  115 GLU A C   1 
ATOM   881  O  O   . GLU A 1 118 ? 33.483 10.366 48.429  1.00 52.04  ?  115 GLU A O   1 
ATOM   882  C  CB  . GLU A 1 118 ? 36.490 10.142 47.026  1.00 43.27  ?  115 GLU A CB  1 
ATOM   883  C  CG  . GLU A 1 118 ? 37.336 9.130  46.286  1.00 45.75  ?  115 GLU A CG  1 
ATOM   884  C  CD  . GLU A 1 118 ? 38.835 9.327  46.498  1.00 47.69  ?  115 GLU A CD  1 
ATOM   885  O  OE1 . GLU A 1 118 ? 39.226 10.385 47.034  1.00 44.73  ?  115 GLU A OE1 1 
ATOM   886  O  OE2 . GLU A 1 118 ? 39.622 8.420  46.117  1.00 49.42  ?  115 GLU A OE2 1 
ATOM   887  N  N   . THR A 1 119 ? 34.250 12.278 47.504  1.00 44.51  ?  116 THR A N   1 
ATOM   888  C  CA  . THR A 1 119 ? 33.476 13.136 48.394  1.00 49.58  ?  116 THR A CA  1 
ATOM   889  C  C   . THR A 1 119 ? 31.986 12.915 48.172  1.00 55.60  ?  116 THR A C   1 
ATOM   890  O  O   . THR A 1 119 ? 31.205 12.876 49.130  1.00 49.92  ?  116 THR A O   1 
ATOM   891  C  CB  . THR A 1 119 ? 33.799 14.636 48.204  1.00 48.98  ?  116 THR A CB  1 
ATOM   892  O  OG1 . THR A 1 119 ? 35.201 14.855 48.389  1.00 53.67  ?  116 THR A OG1 1 
ATOM   893  C  CG2 . THR A 1 119 ? 33.035 15.484 49.243  1.00 53.71  ?  116 THR A CG2 1 
ATOM   894  N  N   . ASP A 1 120 ? 31.586 12.764 46.911  1.00 46.00  ?  117 ASP A N   1 
ATOM   895  C  CA  . ASP A 1 120 ? 30.170 12.570 46.626  1.00 55.06  ?  117 ASP A CA  1 
ATOM   896  C  C   . ASP A 1 120 ? 29.710 11.234 47.193  1.00 57.09  ?  117 ASP A C   1 
ATOM   897  O  O   . ASP A 1 120 ? 28.599 11.123 47.715  1.00 61.72  ?  117 ASP A O   1 
ATOM   898  C  CB  . ASP A 1 120 ? 29.895 12.667 45.118  1.00 50.14  ?  117 ASP A CB  1 
ATOM   899  C  CG  . ASP A 1 120 ? 29.912 14.101 44.623  1.00 63.76  ?  117 ASP A CG  1 
ATOM   900  O  OD1 . ASP A 1 120 ? 30.357 14.991 45.378  1.00 68.88  ?  117 ASP A OD1 1 
ATOM   901  O  OD2 . ASP A 1 120 ? 29.489 14.347 43.476  1.00 75.56  ?  117 ASP A OD2 1 
ATOM   902  N  N   . GLU A 1 121 ? 30.578 10.231 47.134  1.00 48.30  ?  118 GLU A N   1 
ATOM   903  C  CA  . GLU A 1 121 ? 30.235 8.922  47.665  1.00 51.93  ?  118 GLU A CA  1 
ATOM   904  C  C   . GLU A 1 121 ? 30.099 8.966  49.189  1.00 60.09  ?  118 GLU A C   1 
ATOM   905  O  O   . GLU A 1 121 ? 29.205 8.341  49.754  1.00 65.33  ?  118 GLU A O   1 
ATOM   906  C  CB  . GLU A 1 121 ? 31.272 7.875  47.262  1.00 56.73  ?  118 GLU A CB  1 
ATOM   907  C  CG  . GLU A 1 121 ? 30.972 6.496  47.826  1.00 69.00  ?  118 GLU A CG  1 
ATOM   908  C  CD  . GLU A 1 121 ? 31.903 5.410  47.309  1.00 81.38  ?  118 GLU A CD  1 
ATOM   909  O  OE1 . GLU A 1 121 ? 32.624 5.652  46.316  1.00 78.43  ?  118 GLU A OE1 1 
ATOM   910  O  OE2 . GLU A 1 121 ? 31.906 4.306  47.901  1.00 89.12  ?  118 GLU A OE2 1 
ATOM   911  N  N   . ARG A 1 122 ? 30.990 9.703  49.846  1.00 52.62  ?  119 ARG A N   1 
ATOM   912  C  CA  . ARG A 1 122 ? 30.929 9.853  51.294  1.00 55.36  ?  119 ARG A CA  1 
ATOM   913  C  C   . ARG A 1 122 ? 29.661 10.592 51.710  1.00 61.97  ?  119 ARG A C   1 
ATOM   914  O  O   . ARG A 1 122 ? 28.993 10.201 52.665  1.00 63.99  ?  119 ARG A O   1 
ATOM   915  C  CB  . ARG A 1 122 ? 32.161 10.590 51.821  1.00 54.91  ?  119 ARG A CB  1 
ATOM   916  C  CG  . ARG A 1 122 ? 32.185 10.700 53.362  1.00 59.73  ?  119 ARG A CG  1 
ATOM   917  C  CD  . ARG A 1 122 ? 33.257 11.673 53.814  1.00 66.91  ?  119 ARG A CD  1 
ATOM   918  N  NE  . ARG A 1 122 ? 32.904 13.063 53.522  1.00 71.39  ?  119 ARG A NE  1 
ATOM   919  C  CZ  . ARG A 1 122 ? 33.645 13.887 52.791  1.00 74.80  ?  119 ARG A CZ  1 
ATOM   920  N  NH1 . ARG A 1 122 ? 34.784 13.458 52.263  1.00 76.09  ?  119 ARG A NH1 1 
ATOM   921  N  NH2 . ARG A 1 122 ? 33.243 15.136 52.585  1.00 77.07  ?  119 ARG A NH2 1 
ATOM   922  N  N   . ASP A 1 123 ? 29.329 11.659 50.989  1.00 61.70  ?  120 ASP A N   1 
ATOM   923  C  CA  . ASP A 1 123 ? 28.130 12.433 51.284  1.00 63.31  ?  120 ASP A CA  1 
ATOM   924  C  C   . ASP A 1 123 ? 26.869 11.579 51.158  1.00 66.85  ?  120 ASP A C   1 
ATOM   925  O  O   . ASP A 1 123 ? 25.980 11.618 52.032  1.00 63.69  ?  120 ASP A O   1 
ATOM   926  C  CB  . ASP A 1 123 ? 28.040 13.650 50.365  1.00 66.03  ?  120 ASP A CB  1 
ATOM   927  C  CG  . ASP A 1 123 ? 29.143 14.663 50.627  1.00 72.21  ?  120 ASP A CG  1 
ATOM   928  O  OD1 . ASP A 1 123 ? 29.873 14.511 51.626  1.00 74.98  ?  120 ASP A OD1 1 
ATOM   929  O  OD2 . ASP A 1 123 ? 29.280 15.619 49.837  1.00 76.94  ?  120 ASP A OD2 1 
ATOM   930  N  N   . SER A 1 124 ? 26.805 10.783 50.093  1.00 60.42  ?  121 SER A N   1 
ATOM   931  C  CA  . SER A 1 124 ? 25.607 9.993  49.823  1.00 70.70  ?  121 SER A CA  1 
ATOM   932  C  C   . SER A 1 124 ? 25.359 8.913  50.875  1.00 77.71  ?  121 SER A C   1 
ATOM   933  O  O   . SER A 1 124 ? 24.212 8.584  51.168  1.00 83.83  ?  121 SER A O   1 
ATOM   934  C  CB  . SER A 1 124 ? 25.681 9.347  48.441  1.00 70.38  ?  121 SER A CB  1 
ATOM   935  O  OG  . SER A 1 124 ? 24.506 8.591  48.202  1.00 70.66  ?  121 SER A OG  1 
ATOM   936  N  N   . THR A 1 125 ? 26.427 8.360  51.436  1.00 78.02  ?  122 THR A N   1 
ATOM   937  C  CA  . THR A 1 125 ? 26.289 7.336  52.465  1.00 86.31  ?  122 THR A CA  1 
ATOM   938  C  C   . THR A 1 125 ? 26.017 7.950  53.841  1.00 85.10  ?  122 THR A C   1 
ATOM   939  O  O   . THR A 1 125 ? 25.367 7.333  54.687  1.00 93.55  ?  122 THR A O   1 
ATOM   940  C  CB  . THR A 1 125 ? 27.541 6.453  52.538  1.00 92.41  ?  122 THR A CB  1 
ATOM   941  O  OG1 . THR A 1 125 ? 28.671 7.261  52.879  1.00 93.67  ?  122 THR A OG1 1 
ATOM   942  C  CG2 . THR A 1 125 ? 27.793 5.787  51.193  1.00 91.76  ?  122 THR A CG2 1 
ATOM   943  N  N   . ASN A 1 126 ? 26.516 9.164  54.057  1.00 76.83  ?  123 ASN A N   1 
ATOM   944  C  CA  . ASN A 1 126 ? 26.266 9.902  55.297  1.00 77.14  ?  123 ASN A CA  1 
ATOM   945  C  C   . ASN A 1 126 ? 25.021 10.765 55.204  1.00 73.36  ?  123 ASN A C   1 
ATOM   946  O  O   . ASN A 1 126 ? 24.702 11.490 56.135  1.00 75.04  ?  123 ASN A O   1 
ATOM   947  C  CB  . ASN A 1 126 ? 27.458 10.791 55.658  1.00 75.17  ?  123 ASN A CB  1 
ATOM   948  C  CG  . ASN A 1 126 ? 28.675 9.999  56.070  1.00 78.21  ?  123 ASN A CG  1 
ATOM   949  O  OD1 . ASN A 1 126 ? 28.565 8.862  56.532  1.00 84.97  ?  123 ASN A OD1 1 
ATOM   950  N  ND2 . ASN A 1 126 ? 29.848 10.599 55.911  1.00 72.21  ?  123 ASN A ND2 1 
ATOM   951  N  N   . ARG A 1 127 ? 24.342 10.699 54.063  1.00 67.49  ?  124 ARG A N   1 
ATOM   952  C  CA  . ARG A 1 127 ? 23.121 11.462 53.839  1.00 66.16  ?  124 ARG A CA  1 
ATOM   953  C  C   . ARG A 1 127 ? 22.156 11.288 55.008  1.00 72.00  ?  124 ARG A C   1 
ATOM   954  O  O   . ARG A 1 127 ? 21.948 10.178 55.490  1.00 71.48  ?  124 ARG A O   1 
ATOM   955  C  CB  . ARG A 1 127 ? 22.466 11.021 52.537  1.00 70.31  ?  124 ARG A CB  1 
ATOM   956  C  CG  . ARG A 1 127 ? 21.167 11.712 52.209  1.00 73.36  ?  124 ARG A CG  1 
ATOM   957  C  CD  . ARG A 1 127 ? 20.680 11.293 50.830  1.00 79.22  ?  124 ARG A CD  1 
ATOM   958  N  NE  . ARG A 1 127 ? 19.368 11.849 50.528  1.00 83.46  ?  124 ARG A NE  1 
ATOM   959  C  CZ  . ARG A 1 127 ? 18.227 11.325 50.961  1.00 89.01  ?  124 ARG A CZ  1 
ATOM   960  N  NH1 . ARG A 1 127 ? 18.242 10.237 51.718  1.00 83.85  ?  124 ARG A NH1 1 
ATOM   961  N  NH2 . ARG A 1 127 ? 17.070 11.890 50.640  1.00 96.90  ?  124 ARG A NH2 1 
ATOM   962  N  N   . ALA A 1 128 ? 21.599 12.392 55.486  1.00 66.78  ?  125 ALA A N   1 
ATOM   963  C  CA  . ALA A 1 128 ? 20.596 12.328 56.538  1.00 64.91  ?  125 ALA A CA  1 
ATOM   964  C  C   . ALA A 1 128 ? 19.262 11.860 55.964  1.00 69.44  ?  125 ALA A C   1 
ATOM   965  O  O   . ALA A 1 128 ? 18.418 12.677 55.606  1.00 77.31  ?  125 ALA A O   1 
ATOM   966  C  CB  . ALA A 1 128 ? 20.447 13.683 57.208  1.00 64.15  ?  125 ALA A CB  1 
ATOM   967  N  N   . SER A 1 129 ? 19.074 10.547 55.869  1.00 68.38  ?  126 SER A N   1 
ATOM   968  C  CA  . SER A 1 129 ? 17.870 9.997  55.249  1.00 71.11  ?  126 SER A CA  1 
ATOM   969  C  C   . SER A 1 129 ? 16.624 10.127 56.129  1.00 70.61  ?  126 SER A C   1 
ATOM   970  O  O   . SER A 1 129 ? 15.502 10.206 55.622  1.00 71.10  ?  126 SER A O   1 
ATOM   971  C  CB  . SER A 1 129 ? 18.084 8.528  54.887  1.00 70.36  ?  126 SER A CB  1 
ATOM   972  O  OG  . SER A 1 129 ? 19.026 8.391  53.835  1.00 81.42  ?  126 SER A OG  1 
ATOM   973  N  N   . PHE A 1 130 ? 16.826 10.142 57.444  1.00 62.16  ?  127 PHE A N   1 
ATOM   974  C  CA  . PHE A 1 130 ? 15.718 10.173 58.399  1.00 64.19  ?  127 PHE A CA  1 
ATOM   975  C  C   . PHE A 1 130 ? 15.920 11.325 59.385  1.00 60.72  ?  127 PHE A C   1 
ATOM   976  O  O   . PHE A 1 130 ? 17.057 11.645 59.735  1.00 58.53  ?  127 PHE A O   1 
ATOM   977  C  CB  . PHE A 1 130 ? 15.624 8.832  59.139  1.00 69.91  ?  127 PHE A CB  1 
ATOM   978  C  CG  . PHE A 1 130 ? 15.210 7.676  58.263  1.00 82.20  ?  127 PHE A CG  1 
ATOM   979  C  CD1 . PHE A 1 130 ? 16.098 7.129  57.352  1.00 85.52  ?  127 PHE A CD1 1 
ATOM   980  C  CD2 . PHE A 1 130 ? 13.950 7.107  58.383  1.00 86.60  ?  127 PHE A CD2 1 
ATOM   981  C  CE1 . PHE A 1 130 ? 15.727 6.074  56.539  1.00 87.37  ?  127 PHE A CE1 1 
ATOM   982  C  CE2 . PHE A 1 130 ? 13.573 6.039  57.584  1.00 89.45  ?  127 PHE A CE2 1 
ATOM   983  C  CZ  . PHE A 1 130 ? 14.464 5.523  56.658  1.00 88.85  ?  127 PHE A CZ  1 
ATOM   984  N  N   . LYS A 1 131 ? 14.830 11.952 59.823  1.00 59.51  ?  128 LYS A N   1 
ATOM   985  C  CA  . LYS A 1 131 ? 14.916 13.069 60.771  1.00 58.83  ?  128 LYS A CA  1 
ATOM   986  C  C   . LYS A 1 131 ? 13.781 13.033 61.789  1.00 54.44  ?  128 LYS A C   1 
ATOM   987  O  O   . LYS A 1 131 ? 12.626 12.819 61.414  1.00 53.34  ?  128 LYS A O   1 
ATOM   988  C  CB  . LYS A 1 131 ? 14.899 14.403 60.017  1.00 61.72  ?  128 LYS A CB  1 
ATOM   989  C  CG  . LYS A 1 131 ? 15.048 15.622 60.912  1.00 59.90  ?  128 LYS A CG  1 
ATOM   990  C  CD  . LYS A 1 131 ? 15.187 16.892 60.086  1.00 61.96  ?  128 LYS A CD  1 
ATOM   991  C  CE  . LYS A 1 131 ? 15.741 18.019 60.942  1.00 70.91  ?  128 LYS A CE  1 
ATOM   992  N  NZ  . LYS A 1 131 ? 16.192 19.169 60.108  1.00 80.53  ?  128 LYS A NZ  1 
ATOM   993  N  N   . CYS A 1 132 ? 14.108 13.217 63.070  1.00 47.47  ?  129 CYS A N   1 
ATOM   994  C  CA  . CYS A 1 132 ? 13.091 13.291 64.105  1.00 49.06  ?  129 CYS A CA  1 
ATOM   995  C  C   . CYS A 1 132 ? 12.377 14.627 64.008  1.00 53.04  ?  129 CYS A C   1 
ATOM   996  O  O   . CYS A 1 132 ? 13.020 15.674 63.990  1.00 51.18  ?  129 CYS A O   1 
ATOM   997  C  CB  . CYS A 1 132 ? 13.695 13.120 65.505  1.00 44.34  ?  129 CYS A CB  1 
ATOM   998  S  SG  . CYS A 1 132 ? 12.468 13.275 66.835  1.00 51.41  ?  129 CYS A SG  1 
ATOM   999  N  N   . PRO A 1 133 ? 11.039 14.595 63.946  1.00 59.64  ?  130 PRO A N   1 
ATOM   1000 C  CA  . PRO A 1 133 ? 10.228 15.814 63.875  1.00 64.33  ?  130 PRO A CA  1 
ATOM   1001 C  C   . PRO A 1 133 ? 10.262 16.604 65.196  1.00 60.66  ?  130 PRO A C   1 
ATOM   1002 O  O   . PRO A 1 133 ? 9.861  17.769 65.212  1.00 65.44  ?  130 PRO A O   1 
ATOM   1003 C  CB  . PRO A 1 133 ? 8.808  15.290 63.602  1.00 64.81  ?  130 PRO A CB  1 
ATOM   1004 C  CG  . PRO A 1 133 ? 8.931  13.801 63.446  1.00 66.33  ?  130 PRO A CG  1 
ATOM   1005 C  CD  . PRO A 1 133 ? 10.204 13.394 64.102  1.00 62.59  ?  130 PRO A CD  1 
ATOM   1006 N  N   . VAL A 1 134 ? 10.728 15.983 66.277  1.00 54.11  ?  131 VAL A N   1 
ATOM   1007 C  CA  . VAL A 1 134 ? 10.792 16.675 67.570  1.00 48.96  ?  131 VAL A CA  1 
ATOM   1008 C  C   . VAL A 1 134 ? 12.181 17.252 67.850  1.00 50.73  ?  131 VAL A C   1 
ATOM   1009 O  O   . VAL A 1 134 ? 12.357 18.470 67.881  1.00 49.79  ?  131 VAL A O   1 
ATOM   1010 C  CB  . VAL A 1 134 ? 10.385 15.743 68.733  1.00 49.82  ?  131 VAL A CB  1 
ATOM   1011 C  CG1 . VAL A 1 134 ? 10.481 16.472 70.048  1.00 42.90  ?  131 VAL A CG1 1 
ATOM   1012 C  CG2 . VAL A 1 134 ? 8.963  15.229 68.530  1.00 50.64  ?  131 VAL A CG2 1 
ATOM   1013 N  N   . CYS A 1 135 ? 13.178 16.389 68.018  1.00 49.03  ?  132 CYS A N   1 
ATOM   1014 C  CA  . CYS A 1 135 ? 14.487 16.860 68.479  1.00 49.95  ?  132 CYS A CA  1 
ATOM   1015 C  C   . CYS A 1 135 ? 15.457 17.139 67.329  1.00 45.20  ?  132 CYS A C   1 
ATOM   1016 O  O   . CYS A 1 135 ? 16.568 17.628 67.550  1.00 42.70  ?  132 CYS A O   1 
ATOM   1017 C  CB  . CYS A 1 135 ? 15.091 15.849 69.472  1.00 50.76  ?  132 CYS A CB  1 
ATOM   1018 S  SG  . CYS A 1 135 ? 15.704 14.288 68.733  1.00 42.45  ?  132 CYS A SG  1 
ATOM   1019 N  N   . SER A 1 136 ? 15.016 16.842 66.103  1.00 43.69  ?  133 SER A N   1 
ATOM   1020 C  CA  . SER A 1 136 ? 15.730 17.182 64.860  1.00 45.35  ?  133 SER A CA  1 
ATOM   1021 C  C   . SER A 1 136 ? 16.999 16.366 64.648  1.00 48.77  ?  133 SER A C   1 
ATOM   1022 O  O   . SER A 1 136 ? 17.791 16.660 63.749  1.00 48.65  ?  133 SER A O   1 
ATOM   1023 C  CB  . SER A 1 136 ? 16.080 18.674 64.813  1.00 43.09  ?  133 SER A CB  1 
ATOM   1024 O  OG  . SER A 1 136 ? 14.914 19.464 64.930  1.00 46.71  ?  133 SER A OG  1 
ATOM   1025 N  N   . SER A 1 137 ? 17.197 15.346 65.475  1.00 50.46  ?  134 SER A N   1 
ATOM   1026 C  CA  . SER A 1 137 ? 18.260 14.385 65.232  1.00 43.99  ?  134 SER A CA  1 
ATOM   1027 C  C   . SER A 1 137 ? 18.059 13.744 63.866  1.00 47.72  ?  134 SER A C   1 
ATOM   1028 O  O   . SER A 1 137 ? 16.933 13.418 63.493  1.00 45.73  ?  134 SER A O   1 
ATOM   1029 C  CB  . SER A 1 137 ? 18.285 13.329 66.329  1.00 44.42  ?  134 SER A CB  1 
ATOM   1030 O  OG  . SER A 1 137 ? 18.740 13.912 67.548  1.00 45.90  ?  134 SER A OG  1 
ATOM   1031 N  N   . THR A 1 138 ? 19.146 13.578 63.122  1.00 51.47  ?  135 THR A N   1 
ATOM   1032 C  CA  . THR A 1 138 ? 19.083 12.912 61.829  1.00 55.32  ?  135 THR A CA  1 
ATOM   1033 C  C   . THR A 1 138 ? 19.860 11.602 61.856  1.00 55.28  ?  135 THR A C   1 
ATOM   1034 O  O   . THR A 1 138 ? 20.781 11.427 62.658  1.00 53.69  ?  135 THR A O   1 
ATOM   1035 C  CB  . THR A 1 138 ? 19.624 13.807 60.679  1.00 54.97  ?  135 THR A CB  1 
ATOM   1036 O  OG1 . THR A 1 138 ? 21.004 14.120 60.901  1.00 50.41  ?  135 THR A OG1 1 
ATOM   1037 C  CG2 . THR A 1 138 ? 18.809 15.094 60.557  1.00 54.26  ?  135 THR A CG2 1 
ATOM   1038 N  N   . PHE A 1 139 ? 19.473 10.687 60.973  1.00 54.75  ?  136 PHE A N   1 
ATOM   1039 C  CA  . PHE A 1 139 ? 20.059 9.353  60.910  1.00 55.43  ?  136 PHE A CA  1 
ATOM   1040 C  C   . PHE A 1 139 ? 20.297 8.931  59.465  1.00 58.60  ?  136 PHE A C   1 
ATOM   1041 O  O   . PHE A 1 139 ? 19.497 9.247  58.592  1.00 59.34  ?  136 PHE A O   1 
ATOM   1042 C  CB  . PHE A 1 139 ? 19.146 8.326  61.591  1.00 58.02  ?  136 PHE A CB  1 
ATOM   1043 C  CG  . PHE A 1 139 ? 18.706 8.724  62.970  1.00 53.58  ?  136 PHE A CG  1 
ATOM   1044 C  CD1 . PHE A 1 139 ? 19.532 8.507  64.064  1.00 53.21  ?  136 PHE A CD1 1 
ATOM   1045 C  CD2 . PHE A 1 139 ? 17.474 9.315  63.174  1.00 51.93  ?  136 PHE A CD2 1 
ATOM   1046 C  CE1 . PHE A 1 139 ? 19.132 8.877  65.361  1.00 51.32  ?  136 PHE A CE1 1 
ATOM   1047 C  CE2 . PHE A 1 139 ? 17.066 9.694  64.470  1.00 56.30  ?  136 PHE A CE2 1 
ATOM   1048 C  CZ  . PHE A 1 139 ? 17.898 9.471  65.555  1.00 49.63  ?  136 PHE A CZ  1 
ATOM   1049 N  N   . THR A 1 140 ? 21.392 8.209  59.235  1.00 60.93  ?  137 THR A N   1 
ATOM   1050 C  CA  . THR A 1 140 ? 21.708 7.649  57.929  1.00 66.66  ?  137 THR A CA  1 
ATOM   1051 C  C   . THR A 1 140 ? 20.945 6.347  57.759  1.00 71.81  ?  137 THR A C   1 
ATOM   1052 O  O   . THR A 1 140 ? 20.449 5.791  58.737  1.00 77.21  ?  137 THR A O   1 
ATOM   1053 C  CB  . THR A 1 140 ? 23.217 7.382  57.768  1.00 71.22  ?  137 THR A CB  1 
ATOM   1054 O  OG1 . THR A 1 140 ? 23.587 6.216  58.515  1.00 76.86  ?  137 THR A OG1 1 
ATOM   1055 C  CG2 . THR A 1 140 ? 24.024 8.572  58.260  1.00 63.15  ?  137 THR A CG2 1 
ATOM   1056 N  N   . ASP A 1 141 ? 20.853 5.868  56.525  1.00 72.71  ?  138 ASP A N   1 
ATOM   1057 C  CA  . ASP A 1 141 ? 20.167 4.614  56.208  1.00 85.86  ?  138 ASP A CA  1 
ATOM   1058 C  C   . ASP A 1 141 ? 20.689 3.441  57.034  1.00 92.07  ?  138 ASP A C   1 
ATOM   1059 O  O   . ASP A 1 141 ? 19.928 2.551  57.418  1.00 96.30  ?  138 ASP A O   1 
ATOM   1060 C  CB  . ASP A 1 141 ? 20.307 4.286  54.714  1.00 93.86  ?  138 ASP A CB  1 
ATOM   1061 C  CG  . ASP A 1 141 ? 19.391 5.124  53.841  1.00 100.65 ?  138 ASP A CG  1 
ATOM   1062 O  OD1 . ASP A 1 141 ? 18.194 4.787  53.732  1.00 104.37 ?  138 ASP A OD1 1 
ATOM   1063 O  OD2 . ASP A 1 141 ? 19.867 6.120  53.259  1.00 103.06 ?  138 ASP A OD2 1 
ATOM   1064 N  N   . LEU A 1 142 ? 21.992 3.442  57.291  1.00 93.95  ?  139 LEU A N   1 
ATOM   1065 C  CA  . LEU A 1 142 ? 22.615 2.419  58.118  1.00 97.46  ?  139 LEU A CA  1 
ATOM   1066 C  C   . LEU A 1 142 ? 22.136 2.538  59.561  1.00 95.37  ?  139 LEU A C   1 
ATOM   1067 O  O   . LEU A 1 142 ? 21.829 1.535  60.206  1.00 100.97 ?  139 LEU A O   1 
ATOM   1068 C  CB  . LEU A 1 142 ? 24.141 2.527  58.043  1.00 97.78  ?  139 LEU A CB  1 
ATOM   1069 C  CG  . LEU A 1 142 ? 24.962 1.719  59.051  1.00 99.87  ?  139 LEU A CG  1 
ATOM   1070 C  CD1 . LEU A 1 142 ? 26.210 1.166  58.388  1.00 100.28 ?  139 LEU A CD1 1 
ATOM   1071 C  CD2 . LEU A 1 142 ? 25.337 2.566  60.271  1.00 97.67  ?  139 LEU A CD2 1 
ATOM   1072 N  N   . GLU A 1 143 ? 22.084 3.769  60.063  1.00 89.43  ?  140 GLU A N   1 
ATOM   1073 C  CA  . GLU A 1 143 ? 21.607 4.029  61.420  1.00 84.86  ?  140 GLU A CA  1 
ATOM   1074 C  C   . GLU A 1 143 ? 20.113 3.723  61.548  1.00 93.08  ?  140 GLU A C   1 
ATOM   1075 O  O   . GLU A 1 143 ? 19.641 3.303  62.607  1.00 91.60  ?  140 GLU A O   1 
ATOM   1076 C  CB  . GLU A 1 143 ? 21.881 5.485  61.819  1.00 74.49  ?  140 GLU A CB  1 
ATOM   1077 C  CG  . GLU A 1 143 ? 23.355 5.839  61.978  1.00 73.68  ?  140 GLU A CG  1 
ATOM   1078 C  CD  . GLU A 1 143 ? 23.588 7.321  62.244  1.00 73.53  ?  140 GLU A CD  1 
ATOM   1079 O  OE1 . GLU A 1 143 ? 22.636 8.116  62.097  1.00 67.61  ?  140 GLU A OE1 1 
ATOM   1080 O  OE2 . GLU A 1 143 ? 24.729 7.694  62.597  1.00 76.16  ?  140 GLU A OE2 1 
ATOM   1081 N  N   . ALA A 1 144 ? 19.387 3.918  60.449  1.00 98.65  ?  141 ALA A N   1 
ATOM   1082 C  CA  . ALA A 1 144 ? 17.923 3.875  60.441  1.00 98.84  ?  141 ALA A CA  1 
ATOM   1083 C  C   . ALA A 1 144 ? 17.339 2.515  60.810  1.00 97.09  ?  141 ALA A C   1 
ATOM   1084 O  O   . ALA A 1 144 ? 16.336 2.442  61.516  1.00 92.88  ?  141 ALA A O   1 
ATOM   1085 C  CB  . ALA A 1 144 ? 17.400 4.301  59.077  1.00 102.23 ?  141 ALA A CB  1 
ATOM   1086 N  N   . ASN A 1 145 ? 17.951 1.440  60.326  1.00 97.20  ?  142 ASN A N   1 
ATOM   1087 C  CA  . ASN A 1 145 ? 17.402 0.111  60.569  1.00 102.26 ?  142 ASN A CA  1 
ATOM   1088 C  C   . ASN A 1 145 ? 17.464 -0.316 62.034  1.00 102.03 ?  142 ASN A C   1 
ATOM   1089 O  O   . ASN A 1 145 ? 16.616 -1.083 62.495  1.00 104.21 ?  142 ASN A O   1 
ATOM   1090 C  CB  . ASN A 1 145 ? 18.107 -0.912 59.687  1.00 111.26 ?  142 ASN A CB  1 
ATOM   1091 C  CG  . ASN A 1 145 ? 18.032 -0.552 58.221  1.00 116.98 ?  142 ASN A CG  1 
ATOM   1092 O  OD1 . ASN A 1 145 ? 16.953 -0.272 57.695  1.00 117.36 ?  142 ASN A OD1 1 
ATOM   1093 N  ND2 . ASN A 1 145 ? 19.178 -0.554 57.549  1.00 120.76 ?  142 ASN A ND2 1 
ATOM   1094 N  N   . GLN A 1 146 ? 18.447 0.198  62.769  1.00 100.68 ?  143 GLN A N   1 
ATOM   1095 C  CA  . GLN A 1 146 ? 18.517 -0.058 64.203  1.00 98.10  ?  143 GLN A CA  1 
ATOM   1096 C  C   . GLN A 1 146 ? 17.697 0.967  64.981  1.00 91.07  ?  143 GLN A C   1 
ATOM   1097 O  O   . GLN A 1 146 ? 17.939 1.213  66.161  1.00 87.92  ?  143 GLN A O   1 
ATOM   1098 C  CB  . GLN A 1 146 ? 19.967 -0.070 64.676  1.00 101.10 ?  143 GLN A CB  1 
ATOM   1099 C  CG  . GLN A 1 146 ? 20.755 -1.244 64.113  1.00 113.24 ?  143 GLN A CG  1 
ATOM   1100 C  CD  . GLN A 1 146 ? 21.889 -1.684 65.022  1.00 121.04 ?  143 GLN A CD  1 
ATOM   1101 O  OE1 . GLN A 1 146 ? 22.235 -0.997 65.984  1.00 121.63 ?  143 GLN A OE1 1 
ATOM   1102 N  NE2 . GLN A 1 146 ? 22.459 -2.848 64.731  1.00 127.69 ?  143 GLN A NE2 1 
ATOM   1103 N  N   . LEU A 1 147 ? 16.716 1.551  64.299  1.00 88.78  ?  144 LEU A N   1 
ATOM   1104 C  CA  . LEU A 1 147 ? 15.736 2.439  64.910  1.00 77.70  ?  144 LEU A CA  1 
ATOM   1105 C  C   . LEU A 1 147 ? 14.364 1.791  64.886  1.00 79.36  ?  144 LEU A C   1 
ATOM   1106 O  O   . LEU A 1 147 ? 13.427 2.285  65.506  1.00 75.84  ?  144 LEU A O   1 
ATOM   1107 C  CB  . LEU A 1 147 ? 15.682 3.780  64.180  1.00 72.30  ?  144 LEU A CB  1 
ATOM   1108 C  CG  . LEU A 1 147 ? 16.888 4.696  64.338  1.00 71.75  ?  144 LEU A CG  1 
ATOM   1109 C  CD1 . LEU A 1 147 ? 16.820 5.827  63.339  1.00 72.99  ?  144 LEU A CD1 1 
ATOM   1110 C  CD2 . LEU A 1 147 ? 16.900 5.241  65.734  1.00 68.20  ?  144 LEU A CD2 1 
ATOM   1111 N  N   . PHE A 1 148 ? 14.253 0.690  64.146  1.00 78.40  ?  145 PHE A N   1 
ATOM   1112 C  CA  . PHE A 1 148 ? 12.996 -0.040 64.007  1.00 83.22  ?  145 PHE A CA  1 
ATOM   1113 C  C   . PHE A 1 148 ? 12.495 -0.597 65.340  1.00 91.21  ?  145 PHE A C   1 
ATOM   1114 O  O   . PHE A 1 148 ? 13.253 -1.206 66.095  1.00 92.91  ?  145 PHE A O   1 
ATOM   1115 C  CB  . PHE A 1 148 ? 13.165 -1.175 62.997  1.00 82.95  ?  145 PHE A CB  1 
ATOM   1116 C  CG  . PHE A 1 148 ? 11.884 -1.873 62.650  1.00 86.49  ?  145 PHE A CG  1 
ATOM   1117 C  CD1 . PHE A 1 148 ? 11.047 -1.364 61.670  1.00 83.04  ?  145 PHE A CD1 1 
ATOM   1118 C  CD2 . PHE A 1 148 ? 11.512 -3.036 63.308  1.00 88.97  ?  145 PHE A CD2 1 
ATOM   1119 C  CE1 . PHE A 1 148 ? 9.864  -2.006 61.352  1.00 91.62  ?  145 PHE A CE1 1 
ATOM   1120 C  CE2 . PHE A 1 148 ? 10.333 -3.682 62.994  1.00 94.35  ?  145 PHE A CE2 1 
ATOM   1121 C  CZ  . PHE A 1 148 ? 9.508  -3.168 62.015  1.00 96.65  ?  145 PHE A CZ  1 
ATOM   1122 N  N   . ASP A 1 149 ? 11.214 -0.381 65.623  1.00 96.96  ?  146 ASP A N   1 
ATOM   1123 C  CA  . ASP A 1 149 ? 10.592 -0.899 66.838  1.00 104.67 ?  146 ASP A CA  1 
ATOM   1124 C  C   . ASP A 1 149 ? 9.582  -1.982 66.484  1.00 115.73 ?  146 ASP A C   1 
ATOM   1125 O  O   . ASP A 1 149 ? 8.492  -1.678 66.003  1.00 121.13 ?  146 ASP A O   1 
ATOM   1126 C  CB  . ASP A 1 149 ? 9.906  0.226  67.622  1.00 105.11 ?  146 ASP A CB  1 
ATOM   1127 C  CG  . ASP A 1 149 ? 9.307  -0.251 68.941  1.00 112.92 ?  146 ASP A CG  1 
ATOM   1128 O  OD1 . ASP A 1 149 ? 8.200  -0.830 68.927  1.00 117.08 ?  146 ASP A OD1 1 
ATOM   1129 O  OD2 . ASP A 1 149 ? 9.934  -0.026 69.998  1.00 115.21 ?  146 ASP A OD2 1 
ATOM   1130 N  N   . PRO A 1 150 ? 9.937  -3.252 66.729  1.00 118.39 ?  147 PRO A N   1 
ATOM   1131 C  CA  . PRO A 1 150 ? 9.073  -4.390 66.383  1.00 121.81 ?  147 PRO A CA  1 
ATOM   1132 C  C   . PRO A 1 150 ? 7.740  -4.384 67.132  1.00 121.89 ?  147 PRO A C   1 
ATOM   1133 O  O   . PRO A 1 150 ? 6.794  -5.048 66.706  1.00 124.88 ?  147 PRO A O   1 
ATOM   1134 C  CB  . PRO A 1 150 ? 9.916  -5.606 66.788  1.00 124.77 ?  147 PRO A CB  1 
ATOM   1135 C  CG  . PRO A 1 150 ? 10.848 -5.087 67.833  1.00 123.04 ?  147 PRO A CG  1 
ATOM   1136 C  CD  . PRO A 1 150 ? 11.170 -3.682 67.411  1.00 116.96 ?  147 PRO A CD  1 
ATOM   1137 N  N   . MET A 1 151 ? 7.671  -3.635 68.229  1.00 119.16 ?  148 MET A N   1 
ATOM   1138 C  CA  . MET A 1 151 ? 6.469  -3.588 69.054  1.00 125.42 ?  148 MET A CA  1 
ATOM   1139 C  C   . MET A 1 151 ? 5.439  -2.608 68.500  1.00 125.02 ?  148 MET A C   1 
ATOM   1140 O  O   . MET A 1 151 ? 4.239  -2.753 68.736  1.00 129.94 ?  148 MET A O   1 
ATOM   1141 C  CB  . MET A 1 151 ? 6.834  -3.219 70.492  1.00 126.61 ?  148 MET A CB  1 
ATOM   1142 C  CG  . MET A 1 151 ? 7.959  -4.066 71.060  1.00 128.84 ?  148 MET A CG  1 
ATOM   1143 S  SD  . MET A 1 151 ? 7.629  -5.831 70.887  1.00 163.99 ?  148 MET A SD  1 
ATOM   1144 C  CE  . MET A 1 151 ? 9.294  -6.493 70.901  1.00 129.13 ?  148 MET A CE  1 
ATOM   1145 N  N   . THR A 1 152 ? 5.916  -1.608 67.766  1.00 119.18 ?  149 THR A N   1 
ATOM   1146 C  CA  . THR A 1 152 ? 5.031  -0.651 67.112  1.00 116.90 ?  149 THR A CA  1 
ATOM   1147 C  C   . THR A 1 152 ? 5.068  -0.855 65.601  1.00 108.51 ?  149 THR A C   1 
ATOM   1148 O  O   . THR A 1 152 ? 4.129  -0.497 64.888  1.00 106.68 ?  149 THR A O   1 
ATOM   1149 C  CB  . THR A 1 152 ? 5.417  0.801  67.442  1.00 114.72 ?  149 THR A CB  1 
ATOM   1150 O  OG1 . THR A 1 152 ? 6.706  1.094  66.885  1.00 110.11 ?  149 THR A OG1 1 
ATOM   1151 C  CG2 . THR A 1 152 ? 5.455  1.014  68.950  1.00 114.96 ?  149 THR A CG2 1 
ATOM   1152 N  N   . GLY A 1 153 ? 6.162  -1.438 65.125  1.00 104.13 ?  150 GLY A N   1 
ATOM   1153 C  CA  . GLY A 1 153 ? 6.341  -1.691 63.708  1.00 103.85 ?  150 GLY A CA  1 
ATOM   1154 C  C   . GLY A 1 153 ? 6.928  -0.507 62.964  1.00 102.58 ?  150 GLY A C   1 
ATOM   1155 O  O   . GLY A 1 153 ? 6.932  -0.489 61.733  1.00 102.91 ?  150 GLY A O   1 
ATOM   1156 N  N   . THR A 1 154 ? 7.434  0.483  63.698  1.00 99.58  ?  151 THR A N   1 
ATOM   1157 C  CA  . THR A 1 154 ? 7.927  1.700  63.066  1.00 95.44  ?  151 THR A CA  1 
ATOM   1158 C  C   . THR A 1 154 ? 9.334  2.093  63.526  1.00 86.05  ?  151 THR A C   1 
ATOM   1159 O  O   . THR A 1 154 ? 9.846  1.571  64.516  1.00 86.23  ?  151 THR A O   1 
ATOM   1160 C  CB  . THR A 1 154 ? 6.971  2.881  63.323  1.00 101.04 ?  151 THR A CB  1 
ATOM   1161 O  OG1 . THR A 1 154 ? 7.326  3.977  62.471  1.00 102.45 ?  151 THR A OG1 1 
ATOM   1162 C  CG2 . THR A 1 154 ? 7.042  3.324  64.774  1.00 99.93  ?  151 THR A CG2 1 
ATOM   1163 N  N   . PHE A 1 155 ? 9.955  3.008  62.784  1.00 78.83  ?  152 PHE A N   1 
ATOM   1164 C  CA  . PHE A 1 155 ? 11.273 3.520  63.138  1.00 80.90  ?  152 PHE A CA  1 
ATOM   1165 C  C   . PHE A 1 155 ? 11.147 4.700  64.115  1.00 82.65  ?  152 PHE A C   1 
ATOM   1166 O  O   . PHE A 1 155 ? 10.431 5.671  63.850  1.00 81.42  ?  152 PHE A O   1 
ATOM   1167 C  CB  . PHE A 1 155 ? 12.043 3.941  61.884  1.00 78.56  ?  152 PHE A CB  1 
ATOM   1168 C  CG  . PHE A 1 155 ? 12.307 2.813  60.927  1.00 90.41  ?  152 PHE A CG  1 
ATOM   1169 C  CD1 . PHE A 1 155 ? 13.375 1.953  61.124  1.00 93.37  ?  152 PHE A CD1 1 
ATOM   1170 C  CD2 . PHE A 1 155 ? 11.485 2.609  59.828  1.00 96.68  ?  152 PHE A CD2 1 
ATOM   1171 C  CE1 . PHE A 1 155 ? 13.617 0.912  60.240  1.00 96.31  ?  152 PHE A CE1 1 
ATOM   1172 C  CE2 . PHE A 1 155 ? 11.723 1.571  58.944  1.00 97.70  ?  152 PHE A CE2 1 
ATOM   1173 C  CZ  . PHE A 1 155 ? 12.788 0.723  59.151  1.00 96.95  ?  152 PHE A CZ  1 
ATOM   1174 N  N   . ARG A 1 156 ? 11.846 4.604  65.244  1.00 77.44  ?  153 ARG A N   1 
ATOM   1175 C  CA  . ARG A 1 156 ? 11.710 5.585  66.317  1.00 73.10  ?  153 ARG A CA  1 
ATOM   1176 C  C   . ARG A 1 156 ? 13.071 6.124  66.746  1.00 65.55  ?  153 ARG A C   1 
ATOM   1177 O  O   . ARG A 1 156 ? 14.020 5.363  66.923  1.00 69.01  ?  153 ARG A O   1 
ATOM   1178 C  CB  . ARG A 1 156 ? 10.966 4.968  67.512  1.00 75.50  ?  153 ARG A CB  1 
ATOM   1179 C  CG  . ARG A 1 156 ? 9.515  4.585  67.197  1.00 80.25  ?  153 ARG A CG  1 
ATOM   1180 C  CD  . ARG A 1 156 ? 8.909  3.668  68.250  1.00 81.98  ?  153 ARG A CD  1 
ATOM   1181 N  NE  . ARG A 1 156 ? 8.724  4.344  69.525  1.00 82.41  ?  153 ARG A NE  1 
ATOM   1182 C  CZ  . ARG A 1 156 ? 8.227  3.763  70.613  1.00 95.65  ?  153 ARG A CZ  1 
ATOM   1183 N  NH1 . ARG A 1 156 ? 7.863  2.487  70.579  1.00 102.84 1  153 ARG A NH1 1 
ATOM   1184 N  NH2 . ARG A 1 156 ? 8.091  4.458  71.737  1.00 95.71  ?  153 ARG A NH2 1 
ATOM   1185 N  N   . CYS A 1 157 ? 13.139 7.446  66.902  1.00 56.22  ?  154 CYS A N   1 
ATOM   1186 C  CA  . CYS A 1 157 ? 14.358 8.174  67.272  1.00 53.21  ?  154 CYS A CA  1 
ATOM   1187 C  C   . CYS A 1 157 ? 15.084 7.553  68.470  1.00 57.85  ?  154 CYS A C   1 
ATOM   1188 O  O   . CYS A 1 157 ? 14.451 7.167  69.438  1.00 53.37  ?  154 CYS A O   1 
ATOM   1189 C  CB  . CYS A 1 157 ? 13.996 9.630  67.569  1.00 50.35  ?  154 CYS A CB  1 
ATOM   1190 S  SG  . CYS A 1 157 ? 15.309 10.628 68.288  1.00 52.70  ?  154 CYS A SG  1 
ATOM   1191 N  N   . THR A 1 158 ? 16.407 7.432  68.401  1.00 59.42  ?  155 THR A N   1 
ATOM   1192 C  CA  . THR A 1 158 ? 17.149 6.813  69.501  1.00 58.78  ?  155 THR A CA  1 
ATOM   1193 C  C   . THR A 1 158 ? 17.148 7.675  70.747  1.00 59.32  ?  155 THR A C   1 
ATOM   1194 O  O   . THR A 1 158 ? 17.462 7.190  71.831  1.00 62.18  ?  155 THR A O   1 
ATOM   1195 C  CB  . THR A 1 158 ? 18.616 6.527  69.141  1.00 63.11  ?  155 THR A CB  1 
ATOM   1196 O  OG1 . THR A 1 158 ? 19.063 7.479  68.174  1.00 66.36  ?  155 THR A OG1 1 
ATOM   1197 C  CG2 . THR A 1 158 ? 18.783 5.134  68.595  1.00 70.74  ?  155 THR A CG2 1 
ATOM   1198 N  N   . PHE A 1 159 ? 16.813 8.951  70.602  1.00 54.69  ?  156 PHE A N   1 
ATOM   1199 C  CA  . PHE A 1 159 ? 16.862 9.847  71.744  1.00 57.01  ?  156 PHE A CA  1 
ATOM   1200 C  C   . PHE A 1 159 ? 15.490 10.082 72.364  1.00 62.09  ?  156 PHE A C   1 
ATOM   1201 O  O   . PHE A 1 159 ? 15.301 9.824  73.549  1.00 62.72  ?  156 PHE A O   1 
ATOM   1202 C  CB  . PHE A 1 159 ? 17.507 11.173 71.343  1.00 51.11  ?  156 PHE A CB  1 
ATOM   1203 C  CG  . PHE A 1 159 ? 18.892 11.010 70.804  1.00 49.14  ?  156 PHE A CG  1 
ATOM   1204 C  CD1 . PHE A 1 159 ? 19.932 10.628 71.639  1.00 51.74  ?  156 PHE A CD1 1 
ATOM   1205 C  CD2 . PHE A 1 159 ? 19.149 11.182 69.456  1.00 49.48  ?  156 PHE A CD2 1 
ATOM   1206 C  CE1 . PHE A 1 159 ? 21.214 10.455 71.145  1.00 52.14  ?  156 PHE A CE1 1 
ATOM   1207 C  CE2 . PHE A 1 159 ? 20.427 10.995 68.945  1.00 48.03  ?  156 PHE A CE2 1 
ATOM   1208 C  CZ  . PHE A 1 159 ? 21.460 10.638 69.787  1.00 54.70  ?  156 PHE A CZ  1 
ATOM   1209 N  N   . CYS A 1 160 ? 14.524 10.549 71.581  1.00 58.52  ?  157 CYS A N   1 
ATOM   1210 C  CA  . CYS A 1 160 ? 13.238 10.888 72.170  1.00 56.11  ?  157 CYS A CA  1 
ATOM   1211 C  C   . CYS A 1 160 ? 12.150 9.874  71.823  1.00 62.00  ?  157 CYS A C   1 
ATOM   1212 O  O   . CYS A 1 160 ? 11.034 9.980  72.317  1.00 59.86  ?  157 CYS A O   1 
ATOM   1213 C  CB  . CYS A 1 160 ? 12.823 12.292 71.741  1.00 51.45  ?  157 CYS A CB  1 
ATOM   1214 S  SG  . CYS A 1 160 ? 12.237 12.428 70.053  1.00 53.56  ?  157 CYS A SG  1 
ATOM   1215 N  N   . HIS A 1 161 ? 12.491 8.900  70.975  1.00 68.48  ?  158 HIS A N   1 
ATOM   1216 C  CA  . HIS A 1 161 ? 11.612 7.777  70.605  1.00 76.27  ?  158 HIS A CA  1 
ATOM   1217 C  C   . HIS A 1 161 ? 10.384 8.179  69.776  1.00 69.47  ?  158 HIS A C   1 
ATOM   1218 O  O   . HIS A 1 161 ? 9.466  7.378  69.587  1.00 70.74  ?  158 HIS A O   1 
ATOM   1219 C  CB  . HIS A 1 161 ? 11.155 7.016  71.857  1.00 92.12  ?  158 HIS A CB  1 
ATOM   1220 C  CG  . HIS A 1 161 ? 12.276 6.610  72.763  1.00 101.83 ?  158 HIS A CG  1 
ATOM   1221 N  ND1 . HIS A 1 161 ? 13.131 5.567  72.470  1.00 106.52 ?  158 HIS A ND1 1 
ATOM   1222 C  CD2 . HIS A 1 161 ? 12.675 7.096  73.963  1.00 104.07 ?  158 HIS A CD2 1 
ATOM   1223 C  CE1 . HIS A 1 161 ? 14.012 5.436  73.445  1.00 108.05 ?  158 HIS A CE1 1 
ATOM   1224 N  NE2 . HIS A 1 161 ? 13.757 6.351  74.365  1.00 106.08 ?  158 HIS A NE2 1 
ATOM   1225 N  N   . THR A 1 162 ? 10.377 9.416  69.289  1.00 62.55  ?  159 THR A N   1 
ATOM   1226 C  CA  . THR A 1 162 ? 9.371  9.895  68.339  1.00 59.33  ?  159 THR A CA  1 
ATOM   1227 C  C   . THR A 1 162 ? 9.549  9.247  66.956  1.00 63.33  ?  159 THR A C   1 
ATOM   1228 O  O   . THR A 1 162 ? 10.675 9.022  66.497  1.00 56.28  ?  159 THR A O   1 
ATOM   1229 C  CB  . THR A 1 162 ? 9.446  11.433 68.194  1.00 60.39  ?  159 THR A CB  1 
ATOM   1230 O  OG1 . THR A 1 162 ? 9.041  12.055 69.420  1.00 57.61  ?  159 THR A OG1 1 
ATOM   1231 C  CG2 . THR A 1 162 ? 8.575  11.942 67.040  1.00 57.61  ?  159 THR A CG2 1 
ATOM   1232 N  N   . GLU A 1 163 ? 8.436  8.955  66.292  1.00 64.23  ?  160 GLU A N   1 
ATOM   1233 C  CA  . GLU A 1 163 ? 8.481  8.334  64.981  1.00 68.22  ?  160 GLU A CA  1 
ATOM   1234 C  C   . GLU A 1 163 ? 9.176  9.246  63.971  1.00 62.54  ?  160 GLU A C   1 
ATOM   1235 O  O   . GLU A 1 163 ? 8.773  10.387 63.758  1.00 60.24  ?  160 GLU A O   1 
ATOM   1236 C  CB  . GLU A 1 163 ? 7.077  7.990  64.510  1.00 68.31  ?  160 GLU A CB  1 
ATOM   1237 C  CG  . GLU A 1 163 ? 7.066  7.040  63.346  1.00 83.76  ?  160 GLU A CG  1 
ATOM   1238 C  CD  . GLU A 1 163 ? 5.699  6.462  63.102  1.00 95.24  ?  160 GLU A CD  1 
ATOM   1239 O  OE1 . GLU A 1 163 ? 5.279  6.401  61.927  1.00 99.74  ?  160 GLU A OE1 1 
ATOM   1240 O  OE2 . GLU A 1 163 ? 5.047  6.072  64.094  1.00 102.38 -1 160 GLU A OE2 1 
ATOM   1241 N  N   . VAL A 1 164 ? 10.227 8.720  63.358  1.00 64.79  ?  161 VAL A N   1 
ATOM   1242 C  CA  . VAL A 1 164 ? 11.083 9.481  62.452  1.00 67.22  ?  161 VAL A CA  1 
ATOM   1243 C  C   . VAL A 1 164 ? 10.466 9.590  61.047  1.00 69.59  ?  161 VAL A C   1 
ATOM   1244 O  O   . VAL A 1 164 ? 9.595  8.793  60.688  1.00 60.80  ?  161 VAL A O   1 
ATOM   1245 C  CB  . VAL A 1 164 ? 12.472 8.821  62.384  1.00 73.60  ?  161 VAL A CB  1 
ATOM   1246 C  CG1 . VAL A 1 164 ? 13.436 9.678  61.646  1.00 79.41  ?  161 VAL A CG1 1 
ATOM   1247 C  CG2 . VAL A 1 164 ? 12.998 8.577  63.793  1.00 71.04  ?  161 VAL A CG2 1 
ATOM   1248 N  N   . GLU A 1 165 ? 10.894 10.591 60.273  1.00 65.37  ?  162 GLU A N   1 
ATOM   1249 C  CA  . GLU A 1 165 ? 10.375 10.810 58.918  1.00 77.33  ?  162 GLU A CA  1 
ATOM   1250 C  C   . GLU A 1 165 ? 11.468 10.800 57.849  1.00 79.51  ?  162 GLU A C   1 
ATOM   1251 O  O   . GLU A 1 165 ? 12.619 11.172 58.110  1.00 68.56  ?  162 GLU A O   1 
ATOM   1252 C  CB  . GLU A 1 165 ? 9.626  12.141 58.826  1.00 80.27  ?  162 GLU A CB  1 
ATOM   1253 C  CG  . GLU A 1 165 ? 8.535  12.343 59.852  1.00 86.42  ?  162 GLU A CG  1 
ATOM   1254 C  CD  . GLU A 1 165 ? 8.121  13.802 59.972  1.00 89.23  ?  162 GLU A CD  1 
ATOM   1255 O  OE1 . GLU A 1 165 ? 8.797  14.666 59.372  1.00 80.61  ?  162 GLU A OE1 1 
ATOM   1256 O  OE2 . GLU A 1 165 ? 7.123  14.085 60.671  1.00 98.33  -1 162 GLU A OE2 1 
ATOM   1257 N  N   . GLU A 1 166 ? 11.088 10.395 56.640  1.00 90.17  ?  163 GLU A N   1 
ATOM   1258 C  CA  . GLU A 1 166 ? 11.982 10.446 55.496  1.00 100.02 ?  163 GLU A CA  1 
ATOM   1259 C  C   . GLU A 1 166 ? 12.337 11.876 55.091  1.00 106.82 ?  163 GLU A C   1 
ATOM   1260 O  O   . GLU A 1 166 ? 11.524 12.794 55.241  1.00 112.04 ?  163 GLU A O   1 
ATOM   1261 C  CB  . GLU A 1 166 ? 11.343 9.761  54.303  1.00 111.50 ?  163 GLU A CB  1 
ATOM   1262 C  CG  . GLU A 1 166 ? 12.286 8.927  53.476  1.00 121.30 ?  163 GLU A CG  1 
ATOM   1263 C  CD  . GLU A 1 166 ? 12.813 7.717  54.206  1.00 128.67 ?  163 GLU A CD  1 
ATOM   1264 O  OE1 . GLU A 1 166 ? 12.208 7.311  55.215  1.00 131.08 ?  163 GLU A OE1 1 
ATOM   1265 O  OE2 . GLU A 1 166 ? 13.835 7.171  53.756  1.00 131.71 -1 163 GLU A OE2 1 
ATOM   1266 N  N   . ASP A 1 167 ? 13.539 12.046 54.542  1.00 110.17 ?  164 ASP A N   1 
ATOM   1267 C  CA  . ASP A 1 167 ? 13.971 13.308 53.944  1.00 111.66 ?  164 ASP A CA  1 
ATOM   1268 C  C   . ASP A 1 167 ? 13.673 14.494 54.864  1.00 109.67 ?  164 ASP A C   1 
ATOM   1269 O  O   . ASP A 1 167 ? 14.544 15.316 55.145  1.00 106.43 ?  164 ASP A O   1 
ATOM   1270 C  CB  . ASP A 1 167 ? 13.298 13.494 52.580  1.00 116.60 ?  164 ASP A CB  1 
ATOM   1271 C  CG  . ASP A 1 167 ? 13.926 14.604 51.758  1.00 116.45 ?  164 ASP A CG  1 
ATOM   1272 O  OD1 . ASP A 1 167 ? 14.389 15.611 52.333  1.00 112.21 ?  164 ASP A OD1 1 
ATOM   1273 O  OD2 . ASP A 1 167 ? 13.966 14.461 50.521  1.00 120.13 ?  164 ASP A OD2 1 
ATOM   1274 N  N   . THR A 1 178 ? 28.199 2.472  40.751  1.00 82.68  ?  175 THR A N   1 
ATOM   1275 C  CA  . THR A 1 178 ? 28.956 3.541  41.399  1.00 81.44  ?  175 THR A CA  1 
ATOM   1276 C  C   . THR A 1 178 ? 29.842 4.285  40.404  1.00 91.91  ?  175 THR A C   1 
ATOM   1277 O  O   . THR A 1 178 ? 30.441 3.693  39.500  1.00 83.59  ?  175 THR A O   1 
ATOM   1278 C  CB  . THR A 1 178 ? 29.798 2.995  42.587  1.00 79.67  ?  175 THR A CB  1 
ATOM   1279 O  OG1 . THR A 1 178 ? 29.136 3.305  43.826  1.00 81.05  ?  175 THR A OG1 1 
ATOM   1280 C  CG2 . THR A 1 178 ? 31.213 3.563  42.611  1.00 74.89  ?  175 THR A CG2 1 
ATOM   1281 N  N   . LEU A 1 179 ? 29.886 5.602  40.572  1.00 71.60  ?  176 LEU A N   1 
ATOM   1282 C  CA  . LEU A 1 179 ? 30.621 6.489  39.685  1.00 69.42  ?  176 LEU A CA  1 
ATOM   1283 C  C   . LEU A 1 179 ? 32.128 6.247  39.776  1.00 66.22  ?  176 LEU A C   1 
ATOM   1284 O  O   . LEU A 1 179 ? 32.835 6.323  38.770  1.00 70.26  ?  176 LEU A O   1 
ATOM   1285 C  CB  . LEU A 1 179 ? 30.288 7.946  40.019  1.00 68.05  ?  176 LEU A CB  1 
ATOM   1286 C  CG  . LEU A 1 179 ? 30.459 8.969  38.898  1.00 69.27  ?  176 LEU A CG  1 
ATOM   1287 C  CD1 . LEU A 1 179 ? 29.562 8.616  37.732  1.00 70.65  ?  176 LEU A CD1 1 
ATOM   1288 C  CD2 . LEU A 1 179 ? 30.158 10.378 39.394  1.00 67.36  ?  176 LEU A CD2 1 
ATOM   1289 N  N   . LEU A 1 180 ? 32.608 5.945  40.979  1.00 52.01  ?  177 LEU A N   1 
ATOM   1290 C  CA  . LEU A 1 180 ? 34.032 5.718  41.219  1.00 49.70  ?  177 LEU A CA  1 
ATOM   1291 C  C   . LEU A 1 180 ? 34.539 4.496  40.473  1.00 51.75  ?  177 LEU A C   1 
ATOM   1292 O  O   . LEU A 1 180 ? 35.604 4.535  39.862  1.00 53.74  ?  177 LEU A O   1 
ATOM   1293 C  CB  . LEU A 1 180 ? 34.317 5.552  42.720  1.00 51.78  ?  177 LEU A CB  1 
ATOM   1294 C  CG  . LEU A 1 180 ? 35.790 5.584  43.146  1.00 51.39  ?  177 LEU A CG  1 
ATOM   1295 C  CD1 . LEU A 1 180 ? 36.500 6.780  42.522  1.00 51.87  ?  177 LEU A CD1 1 
ATOM   1296 C  CD2 . LEU A 1 180 ? 35.922 5.616  44.677  1.00 47.62  ?  177 LEU A CD2 1 
ATOM   1297 N  N   . ALA A 1 181 ? 33.782 3.406  40.541  1.00 45.79  ?  178 ALA A N   1 
ATOM   1298 C  CA  . ALA A 1 181 ? 34.133 2.203  39.805  1.00 47.28  ?  178 ALA A CA  1 
ATOM   1299 C  C   . ALA A 1 181 ? 34.175 2.464  38.298  1.00 53.97  ?  178 ALA A C   1 
ATOM   1300 O  O   . ALA A 1 181 ? 35.098 2.016  37.635  1.00 61.90  ?  178 ALA A O   1 
ATOM   1301 C  CB  . ALA A 1 181 ? 33.164 1.086  40.123  1.00 51.47  ?  178 ALA A CB  1 
ATOM   1302 N  N   . ARG A 1 182 ? 33.193 3.186  37.760  1.00 55.28  ?  179 ARG A N   1 
ATOM   1303 C  CA  . ARG A 1 182 ? 33.199 3.556  36.332  1.00 59.85  ?  179 ARG A CA  1 
ATOM   1304 C  C   . ARG A 1 182 ? 34.437 4.376  35.966  1.00 59.07  ?  179 ARG A C   1 
ATOM   1305 O  O   . ARG A 1 182 ? 35.116 4.104  34.972  1.00 57.05  ?  179 ARG A O   1 
ATOM   1306 C  CB  . ARG A 1 182 ? 31.949 4.369  35.960  1.00 58.99  ?  179 ARG A CB  1 
ATOM   1307 C  CG  . ARG A 1 182 ? 30.679 3.575  35.729  1.00 67.45  ?  179 ARG A CG  1 
ATOM   1308 C  CD  . ARG A 1 182 ? 29.826 4.253  34.656  1.00 75.05  ?  179 ARG A CD  1 
ATOM   1309 N  NE  . ARG A 1 182 ? 30.381 4.038  33.320  1.00 77.64  ?  179 ARG A NE  1 
ATOM   1310 C  CZ  . ARG A 1 182 ? 29.662 3.721  32.243  1.00 80.26  ?  179 ARG A CZ  1 
ATOM   1311 N  NH1 . ARG A 1 182 ? 28.340 3.599  32.325  1.00 81.83  1  179 ARG A NH1 1 
ATOM   1312 N  NH2 . ARG A 1 182 ? 30.267 3.534  31.077  1.00 76.47  ?  179 ARG A NH2 1 
ATOM   1313 N  N   . PHE A 1 183 ? 34.695 5.395  36.782  1.00 53.80  ?  180 PHE A N   1 
ATOM   1314 C  CA  . PHE A 1 183 ? 35.820 6.297  36.615  1.00 49.24  ?  180 PHE A CA  1 
ATOM   1315 C  C   . PHE A 1 183 ? 37.114 5.510  36.555  1.00 52.14  ?  180 PHE A C   1 
ATOM   1316 O  O   . PHE A 1 183 ? 37.921 5.695  35.641  1.00 46.27  ?  180 PHE A O   1 
ATOM   1317 C  CB  . PHE A 1 183 ? 35.840 7.308  37.766  1.00 47.00  ?  180 PHE A CB  1 
ATOM   1318 C  CG  . PHE A 1 183 ? 37.067 8.175  37.819  1.00 42.81  ?  180 PHE A CG  1 
ATOM   1319 C  CD1 . PHE A 1 183 ? 37.178 9.299  37.018  1.00 46.42  ?  180 PHE A CD1 1 
ATOM   1320 C  CD2 . PHE A 1 183 ? 38.098 7.882  38.694  1.00 42.51  ?  180 PHE A CD2 1 
ATOM   1321 C  CE1 . PHE A 1 183 ? 38.306 10.097 37.077  1.00 43.48  ?  180 PHE A CE1 1 
ATOM   1322 C  CE2 . PHE A 1 183 ? 39.226 8.688  38.764  1.00 39.59  ?  180 PHE A CE2 1 
ATOM   1323 C  CZ  . PHE A 1 183 ? 39.328 9.797  37.968  1.00 35.12  ?  180 PHE A CZ  1 
ATOM   1324 N  N   . ASN A 1 184 ? 37.303 4.629  37.532  1.00 50.90  ?  181 ASN A N   1 
ATOM   1325 C  CA  . ASN A 1 184 ? 38.516 3.821  37.605  1.00 51.23  ?  181 ASN A CA  1 
ATOM   1326 C  C   . ASN A 1 184 ? 38.681 2.904  36.393  1.00 53.74  ?  181 ASN A C   1 
ATOM   1327 O  O   . ASN A 1 184 ? 39.802 2.664  35.949  1.00 52.51  ?  181 ASN A O   1 
ATOM   1328 C  CB  . ASN A 1 184 ? 38.532 2.993  38.896  1.00 46.56  ?  181 ASN A CB  1 
ATOM   1329 C  CG  . ASN A 1 184 ? 38.957 3.807  40.106  1.00 49.86  ?  181 ASN A CG  1 
ATOM   1330 O  OD1 . ASN A 1 184 ? 39.844 4.656  40.023  1.00 52.37  ?  181 ASN A OD1 1 
ATOM   1331 N  ND2 . ASN A 1 184 ? 38.322 3.549  41.239  1.00 50.68  ?  181 ASN A ND2 1 
ATOM   1332 N  N   . GLU A 1 185 ? 37.572 2.380  35.874  1.00 54.46  ?  182 GLU A N   1 
ATOM   1333 C  CA  . GLU A 1 185 ? 37.610 1.574  34.655  1.00 63.60  ?  182 GLU A CA  1 
ATOM   1334 C  C   . GLU A 1 185 ? 38.055 2.423  33.464  1.00 57.21  ?  182 GLU A C   1 
ATOM   1335 O  O   . GLU A 1 185 ? 38.967 2.064  32.731  1.00 55.64  ?  182 GLU A O   1 
ATOM   1336 C  CB  . GLU A 1 185 ? 36.242 0.957  34.356  1.00 77.84  ?  182 GLU A CB  1 
ATOM   1337 C  CG  . GLU A 1 185 ? 35.775 -0.098 35.350  1.00 94.50  ?  182 GLU A CG  1 
ATOM   1338 C  CD  . GLU A 1 185 ? 34.401 -0.666 35.007  1.00 106.64 ?  182 GLU A CD  1 
ATOM   1339 O  OE1 . GLU A 1 185 ? 33.424 0.112  34.952  1.00 105.20 ?  182 GLU A OE1 1 
ATOM   1340 O  OE2 . GLU A 1 185 ? 34.299 -1.894 34.792  1.00 116.32 -1 182 GLU A OE2 1 
ATOM   1341 N  N   . GLN A 1 186 ? 37.419 3.571  33.296  1.00 51.79  ?  183 GLN A N   1 
ATOM   1342 C  CA  . GLN A 1 186 ? 37.622 4.371  32.102  1.00 50.73  ?  183 GLN A CA  1 
ATOM   1343 C  C   . GLN A 1 186 ? 38.929 5.136  32.085  1.00 48.36  ?  183 GLN A C   1 
ATOM   1344 O  O   . GLN A 1 186 ? 39.430 5.462  31.021  1.00 46.13  ?  183 GLN A O   1 
ATOM   1345 C  CB  . GLN A 1 186 ? 36.450 5.335  31.930  1.00 48.82  ?  183 GLN A CB  1 
ATOM   1346 C  CG  . GLN A 1 186 ? 35.137 4.610  31.777  1.00 53.95  ?  183 GLN A CG  1 
ATOM   1347 C  CD  . GLN A 1 186 ? 33.988 5.546  31.519  1.00 53.90  ?  183 GLN A CD  1 
ATOM   1348 O  OE1 . GLN A 1 186 ? 34.182 6.743  31.320  1.00 47.91  ?  183 GLN A OE1 1 
ATOM   1349 N  NE2 . GLN A 1 186 ? 32.777 5.008  31.536  1.00 61.43  ?  183 GLN A NE2 1 
ATOM   1350 N  N   . ILE A 1 187 ? 39.488 5.404  33.257  1.00 41.07  ?  184 ILE A N   1 
ATOM   1351 C  CA  . ILE A 1 187 ? 40.675 6.241  33.360  1.00 39.27  ?  184 ILE A CA  1 
ATOM   1352 C  C   . ILE A 1 187 ? 41.995 5.444  33.397  1.00 42.90  ?  184 ILE A C   1 
ATOM   1353 O  O   . ILE A 1 187 ? 43.084 6.003  33.213  1.00 47.10  ?  184 ILE A O   1 
ATOM   1354 C  CB  . ILE A 1 187 ? 40.523 7.183  34.606  1.00 45.31  ?  184 ILE A CB  1 
ATOM   1355 C  CG1 . ILE A 1 187 ? 39.959 8.508  34.135  1.00 50.92  ?  184 ILE A CG1 1 
ATOM   1356 C  CG2 . ILE A 1 187 ? 41.800 7.422  35.333  1.00 50.42  ?  184 ILE A CG2 1 
ATOM   1357 C  CD1 . ILE A 1 187 ? 40.760 9.135  33.019  1.00 50.34  ?  184 ILE A CD1 1 
ATOM   1358 N  N   . GLU A 1 188 ? 41.906 4.131  33.578  1.00 49.27  ?  185 GLU A N   1 
ATOM   1359 C  CA  . GLU A 1 188 ? 43.119 3.314  33.718  1.00 54.48  ?  185 GLU A CA  1 
ATOM   1360 C  C   . GLU A 1 188 ? 44.122 3.449  32.548  1.00 53.10  ?  185 GLU A C   1 
ATOM   1361 O  O   . GLU A 1 188 ? 45.332 3.494  32.789  1.00 54.67  ?  185 GLU A O   1 
ATOM   1362 C  CB  . GLU A 1 188 ? 42.750 1.841  33.921  1.00 60.48  ?  185 GLU A CB  1 
ATOM   1363 C  CG  . GLU A 1 188 ? 43.954 0.909  33.922  1.00 75.48  ?  185 GLU A CG  1 
ATOM   1364 C  CD  . GLU A 1 188 ? 44.738 1.004  35.216  1.00 92.68  ?  185 GLU A CD  1 
ATOM   1365 O  OE1 . GLU A 1 188 ? 44.199 1.580  36.193  1.00 95.13  ?  185 GLU A OE1 1 
ATOM   1366 O  OE2 . GLU A 1 188 ? 45.896 0.525  35.247  1.00 97.23  -1 185 GLU A OE2 1 
ATOM   1367 N  N   . PRO A 1 189 ? 43.638 3.524  31.289  1.00 50.07  ?  186 PRO A N   1 
ATOM   1368 C  CA  . PRO A 1 189 ? 44.606 3.785  30.210  1.00 46.44  ?  186 PRO A CA  1 
ATOM   1369 C  C   . PRO A 1 189 ? 45.442 5.052  30.442  1.00 44.53  ?  186 PRO A C   1 
ATOM   1370 O  O   . PRO A 1 189 ? 46.637 5.047  30.131  1.00 48.48  ?  186 PRO A O   1 
ATOM   1371 C  CB  . PRO A 1 189 ? 43.718 3.943  28.965  1.00 45.79  ?  186 PRO A CB  1 
ATOM   1372 C  CG  . PRO A 1 189 ? 42.537 3.088  29.245  1.00 50.50  ?  186 PRO A CG  1 
ATOM   1373 C  CD  . PRO A 1 189 ? 42.297 3.224  30.753  1.00 50.41  ?  186 PRO A CD  1 
ATOM   1374 N  N   . ILE A 1 190 ? 44.846 6.108  30.994  1.00 37.45  ?  187 ILE A N   1 
ATOM   1375 C  CA  . ILE A 1 190 ? 45.610 7.330  31.229  1.00 41.01  ?  187 ILE A CA  1 
ATOM   1376 C  C   . ILE A 1 190 ? 46.596 7.134  32.382  1.00 44.76  ?  187 ILE A C   1 
ATOM   1377 O  O   . ILE A 1 190 ? 47.747 7.564  32.282  1.00 46.54  ?  187 ILE A O   1 
ATOM   1378 C  CB  . ILE A 1 190 ? 44.709 8.545  31.537  1.00 44.26  ?  187 ILE A CB  1 
ATOM   1379 C  CG1 . ILE A 1 190 ? 43.608 8.685  30.488  1.00 42.99  ?  187 ILE A CG1 1 
ATOM   1380 C  CG2 . ILE A 1 190 ? 45.557 9.812  31.628  1.00 39.17  ?  187 ILE A CG2 1 
ATOM   1381 C  CD1 . ILE A 1 190 ? 44.122 8.649  29.086  1.00 43.05  ?  187 ILE A CD1 1 
ATOM   1382 N  N   . TYR A 1 191 ? 46.142 6.506  33.474  1.00 43.98  ?  188 TYR A N   1 
ATOM   1383 C  CA  . TYR A 1 191 ? 47.039 6.155  34.577  1.00 42.04  ?  188 TYR A CA  1 
ATOM   1384 C  C   . TYR A 1 191 ? 48.240 5.352  34.066  1.00 45.53  ?  188 TYR A C   1 
ATOM   1385 O  O   . TYR A 1 191 ? 49.386 5.621  34.436  1.00 48.58  ?  188 TYR A O   1 
ATOM   1386 C  CB  . TYR A 1 191 ? 46.317 5.338  35.637  1.00 40.85  ?  188 TYR A CB  1 
ATOM   1387 C  CG  . TYR A 1 191 ? 45.392 6.106  36.559  1.00 40.23  ?  188 TYR A CG  1 
ATOM   1388 C  CD1 . TYR A 1 191 ? 45.489 7.482  36.704  1.00 41.81  ?  188 TYR A CD1 1 
ATOM   1389 C  CD2 . TYR A 1 191 ? 44.410 5.438  37.282  1.00 43.04  ?  188 TYR A CD2 1 
ATOM   1390 C  CE1 . TYR A 1 191 ? 44.623 8.176  37.559  1.00 44.40  ?  188 TYR A CE1 1 
ATOM   1391 C  CE2 . TYR A 1 191 ? 43.557 6.109  38.131  1.00 47.44  ?  188 TYR A CE2 1 
ATOM   1392 C  CZ  . TYR A 1 191 ? 43.663 7.478  38.262  1.00 47.67  ?  188 TYR A CZ  1 
ATOM   1393 O  OH  . TYR A 1 191 ? 42.805 8.128  39.110  1.00 46.09  ?  188 TYR A OH  1 
ATOM   1394 N  N   . ALA A 1 192 ? 47.970 4.371  33.208  1.00 47.73  ?  189 ALA A N   1 
ATOM   1395 C  CA  . ALA A 1 192 ? 49.031 3.542  32.639  1.00 54.49  ?  189 ALA A CA  1 
ATOM   1396 C  C   . ALA A 1 192 ? 50.002 4.373  31.812  1.00 55.79  ?  189 ALA A C   1 
ATOM   1397 O  O   . ALA A 1 192 ? 51.208 4.240  31.963  1.00 59.49  ?  189 ALA A O   1 
ATOM   1398 C  CB  . ALA A 1 192 ? 48.443 2.416  31.794  1.00 49.53  ?  189 ALA A CB  1 
ATOM   1399 N  N   . LEU A 1 193 ? 49.486 5.238  30.943  1.00 54.67  ?  190 LEU A N   1 
ATOM   1400 C  CA  . LEU A 1 193 ? 50.365 6.087  30.140  1.00 49.19  ?  190 LEU A CA  1 
ATOM   1401 C  C   . LEU A 1 193 ? 51.130 7.080  31.018  1.00 48.12  ?  190 LEU A C   1 
ATOM   1402 O  O   . LEU A 1 193 ? 52.270 7.406  30.730  1.00 49.93  ?  190 LEU A O   1 
ATOM   1403 C  CB  . LEU A 1 193 ? 49.575 6.836  29.063  1.00 39.74  ?  190 LEU A CB  1 
ATOM   1404 C  CG  . LEU A 1 193 ? 49.044 5.974  27.916  1.00 42.58  ?  190 LEU A CG  1 
ATOM   1405 C  CD1 . LEU A 1 193 ? 48.002 6.751  27.142  1.00 40.47  ?  190 LEU A CD1 1 
ATOM   1406 C  CD2 . LEU A 1 193 ? 50.165 5.518  26.985  1.00 45.72  ?  190 LEU A CD2 1 
ATOM   1407 N  N   . LEU A 1 194 ? 50.495 7.564  32.080  1.00 48.12  ?  191 LEU A N   1 
ATOM   1408 C  CA  . LEU A 1 194 ? 51.178 8.431  33.036  1.00 54.71  ?  191 LEU A CA  1 
ATOM   1409 C  C   . LEU A 1 194 ? 52.400 7.721  33.638  1.00 64.17  ?  191 LEU A C   1 
ATOM   1410 O  O   . LEU A 1 194 ? 53.515 8.245  33.599  1.00 62.66  ?  191 LEU A O   1 
ATOM   1411 C  CB  . LEU A 1 194 ? 50.216 8.876  34.136  1.00 51.68  ?  191 LEU A CB  1 
ATOM   1412 C  CG  . LEU A 1 194 ? 49.330 10.063 33.740  1.00 49.72  ?  191 LEU A CG  1 
ATOM   1413 C  CD1 . LEU A 1 194 ? 48.426 10.479 34.878  1.00 46.35  ?  191 LEU A CD1 1 
ATOM   1414 C  CD2 . LEU A 1 194 ? 50.192 11.235 33.286  1.00 45.91  ?  191 LEU A CD2 1 
ATOM   1415 N  N   . ARG A 1 195 ? 52.179 6.521  34.173  1.00 69.05  ?  192 ARG A N   1 
ATOM   1416 C  CA  . ARG A 1 195 ? 53.255 5.701  34.733  1.00 66.76  ?  192 ARG A CA  1 
ATOM   1417 C  C   . ARG A 1 195 ? 54.369 5.439  33.730  1.00 70.22  ?  192 ARG A C   1 
ATOM   1418 O  O   . ARG A 1 195 ? 55.541 5.537  34.070  1.00 72.10  ?  192 ARG A O   1 
ATOM   1419 C  CB  . ARG A 1 195 ? 52.709 4.366  35.242  1.00 62.56  ?  192 ARG A CB  1 
ATOM   1420 C  CG  . ARG A 1 195 ? 53.807 3.417  35.683  1.00 71.14  ?  192 ARG A CG  1 
ATOM   1421 C  CD  . ARG A 1 195 ? 53.345 2.490  36.791  1.00 81.20  ?  192 ARG A CD  1 
ATOM   1422 N  NE  . ARG A 1 195 ? 54.462 1.972  37.588  1.00 88.16  ?  192 ARG A NE  1 
ATOM   1423 C  CZ  . ARG A 1 195 ? 55.427 1.174  37.131  1.00 99.96  ?  192 ARG A CZ  1 
ATOM   1424 N  NH1 . ARG A 1 195 ? 56.391 0.773  37.944  1.00 105.10 1  192 ARG A NH1 1 
ATOM   1425 N  NH2 . ARG A 1 195 ? 55.435 0.762  35.872  1.00 105.79 ?  192 ARG A NH2 1 
ATOM   1426 N  N   . GLU A 1 196 ? 53.996 5.111  32.494  1.00 73.33  ?  193 GLU A N   1 
ATOM   1427 C  CA  . GLU A 1 196 ? 54.961 4.852  31.426  1.00 75.53  ?  193 GLU A CA  1 
ATOM   1428 C  C   . GLU A 1 196 ? 55.902 6.031  31.175  1.00 80.91  ?  193 GLU A C   1 
ATOM   1429 O  O   . GLU A 1 196 ? 57.039 5.847  30.755  1.00 87.01  ?  193 GLU A O   1 
ATOM   1430 C  CB  . GLU A 1 196 ? 54.237 4.506  30.123  1.00 74.00  ?  193 GLU A CB  1 
ATOM   1431 C  CG  . GLU A 1 196 ? 53.558 3.141  30.092  1.00 80.63  ?  193 GLU A CG  1 
ATOM   1432 C  CD  . GLU A 1 196 ? 52.982 2.810  28.715  1.00 86.61  ?  193 GLU A CD  1 
ATOM   1433 O  OE1 . GLU A 1 196 ? 53.608 3.187  27.698  1.00 84.33  ?  193 GLU A OE1 1 
ATOM   1434 O  OE2 . GLU A 1 196 ? 51.900 2.185  28.648  1.00 87.17  -1 193 GLU A OE2 1 
ATOM   1435 N  N   . THR A 1 197 ? 55.422 7.239  31.434  1.00 82.04  ?  194 THR A N   1 
ATOM   1436 C  CA  . THR A 1 197 ? 56.185 8.446  31.144  1.00 84.85  ?  194 THR A CA  1 
ATOM   1437 C  C   . THR A 1 197 ? 57.041 8.915  32.313  1.00 90.45  ?  194 THR A C   1 
ATOM   1438 O  O   . THR A 1 197 ? 57.763 9.902  32.197  1.00 95.32  ?  194 THR A O   1 
ATOM   1439 C  CB  . THR A 1 197 ? 55.255 9.604  30.753  1.00 83.78  ?  194 THR A CB  1 
ATOM   1440 O  OG1 . THR A 1 197 ? 54.267 9.787  31.774  1.00 78.92  ?  194 THR A OG1 1 
ATOM   1441 C  CG2 . THR A 1 197 ? 54.558 9.306  29.438  1.00 84.14  ?  194 THR A CG2 1 
ATOM   1442 N  N   . GLU A 1 198 ? 56.972 8.205  33.433  1.00 93.21  ?  195 GLU A N   1 
ATOM   1443 C  CA  . GLU A 1 198 ? 57.543 8.699  34.687  1.00 100.15 ?  195 GLU A CA  1 
ATOM   1444 C  C   . GLU A 1 198 ? 59.065 8.871  34.701  1.00 106.71 ?  195 GLU A C   1 
ATOM   1445 O  O   . GLU A 1 198 ? 59.632 9.182  35.744  1.00 116.36 ?  195 GLU A O   1 
ATOM   1446 C  CB  . GLU A 1 198 ? 57.140 7.774  35.839  1.00 103.01 ?  195 GLU A CB  1 
ATOM   1447 C  CG  . GLU A 1 198 ? 55.767 8.081  36.415  1.00 102.54 ?  195 GLU A CG  1 
ATOM   1448 C  CD  . GLU A 1 198 ? 55.412 7.215  37.612  1.00 109.30 ?  195 GLU A CD  1 
ATOM   1449 O  OE1 . GLU A 1 198 ? 56.036 6.146  37.779  1.00 119.01 ?  195 GLU A OE1 1 
ATOM   1450 O  OE2 . GLU A 1 198 ? 54.514 7.607  38.390  1.00 102.93 ?  195 GLU A OE2 1 
ATOM   1451 N  N   . ASP A 1 199 ? 59.728 8.680  33.563  1.00 104.93 ?  196 ASP A N   1 
ATOM   1452 C  CA  . ASP A 1 199 ? 61.180 8.856  33.495  1.00 108.73 ?  196 ASP A CA  1 
ATOM   1453 C  C   . ASP A 1 199 ? 61.591 10.021 32.590  1.00 104.58 ?  196 ASP A C   1 
ATOM   1454 O  O   . ASP A 1 199 ? 61.064 10.192 31.487  1.00 96.35  ?  196 ASP A O   1 
ATOM   1455 C  CB  . ASP A 1 199 ? 61.851 7.567  33.019  1.00 114.96 ?  196 ASP A CB  1 
ATOM   1456 C  CG  . ASP A 1 199 ? 61.292 7.074  31.700  1.00 115.65 ?  196 ASP A CG  1 
ATOM   1457 O  OD1 . ASP A 1 199 ? 60.240 6.400  31.720  1.00 117.03 ?  196 ASP A OD1 1 
ATOM   1458 O  OD2 . ASP A 1 199 ? 61.901 7.358  30.646  1.00 114.31 ?  196 ASP A OD2 1 
ATOM   1459 N  N   . LYS B 2 6   ? 38.953 20.324 -8.947  1.00 62.47  ?  142 LYS B N   1 
ATOM   1460 C  CA  . LYS B 2 6   ? 39.731 20.607 -7.734  1.00 65.12  ?  142 LYS B CA  1 
ATOM   1461 C  C   . LYS B 2 6   ? 40.357 19.343 -7.119  1.00 61.15  ?  142 LYS B C   1 
ATOM   1462 O  O   . LYS B 2 6   ? 41.536 19.352 -6.751  1.00 60.93  ?  142 LYS B O   1 
ATOM   1463 C  CB  . LYS B 2 6   ? 38.859 21.321 -6.698  1.00 67.13  ?  142 LYS B CB  1 
ATOM   1464 C  CG  . LYS B 2 6   ? 39.560 21.615 -5.372  1.00 64.41  ?  142 LYS B CG  1 
ATOM   1465 C  CD  . LYS B 2 6   ? 40.711 22.592 -5.552  1.00 65.03  ?  142 LYS B CD  1 
ATOM   1466 C  CE  . LYS B 2 6   ? 41.597 22.655 -4.316  1.00 61.24  ?  142 LYS B CE  1 
ATOM   1467 N  NZ  . LYS B 2 6   ? 40.864 23.119 -3.106  1.00 57.32  ?  142 LYS B NZ  1 
ATOM   1468 N  N   . TYR B 2 7   ? 39.571 18.271 -6.998  1.00 52.85  ?  143 TYR B N   1 
ATOM   1469 C  CA  . TYR B 2 7   ? 40.091 16.949 -6.619  1.00 51.04  ?  143 TYR B CA  1 
ATOM   1470 C  C   . TYR B 2 7   ? 39.634 15.874 -7.607  1.00 54.80  ?  143 TYR B C   1 
ATOM   1471 O  O   . TYR B 2 7   ? 38.543 15.943 -8.131  1.00 56.43  ?  143 TYR B O   1 
ATOM   1472 C  CB  . TYR B 2 7   ? 39.642 16.543 -5.210  1.00 48.47  ?  143 TYR B CB  1 
ATOM   1473 C  CG  . TYR B 2 7   ? 40.141 17.436 -4.097  1.00 48.91  ?  143 TYR B CG  1 
ATOM   1474 C  CD1 . TYR B 2 7   ? 41.423 17.293 -3.575  1.00 49.59  ?  143 TYR B CD1 1 
ATOM   1475 C  CD2 . TYR B 2 7   ? 39.322 18.414 -3.561  1.00 49.20  ?  143 TYR B CD2 1 
ATOM   1476 C  CE1 . TYR B 2 7   ? 41.877 18.115 -2.539  1.00 48.91  ?  143 TYR B CE1 1 
ATOM   1477 C  CE2 . TYR B 2 7   ? 39.758 19.229 -2.541  1.00 55.94  ?  143 TYR B CE2 1 
ATOM   1478 C  CZ  . TYR B 2 7   ? 41.031 19.075 -2.033  1.00 50.90  ?  143 TYR B CZ  1 
ATOM   1479 O  OH  . TYR B 2 7   ? 41.430 19.915 -1.035  1.00 50.04  ?  143 TYR B OH  1 
ATOM   1480 N  N   . ASN B 2 8   ? 40.472 14.872 -7.845  1.00 58.22  ?  144 ASN B N   1 
ATOM   1481 C  CA  . ASN B 2 8   ? 40.102 13.736 -8.684  1.00 62.57  ?  144 ASN B CA  1 
ATOM   1482 C  C   . ASN B 2 8   ? 39.648 12.598 -7.789  1.00 59.55  ?  144 ASN B C   1 
ATOM   1483 O  O   . ASN B 2 8   ? 40.479 11.863 -7.270  1.00 61.75  ?  144 ASN B O   1 
ATOM   1484 C  CB  . ASN B 2 8   ? 41.289 13.313 -9.573  1.00 69.14  ?  144 ASN B CB  1 
ATOM   1485 C  CG  . ASN B 2 8   ? 41.031 12.016 -10.369 1.00 80.88  ?  144 ASN B CG  1 
ATOM   1486 O  OD1 . ASN B 2 8   ? 39.914 11.496 -10.418 1.00 78.70  ?  144 ASN B OD1 1 
ATOM   1487 N  ND2 . ASN B 2 8   ? 42.083 11.507 -11.015 1.00 88.40  ?  144 ASN B ND2 1 
ATOM   1488 N  N   . VAL B 2 9   ? 38.336 12.468 -7.588  1.00 60.13  ?  145 VAL B N   1 
ATOM   1489 C  CA  . VAL B 2 9   ? 37.789 11.428 -6.705  1.00 50.67  ?  145 VAL B CA  1 
ATOM   1490 C  C   . VAL B 2 9   ? 36.719 10.616 -7.437  1.00 54.76  ?  145 VAL B C   1 
ATOM   1491 O  O   . VAL B 2 9   ? 35.567 11.036 -7.541  1.00 51.01  ?  145 VAL B O   1 
ATOM   1492 C  CB  . VAL B 2 9   ? 37.206 12.032 -5.419  1.00 46.54  ?  145 VAL B CB  1 
ATOM   1493 C  CG1 . VAL B 2 9   ? 36.768 10.945 -4.462  1.00 45.73  ?  145 VAL B CG1 1 
ATOM   1494 C  CG2 . VAL B 2 9   ? 38.237 12.923 -4.758  1.00 34.26  ?  145 VAL B CG2 1 
ATOM   1495 N  N   . ARG B 2 10  ? 37.126 9.456  -7.951  1.00 59.62  ?  146 ARG B N   1 
ATOM   1496 C  CA  . ARG B 2 10  ? 36.277 8.613  -8.796  1.00 72.62  ?  146 ARG B CA  1 
ATOM   1497 C  C   . ARG B 2 10  ? 35.155 7.923  -8.021  1.00 68.68  ?  146 ARG B C   1 
ATOM   1498 O  O   . ARG B 2 10  ? 34.011 7.869  -8.468  1.00 68.22  ?  146 ARG B O   1 
ATOM   1499 C  CB  . ARG B 2 10  ? 37.143 7.557  -9.506  1.00 78.38  ?  146 ARG B CB  1 
ATOM   1500 C  CG  . ARG B 2 10  ? 36.373 6.536  -10.357 1.00 81.84  ?  146 ARG B CG  1 
ATOM   1501 C  CD  . ARG B 2 10  ? 37.302 5.445  -10.890 1.00 83.01  ?  146 ARG B CD  1 
ATOM   1502 N  NE  . ARG B 2 10  ? 37.142 5.239  -12.329 1.00 97.84  ?  146 ARG B NE  1 
ATOM   1503 C  CZ  . ARG B 2 10  ? 38.146 5.216  -13.204 1.00 103.29 ?  146 ARG B CZ  1 
ATOM   1504 N  NH1 . ARG B 2 10  ? 39.393 5.386  -12.788 1.00 106.24 ?  146 ARG B NH1 1 
ATOM   1505 N  NH2 . ARG B 2 10  ? 37.903 5.021  -14.495 1.00 106.16 ?  146 ARG B NH2 1 
ATOM   1506 N  N   . ASP B 2 11  ? 35.493 7.402  -6.850  1.00 58.13  ?  147 ASP B N   1 
ATOM   1507 C  CA  . ASP B 2 11  ? 34.598 6.529  -6.118  1.00 46.41  ?  147 ASP B CA  1 
ATOM   1508 C  C   . ASP B 2 11  ? 34.878 6.603  -4.620  1.00 49.33  ?  147 ASP B C   1 
ATOM   1509 O  O   . ASP B 2 11  ? 35.689 7.413  -4.170  1.00 40.90  ?  147 ASP B O   1 
ATOM   1510 C  CB  . ASP B 2 11  ? 34.760 5.093  -6.609  1.00 51.06  ?  147 ASP B CB  1 
ATOM   1511 C  CG  . ASP B 2 11  ? 36.224 4.709  -6.817  1.00 62.48  ?  147 ASP B CG  1 
ATOM   1512 O  OD1 . ASP B 2 11  ? 37.061 5.024  -5.944  1.00 59.94  ?  147 ASP B OD1 1 
ATOM   1513 O  OD2 . ASP B 2 11  ? 36.549 4.084  -7.850  1.00 73.29  ?  147 ASP B OD2 1 
ATOM   1514 N  N   . LYS B 2 12  ? 34.219 5.733  -3.866  1.00 46.48  ?  148 LYS B N   1 
ATOM   1515 C  CA  . LYS B 2 12  ? 34.367 5.665  -2.422  1.00 45.52  ?  148 LYS B CA  1 
ATOM   1516 C  C   . LYS B 2 12  ? 35.817 5.428  -2.013  1.00 51.16  ?  148 LYS B C   1 
ATOM   1517 O  O   . LYS B 2 12  ? 36.358 6.117  -1.148  1.00 51.48  ?  148 LYS B O   1 
ATOM   1518 C  CB  . LYS B 2 12  ? 33.482 4.550  -1.871  1.00 44.41  ?  148 LYS B CB  1 
ATOM   1519 C  CG  . LYS B 2 12  ? 33.610 4.349  -0.391  1.00 50.13  ?  148 LYS B CG  1 
ATOM   1520 C  CD  . LYS B 2 12  ? 32.768 3.184  0.078   1.00 56.35  ?  148 LYS B CD  1 
ATOM   1521 C  CE  . LYS B 2 12  ? 33.288 1.879  -0.467  1.00 58.19  ?  148 LYS B CE  1 
ATOM   1522 N  NZ  . LYS B 2 12  ? 32.329 0.787  -0.165  1.00 67.59  ?  148 LYS B NZ  1 
ATOM   1523 N  N   . LYS B 2 13  ? 36.429 4.434  -2.644  1.00 50.37  ?  149 LYS B N   1 
ATOM   1524 C  CA  . LYS B 2 13  ? 37.796 4.031  -2.359  1.00 50.94  ?  149 LYS B CA  1 
ATOM   1525 C  C   . LYS B 2 13  ? 38.784 5.171  -2.605  1.00 51.63  ?  149 LYS B C   1 
ATOM   1526 O  O   . LYS B 2 13  ? 39.659 5.421  -1.773  1.00 47.64  ?  149 LYS B O   1 
ATOM   1527 C  CB  . LYS B 2 13  ? 38.148 2.811  -3.205  1.00 55.01  ?  149 LYS B CB  1 
ATOM   1528 C  CG  . LYS B 2 13  ? 39.539 2.262  -3.014  1.00 64.73  ?  149 LYS B CG  1 
ATOM   1529 C  CD  . LYS B 2 13  ? 39.761 1.050  -3.911  1.00 70.42  ?  149 LYS B CD  1 
ATOM   1530 C  CE  . LYS B 2 13  ? 39.327 1.351  -5.333  1.00 75.19  ?  149 LYS B CE  1 
ATOM   1531 N  NZ  . LYS B 2 13  ? 39.280 0.122  -6.176  1.00 83.87  ?  149 LYS B NZ  1 
ATOM   1532 N  N   . ALA B 2 14  ? 38.637 5.863  -3.736  1.00 44.45  ?  150 ALA B N   1 
ATOM   1533 C  CA  . ALA B 2 14  ? 39.428 7.061  -4.011  1.00 41.94  ?  150 ALA B CA  1 
ATOM   1534 C  C   . ALA B 2 14  ? 39.216 8.158  -2.947  1.00 44.92  ?  150 ALA B C   1 
ATOM   1535 O  O   . ALA B 2 14  ? 40.140 8.900  -2.611  1.00 40.68  ?  150 ALA B O   1 
ATOM   1536 C  CB  . ALA B 2 14  ? 39.103 7.599  -5.396  1.00 40.86  ?  150 ALA B CB  1 
ATOM   1537 N  N   . LEU B 2 15  ? 37.998 8.281  -2.424  1.00 43.81  ?  151 LEU B N   1 
ATOM   1538 C  CA  . LEU B 2 15  ? 37.754 9.254  -1.373  1.00 37.61  ?  151 LEU B CA  1 
ATOM   1539 C  C   . LEU B 2 15  ? 38.546 8.874  -0.113  1.00 39.00  ?  151 LEU B C   1 
ATOM   1540 O  O   . LEU B 2 15  ? 39.191 9.716  0.512   1.00 34.97  ?  151 LEU B O   1 
ATOM   1541 C  CB  . LEU B 2 15  ? 36.265 9.361  -1.052  1.00 39.71  ?  151 LEU B CB  1 
ATOM   1542 C  CG  . LEU B 2 15  ? 35.984 10.250 0.163   1.00 39.09  ?  151 LEU B CG  1 
ATOM   1543 C  CD1 . LEU B 2 15  ? 36.648 11.624 0.014   1.00 38.15  ?  151 LEU B CD1 1 
ATOM   1544 C  CD2 . LEU B 2 15  ? 34.480 10.385 0.428   1.00 38.62  ?  151 LEU B CD2 1 
ATOM   1545 N  N   . LEU B 2 16  ? 38.508 7.604  0.254   1.00 39.30  ?  152 LEU B N   1 
ATOM   1546 C  CA  . LEU B 2 16  ? 39.210 7.176  1.459   1.00 38.61  ?  152 LEU B CA  1 
ATOM   1547 C  C   . LEU B 2 16  ? 40.718 7.352  1.298   1.00 42.99  ?  152 LEU B C   1 
ATOM   1548 O  O   . LEU B 2 16  ? 41.402 7.808  2.221   1.00 45.84  ?  152 LEU B O   1 
ATOM   1549 C  CB  . LEU B 2 16  ? 38.871 5.716  1.793   1.00 36.04  ?  152 LEU B CB  1 
ATOM   1550 C  CG  . LEU B 2 16  ? 39.557 5.190  3.055   1.00 41.59  ?  152 LEU B CG  1 
ATOM   1551 C  CD1 . LEU B 2 16  ? 39.103 5.978  4.241   1.00 34.90  ?  152 LEU B CD1 1 
ATOM   1552 C  CD2 . LEU B 2 16  ? 39.264 3.699  3.235   1.00 47.15  ?  152 LEU B CD2 1 
ATOM   1553 N  N   . ARG B 2 17  ? 41.242 6.998  0.127   1.00 40.26  ?  153 ARG B N   1 
ATOM   1554 C  CA  . ARG B 2 17  ? 42.684 7.083  -0.074  1.00 39.40  ?  153 ARG B CA  1 
ATOM   1555 C  C   . ARG B 2 17  ? 43.144 8.540  -0.044  1.00 38.01  ?  153 ARG B C   1 
ATOM   1556 O  O   . ARG B 2 17  ? 44.198 8.848  0.517   1.00 39.75  ?  153 ARG B O   1 
ATOM   1557 C  CB  . ARG B 2 17  ? 43.122 6.418  -1.382  1.00 49.98  ?  153 ARG B CB  1 
ATOM   1558 C  CG  . ARG B 2 17  ? 44.599 6.661  -1.676  1.00 61.79  ?  153 ARG B CG  1 
ATOM   1559 C  CD  . ARG B 2 17  ? 45.083 6.093  -3.001  1.00 78.69  ?  153 ARG B CD  1 
ATOM   1560 N  NE  . ARG B 2 17  ? 46.542 5.928  -3.015  1.00 95.69  ?  153 ARG B NE  1 
ATOM   1561 C  CZ  . ARG B 2 17  ? 47.240 5.169  -2.166  1.00 105.42 ?  153 ARG B CZ  1 
ATOM   1562 N  NH1 . ARG B 2 17  ? 46.628 4.457  -1.225  1.00 110.36 ?  153 ARG B NH1 1 
ATOM   1563 N  NH2 . ARG B 2 17  ? 48.561 5.101  -2.273  1.00 106.88 ?  153 ARG B NH2 1 
ATOM   1564 N  N   . LEU B 2 18  ? 42.362 9.435  -0.638  1.00 33.39  ?  154 LEU B N   1 
ATOM   1565 C  CA  . LEU B 2 18  ? 42.679 10.854 -0.573  1.00 36.21  ?  154 LEU B CA  1 
ATOM   1566 C  C   . LEU B 2 18  ? 42.750 11.358 0.882   1.00 39.27  ?  154 LEU B C   1 
ATOM   1567 O  O   . LEU B 2 18  ? 43.657 12.095 1.243   1.00 34.61  ?  154 LEU B O   1 
ATOM   1568 C  CB  . LEU B 2 18  ? 41.643 11.656 -1.356  1.00 34.26  ?  154 LEU B CB  1 
ATOM   1569 C  CG  . LEU B 2 18  ? 41.854 13.169 -1.384  1.00 38.79  ?  154 LEU B CG  1 
ATOM   1570 C  CD1 . LEU B 2 18  ? 43.192 13.511 -1.967  1.00 38.00  ?  154 LEU B CD1 1 
ATOM   1571 C  CD2 . LEU B 2 18  ? 40.740 13.865 -2.147  1.00 43.70  ?  154 LEU B CD2 1 
ATOM   1572 N  N   . LEU B 2 19  ? 41.780 10.969 1.707   1.00 38.09  ?  155 LEU B N   1 
ATOM   1573 C  CA  . LEU B 2 19  ? 41.737 11.408 3.093   1.00 33.57  ?  155 LEU B CA  1 
ATOM   1574 C  C   . LEU B 2 19  ? 42.920 10.841 3.865   1.00 35.77  ?  155 LEU B C   1 
ATOM   1575 O  O   . LEU B 2 19  ? 43.587 11.541 4.618   1.00 39.89  ?  155 LEU B O   1 
ATOM   1576 C  CB  . LEU B 2 19  ? 40.421 10.985 3.738   1.00 31.27  ?  155 LEU B CB  1 
ATOM   1577 C  CG  . LEU B 2 19  ? 39.194 11.756 3.267   1.00 37.55  ?  155 LEU B CG  1 
ATOM   1578 C  CD1 . LEU B 2 19  ? 37.908 11.139 3.818   1.00 36.94  ?  155 LEU B CD1 1 
ATOM   1579 C  CD2 . LEU B 2 19  ? 39.331 13.205 3.717   1.00 34.76  ?  155 LEU B CD2 1 
ATOM   1580 N  N   . ASP B 2 20  ? 43.187 9.566  3.626   1.00 35.78  ?  156 ASP B N   1 
ATOM   1581 C  CA  . ASP B 2 20  ? 44.333 8.873  4.191   1.00 39.20  ?  156 ASP B CA  1 
ATOM   1582 C  C   . ASP B 2 20  ? 45.645 9.571  3.847   1.00 44.94  ?  156 ASP B C   1 
ATOM   1583 O  O   . ASP B 2 20  ? 46.477 9.802  4.711   1.00 44.79  ?  156 ASP B O   1 
ATOM   1584 C  CB  . ASP B 2 20  ? 44.349 7.433  3.678   1.00 38.81  ?  156 ASP B CB  1 
ATOM   1585 C  CG  . ASP B 2 20  ? 45.291 6.544  4.450   1.00 49.85  ?  156 ASP B CG  1 
ATOM   1586 O  OD1 . ASP B 2 20  ? 46.064 7.044  5.290   1.00 55.20  ?  156 ASP B OD1 1 
ATOM   1587 O  OD2 . ASP B 2 20  ? 45.260 5.326  4.212   1.00 56.53  ?  156 ASP B OD2 1 
ATOM   1588 N  N   . GLN B 2 21  ? 45.837 9.894  2.574   1.00 45.16  ?  157 GLN B N   1 
ATOM   1589 C  CA  . GLN B 2 21  ? 47.091 10.491 2.133   1.00 42.75  ?  157 GLN B CA  1 
ATOM   1590 C  C   . GLN B 2 21  ? 47.283 11.867 2.743   1.00 39.81  ?  157 GLN B C   1 
ATOM   1591 O  O   . GLN B 2 21  ? 48.393 12.253 3.079   1.00 40.84  ?  157 GLN B O   1 
ATOM   1592 C  CB  . GLN B 2 21  ? 47.127 10.583 0.606   1.00 44.07  ?  157 GLN B CB  1 
ATOM   1593 C  CG  . GLN B 2 21  ? 47.522 9.296  -0.053  1.00 47.16  ?  157 GLN B CG  1 
ATOM   1594 C  CD  . GLN B 2 21  ? 48.927 8.905  0.304   1.00 59.61  ?  157 GLN B CD  1 
ATOM   1595 O  OE1 . GLN B 2 21  ? 49.170 7.836  0.864   1.00 66.95  ?  157 GLN B OE1 1 
ATOM   1596 N  NE2 . GLN B 2 21  ? 49.872 9.783  -0.001  1.00 63.36  ?  157 GLN B NE2 1 
ATOM   1597 N  N   . HIS B 2 22  ? 46.190 12.610 2.870   1.00 34.13  ?  158 HIS B N   1 
ATOM   1598 C  CA  . HIS B 2 22  ? 46.237 13.928 3.477   1.00 36.39  ?  158 HIS B CA  1 
ATOM   1599 C  C   . HIS B 2 22  ? 46.713 13.863 4.922   1.00 38.86  ?  158 HIS B C   1 
ATOM   1600 O  O   . HIS B 2 22  ? 47.522 14.682 5.350   1.00 35.92  ?  158 HIS B O   1 
ATOM   1601 C  CB  . HIS B 2 22  ? 44.865 14.590 3.416   1.00 29.83  ?  158 HIS B CB  1 
ATOM   1602 C  CG  . HIS B 2 22  ? 44.695 15.470 2.225   1.00 37.30  ?  158 HIS B CG  1 
ATOM   1603 N  ND1 . HIS B 2 22  ? 44.212 16.758 2.313   1.00 40.84  ?  158 HIS B ND1 1 
ATOM   1604 C  CD2 . HIS B 2 22  ? 44.951 15.247 0.914   1.00 33.20  ?  158 HIS B CD2 1 
ATOM   1605 C  CE1 . HIS B 2 22  ? 44.188 17.293 1.105   1.00 44.87  ?  158 HIS B CE1 1 
ATOM   1606 N  NE2 . HIS B 2 22  ? 44.647 16.403 0.244   1.00 37.50  ?  158 HIS B NE2 1 
ATOM   1607 N  N   . ASP B 2 23  ? 46.196 12.877 5.645   1.00 38.88  ?  159 ASP B N   1 
ATOM   1608 C  CA  . ASP B 2 23  ? 46.598 12.581 7.011   1.00 41.52  ?  159 ASP B CA  1 
ATOM   1609 C  C   . ASP B 2 23  ? 48.081 12.218 7.052   1.00 43.41  ?  159 ASP B C   1 
ATOM   1610 O  O   . ASP B 2 23  ? 48.854 12.810 7.804   1.00 41.34  ?  159 ASP B O   1 
ATOM   1611 C  CB  . ASP B 2 23  ? 45.732 11.445 7.569   1.00 43.98  ?  159 ASP B CB  1 
ATOM   1612 C  CG  . ASP B 2 23  ? 46.128 11.029 8.982   1.00 54.84  ?  159 ASP B CG  1 
ATOM   1613 O  OD1 . ASP B 2 23  ? 47.064 10.216 9.110   1.00 60.34  ?  159 ASP B OD1 1 
ATOM   1614 O  OD2 . ASP B 2 23  ? 45.482 11.477 9.957   1.00 54.87  ?  159 ASP B OD2 1 
ATOM   1615 N  N   . GLN B 2 24  ? 48.485 11.263 6.219   1.00 40.85  ?  160 GLN B N   1 
ATOM   1616 C  CA  . GLN B 2 24  ? 49.875 10.838 6.196   1.00 42.73  ?  160 GLN B CA  1 
ATOM   1617 C  C   . GLN B 2 24  ? 50.824 11.962 5.799   1.00 45.99  ?  160 GLN B C   1 
ATOM   1618 O  O   . GLN B 2 24  ? 51.945 12.024 6.295   1.00 47.18  ?  160 GLN B O   1 
ATOM   1619 C  CB  . GLN B 2 24  ? 50.063 9.651  5.252   1.00 46.37  ?  160 GLN B CB  1 
ATOM   1620 C  CG  . GLN B 2 24  ? 49.400 8.368  5.742   1.00 56.60  ?  160 GLN B CG  1 
ATOM   1621 C  CD  . GLN B 2 24  ? 49.647 7.192  4.816   1.00 67.93  ?  160 GLN B CD  1 
ATOM   1622 O  OE1 . GLN B 2 24  ? 50.705 7.092  4.192   1.00 76.56  ?  160 GLN B OE1 1 
ATOM   1623 N  NE2 . GLN B 2 24  ? 48.670 6.293  4.720   1.00 66.17  ?  160 GLN B NE2 1 
ATOM   1624 N  N   . ARG B 2 25  ? 50.390 12.855 4.913   1.00 41.18  ?  161 ARG B N   1 
ATOM   1625 C  CA  . ARG B 2 25  ? 51.327 13.829 4.369   1.00 44.39  ?  161 ARG B CA  1 
ATOM   1626 C  C   . ARG B 2 25  ? 51.155 15.225 4.959   1.00 46.05  ?  161 ARG B C   1 
ATOM   1627 O  O   . ARG B 2 25  ? 51.826 16.167 4.524   1.00 46.96  ?  161 ARG B O   1 
ATOM   1628 C  CB  . ARG B 2 25  ? 51.200 13.895 2.847   1.00 46.05  ?  161 ARG B CB  1 
ATOM   1629 C  CG  . ARG B 2 25  ? 51.650 12.635 2.126   1.00 55.76  ?  161 ARG B CG  1 
ATOM   1630 C  CD  . ARG B 2 25  ? 51.260 12.683 0.639   1.00 62.05  ?  161 ARG B CD  1 
ATOM   1631 N  NE  . ARG B 2 25  ? 51.841 13.843 -0.039  1.00 61.25  ?  161 ARG B NE  1 
ATOM   1632 C  CZ  . ARG B 2 25  ? 51.505 14.252 -1.259  1.00 59.36  ?  161 ARG B CZ  1 
ATOM   1633 N  NH1 . ARG B 2 25  ? 50.590 13.596 -1.961  1.00 61.97  ?  161 ARG B NH1 1 
ATOM   1634 N  NH2 . ARG B 2 25  ? 52.088 15.325 -1.778  1.00 50.76  ?  161 ARG B NH2 1 
ATOM   1635 N  N   . GLY B 2 26  ? 50.274 15.355 5.949   1.00 43.70  ?  162 GLY B N   1 
ATOM   1636 C  CA  . GLY B 2 26  ? 50.047 16.632 6.609   1.00 40.74  ?  162 GLY B CA  1 
ATOM   1637 C  C   . GLY B 2 26  ? 49.481 17.682 5.672   1.00 40.17  ?  162 GLY B C   1 
ATOM   1638 O  O   . GLY B 2 26  ? 49.831 18.860 5.756   1.00 41.97  ?  162 GLY B O   1 
ATOM   1639 N  N   . LEU B 2 27  ? 48.594 17.257 4.776   1.00 43.60  ?  163 LEU B N   1 
ATOM   1640 C  CA  . LEU B 2 27  ? 48.025 18.168 3.792   1.00 44.21  ?  163 LEU B CA  1 
ATOM   1641 C  C   . LEU B 2 27  ? 46.755 18.861 4.279   1.00 28.71  ?  163 LEU B C   1 
ATOM   1642 O  O   . LEU B 2 27  ? 46.275 19.802 3.641   1.00 35.80  ?  163 LEU B O   1 
ATOM   1643 C  CB  . LEU B 2 27  ? 47.751 17.422 2.475   1.00 45.90  ?  163 LEU B CB  1 
ATOM   1644 C  CG  . LEU B 2 27  ? 49.031 16.862 1.838   1.00 48.79  ?  163 LEU B CG  1 
ATOM   1645 C  CD1 . LEU B 2 27  ? 48.759 16.254 0.474   1.00 50.13  ?  163 LEU B CD1 1 
ATOM   1646 C  CD2 . LEU B 2 27  ? 50.101 17.937 1.744   1.00 51.22  ?  163 LEU B CD2 1 
ATOM   1647 N  N   . GLY B 2 28  ? 46.184 18.398 5.381   1.00 31.44  ?  164 GLY B N   1 
ATOM   1648 C  CA  . GLY B 2 28  ? 45.095 19.143 6.003   1.00 35.88  ?  164 GLY B CA  1 
ATOM   1649 C  C   . GLY B 2 28  ? 43.677 18.692 5.686   1.00 36.73  ?  164 GLY B C   1 
ATOM   1650 O  O   . GLY B 2 28  ? 43.451 17.633 5.111   1.00 38.72  ?  164 GLY B O   1 
ATOM   1651 N  N   . GLY B 2 29  ? 42.714 19.513 6.089   1.00 36.89  ?  165 GLY B N   1 
ATOM   1652 C  CA  . GLY B 2 29  ? 41.312 19.208 5.907   1.00 38.04  ?  165 GLY B CA  1 
ATOM   1653 C  C   . GLY B 2 29  ? 40.861 19.402 4.463   1.00 34.57  ?  165 GLY B C   1 
ATOM   1654 O  O   . GLY B 2 29  ? 41.447 20.170 3.701   1.00 34.51  ?  165 GLY B O   1 
ATOM   1655 N  N   . ILE B 2 30  ? 39.791 18.712 4.103   1.00 28.78  ?  166 ILE B N   1 
ATOM   1656 C  CA  . ILE B 2 30  ? 39.182 18.866 2.780   1.00 30.38  ?  166 ILE B CA  1 
ATOM   1657 C  C   . ILE B 2 30  ? 37.733 19.281 2.923   1.00 33.23  ?  166 ILE B C   1 
ATOM   1658 O  O   . ILE B 2 30  ? 36.956 18.582 3.575   1.00 33.58  ?  166 ILE B O   1 
ATOM   1659 C  CB  . ILE B 2 30  ? 39.275 17.554 1.989   1.00 32.91  ?  166 ILE B CB  1 
ATOM   1660 C  CG1 . ILE B 2 30  ? 40.741 17.241 1.688   1.00 26.52  ?  166 ILE B CG1 1 
ATOM   1661 C  CG2 . ILE B 2 30  ? 38.459 17.643 0.687   1.00 35.49  ?  166 ILE B CG2 1 
ATOM   1662 C  CD1 . ILE B 2 30  ? 40.974 15.839 1.178   1.00 33.09  ?  166 ILE B CD1 1 
ATOM   1663 N  N   . LEU B 2 31  ? 37.358 20.412 2.324   1.00 31.54  ?  167 LEU B N   1 
ATOM   1664 C  CA  . LEU B 2 31  ? 35.965 20.829 2.374   1.00 32.33  ?  167 LEU B CA  1 
ATOM   1665 C  C   . LEU B 2 31  ? 35.045 19.802 1.702   1.00 37.08  ?  167 LEU B C   1 
ATOM   1666 O  O   . LEU B 2 31  ? 35.355 19.280 0.629   1.00 35.99  ?  167 LEU B O   1 
ATOM   1667 C  CB  . LEU B 2 31  ? 35.777 22.197 1.715   1.00 36.67  ?  167 LEU B CB  1 
ATOM   1668 C  CG  . LEU B 2 31  ? 36.449 23.419 2.342   1.00 37.30  ?  167 LEU B CG  1 
ATOM   1669 C  CD1 . LEU B 2 31  ? 36.014 24.643 1.562   1.00 38.33  ?  167 LEU B CD1 1 
ATOM   1670 C  CD2 . LEU B 2 31  ? 36.070 23.566 3.807   1.00 37.84  ?  167 LEU B CD2 1 
ATOM   1671 N  N   . LEU B 2 32  ? 33.921 19.512 2.350   1.00 36.52  ?  168 LEU B N   1 
ATOM   1672 C  CA  . LEU B 2 32  ? 32.919 18.615 1.800   1.00 33.97  ?  168 LEU B CA  1 
ATOM   1673 C  C   . LEU B 2 32  ? 32.474 19.082 0.415   1.00 39.81  ?  168 LEU B C   1 
ATOM   1674 O  O   . LEU B 2 32  ? 32.306 18.261 -0.484  1.00 36.58  ?  168 LEU B O   1 
ATOM   1675 C  CB  . LEU B 2 32  ? 31.699 18.509 2.728   1.00 34.98  ?  168 LEU B CB  1 
ATOM   1676 C  CG  . LEU B 2 32  ? 30.495 17.716 2.205   1.00 34.18  ?  168 LEU B CG  1 
ATOM   1677 C  CD1 . LEU B 2 32  ? 30.903 16.281 1.859   1.00 36.68  ?  168 LEU B CD1 1 
ATOM   1678 C  CD2 . LEU B 2 32  ? 29.354 17.731 3.228   1.00 37.28  ?  168 LEU B CD2 1 
ATOM   1679 N  N   . GLU B 2 33  ? 32.287 20.388 0.236   1.00 35.80  ?  169 GLU B N   1 
ATOM   1680 C  CA  . GLU B 2 33  ? 31.752 20.871 -1.045  1.00 45.53  ?  169 GLU B CA  1 
ATOM   1681 C  C   . GLU B 2 33  ? 32.699 20.557 -2.212  1.00 39.03  ?  169 GLU B C   1 
ATOM   1682 O  O   . GLU B 2 33  ? 32.246 20.344 -3.326  1.00 39.99  ?  169 GLU B O   1 
ATOM   1683 C  CB  . GLU B 2 33  ? 31.471 22.374 -0.995  1.00 41.45  ?  169 GLU B CB  1 
ATOM   1684 C  CG  . GLU B 2 33  ? 32.694 23.186 -0.584  1.00 51.31  ?  169 GLU B CG  1 
ATOM   1685 C  CD  . GLU B 2 33  ? 32.448 24.677 -0.627  1.00 57.00  ?  169 GLU B CD  1 
ATOM   1686 O  OE1 . GLU B 2 33  ? 31.274 25.083 -0.462  1.00 52.96  ?  169 GLU B OE1 1 
ATOM   1687 O  OE2 . GLU B 2 33  ? 33.431 25.436 -0.820  1.00 59.21  ?  169 GLU B OE2 1 
ATOM   1688 N  N   . ASP B 2 34  ? 34.005 20.521 -1.960  1.00 36.23  ?  170 ASP B N   1 
ATOM   1689 C  CA  . ASP B 2 34  ? 34.966 20.159 -3.011  1.00 43.53  ?  170 ASP B CA  1 
ATOM   1690 C  C   . ASP B 2 34  ? 34.800 18.692 -3.398  1.00 45.65  ?  170 ASP B C   1 
ATOM   1691 O  O   . ASP B 2 34  ? 34.947 18.321 -4.563  1.00 47.91  ?  170 ASP B O   1 
ATOM   1692 C  CB  . ASP B 2 34  ? 36.404 20.425 -2.566  1.00 43.93  ?  170 ASP B CB  1 
ATOM   1693 C  CG  . ASP B 2 34  ? 36.695 21.901 -2.401  1.00 46.37  ?  170 ASP B CG  1 
ATOM   1694 O  OD1 . ASP B 2 34  ? 35.944 22.715 -2.959  1.00 43.96  ?  170 ASP B OD1 1 
ATOM   1695 O  OD2 . ASP B 2 34  ? 37.667 22.258 -1.706  1.00 47.86  ?  170 ASP B OD2 1 
ATOM   1696 N  N   . ILE B 2 35  ? 34.462 17.865 -2.419  1.00 42.13  ?  171 ILE B N   1 
ATOM   1697 C  CA  . ILE B 2 35  ? 34.208 16.455 -2.675  1.00 38.12  ?  171 ILE B CA  1 
ATOM   1698 C  C   . ILE B 2 35  ? 32.908 16.300 -3.456  1.00 41.48  ?  171 ILE B C   1 
ATOM   1699 O  O   . ILE B 2 35  ? 32.832 15.505 -4.399  1.00 41.33  ?  171 ILE B O   1 
ATOM   1700 C  CB  . ILE B 2 35  ? 34.161 15.656 -1.362  1.00 41.29  ?  171 ILE B CB  1 
ATOM   1701 C  CG1 . ILE B 2 35  ? 35.562 15.613 -0.736  1.00 42.57  ?  171 ILE B CG1 1 
ATOM   1702 C  CG2 . ILE B 2 35  ? 33.618 14.239 -1.589  1.00 34.06  ?  171 ILE B CG2 1 
ATOM   1703 C  CD1 . ILE B 2 35  ? 36.678 15.266 -1.737  1.00 43.64  ?  171 ILE B CD1 1 
ATOM   1704 N  N   . GLU B 2 36  ? 31.899 17.090 -3.095  1.00 39.08  ?  172 GLU B N   1 
ATOM   1705 C  CA  . GLU B 2 36  ? 30.598 17.024 -3.767  1.00 39.57  ?  172 GLU B CA  1 
ATOM   1706 C  C   . GLU B 2 36  ? 30.715 17.382 -5.239  1.00 45.35  ?  172 GLU B C   1 
ATOM   1707 O  O   . GLU B 2 36  ? 29.944 16.912 -6.081  1.00 46.25  ?  172 GLU B O   1 
ATOM   1708 C  CB  . GLU B 2 36  ? 29.604 17.960 -3.086  1.00 42.94  ?  172 GLU B CB  1 
ATOM   1709 C  CG  . GLU B 2 36  ? 29.428 17.639 -1.610  1.00 47.38  ?  172 GLU B CG  1 
ATOM   1710 C  CD  . GLU B 2 36  ? 28.342 18.457 -0.947  1.00 50.05  ?  172 GLU B CD  1 
ATOM   1711 O  OE1 . GLU B 2 36  ? 28.175 19.649 -1.302  1.00 47.21  ?  172 GLU B OE1 1 
ATOM   1712 O  OE2 . GLU B 2 36  ? 27.654 17.895 -0.065  1.00 50.40  ?  172 GLU B OE2 1 
ATOM   1713 N  N   . GLU B 2 37  ? 31.672 18.240 -5.549  1.00 44.09  ?  173 GLU B N   1 
ATOM   1714 C  CA  . GLU B 2 37  ? 31.877 18.638 -6.927  1.00 52.37  ?  173 GLU B CA  1 
ATOM   1715 C  C   . GLU B 2 37  ? 32.548 17.503 -7.704  1.00 44.25  ?  173 GLU B C   1 
ATOM   1716 O  O   . GLU B 2 37  ? 32.181 17.227 -8.848  1.00 42.82  ?  173 GLU B O   1 
ATOM   1717 C  CB  . GLU B 2 37  ? 32.700 19.918 -6.986  1.00 62.85  ?  173 GLU B CB  1 
ATOM   1718 C  CG  . GLU B 2 37  ? 33.064 20.365 -8.371  1.00 84.13  ?  173 GLU B CG  1 
ATOM   1719 C  CD  . GLU B 2 37  ? 34.199 21.363 -8.343  1.00 104.66 ?  173 GLU B CD  1 
ATOM   1720 O  OE1 . GLU B 2 37  ? 35.315 21.012 -8.782  1.00 110.93 ?  173 GLU B OE1 1 
ATOM   1721 O  OE2 . GLU B 2 37  ? 33.977 22.495 -7.863  1.00 112.76 ?  173 GLU B OE2 1 
ATOM   1722 N  N   . ALA B 2 38  ? 33.493 16.824 -7.057  1.00 42.19  ?  174 ALA B N   1 
ATOM   1723 C  CA  . ALA B 2 38  ? 34.294 15.772 -7.691  1.00 46.30  ?  174 ALA B CA  1 
ATOM   1724 C  C   . ALA B 2 38  ? 33.557 14.443 -7.881  1.00 47.17  ?  174 ALA B C   1 
ATOM   1725 O  O   . ALA B 2 38  ? 33.767 13.751 -8.873  1.00 46.32  ?  174 ALA B O   1 
ATOM   1726 C  CB  . ALA B 2 38  ? 35.571 15.536 -6.882  1.00 40.18  ?  174 ALA B CB  1 
ATOM   1727 N  N   . LEU B 2 39  ? 32.689 14.101 -6.938  1.00 49.28  ?  175 LEU B N   1 
ATOM   1728 C  CA  . LEU B 2 39  ? 32.154 12.752 -6.824  1.00 34.29  ?  175 LEU B CA  1 
ATOM   1729 C  C   . LEU B 2 39  ? 30.632 12.742 -6.917  1.00 43.46  ?  175 LEU B C   1 
ATOM   1730 O  O   . LEU B 2 39  ? 29.943 13.196 -5.990  1.00 43.85  ?  175 LEU B O   1 
ATOM   1731 C  CB  . LEU B 2 39  ? 32.622 12.137 -5.484  1.00 35.97  ?  175 LEU B CB  1 
ATOM   1732 C  CG  . LEU B 2 39  ? 32.207 10.726 -5.061  1.00 38.22  ?  175 LEU B CG  1 
ATOM   1733 C  CD1 . LEU B 2 39  ? 32.762 9.698  -6.016  1.00 47.89  ?  175 LEU B CD1 1 
ATOM   1734 C  CD2 . LEU B 2 39  ? 32.669 10.432 -3.639  1.00 37.93  ?  175 LEU B CD2 1 
ATOM   1735 N  N   . PRO B 2 40  ? 30.092 12.220 -8.031  1.00 40.23  ?  176 PRO B N   1 
ATOM   1736 C  CA  . PRO B 2 40  ? 28.637 12.120 -8.171  1.00 40.59  ?  176 PRO B CA  1 
ATOM   1737 C  C   . PRO B 2 40  ? 28.048 11.308 -7.026  1.00 40.33  ?  176 PRO B C   1 
ATOM   1738 O  O   . PRO B 2 40  ? 28.684 10.336 -6.595  1.00 40.16  ?  176 PRO B O   1 
ATOM   1739 C  CB  . PRO B 2 40  ? 28.448 11.394 -9.508  1.00 43.09  ?  176 PRO B CB  1 
ATOM   1740 C  CG  . PRO B 2 40  ? 29.713 11.606 -10.251 1.00 45.10  ?  176 PRO B CG  1 
ATOM   1741 C  CD  . PRO B 2 40  ? 30.801 11.669 -9.199  1.00 45.86  ?  176 PRO B CD  1 
ATOM   1742 N  N   . ASN B 2 41  ? 26.875 11.703 -6.542  1.00 41.21  ?  177 ASN B N   1 
ATOM   1743 C  CA  . ASN B 2 41  ? 26.214 10.982 -5.463  1.00 41.35  ?  177 ASN B CA  1 
ATOM   1744 C  C   . ASN B 2 41  ? 27.146 10.809 -4.260  1.00 40.51  ?  177 ASN B C   1 
ATOM   1745 O  O   . ASN B 2 41  ? 27.155 9.758  -3.620  1.00 45.71  ?  177 ASN B O   1 
ATOM   1746 C  CB  . ASN B 2 41  ? 25.732 9.620  -5.955  1.00 42.90  ?  177 ASN B CB  1 
ATOM   1747 C  CG  . ASN B 2 41  ? 24.766 8.967  -4.996  1.00 52.47  ?  177 ASN B CG  1 
ATOM   1748 O  OD1 . ASN B 2 41  ? 24.113 9.649  -4.215  1.00 50.93  ?  177 ASN B OD1 1 
ATOM   1749 N  ND2 . ASN B 2 41  ? 24.674 7.643  -5.042  1.00 45.48  ?  177 ASN B ND2 1 
ATOM   1750 N  N   . SER B 2 42  ? 27.945 11.834 -3.975  1.00 40.07  ?  178 SER B N   1 
ATOM   1751 C  CA  . SER B 2 42  ? 28.918 11.775 -2.887  1.00 42.74  ?  178 SER B CA  1 
ATOM   1752 C  C   . SER B 2 42  ? 28.308 11.331 -1.556  1.00 46.98  ?  178 SER B C   1 
ATOM   1753 O  O   . SER B 2 42  ? 29.007 10.790 -0.707  1.00 46.75  ?  178 SER B O   1 
ATOM   1754 C  CB  . SER B 2 42  ? 29.594 13.135 -2.686  1.00 45.26  ?  178 SER B CB  1 
ATOM   1755 O  OG  . SER B 2 42  ? 28.626 14.165 -2.559  1.00 51.25  ?  178 SER B OG  1 
ATOM   1756 N  N   . GLN B 2 43  ? 27.014 11.558 -1.363  1.00 52.47  ?  179 GLN B N   1 
ATOM   1757 C  CA  . GLN B 2 43  ? 26.401 11.212 -0.079  1.00 56.44  ?  179 GLN B CA  1 
ATOM   1758 C  C   . GLN B 2 43  ? 26.450 9.710  0.207   1.00 51.79  ?  179 GLN B C   1 
ATOM   1759 O  O   . GLN B 2 43  ? 26.638 9.303  1.347   1.00 55.85  ?  179 GLN B O   1 
ATOM   1760 C  CB  . GLN B 2 43  ? 24.963 11.723 -0.021  1.00 67.52  ?  179 GLN B CB  1 
ATOM   1761 C  CG  . GLN B 2 43  ? 24.916 13.162 0.465   1.00 82.94  ?  179 GLN B CG  1 
ATOM   1762 C  CD  . GLN B 2 43  ? 23.513 13.674 0.741   1.00 95.80  ?  179 GLN B CD  1 
ATOM   1763 O  OE1 . GLN B 2 43  ? 22.576 13.416 -0.019  1.00 96.89  ?  179 GLN B OE1 1 
ATOM   1764 N  NE2 . GLN B 2 43  ? 23.363 14.405 1.848   1.00 98.35  ?  179 GLN B NE2 1 
ATOM   1765 N  N   . LYS B 2 44  ? 26.293 8.898  -0.832  1.00 51.22  ?  180 LYS B N   1 
ATOM   1766 C  CA  . LYS B 2 44  ? 26.418 7.448  -0.732  1.00 50.69  ?  180 LYS B CA  1 
ATOM   1767 C  C   . LYS B 2 44  ? 27.808 7.046  -0.256  1.00 48.28  ?  180 LYS B C   1 
ATOM   1768 O  O   . LYS B 2 44  ? 27.948 6.281  0.712   1.00 44.43  ?  180 LYS B O   1 
ATOM   1769 C  CB  . LYS B 2 44  ? 26.123 6.791  -2.086  1.00 57.43  ?  180 LYS B CB  1 
ATOM   1770 C  CG  . LYS B 2 44  ? 26.056 5.251  -2.071  1.00 59.36  ?  180 LYS B CG  1 
ATOM   1771 C  CD  . LYS B 2 44  ? 25.843 4.714  -3.491  1.00 59.19  ?  180 LYS B CD  1 
ATOM   1772 C  CE  . LYS B 2 44  ? 26.005 3.208  -3.585  1.00 58.37  ?  180 LYS B CE  1 
ATOM   1773 N  NZ  . LYS B 2 44  ? 24.823 2.478  -3.072  1.00 71.25  ?  180 LYS B NZ  1 
ATOM   1774 N  N   . ALA B 2 45  ? 28.840 7.540  -0.939  1.00 43.00  ?  181 ALA B N   1 
ATOM   1775 C  CA  . ALA B 2 45  ? 30.217 7.165  -0.578  1.00 46.11  ?  181 ALA B CA  1 
ATOM   1776 C  C   . ALA B 2 45  ? 30.563 7.622  0.831   1.00 45.75  ?  181 ALA B C   1 
ATOM   1777 O  O   . ALA B 2 45  ? 31.140 6.863  1.618   1.00 54.96  ?  181 ALA B O   1 
ATOM   1778 C  CB  . ALA B 2 45  ? 31.220 7.740  -1.578  1.00 40.94  ?  181 ALA B CB  1 
ATOM   1779 N  N   . VAL B 2 46  ? 30.226 8.868  1.148   1.00 40.36  ?  182 VAL B N   1 
ATOM   1780 C  CA  . VAL B 2 46  ? 30.579 9.420  2.447   1.00 41.28  ?  182 VAL B CA  1 
ATOM   1781 C  C   . VAL B 2 46  ? 29.896 8.620  3.560   1.00 46.20  ?  182 VAL B C   1 
ATOM   1782 O  O   . VAL B 2 46  ? 30.531 8.270  4.547   1.00 46.64  ?  182 VAL B O   1 
ATOM   1783 C  CB  . VAL B 2 46  ? 30.210 10.916 2.547   1.00 43.47  ?  182 VAL B CB  1 
ATOM   1784 C  CG1 . VAL B 2 46  ? 30.285 11.407 4.005   1.00 46.03  ?  182 VAL B CG1 1 
ATOM   1785 C  CG2 . VAL B 2 46  ? 31.133 11.739 1.662   1.00 42.89  ?  182 VAL B CG2 1 
ATOM   1786 N  N   . LYS B 2 47  ? 28.617 8.295  3.383   1.00 49.98  ?  183 LYS B N   1 
ATOM   1787 C  CA  . LYS B 2 47  ? 27.906 7.509  4.387   1.00 56.01  ?  183 LYS B CA  1 
ATOM   1788 C  C   . LYS B 2 47  ? 28.483 6.109  4.530   1.00 56.70  ?  183 LYS B C   1 
ATOM   1789 O  O   . LYS B 2 47  ? 28.631 5.613  5.645   1.00 56.67  ?  183 LYS B O   1 
ATOM   1790 C  CB  . LYS B 2 47  ? 26.422 7.409  4.065   1.00 60.19  ?  183 LYS B CB  1 
ATOM   1791 C  CG  . LYS B 2 47  ? 25.625 8.626  4.473   1.00 69.62  ?  183 LYS B CG  1 
ATOM   1792 C  CD  . LYS B 2 47  ? 24.151 8.273  4.621   1.00 80.40  ?  183 LYS B CD  1 
ATOM   1793 C  CE  . LYS B 2 47  ? 23.954 6.999  5.451   1.00 88.02  ?  183 LYS B CE  1 
ATOM   1794 N  NZ  . LYS B 2 47  ? 23.198 7.198  6.731   1.00 87.62  ?  183 LYS B NZ  1 
ATOM   1795 N  N   . ALA B 2 48  ? 28.797 5.477  3.400   1.00 53.29  ?  184 ALA B N   1 
ATOM   1796 C  CA  . ALA B 2 48  ? 29.368 4.134  3.385   1.00 49.02  ?  184 ALA B CA  1 
ATOM   1797 C  C   . ALA B 2 48  ? 30.647 4.041  4.216   1.00 57.68  ?  184 ALA B C   1 
ATOM   1798 O  O   . ALA B 2 48  ? 30.903 3.027  4.879   1.00 58.02  ?  184 ALA B O   1 
ATOM   1799 C  CB  . ALA B 2 48  ? 29.639 3.708  1.953   1.00 46.12  ?  184 ALA B CB  1 
ATOM   1800 N  N   . LEU B 2 49  ? 31.442 5.108  4.188   1.00 54.55  ?  185 LEU B N   1 
ATOM   1801 C  CA  . LEU B 2 49  ? 32.730 5.112  4.858   1.00 48.27  ?  185 LEU B CA  1 
ATOM   1802 C  C   . LEU B 2 49  ? 32.592 5.315  6.360   1.00 51.47  ?  185 LEU B C   1 
ATOM   1803 O  O   . LEU B 2 49  ? 33.557 5.130  7.092   1.00 49.64  ?  185 LEU B O   1 
ATOM   1804 C  CB  . LEU B 2 49  ? 33.638 6.189  4.275   1.00 37.21  ?  185 LEU B CB  1 
ATOM   1805 C  CG  . LEU B 2 49  ? 34.204 5.928  2.886   1.00 44.52  ?  185 LEU B CG  1 
ATOM   1806 C  CD1 . LEU B 2 49  ? 34.956 7.152  2.380   1.00 37.35  ?  185 LEU B CD1 1 
ATOM   1807 C  CD2 . LEU B 2 49  ? 35.092 4.678  2.888   1.00 44.72  ?  185 LEU B CD2 1 
ATOM   1808 N  N   . GLY B 2 50  ? 31.406 5.711  6.811   1.00 53.77  ?  186 GLY B N   1 
ATOM   1809 C  CA  . GLY B 2 50  ? 31.104 5.776  8.240   1.00 49.35  ?  186 GLY B CA  1 
ATOM   1810 C  C   . GLY B 2 50  ? 32.095 6.572  9.073   1.00 52.00  ?  186 GLY B C   1 
ATOM   1811 O  O   . GLY B 2 50  ? 32.455 7.692  8.711   1.00 53.25  ?  186 GLY B O   1 
ATOM   1812 N  N   . ASP B 2 51  ? 32.557 5.995  10.182  1.00 46.26  ?  187 ASP B N   1 
ATOM   1813 C  CA  . ASP B 2 51  ? 33.414 6.733  11.104  1.00 50.36  ?  187 ASP B CA  1 
ATOM   1814 C  C   . ASP B 2 51  ? 34.881 6.725  10.675  1.00 44.62  ?  187 ASP B C   1 
ATOM   1815 O  O   . ASP B 2 51  ? 35.766 7.077  11.452  1.00 52.86  ?  187 ASP B O   1 
ATOM   1816 C  CB  . ASP B 2 51  ? 33.279 6.188  12.543  1.00 52.38  ?  187 ASP B CB  1 
ATOM   1817 C  CG  . ASP B 2 51  ? 33.630 4.704  12.666  1.00 58.98  ?  187 ASP B CG  1 
ATOM   1818 O  OD1 . ASP B 2 51  ? 34.100 4.084  11.690  1.00 62.60  ?  187 ASP B OD1 1 
ATOM   1819 O  OD2 . ASP B 2 51  ? 33.431 4.154  13.767  1.00 71.18  ?  187 ASP B OD2 1 
ATOM   1820 N  N   . GLN B 2 52  ? 35.145 6.345  9.434   1.00 46.40  ?  188 GLN B N   1 
ATOM   1821 C  CA  . GLN B 2 52  ? 36.491 6.494  8.892   1.00 43.17  ?  188 GLN B CA  1 
ATOM   1822 C  C   . GLN B 2 52  ? 36.772 7.958  8.557   1.00 40.61  ?  188 GLN B C   1 
ATOM   1823 O  O   . GLN B 2 52  ? 37.914 8.352  8.292   1.00 45.71  ?  188 GLN B O   1 
ATOM   1824 C  CB  . GLN B 2 52  ? 36.660 5.608  7.664   1.00 47.04  ?  188 GLN B CB  1 
ATOM   1825 C  CG  . GLN B 2 52  ? 36.345 4.169  7.990   1.00 54.52  ?  188 GLN B CG  1 
ATOM   1826 C  CD  . GLN B 2 52  ? 36.505 3.256  6.807   1.00 55.96  ?  188 GLN B CD  1 
ATOM   1827 O  OE1 . GLN B 2 52  ? 35.541 2.954  6.101   1.00 57.84  ?  188 GLN B OE1 1 
ATOM   1828 N  NE2 . GLN B 2 52  ? 37.726 2.795  6.590   1.00 51.85  ?  188 GLN B NE2 1 
ATOM   1829 N  N   . ILE B 2 53  ? 35.719 8.763  8.571   1.00 34.09  ?  189 ILE B N   1 
ATOM   1830 C  CA  . ILE B 2 53  ? 35.847 10.187 8.313   1.00 37.33  ?  189 ILE B CA  1 
ATOM   1831 C  C   . ILE B 2 53  ? 35.498 10.991 9.544   1.00 45.05  ?  189 ILE B C   1 
ATOM   1832 O  O   . ILE B 2 53  ? 34.544 10.666 10.240  1.00 41.13  ?  189 ILE B O   1 
ATOM   1833 C  CB  . ILE B 2 53  ? 34.926 10.611 7.167   1.00 40.81  ?  189 ILE B CB  1 
ATOM   1834 C  CG1 . ILE B 2 53  ? 35.277 9.829  5.902   1.00 37.29  ?  189 ILE B CG1 1 
ATOM   1835 C  CG2 . ILE B 2 53  ? 35.008 12.114 6.923   1.00 43.99  ?  189 ILE B CG2 1 
ATOM   1836 C  CD1 . ILE B 2 53  ? 34.235 9.968  4.836   1.00 37.40  ?  189 ILE B CD1 1 
ATOM   1837 N  N   . LEU B 2 54  ? 36.259 12.044 9.812   1.00 46.25  ?  190 LEU B N   1 
ATOM   1838 C  CA  . LEU B 2 54  ? 35.880 12.981 10.861  1.00 37.62  ?  190 LEU B CA  1 
ATOM   1839 C  C   . LEU B 2 54  ? 35.389 14.288 10.229  1.00 41.83  ?  190 LEU B C   1 
ATOM   1840 O  O   . LEU B 2 54  ? 35.980 14.793 9.260   1.00 36.31  ?  190 LEU B O   1 
ATOM   1841 C  CB  . LEU B 2 54  ? 37.057 13.241 11.792  1.00 32.25  ?  190 LEU B CB  1 
ATOM   1842 C  CG  . LEU B 2 54  ? 37.595 12.070 12.620  1.00 45.15  ?  190 LEU B CG  1 
ATOM   1843 C  CD1 . LEU B 2 54  ? 38.905 12.480 13.262  1.00 48.13  ?  190 LEU B CD1 1 
ATOM   1844 C  CD2 . LEU B 2 54  ? 36.616 11.616 13.714  1.00 46.72  ?  190 LEU B CD2 1 
ATOM   1845 N  N   . PHE B 2 55  ? 34.300 14.820 10.777  1.00 41.54  ?  191 PHE B N   1 
ATOM   1846 C  CA  . PHE B 2 55  ? 33.676 16.039 10.281  1.00 36.69  ?  191 PHE B CA  1 
ATOM   1847 C  C   . PHE B 2 55  ? 33.806 17.181 11.267  1.00 44.31  ?  191 PHE B C   1 
ATOM   1848 O  O   . PHE B 2 55  ? 33.480 17.030 12.442  1.00 49.32  ?  191 PHE B O   1 
ATOM   1849 C  CB  . PHE B 2 55  ? 32.192 15.805 9.998   1.00 36.83  ?  191 PHE B CB  1 
ATOM   1850 C  CG  . PHE B 2 55  ? 31.925 14.665 9.066   1.00 44.57  ?  191 PHE B CG  1 
ATOM   1851 C  CD1 . PHE B 2 55  ? 31.830 13.370 9.547   1.00 51.29  ?  191 PHE B CD1 1 
ATOM   1852 C  CD2 . PHE B 2 55  ? 31.759 14.888 7.711   1.00 43.24  ?  191 PHE B CD2 1 
ATOM   1853 C  CE1 . PHE B 2 55  ? 31.590 12.317 8.688   1.00 53.83  ?  191 PHE B CE1 1 
ATOM   1854 C  CE2 . PHE B 2 55  ? 31.517 13.842 6.851   1.00 46.85  ?  191 PHE B CE2 1 
ATOM   1855 C  CZ  . PHE B 2 55  ? 31.433 12.553 7.337   1.00 50.02  ?  191 PHE B CZ  1 
ATOM   1856 N  N   . VAL B 2 56  ? 34.270 18.326 10.790  1.00 37.40  ?  192 VAL B N   1 
ATOM   1857 C  CA  . VAL B 2 56  ? 34.218 19.546 11.578  1.00 38.13  ?  192 VAL B CA  1 
ATOM   1858 C  C   . VAL B 2 56  ? 33.292 20.536 10.910  1.00 44.04  ?  192 VAL B C   1 
ATOM   1859 O  O   . VAL B 2 56  ? 33.366 20.719 9.687   1.00 42.00  ?  192 VAL B O   1 
ATOM   1860 C  CB  . VAL B 2 56  ? 35.594 20.171 11.731  1.00 40.47  ?  192 VAL B CB  1 
ATOM   1861 C  CG1 . VAL B 2 56  ? 35.494 21.568 12.398  1.00 32.86  ?  192 VAL B CG1 1 
ATOM   1862 C  CG2 . VAL B 2 56  ? 36.489 19.239 12.528  1.00 40.25  ?  192 VAL B CG2 1 
ATOM   1863 N  N   . ASN B 2 57  ? 32.416 21.153 11.703  1.00 38.75  ?  193 ASN B N   1 
ATOM   1864 C  CA  . ASN B 2 57  ? 31.526 22.201 11.226  1.00 42.25  ?  193 ASN B CA  1 
ATOM   1865 C  C   . ASN B 2 57  ? 32.129 23.579 11.427  1.00 48.16  ?  193 ASN B C   1 
ATOM   1866 O  O   . ASN B 2 57  ? 32.522 23.934 12.529  1.00 56.84  ?  193 ASN B O   1 
ATOM   1867 C  CB  . ASN B 2 57  ? 30.162 22.144 11.940  1.00 44.26  ?  193 ASN B CB  1 
ATOM   1868 C  CG  . ASN B 2 57  ? 29.380 20.882 11.612  1.00 51.01  ?  193 ASN B CG  1 
ATOM   1869 O  OD1 . ASN B 2 57  ? 29.177 20.544 10.444  1.00 51.28  ?  193 ASN B OD1 1 
ATOM   1870 N  ND2 . ASN B 2 57  ? 28.934 20.178 12.646  1.00 58.34  ?  193 ASN B ND2 1 
ATOM   1871 N  N   . ARG B 2 58  ? 32.205 24.358 10.359  1.00 43.19  ?  194 ARG B N   1 
ATOM   1872 C  CA  . ARG B 2 58  ? 32.609 25.749 10.487  1.00 45.40  ?  194 ARG B CA  1 
ATOM   1873 C  C   . ARG B 2 58  ? 31.382 26.568 10.848  1.00 53.58  ?  194 ARG B C   1 
ATOM   1874 O  O   . ARG B 2 58  ? 30.269 26.071 10.732  1.00 59.66  ?  194 ARG B O   1 
ATOM   1875 C  CB  . ARG B 2 58  ? 33.234 26.258 9.187   1.00 39.35  ?  194 ARG B CB  1 
ATOM   1876 C  CG  . ARG B 2 58  ? 34.410 25.445 8.689   1.00 45.91  ?  194 ARG B CG  1 
ATOM   1877 C  CD  . ARG B 2 58  ? 34.764 25.902 7.268   1.00 57.33  ?  194 ARG B CD  1 
ATOM   1878 N  NE  . ARG B 2 58  ? 35.047 27.329 7.301   1.00 68.09  ?  194 ARG B NE  1 
ATOM   1879 C  CZ  . ARG B 2 58  ? 35.180 28.094 6.233   1.00 66.72  ?  194 ARG B CZ  1 
ATOM   1880 N  NH1 . ARG B 2 58  ? 35.049 27.567 5.034   1.00 65.53  ?  194 ARG B NH1 1 
ATOM   1881 N  NH2 . ARG B 2 58  ? 35.435 29.388 6.378   1.00 72.45  ?  194 ARG B NH2 1 
ATOM   1882 N  N   . PRO B 2 59  ? 31.583 27.818 11.309  1.00 58.02  ?  195 PRO B N   1 
ATOM   1883 C  CA  . PRO B 2 59  ? 30.488 28.766 11.540  1.00 57.47  ?  195 PRO B CA  1 
ATOM   1884 C  C   . PRO B 2 59  ? 29.570 29.018 10.336  1.00 58.94  ?  195 PRO B C   1 
ATOM   1885 O  O   . PRO B 2 59  ? 28.391 29.311 10.542  1.00 60.11  ?  195 PRO B O   1 
ATOM   1886 C  CB  . PRO B 2 59  ? 31.229 30.053 11.922  1.00 61.56  ?  195 PRO B CB  1 
ATOM   1887 C  CG  . PRO B 2 59  ? 32.445 29.577 12.601  1.00 55.43  ?  195 PRO B CG  1 
ATOM   1888 C  CD  . PRO B 2 59  ? 32.848 28.301 11.902  1.00 54.83  ?  195 PRO B CD  1 
ATOM   1889 N  N   . ASP B 2 60  ? 30.081 28.922 9.111   1.00 59.25  ?  196 ASP B N   1 
ATOM   1890 C  CA  . ASP B 2 60  ? 29.217 29.113 7.947   1.00 58.98  ?  196 ASP B CA  1 
ATOM   1891 C  C   . ASP B 2 60  ? 28.504 27.820 7.538   1.00 63.84  ?  196 ASP B C   1 
ATOM   1892 O  O   . ASP B 2 60  ? 27.876 27.755 6.481   1.00 67.07  ?  196 ASP B O   1 
ATOM   1893 C  CB  . ASP B 2 60  ? 30.007 29.674 6.758   1.00 57.63  ?  196 ASP B CB  1 
ATOM   1894 C  CG  . ASP B 2 60  ? 31.264 28.868 6.435   1.00 61.19  ?  196 ASP B CG  1 
ATOM   1895 O  OD1 . ASP B 2 60  ? 31.387 27.694 6.863   1.00 56.62  ?  196 ASP B OD1 1 
ATOM   1896 O  OD2 . ASP B 2 60  ? 32.126 29.424 5.718   1.00 62.78  ?  196 ASP B OD2 1 
ATOM   1897 N  N   . LYS B 2 61  ? 28.613 26.808 8.397   1.00 61.99  ?  197 LYS B N   1 
ATOM   1898 C  CA  . LYS B 2 61  ? 28.009 25.477 8.237   1.00 56.54  ?  197 LYS B CA  1 
ATOM   1899 C  C   . LYS B 2 61  ? 28.601 24.651 7.093   1.00 53.10  ?  197 LYS B C   1 
ATOM   1900 O  O   . LYS B 2 61  ? 28.050 23.613 6.736   1.00 61.17  ?  197 LYS B O   1 
ATOM   1901 C  CB  . LYS B 2 61  ? 26.488 25.581 8.076   1.00 61.52  ?  197 LYS B CB  1 
ATOM   1902 C  CG  . LYS B 2 61  ? 25.847 26.578 9.041   1.00 78.82  ?  197 LYS B CG  1 
ATOM   1903 C  CD  . LYS B 2 61  ? 24.680 27.331 8.415   1.00 96.08  ?  197 LYS B CD  1 
ATOM   1904 C  CE  . LYS B 2 61  ? 24.007 28.250 9.436   1.00 105.82 ?  197 LYS B CE  1 
ATOM   1905 N  NZ  . LYS B 2 61  ? 23.818 27.613 10.770  1.00 108.60 ?  197 LYS B NZ  1 
ATOM   1906 N  N   . LYS B 2 62  ? 29.731 25.084 6.542   1.00 46.52  ?  198 LYS B N   1 
ATOM   1907 C  CA  . LYS B 2 62  ? 30.490 24.212 5.645   1.00 45.66  ?  198 LYS B CA  1 
ATOM   1908 C  C   . LYS B 2 62  ? 31.182 23.116 6.464   1.00 46.40  ?  198 LYS B C   1 
ATOM   1909 O  O   . LYS B 2 62  ? 31.650 23.361 7.576   1.00 43.01  ?  198 LYS B O   1 
ATOM   1910 C  CB  . LYS B 2 62  ? 31.537 24.994 4.846   1.00 44.85  ?  198 LYS B CB  1 
ATOM   1911 C  CG  . LYS B 2 62  ? 31.005 26.162 4.016   1.00 47.03  ?  198 LYS B CG  1 
ATOM   1912 C  CD  . LYS B 2 62  ? 32.020 26.533 2.949   1.00 50.57  ?  198 LYS B CD  1 
ATOM   1913 C  CE  . LYS B 2 62  ? 31.627 27.785 2.186   1.00 62.39  ?  198 LYS B CE  1 
ATOM   1914 N  NZ  . LYS B 2 62  ? 32.664 28.117 1.171   1.00 66.36  ?  198 LYS B NZ  1 
ATOM   1915 N  N   . LYS B 2 63  ? 31.260 21.919 5.905   1.00 39.50  ?  199 LYS B N   1 
ATOM   1916 C  CA  . LYS B 2 63  ? 31.839 20.790 6.608   1.00 39.63  ?  199 LYS B CA  1 
ATOM   1917 C  C   . LYS B 2 63  ? 33.242 20.488 6.110   1.00 38.10  ?  199 LYS B C   1 
ATOM   1918 O  O   . LYS B 2 63  ? 33.506 20.524 4.907   1.00 38.56  ?  199 LYS B O   1 
ATOM   1919 C  CB  . LYS B 2 63  ? 30.953 19.556 6.450   1.00 39.46  ?  199 LYS B CB  1 
ATOM   1920 C  CG  . LYS B 2 63  ? 29.660 19.646 7.221   1.00 46.41  ?  199 LYS B CG  1 
ATOM   1921 C  CD  . LYS B 2 63  ? 29.088 18.275 7.462   1.00 53.80  ?  199 LYS B CD  1 
ATOM   1922 C  CE  . LYS B 2 63  ? 27.782 18.376 8.222   1.00 68.59  ?  199 LYS B CE  1 
ATOM   1923 N  NZ  . LYS B 2 63  ? 26.852 19.264 7.481   1.00 82.55  ?  199 LYS B NZ  1 
ATOM   1924 N  N   . ILE B 2 64  ? 34.141 20.187 7.037   1.00 32.41  ?  200 ILE B N   1 
ATOM   1925 C  CA  . ILE B 2 64  ? 35.494 19.808 6.674   1.00 34.82  ?  200 ILE B CA  1 
ATOM   1926 C  C   . ILE B 2 64  ? 35.719 18.338 6.996   1.00 39.73  ?  200 ILE B C   1 
ATOM   1927 O  O   . ILE B 2 64  ? 35.322 17.875 8.074   1.00 39.89  ?  200 ILE B O   1 
ATOM   1928 C  CB  . ILE B 2 64  ? 36.535 20.643 7.429   1.00 31.31  ?  200 ILE B CB  1 
ATOM   1929 C  CG1 . ILE B 2 64  ? 36.116 22.100 7.503   1.00 34.30  ?  200 ILE B CG1 1 
ATOM   1930 C  CG2 . ILE B 2 64  ? 37.888 20.527 6.768   1.00 28.75  ?  200 ILE B CG2 1 
ATOM   1931 C  CD1 . ILE B 2 64  ? 36.829 22.840 8.673   1.00 34.11  ?  200 ILE B CD1 1 
ATOM   1932 N  N   . LEU B 2 65  ? 36.395 17.621 6.095   1.00 32.74  ?  201 LEU B N   1 
ATOM   1933 C  CA  . LEU B 2 65  ? 36.610 16.183 6.264   1.00 31.35  ?  201 LEU B CA  1 
ATOM   1934 C  C   . LEU B 2 65  ? 38.061 15.875 6.581   1.00 34.81  ?  201 LEU B C   1 
ATOM   1935 O  O   . LEU B 2 65  ? 38.985 16.432 5.964   1.00 33.52  ?  201 LEU B O   1 
ATOM   1936 C  CB  . LEU B 2 65  ? 36.210 15.394 5.004   1.00 29.85  ?  201 LEU B CB  1 
ATOM   1937 C  CG  . LEU B 2 65  ? 34.884 15.646 4.278   1.00 38.67  ?  201 LEU B CG  1 
ATOM   1938 C  CD1 . LEU B 2 65  ? 34.493 14.431 3.429   1.00 39.08  ?  201 LEU B CD1 1 
ATOM   1939 C  CD2 . LEU B 2 65  ? 33.758 16.016 5.219   1.00 34.96  ?  201 LEU B CD2 1 
ATOM   1940 N  N   . PHE B 2 66  ? 38.243 14.955 7.519   1.00 31.92  ?  202 PHE B N   1 
ATOM   1941 C  CA  . PHE B 2 66  ? 39.553 14.483 7.968   1.00 29.00  ?  202 PHE B CA  1 
ATOM   1942 C  C   . PHE B 2 66  ? 39.524 12.966 8.058   1.00 29.66  ?  202 PHE B C   1 
ATOM   1943 O  O   . PHE B 2 66  ? 38.519 12.378 8.446   1.00 35.01  ?  202 PHE B O   1 
ATOM   1944 C  CB  . PHE B 2 66  ? 39.915 15.059 9.341   1.00 31.72  ?  202 PHE B CB  1 
ATOM   1945 C  CG  . PHE B 2 66  ? 40.039 16.554 9.367   1.00 31.90  ?  202 PHE B CG  1 
ATOM   1946 C  CD1 . PHE B 2 66  ? 38.916 17.349 9.511   1.00 32.26  ?  202 PHE B CD1 1 
ATOM   1947 C  CD2 . PHE B 2 66  ? 41.293 17.161 9.266   1.00 32.85  ?  202 PHE B CD2 1 
ATOM   1948 C  CE1 . PHE B 2 66  ? 39.033 18.729 9.565   1.00 33.52  ?  202 PHE B CE1 1 
ATOM   1949 C  CE2 . PHE B 2 66  ? 41.421 18.549 9.309   1.00 29.17  ?  202 PHE B CE2 1 
ATOM   1950 C  CZ  . PHE B 2 66  ? 40.290 19.329 9.447   1.00 28.52  ?  202 PHE B CZ  1 
ATOM   1951 N  N   . PHE B 2 67  ? 40.627 12.334 7.699   1.00 31.69  ?  203 PHE B N   1 
ATOM   1952 C  CA  . PHE B 2 67  ? 40.769 10.922 7.948   1.00 30.32  ?  203 PHE B CA  1 
ATOM   1953 C  C   . PHE B 2 67  ? 40.703 10.662 9.460   1.00 40.98  ?  203 PHE B C   1 
ATOM   1954 O  O   . PHE B 2 67  ? 41.346 11.367 10.236  1.00 36.65  ?  203 PHE B O   1 
ATOM   1955 C  CB  . PHE B 2 67  ? 42.084 10.439 7.391   1.00 31.28  ?  203 PHE B CB  1 
ATOM   1956 C  CG  . PHE B 2 67  ? 42.316 8.979  7.562   1.00 41.51  ?  203 PHE B CG  1 
ATOM   1957 C  CD1 . PHE B 2 67  ? 41.575 8.061  6.834   1.00 35.65  ?  203 PHE B CD1 1 
ATOM   1958 C  CD2 . PHE B 2 67  ? 43.306 8.520  8.428   1.00 41.80  ?  203 PHE B CD2 1 
ATOM   1959 C  CE1 . PHE B 2 67  ? 41.799 6.704  6.969   1.00 46.13  ?  203 PHE B CE1 1 
ATOM   1960 C  CE2 . PHE B 2 67  ? 43.542 7.163  8.570   1.00 41.58  ?  203 PHE B CE2 1 
ATOM   1961 C  CZ  . PHE B 2 67  ? 42.788 6.253  7.849   1.00 50.47  ?  203 PHE B CZ  1 
ATOM   1962 N  N   . ASN B 2 68  ? 39.926 9.667  9.869   1.00 35.29  ?  204 ASN B N   1 
ATOM   1963 C  CA  . ASN B 2 68  ? 39.935 9.235  11.259  1.00 38.63  ?  204 ASN B CA  1 
ATOM   1964 C  C   . ASN B 2 68  ? 40.970 8.159  11.484  1.00 40.52  ?  204 ASN B C   1 
ATOM   1965 O  O   . ASN B 2 68  ? 40.750 7.012  11.122  1.00 39.95  ?  204 ASN B O   1 
ATOM   1966 C  CB  . ASN B 2 68  ? 38.566 8.717  11.687  1.00 40.47  ?  204 ASN B CB  1 
ATOM   1967 C  CG  . ASN B 2 68  ? 38.521 8.344  13.177  1.00 46.85  ?  204 ASN B CG  1 
ATOM   1968 O  OD1 . ASN B 2 68  ? 39.470 8.595  13.919  1.00 44.75  ?  204 ASN B OD1 1 
ATOM   1969 N  ND2 . ASN B 2 68  ? 37.408 7.764  13.611  1.00 36.04  ?  204 ASN B ND2 1 
ATOM   1970 N  N   . ASP B 2 69  ? 42.099 8.529  12.082  1.00 42.28  ?  205 ASP B N   1 
ATOM   1971 C  CA  . ASP B 2 69  ? 43.055 7.541  12.567  1.00 46.74  ?  205 ASP B CA  1 
ATOM   1972 C  C   . ASP B 2 69  ? 42.565 6.965  13.895  1.00 55.86  ?  205 ASP B C   1 
ATOM   1973 O  O   . ASP B 2 69  ? 42.499 7.663  14.911  1.00 52.72  ?  205 ASP B O   1 
ATOM   1974 C  CB  . ASP B 2 69  ? 44.440 8.148  12.749  1.00 47.67  ?  205 ASP B CB  1 
ATOM   1975 C  CG  . ASP B 2 69  ? 45.456 7.133  13.237  1.00 57.54  ?  205 ASP B CG  1 
ATOM   1976 O  OD1 . ASP B 2 69  ? 45.125 5.927  13.317  1.00 60.11  ?  205 ASP B OD1 1 
ATOM   1977 O  OD2 . ASP B 2 69  ? 46.603 7.532  13.513  1.00 58.87  ?  205 ASP B OD2 1 
ATOM   1978 N  N   . LYS B 2 70  ? 42.246 5.679  13.885  1.00 57.45  ?  206 LYS B N   1 
ATOM   1979 C  CA  . LYS B 2 70  ? 41.698 5.031  15.063  1.00 56.91  ?  206 LYS B CA  1 
ATOM   1980 C  C   . LYS B 2 70  ? 42.781 4.419  15.957  1.00 63.57  ?  206 LYS B C   1 
ATOM   1981 O  O   . LYS B 2 70  ? 42.478 3.661  16.871  1.00 66.50  ?  206 LYS B O   1 
ATOM   1982 C  CB  . LYS B 2 70  ? 40.696 3.967  14.637  1.00 55.62  ?  206 LYS B CB  1 
ATOM   1983 C  CG  . LYS B 2 70  ? 39.623 4.509  13.695  1.00 56.08  ?  206 LYS B CG  1 
ATOM   1984 C  CD  . LYS B 2 70  ? 38.583 3.460  13.370  1.00 54.09  ?  206 LYS B CD  1 
ATOM   1985 C  CE  . LYS B 2 70  ? 37.483 4.030  12.504  1.00 56.39  ?  206 LYS B CE  1 
ATOM   1986 N  NZ  . LYS B 2 70  ? 36.342 3.076  12.366  1.00 60.62  ?  206 LYS B NZ  1 
ATOM   1987 N  N   . SER B 2 71  ? 44.038 4.754  15.688  1.00 63.41  ?  207 SER B N   1 
ATOM   1988 C  CA  . SER B 2 71  ? 45.138 4.263  16.506  1.00 72.70  ?  207 SER B CA  1 
ATOM   1989 C  C   . SER B 2 71  ? 44.966 4.797  17.907  1.00 78.80  ?  207 SER B C   1 
ATOM   1990 O  O   . SER B 2 71  ? 44.854 4.038  18.867  1.00 84.86  ?  207 SER B O   1 
ATOM   1991 C  CB  . SER B 2 71  ? 46.486 4.682  15.932  1.00 69.40  ?  207 SER B CB  1 
ATOM   1992 O  OG  . SER B 2 71  ? 46.803 3.878  14.815  1.00 72.35  ?  207 SER B OG  1 
ATOM   1993 N  N   . CYS B 2 72  ? 44.933 6.116  18.023  1.00 77.36  ?  208 CYS B N   1 
ATOM   1994 C  CA  . CYS B 2 72  ? 44.528 6.706  19.277  1.00 73.24  ?  208 CYS B CA  1 
ATOM   1995 C  C   . CYS B 2 72  ? 43.019 6.885  19.216  1.00 70.34  ?  208 CYS B C   1 
ATOM   1996 O  O   . CYS B 2 72  ? 42.482 7.664  18.414  1.00 69.68  ?  208 CYS B O   1 
ATOM   1997 C  CB  . CYS B 2 72  ? 45.268 8.012  19.543  1.00 64.12  ?  208 CYS B CB  1 
ATOM   1998 S  SG  . CYS B 2 72  ? 47.034 7.727  19.791  1.00 90.73  ?  208 CYS B SG  1 
ATOM   1999 N  N   . GLN B 2 73  ? 42.355 6.067  20.023  1.00 54.86  ?  209 GLN B N   1 
ATOM   2000 C  CA  . GLN B 2 73  ? 40.939 6.169  20.296  1.00 51.73  ?  209 GLN B CA  1 
ATOM   2001 C  C   . GLN B 2 73  ? 40.797 6.048  21.801  1.00 50.69  ?  209 GLN B C   1 
ATOM   2002 O  O   . GLN B 2 73  ? 41.266 5.081  22.398  1.00 57.91  ?  209 GLN B O   1 
ATOM   2003 C  CB  . GLN B 2 73  ? 40.145 5.076  19.597  1.00 57.12  ?  209 GLN B CB  1 
ATOM   2004 C  CG  . GLN B 2 73  ? 39.425 5.540  18.347  1.00 66.92  ?  209 GLN B CG  1 
ATOM   2005 C  CD  . GLN B 2 73  ? 38.580 4.446  17.713  1.00 68.15  ?  209 GLN B CD  1 
ATOM   2006 O  OE1 . GLN B 2 73  ? 38.768 3.259  17.992  1.00 64.48  ?  209 GLN B OE1 1 
ATOM   2007 N  NE2 . GLN B 2 73  ? 37.640 4.846  16.854  1.00 69.36  ?  209 GLN B NE2 1 
ATOM   2008 N  N   . PHE B 2 74  ? 40.184 7.040  22.419  1.00 46.93  ?  210 PHE B N   1 
ATOM   2009 C  CA  . PHE B 2 74  ? 39.954 6.995  23.858  1.00 45.30  ?  210 PHE B CA  1 
ATOM   2010 C  C   . PHE B 2 74  ? 38.749 7.850  24.158  1.00 48.67  ?  210 PHE B C   1 
ATOM   2011 O  O   . PHE B 2 74  ? 38.612 8.938  23.593  1.00 43.84  ?  210 PHE B O   1 
ATOM   2012 C  CB  . PHE B 2 74  ? 41.169 7.488  24.624  1.00 45.25  ?  210 PHE B CB  1 
ATOM   2013 C  CG  . PHE B 2 74  ? 40.940 7.595  26.093  1.00 48.84  ?  210 PHE B CG  1 
ATOM   2014 C  CD1 . PHE B 2 74  ? 41.002 6.467  26.900  1.00 51.65  ?  210 PHE B CD1 1 
ATOM   2015 C  CD2 . PHE B 2 74  ? 40.660 8.824  26.675  1.00 50.73  ?  210 PHE B CD2 1 
ATOM   2016 C  CE1 . PHE B 2 74  ? 40.781 6.558  28.274  1.00 52.52  ?  210 PHE B CE1 1 
ATOM   2017 C  CE2 . PHE B 2 74  ? 40.440 8.924  28.036  1.00 48.97  ?  210 PHE B CE2 1 
ATOM   2018 C  CZ  . PHE B 2 74  ? 40.508 7.788  28.840  1.00 55.18  ?  210 PHE B CZ  1 
ATOM   2019 N  N   . SER B 2 75  ? 37.872 7.371  25.030  1.00 49.44  ?  211 SER B N   1 
ATOM   2020 C  CA  . SER B 2 75  ? 36.686 8.148  25.374  1.00 52.05  ?  211 SER B CA  1 
ATOM   2021 C  C   . SER B 2 75  ? 36.152 7.819  26.760  1.00 51.04  ?  211 SER B C   1 
ATOM   2022 O  O   . SER B 2 75  ? 36.367 6.725  27.283  1.00 56.05  ?  211 SER B O   1 
ATOM   2023 C  CB  . SER B 2 75  ? 35.596 7.923  24.326  1.00 52.11  ?  211 SER B CB  1 
ATOM   2024 O  OG  . SER B 2 75  ? 34.960 6.683  24.555  1.00 56.81  ?  211 SER B OG  1 
ATOM   2025 N  N   . VAL B 2 76  ? 35.460 8.782  27.360  1.00 52.41  ?  212 VAL B N   1 
ATOM   2026 C  CA  . VAL B 2 76  ? 34.850 8.592  28.675  1.00 51.60  ?  212 VAL B CA  1 
ATOM   2027 C  C   . VAL B 2 76  ? 33.404 9.095  28.680  1.00 56.94  ?  212 VAL B C   1 
ATOM   2028 O  O   . VAL B 2 76  ? 33.019 9.888  27.817  1.00 55.48  ?  212 VAL B O   1 
ATOM   2029 C  CB  . VAL B 2 76  ? 35.647 9.336  29.798  1.00 50.08  ?  212 VAL B CB  1 
ATOM   2030 C  CG1 . VAL B 2 76  ? 37.044 8.763  29.947  1.00 51.74  ?  212 VAL B CG1 1 
ATOM   2031 C  CG2 . VAL B 2 76  ? 35.731 10.826 29.503  1.00 48.50  ?  212 VAL B CG2 1 
ATOM   2032 N  N   . ASP B 2 77  ? 32.614 8.628  29.650  1.00 63.97  ?  213 ASP B N   1 
ATOM   2033 C  CA  . ASP B 2 77  ? 31.279 9.167  29.907  1.00 63.19  ?  213 ASP B CA  1 
ATOM   2034 C  C   . ASP B 2 77  ? 31.295 10.687 29.953  1.00 65.93  ?  213 ASP B C   1 
ATOM   2035 O  O   . ASP B 2 77  ? 32.253 11.289 30.441  1.00 65.63  ?  213 ASP B O   1 
ATOM   2036 C  CB  . ASP B 2 77  ? 30.735 8.640  31.231  1.00 66.12  ?  213 ASP B CB  1 
ATOM   2037 C  CG  . ASP B 2 77  ? 30.645 7.138  31.262  1.00 71.49  ?  213 ASP B CG  1 
ATOM   2038 O  OD1 . ASP B 2 77  ? 30.605 6.520  30.176  1.00 66.13  ?  213 ASP B OD1 1 
ATOM   2039 O  OD2 . ASP B 2 77  ? 30.610 6.574  32.375  1.00 78.49  ?  213 ASP B OD2 1 
ATOM   2040 N  N   . GLU B 2 78  ? 30.233 11.312 29.461  1.00 58.78  ?  214 GLU B N   1 
ATOM   2041 C  CA  . GLU B 2 78  ? 30.175 12.768 29.454  1.00 62.03  ?  214 GLU B CA  1 
ATOM   2042 C  C   . GLU B 2 78  ? 30.192 13.362 30.863  1.00 49.72  ?  214 GLU B C   1 
ATOM   2043 O  O   . GLU B 2 78  ? 30.671 14.481 31.048  1.00 52.58  ?  214 GLU B O   1 
ATOM   2044 C  CB  . GLU B 2 78  ? 28.945 13.279 28.698  1.00 69.71  ?  214 GLU B CB  1 
ATOM   2045 C  CG  . GLU B 2 78  ? 29.227 14.617 28.018  1.00 86.16  ?  214 GLU B CG  1 
ATOM   2046 C  CD  . GLU B 2 78  ? 27.977 15.371 27.630  1.00 105.14 ?  214 GLU B CD  1 
ATOM   2047 O  OE1 . GLU B 2 78  ? 26.873 14.926 28.007  1.00 111.82 ?  214 GLU B OE1 1 
ATOM   2048 O  OE2 . GLU B 2 78  ? 28.101 16.414 26.949  1.00 111.13 ?  214 GLU B OE2 1 
ATOM   2049 N  N   . GLU B 2 79  ? 29.682 12.631 31.851  1.00 49.34  ?  215 GLU B N   1 
ATOM   2050 C  CA  . GLU B 2 79  ? 29.790 13.098 33.244  1.00 59.51  ?  215 GLU B CA  1 
ATOM   2051 C  C   . GLU B 2 79  ? 31.258 13.324 33.637  1.00 50.83  ?  215 GLU B C   1 
ATOM   2052 O  O   . GLU B 2 79  ? 31.586 14.304 34.303  1.00 46.94  ?  215 GLU B O   1 
ATOM   2053 C  CB  . GLU B 2 79  ? 29.128 12.114 34.215  1.00 71.43  ?  215 GLU B CB  1 
ATOM   2054 C  CG  . GLU B 2 79  ? 29.541 10.667 34.020  1.00 88.38  ?  215 GLU B CG  1 
ATOM   2055 C  CD  . GLU B 2 79  ? 28.548 9.691  34.618  1.00 101.03 ?  215 GLU B CD  1 
ATOM   2056 O  OE1 . GLU B 2 79  ? 27.753 10.115 35.486  1.00 104.89 ?  215 GLU B OE1 1 
ATOM   2057 O  OE2 . GLU B 2 79  ? 28.559 8.503  34.219  1.00 104.37 ?  215 GLU B OE2 1 
ATOM   2058 N  N   . PHE B 2 80  ? 32.141 12.436 33.193  1.00 46.65  ?  216 PHE B N   1 
ATOM   2059 C  CA  . PHE B 2 80  ? 33.569 12.626 33.415  1.00 39.08  ?  216 PHE B CA  1 
ATOM   2060 C  C   . PHE B 2 80  ? 34.141 13.746 32.565  1.00 40.96  ?  216 PHE B C   1 
ATOM   2061 O  O   . PHE B 2 80  ? 35.092 14.392 32.982  1.00 41.01  ?  216 PHE B O   1 
ATOM   2062 C  CB  . PHE B 2 80  ? 34.323 11.328 33.163  1.00 37.80  ?  216 PHE B CB  1 
ATOM   2063 C  CG  . PHE B 2 80  ? 33.897 10.224 34.076  1.00 44.88  ?  216 PHE B CG  1 
ATOM   2064 C  CD1 . PHE B 2 80  ? 33.525 10.513 35.384  1.00 41.44  ?  216 PHE B CD1 1 
ATOM   2065 C  CD2 . PHE B 2 80  ? 33.822 8.913  33.631  1.00 44.82  ?  216 PHE B CD2 1 
ATOM   2066 C  CE1 . PHE B 2 80  ? 33.094 9.510  36.237  1.00 37.33  ?  216 PHE B CE1 1 
ATOM   2067 C  CE2 . PHE B 2 80  ? 33.410 7.905  34.478  1.00 48.03  ?  216 PHE B CE2 1 
ATOM   2068 C  CZ  . PHE B 2 80  ? 33.036 8.213  35.798  1.00 38.49  ?  216 PHE B CZ  1 
ATOM   2069 N  N   . GLN B 2 81  ? 33.561 13.992 31.390  1.00 42.79  ?  217 GLN B N   1 
ATOM   2070 C  CA  . GLN B 2 81  ? 33.988 15.126 30.584  1.00 38.87  ?  217 GLN B CA  1 
ATOM   2071 C  C   . GLN B 2 81  ? 33.620 16.424 31.282  1.00 43.41  ?  217 GLN B C   1 
ATOM   2072 O  O   . GLN B 2 81  ? 34.405 17.373 31.319  1.00 41.97  ?  217 GLN B O   1 
ATOM   2073 C  CB  . GLN B 2 81  ? 33.344 15.091 29.194  1.00 41.96  ?  217 GLN B CB  1 
ATOM   2074 C  CG  . GLN B 2 81  ? 33.879 14.004 28.283  1.00 45.12  ?  217 GLN B CG  1 
ATOM   2075 C  CD  . GLN B 2 81  ? 32.965 13.758 27.086  1.00 55.43  ?  217 GLN B CD  1 
ATOM   2076 O  OE1 . GLN B 2 81  ? 32.342 14.684 26.557  1.00 56.05  ?  217 GLN B OE1 1 
ATOM   2077 N  NE2 . GLN B 2 81  ? 32.877 12.505 26.666  1.00 58.52  ?  217 GLN B NE2 1 
ATOM   2078 N  N   . LYS B 2 82  ? 32.415 16.480 31.831  1.00 43.80  ?  218 LYS B N   1 
ATOM   2079 C  CA  . LYS B 2 82  ? 31.976 17.721 32.455  1.00 48.88  ?  218 LYS B CA  1 
ATOM   2080 C  C   . LYS B 2 82  ? 32.754 17.937 33.748  1.00 44.68  ?  218 LYS B C   1 
ATOM   2081 O  O   . LYS B 2 82  ? 33.141 19.062 34.068  1.00 45.73  ?  218 LYS B O   1 
ATOM   2082 C  CB  . LYS B 2 82  ? 30.461 17.721 32.696  1.00 57.76  ?  218 LYS B CB  1 
ATOM   2083 C  CG  . LYS B 2 82  ? 29.801 18.974 32.115  1.00 76.71  ?  218 LYS B CG  1 
ATOM   2084 C  CD  . LYS B 2 82  ? 28.364 18.757 31.650  1.00 91.81  ?  218 LYS B CD  1 
ATOM   2085 C  CE  . LYS B 2 82  ? 27.788 20.040 31.025  1.00 100.89 ?  218 LYS B CE  1 
ATOM   2086 N  NZ  . LYS B 2 82  ? 27.313 21.041 32.028  1.00 104.42 ?  218 LYS B NZ  1 
ATOM   2087 N  N   . LEU B 2 83  ? 33.014 16.847 34.459  1.00 38.50  ?  219 LEU B N   1 
ATOM   2088 C  CA  . LEU B 2 83  ? 33.806 16.881 35.679  1.00 40.99  ?  219 LEU B CA  1 
ATOM   2089 C  C   . LEU B 2 83  ? 35.218 17.406 35.412  1.00 44.17  ?  219 LEU B C   1 
ATOM   2090 O  O   . LEU B 2 83  ? 35.744 18.235 36.166  1.00 39.64  ?  219 LEU B O   1 
ATOM   2091 C  CB  . LEU B 2 83  ? 33.858 15.483 36.288  1.00 42.83  ?  219 LEU B CB  1 
ATOM   2092 C  CG  . LEU B 2 83  ? 34.151 15.345 37.776  1.00 47.63  ?  219 LEU B CG  1 
ATOM   2093 C  CD1 . LEU B 2 83  ? 33.023 15.935 38.571  1.00 48.54  ?  219 LEU B CD1 1 
ATOM   2094 C  CD2 . LEU B 2 83  ? 34.360 13.884 38.165  1.00 48.78  ?  219 LEU B CD2 1 
ATOM   2095 N  N   . TRP B 2 84  ? 35.831 16.920 34.333  1.00 40.67  ?  220 TRP B N   1 
ATOM   2096 C  CA  . TRP B 2 84  ? 37.155 17.383 33.935  1.00 33.08  ?  220 TRP B CA  1 
ATOM   2097 C  C   . TRP B 2 84  ? 37.146 18.892 33.721  1.00 44.64  ?  220 TRP B C   1 
ATOM   2098 O  O   . TRP B 2 84  ? 38.039 19.611 34.190  1.00 39.92  ?  220 TRP B O   1 
ATOM   2099 C  CB  . TRP B 2 84  ? 37.606 16.670 32.659  1.00 33.87  ?  220 TRP B CB  1 
ATOM   2100 C  CG  . TRP B 2 84  ? 38.852 17.201 32.012  1.00 36.18  ?  220 TRP B CG  1 
ATOM   2101 C  CD1 . TRP B 2 84  ? 38.965 18.332 31.233  1.00 40.98  ?  220 TRP B CD1 1 
ATOM   2102 C  CD2 . TRP B 2 84  ? 40.147 16.583 32.002  1.00 36.53  ?  220 TRP B CD2 1 
ATOM   2103 N  NE1 . TRP B 2 84  ? 40.260 18.466 30.780  1.00 37.51  ?  220 TRP B NE1 1 
ATOM   2104 C  CE2 . TRP B 2 84  ? 40.999 17.399 31.222  1.00 40.36  ?  220 TRP B CE2 1 
ATOM   2105 C  CE3 . TRP B 2 84  ? 40.672 15.423 32.583  1.00 38.05  ?  220 TRP B CE3 1 
ATOM   2106 C  CZ2 . TRP B 2 84  ? 42.347 17.096 31.017  1.00 42.33  ?  220 TRP B CZ2 1 
ATOM   2107 C  CZ3 . TRP B 2 84  ? 42.008 15.117 32.364  1.00 35.94  ?  220 TRP B CZ3 1 
ATOM   2108 C  CH2 . TRP B 2 84  ? 42.831 15.957 31.601  1.00 39.37  ?  220 TRP B CH2 1 
ATOM   2109 N  N   . ARG B 2 85  ? 36.136 19.367 32.998  1.00 38.34  ?  221 ARG B N   1 
ATOM   2110 C  CA  . ARG B 2 85  ? 36.004 20.793 32.739  1.00 36.70  ?  221 ARG B CA  1 
ATOM   2111 C  C   . ARG B 2 85  ? 35.805 21.607 34.012  1.00 39.61  ?  221 ARG B C   1 
ATOM   2112 O  O   . ARG B 2 85  ? 36.185 22.771 34.068  1.00 39.52  ?  221 ARG B O   1 
ATOM   2113 C  CB  . ARG B 2 85  ? 34.846 21.050 31.775  1.00 38.58  ?  221 ARG B CB  1 
ATOM   2114 C  CG  . ARG B 2 85  ? 35.207 20.655 30.341  1.00 45.34  ?  221 ARG B CG  1 
ATOM   2115 C  CD  . ARG B 2 85  ? 34.152 21.119 29.331  1.00 54.69  ?  221 ARG B CD  1 
ATOM   2116 N  NE  . ARG B 2 85  ? 33.459 19.985 28.718  1.00 68.75  ?  221 ARG B NE  1 
ATOM   2117 C  CZ  . ARG B 2 85  ? 32.169 19.710 28.903  1.00 77.93  ?  221 ARG B CZ  1 
ATOM   2118 N  NH1 . ARG B 2 85  ? 31.425 20.495 29.670  1.00 80.89  ?  221 ARG B NH1 1 
ATOM   2119 N  NH2 . ARG B 2 85  ? 31.618 18.656 28.313  1.00 81.61  ?  221 ARG B NH2 1 
ATOM   2120 N  N   . SER B 2 86  ? 35.227 20.989 35.037  1.00 41.82  ?  222 SER B N   1 
ATOM   2121 C  CA  . SER B 2 86  ? 34.903 21.702 36.263  1.00 46.97  ?  222 SER B CA  1 
ATOM   2122 C  C   . SER B 2 86  ? 36.131 21.942 37.137  1.00 47.46  ?  222 SER B C   1 
ATOM   2123 O  O   . SER B 2 86  ? 36.055 22.682 38.117  1.00 43.37  ?  222 SER B O   1 
ATOM   2124 C  CB  . SER B 2 86  ? 33.861 20.931 37.071  1.00 44.56  ?  222 SER B CB  1 
ATOM   2125 O  OG  . SER B 2 86  ? 34.478 19.836 37.718  1.00 46.80  ?  222 SER B OG  1 
ATOM   2126 N  N   . VAL B 2 87  ? 37.253 21.305 36.808  1.00 48.69  ?  223 VAL B N   1 
ATOM   2127 C  CA  . VAL B 2 87  ? 38.484 21.549 37.564  1.00 48.66  ?  223 VAL B CA  1 
ATOM   2128 C  C   . VAL B 2 87  ? 39.276 22.627 36.838  1.00 50.80  ?  223 VAL B C   1 
ATOM   2129 O  O   . VAL B 2 87  ? 39.944 22.360 35.845  1.00 50.22  ?  223 VAL B O   1 
ATOM   2130 C  CB  . VAL B 2 87  ? 39.345 20.276 37.729  1.00 45.37  ?  223 VAL B CB  1 
ATOM   2131 C  CG1 . VAL B 2 87  ? 40.581 20.557 38.620  1.00 34.54  ?  223 VAL B CG1 1 
ATOM   2132 C  CG2 . VAL B 2 87  ? 38.518 19.154 38.303  1.00 39.09  ?  223 VAL B CG2 1 
ATOM   2133 N  N   . THR B 2 88  ? 39.169 23.848 37.342  1.00 51.13  ?  224 THR B N   1 
ATOM   2134 C  CA  . THR B 2 88  ? 39.793 25.037 36.763  1.00 50.92  ?  224 THR B CA  1 
ATOM   2135 C  C   . THR B 2 88  ? 41.305 25.067 36.889  1.00 46.61  ?  224 THR B C   1 
ATOM   2136 O  O   . THR B 2 88  ? 41.840 24.899 37.986  1.00 51.63  ?  224 THR B O   1 
ATOM   2137 C  CB  . THR B 2 88  ? 39.275 26.310 37.452  1.00 62.18  ?  224 THR B CB  1 
ATOM   2138 O  OG1 . THR B 2 88  ? 37.857 26.225 37.641  1.00 69.50  ?  224 THR B OG1 1 
ATOM   2139 C  CG2 . THR B 2 88  ? 39.613 27.526 36.640  1.00 69.10  ?  224 THR B CG2 1 
ATOM   2140 N  N   . VAL B 2 89  ? 42.006 25.333 35.793  1.00 41.33  ?  225 VAL B N   1 
ATOM   2141 C  CA  . VAL B 2 89  ? 43.446 25.521 35.878  1.00 42.36  ?  225 VAL B CA  1 
ATOM   2142 C  C   . VAL B 2 89  ? 43.907 26.773 35.154  1.00 45.18  ?  225 VAL B C   1 
ATOM   2143 O  O   . VAL B 2 89  ? 45.064 27.174 35.278  1.00 56.11  ?  225 VAL B O   1 
ATOM   2144 C  CB  . VAL B 2 89  ? 44.191 24.308 35.330  1.00 40.83  ?  225 VAL B CB  1 
ATOM   2145 C  CG1 . VAL B 2 89  ? 43.955 23.095 36.237  1.00 38.77  ?  225 VAL B CG1 1 
ATOM   2146 C  CG2 . VAL B 2 89  ? 43.754 24.008 33.865  1.00 40.59  ?  225 VAL B CG2 1 
ATOM   2147 N  N   . ASP B 2 90  ? 43.007 27.406 34.408  1.00 52.30  ?  226 ASP B N   1 
ATOM   2148 C  CA  . ASP B 2 90  ? 43.409 28.537 33.571  1.00 61.31  ?  226 ASP B CA  1 
ATOM   2149 C  C   . ASP B 2 90  ? 43.833 29.746 34.400  1.00 64.83  ?  226 ASP B C   1 
ATOM   2150 O  O   . ASP B 2 90  ? 44.668 30.548 33.978  1.00 63.83  ?  226 ASP B O   1 
ATOM   2151 C  CB  . ASP B 2 90  ? 42.284 28.925 32.610  1.00 69.72  ?  226 ASP B CB  1 
ATOM   2152 C  CG  . ASP B 2 90  ? 40.958 29.117 33.306  1.00 80.00  ?  226 ASP B CG  1 
ATOM   2153 O  OD1 . ASP B 2 90  ? 40.952 29.430 34.515  1.00 86.69  ?  226 ASP B OD1 1 
ATOM   2154 O  OD2 . ASP B 2 90  ? 39.916 28.972 32.637  1.00 84.11  ?  226 ASP B OD2 1 
ATOM   2155 N  N   . SER B 2 91  ? 43.260 29.868 35.589  1.00 63.77  ?  227 SER B N   1 
ATOM   2156 C  CA  . SER B 2 91  ? 43.574 30.981 36.470  1.00 74.04  ?  227 SER B CA  1 
ATOM   2157 C  C   . SER B 2 91  ? 44.797 30.705 37.349  1.00 75.62  ?  227 SER B C   1 
ATOM   2158 O  O   . SER B 2 91  ? 45.256 31.585 38.070  1.00 79.30  ?  227 SER B O   1 
ATOM   2159 C  CB  . SER B 2 91  ? 42.362 31.288 37.340  1.00 79.50  ?  227 SER B CB  1 
ATOM   2160 O  OG  . SER B 2 91  ? 41.748 30.074 37.745  1.00 80.41  ?  227 SER B OG  1 
ATOM   2161 N  N   . MET B 2 92  ? 45.329 29.486 37.276  1.00 70.45  ?  228 MET B N   1 
ATOM   2162 C  CA  . MET B 2 92  ? 46.388 29.053 38.187  1.00 65.00  ?  228 MET B CA  1 
ATOM   2163 C  C   . MET B 2 92  ? 47.802 29.166 37.660  1.00 64.92  ?  228 MET B C   1 
ATOM   2164 O  O   . MET B 2 92  ? 48.089 28.831 36.513  1.00 66.57  ?  228 MET B O   1 
ATOM   2165 C  CB  . MET B 2 92  ? 46.189 27.602 38.584  1.00 64.12  ?  228 MET B CB  1 
ATOM   2166 C  CG  . MET B 2 92  ? 44.928 27.309 39.329  1.00 65.74  ?  228 MET B CG  1 
ATOM   2167 S  SD  . MET B 2 92  ? 45.034 25.590 39.803  1.00 71.42  ?  228 MET B SD  1 
ATOM   2168 C  CE  . MET B 2 92  ? 46.238 25.708 41.117  1.00 48.45  ?  228 MET B CE  1 
ATOM   2169 N  N   . ASP B 2 93  ? 48.682 29.614 38.543  1.00 65.75  ?  229 ASP B N   1 
ATOM   2170 C  CA  . ASP B 2 93  ? 50.120 29.561 38.349  1.00 69.86  ?  229 ASP B CA  1 
ATOM   2171 C  C   . ASP B 2 93  ? 50.555 28.111 38.178  1.00 63.33  ?  229 ASP B C   1 
ATOM   2172 O  O   . ASP B 2 93  ? 50.011 27.217 38.832  1.00 58.70  ?  229 ASP B O   1 
ATOM   2173 C  CB  . ASP B 2 93  ? 50.819 30.192 39.556  1.00 84.23  ?  229 ASP B CB  1 
ATOM   2174 C  CG  . ASP B 2 93  ? 52.026 31.001 39.174  1.00 101.29 ?  229 ASP B CG  1 
ATOM   2175 O  OD1 . ASP B 2 93  ? 52.072 31.494 38.029  1.00 107.24 ?  229 ASP B OD1 1 
ATOM   2176 O  OD2 . ASP B 2 93  ? 52.923 31.159 40.029  1.00 110.39 ?  229 ASP B OD2 1 
ATOM   2177 N  N   . GLU B 2 94  ? 51.534 27.872 37.313  1.00 63.86  ?  230 GLU B N   1 
ATOM   2178 C  CA  . GLU B 2 94  ? 52.042 26.518 37.112  1.00 65.75  ?  230 GLU B CA  1 
ATOM   2179 C  C   . GLU B 2 94  ? 52.673 25.999 38.394  1.00 68.52  ?  230 GLU B C   1 
ATOM   2180 O  O   . GLU B 2 94  ? 52.580 24.812 38.712  1.00 68.29  ?  230 GLU B O   1 
ATOM   2181 C  CB  . GLU B 2 94  ? 53.061 26.480 35.973  1.00 71.54  ?  230 GLU B CB  1 
ATOM   2182 C  CG  . GLU B 2 94  ? 52.461 26.755 34.607  1.00 84.58  ?  230 GLU B CG  1 
ATOM   2183 C  CD  . GLU B 2 94  ? 53.511 26.923 33.521  1.00 97.82  ?  230 GLU B CD  1 
ATOM   2184 O  OE1 . GLU B 2 94  ? 54.721 26.855 33.836  1.00 99.20  ?  230 GLU B OE1 1 
ATOM   2185 O  OE2 . GLU B 2 94  ? 53.121 27.128 32.352  1.00 101.73 ?  230 GLU B OE2 1 
ATOM   2186 N  N   . GLU B 2 95  ? 53.310 26.907 39.124  1.00 70.76  ?  231 GLU B N   1 
ATOM   2187 C  CA  . GLU B 2 95  ? 53.956 26.583 40.389  1.00 71.41  ?  231 GLU B CA  1 
ATOM   2188 C  C   . GLU B 2 95  ? 52.921 26.069 41.372  1.00 65.97  ?  231 GLU B C   1 
ATOM   2189 O  O   . GLU B 2 95  ? 53.152 25.089 42.074  1.00 67.64  ?  231 GLU B O   1 
ATOM   2190 C  CB  . GLU B 2 95  ? 54.685 27.810 40.956  1.00 74.39  ?  231 GLU B CB  1 
ATOM   2191 C  CG  . GLU B 2 95  ? 55.895 28.262 40.129  1.00 86.88  ?  231 GLU B CG  1 
ATOM   2192 C  CD  . GLU B 2 95  ? 55.518 28.917 38.796  1.00 96.01  ?  231 GLU B CD  1 
ATOM   2193 O  OE1 . GLU B 2 95  ? 54.313 29.145 38.552  1.00 96.24  ?  231 GLU B OE1 1 
ATOM   2194 O  OE2 . GLU B 2 95  ? 56.425 29.183 37.978  1.00 99.85  ?  231 GLU B OE2 1 
ATOM   2195 N  N   . LYS B 2 96  ? 51.770 26.729 41.397  1.00 61.92  ?  232 LYS B N   1 
ATOM   2196 C  CA  . LYS B 2 96  ? 50.685 26.353 42.286  1.00 56.42  ?  232 LYS B CA  1 
ATOM   2197 C  C   . LYS B 2 96  ? 50.190 24.936 42.000  1.00 62.91  ?  232 LYS B C   1 
ATOM   2198 O  O   . LYS B 2 96  ? 49.841 24.198 42.923  1.00 56.79  ?  232 LYS B O   1 
ATOM   2199 C  CB  . LYS B 2 96  ? 49.537 27.351 42.162  1.00 60.49  ?  232 LYS B CB  1 
ATOM   2200 C  CG  . LYS B 2 96  ? 48.517 27.246 43.278  1.00 72.18  ?  232 LYS B CG  1 
ATOM   2201 C  CD  . LYS B 2 96  ? 47.574 28.442 43.306  1.00 81.63  ?  232 LYS B CD  1 
ATOM   2202 C  CE  . LYS B 2 96  ? 46.539 28.284 44.414  1.00 86.71  ?  232 LYS B CE  1 
ATOM   2203 N  NZ  . LYS B 2 96  ? 45.659 29.477 44.552  1.00 92.11  ?  232 LYS B NZ  1 
ATOM   2204 N  N   . ILE B 2 97  ? 50.158 24.561 40.721  1.00 57.26  ?  233 ILE B N   1 
ATOM   2205 C  CA  . ILE B 2 97  ? 49.773 23.209 40.324  1.00 51.56  ?  233 ILE B CA  1 
ATOM   2206 C  C   . ILE B 2 97  ? 50.763 22.193 40.875  1.00 53.92  ?  233 ILE B C   1 
ATOM   2207 O  O   . ILE B 2 97  ? 50.371 21.172 41.445  1.00 48.17  ?  233 ILE B O   1 
ATOM   2208 C  CB  . ILE B 2 97  ? 49.696 23.083 38.792  1.00 55.72  ?  233 ILE B CB  1 
ATOM   2209 C  CG1 . ILE B 2 97  ? 48.515 23.897 38.262  1.00 47.81  ?  233 ILE B CG1 1 
ATOM   2210 C  CG2 . ILE B 2 97  ? 49.599 21.606 38.357  1.00 43.90  ?  233 ILE B CG2 1 
ATOM   2211 C  CD1 . ILE B 2 97  ? 48.463 23.980 36.748  1.00 45.26  ?  233 ILE B CD1 1 
ATOM   2212 N  N   . GLU B 2 98  ? 52.050 22.482 40.707  1.00 59.42  ?  234 GLU B N   1 
ATOM   2213 C  CA  . GLU B 2 98  ? 53.105 21.630 41.249  1.00 62.48  ?  234 GLU B CA  1 
ATOM   2214 C  C   . GLU B 2 98  ? 53.040 21.518 42.770  1.00 61.08  ?  234 GLU B C   1 
ATOM   2215 O  O   . GLU B 2 98  ? 53.319 20.455 43.331  1.00 54.84  ?  234 GLU B O   1 
ATOM   2216 C  CB  . GLU B 2 98  ? 54.479 22.160 40.836  1.00 71.64  ?  234 GLU B CB  1 
ATOM   2217 C  CG  . GLU B 2 98  ? 54.694 22.206 39.343  1.00 80.57  ?  234 GLU B CG  1 
ATOM   2218 C  CD  . GLU B 2 98  ? 55.995 22.884 38.961  1.00 95.53  ?  234 GLU B CD  1 
ATOM   2219 O  OE1 . GLU B 2 98  ? 56.342 23.911 39.587  1.00 99.37  ?  234 GLU B OE1 1 
ATOM   2220 O  OE2 . GLU B 2 98  ? 56.672 22.383 38.037  1.00 102.25 ?  234 GLU B OE2 1 
ATOM   2221 N  N   . GLU B 2 99  ? 52.690 22.613 43.439  1.00 55.89  ?  235 GLU B N   1 
ATOM   2222 C  CA  . GLU B 2 99  ? 52.606 22.583 44.900  1.00 60.04  ?  235 GLU B CA  1 
ATOM   2223 C  C   . GLU B 2 99  ? 51.544 21.572 45.301  1.00 61.06  ?  235 GLU B C   1 
ATOM   2224 O  O   . GLU B 2 99  ? 51.779 20.733 46.169  1.00 56.99  ?  235 GLU B O   1 
ATOM   2225 C  CB  . GLU B 2 99  ? 52.278 23.956 45.497  1.00 71.82  ?  235 GLU B CB  1 
ATOM   2226 C  CG  . GLU B 2 99  ? 51.986 23.885 47.005  1.00 88.89  ?  235 GLU B CG  1 
ATOM   2227 C  CD  . GLU B 2 99  ? 51.536 25.206 47.622  1.00 104.06 ?  235 GLU B CD  1 
ATOM   2228 O  OE1 . GLU B 2 99  ? 51.661 26.261 46.964  1.00 111.36 ?  235 GLU B OE1 1 
ATOM   2229 O  OE2 . GLU B 2 99  ? 51.058 25.184 48.780  1.00 106.45 ?  235 GLU B OE2 1 
ATOM   2230 N  N   . TYR B 2 100 ? 50.391 21.642 44.636  1.00 57.09  ?  236 TYR B N   1 
ATOM   2231 C  CA  . TYR B 2 100 ? 49.297 20.724 44.904  1.00 53.35  ?  236 TYR B CA  1 
ATOM   2232 C  C   . TYR B 2 100 ? 49.722 19.275 44.767  1.00 53.21  ?  236 TYR B C   1 
ATOM   2233 O  O   . TYR B 2 100 ? 49.423 18.446 45.631  1.00 49.85  ?  236 TYR B O   1 
ATOM   2234 C  CB  . TYR B 2 100 ? 48.126 20.978 43.965  1.00 46.81  ?  236 TYR B CB  1 
ATOM   2235 C  CG  . TYR B 2 100 ? 47.019 19.978 44.203  1.00 50.07  ?  236 TYR B CG  1 
ATOM   2236 C  CD1 . TYR B 2 100 ? 46.106 20.165 45.238  1.00 50.91  ?  236 TYR B CD1 1 
ATOM   2237 C  CD2 . TYR B 2 100 ? 46.912 18.826 43.426  1.00 42.58  ?  236 TYR B CD2 1 
ATOM   2238 C  CE1 . TYR B 2 100 ? 45.106 19.244 45.479  1.00 48.32  ?  236 TYR B CE1 1 
ATOM   2239 C  CE2 . TYR B 2 100 ? 45.928 17.903 43.659  1.00 41.21  ?  236 TYR B CE2 1 
ATOM   2240 C  CZ  . TYR B 2 100 ? 45.021 18.115 44.683  1.00 47.51  ?  236 TYR B CZ  1 
ATOM   2241 O  OH  . TYR B 2 100 ? 44.030 17.192 44.917  1.00 41.59  ?  236 TYR B OH  1 
ATOM   2242 N  N   . LEU B 2 101 ? 50.377 18.969 43.650  1.00 51.10  ?  237 LEU B N   1 
ATOM   2243 C  CA  . LEU B 2 101 ? 50.829 17.612 43.383  1.00 48.23  ?  237 LEU B CA  1 
ATOM   2244 C  C   . LEU B 2 101 ? 51.760 17.122 44.504  1.00 54.00  ?  237 LEU B C   1 
ATOM   2245 O  O   . LEU B 2 101 ? 51.636 15.994 44.985  1.00 52.25  ?  237 LEU B O   1 
ATOM   2246 C  CB  . LEU B 2 101 ? 51.516 17.553 42.019  1.00 47.73  ?  237 LEU B CB  1 
ATOM   2247 C  CG  . LEU B 2 101 ? 50.574 17.908 40.853  1.00 47.51  ?  237 LEU B CG  1 
ATOM   2248 C  CD1 . LEU B 2 101 ? 51.337 17.941 39.542  1.00 45.17  ?  237 LEU B CD1 1 
ATOM   2249 C  CD2 . LEU B 2 101 ? 49.418 16.936 40.772  1.00 42.49  ?  237 LEU B CD2 1 
ATOM   2250 N  N   . LYS B 2 102 ? 52.671 17.977 44.943  1.00 54.65  ?  238 LYS B N   1 
ATOM   2251 C  CA  . LYS B 2 102 ? 53.565 17.591 46.031  1.00 73.17  ?  238 LYS B CA  1 
ATOM   2252 C  C   . LYS B 2 102 ? 52.822 17.437 47.363  1.00 59.80  ?  238 LYS B C   1 
ATOM   2253 O  O   . LYS B 2 102 ? 53.034 16.460 48.080  1.00 63.82  ?  238 LYS B O   1 
ATOM   2254 C  CB  . LYS B 2 102 ? 54.708 18.596 46.155  1.00 82.91  ?  238 LYS B CB  1 
ATOM   2255 C  CG  . LYS B 2 102 ? 55.965 18.133 45.421  1.00 94.88  ?  238 LYS B CG  1 
ATOM   2256 C  CD  . LYS B 2 102 ? 56.877 19.283 45.030  1.00 100.32 ?  238 LYS B CD  1 
ATOM   2257 C  CE  . LYS B 2 102 ? 57.733 18.905 43.829  1.00 95.73  ?  238 LYS B CE  1 
ATOM   2258 N  NZ  . LYS B 2 102 ? 58.253 20.104 43.128  1.00 93.09  ?  238 LYS B NZ  1 
ATOM   2259 N  N   . ARG B 2 103 ? 51.956 18.390 47.688  1.00 59.07  ?  239 ARG B N   1 
ATOM   2260 C  CA  . ARG B 2 103 ? 51.078 18.280 48.857  1.00 69.49  ?  239 ARG B CA  1 
ATOM   2261 C  C   . ARG B 2 103 ? 50.372 16.917 48.942  1.00 69.72  ?  239 ARG B C   1 
ATOM   2262 O  O   . ARG B 2 103 ? 50.236 16.351 50.029  1.00 80.88  ?  239 ARG B O   1 
ATOM   2263 C  CB  . ARG B 2 103 ? 50.016 19.383 48.831  1.00 69.17  ?  239 ARG B CB  1 
ATOM   2264 C  CG  . ARG B 2 103 ? 50.358 20.694 49.502  1.00 62.31  ?  239 ARG B CG  1 
ATOM   2265 C  CD  . ARG B 2 103 ? 49.204 21.677 49.258  1.00 66.11  ?  239 ARG B CD  1 
ATOM   2266 N  NE  . ARG B 2 103 ? 49.168 22.795 50.204  1.00 71.74  ?  239 ARG B NE  1 
ATOM   2267 C  CZ  . ARG B 2 103 ? 48.423 22.809 51.302  1.00 76.04  ?  239 ARG B CZ  1 
ATOM   2268 N  NH1 . ARG B 2 103 ? 47.665 21.760 51.603  1.00 65.28  ?  239 ARG B NH1 1 
ATOM   2269 N  NH2 . ARG B 2 103 ? 48.446 23.863 52.107  1.00 85.42  ?  239 ARG B NH2 1 
ATOM   2270 N  N   . GLN B 2 104 ? 49.916 16.401 47.797  1.00 58.71  ?  240 GLN B N   1 
ATOM   2271 C  CA  . GLN B 2 104 ? 49.165 15.147 47.780  1.00 53.21  ?  240 GLN B CA  1 
ATOM   2272 C  C   . GLN B 2 104 ? 50.050 13.925 47.585  1.00 54.63  ?  240 GLN B C   1 
ATOM   2273 O  O   . GLN B 2 104 ? 49.575 12.791 47.633  1.00 54.34  ?  240 GLN B O   1 
ATOM   2274 C  CB  . GLN B 2 104 ? 48.079 15.181 46.709  1.00 51.00  ?  240 GLN B CB  1 
ATOM   2275 C  CG  . GLN B 2 104 ? 47.109 16.368 46.811  1.00 47.87  ?  240 GLN B CG  1 
ATOM   2276 C  CD  . GLN B 2 104 ? 46.255 16.338 48.084  1.00 49.69  ?  240 GLN B CD  1 
ATOM   2277 O  OE1 . GLN B 2 104 ? 46.748 16.045 49.165  1.00 52.81  ?  240 GLN B OE1 1 
ATOM   2278 N  NE2 . GLN B 2 104 ? 44.967 16.652 47.945  1.00 47.71  ?  240 GLN B NE2 1 
ATOM   2279 N  N   . GLY B 2 105 ? 51.341 14.161 47.386  1.00 56.67  ?  241 GLY B N   1 
ATOM   2280 C  CA  . GLY B 2 105 ? 52.289 13.074 47.252  1.00 63.94  ?  241 GLY B CA  1 
ATOM   2281 C  C   . GLY B 2 105 ? 52.474 12.529 45.847  1.00 61.84  ?  241 GLY B C   1 
ATOM   2282 O  O   . GLY B 2 105 ? 52.860 11.369 45.677  1.00 63.51  ?  241 GLY B O   1 
ATOM   2283 N  N   . ILE B 2 106 ? 52.216 13.362 44.841  1.00 58.56  ?  242 ILE B N   1 
ATOM   2284 C  CA  . ILE B 2 106 ? 52.352 12.949 43.442  1.00 59.74  ?  242 ILE B CA  1 
ATOM   2285 C  C   . ILE B 2 106 ? 53.128 13.970 42.618  1.00 59.29  ?  242 ILE B C   1 
ATOM   2286 O  O   . ILE B 2 106 ? 54.304 14.234 42.868  1.00 55.20  ?  242 ILE B O   1 
ATOM   2287 C  CB  . ILE B 2 106 ? 50.974 12.733 42.790  1.00 60.34  ?  242 ILE B CB  1 
ATOM   2288 C  CG1 . ILE B 2 106 ? 50.112 13.985 42.950  1.00 46.44  ?  242 ILE B CG1 1 
ATOM   2289 C  CG2 . ILE B 2 106 ? 50.262 11.538 43.421  1.00 63.89  ?  242 ILE B CG2 1 
ATOM   2290 C  CD1 . ILE B 2 106 ? 48.655 13.772 42.608  1.00 47.00  ?  242 ILE B CD1 1 
HETATM 2291 ZN ZN  . ZN  C 3 .   ? 14.082 12.678 68.566  1.00 56.99  ?  301 ZN  A ZN  1 
HETATM 2292 O  O   . HOH D 4 .   ? 54.822 20.926 19.622  1.00 50.20  ?  401 HOH A O   1 
HETATM 2293 O  O   . HOH D 4 .   ? 54.459 14.252 6.448   1.00 52.58  ?  402 HOH A O   1 
HETATM 2294 O  O   . HOH D 4 .   ? 14.187 20.085 67.306  1.00 35.44  ?  403 HOH A O   1 
HETATM 2295 O  O   . HOH D 4 .   ? 41.341 6.569  40.713  1.00 44.16  ?  404 HOH A O   1 
HETATM 2296 O  O   . HOH D 4 .   ? 36.312 35.021 11.569  1.00 62.30  ?  405 HOH A O   1 
HETATM 2297 O  O   . HOH D 4 .   ? 43.072 10.366 40.277  1.00 38.19  ?  406 HOH A O   1 
HETATM 2298 O  O   . HOH D 4 .   ? 57.922 20.016 11.269  1.00 55.31  ?  407 HOH A O   1 
HETATM 2299 O  O   . HOH D 4 .   ? 43.456 31.777 14.117  1.00 43.48  ?  408 HOH A O   1 
HETATM 2300 O  O   . HOH D 4 .   ? 15.822 10.543 75.996  1.00 49.02  ?  409 HOH A O   1 
HETATM 2301 O  O   . HOH D 4 .   ? 38.036 4.855  28.891  1.00 41.81  ?  410 HOH A O   1 
HETATM 2302 O  O   . HOH D 4 .   ? 37.602 25.195 23.251  1.00 48.71  ?  411 HOH A O   1 
HETATM 2303 O  O   . HOH D 4 .   ? 47.863 33.374 18.760  1.00 54.73  ?  412 HOH A O   1 
HETATM 2304 O  O   . HOH D 4 .   ? 45.766 14.871 18.675  1.00 35.83  ?  413 HOH A O   1 
HETATM 2305 O  O   . HOH D 4 .   ? 54.708 27.167 10.916  1.00 40.89  ?  414 HOH A O   1 
HETATM 2306 O  O   . HOH D 4 .   ? 54.717 18.607 8.426   1.00 37.86  ?  415 HOH A O   1 
HETATM 2307 O  O   . HOH D 4 .   ? 44.900 14.844 11.973  1.00 36.27  ?  416 HOH A O   1 
HETATM 2308 O  O   . HOH D 4 .   ? 63.054 39.354 14.702  1.00 44.59  ?  417 HOH A O   1 
HETATM 2309 O  O   . HOH D 4 .   ? 56.979 20.256 21.923  1.00 64.01  ?  418 HOH A O   1 
HETATM 2310 O  O   . HOH D 4 .   ? 35.292 11.102 25.678  1.00 39.54  ?  419 HOH A O   1 
HETATM 2311 O  O   . HOH D 4 .   ? 53.450 9.883  37.271  1.00 66.41  ?  420 HOH A O   1 
HETATM 2312 O  O   . HOH D 4 .   ? 22.672 12.186 59.869  1.00 63.69  ?  421 HOH A O   1 
HETATM 2313 O  O   . HOH D 4 .   ? 50.925 30.954 6.739   1.00 58.24  ?  422 HOH A O   1 
HETATM 2314 O  O   . HOH D 4 .   ? 50.755 12.727 10.111  1.00 47.17  ?  423 HOH A O   1 
HETATM 2315 O  O   . HOH D 4 .   ? 53.750 30.246 6.509   1.00 55.14  ?  424 HOH A O   1 
HETATM 2316 O  O   . HOH D 4 .   ? 33.391 33.083 13.516  1.00 64.18  ?  425 HOH A O   1 
HETATM 2317 O  O   . HOH D 4 .   ? 58.211 6.993  24.875  1.00 60.52  ?  426 HOH A O   1 
HETATM 2318 O  O   . HOH D 4 .   ? 42.323 3.462  40.517  1.00 49.25  ?  427 HOH A O   1 
HETATM 2319 O  O   . HOH D 4 .   ? 55.611 26.774 6.985   1.00 42.86  ?  428 HOH A O   1 
HETATM 2320 O  O   . HOH D 4 .   ? 33.912 16.697 19.067  1.00 49.70  ?  429 HOH A O   1 
HETATM 2321 O  O   . HOH D 4 .   ? 51.706 19.031 9.473   1.00 39.60  ?  430 HOH A O   1 
HETATM 2322 O  O   . HOH D 4 .   ? 50.277 27.536 28.357  1.00 52.20  ?  431 HOH A O   1 
HETATM 2323 O  O   . HOH D 4 .   ? 42.150 10.435 15.721  1.00 49.75  ?  432 HOH A O   1 
HETATM 2324 O  O   . HOH D 4 .   ? 45.035 17.520 11.842  1.00 36.32  ?  433 HOH A O   1 
HETATM 2325 O  O   . HOH D 4 .   ? 38.626 32.428 8.504   1.00 61.68  ?  434 HOH A O   1 
HETATM 2326 O  O   . HOH D 4 .   ? 52.054 30.936 26.071  1.00 46.68  ?  435 HOH A O   1 
HETATM 2327 O  O   . HOH D 4 .   ? 59.836 19.732 13.584  1.00 61.68  ?  436 HOH A O   1 
HETATM 2328 O  O   . HOH D 4 .   ? 60.376 17.752 14.559  1.00 69.01  ?  437 HOH A O   1 
HETATM 2329 O  O   . HOH E 4 .   ? 42.881 20.679 0.492   1.00 62.58  ?  301 HOH B O   1 
HETATM 2330 O  O   . HOH E 4 .   ? 31.384 22.483 30.985  1.00 60.55  ?  302 HOH B O   1 
HETATM 2331 O  O   . HOH E 4 .   ? 47.082 31.365 45.343  1.00 73.19  ?  303 HOH B O   1 
HETATM 2332 O  O   . HOH E 4 .   ? 43.635 13.157 10.238  1.00 36.74  ?  304 HOH B O   1 
HETATM 2333 O  O   . HOH E 4 .   ? 39.220 21.806 0.241   1.00 38.84  ?  305 HOH B O   1 
HETATM 2334 O  O   . HOH E 4 .   ? 32.790 10.629 12.069  1.00 53.20  ?  306 HOH B O   1 
HETATM 2335 O  O   . HOH E 4 .   ? 40.019 3.568  7.362   1.00 49.02  ?  307 HOH B O   1 
HETATM 2336 O  O   . HOH E 4 .   ? 36.646 18.952 -6.344  1.00 47.60  ?  308 HOH B O   1 
HETATM 2337 O  O   . HOH E 4 .   ? 51.722 20.128 6.890   1.00 31.21  ?  309 HOH B O   1 
HETATM 2338 O  O   . HOH E 4 .   ? 30.776 18.615 -10.497 1.00 52.95  ?  310 HOH B O   1 
HETATM 2339 O  O   . HOH E 4 .   ? 27.826 15.903 -5.017  1.00 56.56  ?  311 HOH B O   1 
HETATM 2340 O  O   . HOH E 4 .   ? 48.406 15.145 8.822   1.00 42.06  ?  312 HOH B O   1 
HETATM 2341 O  O   . HOH E 4 .   ? 31.143 9.156  6.989   1.00 40.41  ?  313 HOH B O   1 
HETATM 2342 O  O   . HOH E 4 .   ? 43.886 20.500 2.753   1.00 44.83  ?  314 HOH B O   1 
HETATM 2343 O  O   . HOH E 4 .   ? 31.913 21.364 33.671  1.00 58.60  ?  315 HOH B O   1 
HETATM 2344 O  O   . HOH E 4 .   ? 41.290 15.545 4.929   1.00 35.97  ?  316 HOH B O   1 
HETATM 2345 O  O   . HOH E 4 .   ? 40.903 3.383  -0.508  1.00 61.21  ?  317 HOH B O   1 
HETATM 2346 O  O   . HOH E 4 .   ? 42.622 13.556 6.205   1.00 30.60  ?  318 HOH B O   1 
HETATM 2347 O  O   . HOH E 4 .   ? 39.805 8.995  -8.504  1.00 64.86  ?  319 HOH B O   1 
HETATM 2348 O  O   . HOH E 4 .   ? 29.407 21.491 3.846   1.00 42.32  ?  320 HOH B O   1 
HETATM 2349 O  O   . HOH E 4 .   ? 46.825 7.483  7.979   1.00 52.27  ?  321 HOH B O   1 
HETATM 2350 O  O   . HOH E 4 .   ? 25.260 13.140 -2.944  1.00 51.35  ?  322 HOH B O   1 
HETATM 2351 O  O   . HOH E 4 .   ? 36.705 13.584 -9.657  1.00 47.81  ?  323 HOH B O   1 
HETATM 2352 O  O   . HOH E 4 .   ? 47.159 10.598 12.135  1.00 49.93  ?  324 HOH B O   1 
HETATM 2353 O  O   . HOH E 4 .   ? 27.614 15.016 0.151   1.00 34.35  ?  325 HOH B O   1 
HETATM 2354 O  O   . HOH E 4 .   ? 48.092 30.952 41.053  1.00 60.53  ?  326 HOH B O   1 
HETATM 2355 O  O   . HOH E 4 .   ? 45.769 16.724 -2.424  1.00 46.31  ?  327 HOH B O   1 
HETATM 2356 O  O   . HOH E 4 .   ? 29.811 15.892 36.024  1.00 61.78  ?  328 HOH B O   1 
HETATM 2357 O  O   . HOH E 4 .   ? 38.760 8.631  20.385  1.00 46.26  ?  329 HOH B O   1 
HETATM 2358 O  O   . HOH E 4 .   ? 32.199 22.123 2.761   1.00 41.40  ?  330 HOH B O   1 
HETATM 2359 O  O   . HOH E 4 .   ? 32.183 20.452 14.594  1.00 41.30  ?  331 HOH B O   1 
HETATM 2360 O  O   . HOH E 4 .   ? 42.298 11.348 13.067  1.00 41.05  ?  332 HOH B O   1 
HETATM 2361 O  O   . HOH E 4 .   ? 31.800 4.511  -5.124  1.00 43.11  ?  333 HOH B O   1 
HETATM 2362 O  O   . HOH E 4 .   ? 39.054 23.827 40.333  1.00 51.32  ?  334 HOH B O   1 
HETATM 2363 O  O   . HOH E 4 .   ? 46.283 16.480 7.681   1.00 46.39  ?  335 HOH B O   1 
HETATM 2364 O  O   . HOH E 4 .   ? 26.775 20.954 4.915   1.00 54.73  ?  336 HOH B O   1 
HETATM 2365 O  O   . HOH E 4 .   ? 32.937 13.049 12.949  1.00 39.92  ?  337 HOH B O   1 
HETATM 2366 O  O   . HOH E 4 .   ? 29.997 21.590 15.646  1.00 55.39  ?  338 HOH B O   1 
HETATM 2367 O  O   . HOH E 4 .   ? 44.118 14.859 8.156   1.00 36.85  ?  339 HOH B O   1 
HETATM 2368 O  O   . HOH E 4 .   ? 45.930 18.870 9.438   1.00 41.62  ?  340 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . VAL A 13  ? 0.6699 1.2532 0.9233 0.2504  -0.0210 0.1119  10  VAL A N   
2    C CA  . VAL A 13  ? 0.6873 1.2157 0.9039 0.2409  -0.0406 0.1022  10  VAL A CA  
3    C C   . VAL A 13  ? 0.7184 1.1641 0.8757 0.2889  -0.0323 0.1069  10  VAL A C   
4    O O   . VAL A 13  ? 0.7883 1.1668 0.9088 0.3148  -0.0090 0.1010  10  VAL A O   
5    C CB  . VAL A 13  ? 0.6225 1.0985 0.8210 0.2005  -0.0390 0.0784  10  VAL A CB  
6    C CG1 . VAL A 13  ? 0.6282 1.0219 0.7717 0.1856  -0.0516 0.0663  10  VAL A CG1 
7    C CG2 . VAL A 13  ? 0.5134 1.0537 0.7566 0.1503  -0.0513 0.0734  10  VAL A CG2 
8    N N   . PRO A 14  ? 0.6850 1.1249 0.8239 0.2972  -0.0520 0.1171  11  PRO A N   
9    C CA  . PRO A 14  ? 0.7421 1.0932 0.8157 0.3367  -0.0475 0.1239  11  PRO A CA  
10   C C   . PRO A 14  ? 0.7793 1.0177 0.7903 0.3268  -0.0379 0.1070  11  PRO A C   
11   O O   . PRO A 14  ? 0.7465 0.9720 0.7582 0.2754  -0.0451 0.0891  11  PRO A O   
12   C CB  . PRO A 14  ? 0.7547 1.1265 0.8236 0.3252  -0.0763 0.1340  11  PRO A CB  
13   C CG  . PRO A 14  ? 0.7331 1.2161 0.8702 0.2970  -0.0908 0.1385  11  PRO A CG  
14   C CD  . PRO A 14  ? 0.6820 1.1928 0.8541 0.2652  -0.0806 0.1230  11  PRO A CD  
15   N N   . ALA A 15  ? 0.8418 0.9892 0.7926 0.3659  -0.0204 0.1099  12  ALA A N   
16   C CA  . ALA A 15  ? 0.8203 0.8508 0.7046 0.3419  -0.0108 0.0922  12  ALA A CA  
17   C C   . ALA A 15  ? 0.8264 0.8140 0.6792 0.2985  -0.0293 0.0877  12  ALA A C   
18   O O   . ALA A 15  ? 0.8670 0.8126 0.7018 0.2558  -0.0276 0.0716  12  ALA A O   
19   C CB  . ALA A 15  ? 0.8322 0.7602 0.6424 0.3918  0.0073  0.0980  12  ALA A CB  
20   N N   . ALA A 16  ? 0.7754 0.7804 0.6226 0.3111  -0.0464 0.1041  13  ALA A N   
21   C CA  . ALA A 16  ? 0.8637 0.8301 0.6751 0.2752  -0.0612 0.1036  13  ALA A CA  
22   C C   . ALA A 16  ? 0.8081 0.8358 0.6631 0.2241  -0.0704 0.0878  13  ALA A C   
23   O O   . ALA A 16  ? 0.8512 0.8413 0.6786 0.1882  -0.0720 0.0801  13  ALA A O   
24   C CB  . ALA A 16  ? 0.9107 0.8828 0.7017 0.3050  -0.0774 0.1269  13  ALA A CB  
25   N N   . LEU A 17  ? 0.7615 0.8821 0.6811 0.2215  -0.0757 0.0845  14  LEU A N   
26   C CA  . LEU A 17  ? 0.6297 0.7936 0.5817 0.1765  -0.0823 0.0673  14  LEU A CA  
27   C C   . LEU A 17  ? 0.6064 0.7312 0.5542 0.1526  -0.0657 0.0492  14  LEU A C   
28   O O   . LEU A 17  ? 0.5616 0.6762 0.5030 0.1191  -0.0670 0.0367  14  LEU A O   
29   C CB  . LEU A 17  ? 0.5817 0.8431 0.5965 0.1748  -0.0922 0.0695  14  LEU A CB  
30   C CG  . LEU A 17  ? 0.6522 0.9727 0.6786 0.1729  -0.1185 0.0816  14  LEU A CG  
31   C CD1 . LEU A 17  ? 0.6188 1.0365 0.7076 0.1594  -0.1297 0.0838  14  LEU A CD1 
32   C CD2 . LEU A 17  ? 0.7239 1.0101 0.7119 0.1385  -0.1290 0.0697  14  LEU A CD2 
33   N N   . LYS A 18  ? 0.5718 0.6782 0.5218 0.1732  -0.0495 0.0489  15  LYS A N   
34   C CA  . LYS A 18  ? 0.5599 0.6314 0.5036 0.1520  -0.0360 0.0336  15  LYS A CA  
35   C C   . LYS A 18  ? 0.5284 0.5243 0.4183 0.1325  -0.0357 0.0313  15  LYS A C   
36   O O   . LYS A 18  ? 0.5153 0.5069 0.4078 0.1003  -0.0346 0.0205  15  LYS A O   
37   C CB  . LYS A 18  ? 0.6002 0.6588 0.5437 0.1809  -0.0180 0.0346  15  LYS A CB  
38   C CG  . LYS A 18  ? 0.6536 0.7963 0.6587 0.1845  -0.0134 0.0348  15  LYS A CG  
39   C CD  . LYS A 18  ? 0.6886 0.8269 0.6903 0.2247  0.0079  0.0411  15  LYS A CD  
40   C CE  . LYS A 18  ? 0.6848 0.9107 0.7486 0.2199  0.0155  0.0429  15  LYS A CE  
41   N NZ  . LYS A 18  ? 0.7616 1.0100 0.8313 0.2688  0.0380  0.0553  15  LYS A NZ  
42   N N   . ARG A 19  ? 0.5733 0.5114 0.4137 0.1520  -0.0372 0.0439  16  ARG A N   
43   C CA  . ARG A 19  ? 0.6518 0.5141 0.4356 0.1278  -0.0377 0.0456  16  ARG A CA  
44   C C   . ARG A 19  ? 0.6618 0.5544 0.4537 0.0951  -0.0469 0.0458  16  ARG A C   
45   O O   . ARG A 19  ? 0.6490 0.5260 0.4296 0.0619  -0.0445 0.0418  16  ARG A O   
46   C CB  . ARG A 19  ? 0.8497 0.6309 0.5684 0.1558  -0.0377 0.0608  16  ARG A CB  
47   C CG  . ARG A 19  ? 1.0409 0.7242 0.6901 0.1267  -0.0362 0.0617  16  ARG A CG  
48   C CD  . ARG A 19  ? 1.2442 0.8244 0.8139 0.1562  -0.0356 0.0759  16  ARG A CD  
49   N NE  . ARG A 19  ? 1.4168 0.9762 0.9782 0.2093  -0.0232 0.0741  16  ARG A NE  
50   C CZ  . ARG A 19  ? 1.5246 1.1089 1.0967 0.2640  -0.0219 0.0872  16  ARG A CZ  
51   N NH1 . ARG A 19  ? 1.4935 1.1183 1.0807 0.2697  -0.0358 0.1023  16  ARG A NH1 
52   N NH2 . ARG A 19  ? 1.5972 1.1699 1.1636 0.3150  -0.0063 0.0868  16  ARG A NH2 
53   N N   . LEU A 20  ? 0.6554 0.5953 0.4654 0.1055  -0.0574 0.0518  17  LEU A N   
54   C CA  . LEU A 20  ? 0.6375 0.6055 0.4490 0.0787  -0.0635 0.0498  17  LEU A CA  
55   C C   . LEU A 20  ? 0.5169 0.5186 0.3617 0.0529  -0.0567 0.0326  17  LEU A C   
56   O O   . LEU A 20  ? 0.5282 0.5223 0.3599 0.0284  -0.0515 0.0318  17  LEU A O   
57   C CB  . LEU A 20  ? 0.6495 0.6678 0.4756 0.0921  -0.0783 0.0549  17  LEU A CB  
58   C CG  . LEU A 20  ? 0.5934 0.6389 0.4145 0.0672  -0.0831 0.0487  17  LEU A CG  
59   C CD1 . LEU A 20  ? 0.5836 0.5855 0.3532 0.0546  -0.0799 0.0616  17  LEU A CD1 
60   C CD2 . LEU A 20  ? 0.5421 0.6381 0.3776 0.0755  -0.1013 0.0494  17  LEU A CD2 
61   N N   . ALA A 21  ? 0.4682 0.5092 0.3553 0.0593  -0.0560 0.0215  18  ALA A N   
62   C CA  . ALA A 21  ? 0.4636 0.5277 0.3768 0.0399  -0.0499 0.0064  18  ALA A CA  
63   C C   . ALA A 21  ? 0.5522 0.5836 0.4540 0.0256  -0.0397 0.0051  18  ALA A C   
64   O O   . ALA A 21  ? 0.4539 0.4994 0.3620 0.0078  -0.0352 0.0000  18  ALA A O   
65   C CB  . ALA A 21  ? 0.4404 0.5407 0.3930 0.0466  -0.0510 -0.0016 18  ALA A CB  
66   N N   . LYS A 22  ? 0.5828 0.5708 0.4640 0.0347  -0.0364 0.0104  19  LYS A N   
67   C CA  . LYS A 22  ? 0.6491 0.6019 0.5119 0.0156  -0.0312 0.0093  19  LYS A CA  
68   C C   . LYS A 22  ? 0.6452 0.5808 0.4790 -0.0111 -0.0336 0.0195  19  LYS A C   
69   O O   . LYS A 22  ? 0.6192 0.5700 0.4607 -0.0356 -0.0317 0.0194  19  LYS A O   
70   C CB  . LYS A 22  ? 0.6806 0.5751 0.5112 0.0313  -0.0273 0.0110  19  LYS A CB  
71   C CG  . LYS A 22  ? 0.7137 0.6332 0.5739 0.0588  -0.0206 0.0046  19  LYS A CG  
72   C CD  . LYS A 22  ? 0.7882 0.6894 0.6451 0.0532  -0.0125 -0.0039 19  LYS A CD  
73   C CE  . LYS A 22  ? 0.8979 0.7205 0.6964 0.0674  -0.0065 -0.0019 19  LYS A CE  
74   N NZ  . LYS A 22  ? 0.9334 0.7456 0.7290 0.0644  0.0018  -0.0112 19  LYS A NZ  
75   N N   . TYR A 23  ? 0.6309 0.5393 0.4315 -0.0064 -0.0379 0.0314  20  TYR A N   
76   C CA  . TYR A 23  ? 0.7058 0.6007 0.4766 -0.0349 -0.0390 0.0447  20  TYR A CA  
77   C C   . TYR A 23  ? 0.6143 0.5788 0.4188 -0.0471 -0.0341 0.0420  20  TYR A C   
78   O O   . TYR A 23  ? 0.5628 0.5491 0.3719 -0.0738 -0.0296 0.0481  20  TYR A O   
79   C CB  . TYR A 23  ? 0.7391 0.5889 0.4640 -0.0238 -0.0445 0.0595  20  TYR A CB  
80   C CG  . TYR A 23  ? 0.8387 0.5940 0.5016 -0.0245 -0.0473 0.0691  20  TYR A CG  
81   C CD1 . TYR A 23  ? 0.8390 0.5528 0.4921 -0.0051 -0.0448 0.0600  20  TYR A CD1 
82   C CD2 . TYR A 23  ? 0.9871 0.6861 0.5922 -0.0438 -0.0513 0.0875  20  TYR A CD2 
83   C CE1 . TYR A 23  ? 0.9013 0.5125 0.4828 -0.0021 -0.0460 0.0667  20  TYR A CE1 
84   C CE2 . TYR A 23  ? 1.1203 0.7143 0.6545 -0.0453 -0.0546 0.0958  20  TYR A CE2 
85   C CZ  . TYR A 23  ? 1.0612 0.6077 0.5809 -0.0228 -0.0519 0.0841  20  TYR A CZ  
86   O OH  . TYR A 23  ? 1.1937 0.6200 0.6284 -0.0216 -0.0540 0.0906  20  TYR A OH  
87   N N   . VAL A 24  ? 0.5622 0.5622 0.3871 -0.0269 -0.0350 0.0338  21  VAL A N   
88   C CA  . VAL A 24  ? 0.5676 0.6174 0.4075 -0.0322 -0.0285 0.0294  21  VAL A CA  
89   C C   . VAL A 24  ? 0.5053 0.5892 0.3805 -0.0376 -0.0202 0.0195  21  VAL A C   
90   O O   . VAL A 24  ? 0.4463 0.5650 0.3282 -0.0477 -0.0105 0.0239  21  VAL A O   
91   C CB  . VAL A 24  ? 0.5154 0.5830 0.3580 -0.0130 -0.0350 0.0202  21  VAL A CB  
92   C CG1 . VAL A 24  ? 0.4706 0.5750 0.3230 -0.0134 -0.0266 0.0084  21  VAL A CG1 
93   C CG2 . VAL A 24  ? 0.4444 0.4897 0.2478 -0.0083 -0.0435 0.0349  21  VAL A CG2 
94   N N   . ILE A 25  ? 0.3893 0.4660 0.2860 -0.0291 -0.0227 0.0089  22  ILE A N   
95   C CA  . ILE A 25  ? 0.3575 0.4615 0.2828 -0.0311 -0.0164 0.0013  22  ILE A CA  
96   C C   . ILE A 25  ? 0.4110 0.5230 0.3352 -0.0541 -0.0143 0.0144  22  ILE A C   
97   O O   . ILE A 25  ? 0.4636 0.6183 0.4098 -0.0565 -0.0076 0.0162  22  ILE A O   
98   C CB  . ILE A 25  ? 0.5963 0.6882 0.5403 -0.0201 -0.0194 -0.0105 22  ILE A CB  
99   C CG1 . ILE A 25  ? 0.5627 0.6796 0.5305 -0.0159 -0.0135 -0.0195 22  ILE A CG1 
100  C CG2 . ILE A 25  ? 0.6061 0.6611 0.5373 -0.0260 -0.0225 -0.0055 22  ILE A CG2 
101  C CD1 . ILE A 25  ? 0.6535 0.7857 0.6191 -0.0052 -0.0099 -0.0287 22  ILE A CD1 
102  N N   . ARG A 26  ? 0.4796 0.5502 0.3747 -0.0712 -0.0210 0.0249  23  ARG A N   
103  C CA  . ARG A 26  ? 0.5449 0.6185 0.4330 -0.1030 -0.0240 0.0383  23  ARG A CA  
104  C C   . ARG A 26  ? 0.5357 0.6519 0.4233 -0.1228 -0.0181 0.0553  23  ARG A C   
105  O O   . ARG A 26  ? 0.5403 0.7077 0.4492 -0.1433 -0.0160 0.0670  23  ARG A O   
106  C CB  . ARG A 26  ? 0.5754 0.5720 0.4167 -0.1178 -0.0338 0.0426  23  ARG A CB  
107  C CG  . ARG A 26  ? 0.6784 0.6450 0.5198 -0.1071 -0.0367 0.0299  23  ARG A CG  
108  C CD  . ARG A 26  ? 0.8168 0.6968 0.6051 -0.0989 -0.0403 0.0282  23  ARG A CD  
109  N NE  . ARG A 26  ? 0.7912 0.6492 0.5786 -0.0862 -0.0390 0.0160  23  ARG A NE  
110  C CZ  . ARG A 26  ? 0.7168 0.6009 0.5378 -0.0554 -0.0314 0.0046  23  ARG A CZ  
111  N NH1 . ARG A 26  ? 0.6821 0.5467 0.4977 -0.0475 -0.0284 -0.0038 23  ARG A NH1 
112  N NH2 . ARG A 26  ? 0.5757 0.5049 0.4316 -0.0364 -0.0276 0.0023  23  ARG A NH2 
113  N N   . GLY A 27  ? 0.5328 0.6338 0.3966 -0.1163 -0.0154 0.0591  24  GLY A N   
114  C CA  . GLY A 27  ? 0.5936 0.7305 0.4489 -0.1352 -0.0073 0.0771  24  GLY A CA  
115  C C   . GLY A 27  ? 0.4972 0.7133 0.3879 -0.1194 0.0091  0.0751  24  GLY A C   
116  O O   . GLY A 27  ? 0.5157 0.7886 0.4176 -0.1384 0.0191  0.0934  24  GLY A O   
117  N N   . PHE A 28  ? 0.4520 0.6711 0.3570 -0.0850 0.0127  0.0542  25  PHE A N   
118  C CA  . PHE A 28  ? 0.4533 0.7228 0.3704 -0.0624 0.0298  0.0489  25  PHE A CA  
119  C C   . PHE A 28  ? 0.4725 0.7648 0.4212 -0.0385 0.0350  0.0350  25  PHE A C   
120  O O   . PHE A 28  ? 0.5241 0.8487 0.4756 -0.0146 0.0510  0.0303  25  PHE A O   
121  C CB  . PHE A 28  ? 0.4568 0.6970 0.3401 -0.0446 0.0299  0.0375  25  PHE A CB  
122  C CG  . PHE A 28  ? 0.4739 0.6965 0.3211 -0.0627 0.0275  0.0542  25  PHE A CG  
123  C CD1 . PHE A 28  ? 0.4630 0.7282 0.2995 -0.0736 0.0440  0.0718  25  PHE A CD1 
124  C CD2 . PHE A 28  ? 0.5043 0.6692 0.3268 -0.0669 0.0103  0.0552  25  PHE A CD2 
125  C CE1 . PHE A 28  ? 0.5262 0.7698 0.3235 -0.0937 0.0420  0.0901  25  PHE A CE1 
126  C CE2 . PHE A 28  ? 0.5539 0.6931 0.3358 -0.0811 0.0075  0.0730  25  PHE A CE2 
127  C CZ  . PHE A 28  ? 0.5638 0.7388 0.3309 -0.0972 0.0226  0.0904  25  PHE A CZ  
128  N N   . TYR A 29  ? 0.3431 0.6129 0.3083 -0.0429 0.0229  0.0294  26  TYR A N   
129  C CA  . TYR A 29  ? 0.3994 0.6829 0.3899 -0.0227 0.0258  0.0193  26  TYR A CA  
130  C C   . TYR A 29  ? 0.4629 0.7654 0.4766 -0.0431 0.0170  0.0320  26  TYR A C   
131  O O   . TYR A 29  ? 0.5552 0.8421 0.5572 -0.0740 0.0066  0.0433  26  TYR A O   
132  C CB  . TYR A 29  ? 0.3194 0.5504 0.3001 -0.0070 0.0184  -0.0026 26  TYR A CB  
133  C CG  . TYR A 29  ? 0.4014 0.6134 0.3545 0.0064  0.0214  -0.0148 26  TYR A CG  
134  C CD1 . TYR A 29  ? 0.3870 0.5795 0.3176 -0.0041 0.0137  -0.0115 26  TYR A CD1 
135  C CD2 . TYR A 29  ? 0.4886 0.6952 0.4304 0.0298  0.0303  -0.0293 26  TYR A CD2 
136  C CE1 . TYR A 29  ? 0.4473 0.6255 0.3488 0.0056  0.0127  -0.0215 26  TYR A CE1 
137  C CE2 . TYR A 29  ? 0.5503 0.7324 0.4561 0.0372  0.0301  -0.0417 26  TYR A CE2 
138  C CZ  . TYR A 29  ? 0.5136 0.6866 0.4017 0.0236  0.0202  -0.0374 26  TYR A CZ  
139  O OH  . TYR A 29  ? 0.6208 0.7725 0.4702 0.0286  0.0165  -0.0487 26  TYR A OH  
140  N N   . GLY A 30  ? 0.4616 0.7917 0.5003 -0.0269 0.0198  0.0309  27  GLY A N   
141  C CA  . GLY A 30  ? 0.4162 0.7680 0.4740 -0.0465 0.0083  0.0435  27  GLY A CA  
142  C C   . GLY A 30  ? 0.3556 0.6445 0.3956 -0.0624 -0.0076 0.0348  27  GLY A C   
143  O O   . GLY A 30  ? 0.4087 0.6423 0.4288 -0.0541 -0.0086 0.0194  27  GLY A O   
144  N N   . ILE A 31  ? 0.4712 0.7729 0.5165 -0.0857 -0.0201 0.0463  28  ILE A N   
145  C CA  . ILE A 31  ? 0.3630 0.6048 0.3846 -0.0968 -0.0327 0.0378  28  ILE A CA  
146  C C   . ILE A 31  ? 0.3528 0.5663 0.3785 -0.0652 -0.0265 0.0203  28  ILE A C   
147  O O   . ILE A 31  ? 0.3863 0.5451 0.3910 -0.0625 -0.0275 0.0082  28  ILE A O   
148  C CB  . ILE A 31  ? 0.5037 0.7709 0.5287 -0.1242 -0.0484 0.0524  28  ILE A CB  
149  C CG1 . ILE A 31  ? 0.6535 0.9416 0.6678 -0.1682 -0.0585 0.0715  28  ILE A CG1 
150  C CG2 . ILE A 31  ? 0.5954 0.7946 0.5871 -0.1300 -0.0582 0.0411  28  ILE A CG2 
151  C CD1 . ILE A 31  ? 0.7703 0.9686 0.7273 -0.1939 -0.0667 0.0654  28  ILE A CD1 
152  N N   . GLU A 32  ? 0.3097 0.5610 0.3604 -0.0405 -0.0192 0.0209  29  GLU A N   
153  C CA  . GLU A 32  ? 0.4221 0.6423 0.4713 -0.0161 -0.0146 0.0072  29  GLU A CA  
154  C C   . GLU A 32  ? 0.4310 0.6091 0.4660 -0.0083 -0.0090 -0.0092 29  GLU A C   
155  O O   . GLU A 32  ? 0.3495 0.4914 0.3770 -0.0050 -0.0097 -0.0189 29  GLU A O   
156  C CB  . GLU A 32  ? 0.4541 0.7098 0.5211 0.0134  -0.0059 0.0111  29  GLU A CB  
157  C CG  . GLU A 32  ? 0.5260 0.8374 0.6148 0.0120  -0.0128 0.0308  29  GLU A CG  
158  C CD  . GLU A 32  ? 0.7348 1.1060 0.8459 0.0434  0.0003  0.0412  29  GLU A CD  
159  O OE1 . GLU A 32  ? 0.8575 1.2608 0.9742 0.0426  0.0104  0.0444  29  GLU A OE1 
160  O OE2 . GLU A 32  ? 0.6903 1.0741 0.8093 0.0721  0.0023  0.0469  29  GLU A OE2 
161  N N   . HIS A 33  ? 0.3429 0.5328 0.3748 -0.0068 -0.0037 -0.0100 30  HIS A N   
162  C CA  . HIS A 33  ? 0.3403 0.5004 0.3588 -0.0011 -0.0020 -0.0229 30  HIS A CA  
163  C C   . HIS A 33  ? 0.3592 0.4890 0.3665 -0.0145 -0.0092 -0.0234 30  HIS A C   
164  O O   . HIS A 33  ? 0.3459 0.4546 0.3512 -0.0089 -0.0102 -0.0322 30  HIS A O   
165  C CB  . HIS A 33  ? 0.3438 0.5247 0.3548 0.0044  0.0049  -0.0218 30  HIS A CB  
166  C CG  . HIS A 33  ? 0.3665 0.5720 0.3806 0.0270  0.0169  -0.0230 30  HIS A CG  
167  N ND1 . HIS A 33  ? 0.4157 0.6684 0.4500 0.0332  0.0223  -0.0086 30  HIS A ND1 
168  C CD2 . HIS A 33  ? 0.3777 0.5637 0.3719 0.0474  0.0245  -0.0363 30  HIS A CD2 
169  C CE1 . HIS A 33  ? 0.3997 0.6632 0.4288 0.0634  0.0360  -0.0124 30  HIS A CE1 
170  N NE2 . HIS A 33  ? 0.4538 0.6688 0.4527 0.0717  0.0378  -0.0307 30  HIS A NE2 
171  N N   . ALA A 34  ? 0.2971 0.4245 0.2941 -0.0320 -0.0140 -0.0125 31  ALA A N   
172  C CA  . ALA A 34  ? 0.3229 0.4080 0.2964 -0.0387 -0.0188 -0.0125 31  ALA A CA  
173  C C   . ALA A 34  ? 0.4224 0.4821 0.3941 -0.0326 -0.0184 -0.0193 31  ALA A C   
174  O O   . ALA A 34  ? 0.3981 0.4358 0.3632 -0.0213 -0.0159 -0.0242 31  ALA A O   
175  C CB  . ALA A 34  ? 0.3086 0.3797 0.2576 -0.0637 -0.0253 0.0004  31  ALA A CB  
176  N N   . LEU A 35  ? 0.3520 0.4206 0.3298 -0.0383 -0.0203 -0.0173 32  LEU A N   
177  C CA  . LEU A 35  ? 0.3359 0.3795 0.3056 -0.0345 -0.0188 -0.0220 32  LEU A CA  
178  C C   . LEU A 35  ? 0.3654 0.4147 0.3539 -0.0186 -0.0113 -0.0302 32  LEU A C   
179  O O   . LEU A 35  ? 0.4032 0.4346 0.3860 -0.0127 -0.0060 -0.0336 32  LEU A O   
180  C CB  . LEU A 35  ? 0.3457 0.4004 0.3147 -0.0452 -0.0255 -0.0153 32  LEU A CB  
181  C CG  . LEU A 35  ? 0.4098 0.4604 0.3568 -0.0716 -0.0373 -0.0051 32  LEU A CG  
182  C CD1 . LEU A 35  ? 0.4438 0.5294 0.4017 -0.0827 -0.0476 0.0055  32  LEU A CD1 
183  C CD2 . LEU A 35  ? 0.5307 0.5158 0.4290 -0.0803 -0.0393 -0.0095 32  LEU A CD2 
184  N N   . ALA A 36  ? 0.3657 0.4381 0.3724 -0.0123 -0.0101 -0.0328 33  ALA A N   
185  C CA  . ALA A 36  ? 0.3809 0.4501 0.3971 -0.0054 -0.0062 -0.0408 33  ALA A CA  
186  C C   . ALA A 36  ? 0.4317 0.5031 0.4509 -0.0043 -0.0065 -0.0434 33  ALA A C   
187  O O   . ALA A 36  ? 0.3688 0.4412 0.3961 -0.0038 -0.0036 -0.0445 33  ALA A O   
188  C CB  . ALA A 36  ? 0.3562 0.4326 0.3748 0.0019  -0.0053 -0.0451 33  ALA A CB  
189  N N   . LEU A 37  ? 0.4269 0.5051 0.4407 -0.0035 -0.0100 -0.0414 34  LEU A N   
190  C CA  . LEU A 37  ? 0.3766 0.4608 0.3926 0.0017  -0.0127 -0.0409 34  LEU A CA  
191  C C   . LEU A 37  ? 0.3772 0.4484 0.3880 0.0105  -0.0082 -0.0360 34  LEU A C   
192  O O   . LEU A 37  ? 0.4022 0.4912 0.4261 0.0200  -0.0076 -0.0338 34  LEU A O   
193  C CB  . LEU A 37  ? 0.4266 0.5138 0.4296 0.0018  -0.0173 -0.0373 34  LEU A CB  
194  C CG  . LEU A 37  ? 0.4582 0.5599 0.4644 0.0080  -0.0240 -0.0369 34  LEU A CG  
195  C CD1 . LEU A 37  ? 0.3850 0.5011 0.3973 0.0015  -0.0287 -0.0464 34  LEU A CD1 
196  C CD2 . LEU A 37  ? 0.4848 0.5783 0.4694 0.0106  -0.0278 -0.0289 34  LEU A CD2 
197  N N   . ASP A 38  ? 0.3530 0.3946 0.3416 0.0082  -0.0053 -0.0334 35  ASP A N   
198  C CA  . ASP A 38  ? 0.4552 0.4688 0.4234 0.0207  0.0019  -0.0311 35  ASP A CA  
199  C C   . ASP A 38  ? 0.4121 0.4474 0.4016 0.0302  0.0119  -0.0321 35  ASP A C   
200  O O   . ASP A 38  ? 0.3785 0.4159 0.3661 0.0499  0.0209  -0.0282 35  ASP A O   
201  C CB  . ASP A 38  ? 0.5482 0.5190 0.4799 0.0094  0.0010  -0.0308 35  ASP A CB  
202  C CG  . ASP A 38  ? 0.6243 0.5589 0.5202 0.0002  -0.0064 -0.0259 35  ASP A CG  
203  O OD1 . ASP A 38  ? 0.6599 0.5929 0.5528 0.0101  -0.0077 -0.0220 35  ASP A OD1 
204  O OD2 . ASP A 38  ? 0.6799 0.5867 0.5475 -0.0200 -0.0127 -0.0241 35  ASP A OD2 
205  N N   . ILE A 39  ? 0.3955 0.4470 0.4032 0.0173  0.0115  -0.0353 36  ILE A N   
206  C CA  . ILE A 39  ? 0.4000 0.4710 0.4256 0.0174  0.0205  -0.0340 36  ILE A CA  
207  C C   . ILE A 39  ? 0.4091 0.5256 0.4672 0.0193  0.0186  -0.0306 36  ILE A C   
208  O O   . ILE A 39  ? 0.3759 0.5226 0.4514 0.0279  0.0285  -0.0236 36  ILE A O   
209  C CB  . ILE A 39  ? 0.4166 0.4804 0.4438 0.0015  0.0180  -0.0369 36  ILE A CB  
210  C CG1 . ILE A 39  ? 0.4322 0.4629 0.4302 0.0000  0.0175  -0.0364 36  ILE A CG1 
211  C CG2 . ILE A 39  ? 0.3189 0.3998 0.3622 -0.0061 0.0259  -0.0335 36  ILE A CG2 
212  C CD1 . ILE A 39  ? 0.3577 0.3819 0.3547 -0.0087 0.0138  -0.0358 36  ILE A CD1 
213  N N   . LEU A 40  ? 0.3239 0.4503 0.3890 0.0111  0.0058  -0.0341 37  LEU A N   
214  C CA  . LEU A 40  ? 0.3175 0.4864 0.4077 0.0069  -0.0025 -0.0310 37  LEU A CA  
215  C C   . LEU A 40  ? 0.3439 0.5340 0.4392 0.0302  -0.0021 -0.0219 37  LEU A C   
216  O O   . LEU A 40  ? 0.4330 0.6729 0.5553 0.0316  -0.0084 -0.0142 37  LEU A O   
217  C CB  . LEU A 40  ? 0.3401 0.5000 0.4212 -0.0078 -0.0162 -0.0395 37  LEU A CB  
218  C CG  . LEU A 40  ? 0.3826 0.5156 0.4534 -0.0241 -0.0155 -0.0476 37  LEU A CG  
219  C CD1 . LEU A 40  ? 0.4773 0.5964 0.5309 -0.0339 -0.0264 -0.0572 37  LEU A CD1 
220  C CD2 . LEU A 40  ? 0.2916 0.4394 0.3791 -0.0393 -0.0113 -0.0429 37  LEU A CD2 
221  N N   . ILE A 41  ? 0.3790 0.5296 0.4448 0.0478  0.0037  -0.0210 38  ILE A N   
222  C CA  . ILE A 41  ? 0.4364 0.5901 0.4953 0.0768  0.0069  -0.0114 38  ILE A CA  
223  C C   . ILE A 41  ? 0.5138 0.6775 0.5771 0.0995  0.0258  -0.0053 38  ILE A C   
224  O O   . ILE A 41  ? 0.5731 0.7808 0.6581 0.1244  0.0306  0.0065  38  ILE A O   
225  C CB  . ILE A 41  ? 0.4862 0.5795 0.4992 0.0826  0.0039  -0.0123 38  ILE A CB  
226  C CG1 . ILE A 41  ? 0.5276 0.6325 0.5426 0.0694  -0.0119 -0.0125 38  ILE A CG1 
227  C CG2 . ILE A 41  ? 0.4767 0.5447 0.4641 0.1178  0.0120  -0.0031 38  ILE A CG2 
228  C CD1 . ILE A 41  ? 0.6310 0.6889 0.6092 0.0579  -0.0153 -0.0138 38  ILE A CD1 
229  N N   . ARG A 42  ? 0.4832 0.6118 0.5260 0.0929  0.0369  -0.0116 39  ARG A N   
230  C CA  . ARG A 42  ? 0.5075 0.6441 0.5486 0.1128  0.0581  -0.0069 39  ARG A CA  
231  C C   . ARG A 42  ? 0.3872 0.6078 0.4842 0.1083  0.0634  0.0035  39  ARG A C   
232  O O   . ARG A 42  ? 0.3652 0.6260 0.4777 0.1361  0.0805  0.0149  39  ARG A O   
233  C CB  . ARG A 42  ? 0.5391 0.6263 0.5468 0.0981  0.0651  -0.0155 39  ARG A CB  
234  C CG  . ARG A 42  ? 0.5587 0.5661 0.5018 0.1104  0.0690  -0.0213 39  ARG A CG  
235  C CD  . ARG A 42  ? 0.6151 0.5855 0.5284 0.0916  0.0716  -0.0279 39  ARG A CD  
236  N NE  . ARG A 42  ? 0.5643 0.5603 0.4863 0.1020  0.0921  -0.0238 39  ARG A NE  
237  C CZ  . ARG A 42  ? 0.5867 0.5530 0.4686 0.1305  0.1132  -0.0235 39  ARG A CZ  
238  N NH1 . ARG A 42  ? 0.6299 0.5271 0.4531 0.1514  0.1148  -0.0285 39  ARG A NH1 
239  N NH2 . ARG A 42  ? 0.5970 0.5973 0.4909 0.1383  0.1342  -0.0175 39  ARG A NH2 
240  N N   . ASN A 43  ? 0.3691 0.6140 0.4924 0.0724  0.0497  0.0003  40  ASN A N   
241  C CA  . ASN A 43  ? 0.3824 0.6979 0.5518 0.0537  0.0512  0.0102  40  ASN A CA  
242  C C   . ASN A 43  ? 0.4178 0.7690 0.6132 0.0288  0.0270  0.0104  40  ASN A C   
243  O O   . ASN A 43  ? 0.4700 0.7773 0.6422 0.0155  0.0122  -0.0018 40  ASN A O   
244  C CB  . ASN A 43  ? 0.3840 0.6756 0.5435 0.0275  0.0584  0.0061  40  ASN A CB  
245  C CG  . ASN A 43  ? 0.4564 0.6914 0.5727 0.0463  0.0760  0.0014  40  ASN A CG  
246  O OD1 . ASN A 43  ? 0.4242 0.6756 0.5376 0.0699  0.0976  0.0092  40  ASN A OD1 
247  N ND2 . ASN A 43  ? 0.4608 0.6319 0.5413 0.0363  0.0666  -0.0106 40  ASN A ND2 
248  N N   . SER A 44  ? 0.4726 0.9056 0.7134 0.0214  0.0226  0.0251  41  SER A N   
249  C CA  . SER A 44  ? 0.5253 0.9897 0.7824 -0.0043 -0.0040 0.0254  41  SER A CA  
250  C C   . SER A 44  ? 0.5089 0.9248 0.7429 -0.0478 -0.0170 0.0107  41  SER A C   
251  O O   . SER A 44  ? 0.5513 0.9269 0.7583 -0.0562 -0.0329 -0.0020 41  SER A O   
252  C CB  . SER A 44  ? 0.5148 1.0874 0.8286 -0.0112 -0.0091 0.0472  41  SER A CB  
253  O OG  . SER A 44  ? 0.5927 1.1943 0.9268 -0.0521 -0.0068 0.0528  41  SER A OG  
254  N N   . CYS A 45  ? 0.4527 0.8663 0.6909 -0.0713 -0.0075 0.0131  42  CYS A N   
255  C CA  . CYS A 45  ? 0.3954 0.7606 0.6081 -0.1118 -0.0190 0.0027  42  CYS A CA  
256  C C   . CYS A 45  ? 0.4544 0.7610 0.6401 -0.1097 -0.0013 -0.0019 42  CYS A C   
257  O O   . CYS A 45  ? 0.3698 0.7053 0.5723 -0.1060 0.0170  0.0102  42  CYS A O   
258  C CB  . CYS A 45  ? 0.3510 0.7771 0.5939 -0.1554 -0.0316 0.0159  42  CYS A CB  
259  S SG  . CYS A 45  ? 0.9125 1.2689 1.1101 -0.2095 -0.0539 0.0023  42  CYS A SG  
260  N N   . VAL A 46  ? 0.3624 0.5926 0.5064 -0.1087 -0.0054 -0.0173 43  VAL A N   
261  C CA  . VAL A 46  ? 0.3565 0.5361 0.4750 -0.1041 0.0082  -0.0188 43  VAL A CA  
262  C C   . VAL A 46  ? 0.4379 0.5490 0.5178 -0.1243 -0.0001 -0.0276 43  VAL A C   
263  O O   . VAL A 46  ? 0.4624 0.5395 0.5195 -0.1229 -0.0123 -0.0400 43  VAL A O   
264  C CB  . VAL A 46  ? 0.3708 0.5251 0.4737 -0.0693 0.0160  -0.0245 43  VAL A CB  
265  C CG1 . VAL A 46  ? 0.2966 0.4119 0.3758 -0.0655 0.0279  -0.0225 43  VAL A CG1 
266  C CG2 . VAL A 46  ? 0.3096 0.5085 0.4341 -0.0449 0.0241  -0.0177 43  VAL A CG2 
267  N N   . LYS A 47  ? 0.3986 0.4861 0.4659 -0.1401 0.0082  -0.0202 44  LYS A N   
268  C CA  . LYS A 47  ? 0.5296 0.5386 0.5511 -0.1514 0.0038  -0.0255 44  LYS A CA  
269  C C   . LYS A 47  ? 0.4913 0.4566 0.4876 -0.1169 0.0046  -0.0351 44  LYS A C   
270  O O   . LYS A 47  ? 0.4908 0.4744 0.4976 -0.0933 0.0129  -0.0322 44  LYS A O   
271  C CB  . LYS A 47  ? 0.5458 0.5388 0.5567 -0.1692 0.0154  -0.0116 44  LYS A CB  
272  C CG  . LYS A 47  ? 0.7323 0.7343 0.7455 -0.2171 0.0107  -0.0013 44  LYS A CG  
273  C CD  . LYS A 47  ? 0.8979 0.8924 0.9023 -0.2329 0.0266  0.0162  44  LYS A CD  
274  C CE  . LYS A 47  ? 0.9239 1.0144 0.9795 -0.2310 0.0447  0.0321  44  LYS A CE  
275  N NZ  . LYS A 47  ? 1.0267 1.1170 1.0723 -0.2511 0.0625  0.0512  44  LYS A NZ  
276  N N   . GLU A 48  ? 0.5892 0.4967 0.5487 -0.1145 -0.0038 -0.0455 45  GLU A N   
277  C CA  . GLU A 48  ? 0.5521 0.4310 0.4927 -0.0797 -0.0016 -0.0508 45  GLU A CA  
278  C C   . GLU A 48  ? 0.4988 0.3641 0.4324 -0.0668 0.0067  -0.0396 45  GLU A C   
279  O O   . GLU A 48  ? 0.5423 0.4274 0.4851 -0.0427 0.0088  -0.0374 45  GLU A O   
280  C CB  . GLU A 48  ? 0.5741 0.3860 0.4679 -0.0746 -0.0075 -0.0621 45  GLU A CB  
281  C CG  . GLU A 48  ? 0.5869 0.3821 0.4662 -0.0334 -0.0024 -0.0636 45  GLU A CG  
282  C CD  . GLU A 48  ? 0.7355 0.4663 0.5646 -0.0183 -0.0036 -0.0760 45  GLU A CD  
283  O OE1 . GLU A 48  ? 0.8381 0.5117 0.6284 -0.0440 -0.0102 -0.0835 45  GLU A OE1 
284  O OE2 . GLU A 48  ? 0.7700 0.5070 0.5948 0.0186  0.0024  -0.0776 45  GLU A OE2 
285  N N   . GLU A 49  ? 0.5472 0.3792 0.4612 -0.0870 0.0098  -0.0309 46  GLU A N   
286  C CA  . GLU A 49  ? 0.5800 0.3967 0.4811 -0.0787 0.0169  -0.0182 46  GLU A CA  
287  C C   . GLU A 49  ? 0.5713 0.4442 0.5016 -0.0715 0.0245  -0.0129 46  GLU A C   
288  O O   . GLU A 49  ? 0.5554 0.4258 0.4765 -0.0526 0.0248  -0.0082 46  GLU A O   
289  C CB  . GLU A 49  ? 0.7256 0.5008 0.6003 -0.1095 0.0203  -0.0078 46  GLU A CB  
290  C CG  . GLU A 49  ? 0.9748 0.6618 0.7942 -0.1015 0.0158  -0.0062 46  GLU A CG  
291  C CD  . GLU A 49  ? 1.1410 0.8159 0.9469 -0.0643 0.0171  0.0019  46  GLU A CD  
292  O OE1 . GLU A 49  ? 1.2093 0.9147 1.0266 -0.0650 0.0227  0.0128  46  GLU A OE1 
293  O OE2 . GLU A 49  ? 1.1977 0.8358 0.9801 -0.0332 0.0124  -0.0019 46  GLU A OE2 
294  N N   . ASP A 50  ? 0.5112 0.4329 0.4722 -0.0855 0.0299  -0.0129 47  ASP A N   
295  C CA  . ASP A 50  ? 0.4321 0.3938 0.4094 -0.0728 0.0392  -0.0101 47  ASP A CA  
296  C C   . ASP A 50  ? 0.4670 0.4363 0.4478 -0.0502 0.0317  -0.0185 47  ASP A C   
297  O O   . ASP A 50  ? 0.4839 0.4510 0.4526 -0.0386 0.0334  -0.0162 47  ASP A O   
298  C CB  . ASP A 50  ? 0.3914 0.4075 0.4014 -0.0836 0.0482  -0.0065 47  ASP A CB  
299  C CG  . ASP A 50  ? 0.4852 0.5107 0.4955 -0.1071 0.0603  0.0072  47  ASP A CG  
300  O OD1 . ASP A 50  ? 0.5170 0.4993 0.4949 -0.1110 0.0638  0.0136  47  ASP A OD1 
301  O OD2 . ASP A 50  ? 0.4870 0.5675 0.5304 -0.1222 0.0660  0.0142  47  ASP A OD2 
302  N N   . MET A 51  ? 0.4407 0.4169 0.4331 -0.0474 0.0225  -0.0274 48  MET A N   
303  C CA  . MET A 51  ? 0.3623 0.3491 0.3579 -0.0302 0.0164  -0.0325 48  MET A CA  
304  C C   . MET A 51  ? 0.3841 0.3505 0.3611 -0.0179 0.0119  -0.0279 48  MET A C   
305  O O   . MET A 51  ? 0.4258 0.4055 0.4021 -0.0109 0.0079  -0.0255 48  MET A O   
306  C CB  . MET A 51  ? 0.4225 0.4171 0.4268 -0.0290 0.0091  -0.0414 48  MET A CB  
307  C CG  . MET A 51  ? 0.4919 0.5171 0.5171 -0.0398 0.0084  -0.0437 48  MET A CG  
308  S SD  . MET A 51  ? 0.5029 0.5298 0.5256 -0.0396 -0.0027 -0.0544 48  MET A SD  
309  C CE  . MET A 51  ? 0.3050 0.3459 0.3291 -0.0192 -0.0021 -0.0535 48  MET A CE  
310  N N   . LEU A 52  ? 0.4385 0.3714 0.3978 -0.0164 0.0111  -0.0252 49  LEU A N   
311  C CA  . LEU A 52  ? 0.4749 0.3942 0.4191 0.0016  0.0062  -0.0177 49  LEU A CA  
312  C C   . LEU A 52  ? 0.5011 0.4254 0.4357 -0.0009 0.0052  -0.0076 49  LEU A C   
313  O O   . LEU A 52  ? 0.5248 0.4704 0.4611 0.0073  -0.0032 -0.0022 49  LEU A O   
314  C CB  . LEU A 52  ? 0.5271 0.3945 0.4435 0.0071  0.0070  -0.0159 49  LEU A CB  
315  C CG  . LEU A 52  ? 0.5754 0.4263 0.4737 0.0347  0.0028  -0.0052 49  LEU A CG  
316  C CD1 . LEU A 52  ? 0.5176 0.4049 0.4333 0.0603  0.0000  -0.0068 49  LEU A CD1 
317  C CD2 . LEU A 52  ? 0.5936 0.3727 0.4511 0.0386  0.0053  -0.0029 49  LEU A CD2 
318  N N   . GLU A 53  ? 0.4886 0.3967 0.4111 -0.0154 0.0136  -0.0044 50  GLU A N   
319  C CA  . GLU A 53  ? 0.5083 0.4117 0.4095 -0.0177 0.0145  0.0040  50  GLU A CA  
320  C C   . GLU A 53  ? 0.4950 0.4217 0.3994 -0.0190 0.0129  -0.0011 50  GLU A C   
321  O O   . GLU A 53  ? 0.5492 0.4715 0.4311 -0.0193 0.0051  0.0038  50  GLU A O   
322  C CB  . GLU A 53  ? 0.5682 0.4528 0.4543 -0.0323 0.0285  0.0095  50  GLU A CB  
323  C CG  . GLU A 53  ? 0.6681 0.5122 0.5352 -0.0369 0.0286  0.0178  50  GLU A CG  
324  C CD  . GLU A 53  ? 0.7704 0.6030 0.6241 -0.0585 0.0436  0.0265  50  GLU A CD  
325  O OE1 . GLU A 53  ? 0.7113 0.5625 0.5591 -0.0605 0.0544  0.0294  50  GLU A OE1 
326  O OE2 . GLU A 53  ? 0.8721 0.6748 0.7168 -0.0745 0.0454  0.0308  50  GLU A OE2 
327  N N   . LEU A 54  ? 0.4658 0.4115 0.3916 -0.0208 0.0184  -0.0104 51  LEU A N   
328  C CA  . LEU A 54  ? 0.4895 0.4414 0.4076 -0.0202 0.0177  -0.0151 51  LEU A CA  
329  C C   . LEU A 54  ? 0.4797 0.4426 0.3990 -0.0205 0.0011  -0.0140 51  LEU A C   
330  O O   . LEU A 54  ? 0.5380 0.4905 0.4317 -0.0276 -0.0066 -0.0122 51  LEU A O   
331  C CB  . LEU A 54  ? 0.4665 0.4364 0.4064 -0.0173 0.0269  -0.0221 51  LEU A CB  
332  C CG  . LEU A 54  ? 0.5518 0.5294 0.4953 -0.0170 0.0450  -0.0197 51  LEU A CG  
333  C CD1 . LEU A 54  ? 0.4978 0.5098 0.4751 -0.0136 0.0490  -0.0226 51  LEU A CD1 
334  C CD2 . LEU A 54  ? 0.5798 0.5359 0.4860 -0.0095 0.0564  -0.0189 51  LEU A CD2 
335  N N   . LEU A 55  ? 0.4624 0.4463 0.4079 -0.0145 -0.0039 -0.0143 52  LEU A N   
336  C CA  . LEU A 55  ? 0.3879 0.3986 0.3433 -0.0149 -0.0161 -0.0105 52  LEU A CA  
337  C C   . LEU A 55  ? 0.4497 0.4755 0.4009 -0.0119 -0.0285 0.0027  52  LEU A C   
338  O O   . LEU A 55  ? 0.4355 0.4911 0.3915 -0.0204 -0.0408 0.0101  52  LEU A O   
339  C CB  . LEU A 55  ? 0.3709 0.4020 0.3522 -0.0054 -0.0132 -0.0153 52  LEU A CB  
340  C CG  . LEU A 55  ? 0.4021 0.4312 0.3913 -0.0085 -0.0064 -0.0253 52  LEU A CG  
341  C CD1 . LEU A 55  ? 0.3780 0.4150 0.3812 0.0005  -0.0040 -0.0310 52  LEU A CD1 
342  C CD2 . LEU A 55  ? 0.3511 0.3885 0.3351 -0.0171 -0.0116 -0.0242 52  LEU A CD2 
343  N N   . LYS A 56  ? 0.4101 0.4181 0.3525 -0.0011 -0.0262 0.0080  53  LYS A N   
344  C CA  . LYS A 56  ? 0.4175 0.4406 0.3558 0.0092  -0.0382 0.0237  53  LYS A CA  
345  C C   . LYS A 56  ? 0.4327 0.4985 0.4006 0.0304  -0.0410 0.0305  53  LYS A C   
346  O O   . LYS A 56  ? 0.4353 0.5385 0.4115 0.0414  -0.0527 0.0471  53  LYS A O   
347  C CB  . LYS A 56  ? 0.4747 0.5102 0.3942 -0.0099 -0.0544 0.0319  53  LYS A CB  
348  C CG  . LYS A 56  ? 0.6314 0.6224 0.5134 -0.0276 -0.0486 0.0225  53  LYS A CG  
349  C CD  . LYS A 56  ? 0.6310 0.5882 0.4855 -0.0222 -0.0429 0.0274  53  LYS A CD  
350  C CE  . LYS A 56  ? 0.7091 0.6388 0.5143 -0.0388 -0.0494 0.0286  53  LYS A CE  
351  N NZ  . LYS A 56  ? 0.7275 0.6310 0.5040 -0.0328 -0.0466 0.0387  53  LYS A NZ  
352  N N   . PHE A 57  ? 0.4077 0.4722 0.3901 0.0376  -0.0298 0.0189  54  PHE A N   
353  C CA  . PHE A 57  ? 0.4134 0.5078 0.4145 0.0636  -0.0260 0.0227  54  PHE A CA  
354  C C   . PHE A 57  ? 0.4583 0.5208 0.4419 0.0937  -0.0223 0.0288  54  PHE A C   
355  O O   . PHE A 57  ? 0.5228 0.5300 0.4792 0.0883  -0.0203 0.0261  54  PHE A O   
356  C CB  . PHE A 57  ? 0.3976 0.4824 0.4040 0.0637  -0.0148 0.0067  54  PHE A CB  
357  C CG  . PHE A 57  ? 0.3912 0.5076 0.4127 0.0419  -0.0175 0.0037  54  PHE A CG  
358  C CD1 . PHE A 57  ? 0.3464 0.4865 0.3701 0.0200  -0.0293 0.0128  54  PHE A CD1 
359  C CD2 . PHE A 57  ? 0.4508 0.5651 0.4759 0.0420  -0.0098 -0.0078 54  PHE A CD2 
360  C CE1 . PHE A 57  ? 0.3280 0.4809 0.3544 -0.0011 -0.0320 0.0106  54  PHE A CE1 
361  C CE2 . PHE A 57  ? 0.4109 0.5466 0.4437 0.0238  -0.0124 -0.0083 54  PHE A CE2 
362  C CZ  . PHE A 57  ? 0.3850 0.5363 0.4173 0.0025  -0.0228 0.0010  54  PHE A CZ  
363  N N   . ASP A 58  ? 0.5253 0.6206 0.5212 0.1272  -0.0196 0.0385  55  ASP A N   
364  C CA  . ASP A 58  ? 0.5420 0.5902 0.5109 0.1649  -0.0117 0.0410  55  ASP A CA  
365  C C   . ASP A 58  ? 0.5671 0.5446 0.5070 0.1612  0.0008  0.0188  55  ASP A C   
366  O O   . ASP A 58  ? 0.5445 0.5359 0.4971 0.1420  0.0042  0.0052  55  ASP A O   
367  C CB  . ASP A 58  ? 0.6748 0.7833 0.6648 0.2087  -0.0083 0.0574  55  ASP A CB  
368  C CG  . ASP A 58  ? 0.8558 0.9026 0.8080 0.2567  0.0057  0.0549  55  ASP A CG  
369  O OD1 . ASP A 58  ? 0.8473 0.8505 0.7712 0.2779  0.0019  0.0663  55  ASP A OD1 
370  O OD2 . ASP A 58  ? 0.9414 0.9753 0.8840 0.2740  0.0207  0.0415  55  ASP A OD2 
371  N N   . ARG A 59  ? 0.6686 0.5671 0.5649 0.1759  0.0054  0.0163  56  ARG A N   
372  C CA  . ARG A 59  ? 0.6484 0.4724 0.5085 0.1640  0.0129  -0.0037 56  ARG A CA  
373  C C   . ARG A 59  ? 0.6843 0.5148 0.5405 0.1840  0.0227  -0.0171 56  ARG A C   
374  O O   . ARG A 59  ? 0.6880 0.5129 0.5446 0.1576  0.0231  -0.0333 56  ARG A O   
375  C CB  . ARG A 59  ? 0.8377 0.5664 0.6409 0.1768  0.0146  -0.0006 56  ARG A CB  
376  C CG  . ARG A 59  ? 0.9667 0.6126 0.7278 0.1456  0.0163  -0.0177 56  ARG A CG  
377  C CD  . ARG A 59  ? 1.0758 0.6255 0.7791 0.1448  0.0155  -0.0100 56  ARG A CD  
378  N NE  . ARG A 59  ? 1.1143 0.6836 0.8337 0.1187  0.0099  0.0049  56  ARG A NE  
379  C CZ  . ARG A 59  ? 1.0956 0.6634 0.8220 0.0698  0.0088  0.0018  56  ARG A CZ  
380  N NH1 . ARG A 59  ? 1.1131 0.6665 0.8370 0.0390  0.0091  -0.0141 56  ARG A NH1 
381  N NH2 . ARG A 59  ? 0.9786 0.5640 0.7136 0.0529  0.0076  0.0160  56  ARG A NH2 
382  N N   . LYS A 60  ? 0.6925 0.5386 0.5435 0.2330  0.0314  -0.0087 57  LYS A N   
383  C CA  . LYS A 60  ? 0.7490 0.6059 0.5921 0.2580  0.0448  -0.0194 57  LYS A CA  
384  C C   . LYS A 60  ? 0.7305 0.6800 0.6271 0.2347  0.0431  -0.0188 57  LYS A C   
385  O O   . LYS A 60  ? 0.7141 0.6593 0.6009 0.2281  0.0494  -0.0338 57  LYS A O   
386  C CB  . LYS A 60  ? 0.8236 0.6924 0.6551 0.3227  0.0583  -0.0060 57  LYS A CB  
387  C CG  . LYS A 60  ? 1.0231 0.7936 0.7953 0.3536  0.0600  -0.0024 57  LYS A CG  
388  C CD  . LYS A 60  ? 1.1500 0.9382 0.9093 0.4051  0.0734  0.0100  57  LYS A CD  
389  C CE  . LYS A 60  ? 1.2270 0.9926 0.9710 0.4290  0.0678  0.0303  57  LYS A CE  
390  N NZ  . LYS A 60  ? 1.1864 1.0485 0.9955 0.4213  0.0528  0.0538  57  LYS A NZ  
391  N N   . GLN A 61  ? 0.6476 0.6734 0.5929 0.2199  0.0329  -0.0012 58  GLN A N   
392  C CA  . GLN A 61  ? 0.5706 0.6708 0.5577 0.1919  0.0290  0.0010  58  GLN A CA  
393  C C   . GLN A 61  ? 0.5753 0.6402 0.5533 0.1520  0.0247  -0.0176 58  GLN A C   
394  O O   . GLN A 61  ? 0.5173 0.6063 0.5028 0.1432  0.0285  -0.0241 58  GLN A O   
395  C CB  . GLN A 61  ? 0.4925 0.6573 0.5173 0.1738  0.0145  0.0211  58  GLN A CB  
396  C CG  . GLN A 61  ? 0.3573 0.5832 0.4140 0.1391  0.0080  0.0249  58  GLN A CG  
397  C CD  . GLN A 61  ? 0.4223 0.6929 0.5003 0.1157  -0.0099 0.0429  58  GLN A CD  
398  O OE1 . GLN A 61  ? 0.4895 0.7356 0.5554 0.1188  -0.0184 0.0484  58  GLN A OE1 
399  N NE2 . GLN A 61  ? 0.4294 0.7611 0.5323 0.0896  -0.0168 0.0530  58  GLN A NE2 
400  N N   . LEU A 62  ? 0.6080 0.6216 0.5707 0.1292  0.0173  -0.0236 59  LEU A N   
401  C CA  . LEU A 62  ? 0.5356 0.5296 0.4965 0.0954  0.0134  -0.0373 59  LEU A CA  
402  C C   . LEU A 62  ? 0.5476 0.4972 0.4767 0.0988  0.0185  -0.0543 59  LEU A C   
403  O O   . LEU A 62  ? 0.5255 0.4921 0.4610 0.0842  0.0171  -0.0622 59  LEU A O   
404  C CB  . LEU A 62  ? 0.4589 0.4202 0.4138 0.0719  0.0075  -0.0364 59  LEU A CB  
405  C CG  . LEU A 62  ? 0.4876 0.4366 0.4439 0.0421  0.0052  -0.0475 59  LEU A CG  
406  C CD1 . LEU A 62  ? 0.4036 0.4006 0.3861 0.0318  0.0030  -0.0482 59  LEU A CD1 
407  C CD2 . LEU A 62  ? 0.4928 0.4228 0.4470 0.0222  0.0040  -0.0427 59  LEU A CD2 
408  N N   . ARG A 63  ? 0.5951 0.4804 0.4825 0.1172  0.0230  -0.0595 60  ARG A N   
409  C CA  . ARG A 63  ? 0.6210 0.4438 0.4606 0.1173  0.0255  -0.0776 60  ARG A CA  
410  C C   . ARG A 63  ? 0.6666 0.5228 0.5055 0.1362  0.0342  -0.0835 60  ARG A C   
411  O O   . ARG A 63  ? 0.6215 0.4617 0.4414 0.1188  0.0306  -0.0974 60  ARG A O   
412  C CB  . ARG A 63  ? 0.7106 0.4466 0.4932 0.1417  0.0306  -0.0802 60  ARG A CB  
413  C CG  . ARG A 63  ? 0.9133 0.5690 0.6279 0.1502  0.0349  -0.1002 60  ARG A CG  
414  C CD  . ARG A 63  ? 0.9546 0.5841 0.6558 0.0984  0.0202  -0.1143 60  ARG A CD  
415  N NE  . ARG A 63  ? 0.9418 0.5506 0.6506 0.0600  0.0092  -0.1077 60  ARG A NE  
416  C CZ  . ARG A 63  ? 0.9973 0.5121 0.6485 0.0452  0.0049  -0.1118 60  ARG A CZ  
417  N NH1 . ARG A 63  ? 1.1045 0.5251 0.6789 0.0685  0.0099  -0.1248 60  ARG A NH1 
418  N NH2 . ARG A 63  ? 1.0288 0.5387 0.6931 0.0072  -0.0030 -0.1023 60  ARG A NH2 
419  N N   . SER A 64  ? 0.6147 0.5254 0.4763 0.1698  0.0449  -0.0704 61  SER A N   
420  C CA  . SER A 64  ? 0.6680 0.6255 0.5348 0.1876  0.0567  -0.0708 61  SER A CA  
421  C C   . SER A 64  ? 0.6292 0.6379 0.5294 0.1517  0.0482  -0.0699 61  SER A C   
422  O O   . SER A 64  ? 0.5291 0.5396 0.4117 0.1500  0.0524  -0.0787 61  SER A O   
423  C CB  . SER A 64  ? 0.6977 0.7230 0.5941 0.2263  0.0691  -0.0505 61  SER A CB  
424  O OG  . SER A 64  ? 0.7580 0.8490 0.6720 0.2341  0.0806  -0.0454 61  SER A OG  
425  N N   . VAL A 65  ? 0.5034 0.5459 0.4434 0.1250  0.0365  -0.0593 62  VAL A N   
426  C CA  . VAL A 65  ? 0.4198 0.4941 0.3812 0.0950  0.0285  -0.0583 62  VAL A CA  
427  C C   . VAL A 65  ? 0.5220 0.5510 0.4591 0.0749  0.0204  -0.0746 62  VAL A C   
428  O O   . VAL A 65  ? 0.5207 0.5603 0.4511 0.0665  0.0186  -0.0791 62  VAL A O   
429  C CB  . VAL A 65  ? 0.3903 0.4931 0.3851 0.0738  0.0187  -0.0456 62  VAL A CB  
430  C CG1 . VAL A 65  ? 0.4353 0.5455 0.4379 0.0477  0.0111  -0.0471 62  VAL A CG1 
431  C CG2 . VAL A 65  ? 0.3998 0.5611 0.4201 0.0836  0.0215  -0.0271 62  VAL A CG2 
432  N N   . LEU A 66  ? 0.5150 0.4966 0.4375 0.0651  0.0144  -0.0813 63  LEU A N   
433  C CA  . LEU A 66  ? 0.5628 0.5149 0.4686 0.0400  0.0038  -0.0929 63  LEU A CA  
434  C C   . LEU A 66  ? 0.6284 0.5433 0.4861 0.0482  0.0056  -0.1079 63  LEU A C   
435  O O   . LEU A 66  ? 0.6383 0.5549 0.4865 0.0294  -0.0044 -0.1147 63  LEU A O   
436  C CB  . LEU A 66  ? 0.5339 0.4466 0.4331 0.0225  -0.0020 -0.0938 63  LEU A CB  
437  C CG  . LEU A 66  ? 0.5678 0.5133 0.5064 0.0113  -0.0033 -0.0808 63  LEU A CG  
438  C CD1 . LEU A 66  ? 0.5831 0.4878 0.5088 -0.0019 -0.0045 -0.0789 63  LEU A CD1 
439  C CD2 . LEU A 66  ? 0.4737 0.4618 0.4418 -0.0067 -0.0096 -0.0778 63  LEU A CD2 
440  N N   . ASN A 67  ? 0.6500 0.5308 0.4733 0.0795  0.0186  -0.1123 64  ASN A N   
441  C CA  . ASN A 67  ? 0.7143 0.5447 0.4765 0.0926  0.0236  -0.1288 64  ASN A CA  
442  C C   . ASN A 67  ? 0.7170 0.5962 0.4852 0.0969  0.0282  -0.1279 64  ASN A C   
443  O O   . ASN A 67  ? 0.7164 0.5661 0.4413 0.0881  0.0229  -0.1414 64  ASN A O   
444  C CB  . ASN A 67  ? 0.7969 0.5814 0.5188 0.1367  0.0416  -0.1314 64  ASN A CB  
445  C CG  . ASN A 67  ? 0.9030 0.5937 0.5767 0.1299  0.0352  -0.1403 64  ASN A CG  
446  O OD1 . ASN A 67  ? 0.9176 0.5818 0.5876 0.0869  0.0173  -0.1451 64  ASN A OD1 
447  N ND2 . ASN A 67  ? 0.9053 0.5475 0.5413 0.1730  0.0504  -0.1398 64  ASN A ND2 
448  N N   . ASN A 68  ? 0.6304 0.5821 0.4482 0.1069  0.0365  -0.1105 65  ASN A N   
449  C CA  . ASN A 68  ? 0.6228 0.6254 0.4506 0.1075  0.0420  -0.1039 65  ASN A CA  
450  C C   . ASN A 68  ? 0.6296 0.6416 0.4675 0.0734  0.0234  -0.1046 65  ASN A C   
451  O O   . ASN A 68  ? 0.5910 0.6027 0.4018 0.0697  0.0216  -0.1093 65  ASN A O   
452  C CB  . ASN A 68  ? 0.6408 0.7159 0.5188 0.1173  0.0520  -0.0822 65  ASN A CB  
453  C CG  . ASN A 68  ? 0.8696 0.9961 0.7503 0.1215  0.0635  -0.0724 65  ASN A CG  
454  O OD1 . ASN A 68  ? 0.9214 1.0890 0.8322 0.0983  0.0568  -0.0586 65  ASN A OD1 
455  N ND2 . ASN A 68  ? 0.9205 1.0392 0.7627 0.1516  0.0823  -0.0788 65  ASN A ND2 
456  N N   . LEU A 69  ? 0.5327 0.5540 0.4066 0.0520  0.0103  -0.0986 66  LEU A N   
457  C CA  . LEU A 69  ? 0.4970 0.5331 0.3842 0.0278  -0.0056 -0.0961 66  LEU A CA  
458  C C   . LEU A 69  ? 0.5783 0.5788 0.4314 0.0115  -0.0205 -0.1103 66  LEU A C   
459  O O   . LEU A 69  ? 0.6057 0.6226 0.4559 -0.0015 -0.0333 -0.1088 66  LEU A O   
460  C CB  . LEU A 69  ? 0.4878 0.5426 0.4173 0.0159  -0.0114 -0.0859 66  LEU A CB  
461  C CG  . LEU A 69  ? 0.5503 0.6383 0.5056 0.0223  -0.0031 -0.0711 66  LEU A CG  
462  C CD1 . LEU A 69  ? 0.5320 0.6255 0.5139 0.0115  -0.0085 -0.0636 66  LEU A CD1 
463  C CD2 . LEU A 69  ? 0.5698 0.6813 0.5180 0.0215  -0.0015 -0.0635 66  LEU A CD2 
464  N N   . LYS A 70  ? 0.6577 0.6067 0.4805 0.0102  -0.0208 -0.1228 67  LYS A N   
465  C CA  . LYS A 70  ? 0.7073 0.6124 0.4870 -0.0131 -0.0375 -0.1370 67  LYS A CA  
466  C C   . LYS A 70  ? 0.7198 0.5941 0.4378 -0.0021 -0.0348 -0.1502 67  LYS A C   
467  O O   . LYS A 70  ? 0.7998 0.6606 0.4859 -0.0246 -0.0533 -0.1581 67  LYS A O   
468  C CB  . LYS A 70  ? 0.8339 0.6782 0.5892 -0.0212 -0.0383 -0.1452 67  LYS A CB  
469  C CG  . LYS A 70  ? 1.0050 0.8089 0.7250 -0.0605 -0.0607 -0.1555 67  LYS A CG  
470  C CD  . LYS A 70  ? 1.1711 0.8914 0.8453 -0.0672 -0.0589 -0.1646 67  LYS A CD  
471  C CE  . LYS A 70  ? 1.1356 0.8720 0.8544 -0.0551 -0.0463 -0.1508 67  LYS A CE  
472  N NZ  . LYS A 70  ? 1.2650 0.9149 0.9352 -0.0663 -0.0472 -0.1566 67  LYS A NZ  
473  N N   . GLY A 71  ? 0.6778 0.5464 0.3782 0.0332  -0.0114 -0.1512 68  GLY A N   
474  C CA  . GLY A 71  ? 0.7314 0.5742 0.3708 0.0506  -0.0020 -0.1624 68  GLY A CA  
475  C C   . GLY A 71  ? 0.7931 0.6884 0.4454 0.0417  -0.0080 -0.1528 68  GLY A C   
476  O O   . GLY A 71  ? 0.8165 0.6863 0.4126 0.0374  -0.0139 -0.1633 68  GLY A O   
477  N N   . ASP A 72  ? 0.5787 0.4476 0.4405 -0.0206 0.1171  -0.0491 69  ASP A N   
478  C CA  . ASP A 72  ? 0.5692 0.4468 0.4195 -0.0260 0.0989  -0.0571 69  ASP A CA  
479  C C   . ASP A 72  ? 0.6139 0.5124 0.4373 -0.0452 0.0644  -0.0708 69  ASP A C   
480  O O   . ASP A 72  ? 0.6071 0.5267 0.4352 -0.0489 0.0435  -0.0733 69  ASP A O   
481  C CB  . ASP A 72  ? 0.5689 0.4952 0.4816 -0.0092 0.0838  -0.0435 69  ASP A CB  
482  C CG  . ASP A 72  ? 0.6212 0.5283 0.5674 0.0072  0.1161  -0.0226 69  ASP A CG  
483  O OD1 . ASP A 72  ? 0.6746 0.5272 0.5998 0.0099  0.1584  -0.0187 69  ASP A OD1 
484  O OD2 . ASP A 72  ? 0.6144 0.5559 0.6073 0.0164  0.1030  -0.0077 69  ASP A OD2 
485  N N   . LYS A 73  ? 0.6145 0.5088 0.4180 -0.0564 0.0605  -0.0749 70  LYS A N   
486  C CA  . LYS A 73  ? 0.6093 0.5241 0.3981 -0.0754 0.0315  -0.0789 70  LYS A CA  
487  C C   . LYS A 73  ? 0.5691 0.5440 0.4091 -0.0651 0.0065  -0.0763 70  LYS A C   
488  O O   . LYS A 73  ? 0.5913 0.5860 0.4354 -0.0772 -0.0131 -0.0719 70  LYS A O   
489  C CB  . LYS A 73  ? 0.7052 0.5802 0.4366 -0.1034 0.0257  -0.0795 70  LYS A CB  
490  C CG  . LYS A 73  ? 0.7939 0.5878 0.4513 -0.1211 0.0570  -0.0850 70  LYS A CG  
491  C CD  . LYS A 73  ? 0.8882 0.6279 0.4704 -0.1570 0.0510  -0.0853 70  LYS A CD  
492  C CE  . LYS A 73  ? 1.0072 0.6503 0.4898 -0.1882 0.0799  -0.0923 70  LYS A CE  
493  N NZ  . LYS A 73  ? 1.1453 0.7387 0.6271 -0.1616 0.1380  -0.0981 70  LYS A NZ  
494  N N   . PHE A 74  ? 0.5818 0.5805 0.4597 -0.0459 0.0089  -0.0749 71  PHE A N   
495  C CA  . PHE A 74  ? 0.5408 0.5756 0.4488 -0.0399 -0.0056 -0.0754 71  PHE A CA  
496  C C   . PHE A 74  ? 0.5653 0.6139 0.4778 -0.0435 -0.0088 -0.0769 71  PHE A C   
497  O O   . PHE A 74  ? 0.5599 0.6273 0.4902 -0.0426 -0.0129 -0.0758 71  PHE A O   
498  C CB  . PHE A 74  ? 0.5441 0.5877 0.4727 -0.0290 -0.0052 -0.0722 71  PHE A CB  
499  C CG  . PHE A 74  ? 0.6198 0.6613 0.5557 -0.0236 -0.0057 -0.0696 71  PHE A CG  
500  C CD1 . PHE A 74  ? 0.6740 0.6967 0.5925 -0.0273 -0.0005 -0.0707 71  PHE A CD1 
501  C CD2 . PHE A 74  ? 0.6352 0.6873 0.5870 -0.0195 -0.0124 -0.0652 71  PHE A CD2 
502  C CE1 . PHE A 74  ? 0.7144 0.7336 0.6388 -0.0223 0.0003  -0.0684 71  PHE A CE1 
503  C CE2 . PHE A 74  ? 0.6901 0.7416 0.6505 -0.0146 -0.0135 -0.0619 71  PHE A CE2 
504  C CZ  . PHE A 74  ? 0.6587 0.6961 0.6093 -0.0135 -0.0060 -0.0640 71  PHE A CZ  
505  N N   . ILE A 75  ? 0.6004 0.6374 0.5012 -0.0455 -0.0017 -0.0772 72  ILE A N   
506  C CA  . ILE A 75  ? 0.5235 0.5715 0.4267 -0.0490 -0.0036 -0.0789 72  ILE A CA  
507  C C   . ILE A 75  ? 0.5813 0.6109 0.4600 -0.0597 0.0006  -0.0788 72  ILE A C   
508  O O   . ILE A 75  ? 0.4869 0.4855 0.3426 -0.0622 0.0126  -0.0785 72  ILE A O   
509  C CB  . ILE A 75  ? 0.5420 0.5934 0.4517 -0.0451 -0.0026 -0.0777 72  ILE A CB  
510  C CG1 . ILE A 75  ? 0.4421 0.4820 0.3529 -0.0436 0.0044  -0.0686 72  ILE A CG1 
511  C CG2 . ILE A 75  ? 0.4368 0.4918 0.3537 -0.0422 -0.0074 -0.0768 72  ILE A CG2 
512  C CD1 . ILE A 75  ? 0.5151 0.5634 0.4388 -0.0465 -0.0034 -0.0564 72  ILE A CD1 
513  N N   . LYS A 76  ? 0.5302 0.5723 0.4110 -0.0673 -0.0051 -0.0779 73  LYS A N   
514  C CA  . LYS A 76  ? 0.5706 0.5939 0.4234 -0.0814 -0.0035 -0.0774 73  LYS A CA  
515  C C   . LYS A 76  ? 0.6580 0.6912 0.5200 -0.0765 0.0009  -0.0796 73  LYS A C   
516  O O   . LYS A 76  ? 0.6760 0.7261 0.5586 -0.0669 0.0013  -0.0812 73  LYS A O   
517  C CB  . LYS A 76  ? 0.6119 0.6422 0.4583 -0.1023 -0.0204 -0.0670 73  LYS A CB  
518  C CG  . LYS A 76  ? 0.7622 0.7635 0.5726 -0.1205 -0.0269 -0.0634 73  LYS A CG  
519  C CD  . LYS A 76  ? 0.9101 0.9121 0.7030 -0.1544 -0.0519 -0.0450 73  LYS A CD  
520  C CE  . LYS A 76  ? 1.0906 1.0490 0.8278 -0.1804 -0.0589 -0.0423 73  LYS A CE  
521  N NZ  . LYS A 76  ? 1.2176 1.1643 0.9186 -0.2272 -0.0901 -0.0194 73  LYS A NZ  
522  N N   . CYS A 77  ? 0.6882 0.7023 0.5250 -0.0874 0.0049  -0.0800 74  CYS A N   
523  C CA  . CYS A 77  ? 0.6828 0.7008 0.5232 -0.0846 0.0100  -0.0814 74  CYS A CA  
524  C C   . CYS A 77  ? 0.6734 0.6905 0.4981 -0.1016 0.0031  -0.0789 74  CYS A C   
525  O O   . CYS A 77  ? 0.6780 0.6696 0.4684 -0.1206 -0.0006 -0.0762 74  CYS A O   
526  C CB  . CYS A 77  ? 0.7534 0.7447 0.5853 -0.0779 0.0275  -0.0793 74  CYS A CB  
527  S SG  . CYS A 77  ? 1.0686 1.0621 0.9053 -0.0774 0.0328  -0.0758 74  CYS A SG  
528  N N   . ARG A 78  ? 0.6162 0.6560 0.4606 -0.0992 0.0009  -0.0778 75  ARG A N   
529  C CA  . ARG A 78  ? 0.7103 0.7515 0.5454 -0.1145 -0.0047 -0.0724 75  ARG A CA  
530  C C   . ARG A 78  ? 0.7388 0.7772 0.5712 -0.1087 0.0047  -0.0782 75  ARG A C   
531  O O   . ARG A 78  ? 0.6109 0.6625 0.4611 -0.0978 0.0093  -0.0812 75  ARG A O   
532  C CB  . ARG A 78  ? 0.7016 0.7782 0.5757 -0.1187 -0.0154 -0.0571 75  ARG A CB  
533  C CG  . ARG A 78  ? 0.9451 1.0245 0.8170 -0.1382 -0.0343 -0.0408 75  ARG A CG  
534  C CD  . ARG A 78  ? 1.0528 1.1676 0.9662 -0.1528 -0.0502 -0.0122 75  ARG A CD  
535  N NE  . ARG A 78  ? 1.1643 1.3054 1.1170 -0.1584 -0.0648 0.0118  75  ARG A NE  
536  C CZ  . ARG A 78  ? 1.2804 1.4656 1.3096 -0.1482 -0.0617 0.0388  75  ARG A CZ  
537  N NH1 . ARG A 78  ? 1.3091 1.5100 1.3753 -0.1324 -0.0411 0.0417  75  ARG A NH1 
538  N NH2 . ARG A 78  ? 1.3108 1.5210 1.3818 -0.1535 -0.0752 0.0656  75  ARG A NH2 
539  N N   . MET A 79  ? 0.7824 0.7959 0.5842 -0.1199 0.0086  -0.0793 76  MET A N   
540  C CA  . MET A 79  ? 0.7490 0.7605 0.5504 -0.1156 0.0166  -0.0819 76  MET A CA  
541  C C   . MET A 79  ? 0.7269 0.7618 0.5416 -0.1226 0.0092  -0.0782 76  MET A C   
542  O O   . MET A 79  ? 0.6808 0.7243 0.4972 -0.1372 -0.0022 -0.0686 76  MET A O   
543  C CB  . MET A 79  ? 0.8470 0.8163 0.6126 -0.1225 0.0312  -0.0832 76  MET A CB  
544  C CG  . MET A 79  ? 0.7914 0.7348 0.5576 -0.1096 0.0508  -0.0809 76  MET A CG  
545  S SD  . MET A 79  ? 1.3309 1.2224 1.0702 -0.1109 0.0823  -0.0773 76  MET A SD  
546  C CE  . MET A 79  ? 0.8327 0.7616 0.6028 -0.1066 0.0709  -0.0724 76  MET A CE  
547  N N   . ARG A 80  ? 0.6934 0.7376 0.5189 -0.1149 0.0149  -0.0813 77  ARG A N   
548  C CA  . ARG A 80  ? 0.7807 0.8379 0.6144 -0.1207 0.0153  -0.0779 77  ARG A CA  
549  C C   . ARG A 80  ? 0.7012 0.7430 0.5143 -0.1237 0.0195  -0.0817 77  ARG A C   
550  O O   . ARG A 80  ? 0.6588 0.6926 0.4685 -0.1176 0.0231  -0.0834 77  ARG A O   
551  C CB  . ARG A 80  ? 0.8446 0.9158 0.7020 -0.1118 0.0255  -0.0778 77  ARG A CB  
552  C CG  . ARG A 80  ? 0.9441 1.0370 0.8388 -0.1092 0.0255  -0.0647 77  ARG A CG  
553  C CD  . ARG A 80  ? 1.0479 1.1399 0.9640 -0.0969 0.0484  -0.0645 77  ARG A CD  
554  N NE  . ARG A 80  ? 1.1762 1.2537 1.0813 -0.0971 0.0675  -0.0692 77  ARG A NE  
555  C CZ  . ARG A 80  ? 1.2233 1.2795 1.1289 -0.0904 0.0982  -0.0716 77  ARG A CZ  
556  N NH1 . ARG A 80  ? 1.2328 1.2830 1.1549 -0.0808 0.1134  -0.0689 77  ARG A NH1 
557  N NH2 . ARG A 80  ? 1.2415 1.2740 1.1249 -0.0945 0.1179  -0.0770 77  ARG A NH2 
558  N N   . VAL A 81  ? 0.6347 0.6730 0.4364 -0.1362 0.0165  -0.0782 78  VAL A N   
559  C CA  . VAL A 81  ? 0.6241 0.6449 0.4058 -0.1400 0.0223  -0.0807 78  VAL A CA  
560  C C   . VAL A 81  ? 0.6241 0.6632 0.4167 -0.1455 0.0204  -0.0776 78  VAL A C   
561  O O   . VAL A 81  ? 0.5795 0.6336 0.3840 -0.1561 0.0124  -0.0677 78  VAL A O   
562  C CB  . VAL A 81  ? 0.6955 0.6785 0.4388 -0.1531 0.0266  -0.0808 78  VAL A CB  
563  C CG1 . VAL A 81  ? 0.6756 0.6357 0.4015 -0.1544 0.0393  -0.0818 78  VAL A CG1 
564  C CG2 . VAL A 81  ? 0.6897 0.6493 0.4241 -0.1459 0.0361  -0.0827 78  VAL A CG2 
565  N N   . GLU A 82  ? 0.6148 0.6531 0.4066 -0.1405 0.0269  -0.0814 79  GLU A N   
566  C CA  . GLU A 82  ? 0.6266 0.6753 0.4255 -0.1434 0.0319  -0.0805 79  GLU A CA  
567  C C   . GLU A 82  ? 0.6092 0.6451 0.3890 -0.1474 0.0333  -0.0827 79  GLU A C   
568  O O   . GLU A 82  ? 0.5974 0.6214 0.3700 -0.1451 0.0316  -0.0808 79  GLU A O   
569  C CB  . GLU A 82  ? 0.6701 0.7207 0.4786 -0.1365 0.0438  -0.0834 79  GLU A CB  
570  C CG  . GLU A 82  ? 0.8844 0.9475 0.7195 -0.1290 0.0472  -0.0787 79  GLU A CG  
571  C CD  . GLU A 82  ? 0.9751 1.0218 0.8054 -0.1230 0.0675  -0.0844 79  GLU A CD  
572  O OE1 . GLU A 82  ? 1.0455 1.0948 0.8910 -0.1155 0.0719  -0.0828 79  GLU A OE1 
573  O OE2 . GLU A 82  ? 0.9779 1.0012 0.7811 -0.1289 0.0808  -0.0906 79  GLU A OE2 
574  N N   . THR A 83  ? 0.6440 0.6843 0.4235 -0.1528 0.0378  -0.0821 80  THR A N   
575  C CA  . THR A 83  ? 0.6850 0.7140 0.4466 -0.1581 0.0387  -0.0831 80  THR A CA  
576  C C   . THR A 83  ? 0.7122 0.7295 0.4583 -0.1615 0.0442  -0.0866 80  THR A C   
577  O O   . THR A 83  ? 0.7199 0.7333 0.4670 -0.1603 0.0595  -0.0905 80  THR A O   
578  C CB  . THR A 83  ? 0.6808 0.7144 0.4418 -0.1652 0.0414  -0.0812 80  THR A CB  
579  O OG1 . THR A 83  ? 0.6017 0.6323 0.3583 -0.1711 0.0347  -0.0776 80  THR A OG1 
580  C CG2 . THR A 83  ? 0.7077 0.7295 0.4498 -0.1713 0.0421  -0.0816 80  THR A CG2 
581  N N   . ALA A 84  ? 0.7104 0.7167 0.4408 -0.1689 0.0336  -0.0811 81  ALA A N   
582  C CA  . ALA A 84  ? 0.7214 0.7040 0.4174 -0.1842 0.0328  -0.0819 81  ALA A CA  
583  C C   . ALA A 84  ? 0.8262 0.7895 0.4908 -0.1990 0.0402  -0.0849 81  ALA A C   
584  O O   . ALA A 84  ? 0.8177 0.7936 0.4962 -0.1947 0.0434  -0.0846 81  ALA A O   
585  C CB  . ALA A 84  ? 0.6885 0.6707 0.3834 -0.1946 0.0105  -0.0647 81  ALA A CB  
586  N N   . ALA A 85  ? 0.8943 0.8190 0.5070 -0.2208 0.0431  -0.0875 82  ALA A N   
587  C CA  . ALA A 85  ? 0.9154 0.8070 0.4821 -0.2402 0.0538  -0.0916 82  ALA A CA  
588  C C   . ALA A 85  ? 0.8905 0.7985 0.4633 -0.2515 0.0289  -0.0757 82  ALA A C   
589  O O   . ALA A 85  ? 0.8748 0.7777 0.4382 -0.2549 0.0378  -0.0792 82  ALA A O   
590  C CB  . ALA A 85  ? 0.9846 0.8139 0.4738 -0.2702 0.0620  -0.0972 82  ALA A CB  
591  N N   . ASP A 86  ? 0.8819 0.8109 0.4787 -0.2556 0.0005  -0.0544 83  ASP A N   
592  C CA  . ASP A 86  ? 0.8749 0.8224 0.4937 -0.2625 -0.0187 -0.0317 83  ASP A CA  
593  C C   . ASP A 86  ? 0.8185 0.7965 0.4903 -0.2331 -0.0070 -0.0337 83  ASP A C   
594  O O   . ASP A 86  ? 0.8555 0.8472 0.5558 -0.2318 -0.0147 -0.0139 83  ASP A O   
595  C CB  . ASP A 86  ? 0.9087 0.8675 0.5455 -0.2797 -0.0505 0.0033  83  ASP A CB  
596  C CG  . ASP A 86  ? 0.9561 0.9429 0.6498 -0.2541 -0.0492 0.0116  83  ASP A CG  
597  O OD1 . ASP A 86  ? 0.9873 0.9799 0.6955 -0.2270 -0.0267 -0.0120 83  ASP A OD1 
598  O OD2 . ASP A 86  ? 0.9686 0.9709 0.6936 -0.2640 -0.0721 0.0462  83  ASP A OD2 
599  N N   . GLY A 87  ? 0.7837 0.7674 0.4660 -0.2131 0.0121  -0.0542 84  GLY A N   
600  C CA  . GLY A 87  ? 0.7502 0.7483 0.4602 -0.1964 0.0214  -0.0573 84  GLY A CA  
601  C C   . GLY A 87  ? 0.6968 0.7015 0.4369 -0.1815 0.0228  -0.0491 84  GLY A C   
602  O O   . GLY A 87  ? 0.6765 0.6768 0.4210 -0.1734 0.0337  -0.0544 84  GLY A O   
603  N N   . LYS A 88  ? 0.6589 0.6672 0.4139 -0.1814 0.0132  -0.0345 85  LYS A N   
604  C CA  . LYS A 88  ? 0.6926 0.7017 0.4794 -0.1657 0.0216  -0.0237 85  LYS A CA  
605  C C   . LYS A 88  ? 0.7017 0.7086 0.4806 -0.1567 0.0281  -0.0424 85  LYS A C   
606  O O   . LYS A 88  ? 0.7288 0.7399 0.4906 -0.1610 0.0244  -0.0572 85  LYS A O   
607  C CB  . LYS A 88  ? 0.6434 0.6638 0.4639 -0.1691 0.0080  0.0084  85  LYS A CB  
608  C CG  . LYS A 88  ? 0.7898 0.8174 0.6316 -0.1797 -0.0010 0.0380  85  LYS A CG  
609  C CD  . LYS A 88  ? 0.8636 0.9107 0.7544 -0.1872 -0.0197 0.0833  85  LYS A CD  
610  C CE  . LYS A 88  ? 0.9362 0.9853 0.8811 -0.1611 0.0037  0.0996  85  LYS A CE  
611  N NZ  . LYS A 88  ? 0.9867 1.0626 0.9927 -0.1679 -0.0160 0.1502  85  LYS A NZ  
612  N N   . THR A 89  ? 0.6852 0.6803 0.4764 -0.1448 0.0419  -0.0394 86  THR A N   
613  C CA  . THR A 89  ? 0.6755 0.6665 0.4568 -0.1403 0.0449  -0.0535 86  THR A CA  
614  C C   . THR A 89  ? 0.6985 0.7017 0.4999 -0.1351 0.0365  -0.0452 86  THR A C   
615  O O   . THR A 89  ? 0.6173 0.6238 0.4476 -0.1312 0.0359  -0.0226 86  THR A O   
616  C CB  . THR A 89  ? 0.6617 0.6186 0.4268 -0.1373 0.0655  -0.0565 86  THR A CB  
617  O OG1 . THR A 89  ? 0.6310 0.5735 0.3653 -0.1497 0.0677  -0.0656 86  THR A OG1 
618  C CG2 . THR A 89  ? 0.6042 0.5552 0.3586 -0.1364 0.0647  -0.0655 86  THR A CG2 
619  N N   . THR A 90  ? 0.6926 0.7038 0.4841 -0.1358 0.0301  -0.0589 87  THR A N   
620  C CA  . THR A 90  ? 0.6387 0.6576 0.4389 -0.1343 0.0213  -0.0554 87  THR A CA  
621  C C   . THR A 90  ? 0.6520 0.6681 0.4566 -0.1244 0.0274  -0.0627 87  THR A C   
622  O O   . THR A 90  ? 0.7407 0.7558 0.5339 -0.1259 0.0303  -0.0742 87  THR A O   
623  C CB  . THR A 90  ? 0.6218 0.6416 0.3997 -0.1450 0.0154  -0.0654 87  THR A CB  
624  O OG1 . THR A 90  ? 0.7706 0.7840 0.5341 -0.1615 0.0045  -0.0538 87  THR A OG1 
625  C CG2 . THR A 90  ? 0.7038 0.7227 0.4801 -0.1428 0.0135  -0.0698 87  THR A CG2 
626  N N   . ARG A 91  ? 0.6260 0.6422 0.4495 -0.1173 0.0272  -0.0514 88  ARG A N   
627  C CA  . ARG A 91  ? 0.7059 0.7159 0.5299 -0.1094 0.0331  -0.0579 88  ARG A CA  
628  C C   . ARG A 91  ? 0.7720 0.7953 0.6066 -0.1080 0.0214  -0.0556 88  ARG A C   
629  O O   . ARG A 91  ? 0.8096 0.8371 0.6671 -0.1055 0.0175  -0.0373 88  ARG A O   
630  C CB  . ARG A 91  ? 0.7879 0.7729 0.6208 -0.1002 0.0541  -0.0470 88  ARG A CB  
631  C CG  . ARG A 91  ? 0.9124 0.8653 0.7172 -0.1051 0.0724  -0.0527 88  ARG A CG  
632  C CD  . ARG A 91  ? 1.0131 0.9241 0.8210 -0.0953 0.1064  -0.0408 88  ARG A CD  
633  N NE  . ARG A 91  ? 1.0751 1.0008 0.9385 -0.0827 0.1145  -0.0111 88  ARG A NE  
634  C CZ  . ARG A 91  ? 1.1719 1.0657 1.0608 -0.0688 0.1520  0.0102  88  ARG A CZ  
635  N NH1 . ARG A 91  ? 1.2249 1.0564 1.0702 -0.0677 0.1893  -0.0023 88  ARG A NH1 
636  N NH2 . ARG A 91  ? 1.1858 1.1049 1.1429 -0.0587 0.1545  0.0478  88  ARG A NH2 
637  N N   . HIS A 92  ? 0.7818 0.8112 0.6042 -0.1103 0.0175  -0.0699 89  HIS A N   
638  C CA  . HIS A 92  ? 0.7756 0.8083 0.5994 -0.1099 0.0113  -0.0708 89  HIS A CA  
639  C C   . HIS A 92  ? 0.6128 0.6474 0.4472 -0.0999 0.0146  -0.0744 89  HIS A C   
640  O O   . HIS A 92  ? 0.5973 0.6327 0.4288 -0.0993 0.0185  -0.0811 89  HIS A O   
641  C CB  . HIS A 92  ? 0.9129 0.9406 0.7179 -0.1162 0.0156  -0.0823 89  HIS A CB  
642  C CG  . HIS A 92  ? 1.0619 1.0763 0.8417 -0.1305 0.0156  -0.0821 89  HIS A CG  
643  N ND1 . HIS A 92  ? 1.0843 1.0916 0.8532 -0.1322 0.0306  -0.0914 89  HIS A ND1 
644  C CD2 . HIS A 92  ? 1.0913 1.0967 0.8550 -0.1467 0.0019  -0.0697 89  HIS A CD2 
645  C CE1 . HIS A 92  ? 1.1706 1.1585 0.9080 -0.1484 0.0291  -0.0902 89  HIS A CE1 
646  N NE2 . HIS A 92  ? 1.1989 1.1862 0.9310 -0.1598 0.0084  -0.0762 89  HIS A NE2 
647  N N   . ASN A 93  ? 0.5761 0.6118 0.4215 -0.0962 0.0099  -0.0671 90  ASN A N   
648  C CA  . ASN A 93  ? 0.6007 0.6366 0.4526 -0.0879 0.0126  -0.0715 90  ASN A CA  
649  C C   . ASN A 93  ? 0.5836 0.6245 0.4324 -0.0886 0.0085  -0.0787 90  ASN A C   
650  O O   . ASN A 93  ? 0.6343 0.6707 0.4770 -0.0946 0.0014  -0.0738 90  ASN A O   
651  C CB  . ASN A 93  ? 0.7073 0.7381 0.5787 -0.0804 0.0164  -0.0568 90  ASN A CB  
652  C CG  . ASN A 93  ? 0.8293 0.8449 0.7073 -0.0767 0.0321  -0.0462 90  ASN A CG  
653  O OD1 . ASN A 93  ? 0.8699 0.8616 0.7261 -0.0768 0.0470  -0.0552 90  ASN A OD1 
654  N ND2 . ASN A 93  ? 0.9179 0.9425 0.8234 -0.0772 0.0290  -0.0236 90  ASN A ND2 
655  N N   . TYR A 94  ? 0.5323 0.5796 0.3854 -0.0857 0.0134  -0.0859 91  TYR A N   
656  C CA  . TYR A 94  ? 0.6108 0.6591 0.4688 -0.0826 0.0188  -0.0898 91  TYR A CA  
657  C C   . TYR A 94  ? 0.6181 0.6726 0.4895 -0.0757 0.0142  -0.0880 91  TYR A C   
658  O O   . TYR A 94  ? 0.6051 0.6660 0.4836 -0.0760 0.0100  -0.0847 91  TYR A O   
659  C CB  . TYR A 94  ? 0.6254 0.6830 0.4998 -0.0811 0.0307  -0.0885 91  TYR A CB  
660  C CG  . TYR A 94  ? 0.6268 0.6704 0.4845 -0.0868 0.0431  -0.0922 91  TYR A CG  
661  C CD1 . TYR A 94  ? 0.6468 0.6930 0.4954 -0.0933 0.0365  -0.0915 91  TYR A CD1 
662  C CD2 . TYR A 94  ? 0.6904 0.7091 0.5346 -0.0871 0.0662  -0.0970 91  TYR A CD2 
663  C CE1 . TYR A 94  ? 0.7127 0.7445 0.5431 -0.1000 0.0473  -0.0948 91  TYR A CE1 
664  C CE2 . TYR A 94  ? 0.6467 0.6405 0.4637 -0.0957 0.0821  -0.1016 91  TYR A CE2 
665  C CZ  . TYR A 94  ? 0.7416 0.7462 0.5542 -0.1020 0.0699  -0.1001 91  TYR A CZ  
666  O OH  . TYR A 94  ? 0.8313 0.8111 0.6152 -0.1118 0.0844  -0.1044 91  TYR A OH  
667  N N   . TYR A 95  ? 0.5472 0.5939 0.4137 -0.0743 0.0137  -0.0894 92  TYR A N   
668  C CA  . TYR A 95  ? 0.5740 0.6263 0.4534 -0.0673 0.0095  -0.0877 92  TYR A CA  
669  C C   . TYR A 95  ? 0.5707 0.6260 0.4636 -0.0619 0.0190  -0.0895 92  TYR A C   
670  O O   . TYR A 95  ? 0.4861 0.5271 0.3710 -0.0630 0.0348  -0.0931 92  TYR A O   
671  C CB  . TYR A 95  ? 0.5586 0.6036 0.4323 -0.0694 0.0010  -0.0822 92  TYR A CB  
672  C CG  . TYR A 95  ? 0.6177 0.6641 0.5014 -0.0675 -0.0014 -0.0713 92  TYR A CG  
673  C CD1 . TYR A 95  ? 0.5950 0.6400 0.4768 -0.0743 -0.0037 -0.0627 92  TYR A CD1 
674  C CD2 . TYR A 95  ? 0.6161 0.6592 0.5109 -0.0591 0.0040  -0.0674 92  TYR A CD2 
675  C CE1 . TYR A 95  ? 0.5624 0.6059 0.4632 -0.0692 0.0022  -0.0479 92  TYR A CE1 
676  C CE2 . TYR A 95  ? 0.6541 0.6864 0.5588 -0.0548 0.0149  -0.0555 92  TYR A CE2 
677  C CZ  . TYR A 95  ? 0.6576 0.6918 0.5703 -0.0581 0.0153  -0.0443 92  TYR A CZ  
678  O OH  . TYR A 95  ? 0.6986 0.7194 0.6305 -0.0505 0.0339  -0.0280 92  TYR A OH  
679  N N   . PHE A 96  ? 0.4897 0.5575 0.4016 -0.0568 0.0137  -0.0850 93  PHE A N   
680  C CA  . PHE A 96  ? 0.4811 0.5554 0.4174 -0.0497 0.0233  -0.0806 93  PHE A CA  
681  C C   . PHE A 96  ? 0.4858 0.5669 0.4302 -0.0468 0.0122  -0.0777 93  PHE A C   
682  O O   . PHE A 96  ? 0.4688 0.5485 0.4009 -0.0515 0.0002  -0.0775 93  PHE A O   
683  C CB  . PHE A 96  ? 0.4469 0.5427 0.4206 -0.0491 0.0293  -0.0655 93  PHE A CB  
684  C CG  . PHE A 96  ? 0.6192 0.7326 0.5974 -0.0615 0.0073  -0.0543 93  PHE A CG  
685  C CD1 . PHE A 96  ? 0.5802 0.6885 0.5374 -0.0712 0.0022  -0.0570 93  PHE A CD1 
686  C CD2 . PHE A 96  ? 0.6179 0.7454 0.6123 -0.0683 -0.0083 -0.0400 93  PHE A CD2 
687  C CE1 . PHE A 96  ? 0.6139 0.7232 0.5579 -0.0893 -0.0157 -0.0477 93  PHE A CE1 
688  C CE2 . PHE A 96  ? 0.6316 0.7596 0.6092 -0.0903 -0.0298 -0.0290 93  PHE A CE2 
689  C CZ  . PHE A 96  ? 0.5931 0.7082 0.5414 -0.1017 -0.0322 -0.0338 93  PHE A CZ  
690  N N   . ILE A 97  ? 0.4386 0.5197 0.3998 -0.0392 0.0215  -0.0755 94  ILE A N   
691  C CA  . ILE A 97  ? 0.4718 0.5607 0.4425 -0.0368 0.0107  -0.0717 94  ILE A CA  
692  C C   . ILE A 97  ? 0.5229 0.6371 0.5257 -0.0424 -0.0003 -0.0528 94  ILE A C   
693  O O   . ILE A 97  ? 0.4957 0.6284 0.5380 -0.0405 0.0076  -0.0362 94  ILE A O   
694  C CB  . ILE A 97  ? 0.5243 0.6010 0.4986 -0.0286 0.0237  -0.0752 94  ILE A CB  
695  C CG1 . ILE A 97  ? 0.5507 0.5971 0.4826 -0.0344 0.0271  -0.0883 94  ILE A CG1 
696  C CG2 . ILE A 97  ? 0.5527 0.6391 0.5374 -0.0261 0.0112  -0.0711 94  ILE A CG2 
697  C CD1 . ILE A 97  ? 0.6070 0.6255 0.5247 -0.0333 0.0444  -0.0933 94  ILE A CD1 
698  N N   . ASN A 98  ? 0.5131 0.6243 0.4979 -0.0526 -0.0178 -0.0512 95  ASN A N   
699  C CA  . ASN A 98  ? 0.5222 0.6485 0.5197 -0.0702 -0.0369 -0.0300 95  ASN A CA  
700  C C   . ASN A 98  ? 0.5380 0.6713 0.5516 -0.0682 -0.0435 -0.0220 95  ASN A C   
701  O O   . ASN A 98  ? 0.4813 0.5921 0.4580 -0.0742 -0.0494 -0.0315 95  ASN A O   
702  C CB  . ASN A 98  ? 0.6116 0.7099 0.5544 -0.0921 -0.0483 -0.0350 95  ASN A CB  
703  C CG  . ASN A 98  ? 0.7494 0.8549 0.6889 -0.1228 -0.0732 -0.0099 95  ASN A CG  
704  O OD1 . ASN A 98  ? 0.7728 0.8668 0.6916 -0.1420 -0.0893 -0.0003 95  ASN A OD1 
705  N ND2 . ASN A 98  ? 0.7833 0.9056 0.7395 -0.1325 -0.0792 0.0037  95  ASN A ND2 
706  N N   . TYR A 99  ? 0.6128 0.7042 0.3955 -0.0612 -0.0452 0.0367  96  TYR A N   
707  C CA  . TYR A 99  ? 0.6774 0.7636 0.4715 -0.0418 -0.0426 0.0130  96  TYR A CA  
708  C C   . TYR A 99  ? 0.7462 0.8055 0.5585 -0.0332 -0.0561 0.0123  96  TYR A C   
709  O O   . TYR A 99  ? 0.7404 0.7780 0.5513 -0.0183 -0.0600 0.0016  96  TYR A O   
710  C CB  . TYR A 99  ? 0.6567 0.7851 0.4713 -0.0377 -0.0211 -0.0045 96  TYR A CB  
711  C CG  . TYR A 99  ? 0.6851 0.8387 0.4741 -0.0435 -0.0061 -0.0168 96  TYR A CG  
712  C CD1 . TYR A 99  ? 0.6075 0.7478 0.3808 -0.0352 -0.0043 -0.0370 96  TYR A CD1 
713  C CD2 . TYR A 99  ? 0.6294 0.8256 0.4080 -0.0607 0.0064  -0.0089 96  TYR A CD2 
714  C CE1 . TYR A 99  ? 0.6421 0.8136 0.3884 -0.0454 0.0081  -0.0519 96  TYR A CE1 
715  C CE2 . TYR A 99  ? 0.6953 0.9234 0.4442 -0.0693 0.0195  -0.0211 96  TYR A CE2 
716  C CZ  . TYR A 99  ? 0.6520 0.8689 0.3841 -0.0622 0.0196  -0.0441 96  TYR A CZ  
717  O OH  . TYR A 99  ? 0.7887 1.0456 0.4886 -0.0754 0.0317  -0.0599 96  TYR A OH  
718  N N   . ARG A 100 ? 0.7631 0.8268 0.5901 -0.0455 -0.0634 0.0236  97  ARG A N   
719  C CA  . ARG A 100 ? 0.7649 0.8137 0.6038 -0.0410 -0.0772 0.0212  97  ARG A CA  
720  C C   . ARG A 100 ? 0.7676 0.7673 0.5808 -0.0393 -0.0893 0.0204  97  ARG A C   
721  O O   . ARG A 100 ? 0.6397 0.6241 0.4506 -0.0269 -0.0957 0.0125  97  ARG A O   
722  C CB  . ARG A 100 ? 0.8408 0.9140 0.7017 -0.0595 -0.0832 0.0295  97  ARG A CB  
723  C CG  . ARG A 100 ? 0.8753 0.9492 0.7468 -0.0570 -0.0988 0.0261  97  ARG A CG  
724  C CD  . ARG A 100 ? 1.0195 1.1360 0.9190 -0.0761 -0.1056 0.0322  97  ARG A CD  
725  N NE  . ARG A 100 ? 1.1298 1.2932 1.0628 -0.0596 -0.1076 0.0354  97  ARG A NE  
726  C CZ  . ARG A 100 ? 1.2244 1.4274 1.1789 -0.0693 -0.1224 0.0410  97  ARG A CZ  
727  N NH1 . ARG A 100 ? 1.2659 1.4642 1.2090 -0.0997 -0.1353 0.0373  97  ARG A NH1 
728  N NH2 . ARG A 100 ? 1.2458 1.4944 1.2354 -0.0493 -0.1242 0.0507  97  ARG A NH2 
729  N N   . THR A 101 ? 0.7971 0.7731 0.5932 -0.0499 -0.0907 0.0307  98  THR A N   
730  C CA  . THR A 101 ? 0.8332 0.7643 0.6121 -0.0442 -0.0987 0.0295  98  THR A CA  
731  C C   . THR A 101 ? 0.7879 0.7152 0.5537 -0.0253 -0.0962 0.0228  98  THR A C   
732  O O   . THR A 101 ? 0.7518 0.6535 0.5107 -0.0153 -0.1016 0.0154  98  THR A O   
733  C CB  . THR A 101 ? 1.0030 0.9067 0.7754 -0.0570 -0.0991 0.0467  98  THR A CB  
734  O OG1 . THR A 101 ? 1.1918 1.1058 0.9790 -0.0796 -0.0980 0.0534  98  THR A OG1 
735  C CG2 . THR A 101 ? 1.0441 0.8987 0.8104 -0.0519 -0.1054 0.0412  98  THR A CG2 
736  N N   . LEU A 102 ? 0.6775 0.6341 0.4400 -0.0232 -0.0868 0.0227  99  LEU A N   
737  C CA  . LEU A 102 ? 0.6751 0.6339 0.4260 -0.0112 -0.0842 0.0129  99  LEU A CA  
738  C C   . LEU A 102 ? 0.6824 0.6343 0.4440 0.0013  -0.0828 -0.0043 99  LEU A C   
739  O O   . LEU A 102 ? 0.6569 0.5914 0.4116 0.0099  -0.0862 -0.0102 99  LEU A O   
740  C CB  . LEU A 102 ? 0.6248 0.6224 0.3672 -0.0170 -0.0727 0.0102  99  LEU A CB  
741  C CG  . LEU A 102 ? 0.5881 0.5980 0.3165 -0.0121 -0.0697 -0.0035 99  LEU A CG  
742  C CD1 . LEU A 102 ? 0.6637 0.7157 0.3725 -0.0247 -0.0630 0.0003  99  LEU A CD1 
743  C CD2 . LEU A 102 ? 0.5807 0.5894 0.3238 -0.0037 -0.0591 -0.0299 99  LEU A CD2 
744  N N   . VAL A 103 ? 0.6238 0.5926 0.4059 0.0029  -0.0768 -0.0092 100 VAL A N   
745  C CA  . VAL A 103 ? 0.5922 0.5553 0.3893 0.0160  -0.0748 -0.0177 100 VAL A CA  
746  C C   . VAL A 103 ? 0.6806 0.6192 0.4705 0.0185  -0.0883 -0.0130 100 VAL A C   
747  O O   . VAL A 103 ? 0.6656 0.5907 0.4540 0.0281  -0.0879 -0.0176 100 VAL A O   
748  C CB  . VAL A 103 ? 0.6017 0.5923 0.4297 0.0200  -0.0670 -0.0167 100 VAL A CB  
749  C CG1 . VAL A 103 ? 0.5538 0.5377 0.4017 0.0354  -0.0680 -0.0148 100 VAL A CG1 
750  C CG2 . VAL A 103 ? 0.6126 0.6268 0.4485 0.0196  -0.0478 -0.0289 100 VAL A CG2 
751  N N   . ASN A 104 ? 0.6848 0.6185 0.4697 0.0073  -0.0982 -0.0058 101 ASN A N   
752  C CA  . ASN A 104 ? 0.7649 0.6781 0.5390 0.0060  -0.1086 -0.0076 101 ASN A CA  
753  C C   . ASN A 104 ? 0.7518 0.6354 0.5076 0.0122  -0.1085 -0.0130 101 ASN A C   
754  O O   . ASN A 104 ? 0.6861 0.5599 0.4349 0.0184  -0.1104 -0.0184 101 ASN A O   
755  C CB  . ASN A 104 ? 0.7404 0.6525 0.5141 -0.0121 -0.1166 -0.0051 101 ASN A CB  
756  C CG  . ASN A 104 ? 0.7515 0.6986 0.5427 -0.0181 -0.1230 -0.0015 101 ASN A CG  
757  O OD1 . ASN A 104 ? 0.6984 0.6696 0.5062 -0.0049 -0.1203 0.0035  101 ASN A OD1 
758  N ND2 . ASN A 104 ? 0.8243 0.7757 0.6156 -0.0384 -0.1312 -0.0031 101 ASN A ND2 
759  N N   . VAL A 105 ? 0.6694 0.5449 0.4195 0.0108  -0.1061 -0.0086 102 VAL A N   
760  C CA  . VAL A 105 ? 0.6333 0.4887 0.3740 0.0191  -0.1065 -0.0099 102 VAL A CA  
761  C C   . VAL A 105 ? 0.6363 0.5025 0.3772 0.0292  -0.1019 -0.0178 102 VAL A C   
762  O O   . VAL A 105 ? 0.6494 0.5039 0.3865 0.0364  -0.1019 -0.0232 102 VAL A O   
763  C CB  . VAL A 105 ? 0.6165 0.4700 0.3551 0.0173  -0.1066 0.0044  102 VAL A CB  
764  C CG1 . VAL A 105 ? 0.5913 0.4422 0.3275 0.0298  -0.1071 0.0061  102 VAL A CG1 
765  C CG2 . VAL A 105 ? 0.6592 0.4855 0.4006 0.0079  -0.1091 0.0127  102 VAL A CG2 
766  N N   . VAL A 106 ? 0.6163 0.5045 0.3639 0.0283  -0.0954 -0.0207 103 VAL A N   
767  C CA  . VAL A 106 ? 0.6025 0.4967 0.3543 0.0338  -0.0881 -0.0316 103 VAL A CA  
768  C C   . VAL A 106 ? 0.6885 0.5696 0.4456 0.0400  -0.0877 -0.0331 103 VAL A C   
769  O O   . VAL A 106 ? 0.6290 0.5029 0.3839 0.0438  -0.0854 -0.0376 103 VAL A O   
770  C CB  . VAL A 106 ? 0.5641 0.4788 0.3255 0.0305  -0.0770 -0.0400 103 VAL A CB  
771  C CG1 . VAL A 106 ? 0.5338 0.4445 0.3048 0.0339  -0.0665 -0.0545 103 VAL A CG1 
772  C CG2 . VAL A 106 ? 0.5429 0.4806 0.2916 0.0215  -0.0765 -0.0387 103 VAL A CG2 
773  N N   . LYS A 107 ? 0.6560 0.5403 0.4206 0.0398  -0.0906 -0.0265 104 LYS A N   
774  C CA  . LYS A 107 ? 0.6923 0.5729 0.4590 0.0447  -0.0924 -0.0215 104 LYS A CA  
775  C C   . LYS A 107 ? 0.6853 0.5525 0.4316 0.0428  -0.0984 -0.0244 104 LYS A C   
776  O O   . LYS A 107 ? 0.7022 0.5653 0.4439 0.0466  -0.0952 -0.0244 104 LYS A O   
777  C CB  . LYS A 107 ? 0.6517 0.5507 0.4312 0.0440  -0.0980 -0.0103 104 LYS A CB  
778  C CG  . LYS A 107 ? 0.7218 0.6359 0.5295 0.0504  -0.0881 -0.0079 104 LYS A CG  
779  C CD  . LYS A 107 ? 0.8456 0.7794 0.6769 0.0587  -0.0909 0.0091  104 LYS A CD  
780  C CE  . LYS A 107 ? 0.8713 0.8356 0.7106 0.0507  -0.1014 0.0164  104 LYS A CE  
781  N NZ  . LYS A 107 ? 0.8689 0.8637 0.7385 0.0617  -0.1052 0.0371  104 LYS A NZ  
782  N N   . TYR A 108 ? 0.6568 0.5158 0.3931 0.0363  -0.1042 -0.0276 105 TYR A N   
783  C CA  . TYR A 108 ? 0.6814 0.5238 0.4024 0.0352  -0.1059 -0.0354 105 TYR A CA  
784  C C   . TYR A 108 ? 0.6810 0.5172 0.4019 0.0446  -0.0989 -0.0400 105 TYR A C   
785  O O   . TYR A 108 ? 0.6660 0.5004 0.3789 0.0473  -0.0952 -0.0454 105 TYR A O   
786  C CB  . TYR A 108 ? 0.6502 0.4762 0.3686 0.0270  -0.1096 -0.0382 105 TYR A CB  
787  C CG  . TYR A 108 ? 0.6885 0.4907 0.3958 0.0261  -0.1073 -0.0516 105 TYR A CG  
788  C CD1 . TYR A 108 ? 0.7183 0.5031 0.4308 0.0376  -0.1009 -0.0538 105 TYR A CD1 
789  C CD2 . TYR A 108 ? 0.7059 0.5076 0.3994 0.0135  -0.1106 -0.0637 105 TYR A CD2 
790  C CE1 . TYR A 108 ? 0.7301 0.4910 0.4384 0.0398  -0.0944 -0.0690 105 TYR A CE1 
791  C CE2 . TYR A 108 ? 0.7122 0.4907 0.3947 0.0111  -0.1044 -0.0832 105 TYR A CE2 
792  C CZ  . TYR A 108 ? 0.7670 0.5221 0.4590 0.0258  -0.0946 -0.0864 105 TYR A CZ  
793  O OH  . TYR A 108 ? 0.7527 0.4829 0.4397 0.0264  -0.0844 -0.1081 105 TYR A OH  
794  N N   . LYS A 109 ? 0.5949 0.4355 0.3245 0.0478  -0.0973 -0.0373 106 LYS A N   
795  C CA  . LYS A 109 ? 0.6270 0.4730 0.3611 0.0547  -0.0931 -0.0403 106 LYS A CA  
796  C C   . LYS A 109 ? 0.6358 0.4914 0.3741 0.0545  -0.0862 -0.0442 106 LYS A C   
797  O O   . LYS A 109 ? 0.6217 0.4799 0.3609 0.0579  -0.0815 -0.0481 106 LYS A O   
798  C CB  . LYS A 109 ? 0.6395 0.5000 0.3797 0.0548  -0.0957 -0.0341 106 LYS A CB  
799  C CG  . LYS A 109 ? 0.6596 0.5079 0.4014 0.0595  -0.1003 -0.0241 106 LYS A CG  
800  C CD  . LYS A 109 ? 0.7002 0.5696 0.4438 0.0572  -0.1048 -0.0103 106 LYS A CD  
801  C CE  . LYS A 109 ? 0.6971 0.5531 0.4485 0.0654  -0.1086 0.0075  106 LYS A CE  
802  N NZ  . LYS A 109 ? 0.6912 0.5563 0.4570 0.0805  -0.1086 0.0108  106 LYS A NZ  
803  N N   . LEU A 110 ? 0.5364 0.3959 0.2811 0.0509  -0.0833 -0.0424 107 LEU A N   
804  C CA  . LEU A 110 ? 0.5607 0.4208 0.3147 0.0501  -0.0740 -0.0442 107 LEU A CA  
805  C C   . LEU A 110 ? 0.6804 0.5349 0.4266 0.0520  -0.0729 -0.0364 107 LEU A C   
806  O O   . LEU A 110 ? 0.5974 0.4518 0.3477 0.0508  -0.0646 -0.0351 107 LEU A O   
807  C CB  . LEU A 110 ? 0.5362 0.3960 0.3056 0.0484  -0.0673 -0.0450 107 LEU A CB  
808  C CG  . LEU A 110 ? 0.5933 0.4655 0.3670 0.0426  -0.0642 -0.0573 107 LEU A CG  
809  C CD1 . LEU A 110 ? 0.5412 0.4089 0.3338 0.0422  -0.0517 -0.0635 107 LEU A CD1 
810  C CD2 . LEU A 110 ? 0.5472 0.4330 0.3195 0.0359  -0.0626 -0.0687 107 LEU A CD2 
811  N N   . ASP A 111 ? 0.5788 0.4327 0.3125 0.0520  -0.0808 -0.0313 108 ASP A N   
812  C CA  . ASP A 111 ? 0.5769 0.4355 0.2975 0.0508  -0.0812 -0.0234 108 ASP A CA  
813  C C   . ASP A 111 ? 0.6456 0.5034 0.3523 0.0506  -0.0763 -0.0346 108 ASP A C   
814  O O   . ASP A 111 ? 0.6196 0.4843 0.3215 0.0495  -0.0688 -0.0303 108 ASP A O   
815  C CB  . ASP A 111 ? 0.5762 0.4439 0.2865 0.0465  -0.0925 -0.0179 108 ASP A CB  
816  C CG  . ASP A 111 ? 0.6928 0.5779 0.3887 0.0435  -0.0951 -0.0044 108 ASP A CG  
817  O OD1 . ASP A 111 ? 0.6341 0.5252 0.3442 0.0487  -0.0918 0.0160  108 ASP A OD1 
818  O OD2 . ASP A 111 ? 0.7629 0.6564 0.4336 0.0354  -0.0996 -0.0138 108 ASP A OD2 
819  N N   . HIS A 112 ? 0.6137 0.4636 0.3185 0.0528  -0.0784 -0.0472 109 HIS A N   
820  C CA  . HIS A 112 ? 0.6400 0.4891 0.3403 0.0571  -0.0709 -0.0591 109 HIS A CA  
821  C C   . HIS A 112 ? 0.6286 0.4900 0.3457 0.0611  -0.0625 -0.0587 109 HIS A C   
822  O O   . HIS A 112 ? 0.6524 0.5238 0.3678 0.0625  -0.0527 -0.0638 109 HIS A O   
823  C CB  . HIS A 112 ? 0.6856 0.5180 0.3889 0.0616  -0.0737 -0.0685 109 HIS A CB  
824  C CG  . HIS A 112 ? 0.6421 0.4615 0.3269 0.0537  -0.0764 -0.0790 109 HIS A CG  
825  N ND1 . HIS A 112 ? 0.7431 0.5629 0.4106 0.0509  -0.0679 -0.0954 109 HIS A ND1 
826  C CD2 . HIS A 112 ? 0.6452 0.4557 0.3258 0.0445  -0.0856 -0.0780 109 HIS A CD2 
827  C CE1 . HIS A 112 ? 0.7384 0.5488 0.3898 0.0387  -0.0727 -0.1067 109 HIS A CE1 
828  N NE2 . HIS A 112 ? 0.7411 0.5461 0.4020 0.0344  -0.0841 -0.0952 109 HIS A NE2 
829  N N   . MET A 113 ? 0.5782 0.4440 0.3116 0.0604  -0.0652 -0.0548 110 MET A N   
830  C CA  . MET A 113 ? 0.6108 0.4942 0.3610 0.0586  -0.0583 -0.0571 110 MET A CA  
831  C C   . MET A 113 ? 0.6419 0.5272 0.3916 0.0511  -0.0479 -0.0522 110 MET A C   
832  O O   . MET A 113 ? 0.6505 0.5509 0.4063 0.0494  -0.0386 -0.0549 110 MET A O   
833  C CB  . MET A 113 ? 0.5411 0.4326 0.3038 0.0538  -0.0627 -0.0583 110 MET A CB  
834  C CG  . MET A 113 ? 0.6305 0.5296 0.3951 0.0601  -0.0725 -0.0569 110 MET A CG  
835  S SD  . MET A 113 ? 0.6122 0.5235 0.3787 0.0501  -0.0771 -0.0586 110 MET A SD  
836  C CE  . MET A 113 ? 0.5301 0.4731 0.3122 0.0386  -0.0715 -0.0702 110 MET A CE  
837  N N   . ARG A 114 ? 0.6095 0.4816 0.3553 0.0475  -0.0485 -0.0417 111 ARG A N   
838  C CA  . ARG A 114 ? 0.6152 0.4853 0.3627 0.0418  -0.0387 -0.0288 111 ARG A CA  
839  C C   . ARG A 114 ? 0.6820 0.5652 0.4090 0.0415  -0.0340 -0.0258 111 ARG A C   
840  O O   . ARG A 114 ? 0.6071 0.5012 0.3385 0.0357  -0.0220 -0.0228 111 ARG A O   
841  C CB  . ARG A 114 ? 0.6559 0.5125 0.4060 0.0434  -0.0417 -0.0120 111 ARG A CB  
842  C CG  . ARG A 114 ? 0.6279 0.4770 0.3894 0.0392  -0.0300 0.0076  111 ARG A CG  
843  C CD  . ARG A 114 ? 0.6220 0.4652 0.3873 0.0459  -0.0342 0.0330  111 ARG A CD  
844  N NE  . ARG A 114 ? 0.6316 0.4969 0.3674 0.0471  -0.0455 0.0453  111 ARG A NE  
845  C CZ  . ARG A 114 ? 0.6718 0.5473 0.3967 0.0504  -0.0600 0.0421  111 ARG A CZ  
846  N NH1 . ARG A 114 ? 0.6040 0.4697 0.3452 0.0546  -0.0642 0.0302  111 ARG A NH1 
847  N NH2 . ARG A 114 ? 0.6545 0.5539 0.3511 0.0465  -0.0695 0.0491  111 ARG A NH2 
848  N N   . ARG A 115 ? 0.6276 0.5117 0.3321 0.0452  -0.0420 -0.0297 112 ARG A N   
849  C CA  . ARG A 115 ? 0.7184 0.6169 0.3979 0.0427  -0.0364 -0.0335 112 ARG A CA  
850  C C   . ARG A 115 ? 0.7355 0.6459 0.4218 0.0462  -0.0240 -0.0507 112 ARG A C   
851  O O   . ARG A 115 ? 0.7068 0.6354 0.3788 0.0421  -0.0118 -0.0526 112 ARG A O   
852  C CB  . ARG A 115 ? 0.7097 0.6051 0.3659 0.0420  -0.0473 -0.0421 112 ARG A CB  
853  C CG  . ARG A 115 ? 0.7100 0.6105 0.3583 0.0375  -0.0590 -0.0214 112 ARG A CG  
854  C CD  . ARG A 115 ? 0.6548 0.5594 0.2824 0.0317  -0.0710 -0.0321 112 ARG A CD  
855  N NE  . ARG A 115 ? 0.6977 0.6182 0.3249 0.0286  -0.0838 -0.0086 112 ARG A NE  
856  C CZ  . ARG A 115 ? 0.7215 0.6721 0.3272 0.0215  -0.0879 0.0093  112 ARG A CZ  
857  N NH1 . ARG A 115 ? 0.7667 0.7342 0.3438 0.0140  -0.0785 0.0027  112 ARG A NH1 
858  N NH2 . ARG A 115 ? 0.7098 0.6799 0.3233 0.0220  -0.1011 0.0351  112 ARG A NH2 
859  N N   . ARG A 116 ? 0.6848 0.5908 0.3939 0.0543  -0.0266 -0.0612 113 ARG A N   
860  C CA  . ARG A 116 ? 0.6831 0.6070 0.4084 0.0614  -0.0158 -0.0736 113 ARG A CA  
861  C C   . ARG A 116 ? 0.6921 0.6386 0.4349 0.0525  -0.0051 -0.0661 113 ARG A C   
862  O O   . ARG A 116 ? 0.6587 0.6293 0.4060 0.0522  0.0095  -0.0713 113 ARG A O   
863  C CB  . ARG A 116 ? 0.6425 0.5621 0.3900 0.0736  -0.0241 -0.0794 113 ARG A CB  
864  C CG  . ARG A 116 ? 0.7720 0.7194 0.5487 0.0839  -0.0154 -0.0854 113 ARG A CG  
865  C CD  . ARG A 116 ? 0.9196 0.8754 0.6907 0.0905  0.0021  -0.0993 113 ARG A CD  
866  N NE  . ARG A 116 ? 1.0056 0.9367 0.7747 0.1047  0.0031  -0.1125 113 ARG A NE  
867  C CZ  . ARG A 116 ? 1.0467 0.9787 0.8149 0.1133  0.0208  -0.1319 113 ARG A CZ  
868  N NH1 . ARG A 116 ? 1.0342 0.9977 0.8006 0.1093  0.0383  -0.1383 113 ARG A NH1 
869  N NH2 . ARG A 116 ? 1.0938 0.9940 0.8643 0.1248  0.0234  -0.1461 113 ARG A NH2 
870  N N   . ILE A 117 ? 0.6107 0.5492 0.3653 0.0437  -0.0101 -0.0560 114 ILE A N   
871  C CA  . ILE A 117 ? 0.5986 0.5500 0.3719 0.0301  0.0007  -0.0500 114 ILE A CA  
872  C C   . ILE A 117 ? 0.7227 0.6760 0.4792 0.0215  0.0135  -0.0348 114 ILE A C   
873  O O   . ILE A 117 ? 0.7030 0.6794 0.4695 0.0128  0.0282  -0.0333 114 ILE A O   
874  C CB  . ILE A 117 ? 0.6362 0.5692 0.4242 0.0214  -0.0046 -0.0473 114 ILE A CB  
875  C CG1 . ILE A 117 ? 0.6474 0.5927 0.4493 0.0259  -0.0162 -0.0614 114 ILE A CG1 
876  C CG2 . ILE A 117 ? 0.6603 0.5957 0.4683 0.0033  0.0096  -0.0421 114 ILE A CG2 
877  C CD1 . ILE A 117 ? 0.6201 0.5498 0.4294 0.0174  -0.0208 -0.0652 114 ILE A CD1 
878  N N   . GLU A 118 ? 0.6358 0.5713 0.3677 0.0228  0.0074  -0.0211 115 GLU A N   
879  C CA  . GLU A 118 ? 0.7044 0.6479 0.4153 0.0150  0.0161  -0.0001 115 GLU A CA  
880  C C   . GLU A 118 ? 0.7648 0.7393 0.4555 0.0148  0.0278  -0.0122 115 GLU A C   
881  O O   . GLU A 118 ? 0.7652 0.7607 0.4515 0.0042  0.0435  -0.0003 115 GLU A O   
882  C CB  . GLU A 118 ? 0.6747 0.6057 0.3636 0.0186  0.0029  0.0168  115 GLU A CB  
883  C CG  . GLU A 118 ? 0.7074 0.6108 0.4202 0.0199  -0.0025 0.0338  115 GLU A CG  
884  C CD  . GLU A 118 ? 0.7378 0.6367 0.4373 0.0274  -0.0183 0.0471  115 GLU A CD  
885  O OE1 . GLU A 118 ? 0.7045 0.6197 0.3753 0.0286  -0.0276 0.0372  115 GLU A OE1 
886  O OE2 . GLU A 118 ? 0.7587 0.6389 0.4802 0.0313  -0.0200 0.0659  115 GLU A OE2 
887  N N   . THR A 119 ? 0.6780 0.6540 0.3590 0.0260  0.0228  -0.0365 116 THR A N   
888  C CA  . THR A 119 ? 0.7390 0.7401 0.4048 0.0283  0.0374  -0.0556 116 THR A CA  
889  C C   . THR A 119 ? 0.7957 0.8231 0.4938 0.0284  0.0540  -0.0616 116 THR A C   
890  O O   . THR A 119 ? 0.7165 0.7746 0.4056 0.0227  0.0731  -0.0645 116 THR A O   
891  C CB  . THR A 119 ? 0.7382 0.7254 0.3974 0.0416  0.0318  -0.0831 116 THR A CB  
892  O OG1 . THR A 119 ? 0.8130 0.7813 0.4451 0.0376  0.0158  -0.0789 116 THR A OG1 
893  C CG2 . THR A 119 ? 0.7956 0.8055 0.4398 0.0440  0.0523  -0.1078 116 THR A CG2 
894  N N   . ASP A 120 ? 0.6631 0.6861 0.3986 0.0331  0.0470  -0.0636 117 ASP A N   
895  C CA  . ASP A 120 ? 0.7544 0.8123 0.5255 0.0316  0.0597  -0.0690 117 ASP A CA  
896  C C   . ASP A 120 ? 0.7743 0.8468 0.5480 0.0098  0.0736  -0.0504 117 ASP A C   
897  O O   . ASP A 120 ? 0.8159 0.9261 0.6030 0.0040  0.0921  -0.0531 117 ASP A O   
898  C CB  . ASP A 120 ? 0.6796 0.7388 0.4867 0.0375  0.0458  -0.0737 117 ASP A CB  
899  C CG  . ASP A 120 ? 0.8503 0.9065 0.6655 0.0609  0.0379  -0.0877 117 ASP A CG  
900  O OD1 . ASP A 120 ? 0.9286 0.9685 0.7202 0.0708  0.0422  -0.0975 117 ASP A OD1 
901  O OD2 . ASP A 120 ? 0.9851 1.0555 0.8305 0.0681  0.0275  -0.0882 117 ASP A OD2 
902  N N   . GLU A 121 ? 0.6764 0.7186 0.4401 -0.0016 0.0667  -0.0297 118 GLU A N   
903  C CA  . GLU A 121 ? 0.7193 0.7649 0.4888 -0.0223 0.0810  -0.0068 118 GLU A CA  
904  C C   . GLU A 121 ? 0.8261 0.8953 0.5618 -0.0277 0.0963  0.0064  118 GLU A C   
905  O O   . GLU A 121 ? 0.8808 0.9762 0.6254 -0.0433 0.1157  0.0175  118 GLU A O   
906  C CB  . GLU A 121 ? 0.7938 0.7956 0.5661 -0.0287 0.0722  0.0140  118 GLU A CB  
907  C CG  . GLU A 121 ? 0.9478 0.9428 0.7310 -0.0492 0.0890  0.0425  118 GLU A CG  
908  C CD  . GLU A 121 ? 1.1158 1.0615 0.9148 -0.0527 0.0845  0.0607  118 GLU A CD  
909  O OE1 . GLU A 121 ? 1.0837 1.0067 0.8898 -0.0421 0.0697  0.0454  118 GLU A OE1 
910  O OE2 . GLU A 121 ? 1.2165 1.1463 1.0233 -0.0657 0.0981  0.0916  118 GLU A OE2 
911  N N   . ARG A 122 ? 0.7464 0.8108 0.4420 -0.0180 0.0881  0.0045  119 ARG A N   
912  C CA  . ARG A 122 ? 0.7845 0.8792 0.4395 -0.0253 0.1013  0.0125  119 ARG A CA  
913  C C   . ARG A 122 ? 0.8523 0.9891 0.5131 -0.0231 0.1228  -0.0144 119 ARG A C   
914  O O   . ARG A 122 ? 0.8702 1.0427 0.5185 -0.0368 0.1437  -0.0040 119 ARG A O   
915  C CB  . ARG A 122 ? 0.7961 0.8827 0.4075 -0.0185 0.0860  0.0085  119 ARG A CB  
916  C CG  . ARG A 122 ? 0.8607 0.9870 0.4216 -0.0306 0.0979  0.0162  119 ARG A CG  
917  C CD  . ARG A 122 ? 0.9655 1.0917 0.4850 -0.0269 0.0831  -0.0010 119 ARG A CD  
918  N NE  . ARG A 122 ? 1.0226 1.1433 0.5467 -0.0146 0.0881  -0.0494 119 ARG A NE  
919  C CZ  . ARG A 122 ? 1.0743 1.1618 0.6058 -0.0030 0.0710  -0.0688 119 ARG A CZ  
920  N NH1 . ARG A 122 ? 1.0980 1.1607 0.6322 -0.0025 0.0478  -0.0466 119 ARG A NH1 
921  N NH2 . ARG A 122 ? 1.1032 1.1819 0.6433 0.0087  0.0792  -0.1088 119 ARG A NH2 
922  N N   . ASP A 123 ? 0.8424 0.9768 0.5251 -0.0049 0.1191  -0.0465 120 ASP A N   
923  C CA  . ASP A 123 ? 0.8441 1.0176 0.5437 0.0035  0.1405  -0.0728 120 ASP A CA  
924  C C   . ASP A 123 ? 0.8637 1.0740 0.6022 -0.0093 0.1573  -0.0617 120 ASP A C   
925  O O   . ASP A 123 ? 0.8095 1.0646 0.5459 -0.0156 0.1828  -0.0669 120 ASP A O   
926  C CB  . ASP A 123 ? 0.8742 1.0330 0.6015 0.0286  0.1313  -0.1005 120 ASP A CB  
927  C CG  . ASP A 123 ? 0.9755 1.1012 0.6669 0.0383  0.1208  -0.1174 120 ASP A CG  
928  O OD1 . ASP A 123 ? 1.0268 1.1524 0.6698 0.0253  0.1216  -0.1126 120 ASP A OD1 
929  O OD2 . ASP A 123 ? 1.0363 1.1388 0.7484 0.0573  0.1114  -0.1338 120 ASP A OD2 
930  N N   . SER A 124 ? 0.7761 0.9703 0.5492 -0.0163 0.1446  -0.0485 121 SER A N   
931  C CA  . SER A 124 ? 0.8802 1.1099 0.6959 -0.0326 0.1583  -0.0421 121 SER A CA  
932  C C   . SER A 124 ? 0.9696 1.2139 0.7690 -0.0589 0.1786  -0.0151 121 SER A C   
933  O O   . SER A 124 ? 1.0233 1.3134 0.8485 -0.0724 0.1998  -0.0143 121 SER A O   
934  C CB  . SER A 124 ? 0.8716 1.0796 0.7229 -0.0395 0.1403  -0.0388 121 SER A CB  
935  O OG  . SER A 124 ? 0.8483 1.0951 0.7415 -0.0602 0.1535  -0.0364 121 SER A OG  
936  N N   . THR A 125 ? 0.9984 1.2079 0.7581 -0.0663 0.1722  0.0106  122 THR A N   
937  C CA  . THR A 125 ? 1.1053 1.3266 0.8473 -0.0901 0.1902  0.0453  122 THR A CA  
938  C C   . THR A 125 ? 1.0887 1.3570 0.7875 -0.0905 0.2096  0.0413  122 THR A C   
939  O O   . THR A 125 ? 1.1862 1.4896 0.8789 -0.1109 0.2329  0.0622  122 THR A O   
940  C CB  . THR A 125 ? 1.2061 1.3768 0.9282 -0.0953 0.1757  0.0813  122 THR A CB  
941  O OG1 . THR A 125 ? 1.2407 1.3994 0.9191 -0.0779 0.1583  0.0759  122 THR A OG1 
942  C CG2 . THR A 125 ? 1.1991 1.3232 0.9641 -0.0968 0.1619  0.0800  122 THR A CG2 
943  N N   . ASN A 126 ? 0.9938 1.2628 0.6624 -0.0705 0.2019  0.0129  123 ASN A N   
944  C CA  . ASN A 126 ? 0.9972 1.3108 0.6231 -0.0709 0.2219  -0.0035 123 ASN A CA  
945  C C   . ASN A 126 ? 0.9244 1.2792 0.5838 -0.0585 0.2441  -0.0422 123 ASN A C   
946  O O   . ASN A 126 ? 0.9427 1.3343 0.5743 -0.0560 0.2655  -0.0659 123 ASN A O   
947  C CB  . ASN A 126 ? 0.9956 1.2887 0.5718 -0.0595 0.2051  -0.0196 123 ASN A CB  
948  C CG  . ASN A 126 ? 1.0536 1.3261 0.5917 -0.0715 0.1864  0.0219  123 ASN A CG  
949  O OD1 . ASN A 126 ? 1.1371 1.4202 0.6711 -0.0898 0.1937  0.0647  123 ASN A OD1 
950  N ND2 . ASN A 126 ? 0.9950 1.2396 0.5089 -0.0611 0.1628  0.0120  123 ASN A ND2 
951  N N   . ARG A 127 ? 0.8924 1.1750 0.4970 0.0894  0.1987  -0.1579 124 ARG A N   
952  C CA  . ARG A 127 ? 0.8633 1.1963 0.4542 0.0648  0.1744  -0.1596 124 ARG A CA  
953  C C   . ARG A 127 ? 0.9499 1.2340 0.5517 0.0358  0.1549  -0.1672 124 ARG A C   
954  O O   . ARG A 127 ? 0.9686 1.1860 0.5614 0.0254  0.1623  -0.1989 124 ARG A O   
955  C CB  . ARG A 127 ? 0.9204 1.2959 0.4550 0.0547  0.1811  -0.2039 124 ARG A CB  
956  C CG  . ARG A 127 ? 0.9420 1.3729 0.4725 0.0289  0.1540  -0.1973 124 ARG A CG  
957  C CD  . ARG A 127 ? 1.0169 1.4801 0.5129 0.0183  0.1521  -0.2257 124 ARG A CD  
958  N NE  . ARG A 127 ? 1.0493 1.5695 0.5524 -0.0065 0.1251  -0.2149 124 ARG A NE  
959  C CZ  . ARG A 127 ? 1.1304 1.6253 0.6263 -0.0386 0.1102  -0.2424 124 ARG A CZ  
960  N NH1 . ARG A 127 ? 1.0981 1.5067 0.5811 -0.0503 0.1195  -0.2828 124 ARG A NH1 
961  N NH2 . ARG A 127 ? 1.2042 1.7646 0.7128 -0.0579 0.0884  -0.2258 124 ARG A NH2 
962  N N   . ALA A 128 ? 0.8654 1.1804 0.4916 0.0248  0.1344  -0.1356 125 ALA A N   
963  C CA  . ALA A 128 ? 0.8520 1.1284 0.4859 -0.0017 0.1179  -0.1410 125 ALA A CA  
964  C C   . ALA A 128 ? 0.9153 1.2085 0.5146 -0.0276 0.1107  -0.1779 125 ALA A C   
965  O O   . ALA A 128 ? 0.9944 1.3472 0.5960 -0.0383 0.0982  -0.1626 125 ALA A O   
966  C CB  . ALA A 128 ? 0.8217 1.1221 0.4935 -0.0047 0.1048  -0.0983 125 ALA A CB  
967  N N   . SER A 129 ? 0.9272 1.1708 0.5002 -0.0385 0.1204  -0.2244 126 SER A N   
968  C CA  . SER A 129 ? 0.9666 1.2288 0.5063 -0.0684 0.1135  -0.2667 126 SER A CA  
969  C C   . SER A 129 ? 0.9598 1.2070 0.5163 -0.0958 0.0941  -0.2606 126 SER A C   
970  O O   . SER A 129 ? 0.9548 1.2489 0.4978 -0.1201 0.0803  -0.2730 126 SER A O   
971  C CB  . SER A 129 ? 0.9855 1.1900 0.4977 -0.0746 0.1353  -0.3239 126 SER A CB  
972  O OG  . SER A 129 ? 1.1256 1.3526 0.6155 -0.0517 0.1550  -0.3343 126 SER A OG  
973  N N   . PHE A 130 ? 0.8621 1.0499 0.4497 -0.0914 0.0932  -0.2384 127 PHE A N   
974  C CA  . PHE A 130 ? 0.8903 1.0547 0.4937 -0.1141 0.0798  -0.2322 127 PHE A CA  
975  C C   . PHE A 130 ? 0.8352 1.0022 0.4697 -0.1039 0.0728  -0.1845 127 PHE A C   
976  O O   . PHE A 130 ? 0.8069 0.9619 0.4551 -0.0829 0.0789  -0.1636 127 PHE A O   
977  C CB  . PHE A 130 ? 0.9890 1.0708 0.5963 -0.1238 0.0899  -0.2597 127 PHE A CB  
978  C CG  . PHE A 130 ? 1.1576 1.2263 0.7393 -0.1428 0.0997  -0.3151 127 PHE A CG  
979  C CD1 . PHE A 130 ? 1.2085 1.2727 0.7681 -0.1289 0.1200  -0.3436 127 PHE A CD1 
980  C CD2 . PHE A 130 ? 1.2171 1.2746 0.7989 -0.1762 0.0914  -0.3409 127 PHE A CD2 
981  C CE1 . PHE A 130 ? 1.2463 1.2944 0.7789 -0.1502 0.1328  -0.4030 127 PHE A CE1 
982  C CE2 . PHE A 130 ? 1.2650 1.3090 0.8247 -0.2000 0.1011  -0.3986 127 PHE A CE2 
983  C CZ  . PHE A 130 ? 1.2665 1.3030 0.8063 -0.1849 0.1206  -0.4262 127 PHE A CZ  
984  N N   . LYS A 131 ? 0.8099 0.9939 0.4573 -0.1200 0.0618  -0.1683 128 LYS A N   
985  C CA  . LYS A 131 ? 0.7931 0.9740 0.4681 -0.1144 0.0602  -0.1306 128 LYS A CA  
986  C C   . LYS A 131 ? 0.7442 0.8957 0.4287 -0.1335 0.0554  -0.1267 128 LYS A C   
987  O O   . LYS A 131 ? 0.7237 0.8977 0.4052 -0.1510 0.0497  -0.1353 128 LYS A O   
988  C CB  . LYS A 131 ? 0.8005 1.0522 0.4923 -0.1050 0.0614  -0.1005 128 LYS A CB  
989  C CG  . LYS A 131 ? 0.7693 1.0124 0.4942 -0.1009 0.0663  -0.0672 128 LYS A CG  
990  C CD  . LYS A 131 ? 0.7640 1.0732 0.5170 -0.0878 0.0745  -0.0344 128 LYS A CD  
991  C CE  . LYS A 131 ? 0.8726 1.1603 0.6611 -0.0834 0.0846  -0.0101 128 LYS A CE  
992  N NZ  . LYS A 131 ? 0.9633 1.3081 0.7884 -0.0667 0.0973  0.0231  128 LYS A NZ  
993  N N   . CYS A 132 ? 0.6672 0.7744 0.3621 -0.1313 0.0576  -0.1131 129 CYS A N   
994  C CA  . CYS A 132 ? 0.6935 0.7747 0.3959 -0.1462 0.0567  -0.1059 129 CYS A CA  
995  C C   . CYS A 132 ? 0.7241 0.8443 0.4467 -0.1489 0.0606  -0.0808 129 CYS A C   
996  O O   . CYS A 132 ? 0.6902 0.8270 0.4275 -0.1383 0.0672  -0.0627 129 CYS A O   
997  C CB  . CYS A 132 ? 0.6500 0.6826 0.3519 -0.1432 0.0588  -0.0986 129 CYS A CB  
998  S SG  . CYS A 132 ? 0.7478 0.7518 0.4538 -0.1591 0.0617  -0.0883 129 CYS A SG  
999  N N   . PRO A 133 ? 0.8002 0.9355 0.5305 -0.1631 0.0595  -0.0768 130 PRO A N   
1000 C CA  . PRO A 133 ? 0.8376 1.0106 0.5962 -0.1635 0.0690  -0.0462 130 PRO A CA  
1001 C C   . PRO A 133 ? 0.8017 0.9312 0.5720 -0.1624 0.0836  -0.0325 130 PRO A C   
1002 O O   . PRO A 133 ? 0.8461 0.9950 0.6453 -0.1588 0.1000  -0.0075 130 PRO A O   
1003 C CB  . PRO A 133 ? 0.8339 1.0308 0.5977 -0.1810 0.0624  -0.0464 130 PRO A CB  
1004 C CG  . PRO A 133 ? 0.8714 1.0404 0.6086 -0.1925 0.0494  -0.0838 130 PRO A CG  
1005 C CD  . PRO A 133 ? 0.8482 0.9606 0.5692 -0.1801 0.0526  -0.0973 130 PRO A CD  
1006 N N   . VAL A 134 ? 0.7440 0.8187 0.4934 -0.1657 0.0806  -0.0479 131 VAL A N   
1007 C CA  . VAL A 134 ? 0.6904 0.7295 0.4405 -0.1686 0.0933  -0.0413 131 VAL A CA  
1008 C C   . VAL A 134 ? 0.7161 0.7487 0.4627 -0.1627 0.0940  -0.0446 131 VAL A C   
1009 O O   . VAL A 134 ? 0.6945 0.7352 0.4621 -0.1620 0.1088  -0.0345 131 VAL A O   
1010 C CB  . VAL A 134 ? 0.7225 0.7180 0.4524 -0.1773 0.0903  -0.0497 131 VAL A CB  
1011 C CG1 . VAL A 134 ? 0.6471 0.6143 0.3685 -0.1820 0.1036  -0.0466 131 VAL A CG1 
1012 C CG2 . VAL A 134 ? 0.7270 0.7290 0.4682 -0.1860 0.0907  -0.0445 131 VAL A CG2 
1013 N N   . CYS A 135 ? 0.7052 0.7254 0.4322 -0.1587 0.0803  -0.0562 132 CYS A N   
1014 C CA  . CYS A 135 ? 0.7181 0.7368 0.4432 -0.1568 0.0782  -0.0561 132 CYS A CA  
1015 C C   . CYS A 135 ? 0.6411 0.6942 0.3822 -0.1430 0.0753  -0.0511 132 CYS A C   
1016 O O   . CYS A 135 ? 0.6045 0.6647 0.3532 -0.1417 0.0736  -0.0475 132 CYS A O   
1017 C CB  . CYS A 135 ? 0.7437 0.7393 0.4454 -0.1584 0.0673  -0.0607 132 CYS A CB  
1018 S SG  . CYS A 135 ? 0.6402 0.6343 0.3384 -0.1424 0.0578  -0.0646 132 CYS A SG  
1019 N N   . SER A 136 ? 0.6113 0.6915 0.3574 -0.1344 0.0746  -0.0504 133 SER A N   
1020 C CA  . SER A 136 ? 0.6134 0.7363 0.3735 -0.1193 0.0755  -0.0426 133 SER A CA  
1021 C C   . SER A 136 ? 0.6620 0.7811 0.4101 -0.1071 0.0677  -0.0499 133 SER A C   
1022 O O   . SER A 136 ? 0.6455 0.7978 0.4051 -0.0925 0.0702  -0.0415 133 SER A O   
1023 C CB  . SER A 136 ? 0.5663 0.7097 0.3613 -0.1174 0.0888  -0.0227 133 SER A CB  
1024 O OG  . SER A 136 ? 0.6044 0.7514 0.4192 -0.1245 0.1033  -0.0109 133 SER A OG  
1025 N N   . SER A 137 ? 0.7019 0.7835 0.4319 -0.1104 0.0615  -0.0602 134 SER A N   
1026 C CA  . SER A 137 ? 0.6237 0.6995 0.3481 -0.0958 0.0597  -0.0634 134 SER A CA  
1027 C C   . SER A 137 ? 0.6691 0.7601 0.3837 -0.0861 0.0644  -0.0794 134 SER A C   
1028 O O   . SER A 137 ? 0.6479 0.7383 0.3515 -0.0970 0.0639  -0.0947 134 SER A O   
1029 C CB  . SER A 137 ? 0.6458 0.6818 0.3603 -0.0996 0.0571  -0.0655 134 SER A CB  
1030 O OG  . SER A 137 ? 0.6633 0.6996 0.3809 -0.1082 0.0510  -0.0507 134 SER A OG  
1031 N N   . THR A 138 ? 0.7095 0.8185 0.4275 -0.0673 0.0696  -0.0763 135 THR A N   
1032 C CA  . THR A 138 ? 0.7590 0.8826 0.4602 -0.0583 0.0772  -0.0971 135 THR A CA  
1033 C C   . THR A 138 ? 0.7731 0.8585 0.4687 -0.0452 0.0885  -0.1099 135 THR A C   
1034 O O   . THR A 138 ? 0.7530 0.8213 0.4657 -0.0353 0.0899  -0.0898 135 THR A O   
1035 C CB  . THR A 138 ? 0.7322 0.9151 0.4412 -0.0430 0.0815  -0.0828 135 THR A CB  
1036 O OG1 . THR A 138 ? 0.6655 0.8534 0.3965 -0.0257 0.0852  -0.0599 135 THR A OG1 
1037 C CG2 . THR A 138 ? 0.7045 0.9273 0.4299 -0.0526 0.0772  -0.0642 135 THR A CG2 
1038 N N   . PHE A 139 ? 0.7768 0.8523 0.4511 -0.0465 0.0985  -0.1430 136 PHE A N   
1039 C CA  . PHE A 139 ? 0.8014 0.8303 0.4746 -0.0349 0.1181  -0.1609 136 PHE A CA  
1040 C C   . PHE A 139 ? 0.8439 0.8900 0.4927 -0.0261 0.1343  -0.1919 136 PHE A C   
1041 O O   . PHE A 139 ? 0.8483 0.9341 0.4722 -0.0404 0.1268  -0.2129 136 PHE A O   
1042 C CB  . PHE A 139 ? 0.8522 0.8262 0.5261 -0.0533 0.1209  -0.1814 136 PHE A CB  
1043 C CG  . PHE A 139 ? 0.7945 0.7573 0.4840 -0.0642 0.1058  -0.1543 136 PHE A CG  
1044 C CD1 . PHE A 139 ? 0.7887 0.7329 0.5004 -0.0515 0.1085  -0.1232 136 PHE A CD1 
1045 C CD2 . PHE A 139 ? 0.7712 0.7486 0.4531 -0.0867 0.0906  -0.1578 136 PHE A CD2 
1046 C CE1 . PHE A 139 ? 0.7638 0.7042 0.4821 -0.0631 0.0951  -0.1010 136 PHE A CE1 
1047 C CE2 . PHE A 139 ? 0.8273 0.7924 0.5195 -0.0958 0.0810  -0.1352 136 PHE A CE2 
1048 C CZ  . PHE A 139 ? 0.7441 0.6909 0.4505 -0.0849 0.0829  -0.1097 136 PHE A CZ  
1049 N N   . THR A 140 ? 0.8792 0.9002 0.5355 -0.0023 0.1581  -0.1928 137 THR A N   
1050 C CA  . THR A 140 ? 0.9588 0.9855 0.5885 0.0078  0.1810  -0.2277 137 THR A CA  
1051 C C   . THR A 140 ? 1.0485 1.0180 0.6620 -0.0119 0.1975  -0.2804 137 THR A C   
1052 O O   . THR A 140 ? 1.1262 1.0466 0.7608 -0.0244 0.1958  -0.2788 137 THR A O   
1053 C CB  . THR A 140 ? 1.0126 1.0309 0.6626 0.0439  0.2065  -0.2052 137 THR A CB  
1054 O OG1 . THR A 140 ? 1.0980 1.0468 0.7753 0.0526  0.2294  -0.2042 137 THR A OG1 
1055 C CG2 . THR A 140 ? 0.8847 0.9499 0.5647 0.0585  0.1888  -0.1490 137 THR A CG2 
1056 N N   . ASP A 141 ? 1.0693 1.0474 0.6461 -0.0161 0.2147  -0.3279 138 ASP A N   
1057 C CA  . ASP A 141 ? 1.2596 1.1831 0.8198 -0.0399 0.2342  -0.3889 138 ASP A CA  
1058 C C   . ASP A 141 ? 1.3548 1.1867 0.9567 -0.0263 0.2668  -0.3863 138 ASP A C   
1059 O O   . ASP A 141 ? 1.4231 1.1990 1.0370 -0.0493 0.2754  -0.4155 138 ASP A O   
1060 C CB  . ASP A 141 ? 1.3689 1.3178 0.8794 -0.0424 0.2542  -0.4421 138 ASP A CB  
1061 C CG  . ASP A 141 ? 1.4367 1.4759 0.9116 -0.0646 0.2184  -0.4468 138 ASP A CG  
1062 O OD1 . ASP A 141 ? 1.4848 1.5243 0.9565 -0.0985 0.1978  -0.4693 138 ASP A OD1 
1063 O OD2 . ASP A 141 ? 1.4470 1.5582 0.9107 -0.0451 0.2092  -0.4152 138 ASP A OD2 
1064 N N   . LEU A 142 ? 1.3725 1.1944 1.0029 0.0118  0.2866  -0.3464 139 LEU A N   
1065 C CA  . LEU A 142 ? 1.4243 1.1737 1.1050 0.0318  0.3194  -0.3269 139 LEU A CA  
1066 C C   . LEU A 142 ? 1.3897 1.1278 1.1062 0.0221  0.2956  -0.2856 139 LEU A C   
1067 O O   . LEU A 142 ? 1.4706 1.1462 1.2196 0.0175  0.3158  -0.2897 139 LEU A O   
1068 C CB  . LEU A 142 ? 1.4160 1.1768 1.1224 0.0756  0.3422  -0.2834 139 LEU A CB  
1069 C CG  . LEU A 142 ? 1.4373 1.1492 1.2080 0.1033  0.3710  -0.2370 139 LEU A CG  
1070 C CD1 . LEU A 142 ? 1.4429 1.1358 1.2315 0.1418  0.4193  -0.2312 139 LEU A CD1 
1071 C CD2 . LEU A 142 ? 1.3831 1.1430 1.1848 0.1102  0.3349  -0.1657 139 LEU A CD2 
1072 N N   . GLU A 143 ? 1.2958 1.0943 1.0080 0.0194  0.2561  -0.2459 140 GLU A N   
1073 C CA  . GLU A 143 ? 1.2306 1.0273 0.9663 0.0085  0.2322  -0.2097 140 GLU A CA  
1074 C C   . GLU A 143 ? 1.3470 1.1206 1.0690 -0.0271 0.2209  -0.2454 140 GLU A C   
1075 O O   . GLU A 143 ? 1.3299 1.0724 1.0783 -0.0347 0.2192  -0.2279 140 GLU A O   
1076 C CB  . GLU A 143 ? 1.0788 0.9423 0.8093 0.0100  0.1972  -0.1692 140 GLU A CB  
1077 C CG  . GLU A 143 ? 1.0508 0.9427 0.8062 0.0408  0.2028  -0.1241 140 GLU A CG  
1078 C CD  . GLU A 143 ? 1.0288 0.9841 0.7809 0.0361  0.1706  -0.0936 140 GLU A CD  
1079 O OE1 . GLU A 143 ? 0.9542 0.9316 0.6830 0.0136  0.1491  -0.1090 140 GLU A OE1 
1080 O OE2 . GLU A 143 ? 1.0438 1.0280 0.8219 0.0543  0.1689  -0.0529 140 GLU A OE2 
1081 N N   . ALA A 144 ? 1.4231 1.2195 1.1058 -0.0487 0.2136  -0.2924 141 ALA A N   
1082 C CA  . ALA A 144 ? 1.4297 1.2276 1.0982 -0.0859 0.1954  -0.3218 141 ALA A CA  
1083 C C   . ALA A 144 ? 1.4240 1.1473 1.1177 -0.1019 0.2186  -0.3505 141 ALA A C   
1084 O O   . ALA A 144 ? 1.3694 1.0825 1.0770 -0.1236 0.2043  -0.3452 141 ALA A O   
1085 C CB  . ALA A 144 ? 1.4697 1.3221 1.0923 -0.1047 0.1842  -0.3628 141 ALA A CB  
1086 N N   . ASN A 145 ? 1.4398 1.1092 1.1441 -0.0909 0.2582  -0.3802 142 ASN A N   
1087 C CA  . ASN A 145 ? 1.5190 1.1112 1.2551 -0.1077 0.2873  -0.4122 142 ASN A CA  
1088 C C   . ASN A 145 ? 1.5102 1.0628 1.3038 -0.0932 0.2952  -0.3584 142 ASN A C   
1089 O O   . ASN A 145 ? 1.5431 1.0501 1.3664 -0.1138 0.3047  -0.3710 142 ASN A O   
1090 C CB  . ASN A 145 ? 1.6507 1.1883 1.3883 -0.0973 0.3361  -0.4580 142 ASN A CB  
1091 C CG  . ASN A 145 ? 1.7292 1.3123 1.4032 -0.1129 0.3301  -0.5142 142 ASN A CG  
1092 O OD1 . ASN A 145 ? 1.7313 1.3561 1.3716 -0.1507 0.3011  -0.5489 142 ASN A OD1 
1093 N ND2 . ASN A 145 ? 1.7807 1.3664 1.4412 -0.0822 0.3561  -0.5161 142 ASN A ND2 
1094 N N   . GLN A 146 ? 1.4792 1.0569 1.2895 -0.0595 0.2901  -0.2965 143 GLN A N   
1095 C CA  . GLN A 146 ? 1.4358 0.9987 1.2928 -0.0463 0.2915  -0.2389 143 GLN A CA  
1096 C C   . GLN A 146 ? 1.3370 0.9490 1.1742 -0.0644 0.2472  -0.2142 143 GLN A C   
1097 O O   . GLN A 146 ? 1.2850 0.9136 1.1420 -0.0517 0.2376  -0.1609 143 GLN A O   
1098 C CB  . GLN A 146 ? 1.4599 1.0349 1.3467 -0.0050 0.3073  -0.1827 143 GLN A CB  
1099 C CG  . GLN A 146 ? 1.6216 1.1368 1.5442 0.0184  0.3618  -0.1967 143 GLN A CG  
1100 C CD  . GLN A 146 ? 1.7006 1.2156 1.6827 0.0584  0.3859  -0.1244 143 GLN A CD  
1101 O OE1 . GLN A 146 ? 1.6874 1.2599 1.6742 0.0675  0.3564  -0.0664 143 GLN A OE1 
1102 N NE2 . GLN A 146 ? 1.7894 1.2425 1.8197 0.0812  0.4421  -0.1272 143 GLN A NE2 
1103 N N   . LEU A 147 ? 1.3120 0.9508 1.1103 -0.0944 0.2229  -0.2530 144 LEU A N   
1104 C CA  . LEU A 147 ? 1.1639 0.8406 0.9477 -0.1140 0.1885  -0.2363 144 LEU A CA  
1105 C C   . LEU A 147 ? 1.1910 0.8384 0.9857 -0.1467 0.1897  -0.2677 144 LEU A C   
1106 O O   . LEU A 147 ? 1.1400 0.8077 0.9338 -0.1624 0.1687  -0.2513 144 LEU A O   
1107 C CB  . LEU A 147 ? 1.0875 0.8314 0.8283 -0.1199 0.1600  -0.2425 144 LEU A CB  
1108 C CG  . LEU A 147 ? 1.0698 0.8525 0.8039 -0.0932 0.1522  -0.2061 144 LEU A CG  
1109 C CD1 . LEU A 147 ? 1.0768 0.9189 0.7776 -0.0984 0.1337  -0.2183 144 LEU A CD1 
1110 C CD2 . LEU A 147 ? 1.0168 0.8110 0.7635 -0.0893 0.1375  -0.1597 144 LEU A CD2 
1111 N N   . PHE A 148 ? 1.3068 0.7707 0.9013 -0.3609 0.1361  -0.1539 145 PHE A N   
1112 C CA  . PHE A 148 ? 1.3334 0.8211 1.0073 -0.4143 0.1650  -0.1840 145 PHE A CA  
1113 C C   . PHE A 148 ? 1.4562 0.8875 1.1220 -0.4386 0.2293  -0.1547 145 PHE A C   
1114 O O   . PHE A 148 ? 1.5366 0.8675 1.1262 -0.4246 0.2560  -0.1153 145 PHE A O   
1115 C CB  . PHE A 148 ? 1.3335 0.7871 1.0311 -0.4386 0.1556  -0.2174 145 PHE A CB  
1116 C CG  . PHE A 148 ? 1.3235 0.8325 1.1300 -0.4796 0.1748  -0.2582 145 PHE A CG  
1117 C CD1 . PHE A 148 ? 1.2156 0.8406 1.0990 -0.4845 0.1388  -0.3091 145 PHE A CD1 
1118 C CD2 . PHE A 148 ? 1.3661 0.8148 1.1997 -0.5059 0.2281  -0.2456 145 PHE A CD2 
1119 C CE1 . PHE A 148 ? 1.2698 0.9520 1.2593 -0.5155 0.1529  -0.3526 145 PHE A CE1 
1120 C CE2 . PHE A 148 ? 1.3802 0.8810 1.3238 -0.5408 0.2469  -0.2869 145 PHE A CE2 
1121 C CZ  . PHE A 148 ? 1.3432 0.9623 1.3668 -0.5460 0.2080  -0.3434 145 PHE A CZ  
1122 N N   . ASP A 149 ? 1.4814 0.9789 1.2238 -0.4714 0.2552  -0.1737 146 ASP A N   
1123 C CA  . ASP A 149 ? 1.5938 1.0458 1.3375 -0.4983 0.3247  -0.1472 146 ASP A CA  
1124 C C   . ASP A 149 ? 1.6993 1.1558 1.5423 -0.5497 0.3593  -0.1823 146 ASP A C   
1125 O O   . ASP A 149 ? 1.7011 1.2568 1.6446 -0.5743 0.3505  -0.2298 146 ASP A O   
1126 C CB  . ASP A 149 ? 1.5670 1.0997 1.3272 -0.4878 0.3332  -0.1400 146 ASP A CB  
1127 C CG  . ASP A 149 ? 1.6846 1.1724 1.4336 -0.5098 0.4095  -0.1077 146 ASP A CG  
1128 O OD1 . ASP A 149 ? 1.7023 1.2067 1.5394 -0.5619 0.4530  -0.1327 146 ASP A OD1 
1129 O OD2 . ASP A 149 ? 1.7605 1.2021 1.4148 -0.4714 0.4269  -0.0596 146 ASP A OD2 
1130 N N   . PRO A 150 ? 1.7697 1.1365 1.5920 -0.5483 0.3907  -0.1589 147 PRO A N   
1131 C CA  . PRO A 150 ? 1.7764 1.1518 1.7002 -0.5816 0.4186  -0.1903 147 PRO A CA  
1132 C C   . PRO A 150 ? 1.7400 1.1550 1.7362 -0.6125 0.4728  -0.1966 147 PRO A C   
1133 O O   . PRO A 150 ? 1.7292 1.1824 1.8332 -0.6434 0.4888  -0.2395 147 PRO A O   
1134 C CB  . PRO A 150 ? 1.8732 1.1300 1.7376 -0.5656 0.4460  -0.1479 147 PRO A CB  
1135 C CG  . PRO A 150 ? 1.9170 1.1079 1.6502 -0.5246 0.4541  -0.0861 147 PRO A CG  
1136 C CD  . PRO A 150 ? 1.8281 1.0831 1.5328 -0.5105 0.4017  -0.1020 147 PRO A CD  
1137 N N   . MET A 151 ? 1.7259 1.1364 1.6652 -0.6013 0.5000  -0.1574 148 MET A N   
1138 C CA  . MET A 151 ? 1.7740 1.2202 1.7711 -0.6250 0.5539  -0.1582 148 MET A CA  
1139 C C   . MET A 151 ? 1.6914 1.2722 1.7865 -0.6453 0.5241  -0.2172 148 MET A C   
1140 O O   . MET A 151 ? 1.7070 1.3382 1.8918 -0.6723 0.5571  -0.2447 148 MET A O   
1141 C CB  . MET A 151 ? 1.8420 1.2358 1.7328 -0.5961 0.5934  -0.0919 148 MET A CB  
1142 C CG  . MET A 151 ? 1.9486 1.2183 1.7283 -0.5600 0.6109  -0.0326 148 MET A CG  
1143 S SD  . MET A 151 ? 2.3977 1.5928 2.2403 -0.5853 0.6563  -0.0342 148 MET A SD  
1144 C CE  . MET A 151 ? 2.0345 1.1167 1.7552 -0.5364 0.6326  0.0123  148 MET A CE  
1145 N N   . THR A 152 ? 1.6038 1.2428 1.6817 -0.6283 0.4604  -0.2369 149 THR A N   
1146 C CA  . THR A 152 ? 1.5006 1.2734 1.6676 -0.6358 0.4200  -0.2929 149 THR A CA  
1147 C C   . THR A 152 ? 1.3597 1.1842 1.5790 -0.6312 0.3590  -0.3466 149 THR A C   
1148 O O   . THR A 152 ? 1.2699 1.2029 1.5806 -0.6346 0.3288  -0.4021 149 THR A O   
1149 C CB  . THR A 152 ? 1.4741 1.2940 1.5908 -0.6128 0.3918  -0.2756 149 THR A CB  
1150 O OG1 . THR A 152 ? 1.4568 1.2404 1.4865 -0.5687 0.3379  -0.2541 149 THR A OG1 
1151 C CG2 . THR A 152 ? 1.5126 1.2889 1.5666 -0.6074 0.4499  -0.2217 149 THR A CG2 
1152 N N   . GLY A 153 ? 1.3508 1.0991 1.5066 -0.6165 0.3399  -0.3295 150 GLY A N   
1153 C CA  . GLY A 153 ? 1.3217 1.1131 1.5110 -0.6050 0.2830  -0.3748 150 GLY A CA  
1154 C C   . GLY A 153 ? 1.3012 1.1501 1.4461 -0.5693 0.2158  -0.3813 150 GLY A C   
1155 O O   . GLY A 153 ? 1.2767 1.1853 1.4481 -0.5509 0.1641  -0.4200 150 GLY A O   
1156 N N   . THR A 154 ? 1.2921 1.1239 1.3676 -0.5556 0.2173  -0.3427 151 THR A N   
1157 C CA  . THR A 154 ? 1.2316 1.1257 1.2691 -0.5020 0.1547  -0.3363 151 THR A CA  
1158 C C   . THR A 154 ? 1.1773 0.9924 1.0997 -0.4571 0.1466  -0.2762 151 THR A C   
1159 O O   . THR A 154 ? 1.2296 0.9523 1.0943 -0.4613 0.1874  -0.2367 151 THR A O   
1160 C CB  . THR A 154 ? 1.2481 1.2496 1.3413 -0.4930 0.1448  -0.3491 151 THR A CB  
1161 O OG1 . THR A 154 ? 1.2512 1.3163 1.3251 -0.4423 0.0847  -0.3492 151 THR A OG1 
1162 C CG2 . THR A 154 ? 1.2585 1.2255 1.3130 -0.4887 0.1871  -0.3019 151 THR A CG2 
1163 N N   . PHE A 155 ? 1.0834 0.9366 0.9752 -0.4112 0.0952  -0.2713 152 PHE A N   
1164 C CA  . PHE A 155 ? 1.1591 0.9530 0.9618 -0.3671 0.0848  -0.2252 152 PHE A CA  
1165 C C   . PHE A 155 ? 1.1702 0.9994 0.9708 -0.3430 0.0929  -0.2004 152 PHE A C   
1166 O O   . PHE A 155 ? 1.1056 1.0263 0.9619 -0.3330 0.0735  -0.2163 152 PHE A O   
1167 C CB  . PHE A 155 ? 1.1316 0.9441 0.9094 -0.3304 0.0349  -0.2308 152 PHE A CB  
1168 C CG  . PHE A 155 ? 1.2938 1.0744 1.0669 -0.3477 0.0234  -0.2580 152 PHE A CG  
1169 C CD1 . PHE A 155 ? 1.3870 1.0640 1.0968 -0.3477 0.0357  -0.2387 152 PHE A CD1 
1170 C CD2 . PHE A 155 ? 1.3261 1.1860 1.1614 -0.3604 -0.0021 -0.3082 152 PHE A CD2 
1171 C CE1 . PHE A 155 ? 1.4322 1.0822 1.1451 -0.3637 0.0248  -0.2682 152 PHE A CE1 
1172 C CE2 . PHE A 155 ? 1.3449 1.1843 1.1829 -0.3746 -0.0145 -0.3416 152 PHE A CE2 
1173 C CZ  . PHE A 155 ? 1.3900 1.1238 1.1699 -0.3766 0.0001  -0.3198 152 PHE A CZ  
1174 N N   . ARG A 156 ? 1.1484 0.9080 0.8859 -0.3297 0.1201  -0.1645 153 ARG A N   
1175 C CA  . ARG A 156 ? 1.0822 0.8757 0.8194 -0.3082 0.1325  -0.1477 153 ARG A CA  
1176 C C   . ARG A 156 ? 1.0238 0.7739 0.6930 -0.2586 0.1182  -0.1214 153 ARG A C   
1177 O O   . ARG A 156 ? 1.1191 0.7834 0.7194 -0.2493 0.1244  -0.1043 153 ARG A O   
1178 C CB  . ARG A 156 ? 1.1198 0.8915 0.8572 -0.3399 0.1882  -0.1378 153 ARG A CB  
1179 C CG  . ARG A 156 ? 1.1305 0.9597 0.9590 -0.3913 0.2077  -0.1725 153 ARG A CG  
1180 C CD  . ARG A 156 ? 1.1694 0.9506 0.9949 -0.4292 0.2750  -0.1586 153 ARG A CD  
1181 N NE  . ARG A 156 ? 1.1752 0.9783 0.9779 -0.4110 0.3022  -0.1359 153 ARG A NE  
1182 C CZ  . ARG A 156 ? 1.3600 1.1279 1.1462 -0.4329 0.3658  -0.1150 153 ARG A CZ  
1183 N NH1 . ARG A 156 ? 1.4695 1.1706 1.2674 -0.4769 0.4127  -0.1117 153 ARG A NH1 
1184 N NH2 . ARG A 156 ? 1.3587 1.1583 1.1197 -0.4096 0.3858  -0.0981 153 ARG A NH2 
1185 N N   . CYS A 157 ? 0.8747 0.6876 0.5736 -0.2263 0.0993  -0.1233 154 CYS A N   
1186 C CA  . CYS A 157 ? 0.8552 0.6475 0.5189 -0.1780 0.0844  -0.1109 154 CYS A CA  
1187 C C   . CYS A 157 ? 0.9640 0.6849 0.5493 -0.1629 0.1090  -0.0925 154 CYS A C   
1188 O O   . CYS A 157 ? 0.9133 0.6312 0.4835 -0.1782 0.1433  -0.0840 154 CYS A O   
1189 C CB  . CYS A 157 ? 0.7691 0.6464 0.4974 -0.1544 0.0744  -0.1206 154 CYS A CB  
1190 S SG  . CYS A 157 ? 0.8057 0.6755 0.5213 -0.0980 0.0640  -0.1194 154 CYS A SG  
1191 N N   . THR A 158 ? 1.0202 0.6841 0.5535 -0.1302 0.0930  -0.0864 155 THR A N   
1192 C CA  . THR A 158 ? 1.0615 0.6590 0.5129 -0.1064 0.1107  -0.0708 155 THR A CA  
1193 C C   . THR A 158 ? 1.0517 0.6978 0.5046 -0.0720 0.1185  -0.0757 155 THR A C   
1194 O O   . THR A 158 ? 1.1242 0.7323 0.5059 -0.0499 0.1383  -0.0620 155 THR A O   
1195 C CB  . THR A 158 ? 1.1542 0.6874 0.5563 -0.0744 0.0872  -0.0715 155 THR A CB  
1196 O OG1 . THR A 158 ? 1.1628 0.7369 0.6217 -0.0606 0.0565  -0.0890 155 THR A OG1 
1197 C CG2 . THR A 158 ? 1.2945 0.7442 0.6492 -0.1009 0.0949  -0.0590 155 THR A CG2 
1198 N N   . PHE A 159 ? 0.9383 0.6692 0.4706 -0.0628 0.1029  -0.0958 156 PHE A N   
1199 C CA  . PHE A 159 ? 0.9441 0.7306 0.4913 -0.0278 0.1066  -0.1101 156 PHE A CA  
1200 C C   . PHE A 159 ? 0.9754 0.8253 0.5583 -0.0530 0.1333  -0.1106 156 PHE A C   
1201 O O   . PHE A 159 ? 0.9994 0.8495 0.5341 -0.0409 0.1600  -0.1034 156 PHE A O   
1202 C CB  . PHE A 159 ? 0.8277 0.6644 0.4498 0.0045  0.0763  -0.1366 156 PHE A CB  
1203 C CG  . PHE A 159 ? 0.8305 0.6102 0.4265 0.0303  0.0552  -0.1409 156 PHE A CG  
1204 C CD1 . PHE A 159 ? 0.8985 0.6380 0.4293 0.0691  0.0526  -0.1487 156 PHE A CD1 
1205 C CD2 . PHE A 159 ? 0.8271 0.5943 0.4585 0.0185  0.0387  -0.1378 156 PHE A CD2 
1206 C CE1 . PHE A 159 ? 0.9156 0.6181 0.4473 0.0885  0.0320  -0.1535 156 PHE A CE1 
1207 C CE2 . PHE A 159 ? 0.8337 0.5484 0.4426 0.0400  0.0237  -0.1428 156 PHE A CE2 
1208 C CZ  . PHE A 159 ? 0.9403 0.6278 0.5103 0.0721  0.0201  -0.1511 156 PHE A CZ  
1209 N N   . CYS A 160 ? 0.8848 0.7902 0.5485 -0.0848 0.1273  -0.1195 157 CYS A N   
1210 C CA  . CYS A 160 ? 0.8149 0.7908 0.5261 -0.1067 0.1503  -0.1278 157 CYS A CA  
1211 C C   . CYS A 160 ? 0.8944 0.8535 0.6078 -0.1623 0.1778  -0.1180 157 CYS A C   
1212 O O   . CYS A 160 ? 0.8366 0.8483 0.5896 -0.1867 0.2037  -0.1259 157 CYS A O   
1213 C CB  . CYS A 160 ? 0.6910 0.7574 0.5064 -0.0964 0.1252  -0.1525 157 CYS A CB  
1214 S SG  . CYS A 160 ? 0.6894 0.7767 0.5689 -0.1236 0.0991  -0.1550 157 CYS A SG  
1215 N N   . HIS A 161 ? 1.0108 0.9002 0.6907 -0.1822 0.1731  -0.1065 158 HIS A N   
1216 C CA  . HIS A 161 ? 1.1159 0.9784 0.8036 -0.2353 0.2006  -0.1037 158 HIS A CA  
1217 C C   . HIS A 161 ? 0.9682 0.9149 0.7566 -0.2685 0.1888  -0.1335 158 HIS A C   
1218 O O   . HIS A 161 ? 0.9737 0.9205 0.7936 -0.3145 0.2144  -0.1439 158 HIS A O   
1219 C CB  . HIS A 161 ? 1.3439 1.1712 0.9852 -0.2508 0.2577  -0.0829 158 HIS A CB  
1220 C CG  . HIS A 161 ? 1.5282 1.2790 1.0618 -0.2094 0.2692  -0.0530 158 HIS A CG  
1221 N ND1 . HIS A 161 ? 1.6445 1.2947 1.1080 -0.2061 0.2699  -0.0321 158 HIS A ND1 
1222 C CD2 . HIS A 161 ? 1.5683 1.3338 1.0523 -0.1651 0.2782  -0.0449 158 HIS A CD2 
1223 C CE1 . HIS A 161 ? 1.7093 1.3138 1.0821 -0.1594 0.2776  -0.0104 158 HIS A CE1 
1224 N NE2 . HIS A 161 ? 1.6576 1.3335 1.0396 -0.1325 0.2820  -0.0191 158 HIS A NE2 
1225 N N   . THR A 162 ? 0.8383 0.8565 0.6817 -0.2426 0.1515  -0.1492 159 THR A N   
1226 C CA  . THR A 162 ? 0.7416 0.8406 0.6722 -0.2593 0.1289  -0.1765 159 THR A CA  
1227 C C   . THR A 162 ? 0.8022 0.8761 0.7280 -0.2708 0.1030  -0.1838 159 THR A C   
1228 O O   . THR A 162 ? 0.7524 0.7645 0.6216 -0.2493 0.0864  -0.1672 159 THR A O   
1229 C CB  . THR A 162 ? 0.7136 0.8838 0.6971 -0.2191 0.0979  -0.1834 159 THR A CB  
1230 O OG1 . THR A 162 ? 0.6553 0.8703 0.6633 -0.2126 0.1199  -0.1891 159 THR A OG1 
1231 C CG2 . THR A 162 ? 0.6282 0.8740 0.6868 -0.2226 0.0672  -0.2056 159 THR A CG2 
1232 N N   . GLU A 163 ? 0.7740 0.9029 0.7636 -0.3026 0.0987  -0.2145 160 GLU A N   
1233 C CA  . GLU A 163 ? 0.8258 0.9483 0.8177 -0.3113 0.0720  -0.2317 160 GLU A CA  
1234 C C   . GLU A 163 ? 0.7515 0.8939 0.7308 -0.2629 0.0258  -0.2220 160 GLU A C   
1235 O O   . GLU A 163 ? 0.6831 0.8969 0.7088 -0.2363 0.0052  -0.2257 160 GLU A O   
1236 C CB  . GLU A 163 ? 0.7731 0.9716 0.8506 -0.3483 0.0723  -0.2781 160 GLU A CB  
1237 C CG  . GLU A 163 ? 0.9707 1.1593 1.0525 -0.3647 0.0532  -0.3060 160 GLU A CG  
1238 C CD  . GLU A 163 ? 1.0623 1.3182 1.2382 -0.4090 0.0635  -0.3616 160 GLU A CD  
1239 O OE1 . GLU A 163 ? 1.0844 1.4046 1.3008 -0.4022 0.0243  -0.4031 160 GLU A OE1 
1240 O OE2 . GLU A 163 ? 1.1438 1.3916 1.3548 -0.4484 0.1124  -0.3662 160 GLU A OE2 
1241 N N   . VAL A 164 ? 0.8230 0.8982 0.7406 -0.2508 0.0137  -0.2078 161 VAL A N   
1242 C CA  . VAL A 164 ? 0.8617 0.9370 0.7555 -0.2048 -0.0191 -0.1913 161 VAL A CA  
1243 C C   . VAL A 164 ? 0.8590 1.0023 0.7830 -0.1948 -0.0543 -0.2146 161 VAL A C   
1244 O O   . VAL A 164 ? 0.7257 0.9024 0.6818 -0.2271 -0.0568 -0.2511 161 VAL A O   
1245 C CB  . VAL A 164 ? 1.0009 0.9788 0.8169 -0.1962 -0.0155 -0.1706 161 VAL A CB  
1246 C CG1 . VAL A 164 ? 1.0829 1.0550 0.8794 -0.1499 -0.0378 -0.1508 161 VAL A CG1 
1247 C CG2 . VAL A 164 ? 1.0008 0.9175 0.7808 -0.2013 0.0164  -0.1527 161 VAL A CG2 
1248 N N   . GLU A 165 ? 0.7998 0.9665 0.7174 -0.1472 -0.0791 -0.1956 162 GLU A N   
1249 C CA  . GLU A 165 ? 0.9244 1.1586 0.8552 -0.1227 -0.1142 -0.2112 162 GLU A CA  
1250 C C   . GLU A 165 ? 0.9870 1.1811 0.8530 -0.0872 -0.1299 -0.1887 162 GLU A C   
1251 O O   . GLU A 165 ? 0.8820 1.0109 0.7123 -0.0683 -0.1158 -0.1544 162 GLU A O   
1252 C CB  . GLU A 165 ? 0.9162 1.2310 0.9028 -0.0891 -0.1282 -0.2059 162 GLU A CB  
1253 C CG  . GLU A 165 ? 0.9536 1.3191 1.0109 -0.1185 -0.1133 -0.2292 162 GLU A CG  
1254 C CD  . GLU A 165 ? 0.9521 1.3764 1.0618 -0.0802 -0.1221 -0.2152 162 GLU A CD  
1255 O OE1 . GLU A 165 ? 0.8542 1.2647 0.9439 -0.0318 -0.1324 -0.1804 162 GLU A OE1 
1256 O OE2 . GLU A 165 ? 1.0263 1.5085 1.2014 -0.0986 -0.1152 -0.2388 162 GLU A OE2 
1257 N N   . GLU A 166 ? 1.1098 1.3505 0.9656 -0.0758 -0.1589 -0.2127 163 GLU A N   
1258 C CA  . GLU A 166 ? 1.2627 1.4820 1.0557 -0.0363 -0.1744 -0.1930 163 GLU A CA  
1259 C C   . GLU A 166 ? 1.3467 1.5788 1.1334 0.0221  -0.1757 -0.1465 163 GLU A C   
1260 O O   . GLU A 166 ? 1.3762 1.6685 1.2124 0.0409  -0.1818 -0.1423 163 GLU A O   
1261 C CB  . GLU A 166 ? 1.3877 1.6738 1.1752 -0.0305 -0.2083 -0.2362 163 GLU A CB  
1262 C CG  . GLU A 166 ? 1.5488 1.7895 1.2705 -0.0253 -0.2153 -0.2400 163 GLU A CG  
1263 C CD  . GLU A 166 ? 1.6722 1.8305 1.3863 -0.0794 -0.1926 -0.2553 163 GLU A CD  
1264 O OE1 . GLU A 166 ? 1.6898 1.8393 1.4513 -0.1244 -0.1735 -0.2724 163 GLU A OE1 
1265 O OE2 . GLU A 166 ? 1.7481 1.8492 1.4071 -0.0743 -0.1918 -0.2486 163 GLU A OE2 
1266 N N   . ASP A 167 ? 1.4267 1.6016 1.1575 0.0509  -0.1675 -0.1129 164 ASP A N   
1267 C CA  . ASP A 167 ? 1.4477 1.6253 1.1697 0.1088  -0.1615 -0.0654 164 ASP A CA  
1268 C C   . ASP A 167 ? 1.3964 1.5839 1.1867 0.1166  -0.1440 -0.0450 164 ASP A C   
1269 O O   . ASP A 167 ? 1.3676 1.5063 1.1699 0.1371  -0.1176 -0.0099 164 ASP A O   
1270 C CB  . ASP A 167 ? 1.4935 1.7482 1.1885 0.1549  -0.1928 -0.0675 164 ASP A CB  
1271 C CG  . ASP A 167 ? 1.5072 1.7472 1.1700 0.2199  -0.1795 -0.0092 164 ASP A CG  
1272 O OD1 . ASP A 167 ? 1.4545 1.6543 1.1549 0.2320  -0.1490 0.0289  164 ASP A OD1 
1273 O OD2 . ASP A 167 ? 1.5645 1.8338 1.1661 0.2608  -0.1967 -0.0025 164 ASP A OD2 
1274 N N   . THR A 178 ? 1.3537 1.2574 0.5303 0.1554  -0.1128 -0.2036 175 THR A N   
1275 C CA  . THR A 178 ? 1.3572 1.2055 0.5318 0.1730  -0.0819 -0.1621 175 THR A CA  
1276 C C   . THR A 178 ? 1.5084 1.3517 0.6322 0.2200  -0.0523 -0.1308 175 THR A C   
1277 O O   . THR A 178 ? 1.4041 1.2650 0.5068 0.2247  -0.0516 -0.1494 175 THR A O   
1278 C CB  . THR A 178 ? 1.3380 1.1232 0.5659 0.1343  -0.0742 -0.1768 175 THR A CB  
1279 O OG1 . THR A 178 ? 1.3514 1.1147 0.6133 0.1176  -0.0790 -0.1680 175 THR A OG1 
1280 C CG2 . THR A 178 ? 1.3002 1.0271 0.5182 0.1542  -0.0422 -0.1562 175 THR A CG2 
1281 N N   . LEU A 179 ? 1.0241 0.8680 0.8283 -0.1332 0.0873  0.0477  176 LEU A N   
1282 C CA  . LEU A 179 ? 0.9858 0.8655 0.7864 -0.1142 0.0550  0.0414  176 LEU A CA  
1283 C C   . LEU A 179 ? 0.9721 0.7994 0.7447 -0.0849 0.0535  0.0540  176 LEU A C   
1284 O O   . LEU A 179 ? 1.0231 0.8529 0.7935 -0.0816 0.0411  0.0399  176 LEU A O   
1285 C CB  . LEU A 179 ? 0.9491 0.8863 0.7502 -0.0938 0.0340  0.0543  176 LEU A CB  
1286 C CG  . LEU A 179 ? 0.9492 0.9339 0.7487 -0.0827 0.0103  0.0418  176 LEU A CG  
1287 C CD1 . LEU A 179 ? 0.9416 0.9776 0.7653 -0.1084 0.0059  0.0129  176 LEU A CD1 
1288 C CD2 . LEU A 179 ? 0.9186 0.9358 0.7051 -0.0589 0.0029  0.0592  176 LEU A CD2 
1289 N N   . LEU A 180 ? 0.8130 0.5996 0.5633 -0.0606 0.0669  0.0806  177 LEU A N   
1290 C CA  . LEU A 180 ? 0.8019 0.5594 0.5269 -0.0254 0.0645  0.0943  177 LEU A CA  
1291 C C   . LEU A 180 ? 0.8503 0.5503 0.5656 -0.0294 0.0853  0.0851  177 LEU A C   
1292 O O   . LEU A 180 ? 0.8768 0.5784 0.5866 -0.0120 0.0740  0.0807  177 LEU A O   
1293 C CB  . LEU A 180 ? 0.8447 0.5803 0.5426 0.0070  0.0760  0.1253  177 LEU A CB  
1294 C CG  . LEU A 180 ? 0.8452 0.5877 0.5196 0.0512  0.0656  0.1393  177 LEU A CG  
1295 C CD1 . LEU A 180 ? 0.8250 0.6304 0.5156 0.0496  0.0333  0.1209  177 LEU A CD1 
1296 C CD2 . LEU A 180 ? 0.8071 0.5498 0.4526 0.0850  0.0712  0.1676  177 LEU A CD2 
1297 N N   . ALA A 181 ? 0.7949 0.4393 0.5057 -0.0540 0.1210  0.0810  178 ALA A N   
1298 C CA  . ALA A 181 ? 0.8422 0.4174 0.5370 -0.0643 0.1505  0.0689  178 ALA A CA  
1299 C C   . ALA A 181 ? 0.9076 0.5184 0.6244 -0.0911 0.1292  0.0347  178 ALA A C   
1300 O O   . ALA A 181 ? 1.0247 0.6014 0.7258 -0.0778 0.1337  0.0311  178 ALA A O   
1301 C CB  . ALA A 181 ? 0.9211 0.4278 0.6066 -0.0981 0.2003  0.0627  178 ALA A CB  
1302 N N   . ARG A 182 ? 0.8899 0.5716 0.6391 -0.1230 0.1073  0.0116  179 ARG A N   
1303 C CA  . ARG A 182 ? 0.9285 0.6538 0.6918 -0.1400 0.0843  -0.0187 179 ARG A CA  
1304 C C   . ARG A 182 ? 0.9166 0.6576 0.6699 -0.1023 0.0576  -0.0084 179 ARG A C   
1305 O O   . ARG A 182 ? 0.9001 0.6224 0.6452 -0.1015 0.0563  -0.0226 179 ARG A O   
1306 C CB  . ARG A 182 ? 0.8774 0.6926 0.6713 -0.1640 0.0628  -0.0377 179 ARG A CB  
1307 C CG  . ARG A 182 ? 0.9718 0.8033 0.7877 -0.2158 0.0842  -0.0684 179 ARG A CG  
1308 C CD  . ARG A 182 ? 1.0244 0.9613 0.8659 -0.2329 0.0552  -0.0989 179 ARG A CD  
1309 N NE  . ARG A 182 ? 1.0626 0.9956 0.8917 -0.2377 0.0455  -0.1238 179 ARG A NE  
1310 C CZ  . ARG A 182 ? 1.0719 1.0624 0.9152 -0.2739 0.0407  -0.1664 179 ARG A CZ  
1311 N NH1 . ARG A 182 ? 1.0544 1.1240 0.9309 -0.3103 0.0434  -0.1915 179 ARG A NH1 
1312 N NH2 . ARG A 182 ? 1.0346 1.0117 0.8592 -0.2738 0.0330  -0.1862 179 ARG A NH2 
1313 N N   . PHE A 183 ? 0.8385 0.6137 0.5919 -0.0754 0.0400  0.0132  180 PHE A N   
1314 C CA  . PHE A 183 ? 0.7760 0.5724 0.5224 -0.0467 0.0202  0.0189  180 PHE A CA  
1315 C C   . PHE A 183 ? 0.8326 0.5845 0.5638 -0.0243 0.0313  0.0256  180 PHE A C   
1316 O O   . PHE A 183 ? 0.7576 0.5126 0.4878 -0.0181 0.0237  0.0135  180 PHE A O   
1317 C CB  . PHE A 183 ? 0.7374 0.5667 0.4816 -0.0285 0.0099  0.0383  180 PHE A CB  
1318 C CG  . PHE A 183 ? 0.6796 0.5306 0.4165 -0.0060 -0.0029 0.0394  180 PHE A CG  
1319 C CD1 . PHE A 183 ? 0.7166 0.5943 0.4528 -0.0097 -0.0134 0.0248  180 PHE A CD1 
1320 C CD2 . PHE A 183 ? 0.6795 0.5281 0.4074 0.0197  -0.0007 0.0535  180 PHE A CD2 
1321 C CE1 . PHE A 183 ? 0.6760 0.5699 0.4061 0.0024  -0.0171 0.0199  180 PHE A CE1 
1322 C CE2 . PHE A 183 ? 0.6304 0.5157 0.3580 0.0331  -0.0114 0.0467  180 PHE A CE2 
1323 C CZ  . PHE A 183 ? 0.5666 0.4710 0.2969 0.0197  -0.0174 0.0279  180 PHE A CZ  
1324 N N   . ASN A 184 ? 0.8361 0.5460 0.5518 -0.0074 0.0526  0.0469  181 ASN A N   
1325 C CA  . ASN A 184 ? 0.8602 0.5312 0.5552 0.0262  0.0673  0.0599  181 ASN A CA  
1326 C C   . ASN A 184 ? 0.9127 0.5295 0.5996 0.0109  0.0861  0.0420  181 ASN A C   
1327 O O   . ASN A 184 ? 0.9036 0.5099 0.5816 0.0362  0.0879  0.0441  181 ASN A O   
1328 C CB  . ASN A 184 ? 0.8244 0.4523 0.4923 0.0548  0.0935  0.0905  181 ASN A CB  
1329 C CG  . ASN A 184 ? 0.8472 0.5336 0.5137 0.0865  0.0732  0.1101  181 ASN A CG  
1330 O OD1 . ASN A 184 ? 0.8540 0.6031 0.5327 0.1005  0.0472  0.1036  181 ASN A OD1 
1331 N ND2 . ASN A 184 ? 0.8700 0.5359 0.5199 0.0945  0.0881  0.1309  181 ASN A ND2 
1332 N N   . GLU A 185 ? 0.9306 0.5178 0.6208 -0.0317 0.1020  0.0219  182 GLU A N   
1333 C CA  . GLU A 185 ? 1.0653 0.6053 0.7460 -0.0557 0.1199  -0.0032 182 GLU A CA  
1334 C C   . GLU A 185 ? 0.9630 0.5529 0.6577 -0.0577 0.0885  -0.0235 182 GLU A C   
1335 O O   . GLU A 185 ? 0.9577 0.5172 0.6391 -0.0443 0.0951  -0.0279 182 GLU A O   
1336 C CB  . GLU A 185 ? 1.2501 0.7705 0.9368 -0.1103 0.1410  -0.0304 182 GLU A CB  
1337 C CG  . GLU A 185 ? 1.4937 0.9382 1.1587 -0.1167 0.1880  -0.0161 182 GLU A CG  
1338 C CD  . GLU A 185 ? 1.6457 1.0823 1.3239 -0.1820 0.2124  -0.0525 182 GLU A CD  
1339 O OE1 . GLU A 185 ? 1.5859 1.1103 1.3011 -0.2083 0.1841  -0.0689 182 GLU A OE1 
1340 O OE2 . GLU A 185 ? 1.8083 1.1528 1.4585 -0.2075 0.2634  -0.0666 182 GLU A OE2 
1341 N N   . GLN A 186 ? 0.8634 0.5249 0.5796 -0.0699 0.0585  -0.0332 183 GLN A N   
1342 C CA  . GLN A 186 ? 0.8360 0.5354 0.5561 -0.0722 0.0363  -0.0529 183 GLN A CA  
1343 C C   . GLN A 186 ? 0.8022 0.5154 0.5199 -0.0382 0.0246  -0.0414 183 GLN A C   
1344 O O   . GLN A 186 ? 0.7751 0.4905 0.4872 -0.0358 0.0188  -0.0560 183 GLN A O   
1345 C CB  . GLN A 186 ? 0.7844 0.5516 0.5190 -0.0883 0.0152  -0.0636 183 GLN A CB  
1346 C CG  . GLN A 186 ? 0.8425 0.6194 0.5878 -0.1280 0.0251  -0.0845 183 GLN A CG  
1347 C CD  . GLN A 186 ? 0.8086 0.6702 0.5692 -0.1362 0.0030  -0.0949 183 GLN A CD  
1348 O OE1 . GLN A 186 ? 0.7227 0.6209 0.4767 -0.1093 -0.0158 -0.0853 183 GLN A OE1 
1349 N NE2 . GLN A 186 ? 0.8872 0.7807 0.6661 -0.1723 0.0099  -0.1151 183 GLN A NE2 
1350 N N   . ILE A 187 ? 0.7044 0.4305 0.4256 -0.0136 0.0232  -0.0182 184 ILE A N   
1351 C CA  . ILE A 187 ? 0.6693 0.4282 0.3947 0.0106  0.0127  -0.0145 184 ILE A CA  
1352 C C   . ILE A 187 ? 0.7240 0.4617 0.4443 0.0393  0.0252  -0.0059 184 ILE A C   
1353 O O   . ILE A 187 ? 0.7632 0.5342 0.4921 0.0548  0.0191  -0.0108 184 ILE A O   
1354 C CB  . ILE A 187 ? 0.7278 0.5332 0.4604 0.0179  0.0015  -0.0012 184 ILE A CB  
1355 C CG1 . ILE A 187 ? 0.7890 0.6239 0.5217 0.0034  -0.0093 -0.0138 184 ILE A CG1 
1356 C CG2 . ILE A 187 ? 0.7801 0.6186 0.5171 0.0443  -0.0012 0.0064  184 ILE A CG2 
1357 C CD1 . ILE A 187 ? 0.7830 0.6190 0.5106 0.0054  -0.0085 -0.0315 184 ILE A CD1 
1358 N N   . GLU A 188 ? 0.8290 0.5097 0.5332 0.0468  0.0477  0.0056  185 GLU A N   
1359 C CA  . GLU A 188 ? 0.9065 0.5653 0.5981 0.0858  0.0646  0.0209  185 GLU A CA  
1360 C C   . GLU A 188 ? 0.8862 0.5488 0.5827 0.0918  0.0636  0.0049  185 GLU A C   
1361 O O   . GLU A 188 ? 0.8916 0.5904 0.5953 0.1263  0.0629  0.0133  185 GLU A O   
1362 C CB  . GLU A 188 ? 1.0224 0.5933 0.6823 0.0917  0.1013  0.0352  185 GLU A CB  
1363 C CG  . GLU A 188 ? 1.2321 0.7674 0.8683 0.1399  0.1264  0.0544  185 GLU A CG  
1364 C CD  . GLU A 188 ? 1.4327 1.0221 1.0668 0.1939  0.1207  0.0844  185 GLU A CD  
1365 O OE1 . GLU A 188 ? 1.4469 1.0775 1.0901 0.1890  0.1043  0.0914  185 GLU A OE1 
1366 O OE2 . GLU A 188 ? 1.4909 1.0895 1.1139 0.2432  0.1318  0.1001  185 GLU A OE2 
1367 N N   . PRO A 189 ? 0.8587 0.4925 0.5511 0.0603  0.0635  -0.0192 186 PRO A N   
1368 C CA  . PRO A 189 ? 0.8107 0.4483 0.5054 0.0676  0.0634  -0.0335 186 PRO A CA  
1369 C C   . PRO A 189 ? 0.7532 0.4661 0.4727 0.0779  0.0459  -0.0380 186 PRO A C   
1370 O O   . PRO A 189 ? 0.7942 0.5252 0.5224 0.0985  0.0519  -0.0406 186 PRO A O   
1371 C CB  . PRO A 189 ? 0.8150 0.4265 0.4984 0.0316  0.0599  -0.0594 186 PRO A CB  
1372 C CG  . PRO A 189 ? 0.8915 0.4643 0.5632 0.0074  0.0708  -0.0602 186 PRO A CG  
1373 C CD  . PRO A 189 ? 0.8775 0.4771 0.5606 0.0204  0.0670  -0.0359 186 PRO A CD  
1374 N N   . ILE A 190 ? 0.6458 0.4013 0.3757 0.0624  0.0294  -0.0409 187 ILE A N   
1375 C CA  . ILE A 190 ? 0.6647 0.4811 0.4125 0.0638  0.0218  -0.0510 187 ILE A CA  
1376 C C   . ILE A 190 ? 0.6870 0.5612 0.4526 0.0917  0.0195  -0.0391 187 ILE A C   
1377 O O   . ILE A 190 ? 0.6862 0.6111 0.4709 0.0997  0.0213  -0.0520 187 ILE A O   
1378 C CB  . ILE A 190 ? 0.7002 0.5363 0.4451 0.0417  0.0122  -0.0566 187 ILE A CB  
1379 C CG1 . ILE A 190 ? 0.7041 0.5007 0.4285 0.0240  0.0117  -0.0649 187 ILE A CG1 
1380 C CG2 . ILE A 190 ? 0.6176 0.4980 0.3726 0.0359  0.0163  -0.0736 187 ILE A CG2 
1381 C CD1 . ILE A 190 ? 0.7188 0.4859 0.4311 0.0243  0.0210  -0.0810 187 ILE A CD1 
1382 N N   . TYR A 191 ? 0.6797 0.5530 0.4383 0.1071  0.0170  -0.0163 188 TYR A N   
1383 C CA  . TYR A 191 ? 0.6332 0.5645 0.3995 0.1450  0.0147  -0.0008 188 TYR A CA  
1384 C C   . TYR A 191 ? 0.6751 0.6108 0.4440 0.1797  0.0276  0.0031  188 TYR A C   
1385 O O   . TYR A 191 ? 0.6777 0.6991 0.4689 0.2025  0.0218  -0.0027 188 TYR A O   
1386 C CB  . TYR A 191 ? 0.6355 0.5370 0.3795 0.1644  0.0194  0.0286  188 TYR A CB  
1387 C CG  . TYR A 191 ? 0.6203 0.5432 0.3649 0.1439  0.0059  0.0303  188 TYR A CG  
1388 C CD1 . TYR A 191 ? 0.6150 0.5963 0.3772 0.1193  -0.0090 0.0088  188 TYR A CD1 
1389 C CD2 . TYR A 191 ? 0.6789 0.5544 0.4020 0.1483  0.0149  0.0530  188 TYR A CD2 
1390 C CE1 . TYR A 191 ? 0.6457 0.6385 0.4027 0.1029  -0.0170 0.0121  188 TYR A CE1 
1391 C CE2 . TYR A 191 ? 0.7287 0.6222 0.4518 0.1319  0.0048  0.0562  188 TYR A CE2 
1392 C CZ  . TYR A 191 ? 0.7065 0.6590 0.4459 0.1108  -0.0123 0.0368  188 TYR A CZ  
1393 O OH  . TYR A 191 ? 0.6848 0.6477 0.4188 0.0970  -0.0183 0.0417  188 TYR A OH  
1394 N N   . ALA A 192 ? 0.7397 0.5881 0.4858 0.1823  0.0470  0.0101  189 ALA A N   
1395 C CA  . ALA A 192 ? 0.8313 0.6668 0.5723 0.2174  0.0653  0.0165  189 ALA A CA  
1396 C C   . ALA A 192 ? 0.8194 0.7095 0.5909 0.2064  0.0596  -0.0108 189 ALA A C   
1397 O O   . ALA A 192 ? 0.8382 0.7939 0.6282 0.2402  0.0624  -0.0094 189 ALA A O   
1398 C CB  . ALA A 192 ? 0.8198 0.5378 0.5244 0.2112  0.0922  0.0228  189 ALA A CB  
1399 N N   . LEU A 193 ? 0.8120 0.6786 0.5867 0.1621  0.0545  -0.0357 190 LEU A N   
1400 C CA  . LEU A 193 ? 0.7228 0.6266 0.5196 0.1492  0.0574  -0.0623 190 LEU A CA  
1401 C C   . LEU A 193 ? 0.6604 0.6748 0.4930 0.1463  0.0466  -0.0774 190 LEU A C   
1402 O O   . LEU A 193 ? 0.6545 0.7282 0.5143 0.1501  0.0539  -0.0959 190 LEU A O   
1403 C CB  . LEU A 193 ? 0.6273 0.4751 0.4075 0.1100  0.0591  -0.0817 190 LEU A CB  
1404 C CG  . LEU A 193 ? 0.7044 0.4610 0.4526 0.1069  0.0703  -0.0799 190 LEU A CG  
1405 C CD1 . LEU A 193 ? 0.6954 0.4189 0.4232 0.0751  0.0647  -0.0952 190 LEU A CD1 
1406 C CD2 . LEU A 193 ? 0.7492 0.4897 0.4983 0.1250  0.0891  -0.0860 190 LEU A CD2 
1407 N N   . LEU A 194 ? 0.6504 0.6949 0.4830 0.1358  0.0317  -0.0732 191 LEU A N   
1408 C CA  . LEU A 194 ? 0.6880 0.8407 0.5501 0.1300  0.0222  -0.0909 191 LEU A CA  
1409 C C   . LEU A 194 ? 0.7689 1.0149 0.6542 0.1765  0.0186  -0.0831 191 LEU A C   
1410 O O   . LEU A 194 ? 0.7067 1.0464 0.6277 0.1718  0.0208  -0.1107 191 LEU A O   
1411 C CB  . LEU A 194 ? 0.6516 0.8104 0.5015 0.1173  0.0081  -0.0823 191 LEU A CB  
1412 C CG  . LEU A 194 ? 0.6469 0.7595 0.4829 0.0718  0.0134  -0.0994 191 LEU A CG  
1413 C CD1 . LEU A 194 ? 0.6052 0.7269 0.4292 0.0632  0.0017  -0.0893 191 LEU A CD1 
1414 C CD2 . LEU A 194 ? 0.5795 0.7314 0.4334 0.0417  0.0296  -0.1377 191 LEU A CD2 
1415 N N   . ARG A 195 ? 0.8469 1.0676 0.7090 0.2231  0.0172  -0.0461 192 ARG A N   
1416 C CA  . ARG A 195 ? 0.7885 1.0888 0.6592 0.2839  0.0176  -0.0289 192 ARG A CA  
1417 C C   . ARG A 195 ? 0.8182 1.1396 0.7102 0.2989  0.0327  -0.0404 192 ARG A C   
1418 O O   . ARG A 195 ? 0.7889 1.2355 0.7152 0.3252  0.0278  -0.0520 192 ARG A O   
1419 C CB  . ARG A 195 ? 0.7758 1.0012 0.6002 0.3340  0.0282  0.0178  192 ARG A CB  
1420 C CG  . ARG A 195 ? 0.8647 1.1546 0.6839 0.4109  0.0367  0.0433  192 ARG A CG  
1421 C CD  . ARG A 195 ? 1.0188 1.2763 0.7903 0.4651  0.0443  0.0874  192 ARG A CD  
1422 N NE  . ARG A 195 ? 1.0696 1.4410 0.8391 0.5456  0.0427  0.1088  192 ARG A NE  
1423 C CZ  . ARG A 195 ? 1.2164 1.6021 0.9797 0.6034  0.0629  0.1255  192 ARG A CZ  
1424 N NH1 . ARG A 195 ? 1.2532 1.7375 1.0025 0.6500  0.0606  0.1393  192 ARG A NH1 
1425 N NH2 . ARG A 195 ? 1.3267 1.6094 1.0833 0.5864  0.0881  0.1226  192 ARG A NH2 
1426 N N   . GLU A 196 ? 0.9025 1.1092 0.7745 0.2819  0.0510  -0.0394 193 GLU A N   
1427 C CA  . GLU A 196 ? 0.9256 1.1325 0.8116 0.2937  0.0693  -0.0494 193 GLU A CA  
1428 C C   . GLU A 196 ? 0.9418 1.2534 0.8791 0.2613  0.0668  -0.0928 193 GLU A C   
1429 O O   . GLU A 196 ? 0.9895 1.3622 0.9544 0.2829  0.0781  -0.1023 193 GLU A O   
1430 C CB  . GLU A 196 ? 0.9656 1.0294 0.8168 0.2692  0.0871  -0.0483 193 GLU A CB  
1431 C CG  . GLU A 196 ? 1.1032 1.0563 0.9041 0.2979  0.1032  -0.0134 193 GLU A CG  
1432 C CD  . GLU A 196 ? 1.2300 1.0609 0.9999 0.2690  0.1209  -0.0221 193 GLU A CD  
1433 O OE1 . GLU A 196 ? 1.1961 1.0292 0.9790 0.2576  0.1289  -0.0428 193 GLU A OE1 
1434 O OE2 . GLU A 196 ? 1.2809 1.0180 1.0130 0.2557  0.1283  -0.0114 193 GLU A OE2 
1435 N N   . THR A 197 ? 0.9469 1.2756 0.8946 0.2087  0.0575  -0.1200 194 THR A N   
1436 C CA  . THR A 197 ? 0.9448 1.3471 0.9319 0.1659  0.0667  -0.1663 194 THR A CA  
1437 C C   . THR A 197 ? 0.9456 1.5135 0.9774 0.1679  0.0525  -0.1897 194 THR A C   
1438 O O   . THR A 197 ? 0.9694 1.6137 1.0385 0.1267  0.0644  -0.2352 194 THR A O   
1439 C CB  . THR A 197 ? 0.9647 1.2884 0.9302 0.1075  0.0747  -0.1862 194 THR A CB  
1440 O OG1 . THR A 197 ? 0.9117 1.2288 0.8582 0.1018  0.0552  -0.1719 194 THR A OG1 
1441 C CG2 . THR A 197 ? 1.0285 1.2142 0.9541 0.1029  0.0888  -0.1733 194 THR A CG2 
1442 N N   . GLU A 198 ? 0.9639 1.5887 0.9890 0.2151  0.0307  -0.1612 195 GLU A N   
1443 C CA  . GLU A 198 ? 0.9879 1.7720 1.0455 0.2161  0.0113  -0.1834 195 GLU A CA  
1444 C C   . GLU A 198 ? 0.9949 1.9474 1.1120 0.2248  0.0136  -0.2190 195 GLU A C   
1445 O O   . GLU A 198 ? 1.0551 2.1638 1.2021 0.2299  -0.0048 -0.2410 195 GLU A O   
1446 C CB  . GLU A 198 ? 1.0285 1.8296 1.0557 0.2776  -0.0099 -0.1385 195 GLU A CB  
1447 C CG  . GLU A 198 ? 1.0658 1.7763 1.0539 0.2518  -0.0188 -0.1236 195 GLU A CG  
1448 C CD  . GLU A 198 ? 1.1567 1.8839 1.1123 0.3116  -0.0343 -0.0811 195 GLU A CD  
1449 O OE1 . GLU A 198 ? 1.2710 2.0332 1.2178 0.3822  -0.0317 -0.0508 195 GLU A OE1 
1450 O OE2 . GLU A 198 ? 1.0919 1.7930 1.0260 0.2919  -0.0450 -0.0762 195 GLU A OE2 
1451 N N   . ASP A 199 ? 0.9735 1.9044 1.1088 0.2257  0.0362  -0.2274 196 ASP A N   
1452 C CA  . ASP A 199 ? 0.9455 2.0421 1.1436 0.2307  0.0420  -0.2644 196 ASP A CA  
1453 C C   . ASP A 199 ? 0.8857 1.9721 1.1157 0.1525  0.0729  -0.3209 196 ASP A C   
1454 O O   . ASP A 199 ? 0.8428 1.7756 1.0424 0.1265  0.0971  -0.3153 196 ASP A O   
1455 C CB  . ASP A 199 ? 1.0269 2.1214 1.2196 0.3062  0.0469  -0.2245 196 ASP A CB  
1456 C CG  . ASP A 199 ? 1.1101 2.0202 1.2638 0.3074  0.0736  -0.1997 196 ASP A CG  
1457 O OD1 . ASP A 199 ? 1.1923 1.9661 1.2882 0.3281  0.0702  -0.1569 196 ASP A OD1 
1458 O OD2 . ASP A 199 ? 1.0893 1.9870 1.2668 0.2833  0.0985  -0.2246 196 ASP A OD2 
1459 N N   . LYS B 6   ? 0.8746 0.9532 0.5459 -0.1867 -0.0391 0.2096  142 LYS B N   
1460 C CA  . LYS B 6   ? 0.8936 0.9662 0.6143 -0.1691 -0.0244 0.1987  142 LYS B CA  
1461 C C   . LYS B 6   ? 0.8126 0.9382 0.5727 -0.1499 0.0218  0.1527  142 LYS B C   
1462 O O   . LYS B 6   ? 0.7964 0.9441 0.5744 -0.1594 0.0464  0.1422  142 LYS B O   
1463 C CB  . LYS B 6   ? 0.9201 0.9421 0.6883 -0.1267 -0.0606 0.2020  142 LYS B CB  
1464 C CG  . LYS B 6   ? 0.8728 0.8855 0.6892 -0.1061 -0.0488 0.1859  142 LYS B CG  
1465 C CD  . LYS B 6   ? 0.8958 0.8844 0.6906 -0.1438 -0.0541 0.2127  142 LYS B CD  
1466 C CE  . LYS B 6   ? 0.8314 0.8239 0.6717 -0.1288 -0.0364 0.1920  142 LYS B CE  
1467 N NZ  . LYS B 6   ? 0.7807 0.7340 0.6634 -0.0831 -0.0608 0.1773  142 LYS B NZ  
1468 N N   . TYR B 7   ? 0.6964 0.8389 0.4728 -0.1242 0.0277  0.1269  143 TYR B N   
1469 C CA  . TYR B 7   ? 0.6512 0.8319 0.4561 -0.1099 0.0609  0.0860  143 TYR B CA  
1470 C C   . TYR B 7   ? 0.6995 0.9075 0.4750 -0.1178 0.0688  0.0661  143 TYR B C   
1471 O O   . TYR B 7   ? 0.7328 0.9272 0.4840 -0.1201 0.0455  0.0804  143 TYR B O   
1472 C CB  . TYR B 7   ? 0.6064 0.7712 0.4641 -0.0722 0.0566  0.0713  143 TYR B CB  
1473 C CG  . TYR B 7   ? 0.6100 0.7509 0.4975 -0.0609 0.0510  0.0802  143 TYR B CG  
1474 C CD1 . TYR B 7   ? 0.6064 0.7612 0.5166 -0.0632 0.0702  0.0668  143 TYR B CD1 
1475 C CD2 . TYR B 7   ? 0.6216 0.7285 0.5194 -0.0454 0.0234  0.0969  143 TYR B CD2 
1476 C CE1 . TYR B 7   ? 0.5978 0.7284 0.5322 -0.0548 0.0616  0.0740  143 TYR B CE1 
1477 C CE2 . TYR B 7   ? 0.7070 0.7894 0.6292 -0.0341 0.0162  0.0990  143 TYR B CE2 
1478 C CZ  . TYR B 7   ? 0.6352 0.7273 0.5715 -0.0411 0.0352  0.0895  143 TYR B CZ  
1479 O OH  . TYR B 7   ? 0.6267 0.6915 0.5832 -0.0320 0.0241  0.0914  143 TYR B OH  
1480 N N   . ASN B 8   ? 0.7277 0.9742 0.5103 -0.1194 0.0981  0.0287  144 ASN B N   
1481 C CA  . ASN B 8   ? 0.7833 1.0493 0.5448 -0.1214 0.1035  -0.0008 144 ASN B CA  
1482 C C   . ASN B 8   ? 0.7362 0.9850 0.5414 -0.0897 0.0977  -0.0255 144 ASN B C   
1483 O O   . ASN B 8   ? 0.7488 1.0062 0.5914 -0.0737 0.1112  -0.0564 144 ASN B O   
1484 C CB  . ASN B 8   ? 0.8538 1.1576 0.6154 -0.1333 0.1273  -0.0336 144 ASN B CB  
1485 C CG  . ASN B 8   ? 1.0010 1.3222 0.7499 -0.1292 0.1319  -0.0749 144 ASN B CG  
1486 O OD1 . ASN B 8   ? 0.9861 1.2877 0.7164 -0.1244 0.1150  -0.0745 144 ASN B OD1 
1487 N ND2 . ASN B 8   ? 1.0788 1.4406 0.8393 -0.1323 0.1531  -0.1127 144 ASN B ND2 
1488 N N   . VAL B 9   ? 0.7521 0.9762 0.5565 -0.0825 0.0734  -0.0101 145 VAL B N   
1489 C CA  . VAL B 9   ? 0.6264 0.8323 0.4665 -0.0631 0.0643  -0.0249 145 VAL B CA  
1490 C C   . VAL B 9   ? 0.6860 0.8911 0.5037 -0.0720 0.0484  -0.0332 145 VAL B C   
1491 O O   . VAL B 9   ? 0.6408 0.8448 0.4525 -0.0764 0.0285  -0.0098 145 VAL B O   
1492 C CB  . VAL B 9   ? 0.5688 0.7574 0.4420 -0.0487 0.0527  -0.0006 145 VAL B CB  
1493 C CG1 . VAL B 9   ? 0.5540 0.7289 0.4545 -0.0402 0.0458  -0.0114 145 VAL B CG1 
1494 C CG2 . VAL B 9   ? 0.4091 0.5938 0.2989 -0.0423 0.0638  0.0076  145 VAL B CG2 
1495 N N   . ARG B 10  ? 0.7493 0.9562 0.5598 -0.0729 0.0541  -0.0707 146 ARG B N   
1496 C CA  . ARG B 10  ? 0.9242 1.1280 0.7072 -0.0846 0.0382  -0.0857 146 ARG B CA  
1497 C C   . ARG B 10  ? 0.8736 1.0524 0.6837 -0.0827 0.0140  -0.0757 146 ARG B C   
1498 O O   . ARG B 10  ? 0.8707 1.0550 0.6663 -0.0962 -0.0052 -0.0636 146 ARG B O   
1499 C CB  . ARG B 10  ? 0.9981 1.2088 0.7712 -0.0818 0.0501  -0.1388 146 ARG B CB  
1500 C CG  . ARG B 10  ? 1.0553 1.2547 0.7997 -0.0926 0.0308  -0.1641 146 ARG B CG  
1501 C CD  . ARG B 10  ? 1.0683 1.2704 0.8153 -0.0807 0.0401  -0.2281 146 ARG B CD  
1502 N NE  . ARG B 10  ? 1.2665 1.4970 0.9539 -0.0998 0.0444  -0.2576 146 ARG B NE  
1503 C CZ  . ARG B 10  ? 1.3257 1.5939 1.0049 -0.0978 0.0708  -0.2893 146 ARG B CZ  
1504 N NH1 . ARG B 10  ? 1.3399 1.6325 1.0641 -0.0797 0.0950  -0.3045 146 ARG B NH1 
1505 N NH2 . ARG B 10  ? 1.3724 1.6550 1.0065 -0.1144 0.0705  -0.3011 146 ARG B NH2 
1506 N N   . ASP B 11  ? 0.7353 0.8900 0.5835 -0.0704 0.0130  -0.0788 147 ASP B N   
1507 C CA  . ASP B 11  ? 0.5887 0.7194 0.4551 -0.0787 -0.0089 -0.0713 147 ASP B CA  
1508 C C   . ASP B 11  ? 0.6202 0.7356 0.5185 -0.0714 -0.0072 -0.0543 147 ASP B C   
1509 O O   . ASP B 11  ? 0.5071 0.6307 0.4163 -0.0568 0.0094  -0.0488 147 ASP B O   
1510 C CB  . ASP B 11  ? 0.6619 0.7573 0.5208 -0.0826 -0.0261 -0.1067 147 ASP B CB  
1511 C CG  . ASP B 11  ? 0.8073 0.8911 0.6757 -0.0605 -0.0144 -0.1466 147 ASP B CG  
1512 O OD1 . ASP B 11  ? 0.7670 0.8467 0.6637 -0.0450 -0.0050 -0.1409 147 ASP B OD1 
1513 O OD2 . ASP B 11  ? 0.9497 1.0344 0.8006 -0.0578 -0.0151 -0.1884 147 ASP B OD2 
1514 N N   . LYS B 12  ? 0.5884 0.6810 0.4966 -0.0871 -0.0266 -0.0450 148 LYS B N   
1515 C CA  . LYS B 12  ? 0.5756 0.6530 0.5010 -0.0901 -0.0290 -0.0260 148 LYS B CA  
1516 C C   . LYS B 12  ? 0.6551 0.6967 0.5921 -0.0691 -0.0287 -0.0418 148 LYS B C   
1517 O O   . LYS B 12  ? 0.6532 0.7015 0.6014 -0.0593 -0.0177 -0.0296 148 LYS B O   
1518 C CB  . LYS B 12  ? 0.5706 0.6239 0.4930 -0.1219 -0.0546 -0.0129 148 LYS B CB  
1519 C CG  . LYS B 12  ? 0.6478 0.6831 0.5737 -0.1358 -0.0607 0.0103  148 LYS B CG  
1520 C CD  . LYS B 12  ? 0.7397 0.7475 0.6538 -0.1785 -0.0893 0.0284  148 LYS B CD  
1521 C CE  . LYS B 12  ? 0.7918 0.7198 0.6994 -0.1785 -0.1256 0.0086  148 LYS B CE  
1522 N NZ  . LYS B 12  ? 0.9261 0.8230 0.8188 -0.2276 -0.1588 0.0300  148 LYS B NZ  
1523 N N   . LYS B 13  ? 0.6564 0.6621 0.5952 -0.0607 -0.0439 -0.0736 149 LYS B N   
1524 C CA  . LYS B 13  ? 0.6655 0.6411 0.6289 -0.0362 -0.0505 -0.0982 149 LYS B CA  
1525 C C   . LYS B 13  ? 0.6546 0.6768 0.6301 -0.0156 -0.0176 -0.1073 149 LYS B C   
1526 O O   . LYS B 13  ? 0.5985 0.6136 0.5979 -0.0024 -0.0175 -0.1039 149 LYS B O   
1527 C CB  . LYS B 13  ? 0.7270 0.6665 0.6964 -0.0258 -0.0726 -0.1427 149 LYS B CB  
1528 C CG  . LYS B 13  ? 0.8457 0.7587 0.8550 0.0063  -0.0857 -0.1798 149 LYS B CG  
1529 C CD  . LYS B 13  ? 0.9257 0.8049 0.9451 0.0210  -0.1102 -0.2339 149 LYS B CD  
1530 C CE  . LYS B 13  ? 0.9791 0.9114 0.9663 0.0139  -0.0817 -0.2586 149 LYS B CE  
1531 N NZ  . LYS B 13  ? 1.1017 0.9964 1.0886 0.0225  -0.1090 -0.3116 149 LYS B NZ  
1532 N N   . ALA B 14  ? 0.5551 0.6229 0.5107 -0.0180 0.0065  -0.1154 150 ALA B N   
1533 C CA  . ALA B 14  ? 0.5080 0.6197 0.4658 -0.0108 0.0356  -0.1138 150 ALA B CA  
1534 C C   . ALA B 14  ? 0.5429 0.6581 0.5059 -0.0131 0.0404  -0.0748 150 ALA B C   
1535 O O   . ALA B 14  ? 0.4793 0.6082 0.4581 -0.0046 0.0533  -0.0730 150 ALA B O   
1536 C CB  . ALA B 14  ? 0.4939 0.6444 0.4144 -0.0240 0.0523  -0.1185 150 ALA B CB  
1537 N N   . LEU B 15  ? 0.5344 0.6435 0.4869 -0.0252 0.0303  -0.0478 151 LEU B N   
1538 C CA  . LEU B 15  ? 0.4507 0.5678 0.4106 -0.0240 0.0347  -0.0216 151 LEU B CA  
1539 C C   . LEU B 15  ? 0.4716 0.5607 0.4496 -0.0177 0.0265  -0.0209 151 LEU B C   
1540 O O   . LEU B 15  ? 0.4154 0.5097 0.4035 -0.0090 0.0344  -0.0145 151 LEU B O   
1541 C CB  . LEU B 15  ? 0.4740 0.6069 0.4280 -0.0373 0.0278  -0.0027 151 LEU B CB  
1542 C CG  . LEU B 15  ? 0.4573 0.6053 0.4225 -0.0335 0.0334  0.0131  151 LEU B CG  
1543 C CD1 . LEU B 15  ? 0.4415 0.5962 0.4117 -0.0168 0.0439  0.0153  151 LEU B CD1 
1544 C CD2 . LEU B 15  ? 0.4372 0.6224 0.4078 -0.0447 0.0307  0.0224  151 LEU B CD2 
1545 N N   . LEU B 16  ? 0.4870 0.5397 0.4665 -0.0243 0.0045  -0.0259 152 LEU B N   
1546 C CA  . LEU B 16  ? 0.4865 0.5035 0.4771 -0.0221 -0.0134 -0.0199 152 LEU B CA  
1547 C C   . LEU B 16  ? 0.5316 0.5487 0.5531 0.0028  -0.0101 -0.0431 152 LEU B C   
1548 O O   . LEU B 16  ? 0.5656 0.5777 0.5986 0.0087  -0.0131 -0.0344 152 LEU B O   
1549 C CB  . LEU B 16  ? 0.4741 0.4384 0.4570 -0.0381 -0.0482 -0.0167 152 LEU B CB  
1550 C CG  . LEU B 16  ? 0.5597 0.4747 0.5459 -0.0409 -0.0780 -0.0036 152 LEU B CG  
1551 C CD1 . LEU B 16  ? 0.4754 0.4126 0.4381 -0.0595 -0.0666 0.0270  152 LEU B CD1 
1552 C CD2 . LEU B 16  ? 0.6561 0.5033 0.6320 -0.0597 -0.1225 0.0020  152 LEU B CD2 
1553 N N   . ARG B 17  ? 0.4876 0.5184 0.5237 0.0157  -0.0032 -0.0760 153 ARG B N   
1554 C CA  . ARG B 17  ? 0.4575 0.5065 0.5331 0.0378  0.0028  -0.1054 153 ARG B CA  
1555 C C   . ARG B 17  ? 0.4249 0.5178 0.5014 0.0353  0.0311  -0.0920 153 ARG B C   
1556 O O   . ARG B 17  ? 0.4339 0.5341 0.5421 0.0458  0.0294  -0.0972 153 ARG B O   
1557 C CB  . ARG B 17  ? 0.5791 0.6505 0.6695 0.0502  0.0103  -0.1521 153 ARG B CB  
1558 C CG  . ARG B 17  ? 0.6970 0.8156 0.8352 0.0701  0.0261  -0.1879 153 ARG B CG  
1559 C CD  . ARG B 17  ? 0.8914 1.0537 1.0448 0.0813  0.0420  -0.2437 153 ARG B CD  
1560 N NE  . ARG B 17  ? 1.0697 1.2762 1.2899 0.1068  0.0469  -0.2887 153 ARG B NE  
1561 C CZ  . ARG B 17  ? 1.1861 1.3561 1.4634 0.1356  0.0100  -0.3065 153 ARG B CZ  
1562 N NH1 . ARG B 17  ? 1.2824 1.3630 1.5477 0.1369  -0.0358 -0.2788 153 ARG B NH1 
1563 N NH2 . ARG B 17  ? 1.1677 1.3880 1.5052 0.1534  0.0135  -0.3410 153 ARG B NH2 
1564 N N   . LEU B 18  ? 0.3693 0.4864 0.4131 0.0206  0.0507  -0.0740 154 LEU B N   
1565 C CA  . LEU B 18  ? 0.3979 0.5397 0.4381 0.0149  0.0677  -0.0562 154 LEU B CA  
1566 C C   . LEU B 18  ? 0.4421 0.5601 0.4899 0.0183  0.0558  -0.0355 154 LEU B C   
1567 O O   . LEU B 18  ? 0.3739 0.5015 0.4397 0.0208  0.0600  -0.0343 154 LEU B O   
1568 C CB  . LEU B 18  ? 0.3813 0.5359 0.3846 0.0006  0.0765  -0.0366 154 LEU B CB  
1569 C CG  . LEU B 18  ? 0.4379 0.6024 0.4334 -0.0072 0.0841  -0.0149 154 LEU B CG  
1570 C CD1 . LEU B 18  ? 0.4133 0.6093 0.4211 -0.0156 0.1008  -0.0270 154 LEU B CD1 
1571 C CD2 . LEU B 18  ? 0.5109 0.6763 0.4733 -0.0177 0.0801  0.0053  154 LEU B CD2 
1572 N N   . LEU B 19  ? 0.4412 0.5336 0.4723 0.0140  0.0416  -0.0204 155 LEU B N   
1573 C CA  . LEU B 19  ? 0.3904 0.4674 0.4176 0.0127  0.0327  -0.0043 155 LEU B CA  
1574 C C   . LEU B 19  ? 0.4182 0.4721 0.4689 0.0204  0.0141  -0.0118 155 LEU B C   
1575 O O   . LEU B 19  ? 0.4679 0.5208 0.5271 0.0234  0.0115  -0.0074 155 LEU B O   
1576 C CB  . LEU B 19  ? 0.3721 0.4423 0.3736 -0.0012 0.0255  0.0103  155 LEU B CB  
1577 C CG  . LEU B 19  ? 0.4450 0.5464 0.4353 -0.0043 0.0393  0.0164  155 LEU B CG  
1578 C CD1 . LEU B 19  ? 0.4388 0.5512 0.4136 -0.0221 0.0348  0.0254  155 LEU B CD1 
1579 C CD2 . LEU B 19  ? 0.4047 0.5168 0.3992 0.0060  0.0466  0.0191  155 LEU B CD2 
1580 N N   . ASP B 20  ? 0.4210 0.4531 0.4853 0.0251  -0.0038 -0.0257 156 ASP B N   
1581 C CA  . ASP B 20  ? 0.4618 0.4682 0.5595 0.0384  -0.0310 -0.0378 156 ASP B CA  
1582 C C   . ASP B 20  ? 0.5067 0.5523 0.6486 0.0536  -0.0173 -0.0582 156 ASP B C   
1583 O O   . ASP B 20  ? 0.5004 0.5383 0.6632 0.0589  -0.0333 -0.0553 156 ASP B O   
1584 C CB  . ASP B 20  ? 0.4620 0.4377 0.5749 0.0467  -0.0549 -0.0583 156 ASP B CB  
1585 C CG  . ASP B 20  ? 0.6060 0.5361 0.7519 0.0612  -0.0993 -0.0661 156 ASP B CG  
1586 O OD1 . ASP B 20  ? 0.6682 0.5996 0.8294 0.0656  -0.1088 -0.0581 156 ASP B OD1 
1587 O OD2 . ASP B 20  ? 0.7009 0.5882 0.8590 0.0688  -0.1307 -0.0809 156 ASP B OD2 
1588 N N   . GLN B 21  ? 0.4902 0.5820 0.6436 0.0556  0.0115  -0.0782 157 GLN B N   
1589 C CA  . GLN B 21  ? 0.4285 0.5716 0.6242 0.0611  0.0285  -0.0986 157 GLN B CA  
1590 C C   . GLN B 21  ? 0.3930 0.5421 0.5777 0.0478  0.0361  -0.0725 157 GLN B C   
1591 O O   . GLN B 21  ? 0.3858 0.5568 0.6093 0.0506  0.0331  -0.0805 157 GLN B O   
1592 C CB  . GLN B 21  ? 0.4282 0.6247 0.6215 0.0547  0.0606  -0.1211 157 GLN B CB  
1593 C CG  . GLN B 21  ? 0.4517 0.6611 0.6792 0.0748  0.0547  -0.1667 157 GLN B CG  
1594 C CD  . GLN B 21  ? 0.5756 0.8117 0.8775 0.0983  0.0420  -0.2012 157 GLN B CD  
1595 O OE1 . GLN B 21  ? 0.6711 0.8655 1.0070 0.1231  0.0043  -0.2185 157 GLN B OE1 
1596 N NE2 . GLN B 21  ? 0.5906 0.8957 0.9213 0.0885  0.0685  -0.2098 157 GLN B NE2 
1597 N N   . HIS B 22  ? 0.3429 0.4738 0.4800 0.0346  0.0430  -0.0452 158 HIS B N   
1598 C CA  . HIS B 22  ? 0.3775 0.5026 0.5026 0.0256  0.0443  -0.0250 158 HIS B CA  
1599 C C   . HIS B 22  ? 0.4149 0.5121 0.5495 0.0315  0.0198  -0.0207 158 HIS B C   
1600 O O   . HIS B 22  ? 0.3700 0.4732 0.5216 0.0279  0.0161  -0.0188 158 HIS B O   
1601 C CB  . HIS B 22  ? 0.3140 0.4235 0.3958 0.0191  0.0494  -0.0054 158 HIS B CB  
1602 C CG  . HIS B 22  ? 0.4064 0.5355 0.4755 0.0069  0.0650  0.0021  158 HIS B CG  
1603 N ND1 . HIS B 22  ? 0.4629 0.5753 0.5136 0.0016  0.0604  0.0201  158 HIS B ND1 
1604 C CD2 . HIS B 22  ? 0.3443 0.5051 0.4120 -0.0035 0.0811  -0.0058 158 HIS B CD2 
1605 C CE1 . HIS B 22  ? 0.5145 0.6399 0.5506 -0.0144 0.0683  0.0299  158 HIS B CE1 
1606 N NE2 . HIS B 22  ? 0.4077 0.5675 0.4498 -0.0205 0.0842  0.0148  158 HIS B NE2 
1607 N N   . ASP B 23  ? 0.4312 0.4963 0.5498 0.0354  0.0003  -0.0168 159 ASP B N   
1608 C CA  . ASP B 23  ? 0.4762 0.5095 0.5918 0.0356  -0.0292 -0.0092 159 ASP B CA  
1609 C C   . ASP B 23  ? 0.4776 0.5207 0.6509 0.0489  -0.0476 -0.0270 159 ASP B C   
1610 O O   . ASP B 23  ? 0.4471 0.4897 0.6340 0.0476  -0.0607 -0.0243 159 ASP B O   
1611 C CB  . ASP B 23  ? 0.5310 0.5276 0.6123 0.0278  -0.0489 0.0031  159 ASP B CB  
1612 C CG  . ASP B 23  ? 0.6872 0.6446 0.7519 0.0201  -0.0856 0.0172  159 ASP B CG  
1613 O OD1 . ASP B 23  ? 0.7525 0.6876 0.8525 0.0316  -0.1178 0.0098  159 ASP B OD1 
1614 O OD2 . ASP B 23  ? 0.7061 0.6565 0.7222 0.0024  -0.0849 0.0335  159 ASP B OD2 
1615 N N   . GLN B 24  ? 0.4274 0.4847 0.6398 0.0633  -0.0497 -0.0504 160 GLN B N   
1616 C CA  . GLN B 24  ? 0.4205 0.5000 0.7031 0.0822  -0.0680 -0.0773 160 GLN B CA  
1617 C C   . GLN B 24  ? 0.4286 0.5698 0.7488 0.0761  -0.0433 -0.0876 160 GLN B C   
1618 O O   . GLN B 24  ? 0.4206 0.5794 0.7925 0.0840  -0.0628 -0.0989 160 GLN B O   
1619 C CB  . GLN B 24  ? 0.4491 0.5412 0.7715 0.1030  -0.0711 -0.1120 160 GLN B CB  
1620 C CG  . GLN B 24  ? 0.6111 0.6302 0.9093 0.1081  -0.1111 -0.1029 160 GLN B CG  
1621 C CD  . GLN B 24  ? 0.7385 0.7609 1.0815 0.1332  -0.1214 -0.1445 160 GLN B CD  
1622 O OE1 . GLN B 24  ? 0.8053 0.8840 1.2196 0.1568  -0.1138 -0.1885 160 GLN B OE1 
1623 N NE2 . GLN B 24  ? 0.7476 0.7147 1.0519 0.1270  -0.1388 -0.1350 160 GLN B NE2 
1624 N N   . ARG B 25  ? 0.3660 0.5383 0.6604 0.0585  -0.0052 -0.0810 161 ARG B N   
1625 C CA  . ARG B 25  ? 0.3757 0.6078 0.7034 0.0437  0.0171  -0.0882 161 ARG B CA  
1626 C C   . ARG B 25  ? 0.4160 0.6245 0.7092 0.0222  0.0163  -0.0578 161 ARG B C   
1627 O O   . ARG B 25  ? 0.4092 0.6555 0.7196 0.0011  0.0308  -0.0552 161 ARG B O   
1628 C CB  . ARG B 25  ? 0.3799 0.6664 0.7035 0.0315  0.0552  -0.1021 161 ARG B CB  
1629 C CG  . ARG B 25  ? 0.4733 0.8013 0.8442 0.0537  0.0599  -0.1467 161 ARG B CG  
1630 C CD  . ARG B 25  ? 0.5465 0.9213 0.8897 0.0372  0.0983  -0.1587 161 ARG B CD  
1631 N NE  . ARG B 25  ? 0.5168 0.9536 0.8570 0.0011  0.1288  -0.1493 161 ARG B NE  
1632 C CZ  . ARG B 25  ? 0.5038 0.9605 0.7912 -0.0270 0.1545  -0.1390 161 ARG B CZ  
1633 N NH1 . ARG B 25  ? 0.5563 0.9948 0.8035 -0.0203 0.1591  -0.1458 161 ARG B NH1 
1634 N NH2 . ARG B 25  ? 0.3888 0.8786 0.6612 -0.0646 0.1702  -0.1197 161 ARG B NH2 
1635 N N   . GLY B 26  ? 0.4223 0.5707 0.6674 0.0253  -0.0017 -0.0374 162 GLY B N   
1636 C CA  . GLY B 26  ? 0.4044 0.5251 0.6185 0.0119  -0.0069 -0.0183 162 GLY B CA  
1637 C C   . GLY B 26  ? 0.4045 0.5299 0.5919 -0.0048 0.0149  -0.0051 162 GLY B C   
1638 O O   . GLY B 26  ? 0.4305 0.5479 0.6163 -0.0212 0.0107  0.0054  162 GLY B O   
1639 N N   . LEU B 27  ? 0.4535 0.5849 0.6182 -0.0025 0.0320  -0.0039 163 LEU B N   
1640 C CA  . LEU B 27  ? 0.4706 0.6021 0.6071 -0.0192 0.0453  0.0119  163 LEU B CA  
1641 C C   . LEU B 27  ? 0.3030 0.3879 0.4001 -0.0110 0.0338  0.0250  163 LEU B C   
1642 O O   . LEU B 27  ? 0.4044 0.4744 0.4813 -0.0212 0.0321  0.0400  163 LEU B O   
1643 C CB  . LEU B 27  ? 0.4819 0.6490 0.6130 -0.0230 0.0671  0.0044  163 LEU B CB  
1644 C CG  . LEU B 27  ? 0.4826 0.7124 0.6589 -0.0303 0.0836  -0.0190 163 LEU B CG  
1645 C CD1 . LEU B 27  ? 0.4909 0.7600 0.6538 -0.0370 0.1073  -0.0320 163 LEU B CD1 
1646 C CD2 . LEU B 27  ? 0.4974 0.7544 0.6942 -0.0583 0.0870  -0.0099 163 LEU B CD2 
1647 N N   . GLY B 28  ? 0.3477 0.4126 0.4341 0.0059  0.0237  0.0182  164 GLY B N   
1648 C CA  . GLY B 28  ? 0.4222 0.4594 0.4817 0.0154  0.0152  0.0199  164 GLY B CA  
1649 C C   . GLY B 28  ? 0.4367 0.4820 0.4767 0.0246  0.0234  0.0194  164 GLY B C   
1650 O O   . GLY B 28  ? 0.4559 0.5196 0.4956 0.0225  0.0335  0.0195  164 GLY B O   
1651 N N   . GLY B 29  ? 0.4465 0.4800 0.4753 0.0360  0.0165  0.0144  165 GLY B N   
1652 C CA  . GLY B 29  ? 0.4574 0.5101 0.4780 0.0456  0.0226  0.0098  165 GLY B CA  
1653 C C   . GLY B 29  ? 0.4123 0.4675 0.4339 0.0427  0.0225  0.0229  165 GLY B C   
1654 O O   . GLY B 29  ? 0.4182 0.4534 0.4398 0.0332  0.0144  0.0365  165 GLY B O   
1655 N N   . ILE B 30  ? 0.3318 0.4122 0.3497 0.0457  0.0293  0.0211  166 ILE B N   
1656 C CA  . ILE B 30  ? 0.3521 0.4361 0.3660 0.0430  0.0245  0.0329  166 ILE B CA  
1657 C C   . ILE B 30  ? 0.3786 0.4787 0.4052 0.0617  0.0141  0.0231  166 ILE B C   
1658 O O   . ILE B 30  ? 0.3692 0.5048 0.4019 0.0651  0.0249  0.0094  166 ILE B O   
1659 C CB  . ILE B 30  ? 0.3811 0.4851 0.3844 0.0284  0.0387  0.0361  166 ILE B CB  
1660 C CG1 . ILE B 30  ? 0.3014 0.4011 0.3050 0.0150  0.0481  0.0373  166 ILE B CG1 
1661 C CG2 . ILE B 30  ? 0.4151 0.5267 0.4066 0.0237  0.0318  0.0464  166 ILE B CG2 
1662 C CD1 . ILE B 30  ? 0.3791 0.4966 0.3815 0.0085  0.0595  0.0275  166 ILE B CD1 
1663 N N   . LEU B 31  ? 0.3629 0.4393 0.3962 0.0721  -0.0099 0.0299  167 LEU B N   
1664 C CA  . LEU B 31  ? 0.3572 0.4548 0.4165 0.0963  -0.0253 0.0151  167 LEU B CA  
1665 C C   . LEU B 31  ? 0.4030 0.5436 0.4622 0.0882  -0.0167 0.0184  167 LEU B C   
1666 O O   . LEU B 31  ? 0.4008 0.5324 0.4344 0.0676  -0.0151 0.0387  167 LEU B O   
1667 C CB  . LEU B 31  ? 0.4252 0.4752 0.4930 0.1094  -0.0650 0.0259  167 LEU B CB  
1668 C CG  . LEU B 31  ? 0.4487 0.4459 0.5227 0.1201  -0.0859 0.0203  167 LEU B CG  
1669 C CD1 . LEU B 31  ? 0.4770 0.4195 0.5598 0.1321  -0.1359 0.0345  167 LEU B CD1 
1670 C CD2 . LEU B 31  ? 0.4368 0.4626 0.5384 0.1476  -0.0758 -0.0224 167 LEU B CD2 
1671 N N   . LEU B 32  ? 0.3691 0.5622 0.4564 0.1016  -0.0103 -0.0048 168 LEU B N   
1672 C CA  . LEU B 32  ? 0.3193 0.5577 0.4137 0.0923  -0.0063 -0.0034 168 LEU B CA  
1673 C C   . LEU B 32  ? 0.3997 0.6187 0.4942 0.0959  -0.0363 0.0142  168 LEU B C   
1674 O O   . LEU B 32  ? 0.3634 0.5897 0.4369 0.0755  -0.0345 0.0283  168 LEU B O   
1675 C CB  . LEU B 32  ? 0.2946 0.6055 0.4291 0.1050  0.0031  -0.0336 168 LEU B CB  
1676 C CG  . LEU B 32  ? 0.2586 0.6275 0.4125 0.0942  0.0032  -0.0344 168 LEU B CG  
1677 C CD1 . LEU B 32  ? 0.3077 0.6651 0.4207 0.0565  0.0186  -0.0131 168 LEU B CD1 
1678 C CD2 . LEU B 32  ? 0.2527 0.7109 0.4527 0.1032  0.0174  -0.0689 168 LEU B CD2 
1679 N N   . GLU B 33  ? 0.3523 0.5408 0.4669 0.1202  -0.0691 0.0135  169 GLU B N   
1680 C CA  . GLU B 33  ? 0.4843 0.6497 0.5961 0.1218  -0.1077 0.0345  169 GLU B CA  
1681 C C   . GLU B 33  ? 0.4372 0.5604 0.4855 0.0846  -0.1060 0.0708  169 GLU B C   
1682 O O   . GLU B 33  ? 0.4562 0.5794 0.4839 0.0711  -0.1240 0.0885  169 GLU B O   
1683 C CB  . GLU B 33  ? 0.4363 0.5588 0.5798 0.1544  -0.1538 0.0300  169 GLU B CB  
1684 C CG  . GLU B 33  ? 0.5908 0.6479 0.7109 0.1498  -0.1570 0.0391  169 GLU B CG  
1685 C CD  . GLU B 33  ? 0.6743 0.6702 0.8214 0.1790  -0.2127 0.0376  169 GLU B CD  
1686 O OE1 . GLU B 33  ? 0.5948 0.6172 0.8002 0.2186  -0.2404 0.0092  169 GLU B OE1 
1687 O OE2 . GLU B 33  ? 0.7375 0.6601 0.8520 0.1618  -0.2315 0.0631  169 GLU B OE2 
1688 N N   . ASP B 34  ? 0.4207 0.5166 0.4394 0.0669  -0.0841 0.0785  170 ASP B N   
1689 C CA  . ASP B 34  ? 0.5372 0.6147 0.5020 0.0304  -0.0739 0.1033  170 ASP B CA  
1690 C C   . ASP B 34  ? 0.5550 0.6741 0.5055 0.0154  -0.0471 0.0935  170 ASP B C   
1691 O O   . ASP B 34  ? 0.5969 0.7161 0.5073 -0.0088 -0.0479 0.1063  170 ASP B O   
1692 C CB  . ASP B 34  ? 0.5543 0.6089 0.5061 0.0169  -0.0553 0.1069  170 ASP B CB  
1693 C CG  . ASP B 34  ? 0.6021 0.6022 0.5575 0.0219  -0.0879 0.1221  170 ASP B CG  
1694 O OD1 . ASP B 34  ? 0.5819 0.5512 0.5374 0.0295  -0.1292 0.1374  170 ASP B OD1 
1695 O OD2 . ASP B 34  ? 0.6252 0.6081 0.5851 0.0183  -0.0781 0.1189  170 ASP B OD2 
1696 N N   . ILE B 35  ? 0.4899 0.6419 0.4690 0.0269  -0.0266 0.0704  171 ILE B N   
1697 C CA  . ILE B 35  ? 0.4329 0.6131 0.4024 0.0125  -0.0098 0.0611  171 ILE B CA  
1698 C C   . ILE B 35  ? 0.4663 0.6695 0.4402 0.0117  -0.0314 0.0645  171 ILE B C   
1699 O O   . ILE B 35  ? 0.4728 0.6803 0.4174 -0.0077 -0.0310 0.0666  171 ILE B O   
1700 C CB  . ILE B 35  ? 0.4585 0.6595 0.4510 0.0169  0.0101  0.0434  171 ILE B CB  
1701 C CG1 . ILE B 35  ? 0.4858 0.6614 0.4701 0.0147  0.0264  0.0410  171 ILE B CG1 
1702 C CG2 . ILE B 35  ? 0.3618 0.5838 0.3484 0.0000  0.0158  0.0369  171 ILE B CG2 
1703 C CD1 . ILE B 35  ? 0.5139 0.6738 0.4704 -0.0012 0.0348  0.0444  171 ILE B CD1 
1704 N N   . GLU B 36  ? 0.4169 0.6371 0.4310 0.0345  -0.0531 0.0609  172 GLU B N   
1705 C CA  . GLU B 36  ? 0.4069 0.6571 0.4395 0.0378  -0.0793 0.0618  172 GLU B CA  
1706 C C   . GLU B 36  ? 0.5072 0.7221 0.4936 0.0219  -0.1076 0.0877  172 GLU B C   
1707 O O   . GLU B 36  ? 0.5156 0.7488 0.4930 0.0109  -0.1249 0.0918  172 GLU B O   
1708 C CB  . GLU B 36  ? 0.4185 0.6981 0.5150 0.0725  -0.1005 0.0459  172 GLU B CB  
1709 C CG  . GLU B 36  ? 0.4464 0.7737 0.5804 0.0821  -0.0692 0.0177  172 GLU B CG  
1710 C CD  . GLU B 36  ? 0.4394 0.8186 0.6438 0.1176  -0.0843 -0.0110 172 GLU B CD  
1711 O OE1 . GLU B 36  ? 0.4064 0.7542 0.6330 0.1466  -0.1221 -0.0106 172 GLU B OE1 
1712 O OE2 . GLU B 36  ? 0.4077 0.8611 0.6461 0.1147  -0.0600 -0.0356 172 GLU B OE2 
1713 N N   . GLU B 37  ? 0.5188 0.6844 0.4721 0.0158  -0.1145 0.1070  173 GLU B N   
1714 C CA  . GLU B 37  ? 0.6539 0.7863 0.5497 -0.0096 -0.1404 0.1369  173 GLU B CA  
1715 C C   . GLU B 37  ? 0.5648 0.7114 0.4052 -0.0437 -0.1095 0.1330  173 GLU B C   
1716 O O   . GLU B 37  ? 0.5601 0.7093 0.3578 -0.0653 -0.1259 0.1435  173 GLU B O   
1717 C CB  . GLU B 37  ? 0.8122 0.8889 0.6870 -0.0146 -0.1585 0.1620  173 GLU B CB  
1718 C CG  . GLU B 37  ? 1.1179 1.1595 0.9191 -0.0538 -0.1832 0.1998  173 GLU B CG  
1719 C CD  . GLU B 37  ? 1.4035 1.3975 1.1757 -0.0741 -0.1868 0.2249  173 GLU B CD  
1720 O OE1 . GLU B 37  ? 1.4945 1.5018 1.2185 -0.1113 -0.1521 0.2297  173 GLU B OE1 
1721 O OE2 . GLU B 37  ? 1.5117 1.4583 1.3142 -0.0527 -0.2251 0.2360  173 GLU B OE2 
1722 N N   . ALA B 38  ? 0.5339 0.6907 0.3785 -0.0457 -0.0683 0.1133  174 ALA B N   
1723 C CA  . ALA B 38  ? 0.5947 0.7653 0.3992 -0.0699 -0.0389 0.0987  174 ALA B CA  
1724 C C   . ALA B 38  ? 0.5959 0.7912 0.4052 -0.0715 -0.0356 0.0766  174 ALA B C   
1725 O O   . ALA B 38  ? 0.5970 0.7997 0.3631 -0.0924 -0.0299 0.0663  174 ALA B O   
1726 C CB  . ALA B 38  ? 0.5120 0.6826 0.3322 -0.0658 -0.0050 0.0828  174 ALA B CB  
1727 N N   . LEU B 39  ? 0.6008 0.8113 0.4603 -0.0532 -0.0399 0.0679  175 LEU B N   
1728 C CA  . LEU B 39  ? 0.4018 0.6299 0.2710 -0.0600 -0.0346 0.0483  175 LEU B CA  
1729 C C   . LEU B 39  ? 0.4989 0.7565 0.3960 -0.0583 -0.0615 0.0533  175 LEU B C   
1730 O O   . LEU B 39  ? 0.4784 0.7612 0.4263 -0.0410 -0.0657 0.0540  175 LEU B O   
1731 C CB  . LEU B 39  ? 0.4132 0.6391 0.3144 -0.0512 -0.0124 0.0345  175 LEU B CB  
1732 C CG  . LEU B 39  ? 0.4367 0.6664 0.3489 -0.0628 -0.0110 0.0199  175 LEU B CG  
1733 C CD1 . LEU B 39  ? 0.5781 0.7867 0.4550 -0.0760 -0.0100 0.0006  175 LEU B CD1 
1734 C CD2 . LEU B 39  ? 0.4279 0.6490 0.3643 -0.0572 0.0030  0.0173  175 LEU B CD2 
1735 N N   . PRO B 40  ? 0.4664 0.7288 0.3333 -0.0766 -0.0796 0.0526  176 PRO B N   
1736 C CA  . PRO B 40  ? 0.4482 0.7461 0.3480 -0.0775 -0.1080 0.0555  176 PRO B CA  
1737 C C   . PRO B 40  ? 0.4170 0.7481 0.3674 -0.0790 -0.0948 0.0421  176 PRO B C   
1738 O O   . PRO B 40  ? 0.4262 0.7367 0.3630 -0.0906 -0.0740 0.0305  176 PRO B O   
1739 C CB  . PRO B 40  ? 0.5003 0.7898 0.3470 -0.1033 -0.1242 0.0515  176 PRO B CB  
1740 C CG  . PRO B 40  ? 0.5584 0.8146 0.3404 -0.1128 -0.1086 0.0517  176 PRO B CG  
1741 C CD  . PRO B 40  ? 0.5654 0.8087 0.3683 -0.0981 -0.0740 0.0437  176 PRO B CD  
1742 N N   . ASN B 41  ? 0.3912 0.7748 0.3997 -0.0691 -0.1089 0.0428  177 ASN B N   
1743 C CA  . ASN B 41  ? 0.3623 0.7932 0.4154 -0.0805 -0.0945 0.0324  177 ASN B CA  
1744 C C   . ASN B 41  ? 0.3604 0.7704 0.4086 -0.0782 -0.0618 0.0288  177 ASN B C   
1745 O O   . ASN B 41  ? 0.4274 0.8373 0.4722 -0.1028 -0.0501 0.0264  177 ASN B O   
1746 C CB  . ASN B 41  ? 0.3873 0.8193 0.4233 -0.1161 -0.1043 0.0288  177 ASN B CB  
1747 C CG  . ASN B 41  ? 0.4722 0.9652 0.5561 -0.1389 -0.0980 0.0252  177 ASN B CG  
1748 O OD1 . ASN B 41  ? 0.4121 0.9715 0.5516 -0.1254 -0.0904 0.0205  177 ASN B OD1 
1749 N ND2 . ASN B 41  ? 0.3977 0.8704 0.4599 -0.1759 -0.1020 0.0252  177 ASN B ND2 
1750 N N   . SER B 42  ? 0.3957 0.7098 0.4170 -0.1546 -0.0657 0.0230  178 SER B N   
1751 C CA  . SER B 42  ? 0.4362 0.7253 0.4626 -0.1345 -0.0485 0.0132  178 SER B CA  
1752 C C   . SER B 42  ? 0.4674 0.8035 0.5140 -0.1380 -0.0431 0.0158  178 SER B C   
1753 O O   . SER B 42  ? 0.4780 0.7844 0.5139 -0.1356 -0.0311 0.0106  178 SER B O   
1754 C CB  . SER B 42  ? 0.4624 0.7472 0.5099 -0.0964 -0.0454 0.0058  178 SER B CB  
1755 O OG  . SER B 42  ? 0.5083 0.8508 0.5881 -0.0767 -0.0560 0.0110  178 SER B OG  
1756 N N   . GLN B 43  ? 0.5020 0.9142 0.5773 -0.1436 -0.0522 0.0239  179 GLN B N   
1757 C CA  . GLN B 43  ? 0.5289 0.9921 0.6236 -0.1488 -0.0449 0.0251  179 GLN B CA  
1758 C C   . GLN B 43  ? 0.4959 0.9238 0.5478 -0.1896 -0.0401 0.0274  179 GLN B C   
1759 O O   . GLN B 43  ? 0.5499 0.9740 0.5984 -0.1906 -0.0298 0.0244  179 GLN B O   
1760 C CB  . GLN B 43  ? 0.6219 1.1850 0.7585 -0.1473 -0.0546 0.0329  179 GLN B CB  
1761 C CG  . GLN B 43  ? 0.7920 1.3895 0.9699 -0.0973 -0.0518 0.0279  179 GLN B CG  
1762 C CD  . GLN B 43  ? 0.9040 1.6077 1.1284 -0.0858 -0.0576 0.0340  179 GLN B CD  
1763 O OE1 . GLN B 43  ? 0.8971 1.6538 1.1306 -0.1063 -0.0726 0.0444  179 GLN B OE1 
1764 N NE2 . GLN B 43  ? 0.9151 1.6534 1.1686 -0.0526 -0.0451 0.0273  179 GLN B NE2 
1765 N N   . LYS B 44  ? 0.5136 0.9074 0.5251 -0.2241 -0.0481 0.0328  180 LYS B N   
1766 C CA  . LYS B 44  ? 0.5453 0.8822 0.4985 -0.2633 -0.0441 0.0347  180 LYS B CA  
1767 C C   . LYS B 44  ? 0.5518 0.8052 0.4774 -0.2429 -0.0307 0.0254  180 LYS B C   
1768 O O   . LYS B 44  ? 0.5183 0.7490 0.4209 -0.2525 -0.0240 0.0251  180 LYS B O   
1769 C CB  . LYS B 44  ? 0.6580 0.9592 0.5647 -0.3008 -0.0544 0.0409  180 LYS B CB  
1770 C CG  . LYS B 44  ? 0.7292 0.9648 0.5613 -0.3480 -0.0516 0.0441  180 LYS B CG  
1771 C CD  . LYS B 44  ? 0.7594 0.9503 0.5393 -0.3841 -0.0609 0.0492  180 LYS B CD  
1772 C CE  . LYS B 44  ? 0.8107 0.9072 0.4999 -0.4259 -0.0559 0.0501  180 LYS B CE  
1773 N NZ  . LYS B 44  ? 0.9677 1.1057 0.6337 -0.4785 -0.0629 0.0605  180 LYS B NZ  
1774 N N   . ALA B 45  ? 0.4995 0.7088 0.4254 -0.2160 -0.0276 0.0183  181 ALA B N   
1775 C CA  . ALA B 45  ? 0.5688 0.7096 0.4735 -0.1942 -0.0154 0.0097  181 ALA B CA  
1776 C C   . ALA B 45  ? 0.5435 0.7126 0.4822 -0.1679 -0.0090 0.0065  181 ALA B C   
1777 O O   . ALA B 45  ? 0.6814 0.8110 0.5958 -0.1659 -0.0029 0.0052  181 ALA B O   
1778 C CB  . ALA B 45  ? 0.5146 0.6205 0.4203 -0.1723 -0.0120 0.0018  181 ALA B CB  
1779 N N   . VAL B 46  ? 0.4377 0.6690 0.4269 -0.1467 -0.0109 0.0054  182 VAL B N   
1780 C CA  . VAL B 46  ? 0.4326 0.6863 0.4495 -0.1226 -0.0040 0.0016  182 VAL B CA  
1781 C C   . VAL B 46  ? 0.4927 0.7644 0.4984 -0.1445 -0.0019 0.0064  182 VAL B C   
1782 O O   . VAL B 46  ? 0.5106 0.7563 0.5051 -0.1374 0.0038  0.0044  182 VAL B O   
1783 C CB  . VAL B 46  ? 0.4267 0.7358 0.4892 -0.0968 -0.0056 -0.0007 182 VAL B CB  
1784 C CG1 . VAL B 46  ? 0.4432 0.7786 0.5271 -0.0794 0.0024  -0.0039 182 VAL B CG1 
1785 C CG2 . VAL B 46  ? 0.4295 0.7070 0.4929 -0.0761 -0.0064 -0.0066 182 VAL B CG2 
1786 N N   . LYS B 47  ? 0.5258 0.8424 0.5311 -0.1743 -0.0075 0.0133  183 LYS B N   
1787 C CA  . LYS B 47  ? 0.6009 0.9373 0.5900 -0.2030 -0.0048 0.0176  183 LYS B CA  
1788 C C   . LYS B 47  ? 0.6599 0.9112 0.5834 -0.2260 -0.0039 0.0195  183 LYS B C   
1789 O O   . LYS B 47  ? 0.6717 0.9057 0.5759 -0.2320 0.0004  0.0198  183 LYS B O   
1790 C CB  . LYS B 47  ? 0.6251 1.0355 0.6264 -0.2354 -0.0114 0.0249  183 LYS B CB  
1791 C CG  . LYS B 47  ? 0.6911 1.1982 0.7561 -0.2115 -0.0096 0.0235  183 LYS B CG  
1792 C CD  . LYS B 47  ? 0.7948 1.3882 0.8719 -0.2475 -0.0126 0.0306  183 LYS B CD  
1793 C CE  . LYS B 47  ? 0.9156 1.4846 0.9440 -0.2930 -0.0074 0.0332  183 LYS B CE  
1794 N NZ  . LYS B 47  ? 0.8766 1.5209 0.9316 -0.2986 0.0036  0.0310  183 LYS B NZ  
1795 N N   . ALA B 48  ? 0.6494 0.8421 0.5332 -0.2382 -0.0080 0.0207  184 ALA B N   
1796 C CA  . ALA B 48  ? 0.6508 0.7491 0.4626 -0.2549 -0.0068 0.0219  184 ALA B CA  
1797 C C   . ALA B 48  ? 0.7781 0.8281 0.5855 -0.2195 -0.0007 0.0168  184 ALA B C   
1798 O O   . ALA B 48  ? 0.8192 0.8103 0.5749 -0.2301 -0.0004 0.0195  184 ALA B O   
1799 C CB  . ALA B 48  ? 0.6450 0.6874 0.4197 -0.2638 -0.0091 0.0212  184 ALA B CB  
1800 N N   . LEU B 49  ? 0.7133 0.7882 0.5713 -0.1792 0.0028  0.0102  185 LEU B N   
1801 C CA  . LEU B 49  ? 0.6444 0.6852 0.5044 -0.1456 0.0070  0.0060  185 LEU B CA  
1802 C C   . LEU B 49  ? 0.6702 0.7404 0.5452 -0.1432 0.0075  0.0081  185 LEU B C   
1803 O O   . LEU B 49  ? 0.6593 0.6996 0.5274 -0.1220 0.0080  0.0073  185 LEU B O   
1804 C CB  . LEU B 49  ? 0.4839 0.5429 0.3871 -0.1112 0.0105  -0.0017 185 LEU B CB  
1805 C CG  . LEU B 49  ? 0.5975 0.6135 0.4804 -0.1070 0.0129  -0.0061 185 LEU B CG  
1806 C CD1 . LEU B 49  ? 0.4826 0.5278 0.4088 -0.0804 0.0164  -0.0137 185 LEU B CD1 
1807 C CD2 . LEU B 49  ? 0.6436 0.5807 0.4748 -0.0987 0.0165  -0.0069 185 LEU B CD2 
1808 N N   . GLY B 50  ? 0.6715 0.8039 0.5676 -0.1641 0.0076  0.0107  186 GLY B N   
1809 C CA  . GLY B 50  ? 0.6055 0.7633 0.5062 -0.1698 0.0103  0.0122  186 GLY B CA  
1810 C C   . GLY B 50  ? 0.6277 0.7908 0.5573 -0.1350 0.0133  0.0078  186 GLY B C   
1811 O O   . GLY B 50  ? 0.6194 0.8129 0.5908 -0.1093 0.0157  0.0024  186 GLY B O   
1812 N N   . ASP B 51  ? 0.5757 0.7047 0.4771 -0.1366 0.0119  0.0108  187 ASP B N   
1813 C CA  . ASP B 51  ? 0.6165 0.7555 0.5416 -0.1104 0.0132  0.0082  187 ASP B CA  
1814 C C   . ASP B 51  ? 0.5551 0.6573 0.4829 -0.0788 0.0092  0.0066  187 ASP B C   
1815 O O   . ASP B 51  ? 0.6561 0.7584 0.5939 -0.0605 0.0072  0.0067  187 ASP B O   
1816 C CB  . ASP B 51  ? 0.6578 0.7808 0.5516 -0.1270 0.0117  0.0131  187 ASP B CB  
1817 C CG  . ASP B 51  ? 0.7893 0.8334 0.6183 -0.1396 0.0029  0.0205  187 ASP B CG  
1818 O OD1 . ASP B 51  ? 0.8573 0.8556 0.6656 -0.1306 -0.0008 0.0212  187 ASP B OD1 
1819 O OD2 . ASP B 51  ? 0.9633 0.9852 0.7559 -0.1585 0.0000  0.0255  187 ASP B OD2 
1820 N N   . GLN B 52  ? 0.5894 0.6650 0.5086 -0.0738 0.0086  0.0050  188 GLN B N   
1821 C CA  . GLN B 52  ? 0.5508 0.6080 0.4816 -0.0429 0.0084  0.0012  188 GLN B CA  
1822 C C   . GLN B 52  ? 0.4844 0.5933 0.4652 -0.0279 0.0129  -0.0058 188 GLN B C   
1823 O O   . GLN B 52  ? 0.5429 0.6534 0.5404 -0.0059 0.0137  -0.0098 188 GLN B O   
1824 C CB  . GLN B 52  ? 0.6267 0.6345 0.5260 -0.0436 0.0093  0.0001  188 GLN B CB  
1825 C CG  . GLN B 52  ? 0.7643 0.7069 0.6001 -0.0609 0.0046  0.0070  188 GLN B CG  
1826 C CD  . GLN B 52  ? 0.8175 0.6985 0.6101 -0.0623 0.0068  0.0054  188 GLN B CD  
1827 O OE1 . GLN B 52  ? 0.8525 0.7241 0.6211 -0.0931 0.0075  0.0065  188 GLN B OE1 
1828 N NE2 . GLN B 52  ? 0.7832 0.6232 0.5636 -0.0292 0.0081  0.0029  188 GLN B NE2 
1829 N N   . ILE B 53  ? 0.3809 0.5321 0.3823 -0.0401 0.0158  -0.0072 189 ILE B N   
1830 C CA  . ILE B 53  ? 0.3977 0.5863 0.4346 -0.0264 0.0192  -0.0133 189 ILE B CA  
1831 C C   . ILE B 53  ? 0.4804 0.7005 0.5308 -0.0254 0.0222  -0.0138 189 ILE B C   
1832 O O   . ILE B 53  ? 0.4283 0.6629 0.4715 -0.0410 0.0239  -0.0107 189 ILE B O   
1833 C CB  . ILE B 53  ? 0.4319 0.6395 0.4791 -0.0337 0.0196  -0.0151 189 ILE B CB  
1834 C CG1 . ILE B 53  ? 0.4066 0.5768 0.4335 -0.0380 0.0179  -0.0154 189 ILE B CG1 
1835 C CG2 . ILE B 53  ? 0.4544 0.6891 0.5279 -0.0181 0.0217  -0.0208 189 ILE B CG2 
1836 C CD1 . ILE B 53  ? 0.4028 0.5876 0.4308 -0.0530 0.0152  -0.0142 189 ILE B CD1 
1837 N N   . LEU B 54  ? 0.4874 0.7170 0.5527 -0.0102 0.0240  -0.0182 190 LEU B N   
1838 C CA  . LEU B 54  ? 0.3683 0.6211 0.4401 -0.0087 0.0288  -0.0204 190 LEU B CA  
1839 C C   . LEU B 54  ? 0.4101 0.6820 0.4971 0.0019  0.0330  -0.0265 190 LEU B C   
1840 O O   . LEU B 54  ? 0.3429 0.6038 0.4331 0.0097  0.0309  -0.0297 190 LEU B O   
1841 C CB  . LEU B 54  ? 0.3059 0.5480 0.3715 -0.0033 0.0267  -0.0199 190 LEU B CB  
1842 C CG  . LEU B 54  ? 0.4823 0.7035 0.5297 -0.0089 0.0198  -0.0124 190 LEU B CG  
1843 C CD1 . LEU B 54  ? 0.5200 0.7404 0.5682 -0.0009 0.0148  -0.0113 190 LEU B CD1 
1844 C CD2 . LEU B 54  ? 0.5072 0.7305 0.5374 -0.0260 0.0223  -0.0089 190 LEU B CD2 
1845 N N   . PHE B 55  ? 0.3954 0.6945 0.4885 0.0029  0.0392  -0.0281 191 PHE B N   
1846 C CA  . PHE B 55  ? 0.3253 0.6401 0.4286 0.0187  0.0425  -0.0331 191 PHE B CA  
1847 C C   . PHE B 55  ? 0.4270 0.7367 0.5199 0.0304  0.0505  -0.0387 191 PHE B C   
1848 O O   . PHE B 55  ? 0.4884 0.8093 0.5762 0.0249  0.0576  -0.0389 191 PHE B O   
1849 C CB  . PHE B 55  ? 0.3071 0.6646 0.4276 0.0164  0.0440  -0.0310 191 PHE B CB  
1850 C CG  . PHE B 55  ? 0.4041 0.7634 0.5259 -0.0014 0.0361  -0.0249 191 PHE B CG  
1851 C CD1 . PHE B 55  ? 0.4952 0.8498 0.6038 -0.0246 0.0355  -0.0199 191 PHE B CD1 
1852 C CD2 . PHE B 55  ? 0.3857 0.7436 0.5135 0.0026  0.0289  -0.0241 191 PHE B CD2 
1853 C CE1 . PHE B 55  ? 0.5344 0.8786 0.6323 -0.0435 0.0288  -0.0147 191 PHE B CE1 
1854 C CE2 . PHE B 55  ? 0.4354 0.7882 0.5565 -0.0170 0.0223  -0.0188 191 PHE B CE2 
1855 C CZ  . PHE B 55  ? 0.4839 0.8282 0.5886 -0.0402 0.0228  -0.0143 191 PHE B CZ  
1856 N N   . VAL B 56  ? 0.3507 0.6376 0.4329 0.0438  0.0499  -0.0434 192 VAL B N   
1857 C CA  . VAL B 56  ? 0.3716 0.6437 0.4334 0.0560  0.0583  -0.0495 192 VAL B CA  
1858 C C   . VAL B 56  ? 0.4452 0.7206 0.5074 0.0799  0.0600  -0.0533 192 VAL B C   
1859 O O   . VAL B 56  ? 0.4220 0.6875 0.4865 0.0842  0.0512  -0.0520 192 VAL B O   
1860 C CB  . VAL B 56  ? 0.4237 0.6560 0.4580 0.0490  0.0557  -0.0518 192 VAL B CB  
1861 C CG1 . VAL B 56  ? 0.3494 0.5512 0.3481 0.0599  0.0643  -0.0587 192 VAL B CG1 
1862 C CG2 . VAL B 56  ? 0.4193 0.6550 0.4551 0.0305  0.0524  -0.0469 192 VAL B CG2 
1863 N N   . ASN B 57  ? 0.3751 0.6637 0.4335 0.0968  0.0713  -0.0578 193 ASN B N   
1864 C CA  . ASN B 57  ? 0.4201 0.7098 0.4754 0.1281  0.0734  -0.0616 193 ASN B CA  
1865 C C   . ASN B 57  ? 0.5333 0.7578 0.5386 0.1415  0.0770  -0.0684 193 ASN B C   
1866 O O   . ASN B 57  ? 0.6609 0.8606 0.6380 0.1360  0.0871  -0.0730 193 ASN B O   
1867 C CB  . ASN B 57  ? 0.4189 0.7647 0.4979 0.1446  0.0860  -0.0640 193 ASN B CB  
1868 C CG  . ASN B 57  ? 0.4675 0.8803 0.5902 0.1282  0.0815  -0.0569 193 ASN B CG  
1869 O OD1 . ASN B 57  ? 0.4604 0.8873 0.6006 0.1259  0.0685  -0.0510 193 ASN B OD1 
1870 N ND2 . ASN B 57  ? 0.5443 0.9945 0.6779 0.1127  0.0923  -0.0574 193 ASN B ND2 
1871 N N   . ARG B 58  ? 0.4879 0.6785 0.4746 0.1556  0.0680  -0.0687 194 ARG B N   
1872 C CA  . ARG B 58  ? 0.5594 0.6787 0.4869 0.1689  0.0710  -0.0752 194 ARG B CA  
1873 C C   . ARG B 58  ? 0.6644 0.7871 0.5842 0.2109  0.0809  -0.0802 194 ARG B C   
1874 O O   . ARG B 58  ? 0.7031 0.8930 0.6709 0.2282  0.0822  -0.0775 194 ARG B O   
1875 C CB  . ARG B 58  ? 0.5072 0.5801 0.4078 0.1637  0.0568  -0.0735 194 ARG B CB  
1876 C CG  . ARG B 58  ? 0.5843 0.6627 0.4973 0.1268  0.0489  -0.0698 194 ARG B CG  
1877 C CD  . ARG B 58  ? 0.7482 0.7906 0.6393 0.1234  0.0364  -0.0687 194 ARG B CD  
1878 N NE  . ARG B 58  ? 0.9327 0.8995 0.7550 0.1309  0.0371  -0.0742 194 ARG B NE  
1879 C CZ  . ARG B 58  ? 0.9457 0.8613 0.7279 0.1329  0.0271  -0.0744 194 ARG B CZ  
1880 N NH1 . ARG B 58  ? 0.9148 0.8517 0.7232 0.1282  0.0160  -0.0696 194 ARG B NH1 
1881 N NH2 . ARG B 58  ? 1.0696 0.9056 0.7775 0.1375  0.0281  -0.0795 194 ARG B NH2 
1882 N N   . PRO B 59  ? 0.7656 0.8167 0.6222 0.2271  0.0886  -0.0877 195 PRO B N   
1883 C CA  . PRO B 59  ? 0.7688 0.8079 0.6069 0.2758  0.0984  -0.0937 195 PRO B CA  
1884 C C   . PRO B 59  ? 0.7726 0.8336 0.6333 0.3113  0.0850  -0.0887 195 PRO B C   
1885 O O   . PRO B 59  ? 0.7678 0.8673 0.6488 0.3539  0.0926  -0.0911 195 PRO B O   
1886 C CB  . PRO B 59  ? 0.8872 0.8177 0.6341 0.2766  0.1036  -0.1012 195 PRO B CB  
1887 C CG  . PRO B 59  ? 0.8176 0.7366 0.5520 0.2270  0.1054  -0.1008 195 PRO B CG  
1888 C CD  . PRO B 59  ? 0.7673 0.7505 0.5654 0.1978  0.0917  -0.0915 195 PRO B CD  
1889 N N   . ASP B 60  ? 0.7846 0.8249 0.6416 0.2952  0.0658  -0.0820 196 ASP B N   
1890 C CA  . ASP B 60  ? 0.7677 0.8289 0.6443 0.3253  0.0502  -0.0756 196 ASP B CA  
1891 C C   . ASP B 60  ? 0.7666 0.9337 0.7252 0.3146  0.0438  -0.0671 196 ASP B C   
1892 O O   . ASP B 60  ? 0.7907 0.9857 0.7718 0.3283  0.0277  -0.0594 196 ASP B O   
1893 C CB  . ASP B 60  ? 0.7932 0.7771 0.6191 0.3117  0.0322  -0.0725 196 ASP B CB  
1894 C CG  . ASP B 60  ? 0.8372 0.8184 0.6693 0.2567  0.0279  -0.0704 196 ASP B CG  
1895 O OD1 . ASP B 60  ? 0.7400 0.7863 0.6251 0.2327  0.0334  -0.0683 196 ASP B OD1 
1896 O OD2 . ASP B 60  ? 0.8977 0.8097 0.6779 0.2385  0.0188  -0.0709 196 ASP B OD2 
1897 N N   . LYS B 61  ? 0.7134 0.9333 0.7088 0.2874  0.0556  -0.0680 197 LYS B N   
1898 C CA  . LYS B 61  ? 0.5917 0.9037 0.6531 0.2682  0.0525  -0.0609 197 LYS B CA  
1899 C C   . LYS B 61  ? 0.5451 0.8546 0.6178 0.2340  0.0354  -0.0528 197 LYS B C   
1900 O O   . LYS B 61  ? 0.6113 0.9850 0.7278 0.2178  0.0300  -0.0459 197 LYS B O   
1901 C CB  . LYS B 61  ? 0.6144 1.0046 0.7185 0.3046  0.0519  -0.0580 197 LYS B CB  
1902 C CG  . LYS B 61  ? 0.8397 1.2271 0.9280 0.3496  0.0699  -0.0675 197 LYS B CG  
1903 C CD  . LYS B 61  ? 1.0487 1.4555 1.1465 0.3900  0.0593  -0.0623 197 LYS B CD  
1904 C CE  . LYS B 61  ? 1.1831 1.5761 1.2614 0.4220  0.0766  -0.0699 197 LYS B CE  
1905 N NZ  . LYS B 61  ? 1.1965 1.6330 1.2969 0.3988  0.0982  -0.0758 197 LYS B NZ  
1906 N N   . LYS B 62  ? 0.5009 0.7363 0.5303 0.2198  0.0285  -0.0542 198 LYS B N   
1907 C CA  . LYS B 62  ? 0.4888 0.7198 0.5261 0.1843  0.0181  -0.0493 198 LYS B CA  
1908 C C   . LYS B 62  ? 0.4861 0.7364 0.5406 0.1527  0.0275  -0.0501 198 LYS B C   
1909 O O   . LYS B 62  ? 0.4543 0.6874 0.4924 0.1507  0.0391  -0.0555 198 LYS B O   
1910 C CB  . LYS B 62  ? 0.5217 0.6746 0.5077 0.1757  0.0103  -0.0517 198 LYS B CB  
1911 C CG  . LYS B 62  ? 0.5742 0.6864 0.5264 0.2055  -0.0014 -0.0505 198 LYS B CG  
1912 C CD  . LYS B 62  ? 0.6558 0.7024 0.5632 0.1826  -0.0116 -0.0509 198 LYS B CD  
1913 C CE  . LYS B 62  ? 0.8425 0.8287 0.6994 0.2093  -0.0245 -0.0497 198 LYS B CE  
1914 N NZ  . LYS B 62  ? 0.9309 0.8519 0.7384 0.1794  -0.0329 -0.0509 198 LYS B NZ  
1915 N N   . LYS B 63  ? 0.3802 0.6594 0.4612 0.1283  0.0215  -0.0444 199 LYS B N   
1916 C CA  . LYS B 63  ? 0.3732 0.6660 0.4666 0.1025  0.0279  -0.0438 199 LYS B CA  
1917 C C   . LYS B 63  ? 0.3733 0.6254 0.4488 0.0816  0.0246  -0.0450 199 LYS B C   
1918 O O   . LYS B 63  ? 0.3880 0.6213 0.4558 0.0762  0.0163  -0.0438 199 LYS B O   
1919 C CB  . LYS B 63  ? 0.3414 0.6893 0.4685 0.0887  0.0252  -0.0370 199 LYS B CB  
1920 C CG  . LYS B 63  ? 0.4024 0.8078 0.5532 0.1027  0.0323  -0.0367 199 LYS B CG  
1921 C CD  . LYS B 63  ? 0.4729 0.9256 0.6458 0.0759  0.0330  -0.0310 199 LYS B CD  
1922 C CE  . LYS B 63  ? 0.6286 1.1502 0.8275 0.0862  0.0419  -0.0316 199 LYS B CE  
1923 N NZ  . LYS B 63  ? 0.7882 1.3434 1.0050 0.1165  0.0352  -0.0301 199 LYS B NZ  
1924 N N   . ILE B 64  ? 0.3066 0.5491 0.3759 0.0699  0.0313  -0.0472 200 ILE B N   
1925 C CA  . ILE B 64  ? 0.3479 0.5671 0.4079 0.0528  0.0292  -0.0481 200 ILE B CA  
1926 C C   . ILE B 64  ? 0.3969 0.6364 0.4762 0.0391  0.0296  -0.0436 200 ILE B C   
1927 O O   . ILE B 64  ? 0.3902 0.6485 0.4771 0.0375  0.0337  -0.0413 200 ILE B O   
1928 C CB  . ILE B 64  ? 0.3213 0.5133 0.3550 0.0494  0.0336  -0.0529 200 ILE B CB  
1929 C CG1 . ILE B 64  ? 0.3798 0.5413 0.3821 0.0647  0.0353  -0.0575 200 ILE B CG1 
1930 C CG2 . ILE B 64  ? 0.2966 0.4736 0.3221 0.0336  0.0308  -0.0548 200 ILE B CG2 
1931 C CD1 . ILE B 64  ? 0.3964 0.5325 0.3669 0.0587  0.0419  -0.0616 200 ILE B CD1 
1932 N N   . LEU B 65  ? 0.3113 0.5407 0.3920 0.0292  0.0262  -0.0429 201 LEU B N   
1933 C CA  . LEU B 65  ? 0.2891 0.5241 0.3780 0.0198  0.0260  -0.0386 201 LEU B CA  
1934 C C   . LEU B 65  ? 0.3373 0.5621 0.4231 0.0182  0.0273  -0.0402 201 LEU B C   
1935 O O   . LEU B 65  ? 0.3258 0.5414 0.4062 0.0177  0.0281  -0.0451 201 LEU B O   
1936 C CB  . LEU B 65  ? 0.2724 0.5010 0.3608 0.0119  0.0221  -0.0364 201 LEU B CB  
1937 C CG  . LEU B 65  ? 0.3774 0.6214 0.4703 0.0107  0.0169  -0.0334 201 LEU B CG  
1938 C CD1 . LEU B 65  ? 0.3868 0.6245 0.4733 -0.0060 0.0132  -0.0289 201 LEU B CD1 
1939 C CD2 . LEU B 65  ? 0.3142 0.5935 0.4207 0.0177  0.0184  -0.0310 201 LEU B CD2 
1940 N N   . PHE B 66  ? 0.2988 0.5275 0.3865 0.0165  0.0270  -0.0357 202 PHE B N   
1941 C CA  . PHE B 66  ? 0.2623 0.4888 0.3506 0.0192  0.0257  -0.0347 202 PHE B CA  
1942 C C   . PHE B 66  ? 0.2772 0.4898 0.3600 0.0197  0.0230  -0.0291 202 PHE B C   
1943 O O   . PHE B 66  ? 0.3492 0.5572 0.4236 0.0118  0.0220  -0.0247 202 PHE B O   
1944 C CB  . PHE B 66  ? 0.2944 0.5311 0.3798 0.0182  0.0249  -0.0332 202 PHE B CB  
1945 C CG  . PHE B 66  ? 0.2992 0.5363 0.3765 0.0161  0.0279  -0.0389 202 PHE B CG  
1946 C CD1 . PHE B 66  ? 0.3077 0.5406 0.3773 0.0186  0.0317  -0.0412 202 PHE B CD1 
1947 C CD2 . PHE B 66  ? 0.3113 0.5524 0.3846 0.0114  0.0269  -0.0419 202 PHE B CD2 
1948 C CE1 . PHE B 66  ? 0.3349 0.5536 0.3851 0.0192  0.0344  -0.0464 202 PHE B CE1 
1949 C CE2 . PHE B 66  ? 0.2756 0.5049 0.3278 0.0045  0.0293  -0.0469 202 PHE B CE2 
1950 C CZ  . PHE B 66  ? 0.2786 0.4896 0.3153 0.0097  0.0329  -0.0493 202 PHE B CZ  
1951 N N   . PHE B 67  ? 0.3051 0.5102 0.3888 0.0289  0.0224  -0.0297 203 PHE B N   
1952 C CA  . PHE B 67  ? 0.3008 0.4814 0.3698 0.0345  0.0190  -0.0241 203 PHE B CA  
1953 C C   . PHE B 67  ? 0.4378 0.6198 0.4995 0.0325  0.0126  -0.0166 203 PHE B C   
1954 O O   . PHE B 67  ? 0.3715 0.5765 0.4444 0.0350  0.0102  -0.0162 203 PHE B O   
1955 C CB  . PHE B 67  ? 0.3120 0.4901 0.3862 0.0523  0.0206  -0.0269 203 PHE B CB  
1956 C CG  . PHE B 67  ? 0.4613 0.6030 0.5128 0.0650  0.0172  -0.0216 203 PHE B CG  
1957 C CD1 . PHE B 67  ? 0.4120 0.5092 0.4333 0.0581  0.0198  -0.0213 203 PHE B CD1 
1958 C CD2 . PHE B 67  ? 0.4620 0.6097 0.5167 0.0838  0.0101  -0.0163 203 PHE B CD2 
1959 C CE1 . PHE B 67  ? 0.5724 0.6208 0.5595 0.0698  0.0168  -0.0167 203 PHE B CE1 
1960 C CE2 . PHE B 67  ? 0.4834 0.5872 0.5093 0.1005  0.0057  -0.0110 203 PHE B CE2 
1961 C CZ  . PHE B 67  ? 0.6268 0.6755 0.6152 0.0936  0.0098  -0.0116 203 PHE B CZ  
1962 N N   . ASN B 68  ? 0.3830 0.5379 0.4201 0.0238  0.0097  -0.0107 204 ASN B N   
1963 C CA  . ASN B 68  ? 0.4333 0.5800 0.4546 0.0200  0.0029  -0.0032 204 ASN B CA  
1964 C C   . ASN B 68  ? 0.4724 0.5898 0.4772 0.0382  -0.0056 0.0027  204 ASN B C   
1965 O O   . ASN B 68  ? 0.4906 0.5632 0.4641 0.0394  -0.0073 0.0056  204 ASN B O   
1966 C CB  . ASN B 68  ? 0.4694 0.6020 0.4664 -0.0031 0.0039  0.0004  204 ASN B CB  
1967 C CG  . ASN B 68  ? 0.5612 0.6830 0.5361 -0.0120 -0.0022 0.0075  204 ASN B CG  
1968 O OD1 . ASN B 68  ? 0.5307 0.6584 0.5111 -0.0007 -0.0084 0.0104  204 ASN B OD1 
1969 N ND2 . ASN B 68  ? 0.4374 0.5464 0.3855 -0.0360 -0.0008 0.0107  204 ASN B ND2 
1970 N N   . ASP B 69  ? 0.4808 0.6225 0.5031 0.0528  -0.0116 0.0048  205 ASP B N   
1971 C CA  . ASP B 69  ? 0.5488 0.6698 0.5571 0.0741  -0.0229 0.0127  205 ASP B CA  
1972 C C   . ASP B 69  ? 0.6862 0.7768 0.6593 0.0611  -0.0332 0.0228  205 ASP B C   
1973 O O   . ASP B 69  ? 0.6366 0.7510 0.6154 0.0477  -0.0364 0.0253  205 ASP B O   
1974 C CB  . ASP B 69  ? 0.5328 0.7028 0.5755 0.0920  -0.0277 0.0128  205 ASP B CB  
1975 C CG  . ASP B 69  ? 0.6650 0.8228 0.6986 0.1206  -0.0413 0.0221  205 ASP B CG  
1976 O OD1 . ASP B 69  ? 0.7305 0.8291 0.7244 0.1292  -0.0462 0.0276  205 ASP B OD1 
1977 O OD2 . ASP B 69  ? 0.6555 0.8626 0.7188 0.1348  -0.0479 0.0243  205 ASP B OD2 
1978 N N   . LYS B 70  ? 0.7408 0.7723 0.6699 0.0629  -0.0380 0.0283  206 LYS B N   
1979 C CA  . LYS B 70  ? 0.7616 0.7543 0.6462 0.0451  -0.0475 0.0377  206 LYS B CA  
1980 C C   . LYS B 70  ? 0.8583 0.8311 0.7260 0.0684  -0.0657 0.0489  206 LYS B C   
1981 O O   . LYS B 70  ? 0.9277 0.8522 0.7466 0.0572  -0.0766 0.0583  206 LYS B O   
1982 C CB  . LYS B 70  ? 0.7828 0.7143 0.6161 0.0270  -0.0445 0.0386  206 LYS B CB  
1983 C CG  . LYS B 70  ? 0.7738 0.7314 0.6256 0.0047  -0.0293 0.0293  206 LYS B CG  
1984 C CD  . LYS B 70  ? 0.7849 0.6882 0.5822 -0.0218 -0.0279 0.0316  206 LYS B CD  
1985 C CE  . LYS B 70  ? 0.7940 0.7349 0.6137 -0.0450 -0.0159 0.0243  206 LYS B CE  
1986 N NZ  . LYS B 70  ? 0.8787 0.7797 0.6448 -0.0814 -0.0155 0.0278  206 LYS B NZ  
1987 N N   . SER B 71  ? 0.8298 0.8428 0.7367 0.0995  -0.0698 0.0485  207 SER B N   
1988 C CA  . SER B 71  ? 0.9505 0.9607 0.8510 0.1257  -0.0892 0.0602  207 SER B CA  
1989 C C   . SER B 71  ? 1.0253 1.0506 0.9181 0.1004  -0.0991 0.0678  207 SER B C   
1990 O O   . SER B 71  ? 1.1337 1.1108 0.9797 0.0959  -0.1140 0.0791  207 SER B O   
1991 C CB  . SER B 71  ? 0.8701 0.9428 0.8240 0.1593  -0.0898 0.0573  207 SER B CB  
1992 O OG  . SER B 71  ? 0.9185 0.9635 0.8669 0.1901  -0.0830 0.0523  207 SER B OG  
1993 N N   . CYS B 72  ? 0.9744 1.0592 0.9056 0.0821  -0.0906 0.0612  208 CYS B N   
1994 C CA  . CYS B 72  ? 0.9253 1.0160 0.8415 0.0523  -0.0943 0.0653  208 CYS B CA  
1995 C C   . CYS B 72  ? 0.9021 0.9717 0.7988 0.0210  -0.0774 0.0573  208 CYS B C   
1996 O O   . CYS B 72  ? 0.8753 0.9727 0.7996 0.0144  -0.0605 0.0457  208 CYS B O   
1997 C CB  . CYS B 72  ? 0.7753 0.9307 0.7303 0.0471  -0.0942 0.0629  208 CYS B CB  
1998 S SG  . CYS B 72  ? 1.0907 1.2866 1.0701 0.0794  -0.1172 0.0749  208 CYS B SG  
1999 N N   . GLN B 73  ? 0.7397 0.7589 0.5856 0.0030  -0.0833 0.0643  209 GLN B N   
2000 C CA  . GLN B 73  ? 0.7113 0.7193 0.5349 -0.0316 -0.0692 0.0587  209 GLN B CA  
2001 C C   . GLN B 73  ? 0.7186 0.7053 0.5020 -0.0550 -0.0782 0.0669  209 GLN B C   
2002 O O   . GLN B 73  ? 0.8399 0.7788 0.5816 -0.0501 -0.0970 0.0792  209 GLN B O   
2003 C CB  . GLN B 73  ? 0.8064 0.7673 0.5967 -0.0384 -0.0656 0.0583  209 GLN B CB  
2004 C CG  . GLN B 73  ? 0.9095 0.9005 0.7327 -0.0409 -0.0478 0.0464  209 GLN B CG  
2005 C CD  . GLN B 73  ? 0.9541 0.8981 0.7370 -0.0559 -0.0451 0.0470  209 GLN B CD  
2006 O OE1 . GLN B 73  ? 0.9480 0.8260 0.6759 -0.0562 -0.0572 0.0558  209 GLN B OE1 
2007 N NE2 . GLN B 73  ? 0.9521 0.9264 0.7567 -0.0696 -0.0306 0.0384  209 GLN B NE2 
2008 N N   . PHE B 74  ? 0.6579 0.6759 0.4495 -0.0786 -0.0650 0.0601  210 PHE B N   
2009 C CA  . PHE B 74  ? 0.6581 0.6555 0.4076 -0.1057 -0.0698 0.0659  210 PHE B CA  
2010 C C   . PHE B 74  ? 0.6893 0.7159 0.4440 -0.1323 -0.0454 0.0534  210 PHE B C   
2011 O O   . PHE B 74  ? 0.5995 0.6699 0.3964 -0.1228 -0.0307 0.0426  210 PHE B O   
2012 C CB  . PHE B 74  ? 0.6515 0.6615 0.4062 -0.0966 -0.0863 0.0741  210 PHE B CB  
2013 C CG  . PHE B 74  ? 0.7187 0.7082 0.4288 -0.1275 -0.0901 0.0793  210 PHE B CG  
2014 C CD1 . PHE B 74  ? 0.7923 0.7249 0.4453 -0.1385 -0.1087 0.0926  210 PHE B CD1 
2015 C CD2 . PHE B 74  ? 0.7305 0.7494 0.4476 -0.1462 -0.0748 0.0705  210 PHE B CD2 
2016 C CE1 . PHE B 74  ? 0.8265 0.7363 0.4325 -0.1709 -0.1123 0.0974  210 PHE B CE1 
2017 C CE2 . PHE B 74  ? 0.7312 0.7274 0.4020 -0.1767 -0.0763 0.0742  210 PHE B CE2 
2018 C CZ  . PHE B 74  ? 0.8454 0.7893 0.4619 -0.1905 -0.0953 0.0878  210 PHE B CZ  
2019 N N   . SER B 75  ? 0.7222 0.7244 0.4320 -0.1644 -0.0406 0.0544  211 SER B N   
2020 C CA  . SER B 75  ? 0.7414 0.7788 0.4575 -0.1872 -0.0151 0.0416  211 SER B CA  
2021 C C   . SER B 75  ? 0.7555 0.7672 0.4164 -0.2243 -0.0124 0.0441  211 SER B C   
2022 O O   . SER B 75  ? 0.8539 0.8123 0.4635 -0.2391 -0.0299 0.0560  211 SER B O   
2023 C CB  . SER B 75  ? 0.7264 0.7891 0.4643 -0.1895 0.0001  0.0334  211 SER B CB  
2024 O OG  . SER B 75  ? 0.8144 0.8402 0.5040 -0.2176 -0.0041 0.0392  211 SER B OG  
2025 N N   . VAL B 76  ? 0.7599 0.8049 0.4264 -0.2386 0.0100  0.0325  212 VAL B N   
2026 C CA  . VAL B 76  ? 0.7727 0.8001 0.3877 -0.2767 0.0182  0.0318  212 VAL B CA  
2027 C C   . VAL B 76  ? 0.8176 0.8972 0.4486 -0.2921 0.0508  0.0155  212 VAL B C   
2028 O O   . VAL B 76  ? 0.7652 0.8941 0.4488 -0.2679 0.0658  0.0050  212 VAL B O   
2029 C CB  . VAL B 76  ? 0.7667 0.7770 0.3590 -0.2814 0.0128  0.0345  212 VAL B CB  
2030 C CG1 . VAL B 76  ? 0.8073 0.7759 0.3827 -0.2689 -0.0216 0.0526  212 VAL B CG1 
2031 C CG2 . VAL B 76  ? 0.7192 0.7704 0.3533 -0.2601 0.0303  0.0219  212 VAL B CG2 
2032 N N   . ASP B 77  ? 0.9251 0.9958 0.5098 -0.3318 0.0613  0.0137  213 ASP B N   
2033 C CA  . ASP B 77  ? 0.8914 1.0204 0.4893 -0.3477 0.0946  -0.0026 213 ASP B CA  
2034 C C   . ASP B 77  ? 0.9016 1.0671 0.5364 -0.3191 0.1145  -0.0160 213 ASP B C   
2035 O O   . ASP B 77  ? 0.9135 1.0459 0.5341 -0.3093 0.1057  -0.0129 213 ASP B O   
2036 C CB  . ASP B 77  ? 0.9573 1.0640 0.4909 -0.3963 0.1030  -0.0029 213 ASP B CB  
2037 C CG  . ASP B 77  ? 1.0589 1.1172 0.5403 -0.4298 0.0838  0.0101  213 ASP B CG  
2038 O OD1 . ASP B 77  ? 0.9842 1.0433 0.4849 -0.4186 0.0728  0.0152  213 ASP B OD1 
2039 O OD2 . ASP B 77  ? 1.1812 1.1932 0.6080 -0.4627 0.0762  0.0130  213 ASP B OD2 
2040 N N   . GLU B 78  ? 0.6874 0.8989 0.6470 0.0083  -0.0446 -0.0485 214 GLU B N   
2041 C CA  . GLU B 78  ? 0.7394 0.9528 0.6646 0.0262  -0.0488 -0.0144 214 GLU B CA  
2042 C C   . GLU B 78  ? 0.5902 0.7694 0.5295 0.0551  -0.0342 0.0118  214 GLU B C   
2043 O O   . GLU B 78  ? 0.6437 0.8017 0.5523 0.0696  -0.0292 0.0283  214 GLU B O   
2044 C CB  . GLU B 78  ? 0.8195 1.0834 0.7456 0.0218  -0.0728 0.0084  214 GLU B CB  
2045 C CG  . GLU B 78  ? 1.0423 1.3118 0.9197 0.0287  -0.0799 0.0338  214 GLU B CG  
2046 C CD  . GLU B 78  ? 1.2638 1.5768 1.1544 0.0372  -0.1018 0.0727  214 GLU B CD  
2047 O OE1 . GLU B 78  ? 1.3223 1.6628 1.2635 0.0401  -0.1098 0.0802  214 GLU B OE1 
2048 O OE2 . GLU B 78  ? 1.3483 1.6701 1.2038 0.0414  -0.1108 0.0991  214 GLU B OE2 
2049 N N   . GLU B 79  ? 0.5726 0.7461 0.5561 0.0617  -0.0263 0.0151  215 GLU B N   
2050 C CA  . GLU B 79  ? 0.7101 0.8534 0.6975 0.0868  -0.0099 0.0350  215 GLU B CA  
2051 C C   . GLU B 79  ? 0.6242 0.7279 0.5792 0.0909  0.0012  0.0232  215 GLU B C   
2052 O O   . GLU B 79  ? 0.5907 0.6710 0.5217 0.1075  0.0083  0.0362  215 GLU B O   
2053 C CB  . GLU B 79  ? 0.8434 0.9904 0.8801 0.0893  -0.0008 0.0415  215 GLU B CB  
2054 C CG  . GLU B 79  ? 1.0504 1.1914 1.1163 0.0689  0.0002  0.0164  215 GLU B CG  
2055 C CD  . GLU B 79  ? 1.1862 1.3416 1.3109 0.0641  0.0044  0.0274  215 GLU B CD  
2056 O OE1 . GLU B 79  ? 1.2271 1.3933 1.3650 0.0809  0.0125  0.0563  215 GLU B OE1 
2057 O OE2 . GLU B 79  ? 1.2168 1.3717 1.3769 0.0429  0.0020  0.0062  215 GLU B OE2 
2058 N N   . PHE B 80  ? 0.5721 0.6700 0.5302 0.0749  0.0028  -0.0036 216 PHE B N   
2059 C CA  . PHE B 80  ? 0.4925 0.5637 0.4285 0.0770  0.0115  -0.0144 216 PHE B CA  
2060 C C   . PHE B 80  ? 0.5312 0.6027 0.4225 0.0725  0.0081  -0.0147 216 PHE B C   
2061 O O   . PHE B 80  ? 0.5458 0.5950 0.4175 0.0782  0.0143  -0.0124 216 PHE B O   
2062 C CB  . PHE B 80  ? 0.4686 0.5358 0.4320 0.0645  0.0174  -0.0421 216 PHE B CB  
2063 C CG  . PHE B 80  ? 0.5445 0.6041 0.5567 0.0690  0.0223  -0.0358 216 PHE B CG  
2064 C CD1 . PHE B 80  ? 0.5027 0.5532 0.5186 0.0868  0.0265  -0.0068 216 PHE B CD1 
2065 C CD2 . PHE B 80  ? 0.5294 0.5902 0.5834 0.0544  0.0245  -0.0585 216 PHE B CD2 
2066 C CE1 . PHE B 80  ? 0.4374 0.4844 0.4965 0.0898  0.0325  0.0061  216 PHE B CE1 
2067 C CE2 . PHE B 80  ? 0.5567 0.6070 0.6612 0.0575  0.0300  -0.0469 216 PHE B CE2 
2068 C CZ  . PHE B 80  ? 0.4368 0.4825 0.5430 0.0753  0.0338  -0.0107 216 PHE B CZ  
2069 N N   . GLN B 81  ? 0.5502 0.6496 0.4261 0.0606  -0.0030 -0.0147 217 GLN B N   
2070 C CA  . GLN B 81  ? 0.5140 0.6155 0.3473 0.0567  -0.0061 -0.0049 217 GLN B CA  
2071 C C   . GLN B 81  ? 0.5817 0.6610 0.4065 0.0774  -0.0059 0.0265  217 GLN B C   
2072 O O   . GLN B 81  ? 0.5799 0.6351 0.3798 0.0795  -0.0004 0.0334  217 GLN B O   
2073 C CB  . GLN B 81  ? 0.5451 0.6885 0.3605 0.0394  -0.0211 -0.0059 217 GLN B CB  
2074 C CG  . GLN B 81  ? 0.5806 0.7436 0.3902 0.0154  -0.0182 -0.0451 217 GLN B CG  
2075 C CD  . GLN B 81  ? 0.7001 0.9113 0.4946 -0.0042 -0.0372 -0.0503 217 GLN B CD  
2076 O OE1 . GLN B 81  ? 0.7079 0.9431 0.4787 -0.0025 -0.0528 -0.0193 217 GLN B OE1 
2077 N NE2 . GLN B 81  ? 0.7290 0.9547 0.5397 -0.0232 -0.0372 -0.0892 217 GLN B NE2 
2078 N N   . LYS B 82  ? 0.5757 0.6629 0.4256 0.0921  -0.0098 0.0440  218 LYS B N   
2079 C CA  . LYS B 82  ? 0.6486 0.7137 0.4948 0.1143  -0.0058 0.0699  218 LYS B CA  
2080 C C   . LYS B 82  ? 0.6116 0.6351 0.4509 0.1250  0.0094  0.0613  218 LYS B C   
2081 O O   . LYS B 82  ? 0.6424 0.6335 0.4618 0.1335  0.0150  0.0685  218 LYS B O   
2082 C CB  . LYS B 82  ? 0.7407 0.8318 0.6220 0.1293  -0.0105 0.0904  218 LYS B CB  
2083 C CG  . LYS B 82  ? 0.9796 1.0771 0.8578 0.1422  -0.0187 0.1217  218 LYS B CG  
2084 C CD  . LYS B 82  ? 1.1407 1.2907 1.0569 0.1463  -0.0338 0.1423  218 LYS B CD  
2085 C CE  . LYS B 82  ? 1.2524 1.4103 1.1706 0.1619  -0.0439 0.1800  218 LYS B CE  
2086 N NZ  . LYS B 82  ? 1.3006 1.4245 1.2425 0.1957  -0.0257 0.1976  218 LYS B NZ  
2087 N N   . LEU B 83  ? 0.5272 0.5521 0.3835 0.1224  0.0146  0.0463  219 LEU B N   
2088 C CA  . LEU B 83  ? 0.5713 0.5676 0.4188 0.1294  0.0246  0.0394  219 LEU B CA  
2089 C C   . LEU B 83  ? 0.6268 0.6032 0.4482 0.1182  0.0243  0.0275  219 LEU B C   
2090 O O   . LEU B 83  ? 0.5854 0.5334 0.3875 0.1238  0.0286  0.0271  219 LEU B O   
2091 C CB  . LEU B 83  ? 0.5813 0.5891 0.4571 0.1267  0.0274  0.0323  219 LEU B CB  
2092 C CG  . LEU B 83  ? 0.6485 0.6408 0.5205 0.1382  0.0357  0.0367  219 LEU B CG  
2093 C CD1 . LEU B 83  ? 0.6615 0.6525 0.5302 0.1564  0.0451  0.0522  219 LEU B CD1 
2094 C CD2 . LEU B 83  ? 0.6480 0.6518 0.5535 0.1333  0.0367  0.0358  219 LEU B CD2 
2095 N N   . TRP B 84  ? 0.5765 0.5701 0.3986 0.1007  0.0206  0.0155  220 TRP B N   
2096 C CA  . TRP B 84  ? 0.4897 0.4735 0.2937 0.0881  0.0230  0.0061  220 TRP B CA  
2097 C C   . TRP B 84  ? 0.6526 0.6133 0.4302 0.0898  0.0229  0.0220  220 TRP B C   
2098 O O   . TRP B 84  ? 0.6050 0.5405 0.3713 0.0863  0.0263  0.0189  220 TRP B O   
2099 C CB  . TRP B 84  ? 0.4895 0.5013 0.2959 0.0700  0.0235  -0.0097 220 TRP B CB  
2100 C CG  . TRP B 84  ? 0.5247 0.5363 0.3137 0.0553  0.0296  -0.0161 220 TRP B CG  
2101 C CD1 . TRP B 84  ? 0.5964 0.6046 0.3561 0.0470  0.0296  -0.0007 220 TRP B CD1 
2102 C CD2 . TRP B 84  ? 0.5206 0.5406 0.3268 0.0465  0.0384  -0.0365 220 TRP B CD2 
2103 N NE1 . TRP B 84  ? 0.5518 0.5661 0.3072 0.0315  0.0392  -0.0107 220 TRP B NE1 
2104 C CE2 . TRP B 84  ? 0.5746 0.5989 0.3601 0.0317  0.0449  -0.0341 220 TRP B CE2 
2105 C CE3 . TRP B 84  ? 0.5257 0.5513 0.3688 0.0510  0.0421  -0.0528 220 TRP B CE3 
2106 C CZ2 . TRP B 84  ? 0.5891 0.6278 0.3913 0.0210  0.0564  -0.0504 220 TRP B CZ2 
2107 C CZ3 . TRP B 84  ? 0.4885 0.5265 0.3506 0.0431  0.0517  -0.0680 220 TRP B CZ3 
2108 C CH2 . TRP B 84  ? 0.5356 0.5822 0.3780 0.0282  0.0593  -0.0680 220 TRP B CH2 
2109 N N   . ARG B 85  ? 0.5713 0.5414 0.3439 0.0941  0.0178  0.0406  221 ARG B N   
2110 C CA  . ARG B 85  ? 0.5646 0.5094 0.3206 0.0987  0.0180  0.0622  221 ARG B CA  
2111 C C   . ARG B 85  ? 0.6149 0.5175 0.3726 0.1167  0.0254  0.0637  221 ARG B C   
2112 O O   . ARG B 85  ? 0.6296 0.4959 0.3760 0.1164  0.0295  0.0706  221 ARG B O   
2113 C CB  . ARG B 85  ? 0.5791 0.5495 0.3372 0.1035  0.0082  0.0876  221 ARG B CB  
2114 C CG  . ARG B 85  ? 0.6586 0.6669 0.3975 0.0808  0.0011  0.0869  221 ARG B CG  
2115 C CD  . ARG B 85  ? 0.7688 0.8067 0.5024 0.0832  -0.0134 0.1186  221 ARG B CD  
2116 N NE  . ARG B 85  ? 0.9277 1.0168 0.6676 0.0734  -0.0258 0.1067  221 ARG B NE  
2117 C CZ  . ARG B 85  ? 1.0263 1.1394 0.7952 0.0856  -0.0372 0.1178  221 ARG B CZ  
2118 N NH1 . ARG B 85  ? 1.0626 1.1543 0.8564 0.1115  -0.0346 0.1418  221 ARG B NH1 
2119 N NH2 . ARG B 85  ? 1.0550 1.2144 0.8315 0.0709  -0.0497 0.1028  221 ARG B NH2 
2120 N N   . SER B 86  ? 0.6371 0.5436 0.4084 0.1308  0.0288  0.0560  222 SER B N   
2121 C CA  . SER B 86  ? 0.7152 0.5874 0.4819 0.1486  0.0389  0.0537  222 SER B CA  
2122 C C   . SER B 86  ? 0.7373 0.5823 0.4838 0.1386  0.0415  0.0324  222 SER B C   
2123 O O   . SER B 86  ? 0.7010 0.5130 0.4339 0.1484  0.0495  0.0237  222 SER B O   
2124 C CB  . SER B 86  ? 0.6717 0.5648 0.4567 0.1653  0.0443  0.0552  222 SER B CB  
2125 O OG  . SER B 86  ? 0.6955 0.6022 0.4803 0.1569  0.0432  0.0410  222 SER B OG  
2126 N N   . VAL B 87  ? 0.7473 0.6091 0.4936 0.1192  0.0350  0.0219  223 VAL B N   
2127 C CA  . VAL B 87  ? 0.7565 0.6020 0.4905 0.1073  0.0332  0.0046  223 VAL B CA  
2128 C C   . VAL B 87  ? 0.7938 0.6161 0.5204 0.0905  0.0332  0.0062  223 VAL B C   
2129 O O   . VAL B 87  ? 0.7768 0.6205 0.5107 0.0746  0.0314  0.0093  223 VAL B O   
2130 C CB  . VAL B 87  ? 0.6983 0.5776 0.4478 0.0978  0.0270  -0.0048 223 VAL B CB  
2131 C CG1 . VAL B 87  ? 0.5666 0.4380 0.3078 0.0864  0.0209  -0.0191 223 VAL B CG1 
2132 C CG2 . VAL B 87  ? 0.6071 0.5075 0.3705 0.1124  0.0281  0.0000  223 VAL B CG2 
2133 N N   . THR B 88  ? 0.8174 0.5946 0.5308 0.0939  0.0380  0.0035  224 THR B N   
2134 C CA  . THR B 88  ? 0.8266 0.5704 0.5377 0.0782  0.0401  0.0087  224 THR B CA  
2135 C C   . THR B 88  ? 0.7696 0.5187 0.4826 0.0512  0.0345  -0.0069 224 THR B C   
2136 O O   . THR B 88  ? 0.8355 0.5840 0.5421 0.0469  0.0287  -0.0286 224 THR B O   
2137 C CB  . THR B 88  ? 0.9915 0.6767 0.6945 0.0898  0.0487  0.0037  224 THR B CB  
2138 O OG1 . THR B 88  ? 1.0825 0.7678 0.7903 0.1192  0.0559  0.0145  224 THR B OG1 
2139 C CG2 . THR B 88  ? 1.0896 0.7360 0.7998 0.0774  0.0526  0.0198  224 THR B CG2 
2140 N N   . VAL B 89  ? 0.6967 0.4548 0.4187 0.0318  0.0362  0.0056  225 VAL B N   
2141 C CA  . VAL B 89  ? 0.7040 0.4687 0.4367 0.0046  0.0331  -0.0068 225 VAL B CA  
2142 C C   . VAL B 89  ? 0.7493 0.4811 0.4863 -0.0154 0.0401  0.0083  225 VAL B C   
2143 O O   . VAL B 89  ? 0.8837 0.6140 0.6343 -0.0411 0.0385  -0.0011 225 VAL B O   
2144 C CB  . VAL B 89  ? 0.6589 0.4830 0.4096 -0.0036 0.0320  -0.0095 225 VAL B CB  
2145 C CG1 . VAL B 89  ? 0.6225 0.4728 0.3779 0.0130  0.0241  -0.0232 225 VAL B CG1 
2146 C CG2 . VAL B 89  ? 0.6488 0.4973 0.3963 -0.0028 0.0408  0.0107  225 VAL B CG2 
2147 N N   . ASP B 90  ? 0.8499 0.5572 0.5801 -0.0045 0.0469  0.0351  226 ASP B N   
2148 C CA  . ASP B 90  ? 0.9714 0.6497 0.7082 -0.0232 0.0546  0.0597  226 ASP B CA  
2149 C C   . ASP B 90  ? 1.0346 0.6483 0.7803 -0.0356 0.0560  0.0450  226 ASP B C   
2150 O O   . ASP B 90  ? 1.0237 0.6174 0.7843 -0.0626 0.0610  0.0552  226 ASP B O   
2151 C CB  . ASP B 90  ? 1.0831 0.7532 0.8128 -0.0059 0.0584  0.0983  226 ASP B CB  
2152 C CG  . ASP B 90  ? 1.2238 0.8633 0.9525 0.0271  0.0570  0.0969  226 ASP B CG  
2153 O OD1 . ASP B 90  ? 1.3209 0.9226 1.0505 0.0333  0.0583  0.0681  226 ASP B OD1 
2154 O OD2 . ASP B 90  ? 1.2705 0.9278 0.9977 0.0461  0.0550  0.1243  226 ASP B OD2 
2155 N N   . SER B 91  ? 1.0349 0.6166 0.7713 -0.0179 0.0532  0.0192  227 SER B N   
2156 C CA  . SER B 91  ? 1.1855 0.7027 0.9249 -0.0294 0.0551  -0.0048 227 SER B CA  
2157 C C   . SER B 91  ? 1.1989 0.7362 0.9380 -0.0566 0.0427  -0.0410 227 SER B C   
2158 O O   . SER B 91  ? 1.2605 0.7513 1.0013 -0.0749 0.0408  -0.0668 227 SER B O   
2159 C CB  . SER B 91  ? 1.2733 0.7486 0.9989 0.0026  0.0615  -0.0194 227 SER B CB  
2160 O OG  . SER B 91  ? 1.2732 0.7995 0.9826 0.0250  0.0566  -0.0256 227 SER B OG  
2161 N N   . MET B 92  ? 1.1095 0.7168 0.8506 -0.0597 0.0333  -0.0429 228 MET B N   
2162 C CA  . MET B 92  ? 1.0285 0.6677 0.7737 -0.0791 0.0176  -0.0721 228 MET B CA  
2163 C C   . MET B 92  ? 1.0060 0.6757 0.7851 -0.1146 0.0139  -0.0682 228 MET B C   
2164 O O   . MET B 92  ? 1.0097 0.7130 0.8069 -0.1193 0.0236  -0.0428 228 MET B O   
2165 C CB  . MET B 92  ? 1.0001 0.6984 0.7378 -0.0591 0.0090  -0.0753 228 MET B CB  
2166 C CG  . MET B 92  ? 1.0359 0.7183 0.7436 -0.0275 0.0115  -0.0815 228 MET B CG  
2167 S SD  . MET B 92  ? 1.0833 0.8367 0.7939 -0.0135 -0.0001 -0.0812 228 MET B SD  
2168 C CE  . MET B 92  ? 0.7887 0.5578 0.4942 -0.0373 -0.0219 -0.1093 228 MET B CE  
2169 N N   . ASP B 93  ? 1.0159 0.6793 0.8029 -0.1406 0.0000  -0.0956 229 ASP B N   
2170 C CA  . ASP B 93  ? 1.0399 0.7477 0.8668 -0.1750 -0.0084 -0.0973 229 ASP B CA  
2171 C C   . ASP B 93  ? 0.9237 0.7138 0.7688 -0.1632 -0.0141 -0.0896 229 ASP B C   
2172 O O   . ASP B 93  ? 0.8654 0.6750 0.6898 -0.1372 -0.0227 -0.0964 229 ASP B O   
2173 C CB  . ASP B 93  ? 1.2273 0.9190 1.0542 -0.2028 -0.0288 -0.1335 229 ASP B CB  
2174 C CG  . ASP B 93  ? 1.4280 1.1203 1.3001 -0.2473 -0.0302 -0.1332 229 ASP B CG  
2175 O OD1 . ASP B 93  ? 1.5023 1.1767 1.3955 -0.2560 -0.0096 -0.1042 229 ASP B OD1 
2176 O OD2 . ASP B 93  ? 1.5316 1.2449 1.4179 -0.2755 -0.0526 -0.1602 229 ASP B OD2 
2177 N N   . GLU B 94  ? 0.9006 0.7379 0.7879 -0.1817 -0.0068 -0.0749 230 GLU B N   
2178 C CA  . GLU B 94  ? 0.8901 0.8028 0.8055 -0.1700 -0.0085 -0.0705 230 GLU B CA  
2179 C C   . GLU B 94  ? 0.9080 0.8581 0.8374 -0.1724 -0.0361 -0.0900 230 GLU B C   
2180 O O   . GLU B 94  ? 0.8890 0.8807 0.8250 -0.1490 -0.0429 -0.0880 230 GLU B O   
2181 C CB  . GLU B 94  ? 0.9329 0.8906 0.8948 -0.1913 0.0089  -0.0549 230 GLU B CB  
2182 C CG  . GLU B 94  ? 1.1111 1.0492 1.0533 -0.1870 0.0359  -0.0303 230 GLU B CG  
2183 C CD  . GLU B 94  ? 1.2517 1.2320 1.2331 -0.2136 0.0567  -0.0145 230 GLU B CD  
2184 O OE1 . GLU B 94  ? 1.2373 1.2620 1.2698 -0.2353 0.0508  -0.0233 230 GLU B OE1 
2185 O OE2 . GLU B 94  ? 1.3099 1.2840 1.2713 -0.2133 0.0789  0.0083  230 GLU B OE2 
2186 N N   . GLU B 95  ? 0.9396 0.8744 0.8745 -0.2026 -0.0531 -0.1078 231 GLU B N   
2187 C CA  . GLU B 95  ? 0.9324 0.9061 0.8749 -0.2111 -0.0847 -0.1263 231 GLU B CA  
2188 C C   . GLU B 95  ? 0.8878 0.8439 0.7750 -0.1806 -0.0949 -0.1349 231 GLU B C   
2189 O O   . GLU B 95  ? 0.8896 0.8972 0.7834 -0.1673 -0.1132 -0.1318 231 GLU B O   
2190 C CB  . GLU B 95  ? 0.9754 0.9262 0.9249 -0.2539 -0.1012 -0.1496 231 GLU B CB  
2191 C CG  . GLU B 95  ? 1.1009 1.0831 1.1171 -0.2899 -0.0940 -0.1390 231 GLU B CG  
2192 C CD  . GLU B 95  ? 1.2315 1.1672 1.2492 -0.2931 -0.0590 -0.1174 231 GLU B CD  
2193 O OE1 . GLU B 95  ? 1.2711 1.1458 1.2400 -0.2690 -0.0441 -0.1122 231 GLU B OE1 
2194 O OE2 . GLU B 95  ? 1.2528 1.2188 1.3224 -0.3195 -0.0463 -0.1023 231 GLU B OE2 
2195 N N   . LYS B 96  ? 0.8767 0.7620 0.7140 -0.1684 -0.0811 -0.1419 232 LYS B N   
2196 C CA  . LYS B 96  ? 0.8311 0.6971 0.6157 -0.1397 -0.0844 -0.1499 232 LYS B CA  
2197 C C   . LYS B 96  ? 0.8968 0.8040 0.6897 -0.1060 -0.0783 -0.1260 232 LYS B C   
2198 O O   . LYS B 96  ? 0.8195 0.7478 0.5903 -0.0883 -0.0902 -0.1262 232 LYS B O   
2199 C CB  . LYS B 96  ? 0.9229 0.7077 0.6676 -0.1302 -0.0646 -0.1585 232 LYS B CB  
2200 C CG  . LYS B 96  ? 1.0970 0.8589 0.7864 -0.1071 -0.0662 -0.1752 232 LYS B CG  
2201 C CD  . LYS B 96  ? 1.2540 0.9336 0.9140 -0.1013 -0.0469 -0.1910 232 LYS B CD  
2202 C CE  . LYS B 96  ? 1.3413 1.0054 0.9481 -0.0762 -0.0429 -0.2089 232 LYS B CE  
2203 N NZ  . LYS B 96  ? 1.4438 1.0276 1.0281 -0.0681 -0.0217 -0.2294 232 LYS B NZ  
2204 N N   . ILE B 97  ? 0.8113 0.7295 0.6349 -0.0989 -0.0590 -0.1058 233 ILE B N   
2205 C CA  . ILE B 97  ? 0.7219 0.6763 0.5608 -0.0714 -0.0517 -0.0883 233 ILE B CA  
2206 C C   . ILE B 97  ? 0.7162 0.7362 0.5961 -0.0713 -0.0702 -0.0843 233 ILE B C   
2207 O O   . ILE B 97  ? 0.6374 0.6779 0.5147 -0.0484 -0.0768 -0.0755 233 ILE B O   
2208 C CB  . ILE B 97  ? 0.7663 0.7237 0.6270 -0.0702 -0.0278 -0.0739 233 ILE B CB  
2209 C CG1 . ILE B 97  ? 0.6986 0.5978 0.5200 -0.0626 -0.0124 -0.0685 233 ILE B CG1 
2210 C CG2 . ILE B 97  ? 0.5930 0.5940 0.4809 -0.0483 -0.0210 -0.0642 233 ILE B CG2 
2211 C CD1 . ILE B 97  ? 0.6613 0.5649 0.4936 -0.0668 0.0079  -0.0518 233 ILE B CD1 
2212 N N   . GLU B 98  ? 0.7598 0.8145 0.6836 -0.0970 -0.0784 -0.0872 234 GLU B N   
2213 C CA  . GLU B 98  ? 0.7588 0.8821 0.7329 -0.0977 -0.0988 -0.0805 234 GLU B CA  
2214 C C   . GLU B 98  ? 0.7482 0.8823 0.6903 -0.0956 -0.1298 -0.0849 234 GLU B C   
2215 O O   . GLU B 98  ? 0.6447 0.8269 0.6122 -0.0791 -0.1449 -0.0686 234 GLU B O   
2216 C CB  . GLU B 98  ? 0.8439 1.0045 0.8736 -0.1296 -0.1025 -0.0837 234 GLU B CB  
2217 C CG  . GLU B 98  ? 0.9455 1.1086 1.0073 -0.1337 -0.0699 -0.0767 234 GLU B CG  
2218 C CD  . GLU B 98  ? 1.1058 1.3032 1.2208 -0.1690 -0.0698 -0.0783 234 GLU B CD  
2219 O OE1 . GLU B 98  ? 1.1639 1.3437 1.2680 -0.1986 -0.0886 -0.0906 234 GLU B OE1 
2220 O OE2 . GLU B 98  ? 1.1574 1.4004 1.3273 -0.1684 -0.0493 -0.0694 234 GLU B OE2 
2221 N N   . GLU B 99  ? 0.7156 0.8055 0.6024 -0.1124 -0.1385 -0.1065 235 GLU B N   
2222 C CA  . GLU B 99  ? 0.7787 0.8806 0.6221 -0.1137 -0.1664 -0.1155 235 GLU B CA  
2223 C C   . GLU B 99  ? 0.8021 0.9020 0.6159 -0.0772 -0.1594 -0.0976 235 GLU B C   
2224 O O   . GLU B 99  ? 0.7341 0.8808 0.5504 -0.0672 -0.1806 -0.0813 235 GLU B O   
2225 C CB  . GLU B 99  ? 0.9669 1.0116 0.7504 -0.1365 -0.1700 -0.1499 235 GLU B CB  
2226 C CG  . GLU B 99  ? 1.2005 1.2554 0.9217 -0.1350 -0.1933 -0.1633 235 GLU B CG  
2227 C CD  . GLU B 99  ? 1.4352 1.4265 1.0921 -0.1541 -0.1910 -0.2054 235 GLU B CD  
2228 O OE1 . GLU B 99  ? 1.5400 1.4807 1.2106 -0.1741 -0.1775 -0.2235 235 GLU B OE1 
2229 O OE2 . GLU B 99  ? 1.4869 1.4782 1.0797 -0.1491 -0.2009 -0.2204 235 GLU B OE2 
2230 N N   . TYR B 100 ? 0.7763 0.8255 0.5674 -0.0583 -0.1304 -0.0964 236 TYR B N   
2231 C CA  . TYR B 100 ? 0.7373 0.7823 0.5073 -0.0264 -0.1203 -0.0794 236 TYR B CA  
2232 C C   . TYR B 100 ? 0.6992 0.7977 0.5248 -0.0091 -0.1256 -0.0508 236 TYR B C   
2233 O O   . TYR B 100 ? 0.6528 0.7736 0.4678 0.0073  -0.1359 -0.0325 236 TYR B O   
2234 C CB  . TYR B 100 ? 0.6762 0.6701 0.4323 -0.0116 -0.0900 -0.0799 236 TYR B CB  
2235 C CG  . TYR B 100 ? 0.7208 0.7163 0.4654 0.0180  -0.0800 -0.0617 236 TYR B CG  
2236 C CD1 . TYR B 100 ? 0.7558 0.7329 0.4458 0.0287  -0.0788 -0.0658 236 TYR B CD1 
2237 C CD2 . TYR B 100 ? 0.6032 0.6206 0.3942 0.0335  -0.0704 -0.0422 236 TYR B CD2 
2238 C CE1 . TYR B 100 ? 0.7226 0.7054 0.4080 0.0531  -0.0683 -0.0459 236 TYR B CE1 
2239 C CE2 . TYR B 100 ? 0.5868 0.6047 0.3744 0.0563  -0.0621 -0.0256 236 TYR B CE2 
2240 C CZ  . TYR B 100 ? 0.6889 0.6910 0.4255 0.0656  -0.0612 -0.0249 236 TYR B CZ  
2241 O OH  . TYR B 100 ? 0.6119 0.6178 0.3505 0.0861  -0.0511 -0.0051 236 TYR B OH  
2242 N N   . LEU B 101 ? 0.6464 0.7629 0.5321 -0.0120 -0.1152 -0.0463 237 LEU B N   
2243 C CA  . LEU B 101 ? 0.5739 0.7351 0.5233 0.0058  -0.1148 -0.0242 237 LEU B CA  
2244 C C   . LEU B 101 ? 0.6196 0.8377 0.5943 0.0043  -0.1473 -0.0076 237 LEU B C   
2245 O O   . LEU B 101 ? 0.5818 0.8243 0.5791 0.0263  -0.1538 0.0185  237 LEU B O   
2246 C CB  . LEU B 101 ? 0.5445 0.7185 0.5504 -0.0011 -0.0956 -0.0298 237 LEU B CB  
2247 C CG  . LEU B 101 ? 0.5664 0.6933 0.5454 0.0013  -0.0661 -0.0401 237 LEU B CG  
2248 C CD1 . LEU B 101 ? 0.5154 0.6614 0.5395 -0.0097 -0.0467 -0.0461 237 LEU B CD1 
2249 C CD2 . LEU B 101 ? 0.5117 0.6216 0.4810 0.0276  -0.0544 -0.0306 237 LEU B CD2 
2250 N N   . LYS B 102 ? 0.6215 0.8616 0.5935 -0.0230 -0.1696 -0.0203 238 LYS B N   
2251 C CA  . LYS B 102 ? 0.8282 1.1308 0.8211 -0.0275 -0.2062 -0.0033 238 LYS B CA  
2252 C C   . LYS B 102 ? 0.6840 0.9824 0.6059 -0.0189 -0.2236 0.0061  238 LYS B C   
2253 O O   . LYS B 102 ? 0.7131 1.0566 0.6553 -0.0029 -0.2425 0.0390  238 LYS B O   
2254 C CB  . LYS B 102 ? 0.9371 1.2677 0.9454 -0.0641 -0.2279 -0.0226 238 LYS B CB  
2255 C CG  . LYS B 102 ? 1.0353 1.4244 1.1452 -0.0668 -0.2279 -0.0100 238 LYS B CG  
2256 C CD  . LYS B 102 ? 1.0941 1.4926 1.2251 -0.1058 -0.2324 -0.0333 238 LYS B CD  
2257 C CE  . LYS B 102 ? 0.9931 1.4277 1.2166 -0.1039 -0.2096 -0.0256 238 LYS B CE  
2258 N NZ  . LYS B 102 ? 0.9614 1.3822 1.1936 -0.1405 -0.1982 -0.0474 238 LYS B NZ  
2259 N N   . ARG B 103 ? 0.7192 0.9647 0.5604 -0.0284 -0.2153 -0.0207 239 ARG B N   
2260 C CA  . ARG B 103 ? 0.8790 1.1157 0.6455 -0.0185 -0.2215 -0.0157 239 ARG B CA  
2261 C C   . ARG B 103 ? 0.8728 1.1189 0.6575 0.0154  -0.2101 0.0235  239 ARG B C   
2262 O O   . ARG B 103 ? 1.0129 1.2905 0.7698 0.0238  -0.2273 0.0486  239 ARG B O   
2263 C CB  . ARG B 103 ? 0.9226 1.0889 0.6167 -0.0238 -0.1984 -0.0507 239 ARG B CB  
2264 C CG  . ARG B 103 ? 0.8591 1.0096 0.4988 -0.0554 -0.2141 -0.0906 239 ARG B CG  
2265 C CD  . ARG B 103 ? 0.9510 1.0228 0.5383 -0.0519 -0.1826 -0.1212 239 ARG B CD  
2266 N NE  . ARG B 103 ? 1.0539 1.1004 0.5715 -0.0744 -0.1915 -0.1626 239 ARG B NE  
2267 C CZ  . ARG B 103 ? 1.1342 1.1770 0.5781 -0.0658 -0.1890 -0.1725 239 ARG B CZ  
2268 N NH1 . ARG B 103 ? 0.9938 1.0586 0.4279 -0.0362 -0.1791 -0.1381 239 ARG B NH1 
2269 N NH2 . ARG B 103 ? 1.2826 1.2999 0.6630 -0.0883 -0.1948 -0.2181 239 ARG B NH2 
2270 N N   . GLN B 104 ? 0.7273 0.9463 0.5571 0.0324  -0.1811 0.0288  240 GLN B N   
2271 C CA  . GLN B 104 ? 0.6505 0.8687 0.5025 0.0610  -0.1672 0.0607  240 GLN B CA  
2272 C C   . GLN B 104 ? 0.6236 0.8882 0.5637 0.0745  -0.1774 0.0929  240 GLN B C   
2273 O O   . GLN B 104 ? 0.6098 0.8745 0.5804 0.0971  -0.1684 0.1222  240 GLN B O   
2274 C CB  . GLN B 104 ? 0.6405 0.8056 0.4915 0.0712  -0.1321 0.0471  240 GLN B CB  
2275 C CG  . GLN B 104 ? 0.6418 0.7584 0.4187 0.0636  -0.1183 0.0192  240 GLN B CG  
2276 C CD  . GLN B 104 ? 0.6867 0.8021 0.3991 0.0720  -0.1201 0.0286  240 GLN B CD  
2277 O OE1 . GLN B 104 ? 0.7192 0.8737 0.4138 0.0690  -0.1433 0.0447  240 GLN B OE1 
2278 N NE2 . GLN B 104 ? 0.6865 0.7619 0.3644 0.0823  -0.0950 0.0199  240 GLN B NE2 
2279 N N   . GLY B 105 ? 0.6207 0.9247 0.6078 0.0607  -0.1952 0.0880  241 GLY B N   
2280 C CA  . GLY B 105 ? 0.6652 1.0188 0.7453 0.0754  -0.2050 0.1181  241 GLY B CA  
2281 C C   . GLY B 105 ? 0.6184 0.9581 0.7732 0.0866  -0.1744 0.1081  241 GLY B C   
2282 O O   . GLY B 105 ? 0.6060 0.9686 0.8386 0.1083  -0.1710 0.1328  241 GLY B O   
2283 N N   . ILE B 106 ? 0.5968 0.8996 0.7286 0.0719  -0.1515 0.0722  242 ILE B N   
2284 C CA  . ILE B 106 ? 0.5970 0.8887 0.7843 0.0785  -0.1204 0.0575  242 ILE B CA  
2285 C C   . ILE B 106 ? 0.5859 0.8858 0.7809 0.0535  -0.1131 0.0305  242 ILE B C   
2286 O O   . ILE B 106 ? 0.5044 0.8527 0.7404 0.0407  -0.1312 0.0340  242 ILE B O   
2287 C CB  . ILE B 106 ? 0.6357 0.8710 0.7860 0.0882  -0.0924 0.0462  242 ILE B CB  
2288 C CG1 . ILE B 106 ? 0.5028 0.6974 0.5644 0.0722  -0.0918 0.0282  242 ILE B CG1 
2289 C CG2 . ILE B 106 ? 0.6786 0.9072 0.8417 0.1124  -0.0934 0.0749  242 ILE B CG2 
2290 C CD1 . ILE B 106 ? 0.5373 0.6864 0.5623 0.0836  -0.0715 0.0252  242 ILE B CD1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -2  ?   ?   ?   A . n 
A 1 2   SER 2   -1  ?   ?   ?   A . n 
A 1 3   HIS 3   0   ?   ?   ?   A . n 
A 1 4   MET 4   1   ?   ?   ?   A . n 
A 1 5   ALA 5   2   ?   ?   ?   A . n 
A 1 6   ASP 6   3   ?   ?   ?   A . n 
A 1 7   PRO 7   4   ?   ?   ?   A . n 
A 1 8   ASP 8   5   ?   ?   ?   A . n 
A 1 9   VAL 9   6   ?   ?   ?   A . n 
A 1 10  LEU 10  7   ?   ?   ?   A . n 
A 1 11  THR 11  8   ?   ?   ?   A . n 
A 1 12  GLU 12  9   ?   ?   ?   A . n 
A 1 13  VAL 13  10  10  VAL VAL A . n 
A 1 14  PRO 14  11  11  PRO PRO A . n 
A 1 15  ALA 15  12  12  ALA ALA A . n 
A 1 16  ALA 16  13  13  ALA ALA A . n 
A 1 17  LEU 17  14  14  LEU LEU A . n 
A 1 18  LYS 18  15  15  LYS LYS A . n 
A 1 19  ARG 19  16  16  ARG ARG A . n 
A 1 20  LEU 20  17  17  LEU LEU A . n 
A 1 21  ALA 21  18  18  ALA ALA A . n 
A 1 22  LYS 22  19  19  LYS LYS A . n 
A 1 23  TYR 23  20  20  TYR TYR A . n 
A 1 24  VAL 24  21  21  VAL VAL A . n 
A 1 25  ILE 25  22  22  ILE ILE A . n 
A 1 26  ARG 26  23  23  ARG ARG A . n 
A 1 27  GLY 27  24  24  GLY GLY A . n 
A 1 28  PHE 28  25  25  PHE PHE A . n 
A 1 29  TYR 29  26  26  TYR TYR A . n 
A 1 30  GLY 30  27  27  GLY GLY A . n 
A 1 31  ILE 31  28  28  ILE ILE A . n 
A 1 32  GLU 32  29  29  GLU GLU A . n 
A 1 33  HIS 33  30  30  HIS HIS A . n 
A 1 34  ALA 34  31  31  ALA ALA A . n 
A 1 35  LEU 35  32  32  LEU LEU A . n 
A 1 36  ALA 36  33  33  ALA ALA A . n 
A 1 37  LEU 37  34  34  LEU LEU A . n 
A 1 38  ASP 38  35  35  ASP ASP A . n 
A 1 39  ILE 39  36  36  ILE ILE A . n 
A 1 40  LEU 40  37  37  LEU LEU A . n 
A 1 41  ILE 41  38  38  ILE ILE A . n 
A 1 42  ARG 42  39  39  ARG ARG A . n 
A 1 43  ASN 43  40  40  ASN ASN A . n 
A 1 44  SER 44  41  41  SER SER A . n 
A 1 45  CYS 45  42  42  CYS CYS A . n 
A 1 46  VAL 46  43  43  VAL VAL A . n 
A 1 47  LYS 47  44  44  LYS LYS A . n 
A 1 48  GLU 48  45  45  GLU GLU A . n 
A 1 49  GLU 49  46  46  GLU GLU A . n 
A 1 50  ASP 50  47  47  ASP ASP A . n 
A 1 51  MET 51  48  48  MET MET A . n 
A 1 52  LEU 52  49  49  LEU LEU A . n 
A 1 53  GLU 53  50  50  GLU GLU A . n 
A 1 54  LEU 54  51  51  LEU LEU A . n 
A 1 55  LEU 55  52  52  LEU LEU A . n 
A 1 56  LYS 56  53  53  LYS LYS A . n 
A 1 57  PHE 57  54  54  PHE PHE A . n 
A 1 58  ASP 58  55  55  ASP ASP A . n 
A 1 59  ARG 59  56  56  ARG ARG A . n 
A 1 60  LYS 60  57  57  LYS LYS A . n 
A 1 61  GLN 61  58  58  GLN GLN A . n 
A 1 62  LEU 62  59  59  LEU LEU A . n 
A 1 63  ARG 63  60  60  ARG ARG A . n 
A 1 64  SER 64  61  61  SER SER A . n 
A 1 65  VAL 65  62  62  VAL VAL A . n 
A 1 66  LEU 66  63  63  LEU LEU A . n 
A 1 67  ASN 67  64  64  ASN ASN A . n 
A 1 68  ASN 68  65  65  ASN ASN A . n 
A 1 69  LEU 69  66  66  LEU LEU A . n 
A 1 70  LYS 70  67  67  LYS LYS A . n 
A 1 71  GLY 71  68  68  GLY GLY A . n 
A 1 72  ASP 72  69  69  ASP ASP A . n 
A 1 73  LYS 73  70  70  LYS LYS A . n 
A 1 74  PHE 74  71  71  PHE PHE A . n 
A 1 75  ILE 75  72  72  ILE ILE A . n 
A 1 76  LYS 76  73  73  LYS LYS A . n 
A 1 77  CYS 77  74  74  CYS CYS A . n 
A 1 78  ARG 78  75  75  ARG ARG A . n 
A 1 79  MET 79  76  76  MET MET A . n 
A 1 80  ARG 80  77  77  ARG ARG A . n 
A 1 81  VAL 81  78  78  VAL VAL A . n 
A 1 82  GLU 82  79  79  GLU GLU A . n 
A 1 83  THR 83  80  80  THR THR A . n 
A 1 84  ALA 84  81  81  ALA ALA A . n 
A 1 85  ALA 85  82  82  ALA ALA A . n 
A 1 86  ASP 86  83  83  ASP ASP A . n 
A 1 87  GLY 87  84  84  GLY GLY A . n 
A 1 88  LYS 88  85  85  LYS LYS A . n 
A 1 89  THR 89  86  86  THR THR A . n 
A 1 90  THR 90  87  87  THR THR A . n 
A 1 91  ARG 91  88  88  ARG ARG A . n 
A 1 92  HIS 92  89  89  HIS HIS A . n 
A 1 93  ASN 93  90  90  ASN ASN A . n 
A 1 94  TYR 94  91  91  TYR TYR A . n 
A 1 95  TYR 95  92  92  TYR TYR A . n 
A 1 96  PHE 96  93  93  PHE PHE A . n 
A 1 97  ILE 97  94  94  ILE ILE A . n 
A 1 98  ASN 98  95  95  ASN ASN A . n 
A 1 99  TYR 99  96  96  TYR TYR A . n 
A 1 100 ARG 100 97  97  ARG ARG A . n 
A 1 101 THR 101 98  98  THR THR A . n 
A 1 102 LEU 102 99  99  LEU LEU A . n 
A 1 103 VAL 103 100 100 VAL VAL A . n 
A 1 104 ASN 104 101 101 ASN ASN A . n 
A 1 105 VAL 105 102 102 VAL VAL A . n 
A 1 106 VAL 106 103 103 VAL VAL A . n 
A 1 107 LYS 107 104 104 LYS LYS A . n 
A 1 108 TYR 108 105 105 TYR TYR A . n 
A 1 109 LYS 109 106 106 LYS LYS A . n 
A 1 110 LEU 110 107 107 LEU LEU A . n 
A 1 111 ASP 111 108 108 ASP ASP A . n 
A 1 112 HIS 112 109 109 HIS HIS A . n 
A 1 113 MET 113 110 110 MET MET A . n 
A 1 114 ARG 114 111 111 ARG ARG A . n 
A 1 115 ARG 115 112 112 ARG ARG A . n 
A 1 116 ARG 116 113 113 ARG ARG A . n 
A 1 117 ILE 117 114 114 ILE ILE A . n 
A 1 118 GLU 118 115 115 GLU GLU A . n 
A 1 119 THR 119 116 116 THR THR A . n 
A 1 120 ASP 120 117 117 ASP ASP A . n 
A 1 121 GLU 121 118 118 GLU GLU A . n 
A 1 122 ARG 122 119 119 ARG ARG A . n 
A 1 123 ASP 123 120 120 ASP ASP A . n 
A 1 124 SER 124 121 121 SER SER A . n 
A 1 125 THR 125 122 122 THR THR A . n 
A 1 126 ASN 126 123 123 ASN ASN A . n 
A 1 127 ARG 127 124 124 ARG ARG A . n 
A 1 128 ALA 128 125 125 ALA ALA A . n 
A 1 129 SER 129 126 126 SER SER A . n 
A 1 130 PHE 130 127 127 PHE PHE A . n 
A 1 131 LYS 131 128 128 LYS LYS A . n 
A 1 132 CYS 132 129 129 CYS CYS A . n 
A 1 133 PRO 133 130 130 PRO PRO A . n 
A 1 134 VAL 134 131 131 VAL VAL A . n 
A 1 135 CYS 135 132 132 CYS CYS A . n 
A 1 136 SER 136 133 133 SER SER A . n 
A 1 137 SER 137 134 134 SER SER A . n 
A 1 138 THR 138 135 135 THR THR A . n 
A 1 139 PHE 139 136 136 PHE PHE A . n 
A 1 140 THR 140 137 137 THR THR A . n 
A 1 141 ASP 141 138 138 ASP ASP A . n 
A 1 142 LEU 142 139 139 LEU LEU A . n 
A 1 143 GLU 143 140 140 GLU GLU A . n 
A 1 144 ALA 144 141 141 ALA ALA A . n 
A 1 145 ASN 145 142 142 ASN ASN A . n 
A 1 146 GLN 146 143 143 GLN GLN A . n 
A 1 147 LEU 147 144 144 LEU LEU A . n 
A 1 148 PHE 148 145 145 PHE PHE A . n 
A 1 149 ASP 149 146 146 ASP ASP A . n 
A 1 150 PRO 150 147 147 PRO PRO A . n 
A 1 151 MET 151 148 148 MET MET A . n 
A 1 152 THR 152 149 149 THR THR A . n 
A 1 153 GLY 153 150 150 GLY GLY A . n 
A 1 154 THR 154 151 151 THR THR A . n 
A 1 155 PHE 155 152 152 PHE PHE A . n 
A 1 156 ARG 156 153 153 ARG ARG A . n 
A 1 157 CYS 157 154 154 CYS CYS A . n 
A 1 158 THR 158 155 155 THR THR A . n 
A 1 159 PHE 159 156 156 PHE PHE A . n 
A 1 160 CYS 160 157 157 CYS CYS A . n 
A 1 161 HIS 161 158 158 HIS HIS A . n 
A 1 162 THR 162 159 159 THR THR A . n 
A 1 163 GLU 163 160 160 GLU GLU A . n 
A 1 164 VAL 164 161 161 VAL VAL A . n 
A 1 165 GLU 165 162 162 GLU GLU A . n 
A 1 166 GLU 166 163 163 GLU GLU A . n 
A 1 167 ASP 167 164 164 ASP ASP A . n 
A 1 168 GLU 168 165 ?   ?   ?   A . n 
A 1 169 SER 169 166 ?   ?   ?   A . n 
A 1 170 ALA 170 167 ?   ?   ?   A . n 
A 1 171 MET 171 168 ?   ?   ?   A . n 
A 1 172 PRO 172 169 ?   ?   ?   A . n 
A 1 173 LYS 173 170 ?   ?   ?   A . n 
A 1 174 LYS 174 171 ?   ?   ?   A . n 
A 1 175 ASP 175 172 ?   ?   ?   A . n 
A 1 176 ALA 176 173 ?   ?   ?   A . n 
A 1 177 ARG 177 174 ?   ?   ?   A . n 
A 1 178 THR 178 175 175 THR THR A . n 
A 1 179 LEU 179 176 176 LEU LEU A . n 
A 1 180 LEU 180 177 177 LEU LEU A . n 
A 1 181 ALA 181 178 178 ALA ALA A . n 
A 1 182 ARG 182 179 179 ARG ARG A . n 
A 1 183 PHE 183 180 180 PHE PHE A . n 
A 1 184 ASN 184 181 181 ASN ASN A . n 
A 1 185 GLU 185 182 182 GLU GLU A . n 
A 1 186 GLN 186 183 183 GLN GLN A . n 
A 1 187 ILE 187 184 184 ILE ILE A . n 
A 1 188 GLU 188 185 185 GLU GLU A . n 
A 1 189 PRO 189 186 186 PRO PRO A . n 
A 1 190 ILE 190 187 187 ILE ILE A . n 
A 1 191 TYR 191 188 188 TYR TYR A . n 
A 1 192 ALA 192 189 189 ALA ALA A . n 
A 1 193 LEU 193 190 190 LEU LEU A . n 
A 1 194 LEU 194 191 191 LEU LEU A . n 
A 1 195 ARG 195 192 192 ARG ARG A . n 
A 1 196 GLU 196 193 193 GLU GLU A . n 
A 1 197 THR 197 194 194 THR THR A . n 
A 1 198 GLU 198 195 195 GLU GLU A . n 
A 1 199 ASP 199 196 196 ASP ASP A . n 
A 1 200 VAL 200 197 ?   ?   ?   A . n 
A 1 201 ASN 201 198 ?   ?   ?   A . n 
A 1 202 LEU 202 199 ?   ?   ?   A . n 
A 1 203 ALA 203 200 ?   ?   ?   A . n 
A 1 204 TYR 204 201 ?   ?   ?   A . n 
A 1 205 GLU 205 202 ?   ?   ?   A . n 
A 1 206 ILE 206 203 ?   ?   ?   A . n 
A 1 207 LEU 207 204 ?   ?   ?   A . n 
A 1 208 GLU 208 205 ?   ?   ?   A . n 
A 1 209 PRO 209 206 ?   ?   ?   A . n 
A 1 210 GLU 210 207 ?   ?   ?   A . n 
A 1 211 PRO 211 208 ?   ?   ?   A . n 
A 1 212 THR 212 209 ?   ?   ?   A . n 
A 1 213 GLU 213 210 ?   ?   ?   A . n 
A 1 214 ILE 214 211 ?   ?   ?   A . n 
A 1 215 PRO 215 212 ?   ?   ?   A . n 
A 1 216 ALA 216 213 ?   ?   ?   A . n 
A 1 217 LEU 217 214 ?   ?   ?   A . n 
A 1 218 LYS 218 215 ?   ?   ?   A . n 
A 1 219 GLN 219 216 ?   ?   ?   A . n 
A 1 220 SER 220 217 ?   ?   ?   A . n 
B 2 1   GLY 1   137 ?   ?   ?   B . n 
B 2 2   SER 2   138 ?   ?   ?   B . n 
B 2 3   HIS 3   139 ?   ?   ?   B . n 
B 2 4   MET 4   140 ?   ?   ?   B . n 
B 2 5   PRO 5   141 ?   ?   ?   B . n 
B 2 6   LYS 6   142 142 LYS LYS B . n 
B 2 7   TYR 7   143 143 TYR TYR B . n 
B 2 8   ASN 8   144 144 ASN ASN B . n 
B 2 9   VAL 9   145 145 VAL VAL B . n 
B 2 10  ARG 10  146 146 ARG ARG B . n 
B 2 11  ASP 11  147 147 ASP ASP B . n 
B 2 12  LYS 12  148 148 LYS LYS B . n 
B 2 13  LYS 13  149 149 LYS LYS B . n 
B 2 14  ALA 14  150 150 ALA ALA B . n 
B 2 15  LEU 15  151 151 LEU LEU B . n 
B 2 16  LEU 16  152 152 LEU LEU B . n 
B 2 17  ARG 17  153 153 ARG ARG B . n 
B 2 18  LEU 18  154 154 LEU LEU B . n 
B 2 19  LEU 19  155 155 LEU LEU B . n 
B 2 20  ASP 20  156 156 ASP ASP B . n 
B 2 21  GLN 21  157 157 GLN GLN B . n 
B 2 22  HIS 22  158 158 HIS HIS B . n 
B 2 23  ASP 23  159 159 ASP ASP B . n 
B 2 24  GLN 24  160 160 GLN GLN B . n 
B 2 25  ARG 25  161 161 ARG ARG B . n 
B 2 26  GLY 26  162 162 GLY GLY B . n 
B 2 27  LEU 27  163 163 LEU LEU B . n 
B 2 28  GLY 28  164 164 GLY GLY B . n 
B 2 29  GLY 29  165 165 GLY GLY B . n 
B 2 30  ILE 30  166 166 ILE ILE B . n 
B 2 31  LEU 31  167 167 LEU LEU B . n 
B 2 32  LEU 32  168 168 LEU LEU B . n 
B 2 33  GLU 33  169 169 GLU GLU B . n 
B 2 34  ASP 34  170 170 ASP ASP B . n 
B 2 35  ILE 35  171 171 ILE ILE B . n 
B 2 36  GLU 36  172 172 GLU GLU B . n 
B 2 37  GLU 37  173 173 GLU GLU B . n 
B 2 38  ALA 38  174 174 ALA ALA B . n 
B 2 39  LEU 39  175 175 LEU LEU B . n 
B 2 40  PRO 40  176 176 PRO PRO B . n 
B 2 41  ASN 41  177 177 ASN ASN B . n 
B 2 42  SER 42  178 178 SER SER B . n 
B 2 43  GLN 43  179 179 GLN GLN B . n 
B 2 44  LYS 44  180 180 LYS LYS B . n 
B 2 45  ALA 45  181 181 ALA ALA B . n 
B 2 46  VAL 46  182 182 VAL VAL B . n 
B 2 47  LYS 47  183 183 LYS LYS B . n 
B 2 48  ALA 48  184 184 ALA ALA B . n 
B 2 49  LEU 49  185 185 LEU LEU B . n 
B 2 50  GLY 50  186 186 GLY GLY B . n 
B 2 51  ASP 51  187 187 ASP ASP B . n 
B 2 52  GLN 52  188 188 GLN GLN B . n 
B 2 53  ILE 53  189 189 ILE ILE B . n 
B 2 54  LEU 54  190 190 LEU LEU B . n 
B 2 55  PHE 55  191 191 PHE PHE B . n 
B 2 56  VAL 56  192 192 VAL VAL B . n 
B 2 57  ASN 57  193 193 ASN ASN B . n 
B 2 58  ARG 58  194 194 ARG ARG B . n 
B 2 59  PRO 59  195 195 PRO PRO B . n 
B 2 60  ASP 60  196 196 ASP ASP B . n 
B 2 61  LYS 61  197 197 LYS LYS B . n 
B 2 62  LYS 62  198 198 LYS LYS B . n 
B 2 63  LYS 63  199 199 LYS LYS B . n 
B 2 64  ILE 64  200 200 ILE ILE B . n 
B 2 65  LEU 65  201 201 LEU LEU B . n 
B 2 66  PHE 66  202 202 PHE PHE B . n 
B 2 67  PHE 67  203 203 PHE PHE B . n 
B 2 68  ASN 68  204 204 ASN ASN B . n 
B 2 69  ASP 69  205 205 ASP ASP B . n 
B 2 70  LYS 70  206 206 LYS LYS B . n 
B 2 71  SER 71  207 207 SER SER B . n 
B 2 72  CYS 72  208 208 CYS CYS B . n 
B 2 73  GLN 73  209 209 GLN GLN B . n 
B 2 74  PHE 74  210 210 PHE PHE B . n 
B 2 75  SER 75  211 211 SER SER B . n 
B 2 76  VAL 76  212 212 VAL VAL B . n 
B 2 77  ASP 77  213 213 ASP ASP B . n 
B 2 78  GLU 78  214 214 GLU GLU B . n 
B 2 79  GLU 79  215 215 GLU GLU B . n 
B 2 80  PHE 80  216 216 PHE PHE B . n 
B 2 81  GLN 81  217 217 GLN GLN B . n 
B 2 82  LYS 82  218 218 LYS LYS B . n 
B 2 83  LEU 83  219 219 LEU LEU B . n 
B 2 84  TRP 84  220 220 TRP TRP B . n 
B 2 85  ARG 85  221 221 ARG ARG B . n 
B 2 86  SER 86  222 222 SER SER B . n 
B 2 87  VAL 87  223 223 VAL VAL B . n 
B 2 88  THR 88  224 224 THR THR B . n 
B 2 89  VAL 89  225 225 VAL VAL B . n 
B 2 90  ASP 90  226 226 ASP ASP B . n 
B 2 91  SER 91  227 227 SER SER B . n 
B 2 92  MET 92  228 228 MET MET B . n 
B 2 93  ASP 93  229 229 ASP ASP B . n 
B 2 94  GLU 94  230 230 GLU GLU B . n 
B 2 95  GLU 95  231 231 GLU GLU B . n 
B 2 96  LYS 96  232 232 LYS LYS B . n 
B 2 97  ILE 97  233 233 ILE ILE B . n 
B 2 98  GLU 98  234 234 GLU GLU B . n 
B 2 99  GLU 99  235 235 GLU GLU B . n 
B 2 100 TYR 100 236 236 TYR TYR B . n 
B 2 101 LEU 101 237 237 LEU LEU B . n 
B 2 102 LYS 102 238 238 LYS LYS B . n 
B 2 103 ARG 103 239 239 ARG ARG B . n 
B 2 104 GLN 104 240 240 GLN GLN B . n 
B 2 105 GLY 105 241 241 GLY GLY B . n 
B 2 106 ILE 106 242 242 ILE ILE B . n 
B 2 107 SER 107 243 ?   ?   ?   B . n 
B 2 108 SER 108 244 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 ZN  1  301 1  ZN  ZN  A . 
D 4 HOH 1  401 13 HOH HOH A . 
D 4 HOH 2  402 16 HOH HOH A . 
D 4 HOH 3  403 5  HOH HOH A . 
D 4 HOH 4  404 2  HOH HOH A . 
D 4 HOH 5  405 84 HOH HOH A . 
D 4 HOH 6  406 14 HOH HOH A . 
D 4 HOH 7  407 34 HOH HOH A . 
D 4 HOH 8  408 30 HOH HOH A . 
D 4 HOH 9  409 86 HOH HOH A . 
D 4 HOH 10 410 28 HOH HOH A . 
D 4 HOH 11 411 49 HOH HOH A . 
D 4 HOH 12 412 71 HOH HOH A . 
D 4 HOH 13 413 12 HOH HOH A . 
D 4 HOH 14 414 46 HOH HOH A . 
D 4 HOH 15 415 3  HOH HOH A . 
D 4 HOH 16 416 29 HOH HOH A . 
D 4 HOH 17 417 79 HOH HOH A . 
D 4 HOH 18 418 87 HOH HOH A . 
D 4 HOH 19 419 7  HOH HOH A . 
D 4 HOH 20 420 80 HOH HOH A . 
D 4 HOH 21 421 81 HOH HOH A . 
D 4 HOH 22 422 48 HOH HOH A . 
D 4 HOH 23 423 39 HOH HOH A . 
D 4 HOH 24 424 66 HOH HOH A . 
D 4 HOH 25 425 45 HOH HOH A . 
D 4 HOH 26 426 38 HOH HOH A . 
D 4 HOH 27 427 67 HOH HOH A . 
D 4 HOH 28 428 6  HOH HOH A . 
D 4 HOH 29 429 19 HOH HOH A . 
D 4 HOH 30 430 57 HOH HOH A . 
D 4 HOH 31 431 56 HOH HOH A . 
D 4 HOH 32 432 10 HOH HOH A . 
D 4 HOH 33 433 22 HOH HOH A . 
D 4 HOH 34 434 21 HOH HOH A . 
D 4 HOH 35 435 53 HOH HOH A . 
D 4 HOH 36 436 50 HOH HOH A . 
D 4 HOH 37 437 64 HOH HOH A . 
E 4 HOH 1  301 60 HOH HOH B . 
E 4 HOH 2  302 62 HOH HOH B . 
E 4 HOH 3  303 88 HOH HOH B . 
E 4 HOH 4  304 15 HOH HOH B . 
E 4 HOH 5  305 31 HOH HOH B . 
E 4 HOH 6  306 55 HOH HOH B . 
E 4 HOH 7  307 76 HOH HOH B . 
E 4 HOH 8  308 59 HOH HOH B . 
E 4 HOH 9  309 1  HOH HOH B . 
E 4 HOH 10 310 41 HOH HOH B . 
E 4 HOH 11 311 73 HOH HOH B . 
E 4 HOH 12 312 11 HOH HOH B . 
E 4 HOH 13 313 35 HOH HOH B . 
E 4 HOH 14 314 25 HOH HOH B . 
E 4 HOH 15 315 83 HOH HOH B . 
E 4 HOH 16 316 17 HOH HOH B . 
E 4 HOH 17 317 85 HOH HOH B . 
E 4 HOH 18 318 23 HOH HOH B . 
E 4 HOH 19 319 82 HOH HOH B . 
E 4 HOH 20 320 36 HOH HOH B . 
E 4 HOH 21 321 37 HOH HOH B . 
E 4 HOH 22 322 72 HOH HOH B . 
E 4 HOH 23 323 51 HOH HOH B . 
E 4 HOH 24 324 40 HOH HOH B . 
E 4 HOH 25 325 24 HOH HOH B . 
E 4 HOH 26 326 32 HOH HOH B . 
E 4 HOH 27 327 42 HOH HOH B . 
E 4 HOH 28 328 44 HOH HOH B . 
E 4 HOH 29 329 75 HOH HOH B . 
E 4 HOH 30 330 27 HOH HOH B . 
E 4 HOH 31 331 9  HOH HOH B . 
E 4 HOH 32 332 18 HOH HOH B . 
E 4 HOH 33 333 8  HOH HOH B . 
E 4 HOH 34 334 93 HOH HOH B . 
E 4 HOH 35 335 47 HOH HOH B . 
E 4 HOH 36 336 95 HOH HOH B . 
E 4 HOH 37 337 26 HOH HOH B . 
E 4 HOH 38 338 68 HOH HOH B . 
E 4 HOH 39 339 70 HOH HOH B . 
E 4 HOH 40 340 58 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3780  ? 
1 MORE         -32   ? 
1 'SSA (A^2)'  16830 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 SG ? A CYS 132 ? A CYS 129 ? 1_555 ZN ? C ZN . ? A ZN 301 ? 1_555 SG ? A CYS 135 ? A CYS 132 ? 1_555 110.4 ? 
2 SG ? A CYS 132 ? A CYS 129 ? 1_555 ZN ? C ZN . ? A ZN 301 ? 1_555 SG ? A CYS 157 ? A CYS 154 ? 1_555 117.6 ? 
3 SG ? A CYS 135 ? A CYS 132 ? 1_555 ZN ? C ZN . ? A ZN 301 ? 1_555 SG ? A CYS 157 ? A CYS 154 ? 1_555 104.3 ? 
4 SG ? A CYS 132 ? A CYS 129 ? 1_555 ZN ? C ZN . ? A ZN 301 ? 1_555 SG ? A CYS 160 ? A CYS 157 ? 1_555 87.5  ? 
5 SG ? A CYS 135 ? A CYS 132 ? 1_555 ZN ? C ZN . ? A ZN 301 ? 1_555 SG ? A CYS 160 ? A CYS 157 ? 1_555 125.2 ? 
6 SG ? A CYS 157 ? A CYS 154 ? 1_555 ZN ? C ZN . ? A ZN 301 ? 1_555 SG ? A CYS 160 ? A CYS 157 ? 1_555 112.2 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-11-02 
2 'Structure model' 1 1 2020-02-26 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'      
2 2 'Structure model' 'Database references'  
3 2 'Structure model' 'Derived calculations' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation              
2 2 'Structure model' diffrn_source         
3 2 'Structure model' pdbx_struct_oper_list 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.journal_id_CSD'                  
2 2 'Structure model' '_diffrn_source.pdbx_synchrotron_site'      
3 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 45.8045 21.2399 17.8983 0.2166 0.2975 0.2379 -0.0030 -0.0090 -0.0489 2.4652 4.2505 9.3211 0.1146  
0.1443  -2.2352 -0.0075 -0.2642 0.1423  0.0588  0.0599  -0.1384 -0.0999 -0.0117 -0.0662 
'X-RAY DIFFRACTION' 2 ? refined 54.1898 33.4169 17.6306 0.4889 0.5289 0.3314 -0.0919 0.0157  -0.0832 1.9727 8.4881 3.5074 3.9123  
-2.3691 -5.2459 0.0373  0.0824  -0.0177 0.0406  0.0610  0.0112  -0.2195 0.1952  -0.0597 
'X-RAY DIFFRACTION' 3 ? refined 40.7573 14.5461 41.2720 0.5699 0.4284 0.2867 0.0540  -0.0683 -0.0436 7.5140 3.0269 4.6067 1.4849  
-1.6719 -0.5231 -0.0400 -0.4147 -0.1058 0.3485  -0.1298 0.1100  -0.0969 -0.1185 0.1624  
'X-RAY DIFFRACTION' 4 ? refined 17.7340 9.1435  61.0901 0.8064 0.8248 0.4608 -0.0796 0.1011  -0.1946 8.5307 3.2026 3.5889 0.4014  
-3.5206 -2.7956 -0.1970 1.1983  -1.0237 -0.4611 -0.2517 -0.1967 1.0922  -0.0874 0.4879  
'X-RAY DIFFRACTION' 5 ? refined 11.9049 5.3445  64.2788 0.8916 0.7088 0.6544 -0.3085 0.0796  -0.1789 8.4173 5.1910 2.9228 -3.8150 
-2.1709 3.8778  -0.2732 0.2201  -0.9822 0.4801  -0.4210 1.5528  1.3782  -1.4551 0.6991  
'X-RAY DIFFRACTION' 6 ? refined 44.4333 5.5133  34.5046 0.6264 0.4367 0.3589 0.1036  0.0229  0.0129  3.8069 3.1785 9.2612 -1.7484 
-5.7789 1.5585  -0.5420 -0.7067 -0.8012 0.0051  0.2765  -0.1905 1.1920  0.8121  0.3152  
'X-RAY DIFFRACTION' 7 ? refined 39.2502 13.1668 -1.4326 0.2701 0.4214 0.2341 -0.0092 0.0649  0.0089  7.6930 5.9101 7.3255 2.9955  
4.7670  2.0826  -0.1434 0.7243  -0.1163 -0.4317 0.2881  -0.2037 0.0361  -0.0116 -0.1590 
'X-RAY DIFFRACTION' 8 ? refined 34.4817 12.8090 10.4925 0.2747 0.5510 0.3521 -0.0184 0.0315  -0.0196 0.7533 2.8331 7.4716 1.6223  
0.1500  -0.1296 0.1136  -0.2458 -0.0397 0.1505  -0.0440 0.1438  0.3858  -0.6410 -0.0797 
'X-RAY DIFFRACTION' 9 ? refined 43.6769 20.5833 38.4303 0.5655 0.4684 0.3372 0.0445  0.0066  -0.0379 7.9677 4.9304 4.1041 1.0028  
-0.8903 -0.9528 -0.0640 -0.1419 0.2481  0.2740  0.1896  -0.4030 -0.7542 0.3984  0.0001  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 10 through 68 )
;
'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 69 through 95 )
;
'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 96 through 123 )
;
'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 124 through 144 )
;
'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 145 through 175 )
;
'X-RAY DIFFRACTION' 6 6 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 176 through 196 )
;
'X-RAY DIFFRACTION' 7 7 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 142 through 177 )
;
'X-RAY DIFFRACTION' 8 8 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 178 through 213 )
;
'X-RAY DIFFRACTION' 9 9 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 214 through 242 )
;
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX  ? ? ? 1.9_1692 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? iMOSFLM ? ? ? .        2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? SCALA   ? ? ? .        3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? SHELXD  ? ? ? .        4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 VAL A 131 ? ? -97.02 -65.89 
2 1 GLU A 195 ? ? -64.57 5.87   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -2  ? A GLY 1   
2  1 Y 1 A SER -1  ? A SER 2   
3  1 Y 1 A HIS 0   ? A HIS 3   
4  1 Y 1 A MET 1   ? A MET 4   
5  1 Y 1 A ALA 2   ? A ALA 5   
6  1 Y 1 A ASP 3   ? A ASP 6   
7  1 Y 1 A PRO 4   ? A PRO 7   
8  1 Y 1 A ASP 5   ? A ASP 8   
9  1 Y 1 A VAL 6   ? A VAL 9   
10 1 Y 1 A LEU 7   ? A LEU 10  
11 1 Y 1 A THR 8   ? A THR 11  
12 1 Y 1 A GLU 9   ? A GLU 12  
13 1 Y 1 A GLU 165 ? A GLU 168 
14 1 Y 1 A SER 166 ? A SER 169 
15 1 Y 1 A ALA 167 ? A ALA 170 
16 1 Y 1 A MET 168 ? A MET 171 
17 1 Y 1 A PRO 169 ? A PRO 172 
18 1 Y 1 A LYS 170 ? A LYS 173 
19 1 Y 1 A LYS 171 ? A LYS 174 
20 1 Y 1 A ASP 172 ? A ASP 175 
21 1 Y 1 A ALA 173 ? A ALA 176 
22 1 Y 1 A ARG 174 ? A ARG 177 
23 1 Y 1 A VAL 197 ? A VAL 200 
24 1 Y 1 A ASN 198 ? A ASN 201 
25 1 Y 1 A LEU 199 ? A LEU 202 
26 1 Y 1 A ALA 200 ? A ALA 203 
27 1 Y 1 A TYR 201 ? A TYR 204 
28 1 Y 1 A GLU 202 ? A GLU 205 
29 1 Y 1 A ILE 203 ? A ILE 206 
30 1 Y 1 A LEU 204 ? A LEU 207 
31 1 Y 1 A GLU 205 ? A GLU 208 
32 1 Y 1 A PRO 206 ? A PRO 209 
33 1 Y 1 A GLU 207 ? A GLU 210 
34 1 Y 1 A PRO 208 ? A PRO 211 
35 1 Y 1 A THR 209 ? A THR 212 
36 1 Y 1 A GLU 210 ? A GLU 213 
37 1 Y 1 A ILE 211 ? A ILE 214 
38 1 Y 1 A PRO 212 ? A PRO 215 
39 1 Y 1 A ALA 213 ? A ALA 216 
40 1 Y 1 A LEU 214 ? A LEU 217 
41 1 Y 1 A LYS 215 ? A LYS 218 
42 1 Y 1 A GLN 216 ? A GLN 219 
43 1 Y 1 A SER 217 ? A SER 220 
44 1 Y 1 B GLY 137 ? B GLY 1   
45 1 Y 1 B SER 138 ? B SER 2   
46 1 Y 1 B HIS 139 ? B HIS 3   
47 1 Y 1 B MET 140 ? B MET 4   
48 1 Y 1 B PRO 141 ? B PRO 5   
49 1 Y 1 B SER 243 ? B SER 107 
50 1 Y 1 B SER 244 ? B SER 108 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'ZINC ION' ZN  
4 water      HOH 
#