data_5HAT
# 
_entry.id   5HAT 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.319 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5HAT         
WWPDB D_1000216769 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 5HAN unspecified 
PDB . 5HAO unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5HAT 
_pdbx_database_status.recvd_initial_deposition_date   2015-12-30 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Arbing, M.A.'   1 
'Leong, J.G.'    2 
'Cascio, D.'     3 
'Varaljay, V.A.' 4 
'Satagopan, S.'  5 
'North, J.A.'    6 
'Tabita, F.R.'   7 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'To Be Published' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            0353 
_citation.journal_id_ISSN           ? 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            ? 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     'Structure function studies of R. palustris RubisCO.' 
_citation.year                      ? 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Arbing, M.A.'   1 ? 
primary 'Satagopan, S.'  2 ? 
primary 'Varaljay, V.A.' 3 ? 
primary 'Leong, J.G.'    4 ? 
primary 'Tabita, F.R.'   5 ? 
# 
_cell.entry_id           5HAT 
_cell.length_a           76.140 
_cell.length_b           111.030 
_cell.length_c           167.260 
_cell.angle_alpha        90.03 
_cell.angle_beta         101.69 
_cell.angle_gamma        105.05 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5HAT 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Ribulose bisphosphate carboxylase' 52757.320 12   4.1.1.39 ? ? ? 
2 non-polymer syn 2-CARBOXYARABINITOL-1,5-DIPHOSPHATE 356.115   12   ?        ? ? ? 
3 non-polymer syn 'MAGNESIUM ION'                     24.305    12   ?        ? ? ? 
4 water       nat water                               18.015    2604 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        RuBisCO 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;MGSSHHHHHHSSGLVPRGSHMDQSNRYANLNLKESELIAGGRHVLCAYIMKPKAGFGNFIQTAAHFAAESSTGTNVEVFT
TDDFTRGVDALVYEVDEANSLMKIAYPIELFDRNVIDGRAMIASFLTLTIGNNQGMGDVEYAKMYDFYVPPAYLKLFDGP
STTIKDLWRVLGRPVINGGFIVGTIIKPKLGLRPQPFANACYDFWLGGDFI(KCX)NDEPQGNQVFAPFKDTVRAVADAM
RRAQDKTGEAKLFSFNITADDHYEMLARGEFILETFADNADHIAFLVDGYVAGPAAVTTARRAFPKQYLHYHRAGHGAVT
SPQSKRGYTAFVLSKMARLQGASGIHTGTMGFGKAEGEAADRAIAYMITEDAADGPYFHQEWLGMNPTTPIISGGMNALR
MPGFFDNLGHSNLIMTAGGGAFGHVDGGAAGAKSLRQAEQCWKQGADPVEFAKDHREFARAFESFPQDADKLYPNWRAKL
KPQAA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSSHHHHHHSSGLVPRGSHMDQSNRYANLNLKESELIAGGRHVLCAYIMKPKAGFGNFIQTAAHFAAESSTGTNVEVFT
TDDFTRGVDALVYEVDEANSLMKIAYPIELFDRNVIDGRAMIASFLTLTIGNNQGMGDVEYAKMYDFYVPPAYLKLFDGP
STTIKDLWRVLGRPVINGGFIVGTIIKPKLGLRPQPFANACYDFWLGGDFIKNDEPQGNQVFAPFKDTVRAVADAMRRAQ
DKTGEAKLFSFNITADDHYEMLARGEFILETFADNADHIAFLVDGYVAGPAAVTTARRAFPKQYLHYHRAGHGAVTSPQS
KRGYTAFVLSKMARLQGASGIHTGTMGFGKAEGEAADRAIAYMITEDAADGPYFHQEWLGMNPTTPIISGGMNALRMPGF
FDNLGHSNLIMTAGGGAFGHVDGGAAGAKSLRQAEQCWKQGADPVEFAKDHREFARAFESFPQDADKLYPNWRAKLKPQA
A
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H,I,J,K,L 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  HIS n 
1 21  MET n 
1 22  ASP n 
1 23  GLN n 
1 24  SER n 
1 25  ASN n 
1 26  ARG n 
1 27  TYR n 
1 28  ALA n 
1 29  ASN n 
1 30  LEU n 
1 31  ASN n 
1 32  LEU n 
1 33  LYS n 
1 34  GLU n 
1 35  SER n 
1 36  GLU n 
1 37  LEU n 
1 38  ILE n 
1 39  ALA n 
1 40  GLY n 
1 41  GLY n 
1 42  ARG n 
1 43  HIS n 
1 44  VAL n 
1 45  LEU n 
1 46  CYS n 
1 47  ALA n 
1 48  TYR n 
1 49  ILE n 
1 50  MET n 
1 51  LYS n 
1 52  PRO n 
1 53  LYS n 
1 54  ALA n 
1 55  GLY n 
1 56  PHE n 
1 57  GLY n 
1 58  ASN n 
1 59  PHE n 
1 60  ILE n 
1 61  GLN n 
1 62  THR n 
1 63  ALA n 
1 64  ALA n 
1 65  HIS n 
1 66  PHE n 
1 67  ALA n 
1 68  ALA n 
1 69  GLU n 
1 70  SER n 
1 71  SER n 
1 72  THR n 
1 73  GLY n 
1 74  THR n 
1 75  ASN n 
1 76  VAL n 
1 77  GLU n 
1 78  VAL n 
1 79  PHE n 
1 80  THR n 
1 81  THR n 
1 82  ASP n 
1 83  ASP n 
1 84  PHE n 
1 85  THR n 
1 86  ARG n 
1 87  GLY n 
1 88  VAL n 
1 89  ASP n 
1 90  ALA n 
1 91  LEU n 
1 92  VAL n 
1 93  TYR n 
1 94  GLU n 
1 95  VAL n 
1 96  ASP n 
1 97  GLU n 
1 98  ALA n 
1 99  ASN n 
1 100 SER n 
1 101 LEU n 
1 102 MET n 
1 103 LYS n 
1 104 ILE n 
1 105 ALA n 
1 106 TYR n 
1 107 PRO n 
1 108 ILE n 
1 109 GLU n 
1 110 LEU n 
1 111 PHE n 
1 112 ASP n 
1 113 ARG n 
1 114 ASN n 
1 115 VAL n 
1 116 ILE n 
1 117 ASP n 
1 118 GLY n 
1 119 ARG n 
1 120 ALA n 
1 121 MET n 
1 122 ILE n 
1 123 ALA n 
1 124 SER n 
1 125 PHE n 
1 126 LEU n 
1 127 THR n 
1 128 LEU n 
1 129 THR n 
1 130 ILE n 
1 131 GLY n 
1 132 ASN n 
1 133 ASN n 
1 134 GLN n 
1 135 GLY n 
1 136 MET n 
1 137 GLY n 
1 138 ASP n 
1 139 VAL n 
1 140 GLU n 
1 141 TYR n 
1 142 ALA n 
1 143 LYS n 
1 144 MET n 
1 145 TYR n 
1 146 ASP n 
1 147 PHE n 
1 148 TYR n 
1 149 VAL n 
1 150 PRO n 
1 151 PRO n 
1 152 ALA n 
1 153 TYR n 
1 154 LEU n 
1 155 LYS n 
1 156 LEU n 
1 157 PHE n 
1 158 ASP n 
1 159 GLY n 
1 160 PRO n 
1 161 SER n 
1 162 THR n 
1 163 THR n 
1 164 ILE n 
1 165 LYS n 
1 166 ASP n 
1 167 LEU n 
1 168 TRP n 
1 169 ARG n 
1 170 VAL n 
1 171 LEU n 
1 172 GLY n 
1 173 ARG n 
1 174 PRO n 
1 175 VAL n 
1 176 ILE n 
1 177 ASN n 
1 178 GLY n 
1 179 GLY n 
1 180 PHE n 
1 181 ILE n 
1 182 VAL n 
1 183 GLY n 
1 184 THR n 
1 185 ILE n 
1 186 ILE n 
1 187 LYS n 
1 188 PRO n 
1 189 LYS n 
1 190 LEU n 
1 191 GLY n 
1 192 LEU n 
1 193 ARG n 
1 194 PRO n 
1 195 GLN n 
1 196 PRO n 
1 197 PHE n 
1 198 ALA n 
1 199 ASN n 
1 200 ALA n 
1 201 CYS n 
1 202 TYR n 
1 203 ASP n 
1 204 PHE n 
1 205 TRP n 
1 206 LEU n 
1 207 GLY n 
1 208 GLY n 
1 209 ASP n 
1 210 PHE n 
1 211 ILE n 
1 212 KCX n 
1 213 ASN n 
1 214 ASP n 
1 215 GLU n 
1 216 PRO n 
1 217 GLN n 
1 218 GLY n 
1 219 ASN n 
1 220 GLN n 
1 221 VAL n 
1 222 PHE n 
1 223 ALA n 
1 224 PRO n 
1 225 PHE n 
1 226 LYS n 
1 227 ASP n 
1 228 THR n 
1 229 VAL n 
1 230 ARG n 
1 231 ALA n 
1 232 VAL n 
1 233 ALA n 
1 234 ASP n 
1 235 ALA n 
1 236 MET n 
1 237 ARG n 
1 238 ARG n 
1 239 ALA n 
1 240 GLN n 
1 241 ASP n 
1 242 LYS n 
1 243 THR n 
1 244 GLY n 
1 245 GLU n 
1 246 ALA n 
1 247 LYS n 
1 248 LEU n 
1 249 PHE n 
1 250 SER n 
1 251 PHE n 
1 252 ASN n 
1 253 ILE n 
1 254 THR n 
1 255 ALA n 
1 256 ASP n 
1 257 ASP n 
1 258 HIS n 
1 259 TYR n 
1 260 GLU n 
1 261 MET n 
1 262 LEU n 
1 263 ALA n 
1 264 ARG n 
1 265 GLY n 
1 266 GLU n 
1 267 PHE n 
1 268 ILE n 
1 269 LEU n 
1 270 GLU n 
1 271 THR n 
1 272 PHE n 
1 273 ALA n 
1 274 ASP n 
1 275 ASN n 
1 276 ALA n 
1 277 ASP n 
1 278 HIS n 
1 279 ILE n 
1 280 ALA n 
1 281 PHE n 
1 282 LEU n 
1 283 VAL n 
1 284 ASP n 
1 285 GLY n 
1 286 TYR n 
1 287 VAL n 
1 288 ALA n 
1 289 GLY n 
1 290 PRO n 
1 291 ALA n 
1 292 ALA n 
1 293 VAL n 
1 294 THR n 
1 295 THR n 
1 296 ALA n 
1 297 ARG n 
1 298 ARG n 
1 299 ALA n 
1 300 PHE n 
1 301 PRO n 
1 302 LYS n 
1 303 GLN n 
1 304 TYR n 
1 305 LEU n 
1 306 HIS n 
1 307 TYR n 
1 308 HIS n 
1 309 ARG n 
1 310 ALA n 
1 311 GLY n 
1 312 HIS n 
1 313 GLY n 
1 314 ALA n 
1 315 VAL n 
1 316 THR n 
1 317 SER n 
1 318 PRO n 
1 319 GLN n 
1 320 SER n 
1 321 LYS n 
1 322 ARG n 
1 323 GLY n 
1 324 TYR n 
1 325 THR n 
1 326 ALA n 
1 327 PHE n 
1 328 VAL n 
1 329 LEU n 
1 330 SER n 
1 331 LYS n 
1 332 MET n 
1 333 ALA n 
1 334 ARG n 
1 335 LEU n 
1 336 GLN n 
1 337 GLY n 
1 338 ALA n 
1 339 SER n 
1 340 GLY n 
1 341 ILE n 
1 342 HIS n 
1 343 THR n 
1 344 GLY n 
1 345 THR n 
1 346 MET n 
1 347 GLY n 
1 348 PHE n 
1 349 GLY n 
1 350 LYS n 
1 351 ALA n 
1 352 GLU n 
1 353 GLY n 
1 354 GLU n 
1 355 ALA n 
1 356 ALA n 
1 357 ASP n 
1 358 ARG n 
1 359 ALA n 
1 360 ILE n 
1 361 ALA n 
1 362 TYR n 
1 363 MET n 
1 364 ILE n 
1 365 THR n 
1 366 GLU n 
1 367 ASP n 
1 368 ALA n 
1 369 ALA n 
1 370 ASP n 
1 371 GLY n 
1 372 PRO n 
1 373 TYR n 
1 374 PHE n 
1 375 HIS n 
1 376 GLN n 
1 377 GLU n 
1 378 TRP n 
1 379 LEU n 
1 380 GLY n 
1 381 MET n 
1 382 ASN n 
1 383 PRO n 
1 384 THR n 
1 385 THR n 
1 386 PRO n 
1 387 ILE n 
1 388 ILE n 
1 389 SER n 
1 390 GLY n 
1 391 GLY n 
1 392 MET n 
1 393 ASN n 
1 394 ALA n 
1 395 LEU n 
1 396 ARG n 
1 397 MET n 
1 398 PRO n 
1 399 GLY n 
1 400 PHE n 
1 401 PHE n 
1 402 ASP n 
1 403 ASN n 
1 404 LEU n 
1 405 GLY n 
1 406 HIS n 
1 407 SER n 
1 408 ASN n 
1 409 LEU n 
1 410 ILE n 
1 411 MET n 
1 412 THR n 
1 413 ALA n 
1 414 GLY n 
1 415 GLY n 
1 416 GLY n 
1 417 ALA n 
1 418 PHE n 
1 419 GLY n 
1 420 HIS n 
1 421 VAL n 
1 422 ASP n 
1 423 GLY n 
1 424 GLY n 
1 425 ALA n 
1 426 ALA n 
1 427 GLY n 
1 428 ALA n 
1 429 LYS n 
1 430 SER n 
1 431 LEU n 
1 432 ARG n 
1 433 GLN n 
1 434 ALA n 
1 435 GLU n 
1 436 GLN n 
1 437 CYS n 
1 438 TRP n 
1 439 LYS n 
1 440 GLN n 
1 441 GLY n 
1 442 ALA n 
1 443 ASP n 
1 444 PRO n 
1 445 VAL n 
1 446 GLU n 
1 447 PHE n 
1 448 ALA n 
1 449 LYS n 
1 450 ASP n 
1 451 HIS n 
1 452 ARG n 
1 453 GLU n 
1 454 PHE n 
1 455 ALA n 
1 456 ARG n 
1 457 ALA n 
1 458 PHE n 
1 459 GLU n 
1 460 SER n 
1 461 PHE n 
1 462 PRO n 
1 463 GLN n 
1 464 ASP n 
1 465 ALA n 
1 466 ASP n 
1 467 LYS n 
1 468 LEU n 
1 469 TYR n 
1 470 PRO n 
1 471 ASN n 
1 472 TRP n 
1 473 ARG n 
1 474 ALA n 
1 475 LYS n 
1 476 LEU n 
1 477 LYS n 
1 478 PRO n 
1 479 GLN n 
1 480 ALA n 
1 481 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   481 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Rhodopseudomonas palustris' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1076 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.db_code                    RBL2_RHOPA 
_struct_ref.db_name                    UNP 
_struct_ref.details                    ? 
_struct_ref.entity_id                  1 
_struct_ref.id                         1 
_struct_ref.seq_align                  ? 
_struct_ref.seq_dif                    ? 
_struct_ref.pdbx_db_accession          Q6N0W9 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   
;MDQSNRYANLNLKESELIAGGRHVLCAYIMKPKAGFGNFIQTAAHFAAESSTGTNVEVSTTDDFTRGVDALVYEVDEANS
LMKIAYPIELFDRNVIDGRAMIASFLTLTIGNNQGMGDVEYAKMYDFYVPPAYLKLFDGPSTTIKDLWRVLGRPVINGGF
IVGTIIKPKLGLRPQPFANACYDFWLGGDFIKNDEPQGNQVFAPFKDTVRAVADAMRRAQDKTGEAKLFSFNITADDHYE
MLARGEFILETFADNADHIAFLVDGYVAGPAAVTTARRAFPKQYLHYHRAGHGAVTSPQSKRGYTAFVLSKMARLQGASG
IHTGTMGFGKMEGEAADRAIAYMITEDAADGPYFHQEWLGMNPTTPIISGGMNALRMPGFFDNLGHSNLIMTAGGGAFGH
VDGGAAGAKSLRQAEQCWKQGADPVEFAKDHREFARAFESFPQDADKLYPNWRAKLKPQAA
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_align_end             ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 5HAT A 21 ? 481 ? Q6N0W9 1 ? 461 ? 1 461 
2  1 5HAT B 21 ? 481 ? Q6N0W9 1 ? 461 ? 1 461 
3  1 5HAT C 21 ? 481 ? Q6N0W9 1 ? 461 ? 1 461 
4  1 5HAT D 21 ? 481 ? Q6N0W9 1 ? 461 ? 1 461 
5  1 5HAT E 21 ? 481 ? Q6N0W9 1 ? 461 ? 1 461 
6  1 5HAT F 21 ? 481 ? Q6N0W9 1 ? 461 ? 1 461 
7  1 5HAT G 21 ? 481 ? Q6N0W9 1 ? 461 ? 1 461 
8  1 5HAT H 21 ? 481 ? Q6N0W9 1 ? 461 ? 1 461 
9  1 5HAT I 21 ? 481 ? Q6N0W9 1 ? 461 ? 1 461 
10 1 5HAT J 21 ? 481 ? Q6N0W9 1 ? 461 ? 1 461 
11 1 5HAT K 21 ? 481 ? Q6N0W9 1 ? 461 ? 1 461 
12 1 5HAT L 21 ? 481 ? Q6N0W9 1 ? 461 ? 1 461 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  5HAT MET A 1   ? UNP Q6N0W9 ?   ?   'initiating methionine' -19 1   
1  5HAT GLY A 2   ? UNP Q6N0W9 ?   ?   'expression tag'        -18 2   
1  5HAT SER A 3   ? UNP Q6N0W9 ?   ?   'expression tag'        -17 3   
1  5HAT SER A 4   ? UNP Q6N0W9 ?   ?   'expression tag'        -16 4   
1  5HAT HIS A 5   ? UNP Q6N0W9 ?   ?   'expression tag'        -15 5   
1  5HAT HIS A 6   ? UNP Q6N0W9 ?   ?   'expression tag'        -14 6   
1  5HAT HIS A 7   ? UNP Q6N0W9 ?   ?   'expression tag'        -13 7   
1  5HAT HIS A 8   ? UNP Q6N0W9 ?   ?   'expression tag'        -12 8   
1  5HAT HIS A 9   ? UNP Q6N0W9 ?   ?   'expression tag'        -11 9   
1  5HAT HIS A 10  ? UNP Q6N0W9 ?   ?   'expression tag'        -10 10  
1  5HAT SER A 11  ? UNP Q6N0W9 ?   ?   'expression tag'        -9  11  
1  5HAT SER A 12  ? UNP Q6N0W9 ?   ?   'expression tag'        -8  12  
1  5HAT GLY A 13  ? UNP Q6N0W9 ?   ?   'expression tag'        -7  13  
1  5HAT LEU A 14  ? UNP Q6N0W9 ?   ?   'expression tag'        -6  14  
1  5HAT VAL A 15  ? UNP Q6N0W9 ?   ?   'expression tag'        -5  15  
1  5HAT PRO A 16  ? UNP Q6N0W9 ?   ?   'expression tag'        -4  16  
1  5HAT ARG A 17  ? UNP Q6N0W9 ?   ?   'expression tag'        -3  17  
1  5HAT GLY A 18  ? UNP Q6N0W9 ?   ?   'expression tag'        -2  18  
1  5HAT SER A 19  ? UNP Q6N0W9 ?   ?   'expression tag'        -1  19  
1  5HAT HIS A 20  ? UNP Q6N0W9 ?   ?   'expression tag'        0   20  
1  5HAT PHE A 79  ? UNP Q6N0W9 SER 59  'engineered mutation'   59  21  
1  5HAT ALA A 351 ? UNP Q6N0W9 MET 331 'engineered mutation'   331 22  
2  5HAT MET B 1   ? UNP Q6N0W9 ?   ?   'initiating methionine' -19 23  
2  5HAT GLY B 2   ? UNP Q6N0W9 ?   ?   'expression tag'        -18 24  
2  5HAT SER B 3   ? UNP Q6N0W9 ?   ?   'expression tag'        -17 25  
2  5HAT SER B 4   ? UNP Q6N0W9 ?   ?   'expression tag'        -16 26  
2  5HAT HIS B 5   ? UNP Q6N0W9 ?   ?   'expression tag'        -15 27  
2  5HAT HIS B 6   ? UNP Q6N0W9 ?   ?   'expression tag'        -14 28  
2  5HAT HIS B 7   ? UNP Q6N0W9 ?   ?   'expression tag'        -13 29  
2  5HAT HIS B 8   ? UNP Q6N0W9 ?   ?   'expression tag'        -12 30  
2  5HAT HIS B 9   ? UNP Q6N0W9 ?   ?   'expression tag'        -11 31  
2  5HAT HIS B 10  ? UNP Q6N0W9 ?   ?   'expression tag'        -10 32  
2  5HAT SER B 11  ? UNP Q6N0W9 ?   ?   'expression tag'        -9  33  
2  5HAT SER B 12  ? UNP Q6N0W9 ?   ?   'expression tag'        -8  34  
2  5HAT GLY B 13  ? UNP Q6N0W9 ?   ?   'expression tag'        -7  35  
2  5HAT LEU B 14  ? UNP Q6N0W9 ?   ?   'expression tag'        -6  36  
2  5HAT VAL B 15  ? UNP Q6N0W9 ?   ?   'expression tag'        -5  37  
2  5HAT PRO B 16  ? UNP Q6N0W9 ?   ?   'expression tag'        -4  38  
2  5HAT ARG B 17  ? UNP Q6N0W9 ?   ?   'expression tag'        -3  39  
2  5HAT GLY B 18  ? UNP Q6N0W9 ?   ?   'expression tag'        -2  40  
2  5HAT SER B 19  ? UNP Q6N0W9 ?   ?   'expression tag'        -1  41  
2  5HAT HIS B 20  ? UNP Q6N0W9 ?   ?   'expression tag'        0   42  
2  5HAT PHE B 79  ? UNP Q6N0W9 SER 59  'engineered mutation'   59  43  
2  5HAT ALA B 351 ? UNP Q6N0W9 MET 331 'engineered mutation'   331 44  
3  5HAT MET C 1   ? UNP Q6N0W9 ?   ?   'initiating methionine' -19 45  
3  5HAT GLY C 2   ? UNP Q6N0W9 ?   ?   'expression tag'        -18 46  
3  5HAT SER C 3   ? UNP Q6N0W9 ?   ?   'expression tag'        -17 47  
3  5HAT SER C 4   ? UNP Q6N0W9 ?   ?   'expression tag'        -16 48  
3  5HAT HIS C 5   ? UNP Q6N0W9 ?   ?   'expression tag'        -15 49  
3  5HAT HIS C 6   ? UNP Q6N0W9 ?   ?   'expression tag'        -14 50  
3  5HAT HIS C 7   ? UNP Q6N0W9 ?   ?   'expression tag'        -13 51  
3  5HAT HIS C 8   ? UNP Q6N0W9 ?   ?   'expression tag'        -12 52  
3  5HAT HIS C 9   ? UNP Q6N0W9 ?   ?   'expression tag'        -11 53  
3  5HAT HIS C 10  ? UNP Q6N0W9 ?   ?   'expression tag'        -10 54  
3  5HAT SER C 11  ? UNP Q6N0W9 ?   ?   'expression tag'        -9  55  
3  5HAT SER C 12  ? UNP Q6N0W9 ?   ?   'expression tag'        -8  56  
3  5HAT GLY C 13  ? UNP Q6N0W9 ?   ?   'expression tag'        -7  57  
3  5HAT LEU C 14  ? UNP Q6N0W9 ?   ?   'expression tag'        -6  58  
3  5HAT VAL C 15  ? UNP Q6N0W9 ?   ?   'expression tag'        -5  59  
3  5HAT PRO C 16  ? UNP Q6N0W9 ?   ?   'expression tag'        -4  60  
3  5HAT ARG C 17  ? UNP Q6N0W9 ?   ?   'expression tag'        -3  61  
3  5HAT GLY C 18  ? UNP Q6N0W9 ?   ?   'expression tag'        -2  62  
3  5HAT SER C 19  ? UNP Q6N0W9 ?   ?   'expression tag'        -1  63  
3  5HAT HIS C 20  ? UNP Q6N0W9 ?   ?   'expression tag'        0   64  
3  5HAT PHE C 79  ? UNP Q6N0W9 SER 59  'engineered mutation'   59  65  
3  5HAT ALA C 351 ? UNP Q6N0W9 MET 331 'engineered mutation'   331 66  
4  5HAT MET D 1   ? UNP Q6N0W9 ?   ?   'initiating methionine' -19 67  
4  5HAT GLY D 2   ? UNP Q6N0W9 ?   ?   'expression tag'        -18 68  
4  5HAT SER D 3   ? UNP Q6N0W9 ?   ?   'expression tag'        -17 69  
4  5HAT SER D 4   ? UNP Q6N0W9 ?   ?   'expression tag'        -16 70  
4  5HAT HIS D 5   ? UNP Q6N0W9 ?   ?   'expression tag'        -15 71  
4  5HAT HIS D 6   ? UNP Q6N0W9 ?   ?   'expression tag'        -14 72  
4  5HAT HIS D 7   ? UNP Q6N0W9 ?   ?   'expression tag'        -13 73  
4  5HAT HIS D 8   ? UNP Q6N0W9 ?   ?   'expression tag'        -12 74  
4  5HAT HIS D 9   ? UNP Q6N0W9 ?   ?   'expression tag'        -11 75  
4  5HAT HIS D 10  ? UNP Q6N0W9 ?   ?   'expression tag'        -10 76  
4  5HAT SER D 11  ? UNP Q6N0W9 ?   ?   'expression tag'        -9  77  
4  5HAT SER D 12  ? UNP Q6N0W9 ?   ?   'expression tag'        -8  78  
4  5HAT GLY D 13  ? UNP Q6N0W9 ?   ?   'expression tag'        -7  79  
4  5HAT LEU D 14  ? UNP Q6N0W9 ?   ?   'expression tag'        -6  80  
4  5HAT VAL D 15  ? UNP Q6N0W9 ?   ?   'expression tag'        -5  81  
4  5HAT PRO D 16  ? UNP Q6N0W9 ?   ?   'expression tag'        -4  82  
4  5HAT ARG D 17  ? UNP Q6N0W9 ?   ?   'expression tag'        -3  83  
4  5HAT GLY D 18  ? UNP Q6N0W9 ?   ?   'expression tag'        -2  84  
4  5HAT SER D 19  ? UNP Q6N0W9 ?   ?   'expression tag'        -1  85  
4  5HAT HIS D 20  ? UNP Q6N0W9 ?   ?   'expression tag'        0   86  
4  5HAT PHE D 79  ? UNP Q6N0W9 SER 59  'engineered mutation'   59  87  
4  5HAT ALA D 351 ? UNP Q6N0W9 MET 331 'engineered mutation'   331 88  
5  5HAT MET E 1   ? UNP Q6N0W9 ?   ?   'initiating methionine' -19 89  
5  5HAT GLY E 2   ? UNP Q6N0W9 ?   ?   'expression tag'        -18 90  
5  5HAT SER E 3   ? UNP Q6N0W9 ?   ?   'expression tag'        -17 91  
5  5HAT SER E 4   ? UNP Q6N0W9 ?   ?   'expression tag'        -16 92  
5  5HAT HIS E 5   ? UNP Q6N0W9 ?   ?   'expression tag'        -15 93  
5  5HAT HIS E 6   ? UNP Q6N0W9 ?   ?   'expression tag'        -14 94  
5  5HAT HIS E 7   ? UNP Q6N0W9 ?   ?   'expression tag'        -13 95  
5  5HAT HIS E 8   ? UNP Q6N0W9 ?   ?   'expression tag'        -12 96  
5  5HAT HIS E 9   ? UNP Q6N0W9 ?   ?   'expression tag'        -11 97  
5  5HAT HIS E 10  ? UNP Q6N0W9 ?   ?   'expression tag'        -10 98  
5  5HAT SER E 11  ? UNP Q6N0W9 ?   ?   'expression tag'        -9  99  
5  5HAT SER E 12  ? UNP Q6N0W9 ?   ?   'expression tag'        -8  100 
5  5HAT GLY E 13  ? UNP Q6N0W9 ?   ?   'expression tag'        -7  101 
5  5HAT LEU E 14  ? UNP Q6N0W9 ?   ?   'expression tag'        -6  102 
5  5HAT VAL E 15  ? UNP Q6N0W9 ?   ?   'expression tag'        -5  103 
5  5HAT PRO E 16  ? UNP Q6N0W9 ?   ?   'expression tag'        -4  104 
5  5HAT ARG E 17  ? UNP Q6N0W9 ?   ?   'expression tag'        -3  105 
5  5HAT GLY E 18  ? UNP Q6N0W9 ?   ?   'expression tag'        -2  106 
5  5HAT SER E 19  ? UNP Q6N0W9 ?   ?   'expression tag'        -1  107 
5  5HAT HIS E 20  ? UNP Q6N0W9 ?   ?   'expression tag'        0   108 
5  5HAT PHE E 79  ? UNP Q6N0W9 SER 59  'engineered mutation'   59  109 
5  5HAT ALA E 351 ? UNP Q6N0W9 MET 331 'engineered mutation'   331 110 
6  5HAT MET F 1   ? UNP Q6N0W9 ?   ?   'initiating methionine' -19 111 
6  5HAT GLY F 2   ? UNP Q6N0W9 ?   ?   'expression tag'        -18 112 
6  5HAT SER F 3   ? UNP Q6N0W9 ?   ?   'expression tag'        -17 113 
6  5HAT SER F 4   ? UNP Q6N0W9 ?   ?   'expression tag'        -16 114 
6  5HAT HIS F 5   ? UNP Q6N0W9 ?   ?   'expression tag'        -15 115 
6  5HAT HIS F 6   ? UNP Q6N0W9 ?   ?   'expression tag'        -14 116 
6  5HAT HIS F 7   ? UNP Q6N0W9 ?   ?   'expression tag'        -13 117 
6  5HAT HIS F 8   ? UNP Q6N0W9 ?   ?   'expression tag'        -12 118 
6  5HAT HIS F 9   ? UNP Q6N0W9 ?   ?   'expression tag'        -11 119 
6  5HAT HIS F 10  ? UNP Q6N0W9 ?   ?   'expression tag'        -10 120 
6  5HAT SER F 11  ? UNP Q6N0W9 ?   ?   'expression tag'        -9  121 
6  5HAT SER F 12  ? UNP Q6N0W9 ?   ?   'expression tag'        -8  122 
6  5HAT GLY F 13  ? UNP Q6N0W9 ?   ?   'expression tag'        -7  123 
6  5HAT LEU F 14  ? UNP Q6N0W9 ?   ?   'expression tag'        -6  124 
6  5HAT VAL F 15  ? UNP Q6N0W9 ?   ?   'expression tag'        -5  125 
6  5HAT PRO F 16  ? UNP Q6N0W9 ?   ?   'expression tag'        -4  126 
6  5HAT ARG F 17  ? UNP Q6N0W9 ?   ?   'expression tag'        -3  127 
6  5HAT GLY F 18  ? UNP Q6N0W9 ?   ?   'expression tag'        -2  128 
6  5HAT SER F 19  ? UNP Q6N0W9 ?   ?   'expression tag'        -1  129 
6  5HAT HIS F 20  ? UNP Q6N0W9 ?   ?   'expression tag'        0   130 
6  5HAT PHE F 79  ? UNP Q6N0W9 SER 59  'engineered mutation'   59  131 
6  5HAT ALA F 351 ? UNP Q6N0W9 MET 331 'engineered mutation'   331 132 
7  5HAT MET G 1   ? UNP Q6N0W9 ?   ?   'initiating methionine' -19 133 
7  5HAT GLY G 2   ? UNP Q6N0W9 ?   ?   'expression tag'        -18 134 
7  5HAT SER G 3   ? UNP Q6N0W9 ?   ?   'expression tag'        -17 135 
7  5HAT SER G 4   ? UNP Q6N0W9 ?   ?   'expression tag'        -16 136 
7  5HAT HIS G 5   ? UNP Q6N0W9 ?   ?   'expression tag'        -15 137 
7  5HAT HIS G 6   ? UNP Q6N0W9 ?   ?   'expression tag'        -14 138 
7  5HAT HIS G 7   ? UNP Q6N0W9 ?   ?   'expression tag'        -13 139 
7  5HAT HIS G 8   ? UNP Q6N0W9 ?   ?   'expression tag'        -12 140 
7  5HAT HIS G 9   ? UNP Q6N0W9 ?   ?   'expression tag'        -11 141 
7  5HAT HIS G 10  ? UNP Q6N0W9 ?   ?   'expression tag'        -10 142 
7  5HAT SER G 11  ? UNP Q6N0W9 ?   ?   'expression tag'        -9  143 
7  5HAT SER G 12  ? UNP Q6N0W9 ?   ?   'expression tag'        -8  144 
7  5HAT GLY G 13  ? UNP Q6N0W9 ?   ?   'expression tag'        -7  145 
7  5HAT LEU G 14  ? UNP Q6N0W9 ?   ?   'expression tag'        -6  146 
7  5HAT VAL G 15  ? UNP Q6N0W9 ?   ?   'expression tag'        -5  147 
7  5HAT PRO G 16  ? UNP Q6N0W9 ?   ?   'expression tag'        -4  148 
7  5HAT ARG G 17  ? UNP Q6N0W9 ?   ?   'expression tag'        -3  149 
7  5HAT GLY G 18  ? UNP Q6N0W9 ?   ?   'expression tag'        -2  150 
7  5HAT SER G 19  ? UNP Q6N0W9 ?   ?   'expression tag'        -1  151 
7  5HAT HIS G 20  ? UNP Q6N0W9 ?   ?   'expression tag'        0   152 
7  5HAT PHE G 79  ? UNP Q6N0W9 SER 59  'engineered mutation'   59  153 
7  5HAT ALA G 351 ? UNP Q6N0W9 MET 331 'engineered mutation'   331 154 
8  5HAT MET H 1   ? UNP Q6N0W9 ?   ?   'initiating methionine' -19 155 
8  5HAT GLY H 2   ? UNP Q6N0W9 ?   ?   'expression tag'        -18 156 
8  5HAT SER H 3   ? UNP Q6N0W9 ?   ?   'expression tag'        -17 157 
8  5HAT SER H 4   ? UNP Q6N0W9 ?   ?   'expression tag'        -16 158 
8  5HAT HIS H 5   ? UNP Q6N0W9 ?   ?   'expression tag'        -15 159 
8  5HAT HIS H 6   ? UNP Q6N0W9 ?   ?   'expression tag'        -14 160 
8  5HAT HIS H 7   ? UNP Q6N0W9 ?   ?   'expression tag'        -13 161 
8  5HAT HIS H 8   ? UNP Q6N0W9 ?   ?   'expression tag'        -12 162 
8  5HAT HIS H 9   ? UNP Q6N0W9 ?   ?   'expression tag'        -11 163 
8  5HAT HIS H 10  ? UNP Q6N0W9 ?   ?   'expression tag'        -10 164 
8  5HAT SER H 11  ? UNP Q6N0W9 ?   ?   'expression tag'        -9  165 
8  5HAT SER H 12  ? UNP Q6N0W9 ?   ?   'expression tag'        -8  166 
8  5HAT GLY H 13  ? UNP Q6N0W9 ?   ?   'expression tag'        -7  167 
8  5HAT LEU H 14  ? UNP Q6N0W9 ?   ?   'expression tag'        -6  168 
8  5HAT VAL H 15  ? UNP Q6N0W9 ?   ?   'expression tag'        -5  169 
8  5HAT PRO H 16  ? UNP Q6N0W9 ?   ?   'expression tag'        -4  170 
8  5HAT ARG H 17  ? UNP Q6N0W9 ?   ?   'expression tag'        -3  171 
8  5HAT GLY H 18  ? UNP Q6N0W9 ?   ?   'expression tag'        -2  172 
8  5HAT SER H 19  ? UNP Q6N0W9 ?   ?   'expression tag'        -1  173 
8  5HAT HIS H 20  ? UNP Q6N0W9 ?   ?   'expression tag'        0   174 
8  5HAT PHE H 79  ? UNP Q6N0W9 SER 59  'engineered mutation'   59  175 
8  5HAT ALA H 351 ? UNP Q6N0W9 MET 331 'engineered mutation'   331 176 
9  5HAT MET I 1   ? UNP Q6N0W9 ?   ?   'initiating methionine' -19 177 
9  5HAT GLY I 2   ? UNP Q6N0W9 ?   ?   'expression tag'        -18 178 
9  5HAT SER I 3   ? UNP Q6N0W9 ?   ?   'expression tag'        -17 179 
9  5HAT SER I 4   ? UNP Q6N0W9 ?   ?   'expression tag'        -16 180 
9  5HAT HIS I 5   ? UNP Q6N0W9 ?   ?   'expression tag'        -15 181 
9  5HAT HIS I 6   ? UNP Q6N0W9 ?   ?   'expression tag'        -14 182 
9  5HAT HIS I 7   ? UNP Q6N0W9 ?   ?   'expression tag'        -13 183 
9  5HAT HIS I 8   ? UNP Q6N0W9 ?   ?   'expression tag'        -12 184 
9  5HAT HIS I 9   ? UNP Q6N0W9 ?   ?   'expression tag'        -11 185 
9  5HAT HIS I 10  ? UNP Q6N0W9 ?   ?   'expression tag'        -10 186 
9  5HAT SER I 11  ? UNP Q6N0W9 ?   ?   'expression tag'        -9  187 
9  5HAT SER I 12  ? UNP Q6N0W9 ?   ?   'expression tag'        -8  188 
9  5HAT GLY I 13  ? UNP Q6N0W9 ?   ?   'expression tag'        -7  189 
9  5HAT LEU I 14  ? UNP Q6N0W9 ?   ?   'expression tag'        -6  190 
9  5HAT VAL I 15  ? UNP Q6N0W9 ?   ?   'expression tag'        -5  191 
9  5HAT PRO I 16  ? UNP Q6N0W9 ?   ?   'expression tag'        -4  192 
9  5HAT ARG I 17  ? UNP Q6N0W9 ?   ?   'expression tag'        -3  193 
9  5HAT GLY I 18  ? UNP Q6N0W9 ?   ?   'expression tag'        -2  194 
9  5HAT SER I 19  ? UNP Q6N0W9 ?   ?   'expression tag'        -1  195 
9  5HAT HIS I 20  ? UNP Q6N0W9 ?   ?   'expression tag'        0   196 
9  5HAT PHE I 79  ? UNP Q6N0W9 SER 59  'engineered mutation'   59  197 
9  5HAT ALA I 351 ? UNP Q6N0W9 MET 331 'engineered mutation'   331 198 
10 5HAT MET J 1   ? UNP Q6N0W9 ?   ?   'initiating methionine' -19 199 
10 5HAT GLY J 2   ? UNP Q6N0W9 ?   ?   'expression tag'        -18 200 
10 5HAT SER J 3   ? UNP Q6N0W9 ?   ?   'expression tag'        -17 201 
10 5HAT SER J 4   ? UNP Q6N0W9 ?   ?   'expression tag'        -16 202 
10 5HAT HIS J 5   ? UNP Q6N0W9 ?   ?   'expression tag'        -15 203 
10 5HAT HIS J 6   ? UNP Q6N0W9 ?   ?   'expression tag'        -14 204 
10 5HAT HIS J 7   ? UNP Q6N0W9 ?   ?   'expression tag'        -13 205 
10 5HAT HIS J 8   ? UNP Q6N0W9 ?   ?   'expression tag'        -12 206 
10 5HAT HIS J 9   ? UNP Q6N0W9 ?   ?   'expression tag'        -11 207 
10 5HAT HIS J 10  ? UNP Q6N0W9 ?   ?   'expression tag'        -10 208 
10 5HAT SER J 11  ? UNP Q6N0W9 ?   ?   'expression tag'        -9  209 
10 5HAT SER J 12  ? UNP Q6N0W9 ?   ?   'expression tag'        -8  210 
10 5HAT GLY J 13  ? UNP Q6N0W9 ?   ?   'expression tag'        -7  211 
10 5HAT LEU J 14  ? UNP Q6N0W9 ?   ?   'expression tag'        -6  212 
10 5HAT VAL J 15  ? UNP Q6N0W9 ?   ?   'expression tag'        -5  213 
10 5HAT PRO J 16  ? UNP Q6N0W9 ?   ?   'expression tag'        -4  214 
10 5HAT ARG J 17  ? UNP Q6N0W9 ?   ?   'expression tag'        -3  215 
10 5HAT GLY J 18  ? UNP Q6N0W9 ?   ?   'expression tag'        -2  216 
10 5HAT SER J 19  ? UNP Q6N0W9 ?   ?   'expression tag'        -1  217 
10 5HAT HIS J 20  ? UNP Q6N0W9 ?   ?   'expression tag'        0   218 
10 5HAT PHE J 79  ? UNP Q6N0W9 SER 59  'engineered mutation'   59  219 
10 5HAT ALA J 351 ? UNP Q6N0W9 MET 331 'engineered mutation'   331 220 
11 5HAT MET K 1   ? UNP Q6N0W9 ?   ?   'initiating methionine' -19 221 
11 5HAT GLY K 2   ? UNP Q6N0W9 ?   ?   'expression tag'        -18 222 
11 5HAT SER K 3   ? UNP Q6N0W9 ?   ?   'expression tag'        -17 223 
11 5HAT SER K 4   ? UNP Q6N0W9 ?   ?   'expression tag'        -16 224 
11 5HAT HIS K 5   ? UNP Q6N0W9 ?   ?   'expression tag'        -15 225 
11 5HAT HIS K 6   ? UNP Q6N0W9 ?   ?   'expression tag'        -14 226 
11 5HAT HIS K 7   ? UNP Q6N0W9 ?   ?   'expression tag'        -13 227 
11 5HAT HIS K 8   ? UNP Q6N0W9 ?   ?   'expression tag'        -12 228 
11 5HAT HIS K 9   ? UNP Q6N0W9 ?   ?   'expression tag'        -11 229 
11 5HAT HIS K 10  ? UNP Q6N0W9 ?   ?   'expression tag'        -10 230 
11 5HAT SER K 11  ? UNP Q6N0W9 ?   ?   'expression tag'        -9  231 
11 5HAT SER K 12  ? UNP Q6N0W9 ?   ?   'expression tag'        -8  232 
11 5HAT GLY K 13  ? UNP Q6N0W9 ?   ?   'expression tag'        -7  233 
11 5HAT LEU K 14  ? UNP Q6N0W9 ?   ?   'expression tag'        -6  234 
11 5HAT VAL K 15  ? UNP Q6N0W9 ?   ?   'expression tag'        -5  235 
11 5HAT PRO K 16  ? UNP Q6N0W9 ?   ?   'expression tag'        -4  236 
11 5HAT ARG K 17  ? UNP Q6N0W9 ?   ?   'expression tag'        -3  237 
11 5HAT GLY K 18  ? UNP Q6N0W9 ?   ?   'expression tag'        -2  238 
11 5HAT SER K 19  ? UNP Q6N0W9 ?   ?   'expression tag'        -1  239 
11 5HAT HIS K 20  ? UNP Q6N0W9 ?   ?   'expression tag'        0   240 
11 5HAT PHE K 79  ? UNP Q6N0W9 SER 59  'engineered mutation'   59  241 
11 5HAT ALA K 351 ? UNP Q6N0W9 MET 331 'engineered mutation'   331 242 
12 5HAT MET L 1   ? UNP Q6N0W9 ?   ?   'initiating methionine' -19 243 
12 5HAT GLY L 2   ? UNP Q6N0W9 ?   ?   'expression tag'        -18 244 
12 5HAT SER L 3   ? UNP Q6N0W9 ?   ?   'expression tag'        -17 245 
12 5HAT SER L 4   ? UNP Q6N0W9 ?   ?   'expression tag'        -16 246 
12 5HAT HIS L 5   ? UNP Q6N0W9 ?   ?   'expression tag'        -15 247 
12 5HAT HIS L 6   ? UNP Q6N0W9 ?   ?   'expression tag'        -14 248 
12 5HAT HIS L 7   ? UNP Q6N0W9 ?   ?   'expression tag'        -13 249 
12 5HAT HIS L 8   ? UNP Q6N0W9 ?   ?   'expression tag'        -12 250 
12 5HAT HIS L 9   ? UNP Q6N0W9 ?   ?   'expression tag'        -11 251 
12 5HAT HIS L 10  ? UNP Q6N0W9 ?   ?   'expression tag'        -10 252 
12 5HAT SER L 11  ? UNP Q6N0W9 ?   ?   'expression tag'        -9  253 
12 5HAT SER L 12  ? UNP Q6N0W9 ?   ?   'expression tag'        -8  254 
12 5HAT GLY L 13  ? UNP Q6N0W9 ?   ?   'expression tag'        -7  255 
12 5HAT LEU L 14  ? UNP Q6N0W9 ?   ?   'expression tag'        -6  256 
12 5HAT VAL L 15  ? UNP Q6N0W9 ?   ?   'expression tag'        -5  257 
12 5HAT PRO L 16  ? UNP Q6N0W9 ?   ?   'expression tag'        -4  258 
12 5HAT ARG L 17  ? UNP Q6N0W9 ?   ?   'expression tag'        -3  259 
12 5HAT GLY L 18  ? UNP Q6N0W9 ?   ?   'expression tag'        -2  260 
12 5HAT SER L 19  ? UNP Q6N0W9 ?   ?   'expression tag'        -1  261 
12 5HAT HIS L 20  ? UNP Q6N0W9 ?   ?   'expression tag'        0   262 
12 5HAT PHE L 79  ? UNP Q6N0W9 SER 59  'engineered mutation'   59  263 
12 5HAT ALA L 351 ? UNP Q6N0W9 MET 331 'engineered mutation'   331 264 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                             ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                            ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                          ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                     ? 'C4 H7 N O4'     133.103 
CAP saccharide          . 2-CARBOXYARABINITOL-1,5-DIPHOSPHATE ? 'C6 H14 O13 P2'  356.115 
CYS 'L-peptide linking' y CYSTEINE                            ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                           ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                     ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                             ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                           ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                               ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                          ? 'C6 H13 N O2'    131.173 
KCX 'L-peptide linking' n 'LYSINE NZ-CARBOXYLIC ACID'         ? 'C7 H14 N2 O4'   190.197 
LEU 'L-peptide linking' y LEUCINE                             ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                              ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                          ? 'C5 H11 N O2 S'  149.211 
MG  non-polymer         . 'MAGNESIUM ION'                     ? 'Mg 2'           24.305  
PHE 'L-peptide linking' y PHENYLALANINE                       ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                             ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                              ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                           ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                          ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                            ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                              ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5HAT 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.22 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         44.48 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;Protein storage buffer: 20 mM Tris, pH 8.0, 300 mM NaCl, 10% Glycerol, 10 mM MgCl2, 20 mM NaHCO3. Reservoir solution: 20-24% PEG 3350, 200 mM sodium sulfate, 100 mM Bis-Tris Propane pH 7.0-8.0.
;
_exptl_crystal_grow.pdbx_pH_range   7-8 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M-F' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-11-07 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9790 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 24-ID-C' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9790 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-C 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            35.850 
_reflns.entry_id                         5HAT 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.000 
_reflns.d_resolution_low                 91.97 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       318354 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       -3.000 
_reflns.percent_possible_obs             90.800 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     0.993 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  2.6 
_reflns.pdbx_Rmerge_I_obs                0.093 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            6.000 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 1.018 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.116 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         824839 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
2.000 2.050 ? 1.140  ? 52265 25993 ? 21522 82.800 ? ? 0.634 ? 0.799 ? ? ? ? ? ? ? ? 2.4 ? ? ? ? 1.015 ? 0 1  1 ? ? 
2.050 2.110 ? 1.580  ? 59214 25269 ? 23137 91.600 ? ? 0.694 ? 0.641 ? ? ? ? ? ? ? ? ?   ? ? ? ? 0.813 ? 0 2  1 ? ? 
2.110 2.170 ? 1.850  ? 60758 24588 ? 22963 93.400 ? ? 0.763 ? 0.554 ? ? ? ? ? ? ? ? ?   ? ? ? ? 0.700 ? 0 3  1 ? ? 
2.170 2.230 ? 2.180  ? 58417 23873 ? 22262 93.300 ? ? 0.834 ? 0.451 ? ? ? ? ? ? ? ? ?   ? ? ? ? 0.571 ? 0 4  1 ? ? 
2.230 2.310 ? 2.810  ? 55673 23198 ? 21345 92.000 ? ? 0.879 ? 0.352 ? ? ? ? ? ? ? ? ?   ? ? ? ? 0.446 ? 0 5  1 ? ? 
2.310 2.390 ? 3.320  ? 53092 22358 ? 20366 91.100 ? ? 0.920 ? 0.281 ? ? ? ? ? ? ? ? ?   ? ? ? ? 0.356 ? 0 6  1 ? ? 
2.390 2.480 ? 3.810  ? 47871 21560 ? 19016 88.200 ? ? 0.941 ? 0.232 ? ? ? ? ? ? ? ? ?   ? ? ? ? 0.294 ? 0 7  1 ? ? 
2.480 2.580 ? 4.680  ? 48586 20759 ? 18845 90.800 ? ? 0.961 ? 0.187 ? ? ? ? ? ? ? ? ?   ? ? ? ? 0.237 ? 0 8  1 ? ? 
2.580 2.690 ? 5.340  ? 49393 19951 ? 18662 93.500 ? ? 0.966 ? 0.164 ? ? ? ? ? ? ? ? ?   ? ? ? ? 0.207 ? 0 9  1 ? ? 
2.690 2.830 ? 6.220  ? 46745 19099 ? 17751 92.900 ? ? 0.976 ? 0.136 ? ? ? ? ? ? ? ? ?   ? ? ? ? 0.172 ? 0 10 1 ? ? 
2.830 2.980 ? 7.440  ? 43313 18043 ? 16516 91.500 ? ? 0.984 ? 0.110 ? ? ? ? ? ? ? ? ?   ? ? ? ? 0.137 ? 0 11 1 ? ? 
2.980 3.160 ? 8.700  ? 39442 17176 ? 15254 88.800 ? ? 0.987 ? 0.091 ? ? ? ? ? ? ? ? ?   ? ? ? ? 0.114 ? 0 12 1 ? ? 
3.160 3.380 ? 10.090 ? 35854 16062 ? 14028 87.300 ? ? 0.990 ? 0.077 ? ? ? ? ? ? ? ? ?   ? ? ? ? 0.096 ? 0 13 1 ? ? 
3.380 3.650 ? 11.390 ? 37001 15054 ? 14064 93.400 ? ? 0.990 ? 0.070 ? ? ? ? ? ? ? ? ?   ? ? ? ? 0.088 ? 0 14 1 ? ? 
3.650 4.000 ? 12.630 ? 33350 13763 ? 12747 92.600 ? ? 0.991 ? 0.062 ? ? ? ? ? ? ? ? ?   ? ? ? ? 0.077 ? 0 15 1 ? ? 
4.000 4.470 ? 13.360 ? 29336 12464 ? 11301 90.700 ? ? 0.992 ? 0.057 ? ? ? ? ? ? ? ? ?   ? ? ? ? 0.071 ? 0 16 1 ? ? 
4.470 5.160 ? 13.600 ? 24339 10977 ? 9525  86.800 ? ? 0.992 ? 0.054 ? ? ? ? ? ? ? ? ?   ? ? ? ? 0.067 ? 0 17 1 ? ? 
5.160 6.320 ? 13.290 ? 23430 9287  ? 8874  95.600 ? ? 0.993 ? 0.054 ? ? ? ? ? ? ? ? ?   ? ? ? ? 0.067 ? 0 18 1 ? ? 
6.320 8.940 ? 13.900 ? 17166 7149  ? 6554  91.700 ? ? 0.993 ? 0.051 ? ? ? ? ? ? ? ? ?   ? ? ? ? 0.064 ? 0 19 1 ? ? 
8.940 91.97 ? 14.520 ? 9594  3937  ? 3622  92.000 ? ? 0.994 ? 0.050 ? ? ? ? ? ? ? ? ?   ? ? ? ? 0.062 ? 0 20 1 ? ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5HAT 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     317951 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    91.07 
_refine.ls_R_factor_obs                          0.2162 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2126 
_refine.ls_R_factor_R_free                       0.2490 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.00 
_refine.ls_number_reflns_R_free                  31796 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.9434 
_refine.correlation_coeff_Fo_to_Fc_free          0.9281 
_refine.B_iso_mean                               42.42 
_refine.aniso_B[1][1]                            -2.6687 
_refine.aniso_B[2][2]                            -3.1730 
_refine.aniso_B[3][3]                            5.8417 
_refine.aniso_B[1][2]                            -1.6104 
_refine.aniso_B[1][3]                            -2.6151 
_refine.aniso_B[2][3]                            -2.1178 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      4LF1 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               0.238 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.187 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        5HAT 
_refine_analyze.Luzzati_coordinate_error_obs    0.308 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        82362 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         3120 
_refine_hist.number_atoms_solvent             2604 
_refine_hist.number_atoms_total               88086 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d                  0.010 ? 2.00  83934  'X-RAY DIFFRACTION' HARMONIC     
t_angle_deg               1.00  ? 2.00  150772 'X-RAY DIFFRACTION' HARMONIC     
t_dihedral_angle_d        ?     ? 2.00  23102  'X-RAY DIFFRACTION' SINUSOIDAL   
t_incorr_chiral_ct        ?     ? ?     ?      'X-RAY DIFFRACTION' ?            
t_pseud_angle             ?     ? ?     ?      'X-RAY DIFFRACTION' ?            
t_trig_c_planes           ?     ? 2.00  1021   'X-RAY DIFFRACTION' HARMONIC     
t_gen_planes              ?     ? 5.00  12855  'X-RAY DIFFRACTION' HARMONIC     
t_it                      ?     ? 20.00 83934  'X-RAY DIFFRACTION' HARMONIC     
t_nbd                     ?     ? 5.00  25     'X-RAY DIFFRACTION' SEMIHARMONIC 
t_omega_torsion           3.91  ? ?     ?      'X-RAY DIFFRACTION' ?            
t_other_torsion           2.67  ? ?     ?      'X-RAY DIFFRACTION' ?            
t_improper_torsion        ?     ? ?     ?      'X-RAY DIFFRACTION' ?            
t_chiral_improper_torsion ?     ? 5.00  5527   'X-RAY DIFFRACTION' SEMIHARMONIC 
t_sum_occupancies         ?     ? ?     ?      'X-RAY DIFFRACTION' ?            
t_utility_distance        ?     ? ?     ?      'X-RAY DIFFRACTION' ?            
t_utility_angle           ?     ? ?     ?      'X-RAY DIFFRACTION' ?            
t_utility_torsion         ?     ? ?     ?      'X-RAY DIFFRACTION' ?            
t_ideal_dist_contact      ?     ? 4.00  92057  'X-RAY DIFFRACTION' SEMIHARMONIC 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.00 
_refine_ls_shell.d_res_low                        2.05 
_refine_ls_shell.number_reflns_R_work             19952 
_refine_ls_shell.R_factor_R_work                  0.2239 
_refine_ls_shell.percent_reflns_obs               91.07 
_refine_ls_shell.R_factor_R_free                  0.2543 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            9.99 
_refine_ls_shell.number_reflns_R_free             2214 
_refine_ls_shell.number_reflns_all                22166 
_refine_ls_shell.R_factor_all                     0.2269 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                     5HAT 
_struct.title                        'Structure function studies of R. palustris RubisCO (S59F/M331A mutant; CABP-bound)' 
_struct.pdbx_descriptor              'Form II RubisCO' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5HAT 
_struct_keywords.text            'RubisCO, hexamer, lyase' 
_struct_keywords.pdbx_keywords   LYASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 1 ? 
J  N N 1 ? 
K  N N 1 ? 
L  N N 1 ? 
M  N N 2 ? 
N  N N 3 ? 
O  N N 2 ? 
P  N N 3 ? 
Q  N N 2 ? 
R  N N 3 ? 
S  N N 2 ? 
T  N N 3 ? 
U  N N 2 ? 
V  N N 3 ? 
W  N N 2 ? 
X  N N 3 ? 
Y  N N 2 ? 
Z  N N 3 ? 
AA N N 2 ? 
BA N N 3 ? 
CA N N 2 ? 
DA N N 3 ? 
EA N N 2 ? 
FA N N 3 ? 
GA N N 2 ? 
HA N N 3 ? 
IA N N 2 ? 
JA N N 3 ? 
KA N N 4 ? 
LA N N 4 ? 
MA N N 4 ? 
NA N N 4 ? 
OA N N 4 ? 
PA N N 4 ? 
QA N N 4 ? 
RA N N 4 ? 
SA N N 4 ? 
TA N N 4 ? 
UA N N 4 ? 
VA N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 GLN A 23  ? ALA A 28  ? GLN A 3   ALA A 8   1 ? 6  
HELX_P HELX_P2   AA2 LYS A 33  ? GLY A 41  ? LYS A 13  GLY A 21  1 ? 9  
HELX_P HELX_P3   AA3 ASN A 58  ? SER A 70  ? ASN A 38  SER A 50  1 ? 13 
HELX_P HELX_P4   AA4 ASP A 82  ? VAL A 88  ? ASP A 62  VAL A 68  1 ? 7  
HELX_P HELX_P5   AA5 GLU A 97  ? ASN A 99  ? GLU A 77  ASN A 79  5 ? 3  
HELX_P HELX_P6   AA6 GLU A 109 ? PHE A 111 ? GLU A 89  PHE A 91  5 ? 3  
HELX_P HELX_P7   AA7 MET A 121 ? GLY A 131 ? MET A 101 GLY A 111 1 ? 11 
HELX_P HELX_P8   AA8 ASN A 132 ? MET A 136 ? ASN A 112 MET A 116 5 ? 5  
HELX_P HELX_P9   AA9 PRO A 150 ? LYS A 155 ? PRO A 130 LYS A 135 1 ? 6  
HELX_P HELX_P10  AB1 THR A 163 ? GLY A 172 ? THR A 143 GLY A 152 1 ? 10 
HELX_P HELX_P11  AB2 ARG A 193 ? LEU A 206 ? ARG A 173 LEU A 186 1 ? 14 
HELX_P HELX_P12  AB3 PRO A 224 ? GLY A 244 ? PRO A 204 GLY A 224 1 ? 21 
HELX_P HELX_P13  AB4 ASP A 257 ? ALA A 273 ? ASP A 237 ALA A 253 1 ? 17 
HELX_P HELX_P14  AB5 ASP A 274 ? ASP A 277 ? ASP A 254 ASP A 257 5 ? 4  
HELX_P HELX_P15  AB6 GLY A 289 ? PHE A 300 ? GLY A 269 PHE A 280 1 ? 12 
HELX_P HELX_P16  AB7 HIS A 312 ? SER A 317 ? HIS A 292 SER A 297 1 ? 6  
HELX_P HELX_P17  AB8 THR A 325 ? GLY A 337 ? THR A 305 GLY A 317 1 ? 13 
HELX_P HELX_P18  AB9 GLU A 354 ? ALA A 356 ? GLU A 334 ALA A 336 5 ? 3  
HELX_P HELX_P19  AC1 ASP A 357 ? GLU A 366 ? ASP A 337 GLU A 346 1 ? 10 
HELX_P HELX_P20  AC2 ASN A 393 ? LEU A 395 ? ASN A 373 LEU A 375 5 ? 3  
HELX_P HELX_P21  AC3 ARG A 396 ? GLY A 405 ? ARG A 376 GLY A 385 1 ? 10 
HELX_P HELX_P22  AC4 GLY A 414 ? GLY A 419 ? GLY A 394 GLY A 399 1 ? 6  
HELX_P HELX_P23  AC5 GLY A 423 ? GLY A 441 ? GLY A 403 GLY A 421 1 ? 19 
HELX_P HELX_P24  AC6 ASP A 443 ? LYS A 449 ? ASP A 423 LYS A 429 1 ? 7  
HELX_P HELX_P25  AC7 HIS A 451 ? PHE A 461 ? HIS A 431 PHE A 441 1 ? 11 
HELX_P HELX_P26  AC8 PHE A 461 ? TYR A 469 ? PHE A 441 TYR A 449 1 ? 9  
HELX_P HELX_P27  AC9 GLN B 23  ? ALA B 28  ? GLN B 3   ALA B 8   1 ? 6  
HELX_P HELX_P28  AD1 LYS B 33  ? GLY B 41  ? LYS B 13  GLY B 21  1 ? 9  
HELX_P HELX_P29  AD2 ASN B 58  ? SER B 70  ? ASN B 38  SER B 50  1 ? 13 
HELX_P HELX_P30  AD3 ASP B 82  ? VAL B 88  ? ASP B 62  VAL B 68  1 ? 7  
HELX_P HELX_P31  AD4 GLU B 97  ? ASN B 99  ? GLU B 77  ASN B 79  5 ? 3  
HELX_P HELX_P32  AD5 GLU B 109 ? PHE B 111 ? GLU B 89  PHE B 91  5 ? 3  
HELX_P HELX_P33  AD6 MET B 121 ? ILE B 130 ? MET B 101 ILE B 110 1 ? 10 
HELX_P HELX_P34  AD7 GLY B 131 ? MET B 136 ? GLY B 111 MET B 116 5 ? 6  
HELX_P HELX_P35  AD8 PRO B 150 ? LYS B 155 ? PRO B 130 LYS B 135 1 ? 6  
HELX_P HELX_P36  AD9 THR B 163 ? GLY B 172 ? THR B 143 GLY B 152 1 ? 10 
HELX_P HELX_P37  AE1 ARG B 193 ? LEU B 206 ? ARG B 173 LEU B 186 1 ? 14 
HELX_P HELX_P38  AE2 PRO B 224 ? GLY B 244 ? PRO B 204 GLY B 224 1 ? 21 
HELX_P HELX_P39  AE3 ASP B 257 ? ALA B 273 ? ASP B 237 ALA B 253 1 ? 17 
HELX_P HELX_P40  AE4 ASP B 274 ? ASP B 277 ? ASP B 254 ASP B 257 5 ? 4  
HELX_P HELX_P41  AE5 GLY B 289 ? PHE B 300 ? GLY B 269 PHE B 280 1 ? 12 
HELX_P HELX_P42  AE6 HIS B 312 ? SER B 317 ? HIS B 292 SER B 297 1 ? 6  
HELX_P HELX_P43  AE7 THR B 325 ? GLY B 337 ? THR B 305 GLY B 317 1 ? 13 
HELX_P HELX_P44  AE8 GLU B 354 ? ALA B 356 ? GLU B 334 ALA B 336 5 ? 3  
HELX_P HELX_P45  AE9 ASP B 357 ? GLU B 366 ? ASP B 337 GLU B 346 1 ? 10 
HELX_P HELX_P46  AF1 ARG B 396 ? GLY B 405 ? ARG B 376 GLY B 385 1 ? 10 
HELX_P HELX_P47  AF2 GLY B 414 ? GLY B 419 ? GLY B 394 GLY B 399 1 ? 6  
HELX_P HELX_P48  AF3 GLY B 423 ? GLY B 441 ? GLY B 403 GLY B 421 1 ? 19 
HELX_P HELX_P49  AF4 ASP B 443 ? LYS B 449 ? ASP B 423 LYS B 429 1 ? 7  
HELX_P HELX_P50  AF5 HIS B 451 ? PHE B 461 ? HIS B 431 PHE B 441 1 ? 11 
HELX_P HELX_P51  AF6 PHE B 461 ? TYR B 469 ? PHE B 441 TYR B 449 1 ? 9  
HELX_P HELX_P52  AF7 GLN C 23  ? ALA C 28  ? GLN C 3   ALA C 8   1 ? 6  
HELX_P HELX_P53  AF8 LYS C 33  ? GLY C 41  ? LYS C 13  GLY C 21  1 ? 9  
HELX_P HELX_P54  AF9 ASN C 58  ? SER C 70  ? ASN C 38  SER C 50  1 ? 13 
HELX_P HELX_P55  AG1 ASP C 82  ? VAL C 88  ? ASP C 62  VAL C 68  1 ? 7  
HELX_P HELX_P56  AG2 GLU C 97  ? ASN C 99  ? GLU C 77  ASN C 79  5 ? 3  
HELX_P HELX_P57  AG3 GLU C 109 ? PHE C 111 ? GLU C 89  PHE C 91  5 ? 3  
HELX_P HELX_P58  AG4 MET C 121 ? ILE C 130 ? MET C 101 ILE C 110 1 ? 10 
HELX_P HELX_P59  AG5 GLY C 131 ? MET C 136 ? GLY C 111 MET C 116 5 ? 6  
HELX_P HELX_P60  AG6 PRO C 150 ? LYS C 155 ? PRO C 130 LYS C 135 1 ? 6  
HELX_P HELX_P61  AG7 THR C 163 ? GLY C 172 ? THR C 143 GLY C 152 1 ? 10 
HELX_P HELX_P62  AG8 ARG C 193 ? LEU C 206 ? ARG C 173 LEU C 186 1 ? 14 
HELX_P HELX_P63  AG9 PRO C 224 ? GLY C 244 ? PRO C 204 GLY C 224 1 ? 21 
HELX_P HELX_P64  AH1 ASP C 257 ? ALA C 273 ? ASP C 237 ALA C 253 1 ? 17 
HELX_P HELX_P65  AH2 ASP C 274 ? ASP C 277 ? ASP C 254 ASP C 257 5 ? 4  
HELX_P HELX_P66  AH3 GLY C 289 ? PHE C 300 ? GLY C 269 PHE C 280 1 ? 12 
HELX_P HELX_P67  AH4 HIS C 312 ? SER C 317 ? HIS C 292 SER C 297 1 ? 6  
HELX_P HELX_P68  AH5 THR C 325 ? GLY C 337 ? THR C 305 GLY C 317 1 ? 13 
HELX_P HELX_P69  AH6 GLU C 354 ? ALA C 356 ? GLU C 334 ALA C 336 5 ? 3  
HELX_P HELX_P70  AH7 ASP C 357 ? GLU C 366 ? ASP C 337 GLU C 346 1 ? 10 
HELX_P HELX_P71  AH8 ARG C 396 ? GLY C 405 ? ARG C 376 GLY C 385 1 ? 10 
HELX_P HELX_P72  AH9 GLY C 414 ? GLY C 419 ? GLY C 394 GLY C 399 1 ? 6  
HELX_P HELX_P73  AI1 GLY C 423 ? GLY C 441 ? GLY C 403 GLY C 421 1 ? 19 
HELX_P HELX_P74  AI2 ASP C 443 ? LYS C 449 ? ASP C 423 LYS C 429 1 ? 7  
HELX_P HELX_P75  AI3 HIS C 451 ? PHE C 461 ? HIS C 431 PHE C 441 1 ? 11 
HELX_P HELX_P76  AI4 PHE C 461 ? TYR C 469 ? PHE C 441 TYR C 449 1 ? 9  
HELX_P HELX_P77  AI5 GLN D 23  ? ALA D 28  ? GLN D 3   ALA D 8   1 ? 6  
HELX_P HELX_P78  AI6 LYS D 33  ? GLY D 41  ? LYS D 13  GLY D 21  1 ? 9  
HELX_P HELX_P79  AI7 ASN D 58  ? SER D 70  ? ASN D 38  SER D 50  1 ? 13 
HELX_P HELX_P80  AI8 ASP D 82  ? VAL D 88  ? ASP D 62  VAL D 68  1 ? 7  
HELX_P HELX_P81  AI9 GLU D 97  ? ASN D 99  ? GLU D 77  ASN D 79  5 ? 3  
HELX_P HELX_P82  AJ1 GLU D 109 ? PHE D 111 ? GLU D 89  PHE D 91  5 ? 3  
HELX_P HELX_P83  AJ2 MET D 121 ? ILE D 130 ? MET D 101 ILE D 110 1 ? 10 
HELX_P HELX_P84  AJ3 GLY D 131 ? MET D 136 ? GLY D 111 MET D 116 5 ? 6  
HELX_P HELX_P85  AJ4 PRO D 150 ? LYS D 155 ? PRO D 130 LYS D 135 1 ? 6  
HELX_P HELX_P86  AJ5 THR D 163 ? GLY D 172 ? THR D 143 GLY D 152 1 ? 10 
HELX_P HELX_P87  AJ6 ARG D 193 ? LEU D 206 ? ARG D 173 LEU D 186 1 ? 14 
HELX_P HELX_P88  AJ7 PRO D 224 ? GLY D 244 ? PRO D 204 GLY D 224 1 ? 21 
HELX_P HELX_P89  AJ8 ASP D 257 ? ALA D 273 ? ASP D 237 ALA D 253 1 ? 17 
HELX_P HELX_P90  AJ9 ASP D 274 ? ASP D 277 ? ASP D 254 ASP D 257 5 ? 4  
HELX_P HELX_P91  AK1 GLY D 289 ? PHE D 300 ? GLY D 269 PHE D 280 1 ? 12 
HELX_P HELX_P92  AK2 HIS D 312 ? SER D 317 ? HIS D 292 SER D 297 1 ? 6  
HELX_P HELX_P93  AK3 THR D 325 ? GLY D 337 ? THR D 305 GLY D 317 1 ? 13 
HELX_P HELX_P94  AK4 GLU D 354 ? ALA D 356 ? GLU D 334 ALA D 336 5 ? 3  
HELX_P HELX_P95  AK5 ASP D 357 ? GLU D 366 ? ASP D 337 GLU D 346 1 ? 10 
HELX_P HELX_P96  AK6 ASN D 393 ? LEU D 395 ? ASN D 373 LEU D 375 5 ? 3  
HELX_P HELX_P97  AK7 ARG D 396 ? GLY D 405 ? ARG D 376 GLY D 385 1 ? 10 
HELX_P HELX_P98  AK8 ALA D 413 ? GLY D 419 ? ALA D 393 GLY D 399 1 ? 7  
HELX_P HELX_P99  AK9 GLY D 423 ? GLY D 441 ? GLY D 403 GLY D 421 1 ? 19 
HELX_P HELX_P100 AL1 ASP D 443 ? LYS D 449 ? ASP D 423 LYS D 429 1 ? 7  
HELX_P HELX_P101 AL2 HIS D 451 ? PHE D 461 ? HIS D 431 PHE D 441 1 ? 11 
HELX_P HELX_P102 AL3 PHE D 461 ? TYR D 469 ? PHE D 441 TYR D 449 1 ? 9  
HELX_P HELX_P103 AL4 GLN E 23  ? ALA E 28  ? GLN E 3   ALA E 8   1 ? 6  
HELX_P HELX_P104 AL5 LYS E 33  ? GLY E 41  ? LYS E 13  GLY E 21  1 ? 9  
HELX_P HELX_P105 AL6 ASN E 58  ? SER E 70  ? ASN E 38  SER E 50  1 ? 13 
HELX_P HELX_P106 AL7 ASP E 82  ? VAL E 88  ? ASP E 62  VAL E 68  1 ? 7  
HELX_P HELX_P107 AL8 GLU E 97  ? ASN E 99  ? GLU E 77  ASN E 79  5 ? 3  
HELX_P HELX_P108 AL9 GLU E 109 ? PHE E 111 ? GLU E 89  PHE E 91  5 ? 3  
HELX_P HELX_P109 AM1 MET E 121 ? ILE E 130 ? MET E 101 ILE E 110 1 ? 10 
HELX_P HELX_P110 AM2 GLY E 131 ? MET E 136 ? GLY E 111 MET E 116 5 ? 6  
HELX_P HELX_P111 AM3 PRO E 150 ? LYS E 155 ? PRO E 130 LYS E 135 1 ? 6  
HELX_P HELX_P112 AM4 THR E 163 ? GLY E 172 ? THR E 143 GLY E 152 1 ? 10 
HELX_P HELX_P113 AM5 ARG E 193 ? LEU E 206 ? ARG E 173 LEU E 186 1 ? 14 
HELX_P HELX_P114 AM6 PRO E 224 ? GLY E 244 ? PRO E 204 GLY E 224 1 ? 21 
HELX_P HELX_P115 AM7 ASP E 257 ? ALA E 273 ? ASP E 237 ALA E 253 1 ? 17 
HELX_P HELX_P116 AM8 ASP E 274 ? ASP E 277 ? ASP E 254 ASP E 257 5 ? 4  
HELX_P HELX_P117 AM9 GLY E 289 ? PHE E 300 ? GLY E 269 PHE E 280 1 ? 12 
HELX_P HELX_P118 AN1 HIS E 312 ? SER E 317 ? HIS E 292 SER E 297 1 ? 6  
HELX_P HELX_P119 AN2 THR E 325 ? GLY E 337 ? THR E 305 GLY E 317 1 ? 13 
HELX_P HELX_P120 AN3 GLU E 354 ? ALA E 356 ? GLU E 334 ALA E 336 5 ? 3  
HELX_P HELX_P121 AN4 ASP E 357 ? GLU E 366 ? ASP E 337 GLU E 346 1 ? 10 
HELX_P HELX_P122 AN5 ARG E 396 ? GLY E 405 ? ARG E 376 GLY E 385 1 ? 10 
HELX_P HELX_P123 AN6 GLY E 414 ? GLY E 419 ? GLY E 394 GLY E 399 1 ? 6  
HELX_P HELX_P124 AN7 GLY E 423 ? GLY E 441 ? GLY E 403 GLY E 421 1 ? 19 
HELX_P HELX_P125 AN8 ASP E 443 ? LYS E 449 ? ASP E 423 LYS E 429 1 ? 7  
HELX_P HELX_P126 AN9 HIS E 451 ? PHE E 461 ? HIS E 431 PHE E 441 1 ? 11 
HELX_P HELX_P127 AO1 PHE E 461 ? TYR E 469 ? PHE E 441 TYR E 449 1 ? 9  
HELX_P HELX_P128 AO2 ASN E 471 ? LEU E 476 ? ASN E 451 LEU E 456 1 ? 6  
HELX_P HELX_P129 AO3 GLN F 23  ? ALA F 28  ? GLN F 3   ALA F 8   1 ? 6  
HELX_P HELX_P130 AO4 LYS F 33  ? GLY F 41  ? LYS F 13  GLY F 21  1 ? 9  
HELX_P HELX_P131 AO5 ASN F 58  ? SER F 70  ? ASN F 38  SER F 50  1 ? 13 
HELX_P HELX_P132 AO6 ASP F 82  ? VAL F 88  ? ASP F 62  VAL F 68  1 ? 7  
HELX_P HELX_P133 AO7 GLU F 97  ? ASN F 99  ? GLU F 77  ASN F 79  5 ? 3  
HELX_P HELX_P134 AO8 GLU F 109 ? PHE F 111 ? GLU F 89  PHE F 91  5 ? 3  
HELX_P HELX_P135 AO9 MET F 121 ? ILE F 130 ? MET F 101 ILE F 110 1 ? 10 
HELX_P HELX_P136 AP1 GLY F 131 ? MET F 136 ? GLY F 111 MET F 116 5 ? 6  
HELX_P HELX_P137 AP2 PRO F 150 ? LYS F 155 ? PRO F 130 LYS F 135 1 ? 6  
HELX_P HELX_P138 AP3 THR F 163 ? GLY F 172 ? THR F 143 GLY F 152 1 ? 10 
HELX_P HELX_P139 AP4 ARG F 193 ? LEU F 206 ? ARG F 173 LEU F 186 1 ? 14 
HELX_P HELX_P140 AP5 PRO F 224 ? GLY F 244 ? PRO F 204 GLY F 224 1 ? 21 
HELX_P HELX_P141 AP6 ASP F 257 ? ALA F 273 ? ASP F 237 ALA F 253 1 ? 17 
HELX_P HELX_P142 AP7 ASP F 274 ? ASP F 277 ? ASP F 254 ASP F 257 5 ? 4  
HELX_P HELX_P143 AP8 GLY F 289 ? PHE F 300 ? GLY F 269 PHE F 280 1 ? 12 
HELX_P HELX_P144 AP9 HIS F 312 ? SER F 317 ? HIS F 292 SER F 297 1 ? 6  
HELX_P HELX_P145 AQ1 THR F 325 ? GLY F 337 ? THR F 305 GLY F 317 1 ? 13 
HELX_P HELX_P146 AQ2 GLU F 354 ? ALA F 356 ? GLU F 334 ALA F 336 5 ? 3  
HELX_P HELX_P147 AQ3 ASP F 357 ? GLU F 366 ? ASP F 337 GLU F 346 1 ? 10 
HELX_P HELX_P148 AQ4 ASN F 393 ? LEU F 395 ? ASN F 373 LEU F 375 5 ? 3  
HELX_P HELX_P149 AQ5 ARG F 396 ? GLY F 405 ? ARG F 376 GLY F 385 1 ? 10 
HELX_P HELX_P150 AQ6 GLY F 414 ? GLY F 419 ? GLY F 394 GLY F 399 1 ? 6  
HELX_P HELX_P151 AQ7 GLY F 423 ? GLY F 441 ? GLY F 403 GLY F 421 1 ? 19 
HELX_P HELX_P152 AQ8 ASP F 443 ? LYS F 449 ? ASP F 423 LYS F 429 1 ? 7  
HELX_P HELX_P153 AQ9 HIS F 451 ? PHE F 461 ? HIS F 431 PHE F 441 1 ? 11 
HELX_P HELX_P154 AR1 PHE F 461 ? TYR F 469 ? PHE F 441 TYR F 449 1 ? 9  
HELX_P HELX_P155 AR2 ASN F 471 ? LEU F 476 ? ASN F 451 LEU F 456 1 ? 6  
HELX_P HELX_P156 AR3 GLN G 23  ? ALA G 28  ? GLN G 3   ALA G 8   1 ? 6  
HELX_P HELX_P157 AR4 LYS G 33  ? GLY G 41  ? LYS G 13  GLY G 21  1 ? 9  
HELX_P HELX_P158 AR5 ASN G 58  ? SER G 70  ? ASN G 38  SER G 50  1 ? 13 
HELX_P HELX_P159 AR6 ASP G 82  ? VAL G 88  ? ASP G 62  VAL G 68  1 ? 7  
HELX_P HELX_P160 AR7 GLU G 97  ? ASN G 99  ? GLU G 77  ASN G 79  5 ? 3  
HELX_P HELX_P161 AR8 GLU G 109 ? PHE G 111 ? GLU G 89  PHE G 91  5 ? 3  
HELX_P HELX_P162 AR9 MET G 121 ? ILE G 130 ? MET G 101 ILE G 110 1 ? 10 
HELX_P HELX_P163 AS1 GLY G 131 ? MET G 136 ? GLY G 111 MET G 116 5 ? 6  
HELX_P HELX_P164 AS2 PRO G 150 ? LYS G 155 ? PRO G 130 LYS G 135 1 ? 6  
HELX_P HELX_P165 AS3 THR G 163 ? GLY G 172 ? THR G 143 GLY G 152 1 ? 10 
HELX_P HELX_P166 AS4 ARG G 193 ? LEU G 206 ? ARG G 173 LEU G 186 1 ? 14 
HELX_P HELX_P167 AS5 PRO G 224 ? GLY G 244 ? PRO G 204 GLY G 224 1 ? 21 
HELX_P HELX_P168 AS6 ASP G 257 ? ALA G 273 ? ASP G 237 ALA G 253 1 ? 17 
HELX_P HELX_P169 AS7 ASP G 274 ? ASP G 277 ? ASP G 254 ASP G 257 5 ? 4  
HELX_P HELX_P170 AS8 GLY G 289 ? PHE G 300 ? GLY G 269 PHE G 280 1 ? 12 
HELX_P HELX_P171 AS9 HIS G 312 ? SER G 317 ? HIS G 292 SER G 297 1 ? 6  
HELX_P HELX_P172 AT1 THR G 325 ? GLY G 337 ? THR G 305 GLY G 317 1 ? 13 
HELX_P HELX_P173 AT2 GLU G 354 ? ALA G 356 ? GLU G 334 ALA G 336 5 ? 3  
HELX_P HELX_P174 AT3 ASP G 357 ? GLU G 366 ? ASP G 337 GLU G 346 1 ? 10 
HELX_P HELX_P175 AT4 ASN G 393 ? LEU G 395 ? ASN G 373 LEU G 375 5 ? 3  
HELX_P HELX_P176 AT5 ARG G 396 ? GLY G 405 ? ARG G 376 GLY G 385 1 ? 10 
HELX_P HELX_P177 AT6 GLY G 414 ? GLY G 419 ? GLY G 394 GLY G 399 1 ? 6  
HELX_P HELX_P178 AT7 GLY G 423 ? GLY G 441 ? GLY G 403 GLY G 421 1 ? 19 
HELX_P HELX_P179 AT8 ASP G 443 ? LYS G 449 ? ASP G 423 LYS G 429 1 ? 7  
HELX_P HELX_P180 AT9 HIS G 451 ? PHE G 461 ? HIS G 431 PHE G 441 1 ? 11 
HELX_P HELX_P181 AU1 PHE G 461 ? TYR G 469 ? PHE G 441 TYR G 449 1 ? 9  
HELX_P HELX_P182 AU2 GLN H 23  ? ALA H 28  ? GLN H 3   ALA H 8   1 ? 6  
HELX_P HELX_P183 AU3 LYS H 33  ? GLY H 41  ? LYS H 13  GLY H 21  1 ? 9  
HELX_P HELX_P184 AU4 ASN H 58  ? SER H 70  ? ASN H 38  SER H 50  1 ? 13 
HELX_P HELX_P185 AU5 ASP H 82  ? VAL H 88  ? ASP H 62  VAL H 68  1 ? 7  
HELX_P HELX_P186 AU6 GLU H 97  ? ASN H 99  ? GLU H 77  ASN H 79  5 ? 3  
HELX_P HELX_P187 AU7 GLU H 109 ? PHE H 111 ? GLU H 89  PHE H 91  5 ? 3  
HELX_P HELX_P188 AU8 MET H 121 ? ILE H 130 ? MET H 101 ILE H 110 1 ? 10 
HELX_P HELX_P189 AU9 GLY H 131 ? MET H 136 ? GLY H 111 MET H 116 5 ? 6  
HELX_P HELX_P190 AV1 PRO H 150 ? LYS H 155 ? PRO H 130 LYS H 135 1 ? 6  
HELX_P HELX_P191 AV2 THR H 163 ? GLY H 172 ? THR H 143 GLY H 152 1 ? 10 
HELX_P HELX_P192 AV3 ARG H 193 ? LEU H 206 ? ARG H 173 LEU H 186 1 ? 14 
HELX_P HELX_P193 AV4 PRO H 224 ? GLY H 244 ? PRO H 204 GLY H 224 1 ? 21 
HELX_P HELX_P194 AV5 ASP H 257 ? ALA H 273 ? ASP H 237 ALA H 253 1 ? 17 
HELX_P HELX_P195 AV6 ASP H 274 ? ASP H 277 ? ASP H 254 ASP H 257 5 ? 4  
HELX_P HELX_P196 AV7 GLY H 285 ? GLY H 289 ? GLY H 265 GLY H 269 1 ? 5  
HELX_P HELX_P197 AV8 GLY H 289 ? PHE H 300 ? GLY H 269 PHE H 280 1 ? 12 
HELX_P HELX_P198 AV9 HIS H 312 ? SER H 317 ? HIS H 292 SER H 297 1 ? 6  
HELX_P HELX_P199 AW1 THR H 325 ? GLY H 337 ? THR H 305 GLY H 317 1 ? 13 
HELX_P HELX_P200 AW2 GLU H 354 ? ALA H 356 ? GLU H 334 ALA H 336 5 ? 3  
HELX_P HELX_P201 AW3 ASP H 357 ? GLU H 366 ? ASP H 337 GLU H 346 1 ? 10 
HELX_P HELX_P202 AW4 ARG H 396 ? GLY H 405 ? ARG H 376 GLY H 385 1 ? 10 
HELX_P HELX_P203 AW5 GLY H 414 ? GLY H 419 ? GLY H 394 GLY H 399 1 ? 6  
HELX_P HELX_P204 AW6 GLY H 423 ? GLY H 441 ? GLY H 403 GLY H 421 1 ? 19 
HELX_P HELX_P205 AW7 ASP H 443 ? LYS H 449 ? ASP H 423 LYS H 429 1 ? 7  
HELX_P HELX_P206 AW8 HIS H 451 ? PHE H 461 ? HIS H 431 PHE H 441 1 ? 11 
HELX_P HELX_P207 AW9 PHE H 461 ? TYR H 469 ? PHE H 441 TYR H 449 1 ? 9  
HELX_P HELX_P208 AX1 ASN H 471 ? LEU H 476 ? ASN H 451 LEU H 456 1 ? 6  
HELX_P HELX_P209 AX2 GLN I 23  ? ALA I 28  ? GLN I 3   ALA I 8   1 ? 6  
HELX_P HELX_P210 AX3 LYS I 33  ? GLY I 41  ? LYS I 13  GLY I 21  1 ? 9  
HELX_P HELX_P211 AX4 ASN I 58  ? SER I 70  ? ASN I 38  SER I 50  1 ? 13 
HELX_P HELX_P212 AX5 ASP I 82  ? VAL I 88  ? ASP I 62  VAL I 68  1 ? 7  
HELX_P HELX_P213 AX6 GLU I 97  ? ASN I 99  ? GLU I 77  ASN I 79  5 ? 3  
HELX_P HELX_P214 AX7 GLU I 109 ? PHE I 111 ? GLU I 89  PHE I 91  5 ? 3  
HELX_P HELX_P215 AX8 MET I 121 ? ILE I 130 ? MET I 101 ILE I 110 1 ? 10 
HELX_P HELX_P216 AX9 GLY I 131 ? MET I 136 ? GLY I 111 MET I 116 5 ? 6  
HELX_P HELX_P217 AY1 PRO I 150 ? LYS I 155 ? PRO I 130 LYS I 135 1 ? 6  
HELX_P HELX_P218 AY2 THR I 163 ? GLY I 172 ? THR I 143 GLY I 152 1 ? 10 
HELX_P HELX_P219 AY3 ARG I 193 ? LEU I 206 ? ARG I 173 LEU I 186 1 ? 14 
HELX_P HELX_P220 AY4 PRO I 224 ? GLY I 244 ? PRO I 204 GLY I 224 1 ? 21 
HELX_P HELX_P221 AY5 ASP I 257 ? ALA I 273 ? ASP I 237 ALA I 253 1 ? 17 
HELX_P HELX_P222 AY6 ASP I 274 ? ASP I 277 ? ASP I 254 ASP I 257 5 ? 4  
HELX_P HELX_P223 AY7 GLY I 289 ? PHE I 300 ? GLY I 269 PHE I 280 1 ? 12 
HELX_P HELX_P224 AY8 HIS I 312 ? SER I 317 ? HIS I 292 SER I 297 1 ? 6  
HELX_P HELX_P225 AY9 THR I 325 ? GLY I 337 ? THR I 305 GLY I 317 1 ? 13 
HELX_P HELX_P226 AZ1 GLU I 354 ? ALA I 356 ? GLU I 334 ALA I 336 5 ? 3  
HELX_P HELX_P227 AZ2 ASP I 357 ? GLU I 366 ? ASP I 337 GLU I 346 1 ? 10 
HELX_P HELX_P228 AZ3 ASN I 393 ? LEU I 395 ? ASN I 373 LEU I 375 5 ? 3  
HELX_P HELX_P229 AZ4 ARG I 396 ? GLY I 405 ? ARG I 376 GLY I 385 1 ? 10 
HELX_P HELX_P230 AZ5 GLY I 414 ? GLY I 419 ? GLY I 394 GLY I 399 1 ? 6  
HELX_P HELX_P231 AZ6 GLY I 423 ? GLY I 441 ? GLY I 403 GLY I 421 1 ? 19 
HELX_P HELX_P232 AZ7 ASP I 443 ? LYS I 449 ? ASP I 423 LYS I 429 1 ? 7  
HELX_P HELX_P233 AZ8 HIS I 451 ? PHE I 461 ? HIS I 431 PHE I 441 1 ? 11 
HELX_P HELX_P234 AZ9 PHE I 461 ? TYR I 469 ? PHE I 441 TYR I 449 1 ? 9  
HELX_P HELX_P235 BA1 GLN J 23  ? ALA J 28  ? GLN J 3   ALA J 8   1 ? 6  
HELX_P HELX_P236 BA2 LYS J 33  ? GLY J 41  ? LYS J 13  GLY J 21  1 ? 9  
HELX_P HELX_P237 BA3 ASN J 58  ? SER J 70  ? ASN J 38  SER J 50  1 ? 13 
HELX_P HELX_P238 BA4 ASP J 82  ? VAL J 88  ? ASP J 62  VAL J 68  1 ? 7  
HELX_P HELX_P239 BA5 GLU J 97  ? ASN J 99  ? GLU J 77  ASN J 79  5 ? 3  
HELX_P HELX_P240 BA6 GLU J 109 ? PHE J 111 ? GLU J 89  PHE J 91  5 ? 3  
HELX_P HELX_P241 BA7 MET J 121 ? ILE J 130 ? MET J 101 ILE J 110 1 ? 10 
HELX_P HELX_P242 BA8 GLY J 131 ? MET J 136 ? GLY J 111 MET J 116 5 ? 6  
HELX_P HELX_P243 BA9 PRO J 150 ? LYS J 155 ? PRO J 130 LYS J 135 1 ? 6  
HELX_P HELX_P244 BB1 THR J 163 ? GLY J 172 ? THR J 143 GLY J 152 1 ? 10 
HELX_P HELX_P245 BB2 ARG J 193 ? LEU J 206 ? ARG J 173 LEU J 186 1 ? 14 
HELX_P HELX_P246 BB3 PRO J 224 ? GLY J 244 ? PRO J 204 GLY J 224 1 ? 21 
HELX_P HELX_P247 BB4 ASP J 257 ? ALA J 273 ? ASP J 237 ALA J 253 1 ? 17 
HELX_P HELX_P248 BB5 ASP J 274 ? ASP J 277 ? ASP J 254 ASP J 257 5 ? 4  
HELX_P HELX_P249 BB6 GLY J 289 ? PHE J 300 ? GLY J 269 PHE J 280 1 ? 12 
HELX_P HELX_P250 BB7 HIS J 312 ? SER J 317 ? HIS J 292 SER J 297 1 ? 6  
HELX_P HELX_P251 BB8 THR J 325 ? GLY J 337 ? THR J 305 GLY J 317 1 ? 13 
HELX_P HELX_P252 BB9 GLU J 354 ? ALA J 356 ? GLU J 334 ALA J 336 5 ? 3  
HELX_P HELX_P253 BC1 ASP J 357 ? GLU J 366 ? ASP J 337 GLU J 346 1 ? 10 
HELX_P HELX_P254 BC2 ARG J 396 ? GLY J 405 ? ARG J 376 GLY J 385 1 ? 10 
HELX_P HELX_P255 BC3 GLY J 414 ? GLY J 419 ? GLY J 394 GLY J 399 1 ? 6  
HELX_P HELX_P256 BC4 GLY J 423 ? GLY J 441 ? GLY J 403 GLY J 421 1 ? 19 
HELX_P HELX_P257 BC5 ASP J 443 ? LYS J 449 ? ASP J 423 LYS J 429 1 ? 7  
HELX_P HELX_P258 BC6 HIS J 451 ? PHE J 461 ? HIS J 431 PHE J 441 1 ? 11 
HELX_P HELX_P259 BC7 PHE J 461 ? TYR J 469 ? PHE J 441 TYR J 449 1 ? 9  
HELX_P HELX_P260 BC8 GLN K 23  ? ALA K 28  ? GLN K 3   ALA K 8   1 ? 6  
HELX_P HELX_P261 BC9 LYS K 33  ? GLY K 41  ? LYS K 13  GLY K 21  1 ? 9  
HELX_P HELX_P262 BD1 ASN K 58  ? SER K 70  ? ASN K 38  SER K 50  1 ? 13 
HELX_P HELX_P263 BD2 ASP K 82  ? VAL K 88  ? ASP K 62  VAL K 68  1 ? 7  
HELX_P HELX_P264 BD3 GLU K 97  ? ASN K 99  ? GLU K 77  ASN K 79  5 ? 3  
HELX_P HELX_P265 BD4 GLU K 109 ? PHE K 111 ? GLU K 89  PHE K 91  5 ? 3  
HELX_P HELX_P266 BD5 MET K 121 ? ILE K 130 ? MET K 101 ILE K 110 1 ? 10 
HELX_P HELX_P267 BD6 GLY K 131 ? MET K 136 ? GLY K 111 MET K 116 5 ? 6  
HELX_P HELX_P268 BD7 PRO K 150 ? LYS K 155 ? PRO K 130 LYS K 135 1 ? 6  
HELX_P HELX_P269 BD8 THR K 163 ? GLY K 172 ? THR K 143 GLY K 152 1 ? 10 
HELX_P HELX_P270 BD9 ARG K 193 ? LEU K 206 ? ARG K 173 LEU K 186 1 ? 14 
HELX_P HELX_P271 BE1 PRO K 224 ? GLY K 244 ? PRO K 204 GLY K 224 1 ? 21 
HELX_P HELX_P272 BE2 ASP K 257 ? ALA K 273 ? ASP K 237 ALA K 253 1 ? 17 
HELX_P HELX_P273 BE3 ASP K 274 ? ASP K 277 ? ASP K 254 ASP K 257 5 ? 4  
HELX_P HELX_P274 BE4 GLY K 289 ? PHE K 300 ? GLY K 269 PHE K 280 1 ? 12 
HELX_P HELX_P275 BE5 HIS K 312 ? SER K 317 ? HIS K 292 SER K 297 1 ? 6  
HELX_P HELX_P276 BE6 THR K 325 ? GLY K 337 ? THR K 305 GLY K 317 1 ? 13 
HELX_P HELX_P277 BE7 GLU K 354 ? ALA K 356 ? GLU K 334 ALA K 336 5 ? 3  
HELX_P HELX_P278 BE8 ASP K 357 ? GLU K 366 ? ASP K 337 GLU K 346 1 ? 10 
HELX_P HELX_P279 BE9 ARG K 396 ? GLY K 405 ? ARG K 376 GLY K 385 1 ? 10 
HELX_P HELX_P280 BF1 GLY K 414 ? GLY K 419 ? GLY K 394 GLY K 399 1 ? 6  
HELX_P HELX_P281 BF2 GLY K 423 ? GLY K 441 ? GLY K 403 GLY K 421 1 ? 19 
HELX_P HELX_P282 BF3 ASP K 443 ? LYS K 449 ? ASP K 423 LYS K 429 1 ? 7  
HELX_P HELX_P283 BF4 HIS K 451 ? PHE K 461 ? HIS K 431 PHE K 441 1 ? 11 
HELX_P HELX_P284 BF5 PHE K 461 ? TYR K 469 ? PHE K 441 TYR K 449 1 ? 9  
HELX_P HELX_P285 BF6 GLN L 23  ? ALA L 28  ? GLN L 3   ALA L 8   1 ? 6  
HELX_P HELX_P286 BF7 LYS L 33  ? GLY L 41  ? LYS L 13  GLY L 21  1 ? 9  
HELX_P HELX_P287 BF8 ASN L 58  ? SER L 70  ? ASN L 38  SER L 50  1 ? 13 
HELX_P HELX_P288 BF9 ASP L 82  ? VAL L 88  ? ASP L 62  VAL L 68  1 ? 7  
HELX_P HELX_P289 BG1 GLU L 97  ? ASN L 99  ? GLU L 77  ASN L 79  5 ? 3  
HELX_P HELX_P290 BG2 GLU L 109 ? PHE L 111 ? GLU L 89  PHE L 91  5 ? 3  
HELX_P HELX_P291 BG3 MET L 121 ? ILE L 130 ? MET L 101 ILE L 110 1 ? 10 
HELX_P HELX_P292 BG4 GLY L 131 ? MET L 136 ? GLY L 111 MET L 116 5 ? 6  
HELX_P HELX_P293 BG5 PRO L 150 ? LYS L 155 ? PRO L 130 LYS L 135 1 ? 6  
HELX_P HELX_P294 BG6 THR L 163 ? GLY L 172 ? THR L 143 GLY L 152 1 ? 10 
HELX_P HELX_P295 BG7 ARG L 193 ? LEU L 206 ? ARG L 173 LEU L 186 1 ? 14 
HELX_P HELX_P296 BG8 PRO L 224 ? GLY L 244 ? PRO L 204 GLY L 224 1 ? 21 
HELX_P HELX_P297 BG9 ASP L 257 ? ALA L 273 ? ASP L 237 ALA L 253 1 ? 17 
HELX_P HELX_P298 BH1 ASP L 274 ? ASP L 277 ? ASP L 254 ASP L 257 5 ? 4  
HELX_P HELX_P299 BH2 GLY L 289 ? PHE L 300 ? GLY L 269 PHE L 280 1 ? 12 
HELX_P HELX_P300 BH3 HIS L 312 ? SER L 317 ? HIS L 292 SER L 297 1 ? 6  
HELX_P HELX_P301 BH4 THR L 325 ? GLY L 337 ? THR L 305 GLY L 317 1 ? 13 
HELX_P HELX_P302 BH5 GLU L 354 ? ALA L 356 ? GLU L 334 ALA L 336 5 ? 3  
HELX_P HELX_P303 BH6 ASP L 357 ? GLU L 366 ? ASP L 337 GLU L 346 1 ? 10 
HELX_P HELX_P304 BH7 ARG L 396 ? GLY L 405 ? ARG L 376 GLY L 385 1 ? 10 
HELX_P HELX_P305 BH8 ALA L 413 ? GLY L 419 ? ALA L 393 GLY L 399 1 ? 7  
HELX_P HELX_P306 BH9 GLY L 423 ? GLY L 441 ? GLY L 403 GLY L 421 1 ? 19 
HELX_P HELX_P307 BI1 ASP L 443 ? LYS L 449 ? ASP L 423 LYS L 429 1 ? 7  
HELX_P HELX_P308 BI2 HIS L 451 ? PHE L 461 ? HIS L 431 PHE L 441 1 ? 11 
HELX_P HELX_P309 BI3 PHE L 461 ? TYR L 469 ? PHE L 441 TYR L 449 1 ? 9  
HELX_P HELX_P310 BI4 ASN L 471 ? LYS L 477 ? ASN L 451 LYS L 457 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale both ? A  ILE 211 C   ? ? ? 1_555 A  KCX 212 N  ? ? A ILE 191 A KCX 192 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale2  covale both ? A  KCX 212 C   ? ? ? 1_555 A  ASN 213 N  ? ? A KCX 192 A ASN 193 1_555 ? ? ? ? ? ? ? 1.310 ? 
metalc1  metalc ?    ? A  KCX 212 OQ2 ? ? ? 1_555 N  MG  .   MG ? ? A KCX 192 A MG  501 1_555 ? ? ? ? ? ? ? 2.122 ? 
metalc2  metalc ?    ? A  ASP 214 OD1 ? ? ? 1_555 N  MG  .   MG ? ? A ASP 194 A MG  501 1_555 ? ? ? ? ? ? ? 2.008 ? 
metalc3  metalc ?    ? A  GLU 215 OE1 ? ? ? 1_555 N  MG  .   MG ? ? A GLU 195 A MG  501 1_555 ? ? ? ? ? ? ? 2.151 ? 
covale3  covale both ? B  ILE 211 C   ? ? ? 1_555 B  KCX 212 N  ? ? B ILE 191 B KCX 192 1_555 ? ? ? ? ? ? ? 1.312 ? 
covale4  covale both ? B  KCX 212 C   ? ? ? 1_555 B  ASN 213 N  ? ? B KCX 192 B ASN 193 1_555 ? ? ? ? ? ? ? 1.321 ? 
metalc4  metalc ?    ? B  KCX 212 OQ1 ? ? ? 1_555 P  MG  .   MG ? ? B KCX 192 B MG  501 1_555 ? ? ? ? ? ? ? 2.028 ? 
metalc5  metalc ?    ? B  ASP 214 OD1 ? ? ? 1_555 P  MG  .   MG ? ? B ASP 194 B MG  501 1_555 ? ? ? ? ? ? ? 1.929 ? 
metalc6  metalc ?    ? B  GLU 215 OE1 ? ? ? 1_555 P  MG  .   MG ? ? B GLU 195 B MG  501 1_555 ? ? ? ? ? ? ? 1.999 ? 
covale5  covale both ? C  ILE 211 C   ? ? ? 1_555 C  KCX 212 N  ? ? C ILE 191 C KCX 192 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale6  covale both ? C  KCX 212 C   ? ? ? 1_555 C  ASN 213 N  ? ? C KCX 192 C ASN 193 1_555 ? ? ? ? ? ? ? 1.313 ? 
metalc7  metalc ?    ? C  KCX 212 OQ1 ? ? ? 1_555 R  MG  .   MG ? ? C KCX 192 C MG  501 1_555 ? ? ? ? ? ? ? 1.946 ? 
metalc8  metalc ?    ? C  ASP 214 OD1 ? ? ? 1_555 R  MG  .   MG ? ? C ASP 194 C MG  501 1_555 ? ? ? ? ? ? ? 1.952 ? 
metalc9  metalc ?    ? C  GLU 215 OE1 ? ? ? 1_555 R  MG  .   MG ? ? C GLU 195 C MG  501 1_555 ? ? ? ? ? ? ? 1.936 ? 
covale7  covale both ? D  ILE 211 C   ? ? ? 1_555 D  KCX 212 N  ? ? D ILE 191 D KCX 192 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale8  covale both ? D  KCX 212 C   ? ? ? 1_555 D  ASN 213 N  ? ? D KCX 192 D ASN 193 1_555 ? ? ? ? ? ? ? 1.316 ? 
metalc10 metalc ?    ? D  KCX 212 OQ2 ? ? ? 1_555 T  MG  .   MG ? ? D KCX 192 D MG  501 1_555 ? ? ? ? ? ? ? 1.943 ? 
metalc11 metalc ?    ? D  ASP 214 OD1 ? ? ? 1_555 T  MG  .   MG ? ? D ASP 194 D MG  501 1_555 ? ? ? ? ? ? ? 1.948 ? 
metalc12 metalc ?    ? D  GLU 215 OE1 ? ? ? 1_555 T  MG  .   MG ? ? D GLU 195 D MG  501 1_555 ? ? ? ? ? ? ? 1.950 ? 
covale9  covale both ? E  ILE 211 C   ? ? ? 1_555 E  KCX 212 N  ? ? E ILE 191 E KCX 192 1_555 ? ? ? ? ? ? ? 1.311 ? 
covale10 covale both ? E  KCX 212 C   ? ? ? 1_555 E  ASN 213 N  ? ? E KCX 192 E ASN 193 1_555 ? ? ? ? ? ? ? 1.322 ? 
metalc13 metalc ?    ? E  KCX 212 OQ2 ? ? ? 1_555 V  MG  .   MG ? ? E KCX 192 E MG  501 1_555 ? ? ? ? ? ? ? 1.979 ? 
metalc14 metalc ?    ? E  ASP 214 OD1 ? ? ? 1_555 V  MG  .   MG ? ? E ASP 194 E MG  501 1_555 ? ? ? ? ? ? ? 1.944 ? 
metalc15 metalc ?    ? E  GLU 215 OE1 ? ? ? 1_555 V  MG  .   MG ? ? E GLU 195 E MG  501 1_555 ? ? ? ? ? ? ? 1.950 ? 
covale11 covale both ? F  ILE 211 C   ? ? ? 1_555 F  KCX 212 N  ? ? F ILE 191 F KCX 192 1_555 ? ? ? ? ? ? ? 1.319 ? 
covale12 covale both ? F  KCX 212 C   ? ? ? 1_555 F  ASN 213 N  ? ? F KCX 192 F ASN 193 1_555 ? ? ? ? ? ? ? 1.313 ? 
metalc16 metalc ?    ? F  KCX 212 OQ1 ? ? ? 1_555 X  MG  .   MG ? ? F KCX 192 F MG  501 1_555 ? ? ? ? ? ? ? 2.033 ? 
metalc17 metalc ?    ? F  ASP 214 OD1 ? ? ? 1_555 X  MG  .   MG ? ? F ASP 194 F MG  501 1_555 ? ? ? ? ? ? ? 1.939 ? 
metalc18 metalc ?    ? F  GLU 215 OE1 ? ? ? 1_555 X  MG  .   MG ? ? F GLU 195 F MG  501 1_555 ? ? ? ? ? ? ? 1.996 ? 
covale13 covale both ? G  ILE 211 C   ? ? ? 1_555 G  KCX 212 N  ? ? G ILE 191 G KCX 192 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale14 covale both ? G  KCX 212 C   ? ? ? 1_555 G  ASN 213 N  ? ? G KCX 192 G ASN 193 1_555 ? ? ? ? ? ? ? 1.327 ? 
metalc19 metalc ?    ? G  KCX 212 OQ2 ? ? ? 1_555 Z  MG  .   MG ? ? G KCX 192 G MG  501 1_555 ? ? ? ? ? ? ? 1.969 ? 
metalc20 metalc ?    ? G  ASP 214 OD1 ? ? ? 1_555 Z  MG  .   MG ? ? G ASP 194 G MG  501 1_555 ? ? ? ? ? ? ? 1.927 ? 
metalc21 metalc ?    ? G  GLU 215 OE1 ? ? ? 1_555 Z  MG  .   MG ? ? G GLU 195 G MG  501 1_555 ? ? ? ? ? ? ? 1.987 ? 
covale15 covale both ? H  ILE 211 C   ? ? ? 1_555 H  KCX 212 N  ? ? H ILE 191 H KCX 192 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale16 covale both ? H  KCX 212 C   ? ? ? 1_555 H  ASN 213 N  ? ? H KCX 192 H ASN 193 1_555 ? ? ? ? ? ? ? 1.325 ? 
metalc22 metalc ?    ? H  KCX 212 OQ1 ? ? ? 1_555 BA MG  .   MG ? ? H KCX 192 H MG  501 1_555 ? ? ? ? ? ? ? 2.110 ? 
metalc23 metalc ?    ? H  ASP 214 OD1 ? ? ? 1_555 BA MG  .   MG ? ? H ASP 194 H MG  501 1_555 ? ? ? ? ? ? ? 1.934 ? 
metalc24 metalc ?    ? H  GLU 215 OE1 ? ? ? 1_555 BA MG  .   MG ? ? H GLU 195 H MG  501 1_555 ? ? ? ? ? ? ? 2.034 ? 
covale17 covale both ? I  ILE 211 C   ? ? ? 1_555 I  KCX 212 N  ? ? I ILE 191 I KCX 192 1_555 ? ? ? ? ? ? ? 1.320 ? 
covale18 covale both ? I  KCX 212 C   ? ? ? 1_555 I  ASN 213 N  ? ? I KCX 192 I ASN 193 1_555 ? ? ? ? ? ? ? 1.316 ? 
metalc25 metalc ?    ? I  KCX 212 OQ1 ? ? ? 1_555 DA MG  .   MG ? ? I KCX 192 I MG  501 1_555 ? ? ? ? ? ? ? 1.943 ? 
metalc26 metalc ?    ? I  ASP 214 OD1 ? ? ? 1_555 DA MG  .   MG ? ? I ASP 194 I MG  501 1_555 ? ? ? ? ? ? ? 1.946 ? 
metalc27 metalc ?    ? I  GLU 215 OE1 ? ? ? 1_555 DA MG  .   MG ? ? I GLU 195 I MG  501 1_555 ? ? ? ? ? ? ? 2.049 ? 
covale19 covale both ? J  ILE 211 C   ? ? ? 1_555 J  KCX 212 N  ? ? J ILE 191 J KCX 192 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale20 covale both ? J  KCX 212 C   ? ? ? 1_555 J  ASN 213 N  ? ? J KCX 192 J ASN 193 1_555 ? ? ? ? ? ? ? 1.314 ? 
metalc28 metalc ?    ? J  KCX 212 OQ2 ? ? ? 1_555 FA MG  .   MG ? ? J KCX 192 J MG  501 1_555 ? ? ? ? ? ? ? 2.050 ? 
metalc29 metalc ?    ? J  ASP 214 OD1 ? ? ? 1_555 FA MG  .   MG ? ? J ASP 194 J MG  501 1_555 ? ? ? ? ? ? ? 1.938 ? 
metalc30 metalc ?    ? J  GLU 215 OE1 ? ? ? 1_555 FA MG  .   MG ? ? J GLU 195 J MG  501 1_555 ? ? ? ? ? ? ? 1.942 ? 
covale21 covale both ? K  ILE 211 C   ? ? ? 1_555 K  KCX 212 N  ? ? K ILE 191 K KCX 192 1_555 ? ? ? ? ? ? ? 1.309 ? 
covale22 covale both ? K  KCX 212 C   ? ? ? 1_555 K  ASN 213 N  ? ? K KCX 192 K ASN 193 1_555 ? ? ? ? ? ? ? 1.337 ? 
metalc31 metalc ?    ? K  KCX 212 OQ2 ? ? ? 1_555 HA MG  .   MG ? ? K KCX 192 K MG  501 1_555 ? ? ? ? ? ? ? 1.981 ? 
metalc32 metalc ?    ? K  ASP 214 OD1 ? ? ? 1_555 HA MG  .   MG ? ? K ASP 194 K MG  501 1_555 ? ? ? ? ? ? ? 1.929 ? 
metalc33 metalc ?    ? K  GLU 215 OE1 ? ? ? 1_555 HA MG  .   MG ? ? K GLU 195 K MG  501 1_555 ? ? ? ? ? ? ? 2.112 ? 
covale23 covale both ? L  ILE 211 C   ? ? ? 1_555 L  KCX 212 N  ? ? L ILE 191 L KCX 192 1_555 ? ? ? ? ? ? ? 1.319 ? 
covale24 covale both ? L  KCX 212 C   ? ? ? 1_555 L  ASN 213 N  ? ? L KCX 192 L ASN 193 1_555 ? ? ? ? ? ? ? 1.311 ? 
metalc34 metalc ?    ? L  KCX 212 OQ1 ? ? ? 1_555 JA MG  .   MG ? ? L KCX 192 L MG  501 1_555 ? ? ? ? ? ? ? 2.033 ? 
metalc35 metalc ?    ? L  ASP 214 OD1 ? ? ? 1_555 JA MG  .   MG ? ? L ASP 194 L MG  501 1_555 ? ? ? ? ? ? ? 2.021 ? 
metalc36 metalc ?    ? L  GLU 215 OE1 ? ? ? 1_555 JA MG  .   MG ? ? L GLU 195 L MG  501 1_555 ? ? ? ? ? ? ? 2.037 ? 
metalc37 metalc ?    ? M  CAP .   O2  ? ? ? 1_555 N  MG  .   MG ? ? A CAP 500 A MG  501 1_555 ? ? ? ? ? ? ? 2.046 ? 
metalc38 metalc ?    ? M  CAP .   O3  ? ? ? 1_555 N  MG  .   MG ? ? A CAP 500 A MG  501 1_555 ? ? ? ? ? ? ? 2.243 ? 
metalc39 metalc ?    ? M  CAP .   O6  ? ? ? 1_555 N  MG  .   MG ? ? A CAP 500 A MG  501 1_555 ? ? ? ? ? ? ? 2.121 ? 
metalc40 metalc ?    ? O  CAP .   O2  ? ? ? 1_555 P  MG  .   MG ? ? B CAP 500 B MG  501 1_555 ? ? ? ? ? ? ? 2.204 ? 
metalc41 metalc ?    ? O  CAP .   O3  ? ? ? 1_555 P  MG  .   MG ? ? B CAP 500 B MG  501 1_555 ? ? ? ? ? ? ? 2.322 ? 
metalc42 metalc ?    ? O  CAP .   O6  ? ? ? 1_555 P  MG  .   MG ? ? B CAP 500 B MG  501 1_555 ? ? ? ? ? ? ? 2.174 ? 
metalc43 metalc ?    ? Q  CAP .   O2  ? ? ? 1_555 R  MG  .   MG ? ? C CAP 500 C MG  501 1_555 ? ? ? ? ? ? ? 2.284 ? 
metalc44 metalc ?    ? Q  CAP .   O3  ? ? ? 1_555 R  MG  .   MG ? ? C CAP 500 C MG  501 1_555 ? ? ? ? ? ? ? 2.278 ? 
metalc45 metalc ?    ? Q  CAP .   O6  ? ? ? 1_555 R  MG  .   MG ? ? C CAP 500 C MG  501 1_555 ? ? ? ? ? ? ? 2.287 ? 
metalc46 metalc ?    ? S  CAP .   O2  ? ? ? 1_555 T  MG  .   MG ? ? D CAP 500 D MG  501 1_555 ? ? ? ? ? ? ? 2.287 ? 
metalc47 metalc ?    ? S  CAP .   O3  ? ? ? 1_555 T  MG  .   MG ? ? D CAP 500 D MG  501 1_555 ? ? ? ? ? ? ? 2.207 ? 
metalc48 metalc ?    ? S  CAP .   O7  ? ? ? 1_555 T  MG  .   MG ? ? D CAP 500 D MG  501 1_555 ? ? ? ? ? ? ? 2.202 ? 
metalc49 metalc ?    ? U  CAP .   O2  ? ? ? 1_555 V  MG  .   MG ? ? E CAP 500 E MG  501 1_555 ? ? ? ? ? ? ? 2.257 ? 
metalc50 metalc ?    ? U  CAP .   O3  ? ? ? 1_555 V  MG  .   MG ? ? E CAP 500 E MG  501 1_555 ? ? ? ? ? ? ? 2.311 ? 
metalc51 metalc ?    ? U  CAP .   O7  ? ? ? 1_555 V  MG  .   MG ? ? E CAP 500 E MG  501 1_555 ? ? ? ? ? ? ? 2.239 ? 
metalc52 metalc ?    ? W  CAP .   O2  ? ? ? 1_555 X  MG  .   MG ? ? F CAP 500 F MG  501 1_555 ? ? ? ? ? ? ? 2.209 ? 
metalc53 metalc ?    ? W  CAP .   O3  ? ? ? 1_555 X  MG  .   MG ? ? F CAP 500 F MG  501 1_555 ? ? ? ? ? ? ? 2.308 ? 
metalc54 metalc ?    ? W  CAP .   O7  ? ? ? 1_555 X  MG  .   MG ? ? F CAP 500 F MG  501 1_555 ? ? ? ? ? ? ? 2.183 ? 
metalc55 metalc ?    ? Y  CAP .   O2  ? ? ? 1_555 Z  MG  .   MG ? ? G CAP 500 G MG  501 1_555 ? ? ? ? ? ? ? 2.249 ? 
metalc56 metalc ?    ? Y  CAP .   O3  ? ? ? 1_555 Z  MG  .   MG ? ? G CAP 500 G MG  501 1_555 ? ? ? ? ? ? ? 2.329 ? 
metalc57 metalc ?    ? Y  CAP .   O6  ? ? ? 1_555 Z  MG  .   MG ? ? G CAP 500 G MG  501 1_555 ? ? ? ? ? ? ? 2.246 ? 
metalc58 metalc ?    ? AA CAP .   O2  ? ? ? 1_555 BA MG  .   MG ? ? H CAP 500 H MG  501 1_555 ? ? ? ? ? ? ? 2.161 ? 
metalc59 metalc ?    ? AA CAP .   O3  ? ? ? 1_555 BA MG  .   MG ? ? H CAP 500 H MG  501 1_555 ? ? ? ? ? ? ? 2.341 ? 
metalc60 metalc ?    ? AA CAP .   O6  ? ? ? 1_555 BA MG  .   MG ? ? H CAP 500 H MG  501 1_555 ? ? ? ? ? ? ? 2.071 ? 
metalc61 metalc ?    ? CA CAP .   O2  ? ? ? 1_555 DA MG  .   MG ? ? I CAP 500 I MG  501 1_555 ? ? ? ? ? ? ? 2.164 ? 
metalc62 metalc ?    ? CA CAP .   O3  ? ? ? 1_555 DA MG  .   MG ? ? I CAP 500 I MG  501 1_555 ? ? ? ? ? ? ? 2.295 ? 
metalc63 metalc ?    ? CA CAP .   O6  ? ? ? 1_555 DA MG  .   MG ? ? I CAP 500 I MG  501 1_555 ? ? ? ? ? ? ? 2.302 ? 
metalc64 metalc ?    ? EA CAP .   O2  ? ? ? 1_555 FA MG  .   MG ? ? J CAP 500 J MG  501 1_555 ? ? ? ? ? ? ? 2.270 ? 
metalc65 metalc ?    ? EA CAP .   O3  ? ? ? 1_555 FA MG  .   MG ? ? J CAP 500 J MG  501 1_555 ? ? ? ? ? ? ? 2.292 ? 
metalc66 metalc ?    ? EA CAP .   O7  ? ? ? 1_555 FA MG  .   MG ? ? J CAP 500 J MG  501 1_555 ? ? ? ? ? ? ? 2.183 ? 
metalc67 metalc ?    ? GA CAP .   O2  ? ? ? 1_555 HA MG  .   MG ? ? K CAP 500 K MG  501 1_555 ? ? ? ? ? ? ? 2.109 ? 
metalc68 metalc ?    ? GA CAP .   O3  ? ? ? 1_555 HA MG  .   MG ? ? K CAP 500 K MG  501 1_555 ? ? ? ? ? ? ? 2.351 ? 
metalc69 metalc ?    ? GA CAP .   O7  ? ? ? 1_555 HA MG  .   MG ? ? K CAP 500 K MG  501 1_555 ? ? ? ? ? ? ? 2.208 ? 
metalc70 metalc ?    ? IA CAP .   O2  ? ? ? 1_555 JA MG  .   MG ? ? L CAP 500 L MG  501 1_555 ? ? ? ? ? ? ? 2.154 ? 
metalc71 metalc ?    ? IA CAP .   O3  ? ? ? 1_555 JA MG  .   MG ? ? L CAP 500 L MG  501 1_555 ? ? ? ? ? ? ? 2.228 ? 
metalc72 metalc ?    ? IA CAP .   O7  ? ? ? 1_555 JA MG  .   MG ? ? L CAP 500 L MG  501 1_555 ? ? ? ? ? ? ? 2.175 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  LYS 187 A . ? LYS 167 A PRO 188 A ? PRO 168 A 1 -0.01 
2  LYS 187 B . ? LYS 167 B PRO 188 B ? PRO 168 B 1 0.24  
3  LYS 187 C . ? LYS 167 C PRO 188 C ? PRO 168 C 1 -1.91 
4  LYS 187 D . ? LYS 167 D PRO 188 D ? PRO 168 D 1 -1.42 
5  LYS 187 E . ? LYS 167 E PRO 188 E ? PRO 168 E 1 -0.63 
6  LYS 187 F . ? LYS 167 F PRO 188 F ? PRO 168 F 1 -0.13 
7  LYS 187 G . ? LYS 167 G PRO 188 G ? PRO 168 G 1 0.24  
8  LYS 187 H . ? LYS 167 H PRO 188 H ? PRO 168 H 1 -3.01 
9  LYS 187 I . ? LYS 167 I PRO 188 I ? PRO 168 I 1 -0.96 
10 LYS 187 J . ? LYS 167 J PRO 188 J ? PRO 168 J 1 0.01  
11 LYS 187 K . ? LYS 167 K PRO 188 K ? PRO 168 K 1 -1.88 
12 LYS 187 L . ? LYS 167 L PRO 188 L ? PRO 168 L 1 0.37  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 9 ? 
AA3 ? 2 ? 
AA4 ? 5 ? 
AA5 ? 9 ? 
AA6 ? 2 ? 
AA7 ? 5 ? 
AA8 ? 9 ? 
AA9 ? 2 ? 
AB1 ? 5 ? 
AB2 ? 9 ? 
AB3 ? 2 ? 
AB4 ? 5 ? 
AB5 ? 9 ? 
AB6 ? 2 ? 
AB7 ? 5 ? 
AB8 ? 9 ? 
AB9 ? 2 ? 
AC1 ? 5 ? 
AC2 ? 9 ? 
AC3 ? 2 ? 
AC4 ? 5 ? 
AC5 ? 9 ? 
AC6 ? 2 ? 
AC7 ? 5 ? 
AC8 ? 9 ? 
AC9 ? 2 ? 
AD1 ? 5 ? 
AD2 ? 9 ? 
AD3 ? 2 ? 
AD4 ? 5 ? 
AD5 ? 9 ? 
AD6 ? 2 ? 
AD7 ? 5 ? 
AD8 ? 9 ? 
AD9 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? parallel      
AA2 1 2 ? parallel      
AA2 2 3 ? parallel      
AA2 3 4 ? parallel      
AA2 4 5 ? parallel      
AA2 5 6 ? parallel      
AA2 6 7 ? parallel      
AA2 7 8 ? parallel      
AA2 8 9 ? parallel      
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA4 4 5 ? parallel      
AA5 1 2 ? parallel      
AA5 2 3 ? parallel      
AA5 3 4 ? parallel      
AA5 4 5 ? parallel      
AA5 5 6 ? parallel      
AA5 6 7 ? parallel      
AA5 7 8 ? parallel      
AA5 8 9 ? parallel      
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA7 4 5 ? parallel      
AA8 1 2 ? parallel      
AA8 2 3 ? parallel      
AA8 3 4 ? parallel      
AA8 4 5 ? parallel      
AA8 5 6 ? parallel      
AA8 6 7 ? parallel      
AA8 7 8 ? parallel      
AA8 8 9 ? parallel      
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB1 4 5 ? parallel      
AB2 1 2 ? parallel      
AB2 2 3 ? parallel      
AB2 3 4 ? parallel      
AB2 4 5 ? parallel      
AB2 5 6 ? parallel      
AB2 6 7 ? parallel      
AB2 7 8 ? parallel      
AB2 8 9 ? parallel      
AB3 1 2 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB4 4 5 ? parallel      
AB5 1 2 ? parallel      
AB5 2 3 ? parallel      
AB5 3 4 ? parallel      
AB5 4 5 ? parallel      
AB5 5 6 ? parallel      
AB5 6 7 ? parallel      
AB5 7 8 ? parallel      
AB5 8 9 ? parallel      
AB6 1 2 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB7 3 4 ? anti-parallel 
AB7 4 5 ? parallel      
AB8 1 2 ? parallel      
AB8 2 3 ? parallel      
AB8 3 4 ? parallel      
AB8 4 5 ? parallel      
AB8 5 6 ? parallel      
AB8 6 7 ? parallel      
AB8 7 8 ? parallel      
AB8 8 9 ? parallel      
AB9 1 2 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC1 3 4 ? anti-parallel 
AC1 4 5 ? parallel      
AC2 1 2 ? parallel      
AC2 2 3 ? parallel      
AC2 3 4 ? parallel      
AC2 4 5 ? parallel      
AC2 5 6 ? parallel      
AC2 6 7 ? parallel      
AC2 7 8 ? parallel      
AC2 8 9 ? parallel      
AC3 1 2 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC4 2 3 ? anti-parallel 
AC4 3 4 ? anti-parallel 
AC4 4 5 ? parallel      
AC5 1 2 ? parallel      
AC5 2 3 ? parallel      
AC5 3 4 ? parallel      
AC5 4 5 ? parallel      
AC5 5 6 ? parallel      
AC5 6 7 ? parallel      
AC5 7 8 ? parallel      
AC5 8 9 ? parallel      
AC6 1 2 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC7 2 3 ? anti-parallel 
AC7 3 4 ? anti-parallel 
AC7 4 5 ? parallel      
AC8 1 2 ? parallel      
AC8 2 3 ? parallel      
AC8 3 4 ? parallel      
AC8 4 5 ? parallel      
AC8 5 6 ? parallel      
AC8 6 7 ? parallel      
AC8 7 8 ? parallel      
AC8 8 9 ? parallel      
AC9 1 2 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD1 2 3 ? anti-parallel 
AD1 3 4 ? anti-parallel 
AD1 4 5 ? parallel      
AD2 1 2 ? parallel      
AD2 2 3 ? parallel      
AD2 3 4 ? parallel      
AD2 4 5 ? parallel      
AD2 5 6 ? parallel      
AD2 6 7 ? parallel      
AD2 7 8 ? parallel      
AD2 8 9 ? parallel      
AD3 1 2 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD4 2 3 ? anti-parallel 
AD4 3 4 ? anti-parallel 
AD4 4 5 ? parallel      
AD5 1 2 ? parallel      
AD5 2 3 ? parallel      
AD5 3 4 ? parallel      
AD5 4 5 ? parallel      
AD5 5 6 ? parallel      
AD5 6 7 ? parallel      
AD5 7 8 ? parallel      
AD5 8 9 ? parallel      
AD6 1 2 ? anti-parallel 
AD7 1 2 ? anti-parallel 
AD7 2 3 ? anti-parallel 
AD7 3 4 ? anti-parallel 
AD7 4 5 ? parallel      
AD8 1 2 ? parallel      
AD8 2 3 ? parallel      
AD8 3 4 ? parallel      
AD8 4 5 ? parallel      
AD8 5 6 ? parallel      
AD8 6 7 ? parallel      
AD8 7 8 ? parallel      
AD8 8 9 ? parallel      
AD9 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LEU A 91  ? ASP A 96  ? LEU A 71  ASP A 76  
AA1 2 LEU A 101 ? PRO A 107 ? LEU A 81  PRO A 87  
AA1 3 HIS A 43  ? PRO A 52  ? HIS A 23  PRO A 32  
AA1 4 VAL A 139 ? TYR A 148 ? VAL A 119 TYR A 128 
AA1 5 GLY A 323 ? TYR A 324 ? GLY A 303 TYR A 304 
AA2 1 ILE A 181 ? ILE A 185 ? ILE A 161 ILE A 165 
AA2 2 PHE A 210 ? KCX A 212 ? PHE A 190 KCX A 192 
AA2 3 LEU A 248 ? ASN A 252 ? LEU A 228 ASN A 232 
AA2 4 ILE A 279 ? ASP A 284 ? ILE A 259 ASP A 264 
AA2 5 TYR A 304 ? HIS A 308 ? TYR A 284 HIS A 288 
AA2 6 GLY A 340 ? HIS A 342 ? GLY A 320 HIS A 322 
AA2 7 THR A 385 ? ILE A 388 ? THR A 365 ILE A 368 
AA2 8 ILE A 410 ? THR A 412 ? ILE A 390 THR A 392 
AA2 9 ILE A 181 ? ILE A 185 ? ILE A 161 ILE A 165 
AA3 1 ALA A 368 ? ASP A 370 ? ALA A 348 ASP A 350 
AA3 2 HIS A 375 ? GLU A 377 ? HIS A 355 GLU A 357 
AA4 1 LEU B 91  ? ASP B 96  ? LEU B 71  ASP B 76  
AA4 2 LEU B 101 ? PRO B 107 ? LEU B 81  PRO B 87  
AA4 3 HIS B 43  ? PRO B 52  ? HIS B 23  PRO B 32  
AA4 4 VAL B 139 ? TYR B 148 ? VAL B 119 TYR B 128 
AA4 5 GLY B 323 ? TYR B 324 ? GLY B 303 TYR B 304 
AA5 1 ILE B 181 ? ILE B 185 ? ILE B 161 ILE B 165 
AA5 2 PHE B 210 ? KCX B 212 ? PHE B 190 KCX B 192 
AA5 3 LEU B 248 ? ASN B 252 ? LEU B 228 ASN B 232 
AA5 4 ILE B 279 ? ASP B 284 ? ILE B 259 ASP B 264 
AA5 5 TYR B 304 ? HIS B 308 ? TYR B 284 HIS B 288 
AA5 6 GLY B 340 ? HIS B 342 ? GLY B 320 HIS B 322 
AA5 7 THR B 385 ? SER B 389 ? THR B 365 SER B 369 
AA5 8 ILE B 410 ? THR B 412 ? ILE B 390 THR B 392 
AA5 9 ILE B 181 ? ILE B 185 ? ILE B 161 ILE B 165 
AA6 1 ALA B 368 ? ASP B 370 ? ALA B 348 ASP B 350 
AA6 2 HIS B 375 ? GLU B 377 ? HIS B 355 GLU B 357 
AA7 1 LEU C 91  ? ASP C 96  ? LEU C 71  ASP C 76  
AA7 2 LEU C 101 ? PRO C 107 ? LEU C 81  PRO C 87  
AA7 3 HIS C 43  ? PRO C 52  ? HIS C 23  PRO C 32  
AA7 4 VAL C 139 ? TYR C 148 ? VAL C 119 TYR C 128 
AA7 5 GLY C 323 ? TYR C 324 ? GLY C 303 TYR C 304 
AA8 1 ILE C 181 ? ILE C 185 ? ILE C 161 ILE C 165 
AA8 2 PHE C 210 ? KCX C 212 ? PHE C 190 KCX C 192 
AA8 3 LEU C 248 ? ASN C 252 ? LEU C 228 ASN C 232 
AA8 4 ILE C 279 ? ASP C 284 ? ILE C 259 ASP C 264 
AA8 5 TYR C 304 ? HIS C 308 ? TYR C 284 HIS C 288 
AA8 6 GLY C 340 ? HIS C 342 ? GLY C 320 HIS C 322 
AA8 7 THR C 385 ? SER C 389 ? THR C 365 SER C 369 
AA8 8 ILE C 410 ? THR C 412 ? ILE C 390 THR C 392 
AA8 9 ILE C 181 ? ILE C 185 ? ILE C 161 ILE C 165 
AA9 1 ALA C 368 ? ASP C 370 ? ALA C 348 ASP C 350 
AA9 2 HIS C 375 ? GLU C 377 ? HIS C 355 GLU C 357 
AB1 1 LEU D 91  ? ASP D 96  ? LEU D 71  ASP D 76  
AB1 2 LEU D 101 ? PRO D 107 ? LEU D 81  PRO D 87  
AB1 3 HIS D 43  ? PRO D 52  ? HIS D 23  PRO D 32  
AB1 4 VAL D 139 ? TYR D 148 ? VAL D 119 TYR D 128 
AB1 5 GLY D 323 ? TYR D 324 ? GLY D 303 TYR D 304 
AB2 1 ILE D 181 ? ILE D 185 ? ILE D 161 ILE D 165 
AB2 2 PHE D 210 ? KCX D 212 ? PHE D 190 KCX D 192 
AB2 3 LEU D 248 ? ASN D 252 ? LEU D 228 ASN D 232 
AB2 4 ILE D 279 ? ASP D 284 ? ILE D 259 ASP D 264 
AB2 5 TYR D 304 ? HIS D 308 ? TYR D 284 HIS D 288 
AB2 6 GLY D 340 ? HIS D 342 ? GLY D 320 HIS D 322 
AB2 7 THR D 385 ? SER D 389 ? THR D 365 SER D 369 
AB2 8 ILE D 410 ? THR D 412 ? ILE D 390 THR D 392 
AB2 9 ILE D 181 ? ILE D 185 ? ILE D 161 ILE D 165 
AB3 1 ALA D 368 ? ASP D 370 ? ALA D 348 ASP D 350 
AB3 2 HIS D 375 ? GLU D 377 ? HIS D 355 GLU D 357 
AB4 1 LEU E 91  ? ASP E 96  ? LEU E 71  ASP E 76  
AB4 2 LEU E 101 ? PRO E 107 ? LEU E 81  PRO E 87  
AB4 3 HIS E 43  ? PRO E 52  ? HIS E 23  PRO E 32  
AB4 4 VAL E 139 ? TYR E 148 ? VAL E 119 TYR E 128 
AB4 5 GLY E 323 ? TYR E 324 ? GLY E 303 TYR E 304 
AB5 1 ILE E 181 ? ILE E 185 ? ILE E 161 ILE E 165 
AB5 2 PHE E 210 ? KCX E 212 ? PHE E 190 KCX E 192 
AB5 3 LEU E 248 ? ASN E 252 ? LEU E 228 ASN E 232 
AB5 4 ILE E 279 ? ASP E 284 ? ILE E 259 ASP E 264 
AB5 5 TYR E 304 ? HIS E 308 ? TYR E 284 HIS E 288 
AB5 6 GLY E 340 ? HIS E 342 ? GLY E 320 HIS E 322 
AB5 7 THR E 385 ? SER E 389 ? THR E 365 SER E 369 
AB5 8 ILE E 410 ? THR E 412 ? ILE E 390 THR E 392 
AB5 9 ILE E 181 ? ILE E 185 ? ILE E 161 ILE E 165 
AB6 1 ALA E 368 ? ASP E 370 ? ALA E 348 ASP E 350 
AB6 2 HIS E 375 ? GLU E 377 ? HIS E 355 GLU E 357 
AB7 1 LEU F 91  ? ASP F 96  ? LEU F 71  ASP F 76  
AB7 2 LEU F 101 ? PRO F 107 ? LEU F 81  PRO F 87  
AB7 3 HIS F 43  ? PRO F 52  ? HIS F 23  PRO F 32  
AB7 4 VAL F 139 ? TYR F 148 ? VAL F 119 TYR F 128 
AB7 5 GLY F 323 ? TYR F 324 ? GLY F 303 TYR F 304 
AB8 1 ILE F 181 ? ILE F 185 ? ILE F 161 ILE F 165 
AB8 2 PHE F 210 ? KCX F 212 ? PHE F 190 KCX F 192 
AB8 3 LEU F 248 ? ASN F 252 ? LEU F 228 ASN F 232 
AB8 4 ILE F 279 ? ASP F 284 ? ILE F 259 ASP F 264 
AB8 5 TYR F 304 ? HIS F 308 ? TYR F 284 HIS F 288 
AB8 6 GLY F 340 ? HIS F 342 ? GLY F 320 HIS F 322 
AB8 7 THR F 385 ? SER F 389 ? THR F 365 SER F 369 
AB8 8 ILE F 410 ? THR F 412 ? ILE F 390 THR F 392 
AB8 9 ILE F 181 ? ILE F 185 ? ILE F 161 ILE F 165 
AB9 1 ALA F 368 ? ASP F 370 ? ALA F 348 ASP F 350 
AB9 2 HIS F 375 ? GLU F 377 ? HIS F 355 GLU F 357 
AC1 1 LEU G 91  ? ASP G 96  ? LEU G 71  ASP G 76  
AC1 2 LEU G 101 ? PRO G 107 ? LEU G 81  PRO G 87  
AC1 3 HIS G 43  ? PRO G 52  ? HIS G 23  PRO G 32  
AC1 4 VAL G 139 ? TYR G 148 ? VAL G 119 TYR G 128 
AC1 5 GLY G 323 ? TYR G 324 ? GLY G 303 TYR G 304 
AC2 1 ILE G 181 ? ILE G 185 ? ILE G 161 ILE G 165 
AC2 2 PHE G 210 ? KCX G 212 ? PHE G 190 KCX G 192 
AC2 3 LEU G 248 ? ASN G 252 ? LEU G 228 ASN G 232 
AC2 4 ILE G 279 ? ASP G 284 ? ILE G 259 ASP G 264 
AC2 5 TYR G 304 ? HIS G 308 ? TYR G 284 HIS G 288 
AC2 6 GLY G 340 ? HIS G 342 ? GLY G 320 HIS G 322 
AC2 7 THR G 385 ? ILE G 388 ? THR G 365 ILE G 368 
AC2 8 ILE G 410 ? THR G 412 ? ILE G 390 THR G 392 
AC2 9 ILE G 181 ? ILE G 185 ? ILE G 161 ILE G 165 
AC3 1 ALA G 368 ? ASP G 370 ? ALA G 348 ASP G 350 
AC3 2 HIS G 375 ? GLU G 377 ? HIS G 355 GLU G 357 
AC4 1 LEU H 91  ? ASP H 96  ? LEU H 71  ASP H 76  
AC4 2 LEU H 101 ? PRO H 107 ? LEU H 81  PRO H 87  
AC4 3 HIS H 43  ? PRO H 52  ? HIS H 23  PRO H 32  
AC4 4 VAL H 139 ? TYR H 148 ? VAL H 119 TYR H 128 
AC4 5 GLY H 323 ? TYR H 324 ? GLY H 303 TYR H 304 
AC5 1 ILE H 181 ? ILE H 185 ? ILE H 161 ILE H 165 
AC5 2 PHE H 210 ? KCX H 212 ? PHE H 190 KCX H 192 
AC5 3 LEU H 248 ? ASN H 252 ? LEU H 228 ASN H 232 
AC5 4 ILE H 279 ? ASP H 284 ? ILE H 259 ASP H 264 
AC5 5 TYR H 304 ? HIS H 308 ? TYR H 284 HIS H 288 
AC5 6 GLY H 340 ? HIS H 342 ? GLY H 320 HIS H 322 
AC5 7 THR H 385 ? ILE H 388 ? THR H 365 ILE H 368 
AC5 8 ILE H 410 ? THR H 412 ? ILE H 390 THR H 392 
AC5 9 ILE H 181 ? ILE H 185 ? ILE H 161 ILE H 165 
AC6 1 ALA H 368 ? ASP H 370 ? ALA H 348 ASP H 350 
AC6 2 HIS H 375 ? GLU H 377 ? HIS H 355 GLU H 357 
AC7 1 LEU I 91  ? ASP I 96  ? LEU I 71  ASP I 76  
AC7 2 LEU I 101 ? PRO I 107 ? LEU I 81  PRO I 87  
AC7 3 HIS I 43  ? PRO I 52  ? HIS I 23  PRO I 32  
AC7 4 VAL I 139 ? TYR I 148 ? VAL I 119 TYR I 128 
AC7 5 GLY I 323 ? TYR I 324 ? GLY I 303 TYR I 304 
AC8 1 ILE I 181 ? ILE I 185 ? ILE I 161 ILE I 165 
AC8 2 PHE I 210 ? KCX I 212 ? PHE I 190 KCX I 192 
AC8 3 LEU I 248 ? ASN I 252 ? LEU I 228 ASN I 232 
AC8 4 ILE I 279 ? ASP I 284 ? ILE I 259 ASP I 264 
AC8 5 TYR I 304 ? HIS I 308 ? TYR I 284 HIS I 288 
AC8 6 GLY I 340 ? HIS I 342 ? GLY I 320 HIS I 322 
AC8 7 THR I 385 ? SER I 389 ? THR I 365 SER I 369 
AC8 8 ILE I 410 ? THR I 412 ? ILE I 390 THR I 392 
AC8 9 ILE I 181 ? ILE I 185 ? ILE I 161 ILE I 165 
AC9 1 ALA I 368 ? ASP I 370 ? ALA I 348 ASP I 350 
AC9 2 HIS I 375 ? GLU I 377 ? HIS I 355 GLU I 357 
AD1 1 LEU J 91  ? ASP J 96  ? LEU J 71  ASP J 76  
AD1 2 LEU J 101 ? PRO J 107 ? LEU J 81  PRO J 87  
AD1 3 HIS J 43  ? PRO J 52  ? HIS J 23  PRO J 32  
AD1 4 VAL J 139 ? TYR J 148 ? VAL J 119 TYR J 128 
AD1 5 GLY J 323 ? TYR J 324 ? GLY J 303 TYR J 304 
AD2 1 ILE J 181 ? ILE J 185 ? ILE J 161 ILE J 165 
AD2 2 PHE J 210 ? KCX J 212 ? PHE J 190 KCX J 192 
AD2 3 LEU J 248 ? ASN J 252 ? LEU J 228 ASN J 232 
AD2 4 ILE J 279 ? ASP J 284 ? ILE J 259 ASP J 264 
AD2 5 TYR J 304 ? HIS J 308 ? TYR J 284 HIS J 288 
AD2 6 GLY J 340 ? HIS J 342 ? GLY J 320 HIS J 322 
AD2 7 THR J 385 ? SER J 389 ? THR J 365 SER J 369 
AD2 8 ILE J 410 ? THR J 412 ? ILE J 390 THR J 392 
AD2 9 ILE J 181 ? ILE J 185 ? ILE J 161 ILE J 165 
AD3 1 ALA J 368 ? ASP J 370 ? ALA J 348 ASP J 350 
AD3 2 HIS J 375 ? GLU J 377 ? HIS J 355 GLU J 357 
AD4 1 LEU K 91  ? ASP K 96  ? LEU K 71  ASP K 76  
AD4 2 LEU K 101 ? PRO K 107 ? LEU K 81  PRO K 87  
AD4 3 HIS K 43  ? PRO K 52  ? HIS K 23  PRO K 32  
AD4 4 VAL K 139 ? TYR K 148 ? VAL K 119 TYR K 128 
AD4 5 GLY K 323 ? TYR K 324 ? GLY K 303 TYR K 304 
AD5 1 ILE K 181 ? ILE K 185 ? ILE K 161 ILE K 165 
AD5 2 PHE K 210 ? KCX K 212 ? PHE K 190 KCX K 192 
AD5 3 LEU K 248 ? ASN K 252 ? LEU K 228 ASN K 232 
AD5 4 ILE K 279 ? ASP K 284 ? ILE K 259 ASP K 264 
AD5 5 TYR K 304 ? HIS K 308 ? TYR K 284 HIS K 288 
AD5 6 GLY K 340 ? HIS K 342 ? GLY K 320 HIS K 322 
AD5 7 THR K 385 ? ILE K 388 ? THR K 365 ILE K 368 
AD5 8 ILE K 410 ? THR K 412 ? ILE K 390 THR K 392 
AD5 9 ILE K 181 ? ILE K 185 ? ILE K 161 ILE K 165 
AD6 1 ALA K 368 ? ASP K 370 ? ALA K 348 ASP K 350 
AD6 2 HIS K 375 ? GLU K 377 ? HIS K 355 GLU K 357 
AD7 1 LEU L 91  ? ASP L 96  ? LEU L 71  ASP L 76  
AD7 2 LEU L 101 ? PRO L 107 ? LEU L 81  PRO L 87  
AD7 3 HIS L 43  ? PRO L 52  ? HIS L 23  PRO L 32  
AD7 4 VAL L 139 ? TYR L 148 ? VAL L 119 TYR L 128 
AD7 5 GLY L 323 ? TYR L 324 ? GLY L 303 TYR L 304 
AD8 1 ILE L 181 ? ILE L 185 ? ILE L 161 ILE L 165 
AD8 2 PHE L 210 ? KCX L 212 ? PHE L 190 KCX L 192 
AD8 3 LEU L 248 ? ASN L 252 ? LEU L 228 ASN L 232 
AD8 4 ILE L 279 ? ASP L 284 ? ILE L 259 ASP L 264 
AD8 5 TYR L 304 ? HIS L 308 ? TYR L 284 HIS L 288 
AD8 6 GLY L 340 ? HIS L 342 ? GLY L 320 HIS L 322 
AD8 7 THR L 385 ? SER L 389 ? THR L 365 SER L 369 
AD8 8 ILE L 410 ? THR L 412 ? ILE L 390 THR L 392 
AD8 9 ILE L 181 ? ILE L 185 ? ILE L 161 ILE L 165 
AD9 1 ALA L 368 ? ASP L 370 ? ALA L 348 ASP L 350 
AD9 2 HIS L 375 ? GLU L 377 ? HIS L 355 GLU L 357 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLU A 94  ? N GLU A 74  O LYS A 103 ? O LYS A 83  
AA1 2 3 O TYR A 106 ? O TYR A 86  N VAL A 44  ? N VAL A 24  
AA1 3 4 N ALA A 47  ? N ALA A 27  O TYR A 145 ? O TYR A 125 
AA1 4 5 N MET A 144 ? N MET A 124 O GLY A 323 ? O GLY A 303 
AA2 1 2 N VAL A 182 ? N VAL A 162 O PHE A 210 ? O PHE A 190 
AA2 2 3 N ILE A 211 ? N ILE A 191 O SER A 250 ? O SER A 230 
AA2 3 4 N PHE A 251 ? N PHE A 231 O LEU A 282 ? O LEU A 262 
AA2 4 5 N PHE A 281 ? N PHE A 261 O TYR A 304 ? O TYR A 284 
AA2 5 6 N TYR A 307 ? N TYR A 287 O GLY A 340 ? O GLY A 320 
AA2 6 7 N ILE A 341 ? N ILE A 321 O ILE A 387 ? O ILE A 367 
AA2 7 8 N ILE A 388 ? N ILE A 368 O THR A 412 ? O THR A 392 
AA2 8 9 O MET A 411 ? O MET A 391 N ILE A 181 ? N ILE A 161 
AA3 1 2 N ALA A 369 ? N ALA A 349 O GLN A 376 ? O GLN A 356 
AA4 1 2 N LEU B 91  ? N LEU B 71  O ALA B 105 ? O ALA B 85  
AA4 2 3 O TYR B 106 ? O TYR B 86  N VAL B 44  ? N VAL B 24  
AA4 3 4 N ALA B 47  ? N ALA B 27  O TYR B 145 ? O TYR B 125 
AA4 4 5 N MET B 144 ? N MET B 124 O GLY B 323 ? O GLY B 303 
AA5 1 2 N VAL B 182 ? N VAL B 162 O PHE B 210 ? O PHE B 190 
AA5 2 3 N ILE B 211 ? N ILE B 191 O SER B 250 ? O SER B 230 
AA5 3 4 N PHE B 249 ? N PHE B 229 O ALA B 280 ? O ALA B 260 
AA5 4 5 N PHE B 281 ? N PHE B 261 O TYR B 304 ? O TYR B 284 
AA5 5 6 N TYR B 307 ? N TYR B 287 O GLY B 340 ? O GLY B 320 
AA5 6 7 N ILE B 341 ? N ILE B 321 O ILE B 387 ? O ILE B 367 
AA5 7 8 N ILE B 388 ? N ILE B 368 O ILE B 410 ? O ILE B 390 
AA5 8 9 O MET B 411 ? O MET B 391 N ILE B 181 ? N ILE B 161 
AA6 1 2 N ALA B 369 ? N ALA B 349 O GLN B 376 ? O GLN B 356 
AA7 1 2 N LEU C 91  ? N LEU C 71  O ALA C 105 ? O ALA C 85  
AA7 2 3 O TYR C 106 ? O TYR C 86  N VAL C 44  ? N VAL C 24  
AA7 3 4 N LEU C 45  ? N LEU C 25  O TYR C 148 ? O TYR C 128 
AA7 4 5 N MET C 144 ? N MET C 124 O GLY C 323 ? O GLY C 303 
AA8 1 2 N VAL C 182 ? N VAL C 162 O PHE C 210 ? O PHE C 190 
AA8 2 3 N ILE C 211 ? N ILE C 191 O SER C 250 ? O SER C 230 
AA8 3 4 N PHE C 251 ? N PHE C 231 O LEU C 282 ? O LEU C 262 
AA8 4 5 N PHE C 281 ? N PHE C 261 O TYR C 304 ? O TYR C 284 
AA8 5 6 N TYR C 307 ? N TYR C 287 O GLY C 340 ? O GLY C 320 
AA8 6 7 N ILE C 341 ? N ILE C 321 O ILE C 387 ? O ILE C 367 
AA8 7 8 N ILE C 388 ? N ILE C 368 O ILE C 410 ? O ILE C 390 
AA8 8 9 O MET C 411 ? O MET C 391 N GLY C 183 ? N GLY C 163 
AA9 1 2 N ALA C 369 ? N ALA C 349 O GLN C 376 ? O GLN C 356 
AB1 1 2 N LEU D 91  ? N LEU D 71  O ALA D 105 ? O ALA D 85  
AB1 2 3 O TYR D 106 ? O TYR D 86  N VAL D 44  ? N VAL D 24  
AB1 3 4 N LEU D 45  ? N LEU D 25  O TYR D 148 ? O TYR D 128 
AB1 4 5 N MET D 144 ? N MET D 124 O GLY D 323 ? O GLY D 303 
AB2 1 2 N VAL D 182 ? N VAL D 162 O PHE D 210 ? O PHE D 190 
AB2 2 3 N ILE D 211 ? N ILE D 191 O SER D 250 ? O SER D 230 
AB2 3 4 N PHE D 249 ? N PHE D 229 O ALA D 280 ? O ALA D 260 
AB2 4 5 N PHE D 281 ? N PHE D 261 O TYR D 304 ? O TYR D 284 
AB2 5 6 N TYR D 307 ? N TYR D 287 O GLY D 340 ? O GLY D 320 
AB2 6 7 N ILE D 341 ? N ILE D 321 O ILE D 387 ? O ILE D 367 
AB2 7 8 N ILE D 388 ? N ILE D 368 O ILE D 410 ? O ILE D 390 
AB2 8 9 O MET D 411 ? O MET D 391 N GLY D 183 ? N GLY D 163 
AB3 1 2 N ALA D 369 ? N ALA D 349 O GLN D 376 ? O GLN D 356 
AB4 1 2 N LEU E 91  ? N LEU E 71  O ALA E 105 ? O ALA E 85  
AB4 2 3 O TYR E 106 ? O TYR E 86  N VAL E 44  ? N VAL E 24  
AB4 3 4 N ALA E 47  ? N ALA E 27  O TYR E 145 ? O TYR E 125 
AB4 4 5 N MET E 144 ? N MET E 124 O GLY E 323 ? O GLY E 303 
AB5 1 2 N VAL E 182 ? N VAL E 162 O PHE E 210 ? O PHE E 190 
AB5 2 3 N ILE E 211 ? N ILE E 191 O SER E 250 ? O SER E 230 
AB5 3 4 N PHE E 251 ? N PHE E 231 O LEU E 282 ? O LEU E 262 
AB5 4 5 N PHE E 281 ? N PHE E 261 O TYR E 304 ? O TYR E 284 
AB5 5 6 N TYR E 307 ? N TYR E 287 O GLY E 340 ? O GLY E 320 
AB5 6 7 N ILE E 341 ? N ILE E 321 O ILE E 387 ? O ILE E 367 
AB5 7 8 N ILE E 388 ? N ILE E 368 O ILE E 410 ? O ILE E 390 
AB5 8 9 O MET E 411 ? O MET E 391 N GLY E 183 ? N GLY E 163 
AB6 1 2 N ALA E 369 ? N ALA E 349 O GLN E 376 ? O GLN E 356 
AB7 1 2 N LEU F 91  ? N LEU F 71  O ALA F 105 ? O ALA F 85  
AB7 2 3 O TYR F 106 ? O TYR F 86  N VAL F 44  ? N VAL F 24  
AB7 3 4 N ALA F 47  ? N ALA F 27  O TYR F 145 ? O TYR F 125 
AB7 4 5 N MET F 144 ? N MET F 124 O GLY F 323 ? O GLY F 303 
AB8 1 2 N VAL F 182 ? N VAL F 162 O PHE F 210 ? O PHE F 190 
AB8 2 3 N ILE F 211 ? N ILE F 191 O SER F 250 ? O SER F 230 
AB8 3 4 N PHE F 251 ? N PHE F 231 O LEU F 282 ? O LEU F 262 
AB8 4 5 N PHE F 281 ? N PHE F 261 O TYR F 304 ? O TYR F 284 
AB8 5 6 N TYR F 307 ? N TYR F 287 O GLY F 340 ? O GLY F 320 
AB8 6 7 N ILE F 341 ? N ILE F 321 O ILE F 387 ? O ILE F 367 
AB8 7 8 N ILE F 388 ? N ILE F 368 O ILE F 410 ? O ILE F 390 
AB8 8 9 O MET F 411 ? O MET F 391 N ILE F 181 ? N ILE F 161 
AB9 1 2 N ALA F 369 ? N ALA F 349 O GLN F 376 ? O GLN F 356 
AC1 1 2 N LEU G 91  ? N LEU G 71  O ALA G 105 ? O ALA G 85  
AC1 2 3 O TYR G 106 ? O TYR G 86  N VAL G 44  ? N VAL G 24  
AC1 3 4 N ALA G 47  ? N ALA G 27  O TYR G 145 ? O TYR G 125 
AC1 4 5 N MET G 144 ? N MET G 124 O GLY G 323 ? O GLY G 303 
AC2 1 2 N VAL G 182 ? N VAL G 162 O PHE G 210 ? O PHE G 190 
AC2 2 3 N ILE G 211 ? N ILE G 191 O SER G 250 ? O SER G 230 
AC2 3 4 N PHE G 251 ? N PHE G 231 O LEU G 282 ? O LEU G 262 
AC2 4 5 N PHE G 281 ? N PHE G 261 O TYR G 304 ? O TYR G 284 
AC2 5 6 N TYR G 307 ? N TYR G 287 O GLY G 340 ? O GLY G 320 
AC2 6 7 N ILE G 341 ? N ILE G 321 O ILE G 387 ? O ILE G 367 
AC2 7 8 N ILE G 388 ? N ILE G 368 O ILE G 410 ? O ILE G 390 
AC2 8 9 O MET G 411 ? O MET G 391 N ILE G 181 ? N ILE G 161 
AC3 1 2 N ALA G 369 ? N ALA G 349 O GLN G 376 ? O GLN G 356 
AC4 1 2 N LEU H 91  ? N LEU H 71  O ALA H 105 ? O ALA H 85  
AC4 2 3 O TYR H 106 ? O TYR H 86  N VAL H 44  ? N VAL H 24  
AC4 3 4 N ALA H 47  ? N ALA H 27  O TYR H 145 ? O TYR H 125 
AC4 4 5 N MET H 144 ? N MET H 124 O GLY H 323 ? O GLY H 303 
AC5 1 2 N VAL H 182 ? N VAL H 162 O PHE H 210 ? O PHE H 190 
AC5 2 3 N ILE H 211 ? N ILE H 191 O SER H 250 ? O SER H 230 
AC5 3 4 N PHE H 251 ? N PHE H 231 O LEU H 282 ? O LEU H 262 
AC5 4 5 N PHE H 281 ? N PHE H 261 O TYR H 304 ? O TYR H 284 
AC5 5 6 N TYR H 307 ? N TYR H 287 O GLY H 340 ? O GLY H 320 
AC5 6 7 N ILE H 341 ? N ILE H 321 O ILE H 387 ? O ILE H 367 
AC5 7 8 N ILE H 388 ? N ILE H 368 O ILE H 410 ? O ILE H 390 
AC5 8 9 O MET H 411 ? O MET H 391 N GLY H 183 ? N GLY H 163 
AC6 1 2 N ALA H 369 ? N ALA H 349 O GLN H 376 ? O GLN H 356 
AC7 1 2 N LEU I 91  ? N LEU I 71  O ALA I 105 ? O ALA I 85  
AC7 2 3 O TYR I 106 ? O TYR I 86  N VAL I 44  ? N VAL I 24  
AC7 3 4 N LYS I 51  ? N LYS I 31  O GLU I 140 ? O GLU I 120 
AC7 4 5 N MET I 144 ? N MET I 124 O GLY I 323 ? O GLY I 303 
AC8 1 2 N THR I 184 ? N THR I 164 O KCX I 212 ? O KCX I 192 
AC8 2 3 N ILE I 211 ? N ILE I 191 O SER I 250 ? O SER I 230 
AC8 3 4 N PHE I 251 ? N PHE I 231 O LEU I 282 ? O LEU I 262 
AC8 4 5 N PHE I 281 ? N PHE I 261 O TYR I 304 ? O TYR I 284 
AC8 5 6 N TYR I 307 ? N TYR I 287 O GLY I 340 ? O GLY I 320 
AC8 6 7 N ILE I 341 ? N ILE I 321 O ILE I 387 ? O ILE I 367 
AC8 7 8 N ILE I 388 ? N ILE I 368 O ILE I 410 ? O ILE I 390 
AC8 8 9 O MET I 411 ? O MET I 391 N GLY I 183 ? N GLY I 163 
AC9 1 2 N ALA I 369 ? N ALA I 349 O GLN I 376 ? O GLN I 356 
AD1 1 2 N LEU J 91  ? N LEU J 71  O ALA J 105 ? O ALA J 85  
AD1 2 3 O TYR J 106 ? O TYR J 86  N VAL J 44  ? N VAL J 24  
AD1 3 4 N ALA J 47  ? N ALA J 27  O TYR J 145 ? O TYR J 125 
AD1 4 5 N MET J 144 ? N MET J 124 O GLY J 323 ? O GLY J 303 
AD2 1 2 N VAL J 182 ? N VAL J 162 O PHE J 210 ? O PHE J 190 
AD2 2 3 N ILE J 211 ? N ILE J 191 O SER J 250 ? O SER J 230 
AD2 3 4 N PHE J 251 ? N PHE J 231 O LEU J 282 ? O LEU J 262 
AD2 4 5 N PHE J 281 ? N PHE J 261 O TYR J 304 ? O TYR J 284 
AD2 5 6 N TYR J 307 ? N TYR J 287 O GLY J 340 ? O GLY J 320 
AD2 6 7 N ILE J 341 ? N ILE J 321 O ILE J 387 ? O ILE J 367 
AD2 7 8 N ILE J 388 ? N ILE J 368 O ILE J 410 ? O ILE J 390 
AD2 8 9 O MET J 411 ? O MET J 391 N GLY J 183 ? N GLY J 163 
AD3 1 2 N ALA J 369 ? N ALA J 349 O GLN J 376 ? O GLN J 356 
AD4 1 2 N LEU K 91  ? N LEU K 71  O ALA K 105 ? O ALA K 85  
AD4 2 3 O TYR K 106 ? O TYR K 86  N VAL K 44  ? N VAL K 24  
AD4 3 4 N ALA K 47  ? N ALA K 27  O TYR K 145 ? O TYR K 125 
AD4 4 5 N MET K 144 ? N MET K 124 O GLY K 323 ? O GLY K 303 
AD5 1 2 N VAL K 182 ? N VAL K 162 O PHE K 210 ? O PHE K 190 
AD5 2 3 N ILE K 211 ? N ILE K 191 O SER K 250 ? O SER K 230 
AD5 3 4 N PHE K 251 ? N PHE K 231 O LEU K 282 ? O LEU K 262 
AD5 4 5 N PHE K 281 ? N PHE K 261 O TYR K 304 ? O TYR K 284 
AD5 5 6 N TYR K 307 ? N TYR K 287 O GLY K 340 ? O GLY K 320 
AD5 6 7 N ILE K 341 ? N ILE K 321 O ILE K 387 ? O ILE K 367 
AD5 7 8 N ILE K 388 ? N ILE K 368 O ILE K 410 ? O ILE K 390 
AD5 8 9 O MET K 411 ? O MET K 391 N GLY K 183 ? N GLY K 163 
AD6 1 2 N ALA K 369 ? N ALA K 349 O GLN K 376 ? O GLN K 356 
AD7 1 2 N GLU L 94  ? N GLU L 74  O LYS L 103 ? O LYS L 83  
AD7 2 3 O TYR L 106 ? O TYR L 86  N VAL L 44  ? N VAL L 24  
AD7 3 4 N ALA L 47  ? N ALA L 27  O TYR L 145 ? O TYR L 125 
AD7 4 5 N MET L 144 ? N MET L 124 O GLY L 323 ? O GLY L 303 
AD8 1 2 N VAL L 182 ? N VAL L 162 O PHE L 210 ? O PHE L 190 
AD8 2 3 N ILE L 211 ? N ILE L 191 O SER L 250 ? O SER L 230 
AD8 3 4 N PHE L 251 ? N PHE L 231 O LEU L 282 ? O LEU L 262 
AD8 4 5 N PHE L 281 ? N PHE L 261 O TYR L 304 ? O TYR L 284 
AD8 5 6 N TYR L 307 ? N TYR L 287 O GLY L 340 ? O GLY L 320 
AD8 6 7 N ILE L 341 ? N ILE L 321 O ILE L 387 ? O ILE L 367 
AD8 7 8 N ILE L 388 ? N ILE L 368 O ILE L 410 ? O ILE L 390 
AD8 8 9 O MET L 411 ? O MET L 391 N GLY L 183 ? N GLY L 163 
AD9 1 2 N ALA L 369 ? N ALA L 349 O GLN L 376 ? O GLN L 356 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A CAP 500 ? 28 'binding site for residue CAP A 500' 
AC2 Software A MG  501 ? 4  'binding site for residue MG A 501'  
AC3 Software B CAP 500 ? 27 'binding site for residue CAP B 500' 
AC4 Software B MG  501 ? 4  'binding site for residue MG B 501'  
AC5 Software C CAP 500 ? 25 'binding site for residue CAP C 500' 
AC6 Software C MG  501 ? 4  'binding site for residue MG C 501'  
AC7 Software D CAP 500 ? 28 'binding site for residue CAP D 500' 
AC8 Software D MG  501 ? 4  'binding site for residue MG D 501'  
AC9 Software E CAP 500 ? 27 'binding site for residue CAP E 500' 
AD1 Software E MG  501 ? 4  'binding site for residue MG E 501'  
AD2 Software F CAP 500 ? 25 'binding site for residue CAP F 500' 
AD3 Software F MG  501 ? 4  'binding site for residue MG F 501'  
AD4 Software G CAP 500 ? 27 'binding site for residue CAP G 500' 
AD5 Software G MG  501 ? 4  'binding site for residue MG G 501'  
AD6 Software H CAP 500 ? 28 'binding site for residue CAP H 500' 
AD7 Software H MG  501 ? 5  'binding site for residue MG H 501'  
AD8 Software I CAP 500 ? 29 'binding site for residue CAP I 500' 
AD9 Software I MG  501 ? 4  'binding site for residue MG I 501'  
AE1 Software J CAP 500 ? 28 'binding site for residue CAP J 500' 
AE2 Software J MG  501 ? 4  'binding site for residue MG J 501'  
AE3 Software K CAP 500 ? 24 'binding site for residue CAP K 500' 
AE4 Software K MG  501 ? 4  'binding site for residue MG K 501'  
AE5 Software L CAP 500 ? 25 'binding site for residue CAP L 500' 
AE6 Software L MG  501 ? 4  'binding site for residue MG L 501'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 28 ILE A  185 ? ILE A 165 . ? 1_555 ? 
2   AC1 28 LYS A  187 ? LYS A 167 . ? 1_555 ? 
3   AC1 28 LYS A  189 ? LYS A 169 . ? 1_555 ? 
4   AC1 28 KCX A  212 ? KCX A 192 . ? 1_555 ? 
5   AC1 28 ASP A  214 ? ASP A 194 . ? 1_555 ? 
6   AC1 28 GLU A  215 ? GLU A 195 . ? 1_555 ? 
7   AC1 28 HIS A  308 ? HIS A 288 . ? 1_555 ? 
8   AC1 28 ARG A  309 ? ARG A 289 . ? 1_555 ? 
9   AC1 28 HIS A  342 ? HIS A 322 . ? 1_555 ? 
10  AC1 28 LYS A  350 ? LYS A 330 . ? 1_555 ? 
11  AC1 28 SER A  389 ? SER A 369 . ? 1_555 ? 
12  AC1 28 GLY A  390 ? GLY A 370 . ? 1_555 ? 
13  AC1 28 GLY A  391 ? GLY A 371 . ? 1_555 ? 
14  AC1 28 GLY A  414 ? GLY A 394 . ? 1_555 ? 
15  AC1 28 GLY A  415 ? GLY A 395 . ? 1_555 ? 
16  AC1 28 MG  N  .   ? MG  A 501 . ? 1_555 ? 
17  AC1 28 HOH KA .   ? HOH A 616 . ? 1_555 ? 
18  AC1 28 HOH KA .   ? HOH A 629 . ? 1_555 ? 
19  AC1 28 HOH KA .   ? HOH A 632 . ? 1_555 ? 
20  AC1 28 HOH KA .   ? HOH A 633 . ? 1_555 ? 
21  AC1 28 HOH KA .   ? HOH A 642 . ? 1_555 ? 
22  AC1 28 HOH KA .   ? HOH A 671 . ? 1_555 ? 
23  AC1 28 HOH KA .   ? HOH A 755 . ? 1_555 ? 
24  AC1 28 GLU B  69  ? GLU B 49  . ? 1_555 ? 
25  AC1 28 THR B  74  ? THR B 54  . ? 1_555 ? 
26  AC1 28 ASN B  132 ? ASN B 112 . ? 1_555 ? 
27  AC1 28 HOH LA .   ? HOH B 638 . ? 1_555 ? 
28  AC1 28 HOH LA .   ? HOH B 685 . ? 1_555 ? 
29  AC2 4  KCX A  212 ? KCX A 192 . ? 1_555 ? 
30  AC2 4  ASP A  214 ? ASP A 194 . ? 1_555 ? 
31  AC2 4  GLU A  215 ? GLU A 195 . ? 1_555 ? 
32  AC2 4  CAP M  .   ? CAP A 500 . ? 1_555 ? 
33  AC3 27 GLU A  69  ? GLU A 49  . ? 1_555 ? 
34  AC3 27 THR A  74  ? THR A 54  . ? 1_555 ? 
35  AC3 27 ASN A  132 ? ASN A 112 . ? 1_555 ? 
36  AC3 27 HOH KA .   ? HOH A 621 . ? 1_555 ? 
37  AC3 27 ILE B  185 ? ILE B 165 . ? 1_555 ? 
38  AC3 27 LYS B  187 ? LYS B 167 . ? 1_555 ? 
39  AC3 27 LYS B  189 ? LYS B 169 . ? 1_555 ? 
40  AC3 27 KCX B  212 ? KCX B 192 . ? 1_555 ? 
41  AC3 27 ASP B  214 ? ASP B 194 . ? 1_555 ? 
42  AC3 27 GLU B  215 ? GLU B 195 . ? 1_555 ? 
43  AC3 27 HIS B  308 ? HIS B 288 . ? 1_555 ? 
44  AC3 27 ARG B  309 ? ARG B 289 . ? 1_555 ? 
45  AC3 27 HIS B  342 ? HIS B 322 . ? 1_555 ? 
46  AC3 27 LYS B  350 ? LYS B 330 . ? 1_555 ? 
47  AC3 27 SER B  389 ? SER B 369 . ? 1_555 ? 
48  AC3 27 GLY B  390 ? GLY B 370 . ? 1_555 ? 
49  AC3 27 GLY B  391 ? GLY B 371 . ? 1_555 ? 
50  AC3 27 GLY B  414 ? GLY B 394 . ? 1_555 ? 
51  AC3 27 GLY B  415 ? GLY B 395 . ? 1_555 ? 
52  AC3 27 MG  P  .   ? MG  B 501 . ? 1_555 ? 
53  AC3 27 HOH LA .   ? HOH B 631 . ? 1_555 ? 
54  AC3 27 HOH LA .   ? HOH B 643 . ? 1_555 ? 
55  AC3 27 HOH LA .   ? HOH B 644 . ? 1_555 ? 
56  AC3 27 HOH LA .   ? HOH B 645 . ? 1_555 ? 
57  AC3 27 HOH LA .   ? HOH B 648 . ? 1_555 ? 
58  AC3 27 HOH LA .   ? HOH B 653 . ? 1_555 ? 
59  AC3 27 HOH LA .   ? HOH B 673 . ? 1_555 ? 
60  AC4 4  KCX B  212 ? KCX B 192 . ? 1_555 ? 
61  AC4 4  ASP B  214 ? ASP B 194 . ? 1_555 ? 
62  AC4 4  GLU B  215 ? GLU B 195 . ? 1_555 ? 
63  AC4 4  CAP O  .   ? CAP B 500 . ? 1_555 ? 
64  AC5 25 ILE C  185 ? ILE C 165 . ? 1_555 ? 
65  AC5 25 LYS C  187 ? LYS C 167 . ? 1_555 ? 
66  AC5 25 LYS C  189 ? LYS C 169 . ? 1_555 ? 
67  AC5 25 KCX C  212 ? KCX C 192 . ? 1_555 ? 
68  AC5 25 ASP C  214 ? ASP C 194 . ? 1_555 ? 
69  AC5 25 GLU C  215 ? GLU C 195 . ? 1_555 ? 
70  AC5 25 HIS C  308 ? HIS C 288 . ? 1_555 ? 
71  AC5 25 ARG C  309 ? ARG C 289 . ? 1_555 ? 
72  AC5 25 HIS C  342 ? HIS C 322 . ? 1_555 ? 
73  AC5 25 LYS C  350 ? LYS C 330 . ? 1_555 ? 
74  AC5 25 SER C  389 ? SER C 369 . ? 1_555 ? 
75  AC5 25 GLY C  390 ? GLY C 370 . ? 1_555 ? 
76  AC5 25 GLY C  391 ? GLY C 371 . ? 1_555 ? 
77  AC5 25 GLY C  414 ? GLY C 394 . ? 1_555 ? 
78  AC5 25 GLY C  415 ? GLY C 395 . ? 1_555 ? 
79  AC5 25 MG  R  .   ? MG  C 501 . ? 1_555 ? 
80  AC5 25 HOH MA .   ? HOH C 616 . ? 1_555 ? 
81  AC5 25 HOH MA .   ? HOH C 640 . ? 1_555 ? 
82  AC5 25 HOH MA .   ? HOH C 658 . ? 1_555 ? 
83  AC5 25 HOH MA .   ? HOH C 662 . ? 1_555 ? 
84  AC5 25 HOH MA .   ? HOH C 682 . ? 1_555 ? 
85  AC5 25 GLU D  69  ? GLU D 49  . ? 1_555 ? 
86  AC5 25 THR D  74  ? THR D 54  . ? 1_555 ? 
87  AC5 25 ASN D  132 ? ASN D 112 . ? 1_555 ? 
88  AC5 25 HOH NA .   ? HOH D 619 . ? 1_555 ? 
89  AC6 4  KCX C  212 ? KCX C 192 . ? 1_555 ? 
90  AC6 4  ASP C  214 ? ASP C 194 . ? 1_555 ? 
91  AC6 4  GLU C  215 ? GLU C 195 . ? 1_555 ? 
92  AC6 4  CAP Q  .   ? CAP C 500 . ? 1_555 ? 
93  AC7 28 GLU C  69  ? GLU C 49  . ? 1_555 ? 
94  AC7 28 THR C  74  ? THR C 54  . ? 1_555 ? 
95  AC7 28 ASN C  132 ? ASN C 112 . ? 1_555 ? 
96  AC7 28 HOH MA .   ? HOH C 603 . ? 1_555 ? 
97  AC7 28 HOH MA .   ? HOH C 692 . ? 1_555 ? 
98  AC7 28 ILE D  185 ? ILE D 165 . ? 1_555 ? 
99  AC7 28 LYS D  187 ? LYS D 167 . ? 1_555 ? 
100 AC7 28 LYS D  189 ? LYS D 169 . ? 1_555 ? 
101 AC7 28 KCX D  212 ? KCX D 192 . ? 1_555 ? 
102 AC7 28 ASP D  214 ? ASP D 194 . ? 1_555 ? 
103 AC7 28 GLU D  215 ? GLU D 195 . ? 1_555 ? 
104 AC7 28 HIS D  308 ? HIS D 288 . ? 1_555 ? 
105 AC7 28 ARG D  309 ? ARG D 289 . ? 1_555 ? 
106 AC7 28 HIS D  342 ? HIS D 322 . ? 1_555 ? 
107 AC7 28 LYS D  350 ? LYS D 330 . ? 1_555 ? 
108 AC7 28 SER D  389 ? SER D 369 . ? 1_555 ? 
109 AC7 28 GLY D  390 ? GLY D 370 . ? 1_555 ? 
110 AC7 28 GLY D  391 ? GLY D 371 . ? 1_555 ? 
111 AC7 28 GLY D  414 ? GLY D 394 . ? 1_555 ? 
112 AC7 28 GLY D  415 ? GLY D 395 . ? 1_555 ? 
113 AC7 28 MG  T  .   ? MG  D 501 . ? 1_555 ? 
114 AC7 28 HOH NA .   ? HOH D 621 . ? 1_555 ? 
115 AC7 28 HOH NA .   ? HOH D 637 . ? 1_555 ? 
116 AC7 28 HOH NA .   ? HOH D 638 . ? 1_555 ? 
117 AC7 28 HOH NA .   ? HOH D 660 . ? 1_555 ? 
118 AC7 28 HOH NA .   ? HOH D 684 . ? 1_555 ? 
119 AC7 28 HOH NA .   ? HOH D 687 . ? 1_555 ? 
120 AC7 28 HOH NA .   ? HOH D 739 . ? 1_555 ? 
121 AC8 4  KCX D  212 ? KCX D 192 . ? 1_555 ? 
122 AC8 4  ASP D  214 ? ASP D 194 . ? 1_555 ? 
123 AC8 4  GLU D  215 ? GLU D 195 . ? 1_555 ? 
124 AC8 4  CAP S  .   ? CAP D 500 . ? 1_555 ? 
125 AC9 27 ILE E  185 ? ILE E 165 . ? 1_555 ? 
126 AC9 27 LYS E  187 ? LYS E 167 . ? 1_555 ? 
127 AC9 27 LYS E  189 ? LYS E 169 . ? 1_555 ? 
128 AC9 27 KCX E  212 ? KCX E 192 . ? 1_555 ? 
129 AC9 27 ASP E  214 ? ASP E 194 . ? 1_555 ? 
130 AC9 27 GLU E  215 ? GLU E 195 . ? 1_555 ? 
131 AC9 27 HIS E  308 ? HIS E 288 . ? 1_555 ? 
132 AC9 27 ARG E  309 ? ARG E 289 . ? 1_555 ? 
133 AC9 27 HIS E  342 ? HIS E 322 . ? 1_555 ? 
134 AC9 27 LYS E  350 ? LYS E 330 . ? 1_555 ? 
135 AC9 27 SER E  389 ? SER E 369 . ? 1_555 ? 
136 AC9 27 GLY E  390 ? GLY E 370 . ? 1_555 ? 
137 AC9 27 GLY E  391 ? GLY E 371 . ? 1_555 ? 
138 AC9 27 GLY E  414 ? GLY E 394 . ? 1_555 ? 
139 AC9 27 GLY E  415 ? GLY E 395 . ? 1_555 ? 
140 AC9 27 MG  V  .   ? MG  E 501 . ? 1_555 ? 
141 AC9 27 HOH OA .   ? HOH E 612 . ? 1_555 ? 
142 AC9 27 HOH OA .   ? HOH E 614 . ? 1_555 ? 
143 AC9 27 HOH OA .   ? HOH E 626 . ? 1_555 ? 
144 AC9 27 HOH OA .   ? HOH E 664 . ? 1_555 ? 
145 AC9 27 HOH OA .   ? HOH E 684 . ? 1_555 ? 
146 AC9 27 HOH OA .   ? HOH E 698 . ? 1_555 ? 
147 AC9 27 HOH OA .   ? HOH E 743 . ? 1_555 ? 
148 AC9 27 GLU F  69  ? GLU F 49  . ? 1_555 ? 
149 AC9 27 THR F  74  ? THR F 54  . ? 1_555 ? 
150 AC9 27 ASN F  132 ? ASN F 112 . ? 1_555 ? 
151 AC9 27 HOH PA .   ? HOH F 617 . ? 1_555 ? 
152 AD1 4  KCX E  212 ? KCX E 192 . ? 1_555 ? 
153 AD1 4  ASP E  214 ? ASP E 194 . ? 1_555 ? 
154 AD1 4  GLU E  215 ? GLU E 195 . ? 1_555 ? 
155 AD1 4  CAP U  .   ? CAP E 500 . ? 1_555 ? 
156 AD2 25 GLU E  69  ? GLU E 49  . ? 1_555 ? 
157 AD2 25 THR E  74  ? THR E 54  . ? 1_555 ? 
158 AD2 25 ASN E  132 ? ASN E 112 . ? 1_555 ? 
159 AD2 25 ILE F  185 ? ILE F 165 . ? 1_555 ? 
160 AD2 25 LYS F  187 ? LYS F 167 . ? 1_555 ? 
161 AD2 25 LYS F  189 ? LYS F 169 . ? 1_555 ? 
162 AD2 25 KCX F  212 ? KCX F 192 . ? 1_555 ? 
163 AD2 25 ASP F  214 ? ASP F 194 . ? 1_555 ? 
164 AD2 25 GLU F  215 ? GLU F 195 . ? 1_555 ? 
165 AD2 25 HIS F  308 ? HIS F 288 . ? 1_555 ? 
166 AD2 25 ARG F  309 ? ARG F 289 . ? 1_555 ? 
167 AD2 25 HIS F  342 ? HIS F 322 . ? 1_555 ? 
168 AD2 25 LYS F  350 ? LYS F 330 . ? 1_555 ? 
169 AD2 25 SER F  389 ? SER F 369 . ? 1_555 ? 
170 AD2 25 GLY F  390 ? GLY F 370 . ? 1_555 ? 
171 AD2 25 GLY F  391 ? GLY F 371 . ? 1_555 ? 
172 AD2 25 GLY F  414 ? GLY F 394 . ? 1_555 ? 
173 AD2 25 GLY F  415 ? GLY F 395 . ? 1_555 ? 
174 AD2 25 MG  X  .   ? MG  F 501 . ? 1_555 ? 
175 AD2 25 HOH PA .   ? HOH F 627 . ? 1_555 ? 
176 AD2 25 HOH PA .   ? HOH F 631 . ? 1_555 ? 
177 AD2 25 HOH PA .   ? HOH F 664 . ? 1_555 ? 
178 AD2 25 HOH PA .   ? HOH F 669 . ? 1_555 ? 
179 AD2 25 HOH PA .   ? HOH F 689 . ? 1_555 ? 
180 AD2 25 HOH PA .   ? HOH F 711 . ? 1_555 ? 
181 AD3 4  KCX F  212 ? KCX F 192 . ? 1_555 ? 
182 AD3 4  ASP F  214 ? ASP F 194 . ? 1_555 ? 
183 AD3 4  GLU F  215 ? GLU F 195 . ? 1_555 ? 
184 AD3 4  CAP W  .   ? CAP F 500 . ? 1_555 ? 
185 AD4 27 ILE G  185 ? ILE G 165 . ? 1_555 ? 
186 AD4 27 LYS G  187 ? LYS G 167 . ? 1_555 ? 
187 AD4 27 LYS G  189 ? LYS G 169 . ? 1_555 ? 
188 AD4 27 KCX G  212 ? KCX G 192 . ? 1_555 ? 
189 AD4 27 ASP G  214 ? ASP G 194 . ? 1_555 ? 
190 AD4 27 GLU G  215 ? GLU G 195 . ? 1_555 ? 
191 AD4 27 HIS G  308 ? HIS G 288 . ? 1_555 ? 
192 AD4 27 ARG G  309 ? ARG G 289 . ? 1_555 ? 
193 AD4 27 HIS G  342 ? HIS G 322 . ? 1_555 ? 
194 AD4 27 LYS G  350 ? LYS G 330 . ? 1_555 ? 
195 AD4 27 SER G  389 ? SER G 369 . ? 1_555 ? 
196 AD4 27 GLY G  390 ? GLY G 370 . ? 1_555 ? 
197 AD4 27 GLY G  391 ? GLY G 371 . ? 1_555 ? 
198 AD4 27 GLY G  414 ? GLY G 394 . ? 1_555 ? 
199 AD4 27 GLY G  415 ? GLY G 395 . ? 1_555 ? 
200 AD4 27 MG  Z  .   ? MG  G 501 . ? 1_555 ? 
201 AD4 27 HOH QA .   ? HOH G 612 . ? 1_555 ? 
202 AD4 27 HOH QA .   ? HOH G 624 . ? 1_555 ? 
203 AD4 27 HOH QA .   ? HOH G 638 . ? 1_555 ? 
204 AD4 27 HOH QA .   ? HOH G 675 . ? 1_555 ? 
205 AD4 27 HOH QA .   ? HOH G 685 . ? 1_555 ? 
206 AD4 27 HOH QA .   ? HOH G 693 . ? 1_555 ? 
207 AD4 27 HOH QA .   ? HOH G 703 . ? 1_555 ? 
208 AD4 27 GLU H  69  ? GLU H 49  . ? 1_555 ? 
209 AD4 27 THR H  74  ? THR H 54  . ? 1_555 ? 
210 AD4 27 ASN H  132 ? ASN H 112 . ? 1_555 ? 
211 AD4 27 HOH RA .   ? HOH H 677 . ? 1_555 ? 
212 AD5 4  KCX G  212 ? KCX G 192 . ? 1_555 ? 
213 AD5 4  ASP G  214 ? ASP G 194 . ? 1_555 ? 
214 AD5 4  GLU G  215 ? GLU G 195 . ? 1_555 ? 
215 AD5 4  CAP Y  .   ? CAP G 500 . ? 1_555 ? 
216 AD6 28 GLU G  69  ? GLU G 49  . ? 1_555 ? 
217 AD6 28 THR G  74  ? THR G 54  . ? 1_555 ? 
218 AD6 28 ASN G  132 ? ASN G 112 . ? 1_555 ? 
219 AD6 28 HOH QA .   ? HOH G 642 . ? 1_555 ? 
220 AD6 28 HOH QA .   ? HOH G 665 . ? 1_555 ? 
221 AD6 28 ILE H  185 ? ILE H 165 . ? 1_555 ? 
222 AD6 28 LYS H  187 ? LYS H 167 . ? 1_555 ? 
223 AD6 28 LYS H  189 ? LYS H 169 . ? 1_555 ? 
224 AD6 28 KCX H  212 ? KCX H 192 . ? 1_555 ? 
225 AD6 28 ASP H  214 ? ASP H 194 . ? 1_555 ? 
226 AD6 28 GLU H  215 ? GLU H 195 . ? 1_555 ? 
227 AD6 28 HIS H  308 ? HIS H 288 . ? 1_555 ? 
228 AD6 28 ARG H  309 ? ARG H 289 . ? 1_555 ? 
229 AD6 28 HIS H  342 ? HIS H 322 . ? 1_555 ? 
230 AD6 28 LYS H  350 ? LYS H 330 . ? 1_555 ? 
231 AD6 28 SER H  389 ? SER H 369 . ? 1_555 ? 
232 AD6 28 GLY H  390 ? GLY H 370 . ? 1_555 ? 
233 AD6 28 GLY H  391 ? GLY H 371 . ? 1_555 ? 
234 AD6 28 GLY H  414 ? GLY H 394 . ? 1_555 ? 
235 AD6 28 GLY H  415 ? GLY H 395 . ? 1_555 ? 
236 AD6 28 MG  BA .   ? MG  H 501 . ? 1_555 ? 
237 AD6 28 HOH RA .   ? HOH H 605 . ? 1_555 ? 
238 AD6 28 HOH RA .   ? HOH H 628 . ? 1_555 ? 
239 AD6 28 HOH RA .   ? HOH H 643 . ? 1_555 ? 
240 AD6 28 HOH RA .   ? HOH H 647 . ? 1_555 ? 
241 AD6 28 HOH RA .   ? HOH H 666 . ? 1_555 ? 
242 AD6 28 HOH RA .   ? HOH H 669 . ? 1_555 ? 
243 AD6 28 HOH RA .   ? HOH H 723 . ? 1_555 ? 
244 AD7 5  LYS H  189 ? LYS H 169 . ? 1_555 ? 
245 AD7 5  KCX H  212 ? KCX H 192 . ? 1_555 ? 
246 AD7 5  ASP H  214 ? ASP H 194 . ? 1_555 ? 
247 AD7 5  GLU H  215 ? GLU H 195 . ? 1_555 ? 
248 AD7 5  CAP AA .   ? CAP H 500 . ? 1_555 ? 
249 AD8 29 ILE I  185 ? ILE I 165 . ? 1_555 ? 
250 AD8 29 LYS I  187 ? LYS I 167 . ? 1_555 ? 
251 AD8 29 LYS I  189 ? LYS I 169 . ? 1_555 ? 
252 AD8 29 KCX I  212 ? KCX I 192 . ? 1_555 ? 
253 AD8 29 ASP I  214 ? ASP I 194 . ? 1_555 ? 
254 AD8 29 GLU I  215 ? GLU I 195 . ? 1_555 ? 
255 AD8 29 HIS I  308 ? HIS I 288 . ? 1_555 ? 
256 AD8 29 ARG I  309 ? ARG I 289 . ? 1_555 ? 
257 AD8 29 HIS I  342 ? HIS I 322 . ? 1_555 ? 
258 AD8 29 LYS I  350 ? LYS I 330 . ? 1_555 ? 
259 AD8 29 SER I  389 ? SER I 369 . ? 1_555 ? 
260 AD8 29 GLY I  390 ? GLY I 370 . ? 1_555 ? 
261 AD8 29 GLY I  391 ? GLY I 371 . ? 1_555 ? 
262 AD8 29 GLY I  414 ? GLY I 394 . ? 1_555 ? 
263 AD8 29 GLY I  415 ? GLY I 395 . ? 1_555 ? 
264 AD8 29 MG  DA .   ? MG  I 501 . ? 1_555 ? 
265 AD8 29 HOH SA .   ? HOH I 610 . ? 1_555 ? 
266 AD8 29 HOH SA .   ? HOH I 616 . ? 1_555 ? 
267 AD8 29 HOH SA .   ? HOH I 618 . ? 1_555 ? 
268 AD8 29 HOH SA .   ? HOH I 640 . ? 1_555 ? 
269 AD8 29 HOH SA .   ? HOH I 651 . ? 1_555 ? 
270 AD8 29 HOH SA .   ? HOH I 680 . ? 1_555 ? 
271 AD8 29 HOH SA .   ? HOH I 696 . ? 1_555 ? 
272 AD8 29 HOH SA .   ? HOH I 757 . ? 1_555 ? 
273 AD8 29 GLU J  69  ? GLU J 49  . ? 1_555 ? 
274 AD8 29 THR J  74  ? THR J 54  . ? 1_555 ? 
275 AD8 29 ASN J  132 ? ASN J 112 . ? 1_555 ? 
276 AD8 29 HOH TA .   ? HOH J 627 . ? 1_555 ? 
277 AD8 29 HOH TA .   ? HOH J 646 . ? 1_555 ? 
278 AD9 4  KCX I  212 ? KCX I 192 . ? 1_555 ? 
279 AD9 4  ASP I  214 ? ASP I 194 . ? 1_555 ? 
280 AD9 4  GLU I  215 ? GLU I 195 . ? 1_555 ? 
281 AD9 4  CAP CA .   ? CAP I 500 . ? 1_555 ? 
282 AE1 28 GLU I  69  ? GLU I 49  . ? 1_555 ? 
283 AE1 28 THR I  74  ? THR I 54  . ? 1_555 ? 
284 AE1 28 ASN I  132 ? ASN I 112 . ? 1_555 ? 
285 AE1 28 HOH SA .   ? HOH I 622 . ? 1_555 ? 
286 AE1 28 HOH SA .   ? HOH I 663 . ? 1_555 ? 
287 AE1 28 ILE J  185 ? ILE J 165 . ? 1_555 ? 
288 AE1 28 LYS J  187 ? LYS J 167 . ? 1_555 ? 
289 AE1 28 LYS J  189 ? LYS J 169 . ? 1_555 ? 
290 AE1 28 KCX J  212 ? KCX J 192 . ? 1_555 ? 
291 AE1 28 ASP J  214 ? ASP J 194 . ? 1_555 ? 
292 AE1 28 GLU J  215 ? GLU J 195 . ? 1_555 ? 
293 AE1 28 HIS J  308 ? HIS J 288 . ? 1_555 ? 
294 AE1 28 ARG J  309 ? ARG J 289 . ? 1_555 ? 
295 AE1 28 HIS J  342 ? HIS J 322 . ? 1_555 ? 
296 AE1 28 LYS J  350 ? LYS J 330 . ? 1_555 ? 
297 AE1 28 SER J  389 ? SER J 369 . ? 1_555 ? 
298 AE1 28 GLY J  390 ? GLY J 370 . ? 1_555 ? 
299 AE1 28 GLY J  391 ? GLY J 371 . ? 1_555 ? 
300 AE1 28 GLY J  414 ? GLY J 394 . ? 1_555 ? 
301 AE1 28 GLY J  415 ? GLY J 395 . ? 1_555 ? 
302 AE1 28 MG  FA .   ? MG  J 501 . ? 1_555 ? 
303 AE1 28 HOH TA .   ? HOH J 633 . ? 1_555 ? 
304 AE1 28 HOH TA .   ? HOH J 640 . ? 1_555 ? 
305 AE1 28 HOH TA .   ? HOH J 647 . ? 1_555 ? 
306 AE1 28 HOH TA .   ? HOH J 648 . ? 1_555 ? 
307 AE1 28 HOH TA .   ? HOH J 674 . ? 1_555 ? 
308 AE1 28 HOH TA .   ? HOH J 693 . ? 1_555 ? 
309 AE1 28 HOH TA .   ? HOH J 703 . ? 1_555 ? 
310 AE2 4  KCX J  212 ? KCX J 192 . ? 1_555 ? 
311 AE2 4  ASP J  214 ? ASP J 194 . ? 1_555 ? 
312 AE2 4  GLU J  215 ? GLU J 195 . ? 1_555 ? 
313 AE2 4  CAP EA .   ? CAP J 500 . ? 1_555 ? 
314 AE3 24 ILE K  185 ? ILE K 165 . ? 1_555 ? 
315 AE3 24 LYS K  187 ? LYS K 167 . ? 1_555 ? 
316 AE3 24 LYS K  189 ? LYS K 169 . ? 1_555 ? 
317 AE3 24 KCX K  212 ? KCX K 192 . ? 1_555 ? 
318 AE3 24 ASP K  214 ? ASP K 194 . ? 1_555 ? 
319 AE3 24 GLU K  215 ? GLU K 195 . ? 1_555 ? 
320 AE3 24 HIS K  308 ? HIS K 288 . ? 1_555 ? 
321 AE3 24 ARG K  309 ? ARG K 289 . ? 1_555 ? 
322 AE3 24 HIS K  342 ? HIS K 322 . ? 1_555 ? 
323 AE3 24 LYS K  350 ? LYS K 330 . ? 1_555 ? 
324 AE3 24 SER K  389 ? SER K 369 . ? 1_555 ? 
325 AE3 24 GLY K  390 ? GLY K 370 . ? 1_555 ? 
326 AE3 24 GLY K  391 ? GLY K 371 . ? 1_555 ? 
327 AE3 24 GLY K  414 ? GLY K 394 . ? 1_555 ? 
328 AE3 24 GLY K  415 ? GLY K 395 . ? 1_555 ? 
329 AE3 24 MG  HA .   ? MG  K 501 . ? 1_555 ? 
330 AE3 24 HOH UA .   ? HOH K 632 . ? 1_555 ? 
331 AE3 24 HOH UA .   ? HOH K 638 . ? 1_555 ? 
332 AE3 24 HOH UA .   ? HOH K 640 . ? 1_555 ? 
333 AE3 24 HOH UA .   ? HOH K 693 . ? 1_555 ? 
334 AE3 24 GLU L  69  ? GLU L 49  . ? 1_555 ? 
335 AE3 24 THR L  74  ? THR L 54  . ? 1_555 ? 
336 AE3 24 ASN L  132 ? ASN L 112 . ? 1_555 ? 
337 AE3 24 HOH VA .   ? HOH L 682 . ? 1_555 ? 
338 AE4 4  KCX K  212 ? KCX K 192 . ? 1_555 ? 
339 AE4 4  ASP K  214 ? ASP K 194 . ? 1_555 ? 
340 AE4 4  GLU K  215 ? GLU K 195 . ? 1_555 ? 
341 AE4 4  CAP GA .   ? CAP K 500 . ? 1_555 ? 
342 AE5 25 GLU K  69  ? GLU K 49  . ? 1_555 ? 
343 AE5 25 THR K  74  ? THR K 54  . ? 1_555 ? 
344 AE5 25 ASN K  132 ? ASN K 112 . ? 1_555 ? 
345 AE5 25 HOH UA .   ? HOH K 652 . ? 1_555 ? 
346 AE5 25 HOH UA .   ? HOH K 680 . ? 1_555 ? 
347 AE5 25 ILE L  185 ? ILE L 165 . ? 1_555 ? 
348 AE5 25 LYS L  187 ? LYS L 167 . ? 1_555 ? 
349 AE5 25 LYS L  189 ? LYS L 169 . ? 1_555 ? 
350 AE5 25 KCX L  212 ? KCX L 192 . ? 1_555 ? 
351 AE5 25 ASP L  214 ? ASP L 194 . ? 1_555 ? 
352 AE5 25 GLU L  215 ? GLU L 195 . ? 1_555 ? 
353 AE5 25 HIS L  308 ? HIS L 288 . ? 1_555 ? 
354 AE5 25 ARG L  309 ? ARG L 289 . ? 1_555 ? 
355 AE5 25 HIS L  342 ? HIS L 322 . ? 1_555 ? 
356 AE5 25 LYS L  350 ? LYS L 330 . ? 1_555 ? 
357 AE5 25 SER L  389 ? SER L 369 . ? 1_555 ? 
358 AE5 25 GLY L  390 ? GLY L 370 . ? 1_555 ? 
359 AE5 25 GLY L  391 ? GLY L 371 . ? 1_555 ? 
360 AE5 25 GLY L  414 ? GLY L 394 . ? 1_555 ? 
361 AE5 25 GLY L  415 ? GLY L 395 . ? 1_555 ? 
362 AE5 25 MG  JA .   ? MG  L 501 . ? 1_555 ? 
363 AE5 25 HOH VA .   ? HOH L 630 . ? 1_555 ? 
364 AE5 25 HOH VA .   ? HOH L 645 . ? 1_555 ? 
365 AE5 25 HOH VA .   ? HOH L 648 . ? 1_555 ? 
366 AE5 25 HOH VA .   ? HOH L 670 . ? 1_555 ? 
367 AE6 4  KCX L  212 ? KCX L 192 . ? 1_555 ? 
368 AE6 4  ASP L  214 ? ASP L 194 . ? 1_555 ? 
369 AE6 4  GLU L  215 ? GLU L 195 . ? 1_555 ? 
370 AE6 4  CAP IA .   ? CAP L 500 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5HAT 
_atom_sites.fract_transf_matrix[1][1]   0.013134 
_atom_sites.fract_transf_matrix[1][2]   0.003531 
_atom_sites.fract_transf_matrix[1][3]   0.002921 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009326 
_atom_sites.fract_transf_matrix[2][3]   0.000525 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006115 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N    . MET A  1 21  ? 52.080  -87.407  19.277  1.00 55.89  ? 1   MET A N    1 
ATOM   2     C  CA   . MET A  1 21  ? 51.048  -88.132  18.538  1.00 55.82  ? 1   MET A CA   1 
ATOM   3     C  C    . MET A  1 21  ? 51.616  -89.391  17.866  1.00 57.31  ? 1   MET A C    1 
ATOM   4     O  O    . MET A  1 21  ? 52.605  -89.298  17.144  1.00 59.55  ? 1   MET A O    1 
ATOM   5     C  CB   . MET A  1 21  ? 50.442  -87.217  17.464  1.00 58.54  ? 1   MET A CB   1 
ATOM   6     C  CG   . MET A  1 21  ? 49.323  -87.860  16.653  1.00 62.27  ? 1   MET A CG   1 
ATOM   7     S  SD   . MET A  1 21  ? 48.883  -86.844  15.231  1.00 66.62  ? 1   MET A SD   1 
ATOM   8     C  CE   . MET A  1 21  ? 47.608  -87.858  14.505  1.00 63.96  ? 1   MET A CE   1 
ATOM   9     H  HA   . MET A  1 21  ? 50.250  -88.409  19.225  1.00 55.88  ? 1   MET A HA   1 
ATOM   10    H  HB2  . MET A  1 21  ? 50.033  -86.334  17.954  1.00 58.65  ? 1   MET A HB2  1 
ATOM   11    H  HB3  . MET A  1 21  ? 51.226  -86.920  16.767  1.00 58.95  ? 1   MET A HB3  1 
ATOM   12    H  HG2  . MET A  1 21  ? 49.628  -88.824  16.254  1.00 61.28  ? 1   MET A HG2  1 
ATOM   13    H  HG3  . MET A  1 21  ? 48.443  -87.974  17.285  1.00 63.19  ? 1   MET A HG3  1 
ATOM   14    H  HE1  . MET A  1 21  ? 47.290  -87.406  13.566  1.00 63.53  ? 1   MET A HE1  1 
ATOM   15    H  HE2  . MET A  1 21  ? 48.023  -88.847  14.311  1.00 64.60  ? 1   MET A HE2  1 
ATOM   16    H  HE3  . MET A  1 21  ? 46.764  -87.937  15.188  1.00 63.61  ? 1   MET A HE3  1 
ATOM   17    N  N    . ASP A  1 22  ? 50.947  -90.540  18.038  1.00 48.74  ? 2   ASP A N    1 
ATOM   18    C  CA   . ASP A  1 22  ? 51.328  -91.800  17.412  1.00 46.69  ? 2   ASP A CA   1 
ATOM   19    C  C    . ASP A  1 22  ? 50.651  -91.923  16.036  1.00 48.83  ? 2   ASP A C    1 
ATOM   20    O  O    . ASP A  1 22  ? 49.436  -92.148  15.970  1.00 48.48  ? 2   ASP A O    1 
ATOM   21    C  CB   . ASP A  1 22  ? 50.950  -92.997  18.314  1.00 49.30  ? 2   ASP A CB   1 
ATOM   22    C  CG   . ASP A  1 22  ? 51.386  -94.360  17.797  1.00 59.86  ? 2   ASP A CG   1 
ATOM   23    O  OD1  . ASP A  1 22  ? 51.854  -94.440  16.622  1.00 61.53  ? 2   ASP A OD1  1 
ATOM   24    O  OD2  . ASP A  1 22  ? 51.296  -95.344  18.571  1.00 56.56  ? 2   ASP A OD2  1 
ATOM   25    H  H    . ASP A  1 22  ? 50.120  -90.625  18.622  1.00 50.82  ? 2   ASP A H    1 
ATOM   26    H  HA   . ASP A  1 22  ? 52.407  -91.819  17.269  1.00 46.52  ? 2   ASP A HA   1 
ATOM   27    H  HB2  . ASP A  1 22  ? 51.423  -92.854  19.284  1.00 50.03  ? 2   ASP A HB2  1 
ATOM   28    H  HB3  . ASP A  1 22  ? 49.868  -93.024  18.438  1.00 49.28  ? 2   ASP A HB3  1 
ATOM   29    N  N    . GLN A  1 23  ? 51.447  -91.819  14.951  1.00 43.75  ? 3   GLN A N    1 
ATOM   30    C  CA   . GLN A  1 23  ? 50.951  -91.922  13.575  1.00 42.66  ? 3   GLN A CA   1 
ATOM   31    C  C    . GLN A  1 23  ? 51.344  -93.260  12.896  1.00 43.03  ? 3   GLN A C    1 
ATOM   32    O  O    . GLN A  1 23  ? 51.262  -93.370  11.672  1.00 40.58  ? 3   GLN A O    1 
ATOM   33    C  CB   . GLN A  1 23  ? 51.498  -90.747  12.750  1.00 42.99  ? 3   GLN A CB   1 
ATOM   34    C  CG   . GLN A  1 23  ? 51.356  -89.391  13.425  1.00 38.29  ? 3   GLN A CG   1 
ATOM   35    C  CD   . GLN A  1 23  ? 51.497  -88.262  12.431  1.00 58.65  ? 3   GLN A CD   1 
ATOM   36    O  OE1  . GLN A  1 23  ? 50.674  -88.105  11.522  1.00 43.86  ? 3   GLN A OE1  1 
ATOM   37    N  NE2  . GLN A  1 23  ? 52.530  -87.444  12.574  1.00 56.15  ? 3   GLN A NE2  1 
ATOM   38    H  H    . GLN A  1 23  ? 52.450  -91.652  14.987  1.00 43.79  ? 3   GLN A H    1 
ATOM   39    H  HA   . GLN A  1 23  ? 49.866  -91.854  13.556  1.00 42.83  ? 3   GLN A HA   1 
ATOM   40    H  HB2  . GLN A  1 23  ? 52.550  -90.917  12.525  1.00 43.25  ? 3   GLN A HB2  1 
ATOM   41    H  HB3  . GLN A  1 23  ? 50.925  -90.704  11.825  1.00 44.43  ? 3   GLN A HB3  1 
ATOM   42    H  HG2  . GLN A  1 23  ? 50.364  -89.323  13.867  1.00 38.21  ? 3   GLN A HG2  1 
ATOM   43    H  HG3  . GLN A  1 23  ? 52.124  -89.293  14.191  1.00 38.58  ? 3   GLN A HG3  1 
ATOM   44    H  HE21 . GLN A  1 23  ? 53.204  -87.573  13.322  1.00 56.72  ? 3   GLN A HE21 1 
ATOM   45    H  HE22 . GLN A  1 23  ? 52.648  -86.676  11.920  1.00 56.21  ? 3   GLN A HE22 1 
ATOM   46    N  N    . SER A  1 24  ? 51.731  -94.270  13.692  1.00 39.36  ? 4   SER A N    1 
ATOM   47    C  CA   . SER A  1 24  ? 52.178  -95.575  13.190  1.00 39.43  ? 4   SER A CA   1 
ATOM   48    C  C    . SER A  1 24  ? 51.073  -96.360  12.475  1.00 44.11  ? 4   SER A C    1 
ATOM   49    O  O    . SER A  1 24  ? 51.380  -97.022  11.495  1.00 39.37  ? 4   SER A O    1 
ATOM   50    C  CB   . SER A  1 24  ? 52.772  -96.407  14.325  1.00 43.99  ? 4   SER A CB   1 
ATOM   51    O  OG   . SER A  1 24  ? 51.788  -96.865  15.233  1.00 60.37  ? 4   SER A OG   1 
ATOM   52    H  H    . SER A  1 24  ? 51.766  -94.203  14.704  1.00 40.01  ? 4   SER A H    1 
ATOM   53    H  HA   . SER A  1 24  ? 52.956  -95.429  12.446  1.00 37.68  ? 4   SER A HA   1 
ATOM   54    H  HB2  . SER A  1 24  ? 53.274  -97.267  13.885  1.00 45.32  ? 4   SER A HB2  1 
ATOM   55    H  HB3  . SER A  1 24  ? 53.500  -95.806  14.868  1.00 42.89  ? 4   SER A HB3  1 
ATOM   56    H  HG   . SER A  1 24  ? 51.157  -96.149  15.503  1.00 60.59  ? 4   SER A HG   1 
ATOM   57    N  N    . ASN A  1 25  ? 49.794  -96.250  12.906  1.00 44.57  ? 5   ASN A N    1 
ATOM   58    C  CA   . ASN A  1 25  ? 48.710  -96.980  12.231  1.00 44.81  ? 5   ASN A CA   1 
ATOM   59    C  C    . ASN A  1 25  ? 48.513  -96.496  10.802  1.00 47.89  ? 5   ASN A C    1 
ATOM   60    O  O    . ASN A  1 25  ? 48.231  -97.313  9.926   1.00 50.22  ? 5   ASN A O    1 
ATOM   61    C  CB   . ASN A  1 25  ? 47.396  -96.893  13.006  1.00 49.87  ? 5   ASN A CB   1 
ATOM   62    C  CG   . ASN A  1 25  ? 47.408  -97.622  14.350  1.00 89.42  ? 5   ASN A CG   1 
ATOM   63    O  OD1  . ASN A  1 25  ? 48.257  -98.484  14.645  1.00 87.24  ? 5   ASN A OD1  1 
ATOM   64    N  ND2  . ASN A  1 25  ? 46.442  -97.308  15.192  1.00 82.39  ? 5   ASN A ND2  1 
ATOM   65    H  H    . ASN A  1 25  ? 49.496  -95.671  13.685  1.00 44.95  ? 5   ASN A H    1 
ATOM   66    H  HA   . ASN A  1 25  ? 48.987  -98.033  12.178  1.00 46.40  ? 5   ASN A HA   1 
ATOM   67    H  HB2  . ASN A  1 25  ? 47.186  -95.841  13.197  1.00 50.63  ? 5   ASN A HB2  1 
ATOM   68    H  HB3  . ASN A  1 25  ? 46.589  -97.323  12.415  1.00 49.29  ? 5   ASN A HB3  1 
ATOM   69    H  HD21 . ASN A  1 25  ? 46.408  -97.757  16.101  1.00 82.91  ? 5   ASN A HD21 1 
ATOM   70    H  HD22 . ASN A  1 25  ? 45.738  -96.625  14.932  1.00 82.39  ? 5   ASN A HD22 1 
ATOM   71    N  N    . ARG A  1 26  ? 48.722  -95.201  10.541  1.00 43.72  ? 6   ARG A N    1 
ATOM   72    C  CA   . ARG A  1 26  ? 48.576  -94.635  9.205   1.00 41.44  ? 6   ARG A CA   1 
ATOM   73    C  C    . ARG A  1 26  ? 49.846  -94.797  8.352   1.00 43.22  ? 6   ARG A C    1 
ATOM   74    O  O    . ARG A  1 26  ? 49.743  -95.232  7.207   1.00 43.30  ? 6   ARG A O    1 
ATOM   75    C  CB   . ARG A  1 26  ? 48.219  -93.139  9.314   1.00 37.88  ? 6   ARG A CB   1 
ATOM   76    C  CG   . ARG A  1 26  ? 48.044  -92.451  7.975   1.00 37.52  ? 6   ARG A CG   1 
ATOM   77    C  CD   . ARG A  1 26  ? 47.552  -91.045  8.140   1.00 40.78  ? 6   ARG A CD   1 
ATOM   78    N  NE   . ARG A  1 26  ? 47.609  -90.328  6.864   1.00 47.41  ? 6   ARG A NE   1 
ATOM   79    C  CZ   . ARG A  1 26  ? 47.452  -89.017  6.712   1.00 60.16  ? 6   ARG A CZ   1 
ATOM   80    N  NH1  . ARG A  1 26  ? 47.219  -88.237  7.768   1.00 45.19  ? 6   ARG A NH1  1 
ATOM   81    N  NH2  . ARG A  1 26  ? 47.537  -88.470  5.508   1.00 39.27  ? 6   ARG A NH2  1 
ATOM   82    H  H    . ARG A  1 26  ? 49.004  -94.514  11.233  1.00 44.45  ? 6   ARG A H    1 
ATOM   83    H  HA   . ARG A  1 26  ? 47.761  -95.127  8.677   1.00 41.73  ? 6   ARG A HA   1 
ATOM   84    H  HB2  . ARG A  1 26  ? 47.286  -93.042  9.865   1.00 36.93  ? 6   ARG A HB2  1 
ATOM   85    H  HB3  . ARG A  1 26  ? 49.017  -92.615  9.836   1.00 38.56  ? 6   ARG A HB3  1 
ATOM   86    H  HG2  . ARG A  1 26  ? 48.994  -92.392  7.446   1.00 35.96  ? 6   ARG A HG2  1 
ATOM   87    H  HG3  . ARG A  1 26  ? 47.318  -93.005  7.382   1.00 37.57  ? 6   ARG A HG3  1 
ATOM   88    H  HD2  . ARG A  1 26  ? 46.525  -91.048  8.502   1.00 40.97  ? 6   ARG A HD2  1 
ATOM   89    H  HD3  . ARG A  1 26  ? 48.203  -90.541  8.851   1.00 41.06  ? 6   ARG A HD3  1 
ATOM   90    H  HE   . ARG A  1 26  ? 47.766  -90.891  6.036   1.00 46.81  ? 6   ARG A HE   1 
ATOM   91    H  HH11 . ARG A  1 26  ? 47.147  -88.606  8.709   1.00 44.68  ? 6   ARG A HH11 1 
ATOM   92    H  HH12 . ARG A  1 26  ? 47.105  -87.238  7.625   1.00 45.41  ? 6   ARG A HH12 1 
ATOM   93    H  HH21 . ARG A  1 26  ? 47.693  -89.058  4.694   1.00 40.04  ? 6   ARG A HH21 1 
ATOM   94    H  HH22 . ARG A  1 26  ? 47.405  -87.473  5.378   1.00 38.87  ? 6   ARG A HH22 1 
ATOM   95    N  N    . TYR A  1 27  ? 51.023  -94.387  8.878   1.00 36.46  ? 7   TYR A N    1 
ATOM   96    C  CA   . TYR A  1 27  ? 52.260  -94.318  8.094   1.00 34.83  ? 7   TYR A CA   1 
ATOM   97    C  C    . TYR A  1 27  ? 53.188  -95.541  8.183   1.00 41.12  ? 7   TYR A C    1 
ATOM   98    O  O    . TYR A  1 27  ? 54.285  -95.502  7.619   1.00 36.36  ? 7   TYR A O    1 
ATOM   99    C  CB   . TYR A  1 27  ? 53.046  -93.056  8.471   1.00 34.11  ? 7   TYR A CB   1 
ATOM   100   C  CG   . TYR A  1 27  ? 52.353  -91.791  8.028   1.00 34.66  ? 7   TYR A CG   1 
ATOM   101   C  CD1  . TYR A  1 27  ? 52.503  -91.308  6.735   1.00 36.51  ? 7   TYR A CD1  1 
ATOM   102   C  CD2  . TYR A  1 27  ? 51.529  -91.079  8.898   1.00 34.42  ? 7   TYR A CD2  1 
ATOM   103   C  CE1  . TYR A  1 27  ? 51.867  -90.151  6.316   1.00 33.77  ? 7   TYR A CE1  1 
ATOM   104   C  CE2  . TYR A  1 27  ? 50.930  -89.883  8.506   1.00 34.38  ? 7   TYR A CE2  1 
ATOM   105   C  CZ   . TYR A  1 27  ? 51.109  -89.414  7.215   1.00 37.99  ? 7   TYR A CZ   1 
ATOM   106   O  OH   . TYR A  1 27  ? 50.506  -88.233  6.818   1.00 34.96  ? 7   TYR A OH   1 
ATOM   107   H  H    . TYR A  1 27  ? 51.132  -94.110  9.848   1.00 36.38  ? 7   TYR A H    1 
ATOM   108   H  HA   . TYR A  1 27  ? 52.006  -94.194  7.041   1.00 36.32  ? 7   TYR A HA   1 
ATOM   109   H  HB2  . TYR A  1 27  ? 53.149  -93.013  9.554   1.00 34.86  ? 7   TYR A HB2  1 
ATOM   110   H  HB3  . TYR A  1 27  ? 54.026  -93.062  8.001   1.00 32.41  ? 7   TYR A HB3  1 
ATOM   111   H  HD1  . TYR A  1 27  ? 53.141  -91.847  6.039   1.00 38.40  ? 7   TYR A HD1  1 
ATOM   112   H  HD2  . TYR A  1 27  ? 51.406  -91.441  9.916   1.00 32.50  ? 7   TYR A HD2  1 
ATOM   113   H  HE1  . TYR A  1 27  ? 52.047  -89.783  5.307   1.00 33.52  ? 7   TYR A HE1  1 
ATOM   114   H  HE2  . TYR A  1 27  ? 50.301  -89.338  9.208   1.00 35.59  ? 7   TYR A HE2  1 
ATOM   115   H  HH   . TYR A  1 27  ? 50.902  -87.878  5.984   1.00 32.80  ? 7   TYR A HH   1 
ATOM   116   N  N    . ALA A  1 28  ? 52.772  -96.620  8.850   1.00 43.13  ? 8   ALA A N    1 
ATOM   117   C  CA   . ALA A  1 28  ? 53.580  -97.840  8.905   1.00 43.08  ? 8   ALA A CA   1 
ATOM   118   C  C    . ALA A  1 28  ? 52.755  -99.024  8.469   1.00 46.83  ? 8   ALA A C    1 
ATOM   119   O  O    . ALA A  1 28  ? 51.637  -99.215  8.947   1.00 45.98  ? 8   ALA A O    1 
ATOM   120   C  CB   . ALA A  1 28  ? 54.117  -98.072  10.316  1.00 44.47  ? 8   ALA A CB   1 
ATOM   121   H  H    . ALA A  1 28  ? 51.900  -96.686  9.367   1.00 44.19  ? 8   ALA A H    1 
ATOM   122   H  HA   . ALA A  1 28  ? 54.440  -97.761  8.243   1.00 42.19  ? 8   ALA A HA   1 
ATOM   123   H  HB1  . ALA A  1 28  ? 54.982  -98.728  10.248  1.00 44.33  ? 8   ALA A HB1  1 
ATOM   124   H  HB2  . ALA A  1 28  ? 54.409  -97.119  10.756  1.00 44.33  ? 8   ALA A HB2  1 
ATOM   125   H  HB3  . ALA A  1 28  ? 53.357  -98.553  10.929  1.00 45.05  ? 8   ALA A HB3  1 
ATOM   126   N  N    . ASN A  1 29  ? 53.289  -99.805  7.526   1.00 44.35  ? 9   ASN A N    1 
ATOM   127   C  CA   . ASN A  1 29  ? 52.684  -101.065 7.109   1.00 43.41  ? 9   ASN A CA   1 
ATOM   128   C  C    . ASN A  1 29  ? 53.807  -102.071 6.904   1.00 43.79  ? 9   ASN A C    1 
ATOM   129   O  O    . ASN A  1 29  ? 54.278  -102.275 5.790   1.00 41.18  ? 9   ASN A O    1 
ATOM   130   C  CB   . ASN A  1 29  ? 51.784  -100.936 5.879   1.00 41.60  ? 9   ASN A CB   1 
ATOM   131   C  CG   . ASN A  1 29  ? 50.986  -102.207 5.615   1.00 41.72  ? 9   ASN A CG   1 
ATOM   132   O  OD1  . ASN A  1 29  ? 51.104  -103.210 6.305   1.00 42.66  ? 9   ASN A OD1  1 
ATOM   133   N  ND2  . ASN A  1 29  ? 50.170  -102.208 4.591   1.00 44.40  ? 9   ASN A ND2  1 
ATOM   134   H  H    . ASN A  1 29  ? 54.139  -99.582  7.019   1.00 44.47  ? 9   ASN A H    1 
ATOM   135   H  HA   . ASN A  1 29  ? 52.064  -101.442 7.922   1.00 44.44  ? 9   ASN A HA   1 
ATOM   136   H  HB2  . ASN A  1 29  ? 51.071  -100.130 6.052   1.00 41.69  ? 9   ASN A HB2  1 
ATOM   137   H  HB3  . ASN A  1 29  ? 52.384  -100.700 5.003   1.00 40.45  ? 9   ASN A HB3  1 
ATOM   138   H  HD21 . ASN A  1 29  ? 49.623  -103.037 4.383   1.00 44.75  ? 9   ASN A HD21 1 
ATOM   139   H  HD22 . ASN A  1 29  ? 50.089  -101.382 4.004   1.00 45.01  ? 9   ASN A HD22 1 
ATOM   140   N  N    . LEU A  1 30  ? 54.192  -102.744 8.004   1.00 40.03  ? 10  LEU A N    1 
ATOM   141   C  CA   . LEU A  1 30  ? 55.283  -103.703 7.991   1.00 40.48  ? 10  LEU A CA   1 
ATOM   142   C  C    . LEU A  1 30  ? 54.886  -105.042 7.316   1.00 45.41  ? 10  LEU A C    1 
ATOM   143   O  O    . LEU A  1 30  ? 55.781  -105.844 7.027   1.00 45.77  ? 10  LEU A O    1 
ATOM   144   C  CB   . LEU A  1 30  ? 55.818  -103.943 9.397   1.00 40.99  ? 10  LEU A CB   1 
ATOM   145   C  CG   . LEU A  1 30  ? 56.304  -102.697 10.159  1.00 44.43  ? 10  LEU A CG   1 
ATOM   146   C  CD1  . LEU A  1 30  ? 56.785  -103.064 11.547  1.00 45.51  ? 10  LEU A CD1  1 
ATOM   147   C  CD2  . LEU A  1 30  ? 57.411  -101.951 9.409   1.00 47.27  ? 10  LEU A CD2  1 
ATOM   148   H  H    . LEU A  1 30  ? 53.735  -102.657 8.906   1.00 39.85  ? 10  LEU A H    1 
ATOM   149   H  HA   . LEU A  1 30  ? 56.093  -103.278 7.399   1.00 40.82  ? 10  LEU A HA   1 
ATOM   150   H  HB2  . LEU A  1 30  ? 55.019  -104.391 9.987   1.00 42.37  ? 10  LEU A HB2  1 
ATOM   151   H  HB3  . LEU A  1 30  ? 56.656  -104.637 9.334   1.00 41.01  ? 10  LEU A HB3  1 
ATOM   152   H  HG   . LEU A  1 30  ? 55.470  -102.006 10.280  1.00 44.72  ? 10  LEU A HG   1 
ATOM   153   H  HD11 . LEU A  1 30  ? 57.055  -102.159 12.089  1.00 45.77  ? 10  LEU A HD11 1 
ATOM   154   H  HD12 . LEU A  1 30  ? 55.984  -103.579 12.076  1.00 46.07  ? 10  LEU A HD12 1 
ATOM   155   H  HD13 . LEU A  1 30  ? 57.649  -103.721 11.461  1.00 45.18  ? 10  LEU A HD13 1 
ATOM   156   H  HD21 . LEU A  1 30  ? 57.877  -101.227 10.078  1.00 46.62  ? 10  LEU A HD21 1 
ATOM   157   H  HD22 . LEU A  1 30  ? 58.149  -102.672 9.064   1.00 48.12  ? 10  LEU A HD22 1 
ATOM   158   H  HD23 . LEU A  1 30  ? 56.976  -101.429 8.559   1.00 46.56  ? 10  LEU A HD23 1 
ATOM   159   N  N    . ASN A  1 31  ? 53.585  -105.243 6.975   1.00 39.66  ? 11  ASN A N    1 
ATOM   160   C  CA   . ASN A  1 31  ? 53.150  -106.412 6.222   1.00 39.70  ? 11  ASN A CA   1 
ATOM   161   C  C    . ASN A  1 31  ? 53.364  -106.223 4.701   1.00 46.55  ? 11  ASN A C    1 
ATOM   162   O  O    . ASN A  1 31  ? 53.225  -107.197 3.960   1.00 46.91  ? 11  ASN A O    1 
ATOM   163   C  CB   . ASN A  1 31  ? 51.696  -106.751 6.514   1.00 43.92  ? 11  ASN A CB   1 
ATOM   164   C  CG   . ASN A  1 31  ? 51.396  -107.015 7.979   1.00 69.96  ? 11  ASN A CG   1 
ATOM   165   O  OD1  . ASN A  1 31  ? 50.396  -106.524 8.481   1.00 72.82  ? 11  ASN A OD1  1 
ATOM   166   N  ND2  . ASN A  1 31  ? 52.222  -107.773 8.728   1.00 58.31  ? 11  ASN A ND2  1 
ATOM   167   H  H    . ASN A  1 31  ? 52.818  -104.635 7.241   1.00 38.42  ? 11  ASN A H    1 
ATOM   168   H  HA   . ASN A  1 31  ? 53.747  -107.273 6.517   1.00 38.85  ? 11  ASN A HA   1 
ATOM   169   H  HB2  . ASN A  1 31  ? 51.082  -105.902 6.214   1.00 44.00  ? 11  ASN A HB2  1 
ATOM   170   H  HB3  . ASN A  1 31  ? 51.405  -107.627 5.936   1.00 43.74  ? 11  ASN A HB3  1 
ATOM   171   H  HD21 . ASN A  1 31  ? 51.992  -107.940 9.703   1.00 59.51  ? 11  ASN A HD21 1 
ATOM   172   H  HD22 . ASN A  1 31  ? 53.049  -108.215 8.343   1.00 58.33  ? 11  ASN A HD22 1 
ATOM   173   N  N    . LEU A  1 32  ? 53.750  -105.014 4.222   1.00 45.41  ? 12  LEU A N    1 
ATOM   174   C  CA   . LEU A  1 32  ? 54.089  -104.842 2.803   1.00 44.71  ? 12  LEU A CA   1 
ATOM   175   C  C    . LEU A  1 32  ? 55.395  -105.576 2.495   1.00 51.59  ? 12  LEU A C    1 
ATOM   176   O  O    . LEU A  1 32  ? 56.332  -105.511 3.297   1.00 53.80  ? 12  LEU A O    1 
ATOM   177   C  CB   . LEU A  1 32  ? 54.258  -103.375 2.429   1.00 43.75  ? 12  LEU A CB   1 
ATOM   178   C  CG   . LEU A  1 32  ? 53.013  -102.505 2.475   1.00 47.17  ? 12  LEU A CG   1 
ATOM   179   C  CD1  . LEU A  1 32  ? 53.384  -101.045 2.371   1.00 45.53  ? 12  LEU A CD1  1 
ATOM   180   C  CD2  . LEU A  1 32  ? 52.008  -102.883 1.386   1.00 48.54  ? 12  LEU A CD2  1 
ATOM   181   H  H    . LEU A  1 32  ? 53.807  -104.158 4.762   1.00 45.84  ? 12  LEU A H    1 
ATOM   182   H  HA   . LEU A  1 32  ? 53.300  -105.275 2.192   1.00 44.61  ? 12  LEU A HA   1 
ATOM   183   H  HB2  . LEU A  1 32  ? 54.981  -102.938 3.113   1.00 43.09  ? 12  LEU A HB2  1 
ATOM   184   H  HB3  . LEU A  1 32  ? 54.651  -103.324 1.414   1.00 44.11  ? 12  LEU A HB3  1 
ATOM   185   H  HG   . LEU A  1 32  ? 52.531  -102.667 3.436   1.00 48.73  ? 12  LEU A HG   1 
ATOM   186   H  HD11 . LEU A  1 32  ? 52.477  -100.444 2.355   1.00 45.51  ? 12  LEU A HD11 1 
ATOM   187   H  HD12 . LEU A  1 32  ? 53.992  -100.775 3.234   1.00 45.15  ? 12  LEU A HD12 1 
ATOM   188   H  HD13 . LEU A  1 32  ? 53.954  -100.890 1.457   1.00 45.21  ? 12  LEU A HD13 1 
ATOM   189   H  HD21 . LEU A  1 32  ? 51.208  -102.145 1.364   1.00 48.02  ? 12  LEU A HD21 1 
ATOM   190   H  HD22 . LEU A  1 32  ? 52.522  -102.902 0.426   1.00 48.51  ? 12  LEU A HD22 1 
ATOM   191   H  HD23 . LEU A  1 32  ? 51.593  -103.865 1.607   1.00 48.31  ? 12  LEU A HD23 1 
ATOM   192   N  N    . LYS A  1 33  ? 55.450  -106.284 1.361   1.00 44.87  ? 13  LYS A N    1 
ATOM   193   C  CA   . LYS A  1 33  ? 56.637  -107.024 0.949   1.00 43.19  ? 13  LYS A CA   1 
ATOM   194   C  C    . LYS A  1 33  ? 57.436  -106.173 -0.018  1.00 44.78  ? 13  LYS A C    1 
ATOM   195   O  O    . LYS A  1 33  ? 56.867  -105.651 -0.981  1.00 40.76  ? 13  LYS A O    1 
ATOM   196   C  CB   . LYS A  1 33  ? 56.237  -108.352 0.300   1.00 45.89  ? 13  LYS A CB   1 
ATOM   197   C  CG   . LYS A  1 33  ? 55.530  -109.302 1.271   1.00 61.62  ? 13  LYS A CG   1 
ATOM   198   C  CD   . LYS A  1 33  ? 55.200  -110.613 0.595   1.00 78.55  ? 13  LYS A CD   1 
ATOM   199   C  CE   . LYS A  1 33  ? 54.675  -111.659 1.550   1.00 94.40  ? 13  LYS A CE   1 
ATOM   200   N  NZ   . LYS A  1 33  ? 54.162  -112.856 0.824   1.00 108.05 ? 13  LYS A NZ   1 
ATOM   201   H  H    . LYS A  1 33  ? 54.683  -106.351 0.698   1.00 45.60  ? 13  LYS A H    1 
ATOM   202   H  HA   . LYS A  1 33  ? 57.258  -107.260 1.812   1.00 42.04  ? 13  LYS A HA   1 
ATOM   203   H  HB2  . LYS A  1 33  ? 55.553  -108.157 -0.524  1.00 44.91  ? 13  LYS A HB2  1 
ATOM   204   H  HB3  . LYS A  1 33  ? 57.135  -108.849 -0.062  1.00 45.90  ? 13  LYS A HB3  1 
ATOM   205   H  HG2  . LYS A  1 33  ? 56.181  -109.504 2.120   1.00 61.45  ? 13  LYS A HG2  1 
ATOM   206   H  HG3  . LYS A  1 33  ? 54.600  -108.848 1.612   1.00 61.57  ? 13  LYS A HG3  1 
ATOM   207   H  HD2  . LYS A  1 33  ? 54.429  -110.438 -0.152  1.00 78.37  ? 13  LYS A HD2  1 
ATOM   208   H  HD3  . LYS A  1 33  ? 56.102  -111.004 0.126   1.00 78.14  ? 13  LYS A HD3  1 
ATOM   209   H  HE2  . LYS A  1 33  ? 55.482  -111.979 2.207   1.00 94.62  ? 13  LYS A HE2  1 
ATOM   210   H  HE3  . LYS A  1 33  ? 53.857  -111.240 2.134   1.00 94.31  ? 13  LYS A HE3  1 
ATOM   211   H  HZ1  . LYS A  1 33  ? 53.882  -113.570 1.489   1.00 108.75 ? 13  LYS A HZ1  1 
ATOM   212   H  HZ2  . LYS A  1 33  ? 53.358  -112.602 0.259   1.00 107.83 ? 13  LYS A HZ2  1 
ATOM   213   H  HZ3  . LYS A  1 33  ? 54.885  -113.234 0.220   1.00 107.93 ? 13  LYS A HZ3  1 
ATOM   214   N  N    . GLU A  1 34  ? 58.757  -106.045 0.230   1.00 41.21  ? 14  GLU A N    1 
ATOM   215   C  CA   . GLU A  1 34  ? 59.664  -105.272 -0.616  1.00 40.17  ? 14  GLU A CA   1 
ATOM   216   C  C    . GLU A  1 34  ? 59.668  -105.797 -2.066  1.00 41.94  ? 14  GLU A C    1 
ATOM   217   O  O    . GLU A  1 34  ? 59.694  -105.006 -3.001  1.00 38.73  ? 14  GLU A O    1 
ATOM   218   C  CB   . GLU A  1 34  ? 61.096  -105.317 -0.072  1.00 41.17  ? 14  GLU A CB   1 
ATOM   219   C  CG   . GLU A  1 34  ? 62.016  -104.324 -0.745  1.00 41.27  ? 14  GLU A CG   1 
ATOM   220   C  CD   . GLU A  1 34  ? 63.414  -104.323 -0.182  1.00 45.62  ? 14  GLU A CD   1 
ATOM   221   O  OE1  . GLU A  1 34  ? 63.683  -103.499 0.713   1.00 43.26  ? 14  GLU A OE1  1 
ATOM   222   O  OE2  . GLU A  1 34  ? 64.238  -105.160 -0.613  1.00 54.80  ? 14  GLU A OE2  1 
ATOM   223   H  H    . GLU A  1 34  ? 59.217  -106.494 1.016   1.00 42.07  ? 14  GLU A H    1 
ATOM   224   H  HA   . GLU A  1 34  ? 59.341  -104.232 -0.633  1.00 38.74  ? 14  GLU A HA   1 
ATOM   225   H  HB2  . GLU A  1 34  ? 61.081  -105.110 0.996   1.00 42.21  ? 14  GLU A HB2  1 
ATOM   226   H  HB3  . GLU A  1 34  ? 61.505  -106.313 -0.241  1.00 40.41  ? 14  GLU A HB3  1 
ATOM   227   H  HG2  . GLU A  1 34  ? 62.109  -104.567 -1.804  1.00 40.63  ? 14  GLU A HG2  1 
ATOM   228   H  HG3  . GLU A  1 34  ? 61.600  -103.324 -0.634  1.00 40.94  ? 14  GLU A HG3  1 
ATOM   229   N  N    . SER A  1 35  ? 59.654  -107.101 -2.236  1.00 37.14  ? 15  SER A N    1 
ATOM   230   C  CA   . SER A  1 35  ? 59.662  -107.697 -3.585  1.00 38.56  ? 15  SER A CA   1 
ATOM   231   C  C    . SER A  1 35  ? 58.391  -107.326 -4.369  1.00 42.07  ? 15  SER A C    1 
ATOM   232   O  O    . SER A  1 35  ? 58.464  -107.178 -5.594  1.00 37.59  ? 15  SER A O    1 
ATOM   233   C  CB   . SER A  1 35  ? 59.796  -109.214 -3.486  1.00 43.88  ? 15  SER A CB   1 
ATOM   234   O  OG   . SER A  1 35  ? 58.782  -109.727 -2.641  1.00 42.81  ? 15  SER A OG   1 
ATOM   235   H  H    . SER A  1 35  ? 59.666  -107.781 -1.484  1.00 36.39  ? 15  SER A H    1 
ATOM   236   H  HA   . SER A  1 35  ? 60.515  -107.316 -4.144  1.00 38.30  ? 15  SER A HA   1 
ATOM   237   H  HB2  . SER A  1 35  ? 59.690  -109.648 -4.480  1.00 44.61  ? 15  SER A HB2  1 
ATOM   238   H  HB3  . SER A  1 35  ? 60.771  -109.464 -3.069  1.00 43.79  ? 15  SER A HB3  1 
ATOM   239   H  HG   . SER A  1 35  ? 59.183  -110.058 -1.796  1.00 44.20  ? 15  SER A HG   1 
ATOM   240   N  N    . GLU A  1 36  ? 57.241  -107.173 -3.661  1.00 41.17  ? 16  GLU A N    1 
ATOM   241   C  CA   . GLU A  1 36  ? 55.976  -106.757 -4.286  1.00 41.89  ? 16  GLU A CA   1 
ATOM   242   C  C    . GLU A  1 36  ? 56.002  -105.248 -4.574  1.00 43.24  ? 16  GLU A C    1 
ATOM   243   O  O    . GLU A  1 36  ? 55.501  -104.793 -5.610  1.00 39.55  ? 16  GLU A O    1 
ATOM   244   C  CB   . GLU A  1 36  ? 54.765  -107.099 -3.404  1.00 44.13  ? 16  GLU A CB   1 
ATOM   245   C  CG   . GLU A  1 36  ? 54.580  -108.593 -3.177  1.00 53.27  ? 16  GLU A CG   1 
ATOM   246   C  CD   . GLU A  1 36  ? 53.377  -108.983 -2.336  1.00 84.05  ? 16  GLU A CD   1 
ATOM   247   O  OE1  . GLU A  1 36  ? 52.815  -108.108 -1.638  1.00 85.30  ? 16  GLU A OE1  1 
ATOM   248   O  OE2  . GLU A  1 36  ? 53.020  -110.183 -2.350  1.00 78.47  ? 16  GLU A OE2  1 
ATOM   249   H  H    . GLU A  1 36  ? 57.157  -107.354 -2.666  1.00 40.86  ? 16  GLU A H    1 
ATOM   250   H  HA   . GLU A  1 36  ? 55.853  -107.289 -5.229  1.00 41.39  ? 16  GLU A HA   1 
ATOM   251   H  HB2  . GLU A  1 36  ? 54.890  -106.613 -2.437  1.00 44.73  ? 16  GLU A HB2  1 
ATOM   252   H  HB3  . GLU A  1 36  ? 53.865  -106.724 -3.890  1.00 43.52  ? 16  GLU A HB3  1 
ATOM   253   H  HG2  . GLU A  1 36  ? 54.466  -109.073 -4.148  1.00 52.98  ? 16  GLU A HG2  1 
ATOM   254   H  HG3  . GLU A  1 36  ? 55.465  -108.984 -2.679  1.00 52.92  ? 16  GLU A HG3  1 
ATOM   255   N  N    . LEU A  1 37  ? 56.581  -104.461 -3.658  1.00 38.55  ? 17  LEU A N    1 
ATOM   256   C  CA   . LEU A  1 37  ? 56.703  -103.005 -3.876  1.00 37.41  ? 17  LEU A CA   1 
ATOM   257   C  C    . LEU A  1 37  ? 57.598  -102.729 -5.104  1.00 39.93  ? 17  LEU A C    1 
ATOM   258   O  O    . LEU A  1 37  ? 57.312  -101.816 -5.887  1.00 39.21  ? 17  LEU A O    1 
ATOM   259   C  CB   . LEU A  1 37  ? 57.263  -102.296 -2.620  1.00 36.99  ? 17  LEU A CB   1 
ATOM   260   C  CG   . LEU A  1 37  ? 56.316  -102.238 -1.393  1.00 39.65  ? 17  LEU A CG   1 
ATOM   261   C  CD1  . LEU A  1 37  ? 57.078  -101.865 -0.148  1.00 41.07  ? 17  LEU A CD1  1 
ATOM   262   C  CD2  . LEU A  1 37  ? 55.186  -101.256 -1.613  1.00 34.66  ? 17  LEU A CD2  1 
ATOM   263   H  H    . LEU A  1 37  ? 56.955  -104.783 -2.773  1.00 38.49  ? 17  LEU A H    1 
ATOM   264   H  HA   . LEU A  1 37  ? 55.717  -102.602 -4.100  1.00 37.06  ? 17  LEU A HA   1 
ATOM   265   H  HB2  . LEU A  1 37  ? 58.174  -102.803 -2.307  1.00 36.29  ? 17  LEU A HB2  1 
ATOM   266   H  HB3  . LEU A  1 37  ? 57.488  -101.267 -2.892  1.00 36.14  ? 17  LEU A HB3  1 
ATOM   267   H  HG   . LEU A  1 37  ? 55.871  -103.220 -1.239  1.00 38.16  ? 17  LEU A HG   1 
ATOM   268   H  HD11 . LEU A  1 37  ? 56.373  -101.690 0.664   1.00 40.76  ? 17  LEU A HD11 1 
ATOM   269   H  HD12 . LEU A  1 37  ? 57.749  -102.680 0.120   1.00 41.40  ? 17  LEU A HD12 1 
ATOM   270   H  HD13 . LEU A  1 37  ? 57.657  -100.964 -0.345  1.00 40.28  ? 17  LEU A HD13 1 
ATOM   271   H  HD21 . LEU A  1 37  ? 54.523  -101.282 -0.750  1.00 34.48  ? 17  LEU A HD21 1 
ATOM   272   H  HD22 . LEU A  1 37  ? 55.608  -100.260 -1.737  1.00 35.18  ? 17  LEU A HD22 1 
ATOM   273   H  HD23 . LEU A  1 37  ? 54.621  -101.524 -2.503  1.00 35.14  ? 17  LEU A HD23 1 
ATOM   274   N  N    . ILE A  1 38  ? 58.672  -103.527 -5.276  1.00 37.14  ? 18  ILE A N    1 
ATOM   275   C  CA   . ILE A  1 38  ? 59.564  -103.404 -6.444  1.00 38.43  ? 18  ILE A CA   1 
ATOM   276   C  C    . ILE A  1 38  ? 58.794  -103.850 -7.699  1.00 42.08  ? 18  ILE A C    1 
ATOM   277   O  O    . ILE A  1 38  ? 58.715  -103.090 -8.655  1.00 42.22  ? 18  ILE A O    1 
ATOM   278   C  CB   . ILE A  1 38  ? 60.879  -104.219 -6.257  1.00 41.19  ? 18  ILE A CB   1 
ATOM   279   C  CG1  . ILE A  1 38  ? 61.766  -103.561 -5.181  1.00 41.66  ? 18  ILE A CG1  1 
ATOM   280   C  CG2  . ILE A  1 38  ? 61.630  -104.346 -7.595  1.00 40.62  ? 18  ILE A CG2  1 
ATOM   281   C  CD1  . ILE A  1 38  ? 62.724  -104.416 -4.566  1.00 43.12  ? 18  ILE A CD1  1 
ATOM   282   H  H    . ILE A  1 38  ? 58.960  -104.245 -4.619  1.00 38.08  ? 18  ILE A H    1 
ATOM   283   H  HA   . ILE A  1 38  ? 59.831  -102.355 -6.576  1.00 37.86  ? 18  ILE A HA   1 
ATOM   284   H  HB   . ILE A  1 38  ? 60.618  -105.219 -5.913  1.00 41.49  ? 18  ILE A HB   1 
ATOM   285   H  HG12 . ILE A  1 38  ? 62.307  -102.739 -5.648  1.00 41.98  ? 18  ILE A HG12 1 
ATOM   286   H  HG13 . ILE A  1 38  ? 61.131  -103.178 -4.384  1.00 40.73  ? 18  ILE A HG13 1 
ATOM   287   H  HG21 . ILE A  1 38  ? 62.664  -104.629 -7.416  1.00 41.19  ? 18  ILE A HG21 1 
ATOM   288   H  HG22 . ILE A  1 38  ? 61.156  -105.112 -8.207  1.00 39.88  ? 18  ILE A HG22 1 
ATOM   289   H  HG23 . ILE A  1 38  ? 61.600  -103.393 -8.121  1.00 41.90  ? 18  ILE A HG23 1 
ATOM   290   H  HD11 . ILE A  1 38  ? 63.240  -103.864 -3.782  1.00 43.10  ? 18  ILE A HD11 1 
ATOM   291   H  HD12 . ILE A  1 38  ? 62.210  -105.269 -4.126  1.00 44.33  ? 18  ILE A HD12 1 
ATOM   292   H  HD13 . ILE A  1 38  ? 63.444  -104.755 -5.309  1.00 42.57  ? 18  ILE A HD13 1 
ATOM   293   N  N    . ALA A  1 39  ? 58.217  -105.066 -7.667  1.00 37.78  ? 19  ALA A N    1 
ATOM   294   C  CA   . ALA A  1 39  ? 57.483  -105.616 -8.805  1.00 38.10  ? 19  ALA A CA   1 
ATOM   295   C  C    . ALA A  1 39  ? 56.353  -104.675 -9.281  1.00 42.95  ? 19  ALA A C    1 
ATOM   296   O  O    . ALA A  1 39  ? 56.158  -104.534 -10.485 1.00 42.84  ? 19  ALA A O    1 
ATOM   297   C  CB   . ALA A  1 39  ? 56.921  -106.979 -8.460  1.00 38.31  ? 19  ALA A CB   1 
ATOM   298   H  H    . ALA A  1 39  ? 58.230  -105.669 -6.850  1.00 37.82  ? 19  ALA A H    1 
ATOM   299   H  HA   . ALA A  1 39  ? 58.175  -105.741 -9.637  1.00 39.30  ? 19  ALA A HA   1 
ATOM   300   H  HB1  . ALA A  1 39  ? 56.375  -107.369 -9.319  1.00 38.74  ? 19  ALA A HB1  1 
ATOM   301   H  HB2  . ALA A  1 39  ? 57.748  -107.644 -8.217  1.00 38.39  ? 19  ALA A HB2  1 
ATOM   302   H  HB3  . ALA A  1 39  ? 56.254  -106.879 -7.607  1.00 38.09  ? 19  ALA A HB3  1 
ATOM   303   N  N    . GLY A  1 40  ? 55.673  -104.014 -8.341  1.00 39.50  ? 20  GLY A N    1 
ATOM   304   C  CA   . GLY A  1 40  ? 54.604  -103.072 -8.642  1.00 38.94  ? 20  GLY A CA   1 
ATOM   305   C  C    . GLY A  1 40  ? 55.019  -101.884 -9.496  1.00 41.17  ? 20  GLY A C    1 
ATOM   306   O  O    . GLY A  1 40  ? 54.200  -101.370 -10.253 1.00 39.58  ? 20  GLY A O    1 
ATOM   307   H  H    . GLY A  1 40  ? 55.834  -104.118 -7.345  1.00 40.31  ? 20  GLY A H    1 
ATOM   308   H  HA2  . GLY A  1 40  ? 53.807  -103.598 -9.166  1.00 39.32  ? 20  GLY A HA2  1 
ATOM   309   H  HA3  . GLY A  1 40  ? 54.193  -102.694 -7.707  1.00 39.05  ? 20  GLY A HA3  1 
ATOM   310   N  N    . GLY A  1 41  ? 56.263  -101.419 -9.331  1.00 38.38  ? 21  GLY A N    1 
ATOM   311   C  CA   . GLY A  1 41  ? 56.798  -100.272 -10.061 1.00 38.83  ? 21  GLY A CA   1 
ATOM   312   C  C    . GLY A  1 41  ? 56.149  -98.931  -9.783  1.00 41.72  ? 21  GLY A C    1 
ATOM   313   O  O    . GLY A  1 41  ? 56.285  -98.019  -10.599 1.00 40.19  ? 21  GLY A O    1 
ATOM   314   H  H    . GLY A  1 41  ? 56.930  -101.799 -8.667  1.00 37.90  ? 21  GLY A H    1 
ATOM   315   H  HA2  . GLY A  1 41  ? 57.860  -100.185 -9.843  1.00 38.45  ? 21  GLY A HA2  1 
ATOM   316   H  HA3  . GLY A  1 41  ? 56.686  -100.471 -11.127 1.00 39.73  ? 21  GLY A HA3  1 
ATOM   317   N  N    . ARG A  1 42  ? 55.446  -98.785  -8.624  1.00 38.89  ? 22  ARG A N    1 
ATOM   318   C  CA   . ARG A  1 42  ? 54.707  -97.566  -8.274  1.00 37.94  ? 22  ARG A CA   1 
ATOM   319   C  C    . ARG A  1 42  ? 55.328  -96.827  -7.085  1.00 38.16  ? 22  ARG A C    1 
ATOM   320   O  O    . ARG A  1 42  ? 54.743  -95.841  -6.643  1.00 38.16  ? 22  ARG A O    1 
ATOM   321   C  CB   . ARG A  1 42  ? 53.237  -97.935  -7.919  1.00 43.01  ? 22  ARG A CB   1 
ATOM   322   C  CG   . ARG A  1 42  ? 52.411  -98.585  -9.032  1.00 56.88  ? 22  ARG A CG   1 
ATOM   323   C  CD   . ARG A  1 42  ? 52.426  -97.834  -10.353 1.00 74.13  ? 22  ARG A CD   1 
ATOM   324   N  NE   . ARG A  1 42  ? 51.956  -96.449  -10.214 1.00 89.40  ? 22  ARG A NE   1 
ATOM   325   C  CZ   . ARG A  1 42  ? 52.098  -95.494  -11.138 1.00 98.93  ? 22  ARG A CZ   1 
ATOM   326   N  NH1  . ARG A  1 42  ? 52.720  -95.751  -12.287 1.00 87.79  ? 22  ARG A NH1  1 
ATOM   327   N  NH2  . ARG A  1 42  ? 51.630  -94.273  -10.916 1.00 79.04  ? 22  ARG A NH2  1 
ATOM   328   H  H    . ARG A  1 42  ? 55.377  -99.494  -7.903  1.00 37.71  ? 22  ARG A H    1 
ATOM   329   H  HA   . ARG A  1 42  ? 54.689  -96.860  -9.102  1.00 36.54  ? 22  ARG A HA   1 
ATOM   330   H  HB2  . ARG A  1 42  ? 53.252  -98.639  -7.088  1.00 41.55  ? 22  ARG A HB2  1 
ATOM   331   H  HB3  . ARG A  1 42  ? 52.702  -97.033  -7.626  1.00 43.54  ? 22  ARG A HB3  1 
ATOM   332   H  HG2  . ARG A  1 42  ? 52.788  -99.591  -9.207  1.00 56.85  ? 22  ARG A HG2  1 
ATOM   333   H  HG3  . ARG A  1 42  ? 51.377  -98.639  -8.697  1.00 57.02  ? 22  ARG A HG3  1 
ATOM   334   H  HD2  . ARG A  1 42  ? 53.442  -97.837  -10.746 1.00 74.06  ? 22  ARG A HD2  1 
ATOM   335   H  HD3  . ARG A  1 42  ? 51.762  -98.343  -11.051 1.00 74.15  ? 22  ARG A HD3  1 
ATOM   336   H  HE   . ARG A  1 42  ? 51.458  -96.209  -9.363  1.00 89.22  ? 22  ARG A HE   1 
ATOM   337   H  HH11 . ARG A  1 42  ? 53.095  -96.665  -12.516 1.00 87.73  ? 22  ARG A HH11 1 
ATOM   338   H  HH12 . ARG A  1 42  ? 52.821  -95.007  -12.971 1.00 87.71  ? 22  ARG A HH12 1 
ATOM   339   H  HH21 . ARG A  1 42  ? 51.149  -94.061  -10.048 1.00 79.37  ? 22  ARG A HH21 1 
ATOM   340   H  HH22 . ARG A  1 42  ? 51.741  -93.546  -11.615 1.00 79.09  ? 22  ARG A HH22 1 
ATOM   341   N  N    . HIS A  1 43  ? 56.489  -97.275  -6.567  1.00 32.60  ? 23  HIS A N    1 
ATOM   342   C  CA   . HIS A  1 43  ? 57.113  -96.660  -5.402  1.00 31.22  ? 23  HIS A CA   1 
ATOM   343   C  C    . HIS A  1 43  ? 58.610  -96.481  -5.500  1.00 36.20  ? 23  HIS A C    1 
ATOM   344   O  O    . HIS A  1 43  ? 59.340  -97.411  -5.862  1.00 36.72  ? 23  HIS A O    1 
ATOM   345   C  CB   . HIS A  1 43  ? 56.882  -97.512  -4.121  1.00 31.84  ? 23  HIS A CB   1 
ATOM   346   C  CG   . HIS A  1 43  ? 55.456  -97.626  -3.692  1.00 34.24  ? 23  HIS A CG   1 
ATOM   347   N  ND1  . HIS A  1 43  ? 54.588  -98.530  -4.279  1.00 34.27  ? 23  HIS A ND1  1 
ATOM   348   C  CD2  . HIS A  1 43  ? 54.796  -96.953  -2.730  1.00 34.58  ? 23  HIS A CD2  1 
ATOM   349   C  CE1  . HIS A  1 43  ? 53.421  -98.359  -3.675  1.00 31.85  ? 23  HIS A CE1  1 
ATOM   350   N  NE2  . HIS A  1 43  ? 53.505  -97.452  -2.719  1.00 33.22  ? 23  HIS A NE2  1 
ATOM   351   H  H    . HIS A  1 43  ? 57.011  -98.073  -6.920  1.00 33.95  ? 23  HIS A H    1 
ATOM   352   H  HA   . HIS A  1 43  ? 56.660  -95.689  -5.223  1.00 31.03  ? 23  HIS A HA   1 
ATOM   353   H  HB2  . HIS A  1 43  ? 57.247  -98.523  -4.301  1.00 33.92  ? 23  HIS A HB2  1 
ATOM   354   H  HB3  . HIS A  1 43  ? 57.429  -97.065  -3.293  1.00 29.59  ? 23  HIS A HB3  1 
ATOM   355   H  HD2  . HIS A  1 43  ? 55.199  -96.146  -2.120  1.00 35.22  ? 23  HIS A HD2  1 
ATOM   356   H  HE1  . HIS A  1 43  ? 52.516  -98.912  -3.920  1.00 30.50  ? 23  HIS A HE1  1 
ATOM   357   H  HE2  . HIS A  1 43  ? 52.755  -97.156  -2.103  1.00 33.85  ? 23  HIS A HE2  1 
ATOM   358   N  N    . VAL A  1 44  ? 59.078  -95.343  -5.014  1.00 33.15  ? 24  VAL A N    1 
ATOM   359   C  CA   . VAL A  1 44  ? 60.491  -95.096  -4.789  1.00 33.37  ? 24  VAL A CA   1 
ATOM   360   C  C    . VAL A  1 44  ? 60.755  -95.660  -3.384  1.00 37.85  ? 24  VAL A C    1 
ATOM   361   O  O    . VAL A  1 44  ? 59.946  -95.437  -2.485  1.00 36.13  ? 24  VAL A O    1 
ATOM   362   C  CB   . VAL A  1 44  ? 60.868  -93.605  -4.923  1.00 35.52  ? 24  VAL A CB   1 
ATOM   363   C  CG1  . VAL A  1 44  ? 62.207  -93.295  -4.248  1.00 34.12  ? 24  VAL A CG1  1 
ATOM   364   C  CG2  . VAL A  1 44  ? 60.893  -93.182  -6.380  1.00 36.47  ? 24  VAL A CG2  1 
ATOM   365   H  H    . VAL A  1 44  ? 58.493  -94.550  -4.769  1.00 34.54  ? 24  VAL A H    1 
ATOM   366   H  HA   . VAL A  1 44  ? 61.083  -95.656  -5.509  1.00 34.14  ? 24  VAL A HA   1 
ATOM   367   H  HB   . VAL A  1 44  ? 60.113  -93.002  -4.421  1.00 35.28  ? 24  VAL A HB   1 
ATOM   368   H  HG11 . VAL A  1 44  ? 62.585  -92.362  -4.661  1.00 33.61  ? 24  VAL A HG11 1 
ATOM   369   H  HG12 . VAL A  1 44  ? 62.056  -93.178  -3.176  1.00 34.39  ? 24  VAL A HG12 1 
ATOM   370   H  HG13 . VAL A  1 44  ? 62.917  -94.097  -4.438  1.00 34.94  ? 24  VAL A HG13 1 
ATOM   371   H  HG21 . VAL A  1 44  ? 60.613  -92.131  -6.449  1.00 38.04  ? 24  VAL A HG21 1 
ATOM   372   H  HG22 . VAL A  1 44  ? 61.902  -93.312  -6.767  1.00 36.81  ? 24  VAL A HG22 1 
ATOM   373   H  HG23 . VAL A  1 44  ? 60.197  -93.793  -6.950  1.00 36.82  ? 24  VAL A HG23 1 
ATOM   374   N  N    . LEU A  1 45  ? 61.847  -96.409  -3.206  1.00 36.60  ? 25  LEU A N    1 
ATOM   375   C  CA   . LEU A  1 45  ? 62.193  -96.972  -1.885  1.00 35.89  ? 25  LEU A CA   1 
ATOM   376   C  C    . LEU A  1 45  ? 63.483  -96.338  -1.391  1.00 38.27  ? 25  LEU A C    1 
ATOM   377   O  O    . LEU A  1 45  ? 64.398  -96.141  -2.202  1.00 32.67  ? 25  LEU A O    1 
ATOM   378   C  CB   . LEU A  1 45  ? 62.360  -98.470  -1.940  1.00 34.90  ? 25  LEU A CB   1 
ATOM   379   C  CG   . LEU A  1 45  ? 61.285  -99.273  -2.647  1.00 37.92  ? 25  LEU A CG   1 
ATOM   380   C  CD1  . LEU A  1 45  ? 61.641  -100.721 -2.670  1.00 35.25  ? 25  LEU A CD1  1 
ATOM   381   C  CD2  . LEU A  1 45  ? 59.937  -99.074  -2.000  1.00 40.73  ? 25  LEU A CD2  1 
ATOM   382   H  H    . LEU A  1 45  ? 62.501  -96.652  -3.942  1.00 34.77  ? 25  LEU A H    1 
ATOM   383   H  HA   . LEU A  1 45  ? 61.411  -96.770  -1.155  1.00 36.03  ? 25  LEU A HA   1 
ATOM   384   H  HB2  . LEU A  1 45  ? 63.317  -98.691  -2.409  1.00 34.16  ? 25  LEU A HB2  1 
ATOM   385   H  HB3  . LEU A  1 45  ? 62.390  -98.828  -0.911  1.00 37.43  ? 25  LEU A HB3  1 
ATOM   386   H  HG   . LEU A  1 45  ? 61.215  -98.926  -3.676  1.00 37.89  ? 25  LEU A HG   1 
ATOM   387   H  HD11 . LEU A  1 45  ? 60.856  -101.270 -3.184  1.00 35.14  ? 25  LEU A HD11 1 
ATOM   388   H  HD12 . LEU A  1 45  ? 62.582  -100.833 -3.209  1.00 35.24  ? 25  LEU A HD12 1 
ATOM   389   H  HD13 . LEU A  1 45  ? 61.747  -101.090 -1.651  1.00 34.17  ? 25  LEU A HD13 1 
ATOM   390   H  HD21 . LEU A  1 45  ? 59.258  -99.861  -2.321  1.00 40.74  ? 25  LEU A HD21 1 
ATOM   391   H  HD22 . LEU A  1 45  ? 60.045  -99.105  -0.916  1.00 41.71  ? 25  LEU A HD22 1 
ATOM   392   H  HD23 . LEU A  1 45  ? 59.542  -98.106  -2.305  1.00 40.05  ? 25  LEU A HD23 1 
ATOM   393   N  N    . CYS A  1 46  ? 63.528  -95.971  -0.092  1.00 36.70  ? 26  CYS A N    1 
ATOM   394   C  CA   . CYS A  1 46  ? 64.725  -95.410  0.548   1.00 36.35  ? 26  CYS A CA   1 
ATOM   395   C  C    . CYS A  1 46  ? 65.029  -96.204  1.800   1.00 40.18  ? 26  CYS A C    1 
ATOM   396   O  O    . CYS A  1 46  ? 64.117  -96.578  2.531   1.00 40.38  ? 26  CYS A O    1 
ATOM   397   C  CB   . CYS A  1 46  ? 64.574  -93.931  0.865   1.00 35.62  ? 26  CYS A CB   1 
ATOM   398   S  SG   . CYS A  1 46  ? 64.226  -92.884  -0.569  1.00 38.17  ? 26  CYS A SG   1 
ATOM   399   H  H    . CYS A  1 46  ? 62.737  -96.037  0.541   1.00 36.34  ? 26  CYS A H    1 
ATOM   400   H  HA   . CYS A  1 46  ? 65.573  -95.501  -0.128  1.00 36.94  ? 26  CYS A HA   1 
ATOM   401   H  HB2  . CYS A  1 46  ? 63.757  -93.822  1.574   1.00 37.12  ? 26  CYS A HB2  1 
ATOM   402   H  HB3  . CYS A  1 46  ? 65.499  -93.578  1.319   1.00 35.51  ? 26  CYS A HB3  1 
ATOM   403   H  HG   . CYS A  1 46  ? 63.336  -91.963  -0.189  1.00 39.11  ? 26  CYS A HG   1 
ATOM   404   N  N    . ALA A  1 47  ? 66.310  -96.467  2.023   1.00 34.38  ? 27  ALA A N    1 
ATOM   405   C  CA   . ALA A  1 47  ? 66.810  -97.188  3.167   1.00 33.17  ? 27  ALA A CA   1 
ATOM   406   C  C    . ALA A  1 47  ? 67.658  -96.218  3.971   1.00 36.99  ? 27  ALA A C    1 
ATOM   407   O  O    . ALA A  1 47  ? 68.608  -95.657  3.441   1.00 34.07  ? 27  ALA A O    1 
ATOM   408   C  CB   . ALA A  1 47  ? 67.625  -98.405  2.723   1.00 33.20  ? 27  ALA A CB   1 
ATOM   409   H  H    . ALA A  1 47  ? 67.055  -96.155  1.408   1.00 34.79  ? 27  ALA A H    1 
ATOM   410   H  HA   . ALA A  1 47  ? 65.989  -97.548  3.785   1.00 33.04  ? 27  ALA A HA   1 
ATOM   411   H  HB1  . ALA A  1 47  ? 68.175  -98.801  3.575   1.00 33.01  ? 27  ALA A HB1  1 
ATOM   412   H  HB2  . ALA A  1 47  ? 66.944  -99.164  2.343   1.00 32.24  ? 27  ALA A HB2  1 
ATOM   413   H  HB3  . ALA A  1 47  ? 68.328  -98.108  1.947   1.00 33.41  ? 27  ALA A HB3  1 
ATOM   414   N  N    . TYR A  1 48  ? 67.289  -96.008  5.235   1.00 36.67  ? 28  TYR A N    1 
ATOM   415   C  CA   . TYR A  1 48  ? 67.988  -95.105  6.157   1.00 35.34  ? 28  TYR A CA   1 
ATOM   416   C  C    . TYR A  1 48  ? 68.467  -95.788  7.408   1.00 37.55  ? 28  TYR A C    1 
ATOM   417   O  O    . TYR A  1 48  ? 67.838  -96.726  7.898   1.00 37.90  ? 28  TYR A O    1 
ATOM   418   C  CB   . TYR A  1 48  ? 67.072  -93.976  6.614   1.00 34.73  ? 28  TYR A CB   1 
ATOM   419   C  CG   . TYR A  1 48  ? 66.291  -93.260  5.549   1.00 31.43  ? 28  TYR A CG   1 
ATOM   420   C  CD1  . TYR A  1 48  ? 65.115  -93.803  5.043   1.00 31.32  ? 28  TYR A CD1  1 
ATOM   421   C  CD2  . TYR A  1 48  ? 66.619  -91.968  5.174   1.00 33.18  ? 28  TYR A CD2  1 
ATOM   422   C  CE1  . TYR A  1 48  ? 64.284  -93.083  4.204   1.00 30.50  ? 28  TYR A CE1  1 
ATOM   423   C  CE2  . TYR A  1 48  ? 65.850  -91.267  4.243   1.00 34.06  ? 28  TYR A CE2  1 
ATOM   424   C  CZ   . TYR A  1 48  ? 64.666  -91.823  3.774   1.00 38.53  ? 28  TYR A CZ   1 
ATOM   425   O  OH   . TYR A  1 48  ? 63.895  -91.185  2.839   1.00 32.73  ? 28  TYR A OH   1 
ATOM   426   H  H    . TYR A  1 48  ? 66.483  -96.448  5.668   1.00 38.26  ? 28  TYR A H    1 
ATOM   427   H  HA   . TYR A  1 48  ? 68.844  -94.659  5.656   1.00 35.19  ? 28  TYR A HA   1 
ATOM   428   H  HB2  . TYR A  1 48  ? 66.346  -94.389  7.312   1.00 35.22  ? 28  TYR A HB2  1 
ATOM   429   H  HB3  . TYR A  1 48  ? 67.687  -93.235  7.122   1.00 37.36  ? 28  TYR A HB3  1 
ATOM   430   H  HD1  . TYR A  1 48  ? 64.780  -94.769  5.416   1.00 33.32  ? 28  TYR A HD1  1 
ATOM   431   H  HD2  . TYR A  1 48  ? 67.547  -91.531  5.540   1.00 33.78  ? 28  TYR A HD2  1 
ATOM   432   H  HE1  . TYR A  1 48  ? 63.388  -93.552  3.801   1.00 29.69  ? 28  TYR A HE1  1 
ATOM   433   H  HE2  . TYR A  1 48  ? 66.165  -90.277  3.920   1.00 33.01  ? 28  TYR A HE2  1 
ATOM   434   H  HH   . TYR A  1 48  ? 63.871  -90.208  3.015   1.00 32.83  ? 28  TYR A HH   1 
ATOM   435   N  N    . ILE A  1 49  ? 69.561  -95.270  7.957   1.00 34.51  ? 29  ILE A N    1 
ATOM   436   C  CA   . ILE A  1 49  ? 70.088  -95.632  9.267   1.00 33.81  ? 29  ILE A CA   1 
ATOM   437   C  C    . ILE A  1 49  ? 69.647  -94.475  10.175  1.00 39.25  ? 29  ILE A C    1 
ATOM   438   O  O    . ILE A  1 49  ? 70.147  -93.348  10.018  1.00 36.54  ? 29  ILE A O    1 
ATOM   439   C  CB   . ILE A  1 49  ? 71.607  -95.889  9.263   1.00 36.30  ? 29  ILE A CB   1 
ATOM   440   C  CG1  . ILE A  1 49  ? 71.954  -97.106  8.386   1.00 37.41  ? 29  ILE A CG1  1 
ATOM   441   C  CG2  . ILE A  1 49  ? 72.131  -96.064  10.691  1.00 36.70  ? 29  ILE A CG2  1 
ATOM   442   C  CD1  . ILE A  1 49  ? 71.327  -98.457  8.802   1.00 49.41  ? 29  ILE A CD1  1 
ATOM   443   H  H    . ILE A  1 49  ? 70.124  -94.565  7.492   1.00 34.32  ? 29  ILE A H    1 
ATOM   444   H  HA   . ILE A  1 49  ? 69.608  -96.540  9.620   1.00 35.24  ? 29  ILE A HA   1 
ATOM   445   H  HB   . ILE A  1 49  ? 72.093  -95.016  8.832   1.00 36.56  ? 29  ILE A HB   1 
ATOM   446   H  HG12 . ILE A  1 49  ? 71.636  -96.898  7.365   1.00 38.50  ? 29  ILE A HG12 1 
ATOM   447   H  HG13 . ILE A  1 49  ? 73.034  -97.242  8.393   1.00 38.71  ? 29  ILE A HG13 1 
ATOM   448   H  HG21 . ILE A  1 49  ? 73.098  -96.561  10.648  1.00 36.80  ? 29  ILE A HG21 1 
ATOM   449   H  HG22 . ILE A  1 49  ? 72.244  -95.095  11.173  1.00 37.08  ? 29  ILE A HG22 1 
ATOM   450   H  HG23 . ILE A  1 49  ? 71.421  -96.664  11.258  1.00 36.57  ? 29  ILE A HG23 1 
ATOM   451   H  HD11 . ILE A  1 49  ? 71.805  -99.250  8.227   1.00 48.60  ? 29  ILE A HD11 1 
ATOM   452   H  HD12 . ILE A  1 49  ? 71.462  -98.625  9.872   1.00 50.17  ? 29  ILE A HD12 1 
ATOM   453   H  HD13 . ILE A  1 49  ? 70.264  -98.442  8.569   1.00 49.71  ? 29  ILE A HD13 1 
ATOM   454   N  N    . MET A  1 50  ? 68.669  -94.737  11.072  1.00 37.39  ? 30  MET A N    1 
ATOM   455   C  CA   . MET A  1 50  ? 68.035  -93.731  11.922  1.00 37.07  ? 30  MET A CA   1 
ATOM   456   C  C    . MET A  1 50  ? 68.061  -94.108  13.407  1.00 43.76  ? 30  MET A C    1 
ATOM   457   O  O    . MET A  1 50  ? 68.004  -95.278  13.754  1.00 44.82  ? 30  MET A O    1 
ATOM   458   C  CB   . MET A  1 50  ? 66.575  -93.569  11.435  1.00 38.07  ? 30  MET A CB   1 
ATOM   459   C  CG   . MET A  1 50  ? 65.731  -92.509  12.182  1.00 39.34  ? 30  MET A CG   1 
ATOM   460   S  SD   . MET A  1 50  ? 64.926  -93.017  13.707  1.00 40.47  ? 30  MET A SD   1 
ATOM   461   C  CE   . MET A  1 50  ? 63.586  -94.028  13.115  1.00 38.47  ? 30  MET A CE   1 
ATOM   462   H  H    . MET A  1 50  ? 68.305  -95.666  11.250  1.00 37.55  ? 30  MET A H    1 
ATOM   463   H  HA   . MET A  1 50  ? 68.543  -92.778  11.798  1.00 37.22  ? 30  MET A HA   1 
ATOM   464   H  HB2  . MET A  1 50  ? 66.613  -93.278  10.387  1.00 36.90  ? 30  MET A HB2  1 
ATOM   465   H  HB3  . MET A  1 50  ? 66.067  -94.528  11.526  1.00 38.90  ? 30  MET A HB3  1 
ATOM   466   H  HG2  . MET A  1 50  ? 66.371  -91.662  12.422  1.00 39.55  ? 30  MET A HG2  1 
ATOM   467   H  HG3  . MET A  1 50  ? 64.939  -92.181  11.511  1.00 38.72  ? 30  MET A HG3  1 
ATOM   468   H  HE1  . MET A  1 50  ? 63.020  -94.415  13.962  1.00 39.21  ? 30  MET A HE1  1 
ATOM   469   H  HE2  . MET A  1 50  ? 62.939  -93.423  12.484  1.00 37.42  ? 30  MET A HE2  1 
ATOM   470   H  HE3  . MET A  1 50  ? 63.997  -94.861  12.546  1.00 39.09  ? 30  MET A HE3  1 
ATOM   471   N  N    . LYS A  1 51  ? 68.140  -93.100  14.282  1.00 41.03  ? 31  LYS A N    1 
ATOM   472   C  CA   . LYS A  1 51  ? 68.095  -93.276  15.722  1.00 42.26  ? 31  LYS A CA   1 
ATOM   473   C  C    . LYS A  1 51  ? 67.152  -92.251  16.328  1.00 45.60  ? 31  LYS A C    1 
ATOM   474   O  O    . LYS A  1 51  ? 67.400  -91.051  16.156  1.00 42.52  ? 31  LYS A O    1 
ATOM   475   C  CB   . LYS A  1 51  ? 69.486  -93.145  16.356  1.00 46.67  ? 31  LYS A CB   1 
ATOM   476   C  CG   . LYS A  1 51  ? 69.503  -93.510  17.837  1.00 51.88  ? 31  LYS A CG   1 
ATOM   477   C  CD   . LYS A  1 51  ? 70.860  -93.282  18.476  1.00 66.33  ? 31  LYS A CD   1 
ATOM   478   C  CE   . LYS A  1 51  ? 70.860  -93.625  19.944  1.00 90.27  ? 31  LYS A CE   1 
ATOM   479   N  NZ   . LYS A  1 51  ? 72.038  -93.045  20.642  1.00 96.91  ? 31  LYS A NZ   1 
ATOM   480   H  H    . LYS A  1 51  ? 68.252  -92.131  14.006  1.00 41.41  ? 31  LYS A H    1 
ATOM   481   H  HA   . LYS A  1 51  ? 67.757  -94.281  15.965  1.00 43.08  ? 31  LYS A HA   1 
ATOM   482   H  HB2  . LYS A  1 51  ? 70.166  -93.815  15.832  1.00 47.97  ? 31  LYS A HB2  1 
ATOM   483   H  HB3  . LYS A  1 51  ? 69.835  -92.118  16.254  1.00 48.00  ? 31  LYS A HB3  1 
ATOM   484   H  HG2  . LYS A  1 51  ? 68.783  -92.902  18.381  1.00 51.20  ? 31  LYS A HG2  1 
ATOM   485   H  HG3  . LYS A  1 51  ? 69.258  -94.567  17.941  1.00 52.07  ? 31  LYS A HG3  1 
ATOM   486   H  HD2  . LYS A  1 51  ? 71.596  -93.919  17.987  1.00 66.17  ? 31  LYS A HD2  1 
ATOM   487   H  HD3  . LYS A  1 51  ? 71.137  -92.233  18.376  1.00 65.85  ? 31  LYS A HD3  1 
ATOM   488   H  HE2  . LYS A  1 51  ? 69.957  -93.233  20.412  1.00 90.51  ? 31  LYS A HE2  1 
ATOM   489   H  HE3  . LYS A  1 51  ? 70.901  -94.709  20.049  1.00 90.73  ? 31  LYS A HE3  1 
ATOM   490   H  HZ1  . LYS A  1 51  ? 72.058  -93.362  21.605  1.00 97.56  ? 31  LYS A HZ1  1 
ATOM   491   H  HZ2  . LYS A  1 51  ? 72.895  -93.333  20.179  1.00 96.65  ? 31  LYS A HZ2  1 
ATOM   492   H  HZ3  . LYS A  1 51  ? 71.979  -92.032  20.630  1.00 96.69  ? 31  LYS A HZ3  1 
ATOM   493   N  N    . PRO A  1 52  ? 66.073  -92.679  17.034  1.00 42.79  ? 32  PRO A N    1 
ATOM   494   C  CA   . PRO A  1 52  ? 65.201  -91.700  17.698  1.00 42.59  ? 32  PRO A CA   1 
ATOM   495   C  C    . PRO A  1 52  ? 65.913  -90.991  18.851  1.00 44.84  ? 32  PRO A C    1 
ATOM   496   O  O    . PRO A  1 52  ? 66.782  -91.574  19.502  1.00 42.95  ? 32  PRO A O    1 
ATOM   497   C  CB   . PRO A  1 52  ? 64.045  -92.562  18.250  1.00 44.80  ? 32  PRO A CB   1 
ATOM   498   C  CG   . PRO A  1 52  ? 64.140  -93.851  17.566  1.00 49.50  ? 32  PRO A CG   1 
ATOM   499   C  CD   . PRO A  1 52  ? 65.608  -94.051  17.305  1.00 45.07  ? 32  PRO A CD   1 
ATOM   500   H  HA   . PRO A  1 52  ? 64.810  -90.982  16.980  1.00 43.10  ? 32  PRO A HA   1 
ATOM   501   H  HB2  . PRO A  1 52  ? 64.161  -92.704  19.324  1.00 44.21  ? 32  PRO A HB2  1 
ATOM   502   H  HB3  . PRO A  1 52  ? 63.092  -92.078  18.046  1.00 44.71  ? 32  PRO A HB3  1 
ATOM   503   H  HG2  . PRO A  1 52  ? 63.747  -94.636  18.211  1.00 50.53  ? 32  PRO A HG2  1 
ATOM   504   H  HG3  . PRO A  1 52  ? 63.587  -93.814  16.630  1.00 48.90  ? 32  PRO A HG3  1 
ATOM   505   H  HD2  . PRO A  1 52  ? 66.105  -94.463  18.181  1.00 45.42  ? 32  PRO A HD2  1 
ATOM   506   H  HD3  . PRO A  1 52  ? 65.724  -94.689  16.431  1.00 44.41  ? 32  PRO A HD3  1 
ATOM   507   N  N    . LYS A  1 53  ? 65.527  -89.743  19.127  1.00 44.59  ? 33  LYS A N    1 
ATOM   508   C  CA   . LYS A  1 53  ? 66.043  -89.040  20.305  1.00 46.14  ? 33  LYS A CA   1 
ATOM   509   C  C    . LYS A  1 53  ? 65.337  -89.617  21.506  1.00 49.82  ? 33  LYS A C    1 
ATOM   510   O  O    . LYS A  1 53  ? 64.165  -89.971  21.380  1.00 46.94  ? 33  LYS A O    1 
ATOM   511   C  CB   . LYS A  1 53  ? 65.778  -87.510  20.221  1.00 49.07  ? 33  LYS A CB   1 
ATOM   512   C  CG   . LYS A  1 53  ? 67.014  -86.651  20.005  1.00 40.29  ? 33  LYS A CG   1 
ATOM   513   C  CD   . LYS A  1 53  ? 66.590  -85.202  20.001  1.00 40.02  ? 33  LYS A CD   1 
ATOM   514   C  CE   . LYS A  1 53  ? 67.435  -84.280  19.185  1.00 47.90  ? 33  LYS A CE   1 
ATOM   515   N  NZ   . LYS A  1 53  ? 66.752  -82.967  19.070  1.00 66.02  ? 33  LYS A NZ   1 
ATOM   516   H  H    . LYS A  1 53  ? 64.868  -89.219  18.562  1.00 43.72  ? 33  LYS A H    1 
ATOM   517   H  HA   . LYS A  1 53  ? 67.113  -89.208  20.413  1.00 46.83  ? 33  LYS A HA   1 
ATOM   518   H  HB2  . LYS A  1 53  ? 65.107  -87.300  19.390  1.00 48.16  ? 33  LYS A HB2  1 
ATOM   519   H  HB3  . LYS A  1 53  ? 65.313  -87.173  21.147  1.00 48.09  ? 33  LYS A HB3  1 
ATOM   520   H  HG2  . LYS A  1 53  ? 67.734  -86.808  20.806  1.00 40.26  ? 33  LYS A HG2  1 
ATOM   521   H  HG3  . LYS A  1 53  ? 67.448  -86.898  19.039  1.00 40.00  ? 33  LYS A HG3  1 
ATOM   522   H  HD2  . LYS A  1 53  ? 65.588  -85.149  19.585  1.00 38.18  ? 33  LYS A HD2  1 
ATOM   523   H  HD3  . LYS A  1 53  ? 66.583  -84.830  21.026  1.00 40.49  ? 33  LYS A HD3  1 
ATOM   524   H  HE2  . LYS A  1 53  ? 68.403  -84.142  19.665  1.00 47.43  ? 33  LYS A HE2  1 
ATOM   525   H  HE3  . LYS A  1 53  ? 67.559  -84.686  18.182  1.00 46.22  ? 33  LYS A HE3  1 
ATOM   526   H  HZ1  . LYS A  1 53  ? 67.421  -82.255  18.798  1.00 65.93  ? 33  LYS A HZ1  1 
ATOM   527   H  HZ2  . LYS A  1 53  ? 66.021  -83.033  18.369  1.00 65.28  ? 33  LYS A HZ2  1 
ATOM   528   H  HZ3  . LYS A  1 53  ? 66.331  -82.700  19.955  1.00 66.73  ? 33  LYS A HZ3  1 
ATOM   529   N  N    . ALA A  1 54  ? 66.012  -89.705  22.662  1.00 50.88  ? 34  ALA A N    1 
ATOM   530   C  CA   . ALA A  1 54  ? 65.363  -90.184  23.885  1.00 53.61  ? 34  ALA A CA   1 
ATOM   531   C  C    . ALA A  1 54  ? 64.327  -89.154  24.340  1.00 58.54  ? 34  ALA A C    1 
ATOM   532   O  O    . ALA A  1 54  ? 64.531  -87.963  24.140  1.00 56.59  ? 34  ALA A O    1 
ATOM   533   C  CB   . ALA A  1 54  ? 66.394  -90.400  24.998  1.00 55.41  ? 34  ALA A CB   1 
ATOM   534   H  H    . ALA A  1 54  ? 66.984  -89.437  22.772  1.00 50.85  ? 34  ALA A H    1 
ATOM   535   H  HA   . ALA A  1 54  ? 64.890  -91.141  23.670  1.00 54.15  ? 34  ALA A HA   1 
ATOM   536   H  HB1  . ALA A  1 54  ? 65.911  -90.902  25.834  1.00 54.63  ? 34  ALA A HB1  1 
ATOM   537   H  HB2  . ALA A  1 54  ? 67.196  -91.020  24.595  1.00 56.98  ? 34  ALA A HB2  1 
ATOM   538   H  HB3  . ALA A  1 54  ? 66.783  -89.435  25.318  1.00 55.03  ? 34  ALA A HB3  1 
ATOM   539   N  N    . GLY A  1 55  ? 63.188  -89.586  24.835  1.00 57.99  ? 35  GLY A N    1 
ATOM   540   C  CA   . GLY A  1 55  ? 62.191  -88.633  25.323  1.00 58.76  ? 35  GLY A CA   1 
ATOM   541   C  C    . GLY A  1 55  ? 60.987  -88.422  24.439  1.00 61.81  ? 35  GLY A C    1 
ATOM   542   O  O    . GLY A  1 55  ? 60.200  -87.494  24.662  1.00 60.53  ? 35  GLY A O    1 
ATOM   543   H  H    . GLY A  1 55  ? 62.917  -90.561  24.900  1.00 58.72  ? 35  GLY A H    1 
ATOM   544   H  HA2  . GLY A  1 55  ? 61.868  -88.952  26.309  1.00 60.33  ? 35  GLY A HA2  1 
ATOM   545   H  HA3  . GLY A  1 55  ? 62.634  -87.648  25.471  1.00 58.86  ? 35  GLY A HA3  1 
ATOM   546   N  N    . PHE A  1 56  ? 60.892  -89.195  23.372  1.00 58.58  ? 36  PHE A N    1 
ATOM   547   C  CA   . PHE A  1 56  ? 59.784  -89.020  22.449  1.00 58.03  ? 36  PHE A CA   1 
ATOM   548   C  C    . PHE A  1 56  ? 59.127  -90.385  22.168  1.00 61.39  ? 36  PHE A C    1 
ATOM   549   O  O    . PHE A  1 56  ? 58.874  -91.106  23.127  1.00 63.16  ? 36  PHE A O    1 
ATOM   550   C  CB   . PHE A  1 56  ? 60.315  -88.316  21.168  1.00 58.84  ? 36  PHE A CB   1 
ATOM   551   C  CG   . PHE A  1 56  ? 60.958  -86.963  21.424  1.00 60.15  ? 36  PHE A CG   1 
ATOM   552   C  CD1  . PHE A  1 56  ? 62.294  -86.868  21.785  1.00 63.51  ? 36  PHE A CD1  1 
ATOM   553   C  CD2  . PHE A  1 56  ? 60.220  -85.793  21.321  1.00 61.99  ? 36  PHE A CD2  1 
ATOM   554   C  CE1  . PHE A  1 56  ? 62.879  -85.627  22.035  1.00 64.77  ? 36  PHE A CE1  1 
ATOM   555   C  CE2  . PHE A  1 56  ? 60.808  -84.553  21.554  1.00 65.20  ? 36  PHE A CE2  1 
ATOM   556   C  CZ   . PHE A  1 56  ? 62.130  -84.477  21.917  1.00 64.20  ? 36  PHE A CZ   1 
ATOM   557   H  H    . PHE A  1 56  ? 61.608  -89.830  23.030  1.00 58.80  ? 36  PHE A H    1 
ATOM   558   H  HA   . PHE A  1 56  ? 59.014  -88.385  22.884  1.00 57.01  ? 36  PHE A HA   1 
ATOM   559   H  HB2  . PHE A  1 56  ? 61.055  -88.954  20.684  1.00 58.87  ? 36  PHE A HB2  1 
ATOM   560   H  HB3  . PHE A  1 56  ? 59.472  -88.130  20.506  1.00 57.43  ? 36  PHE A HB3  1 
ATOM   561   H  HD1  . PHE A  1 56  ? 62.887  -87.775  21.888  1.00 63.81  ? 36  PHE A HD1  1 
ATOM   562   H  HD2  . PHE A  1 56  ? 59.170  -85.835  21.036  1.00 62.09  ? 36  PHE A HD2  1 
ATOM   563   H  HE1  . PHE A  1 56  ? 63.930  -85.566  22.316  1.00 64.93  ? 36  PHE A HE1  1 
ATOM   564   H  HE2  . PHE A  1 56  ? 60.218  -83.644  21.453  1.00 64.85  ? 36  PHE A HE2  1 
ATOM   565   H  HZ   . PHE A  1 56  ? 62.586  -83.505  22.099  1.00 64.83  ? 36  PHE A HZ   1 
ATOM   566   N  N    . GLY A  1 57  ? 58.809  -90.713  20.903  1.00 55.40  ? 37  GLY A N    1 
ATOM   567   C  CA   . GLY A  1 57  ? 58.209  -92.000  20.558  1.00 53.78  ? 37  GLY A CA   1 
ATOM   568   C  C    . GLY A  1 57  ? 59.267  -93.074  20.378  1.00 53.04  ? 37  GLY A C    1 
ATOM   569   O  O    . GLY A  1 57  ? 60.449  -92.748  20.240  1.00 48.86  ? 37  GLY A O    1 
ATOM   570   H  H    . GLY A  1 57  ? 58.926  -90.129  20.083  1.00 54.53  ? 37  GLY A H    1 
ATOM   571   H  HA2  . GLY A  1 57  ? 57.514  -92.318  21.334  1.00 54.28  ? 37  GLY A HA2  1 
ATOM   572   H  HA3  . GLY A  1 57  ? 57.653  -91.902  19.626  1.00 52.81  ? 37  GLY A HA3  1 
ATOM   573   N  N    . ASN A  1 58  ? 58.840  -94.370  20.387  1.00 48.36  ? 38  ASN A N    1 
ATOM   574   C  CA   . ASN A  1 58  ? 59.677  -95.565  20.148  1.00 46.54  ? 38  ASN A CA   1 
ATOM   575   C  C    . ASN A  1 58  ? 60.165  -95.580  18.662  1.00 44.67  ? 38  ASN A C    1 
ATOM   576   O  O    . ASN A  1 58  ? 59.932  -94.617  17.915  1.00 43.26  ? 38  ASN A O    1 
ATOM   577   C  CB   . ASN A  1 58  ? 58.897  -96.860  20.530  1.00 40.26  ? 38  ASN A CB   1 
ATOM   578   C  CG   . ASN A  1 58  ? 57.692  -97.178  19.676  1.00 55.17  ? 38  ASN A CG   1 
ATOM   579   O  OD1  . ASN A  1 58  ? 57.509  -96.631  18.601  1.00 40.00  ? 38  ASN A OD1  1 
ATOM   580   N  ND2  . ASN A  1 58  ? 56.850  -98.080  20.132  1.00 48.51  ? 38  ASN A ND2  1 
ATOM   581   H  H    . ASN A  1 58  ? 57.863  -94.600  20.533  1.00 48.52  ? 38  ASN A H    1 
ATOM   582   H  HA   . ASN A  1 58  ? 60.563  -95.524  20.780  1.00 47.53  ? 38  ASN A HA   1 
ATOM   583   H  HB2  . ASN A  1 58  ? 59.560  -97.721  20.496  1.00 38.58  ? 38  ASN A HB2  1 
ATOM   584   H  HB3  . ASN A  1 58  ? 58.530  -96.728  21.545  1.00 41.53  ? 38  ASN A HB3  1 
ATOM   585   H  HD21 . ASN A  1 58  ? 56.020  -98.317  19.598  1.00 48.03  ? 38  ASN A HD21 1 
ATOM   586   H  HD22 . ASN A  1 58  ? 57.021  -98.526  21.028  1.00 49.62  ? 38  ASN A HD22 1 
ATOM   587   N  N    . PHE A  1 59  ? 60.822  -96.660  18.218  1.00 39.81  ? 39  PHE A N    1 
ATOM   588   C  CA   . PHE A  1 59  ? 61.387  -96.702  16.868  1.00 38.72  ? 39  PHE A CA   1 
ATOM   589   C  C    . PHE A  1 59  ? 60.346  -96.617  15.737  1.00 41.49  ? 39  PHE A C    1 
ATOM   590   O  O    . PHE A  1 59  ? 60.506  -95.771  14.844  1.00 38.25  ? 39  PHE A O    1 
ATOM   591   C  CB   . PHE A  1 59  ? 62.206  -97.948  16.686  1.00 39.94  ? 39  PHE A CB   1 
ATOM   592   C  CG   . PHE A  1 59  ? 63.148  -97.833  15.519  1.00 39.38  ? 39  PHE A CG   1 
ATOM   593   C  CD1  . PHE A  1 59  ? 64.324  -97.111  15.628  1.00 40.34  ? 39  PHE A CD1  1 
ATOM   594   C  CD2  . PHE A  1 59  ? 62.887  -98.493  14.325  1.00 39.38  ? 39  PHE A CD2  1 
ATOM   595   C  CE1  . PHE A  1 59  ? 65.170  -96.973  14.535  1.00 40.45  ? 39  PHE A CE1  1 
ATOM   596   C  CE2  . PHE A  1 59  ? 63.772  -98.419  13.278  1.00 41.72  ? 39  PHE A CE2  1 
ATOM   597   C  CZ   . PHE A  1 59  ? 64.884  -97.618  13.374  1.00 40.31  ? 39  PHE A CZ   1 
ATOM   598   H  H    . PHE A  1 59  ? 60.962  -97.510  18.754  1.00 41.79  ? 39  PHE A H    1 
ATOM   599   H  HA   . PHE A  1 59  ? 62.052  -95.847  16.757  1.00 39.14  ? 39  PHE A HA   1 
ATOM   600   H  HB2  . PHE A  1 59  ? 62.808  -98.085  17.582  1.00 40.09  ? 39  PHE A HB2  1 
ATOM   601   H  HB3  . PHE A  1 59  ? 61.546  -98.801  16.537  1.00 41.45  ? 39  PHE A HB3  1 
ATOM   602   H  HD1  . PHE A  1 59  ? 64.546  -96.599  16.562  1.00 38.88  ? 39  PHE A HD1  1 
ATOM   603   H  HD2  . PHE A  1 59  ? 61.980  -99.084  14.214  1.00 39.48  ? 39  PHE A HD2  1 
ATOM   604   H  HE1  . PHE A  1 59  ? 66.097  -96.413  14.632  1.00 40.26  ? 39  PHE A HE1  1 
ATOM   605   H  HE2  . PHE A  1 59  ? 63.527  -98.899  12.332  1.00 41.39  ? 39  PHE A HE2  1 
ATOM   606   H  HZ   . PHE A  1 59  ? 65.584  -97.563  12.541  1.00 41.28  ? 39  PHE A HZ   1 
ATOM   607   N  N    . ILE A  1 60  ? 59.278  -97.447  15.806  1.00 38.92  ? 40  ILE A N    1 
ATOM   608   C  CA   . ILE A  1 60  ? 58.232  -97.454  14.778  1.00 39.85  ? 40  ILE A CA   1 
ATOM   609   C  C    . ILE A  1 60  ? 57.420  -96.130  14.782  1.00 41.76  ? 40  ILE A C    1 
ATOM   610   O  O    . ILE A  1 60  ? 57.069  -95.648  13.704  1.00 41.26  ? 40  ILE A O    1 
ATOM   611   C  CB   . ILE A  1 60  ? 57.304  -98.709  14.877  1.00 44.39  ? 40  ILE A CB   1 
ATOM   612   C  CG1  . ILE A  1 60  ? 56.470  -98.910  13.588  1.00 45.66  ? 40  ILE A CG1  1 
ATOM   613   C  CG2  . ILE A  1 60  ? 56.381  -98.678  16.104  1.00 50.64  ? 40  ILE A CG2  1 
ATOM   614   C  CD1  . ILE A  1 60  ? 57.276  -99.118  12.303  1.00 46.46  ? 40  ILE A CD1  1 
ATOM   615   H  H    . ILE A  1 60  ? 59.142  -98.116  16.555  1.00 38.36  ? 40  ILE A H    1 
ATOM   616   H  HA   . ILE A  1 60  ? 58.746  -97.495  13.819  1.00 38.85  ? 40  ILE A HA   1 
ATOM   617   H  HB   . ILE A  1 60  ? 57.956  -99.577  14.971  1.00 43.92  ? 40  ILE A HB   1 
ATOM   618   H  HG12 . ILE A  1 60  ? 55.847  -99.793  13.716  1.00 46.29  ? 40  ILE A HG12 1 
ATOM   619   H  HG13 . ILE A  1 60  ? 55.834  -98.039  13.435  1.00 46.28  ? 40  ILE A HG13 1 
ATOM   620   H  HG21 . ILE A  1 60  ? 55.832  -99.618  16.141  1.00 51.44  ? 40  ILE A HG21 1 
ATOM   621   H  HG22 . ILE A  1 60  ? 56.972  -98.574  17.013  1.00 51.22  ? 40  ILE A HG22 1 
ATOM   622   H  HG23 . ILE A  1 60  ? 55.671  -97.856  16.020  1.00 51.45  ? 40  ILE A HG23 1 
ATOM   623   H  HD11 . ILE A  1 60  ? 56.654  -99.632  11.572  1.00 46.05  ? 40  ILE A HD11 1 
ATOM   624   H  HD12 . ILE A  1 60  ? 57.577  -98.149  11.905  1.00 45.57  ? 40  ILE A HD12 1 
ATOM   625   H  HD13 . ILE A  1 60  ? 58.158  -99.713  12.530  1.00 47.21  ? 40  ILE A HD13 1 
ATOM   626   N  N    . GLN A  1 61  ? 57.131  -95.559  15.957  1.00 38.88  ? 41  GLN A N    1 
ATOM   627   C  CA   . GLN A  1 61  ? 56.427  -94.276  16.068  1.00 39.38  ? 41  GLN A CA   1 
ATOM   628   C  C    . GLN A  1 61  ? 57.241  -93.144  15.421  1.00 41.45  ? 41  GLN A C    1 
ATOM   629   O  O    . GLN A  1 61  ? 56.697  -92.327  14.669  1.00 39.69  ? 41  GLN A O    1 
ATOM   630   C  CB   . GLN A  1 61  ? 56.159  -93.919  17.535  1.00 42.53  ? 41  GLN A CB   1 
ATOM   631   C  CG   . GLN A  1 61  ? 55.071  -94.770  18.167  1.00 58.33  ? 41  GLN A CG   1 
ATOM   632   C  CD   . GLN A  1 61  ? 54.989  -94.665  19.672  1.00 69.93  ? 41  GLN A CD   1 
ATOM   633   O  OE1  . GLN A  1 61  ? 55.908  -94.211  20.356  1.00 70.44  ? 41  GLN A OE1  1 
ATOM   634   N  NE2  . GLN A  1 61  ? 53.889  -95.128  20.227  1.00 53.67  ? 41  GLN A NE2  1 
ATOM   635   H  H    . GLN A  1 61  ? 57.367  -95.976  16.853  1.00 40.30  ? 41  GLN A H    1 
ATOM   636   H  HA   . GLN A  1 61  ? 55.467  -94.355  15.560  1.00 38.67  ? 41  GLN A HA   1 
ATOM   637   H  HB2  . GLN A  1 61  ? 57.084  -94.036  18.096  1.00 43.07  ? 41  GLN A HB2  1 
ATOM   638   H  HB3  . GLN A  1 61  ? 55.836  -92.880  17.587  1.00 41.89  ? 41  GLN A HB3  1 
ATOM   639   H  HG2  . GLN A  1 61  ? 54.119  -94.425  17.773  1.00 58.04  ? 41  GLN A HG2  1 
ATOM   640   H  HG3  . GLN A  1 61  ? 55.211  -95.814  17.894  1.00 58.51  ? 41  GLN A HG3  1 
ATOM   641   H  HE21 . GLN A  1 61  ? 53.165  -95.559  19.662  1.00 53.00  ? 41  GLN A HE21 1 
ATOM   642   H  HE22 . GLN A  1 61  ? 53.780  -95.095  21.238  1.00 55.80  ? 41  GLN A HE22 1 
ATOM   643   N  N    . THR A  1 62  ? 58.553  -93.124  15.691  1.00 36.37  ? 42  THR A N    1 
ATOM   644   C  CA   . THR A  1 62  ? 59.471  -92.140  15.139  1.00 33.93  ? 42  THR A CA   1 
ATOM   645   C  C    . THR A  1 62  ? 59.613  -92.327  13.620  1.00 35.60  ? 42  THR A C    1 
ATOM   646   O  O    . THR A  1 62  ? 59.620  -91.338  12.891  1.00 33.17  ? 42  THR A O    1 
ATOM   647   C  CB   . THR A  1 62  ? 60.820  -92.221  15.843  1.00 38.85  ? 42  THR A CB   1 
ATOM   648   O  OG1  . THR A  1 62  ? 60.585  -92.061  17.244  1.00 40.44  ? 42  THR A OG1  1 
ATOM   649   C  CG2  . THR A  1 62  ? 61.804  -91.185  15.338  1.00 40.59  ? 42  THR A CG2  1 
ATOM   650   H  H    . THR A  1 62  ? 59.006  -93.792  16.307  1.00 37.95  ? 42  THR A H    1 
ATOM   651   H  HA   . THR A  1 62  ? 59.070  -91.145  15.324  1.00 34.01  ? 42  THR A HA   1 
ATOM   652   H  HB   . THR A  1 62  ? 61.254  -93.201  15.650  1.00 38.82  ? 42  THR A HB   1 
ATOM   653   H  HG1  . THR A  1 62  ? 60.855  -92.894  17.715  1.00 40.64  ? 42  THR A HG1  1 
ATOM   654   H  HG21 . THR A  1 62  ? 62.563  -90.981  16.089  1.00 41.14  ? 42  THR A HG21 1 
ATOM   655   H  HG22 . THR A  1 62  ? 62.298  -91.543  14.434  1.00 40.24  ? 42  THR A HG22 1 
ATOM   656   H  HG23 . THR A  1 62  ? 61.285  -90.258  15.099  1.00 41.61  ? 42  THR A HG23 1 
ATOM   657   N  N    . ALA A  1 63  ? 59.727  -93.575  13.154  1.00 33.65  ? 43  ALA A N    1 
ATOM   658   C  CA   . ALA A  1 63  ? 59.812  -93.869  11.725  1.00 34.02  ? 43  ALA A CA   1 
ATOM   659   C  C    . ALA A  1 63  ? 58.512  -93.452  10.994  1.00 37.82  ? 43  ALA A C    1 
ATOM   660   O  O    . ALA A  1 63  ? 58.578  -92.939  9.879   1.00 34.68  ? 43  ALA A O    1 
ATOM   661   C  CB   . ALA A  1 63  ? 60.091  -95.350  11.511  1.00 35.18  ? 43  ALA A CB   1 
ATOM   662   H  H    . ALA A  1 63  ? 59.778  -94.397  13.747  1.00 33.78  ? 43  ALA A H    1 
ATOM   663   H  HA   . ALA A  1 63  ? 60.627  -93.289  11.297  1.00 33.98  ? 43  ALA A HA   1 
ATOM   664   H  HB1  . ALA A  1 63  ? 60.097  -95.546  10.439  1.00 34.57  ? 43  ALA A HB1  1 
ATOM   665   H  HB2  . ALA A  1 63  ? 61.059  -95.592  11.945  1.00 34.29  ? 43  ALA A HB2  1 
ATOM   666   H  HB3  . ALA A  1 63  ? 59.308  -95.930  11.995  1.00 35.47  ? 43  ALA A HB3  1 
ATOM   667   N  N    . ALA A  1 64  ? 57.346  -93.638  11.647  1.00 38.00  ? 44  ALA A N    1 
ATOM   668   C  CA   . ALA A  1 64  ? 56.054  -93.230  11.088  1.00 37.47  ? 44  ALA A CA   1 
ATOM   669   C  C    . ALA A  1 64  ? 55.946  -91.702  10.981  1.00 41.06  ? 44  ALA A C    1 
ATOM   670   O  O    . ALA A  1 64  ? 55.460  -91.187  9.966   1.00 38.41  ? 44  ALA A O    1 
ATOM   671   C  CB   . ALA A  1 64  ? 54.936  -93.766  11.949  1.00 39.05  ? 44  ALA A CB   1 
ATOM   672   H  H    . ALA A  1 64  ? 57.268  -94.078  12.559  1.00 36.69  ? 44  ALA A H    1 
ATOM   673   H  HA   . ALA A  1 64  ? 55.958  -93.646  10.088  1.00 37.49  ? 44  ALA A HA   1 
ATOM   674   H  HB1  . ALA A  1 64  ? 53.976  -93.524  11.496  1.00 39.79  ? 44  ALA A HB1  1 
ATOM   675   H  HB2  . ALA A  1 64  ? 55.058  -94.846  12.020  1.00 39.67  ? 44  ALA A HB2  1 
ATOM   676   H  HB3  . ALA A  1 64  ? 54.988  -93.315  12.939  1.00 38.42  ? 44  ALA A HB3  1 
ATOM   677   N  N    . HIS A  1 65  ? 56.412  -90.966  12.019  1.00 39.53  ? 45  HIS A N    1 
ATOM   678   C  CA   . HIS A  1 65  ? 56.423  -89.502  11.955  1.00 38.90  ? 45  HIS A CA   1 
ATOM   679   C  C    . HIS A  1 65  ? 57.392  -89.040  10.849  1.00 42.08  ? 45  HIS A C    1 
ATOM   680   O  O    . HIS A  1 65  ? 57.104  -88.077  10.121  1.00 39.74  ? 45  HIS A O    1 
ATOM   681   C  CB   . HIS A  1 65  ? 56.800  -88.891  13.314  1.00 40.10  ? 45  HIS A CB   1 
ATOM   682   C  CG   . HIS A  1 65  ? 56.729  -87.403  13.341  1.00 42.52  ? 45  HIS A CG   1 
ATOM   683   N  ND1  . HIS A  1 65  ? 57.482  -86.666  14.231  1.00 44.48  ? 45  HIS A ND1  1 
ATOM   684   C  CD2  . HIS A  1 65  ? 55.987  -86.554  12.597  1.00 42.35  ? 45  HIS A CD2  1 
ATOM   685   C  CE1  . HIS A  1 65  ? 57.201  -85.396  13.992  1.00 43.33  ? 45  HIS A CE1  1 
ATOM   686   N  NE2  . HIS A  1 65  ? 56.311  -85.283  13.004  1.00 42.71  ? 45  HIS A NE2  1 
ATOM   687   H  H    . HIS A  1 65  ? 56.776  -91.354  12.882  1.00 39.62  ? 45  HIS A H    1 
ATOM   688   H  HA   . HIS A  1 65  ? 55.419  -89.167  11.701  1.00 39.01  ? 45  HIS A HA   1 
ATOM   689   H  HB2  . HIS A  1 65  ? 56.127  -89.279  14.078  1.00 40.31  ? 45  HIS A HB2  1 
ATOM   690   H  HB3  . HIS A  1 65  ? 57.826  -89.175  13.543  1.00 41.12  ? 45  HIS A HB3  1 
ATOM   691   H  HD1  . HIS A  1 65  ? 58.106  -87.033  14.940  1.00 45.83  ? 45  HIS A HD1  1 
ATOM   692   H  HD2  . HIS A  1 65  ? 55.264  -86.824  11.830  1.00 41.40  ? 45  HIS A HD2  1 
ATOM   693   H  HE1  . HIS A  1 65  ? 57.630  -84.550  14.527  1.00 43.28  ? 45  HIS A HE1  1 
ATOM   694   H  HE2  . HIS A  1 65  ? 55.946  -84.414  12.631  1.00 42.41  ? 45  HIS A HE2  1 
ATOM   695   N  N    . PHE A  1 66  ? 58.523  -89.734  10.706  1.00 38.91  ? 46  PHE A N    1 
ATOM   696   C  CA   . PHE A  1 66  ? 59.516  -89.434  9.662   1.00 38.79  ? 46  PHE A CA   1 
ATOM   697   C  C    . PHE A  1 66  ? 58.880  -89.556  8.272   1.00 39.45  ? 46  PHE A C    1 
ATOM   698   O  O    . PHE A  1 66  ? 59.034  -88.670  7.444   1.00 39.60  ? 46  PHE A O    1 
ATOM   699   C  CB   . PHE A  1 66  ? 60.727  -90.380  9.806   1.00 40.16  ? 46  PHE A CB   1 
ATOM   700   C  CG   . PHE A  1 66  ? 61.923  -90.066  8.968   1.00 40.05  ? 46  PHE A CG   1 
ATOM   701   C  CD1  . PHE A  1 66  ? 61.985  -90.469  7.636   1.00 42.36  ? 46  PHE A CD1  1 
ATOM   702   C  CD2  . PHE A  1 66  ? 63.047  -89.477  9.532   1.00 41.87  ? 46  PHE A CD2  1 
ATOM   703   C  CE1  . PHE A  1 66  ? 63.118  -90.219  6.863   1.00 41.36  ? 46  PHE A CE1  1 
ATOM   704   C  CE2  . PHE A  1 66  ? 64.191  -89.249  8.767   1.00 43.41  ? 46  PHE A CE2  1 
ATOM   705   C  CZ   . PHE A  1 66  ? 64.223  -89.630  7.436   1.00 41.25  ? 46  PHE A CZ   1 
ATOM   706   H  H    . PHE A  1 66  ? 58.784  -90.513  11.301  1.00 38.59  ? 46  PHE A H    1 
ATOM   707   H  HA   . PHE A  1 66  ? 59.859  -88.408  9.775   1.00 39.21  ? 46  PHE A HA   1 
ATOM   708   H  HB2  . PHE A  1 66  ? 61.049  -90.361  10.848  1.00 41.64  ? 46  PHE A HB2  1 
ATOM   709   H  HB3  . PHE A  1 66  ? 60.428  -91.392  9.542   1.00 40.87  ? 46  PHE A HB3  1 
ATOM   710   H  HD1  . PHE A  1 66  ? 61.118  -90.942  7.180   1.00 42.32  ? 46  PHE A HD1  1 
ATOM   711   H  HD2  . PHE A  1 66  ? 63.031  -89.172  10.578  1.00 41.45  ? 46  PHE A HD2  1 
ATOM   712   H  HE1  . PHE A  1 66  ? 63.129  -90.506  5.815   1.00 41.11  ? 46  PHE A HE1  1 
ATOM   713   H  HE2  . PHE A  1 66  ? 65.035  -88.723  9.207   1.00 42.70  ? 46  PHE A HE2  1 
ATOM   714   H  HZ   . PHE A  1 66  ? 65.097  -89.409  6.825   1.00 40.79  ? 46  PHE A HZ   1 
ATOM   715   N  N    . ALA A  1 67  ? 58.074  -90.579  8.060   1.00 37.45  ? 47  ALA A N    1 
ATOM   716   C  CA   . ALA A  1 67  ? 57.396  -90.806  6.774   1.00 35.77  ? 47  ALA A CA   1 
ATOM   717   C  C    . ALA A  1 67  ? 56.317  -89.753  6.571   1.00 39.47  ? 47  ALA A C    1 
ATOM   718   O  O    . ALA A  1 67  ? 56.151  -89.301  5.459   1.00 40.77  ? 47  ALA A O    1 
ATOM   719   C  CB   . ALA A  1 67  ? 56.799  -92.205  6.717   1.00 36.09  ? 47  ALA A CB   1 
ATOM   720   H  H    . ALA A  1 67  ? 57.852  -91.277  8.763   1.00 38.43  ? 47  ALA A H    1 
ATOM   721   H  HA   . ALA A  1 67  ? 58.119  -90.715  5.966   1.00 36.92  ? 47  ALA A HA   1 
ATOM   722   H  HB1  . ALA A  1 67  ? 56.250  -92.328  5.785   1.00 36.52  ? 47  ALA A HB1  1 
ATOM   723   H  HB2  . ALA A  1 67  ? 57.594  -92.945  6.781   1.00 35.86  ? 47  ALA A HB2  1 
ATOM   724   H  HB3  . ALA A  1 67  ? 56.125  -92.321  7.563   1.00 36.51  ? 47  ALA A HB3  1 
ATOM   725   N  N    . ALA A  1 68  ? 55.617  -89.330  7.635   1.00 36.76  ? 48  ALA A N    1 
ATOM   726   C  CA   . ALA A  1 68  ? 54.606  -88.270  7.542   1.00 36.03  ? 48  ALA A CA   1 
ATOM   727   C  C    . ALA A  1 68  ? 55.231  -86.926  7.121   1.00 39.38  ? 48  ALA A C    1 
ATOM   728   O  O    . ALA A  1 68  ? 54.747  -86.277  6.185   1.00 37.62  ? 48  ALA A O    1 
ATOM   729   C  CB   . ALA A  1 68  ? 53.878  -88.118  8.867   1.00 36.88  ? 48  ALA A CB   1 
ATOM   730   H  H    . ALA A  1 68  ? 55.709  -89.733  8.561   1.00 36.99  ? 48  ALA A H    1 
ATOM   731   H  HA   . ALA A  1 68  ? 53.885  -88.542  6.774   1.00 37.61  ? 48  ALA A HA   1 
ATOM   732   H  HB1  . ALA A  1 68  ? 53.009  -87.478  8.731   1.00 36.00  ? 48  ALA A HB1  1 
ATOM   733   H  HB2  . ALA A  1 68  ? 53.562  -89.097  9.224   1.00 37.56  ? 48  ALA A HB2  1 
ATOM   734   H  HB3  . ALA A  1 68  ? 54.553  -87.665  9.592   1.00 37.28  ? 48  ALA A HB3  1 
ATOM   735   N  N    . GLU A  1 69  ? 56.341  -86.546  7.761   1.00 36.29  ? 49  GLU A N    1 
ATOM   736   C  CA   . GLU A  1 69  ? 57.057  -85.295  7.446   1.00 36.49  ? 49  GLU A CA   1 
ATOM   737   C  C    . GLU A  1 69  ? 57.787  -85.351  6.090   1.00 40.56  ? 49  GLU A C    1 
ATOM   738   O  O    . GLU A  1 69  ? 58.278  -84.325  5.618   1.00 41.82  ? 49  GLU A O    1 
ATOM   739   C  CB   . GLU A  1 69  ? 58.087  -84.972  8.550   1.00 37.22  ? 49  GLU A CB   1 
ATOM   740   C  CG   . GLU A  1 69  ? 57.439  -84.662  9.889   1.00 36.57  ? 49  GLU A CG   1 
ATOM   741   C  CD   . GLU A  1 69  ? 56.789  -83.306  10.082  1.00 62.05  ? 49  GLU A CD   1 
ATOM   742   O  OE1  . GLU A  1 69  ? 56.346  -83.033  11.230  1.00 39.51  ? 49  GLU A OE1  1 
ATOM   743   O  OE2  . GLU A  1 69  ? 56.733  -82.519  9.106   1.00 50.73  ? 49  GLU A OE2  1 
ATOM   744   H  H    . GLU A  1 69  ? 56.776  -87.099  8.491   1.00 36.65  ? 49  GLU A H    1 
ATOM   745   H  HA   . GLU A  1 69  ? 56.332  -84.483  7.399   1.00 36.44  ? 49  GLU A HA   1 
ATOM   746   H  HB2  . GLU A  1 69  ? 58.739  -85.835  8.679   1.00 36.81  ? 49  GLU A HB2  1 
ATOM   747   H  HB3  . GLU A  1 69  ? 58.687  -84.113  8.254   1.00 36.13  ? 49  GLU A HB3  1 
ATOM   748   H  HG2  . GLU A  1 69  ? 56.658  -85.395  10.084  1.00 36.51  ? 49  GLU A HG2  1 
ATOM   749   H  HG3  . GLU A  1 69  ? 58.211  -84.748  10.653  1.00 36.98  ? 49  GLU A HG3  1 
ATOM   750   N  N    . SER A  1 70  ? 57.892  -86.534  5.493   1.00 36.50  ? 50  SER A N    1 
ATOM   751   C  CA   . SER A  1 70  ? 58.530  -86.746  4.200   1.00 36.70  ? 50  SER A CA   1 
ATOM   752   C  C    . SER A  1 70  ? 57.489  -86.988  3.085   1.00 40.29  ? 50  SER A C    1 
ATOM   753   O  O    . SER A  1 70  ? 57.893  -87.304  1.962   1.00 40.58  ? 50  SER A O    1 
ATOM   754   C  CB   . SER A  1 70  ? 59.481  -87.933  4.315   1.00 41.20  ? 50  SER A CB   1 
ATOM   755   O  OG   . SER A  1 70  ? 60.482  -87.670  5.285   1.00 43.79  ? 50  SER A OG   1 
ATOM   756   H  H    . SER A  1 70  ? 57.581  -87.411  5.895   1.00 37.43  ? 50  SER A H    1 
ATOM   757   H  HA   . SER A  1 70  ? 59.129  -85.885  3.913   1.00 36.09  ? 50  SER A HA   1 
ATOM   758   H  HB2  . SER A  1 70  ? 58.912  -88.814  4.613   1.00 42.84  ? 50  SER A HB2  1 
ATOM   759   H  HB3  . SER A  1 70  ? 59.966  -88.129  3.362   1.00 41.24  ? 50  SER A HB3  1 
ATOM   760   H  HG   . SER A  1 70  ? 60.137  -87.906  6.187   1.00 44.47  ? 50  SER A HG   1 
ATOM   761   N  N    . SER A  1 71  ? 56.160  -86.814  3.357   1.00 35.38  ? 51  SER A N    1 
ATOM   762   C  CA   . SER A  1 71  ? 55.168  -87.085  2.315   1.00 35.16  ? 51  SER A CA   1 
ATOM   763   C  C    . SER A  1 71  ? 53.902  -86.240  2.411   1.00 39.67  ? 51  SER A C    1 
ATOM   764   O  O    . SER A  1 71  ? 53.763  -85.297  1.623   1.00 40.19  ? 51  SER A O    1 
ATOM   765   C  CB   . SER A  1 71  ? 54.800  -88.562  2.288   1.00 34.49  ? 51  SER A CB   1 
ATOM   766   O  OG   . SER A  1 71  ? 54.229  -89.038  3.501   1.00 37.37  ? 51  SER A OG   1 
ATOM   767   H  H    . SER A  1 71  ? 55.760  -86.513  4.237   1.00 34.09  ? 51  SER A H    1 
ATOM   768   H  HA   . SER A  1 71  ? 55.592  -86.864  1.336   1.00 35.91  ? 51  SER A HA   1 
ATOM   769   H  HB2  . SER A  1 71  ? 54.088  -88.737  1.483   1.00 33.49  ? 51  SER A HB2  1 
ATOM   770   H  HB3  . SER A  1 71  ? 55.717  -89.112  2.098   1.00 34.29  ? 51  SER A HB3  1 
ATOM   771   H  HG   . SER A  1 71  ? 54.931  -89.134  4.194   1.00 37.56  ? 51  SER A HG   1 
ATOM   772   N  N    . THR A  1 72  ? 52.966  -86.589  3.279   1.00 36.09  ? 52  THR A N    1 
ATOM   773   C  CA   . THR A  1 72  ? 51.662  -85.921  3.345   1.00 36.74  ? 52  THR A CA   1 
ATOM   774   C  C    . THR A  1 72  ? 51.282  -85.271  4.674   1.00 42.17  ? 52  THR A C    1 
ATOM   775   O  O    . THR A  1 72  ? 50.255  -84.588  4.718   1.00 41.54  ? 52  THR A O    1 
ATOM   776   C  CB   . THR A  1 72  ? 50.575  -86.969  3.068   1.00 38.42  ? 52  THR A CB   1 
ATOM   777   O  OG1  . THR A  1 72  ? 50.704  -88.007  4.044   1.00 42.57  ? 52  THR A OG1  1 
ATOM   778   C  CG2  . THR A  1 72  ? 50.679  -87.549  1.711   1.00 37.14  ? 52  THR A CG2  1 
ATOM   779   H  H    . THR A  1 72  ? 53.062  -87.337  3.957   1.00 38.13  ? 52  THR A H    1 
ATOM   780   H  HA   . THR A  1 72  ? 51.573  -85.164  2.570   1.00 35.94  ? 52  THR A HA   1 
ATOM   781   H  HB   . THR A  1 72  ? 49.586  -86.524  3.159   1.00 38.05  ? 52  THR A HB   1 
ATOM   782   H  HG1  . THR A  1 72  ? 49.898  -88.584  4.011   1.00 43.15  ? 52  THR A HG1  1 
ATOM   783   H  HG21 . THR A  1 72  ? 49.776  -88.120  1.494   1.00 38.39  ? 52  THR A HG21 1 
ATOM   784   H  HG22 . THR A  1 72  ? 50.802  -86.765  0.966   1.00 36.95  ? 52  THR A HG22 1 
ATOM   785   H  HG23 . THR A  1 72  ? 51.537  -88.218  1.652   1.00 37.23  ? 52  THR A HG23 1 
ATOM   786   N  N    . GLY A  1 73  ? 52.046  -85.497  5.737   1.00 40.48  ? 53  GLY A N    1 
ATOM   787   C  CA   . GLY A  1 73  ? 51.643  -85.050  7.063   1.00 39.46  ? 53  GLY A CA   1 
ATOM   788   C  C    . GLY A  1 73  ? 52.457  -83.957  7.709   1.00 42.72  ? 53  GLY A C    1 
ATOM   789   O  O    . GLY A  1 73  ? 53.244  -83.241  7.080   1.00 39.31  ? 53  GLY A O    1 
ATOM   790   H  H    . GLY A  1 73  ? 52.957  -85.944  5.728   1.00 40.51  ? 53  GLY A H    1 
ATOM   791   H  HA2  . GLY A  1 73  ? 50.608  -84.715  7.066   1.00 38.91  ? 53  GLY A HA2  1 
ATOM   792   H  HA3  . GLY A  1 73  ? 51.700  -85.912  7.722   1.00 38.67  ? 53  GLY A HA3  1 
ATOM   793   N  N    . THR A  1 74  ? 52.177  -83.804  9.001   1.00 39.83  ? 54  THR A N    1 
ATOM   794   C  CA   . THR A  1 74  ? 52.867  -82.881  9.887   1.00 38.48  ? 54  THR A CA   1 
ATOM   795   C  C    . THR A  1 74  ? 52.914  -83.613  11.244  1.00 43.10  ? 54  THR A C    1 
ATOM   796   O  O    . THR A  1 74  ? 52.815  -84.840  11.256  1.00 41.97  ? 54  THR A O    1 
ATOM   797   C  CB   . THR A  1 74  ? 52.229  -81.475  9.841   1.00 39.24  ? 54  THR A CB   1 
ATOM   798   O  OG1  . THR A  1 74  ? 52.942  -80.621  10.740  1.00 36.66  ? 54  THR A OG1  1 
ATOM   799   C  CG2  . THR A  1 74  ? 50.720  -81.472  10.152  1.00 38.97  ? 54  THR A CG2  1 
ATOM   800   H  H    . THR A  1 74  ? 51.428  -84.315  9.457   1.00 39.59  ? 54  THR A H    1 
ATOM   801   H  HA   . THR A  1 74  ? 53.900  -82.770  9.560   1.00 38.48  ? 54  THR A HA   1 
ATOM   802   H  HB   . THR A  1 74  ? 52.347  -81.076  8.836   1.00 38.15  ? 54  THR A HB   1 
ATOM   803   H  HG1  . THR A  1 74  ? 52.383  -79.857  11.041  1.00 35.56  ? 54  THR A HG1  1 
ATOM   804   H  HG21 . THR A  1 74  ? 50.330  -80.462  10.033  1.00 40.37  ? 54  THR A HG21 1 
ATOM   805   H  HG22 . THR A  1 74  ? 50.188  -82.136  9.474   1.00 36.39  ? 54  THR A HG22 1 
ATOM   806   H  HG23 . THR A  1 74  ? 50.536  -81.771  11.182  1.00 38.20  ? 54  THR A HG23 1 
ATOM   807   N  N    . ASN A  1 75  ? 53.088  -82.894  12.364  1.00 40.18  ? 55  ASN A N    1 
ATOM   808   C  CA   . ASN A  1 75  ? 53.232  -83.508  13.688  1.00 39.98  ? 55  ASN A CA   1 
ATOM   809   C  C    . ASN A  1 75  ? 51.909  -83.614  14.475  1.00 45.44  ? 55  ASN A C    1 
ATOM   810   O  O    . ASN A  1 75  ? 51.915  -84.059  15.619  1.00 45.76  ? 55  ASN A O    1 
ATOM   811   C  CB   . ASN A  1 75  ? 54.245  -82.715  14.505  1.00 39.84  ? 55  ASN A CB   1 
ATOM   812   C  CG   . ASN A  1 75  ? 53.783  -81.349  14.945  1.00 57.63  ? 55  ASN A CG   1 
ATOM   813   O  OD1  . ASN A  1 75  ? 52.993  -80.679  14.279  1.00 53.52  ? 55  ASN A OD1  1 
ATOM   814   N  ND2  . ASN A  1 75  ? 54.296  -80.893  16.064  1.00 56.43  ? 55  ASN A ND2  1 
ATOM   815   H  H    . ASN A  1 75  ? 53.144  -81.880  12.371  1.00 40.09  ? 55  ASN A H    1 
ATOM   816   H  HA   . ASN A  1 75  ? 53.637  -84.514  13.593  1.00 40.09  ? 55  ASN A HA   1 
ATOM   817   H  HB2  . ASN A  1 75  ? 54.480  -83.296  15.396  1.00 41.11  ? 55  ASN A HB2  1 
ATOM   818   H  HB3  . ASN A  1 75  ? 55.144  -82.588  13.905  1.00 39.43  ? 55  ASN A HB3  1 
ATOM   819   H  HD21 . ASN A  1 75  ? 54.011  -79.981  16.409  1.00 57.78  ? 55  ASN A HD21 1 
ATOM   820   H  HD22 . ASN A  1 75  ? 54.960  -81.445  16.598  1.00 56.41  ? 55  ASN A HD22 1 
ATOM   821   N  N    . VAL A  1 76  ? 50.809  -83.193  13.878  1.00 42.16  ? 56  VAL A N    1 
ATOM   822   C  CA   . VAL A  1 76  ? 49.491  -83.198  14.489  1.00 43.07  ? 56  VAL A CA   1 
ATOM   823   C  C    . VAL A  1 76  ? 48.466  -83.578  13.399  1.00 45.52  ? 56  VAL A C    1 
ATOM   824   O  O    . VAL A  1 76  ? 48.769  -83.472  12.215  1.00 43.94  ? 56  VAL A O    1 
ATOM   825   C  CB   . VAL A  1 76  ? 49.252  -81.773  15.107  1.00 47.62  ? 56  VAL A CB   1 
ATOM   826   C  CG1  . VAL A  1 76  ? 48.821  -80.745  14.045  1.00 45.63  ? 56  VAL A CG1  1 
ATOM   827   C  CG2  . VAL A  1 76  ? 48.270  -81.817  16.237  1.00 48.34  ? 56  VAL A CG2  1 
ATOM   828   H  H    . VAL A  1 76  ? 50.784  -82.805  12.942  1.00 42.23  ? 56  VAL A H    1 
ATOM   829   H  HA   . VAL A  1 76  ? 49.428  -83.926  15.293  1.00 43.41  ? 56  VAL A HA   1 
ATOM   830   H  HB   . VAL A  1 76  ? 50.191  -81.418  15.531  1.00 48.28  ? 56  VAL A HB   1 
ATOM   831   H  HG11 . VAL A  1 76  ? 48.953  -79.749  14.466  1.00 45.61  ? 56  VAL A HG11 1 
ATOM   832   H  HG12 . VAL A  1 76  ? 49.437  -80.852  13.154  1.00 43.28  ? 56  VAL A HG12 1 
ATOM   833   H  HG13 . VAL A  1 76  ? 47.770  -80.888  13.801  1.00 43.81  ? 56  VAL A HG13 1 
ATOM   834   H  HG21 . VAL A  1 76  ? 48.242  -80.839  16.713  1.00 49.10  ? 56  VAL A HG21 1 
ATOM   835   H  HG22 . VAL A  1 76  ? 47.286  -82.062  15.840  1.00 48.84  ? 56  VAL A HG22 1 
ATOM   836   H  HG23 . VAL A  1 76  ? 48.584  -82.562  16.966  1.00 49.40  ? 56  VAL A HG23 1 
ATOM   837   N  N    . GLU A  1 77  ? 47.258  -83.958  13.801  1.00 44.81  ? 57  GLU A N    1 
ATOM   838   C  CA   . GLU A  1 77  ? 46.154  -84.244  12.879  1.00 45.53  ? 57  GLU A CA   1 
ATOM   839   C  C    . GLU A  1 77  ? 45.611  -82.946  12.295  1.00 46.14  ? 57  GLU A C    1 
ATOM   840   O  O    . GLU A  1 77  ? 45.463  -81.972  13.023  1.00 44.19  ? 57  GLU A O    1 
ATOM   841   C  CB   . GLU A  1 77  ? 45.011  -85.009  13.618  1.00 48.46  ? 57  GLU A CB   1 
ATOM   842   C  CG   . GLU A  1 77  ? 43.730  -85.178  12.805  1.00 59.77  ? 57  GLU A CG   1 
ATOM   843   C  CD   . GLU A  1 77  ? 42.672  -86.058  13.448  1.00 77.60  ? 57  GLU A CD   1 
ATOM   844   O  OE1  . GLU A  1 77  ? 42.821  -86.399  14.644  1.00 76.18  ? 57  GLU A OE1  1 
ATOM   845   O  OE2  . GLU A  1 77  ? 41.666  -86.365  12.766  1.00 63.73  ? 57  GLU A OE2  1 
ATOM   846   H  H    . GLU A  1 77  ? 47.015  -84.089  14.778  1.00 46.61  ? 57  GLU A H    1 
ATOM   847   H  HA   . GLU A  1 77  ? 46.516  -84.874  12.069  1.00 45.95  ? 57  GLU A HA   1 
ATOM   848   H  HB2  . GLU A  1 77  ? 45.373  -85.999  13.890  1.00 48.33  ? 57  GLU A HB2  1 
ATOM   849   H  HB3  . GLU A  1 77  ? 44.738  -84.453  14.514  1.00 48.88  ? 57  GLU A HB3  1 
ATOM   850   H  HG2  . GLU A  1 77  ? 43.264  -84.204  12.665  1.00 59.52  ? 57  GLU A HG2  1 
ATOM   851   H  HG3  . GLU A  1 77  ? 43.990  -85.602  11.837  1.00 59.33  ? 57  GLU A HG3  1 
ATOM   852   N  N    . VAL A  1 78  ? 45.301  -82.936  10.990  1.00 42.67  ? 58  VAL A N    1 
ATOM   853   C  CA   . VAL A  1 78  ? 44.694  -81.776  10.324  1.00 42.62  ? 58  VAL A CA   1 
ATOM   854   C  C    . VAL A  1 78  ? 43.378  -82.254  9.746   1.00 49.37  ? 58  VAL A C    1 
ATOM   855   O  O    . VAL A  1 78  ? 43.309  -83.367  9.221   1.00 50.29  ? 58  VAL A O    1 
ATOM   856   C  CB   . VAL A  1 78  ? 45.603  -81.078  9.285   1.00 45.38  ? 58  VAL A CB   1 
ATOM   857   C  CG1  . VAL A  1 78  ? 46.795  -80.430  9.974   1.00 44.02  ? 58  VAL A CG1  1 
ATOM   858   C  CG2  . VAL A  1 78  ? 46.052  -82.035  8.185   1.00 44.70  ? 58  VAL A CG2  1 
ATOM   859   H  H    . VAL A  1 78  ? 45.428  -83.738  10.385  1.00 42.28  ? 58  VAL A H    1 
ATOM   860   H  HA   . VAL A  1 78  ? 44.440  -81.016  11.061  1.00 42.98  ? 58  VAL A HA   1 
ATOM   861   H  HB   . VAL A  1 78  ? 45.035  -80.282  8.807   1.00 45.47  ? 58  VAL A HB   1 
ATOM   862   H  HG11 . VAL A  1 78  ? 47.365  -79.868  9.235   1.00 43.45  ? 58  VAL A HG11 1 
ATOM   863   H  HG12 . VAL A  1 78  ? 46.432  -79.766  10.755  1.00 43.45  ? 58  VAL A HG12 1 
ATOM   864   H  HG13 . VAL A  1 78  ? 47.415  -81.213  10.409  1.00 43.62  ? 58  VAL A HG13 1 
ATOM   865   H  HG21 . VAL A  1 78  ? 46.713  -81.493  7.513   1.00 45.46  ? 58  VAL A HG21 1 
ATOM   866   H  HG22 . VAL A  1 78  ? 46.588  -82.875  8.622   1.00 44.85  ? 58  VAL A HG22 1 
ATOM   867   H  HG23 . VAL A  1 78  ? 45.187  -82.386  7.625   1.00 44.57  ? 58  VAL A HG23 1 
ATOM   868   N  N    . PHE A  1 79  ? 42.330  -81.422  9.847   1.00 46.41  ? 59  PHE A N    1 
ATOM   869   C  CA   . PHE A  1 79  ? 40.983  -81.814  9.422   1.00 47.23  ? 59  PHE A CA   1 
ATOM   870   C  C    . PHE A  1 79  ? 40.746  -81.669  7.912   1.00 48.38  ? 59  PHE A C    1 
ATOM   871   O  O    . PHE A  1 79  ? 39.678  -82.072  7.435   1.00 47.95  ? 59  PHE A O    1 
ATOM   872   C  CB   . PHE A  1 79  ? 39.943  -81.030  10.233  1.00 50.19  ? 59  PHE A CB   1 
ATOM   873   C  CG   . PHE A  1 79  ? 40.132  -81.284  11.716  1.00 51.69  ? 59  PHE A CG   1 
ATOM   874   C  CD1  . PHE A  1 79  ? 40.034  -82.567  12.234  1.00 54.97  ? 59  PHE A CD1  1 
ATOM   875   C  CD2  . PHE A  1 79  ? 40.561  -80.273  12.559  1.00 54.90  ? 59  PHE A CD2  1 
ATOM   876   C  CE1  . PHE A  1 79  ? 40.302  -82.818  13.584  1.00 56.87  ? 59  PHE A CE1  1 
ATOM   877   C  CE2  . PHE A  1 79  ? 40.818  -80.526  13.908  1.00 57.63  ? 59  PHE A CE2  1 
ATOM   878   C  CZ   . PHE A  1 79  ? 40.700  -81.797  14.409  1.00 55.58  ? 59  PHE A CZ   1 
ATOM   879   H  H    . PHE A  1 79  ? 42.394  -80.469  10.189  1.00 45.10  ? 59  PHE A H    1 
ATOM   880   H  HA   . PHE A  1 79  ? 40.835  -82.871  9.636   1.00 46.61  ? 59  PHE A HA   1 
ATOM   881   H  HB2  . PHE A  1 79  ? 40.063  -79.965  10.038  1.00 49.27  ? 59  PHE A HB2  1 
ATOM   882   H  HB3  . PHE A  1 79  ? 38.942  -81.359  9.958   1.00 51.40  ? 59  PHE A HB3  1 
ATOM   883   H  HD1  . PHE A  1 79  ? 39.748  -83.394  11.587  1.00 54.50  ? 59  PHE A HD1  1 
ATOM   884   H  HD2  . PHE A  1 79  ? 40.662  -79.257  12.179  1.00 55.25  ? 59  PHE A HD2  1 
ATOM   885   H  HE1  . PHE A  1 79  ? 40.205  -83.827  13.983  1.00 57.13  ? 59  PHE A HE1  1 
ATOM   886   H  HE2  . PHE A  1 79  ? 41.093  -79.706  14.567  1.00 58.26  ? 59  PHE A HE2  1 
ATOM   887   H  HZ   . PHE A  1 79  ? 40.879  -81.987  15.466  1.00 55.88  ? 59  PHE A HZ   1 
ATOM   888   N  N    . THR A  1 80  ? 41.760  -81.196  7.157   1.00 42.11  ? 60  THR A N    1 
ATOM   889   C  CA   . THR A  1 80  ? 41.710  -81.088  5.698   1.00 40.08  ? 60  THR A CA   1 
ATOM   890   C  C    . THR A  1 80  ? 42.126  -82.415  5.022   1.00 40.78  ? 60  THR A C    1 
ATOM   891   O  O    . THR A  1 80  ? 41.961  -82.555  3.808   1.00 39.82  ? 60  THR A O    1 
ATOM   892   C  CB   . THR A  1 80  ? 42.617  -79.944  5.258   1.00 42.53  ? 60  THR A CB   1 
ATOM   893   O  OG1  . THR A  1 80  ? 43.834  -80.038  5.999   1.00 38.04  ? 60  THR A OG1  1 
ATOM   894   C  CG2  . THR A  1 80  ? 41.987  -78.592  5.490   1.00 42.60  ? 60  THR A CG2  1 
ATOM   895   H  H    . THR A  1 80  ? 42.641  -80.854  7.525   1.00 41.96  ? 60  THR A H    1 
ATOM   896   H  HA   . THR A  1 80  ? 40.696  -80.846  5.381   1.00 40.26  ? 60  THR A HA   1 
ATOM   897   H  HB   . THR A  1 80  ? 42.826  -80.045  4.195   1.00 42.64  ? 60  THR A HB   1 
ATOM   898   H  HG1  . THR A  1 80  ? 44.423  -79.264  5.803   1.00 37.36  ? 60  THR A HG1  1 
ATOM   899   H  HG21 . THR A  1 80  ? 42.655  -77.804  5.148   1.00 42.14  ? 60  THR A HG21 1 
ATOM   900   H  HG22 . THR A  1 80  ? 41.049  -78.529  4.940   1.00 43.57  ? 60  THR A HG22 1 
ATOM   901   H  HG23 . THR A  1 80  ? 41.780  -78.452  6.549   1.00 43.02  ? 60  THR A HG23 1 
ATOM   902   N  N    . THR A  1 81  ? 42.666  -83.395  5.793   1.00 38.95  ? 61  THR A N    1 
ATOM   903   C  CA   . THR A  1 81  ? 43.048  -84.708  5.257   1.00 38.19  ? 61  THR A CA   1 
ATOM   904   C  C    . THR A  1 81  ? 41.816  -85.470  4.772   1.00 41.45  ? 61  THR A C    1 
ATOM   905   O  O    . THR A  1 81  ? 40.809  -85.507  5.463   1.00 36.80  ? 61  THR A O    1 
ATOM   906   C  CB   . THR A  1 81  ? 43.804  -85.534  6.318   1.00 48.45  ? 61  THR A CB   1 
ATOM   907   O  OG1  . THR A  1 81  ? 45.011  -84.850  6.666   1.00 45.06  ? 61  THR A OG1  1 
ATOM   908   C  CG2  . THR A  1 81  ? 44.144  -86.970  5.832   1.00 47.56  ? 61  THR A CG2  1 
ATOM   909   H  H    . THR A  1 81  ? 42.869  -83.300  6.783   1.00 39.83  ? 61  THR A H    1 
ATOM   910   H  HA   . THR A  1 81  ? 43.714  -84.561  4.408   1.00 38.19  ? 61  THR A HA   1 
ATOM   911   H  HB   . THR A  1 81  ? 43.170  -85.626  7.198   1.00 48.14  ? 61  THR A HB   1 
ATOM   912   H  HG1  . THR A  1 81  ? 45.470  -85.333  7.403   1.00 45.10  ? 61  THR A HG1  1 
ATOM   913   H  HG21 . THR A  1 81  ? 44.857  -87.437  6.510   1.00 47.71  ? 61  THR A HG21 1 
ATOM   914   H  HG22 . THR A  1 81  ? 43.248  -87.588  5.814   1.00 47.36  ? 61  THR A HG22 1 
ATOM   915   H  HG23 . THR A  1 81  ? 44.577  -86.933  4.834   1.00 45.93  ? 61  THR A HG23 1 
ATOM   916   N  N    . ASP A  1 82  ? 41.907  -86.069  3.572   1.00 41.28  ? 62  ASP A N    1 
ATOM   917   C  CA   . ASP A  1 82  ? 40.839  -86.895  2.985   1.00 40.37  ? 62  ASP A CA   1 
ATOM   918   C  C    . ASP A  1 82  ? 41.436  -88.265  2.648   1.00 41.97  ? 62  ASP A C    1 
ATOM   919   O  O    . ASP A  1 82  ? 42.638  -88.465  2.815   1.00 38.44  ? 62  ASP A O    1 
ATOM   920   C  CB   . ASP A  1 82  ? 40.208  -86.209  1.746   1.00 42.32  ? 62  ASP A CB   1 
ATOM   921   C  CG   . ASP A  1 82  ? 41.150  -85.804  0.633   1.00 53.79  ? 62  ASP A CG   1 
ATOM   922   O  OD1  . ASP A  1 82  ? 42.345  -86.195  0.688   1.00 53.17  ? 62  ASP A OD1  1 
ATOM   923   O  OD2  . ASP A  1 82  ? 40.713  -85.038  -0.263  1.00 63.56  ? 62  ASP A OD2  1 
ATOM   924   H  H    . ASP A  1 82  ? 42.727  -85.997  2.978   1.00 41.18  ? 62  ASP A H    1 
ATOM   925   H  HA   . ASP A  1 82  ? 40.034  -87.052  3.700   1.00 38.88  ? 62  ASP A HA   1 
ATOM   926   H  HB2  . ASP A  1 82  ? 39.473  -86.884  1.312   1.00 43.10  ? 62  ASP A HB2  1 
ATOM   927   H  HB3  . ASP A  1 82  ? 39.706  -85.304  2.083   1.00 41.56  ? 62  ASP A HB3  1 
ATOM   928   N  N    . ASP A  1 83  ? 40.606  -89.202  2.193   1.00 42.13  ? 63  ASP A N    1 
ATOM   929   C  CA   . ASP A  1 83  ? 41.084  -90.543  1.873   1.00 43.91  ? 63  ASP A CA   1 
ATOM   930   C  C    . ASP A  1 83  ? 41.989  -90.551  0.642   1.00 45.40  ? 63  ASP A C    1 
ATOM   931   O  O    . ASP A  1 83  ? 42.855  -91.427  0.561   1.00 43.07  ? 63  ASP A O    1 
ATOM   932   C  CB   . ASP A  1 83  ? 39.922  -91.518  1.686   1.00 47.39  ? 63  ASP A CB   1 
ATOM   933   C  CG   . ASP A  1 83  ? 39.245  -91.994  2.985   1.00 59.41  ? 63  ASP A CG   1 
ATOM   934   O  OD1  . ASP A  1 83  ? 39.742  -91.662  4.069   1.00 58.81  ? 63  ASP A OD1  1 
ATOM   935   O  OD2  . ASP A  1 83  ? 38.253  -92.750  2.902   1.00 65.05  ? 63  ASP A OD2  1 
ATOM   936   H  H    . ASP A  1 83  ? 39.611  -89.060  2.051   1.00 42.84  ? 63  ASP A H    1 
ATOM   937   H  HA   . ASP A  1 83  ? 41.697  -90.914  2.691   1.00 43.65  ? 63  ASP A HA   1 
ATOM   938   H  HB2  . ASP A  1 83  ? 39.175  -91.024  1.067   1.00 47.36  ? 63  ASP A HB2  1 
ATOM   939   H  HB3  . ASP A  1 83  ? 40.312  -92.397  1.175   1.00 47.35  ? 63  ASP A HB3  1 
ATOM   940   N  N    . PHE A  1 84  ? 41.818  -89.598  -0.300  1.00 42.98  ? 64  PHE A N    1 
ATOM   941   C  CA   . PHE A  1 84  ? 42.711  -89.524  -1.455  1.00 42.04  ? 64  PHE A CA   1 
ATOM   942   C  C    . PHE A  1 84  ? 44.154  -89.262  -0.964  1.00 42.23  ? 64  PHE A C    1 
ATOM   943   O  O    . PHE A  1 84  ? 45.102  -89.885  -1.462  1.00 41.43  ? 64  PHE A O    1 
ATOM   944   C  CB   . PHE A  1 84  ? 42.266  -88.435  -2.459  1.00 45.21  ? 64  PHE A CB   1 
ATOM   945   C  CG   . PHE A  1 84  ? 43.122  -88.430  -3.707  1.00 47.34  ? 64  PHE A CG   1 
ATOM   946   C  CD1  . PHE A  1 84  ? 44.334  -87.749  -3.738  1.00 50.69  ? 64  PHE A CD1  1 
ATOM   947   C  CD2  . PHE A  1 84  ? 42.772  -89.189  -4.808  1.00 51.28  ? 64  PHE A CD2  1 
ATOM   948   C  CE1  . PHE A  1 84  ? 45.169  -87.823  -4.846  1.00 51.14  ? 64  PHE A CE1  1 
ATOM   949   C  CE2  . PHE A  1 84  ? 43.599  -89.244  -5.927  1.00 54.04  ? 64  PHE A CE2  1 
ATOM   950   C  CZ   . PHE A  1 84  ? 44.795  -88.563  -5.937  1.00 51.47  ? 64  PHE A CZ   1 
ATOM   951   H  H    . PHE A  1 84  ? 41.071  -88.913  -0.307  1.00 43.71  ? 64  PHE A H    1 
ATOM   952   H  HA   . PHE A  1 84  ? 42.704  -90.478  -1.978  1.00 41.05  ? 64  PHE A HA   1 
ATOM   953   H  HB2  . PHE A  1 84  ? 41.234  -88.631  -2.747  1.00 45.60  ? 64  PHE A HB2  1 
ATOM   954   H  HB3  . PHE A  1 84  ? 42.354  -87.456  -1.993  1.00 45.36  ? 64  PHE A HB3  1 
ATOM   955   H  HD1  . PHE A  1 84  ? 44.659  -87.185  -2.869  1.00 50.46  ? 64  PHE A HD1  1 
ATOM   956   H  HD2  . PHE A  1 84  ? 41.837  -89.747  -4.794  1.00 52.66  ? 64  PHE A HD2  1 
ATOM   957   H  HE1  . PHE A  1 84  ? 46.116  -87.288  -4.849  1.00 50.76  ? 64  PHE A HE1  1 
ATOM   958   H  HE2  . PHE A  1 84  ? 43.300  -89.836  -6.790  1.00 54.33  ? 64  PHE A HE2  1 
ATOM   959   H  HZ   . PHE A  1 84  ? 45.445  -88.618  -6.808  1.00 51.68  ? 64  PHE A HZ   1 
ATOM   960   N  N    . THR A  1 85  ? 44.309  -88.349  0.007   1.00 37.25  ? 65  THR A N    1 
ATOM   961   C  CA   . THR A  1 85  ? 45.609  -88.018  0.598   1.00 36.90  ? 65  THR A CA   1 
ATOM   962   C  C    . THR A  1 85  ? 46.231  -89.245  1.234   1.00 41.74  ? 65  THR A C    1 
ATOM   963   O  O    . THR A  1 85  ? 47.429  -89.485  1.066   1.00 39.80  ? 65  THR A O    1 
ATOM   964   C  CB   . THR A  1 85  ? 45.459  -86.903  1.658   1.00 41.58  ? 65  THR A CB   1 
ATOM   965   O  OG1  . THR A  1 85  ? 45.033  -85.707  1.019   1.00 45.45  ? 65  THR A OG1  1 
ATOM   966   C  CG2  . THR A  1 85  ? 46.742  -86.655  2.439   1.00 40.42  ? 65  THR A CG2  1 
ATOM   967   H  H    . THR A  1 85  ? 43.539  -87.818  0.405   1.00 38.20  ? 65  THR A H    1 
ATOM   968   H  HA   . THR A  1 85  ? 46.283  -87.664  -0.179  1.00 35.98  ? 65  THR A HA   1 
ATOM   969   H  HB   . THR A  1 85  ? 44.701  -87.193  2.384   1.00 41.99  ? 65  THR A HB   1 
ATOM   970   H  HG1  . THR A  1 85  ? 44.047  -85.605  1.092   1.00 46.22  ? 65  THR A HG1  1 
ATOM   971   H  HG21 . THR A  1 85  ? 46.559  -85.877  3.178   1.00 41.01  ? 65  THR A HG21 1 
ATOM   972   H  HG22 . THR A  1 85  ? 47.052  -87.542  2.991   1.00 41.11  ? 65  THR A HG22 1 
ATOM   973   H  HG23 . THR A  1 85  ? 47.547  -86.353  1.773   1.00 38.28  ? 65  THR A HG23 1 
ATOM   974   N  N    . ARG A  1 86  ? 45.432  -89.997  1.990   1.00 41.93  ? 66  ARG A N    1 
ATOM   975   C  CA   . ARG A  1 86  ? 45.920  -91.202  2.678   1.00 43.53  ? 66  ARG A CA   1 
ATOM   976   C  C    . ARG A  1 86  ? 46.508  -92.225  1.677   1.00 50.22  ? 66  ARG A C    1 
ATOM   977   O  O    . ARG A  1 86  ? 47.505  -92.877  1.990   1.00 50.05  ? 66  ARG A O    1 
ATOM   978   C  CB   . ARG A  1 86  ? 44.813  -91.851  3.530   1.00 42.47  ? 66  ARG A CB   1 
ATOM   979   C  CG   . ARG A  1 86  ? 44.436  -91.038  4.772   1.00 44.38  ? 66  ARG A CG   1 
ATOM   980   C  CD   . ARG A  1 86  ? 43.220  -91.607  5.505   1.00 49.58  ? 66  ARG A CD   1 
ATOM   981   N  NE   . ARG A  1 86  ? 42.409  -90.546  6.121   1.00 68.83  ? 66  ARG A NE   1 
ATOM   982   C  CZ   . ARG A  1 86  ? 42.630  -89.986  7.306   1.00 84.14  ? 66  ARG A CZ   1 
ATOM   983   N  NH1  . ARG A  1 86  ? 43.654  -90.376  8.055   1.00 73.19  ? 66  ARG A NH1  1 
ATOM   984   N  NH2  . ARG A  1 86  ? 41.825  -89.028  7.752   1.00 72.52  ? 66  ARG A NH2  1 
ATOM   985   H  H    . ARG A  1 86  ? 44.453  -89.791  2.166   1.00 42.57  ? 66  ARG A H    1 
ATOM   986   H  HA   . ARG A  1 86  ? 46.710  -90.896  3.359   1.00 43.19  ? 66  ARG A HA   1 
ATOM   987   H  HB2  . ARG A  1 86  ? 43.919  -91.962  2.917   1.00 43.05  ? 66  ARG A HB2  1 
ATOM   988   H  HB3  . ARG A  1 86  ? 45.157  -92.832  3.853   1.00 41.78  ? 66  ARG A HB3  1 
ATOM   989   H  HG2  . ARG A  1 86  ? 45.274  -91.051  5.466   1.00 44.66  ? 66  ARG A HG2  1 
ATOM   990   H  HG3  . ARG A  1 86  ? 44.212  -90.012  4.487   1.00 42.41  ? 66  ARG A HG3  1 
ATOM   991   H  HD2  . ARG A  1 86  ? 42.585  -92.117  4.784   1.00 48.80  ? 66  ARG A HD2  1 
ATOM   992   H  HD3  . ARG A  1 86  ? 43.531  -92.332  6.254   1.00 50.10  ? 66  ARG A HD3  1 
ATOM   993   H  HE   . ARG A  1 86  ? 41.610  -90.210  5.597   1.00 68.77  ? 66  ARG A HE   1 
ATOM   994   H  HH11 . ARG A  1 86  ? 44.302  -91.094  7.749   1.00 72.80  ? 66  ARG A HH11 1 
ATOM   995   H  HH12 . ARG A  1 86  ? 43.810  -89.935  8.955   1.00 73.31  ? 66  ARG A HH12 1 
ATOM   996   H  HH21 . ARG A  1 86  ? 41.030  -88.720  7.203   1.00 72.52  ? 66  ARG A HH21 1 
ATOM   997   H  HH22 . ARG A  1 86  ? 41.988  -88.603  8.658   1.00 72.74  ? 66  ARG A HH22 1 
ATOM   998   N  N    . GLY A  1 87  ? 45.944  -92.290  0.464   1.00 46.84  ? 67  GLY A N    1 
ATOM   999   C  CA   . GLY A  1 87  ? 46.430  -93.184  -0.583  1.00 44.10  ? 67  GLY A CA   1 
ATOM   1000  C  C    . GLY A  1 87  ? 47.825  -92.875  -1.099  1.00 46.16  ? 67  GLY A C    1 
ATOM   1001  O  O    . GLY A  1 87  ? 48.502  -93.776  -1.603  1.00 45.85  ? 67  GLY A O    1 
ATOM   1002  H  H    . GLY A  1 87  ? 45.139  -91.744  0.172   1.00 47.03  ? 67  GLY A H    1 
ATOM   1003  H  HA2  . GLY A  1 87  ? 46.443  -94.198  -0.186  1.00 44.61  ? 67  GLY A HA2  1 
ATOM   1004  H  HA3  . GLY A  1 87  ? 45.738  -93.159  -1.423  1.00 42.54  ? 67  GLY A HA3  1 
ATOM   1005  N  N    . VAL A  1 88  ? 48.285  -91.612  -0.970  1.00 42.33  ? 68  VAL A N    1 
ATOM   1006  C  CA   . VAL A  1 88  ? 49.616  -91.221  -1.435  1.00 40.43  ? 68  VAL A CA   1 
ATOM   1007  C  C    . VAL A  1 88  ? 50.600  -91.094  -0.251  1.00 38.60  ? 68  VAL A C    1 
ATOM   1008  O  O    . VAL A  1 88  ? 51.730  -90.661  -0.458  1.00 37.67  ? 68  VAL A O    1 
ATOM   1009  C  CB   . VAL A  1 88  ? 49.599  -89.936  -2.340  1.00 44.23  ? 68  VAL A CB   1 
ATOM   1010  C  CG1  . VAL A  1 88  ? 48.735  -90.167  -3.580  1.00 44.63  ? 68  VAL A CG1  1 
ATOM   1011  C  CG2  . VAL A  1 88  ? 49.139  -88.693  -1.602  1.00 43.32  ? 68  VAL A CG2  1 
ATOM   1012  H  H    . VAL A  1 88  ? 47.759  -90.857  -0.544  1.00 42.76  ? 68  VAL A H    1 
ATOM   1013  H  HA   . VAL A  1 88  ? 50.021  -92.003  -2.075  1.00 40.13  ? 68  VAL A HA   1 
ATOM   1014  H  HB   . VAL A  1 88  ? 50.616  -89.746  -2.683  1.00 43.57  ? 68  VAL A HB   1 
ATOM   1015  H  HG11 . VAL A  1 88  ? 48.789  -89.278  -4.206  1.00 45.14  ? 68  VAL A HG11 1 
ATOM   1016  H  HG12 . VAL A  1 88  ? 49.120  -91.027  -4.124  1.00 43.72  ? 68  VAL A HG12 1 
ATOM   1017  H  HG13 . VAL A  1 88  ? 47.703  -90.341  -3.275  1.00 45.42  ? 68  VAL A HG13 1 
ATOM   1018  H  HG21 . VAL A  1 88  ? 49.246  -87.847  -2.279  1.00 42.39  ? 68  VAL A HG21 1 
ATOM   1019  H  HG22 . VAL A  1 88  ? 48.091  -88.798  -1.329  1.00 43.99  ? 68  VAL A HG22 1 
ATOM   1020  H  HG23 . VAL A  1 88  ? 49.758  -88.529  -0.723  1.00 42.00  ? 68  VAL A HG23 1 
ATOM   1021  N  N    . ASP A  1 89  ? 50.229  -91.537  0.957   1.00 36.98  ? 69  ASP A N    1 
ATOM   1022  C  CA   . ASP A  1 89  ? 51.165  -91.492  2.091   1.00 35.25  ? 69  ASP A CA   1 
ATOM   1023  C  C    . ASP A  1 89  ? 52.411  -92.323  1.806   1.00 37.33  ? 69  ASP A C    1 
ATOM   1024  O  O    . ASP A  1 89  ? 52.286  -93.403  1.239   1.00 35.91  ? 69  ASP A O    1 
ATOM   1025  C  CB   . ASP A  1 89  ? 50.539  -92.068  3.381   1.00 35.31  ? 69  ASP A CB   1 
ATOM   1026  C  CG   . ASP A  1 89  ? 49.377  -91.318  4.002   1.00 41.30  ? 69  ASP A CG   1 
ATOM   1027  O  OD1  . ASP A  1 89  ? 49.227  -90.092  3.718   1.00 40.87  ? 69  ASP A OD1  1 
ATOM   1028  O  OD2  . ASP A  1 89  ? 48.621  -91.943  4.801   1.00 46.69  ? 69  ASP A OD2  1 
ATOM   1029  H  H    . ASP A  1 89  ? 49.328  -91.941  1.191   1.00 37.47  ? 69  ASP A H    1 
ATOM   1030  H  HA   . ASP A  1 89  ? 51.464  -90.461  2.276   1.00 36.13  ? 69  ASP A HA   1 
ATOM   1031  H  HB2  . ASP A  1 89  ? 50.187  -93.076  3.161   1.00 34.90  ? 69  ASP A HB2  1 
ATOM   1032  H  HB3  . ASP A  1 89  ? 51.317  -92.121  4.140   1.00 33.61  ? 69  ASP A HB3  1 
ATOM   1033  N  N    . ALA A  1 90  ? 53.583  -91.853  2.267   1.00 31.94  ? 70  ALA A N    1 
ATOM   1034  C  CA   . ALA A  1 90  ? 54.791  -92.654  2.264   1.00 30.09  ? 70  ALA A CA   1 
ATOM   1035  C  C    . ALA A  1 90  ? 54.640  -93.634  3.427   1.00 34.98  ? 70  ALA A C    1 
ATOM   1036  O  O    . ALA A  1 90  ? 54.048  -93.279  4.442   1.00 37.24  ? 70  ALA A O    1 
ATOM   1037  C  CB   . ALA A  1 90  ? 56.036  -91.797  2.424   1.00 30.30  ? 70  ALA A CB   1 
ATOM   1038  H  H    . ALA A  1 90  ? 53.688  -90.933  2.682   1.00 31.20  ? 70  ALA A H    1 
ATOM   1039  H  HA   . ALA A  1 90  ? 54.863  -93.205  1.331   1.00 28.45  ? 70  ALA A HA   1 
ATOM   1040  H  HB1  . ALA A  1 90  ? 56.889  -92.454  2.591   1.00 30.97  ? 70  ALA A HB1  1 
ATOM   1041  H  HB2  . ALA A  1 90  ? 56.193  -91.232  1.507   1.00 28.94  ? 70  ALA A HB2  1 
ATOM   1042  H  HB3  . ALA A  1 90  ? 55.920  -91.131  3.278   1.00 30.30  ? 70  ALA A HB3  1 
ATOM   1043  N  N    . LEU A  1 91  ? 55.108  -94.873  3.275   1.00 32.86  ? 71  LEU A N    1 
ATOM   1044  C  CA   . LEU A  1 91  ? 54.915  -95.887  4.289   1.00 32.81  ? 71  LEU A CA   1 
ATOM   1045  C  C    . LEU A  1 91  ? 56.200  -96.531  4.742   1.00 37.30  ? 71  LEU A C    1 
ATOM   1046  O  O    . LEU A  1 91  ? 56.979  -96.994  3.907   1.00 36.17  ? 71  LEU A O    1 
ATOM   1047  C  CB   . LEU A  1 91  ? 53.990  -96.988  3.741   1.00 33.06  ? 71  LEU A CB   1 
ATOM   1048  C  CG   . LEU A  1 91  ? 52.573  -96.555  3.351   1.00 37.81  ? 71  LEU A CG   1 
ATOM   1049  C  CD1  . LEU A  1 91  ? 51.849  -97.675  2.660   1.00 38.45  ? 71  LEU A CD1  1 
ATOM   1050  C  CD2  . LEU A  1 91  ? 51.771  -96.104  4.558   1.00 38.24  ? 71  LEU A CD2  1 
ATOM   1051  H  H    . LEU A  1 91  ? 55.628  -95.192  2.463   1.00 33.99  ? 71  LEU A H    1 
ATOM   1052  H  HA   . LEU A  1 91  ? 54.431  -95.463  5.166   1.00 33.08  ? 71  LEU A HA   1 
ATOM   1053  H  HB2  . LEU A  1 91  ? 54.465  -97.432  2.870   1.00 27.70  ? 71  LEU A HB2  1 
ATOM   1054  H  HB3  . LEU A  1 91  ? 53.885  -97.750  4.516   1.00 35.41  ? 71  LEU A HB3  1 
ATOM   1055  H  HG   . LEU A  1 91  ? 52.634  -95.719  2.658   1.00 37.18  ? 71  LEU A HG   1 
ATOM   1056  H  HD11 . LEU A  1 91  ? 50.904  -97.300  2.271   1.00 38.50  ? 71  LEU A HD11 1 
ATOM   1057  H  HD12 . LEU A  1 91  ? 52.463  -98.060  1.850   1.00 38.13  ? 71  LEU A HD12 1 
ATOM   1058  H  HD13 . LEU A  1 91  ? 51.661  -98.470  3.383   1.00 40.00  ? 71  LEU A HD13 1 
ATOM   1059  H  HD21 . LEU A  1 91  ? 50.725  -96.001  4.275   1.00 37.79  ? 71  LEU A HD21 1 
ATOM   1060  H  HD22 . LEU A  1 91  ? 51.875  -96.835  5.357   1.00 38.39  ? 71  LEU A HD22 1 
ATOM   1061  H  HD23 . LEU A  1 91  ? 52.144  -95.137  4.893   1.00 38.95  ? 71  LEU A HD23 1 
ATOM   1062  N  N    . VAL A  1 92  ? 56.359  -96.669  6.076   1.00 36.39  ? 72  VAL A N    1 
ATOM   1063  C  CA   . VAL A  1 92  ? 57.451  -97.431  6.684   1.00 36.91  ? 72  VAL A CA   1 
ATOM   1064  C  C    . VAL A  1 92  ? 57.111  -98.926  6.457   1.00 38.02  ? 72  VAL A C    1 
ATOM   1065  O  O    . VAL A  1 92  ? 56.116  -99.355  6.984   1.00 38.26  ? 72  VAL A O    1 
ATOM   1066  C  CB   . VAL A  1 92  ? 57.605  -97.120  8.190   1.00 41.20  ? 72  VAL A CB   1 
ATOM   1067  C  CG1  . VAL A  1 92  ? 58.754  -97.934  8.791   1.00 40.16  ? 72  VAL A CG1  1 
ATOM   1068  C  CG2  . VAL A  1 92  ? 57.793  -95.637  8.444   1.00 40.76  ? 72  VAL A CG2  1 
ATOM   1069  H  H    . VAL A  1 92  ? 55.699  -96.311  6.759   1.00 36.50  ? 72  VAL A H    1 
ATOM   1070  H  HA   . VAL A  1 92  ? 58.388  -97.188  6.187   1.00 37.74  ? 72  VAL A HA   1 
ATOM   1071  H  HB   . VAL A  1 92  ? 56.693  -97.412  8.709   1.00 42.29  ? 72  VAL A HB   1 
ATOM   1072  H  HG11 . VAL A  1 92  ? 59.027  -97.502  9.751   1.00 39.56  ? 72  VAL A HG11 1 
ATOM   1073  H  HG12 . VAL A  1 92  ? 58.432  -98.965  8.924   1.00 39.99  ? 72  VAL A HG12 1 
ATOM   1074  H  HG13 . VAL A  1 92  ? 59.603  -97.899  8.110   1.00 40.89  ? 72  VAL A HG13 1 
ATOM   1075  H  HG21 . VAL A  1 92  ? 57.662  -95.489  9.515   1.00 41.14  ? 72  VAL A HG21 1 
ATOM   1076  H  HG22 . VAL A  1 92  ? 58.800  -95.351  8.144   1.00 39.74  ? 72  VAL A HG22 1 
ATOM   1077  H  HG23 . VAL A  1 92  ? 57.054  -95.044  7.909   1.00 40.70  ? 72  VAL A HG23 1 
ATOM   1078  N  N    . TYR A  1 93  ? 57.821  -99.658  5.587   1.00 36.30  ? 73  TYR A N    1 
ATOM   1079  C  CA   . TYR A  1 93  ? 57.471  -101.053 5.273   1.00 35.51  ? 73  TYR A CA   1 
ATOM   1080  C  C    . TYR A  1 93  ? 58.427  -102.067 5.900   1.00 40.39  ? 73  TYR A C    1 
ATOM   1081  O  O    . TYR A  1 93  ? 58.128  -103.255 5.895   1.00 37.91  ? 73  TYR A O    1 
ATOM   1082  C  CB   . TYR A  1 93  ? 57.393  -101.282 3.732   1.00 34.44  ? 73  TYR A CB   1 
ATOM   1083  C  CG   . TYR A  1 93  ? 58.707  -101.212 2.998   1.00 35.19  ? 73  TYR A CG   1 
ATOM   1084  C  CD1  . TYR A  1 93  ? 59.461  -102.357 2.770   1.00 39.88  ? 73  TYR A CD1  1 
ATOM   1085  C  CD2  . TYR A  1 93  ? 59.148  -100.020 2.420   1.00 33.37  ? 73  TYR A CD2  1 
ATOM   1086  C  CE1  . TYR A  1 93  ? 60.676  -102.297 2.082   1.00 39.94  ? 73  TYR A CE1  1 
ATOM   1087  C  CE2  . TYR A  1 93  ? 60.362  -99.948  1.741   1.00 33.20  ? 73  TYR A CE2  1 
ATOM   1088  C  CZ   . TYR A  1 93  ? 61.108  -101.092 1.547   1.00 40.09  ? 73  TYR A CZ   1 
ATOM   1089  O  OH   . TYR A  1 93  ? 62.303  -100.990 0.892   1.00 44.79  ? 73  TYR A OH   1 
ATOM   1090  H  H    . TYR A  1 93  ? 58.635  -99.303  5.095   1.00 35.27  ? 73  TYR A H    1 
ATOM   1091  H  HA   . TYR A  1 93  ? 56.490  -101.306 5.666   1.00 34.28  ? 73  TYR A HA   1 
ATOM   1092  H  HB2  . TYR A  1 93  ? 57.000  -102.284 3.570   1.00 33.06  ? 73  TYR A HB2  1 
ATOM   1093  H  HB3  . TYR A  1 93  ? 56.716  -100.542 3.306   1.00 33.20  ? 73  TYR A HB3  1 
ATOM   1094  H  HD1  . TYR A  1 93  ? 59.128  -103.305 3.190   1.00 40.50  ? 73  TYR A HD1  1 
ATOM   1095  H  HD2  . TYR A  1 93  ? 58.569  -99.111  2.572   1.00 32.93  ? 73  TYR A HD2  1 
ATOM   1096  H  HE1  . TYR A  1 93  ? 61.272  -103.199 1.966   1.00 40.65  ? 73  TYR A HE1  1 
ATOM   1097  H  HE2  . TYR A  1 93  ? 60.717  -99.002  1.336   1.00 32.94  ? 73  TYR A HE2  1 
ATOM   1098  H  HH   . TYR A  1 93  ? 62.872  -101.785 1.068   1.00 45.61  ? 73  TYR A HH   1 
ATOM   1099  N  N    . GLU A  1 94  ? 59.573  -101.624 6.407   1.00 39.28  ? 74  GLU A N    1 
ATOM   1100  C  CA   . GLU A  1 94  ? 60.531  -102.528 7.013   1.00 41.53  ? 74  GLU A CA   1 
ATOM   1101  C  C    . GLU A  1 94  ? 61.383  -101.766 8.021   1.00 46.73  ? 74  GLU A C    1 
ATOM   1102  O  O    . GLU A  1 94  ? 61.867  -100.677 7.709   1.00 45.22  ? 74  GLU A O    1 
ATOM   1103  C  CB   . GLU A  1 94  ? 61.411  -103.145 5.924   1.00 42.97  ? 74  GLU A CB   1 
ATOM   1104  C  CG   . GLU A  1 94  ? 62.178  -104.383 6.328   1.00 53.21  ? 74  GLU A CG   1 
ATOM   1105  C  CD   . GLU A  1 94  ? 62.967  -104.959 5.167   1.00 70.10  ? 74  GLU A CD   1 
ATOM   1106  O  OE1  . GLU A  1 94  ? 64.212  -105.040 5.285   1.00 69.73  ? 74  GLU A OE1  1 
ATOM   1107  O  OE2  . GLU A  1 94  ? 62.353  -105.279 4.122   1.00 51.99  ? 74  GLU A OE2  1 
ATOM   1108  H  H    . GLU A  1 94  ? 59.877  -100.656 6.420   1.00 39.16  ? 74  GLU A H    1 
ATOM   1109  H  HA   . GLU A  1 94  ? 60.009  -103.333 7.530   1.00 41.22  ? 74  GLU A HA   1 
ATOM   1110  H  HB2  . GLU A  1 94  ? 60.786  -103.414 5.074   1.00 43.45  ? 74  GLU A HB2  1 
ATOM   1111  H  HB3  . GLU A  1 94  ? 62.154  -102.414 5.617   1.00 42.88  ? 74  GLU A HB3  1 
ATOM   1112  H  HG2  . GLU A  1 94  ? 62.878  -104.121 7.118   1.00 52.96  ? 74  GLU A HG2  1 
ATOM   1113  H  HG3  . GLU A  1 94  ? 61.478  -105.138 6.681   1.00 53.35  ? 74  GLU A HG3  1 
ATOM   1114  N  N    . VAL A  1 95  ? 61.523  -102.325 9.232   1.00 42.62  ? 75  VAL A N    1 
ATOM   1115  C  CA   . VAL A  1 95  ? 62.362  -101.788 10.265  1.00 41.97  ? 75  VAL A CA   1 
ATOM   1116  C  C    . VAL A  1 95  ? 63.224  -102.926 10.847  1.00 51.09  ? 75  VAL A C    1 
ATOM   1117  O  O    . VAL A  1 95  ? 62.887  -104.113 10.740  1.00 49.96  ? 75  VAL A O    1 
ATOM   1118  C  CB   . VAL A  1 95  ? 61.572  -101.063 11.390  1.00 46.74  ? 75  VAL A CB   1 
ATOM   1119  C  CG1  . VAL A  1 95  ? 60.953  -99.776  10.891  1.00 45.06  ? 75  VAL A CG1  1 
ATOM   1120  C  CG2  . VAL A  1 95  ? 60.517  -101.972 12.034  1.00 46.92  ? 75  VAL A CG2  1 
ATOM   1121  H  H    . VAL A  1 95  ? 61.068  -103.193 9.500   1.00 43.54  ? 75  VAL A H    1 
ATOM   1122  H  HA   . VAL A  1 95  ? 63.037  -101.057 9.831   1.00 40.60  ? 75  VAL A HA   1 
ATOM   1123  H  HB   . VAL A  1 95  ? 62.271  -100.808 12.185  1.00 47.72  ? 75  VAL A HB   1 
ATOM   1124  H  HG11 . VAL A  1 95  ? 60.444  -99.293  11.724  1.00 45.08  ? 75  VAL A HG11 1 
ATOM   1125  H  HG12 . VAL A  1 95  ? 61.744  -99.138  10.503  1.00 44.75  ? 75  VAL A HG12 1 
ATOM   1126  H  HG13 . VAL A  1 95  ? 60.239  -100.024 10.109  1.00 45.18  ? 75  VAL A HG13 1 
ATOM   1127  H  HG21 . VAL A  1 95  ? 59.995  -101.405 12.801  1.00 45.35  ? 75  VAL A HG21 1 
ATOM   1128  H  HG22 . VAL A  1 95  ? 59.809  -102.297 11.272  1.00 47.40  ? 75  VAL A HG22 1 
ATOM   1129  H  HG23 . VAL A  1 95  ? 60.997  -102.838 12.489  1.00 47.45  ? 75  VAL A HG23 1 
ATOM   1130  N  N    . ASP A  1 96  ? 64.344  -102.532 11.458  1.00 50.01  ? 76  ASP A N    1 
ATOM   1131  C  CA   . ASP A  1 96  ? 65.260  -103.421 12.172  1.00 49.42  ? 76  ASP A CA   1 
ATOM   1132  C  C    . ASP A  1 96  ? 65.966  -102.535 13.180  1.00 50.53  ? 76  ASP A C    1 
ATOM   1133  O  O    . ASP A  1 96  ? 67.055  -102.015 12.910  1.00 46.30  ? 76  ASP A O    1 
ATOM   1134  C  CB   . ASP A  1 96  ? 66.211  -104.149 11.204  1.00 51.51  ? 76  ASP A CB   1 
ATOM   1135  C  CG   . ASP A  1 96  ? 67.136  -105.149 11.880  1.00 69.68  ? 76  ASP A CG   1 
ATOM   1136  O  OD1  . ASP A  1 96  ? 66.925  -105.450 13.062  1.00 71.66  ? 76  ASP A OD1  1 
ATOM   1137  O  OD2  . ASP A  1 96  ? 68.096  -105.595 11.231  1.00 81.39  ? 76  ASP A OD2  1 
ATOM   1138  H  H    . ASP A  1 96  ? 64.655  -101.565 11.439  1.00 50.38  ? 76  ASP A H    1 
ATOM   1139  H  HA   . ASP A  1 96  ? 64.683  -104.171 12.709  1.00 50.19  ? 76  ASP A HA   1 
ATOM   1140  H  HB2  . ASP A  1 96  ? 65.619  -104.684 10.463  1.00 50.81  ? 76  ASP A HB2  1 
ATOM   1141  H  HB3  . ASP A  1 96  ? 66.849  -103.430 10.695  1.00 50.08  ? 76  ASP A HB3  1 
ATOM   1142  N  N    . GLU A  1 97  ? 65.260  -102.269 14.317  1.00 50.98  ? 77  GLU A N    1 
ATOM   1143  C  CA   . GLU A  1 97  ? 65.704  -101.359 15.390  1.00 50.12  ? 77  GLU A CA   1 
ATOM   1144  C  C    . GLU A  1 97  ? 67.077  -101.766 15.966  1.00 55.55  ? 77  GLU A C    1 
ATOM   1145  O  O    . GLU A  1 97  ? 67.828  -100.869 16.380  1.00 55.53  ? 77  GLU A O    1 
ATOM   1146  C  CB   . GLU A  1 97  ? 64.648  -101.247 16.501  1.00 51.25  ? 77  GLU A CB   1 
ATOM   1147  C  CG   . GLU A  1 97  ? 64.966  -100.224 17.604  1.00 62.29  ? 77  GLU A CG   1 
ATOM   1148  C  CD   . GLU A  1 97  ? 63.969  -100.121 18.748  1.00 80.01  ? 77  GLU A CD   1 
ATOM   1149  O  OE1  . GLU A  1 97  ? 62.932  -100.822 18.698  1.00 78.95  ? 77  GLU A OE1  1 
ATOM   1150  O  OE2  . GLU A  1 97  ? 64.213  -99.328  19.690  1.00 62.93  ? 77  GLU A OE2  1 
ATOM   1151  H  H    . GLU A  1 97  ? 64.362  -102.698 14.518  1.00 51.96  ? 77  GLU A H    1 
ATOM   1152  H  HA   . GLU A  1 97  ? 65.822  -100.363 14.966  1.00 51.30  ? 77  GLU A HA   1 
ATOM   1153  H  HB2  . GLU A  1 97  ? 63.704  -100.961 16.039  1.00 49.81  ? 77  GLU A HB2  1 
ATOM   1154  H  HB3  . GLU A  1 97  ? 64.541  -102.222 16.972  1.00 52.55  ? 77  GLU A HB3  1 
ATOM   1155  H  HG2  . GLU A  1 97  ? 65.919  -100.468 18.067  1.00 62.52  ? 77  GLU A HG2  1 
ATOM   1156  H  HG3  . GLU A  1 97  ? 65.043  -99.237  17.154  1.00 62.02  ? 77  GLU A HG3  1 
ATOM   1157  N  N    . ALA A  1 98  ? 67.432  -103.082 15.956  1.00 51.57  ? 78  ALA A N    1 
ATOM   1158  C  CA   . ALA A  1 98  ? 68.747  -103.520 16.436  1.00 51.54  ? 78  ALA A CA   1 
ATOM   1159  C  C    . ALA A  1 98  ? 69.877  -102.982 15.555  1.00 51.39  ? 78  ALA A C    1 
ATOM   1160  O  O    . ALA A  1 98  ? 70.935  -102.657 16.077  1.00 50.45  ? 78  ALA A O    1 
ATOM   1161  C  CB   . ALA A  1 98  ? 68.812  -105.037 16.499  1.00 53.17  ? 78  ALA A CB   1 
ATOM   1162  H  H    . ALA A  1 98  ? 66.826  -103.845 15.671  1.00 50.47  ? 78  ALA A H    1 
ATOM   1163  H  HA   . ALA A  1 98  ? 68.902  -103.138 17.444  1.00 52.32  ? 78  ALA A HA   1 
ATOM   1164  H  HB1  . ALA A  1 98  ? 69.806  -105.337 16.829  1.00 53.83  ? 78  ALA A HB1  1 
ATOM   1165  H  HB2  . ALA A  1 98  ? 68.071  -105.389 17.216  1.00 54.37  ? 78  ALA A HB2  1 
ATOM   1166  H  HB3  . ALA A  1 98  ? 68.598  -105.454 15.516  1.00 52.32  ? 78  ALA A HB3  1 
ATOM   1167  N  N    . ASN A  1 99  ? 69.628  -102.826 14.235  1.00 46.28  ? 79  ASN A N    1 
ATOM   1168  C  CA   . ASN A  1 99  ? 70.601  -102.296 13.281  1.00 44.22  ? 79  ASN A CA   1 
ATOM   1169  C  C    . ASN A  1 99  ? 70.251  -100.851 12.840  1.00 46.04  ? 79  ASN A C    1 
ATOM   1170  O  O    . ASN A  1 99  ? 70.851  -100.335 11.894  1.00 43.02  ? 79  ASN A O    1 
ATOM   1171  C  CB   . ASN A  1 99  ? 70.685  -103.230 12.071  1.00 41.81  ? 79  ASN A CB   1 
ATOM   1172  C  CG   . ASN A  1 99  ? 71.317  -104.548 12.450  1.00 72.71  ? 79  ASN A CG   1 
ATOM   1173  O  OD1  . ASN A  1 99  ? 72.392  -104.589 13.051  1.00 73.93  ? 79  ASN A OD1  1 
ATOM   1174  N  ND2  . ASN A  1 99  ? 70.691  -105.659 12.111  1.00 64.70  ? 79  ASN A ND2  1 
ATOM   1175  H  H    . ASN A  1 99  ? 68.749  -103.075 13.794  1.00 46.02  ? 79  ASN A H    1 
ATOM   1176  H  HA   . ASN A  1 99  ? 71.591  -102.248 13.730  1.00 44.09  ? 79  ASN A HA   1 
ATOM   1177  H  HB2  . ASN A  1 99  ? 69.684  -103.399 11.677  1.00 40.88  ? 79  ASN A HB2  1 
ATOM   1178  H  HB3  . ASN A  1 99  ? 71.297  -102.772 11.293  1.00 41.18  ? 79  ASN A HB3  1 
ATOM   1179  H  HD21 . ASN A  1 99  ? 71.099  -106.556 12.355  1.00 64.84  ? 79  ASN A HD21 1 
ATOM   1180  H  HD22 . ASN A  1 99  ? 69.832  -105.622 11.573  1.00 64.57  ? 79  ASN A HD22 1 
ATOM   1181  N  N    . SER A  1 100 ? 69.313  -100.201 13.550  1.00 42.57  ? 80  SER A N    1 
ATOM   1182  C  CA   . SER A  1 100 ? 68.888  -98.819  13.299  1.00 42.11  ? 80  SER A CA   1 
ATOM   1183  C  C    . SER A  1 100 ? 68.375  -98.624  11.848  1.00 41.02  ? 80  SER A C    1 
ATOM   1184  O  O    . SER A  1 100 ? 68.448  -97.519  11.341  1.00 38.84  ? 80  SER A O    1 
ATOM   1185  C  CB   . SER A  1 100 ? 70.053  -97.870  13.593  1.00 48.11  ? 80  SER A CB   1 
ATOM   1186  O  OG   . SER A  1 100 ? 70.501  -98.000  14.928  1.00 52.25  ? 80  SER A OG   1 
ATOM   1187  H  H    . SER A  1 100 ? 68.814  -100.592 14.339  1.00 41.77  ? 80  SER A H    1 
ATOM   1188  H  HA   . SER A  1 100 ? 68.071  -98.574  13.976  1.00 41.83  ? 80  SER A HA   1 
ATOM   1189  H  HB2  . SER A  1 100 ? 70.889  -98.094  12.932  1.00 49.16  ? 80  SER A HB2  1 
ATOM   1190  H  HB3  . SER A  1 100 ? 69.746  -96.839  13.437  1.00 49.18  ? 80  SER A HB3  1 
ATOM   1191  H  HG   . SER A  1 100 ? 71.050  -97.215  15.185  1.00 52.38  ? 80  SER A HG   1 
ATOM   1192  N  N    . LEU A  1 101 ? 67.823  -99.685  11.223  1.00 38.33  ? 81  LEU A N    1 
ATOM   1193  C  CA   . LEU A  1 101 ? 67.382  -99.676  9.842   1.00 37.90  ? 81  LEU A CA   1 
ATOM   1194  C  C    . LEU A  1 101 ? 65.900  -99.353  9.724   1.00 42.72  ? 81  LEU A C    1 
ATOM   1195  O  O    . LEU A  1 101 ? 65.080  -99.891  10.446  1.00 42.23  ? 81  LEU A O    1 
ATOM   1196  C  CB   . LEU A  1 101 ? 67.672  -101.012 9.180   1.00 37.44  ? 81  LEU A CB   1 
ATOM   1197  C  CG   . LEU A  1 101 ? 67.337  -101.138 7.676   1.00 42.31  ? 81  LEU A CG   1 
ATOM   1198  C  CD1  . LEU A  1 101 ? 68.155  -100.146 6.814   1.00 42.11  ? 81  LEU A CD1  1 
ATOM   1199  C  CD2  . LEU A  1 101 ? 67.556  -102.550 7.201   1.00 43.34  ? 81  LEU A CD2  1 
ATOM   1200  H  H    . LEU A  1 101 ? 67.628  -100.570 11.679  1.00 39.78  ? 81  LEU A H    1 
ATOM   1201  H  HA   . LEU A  1 101 ? 67.955  -98.923  9.304   1.00 38.73  ? 81  LEU A HA   1 
ATOM   1202  H  HB2  . LEU A  1 101 ? 68.728  -101.246 9.316   1.00 37.12  ? 81  LEU A HB2  1 
ATOM   1203  H  HB3  . LEU A  1 101 ? 67.055  -101.744 9.689   1.00 36.91  ? 81  LEU A HB3  1 
ATOM   1204  H  HG   . LEU A  1 101 ? 66.286  -100.905 7.509   1.00 42.70  ? 81  LEU A HG   1 
ATOM   1205  H  HD11 . LEU A  1 101 ? 68.134  -100.461 5.771   1.00 41.72  ? 81  LEU A HD11 1 
ATOM   1206  H  HD12 . LEU A  1 101 ? 67.710  -99.156  6.895   1.00 42.30  ? 81  LEU A HD12 1 
ATOM   1207  H  HD13 . LEU A  1 101 ? 69.181  -100.124 7.179   1.00 42.47  ? 81  LEU A HD13 1 
ATOM   1208  H  HD21 . LEU A  1 101 ? 67.254  -102.619 6.154   1.00 44.15  ? 81  LEU A HD21 1 
ATOM   1209  H  HD22 . LEU A  1 101 ? 68.613  -102.795 7.295   1.00 43.19  ? 81  LEU A HD22 1 
ATOM   1210  H  HD23 . LEU A  1 101 ? 66.954  -103.216 7.816   1.00 42.17  ? 81  LEU A HD23 1 
ATOM   1211  N  N    . MET A  1 102 ? 65.574  -98.486  8.786   1.00 39.83  ? 82  MET A N    1 
ATOM   1212  C  CA   . MET A  1 102 ? 64.212  -98.043  8.483   1.00 38.92  ? 82  MET A CA   1 
ATOM   1213  C  C    . MET A  1 102 ? 64.128  -97.927  6.980   1.00 39.63  ? 82  MET A C    1 
ATOM   1214  O  O    . MET A  1 102 ? 64.956  -97.238  6.419   1.00 38.55  ? 82  MET A O    1 
ATOM   1215  C  CB   . MET A  1 102 ? 63.975  -96.675  9.178   1.00 40.61  ? 82  MET A CB   1 
ATOM   1216  C  CG   . MET A  1 102 ? 62.799  -95.893  8.669   1.00 42.80  ? 82  MET A CG   1 
ATOM   1217  S  SD   . MET A  1 102 ? 62.708  -94.263  9.443   1.00 46.00  ? 82  MET A SD   1 
ATOM   1218  C  CE   . MET A  1 102 ? 63.969  -93.347  8.599   1.00 42.75  ? 82  MET A CE   1 
ATOM   1219  H  H    . MET A  1 102 ? 66.260  -98.011  8.206   1.00 39.64  ? 82  MET A H    1 
ATOM   1220  H  HA   . MET A  1 102 ? 63.475  -98.759  8.846   1.00 38.38  ? 82  MET A HA   1 
ATOM   1221  H  HB2  . MET A  1 102 ? 63.816  -96.856  10.240  1.00 41.49  ? 82  MET A HB2  1 
ATOM   1222  H  HB3  . MET A  1 102 ? 64.859  -96.054  9.043   1.00 40.02  ? 82  MET A HB3  1 
ATOM   1223  H  HG2  . MET A  1 102 ? 62.878  -95.721  7.597   1.00 43.07  ? 82  MET A HG2  1 
ATOM   1224  H  HG3  . MET A  1 102 ? 61.887  -96.445  8.891   1.00 42.49  ? 82  MET A HG3  1 
ATOM   1225  H  HE1  . MET A  1 102 ? 63.843  -92.287  8.812   1.00 42.75  ? 82  MET A HE1  1 
ATOM   1226  H  HE2  . MET A  1 102 ? 64.940  -93.680  8.961   1.00 43.82  ? 82  MET A HE2  1 
ATOM   1227  H  HE3  . MET A  1 102 ? 63.883  -93.520  7.528   1.00 42.61  ? 82  MET A HE3  1 
ATOM   1228  N  N    . LYS A  1 103 ? 63.151  -98.585  6.342   1.00 36.14  ? 83  LYS A N    1 
ATOM   1229  C  CA   . LYS A  1 103 ? 62.920  -98.504  4.901   1.00 35.57  ? 83  LYS A CA   1 
ATOM   1230  C  C    . LYS A  1 103 ? 61.532  -97.934  4.649   1.00 38.55  ? 83  LYS A C    1 
ATOM   1231  O  O    . LYS A  1 103 ? 60.564  -98.381  5.275   1.00 37.84  ? 83  LYS A O    1 
ATOM   1232  C  CB   . LYS A  1 103 ? 63.072  -99.862  4.221   1.00 38.69  ? 83  LYS A CB   1 
ATOM   1233  C  CG   . LYS A  1 103 ? 64.478  -100.438 4.295   1.00 42.76  ? 83  LYS A CG   1 
ATOM   1234  C  CD   . LYS A  1 103 ? 64.464  -101.892 3.910   1.00 43.52  ? 83  LYS A CD   1 
ATOM   1235  C  CE   . LYS A  1 103 ? 65.715  -102.359 3.224   1.00 52.18  ? 83  LYS A CE   1 
ATOM   1236  N  NZ   . LYS A  1 103 ? 65.578  -103.770 2.789   1.00 42.94  ? 83  LYS A NZ   1 
ATOM   1237  H  H    . LYS A  1 103 ? 62.497  -99.195  6.819   1.00 36.34  ? 83  LYS A H    1 
ATOM   1238  H  HA   . LYS A  1 103 ? 63.660  -97.849  4.447   1.00 36.86  ? 83  LYS A HA   1 
ATOM   1239  H  HB2  . LYS A  1 103 ? 62.372  -100.563 4.668   1.00 39.33  ? 83  LYS A HB2  1 
ATOM   1240  H  HB3  . LYS A  1 103 ? 62.838  -99.723  3.167   1.00 39.22  ? 83  LYS A HB3  1 
ATOM   1241  H  HG2  . LYS A  1 103 ? 65.117  -99.897  3.597   1.00 43.42  ? 83  LYS A HG2  1 
ATOM   1242  H  HG3  . LYS A  1 103 ? 64.868  -100.355 5.308   1.00 42.65  ? 83  LYS A HG3  1 
ATOM   1243  H  HD2  . LYS A  1 103 ? 64.362  -102.474 4.823   1.00 44.82  ? 83  LYS A HD2  1 
ATOM   1244  H  HD3  . LYS A  1 103 ? 63.624  -102.084 3.244   1.00 43.06  ? 83  LYS A HD3  1 
ATOM   1245  H  HE2  . LYS A  1 103 ? 65.896  -101.744 2.341   1.00 52.48  ? 83  LYS A HE2  1 
ATOM   1246  H  HE3  . LYS A  1 103 ? 66.551  -102.286 3.918   1.00 51.86  ? 83  LYS A HE3  1 
ATOM   1247  H  HZ1  . LYS A  1 103 ? 66.380  -104.031 2.222   1.00 43.80  ? 83  LYS A HZ1  1 
ATOM   1248  H  HZ2  . LYS A  1 103 ? 65.527  -104.383 3.597   1.00 42.94  ? 83  LYS A HZ2  1 
ATOM   1249  H  HZ3  . LYS A  1 103 ? 64.736  -103.883 2.237   1.00 41.73  ? 83  LYS A HZ3  1 
ATOM   1250  N  N    . ILE A  1 104 ? 61.430  -96.941  3.763   1.00 35.48  ? 84  ILE A N    1 
ATOM   1251  C  CA   . ILE A  1 104 ? 60.173  -96.270  3.445   1.00 32.73  ? 84  ILE A CA   1 
ATOM   1252  C  C    . ILE A  1 104 ? 59.899  -96.380  1.952   1.00 35.86  ? 84  ILE A C    1 
ATOM   1253  O  O    . ILE A  1 104 ? 60.818  -96.272  1.153   1.00 34.59  ? 84  ILE A O    1 
ATOM   1254  C  CB   . ILE A  1 104 ? 60.293  -94.800  3.947   1.00 34.28  ? 84  ILE A CB   1 
ATOM   1255  C  CG1  . ILE A  1 104 ? 60.520  -94.807  5.476   1.00 34.54  ? 84  ILE A CG1  1 
ATOM   1256  C  CG2  . ILE A  1 104 ? 59.065  -93.964  3.610   1.00 33.31  ? 84  ILE A CG2  1 
ATOM   1257  C  CD1  . ILE A  1 104 ? 60.685  -93.439  6.131   1.00 36.31  ? 84  ILE A CD1  1 
ATOM   1258  H  H    . ILE A  1 104 ? 62.216  -96.550  3.252   1.00 35.71  ? 84  ILE A H    1 
ATOM   1259  H  HA   . ILE A  1 104 ? 59.349  -96.732  3.983   1.00 32.56  ? 84  ILE A HA   1 
ATOM   1260  H  HB   . ILE A  1 104 ? 61.161  -94.341  3.475   1.00 32.98  ? 84  ILE A HB   1 
ATOM   1261  H  HG12 . ILE A  1 104 ? 59.663  -95.296  5.936   1.00 34.79  ? 84  ILE A HG12 1 
ATOM   1262  H  HG13 . ILE A  1 104 ? 61.429  -95.358  5.710   1.00 34.01  ? 84  ILE A HG13 1 
ATOM   1263  H  HG21 . ILE A  1 104 ? 59.251  -92.920  3.857   1.00 32.57  ? 84  ILE A HG21 1 
ATOM   1264  H  HG22 . ILE A  1 104 ? 58.853  -94.027  2.544   1.00 33.68  ? 84  ILE A HG22 1 
ATOM   1265  H  HG23 . ILE A  1 104 ? 58.214  -94.331  4.181   1.00 32.31  ? 84  ILE A HG23 1 
ATOM   1266  H  HD11 . ILE A  1 104 ? 60.955  -93.569  7.178   1.00 36.96  ? 84  ILE A HD11 1 
ATOM   1267  H  HD12 . ILE A  1 104 ? 61.474  -92.900  5.608   1.00 35.94  ? 84  ILE A HD12 1 
ATOM   1268  H  HD13 . ILE A  1 104 ? 59.753  -92.880  6.081   1.00 35.94  ? 84  ILE A HD13 1 
ATOM   1269  N  N    . ALA A  1 105 ? 58.610  -96.616  1.584   1.00 35.90  ? 85  ALA A N    1 
ATOM   1270  C  CA   . ALA A  1 105 ? 58.091  -96.628  0.199   1.00 33.24  ? 85  ALA A CA   1 
ATOM   1271  C  C    . ALA A  1 105 ? 57.374  -95.292  -0.063  1.00 33.52  ? 85  ALA A C    1 
ATOM   1272  O  O    . ALA A  1 105 ? 56.445  -94.947  0.677   1.00 31.59  ? 85  ALA A O    1 
ATOM   1273  C  CB   . ALA A  1 105 ? 57.119  -97.772  -0.001  1.00 34.10  ? 85  ALA A CB   1 
ATOM   1274  H  H    . ALA A  1 105 ? 57.875  -96.795  2.261   1.00 37.29  ? 85  ALA A H    1 
ATOM   1275  H  HA   . ALA A  1 105 ? 58.910  -96.755  -0.505  1.00 31.79  ? 85  ALA A HA   1 
ATOM   1276  H  HB1  . ALA A  1 105 ? 56.896  -97.861  -1.063  1.00 33.49  ? 85  ALA A HB1  1 
ATOM   1277  H  HB2  . ALA A  1 105 ? 57.566  -98.693  0.369   1.00 36.02  ? 85  ALA A HB2  1 
ATOM   1278  H  HB3  . ALA A  1 105 ? 56.202  -97.563  0.547   1.00 34.31  ? 85  ALA A HB3  1 
ATOM   1279  N  N    . TYR A  1 106 ? 57.774  -94.576  -1.123  1.00 31.57  ? 86  TYR A N    1 
ATOM   1280  C  CA   . TYR A  1 106 ? 57.202  -93.280  -1.513  1.00 29.70  ? 86  TYR A CA   1 
ATOM   1281  C  C    . TYR A  1 106 ? 56.402  -93.434  -2.773  1.00 35.57  ? 86  TYR A C    1 
ATOM   1282  O  O    . TYR A  1 106 ? 56.996  -93.683  -3.792  1.00 36.00  ? 86  TYR A O    1 
ATOM   1283  C  CB   . TYR A  1 106 ? 58.327  -92.299  -1.752  1.00 30.08  ? 86  TYR A CB   1 
ATOM   1284  C  CG   . TYR A  1 106 ? 59.071  -91.892  -0.502  1.00 34.76  ? 86  TYR A CG   1 
ATOM   1285  C  CD1  . TYR A  1 106 ? 60.178  -92.615  -0.056  1.00 37.36  ? 86  TYR A CD1  1 
ATOM   1286  C  CD2  . TYR A  1 106 ? 58.709  -90.748  0.208   1.00 34.54  ? 86  TYR A CD2  1 
ATOM   1287  C  CE1  . TYR A  1 106 ? 60.931  -92.179  1.033   1.00 39.54  ? 86  TYR A CE1  1 
ATOM   1288  C  CE2  . TYR A  1 106 ? 59.489  -90.273  1.258   1.00 34.06  ? 86  TYR A CE2  1 
ATOM   1289  C  CZ   . TYR A  1 106 ? 60.580  -91.006  1.690   1.00 38.92  ? 86  TYR A CZ   1 
ATOM   1290  O  OH   . TYR A  1 106 ? 61.261  -90.587  2.803   1.00 38.78  ? 86  TYR A OH   1 
ATOM   1291  H  H    . TYR A  1 106 ? 58.501  -94.880  -1.762  1.00 31.41  ? 86  TYR A H    1 
ATOM   1292  H  HA   . TYR A  1 106 ? 56.581  -92.859  -0.726  1.00 28.18  ? 86  TYR A HA   1 
ATOM   1293  H  HB2  . TYR A  1 106 ? 59.062  -92.754  -2.412  1.00 30.62  ? 86  TYR A HB2  1 
ATOM   1294  H  HB3  . TYR A  1 106 ? 57.923  -91.399  -2.212  1.00 30.28  ? 86  TYR A HB3  1 
ATOM   1295  H  HD1  . TYR A  1 106 ? 60.502  -93.496  -0.608  1.00 36.71  ? 86  TYR A HD1  1 
ATOM   1296  H  HD2  . TYR A  1 106 ? 57.864  -90.153  -0.133  1.00 34.77  ? 86  TYR A HD2  1 
ATOM   1297  H  HE1  . TYR A  1 106 ? 61.801  -92.747  1.354   1.00 39.88  ? 86  TYR A HE1  1 
ATOM   1298  H  HE2  . TYR A  1 106 ? 59.157  -89.402  1.816   1.00 34.26  ? 86  TYR A HE2  1 
ATOM   1299  H  HH   . TYR A  1 106 ? 61.503  -91.356  3.383   1.00 38.35  ? 86  TYR A HH   1 
ATOM   1300  N  N    . PRO A  1 107 ? 55.066  -93.343  -2.769  1.00 33.88  ? 87  PRO A N    1 
ATOM   1301  C  CA   . PRO A  1 107 ? 54.317  -93.411  -4.034  1.00 33.29  ? 87  PRO A CA   1 
ATOM   1302  C  C    . PRO A  1 107 ? 54.877  -92.392  -5.047  1.00 33.39  ? 87  PRO A C    1 
ATOM   1303  O  O    . PRO A  1 107 ? 55.157  -91.248  -4.695  1.00 32.09  ? 87  PRO A O    1 
ATOM   1304  C  CB   . PRO A  1 107 ? 52.883  -93.091  -3.599  1.00 35.10  ? 87  PRO A CB   1 
ATOM   1305  C  CG   . PRO A  1 107 ? 52.818  -93.584  -2.212  1.00 39.57  ? 87  PRO A CG   1 
ATOM   1306  C  CD   . PRO A  1 107 ? 54.155  -93.186  -1.630  1.00 34.96  ? 87  PRO A CD   1 
ATOM   1307  H  HA   . PRO A  1 107 ? 54.357  -94.422  -4.438  1.00 33.95  ? 87  PRO A HA   1 
ATOM   1308  H  HB2  . PRO A  1 107 ? 52.713  -92.016  -3.637  1.00 35.50  ? 87  PRO A HB2  1 
ATOM   1309  H  HB3  . PRO A  1 107 ? 52.159  -93.614  -4.222  1.00 35.72  ? 87  PRO A HB3  1 
ATOM   1310  H  HG2  . PRO A  1 107 ? 51.998  -93.101  -1.685  1.00 40.27  ? 87  PRO A HG2  1 
ATOM   1311  H  HG3  . PRO A  1 107 ? 52.699  -94.666  -2.210  1.00 39.16  ? 87  PRO A HG3  1 
ATOM   1312  H  HD2  . PRO A  1 107 ? 54.143  -92.154  -1.289  1.00 35.40  ? 87  PRO A HD2  1 
ATOM   1313  H  HD3  . PRO A  1 107 ? 54.436  -93.876  -0.836  1.00 34.48  ? 87  PRO A HD3  1 
ATOM   1314  N  N    . ILE A  1 108 ? 55.114  -92.825  -6.271  1.00 30.24  ? 88  ILE A N    1 
ATOM   1315  C  CA   . ILE A  1 108 ? 55.777  -91.981  -7.268  1.00 29.45  ? 88  ILE A CA   1 
ATOM   1316  C  C    . ILE A  1 108 ? 54.965  -90.720  -7.654  1.00 35.27  ? 88  ILE A C    1 
ATOM   1317  O  O    . ILE A  1 108 ? 55.560  -89.739  -8.089  1.00 31.61  ? 88  ILE A O    1 
ATOM   1318  C  CB   . ILE A  1 108 ? 56.245  -92.754  -8.527  1.00 32.94  ? 88  ILE A CB   1 
ATOM   1319  C  CG1  . ILE A  1 108 ? 55.087  -93.404  -9.313  1.00 31.89  ? 88  ILE A CG1  1 
ATOM   1320  C  CG2  . ILE A  1 108 ? 57.316  -93.769  -8.107  1.00 34.24  ? 88  ILE A CG2  1 
ATOM   1321  C  CD1  . ILE A  1 108 ? 55.536  -93.971  -10.617 1.00 36.20  ? 88  ILE A CD1  1 
ATOM   1322  H  H    . ILE A  1 108 ? 54.866  -93.759  -6.588  1.00 32.17  ? 88  ILE A H    1 
ATOM   1323  H  HA   . ILE A  1 108 ? 56.690  -91.632  -6.789  1.00 29.50  ? 88  ILE A HA   1 
ATOM   1324  H  HB   . ILE A  1 108 ? 56.727  -92.023  -9.175  1.00 31.83  ? 88  ILE A HB   1 
ATOM   1325  H  HG12 . ILE A  1 108 ? 54.649  -94.215  -8.736  1.00 30.85  ? 88  ILE A HG12 1 
ATOM   1326  H  HG13 . ILE A  1 108 ? 54.324  -92.659  -9.533  1.00 32.36  ? 88  ILE A HG13 1 
ATOM   1327  H  HG21 . ILE A  1 108 ? 57.742  -94.239  -8.990  1.00 35.49  ? 88  ILE A HG21 1 
ATOM   1328  H  HG22 . ILE A  1 108 ? 58.101  -93.239  -7.568  1.00 34.31  ? 88  ILE A HG22 1 
ATOM   1329  H  HG23 . ILE A  1 108 ? 56.877  -94.519  -7.455  1.00 33.51  ? 88  ILE A HG23 1 
ATOM   1330  H  HD11 . ILE A  1 108 ? 54.668  -94.137  -11.253 1.00 36.57  ? 88  ILE A HD11 1 
ATOM   1331  H  HD12 . ILE A  1 108 ? 56.225  -93.276  -11.096 1.00 36.13  ? 88  ILE A HD12 1 
ATOM   1332  H  HD13 . ILE A  1 108 ? 56.035  -94.923  -10.437 1.00 36.33  ? 88  ILE A HD13 1 
ATOM   1333  N  N    . GLU A  1 109 ? 53.642  -90.716  -7.414  1.00 36.22  ? 89  GLU A N    1 
ATOM   1334  C  CA   . GLU A  1 109 ? 52.763  -89.549  -7.637  1.00 34.59  ? 89  GLU A CA   1 
ATOM   1335  C  C    . GLU A  1 109 ? 53.152  -88.352  -6.756  1.00 35.64  ? 89  GLU A C    1 
ATOM   1336  O  O    . GLU A  1 109 ? 52.741  -87.241  -7.033  1.00 32.14  ? 89  GLU A O    1 
ATOM   1337  C  CB   . GLU A  1 109 ? 51.285  -89.913  -7.348  1.00 36.36  ? 89  GLU A CB   1 
ATOM   1338  C  CG   . GLU A  1 109 ? 50.711  -90.984  -8.265  1.00 48.67  ? 89  GLU A CG   1 
ATOM   1339  C  CD   . GLU A  1 109 ? 50.764  -92.409  -7.734  1.00 66.22  ? 89  GLU A CD   1 
ATOM   1340  O  OE1  . GLU A  1 109 ? 51.656  -92.707  -6.907  1.00 45.91  ? 89  GLU A OE1  1 
ATOM   1341  O  OE2  . GLU A  1 109 ? 49.945  -93.240  -8.188  1.00 64.73  ? 89  GLU A OE2  1 
ATOM   1342  H  H    . GLU A  1 109 ? 53.149  -91.528  -7.059  1.00 36.22  ? 89  GLU A H    1 
ATOM   1343  H  HA   . GLU A  1 109 ? 52.843  -89.250  -8.681  1.00 33.44  ? 89  GLU A HA   1 
ATOM   1344  H  HB2  . GLU A  1 109 ? 51.187  -90.246  -6.315  1.00 34.27  ? 89  GLU A HB2  1 
ATOM   1345  H  HB3  . GLU A  1 109 ? 50.681  -89.020  -7.497  1.00 37.57  ? 89  GLU A HB3  1 
ATOM   1346  H  HG2  . GLU A  1 109 ? 49.667  -90.740  -8.456  1.00 48.90  ? 89  GLU A HG2  1 
ATOM   1347  H  HG3  . GLU A  1 109 ? 51.265  -90.973  -9.202  1.00 47.98  ? 89  GLU A HG3  1 
ATOM   1348  N  N    . LEU A  1 110 ? 53.859  -88.580  -5.643  1.00 35.88  ? 90  LEU A N    1 
ATOM   1349  C  CA   . LEU A  1 110 ? 54.286  -87.487  -4.754  1.00 34.99  ? 90  LEU A CA   1 
ATOM   1350  C  C    . LEU A  1 110 ? 55.304  -86.554  -5.396  1.00 37.89  ? 90  LEU A C    1 
ATOM   1351  O  O    . LEU A  1 110 ? 55.363  -85.378  -5.034  1.00 36.46  ? 90  LEU A O    1 
ATOM   1352  C  CB   . LEU A  1 110 ? 54.942  -88.055  -3.480  1.00 35.08  ? 90  LEU A CB   1 
ATOM   1353  C  CG   . LEU A  1 110 ? 54.081  -88.849  -2.494  1.00 40.53  ? 90  LEU A CG   1 
ATOM   1354  C  CD1  . LEU A  1 110 ? 54.957  -89.461  -1.424  1.00 40.52  ? 90  LEU A CD1  1 
ATOM   1355  C  CD2  . LEU A  1 110 ? 53.001  -87.975  -1.882  1.00 39.69  ? 90  LEU A CD2  1 
ATOM   1356  H  H    . LEU A  1 110 ? 54.109  -89.498  -5.291  1.00 34.88  ? 90  LEU A H    1 
ATOM   1357  H  HA   . LEU A  1 110 ? 53.417  -86.894  -4.470  1.00 37.08  ? 90  LEU A HA   1 
ATOM   1358  H  HB2  . LEU A  1 110 ? 55.753  -88.716  -3.781  1.00 34.85  ? 90  LEU A HB2  1 
ATOM   1359  H  HB3  . LEU A  1 110 ? 55.364  -87.225  -2.914  1.00 35.75  ? 90  LEU A HB3  1 
ATOM   1360  H  HG   . LEU A  1 110 ? 53.585  -89.663  -3.022  1.00 41.23  ? 90  LEU A HG   1 
ATOM   1361  H  HD11 . LEU A  1 110 ? 54.329  -89.920  -0.662  1.00 41.41  ? 90  LEU A HD11 1 
ATOM   1362  H  HD12 . LEU A  1 110 ? 55.596  -90.215  -1.879  1.00 39.44  ? 90  LEU A HD12 1 
ATOM   1363  H  HD13 . LEU A  1 110 ? 55.568  -88.675  -0.983  1.00 40.00  ? 90  LEU A HD13 1 
ATOM   1364  H  HD21 . LEU A  1 110 ? 52.539  -88.481  -1.039  1.00 39.04  ? 90  LEU A HD21 1 
ATOM   1365  H  HD22 . LEU A  1 110 ? 53.455  -87.047  -1.542  1.00 40.62  ? 90  LEU A HD22 1 
ATOM   1366  H  HD23 . LEU A  1 110 ? 52.241  -87.767  -2.634  1.00 39.36  ? 90  LEU A HD23 1 
ATOM   1367  N  N    . PHE A  1 111 ? 56.157  -87.087  -6.296  1.00 33.63  ? 91  PHE A N    1 
ATOM   1368  C  CA   . PHE A  1 111 ? 57.287  -86.341  -6.823  1.00 31.83  ? 91  PHE A CA   1 
ATOM   1369  C  C    . PHE A  1 111 ? 56.862  -85.327  -7.908  1.00 34.38  ? 91  PHE A C    1 
ATOM   1370  O  O    . PHE A  1 111 ? 56.069  -85.640  -8.816  1.00 30.77  ? 91  PHE A O    1 
ATOM   1371  C  CB   . PHE A  1 111 ? 58.373  -87.300  -7.335  1.00 33.47  ? 91  PHE A CB   1 
ATOM   1372  C  CG   . PHE A  1 111 ? 58.904  -88.186  -6.231  1.00 33.23  ? 91  PHE A CG   1 
ATOM   1373  C  CD1  . PHE A  1 111 ? 59.736  -87.674  -5.246  1.00 35.71  ? 91  PHE A CD1  1 
ATOM   1374  C  CD2  . PHE A  1 111 ? 58.491  -89.506  -6.122  1.00 32.12  ? 91  PHE A CD2  1 
ATOM   1375  C  CE1  . PHE A  1 111 ? 60.152  -88.482  -4.161  1.00 35.88  ? 91  PHE A CE1  1 
ATOM   1376  C  CE2  . PHE A  1 111 ? 58.903  -90.307  -5.041  1.00 34.75  ? 91  PHE A CE2  1 
ATOM   1377  C  CZ   . PHE A  1 111 ? 59.751  -89.796  -4.087  1.00 33.00  ? 91  PHE A CZ   1 
ATOM   1378  H  H    . PHE A  1 111 ? 56.074  -88.025  -6.669  1.00 33.54  ? 91  PHE A H    1 
ATOM   1379  H  HA   . PHE A  1 111 ? 57.740  -85.784  -6.003  1.00 31.02  ? 91  PHE A HA   1 
ATOM   1380  H  HB2  . PHE A  1 111 ? 57.965  -87.933  -8.121  1.00 33.04  ? 91  PHE A HB2  1 
ATOM   1381  H  HB3  . PHE A  1 111 ? 59.205  -86.710  -7.718  1.00 34.17  ? 91  PHE A HB3  1 
ATOM   1382  H  HD1  . PHE A  1 111 ? 60.037  -86.628  -5.285  1.00 34.43  ? 91  PHE A HD1  1 
ATOM   1383  H  HD2  . PHE A  1 111 ? 57.835  -89.913  -6.887  1.00 31.74  ? 91  PHE A HD2  1 
ATOM   1384  H  HE1  . PHE A  1 111 ? 60.803  -88.071  -3.392  1.00 35.38  ? 91  PHE A HE1  1 
ATOM   1385  H  HE2  . PHE A  1 111 ? 58.589  -91.347  -4.989  1.00 35.09  ? 91  PHE A HE2  1 
ATOM   1386  H  HZ   . PHE A  1 111 ? 60.087  -90.419  -3.261  1.00 34.24  ? 91  PHE A HZ   1 
ATOM   1387  N  N    . ASP A  1 112 ? 57.378  -84.096  -7.761  1.00 31.18  ? 92  ASP A N    1 
ATOM   1388  C  CA   . ASP A  1 112 ? 57.093  -82.988  -8.660  1.00 30.77  ? 92  ASP A CA   1 
ATOM   1389  C  C    . ASP A  1 112 ? 57.659  -83.269  -10.058 1.00 33.39  ? 92  ASP A C    1 
ATOM   1390  O  O    . ASP A  1 112 ? 58.659  -83.968  -10.197 1.00 32.46  ? 92  ASP A O    1 
ATOM   1391  C  CB   . ASP A  1 112 ? 57.657  -81.669  -8.099  1.00 33.30  ? 92  ASP A CB   1 
ATOM   1392  C  CG   . ASP A  1 112 ? 56.992  -80.414  -8.636  1.00 40.30  ? 92  ASP A CG   1 
ATOM   1393  O  OD1  . ASP A  1 112 ? 56.120  -80.536  -9.518  1.00 37.95  ? 92  ASP A OD1  1 
ATOM   1394  O  OD2  . ASP A  1 112 ? 57.314  -79.308  -8.143  1.00 40.24  ? 92  ASP A OD2  1 
ATOM   1395  H  H    . ASP A  1 112 ? 58.004  -83.845  -7.004  1.00 31.92  ? 92  ASP A H    1 
ATOM   1396  H  HA   . ASP A  1 112 ? 56.011  -82.897  -8.730  1.00 31.72  ? 92  ASP A HA   1 
ATOM   1397  H  HB2  . ASP A  1 112 ? 57.532  -81.660  -7.018  1.00 34.19  ? 92  ASP A HB2  1 
ATOM   1398  H  HB3  . ASP A  1 112 ? 58.716  -81.609  -8.346  1.00 33.75  ? 92  ASP A HB3  1 
ATOM   1399  N  N    . ARG A  1 113 ? 56.984  -82.713  -11.073 1.00 30.93  ? 93  ARG A N    1 
ATOM   1400  C  CA   . ARG A  1 113 ? 57.308  -82.842  -12.483 1.00 31.93  ? 93  ARG A CA   1 
ATOM   1401  C  C    . ARG A  1 113 ? 57.310  -81.477  -13.151 1.00 36.10  ? 93  ARG A C    1 
ATOM   1402  O  O    . ARG A  1 113 ? 56.525  -80.622  -12.774 1.00 33.77  ? 93  ARG A O    1 
ATOM   1403  C  CB   . ARG A  1 113 ? 56.271  -83.721  -13.205 1.00 33.58  ? 93  ARG A CB   1 
ATOM   1404  C  CG   . ARG A  1 113 ? 55.766  -84.946  -12.440 1.00 42.45  ? 93  ARG A CG   1 
ATOM   1405  C  CD   . ARG A  1 113 ? 56.809  -86.034  -12.314 1.00 49.49  ? 93  ARG A CD   1 
ATOM   1406  N  NE   . ARG A  1 113 ? 56.320  -87.135  -11.477 1.00 58.53  ? 93  ARG A NE   1 
ATOM   1407  C  CZ   . ARG A  1 113 ? 55.506  -88.117  -11.877 1.00 63.30  ? 93  ARG A CZ   1 
ATOM   1408  N  NH1  . ARG A  1 113 ? 55.070  -88.167  -13.137 1.00 45.64  ? 93  ARG A NH1  1 
ATOM   1409  N  NH2  . ARG A  1 113 ? 55.123  -89.058  -11.023 1.00 45.02  ? 93  ARG A NH2  1 
ATOM   1410  H  H    . ARG A  1 113 ? 56.167  -82.127  -10.924 1.00 30.80  ? 93  ARG A H    1 
ATOM   1411  H  HA   . ARG A  1 113 ? 58.292  -83.291  -12.604 1.00 32.34  ? 93  ARG A HA   1 
ATOM   1412  H  HB2  . ARG A  1 113 ? 55.400  -83.110  -13.436 1.00 33.01  ? 93  ARG A HB2  1 
ATOM   1413  H  HB3  . ARG A  1 113 ? 56.717  -84.067  -14.137 1.00 34.06  ? 93  ARG A HB3  1 
ATOM   1414  H  HG2  . ARG A  1 113 ? 55.437  -84.660  -11.443 1.00 41.88  ? 93  ARG A HG2  1 
ATOM   1415  H  HG3  . ARG A  1 113 ? 54.919  -85.363  -12.982 1.00 42.51  ? 93  ARG A HG3  1 
ATOM   1416  H  HD2  . ARG A  1 113 ? 57.092  -86.406  -13.296 1.00 49.34  ? 93  ARG A HD2  1 
ATOM   1417  H  HD3  . ARG A  1 113 ? 57.695  -85.624  -11.834 1.00 48.84  ? 93  ARG A HD3  1 
ATOM   1418  H  HE   . ARG A  1 113 ? 56.616  -87.131  -10.507 1.00 58.70  ? 93  ARG A HE   1 
ATOM   1419  H  HH11 . ARG A  1 113 ? 55.311  -87.469  -13.834 1.00 45.15  ? 93  ARG A HH11 1 
ATOM   1420  H  HH12 . ARG A  1 113 ? 54.442  -88.916  -13.409 1.00 45.89  ? 93  ARG A HH12 1 
ATOM   1421  H  HH21 . ARG A  1 113 ? 55.439  -89.033  -10.059 1.00 45.80  ? 93  ARG A HH21 1 
ATOM   1422  H  HH22 . ARG A  1 113 ? 54.499  -89.804  -11.316 1.00 45.44  ? 93  ARG A HH22 1 
ATOM   1423  N  N    . ASN A  1 114 ? 58.124  -81.304  -14.192 1.00 32.99  ? 94  ASN A N    1 
ATOM   1424  C  CA   . ASN A  1 114 ? 58.138  -80.028  -14.907 1.00 30.96  ? 94  ASN A CA   1 
ATOM   1425  C  C    . ASN A  1 114 ? 56.867  -79.796  -15.683 1.00 34.00  ? 94  ASN A C    1 
ATOM   1426  O  O    . ASN A  1 114 ? 56.408  -80.687  -16.378 1.00 32.66  ? 94  ASN A O    1 
ATOM   1427  C  CB   . ASN A  1 114 ? 59.288  -79.961  -15.891 1.00 20.66  ? 94  ASN A CB   1 
ATOM   1428  C  CG   . ASN A  1 114 ? 60.655  -79.989  -15.289 1.00 38.85  ? 94  ASN A CG   1 
ATOM   1429  O  OD1  . ASN A  1 114 ? 60.886  -79.532  -14.177 1.00 42.41  ? 94  ASN A OD1  1 
ATOM   1430  N  ND2  . ASN A  1 114 ? 61.611  -80.485  -16.040 1.00 31.36  ? 94  ASN A ND2  1 
ATOM   1431  H  H    . ASN A  1 114 ? 58.773  -82.006  -14.530 1.00 33.25  ? 94  ASN A H    1 
ATOM   1432  H  HA   . ASN A  1 114 ? 58.268  -79.231  -14.178 1.00 29.99  ? 94  ASN A HA   1 
ATOM   1433  H  HB2  . ASN A  1 114 ? 59.172  -80.819  -16.544 1.00 19.44  ? 94  ASN A HB2  1 
ATOM   1434  H  HB3  . ASN A  1 114 ? 59.207  -79.035  -16.460 1.00 21.04  ? 94  ASN A HB3  1 
ATOM   1435  H  HD21 . ASN A  1 114 ? 62.560  -80.535  -15.689 1.00 31.59  ? 94  ASN A HD21 1 
ATOM   1436  H  HD22 . ASN A  1 114 ? 61.411  -80.817  -16.977 1.00 32.45  ? 94  ASN A HD22 1 
ATOM   1437  N  N    . VAL A  1 115 ? 56.311  -78.591  -15.572 1.00 30.89  ? 95  VAL A N    1 
ATOM   1438  C  CA   . VAL A  1 115 ? 55.174  -78.114  -16.366 1.00 32.11  ? 95  VAL A CA   1 
ATOM   1439  C  C    . VAL A  1 115 ? 55.581  -78.056  -17.863 1.00 35.16  ? 95  VAL A C    1 
ATOM   1440  O  O    . VAL A  1 115 ? 54.782  -78.426  -18.714 1.00 34.81  ? 95  VAL A O    1 
ATOM   1441  C  CB   . VAL A  1 115 ? 54.695  -76.710  -15.872 1.00 36.30  ? 95  VAL A CB   1 
ATOM   1442  C  CG1  . VAL A  1 115 ? 53.661  -76.112  -16.837 1.00 37.86  ? 95  VAL A CG1  1 
ATOM   1443  C  CG2  . VAL A  1 115 ? 54.102  -76.783  -14.461 1.00 36.57  ? 95  VAL A CG2  1 
ATOM   1444  H  H    . VAL A  1 115 ? 56.618  -77.906  -14.893 1.00 32.39  ? 95  VAL A H    1 
ATOM   1445  H  HA   . VAL A  1 115 ? 54.349  -78.818  -16.265 1.00 32.59  ? 95  VAL A HA   1 
ATOM   1446  H  HB   . VAL A  1 115 ? 55.552  -76.040  -15.839 1.00 32.64  ? 95  VAL A HB   1 
ATOM   1447  H  HG11 . VAL A  1 115 ? 53.114  -75.320  -16.327 1.00 38.61  ? 95  VAL A HG11 1 
ATOM   1448  H  HG12 . VAL A  1 115 ? 54.172  -75.685  -17.699 1.00 38.35  ? 95  VAL A HG12 1 
ATOM   1449  H  HG13 . VAL A  1 115 ? 52.969  -76.890  -17.154 1.00 37.59  ? 95  VAL A HG13 1 
ATOM   1450  H  HG21 . VAL A  1 115 ? 53.847  -75.775  -14.138 1.00 36.79  ? 95  VAL A HG21 1 
ATOM   1451  H  HG22 . VAL A  1 115 ? 53.205  -77.399  -14.489 1.00 37.00  ? 95  VAL A HG22 1 
ATOM   1452  H  HG23 . VAL A  1 115 ? 54.820  -77.221  -13.768 1.00 37.16  ? 95  VAL A HG23 1 
ATOM   1453  N  N    . ILE A  1 116 ? 56.835  -77.615  -18.162 1.00 32.49  ? 96  ILE A N    1 
ATOM   1454  C  CA   . ILE A  1 116 ? 57.295  -77.431  -19.550 1.00 34.04  ? 96  ILE A CA   1 
ATOM   1455  C  C    . ILE A  1 116 ? 57.482  -78.744  -20.326 1.00 35.94  ? 96  ILE A C    1 
ATOM   1456  O  O    . ILE A  1 116 ? 57.262  -78.731  -21.524 1.00 33.56  ? 96  ILE A O    1 
ATOM   1457  C  CB   . ILE A  1 116 ? 58.590  -76.560  -19.676 1.00 37.51  ? 96  ILE A CB   1 
ATOM   1458  C  CG1  . ILE A  1 116 ? 59.849  -77.257  -19.075 1.00 39.98  ? 96  ILE A CG1  1 
ATOM   1459  C  CG2  . ILE A  1 116 ? 58.375  -75.154  -19.109 1.00 34.84  ? 96  ILE A CG2  1 
ATOM   1460  C  CD1  . ILE A  1 116 ? 61.150  -76.407  -19.129 1.00 53.81  ? 96  ILE A CD1  1 
ATOM   1461  H  H    . ILE A  1 116 ? 57.528  -77.376  -17.461 1.00 31.16  ? 96  ILE A H    1 
ATOM   1462  H  HA   . ILE A  1 116 ? 56.515  -76.874  -20.068 1.00 35.06  ? 96  ILE A HA   1 
ATOM   1463  H  HB   . ILE A  1 116 ? 58.786  -76.438  -20.739 1.00 35.94  ? 96  ILE A HB   1 
ATOM   1464  H  HG12 . ILE A  1 116 ? 59.675  -77.497  -18.028 1.00 40.16  ? 96  ILE A HG12 1 
ATOM   1465  H  HG13 . ILE A  1 116 ? 60.059  -78.168  -19.632 1.00 39.82  ? 96  ILE A HG13 1 
ATOM   1466  H  HG21 . ILE A  1 116 ? 59.226  -74.522  -19.354 1.00 33.55  ? 96  ILE A HG21 1 
ATOM   1467  H  HG22 . ILE A  1 116 ? 57.466  -74.738  -19.540 1.00 34.56  ? 96  ILE A HG22 1 
ATOM   1468  H  HG23 . ILE A  1 116 ? 58.268  -75.204  -18.026 1.00 36.28  ? 96  ILE A HG23 1 
ATOM   1469  H  HD11 . ILE A  1 116 ? 61.985  -77.075  -18.930 1.00 53.65  ? 96  ILE A HD11 1 
ATOM   1470  H  HD12 . ILE A  1 116 ? 61.251  -75.972  -20.122 1.00 54.26  ? 96  ILE A HD12 1 
ATOM   1471  H  HD13 . ILE A  1 116 ? 61.105  -75.623  -18.376 1.00 52.55  ? 96  ILE A HD13 1 
ATOM   1472  N  N    . ASP A  1 117 ? 57.991  -79.830  -19.696 1.00 33.81  ? 97  ASP A N    1 
ATOM   1473  C  CA   . ASP A  1 117 ? 58.274  -81.073  -20.435 1.00 33.59  ? 97  ASP A CA   1 
ATOM   1474  C  C    . ASP A  1 117 ? 57.873  -82.365  -19.717 1.00 35.51  ? 97  ASP A C    1 
ATOM   1475  O  O    . ASP A  1 117 ? 58.263  -83.434  -20.191 1.00 35.77  ? 97  ASP A O    1 
ATOM   1476  C  CB   . ASP A  1 117 ? 59.785  -81.127  -20.800 1.00 34.79  ? 97  ASP A CB   1 
ATOM   1477  C  CG   . ASP A  1 117 ? 60.745  -81.127  -19.625 1.00 35.51  ? 97  ASP A CG   1 
ATOM   1478  O  OD1  . ASP A  1 117 ? 60.290  -81.303  -18.499 1.00 36.31  ? 97  ASP A OD1  1 
ATOM   1479  O  OD2  . ASP A  1 117 ? 61.970  -81.038  -19.857 1.00 42.68  ? 97  ASP A OD2  1 
ATOM   1480  H  H    . ASP A  1 117 ? 58.256  -79.850  -18.718 1.00 34.08  ? 97  ASP A H    1 
ATOM   1481  H  HA   . ASP A  1 117 ? 57.725  -81.083  -21.376 1.00 33.80  ? 97  ASP A HA   1 
ATOM   1482  H  HB2  . ASP A  1 117 ? 59.985  -82.021  -21.389 1.00 34.94  ? 97  ASP A HB2  1 
ATOM   1483  H  HB3  . ASP A  1 117 ? 60.016  -80.248  -21.400 1.00 34.52  ? 97  ASP A HB3  1 
ATOM   1484  N  N    . GLY A  1 118 ? 57.123  -82.286  -18.602 1.00 32.63  ? 98  GLY A N    1 
ATOM   1485  C  CA   . GLY A  1 118 ? 56.701  -83.476  -17.861 1.00 29.30  ? 98  GLY A CA   1 
ATOM   1486  C  C    . GLY A  1 118 ? 57.788  -84.353  -17.279 1.00 31.01  ? 98  GLY A C    1 
ATOM   1487  O  O    . GLY A  1 118 ? 57.496  -85.474  -16.855 1.00 33.74  ? 98  GLY A O    1 
ATOM   1488  H  H    . GLY A  1 118 ? 56.761  -81.431  -18.194 1.00 31.79  ? 98  GLY A H    1 
ATOM   1489  H  HA2  . GLY A  1 118 ? 56.026  -83.184  -17.057 1.00 30.38  ? 98  GLY A HA2  1 
ATOM   1490  H  HA3  . GLY A  1 118 ? 56.145  -84.120  -18.538 1.00 28.41  ? 98  GLY A HA3  1 
ATOM   1491  N  N    . ARG A  1 119 ? 59.025  -83.861  -17.208 1.00 24.88  ? 99  ARG A N    1 
ATOM   1492  C  CA   . ARG A  1 119 ? 60.144  -84.635  -16.693 1.00 25.36  ? 99  ARG A CA   1 
ATOM   1493  C  C    . ARG A  1 119 ? 60.331  -84.454  -15.183 1.00 31.71  ? 99  ARG A C    1 
ATOM   1494  O  O    . ARG A  1 119 ? 59.799  -83.534  -14.571 1.00 30.34  ? 99  ARG A O    1 
ATOM   1495  C  CB   . ARG A  1 119 ? 61.426  -84.278  -17.438 1.00 22.98  ? 99  ARG A CB   1 
ATOM   1496  C  CG   . ARG A  1 119 ? 61.383  -84.587  -18.961 1.00 30.23  ? 99  ARG A CG   1 
ATOM   1497  C  CD   . ARG A  1 119 ? 60.677  -85.897  -19.313 1.00 33.22  ? 99  ARG A CD   1 
ATOM   1498  N  NE   . ARG A  1 119 ? 61.096  -86.448  -20.597 1.00 33.15  ? 99  ARG A NE   1 
ATOM   1499  C  CZ   . ARG A  1 119 ? 60.691  -86.045  -21.812 1.00 42.30  ? 99  ARG A CZ   1 
ATOM   1500  N  NH1  . ARG A  1 119 ? 59.776  -85.088  -21.940 1.00 39.49  ? 99  ARG A NH1  1 
ATOM   1501  N  NH2  . ARG A  1 119 ? 61.175  -86.625  -22.907 1.00 28.81  ? 99  ARG A NH2  1 
ATOM   1502  H  H    . ARG A  1 119 ? 59.299  -82.915  -17.453 1.00 24.40  ? 99  ARG A H    1 
ATOM   1503  H  HA   . ARG A  1 119 ? 59.951  -85.698  -16.825 1.00 26.71  ? 99  ARG A HA   1 
ATOM   1504  H  HB2  . ARG A  1 119 ? 61.619  -83.214  -17.315 1.00 21.77  ? 99  ARG A HB2  1 
ATOM   1505  H  HB3  . ARG A  1 119 ? 62.264  -84.830  -17.019 1.00 24.92  ? 99  ARG A HB3  1 
ATOM   1506  H  HG2  . ARG A  1 119 ? 60.837  -83.788  -19.462 1.00 28.99  ? 99  ARG A HG2  1 
ATOM   1507  H  HG3  . ARG A  1 119 ? 62.402  -84.623  -19.342 1.00 30.56  ? 99  ARG A HG3  1 
ATOM   1508  H  HD2  . ARG A  1 119 ? 60.959  -86.644  -18.574 1.00 33.17  ? 99  ARG A HD2  1 
ATOM   1509  H  HD3  . ARG A  1 119 ? 59.597  -85.761  -19.316 1.00 32.57  ? 99  ARG A HD3  1 
ATOM   1510  H  HE   . ARG A  1 119 ? 61.787  -87.192  -20.551 1.00 34.02  ? 99  ARG A HE   1 
ATOM   1511  H  HH11 . ARG A  1 119 ? 59.390  -84.596  -21.143 1.00 40.63  ? 99  ARG A HH11 1 
ATOM   1512  H  HH12 . ARG A  1 119 ? 59.474  -84.808  -22.867 1.00 39.23  ? 99  ARG A HH12 1 
ATOM   1513  H  HH21 . ARG A  1 119 ? 61.844  -87.384  -22.826 1.00 29.71  ? 99  ARG A HH21 1 
ATOM   1514  H  HH22 . ARG A  1 119 ? 60.844  -86.355  -23.828 1.00 28.22  ? 99  ARG A HH22 1 
ATOM   1515  N  N    . ALA A  1 120 ? 61.078  -85.384  -14.587 1.00 31.24  ? 100 ALA A N    1 
ATOM   1516  C  CA   . ALA A  1 120 ? 61.340  -85.395  -13.154 1.00 32.69  ? 100 ALA A CA   1 
ATOM   1517  C  C    . ALA A  1 120 ? 62.398  -84.380  -12.785 1.00 37.85  ? 100 ALA A C    1 
ATOM   1518  O  O    . ALA A  1 120 ? 63.123  -83.880  -13.637 1.00 36.06  ? 100 ALA A O    1 
ATOM   1519  C  CB   . ALA A  1 120 ? 61.775  -86.784  -12.695 1.00 33.80  ? 100 ALA A CB   1 
ATOM   1520  H  H    . ALA A  1 120 ? 61.550  -86.125  -15.094 1.00 31.69  ? 100 ALA A H    1 
ATOM   1521  H  HA   . ALA A  1 120 ? 60.422  -85.143  -12.622 1.00 32.95  ? 100 ALA A HA   1 
ATOM   1522  H  HB1  . ALA A  1 120 ? 61.995  -86.752  -11.630 1.00 33.58  ? 100 ALA A HB1  1 
ATOM   1523  H  HB2  . ALA A  1 120 ? 60.965  -87.487  -12.889 1.00 33.68  ? 100 ALA A HB2  1 
ATOM   1524  H  HB3  . ALA A  1 120 ? 62.665  -87.077  -13.248 1.00 35.15  ? 100 ALA A HB3  1 
ATOM   1525  N  N    . MET A  1 121 ? 62.451  -84.059  -11.493 1.00 33.89  ? 101 MET A N    1 
ATOM   1526  C  CA   . MET A  1 121 ? 63.437  -83.143  -10.942 1.00 33.79  ? 101 MET A CA   1 
ATOM   1527  C  C    . MET A  1 121 ? 63.987  -83.756  -9.670  1.00 34.91  ? 101 MET A C    1 
ATOM   1528  O  O    . MET A  1 121 ? 63.208  -84.253  -8.838  1.00 30.91  ? 101 MET A O    1 
ATOM   1529  C  CB   . MET A  1 121 ? 62.826  -81.746  -10.692 1.00 36.28  ? 101 MET A CB   1 
ATOM   1530  C  CG   . MET A  1 121 ? 61.574  -81.746  -9.858  1.00 38.86  ? 101 MET A CG   1 
ATOM   1531  S  SD   . MET A  1 121 ? 61.052  -80.085  -9.417  1.00 43.13  ? 101 MET A SD   1 
ATOM   1532  C  CE   . MET A  1 121 ? 60.060  -79.696  -10.780 1.00 37.64  ? 101 MET A CE   1 
ATOM   1533  H  H    . MET A  1 121 ? 61.822  -84.449  -10.802 1.00 31.92  ? 101 MET A H    1 
ATOM   1534  H  HA   . MET A  1 121 ? 64.259  -83.011  -11.645 1.00 33.32  ? 101 MET A HA   1 
ATOM   1535  H  HB2  . MET A  1 121 ? 63.567  -81.121  -10.198 1.00 36.43  ? 101 MET A HB2  1 
ATOM   1536  H  HB3  . MET A  1 121 ? 62.568  -81.308  -11.655 1.00 35.92  ? 101 MET A HB3  1 
ATOM   1537  H  HG2  . MET A  1 121 ? 60.768  -82.201  -10.429 1.00 38.62  ? 101 MET A HG2  1 
ATOM   1538  H  HG3  . MET A  1 121 ? 61.724  -82.297  -8.933  1.00 39.57  ? 101 MET A HG3  1 
ATOM   1539  H  HE1  . MET A  1 121 ? 59.827  -78.633  -10.763 1.00 37.36  ? 101 MET A HE1  1 
ATOM   1540  H  HE2  . MET A  1 121 ? 60.627  -79.952  -11.671 1.00 37.46  ? 101 MET A HE2  1 
ATOM   1541  H  HE3  . MET A  1 121 ? 59.144  -80.283  -10.733 1.00 36.89  ? 101 MET A HE3  1 
ATOM   1542  N  N    . ILE A  1 122 ? 65.331  -83.791  -9.542  1.00 32.13  ? 102 ILE A N    1 
ATOM   1543  C  CA   . ILE A  1 122 ? 65.961  -84.349  -8.364  1.00 32.00  ? 102 ILE A CA   1 
ATOM   1544  C  C    . ILE A  1 122 ? 65.671  -83.469  -7.126  1.00 34.16  ? 102 ILE A C    1 
ATOM   1545  O  O    . ILE A  1 122 ? 65.674  -83.997  -6.014  1.00 34.62  ? 102 ILE A O    1 
ATOM   1546  C  CB   . ILE A  1 122 ? 67.487  -84.586  -8.559  1.00 35.40  ? 102 ILE A CB   1 
ATOM   1547  C  CG1  . ILE A  1 122 ? 67.969  -85.772  -7.700  1.00 37.65  ? 102 ILE A CG1  1 
ATOM   1548  C  CG2  . ILE A  1 122 ? 68.311  -83.360  -8.246  1.00 35.64  ? 102 ILE A CG2  1 
ATOM   1549  C  CD1  . ILE A  1 122 ? 67.459  -87.169  -8.174  1.00 30.22  ? 102 ILE A CD1  1 
ATOM   1550  H  H    . ILE A  1 122 ? 65.981  -83.455  -10.243 1.00 31.91  ? 102 ILE A H    1 
ATOM   1551  H  HA   . ILE A  1 122 ? 65.492  -85.312  -8.168  1.00 32.36  ? 102 ILE A HA   1 
ATOM   1552  H  HB   . ILE A  1 122 ? 67.662  -84.843  -9.602  1.00 36.26  ? 102 ILE A HB   1 
ATOM   1553  H  HG12 . ILE A  1 122 ? 69.057  -85.786  -7.727  1.00 39.06  ? 102 ILE A HG12 1 
ATOM   1554  H  HG13 . ILE A  1 122 ? 67.634  -85.622  -6.674  1.00 37.90  ? 102 ILE A HG13 1 
ATOM   1555  H  HG21 . ILE A  1 122 ? 69.321  -83.546  -8.604  1.00 34.91  ? 102 ILE A HG21 1 
ATOM   1556  H  HG22 . ILE A  1 122 ? 67.882  -82.489  -8.740  1.00 37.19  ? 102 ILE A HG22 1 
ATOM   1557  H  HG23 . ILE A  1 122 ? 68.359  -83.201  -7.169  1.00 37.25  ? 102 ILE A HG23 1 
ATOM   1558  H  HD11 . ILE A  1 122 ? 68.121  -87.932  -7.772  1.00 31.27  ? 102 ILE A HD11 1 
ATOM   1559  H  HD12 . ILE A  1 122 ? 66.450  -87.333  -7.800  1.00 28.23  ? 102 ILE A HD12 1 
ATOM   1560  H  HD13 . ILE A  1 122 ? 67.468  -87.198  -9.262  1.00 29.12  ? 102 ILE A HD13 1 
ATOM   1561  N  N    . ALA A  1 123 ? 65.427  -82.154  -7.301  1.00 30.04  ? 103 ALA A N    1 
ATOM   1562  C  CA   . ALA A  1 123 ? 65.123  -81.272  -6.153  1.00 28.90  ? 103 ALA A CA   1 
ATOM   1563  C  C    . ALA A  1 123 ? 63.884  -81.763  -5.378  1.00 32.81  ? 103 ALA A C    1 
ATOM   1564  O  O    . ALA A  1 123 ? 63.858  -81.666  -4.170  1.00 33.09  ? 103 ALA A O    1 
ATOM   1565  C  CB   . ALA A  1 123 ? 64.905  -79.848  -6.634  1.00 28.84  ? 103 ALA A CB   1 
ATOM   1566  H  H    . ALA A  1 123 ? 65.454  -81.669  -8.191  1.00 28.88  ? 103 ALA A H    1 
ATOM   1567  H  HA   . ALA A  1 123 ? 65.965  -81.273  -5.463  1.00 28.29  ? 103 ALA A HA   1 
ATOM   1568  H  HB1  . ALA A  1 123 ? 64.668  -79.221  -5.776  1.00 30.02  ? 103 ALA A HB1  1 
ATOM   1569  H  HB2  . ALA A  1 123 ? 65.821  -79.498  -7.108  1.00 27.87  ? 103 ALA A HB2  1 
ATOM   1570  H  HB3  . ALA A  1 123 ? 64.077  -79.826  -7.339  1.00 29.20  ? 103 ALA A HB3  1 
ATOM   1571  N  N    . SER A  1 124 ? 62.873  -82.326  -6.081  1.00 31.60  ? 104 SER A N    1 
ATOM   1572  C  CA   . SER A  1 124 ? 61.661  -82.856  -5.442  1.00 30.25  ? 104 SER A CA   1 
ATOM   1573  C  C    . SER A  1 124 ? 61.987  -84.141  -4.692  1.00 34.87  ? 104 SER A C    1 
ATOM   1574  O  O    . SER A  1 124 ? 61.545  -84.305  -3.548  1.00 34.41  ? 104 SER A O    1 
ATOM   1575  C  CB   . SER A  1 124 ? 60.571  -83.097  -6.474  1.00 33.99  ? 104 SER A CB   1 
ATOM   1576  O  OG   . SER A  1 124 ? 59.396  -83.651  -5.902  1.00 42.55  ? 104 SER A OG   1 
ATOM   1577  H  H    . SER A  1 124 ? 62.881  -82.426  -7.090  1.00 30.83  ? 104 SER A H    1 
ATOM   1578  H  HA   . SER A  1 124 ? 61.284  -82.121  -4.733  1.00 26.81  ? 104 SER A HA   1 
ATOM   1579  H  HB2  . SER A  1 124 ? 60.330  -82.141  -6.936  1.00 31.58  ? 104 SER A HB2  1 
ATOM   1580  H  HB3  . SER A  1 124 ? 60.948  -83.792  -7.225  1.00 34.31  ? 104 SER A HB3  1 
ATOM   1581  H  HG   . SER A  1 124 ? 59.133  -83.129  -5.101  1.00 42.71  ? 104 SER A HG   1 
ATOM   1582  N  N    . PHE A  1 125 ? 62.788  -85.043  -5.309  1.00 33.54  ? 105 PHE A N    1 
ATOM   1583  C  CA   . PHE A  1 125 ? 63.252  -86.277  -4.660  1.00 32.87  ? 105 PHE A CA   1 
ATOM   1584  C  C    . PHE A  1 125 ? 63.957  -85.927  -3.344  1.00 35.63  ? 105 PHE A C    1 
ATOM   1585  O  O    . PHE A  1 125 ? 63.605  -86.473  -2.308  1.00 34.62  ? 105 PHE A O    1 
ATOM   1586  C  CB   . PHE A  1 125 ? 64.190  -87.075  -5.585  1.00 34.95  ? 105 PHE A CB   1 
ATOM   1587  C  CG   . PHE A  1 125 ? 64.904  -88.233  -4.919  1.00 34.44  ? 105 PHE A CG   1 
ATOM   1588  C  CD1  . PHE A  1 125 ? 64.242  -89.429  -4.675  1.00 36.84  ? 105 PHE A CD1  1 
ATOM   1589  C  CD2  . PHE A  1 125 ? 66.215  -88.099  -4.477  1.00 33.89  ? 105 PHE A CD2  1 
ATOM   1590  C  CE1  . PHE A  1 125 ? 64.873  -90.462  -3.980  1.00 37.86  ? 105 PHE A CE1  1 
ATOM   1591  C  CE2  . PHE A  1 125 ? 66.841  -89.130  -3.763  1.00 38.15  ? 105 PHE A CE2  1 
ATOM   1592  C  CZ   . PHE A  1 125 ? 66.171  -90.306  -3.528  1.00 37.18  ? 105 PHE A CZ   1 
ATOM   1593  H  H    . PHE A  1 125 ? 63.117  -84.944  -6.263  1.00 32.80  ? 105 PHE A H    1 
ATOM   1594  H  HA   . PHE A  1 125 ? 62.397  -86.910  -4.434  1.00 32.67  ? 105 PHE A HA   1 
ATOM   1595  H  HB2  . PHE A  1 125 ? 63.591  -87.499  -6.387  1.00 35.44  ? 105 PHE A HB2  1 
ATOM   1596  H  HB3  . PHE A  1 125 ? 64.949  -86.412  -5.998  1.00 35.29  ? 105 PHE A HB3  1 
ATOM   1597  H  HD1  . PHE A  1 125 ? 63.204  -89.542  -4.985  1.00 36.33  ? 105 PHE A HD1  1 
ATOM   1598  H  HD2  . PHE A  1 125 ? 66.748  -87.164  -4.646  1.00 31.83  ? 105 PHE A HD2  1 
ATOM   1599  H  HE1  . PHE A  1 125 ? 64.349  -91.395  -3.776  1.00 37.40  ? 105 PHE A HE1  1 
ATOM   1600  H  HE2  . PHE A  1 125 ? 67.876  -89.030  -3.442  1.00 38.21  ? 105 PHE A HE2  1 
ATOM   1601  H  HZ   . PHE A  1 125 ? 66.672  -91.128  -3.017  1.00 36.98  ? 105 PHE A HZ   1 
ATOM   1602  N  N    . LEU A  1 126 ? 64.903  -84.969  -3.392  1.00 34.45  ? 106 LEU A N    1 
ATOM   1603  C  CA   . LEU A  1 126 ? 65.652  -84.518  -2.208  1.00 34.75  ? 106 LEU A CA   1 
ATOM   1604  C  C    . LEU A  1 126 ? 64.735  -83.874  -1.164  1.00 41.03  ? 106 LEU A C    1 
ATOM   1605  O  O    . LEU A  1 126 ? 64.862  -84.149  0.026   1.00 42.24  ? 106 LEU A O    1 
ATOM   1606  C  CB   . LEU A  1 126 ? 66.730  -83.518  -2.618  1.00 34.83  ? 106 LEU A CB   1 
ATOM   1607  C  CG   . LEU A  1 126 ? 67.912  -84.073  -3.395  1.00 39.37  ? 106 LEU A CG   1 
ATOM   1608  C  CD1  . LEU A  1 126 ? 68.681  -82.945  -4.089  1.00 41.23  ? 106 LEU A CD1  1 
ATOM   1609  C  CD2  . LEU A  1 126 ? 68.833  -84.862  -2.492  1.00 39.11  ? 106 LEU A CD2  1 
ATOM   1610  H  H    . LEU A  1 126 ? 65.161  -84.486  -4.246  1.00 33.72  ? 106 LEU A H    1 
ATOM   1611  H  HA   . LEU A  1 126 ? 66.132  -85.378  -1.747  1.00 34.55  ? 106 LEU A HA   1 
ATOM   1612  H  HB2  . LEU A  1 126 ? 66.269  -82.743  -3.233  1.00 35.32  ? 106 LEU A HB2  1 
ATOM   1613  H  HB3  . LEU A  1 126 ? 67.125  -83.053  -1.716  1.00 35.54  ? 106 LEU A HB3  1 
ATOM   1614  H  HG   . LEU A  1 126 ? 67.536  -84.738  -4.171  1.00 39.94  ? 106 LEU A HG   1 
ATOM   1615  H  HD11 . LEU A  1 126 ? 69.549  -83.360  -4.599  1.00 41.22  ? 106 LEU A HD11 1 
ATOM   1616  H  HD12 . LEU A  1 126 ? 68.029  -82.466  -4.817  1.00 41.33  ? 106 LEU A HD12 1 
ATOM   1617  H  HD13 . LEU A  1 126 ? 68.999  -82.225  -3.336  1.00 40.08  ? 106 LEU A HD13 1 
ATOM   1618  H  HD21 . LEU A  1 126 ? 69.787  -85.008  -2.997  1.00 39.91  ? 106 LEU A HD21 1 
ATOM   1619  H  HD22 . LEU A  1 126 ? 68.998  -84.318  -1.564  1.00 38.67  ? 106 LEU A HD22 1 
ATOM   1620  H  HD23 . LEU A  1 126 ? 68.378  -85.829  -2.287  1.00 38.34  ? 106 LEU A HD23 1 
ATOM   1621  N  N    . THR A  1 127 ? 63.833  -82.982  -1.606  1.00 37.87  ? 107 THR A N    1 
ATOM   1622  C  CA   . THR A  1 127 ? 62.916  -82.280  -0.704  1.00 37.33  ? 107 THR A CA   1 
ATOM   1623  C  C    . THR A  1 127 ? 62.101  -83.259  0.135   1.00 36.84  ? 107 THR A C    1 
ATOM   1624  O  O    . THR A  1 127 ? 61.928  -83.055  1.337   1.00 35.09  ? 107 THR A O    1 
ATOM   1625  C  CB   . THR A  1 127 ? 61.956  -81.346  -1.494  1.00 47.01  ? 107 THR A CB   1 
ATOM   1626  O  OG1  . THR A  1 127 ? 62.721  -80.367  -2.179  1.00 57.60  ? 107 THR A OG1  1 
ATOM   1627  C  CG2  . THR A  1 127 ? 60.977  -80.624  -0.597  1.00 48.01  ? 107 THR A CG2  1 
ATOM   1628  H  H    . THR A  1 127 ? 63.733  -82.718  -2.580  1.00 37.01  ? 107 THR A H    1 
ATOM   1629  H  HA   . THR A  1 127 ? 63.498  -81.657  -0.025  1.00 38.17  ? 107 THR A HA   1 
ATOM   1630  H  HB   . THR A  1 127 ? 61.378  -81.938  -2.201  1.00 45.76  ? 107 THR A HB   1 
ATOM   1631  H  HG1  . THR A  1 127 ? 62.169  -79.954  -2.895  1.00 58.57  ? 107 THR A HG1  1 
ATOM   1632  H  HG21 . THR A  1 127 ? 60.541  -79.786  -1.137  1.00 48.14  ? 107 THR A HG21 1 
ATOM   1633  H  HG22 . THR A  1 127 ? 60.172  -81.293  -0.297  1.00 48.89  ? 107 THR A HG22 1 
ATOM   1634  H  HG23 . THR A  1 127 ? 61.491  -80.259  0.291   1.00 47.34  ? 107 THR A HG23 1 
ATOM   1635  N  N    . LEU A  1 128 ? 61.565  -84.284  -0.499  1.00 30.01  ? 108 LEU A N    1 
ATOM   1636  C  CA   . LEU A  1 128 ? 60.735  -85.224  0.227   1.00 32.08  ? 108 LEU A CA   1 
ATOM   1637  C  C    . LEU A  1 128 ? 61.547  -86.277  1.024   1.00 35.88  ? 108 LEU A C    1 
ATOM   1638  O  O    . LEU A  1 128 ? 61.295  -86.473  2.203   1.00 34.59  ? 108 LEU A O    1 
ATOM   1639  C  CB   . LEU A  1 128 ? 59.790  -85.959  -0.751  1.00 32.93  ? 108 LEU A CB   1 
ATOM   1640  C  CG   . LEU A  1 128 ? 58.670  -85.083  -1.326  1.00 38.08  ? 108 LEU A CG   1 
ATOM   1641  C  CD1  . LEU A  1 128 ? 58.060  -85.741  -2.528  1.00 40.52  ? 108 LEU A CD1  1 
ATOM   1642  C  CD2  . LEU A  1 128 ? 57.579  -84.801  -0.301  1.00 37.91  ? 108 LEU A CD2  1 
ATOM   1643  H  H    . LEU A  1 128 ? 61.690  -84.490  -1.484  1.00 28.58  ? 108 LEU A H    1 
ATOM   1644  H  HA   . LEU A  1 128 ? 60.114  -84.682  0.936   1.00 30.10  ? 108 LEU A HA   1 
ATOM   1645  H  HB2  . LEU A  1 128 ? 60.383  -86.348  -1.576  1.00 32.32  ? 108 LEU A HB2  1 
ATOM   1646  H  HB3  . LEU A  1 128 ? 59.324  -86.789  -0.223  1.00 32.56  ? 108 LEU A HB3  1 
ATOM   1647  H  HG   . LEU A  1 128 ? 59.089  -84.127  -1.631  1.00 37.53  ? 108 LEU A HG   1 
ATOM   1648  H  HD11 . LEU A  1 128 ? 57.223  -85.138  -2.874  1.00 41.53  ? 108 LEU A HD11 1 
ATOM   1649  H  HD12 . LEU A  1 128 ? 58.821  -85.815  -3.303  1.00 39.69  ? 108 LEU A HD12 1 
ATOM   1650  H  HD13 . LEU A  1 128 ? 57.717  -86.735  -2.244  1.00 41.06  ? 108 LEU A HD13 1 
ATOM   1651  H  HD21 . LEU A  1 128 ? 56.797  -84.202  -0.763  1.00 38.08  ? 108 LEU A HD21 1 
ATOM   1652  H  HD22 . LEU A  1 128 ? 57.160  -85.756  0.014   1.00 38.60  ? 108 LEU A HD22 1 
ATOM   1653  H  HD23 . LEU A  1 128 ? 57.986  -84.267  0.555   1.00 37.19  ? 108 LEU A HD23 1 
ATOM   1654  N  N    . THR A  1 129 ? 62.524  -86.905  0.394   1.00 32.28  ? 109 THR A N    1 
ATOM   1655  C  CA   . THR A  1 129 ? 63.245  -88.020  1.000   1.00 32.84  ? 109 THR A CA   1 
ATOM   1656  C  C    . THR A  1 129 ? 64.353  -87.622  1.963   1.00 36.70  ? 109 THR A C    1 
ATOM   1657  O  O    . THR A  1 129 ? 64.735  -88.459  2.787   1.00 35.41  ? 109 THR A O    1 
ATOM   1658  C  CB   . THR A  1 129 ? 63.805  -88.970  -0.064  1.00 31.61  ? 109 THR A CB   1 
ATOM   1659  O  OG1  . THR A  1 129 ? 64.935  -88.397  -0.732  1.00 28.25  ? 109 THR A OG1  1 
ATOM   1660  C  CG2  . THR A  1 129 ? 62.731  -89.460  -1.037  1.00 30.21  ? 109 THR A CG2  1 
ATOM   1661  H  H    . THR A  1 129 ? 62.842  -86.644  -0.532  1.00 31.96  ? 109 THR A H    1 
ATOM   1662  H  HA   . THR A  1 129 ? 62.531  -88.608  1.578   1.00 33.86  ? 109 THR A HA   1 
ATOM   1663  H  HB   . THR A  1 129 ? 64.155  -89.862  0.452   1.00 31.85  ? 109 THR A HB   1 
ATOM   1664  H  HG1  . THR A  1 129 ? 64.863  -87.412  -0.828  1.00 28.98  ? 109 THR A HG1  1 
ATOM   1665  H  HG21 . THR A  1 129 ? 63.164  -90.178  -1.731  1.00 29.48  ? 109 THR A HG21 1 
ATOM   1666  H  HG22 . THR A  1 129 ? 61.923  -89.944  -0.493  1.00 28.61  ? 109 THR A HG22 1 
ATOM   1667  H  HG23 . THR A  1 129 ? 62.314  -88.633  -1.613  1.00 31.95  ? 109 THR A HG23 1 
ATOM   1668  N  N    . ILE A  1 130 ? 64.859  -86.392  1.896   1.00 33.82  ? 110 ILE A N    1 
ATOM   1669  C  CA   . ILE A  1 130 ? 65.947  -85.994  2.817   1.00 33.39  ? 110 ILE A CA   1 
ATOM   1670  C  C    . ILE A  1 130 ? 65.919  -84.489  3.088   1.00 36.69  ? 110 ILE A C    1 
ATOM   1671  O  O    . ILE A  1 130 ? 66.953  -83.852  3.290   1.00 36.59  ? 110 ILE A O    1 
ATOM   1672  C  CB   . ILE A  1 130 ? 67.297  -86.507  2.206   1.00 35.31  ? 110 ILE A CB   1 
ATOM   1673  C  CG1  . ILE A  1 130 ? 68.329  -86.784  3.312   1.00 35.80  ? 110 ILE A CG1  1 
ATOM   1674  C  CG2  . ILE A  1 130 ? 67.824  -85.622  1.100   1.00 33.25  ? 110 ILE A CG2  1 
ATOM   1675  C  CD1  . ILE A  1 130 ? 68.134  -88.098  3.918   1.00 34.68  ? 110 ILE A CD1  1 
ATOM   1676  H  H    . ILE A  1 130 ? 64.583  -85.683  1.225   1.00 33.86  ? 110 ILE A H    1 
ATOM   1677  H  HA   . ILE A  1 130 ? 65.807  -86.460  3.791   1.00 34.27  ? 110 ILE A HA   1 
ATOM   1678  H  HB   . ILE A  1 130 ? 67.098  -87.466  1.732   1.00 36.11  ? 110 ILE A HB   1 
ATOM   1679  H  HG12 . ILE A  1 130 ? 69.336  -86.743  2.902   1.00 35.57  ? 110 ILE A HG12 1 
ATOM   1680  H  HG13 . ILE A  1 130 ? 68.217  -86.042  4.101   1.00 35.36  ? 110 ILE A HG13 1 
ATOM   1681  H  HG21 . ILE A  1 130 ? 68.487  -86.215  0.473   1.00 33.57  ? 110 ILE A HG21 1 
ATOM   1682  H  HG22 . ILE A  1 130 ? 66.986  -85.257  0.510   1.00 31.43  ? 110 ILE A HG22 1 
ATOM   1683  H  HG23 . ILE A  1 130 ? 68.386  -84.793  1.529   1.00 32.18  ? 110 ILE A HG23 1 
ATOM   1684  H  HD11 . ILE A  1 130 ? 68.588  -88.092  4.908   1.00 35.13  ? 110 ILE A HD11 1 
ATOM   1685  H  HD12 . ILE A  1 130 ? 67.071  -88.310  4.005   1.00 34.17  ? 110 ILE A HD12 1 
ATOM   1686  H  HD13 . ILE A  1 130 ? 68.617  -88.843  3.289   1.00 33.38  ? 110 ILE A HD13 1 
ATOM   1687  N  N    . GLY A  1 131 ? 64.705  -83.970  3.227   1.00 33.98  ? 111 GLY A N    1 
ATOM   1688  C  CA   . GLY A  1 131 ? 64.465  -82.550  3.419   1.00 34.06  ? 111 GLY A CA   1 
ATOM   1689  C  C    . GLY A  1 131 ? 64.217  -82.183  4.874   1.00 38.64  ? 111 GLY A C    1 
ATOM   1690  O  O    . GLY A  1 131 ? 65.130  -82.221  5.711   1.00 35.83  ? 111 GLY A O    1 
ATOM   1691  H  H    . GLY A  1 131 ? 63.856  -84.524  3.263   1.00 34.17  ? 111 GLY A H    1 
ATOM   1692  H  HA2  . GLY A  1 131 ? 65.300  -81.966  3.034   1.00 33.77  ? 111 GLY A HA2  1 
ATOM   1693  H  HA3  . GLY A  1 131 ? 63.591  -82.268  2.836   1.00 34.80  ? 111 GLY A HA3  1 
ATOM   1694  N  N    . ASN A  1 132 ? 62.959  -81.839  5.199   1.00 35.31  ? 112 ASN A N    1 
ATOM   1695  C  CA   . ASN A  1 132 ? 62.584  -81.446  6.539   1.00 35.33  ? 112 ASN A CA   1 
ATOM   1696  C  C    . ASN A  1 132 ? 62.790  -82.561  7.549   1.00 37.92  ? 112 ASN A C    1 
ATOM   1697  O  O    . ASN A  1 132 ? 62.937  -82.258  8.722   1.00 35.25  ? 112 ASN A O    1 
ATOM   1698  C  CB   . ASN A  1 132 ? 61.107  -81.031  6.617   1.00 41.40  ? 112 ASN A CB   1 
ATOM   1699  C  CG   . ASN A  1 132 ? 60.823  -79.652  6.121   1.00 47.47  ? 112 ASN A CG   1 
ATOM   1700  O  OD1  . ASN A  1 132 ? 61.722  -78.867  5.841   1.00 37.86  ? 112 ASN A OD1  1 
ATOM   1701  N  ND2  . ASN A  1 132 ? 59.546  -79.328  6.035   1.00 44.04  ? 112 ASN A ND2  1 
ATOM   1702  H  H    . ASN A  1 132 ? 62.197  -81.810  4.528   1.00 36.00  ? 112 ASN A H    1 
ATOM   1703  H  HA   . ASN A  1 132 ? 63.212  -80.609  6.842   1.00 32.43  ? 112 ASN A HA   1 
ATOM   1704  H  HB2  . ASN A  1 132 ? 60.505  -81.744  6.055   1.00 42.01  ? 112 ASN A HB2  1 
ATOM   1705  H  HB3  . ASN A  1 132 ? 60.788  -81.056  7.657   1.00 41.52  ? 112 ASN A HB3  1 
ATOM   1706  H  HD21 . ASN A  1 132 ? 59.279  -78.404  5.711   1.00 44.85  ? 112 ASN A HD21 1 
ATOM   1707  H  HD22 . ASN A  1 132 ? 58.833  -79.998  6.306   1.00 44.45  ? 112 ASN A HD22 1 
ATOM   1708  N  N    . ASN A  1 133 ? 62.829  -83.829  7.106   1.00 33.39  ? 113 ASN A N    1 
ATOM   1709  C  CA   . ASN A  1 133 ? 63.077  -84.927  8.021   1.00 34.41  ? 113 ASN A CA   1 
ATOM   1710  C  C    . ASN A  1 133 ? 64.476  -84.823  8.701   1.00 39.47  ? 113 ASN A C    1 
ATOM   1711  O  O    . ASN A  1 133 ? 64.655  -85.415  9.759   1.00 43.54  ? 113 ASN A O    1 
ATOM   1712  C  CB   . ASN A  1 133 ? 62.868  -86.276  7.349   1.00 33.52  ? 113 ASN A CB   1 
ATOM   1713  C  CG   . ASN A  1 133 ? 63.807  -86.657  6.224   1.00 40.92  ? 113 ASN A CG   1 
ATOM   1714  O  OD1  . ASN A  1 133 ? 65.035  -86.478  6.273   1.00 34.41  ? 113 ASN A OD1  1 
ATOM   1715  N  ND2  . ASN A  1 133 ? 63.261  -87.284  5.209   1.00 32.75  ? 113 ASN A ND2  1 
ATOM   1716  H  H    . ASN A  1 133 ? 62.622  -84.115  6.156   1.00 33.52  ? 113 ASN A H    1 
ATOM   1717  H  HA   . ASN A  1 133 ? 62.314  -84.865  8.795   1.00 34.74  ? 113 ASN A HA   1 
ATOM   1718  H  HB2  . ASN A  1 133 ? 62.912  -87.042  8.120   1.00 33.88  ? 113 ASN A HB2  1 
ATOM   1719  H  HB3  . ASN A  1 133 ? 61.853  -86.252  6.952   1.00 34.45  ? 113 ASN A HB3  1 
ATOM   1720  H  HD21 . ASN A  1 133 ? 63.849  -87.585  4.442   1.00 31.31  ? 113 ASN A HD21 1 
ATOM   1721  H  HD22 . ASN A  1 133 ? 62.273  -87.519  5.206   1.00 33.93  ? 113 ASN A HD22 1 
ATOM   1722  N  N    . GLN A  1 134 ? 65.409  -84.021  8.151   1.00 33.07  ? 114 GLN A N    1 
ATOM   1723  C  CA   . GLN A  1 134 ? 66.738  -83.787  8.721   1.00 32.97  ? 114 GLN A CA   1 
ATOM   1724  C  C    . GLN A  1 134 ? 66.756  -82.730  9.855   1.00 39.20  ? 114 GLN A C    1 
ATOM   1725  O  O    . GLN A  1 134 ? 67.812  -82.514  10.464  1.00 38.32  ? 114 GLN A O    1 
ATOM   1726  C  CB   . GLN A  1 134 ? 67.721  -83.374  7.627   1.00 34.39  ? 114 GLN A CB   1 
ATOM   1727  C  CG   . GLN A  1 134 ? 67.942  -84.433  6.581   1.00 43.65  ? 114 GLN A CG   1 
ATOM   1728  C  CD   . GLN A  1 134 ? 68.614  -85.645  7.196   1.00 42.85  ? 114 GLN A CD   1 
ATOM   1729  O  OE1  . GLN A  1 134 ? 69.772  -85.604  7.639   1.00 32.63  ? 114 GLN A OE1  1 
ATOM   1730  N  NE2  . GLN A  1 134 ? 67.882  -86.724  7.342   1.00 31.67  ? 114 GLN A NE2  1 
ATOM   1731  H  H    . GLN A  1 134 ? 65.289  -83.538  7.267   1.00 33.03  ? 114 GLN A H    1 
ATOM   1732  H  HA   . GLN A  1 134 ? 67.098  -84.717  9.151   1.00 34.44  ? 114 GLN A HA   1 
ATOM   1733  H  HB2  . GLN A  1 134 ? 67.364  -82.481  7.116   1.00 36.00  ? 114 GLN A HB2  1 
ATOM   1734  H  HB3  . GLN A  1 134 ? 68.687  -83.162  8.081   1.00 35.40  ? 114 GLN A HB3  1 
ATOM   1735  H  HG2  . GLN A  1 134 ? 66.991  -84.717  6.133   1.00 44.15  ? 114 GLN A HG2  1 
ATOM   1736  H  HG3  . GLN A  1 134 ? 68.594  -84.033  5.805   1.00 43.97  ? 114 GLN A HG3  1 
ATOM   1737  H  HE21 . GLN A  1 134 ? 66.905  -86.741  7.070   1.00 31.35  ? 114 GLN A HE21 1 
ATOM   1738  H  HE22 . GLN A  1 134 ? 68.298  -87.552  7.758   1.00 31.60  ? 114 GLN A HE22 1 
ATOM   1739  N  N    . GLY A  1 135 ? 65.626  -82.076  10.129  1.00 35.96  ? 115 GLY A N    1 
ATOM   1740  C  CA   . GLY A  1 135 ? 65.509  -81.114  11.220  1.00 37.36  ? 115 GLY A CA   1 
ATOM   1741  C  C    . GLY A  1 135 ? 64.514  -81.527  12.289  1.00 44.47  ? 115 GLY A C    1 
ATOM   1742  O  O    . GLY A  1 135 ? 64.124  -80.701  13.116  1.00 44.88  ? 115 GLY A O    1 
ATOM   1743  H  H    . GLY A  1 135 ? 64.768  -82.146  9.595   1.00 34.83  ? 115 GLY A H    1 
ATOM   1744  H  HA2  . GLY A  1 135 ? 66.461  -80.961  11.718  1.00 37.73  ? 115 GLY A HA2  1 
ATOM   1745  H  HA3  . GLY A  1 135 ? 65.186  -80.154  10.819  1.00 36.78  ? 115 GLY A HA3  1 
ATOM   1746  N  N    . MET A  1 136 ? 64.098  -82.805  12.304  1.00 41.76  ? 116 MET A N    1 
ATOM   1747  C  CA   . MET A  1 136 ? 63.098  -83.283  13.265  1.00 41.29  ? 116 MET A CA   1 
ATOM   1748  C  C    . MET A  1 136 ? 63.651  -83.255  14.697  1.00 45.32  ? 116 MET A C    1 
ATOM   1749  O  O    . MET A  1 136 ? 64.753  -83.750  14.942  1.00 45.56  ? 116 MET A O    1 
ATOM   1750  C  CB   . MET A  1 136 ? 62.650  -84.705  12.896  1.00 42.95  ? 116 MET A CB   1 
ATOM   1751  C  CG   . MET A  1 136 ? 61.847  -84.749  11.635  1.00 46.77  ? 116 MET A CG   1 
ATOM   1752  S  SD   . MET A  1 136 ? 61.457  -86.432  11.083  1.00 49.25  ? 116 MET A SD   1 
ATOM   1753  C  CE   . MET A  1 136 ? 60.255  -86.898  12.319  1.00 45.01  ? 116 MET A CE   1 
ATOM   1754  H  H    . MET A  1 136 ? 64.457  -83.532  11.695  1.00 41.66  ? 116 MET A H    1 
ATOM   1755  H  HA   . MET A  1 136 ? 62.224  -82.636  13.207  1.00 40.71  ? 116 MET A HA   1 
ATOM   1756  H  HB2  . MET A  1 136 ? 63.524  -85.340  12.766  1.00 41.29  ? 116 MET A HB2  1 
ATOM   1757  H  HB3  . MET A  1 136 ? 62.026  -85.094  13.698  1.00 44.11  ? 116 MET A HB3  1 
ATOM   1758  H  HG2  . MET A  1 136 ? 60.906  -84.225  11.797  1.00 47.52  ? 116 MET A HG2  1 
ATOM   1759  H  HG3  . MET A  1 136 ? 62.414  -84.252  10.850  1.00 47.18  ? 116 MET A HG3  1 
ATOM   1760  H  HE1  . MET A  1 136 ? 60.777  -87.110  13.250  1.00 45.45  ? 116 MET A HE1  1 
ATOM   1761  H  HE2  . MET A  1 136 ? 59.564  -86.070  12.467  1.00 46.23  ? 116 MET A HE2  1 
ATOM   1762  H  HE3  . MET A  1 136 ? 59.707  -87.782  12.001  1.00 43.86  ? 116 MET A HE3  1 
ATOM   1763  N  N    . GLY A  1 137 ? 62.889  -82.669  15.616  1.00 39.88  ? 117 GLY A N    1 
ATOM   1764  C  CA   . GLY A  1 137 ? 63.306  -82.567  17.000  1.00 39.82  ? 117 GLY A CA   1 
ATOM   1765  C  C    . GLY A  1 137 ? 63.319  -83.883  17.759  1.00 48.77  ? 117 GLY A C    1 
ATOM   1766  O  O    . GLY A  1 137 ? 64.031  -84.001  18.760  1.00 49.17  ? 117 GLY A O    1 
ATOM   1767  H  H    . GLY A  1 137 ? 61.975  -82.268  15.431  1.00 38.60  ? 117 GLY A H    1 
ATOM   1768  H  HA2  . GLY A  1 137 ? 64.307  -82.143  17.043  1.00 39.52  ? 117 GLY A HA2  1 
ATOM   1769  H  HA3  . GLY A  1 137 ? 62.638  -81.882  17.518  1.00 39.74  ? 117 GLY A HA3  1 
ATOM   1770  N  N    . ASP A  1 138 ? 62.529  -84.887  17.302  1.00 45.72  ? 118 ASP A N    1 
ATOM   1771  C  CA   . ASP A  1 138 ? 62.418  -86.190  17.970  1.00 45.69  ? 118 ASP A CA   1 
ATOM   1772  C  C    . ASP A  1 138 ? 63.346  -87.257  17.357  1.00 50.34  ? 118 ASP A C    1 
ATOM   1773  O  O    . ASP A  1 138 ? 63.316  -88.411  17.804  1.00 49.92  ? 118 ASP A O    1 
ATOM   1774  C  CB   . ASP A  1 138 ? 60.964  -86.684  17.935  1.00 47.44  ? 118 ASP A CB   1 
ATOM   1775  C  CG   . ASP A  1 138 ? 60.322  -86.806  16.564  1.00 56.01  ? 118 ASP A CG   1 
ATOM   1776  O  OD1  . ASP A  1 138 ? 60.666  -85.979  15.664  1.00 57.35  ? 118 ASP A OD1  1 
ATOM   1777  O  OD2  . ASP A  1 138 ? 59.387  -87.649  16.416  1.00 49.32  ? 118 ASP A OD2  1 
ATOM   1778  H  H    . ASP A  1 138 ? 61.966  -84.811  16.463  1.00 44.24  ? 118 ASP A H    1 
ATOM   1779  H  HA   . ASP A  1 138 ? 62.682  -86.090  19.022  1.00 45.23  ? 118 ASP A HA   1 
ATOM   1780  H  HB2  . ASP A  1 138 ? 60.919  -87.665  18.405  1.00 47.66  ? 118 ASP A HB2  1 
ATOM   1781  H  HB3  . ASP A  1 138 ? 60.355  -85.975  18.494  1.00 47.99  ? 118 ASP A HB3  1 
ATOM   1782  N  N    . VAL A  1 139 ? 64.198  -86.881  16.367  1.00 45.05  ? 119 VAL A N    1 
ATOM   1783  C  CA   . VAL A  1 139 ? 65.138  -87.796  15.724  1.00 43.96  ? 119 VAL A CA   1 
ATOM   1784  C  C    . VAL A  1 139 ? 66.549  -87.355  16.068  1.00 42.66  ? 119 VAL A C    1 
ATOM   1785  O  O    . VAL A  1 139 ? 66.854  -86.174  15.903  1.00 40.20  ? 119 VAL A O    1 
ATOM   1786  C  CB   . VAL A  1 139 ? 64.904  -87.812  14.192  1.00 49.39  ? 119 VAL A CB   1 
ATOM   1787  C  CG1  . VAL A  1 139 ? 65.973  -88.629  13.472  1.00 48.32  ? 119 VAL A CG1  1 
ATOM   1788  C  CG2  . VAL A  1 139 ? 63.508  -88.341  13.868  1.00 49.85  ? 119 VAL A CG2  1 
ATOM   1789  H  H    . VAL A  1 139 ? 64.290  -85.939  16.007  1.00 43.95  ? 119 VAL A H    1 
ATOM   1790  H  HA   . VAL A  1 139 ? 64.996  -88.813  16.085  1.00 44.83  ? 119 VAL A HA   1 
ATOM   1791  H  HB   . VAL A  1 139 ? 64.971  -86.789  13.826  1.00 50.11  ? 119 VAL A HB   1 
ATOM   1792  H  HG11 . VAL A  1 139 ? 65.600  -88.903  12.486  1.00 48.22  ? 119 VAL A HG11 1 
ATOM   1793  H  HG12 . VAL A  1 139 ? 66.879  -88.033  13.368  1.00 48.21  ? 119 VAL A HG12 1 
ATOM   1794  H  HG13 . VAL A  1 139 ? 66.182  -89.529  14.048  1.00 49.07  ? 119 VAL A HG13 1 
ATOM   1795  H  HG21 . VAL A  1 139 ? 63.325  -88.223  12.802  1.00 48.83  ? 119 VAL A HG21 1 
ATOM   1796  H  HG22 . VAL A  1 139 ? 63.479  -89.397  14.130  1.00 50.86  ? 119 VAL A HG22 1 
ATOM   1797  H  HG23 . VAL A  1 139 ? 62.758  -87.797  14.441  1.00 49.58  ? 119 VAL A HG23 1 
ATOM   1798  N  N    . GLU A  1 140 ? 67.407  -88.264  16.564  1.00 37.12  ? 120 GLU A N    1 
ATOM   1799  C  CA   . GLU A  1 140 ? 68.807  -87.884  16.814  1.00 35.29  ? 120 GLU A CA   1 
ATOM   1800  C  C    . GLU A  1 140 ? 69.507  -87.722  15.460  1.00 39.67  ? 120 GLU A C    1 
ATOM   1801  O  O    . GLU A  1 140 ? 70.207  -86.740  15.240  1.00 40.65  ? 120 GLU A O    1 
ATOM   1802  C  CB   . GLU A  1 140 ? 69.525  -88.912  17.655  1.00 36.56  ? 120 GLU A CB   1 
ATOM   1803  C  CG   . GLU A  1 140 ? 70.805  -88.333  18.258  1.00 49.17  ? 120 GLU A CG   1 
ATOM   1804  C  CD   . GLU A  1 140 ? 71.530  -89.257  19.222  1.00 71.87  ? 120 GLU A CD   1 
ATOM   1805  O  OE1  . GLU A  1 140 ? 72.782  -89.239  19.219  1.00 63.66  ? 120 GLU A OE1  1 
ATOM   1806  O  OE2  . GLU A  1 140 ? 70.855  -90.003  19.970  1.00 62.93  ? 120 GLU A OE2  1 
ATOM   1807  H  H    . GLU A  1 140 ? 67.180  -89.230  16.778  1.00 36.02  ? 120 GLU A H    1 
ATOM   1808  H  HA   . GLU A  1 140 ? 68.856  -86.936  17.343  1.00 34.25  ? 120 GLU A HA   1 
ATOM   1809  H  HB2  . GLU A  1 140 ? 68.861  -89.235  18.456  1.00 36.71  ? 120 GLU A HB2  1 
ATOM   1810  H  HB3  . GLU A  1 140 ? 69.795  -89.767  17.037  1.00 35.03  ? 120 GLU A HB3  1 
ATOM   1811  H  HG2  . GLU A  1 140 ? 71.501  -88.083  17.459  1.00 48.13  ? 120 GLU A HG2  1 
ATOM   1812  H  HG3  . GLU A  1 140 ? 70.559  -87.427  18.809  1.00 49.15  ? 120 GLU A HG3  1 
ATOM   1813  N  N    . TYR A  1 141 ? 69.331  -88.699  14.567  1.00 36.10  ? 121 TYR A N    1 
ATOM   1814  C  CA   . TYR A  1 141 ? 69.938  -88.638  13.240  1.00 37.44  ? 121 TYR A CA   1 
ATOM   1815  C  C    . TYR A  1 141 ? 69.264  -89.628  12.308  1.00 36.99  ? 121 TYR A C    1 
ATOM   1816  O  O    . TYR A  1 141 ? 68.680  -90.591  12.778  1.00 33.63  ? 121 TYR A O    1 
ATOM   1817  C  CB   . TYR A  1 141 ? 71.472  -88.911  13.301  1.00 39.46  ? 121 TYR A CB   1 
ATOM   1818  C  CG   . TYR A  1 141 ? 71.854  -90.199  13.989  1.00 41.07  ? 121 TYR A CG   1 
ATOM   1819  C  CD1  . TYR A  1 141 ? 71.724  -91.422  13.342  1.00 42.94  ? 121 TYR A CD1  1 
ATOM   1820  C  CD2  . TYR A  1 141 ? 72.433  -90.191  15.252  1.00 42.98  ? 121 TYR A CD2  1 
ATOM   1821  C  CE1  . TYR A  1 141 ? 72.093  -92.612  13.961  1.00 45.48  ? 121 TYR A CE1  1 
ATOM   1822  C  CE2  . TYR A  1 141 ? 72.814  -91.374  15.881  1.00 44.83  ? 121 TYR A CE2  1 
ATOM   1823  C  CZ   . TYR A  1 141 ? 72.662  -92.585  15.219  1.00 52.87  ? 121 TYR A CZ   1 
ATOM   1824  O  OH   . TYR A  1 141 ? 73.031  -93.773  15.795  1.00 55.25  ? 121 TYR A OH   1 
ATOM   1825  H  H    . TYR A  1 141 ? 68.792  -89.545  14.730  1.00 36.23  ? 121 TYR A H    1 
ATOM   1826  H  HA   . TYR A  1 141 ? 69.789  -87.639  12.833  1.00 37.36  ? 121 TYR A HA   1 
ATOM   1827  H  HB2  . TYR A  1 141 ? 71.855  -88.940  12.286  1.00 36.55  ? 121 TYR A HB2  1 
ATOM   1828  H  HB3  . TYR A  1 141 ? 71.958  -88.097  13.840  1.00 40.21  ? 121 TYR A HB3  1 
ATOM   1829  H  HD1  . TYR A  1 141 ? 71.324  -91.468  12.331  1.00 42.90  ? 121 TYR A HD1  1 
ATOM   1830  H  HD2  . TYR A  1 141 ? 72.560  -89.249  15.781  1.00 43.13  ? 121 TYR A HD2  1 
ATOM   1831  H  HE1  . TYR A  1 141 ? 71.990  -93.555  13.424  1.00 46.16  ? 121 TYR A HE1  1 
ATOM   1832  H  HE2  . TYR A  1 141 ? 73.236  -91.342  16.884  1.00 44.50  ? 121 TYR A HE2  1 
ATOM   1833  H  HH   . TYR A  1 141 ? 73.643  -93.621  16.563  1.00 55.82  ? 121 TYR A HH   1 
ATOM   1834  N  N    . ALA A  1 142 ? 69.374  -89.382  10.997  1.00 32.76  ? 122 ALA A N    1 
ATOM   1835  C  CA   . ALA A  1 142 ? 68.883  -90.256  9.941   1.00 33.07  ? 122 ALA A CA   1 
ATOM   1836  C  C    . ALA A  1 142 ? 69.647  -89.987  8.655   1.00 37.23  ? 122 ALA A C    1 
ATOM   1837  O  O    . ALA A  1 142 ? 69.708  -88.837  8.222   1.00 38.80  ? 122 ALA A O    1 
ATOM   1838  C  CB   . ALA A  1 142 ? 67.384  -90.054  9.733   1.00 33.91  ? 122 ALA A CB   1 
ATOM   1839  H  H    . ALA A  1 142 ? 69.819  -88.538  10.651  1.00 32.63  ? 122 ALA A H    1 
ATOM   1840  H  HA   . ALA A  1 142 ? 69.034  -91.294  10.225  1.00 33.73  ? 122 ALA A HA   1 
ATOM   1841  H  HB1  . ALA A  1 142 ? 67.026  -90.807  9.031   1.00 33.26  ? 122 ALA A HB1  1 
ATOM   1842  H  HB2  . ALA A  1 142 ? 66.863  -90.144  10.684  1.00 33.28  ? 122 ALA A HB2  1 
ATOM   1843  H  HB3  . ALA A  1 142 ? 67.238  -89.058  9.322   1.00 33.58  ? 122 ALA A HB3  1 
ATOM   1844  N  N    . LYS A  1 143 ? 70.258  -91.017  8.060   1.00 31.50  ? 123 LYS A N    1 
ATOM   1845  C  CA   . LYS A  1 143 ? 71.062  -90.893  6.857   1.00 31.62  ? 123 LYS A CA   1 
ATOM   1846  C  C    . LYS A  1 143 ? 70.586  -91.898  5.859   1.00 36.21  ? 123 LYS A C    1 
ATOM   1847  O  O    . LYS A  1 143 ? 70.377  -93.061  6.226   1.00 33.21  ? 123 LYS A O    1 
ATOM   1848  C  CB   . LYS A  1 143 ? 72.536  -91.130  7.196   1.00 33.12  ? 123 LYS A CB   1 
ATOM   1849  C  CG   . LYS A  1 143 ? 73.512  -91.014  6.042   1.00 29.40  ? 123 LYS A CG   1 
ATOM   1850  C  CD   . LYS A  1 143 ? 74.949  -91.032  6.563   1.00 38.05  ? 123 LYS A CD   1 
ATOM   1851  C  CE   . LYS A  1 143 ? 75.920  -90.417  5.590   1.00 29.43  ? 123 LYS A CE   1 
ATOM   1852  N  NZ   . LYS A  1 143 ? 77.293  -90.317  6.160   1.00 35.31  ? 123 LYS A NZ   1 
ATOM   1853  H  H    . LYS A  1 143 ? 70.197  -91.971  8.397   1.00 32.13  ? 123 LYS A H    1 
ATOM   1854  H  HA   . LYS A  1 143 ? 70.968  -89.895  6.434   1.00 31.88  ? 123 LYS A HA   1 
ATOM   1855  H  HB2  . LYS A  1 143 ? 72.813  -90.367  7.919   1.00 33.69  ? 123 LYS A HB2  1 
ATOM   1856  H  HB3  . LYS A  1 143 ? 72.651  -92.114  7.643   1.00 33.65  ? 123 LYS A HB3  1 
ATOM   1857  H  HG2  . LYS A  1 143 ? 73.392  -91.836  5.342   1.00 29.09  ? 123 LYS A HG2  1 
ATOM   1858  H  HG3  . LYS A  1 143 ? 73.349  -90.065  5.532   1.00 30.68  ? 123 LYS A HG3  1 
ATOM   1859  H  HD2  . LYS A  1 143 ? 75.015  -90.465  7.492   1.00 38.57  ? 123 LYS A HD2  1 
ATOM   1860  H  HD3  . LYS A  1 143 ? 75.253  -92.061  6.736   1.00 36.94  ? 123 LYS A HD3  1 
ATOM   1861  H  HE2  . LYS A  1 143 ? 75.959  -91.030  4.694   1.00 29.14  ? 123 LYS A HE2  1 
ATOM   1862  H  HE3  . LYS A  1 143 ? 75.583  -89.413  5.340   1.00 29.07  ? 123 LYS A HE3  1 
ATOM   1863  H  HZ1  . LYS A  1 143 ? 77.345  -89.543  6.814   1.00 34.16  ? 123 LYS A HZ1  1 
ATOM   1864  H  HZ2  . LYS A  1 143 ? 77.523  -91.178  6.649   1.00 35.54  ? 123 LYS A HZ2  1 
ATOM   1865  H  HZ3  . LYS A  1 143 ? 77.968  -90.177  5.417   1.00 34.83  ? 123 LYS A HZ3  1 
ATOM   1866  N  N    . MET A  1 144 ? 70.383  -91.470  4.611   1.00 33.41  ? 124 MET A N    1 
ATOM   1867  C  CA   . MET A  1 144 ? 69.963  -92.388  3.568   1.00 32.15  ? 124 MET A CA   1 
ATOM   1868  C  C    . MET A  1 144 ? 71.203  -93.106  3.002   1.00 34.40  ? 124 MET A C    1 
ATOM   1869  O  O    . MET A  1 144 ? 72.176  -92.461  2.684   1.00 32.35  ? 124 MET A O    1 
ATOM   1870  C  CB   . MET A  1 144 ? 69.206  -91.646  2.457   1.00 33.99  ? 124 MET A CB   1 
ATOM   1871  C  CG   . MET A  1 144 ? 68.441  -92.600  1.496   1.00 36.83  ? 124 MET A CG   1 
ATOM   1872  S  SD   . MET A  1 144 ? 67.924  -91.861  -0.068  1.00 40.94  ? 124 MET A SD   1 
ATOM   1873  C  CE   . MET A  1 144 ? 67.116  -90.554  0.453   1.00 40.23  ? 124 MET A CE   1 
ATOM   1874  H  H    . MET A  1 144 ? 70.483  -90.506  4.307   1.00 33.41  ? 124 MET A H    1 
ATOM   1875  H  HA   . MET A  1 144 ? 69.262  -93.108  3.985   1.00 31.58  ? 124 MET A HA   1 
ATOM   1876  H  HB2  . MET A  1 144 ? 68.462  -91.009  2.932   1.00 34.47  ? 124 MET A HB2  1 
ATOM   1877  H  HB3  . MET A  1 144 ? 69.904  -91.040  1.881   1.00 33.10  ? 124 MET A HB3  1 
ATOM   1878  H  HG2  . MET A  1 144 ? 69.076  -93.447  1.245   1.00 36.45  ? 124 MET A HG2  1 
ATOM   1879  H  HG3  . MET A  1 144 ? 67.548  -92.948  2.011   1.00 36.01  ? 124 MET A HG3  1 
ATOM   1880  H  HE1  . MET A  1 144 ? 66.648  -90.101  -0.419  1.00 40.96  ? 124 MET A HE1  1 
ATOM   1881  H  HE2  . MET A  1 144 ? 66.365  -90.859  1.180   1.00 41.15  ? 124 MET A HE2  1 
ATOM   1882  H  HE3  . MET A  1 144 ? 67.812  -89.850  0.906   1.00 41.36  ? 124 MET A HE3  1 
ATOM   1883  N  N    . TYR A  1 145 ? 71.144  -94.438  2.883   1.00 32.97  ? 125 TYR A N    1 
ATOM   1884  C  CA   . TYR A  1 145 ? 72.215  -95.292  2.371   1.00 32.48  ? 125 TYR A CA   1 
ATOM   1885  C  C    . TYR A  1 145 ? 71.942  -95.798  0.952   1.00 35.94  ? 125 TYR A C    1 
ATOM   1886  O  O    . TYR A  1 145 ? 72.878  -96.197  0.252   1.00 31.75  ? 125 TYR A O    1 
ATOM   1887  C  CB   . TYR A  1 145 ? 72.427  -96.497  3.338   1.00 34.11  ? 125 TYR A CB   1 
ATOM   1888  C  CG   . TYR A  1 145 ? 73.357  -96.162  4.484   1.00 36.94  ? 125 TYR A CG   1 
ATOM   1889  C  CD1  . TYR A  1 145 ? 72.980  -95.256  5.465   1.00 37.75  ? 125 TYR A CD1  1 
ATOM   1890  C  CD2  . TYR A  1 145 ? 74.653  -96.661  4.523   1.00 38.01  ? 125 TYR A CD2  1 
ATOM   1891  C  CE1  . TYR A  1 145 ? 73.856  -94.880  6.478   1.00 39.61  ? 125 TYR A CE1  1 
ATOM   1892  C  CE2  . TYR A  1 145 ? 75.530  -96.313  5.547   1.00 39.73  ? 125 TYR A CE2  1 
ATOM   1893  C  CZ   . TYR A  1 145 ? 75.133  -95.411  6.517   1.00 44.69  ? 125 TYR A CZ   1 
ATOM   1894  O  OH   . TYR A  1 145 ? 75.987  -95.051  7.539   1.00 46.89  ? 125 TYR A OH   1 
ATOM   1895  H  H    . TYR A  1 145 ? 70.334  -94.966  3.193   1.00 34.42  ? 125 TYR A H    1 
ATOM   1896  H  HA   . TYR A  1 145 ? 73.155  -94.744  2.322   1.00 32.25  ? 125 TYR A HA   1 
ATOM   1897  H  HB2  . TYR A  1 145 ? 71.476  -96.798  3.773   1.00 33.49  ? 125 TYR A HB2  1 
ATOM   1898  H  HB3  . TYR A  1 145 ? 72.874  -97.322  2.787   1.00 33.18  ? 125 TYR A HB3  1 
ATOM   1899  H  HD1  . TYR A  1 145 ? 71.983  -94.825  5.428   1.00 37.49  ? 125 TYR A HD1  1 
ATOM   1900  H  HD2  . TYR A  1 145 ? 74.987  -97.357  3.758   1.00 37.92  ? 125 TYR A HD2  1 
ATOM   1901  H  HE1  . TYR A  1 145 ? 73.538  -94.178  7.247   1.00 39.83  ? 125 TYR A HE1  1 
ATOM   1902  H  HE2  . TYR A  1 145 ? 76.531  -96.741  5.571   1.00 40.35  ? 125 TYR A HE2  1 
ATOM   1903  H  HH   . TYR A  1 145 ? 76.935  -95.145  7.257   1.00 46.19  ? 125 TYR A HH   1 
ATOM   1904  N  N    . ASP A  1 146 ? 70.665  -95.857  0.550   1.00 34.34  ? 126 ASP A N    1 
ATOM   1905  C  CA   . ASP A  1 146 ? 70.291  -96.361  -0.763  1.00 33.00  ? 126 ASP A CA   1 
ATOM   1906  C  C    . ASP A  1 146 ? 68.856  -95.988  -1.107  1.00 37.81  ? 126 ASP A C    1 
ATOM   1907  O  O    . ASP A  1 146 ? 68.016  -95.661  -0.243  1.00 34.67  ? 126 ASP A O    1 
ATOM   1908  C  CB   . ASP A  1 146 ? 70.453  -97.901  -0.820  1.00 35.58  ? 126 ASP A CB   1 
ATOM   1909  C  CG   . ASP A  1 146 ? 70.550  -98.529  -2.209  1.00 43.86  ? 126 ASP A CG   1 
ATOM   1910  O  OD1  . ASP A  1 146 ? 70.393  -97.794  -3.210  1.00 43.87  ? 126 ASP A OD1  1 
ATOM   1911  O  OD2  . ASP A  1 146 ? 70.713  -99.772  -2.290  1.00 43.76  ? 126 ASP A OD2  1 
ATOM   1912  H  H    . ASP A  1 146 ? 69.868  -95.596  1.121   1.00 34.09  ? 126 ASP A H    1 
ATOM   1913  H  HA   . ASP A  1 146 ? 70.941  -95.910  -1.511  1.00 32.82  ? 126 ASP A HA   1 
ATOM   1914  H  HB2  . ASP A  1 146 ? 71.357  -98.192  -0.288  1.00 36.33  ? 126 ASP A HB2  1 
ATOM   1915  H  HB3  . ASP A  1 146 ? 69.588  -98.351  -0.334  1.00 36.20  ? 126 ASP A HB3  1 
ATOM   1916  N  N    . PHE A  1 147 ? 68.601  -95.974  -2.407  1.00 37.79  ? 127 PHE A N    1 
ATOM   1917  C  CA   . PHE A  1 147 ? 67.267  -95.702  -2.910  1.00 36.00  ? 127 PHE A CA   1 
ATOM   1918  C  C    . PHE A  1 147 ? 67.039  -96.536  -4.179  1.00 38.69  ? 127 PHE A C    1 
ATOM   1919  O  O    . PHE A  1 147 ? 67.982  -96.898  -4.869  1.00 35.91  ? 127 PHE A O    1 
ATOM   1920  C  CB   . PHE A  1 147 ? 67.002  -94.203  -3.137  1.00 35.74  ? 127 PHE A CB   1 
ATOM   1921  C  CG   . PHE A  1 147 ? 67.788  -93.527  -4.234  1.00 34.39  ? 127 PHE A CG   1 
ATOM   1922  C  CD1  . PHE A  1 147 ? 69.020  -92.932  -3.968  1.00 33.07  ? 127 PHE A CD1  1 
ATOM   1923  C  CD2  . PHE A  1 147 ? 67.269  -93.423  -5.518  1.00 36.26  ? 127 PHE A CD2  1 
ATOM   1924  C  CE1  . PHE A  1 147 ? 69.737  -92.299  -4.974  1.00 33.39  ? 127 PHE A CE1  1 
ATOM   1925  C  CE2  . PHE A  1 147 ? 67.985  -92.771  -6.527  1.00 38.99  ? 127 PHE A CE2  1 
ATOM   1926  C  CZ   . PHE A  1 147 ? 69.213  -92.210  -6.245  1.00 36.15  ? 127 PHE A CZ   1 
ATOM   1927  H  H    . PHE A  1 147 ? 69.286  -96.157  -3.132  1.00 37.08  ? 127 PHE A H    1 
ATOM   1928  H  HA   . PHE A  1 147 ? 66.562  -96.055  -2.162  1.00 35.50  ? 127 PHE A HA   1 
ATOM   1929  H  HB2  . PHE A  1 147 ? 65.949  -94.090  -3.389  1.00 36.64  ? 127 PHE A HB2  1 
ATOM   1930  H  HB3  . PHE A  1 147 ? 67.202  -93.665  -2.213  1.00 36.80  ? 127 PHE A HB3  1 
ATOM   1931  H  HD1  . PHE A  1 147 ? 69.447  -92.998  -2.970  1.00 34.37  ? 127 PHE A HD1  1 
ATOM   1932  H  HD2  . PHE A  1 147 ? 66.300  -93.864  -5.745  1.00 35.53  ? 127 PHE A HD2  1 
ATOM   1933  H  HE1  . PHE A  1 147 ? 70.717  -91.870  -4.771  1.00 32.67  ? 127 PHE A HE1  1 
ATOM   1934  H  HE2  . PHE A  1 147 ? 67.577  -92.720  -7.535  1.00 38.70  ? 127 PHE A HE2  1 
ATOM   1935  H  HZ   . PHE A  1 147 ? 69.783  -91.723  -7.035  1.00 35.97  ? 127 PHE A HZ   1 
ATOM   1936  N  N    . TYR A  1 148 ? 65.782  -96.881  -4.428  1.00 36.28  ? 128 TYR A N    1 
ATOM   1937  C  CA   . TYR A  1 148 ? 65.364  -97.608  -5.610  1.00 35.71  ? 128 TYR A CA   1 
ATOM   1938  C  C    . TYR A  1 148 ? 64.430  -96.720  -6.435  1.00 38.61  ? 128 TYR A C    1 
ATOM   1939  O  O    . TYR A  1 148 ? 63.456  -96.198  -5.906  1.00 38.31  ? 128 TYR A O    1 
ATOM   1940  C  CB   . TYR A  1 148 ? 64.664  -98.924  -5.234  1.00 37.52  ? 128 TYR A CB   1 
ATOM   1941  C  CG   . TYR A  1 148 ? 64.107  -99.630  -6.442  1.00 36.32  ? 128 TYR A CG   1 
ATOM   1942  C  CD1  . TYR A  1 148 ? 64.947  -100.254 -7.355  1.00 36.05  ? 128 TYR A CD1  1 
ATOM   1943  C  CD2  . TYR A  1 148 ? 62.751  -99.587  -6.730  1.00 38.12  ? 128 TYR A CD2  1 
ATOM   1944  C  CE1  . TYR A  1 148 ? 64.452  -100.821 -8.521  1.00 36.28  ? 128 TYR A CE1  1 
ATOM   1945  C  CE2  . TYR A  1 148 ? 62.241  -100.168 -7.884  1.00 39.55  ? 128 TYR A CE2  1 
ATOM   1946  C  CZ   . TYR A  1 148 ? 63.095  -100.783 -8.782  1.00 41.82  ? 128 TYR A CZ   1 
ATOM   1947  O  OH   . TYR A  1 148 ? 62.623  -101.279 -9.965  1.00 34.25  ? 128 TYR A OH   1 
ATOM   1948  H  H    . TYR A  1 148 ? 65.009  -96.649  -3.812  1.00 36.31  ? 128 TYR A H    1 
ATOM   1949  H  HA   . TYR A  1 148 ? 66.222  -97.866  -6.226  1.00 35.83  ? 128 TYR A HA   1 
ATOM   1950  H  HB2  . TYR A  1 148 ? 65.380  -99.586  -4.751  1.00 38.99  ? 128 TYR A HB2  1 
ATOM   1951  H  HB3  . TYR A  1 148 ? 63.840  -98.702  -4.560  1.00 38.16  ? 128 TYR A HB3  1 
ATOM   1952  H  HD1  . TYR A  1 148 ? 66.019  -100.259 -7.171  1.00 35.97  ? 128 TYR A HD1  1 
ATOM   1953  H  HD2  . TYR A  1 148 ? 62.070  -99.090  -6.041  1.00 37.58  ? 128 TYR A HD2  1 
ATOM   1954  H  HE1  . TYR A  1 148 ? 65.129  -101.291 -9.231  1.00 36.44  ? 128 TYR A HE1  1 
ATOM   1955  H  HE2  . TYR A  1 148 ? 61.173  -100.121 -8.081  1.00 40.73  ? 128 TYR A HE2  1 
ATOM   1956  H  HH   . TYR A  1 148 ? 61.634  -101.372 -9.962  1.00 33.85  ? 128 TYR A HH   1 
ATOM   1957  N  N    . VAL A  1 149 ? 64.678  -96.616  -7.749  1.00 36.31  ? 129 VAL A N    1 
ATOM   1958  C  CA   . VAL A  1 149 ? 63.823  -95.821  -8.614  1.00 35.18  ? 129 VAL A CA   1 
ATOM   1959  C  C    . VAL A  1 149 ? 63.188  -96.804  -9.631  1.00 36.88  ? 129 VAL A C    1 
ATOM   1960  O  O    . VAL A  1 149 ? 63.894  -97.516  -10.354 1.00 36.00  ? 129 VAL A O    1 
ATOM   1961  C  CB   . VAL A  1 149 ? 64.564  -94.582  -9.213  1.00 40.95  ? 129 VAL A CB   1 
ATOM   1962  C  CG1  . VAL A  1 149 ? 65.904  -94.954  -9.818  1.00 42.74  ? 129 VAL A CG1  1 
ATOM   1963  C  CG2  . VAL A  1 149 ? 63.708  -93.856  -10.219 1.00 41.11  ? 129 VAL A CG2  1 
ATOM   1964  H  H    . VAL A  1 149 ? 65.418  -97.112  -8.233  1.00 35.33  ? 129 VAL A H    1 
ATOM   1965  H  HA   . VAL A  1 149 ? 63.019  -95.389  -8.021  1.00 36.22  ? 129 VAL A HA   1 
ATOM   1966  H  HB   . VAL A  1 149 ? 64.768  -93.875  -8.409  1.00 38.28  ? 129 VAL A HB   1 
ATOM   1967  H  HG11 . VAL A  1 149 ? 66.317  -94.064  -10.294 1.00 44.39  ? 129 VAL A HG11 1 
ATOM   1968  H  HG12 . VAL A  1 149 ? 66.580  -95.276  -9.026  1.00 43.73  ? 129 VAL A HG12 1 
ATOM   1969  H  HG13 . VAL A  1 149 ? 65.772  -95.739  -10.560 1.00 41.62  ? 129 VAL A HG13 1 
ATOM   1970  H  HG21 . VAL A  1 149 ? 63.919  -92.789  -10.170 1.00 42.13  ? 129 VAL A HG21 1 
ATOM   1971  H  HG22 . VAL A  1 149 ? 63.955  -94.232  -11.209 1.00 41.13  ? 129 VAL A HG22 1 
ATOM   1972  H  HG23 . VAL A  1 149 ? 62.659  -94.051  -10.009 1.00 41.18  ? 129 VAL A HG23 1 
ATOM   1973  N  N    . PRO A  1 150 ? 61.843  -96.933  -9.626  1.00 30.83  ? 130 PRO A N    1 
ATOM   1974  C  CA   . PRO A  1 150 ? 61.202  -97.841  -10.581 1.00 31.50  ? 130 PRO A CA   1 
ATOM   1975  C  C    . PRO A  1 150 ? 61.204  -97.280  -12.010 1.00 37.67  ? 130 PRO A C    1 
ATOM   1976  O  O    . PRO A  1 150 ? 61.431  -96.083  -12.201 1.00 38.14  ? 130 PRO A O    1 
ATOM   1977  C  CB   . PRO A  1 150 ? 59.778  -97.960  -10.029 1.00 33.27  ? 130 PRO A CB   1 
ATOM   1978  C  CG   . PRO A  1 150 ? 59.513  -96.639  -9.405  1.00 37.18  ? 130 PRO A CG   1 
ATOM   1979  C  CD   . PRO A  1 150 ? 60.835  -96.191  -8.832  1.00 32.13  ? 130 PRO A CD   1 
ATOM   1980  H  HA   . PRO A  1 150 ? 61.687  -98.814  -10.543 1.00 32.77  ? 130 PRO A HA   1 
ATOM   1981  H  HB2  . PRO A  1 150 ? 59.077  -98.152  -10.840 1.00 35.01  ? 130 PRO A HB2  1 
ATOM   1982  H  HB3  . PRO A  1 150 ? 59.739  -98.761  -9.292  1.00 32.10  ? 130 PRO A HB3  1 
ATOM   1983  H  HG2  . PRO A  1 150 ? 59.165  -95.942  -10.166 1.00 37.03  ? 130 PRO A HG2  1 
ATOM   1984  H  HG3  . PRO A  1 150 ? 58.771  -96.738  -8.614  1.00 37.99  ? 130 PRO A HG3  1 
ATOM   1985  H  HD2  . PRO A  1 150 ? 60.939  -95.116  -8.970  1.00 31.99  ? 130 PRO A HD2  1 
ATOM   1986  H  HD3  . PRO A  1 150 ? 60.914  -96.465  -7.782  1.00 29.84  ? 130 PRO A HD3  1 
ATOM   1987  N  N    . PRO A  1 151 ? 60.927  -98.120  -13.038 1.00 36.35  ? 131 PRO A N    1 
ATOM   1988  C  CA   . PRO A  1 151 ? 60.973  -97.629  -14.438 1.00 36.27  ? 131 PRO A CA   1 
ATOM   1989  C  C    . PRO A  1 151 ? 60.117  -96.389  -14.743 1.00 38.87  ? 131 PRO A C    1 
ATOM   1990  O  O    . PRO A  1 151 ? 60.590  -95.472  -15.426 1.00 35.22  ? 131 PRO A O    1 
ATOM   1991  C  CB   . PRO A  1 151 ? 60.448  -98.839  -15.235 1.00 38.20  ? 131 PRO A CB   1 
ATOM   1992  C  CG   . PRO A  1 151 ? 60.856  -99.994  -14.441 1.00 41.57  ? 131 PRO A CG   1 
ATOM   1993  C  CD   . PRO A  1 151 ? 60.694  -99.578  -12.999 1.00 37.39  ? 131 PRO A CD   1 
ATOM   1994  H  HA   . PRO A  1 151 ? 61.998  -97.413  -14.735 1.00 35.67  ? 131 PRO A HA   1 
ATOM   1995  H  HB2  . PRO A  1 151 ? 59.361  -98.791  -15.300 1.00 39.49  ? 131 PRO A HB2  1 
ATOM   1996  H  HB3  . PRO A  1 151 ? 60.876  -98.854  -16.235 1.00 36.77  ? 131 PRO A HB3  1 
ATOM   1997  H  HG2  . PRO A  1 151 ? 60.209  -100.843 -14.662 1.00 41.60  ? 131 PRO A HG2  1 
ATOM   1998  H  HG3  . PRO A  1 151 ? 61.896  -100.236 -14.651 1.00 40.58  ? 131 PRO A HG3  1 
ATOM   1999  H  HD2  . PRO A  1 151 ? 59.692  -99.805  -12.644 1.00 36.04  ? 131 PRO A HD2  1 
ATOM   2000  H  HD3  . PRO A  1 151 ? 61.451  -100.079 -12.397 1.00 37.94  ? 131 PRO A HD3  1 
ATOM   2001  N  N    . ALA A  1 152 ? 58.864  -96.349  -14.234 1.00 35.59  ? 132 ALA A N    1 
ATOM   2002  C  CA   . ALA A  1 152 ? 57.969  -95.222  -14.505 1.00 35.80  ? 132 ALA A CA   1 
ATOM   2003  C  C    . ALA A  1 152 ? 58.545  -93.874  -14.021 1.00 38.15  ? 132 ALA A C    1 
ATOM   2004  O  O    . ALA A  1 152 ? 58.209  -92.848  -14.595 1.00 39.28  ? 132 ALA A O    1 
ATOM   2005  C  CB   . ALA A  1 152 ? 56.615  -95.450  -13.873 1.00 37.26  ? 132 ALA A CB   1 
ATOM   2006  H  H    . ALA A  1 152 ? 58.473  -97.067  -13.632 1.00 34.25  ? 132 ALA A H    1 
ATOM   2007  H  HA   . ALA A  1 152 ? 57.826  -95.157  -15.580 1.00 35.70  ? 132 ALA A HA   1 
ATOM   2008  H  HB1  . ALA A  1 152 ? 56.005  -94.558  -14.011 1.00 37.10  ? 132 ALA A HB1  1 
ATOM   2009  H  HB2  . ALA A  1 152 ? 56.145  -96.302  -14.362 1.00 37.05  ? 132 ALA A HB2  1 
ATOM   2010  H  HB3  . ALA A  1 152 ? 56.741  -95.655  -12.809 1.00 37.58  ? 132 ALA A HB3  1 
ATOM   2011  N  N    . TYR A  1 153 ? 59.419  -93.879  -12.997 1.00 31.73  ? 133 TYR A N    1 
ATOM   2012  C  CA   . TYR A  1 153 ? 60.019  -92.645  -12.512 1.00 30.81  ? 133 TYR A CA   1 
ATOM   2013  C  C    . TYR A  1 153 ? 61.410  -92.447  -13.140 1.00 34.14  ? 133 TYR A C    1 
ATOM   2014  O  O    . TYR A  1 153 ? 61.735  -91.335  -13.608 1.00 33.14  ? 133 TYR A O    1 
ATOM   2015  C  CB   . TYR A  1 153 ? 60.051  -92.676  -10.978 1.00 32.14  ? 133 TYR A CB   1 
ATOM   2016  C  CG   . TYR A  1 153 ? 60.467  -91.390  -10.314 1.00 33.75  ? 133 TYR A CG   1 
ATOM   2017  C  CD1  . TYR A  1 153 ? 59.893  -90.173  -10.679 1.00 36.84  ? 133 TYR A CD1  1 
ATOM   2018  C  CD2  . TYR A  1 153 ? 61.365  -91.391  -9.254  1.00 33.26  ? 133 TYR A CD2  1 
ATOM   2019  C  CE1  . TYR A  1 153 ? 60.256  -88.987  -10.048 1.00 36.04  ? 133 TYR A CE1  1 
ATOM   2020  C  CE2  . TYR A  1 153 ? 61.743  -90.212  -8.627  1.00 34.40  ? 133 TYR A CE2  1 
ATOM   2021  C  CZ   . TYR A  1 153 ? 61.202  -89.005  -9.042  1.00 32.99  ? 133 TYR A CZ   1 
ATOM   2022  O  OH   . TYR A  1 153 ? 61.578  -87.836  -8.442  1.00 31.42  ? 133 TYR A OH   1 
ATOM   2023  H  H    . TYR A  1 153 ? 59.692  -94.699  -12.468 1.00 29.68  ? 133 TYR A H    1 
ATOM   2024  H  HA   . TYR A  1 153 ? 59.405  -91.801  -12.822 1.00 32.20  ? 133 TYR A HA   1 
ATOM   2025  H  HB2  . TYR A  1 153 ? 59.051  -92.918  -10.622 1.00 33.03  ? 133 TYR A HB2  1 
ATOM   2026  H  HB3  . TYR A  1 153 ? 60.733  -93.463  -10.662 1.00 31.99  ? 133 TYR A HB3  1 
ATOM   2027  H  HD1  . TYR A  1 153 ? 59.168  -90.126  -11.489 1.00 37.11  ? 133 TYR A HD1  1 
ATOM   2028  H  HD2  . TYR A  1 153 ? 61.808  -92.324  -8.918  1.00 33.89  ? 133 TYR A HD2  1 
ATOM   2029  H  HE1  . TYR A  1 153 ? 59.837  -88.039  -10.384 1.00 37.65  ? 133 TYR A HE1  1 
ATOM   2030  H  HE2  . TYR A  1 153 ? 62.474  -90.240  -7.820  1.00 36.07  ? 133 TYR A HE2  1 
ATOM   2031  H  HH   . TYR A  1 153 ? 62.479  -87.917  -8.036  1.00 31.60  ? 133 TYR A HH   1 
ATOM   2032  N  N    . LEU A  1 154 ? 62.210  -93.509  -13.186 1.00 33.12  ? 134 LEU A N    1 
ATOM   2033  C  CA   . LEU A  1 154 ? 63.558  -93.493  -13.794 1.00 34.11  ? 134 LEU A CA   1 
ATOM   2034  C  C    . LEU A  1 154 ? 63.587  -92.847  -15.202 1.00 33.66  ? 134 LEU A C    1 
ATOM   2035  O  O    . LEU A  1 154 ? 64.445  -91.999  -15.500 1.00 29.58  ? 134 LEU A O    1 
ATOM   2036  C  CB   . LEU A  1 154 ? 64.083  -94.942  -13.915 1.00 34.00  ? 134 LEU A CB   1 
ATOM   2037  C  CG   . LEU A  1 154 ? 65.461  -95.130  -14.526 1.00 37.83  ? 134 LEU A CG   1 
ATOM   2038  C  CD1  . LEU A  1 154 ? 66.482  -94.350  -13.813 1.00 36.70  ? 134 LEU A CD1  1 
ATOM   2039  C  CD2  . LEU A  1 154 ? 65.865  -96.580  -14.502 1.00 46.78  ? 134 LEU A CD2  1 
ATOM   2040  H  H    . LEU A  1 154 ? 61.965  -94.419  -12.805 1.00 34.05  ? 134 LEU A H    1 
ATOM   2041  H  HA   . LEU A  1 154 ? 64.219  -92.920  -13.143 1.00 35.59  ? 134 LEU A HA   1 
ATOM   2042  H  HB2  . LEU A  1 154 ? 64.097  -95.418  -12.934 1.00 35.84  ? 134 LEU A HB2  1 
ATOM   2043  H  HB3  . LEU A  1 154 ? 63.382  -95.495  -14.538 1.00 34.26  ? 134 LEU A HB3  1 
ATOM   2044  H  HG   . LEU A  1 154 ? 65.456  -94.823  -15.569 1.00 36.81  ? 134 LEU A HG   1 
ATOM   2045  H  HD11 . LEU A  1 154 ? 67.469  -94.713  -14.097 1.00 36.11  ? 134 LEU A HD11 1 
ATOM   2046  H  HD12 . LEU A  1 154 ? 66.381  -93.306  -14.106 1.00 37.26  ? 134 LEU A HD12 1 
ATOM   2047  H  HD13 . LEU A  1 154 ? 66.331  -94.460  -12.742 1.00 35.96  ? 134 LEU A HD13 1 
ATOM   2048  H  HD21 . LEU A  1 154 ? 66.714  -96.707  -15.170 1.00 46.07  ? 134 LEU A HD21 1 
ATOM   2049  H  HD22 . LEU A  1 154 ? 66.141  -96.854  -13.484 1.00 47.42  ? 134 LEU A HD22 1 
ATOM   2050  H  HD23 . LEU A  1 154 ? 65.031  -97.194  -14.840 1.00 47.94  ? 134 LEU A HD23 1 
ATOM   2051  N  N    . LYS A  1 155 ? 62.632  -93.247  -16.060 1.00 28.72  ? 135 LYS A N    1 
ATOM   2052  C  CA   . LYS A  1 155 ? 62.597  -92.797  -17.447 1.00 27.38  ? 135 LYS A CA   1 
ATOM   2053  C  C    . LYS A  1 155 ? 62.299  -91.299  -17.602 1.00 35.07  ? 135 LYS A C    1 
ATOM   2054  O  O    . LYS A  1 155 ? 62.510  -90.789  -18.685 1.00 33.86  ? 135 LYS A O    1 
ATOM   2055  C  CB   . LYS A  1 155 ? 61.609  -93.605  -18.254 1.00 26.12  ? 135 LYS A CB   1 
ATOM   2056  C  CG   . LYS A  1 155 ? 60.147  -93.304  -18.020 1.00 35.21  ? 135 LYS A CG   1 
ATOM   2057  C  CD   . LYS A  1 155 ? 59.301  -94.253  -18.868 1.00 30.45  ? 135 LYS A CD   1 
ATOM   2058  C  CE   . LYS A  1 155 ? 57.830  -94.164  -18.573 1.00 41.83  ? 135 LYS A CE   1 
ATOM   2059  N  NZ   . LYS A  1 155 ? 57.208  -92.906  -19.041 1.00 50.92  ? 135 LYS A NZ   1 
ATOM   2060  H  H    . LYS A  1 155 ? 61.883  -93.882  -15.802 1.00 28.61  ? 135 LYS A H    1 
ATOM   2061  H  HA   . LYS A  1 155 ? 63.582  -92.962  -17.880 1.00 27.24  ? 135 LYS A HA   1 
ATOM   2062  H  HB2  . LYS A  1 155 ? 61.803  -93.429  -19.311 1.00 27.67  ? 135 LYS A HB2  1 
ATOM   2063  H  HB3  . LYS A  1 155 ? 61.770  -94.661  -18.042 1.00 27.64  ? 135 LYS A HB3  1 
ATOM   2064  H  HG2  . LYS A  1 155 ? 59.893  -93.452  -16.973 1.00 36.55  ? 135 LYS A HG2  1 
ATOM   2065  H  HG3  . LYS A  1 155 ? 59.908  -92.289  -18.335 1.00 33.74  ? 135 LYS A HG3  1 
ATOM   2066  H  HD2  . LYS A  1 155 ? 59.444  -93.998  -19.917 1.00 30.03  ? 135 LYS A HD2  1 
ATOM   2067  H  HD3  . LYS A  1 155 ? 59.615  -95.279  -18.685 1.00 28.02  ? 135 LYS A HD3  1 
ATOM   2068  H  HE2  . LYS A  1 155 ? 57.335  -95.004  -19.056 1.00 41.89  ? 135 LYS A HE2  1 
ATOM   2069  H  HE3  . LYS A  1 155 ? 57.684  -94.209  -17.495 1.00 42.45  ? 135 LYS A HE3  1 
ATOM   2070  H  HZ1  . LYS A  1 155 ? 57.586  -92.112  -18.533 1.00 51.59  ? 135 LYS A HZ1  1 
ATOM   2071  H  HZ2  . LYS A  1 155 ? 57.384  -92.782  -20.032 1.00 51.11  ? 135 LYS A HZ2  1 
ATOM   2072  H  HZ3  . LYS A  1 155 ? 56.205  -92.937  -18.887 1.00 51.10  ? 135 LYS A HZ3  1 
ATOM   2073  N  N    . LEU A  1 156 ? 61.799  -90.611  -16.536 1.00 32.25  ? 136 LEU A N    1 
ATOM   2074  C  CA   . LEU A  1 156 ? 61.519  -89.193  -16.546 1.00 31.99  ? 136 LEU A CA   1 
ATOM   2075  C  C    . LEU A  1 156 ? 62.756  -88.352  -16.194 1.00 33.72  ? 136 LEU A C    1 
ATOM   2076  O  O    . LEU A  1 156 ? 62.675  -87.124  -16.272 1.00 32.61  ? 136 LEU A O    1 
ATOM   2077  C  CB   . LEU A  1 156 ? 60.380  -88.883  -15.583 1.00 33.37  ? 136 LEU A CB   1 
ATOM   2078  C  CG   . LEU A  1 156 ? 59.058  -89.625  -15.891 1.00 38.48  ? 136 LEU A CG   1 
ATOM   2079  C  CD1  . LEU A  1 156 ? 58.033  -89.301  -14.853 1.00 38.72  ? 136 LEU A CD1  1 
ATOM   2080  C  CD2  . LEU A  1 156 ? 58.535  -89.255  -17.277 1.00 41.76  ? 136 LEU A CD2  1 
ATOM   2081  H  H    . LEU A  1 156 ? 61.565  -91.043  -15.647 1.00 33.31  ? 136 LEU A H    1 
ATOM   2082  H  HA   . LEU A  1 156 ? 61.209  -88.887  -17.544 1.00 33.48  ? 136 LEU A HA   1 
ATOM   2083  H  HB2  . LEU A  1 156 ? 60.683  -89.136  -14.568 1.00 33.13  ? 136 LEU A HB2  1 
ATOM   2084  H  HB3  . LEU A  1 156 ? 60.161  -87.818  -15.640 1.00 34.08  ? 136 LEU A HB3  1 
ATOM   2085  H  HG   . LEU A  1 156 ? 59.228  -90.699  -15.861 1.00 38.12  ? 136 LEU A HG   1 
ATOM   2086  H  HD11 . LEU A  1 156 ? 57.142  -89.896  -15.047 1.00 39.16  ? 136 LEU A HD11 1 
ATOM   2087  H  HD12 . LEU A  1 156 ? 58.437  -89.539  -13.869 1.00 38.33  ? 136 LEU A HD12 1 
ATOM   2088  H  HD13 . LEU A  1 156 ? 57.799  -88.238  -14.909 1.00 39.16  ? 136 LEU A HD13 1 
ATOM   2089  H  HD21 . LEU A  1 156 ? 57.509  -89.604  -17.375 1.00 42.05  ? 136 LEU A HD21 1 
ATOM   2090  H  HD22 . LEU A  1 156 ? 58.586  -88.175  -17.418 1.00 39.66  ? 136 LEU A HD22 1 
ATOM   2091  H  HD23 . LEU A  1 156 ? 59.144  -89.753  -18.031 1.00 42.40  ? 136 LEU A HD23 1 
ATOM   2092  N  N    . PHE A  1 157 ? 63.898  -88.975  -15.865 1.00 29.50  ? 137 PHE A N    1 
ATOM   2093  C  CA   . PHE A  1 157 ? 65.131  -88.229  -15.583 1.00 29.78  ? 137 PHE A CA   1 
ATOM   2094  C  C    . PHE A  1 157 ? 65.946  -88.014  -16.864 1.00 38.21  ? 137 PHE A C    1 
ATOM   2095  O  O    . PHE A  1 157 ? 65.862  -88.802  -17.810 1.00 36.79  ? 137 PHE A O    1 
ATOM   2096  C  CB   . PHE A  1 157 ? 65.965  -88.949  -14.528 1.00 31.19  ? 137 PHE A CB   1 
ATOM   2097  C  CG   . PHE A  1 157 ? 65.431  -88.739  -13.136 1.00 31.35  ? 137 PHE A CG   1 
ATOM   2098  C  CD1  . PHE A  1 157 ? 65.742  -87.583  -12.429 1.00 32.27  ? 137 PHE A CD1  1 
ATOM   2099  C  CD2  . PHE A  1 157 ? 64.541  -89.638  -12.574 1.00 32.05  ? 137 PHE A CD2  1 
ATOM   2100  C  CE1  . PHE A  1 157 ? 65.219  -87.367  -11.149 1.00 33.81  ? 137 PHE A CE1  1 
ATOM   2101  C  CE2  . PHE A  1 157 ? 64.007  -89.415  -11.298 1.00 33.95  ? 137 PHE A CE2  1 
ATOM   2102  C  CZ   . PHE A  1 157 ? 64.365  -88.300  -10.587 1.00 32.44  ? 137 PHE A CZ   1 
ATOM   2103  H  H    . PHE A  1 157 ? 64.015  -89.979  -15.787 1.00 29.17  ? 137 PHE A H    1 
ATOM   2104  H  HA   . PHE A  1 157 ? 64.876  -87.250  -15.181 1.00 28.90  ? 137 PHE A HA   1 
ATOM   2105  H  HB2  . PHE A  1 157 ? 65.990  -90.021  -14.726 1.00 32.95  ? 137 PHE A HB2  1 
ATOM   2106  H  HB3  . PHE A  1 157 ? 66.977  -88.550  -14.554 1.00 29.87  ? 137 PHE A HB3  1 
ATOM   2107  H  HD1  . PHE A  1 157 ? 66.433  -86.862  -12.863 1.00 30.24  ? 137 PHE A HD1  1 
ATOM   2108  H  HD2  . PHE A  1 157 ? 64.260  -90.540  -13.115 1.00 32.71  ? 137 PHE A HD2  1 
ATOM   2109  H  HE1  . PHE A  1 157 ? 65.508  -86.480  -10.589 1.00 31.18  ? 137 PHE A HE1  1 
ATOM   2110  H  HE2  . PHE A  1 157 ? 63.343  -90.157  -10.864 1.00 34.93  ? 137 PHE A HE2  1 
ATOM   2111  H  HZ   . PHE A  1 157 ? 63.973  -88.132  -9.588  1.00 31.41  ? 137 PHE A HZ   1 
ATOM   2112  N  N    . ASP A  1 158 ? 66.728  -86.919  -16.901 1.00 35.91  ? 138 ASP A N    1 
ATOM   2113  C  CA   . ASP A  1 158 ? 67.534  -86.583  -18.085 1.00 35.35  ? 138 ASP A CA   1 
ATOM   2114  C  C    . ASP A  1 158 ? 68.547  -87.671  -18.444 1.00 37.49  ? 138 ASP A C    1 
ATOM   2115  O  O    . ASP A  1 158 ? 68.690  -88.031  -19.620 1.00 34.55  ? 138 ASP A O    1 
ATOM   2116  C  CB   . ASP A  1 158 ? 68.315  -85.263  -17.860 1.00 37.22  ? 138 ASP A CB   1 
ATOM   2117  C  CG   . ASP A  1 158 ? 67.513  -83.994  -18.061 1.00 40.37  ? 138 ASP A CG   1 
ATOM   2118  O  OD1  . ASP A  1 158 ? 66.404  -84.073  -18.648 1.00 42.18  ? 138 ASP A OD1  1 
ATOM   2119  O  OD2  . ASP A  1 158 ? 67.972  -82.934  -17.607 1.00 43.16  ? 138 ASP A OD2  1 
ATOM   2120  H  H    . ASP A  1 158 ? 66.793  -86.249  -16.143 1.00 34.89  ? 138 ASP A H    1 
ATOM   2121  H  HA   . ASP A  1 158 ? 66.872  -86.471  -18.941 1.00 33.44  ? 138 ASP A HA   1 
ATOM   2122  H  HB2  . ASP A  1 158 ? 68.725  -85.246  -16.852 1.00 36.30  ? 138 ASP A HB2  1 
ATOM   2123  H  HB3  . ASP A  1 158 ? 69.139  -85.222  -18.571 1.00 39.32  ? 138 ASP A HB3  1 
ATOM   2124  N  N    . GLY A  1 159 ? 69.286  -88.135  -17.451 1.00 33.28  ? 139 GLY A N    1 
ATOM   2125  C  CA   . GLY A  1 159 ? 70.368  -89.083  -17.674 1.00 31.32  ? 139 GLY A CA   1 
ATOM   2126  C  C    . GLY A  1 159 ? 71.511  -88.417  -18.443 1.00 33.12  ? 139 GLY A C    1 
ATOM   2127  O  O    . GLY A  1 159 ? 71.330  -87.308  -18.959 1.00 28.99  ? 139 GLY A O    1 
ATOM   2128  H  H    . GLY A  1 159 ? 69.158  -87.879  -16.476 1.00 33.92  ? 139 GLY A H    1 
ATOM   2129  H  HA2  . GLY A  1 159 ? 70.713  -89.442  -16.706 1.00 31.59  ? 139 GLY A HA2  1 
ATOM   2130  H  HA3  . GLY A  1 159 ? 70.000  -89.935  -18.243 1.00 31.35  ? 139 GLY A HA3  1 
ATOM   2131  N  N    . PRO A  1 160 ? 72.743  -88.999  -18.512 1.00 29.53  ? 140 PRO A N    1 
ATOM   2132  C  CA   . PRO A  1 160 ? 73.818  -88.369  -19.289 1.00 29.38  ? 140 PRO A CA   1 
ATOM   2133  C  C    . PRO A  1 160 ? 73.565  -88.357  -20.787 1.00 35.08  ? 140 PRO A C    1 
ATOM   2134  O  O    . PRO A  1 160 ? 73.079  -89.330  -21.359 1.00 33.21  ? 140 PRO A O    1 
ATOM   2135  C  CB   . PRO A  1 160 ? 75.038  -89.252  -18.995 1.00 30.19  ? 140 PRO A CB   1 
ATOM   2136  C  CG   . PRO A  1 160 ? 74.680  -89.887  -17.698 1.00 34.20  ? 140 PRO A CG   1 
ATOM   2137  C  CD   . PRO A  1 160 ? 73.239  -90.224  -17.886 1.00 30.34  ? 140 PRO A CD   1 
ATOM   2138  H  HA   . PRO A  1 160 ? 74.001  -87.362  -18.922 1.00 29.93  ? 140 PRO A HA   1 
ATOM   2139  H  HB2  . PRO A  1 160 ? 75.167  -89.997  -19.778 1.00 29.00  ? 140 PRO A HB2  1 
ATOM   2140  H  HB3  . PRO A  1 160 ? 75.931  -88.635  -18.915 1.00 28.78  ? 140 PRO A HB3  1 
ATOM   2141  H  HG2  . PRO A  1 160 ? 75.283  -90.777  -17.527 1.00 36.53  ? 140 PRO A HG2  1 
ATOM   2142  H  HG3  . PRO A  1 160 ? 74.783  -89.175  -16.882 1.00 33.14  ? 140 PRO A HG3  1 
ATOM   2143  H  HD2  . PRO A  1 160 ? 73.123  -91.068  -18.564 1.00 32.15  ? 140 PRO A HD2  1 
ATOM   2144  H  HD3  . PRO A  1 160 ? 72.762  -90.415  -16.929 1.00 30.97  ? 140 PRO A HD3  1 
ATOM   2145  N  N    . SER A  1 161 ? 73.866  -87.232  -21.421 1.00 33.10  ? 141 SER A N    1 
ATOM   2146  C  CA   . SER A  1 161 ? 73.768  -87.100  -22.881 1.00 33.31  ? 141 SER A CA   1 
ATOM   2147  C  C    . SER A  1 161 ? 75.138  -87.412  -23.537 1.00 38.15  ? 141 SER A C    1 
ATOM   2148  O  O    . SER A  1 161 ? 75.181  -87.869  -24.689 1.00 37.32  ? 141 SER A O    1 
ATOM   2149  C  CB   . SER A  1 161 ? 73.294  -85.697  -23.274 1.00 34.30  ? 141 SER A CB   1 
ATOM   2150  O  OG   . SER A  1 161 ? 73.943  -84.691  -22.517 1.00 43.71  ? 141 SER A OG   1 
ATOM   2151  H  H    . SER A  1 161 ? 74.194  -86.395  -20.953 1.00 32.29  ? 141 SER A H    1 
ATOM   2152  H  HA   . SER A  1 161 ? 73.044  -87.805  -23.285 1.00 32.30  ? 141 SER A HA   1 
ATOM   2153  H  HB2  . SER A  1 161 ? 73.520  -85.528  -24.326 1.00 34.46  ? 141 SER A HB2  1 
ATOM   2154  H  HB3  . SER A  1 161 ? 72.217  -85.639  -23.125 1.00 32.85  ? 141 SER A HB3  1 
ATOM   2155  H  HG   . SER A  1 161 ? 74.887  -84.587  -22.805 1.00 43.43  ? 141 SER A HG   1 
ATOM   2156  N  N    . THR A  1 162 ? 76.242  -87.083  -22.844 1.00 35.23  ? 142 THR A N    1 
ATOM   2157  C  CA   . THR A  1 162 ? 77.612  -87.304  -23.338 1.00 36.08  ? 142 THR A CA   1 
ATOM   2158  C  C    . THR A  1 162 ? 78.289  -88.281  -22.371 1.00 39.15  ? 142 THR A C    1 
ATOM   2159  O  O    . THR A  1 162 ? 77.973  -88.273  -21.193 1.00 37.41  ? 142 THR A O    1 
ATOM   2160  C  CB   . THR A  1 162 ? 78.345  -85.961  -23.474 1.00 40.08  ? 142 THR A CB   1 
ATOM   2161  O  OG1  . THR A  1 162 ? 77.688  -85.223  -24.499 1.00 45.44  ? 142 THR A OG1  1 
ATOM   2162  C  CG2  . THR A  1 162 ? 79.829  -86.122  -23.867 1.00 33.17  ? 142 THR A CG2  1 
ATOM   2163  H  H    . THR A  1 162 ? 76.240  -86.620  -21.942 1.00 34.46  ? 142 THR A H    1 
ATOM   2164  H  HA   . THR A  1 162 ? 77.602  -87.777  -24.318 1.00 35.61  ? 142 THR A HA   1 
ATOM   2165  H  HB   . THR A  1 162 ? 78.285  -85.403  -22.541 1.00 38.37  ? 142 THR A HB   1 
ATOM   2166  H  HG1  . THR A  1 162 ? 76.901  -84.746  -24.125 1.00 46.28  ? 142 THR A HG1  1 
ATOM   2167  H  HG21 . THR A  1 162 ? 80.302  -85.141  -23.912 1.00 33.75  ? 142 THR A HG21 1 
ATOM   2168  H  HG22 . THR A  1 162 ? 80.371  -86.736  -23.150 1.00 31.76  ? 142 THR A HG22 1 
ATOM   2169  H  HG23 . THR A  1 162 ? 79.894  -86.566  -24.856 1.00 33.18  ? 142 THR A HG23 1 
ATOM   2170  N  N    . THR A  1 163 ? 79.167  -89.177  -22.910 1.00 36.29  ? 143 THR A N    1 
ATOM   2171  C  CA   . THR A  1 163 ? 79.877  -90.183  -22.103 1.00 35.05  ? 143 THR A CA   1 
ATOM   2172  C  C    . THR A  1 163 ? 81.374  -90.194  -22.413 1.00 34.74  ? 143 THR A C    1 
ATOM   2173  O  O    . THR A  1 163 ? 81.867  -89.434  -23.261 1.00 29.39  ? 143 THR A O    1 
ATOM   2174  C  CB   . THR A  1 163 ? 79.284  -91.597  -22.329 1.00 41.10  ? 143 THR A CB   1 
ATOM   2175  O  OG1  . THR A  1 163 ? 79.657  -92.065  -23.605 1.00 37.66  ? 143 THR A OG1  1 
ATOM   2176  C  CG2  . THR A  1 163 ? 77.758  -91.665  -22.155 1.00 42.60  ? 143 THR A CG2  1 
ATOM   2177  H  H    . THR A  1 163 ? 79.385  -89.234  -23.901 1.00 35.48  ? 143 THR A H    1 
ATOM   2178  H  HA   . THR A  1 163 ? 79.779  -89.943  -21.046 1.00 35.00  ? 143 THR A HA   1 
ATOM   2179  H  HB   . THR A  1 163 ? 79.706  -92.279  -21.593 1.00 42.34  ? 143 THR A HB   1 
ATOM   2180  H  HG1  . THR A  1 163 ? 79.570  -93.053  -23.628 1.00 37.66  ? 143 THR A HG1  1 
ATOM   2181  H  HG21 . THR A  1 163 ? 77.413  -92.680  -22.348 1.00 42.05  ? 143 THR A HG21 1 
ATOM   2182  H  HG22 . THR A  1 163 ? 77.495  -91.393  -21.133 1.00 42.05  ? 143 THR A HG22 1 
ATOM   2183  H  HG23 . THR A  1 163 ? 77.248  -90.997  -22.848 1.00 42.28  ? 143 THR A HG23 1 
ATOM   2184  N  N    . ILE A  1 164 ? 82.106  -91.082  -21.706 1.00 33.73  ? 144 ILE A N    1 
ATOM   2185  C  CA   . ILE A  1 164 ? 83.534  -91.257  -21.962 1.00 33.13  ? 144 ILE A CA   1 
ATOM   2186  C  C    . ILE A  1 164 ? 83.767  -91.676  -23.433 1.00 37.13  ? 144 ILE A C    1 
ATOM   2187  O  O    . ILE A  1 164 ? 84.826  -91.344  -23.952 1.00 37.16  ? 144 ILE A O    1 
ATOM   2188  C  CB   . ILE A  1 164 ? 84.191  -92.240  -20.976 1.00 34.53  ? 144 ILE A CB   1 
ATOM   2189  C  CG1  . ILE A  1 164 ? 85.731  -92.146  -21.051 1.00 34.28  ? 144 ILE A CG1  1 
ATOM   2190  C  CG2  . ILE A  1 164 ? 83.699  -93.684  -21.190 1.00 35.86  ? 144 ILE A CG2  1 
ATOM   2191  C  CD1  . ILE A  1 164 ? 86.420  -92.826  -19.961 1.00 35.00  ? 144 ILE A CD1  1 
ATOM   2192  H  H    . ILE A  1 164 ? 81.755  -91.615  -20.918 1.00 34.56  ? 144 ILE A H    1 
ATOM   2193  H  HA   . ILE A  1 164 ? 84.011  -90.284  -21.835 1.00 34.19  ? 144 ILE A HA   1 
ATOM   2194  H  HB   . ILE A  1 164 ? 83.903  -91.933  -19.972 1.00 35.83  ? 144 ILE A HB   1 
ATOM   2195  H  HG12 . ILE A  1 164 ? 86.071  -92.588  -21.987 1.00 33.63  ? 144 ILE A HG12 1 
ATOM   2196  H  HG13 . ILE A  1 164 ? 86.024  -91.098  -21.016 1.00 32.91  ? 144 ILE A HG13 1 
ATOM   2197  H  HG21 . ILE A  1 164 ? 83.961  -94.282  -20.317 1.00 35.48  ? 144 ILE A HG21 1 
ATOM   2198  H  HG22 . ILE A  1 164 ? 82.620  -93.694  -21.333 1.00 34.51  ? 144 ILE A HG22 1 
ATOM   2199  H  HG23 . ILE A  1 164 ? 84.192  -94.095  -22.068 1.00 35.56  ? 144 ILE A HG23 1 
ATOM   2200  H  HD11 . ILE A  1 164 ? 87.493  -92.662  -20.057 1.00 36.24  ? 144 ILE A HD11 1 
ATOM   2201  H  HD12 . ILE A  1 164 ? 86.071  -92.417  -19.015 1.00 34.59  ? 144 ILE A HD12 1 
ATOM   2202  H  HD13 . ILE A  1 164 ? 86.223  -93.897  -19.998 1.00 34.15  ? 144 ILE A HD13 1 
ATOM   2203  N  N    . LYS A  1 165 ? 82.784  -92.370  -24.100 1.00 34.77  ? 145 LYS A N    1 
ATOM   2204  C  CA   . LYS A  1 165 ? 82.868  -92.722  -25.525 1.00 34.26  ? 145 LYS A CA   1 
ATOM   2205  C  C    . LYS A  1 165 ? 83.216  -91.510  -26.371 1.00 38.26  ? 145 LYS A C    1 
ATOM   2206  O  O    . LYS A  1 165 ? 84.018  -91.611  -27.293 1.00 39.66  ? 145 LYS A O    1 
ATOM   2207  C  CB   . LYS A  1 165 ? 81.533  -93.269  -26.070 1.00 38.45  ? 145 LYS A CB   1 
ATOM   2208  C  CG   . LYS A  1 165 ? 81.065  -94.629  -25.565 1.00 61.16  ? 145 LYS A CG   1 
ATOM   2209  C  CD   . LYS A  1 165 ? 79.636  -94.971  -26.018 1.00 67.06  ? 145 LYS A CD   1 
ATOM   2210  C  CE   . LYS A  1 165 ? 79.412  -94.890  -27.518 1.00 73.64  ? 145 LYS A CE   1 
ATOM   2211  N  NZ   . LYS A  1 165 ? 78.034  -95.312  -27.905 1.00 84.70  ? 145 LYS A NZ   1 
ATOM   2212  H  H    . LYS A  1 165 ? 81.935  -92.699  -23.652 1.00 35.35  ? 145 LYS A H    1 
ATOM   2213  H  HA   . LYS A  1 165 ? 83.636  -93.476  -25.681 1.00 34.55  ? 145 LYS A HA   1 
ATOM   2214  H  HB2  . LYS A  1 165 ? 80.753  -92.541  -25.853 1.00 39.34  ? 145 LYS A HB2  1 
ATOM   2215  H  HB3  . LYS A  1 165 ? 81.650  -93.362  -27.148 1.00 37.97  ? 145 LYS A HB3  1 
ATOM   2216  H  HG2  . LYS A  1 165 ? 81.720  -95.399  -25.966 1.00 62.19  ? 145 LYS A HG2  1 
ATOM   2217  H  HG3  . LYS A  1 165 ? 81.086  -94.646  -24.477 1.00 61.52  ? 145 LYS A HG3  1 
ATOM   2218  H  HD2  . LYS A  1 165 ? 79.415  -95.993  -25.712 1.00 66.87  ? 145 LYS A HD2  1 
ATOM   2219  H  HD3  . LYS A  1 165 ? 78.941  -94.280  -25.542 1.00 67.29  ? 145 LYS A HD3  1 
ATOM   2220  H  HE2  . LYS A  1 165 ? 79.530  -93.860  -27.849 1.00 73.43  ? 145 LYS A HE2  1 
ATOM   2221  H  HE3  . LYS A  1 165 ? 80.128  -95.537  -28.023 1.00 73.69  ? 145 LYS A HE3  1 
ATOM   2222  H  HZ1  . LYS A  1 165 ? 77.899  -95.195  -28.904 1.00 84.55  ? 145 LYS A HZ1  1 
ATOM   2223  H  HZ2  . LYS A  1 165 ? 77.895  -96.289  -27.666 1.00 85.00  ? 145 LYS A HZ2  1 
ATOM   2224  H  HZ3  . LYS A  1 165 ? 77.346  -94.753  -27.409 1.00 84.73  ? 145 LYS A HZ3  1 
ATOM   2225  N  N    . ASP A  1 166 ? 82.592  -90.358  -26.055 1.00 34.60  ? 146 ASP A N    1 
ATOM   2226  C  CA   . ASP A  1 166 ? 82.777  -89.102  -26.781 1.00 33.84  ? 146 ASP A CA   1 
ATOM   2227  C  C    . ASP A  1 166 ? 84.193  -88.501  -26.522 1.00 38.06  ? 146 ASP A C    1 
ATOM   2228  O  O    . ASP A  1 166 ? 84.746  -87.859  -27.411 1.00 39.32  ? 146 ASP A O    1 
ATOM   2229  C  CB   . ASP A  1 166 ? 81.665  -88.116  -26.428 1.00 34.48  ? 146 ASP A CB   1 
ATOM   2230  C  CG   . ASP A  1 166 ? 80.275  -88.694  -26.695 1.00 37.98  ? 146 ASP A CG   1 
ATOM   2231  O  OD1  . ASP A  1 166 ? 79.979  -89.009  -27.858 1.00 37.53  ? 146 ASP A OD1  1 
ATOM   2232  O  OD2  . ASP A  1 166 ? 79.538  -88.941  -25.721 1.00 46.89  ? 146 ASP A OD2  1 
ATOM   2233  H  H    . ASP A  1 166 ? 81.956  -90.275  -25.268 1.00 35.22  ? 146 ASP A H    1 
ATOM   2234  H  HA   . ASP A  1 166 ? 82.708  -89.313  -27.848 1.00 33.82  ? 146 ASP A HA   1 
ATOM   2235  H  HB2  . ASP A  1 166 ? 81.740  -87.866  -25.370 1.00 35.71  ? 146 ASP A HB2  1 
ATOM   2236  H  HB3  . ASP A  1 166 ? 81.788  -87.216  -27.028 1.00 34.08  ? 146 ASP A HB3  1 
ATOM   2237  N  N    . LEU A  1 167 ? 84.814  -88.797  -25.373 1.00 32.29  ? 147 LEU A N    1 
ATOM   2238  C  CA   . LEU A  1 167 ? 86.201  -88.387  -25.117 1.00 33.06  ? 147 LEU A CA   1 
ATOM   2239  C  C    . LEU A  1 167 ? 87.153  -89.358  -25.831 1.00 40.52  ? 147 LEU A C    1 
ATOM   2240  O  O    . LEU A  1 167 ? 88.082  -88.911  -26.499 1.00 39.41  ? 147 LEU A O    1 
ATOM   2241  C  CB   . LEU A  1 167 ? 86.499  -88.313  -23.626 1.00 34.49  ? 147 LEU A CB   1 
ATOM   2242  C  CG   . LEU A  1 167 ? 85.603  -87.360  -22.810 1.00 37.90  ? 147 LEU A CG   1 
ATOM   2243  C  CD1  . LEU A  1 167 ? 86.075  -87.273  -21.371 1.00 39.65  ? 147 LEU A CD1  1 
ATOM   2244  C  CD2  . LEU A  1 167 ? 85.557  -85.908  -23.421 1.00 32.04  ? 147 LEU A CD2  1 
ATOM   2245  H  H    . LEU A  1 167 ? 84.384  -89.287  -24.598 1.00 32.76  ? 147 LEU A H    1 
ATOM   2246  H  HA   . LEU A  1 167 ? 86.383  -87.406  -25.553 1.00 34.07  ? 147 LEU A HA   1 
ATOM   2247  H  HB2  . LEU A  1 167 ? 86.398  -89.311  -23.199 1.00 34.80  ? 147 LEU A HB2  1 
ATOM   2248  H  HB3  . LEU A  1 167 ? 87.528  -87.976  -23.509 1.00 36.79  ? 147 LEU A HB3  1 
ATOM   2249  H  HG   . LEU A  1 167 ? 84.586  -87.751  -22.797 1.00 37.45  ? 147 LEU A HG   1 
ATOM   2250  H  HD11 . LEU A  1 167 ? 85.402  -86.630  -20.805 1.00 38.32  ? 147 LEU A HD11 1 
ATOM   2251  H  HD12 . LEU A  1 167 ? 86.069  -88.280  -20.954 1.00 40.62  ? 147 LEU A HD12 1 
ATOM   2252  H  HD13 . LEU A  1 167 ? 87.083  -86.865  -21.363 1.00 39.77  ? 147 LEU A HD13 1 
ATOM   2253  H  HD21 . LEU A  1 167 ? 85.084  -85.240  -22.702 1.00 31.50  ? 147 LEU A HD21 1 
ATOM   2254  H  HD22 . LEU A  1 167 ? 86.570  -85.573  -23.632 1.00 30.76  ? 147 LEU A HD22 1 
ATOM   2255  H  HD23 . LEU A  1 167 ? 84.963  -85.924  -24.333 1.00 31.09  ? 147 LEU A HD23 1 
ATOM   2256  N  N    . TRP A  1 168 ? 86.892  -90.681  -25.740 1.00 35.97  ? 148 TRP A N    1 
ATOM   2257  C  CA   . TRP A  1 168 ? 87.680  -91.694  -26.460 1.00 36.25  ? 148 TRP A CA   1 
ATOM   2258  C  C    . TRP A  1 168 ? 87.681  -91.412  -27.967 1.00 38.17  ? 148 TRP A C    1 
ATOM   2259  O  O    . TRP A  1 168 ? 88.743  -91.413  -28.587 1.00 37.51  ? 148 TRP A O    1 
ATOM   2260  C  CB   . TRP A  1 168 ? 87.131  -93.128  -26.193 1.00 34.43  ? 148 TRP A CB   1 
ATOM   2261  C  CG   . TRP A  1 168 ? 87.420  -93.685  -24.827 1.00 35.15  ? 148 TRP A CG   1 
ATOM   2262  C  CD1  . TRP A  1 168 ? 88.515  -93.431  -24.039 1.00 37.97  ? 148 TRP A CD1  1 
ATOM   2263  C  CD2  . TRP A  1 168 ? 86.632  -94.648  -24.118 1.00 34.34  ? 148 TRP A CD2  1 
ATOM   2264  N  NE1  . TRP A  1 168 ? 88.427  -94.136  -22.870 1.00 36.64  ? 148 TRP A NE1  1 
ATOM   2265  C  CE2  . TRP A  1 168 ? 87.296  -94.921  -22.904 1.00 37.84  ? 148 TRP A CE2  1 
ATOM   2266  C  CE3  . TRP A  1 168 ? 85.447  -95.339  -24.410 1.00 35.56  ? 148 TRP A CE3  1 
ATOM   2267  C  CZ2  . TRP A  1 168 ? 86.800  -95.838  -21.971 1.00 36.91  ? 148 TRP A CZ2  1 
ATOM   2268  C  CZ3  . TRP A  1 168 ? 84.956  -96.261  -23.485 1.00 36.57  ? 148 TRP A CZ3  1 
ATOM   2269  C  CH2  . TRP A  1 168 ? 85.628  -96.496  -22.281 1.00 37.50  ? 148 TRP A CH2  1 
ATOM   2270  H  H    . TRP A  1 168 ? 86.164  -91.066  -25.147 1.00 35.98  ? 148 TRP A H    1 
ATOM   2271  H  HA   . TRP A  1 168 ? 88.715  -91.633  -26.129 1.00 36.89  ? 148 TRP A HA   1 
ATOM   2272  H  HB2  . TRP A  1 168 ? 86.048  -93.099  -26.295 1.00 33.06  ? 148 TRP A HB2  1 
ATOM   2273  H  HB3  . TRP A  1 168 ? 87.540  -93.815  -26.931 1.00 35.42  ? 148 TRP A HB3  1 
ATOM   2274  H  HD1  . TRP A  1 168 ? 89.305  -92.720  -24.270 1.00 38.39  ? 148 TRP A HD1  1 
ATOM   2275  H  HE1  . TRP A  1 168 ? 89.104  -94.116  -22.114 1.00 37.03  ? 148 TRP A HE1  1 
ATOM   2276  H  HE3  . TRP A  1 168 ? 84.951  -95.182  -25.365 1.00 34.57  ? 148 TRP A HE3  1 
ATOM   2277  H  HZ2  . TRP A  1 168 ? 87.316  -96.017  -21.029 1.00 37.21  ? 148 TRP A HZ2  1 
ATOM   2278  H  HZ3  . TRP A  1 168 ? 84.032  -96.797  -23.691 1.00 34.10  ? 148 TRP A HZ3  1 
ATOM   2279  H  HH2  . TRP A  1 168 ? 85.209  -97.212  -21.576 1.00 37.75  ? 148 TRP A HH2  1 
ATOM   2280  N  N    . ARG A  1 169 ? 86.513  -91.111  -28.540 1.00 33.20  ? 149 ARG A N    1 
ATOM   2281  C  CA   . ARG A  1 169 ? 86.410  -90.797  -29.962 1.00 34.39  ? 149 ARG A CA   1 
ATOM   2282  C  C    . ARG A  1 169 ? 87.297  -89.597  -30.336 1.00 37.66  ? 149 ARG A C    1 
ATOM   2283  O  O    . ARG A  1 169 ? 88.047  -89.687  -31.287 1.00 36.18  ? 149 ARG A O    1 
ATOM   2284  C  CB   . ARG A  1 169 ? 84.955  -90.534  -30.375 1.00 30.66  ? 149 ARG A CB   1 
ATOM   2285  C  CG   . ARG A  1 169 ? 84.762  -90.526  -31.900 1.00 30.21  ? 149 ARG A CG   1 
ATOM   2286  C  CD   . ARG A  1 169 ? 83.334  -90.160  -32.261 1.00 35.77  ? 149 ARG A CD   1 
ATOM   2287  N  NE   . ARG A  1 169 ? 82.346  -91.068  -31.667 1.00 35.68  ? 149 ARG A NE   1 
ATOM   2288  C  CZ   . ARG A  1 169 ? 81.489  -90.802  -30.676 1.00 48.54  ? 149 ARG A CZ   1 
ATOM   2289  N  NH1  . ARG A  1 169 ? 81.473  -89.603  -30.096 1.00 41.38  ? 149 ARG A NH1  1 
ATOM   2290  N  NH2  . ARG A  1 169 ? 80.631  -91.728  -30.270 1.00 30.94  ? 149 ARG A NH2  1 
ATOM   2291  H  H    . ARG A  1 169 ? 85.630  -91.083  -28.038 1.00 33.69  ? 149 ARG A H    1 
ATOM   2292  H  HA   . ARG A  1 169 ? 86.757  -91.657  -30.534 1.00 37.21  ? 149 ARG A HA   1 
ATOM   2293  H  HB2  . ARG A  1 169 ? 84.326  -91.319  -29.957 1.00 30.28  ? 149 ARG A HB2  1 
ATOM   2294  H  HB3  . ARG A  1 169 ? 84.656  -89.567  -29.975 1.00 31.52  ? 149 ARG A HB3  1 
ATOM   2295  H  HG2  . ARG A  1 169 ? 85.414  -89.785  -32.358 1.00 27.76  ? 149 ARG A HG2  1 
ATOM   2296  H  HG3  . ARG A  1 169 ? 84.968  -91.518  -32.296 1.00 30.19  ? 149 ARG A HG3  1 
ATOM   2297  H  HD2  . ARG A  1 169 ? 83.149  -89.123  -31.988 1.00 36.63  ? 149 ARG A HD2  1 
ATOM   2298  H  HD3  . ARG A  1 169 ? 83.234  -90.258  -33.340 1.00 35.53  ? 149 ARG A HD3  1 
ATOM   2299  H  HE   . ARG A  1 169 ? 82.293  -91.996  -32.071 1.00 37.12  ? 149 ARG A HE   1 
ATOM   2300  H  HH11 . ARG A  1 169 ? 82.095  -88.847  -30.360 1.00 42.26  ? 149 ARG A HH11 1 
ATOM   2301  H  HH12 . ARG A  1 169 ? 80.812  -89.426  -29.348 1.00 39.77  ? 149 ARG A HH12 1 
ATOM   2302  H  HH21 . ARG A  1 169 ? 80.619  -92.648  -30.696 1.00 31.04  ? 149 ARG A HH21 1 
ATOM   2303  H  HH22 . ARG A  1 169 ? 79.986  -91.523  -29.512 1.00 32.67  ? 149 ARG A HH22 1 
ATOM   2304  N  N    . VAL A  1 170 ? 87.276  -88.531  -29.541 1.00 35.44  ? 150 VAL A N    1 
ATOM   2305  C  CA   . VAL A  1 170 ? 88.115  -87.344  -29.779 1.00 36.18  ? 150 VAL A CA   1 
ATOM   2306  C  C    . VAL A  1 170 ? 89.627  -87.712  -29.680 1.00 41.59  ? 150 VAL A C    1 
ATOM   2307  O  O    . VAL A  1 170 ? 90.410  -87.239  -30.502 1.00 40.11  ? 150 VAL A O    1 
ATOM   2308  C  CB   . VAL A  1 170 ? 87.727  -86.183  -28.834 1.00 37.94  ? 150 VAL A CB   1 
ATOM   2309  C  CG1  . VAL A  1 170 ? 88.806  -85.088  -28.790 1.00 36.84  ? 150 VAL A CG1  1 
ATOM   2310  C  CG2  . VAL A  1 170 ? 86.384  -85.598  -29.248 1.00 37.72  ? 150 VAL A CG2  1 
ATOM   2311  H  H    . VAL A  1 170 ? 86.684  -88.457  -28.721 1.00 35.94  ? 150 VAL A H    1 
ATOM   2312  H  HA   . VAL A  1 170 ? 87.938  -87.005  -30.799 1.00 37.01  ? 150 VAL A HA   1 
ATOM   2313  H  HB   . VAL A  1 170 ? 87.620  -86.572  -27.820 1.00 38.25  ? 150 VAL A HB   1 
ATOM   2314  H  HG11 . VAL A  1 170 ? 88.389  -84.212  -28.298 1.00 35.26  ? 150 VAL A HG11 1 
ATOM   2315  H  HG12 . VAL A  1 170 ? 89.680  -85.430  -28.238 1.00 36.76  ? 150 VAL A HG12 1 
ATOM   2316  H  HG13 . VAL A  1 170 ? 89.102  -84.833  -29.805 1.00 38.77  ? 150 VAL A HG13 1 
ATOM   2317  H  HG21 . VAL A  1 170 ? 85.965  -85.053  -28.404 1.00 38.01  ? 150 VAL A HG21 1 
ATOM   2318  H  HG22 . VAL A  1 170 ? 86.542  -84.917  -30.081 1.00 38.09  ? 150 VAL A HG22 1 
ATOM   2319  H  HG23 . VAL A  1 170 ? 85.708  -86.401  -29.544 1.00 38.23  ? 150 VAL A HG23 1 
ATOM   2320  N  N    . LEU A  1 171 ? 90.002  -88.593  -28.736 1.00 37.95  ? 151 LEU A N    1 
ATOM   2321  C  CA   . LEU A  1 171 ? 91.397  -89.051  -28.589 1.00 38.10  ? 151 LEU A CA   1 
ATOM   2322  C  C    . LEU A  1 171 ? 91.850  -90.060  -29.651 1.00 41.52  ? 151 LEU A C    1 
ATOM   2323  O  O    . LEU A  1 171 ? 93.035  -90.357  -29.709 1.00 42.17  ? 151 LEU A O    1 
ATOM   2324  C  CB   . LEU A  1 171 ? 91.599  -89.685  -27.206 1.00 37.05  ? 151 LEU A CB   1 
ATOM   2325  C  CG   . LEU A  1 171 ? 91.472  -88.720  -26.010 1.00 39.89  ? 151 LEU A CG   1 
ATOM   2326  C  CD1  . LEU A  1 171 ? 91.407  -89.490  -24.710 1.00 39.16  ? 151 LEU A CD1  1 
ATOM   2327  C  CD2  . LEU A  1 171 ? 92.614  -87.712  -25.994 1.00 43.27  ? 151 LEU A CD2  1 
ATOM   2328  H  H    . LEU A  1 171 ? 89.365  -89.008  -28.064 1.00 37.01  ? 151 LEU A H    1 
ATOM   2329  H  HA   . LEU A  1 171 ? 92.062  -88.194  -28.679 1.00 38.78  ? 151 LEU A HA   1 
ATOM   2330  H  HB2  . LEU A  1 171 ? 90.863  -90.473  -27.068 1.00 35.62  ? 151 LEU A HB2  1 
ATOM   2331  H  HB3  . LEU A  1 171 ? 92.600  -90.112  -27.155 1.00 38.13  ? 151 LEU A HB3  1 
ATOM   2332  H  HG   . LEU A  1 171 ? 90.545  -88.159  -26.108 1.00 39.57  ? 151 LEU A HG   1 
ATOM   2333  H  HD11 . LEU A  1 171 ? 91.361  -88.789  -23.878 1.00 39.52  ? 151 LEU A HD11 1 
ATOM   2334  H  HD12 . LEU A  1 171 ? 90.509  -90.107  -24.717 1.00 38.45  ? 151 LEU A HD12 1 
ATOM   2335  H  HD13 . LEU A  1 171 ? 92.293  -90.116  -24.622 1.00 38.12  ? 151 LEU A HD13 1 
ATOM   2336  H  HD21 . LEU A  1 171 ? 92.585  -87.161  -25.056 1.00 43.72  ? 151 LEU A HD21 1 
ATOM   2337  H  HD22 . LEU A  1 171 ? 93.563  -88.237  -26.085 1.00 43.98  ? 151 LEU A HD22 1 
ATOM   2338  H  HD23 . LEU A  1 171 ? 92.496  -87.011  -26.821 1.00 43.04  ? 151 LEU A HD23 1 
ATOM   2339  N  N    . GLY A  1 172 ? 90.930  -90.581  -30.457 1.00 38.34  ? 152 GLY A N    1 
ATOM   2340  C  CA   . GLY A  1 172 ? 91.247  -91.575  -31.472 1.00 38.12  ? 152 GLY A CA   1 
ATOM   2341  C  C    . GLY A  1 172 ? 91.367  -92.962  -30.888 1.00 42.26  ? 152 GLY A C    1 
ATOM   2342  O  O    . GLY A  1 172 ? 92.014  -93.828  -31.477 1.00 42.03  ? 152 GLY A O    1 
ATOM   2343  H  H    . GLY A  1 172 ? 89.939  -90.374  -30.431 1.00 37.91  ? 152 GLY A H    1 
ATOM   2344  H  HA2  . GLY A  1 172 ? 90.464  -91.583  -32.226 1.00 37.81  ? 152 GLY A HA2  1 
ATOM   2345  H  HA3  . GLY A  1 172 ? 92.187  -91.326  -31.961 1.00 39.81  ? 152 GLY A HA3  1 
ATOM   2346  N  N    . ARG A  1 173 ? 90.749  -93.183  -29.709 1.00 38.66  ? 153 ARG A N    1 
ATOM   2347  C  CA   . ARG A  1 173 ? 90.733  -94.473  -29.032 1.00 39.41  ? 153 ARG A CA   1 
ATOM   2348  C  C    . ARG A  1 173 ? 89.505  -95.276  -29.470 1.00 42.52  ? 153 ARG A C    1 
ATOM   2349  O  O    . ARG A  1 173 ? 88.489  -94.681  -29.821 1.00 39.66  ? 153 ARG A O    1 
ATOM   2350  C  CB   . ARG A  1 173 ? 90.648  -94.285  -27.494 1.00 41.12  ? 153 ARG A CB   1 
ATOM   2351  C  CG   . ARG A  1 173 ? 91.665  -93.352  -26.864 1.00 50.59  ? 153 ARG A CG   1 
ATOM   2352  C  CD   . ARG A  1 173 ? 92.974  -94.007  -26.546 1.00 52.38  ? 153 ARG A CD   1 
ATOM   2353  N  NE   . ARG A  1 173 ? 93.699  -93.167  -25.603 1.00 50.06  ? 153 ARG A NE   1 
ATOM   2354  C  CZ   . ARG A  1 173 ? 93.595  -93.216  -24.271 1.00 65.99  ? 153 ARG A CZ   1 
ATOM   2355  N  NH1  . ARG A  1 173 ? 92.788  -94.106  -23.681 1.00 38.24  ? 153 ARG A NH1  1 
ATOM   2356  N  NH2  . ARG A  1 173 ? 94.304  -92.387  -23.517 1.00 41.02  ? 153 ARG A NH2  1 
ATOM   2357  H  H    . ARG A  1 173 ? 90.200  -92.488  -29.213 1.00 38.39  ? 153 ARG A H    1 
ATOM   2358  H  HA   . ARG A  1 173 ? 91.644  -95.023  -29.257 1.00 40.20  ? 153 ARG A HA   1 
ATOM   2359  H  HB2  . ARG A  1 173 ? 89.672  -93.863  -27.261 1.00 41.29  ? 153 ARG A HB2  1 
ATOM   2360  H  HB3  . ARG A  1 173 ? 90.730  -95.251  -26.999 1.00 41.48  ? 153 ARG A HB3  1 
ATOM   2361  H  HG2  . ARG A  1 173 ? 91.878  -92.526  -27.540 1.00 50.90  ? 153 ARG A HG2  1 
ATOM   2362  H  HG3  . ARG A  1 173 ? 91.252  -92.970  -25.931 1.00 48.93  ? 153 ARG A HG3  1 
ATOM   2363  H  HD2  . ARG A  1 173 ? 92.845  -95.016  -26.155 1.00 51.85  ? 153 ARG A HD2  1 
ATOM   2364  H  HD3  . ARG A  1 173 ? 93.557  -94.041  -27.466 1.00 53.07  ? 153 ARG A HD3  1 
ATOM   2365  H  HE   . ARG A  1 173 ? 94.320  -92.473  -26.008 1.00 49.77  ? 153 ARG A HE   1 
ATOM   2366  H  HH11 . ARG A  1 173 ? 92.214  -94.762  -24.198 1.00 39.00  ? 153 ARG A HH11 1 
ATOM   2367  H  HH12 . ARG A  1 173 ? 92.731  -94.121  -22.669 1.00 38.17  ? 153 ARG A HH12 1 
ATOM   2368  H  HH21 . ARG A  1 173 ? 94.910  -91.708  -23.964 1.00 40.32  ? 153 ARG A HH21 1 
ATOM   2369  H  HH22 . ARG A  1 173 ? 94.229  -92.417  -22.505 1.00 41.42  ? 153 ARG A HH22 1 
ATOM   2370  N  N    . PRO A  1 174 ? 89.501  -96.604  -29.257 1.00 43.30  ? 154 PRO A N    1 
ATOM   2371  C  CA   . PRO A  1 174 ? 88.263  -97.377  -29.481 1.00 42.18  ? 154 PRO A CA   1 
ATOM   2372  C  C    . PRO A  1 174 ? 87.121  -96.823  -28.620 1.00 43.37  ? 154 PRO A C    1 
ATOM   2373  O  O    . PRO A  1 174 ? 87.349  -96.452  -27.469 1.00 41.29  ? 154 PRO A O    1 
ATOM   2374  C  CB   . PRO A  1 174 ? 88.653  -98.799  -29.052 1.00 44.32  ? 154 PRO A CB   1 
ATOM   2375  C  CG   . PRO A  1 174 ? 90.125  -98.835  -29.143 1.00 50.11  ? 154 PRO A CG   1 
ATOM   2376  C  CD   . PRO A  1 174 ? 90.590  -97.475  -28.766 1.00 45.73  ? 154 PRO A CD   1 
ATOM   2377  H  HA   . PRO A  1 174 ? 87.994  -97.363  -30.536 1.00 42.56  ? 154 PRO A HA   1 
ATOM   2378  H  HB2  . PRO A  1 174 ? 88.348  -98.974  -28.022 1.00 44.65  ? 154 PRO A HB2  1 
ATOM   2379  H  HB3  . PRO A  1 174 ? 88.199  -99.530  -29.719 1.00 43.84  ? 154 PRO A HB3  1 
ATOM   2380  H  HG2  . PRO A  1 174 ? 90.523  -99.575  -28.452 1.00 50.92  ? 154 PRO A HG2  1 
ATOM   2381  H  HG3  . PRO A  1 174 ? 90.422  -99.065  -30.165 1.00 49.91  ? 154 PRO A HG3  1 
ATOM   2382  H  HD2  . PRO A  1 174 ? 90.711  -97.410  -27.686 1.00 45.85  ? 154 PRO A HD2  1 
ATOM   2383  H  HD3  . PRO A  1 174 ? 91.521  -97.261  -29.290 1.00 45.94  ? 154 PRO A HD3  1 
ATOM   2384  N  N    . VAL A  1 175 ? 85.902  -96.738  -29.171 1.00 37.91  ? 155 VAL A N    1 
ATOM   2385  C  CA   . VAL A  1 175 ? 84.768  -96.197  -28.419 1.00 36.23  ? 155 VAL A CA   1 
ATOM   2386  C  C    . VAL A  1 175 ? 84.213  -97.236  -27.420 1.00 39.37  ? 155 VAL A C    1 
ATOM   2387  O  O    . VAL A  1 175 ? 83.405  -96.877  -26.568 1.00 35.56  ? 155 VAL A O    1 
ATOM   2388  C  CB   . VAL A  1 175 ? 83.667  -95.626  -29.317 1.00 40.81  ? 155 VAL A CB   1 
ATOM   2389  C  CG1  . VAL A  1 175 ? 84.222  -94.431  -30.105 1.00 41.55  ? 155 VAL A CG1  1 
ATOM   2390  C  CG2  . VAL A  1 175 ? 83.071  -96.692  -30.264 1.00 40.59  ? 155 VAL A CG2  1 
ATOM   2391  H  H    . VAL A  1 175 ? 85.694  -97.063  -30.109 1.00 39.23  ? 155 VAL A H    1 
ATOM   2392  H  HA   . VAL A  1 175 ? 85.123  -95.356  -27.827 1.00 34.50  ? 155 VAL A HA   1 
ATOM   2393  H  HB   . VAL A  1 175 ? 82.856  -95.262  -28.688 1.00 39.14  ? 155 VAL A HB   1 
ATOM   2394  H  HG11 . VAL A  1 175 ? 83.445  -94.023  -30.748 1.00 41.22  ? 155 VAL A HG11 1 
ATOM   2395  H  HG12 . VAL A  1 175 ? 84.545  -93.670  -29.396 1.00 42.56  ? 155 VAL A HG12 1 
ATOM   2396  H  HG13 . VAL A  1 175 ? 85.069  -94.753  -30.707 1.00 41.21  ? 155 VAL A HG13 1 
ATOM   2397  H  HG21 . VAL A  1 175 ? 82.087  -96.349  -30.577 1.00 40.44  ? 155 VAL A HG21 1 
ATOM   2398  H  HG22 . VAL A  1 175 ? 83.711  -96.777  -31.139 1.00 40.15  ? 155 VAL A HG22 1 
ATOM   2399  H  HG23 . VAL A  1 175 ? 82.987  -97.653  -29.761 1.00 38.59  ? 155 VAL A HG23 1 
ATOM   2400  N  N    . ILE A  1 176 ? 84.610  -98.518  -27.550 1.00 36.98  ? 156 ILE A N    1 
ATOM   2401  C  CA   . ILE A  1 176 ? 84.271  -99.557  -26.579 1.00 37.48  ? 156 ILE A CA   1 
ATOM   2402  C  C    . ILE A  1 176 ? 85.579  -99.908  -25.895 1.00 40.99  ? 156 ILE A C    1 
ATOM   2403  O  O    . ILE A  1 176 ? 86.529  -100.214 -26.589 1.00 39.61  ? 156 ILE A O    1 
ATOM   2404  C  CB   . ILE A  1 176 ? 83.549  -100.758 -27.222 1.00 41.06  ? 156 ILE A CB   1 
ATOM   2405  C  CG1  . ILE A  1 176 ? 82.134  -100.320 -27.680 1.00 41.15  ? 156 ILE A CG1  1 
ATOM   2406  C  CG2  . ILE A  1 176 ? 83.483  -101.942 -26.224 1.00 44.61  ? 156 ILE A CG2  1 
ATOM   2407  C  CD1  . ILE A  1 176 ? 81.349  -101.373 -28.488 1.00 51.86  ? 156 ILE A CD1  1 
ATOM   2408  H  H    . ILE A  1 176 ? 85.150  -98.886  -28.323 1.00 36.18  ? 156 ILE A H    1 
ATOM   2409  H  HA   . ILE A  1 176 ? 83.599  -99.157  -25.819 1.00 38.64  ? 156 ILE A HA   1 
ATOM   2410  H  HB   . ILE A  1 176 ? 84.118  -101.074 -28.095 1.00 40.50  ? 156 ILE A HB   1 
ATOM   2411  H  HG12 . ILE A  1 176 ? 81.535  -100.070 -26.805 1.00 39.82  ? 156 ILE A HG12 1 
ATOM   2412  H  HG13 . ILE A  1 176 ? 82.230  -99.432  -28.304 1.00 41.66  ? 156 ILE A HG13 1 
ATOM   2413  H  HG21 . ILE A  1 176 ? 82.781  -102.694 -26.579 1.00 44.82  ? 156 ILE A HG21 1 
ATOM   2414  H  HG22 . ILE A  1 176 ? 84.466  -102.405 -26.146 1.00 45.41  ? 156 ILE A HG22 1 
ATOM   2415  H  HG23 . ILE A  1 176 ? 83.176  -101.572 -25.247 1.00 44.03  ? 156 ILE A HG23 1 
ATOM   2416  H  HD11 . ILE A  1 176 ? 80.538  -100.880 -29.023 1.00 51.94  ? 156 ILE A HD11 1 
ATOM   2417  H  HD12 . ILE A  1 176 ? 82.025  -101.849 -29.197 1.00 52.27  ? 156 ILE A HD12 1 
ATOM   2418  H  HD13 . ILE A  1 176 ? 80.932  -102.119 -27.813 1.00 51.65  ? 156 ILE A HD13 1 
ATOM   2419  N  N    . ASN A  1 177 ? 85.649  -99.772  -24.547 1.00 40.49  ? 157 ASN A N    1 
ATOM   2420  C  CA   . ASN A  1 177 ? 86.851  -100.043 -23.747 1.00 40.93  ? 157 ASN A CA   1 
ATOM   2421  C  C    . ASN A  1 177 ? 88.074  -99.269  -24.282 1.00 42.30  ? 157 ASN A C    1 
ATOM   2422  O  O    . ASN A  1 177 ? 89.128  -99.848  -24.549 1.00 43.87  ? 157 ASN A O    1 
ATOM   2423  C  CB   . ASN A  1 177 ? 87.148  -101.557 -23.680 1.00 41.31  ? 157 ASN A CB   1 
ATOM   2424  C  CG   . ASN A  1 177 ? 86.093  -102.383 -22.988 1.00 54.32  ? 157 ASN A CG   1 
ATOM   2425  O  OD1  . ASN A  1 177 ? 85.516  -101.982 -21.979 1.00 47.64  ? 157 ASN A OD1  1 
ATOM   2426  N  ND2  . ASN A  1 177 ? 85.866  -103.595 -23.477 1.00 52.35  ? 157 ASN A ND2  1 
ATOM   2427  H  H    . ASN A  1 177 ? 84.874  -99.461  -23.969 1.00 39.65  ? 157 ASN A H    1 
ATOM   2428  H  HA   . ASN A  1 177 ? 86.667  -99.687  -22.734 1.00 41.44  ? 157 ASN A HA   1 
ATOM   2429  H  HB2  . ASN A  1 177 ? 87.263  -101.935 -24.695 1.00 41.25  ? 157 ASN A HB2  1 
ATOM   2430  H  HB3  . ASN A  1 177 ? 88.067  -101.711 -23.118 1.00 40.82  ? 157 ASN A HB3  1 
ATOM   2431  H  HD21 . ASN A  1 177 ? 85.160  -104.180 -23.040 1.00 53.72  ? 157 ASN A HD21 1 
ATOM   2432  H  HD22 . ASN A  1 177 ? 86.375  -103.951 -24.279 1.00 52.26  ? 157 ASN A HD22 1 
ATOM   2433  N  N    . GLY A  1 178 ? 87.906  -97.964  -24.424 1.00 33.49  ? 158 GLY A N    1 
ATOM   2434  C  CA   . GLY A  1 178 ? 88.964  -97.066  -24.896 1.00 33.00  ? 158 GLY A CA   1 
ATOM   2435  C  C    . GLY A  1 178 ? 90.142  -96.932  -23.960 1.00 36.75  ? 158 GLY A C    1 
ATOM   2436  O  O    . GLY A  1 178 ? 91.228  -96.521  -24.366 1.00 36.39  ? 158 GLY A O    1 
ATOM   2437  H  H    . GLY A  1 178 ? 87.015  -97.509  -24.281 1.00 32.06  ? 158 GLY A H    1 
ATOM   2438  H  HA2  . GLY A  1 178 ? 89.355  -97.472  -25.827 1.00 35.09  ? 158 GLY A HA2  1 
ATOM   2439  H  HA3  . GLY A  1 178 ? 88.585  -96.076  -25.132 1.00 31.51  ? 158 GLY A HA3  1 
ATOM   2440  N  N    . GLY A  1 179 ? 89.953  -97.309  -22.722 1.00 36.90  ? 159 GLY A N    1 
ATOM   2441  C  CA   . GLY A  1 179 ? 91.031  -97.275  -21.749 1.00 36.43  ? 159 GLY A CA   1 
ATOM   2442  C  C    . GLY A  1 179 ? 91.168  -95.997  -20.966 1.00 34.81  ? 159 GLY A C    1 
ATOM   2443  O  O    . GLY A  1 179 ? 90.269  -95.143  -20.912 1.00 34.20  ? 159 GLY A O    1 
ATOM   2444  H  H    . GLY A  1 179 ? 89.083  -97.645  -22.322 1.00 37.85  ? 159 GLY A H    1 
ATOM   2445  H  HA2  . GLY A  1 179 ? 90.886  -98.076  -21.027 1.00 35.55  ? 159 GLY A HA2  1 
ATOM   2446  H  HA3  . GLY A  1 179 ? 91.975  -97.451  -22.264 1.00 37.14  ? 159 GLY A HA3  1 
ATOM   2447  N  N    . PHE A  1 180 ? 92.313  -95.921  -20.318 1.00 29.26  ? 160 PHE A N    1 
ATOM   2448  C  CA   . PHE A  1 180 ? 92.700  -94.872  -19.374 1.00 26.68  ? 160 PHE A CA   1 
ATOM   2449  C  C    . PHE A  1 180 ? 92.954  -93.527  -19.970 1.00 30.57  ? 160 PHE A C    1 
ATOM   2450  O  O    . PHE A  1 180 ? 93.744  -93.434  -20.889 1.00 30.56  ? 160 PHE A O    1 
ATOM   2451  C  CB   . PHE A  1 180 ? 93.992  -95.339  -18.676 1.00 28.27  ? 160 PHE A CB   1 
ATOM   2452  C  CG   . PHE A  1 180 ? 94.443  -94.512  -17.516 1.00 28.97  ? 160 PHE A CG   1 
ATOM   2453  C  CD1  . PHE A  1 180 ? 93.548  -94.117  -16.536 1.00 31.95  ? 160 PHE A CD1  1 
ATOM   2454  C  CD2  . PHE A  1 180 ? 95.764  -94.130  -17.394 1.00 31.01  ? 160 PHE A CD2  1 
ATOM   2455  C  CE1  . PHE A  1 180 ? 93.956  -93.341  -15.481 1.00 33.18  ? 160 PHE A CE1  1 
ATOM   2456  C  CE2  . PHE A  1 180 ? 96.187  -93.393  -16.298 1.00 33.52  ? 160 PHE A CE2  1 
ATOM   2457  C  CZ   . PHE A  1 180 ? 95.270  -92.913  -15.396 1.00 31.50  ? 160 PHE A CZ   1 
ATOM   2458  H  H    . PHE A  1 180 ? 93.033  -96.628  -20.428 1.00 28.96  ? 160 PHE A H    1 
ATOM   2459  H  HA   . PHE A  1 180 ? 91.891  -94.762  -18.655 1.00 25.57  ? 160 PHE A HA   1 
ATOM   2460  H  HB2  . PHE A  1 180 ? 93.812  -96.345  -18.301 1.00 29.21  ? 160 PHE A HB2  1 
ATOM   2461  H  HB3  . PHE A  1 180 ? 94.804  -95.370  -19.400 1.00 28.46  ? 160 PHE A HB3  1 
ATOM   2462  H  HD1  . PHE A  1 180 ? 92.495  -94.382  -16.606 1.00 32.30  ? 160 PHE A HD1  1 
ATOM   2463  H  HD2  . PHE A  1 180 ? 96.483  -94.457  -18.143 1.00 30.37  ? 160 PHE A HD2  1 
ATOM   2464  H  HE1  . PHE A  1 180 ? 93.206  -93.058  -14.747 1.00 33.09  ? 160 PHE A HE1  1 
ATOM   2465  H  HE2  . PHE A  1 180 ? 97.226  -93.074  -16.239 1.00 33.53  ? 160 PHE A HE2  1 
ATOM   2466  H  HZ   . PHE A  1 180 ? 95.611  -92.331  -14.541 1.00 28.75  ? 160 PHE A HZ   1 
ATOM   2467  N  N    . ILE A  1 181 ? 92.335  -92.469  -19.374 1.00 29.85  ? 161 ILE A N    1 
ATOM   2468  C  CA   . ILE A  1 181 ? 92.466  -91.095  -19.776 1.00 31.00  ? 161 ILE A CA   1 
ATOM   2469  C  C    . ILE A  1 181 ? 93.340  -90.495  -18.720 1.00 35.85  ? 161 ILE A C    1 
ATOM   2470  O  O    . ILE A  1 181 ? 92.943  -90.406  -17.543 1.00 36.22  ? 161 ILE A O    1 
ATOM   2471  C  CB   . ILE A  1 181 ? 91.083  -90.394  -19.982 1.00 33.95  ? 161 ILE A CB   1 
ATOM   2472  C  CG1  . ILE A  1 181 ? 90.342  -91.013  -21.189 1.00 32.97  ? 161 ILE A CG1  1 
ATOM   2473  C  CG2  . ILE A  1 181 ? 91.244  -88.859  -20.240 1.00 35.48  ? 161 ILE A CG2  1 
ATOM   2474  C  CD1  . ILE A  1 181 ? 88.965  -90.547  -21.316 1.00 42.43  ? 161 ILE A CD1  1 
ATOM   2475  H  H    . ILE A  1 181 ? 91.715  -92.554  -18.574 1.00 29.69  ? 161 ILE A H    1 
ATOM   2476  H  HA   . ILE A  1 181 ? 92.982  -91.031  -20.734 1.00 31.93  ? 161 ILE A HA   1 
ATOM   2477  H  HB   . ILE A  1 181 ? 90.479  -90.559  -19.092 1.00 34.18  ? 161 ILE A HB   1 
ATOM   2478  H  HG12 . ILE A  1 181 ? 90.868  -90.741  -22.102 1.00 32.64  ? 161 ILE A HG12 1 
ATOM   2479  H  HG13 . ILE A  1 181 ? 90.324  -92.097  -21.099 1.00 32.74  ? 161 ILE A HG13 1 
ATOM   2480  H  HG21 . ILE A  1 181 ? 90.262  -88.390  -20.236 1.00 35.56  ? 161 ILE A HG21 1 
ATOM   2481  H  HG22 . ILE A  1 181 ? 91.858  -88.396  -19.470 1.00 36.44  ? 161 ILE A HG22 1 
ATOM   2482  H  HG23 . ILE A  1 181 ? 91.711  -88.706  -21.212 1.00 35.57  ? 161 ILE A HG23 1 
ATOM   2483  H  HD11 . ILE A  1 181 ? 88.449  -91.200  -22.018 1.00 43.13  ? 161 ILE A HD11 1 
ATOM   2484  H  HD12 . ILE A  1 181 ? 88.486  -90.582  -20.339 1.00 42.52  ? 161 ILE A HD12 1 
ATOM   2485  H  HD13 . ILE A  1 181 ? 88.947  -89.527  -21.695 1.00 42.69  ? 161 ILE A HD13 1 
ATOM   2486  N  N    . VAL A  1 182 ? 94.573  -90.154  -19.124 1.00 32.17  ? 162 VAL A N    1 
ATOM   2487  C  CA   . VAL A  1 182 ? 95.551  -89.566  -18.209 1.00 32.19  ? 162 VAL A CA   1 
ATOM   2488  C  C    . VAL A  1 182 ? 95.168  -88.111  -17.983 1.00 35.63  ? 162 VAL A C    1 
ATOM   2489  O  O    . VAL A  1 182 ? 95.131  -87.323  -18.933 1.00 34.08  ? 162 VAL A O    1 
ATOM   2490  C  CB   . VAL A  1 182 ? 97.009  -89.702  -18.763 1.00 33.86  ? 162 VAL A CB   1 
ATOM   2491  C  CG1  . VAL A  1 182 ? 98.010  -88.929  -17.898 1.00 34.63  ? 162 VAL A CG1  1 
ATOM   2492  C  CG2  . VAL A  1 182 ? 97.412  -91.139  -18.855 1.00 32.32  ? 162 VAL A CG2  1 
ATOM   2493  H  H    . VAL A  1 182 ? 94.919  -90.252  -20.073 1.00 31.62  ? 162 VAL A H    1 
ATOM   2494  H  HA   . VAL A  1 182 ? 95.507  -90.083  -17.251 1.00 32.24  ? 162 VAL A HA   1 
ATOM   2495  H  HB   . VAL A  1 182 ? 97.046  -89.278  -19.765 1.00 34.14  ? 162 VAL A HB   1 
ATOM   2496  H  HG11 . VAL A  1 182 ? 98.996  -89.373  -18.029 1.00 33.71  ? 162 VAL A HG11 1 
ATOM   2497  H  HG12 . VAL A  1 182 ? 98.026  -87.885  -18.209 1.00 32.70  ? 162 VAL A HG12 1 
ATOM   2498  H  HG13 . VAL A  1 182 ? 97.706  -89.002  -16.854 1.00 34.89  ? 162 VAL A HG13 1 
ATOM   2499  H  HG21 . VAL A  1 182 ? 98.318  -91.198  -19.455 1.00 32.31  ? 162 VAL A HG21 1 
ATOM   2500  H  HG22 . VAL A  1 182 ? 97.618  -91.517  -17.857 1.00 32.40  ? 162 VAL A HG22 1 
ATOM   2501  H  HG23 . VAL A  1 182 ? 96.616  -91.721  -19.315 1.00 33.72  ? 162 VAL A HG23 1 
ATOM   2502  N  N    . GLY A  1 183 ? 94.949  -87.742  -16.730 1.00 31.84  ? 163 GLY A N    1 
ATOM   2503  C  CA   . GLY A  1 183 ? 94.643  -86.369  -16.430 1.00 31.45  ? 163 GLY A CA   1 
ATOM   2504  C  C    . GLY A  1 183 ? 95.367  -85.738  -15.272 1.00 36.28  ? 163 GLY A C    1 
ATOM   2505  O  O    . GLY A  1 183 ? 96.085  -86.402  -14.509 1.00 34.48  ? 163 GLY A O    1 
ATOM   2506  H  H    . GLY A  1 183 ? 94.969  -88.357  -15.925 1.00 33.20  ? 163 GLY A H    1 
ATOM   2507  H  HA2  . GLY A  1 183 ? 94.885  -85.752  -17.292 1.00 31.40  ? 163 GLY A HA2  1 
ATOM   2508  H  HA3  . GLY A  1 183 ? 93.573  -86.299  -16.244 1.00 32.23  ? 163 GLY A HA3  1 
ATOM   2509  N  N    . THR A  1 184 ? 95.160  -84.424  -15.158 1.00 32.56  ? 164 THR A N    1 
ATOM   2510  C  CA   . THR A  1 184 ? 95.651  -83.612  -14.054 1.00 32.64  ? 164 THR A CA   1 
ATOM   2511  C  C    . THR A  1 184 ? 94.715  -82.472  -13.801 1.00 38.02  ? 164 THR A C    1 
ATOM   2512  O  O    . THR A  1 184 ? 93.752  -82.243  -14.538 1.00 37.23  ? 164 THR A O    1 
ATOM   2513  C  CB   . THR A  1 184 ? 97.080  -83.068  -14.312 1.00 35.85  ? 164 THR A CB   1 
ATOM   2514  O  OG1  . THR A  1 184 ? 97.602  -82.519  -13.094 1.00 42.38  ? 164 THR A OG1  1 
ATOM   2515  C  CG2  . THR A  1 184 ? 97.119  -81.945  -15.371 1.00 30.16  ? 164 THR A CG2  1 
ATOM   2516  H  H    . THR A  1 184 ? 94.641  -83.886  -15.847 1.00 33.34  ? 164 THR A H    1 
ATOM   2517  H  HA   . THR A  1 184 ? 95.672  -84.192  -13.135 1.00 32.22  ? 164 THR A HA   1 
ATOM   2518  H  HB   . THR A  1 184 ? 97.716  -83.893  -14.617 1.00 33.21  ? 164 THR A HB   1 
ATOM   2519  H  HG1  . THR A  1 184 ? 98.087  -83.231  -12.602 1.00 42.99  ? 164 THR A HG1  1 
ATOM   2520  H  HG21 . THR A  1 184 ? 98.145  -81.608  -15.496 1.00 29.45  ? 164 THR A HG21 1 
ATOM   2521  H  HG22 . THR A  1 184 ? 96.734  -82.347  -16.304 1.00 30.11  ? 164 THR A HG22 1 
ATOM   2522  H  HG23 . THR A  1 184 ? 96.525  -81.082  -15.073 1.00 28.77  ? 164 THR A HG23 1 
ATOM   2523  N  N    . ILE A  1 185 ? 95.060  -81.734  -12.759 1.00 35.33  ? 165 ILE A N    1 
ATOM   2524  C  CA   . ILE A  1 185 ? 94.435  -80.510  -12.316 1.00 33.91  ? 165 ILE A CA   1 
ATOM   2525  C  C    . ILE A  1 185 ? 95.526  -79.443  -12.354 1.00 36.48  ? 165 ILE A C    1 
ATOM   2526  O  O    . ILE A  1 185 ? 96.651  -79.707  -11.939 1.00 35.16  ? 165 ILE A O    1 
ATOM   2527  C  CB   . ILE A  1 185 ? 93.893  -80.720  -10.876 1.00 36.35  ? 165 ILE A CB   1 
ATOM   2528  C  CG1  . ILE A  1 185 ? 92.949  -81.946  -10.791 1.00 35.64  ? 165 ILE A CG1  1 
ATOM   2529  C  CG2  . ILE A  1 185 ? 93.236  -79.433  -10.321 1.00 35.44  ? 165 ILE A CG2  1 
ATOM   2530  C  CD1  . ILE A  1 185 ? 93.577  -83.050  -9.980  1.00 38.04  ? 165 ILE A CD1  1 
ATOM   2531  H  H    . ILE A  1 185 ? 95.807  -82.008  -12.129 1.00 36.80  ? 165 ILE A H    1 
ATOM   2532  H  HA   . ILE A  1 185 ? 93.611  -80.222  -12.967 1.00 32.92  ? 165 ILE A HA   1 
ATOM   2533  H  HB   . ILE A  1 185 ? 94.772  -80.933  -10.269 1.00 36.48  ? 165 ILE A HB   1 
ATOM   2534  H  HG12 . ILE A  1 185 ? 92.007  -81.670  -10.320 1.00 35.36  ? 165 ILE A HG12 1 
ATOM   2535  H  HG13 . ILE A  1 185 ? 92.738  -82.321  -11.789 1.00 34.92  ? 165 ILE A HG13 1 
ATOM   2536  H  HG21 . ILE A  1 185 ? 92.667  -79.690  -9.429  1.00 34.66  ? 165 ILE A HG21 1 
ATOM   2537  H  HG22 . ILE A  1 185 ? 94.018  -78.723  -10.055 1.00 35.81  ? 165 ILE A HG22 1 
ATOM   2538  H  HG23 . ILE A  1 185 ? 92.582  -78.993  -11.071 1.00 33.94  ? 165 ILE A HG23 1 
ATOM   2539  H  HD11 . ILE A  1 185 ? 92.815  -83.785  -9.729  1.00 38.11  ? 165 ILE A HD11 1 
ATOM   2540  H  HD12 . ILE A  1 185 ? 94.359  -83.509  -10.584 1.00 37.75  ? 165 ILE A HD12 1 
ATOM   2541  H  HD13 . ILE A  1 185 ? 94.004  -82.636  -9.068  1.00 37.78  ? 165 ILE A HD13 1 
ATOM   2542  N  N    . ILE A  1 186 ? 95.222  -78.262  -12.814 1.00 34.55  ? 166 ILE A N    1 
ATOM   2543  C  CA   . ILE A  1 186 ? 96.236  -77.226  -12.748 1.00 36.59  ? 166 ILE A CA   1 
ATOM   2544  C  C    . ILE A  1 186 ? 96.404  -76.810  -11.283 1.00 39.33  ? 166 ILE A C    1 
ATOM   2545  O  O    . ILE A  1 186 ? 95.434  -76.420  -10.629 1.00 39.09  ? 166 ILE A O    1 
ATOM   2546  C  CB   . ILE A  1 186 ? 95.907  -76.014  -13.669 1.00 39.29  ? 166 ILE A CB   1 
ATOM   2547  C  CG1  . ILE A  1 186 ? 95.852  -76.460  -15.147 1.00 38.93  ? 166 ILE A CG1  1 
ATOM   2548  C  CG2  . ILE A  1 186 ? 96.930  -74.883  -13.467 1.00 40.73  ? 166 ILE A CG2  1 
ATOM   2549  C  CD1  . ILE A  1 186 ? 97.182  -77.201  -15.671 1.00 45.24  ? 166 ILE A CD1  1 
ATOM   2550  H  H    . ILE A  1 186 ? 94.335  -77.985  -13.221 1.00 33.70  ? 166 ILE A H    1 
ATOM   2551  H  HA   . ILE A  1 186 ? 97.187  -77.642  -13.078 1.00 37.27  ? 166 ILE A HA   1 
ATOM   2552  H  HB   . ILE A  1 186 ? 94.926  -75.634  -13.387 1.00 39.13  ? 166 ILE A HB   1 
ATOM   2553  H  HG12 . ILE A  1 186 ? 95.015  -77.144  -15.273 1.00 37.24  ? 166 ILE A HG12 1 
ATOM   2554  H  HG13 . ILE A  1 186 ? 95.694  -75.584  -15.774 1.00 39.76  ? 166 ILE A HG13 1 
ATOM   2555  H  HG21 . ILE A  1 186 ? 96.904  -74.220  -14.330 1.00 41.73  ? 166 ILE A HG21 1 
ATOM   2556  H  HG22 . ILE A  1 186 ? 96.662  -74.314  -12.579 1.00 40.10  ? 166 ILE A HG22 1 
ATOM   2557  H  HG23 . ILE A  1 186 ? 97.924  -75.313  -13.355 1.00 40.14  ? 166 ILE A HG23 1 
ATOM   2558  H  HD11 . ILE A  1 186 ? 97.176  -77.233  -16.758 1.00 44.95  ? 166 ILE A HD11 1 
ATOM   2559  H  HD12 . ILE A  1 186 ? 98.060  -76.654  -15.327 1.00 46.29  ? 166 ILE A HD12 1 
ATOM   2560  H  HD13 . ILE A  1 186 ? 97.201  -78.217  -15.279 1.00 45.22  ? 166 ILE A HD13 1 
ATOM   2561  N  N    . LYS A  1 187 ? 97.637  -76.939  -10.784 1.00 34.06  ? 167 LYS A N    1 
ATOM   2562  C  CA   . LYS A  1 187 ? 98.043  -76.533  -9.452  1.00 34.13  ? 167 LYS A CA   1 
ATOM   2563  C  C    . LYS A  1 187 ? 99.132  -75.486  -9.616  1.00 42.72  ? 167 LYS A C    1 
ATOM   2564  O  O    . LYS A  1 187 ? 99.946  -75.671  -10.534 1.00 42.73  ? 167 LYS A O    1 
ATOM   2565  C  CB   . LYS A  1 187 ? 98.582  -77.718  -8.633  1.00 36.94  ? 167 LYS A CB   1 
ATOM   2566  C  CG   . LYS A  1 187 ? 97.606  -78.869  -8.419  1.00 34.23  ? 167 LYS A CG   1 
ATOM   2567  C  CD   . LYS A  1 187 ? 96.389  -78.463  -7.611  1.00 45.26  ? 167 LYS A CD   1 
ATOM   2568  C  CE   . LYS A  1 187 ? 95.531  -79.667  -7.384  1.00 46.79  ? 167 LYS A CE   1 
ATOM   2569  N  NZ   . LYS A  1 187 ? 94.340  -79.400  -6.551  1.00 47.04  ? 167 LYS A NZ   1 
ATOM   2570  H  H    . LYS A  1 187 ? 98.412  -77.334  -11.308 1.00 33.36  ? 167 LYS A H    1 
ATOM   2571  H  HA   . LYS A  1 187 ? 97.192  -76.123  -8.916  1.00 33.97  ? 167 LYS A HA   1 
ATOM   2572  H  HB2  . LYS A  1 187 ? 99.467  -78.122  -9.123  1.00 37.58  ? 167 LYS A HB2  1 
ATOM   2573  H  HB3  . LYS A  1 187 ? 98.862  -77.352  -7.646  1.00 38.35  ? 167 LYS A HB3  1 
ATOM   2574  H  HG2  . LYS A  1 187 ? 97.266  -79.239  -9.384  1.00 34.78  ? 167 LYS A HG2  1 
ATOM   2575  H  HG3  . LYS A  1 187 ? 98.120  -79.664  -7.881  1.00 34.25  ? 167 LYS A HG3  1 
ATOM   2576  H  HD2  . LYS A  1 187 ? 96.691  -78.059  -6.645  1.00 45.41  ? 167 LYS A HD2  1 
ATOM   2577  H  HD3  . LYS A  1 187 ? 95.802  -77.732  -8.167  1.00 45.52  ? 167 LYS A HD3  1 
ATOM   2578  H  HE2  . LYS A  1 187 ? 95.191  -80.023  -8.354  1.00 46.73  ? 167 LYS A HE2  1 
ATOM   2579  H  HE3  . LYS A  1 187 ? 96.130  -80.421  -6.882  1.00 46.84  ? 167 LYS A HE3  1 
ATOM   2580  H  HZ1  . LYS A  1 187 ? 94.446  -79.841  -5.642  1.00 47.19  ? 167 LYS A HZ1  1 
ATOM   2581  H  HZ2  . LYS A  1 187 ? 94.214  -78.402  -6.415  1.00 46.90  ? 167 LYS A HZ2  1 
ATOM   2582  H  HZ3  . LYS A  1 187 ? 93.518  -79.773  -7.013  1.00 46.07  ? 167 LYS A HZ3  1 
ATOM   2583  N  N    . PRO A  1 188 ? 99.226  -74.404  -8.802  1.00 39.64  ? 168 PRO A N    1 
ATOM   2584  C  CA   . PRO A  1 188 ? 98.385  -73.999  -7.662  1.00 40.62  ? 168 PRO A CA   1 
ATOM   2585  C  C    . PRO A  1 188 ? 96.876  -73.970  -7.920  1.00 43.63  ? 168 PRO A C    1 
ATOM   2586  O  O    . PRO A  1 188 ? 96.451  -73.655  -9.031  1.00 42.89  ? 168 PRO A O    1 
ATOM   2587  C  CB   . PRO A  1 188 ? 98.836  -72.562  -7.401  1.00 42.59  ? 168 PRO A CB   1 
ATOM   2588  C  CG   . PRO A  1 188 ? 100.234 -72.504  -7.863  1.00 46.98  ? 168 PRO A CG   1 
ATOM   2589  C  CD   . PRO A  1 188 ? 100.363 -73.479  -8.983  1.00 42.82  ? 168 PRO A CD   1 
ATOM   2590  H  HA   . PRO A  1 188 ? 98.604  -74.613  -6.789  1.00 41.91  ? 168 PRO A HA   1 
ATOM   2591  H  HB2  . PRO A  1 188 ? 98.227  -71.862  -7.973  1.00 43.18  ? 168 PRO A HB2  1 
ATOM   2592  H  HB3  . PRO A  1 188 ? 98.754  -72.354  -6.335  1.00 41.68  ? 168 PRO A HB3  1 
ATOM   2593  H  HG2  . PRO A  1 188 ? 100.458 -71.496  -8.210  1.00 47.15  ? 168 PRO A HG2  1 
ATOM   2594  H  HG3  . PRO A  1 188 ? 100.890 -72.786  -7.041  1.00 47.79  ? 168 PRO A HG3  1 
ATOM   2595  H  HD2  . PRO A  1 188 ? 100.309 -72.976  -9.946  1.00 44.12  ? 168 PRO A HD2  1 
ATOM   2596  H  HD3  . PRO A  1 188 ? 101.304 -74.016  -8.879  1.00 43.03  ? 168 PRO A HD3  1 
ATOM   2597  N  N    . LYS A  1 189 ? 96.083  -74.260  -6.877  1.00 39.40  ? 169 LYS A N    1 
ATOM   2598  C  CA   . LYS A  1 189 ? 94.614  -74.240  -6.943  1.00 38.45  ? 169 LYS A CA   1 
ATOM   2599  C  C    . LYS A  1 189 ? 94.111  -72.858  -7.418  1.00 40.67  ? 169 LYS A C    1 
ATOM   2600  O  O    . LYS A  1 189 ? 93.173  -72.792  -8.202  1.00 38.11  ? 169 LYS A O    1 
ATOM   2601  C  CB   . LYS A  1 189 ? 94.007  -74.619  -5.567  1.00 40.60  ? 169 LYS A CB   1 
ATOM   2602  C  CG   . LYS A  1 189 ? 92.480  -74.406  -5.455  1.00 49.96  ? 169 LYS A CG   1 
ATOM   2603  C  CD   . LYS A  1 189 ? 91.914  -74.728  -4.072  1.00 55.95  ? 169 LYS A CD   1 
ATOM   2604  C  CE   . LYS A  1 189 ? 92.262  -76.086  -3.543  1.00 61.33  ? 169 LYS A CE   1 
ATOM   2605  N  NZ   . LYS A  1 189 ? 91.818  -77.170  -4.441  1.00 51.87  ? 169 LYS A NZ   1 
ATOM   2606  H  H    . LYS A  1 189 ? 96.442  -74.524  -5.965  1.00 39.20  ? 169 LYS A H    1 
ATOM   2607  H  HA   . LYS A  1 189 ? 94.299  -74.968  -7.687  1.00 37.44  ? 169 LYS A HA   1 
ATOM   2608  H  HB2  . LYS A  1 189 ? 94.242  -75.667  -5.390  1.00 39.01  ? 169 LYS A HB2  1 
ATOM   2609  H  HB3  . LYS A  1 189 ? 94.465  -74.005  -4.793  1.00 40.77  ? 169 LYS A HB3  1 
ATOM   2610  H  HG2  . LYS A  1 189 ? 92.243  -73.359  -5.640  1.00 49.11  ? 169 LYS A HG2  1 
ATOM   2611  H  HG3  . LYS A  1 189 ? 91.971  -75.029  -6.188  1.00 49.93  ? 169 LYS A HG3  1 
ATOM   2612  H  HD2  . LYS A  1 189 ? 92.279  -74.008  -3.343  1.00 56.55  ? 169 LYS A HD2  1 
ATOM   2613  H  HD3  . LYS A  1 189 ? 90.828  -74.662  -4.115  1.00 56.00  ? 169 LYS A HD3  1 
ATOM   2614  H  HE2  . LYS A  1 189 ? 93.335  -76.170  -3.380  1.00 61.51  ? 169 LYS A HE2  1 
ATOM   2615  H  HE3  . LYS A  1 189 ? 91.739  -76.219  -2.600  1.00 61.84  ? 169 LYS A HE3  1 
ATOM   2616  H  HZ1  . LYS A  1 189 ? 91.713  -78.027  -3.909  1.00 51.71  ? 169 LYS A HZ1  1 
ATOM   2617  H  HZ2  . LYS A  1 189 ? 90.935  -76.922  -4.872  1.00 50.84  ? 169 LYS A HZ2  1 
ATOM   2618  H  HZ3  . LYS A  1 189 ? 92.518  -77.316  -5.162  1.00 52.54  ? 169 LYS A HZ3  1 
ATOM   2619  N  N    . LEU A  1 190 ? 94.748  -71.797  -6.955  1.00 38.19  ? 170 LEU A N    1 
ATOM   2620  C  CA   . LEU A  1 190 ? 94.527  -70.417  -7.357  1.00 38.53  ? 170 LEU A CA   1 
ATOM   2621  C  C    . LEU A  1 190 ? 95.877  -69.715  -7.239  1.00 43.06  ? 170 LEU A C    1 
ATOM   2622  O  O    . LEU A  1 190 ? 96.699  -70.128  -6.414  1.00 42.25  ? 170 LEU A O    1 
ATOM   2623  C  CB   . LEU A  1 190 ? 93.459  -69.715  -6.499  1.00 39.29  ? 170 LEU A CB   1 
ATOM   2624  C  CG   . LEU A  1 190 ? 91.996  -70.114  -6.730  1.00 44.44  ? 170 LEU A CG   1 
ATOM   2625  C  CD1  . LEU A  1 190 ? 91.100  -69.547  -5.630  1.00 44.88  ? 170 LEU A CD1  1 
ATOM   2626  C  CD2  . LEU A  1 190 ? 91.506  -69.662  -8.097  1.00 48.98  ? 170 LEU A CD2  1 
ATOM   2627  H  H    . LEU A  1 190 ? 95.486  -71.874  -6.263  1.00 39.31  ? 170 LEU A H    1 
ATOM   2628  H  HA   . LEU A  1 190 ? 94.224  -70.383  -8.401  1.00 38.53  ? 170 LEU A HA   1 
ATOM   2629  H  HB2  . LEU A  1 190 ? 93.684  -69.916  -5.452  1.00 39.77  ? 170 LEU A HB2  1 
ATOM   2630  H  HB3  . LEU A  1 190 ? 93.527  -68.643  -6.675  1.00 38.84  ? 170 LEU A HB3  1 
ATOM   2631  H  HG   . LEU A  1 190 ? 91.909  -71.196  -6.670  1.00 44.77  ? 170 LEU A HG   1 
ATOM   2632  H  HD11 . LEU A  1 190 ? 90.064  -69.801  -5.846  1.00 44.70  ? 170 LEU A HD11 1 
ATOM   2633  H  HD12 . LEU A  1 190 ? 91.397  -69.982  -4.678  1.00 44.27  ? 170 LEU A HD12 1 
ATOM   2634  H  HD13 . LEU A  1 190 ? 91.216  -68.465  -5.609  1.00 45.42  ? 170 LEU A HD13 1 
ATOM   2635  H  HD21 . LEU A  1 190 ? 90.434  -69.844  -8.169  1.00 48.63  ? 170 LEU A HD21 1 
ATOM   2636  H  HD22 . LEU A  1 190 ? 91.707  -68.597  -8.213  1.00 50.16  ? 170 LEU A HD22 1 
ATOM   2637  H  HD23 . LEU A  1 190 ? 92.026  -70.225  -8.868  1.00 48.28  ? 170 LEU A HD23 1 
ATOM   2638  N  N    . GLY A  1 191 ? 96.126  -68.735  -8.091  1.00 39.85  ? 171 GLY A N    1 
ATOM   2639  C  CA   . GLY A  1 191 ? 97.350  -67.949  -8.046  1.00 41.08  ? 171 GLY A CA   1 
ATOM   2640  C  C    . GLY A  1 191 ? 98.075  -67.802  -9.361  1.00 46.10  ? 171 GLY A C    1 
ATOM   2641  O  O    . GLY A  1 191 ? 98.801  -66.825  -9.535  1.00 46.14  ? 171 GLY A O    1 
ATOM   2642  H  H    . GLY A  1 191 ? 95.512  -68.478  -8.857  1.00 40.80  ? 171 GLY A H    1 
ATOM   2643  H  HA2  . GLY A  1 191 ? 97.090  -66.946  -7.710  1.00 39.22  ? 171 GLY A HA2  1 
ATOM   2644  H  HA3  . GLY A  1 191 ? 98.055  -68.376  -7.335  1.00 42.75  ? 171 GLY A HA3  1 
ATOM   2645  N  N    . LEU A  1 192 ? 97.920  -68.753  -10.285 1.00 42.70  ? 172 LEU A N    1 
ATOM   2646  C  CA   . LEU A  1 192 ? 98.583  -68.612  -11.587 1.00 41.91  ? 172 LEU A CA   1 
ATOM   2647  C  C    . LEU A  1 192 ? 97.845  -67.576  -12.424 1.00 44.72  ? 172 LEU A C    1 
ATOM   2648  O  O    . LEU A  1 192 ? 96.619  -67.625  -12.528 1.00 45.82  ? 172 LEU A O    1 
ATOM   2649  C  CB   . LEU A  1 192 ? 98.672  -69.943  -12.359 1.00 41.00  ? 172 LEU A CB   1 
ATOM   2650  C  CG   . LEU A  1 192 ? 99.574  -71.019  -11.774 1.00 46.29  ? 172 LEU A CG   1 
ATOM   2651  C  CD1  . LEU A  1 192 ? 99.627  -72.232  -12.678 1.00 45.40  ? 172 LEU A CD1  1 
ATOM   2652  C  CD2  . LEU A  1 192 ? 101.001 -70.500  -11.558 1.00 50.09  ? 172 LEU A CD2  1 
ATOM   2653  H  H    . LEU A  1 192 ? 97.384  -69.608  -10.177 1.00 42.70  ? 172 LEU A H    1 
ATOM   2654  H  HA   . LEU A  1 192 ? 99.601  -68.263  -11.433 1.00 42.30  ? 172 LEU A HA   1 
ATOM   2655  H  HB2  . LEU A  1 192 ? 97.671  -70.361  -12.443 1.00 40.57  ? 172 LEU A HB2  1 
ATOM   2656  H  HB3  . LEU A  1 192 ? 99.048  -69.724  -13.357 1.00 40.73  ? 172 LEU A HB3  1 
ATOM   2657  H  HG   . LEU A  1 192 ? 99.159  -71.318  -10.813 1.00 46.18  ? 172 LEU A HG   1 
ATOM   2658  H  HD11 . LEU A  1 192 ? 100.176 -73.034  -12.187 1.00 45.33  ? 172 LEU A HD11 1 
ATOM   2659  H  HD12 . LEU A  1 192 ? 98.614  -72.561  -12.903 1.00 45.57  ? 172 LEU A HD12 1 
ATOM   2660  H  HD13 . LEU A  1 192 ? 100.142 -71.952  -13.594 1.00 45.62  ? 172 LEU A HD13 1 
ATOM   2661  H  HD21 . LEU A  1 192 ? 101.673 -71.349  -11.449 1.00 50.19  ? 172 LEU A HD21 1 
ATOM   2662  H  HD22 . LEU A  1 192 ? 101.290 -69.902  -12.420 1.00 50.34  ? 172 LEU A HD22 1 
ATOM   2663  H  HD23 . LEU A  1 192 ? 101.028 -69.892  -10.655 1.00 49.71  ? 172 LEU A HD23 1 
ATOM   2664  N  N    . ARG A  1 193 ? 98.591  -66.657  -13.025 1.00 40.55  ? 173 ARG A N    1 
ATOM   2665  C  CA   . ARG A  1 193 ? 98.040  -65.643  -13.941 1.00 38.18  ? 173 ARG A CA   1 
ATOM   2666  C  C    . ARG A  1 193 ? 97.844  -66.353  -15.306 1.00 41.01  ? 173 ARG A C    1 
ATOM   2667  O  O    . ARG A  1 193 ? 98.277  -67.496  -15.445 1.00 39.70  ? 173 ARG A O    1 
ATOM   2668  C  CB   . ARG A  1 193 ? 98.944  -64.385  -13.968 1.00 34.60  ? 173 ARG A CB   1 
ATOM   2669  C  CG   . ARG A  1 193 ? 98.785  -63.558  -12.680 1.00 43.50  ? 173 ARG A CG   1 
ATOM   2670  C  CD   . ARG A  1 193 ? 100.022 -62.815  -12.245 1.00 52.39  ? 173 ARG A CD   1 
ATOM   2671  N  NE   . ARG A  1 193 ? 101.120 -63.707  -11.897 1.00 60.61  ? 173 ARG A NE   1 
ATOM   2672  C  CZ   . ARG A  1 193 ? 102.352 -63.306  -11.597 1.00 76.60  ? 173 ARG A CZ   1 
ATOM   2673  N  NH1  . ARG A  1 193 ? 102.653 -62.014  -11.580 1.00 66.53  ? 173 ARG A NH1  1 
ATOM   2674  N  NH2  . ARG A  1 193 ? 103.298 -64.198  -11.314 1.00 68.07  ? 173 ARG A NH2  1 
ATOM   2675  H  H    . ARG A  1 193 ? 99.599  -66.592  -12.914 1.00 41.85  ? 173 ARG A H    1 
ATOM   2676  H  HA   . ARG A  1 193 ? 97.066  -65.325  -13.575 1.00 37.20  ? 173 ARG A HA   1 
ATOM   2677  H  HB2  . ARG A  1 193 ? 99.983  -64.693  -14.078 1.00 34.32  ? 173 ARG A HB2  1 
ATOM   2678  H  HB3  . ARG A  1 193 ? 98.668  -63.744  -14.802 1.00 34.37  ? 173 ARG A HB3  1 
ATOM   2679  H  HG2  . ARG A  1 193 ? 98.022  -62.801  -12.847 1.00 42.93  ? 173 ARG A HG2  1 
ATOM   2680  H  HG3  . ARG A  1 193 ? 98.488  -64.210  -11.859 1.00 43.10  ? 173 ARG A HG3  1 
ATOM   2681  H  HD2  . ARG A  1 193 ? 100.342 -62.189  -13.077 1.00 53.12  ? 173 ARG A HD2  1 
ATOM   2682  H  HD3  . ARG A  1 193 ? 99.798  -62.204  -11.373 1.00 52.01  ? 173 ARG A HD3  1 
ATOM   2683  H  HE   . ARG A  1 193 ? 100.936 -64.705  -11.914 1.00 60.50  ? 173 ARG A HE   1 
ATOM   2684  H  HH11 . ARG A  1 193 ? 101.965 -61.295  -11.779 1.00 66.67  ? 173 ARG A HH11 1 
ATOM   2685  H  HH12 . ARG A  1 193 ? 103.595 -61.725  -11.338 1.00 67.47  ? 173 ARG A HH12 1 
ATOM   2686  H  HH21 . ARG A  1 193 ? 103.093 -65.192  -11.331 1.00 67.59  ? 173 ARG A HH21 1 
ATOM   2687  H  HH22 . ARG A  1 193 ? 104.238 -63.893  -11.078 1.00 68.74  ? 173 ARG A HH22 1 
ATOM   2688  N  N    . PRO A  1 194 ? 97.149  -65.755  -16.295 1.00 37.95  ? 174 PRO A N    1 
ATOM   2689  C  CA   . PRO A  1 194 ? 96.812  -66.499  -17.524 1.00 37.27  ? 174 PRO A CA   1 
ATOM   2690  C  C    . PRO A  1 194 ? 97.951  -67.204  -18.287 1.00 40.80  ? 174 PRO A C    1 
ATOM   2691  O  O    . PRO A  1 194 ? 97.762  -68.377  -18.666 1.00 36.34  ? 174 PRO A O    1 
ATOM   2692  C  CB   . PRO A  1 194 ? 96.155  -65.435  -18.403 1.00 39.21  ? 174 PRO A CB   1 
ATOM   2693  C  CG   . PRO A  1 194 ? 95.481  -64.509  -17.389 1.00 43.56  ? 174 PRO A CG   1 
ATOM   2694  C  CD   . PRO A  1 194 ? 96.518  -64.411  -16.295 1.00 38.97  ? 174 PRO A CD   1 
ATOM   2695  H  HA   . PRO A  1 194 ? 96.062  -67.248  -17.280 1.00 36.90  ? 174 PRO A HA   1 
ATOM   2696  H  HB2  . PRO A  1 194 ? 96.908  -64.899  -18.978 1.00 38.87  ? 174 PRO A HB2  1 
ATOM   2697  H  HB3  . PRO A  1 194 ? 95.413  -65.888  -19.058 1.00 38.80  ? 174 PRO A HB3  1 
ATOM   2698  H  HG2  . PRO A  1 194 ? 95.278  -63.540  -17.839 1.00 43.49  ? 174 PRO A HG2  1 
ATOM   2699  H  HG3  . PRO A  1 194 ? 94.566  -64.965  -17.015 1.00 43.63  ? 174 PRO A HG3  1 
ATOM   2700  H  HD2  . PRO A  1 194 ? 97.246  -63.647  -16.562 1.00 38.69  ? 174 PRO A HD2  1 
ATOM   2701  H  HD3  . PRO A  1 194 ? 96.055  -64.194  -15.336 1.00 38.56  ? 174 PRO A HD3  1 
ATOM   2702  N  N    . GLN A  1 195 ? 99.112  -66.542  -18.540 1.00 39.47  ? 175 GLN A N    1 
ATOM   2703  C  CA   . GLN A  1 195 ? 100.179 -67.222  -19.318 1.00 38.73  ? 175 GLN A CA   1 
ATOM   2704  C  C    . GLN A  1 195 ? 100.863 -68.319  -18.474 1.00 42.01  ? 175 GLN A C    1 
ATOM   2705  O  O    . GLN A  1 195 ? 100.898 -69.449  -18.955 1.00 42.28  ? 175 GLN A O    1 
ATOM   2706  C  CB   . GLN A  1 195 ? 101.202 -66.245  -19.922 1.00 39.65  ? 175 GLN A CB   1 
ATOM   2707  C  CG   . GLN A  1 195 ? 101.914 -66.797  -21.165 1.00 40.33  ? 175 GLN A CG   1 
ATOM   2708  C  CD   . GLN A  1 195 ? 101.024 -67.473  -22.216 1.00 59.06  ? 175 GLN A CD   1 
ATOM   2709  O  OE1  . GLN A  1 195 ? 101.108 -68.699  -22.387 1.00 49.20  ? 175 GLN A OE1  1 
ATOM   2710  N  NE2  . GLN A  1 195 ? 100.199 -66.754  -22.956 1.00 45.32  ? 175 GLN A NE2  1 
ATOM   2711  H  H    . GLN A  1 195 ? 99.321  -65.591  -18.255 1.00 39.85  ? 175 GLN A H    1 
ATOM   2712  H  HA   . GLN A  1 195 ? 99.688  -67.724  -20.151 1.00 37.66  ? 175 GLN A HA   1 
ATOM   2713  H  HB2  . GLN A  1 195 ? 100.688 -65.329  -20.210 1.00 39.81  ? 175 GLN A HB2  1 
ATOM   2714  H  HB3  . GLN A  1 195 ? 101.976 -66.032  -19.187 1.00 39.26  ? 175 GLN A HB3  1 
ATOM   2715  H  HG2  . GLN A  1 195 ? 102.475 -65.994  -21.643 1.00 40.19  ? 175 GLN A HG2  1 
ATOM   2716  H  HG3  . GLN A  1 195 ? 102.618 -67.561  -20.835 1.00 39.77  ? 175 GLN A HG3  1 
ATOM   2717  H  HE21 . GLN A  1 195 ? 100.107 -65.755  -22.806 1.00 45.22  ? 175 GLN A HE21 1 
ATOM   2718  H  HE22 . GLN A  1 195 ? 99.624  -67.218  -23.654 1.00 45.52  ? 175 GLN A HE22 1 
ATOM   2719  N  N    . PRO A  1 196 ? 101.325 -68.075  -17.223 1.00 37.67  ? 176 PRO A N    1 
ATOM   2720  C  CA   . PRO A  1 196 ? 101.839 -69.190  -16.395 1.00 36.47  ? 176 PRO A CA   1 
ATOM   2721  C  C    . PRO A  1 196 ? 100.865 -70.383  -16.310 1.00 38.53  ? 176 PRO A C    1 
ATOM   2722  O  O    . PRO A  1 196 ? 101.302 -71.546  -16.311 1.00 36.64  ? 176 PRO A O    1 
ATOM   2723  C  CB   . PRO A  1 196 ? 102.003 -68.559  -15.015 1.00 38.39  ? 176 PRO A CB   1 
ATOM   2724  C  CG   . PRO A  1 196 ? 102.160 -67.142  -15.252 1.00 43.72  ? 176 PRO A CG   1 
ATOM   2725  C  CD   . PRO A  1 196 ? 101.374 -66.801  -16.479 1.00 39.58  ? 176 PRO A CD   1 
ATOM   2726  H  HA   . PRO A  1 196 ? 102.804 -69.534  -16.766 1.00 37.75  ? 176 PRO A HA   1 
ATOM   2727  H  HB2  . PRO A  1 196 ? 101.114 -68.735  -14.412 1.00 37.92  ? 176 PRO A HB2  1 
ATOM   2728  H  HB3  . PRO A  1 196 ? 102.885 -68.978  -14.532 1.00 39.90  ? 176 PRO A HB3  1 
ATOM   2729  H  HG2  . PRO A  1 196 ? 101.778 -66.592  -14.392 1.00 44.05  ? 176 PRO A HG2  1 
ATOM   2730  H  HG3  . PRO A  1 196 ? 103.213 -66.912  -15.407 1.00 43.77  ? 176 PRO A HG3  1 
ATOM   2731  H  HD2  . PRO A  1 196 ? 100.383 -66.446  -16.207 1.00 39.52  ? 176 PRO A HD2  1 
ATOM   2732  H  HD3  . PRO A  1 196 ? 101.916 -66.048  -17.045 1.00 39.25  ? 176 PRO A HD3  1 
ATOM   2733  N  N    . PHE A  1 197 ? 99.538  -70.094  -16.240 1.00 33.30  ? 177 PHE A N    1 
ATOM   2734  C  CA   . PHE A  1 197 ? 98.513  -71.136  -16.221 1.00 32.46  ? 177 PHE A CA   1 
ATOM   2735  C  C    . PHE A  1 197 ? 98.577  -71.954  -17.521 1.00 36.30  ? 177 PHE A C    1 
ATOM   2736  O  O    . PHE A  1 197 ? 98.714  -73.177  -17.480 1.00 36.55  ? 177 PHE A O    1 
ATOM   2737  C  CB   . PHE A  1 197 ? 97.136  -70.512  -16.045 1.00 33.75  ? 177 PHE A CB   1 
ATOM   2738  C  CG   . PHE A  1 197 ? 96.025  -71.505  -15.848 1.00 34.17  ? 177 PHE A CG   1 
ATOM   2739  C  CD1  . PHE A  1 197 ? 95.477  -72.180  -16.925 1.00 35.17  ? 177 PHE A CD1  1 
ATOM   2740  C  CD2  . PHE A  1 197 ? 95.439  -71.674  -14.605 1.00 35.47  ? 177 PHE A CD2  1 
ATOM   2741  C  CE1  . PHE A  1 197 ? 94.416  -73.064  -16.748 1.00 34.80  ? 177 PHE A CE1  1 
ATOM   2742  C  CE2  . PHE A  1 197 ? 94.400  -72.578  -14.429 1.00 36.29  ? 177 PHE A CE2  1 
ATOM   2743  C  CZ   . PHE A  1 197 ? 93.892  -73.263  -15.499 1.00 35.44  ? 177 PHE A CZ   1 
ATOM   2744  H  H    . PHE A  1 197 ? 99.162  -69.151  -16.204 1.00 34.25  ? 177 PHE A H    1 
ATOM   2745  H  HA   . PHE A  1 197 ? 98.705  -71.812  -15.389 1.00 32.44  ? 177 PHE A HA   1 
ATOM   2746  H  HB2  . PHE A  1 197 ? 97.159  -69.867  -15.166 1.00 35.21  ? 177 PHE A HB2  1 
ATOM   2747  H  HB3  . PHE A  1 197 ? 96.881  -69.918  -16.920 1.00 34.44  ? 177 PHE A HB3  1 
ATOM   2748  H  HD1  . PHE A  1 197 ? 95.877  -72.017  -17.924 1.00 35.39  ? 177 PHE A HD1  1 
ATOM   2749  H  HD2  . PHE A  1 197 ? 95.847  -71.153  -13.739 1.00 35.39  ? 177 PHE A HD2  1 
ATOM   2750  H  HE1  . PHE A  1 197 ? 94.012  -73.613  -17.595 1.00 34.29  ? 177 PHE A HE1  1 
ATOM   2751  H  HE2  . PHE A  1 197 ? 94.005  -72.723  -13.428 1.00 37.23  ? 177 PHE A HE2  1 
ATOM   2752  H  HZ   . PHE A  1 197 ? 93.074  -73.967  -15.363 1.00 35.77  ? 177 PHE A HZ   1 
ATOM   2753  N  N    . ALA A  1 198 ? 98.530  -71.260  -18.667 1.00 32.05  ? 178 ALA A N    1 
ATOM   2754  C  CA   . ALA A  1 198 ? 98.583  -71.920  -19.984 1.00 30.25  ? 178 ALA A CA   1 
ATOM   2755  C  C    . ALA A  1 198 ? 99.919  -72.652  -20.217 1.00 35.40  ? 178 ALA A C    1 
ATOM   2756  O  O    . ALA A  1 198 ? 99.939  -73.673  -20.915 1.00 37.18  ? 178 ALA A O    1 
ATOM   2757  C  CB   . ALA A  1 198 ? 98.324  -70.912  -21.082 1.00 30.95  ? 178 ALA A CB   1 
ATOM   2758  H  H    . ALA A  1 198 ? 98.447  -70.250  -18.715 1.00 31.35  ? 178 ALA A H    1 
ATOM   2759  H  HA   . ALA A  1 198 ? 97.795  -72.670  -20.034 1.00 29.99  ? 178 ALA A HA   1 
ATOM   2760  H  HB1  . ALA A  1 198 ? 98.404  -71.399  -22.051 1.00 30.99  ? 178 ALA A HB1  1 
ATOM   2761  H  HB2  . ALA A  1 198 ? 97.319  -70.513  -20.949 1.00 30.29  ? 178 ALA A HB2  1 
ATOM   2762  H  HB3  . ALA A  1 198 ? 99.059  -70.110  -21.014 1.00 33.00  ? 178 ALA A HB3  1 
ATOM   2763  N  N    . ASN A  1 199 ? 101.027 -72.148  -19.649 1.00 34.10  ? 179 ASN A N    1 
ATOM   2764  C  CA   . ASN A  1 199 ? 102.328 -72.825  -19.768 1.00 34.63  ? 179 ASN A CA   1 
ATOM   2765  C  C    . ASN A  1 199 ? 102.305 -74.195  -19.050 1.00 39.62  ? 179 ASN A C    1 
ATOM   2766  O  O    . ASN A  1 199 ? 102.856 -75.167  -19.568 1.00 40.37  ? 179 ASN A O    1 
ATOM   2767  C  CB   . ASN A  1 199 ? 103.452 -71.955  -19.191 1.00 36.64  ? 179 ASN A CB   1 
ATOM   2768  C  CG   . ASN A  1 199 ? 103.754 -70.712  -19.995 1.00 53.78  ? 179 ASN A CG   1 
ATOM   2769  O  OD1  . ASN A  1 199 ? 103.432 -70.605  -21.186 1.00 40.86  ? 179 ASN A OD1  1 
ATOM   2770  N  ND2  . ASN A  1 199 ? 104.418 -69.753  -19.373 1.00 45.72  ? 179 ASN A ND2  1 
ATOM   2771  H  H    . ASN A  1 199 ? 101.052 -71.286  -19.113 1.00 33.80  ? 179 ASN A H    1 
ATOM   2772  H  HA   . ASN A  1 199 ? 102.538 -73.015  -20.817 1.00 33.86  ? 179 ASN A HA   1 
ATOM   2773  H  HB2  . ASN A  1 199 ? 103.177 -71.642  -18.185 1.00 35.66  ? 179 ASN A HB2  1 
ATOM   2774  H  HB3  . ASN A  1 199 ? 104.362 -72.553  -19.158 1.00 36.83  ? 179 ASN A HB3  1 
ATOM   2775  H  HD21 . ASN A  1 199 ? 104.649 -68.897  -19.866 1.00 46.53  ? 179 ASN A HD21 1 
ATOM   2776  H  HD22 . ASN A  1 199 ? 104.705 -69.868  -18.407 1.00 46.48  ? 179 ASN A HD22 1 
ATOM   2777  N  N    . ALA A  1 200 ? 101.664 -74.272  -17.872 1.00 35.62  ? 180 ALA A N    1 
ATOM   2778  C  CA   . ALA A  1 200 ? 101.555 -75.542  -17.132 1.00 34.97  ? 180 ALA A CA   1 
ATOM   2779  C  C    . ALA A  1 200 ? 100.669 -76.527  -17.919 1.00 38.38  ? 180 ALA A C    1 
ATOM   2780  O  O    . ALA A  1 200 ? 100.948 -77.725  -17.918 1.00 36.23  ? 180 ALA A O    1 
ATOM   2781  C  CB   . ALA A  1 200 ? 100.986 -75.303  -15.743 1.00 35.00  ? 180 ALA A CB   1 
ATOM   2782  H  H    . ALA A  1 200 ? 101.237 -73.480  -17.401 1.00 35.22  ? 180 ALA A H    1 
ATOM   2783  H  HA   . ALA A  1 200 ? 102.544 -75.985  -17.019 1.00 35.10  ? 180 ALA A HA   1 
ATOM   2784  H  HB1  . ALA A  1 200 ? 101.073 -76.223  -15.167 1.00 35.59  ? 180 ALA A HB1  1 
ATOM   2785  H  HB2  . ALA A  1 200 ? 101.543 -74.505  -15.256 1.00 35.07  ? 180 ALA A HB2  1 
ATOM   2786  H  HB3  . ALA A  1 200 ? 99.937  -75.020  -15.829 1.00 34.35  ? 180 ALA A HB3  1 
ATOM   2787  N  N    . CYS A  1 201 ? 99.614  -76.009  -18.607 1.00 34.05  ? 181 CYS A N    1 
ATOM   2788  C  CA   . CYS A  1 201 ? 98.742  -76.833  -19.453 1.00 34.60  ? 181 CYS A CA   1 
ATOM   2789  C  C    . CYS A  1 201 ? 99.539  -77.479  -20.571 1.00 39.68  ? 181 CYS A C    1 
ATOM   2790  O  O    . CYS A  1 201 ? 99.450  -78.688  -20.805 1.00 39.95  ? 181 CYS A O    1 
ATOM   2791  C  CB   . CYS A  1 201 ? 97.596  -76.012  -20.039 1.00 34.56  ? 181 CYS A CB   1 
ATOM   2792  S  SG   . CYS A  1 201 ? 96.397  -75.430  -18.834 1.00 37.54  ? 181 CYS A SG   1 
ATOM   2793  H  H    . CYS A  1 201 ? 99.331  -75.037  -18.560 1.00 31.43  ? 181 CYS A H    1 
ATOM   2794  H  HA   . CYS A  1 201 ? 98.321  -77.618  -18.828 1.00 33.62  ? 181 CYS A HA   1 
ATOM   2795  H  HB2  . CYS A  1 201 ? 97.993  -75.142  -20.561 1.00 35.73  ? 181 CYS A HB2  1 
ATOM   2796  H  HB3  . CYS A  1 201 ? 97.053  -76.638  -20.745 1.00 35.10  ? 181 CYS A HB3  1 
ATOM   2797  H  HG   . CYS A  1 201 ? 96.991  -74.531  -18.041 1.00 37.21  ? 181 CYS A HG   1 
ATOM   2798  N  N    . TYR A  1 202 ? 100.272 -76.651  -21.301 1.00 38.43  ? 182 TYR A N    1 
ATOM   2799  C  CA   . TYR A  1 202 ? 101.110 -77.102  -22.410 1.00 37.17  ? 182 TYR A CA   1 
ATOM   2800  C  C    . TYR A  1 202 ? 102.070 -78.189  -21.954 1.00 41.81  ? 182 TYR A C    1 
ATOM   2801  O  O    . TYR A  1 202 ? 102.137 -79.247  -22.592 1.00 42.07  ? 182 TYR A O    1 
ATOM   2802  C  CB   . TYR A  1 202 ? 101.892 -75.907  -23.006 1.00 38.64  ? 182 TYR A CB   1 
ATOM   2803  C  CG   . TYR A  1 202 ? 102.850 -76.302  -24.095 1.00 40.82  ? 182 TYR A CG   1 
ATOM   2804  C  CD1  . TYR A  1 202 ? 102.399 -76.557  -25.385 1.00 43.37  ? 182 TYR A CD1  1 
ATOM   2805  C  CD2  . TYR A  1 202 ? 104.208 -76.477  -23.829 1.00 41.59  ? 182 TYR A CD2  1 
ATOM   2806  C  CE1  . TYR A  1 202 ? 103.279 -76.946  -26.395 1.00 44.97  ? 182 TYR A CE1  1 
ATOM   2807  C  CE2  . TYR A  1 202 ? 105.092 -76.890  -24.824 1.00 42.53  ? 182 TYR A CE2  1 
ATOM   2808  C  CZ   . TYR A  1 202 ? 104.624 -77.119  -26.109 1.00 44.98  ? 182 TYR A CZ   1 
ATOM   2809  O  OH   . TYR A  1 202 ? 105.466 -77.517  -27.115 1.00 41.32  ? 182 TYR A OH   1 
ATOM   2810  H  H    . TYR A  1 202 ? 100.291 -75.646  -21.155 1.00 38.77  ? 182 TYR A H    1 
ATOM   2811  H  HA   . TYR A  1 202 ? 100.474 -77.513  -23.193 1.00 37.16  ? 182 TYR A HA   1 
ATOM   2812  H  HB2  . TYR A  1 202 ? 101.188 -75.193  -23.432 1.00 37.63  ? 182 TYR A HB2  1 
ATOM   2813  H  HB3  . TYR A  1 202 ? 102.465 -75.426  -22.213 1.00 39.97  ? 182 TYR A HB3  1 
ATOM   2814  H  HD1  . TYR A  1 202 ? 101.344 -76.421  -25.618 1.00 42.77  ? 182 TYR A HD1  1 
ATOM   2815  H  HD2  . TYR A  1 202 ? 104.581 -76.319  -22.819 1.00 41.77  ? 182 TYR A HD2  1 
ATOM   2816  H  HE1  . TYR A  1 202 ? 102.914 -77.127  -27.404 1.00 45.02  ? 182 TYR A HE1  1 
ATOM   2817  H  HE2  . TYR A  1 202 ? 106.147 -77.020  -24.589 1.00 43.28  ? 182 TYR A HE2  1 
ATOM   2818  H  HH   . TYR A  1 202 ? 106.361 -77.775  -26.771 1.00 41.52  ? 182 TYR A HH   1 
ATOM   2819  N  N    . ASP A  1 203 ? 102.790 -77.949  -20.841 1.00 40.68  ? 183 ASP A N    1 
ATOM   2820  C  CA   . ASP A  1 203 ? 103.770 -78.910  -20.301 1.00 41.50  ? 183 ASP A CA   1 
ATOM   2821  C  C    . ASP A  1 203 ? 103.137 -80.262  -19.996 1.00 43.33  ? 183 ASP A C    1 
ATOM   2822  O  O    . ASP A  1 203 ? 103.675 -81.291  -20.416 1.00 41.87  ? 183 ASP A O    1 
ATOM   2823  C  CB   . ASP A  1 203 ? 104.459 -78.376  -19.030 1.00 44.48  ? 183 ASP A CB   1 
ATOM   2824  C  CG   . ASP A  1 203 ? 105.426 -77.220  -19.281 1.00 64.70  ? 183 ASP A CG   1 
ATOM   2825  O  OD1  . ASP A  1 203 ? 105.887 -77.061  -20.447 1.00 66.39  ? 183 ASP A OD1  1 
ATOM   2826  O  OD2  . ASP A  1 203 ? 105.750 -76.490  -18.308 1.00 72.87  ? 183 ASP A OD2  1 
ATOM   2827  H  H    . ASP A  1 203 ? 102.706 -77.097  -20.294 1.00 40.62  ? 183 ASP A H    1 
ATOM   2828  H  HA   . ASP A  1 203 ? 104.533 -79.085  -21.058 1.00 42.18  ? 183 ASP A HA   1 
ATOM   2829  H  HB2  . ASP A  1 203 ? 103.690 -78.025  -18.341 1.00 44.10  ? 183 ASP A HB2  1 
ATOM   2830  H  HB3  . ASP A  1 203 ? 105.025 -79.189  -18.576 1.00 43.30  ? 183 ASP A HB3  1 
ATOM   2831  N  N    . PHE A  1 204 ? 101.997 -80.271  -19.295 1.00 38.45  ? 184 PHE A N    1 
ATOM   2832  C  CA   . PHE A  1 204 ? 101.317 -81.534  -18.989 1.00 35.87  ? 184 PHE A CA   1 
ATOM   2833  C  C    . PHE A  1 204 ? 100.848 -82.241  -20.281 1.00 35.33  ? 184 PHE A C    1 
ATOM   2834  O  O    . PHE A  1 204 ? 101.001 -83.462  -20.408 1.00 31.37  ? 184 PHE A O    1 
ATOM   2835  C  CB   . PHE A  1 204 ? 100.122 -81.324  -18.071 1.00 36.50  ? 184 PHE A CB   1 
ATOM   2836  C  CG   . PHE A  1 204 ? 99.438  -82.626  -17.723 1.00 38.29  ? 184 PHE A CG   1 
ATOM   2837  C  CD1  . PHE A  1 204 ? 99.926  -83.436  -16.704 1.00 40.51  ? 184 PHE A CD1  1 
ATOM   2838  C  CD2  . PHE A  1 204 ? 98.348  -83.080  -18.461 1.00 39.17  ? 184 PHE A CD2  1 
ATOM   2839  C  CE1  . PHE A  1 204 ? 99.318  -84.654  -16.418 1.00 41.78  ? 184 PHE A CE1  1 
ATOM   2840  C  CE2  . PHE A  1 204 ? 97.725  -84.279  -18.148 1.00 40.51  ? 184 PHE A CE2  1 
ATOM   2841  C  CZ   . PHE A  1 204 ? 98.213  -85.063  -17.137 1.00 39.80  ? 184 PHE A CZ   1 
ATOM   2842  H  H    . PHE A  1 204 ? 101.528 -79.442  -18.942 1.00 38.74  ? 184 PHE A H    1 
ATOM   2843  H  HA   . PHE A  1 204 ? 102.014 -82.198  -18.481 1.00 36.86  ? 184 PHE A HA   1 
ATOM   2844  H  HB2  . PHE A  1 204 ? 100.463 -80.858  -17.147 1.00 37.30  ? 184 PHE A HB2  1 
ATOM   2845  H  HB3  . PHE A  1 204 ? 99.396  -80.678  -18.564 1.00 36.12  ? 184 PHE A HB3  1 
ATOM   2846  H  HD1  . PHE A  1 204 ? 100.802 -83.122  -16.139 1.00 39.16  ? 184 PHE A HD1  1 
ATOM   2847  H  HD2  . PHE A  1 204 ? 97.944  -82.455  -19.256 1.00 38.85  ? 184 PHE A HD2  1 
ATOM   2848  H  HE1  . PHE A  1 204 ? 99.695  -85.277  -15.608 1.00 43.08  ? 184 PHE A HE1  1 
ATOM   2849  H  HE2  . PHE A  1 204 ? 96.856  -84.607  -18.715 1.00 40.65  ? 184 PHE A HE2  1 
ATOM   2850  H  HZ   . PHE A  1 204 ? 97.735  -86.013  -16.897 1.00 40.51  ? 184 PHE A HZ   1 
ATOM   2851  N  N    . TRP A  1 205 ? 100.274 -81.488  -21.216 1.00 33.90  ? 185 TRP A N    1 
ATOM   2852  C  CA   . TRP A  1 205 ? 99.747  -82.071  -22.460 1.00 34.65  ? 185 TRP A CA   1 
ATOM   2853  C  C    . TRP A  1 205 ? 100.835 -82.717  -23.343 1.00 38.97  ? 185 TRP A C    1 
ATOM   2854  O  O    . TRP A  1 205 ? 100.495 -83.555  -24.168 1.00 35.71  ? 185 TRP A O    1 
ATOM   2855  C  CB   . TRP A  1 205 ? 98.941  -81.049  -23.255 1.00 33.93  ? 185 TRP A CB   1 
ATOM   2856  C  CG   . TRP A  1 205 ? 97.517  -80.868  -22.785 1.00 34.72  ? 185 TRP A CG   1 
ATOM   2857  C  CD1  . TRP A  1 205 ? 96.657  -81.839  -22.371 1.00 36.90  ? 185 TRP A CD1  1 
ATOM   2858  C  CD2  . TRP A  1 205 ? 96.743  -79.661  -22.881 1.00 34.81  ? 185 TRP A CD2  1 
ATOM   2859  N  NE1  . TRP A  1 205 ? 95.407  -81.314  -22.181 1.00 37.08  ? 185 TRP A NE1  1 
ATOM   2860  C  CE2  . TRP A  1 205 ? 95.428  -79.977  -22.491 1.00 38.74  ? 185 TRP A CE2  1 
ATOM   2861  C  CE3  . TRP A  1 205 ? 97.031  -78.342  -23.277 1.00 36.22  ? 185 TRP A CE3  1 
ATOM   2862  C  CZ2  . TRP A  1 205 ? 94.409  -79.024  -22.463 1.00 37.41  ? 185 TRP A CZ2  1 
ATOM   2863  C  CZ3  . TRP A  1 205 ? 96.026  -77.394  -23.226 1.00 37.91  ? 185 TRP A CZ3  1 
ATOM   2864  C  CH2  . TRP A  1 205 ? 94.727  -77.739  -22.835 1.00 38.31  ? 185 TRP A CH2  1 
ATOM   2865  H  H    . TRP A  1 205 ? 100.134 -80.486  -21.131 1.00 34.31  ? 185 TRP A H    1 
ATOM   2866  H  HA   . TRP A  1 205 ? 99.088  -82.893  -22.183 1.00 34.83  ? 185 TRP A HA   1 
ATOM   2867  H  HB2  . TRP A  1 205 ? 99.425  -80.072  -23.203 1.00 35.06  ? 185 TRP A HB2  1 
ATOM   2868  H  HB3  . TRP A  1 205 ? 98.898  -81.359  -24.299 1.00 34.96  ? 185 TRP A HB3  1 
ATOM   2869  H  HD1  . TRP A  1 205 ? 96.900  -82.892  -22.249 1.00 37.12  ? 185 TRP A HD1  1 
ATOM   2870  H  HE1  . TRP A  1 205 ? 94.591  -81.827  -21.863 1.00 37.27  ? 185 TRP A HE1  1 
ATOM   2871  H  HE3  . TRP A  1 205 ? 98.030  -78.068  -23.612 1.00 37.20  ? 185 TRP A HE3  1 
ATOM   2872  H  HZ2  . TRP A  1 205 ? 93.414  -79.281  -22.109 1.00 37.69  ? 185 TRP A HZ2  1 
ATOM   2873  H  HZ3  . TRP A  1 205 ? 96.242  -76.363  -23.507 1.00 38.17  ? 185 TRP A HZ3  1 
ATOM   2874  H  HH2  . TRP A  1 205 ? 93.966  -76.961  -22.775 1.00 37.29  ? 185 TRP A HH2  1 
ATOM   2875  N  N    . LEU A  1 206 ? 102.132 -82.404  -23.138 1.00 38.56  ? 186 LEU A N    1 
ATOM   2876  C  CA   . LEU A  1 206 ? 103.198 -83.077  -23.880 1.00 38.47  ? 186 LEU A CA   1 
ATOM   2877  C  C    . LEU A  1 206 ? 103.243 -84.582  -23.528 1.00 42.73  ? 186 LEU A C    1 
ATOM   2878  O  O    . LEU A  1 206 ? 103.724 -85.357  -24.342 1.00 42.24  ? 186 LEU A O    1 
ATOM   2879  C  CB   . LEU A  1 206 ? 104.569 -82.430  -23.631 1.00 38.03  ? 186 LEU A CB   1 
ATOM   2880  C  CG   . LEU A  1 206 ? 104.746 -81.003  -24.127 1.00 41.96  ? 186 LEU A CG   1 
ATOM   2881  C  CD1  . LEU A  1 206 ? 106.148 -80.486  -23.801 1.00 43.66  ? 186 LEU A CD1  1 
ATOM   2882  C  CD2  . LEU A  1 206 ? 104.470 -80.882  -25.618 1.00 39.23  ? 186 LEU A CD2  1 
ATOM   2883  H  H    . LEU A  1 206 ? 102.464 -81.671  -22.518 1.00 39.39  ? 186 LEU A H    1 
ATOM   2884  H  HA   . LEU A  1 206 ? 102.979 -83.015  -24.945 1.00 39.07  ? 186 LEU A HA   1 
ATOM   2885  H  HB2  . LEU A  1 206 ? 104.761 -82.433  -22.559 1.00 37.97  ? 186 LEU A HB2  1 
ATOM   2886  H  HB3  . LEU A  1 206 ? 105.321 -83.045  -24.122 1.00 38.96  ? 186 LEU A HB3  1 
ATOM   2887  H  HG   . LEU A  1 206 ? 104.044 -80.354  -23.611 1.00 41.56  ? 186 LEU A HG   1 
ATOM   2888  H  HD11 . LEU A  1 206 ? 106.210 -79.433  -24.074 1.00 43.71  ? 186 LEU A HD11 1 
ATOM   2889  H  HD12 . LEU A  1 206 ? 106.324 -80.606  -22.733 1.00 43.83  ? 186 LEU A HD12 1 
ATOM   2890  H  HD13 . LEU A  1 206 ? 106.880 -81.058  -24.369 1.00 43.89  ? 186 LEU A HD13 1 
ATOM   2891  H  HD21 . LEU A  1 206 ? 104.915 -79.964  -25.995 1.00 38.40  ? 186 LEU A HD21 1 
ATOM   2892  H  HD22 . LEU A  1 206 ? 104.900 -81.742  -26.128 1.00 40.27  ? 186 LEU A HD22 1 
ATOM   2893  H  HD23 . LEU A  1 206 ? 103.393 -80.859  -25.772 1.00 38.17  ? 186 LEU A HD23 1 
ATOM   2894  N  N    . GLY A  1 207 ? 102.740 -84.972  -22.341 1.00 41.23  ? 187 GLY A N    1 
ATOM   2895  C  CA   . GLY A  1 207 ? 102.658 -86.372  -21.934 1.00 41.56  ? 187 GLY A CA   1 
ATOM   2896  C  C    . GLY A  1 207 ? 101.283 -86.914  -21.561 1.00 46.68  ? 187 GLY A C    1 
ATOM   2897  O  O    . GLY A  1 207 ? 101.142 -88.135  -21.440 1.00 48.16  ? 187 GLY A O    1 
ATOM   2898  H  H    . GLY A  1 207 ? 102.474 -84.337  -21.597 1.00 40.80  ? 187 GLY A H    1 
ATOM   2899  H  HA2  . GLY A  1 207 ? 103.037 -87.020  -22.724 1.00 40.79  ? 187 GLY A HA2  1 
ATOM   2900  H  HA3  . GLY A  1 207 ? 103.312 -86.507  -21.075 1.00 41.97  ? 187 GLY A HA3  1 
ATOM   2901  N  N    . GLY A  1 208 ? 100.279 -86.046  -21.361 1.00 41.03  ? 188 GLY A N    1 
ATOM   2902  C  CA   . GLY A  1 208 ? 98.942  -86.436  -20.916 1.00 38.06  ? 188 GLY A CA   1 
ATOM   2903  C  C    . GLY A  1 208 ? 97.804  -86.027  -21.827 1.00 39.19  ? 188 GLY A C    1 
ATOM   2904  O  O    . GLY A  1 208 ? 98.023  -85.315  -22.807 1.00 41.71  ? 188 GLY A O    1 
ATOM   2905  H  H    . GLY A  1 208 ? 100.341 -85.047  -21.533 1.00 42.18  ? 188 GLY A H    1 
ATOM   2906  H  HA2  . GLY A  1 208 ? 98.876  -87.517  -20.803 1.00 38.41  ? 188 GLY A HA2  1 
ATOM   2907  H  HA3  . GLY A  1 208 ? 98.761  -85.999  -19.936 1.00 37.56  ? 188 GLY A HA3  1 
ATOM   2908  N  N    . ASP A  1 209 ? 96.570  -86.444  -21.478 1.00 31.21  ? 189 ASP A N    1 
ATOM   2909  C  CA   . ASP A  1 209 ? 95.371  -86.259  -22.279 1.00 29.62  ? 189 ASP A CA   1 
ATOM   2910  C  C    . ASP A  1 209 ? 94.445  -85.119  -21.841 1.00 34.91  ? 189 ASP A C    1 
ATOM   2911  O  O    . ASP A  1 209 ? 93.991  -84.324  -22.659 1.00 33.81  ? 189 ASP A O    1 
ATOM   2912  C  CB   . ASP A  1 209 ? 94.523  -87.539  -22.239 1.00 31.47  ? 189 ASP A CB   1 
ATOM   2913  C  CG   . ASP A  1 209 ? 95.271  -88.790  -22.701 1.00 45.52  ? 189 ASP A CG   1 
ATOM   2914  O  OD1  . ASP A  1 209 ? 96.086  -88.681  -23.647 1.00 49.61  ? 189 ASP A OD1  1 
ATOM   2915  O  OD2  . ASP A  1 209 ? 95.105  -89.866  -22.060 1.00 45.13  ? 189 ASP A OD2  1 
ATOM   2916  H  H    . ASP A  1 209 ? 96.383  -86.948  -20.615 1.00 32.18  ? 189 ASP A H    1 
ATOM   2917  H  HA   . ASP A  1 209 ? 95.652  -86.078  -23.315 1.00 29.68  ? 189 ASP A HA   1 
ATOM   2918  H  HB2  . ASP A  1 209 ? 94.151  -87.714  -21.232 1.00 28.17  ? 189 ASP A HB2  1 
ATOM   2919  H  HB3  . ASP A  1 209 ? 93.677  -87.414  -22.915 1.00 32.61  ? 189 ASP A HB3  1 
ATOM   2920  N  N    . PHE A  1 210 ? 94.124  -85.093  -20.557 1.00 30.89  ? 190 PHE A N    1 
ATOM   2921  C  CA   . PHE A  1 210 ? 93.079  -84.307  -19.985 1.00 30.73  ? 190 PHE A CA   1 
ATOM   2922  C  C    . PHE A  1 210 ? 93.560  -83.401  -18.872 1.00 37.23  ? 190 PHE A C    1 
ATOM   2923  O  O    . PHE A  1 210 ? 94.338  -83.820  -18.020 1.00 38.38  ? 190 PHE A O    1 
ATOM   2924  C  CB   . PHE A  1 210 ? 92.061  -85.305  -19.431 1.00 32.69  ? 190 PHE A CB   1 
ATOM   2925  C  CG   . PHE A  1 210 ? 90.820  -84.774  -18.771 1.00 34.26  ? 190 PHE A CG   1 
ATOM   2926  C  CD1  . PHE A  1 210 ? 90.833  -84.394  -17.430 1.00 37.50  ? 190 PHE A CD1  1 
ATOM   2927  C  CD2  . PHE A  1 210 ? 89.602  -84.799  -19.433 1.00 36.93  ? 190 PHE A CD2  1 
ATOM   2928  C  CE1  . PHE A  1 210 ? 89.671  -83.972  -16.795 1.00 37.65  ? 190 PHE A CE1  1 
ATOM   2929  C  CE2  . PHE A  1 210 ? 88.433  -84.403  -18.789 1.00 39.16  ? 190 PHE A CE2  1 
ATOM   2930  C  CZ   . PHE A  1 210 ? 88.471  -83.998  -17.472 1.00 37.83  ? 190 PHE A CZ   1 
ATOM   2931  H  H    . PHE A  1 210 ? 94.603  -85.656  -19.859 1.00 32.59  ? 190 PHE A H    1 
ATOM   2932  H  HA   . PHE A  1 210 ? 92.575  -83.719  -20.746 1.00 30.30  ? 190 PHE A HA   1 
ATOM   2933  H  HB2  . PHE A  1 210 ? 91.740  -85.950  -20.248 1.00 32.12  ? 190 PHE A HB2  1 
ATOM   2934  H  HB3  . PHE A  1 210 ? 92.562  -85.925  -18.687 1.00 34.24  ? 190 PHE A HB3  1 
ATOM   2935  H  HD1  . PHE A  1 210 ? 91.768  -84.398  -16.873 1.00 38.82  ? 190 PHE A HD1  1 
ATOM   2936  H  HD2  . PHE A  1 210 ? 89.558  -85.131  -20.469 1.00 37.73  ? 190 PHE A HD2  1 
ATOM   2937  H  HE1  . PHE A  1 210 ? 89.707  -83.635  -15.760 1.00 37.95  ? 190 PHE A HE1  1 
ATOM   2938  H  HE2  . PHE A  1 210 ? 87.492  -84.400  -19.336 1.00 38.88  ? 190 PHE A HE2  1 
ATOM   2939  N  N    . ILE A  1 211 ? 93.039  -82.182  -18.848 1.00 31.69  ? 191 ILE A N    1 
ATOM   2940  C  CA   . ILE A  1 211 ? 93.317  -81.201  -17.797 1.00 30.64  ? 191 ILE A CA   1 
ATOM   2941  C  C    . ILE A  1 211 ? 92.023  -80.625  -17.345 1.00 35.27  ? 191 ILE A C    1 
ATOM   2942  O  O    . ILE A  1 211 ? 91.201  -80.254  -18.173 1.00 33.69  ? 191 ILE A O    1 
ATOM   2943  C  CB   . ILE A  1 211 ? 94.273  -80.071  -18.250 1.00 31.92  ? 191 ILE A CB   1 
ATOM   2944  C  CG1  . ILE A  1 211 ? 95.584  -80.664  -18.781 1.00 34.90  ? 191 ILE A CG1  1 
ATOM   2945  C  CG2  . ILE A  1 211 ? 94.517  -79.081  -17.118 1.00 30.05  ? 191 ILE A CG2  1 
ATOM   2946  C  CD1  . ILE A  1 211 ? 96.632  -79.672  -19.187 1.00 47.28  ? 191 ILE A CD1  1 
ATOM   2947  H  H    . ILE A  1 211 ? 92.411  -81.819  -19.560 1.00 32.25  ? 191 ILE A H    1 
ATOM   2948  H  HA   . ILE A  1 211 ? 93.787  -81.696  -16.950 1.00 32.38  ? 191 ILE A HA   1 
ATOM   2949  H  HB   . ILE A  1 211 ? 93.790  -79.538  -19.068 1.00 30.85  ? 191 ILE A HB   1 
ATOM   2950  H  HG12 . ILE A  1 211 ? 96.019  -81.289  -18.007 1.00 34.94  ? 191 ILE A HG12 1 
ATOM   2951  H  HG13 . ILE A  1 211 ? 95.369  -81.269  -19.659 1.00 34.69  ? 191 ILE A HG13 1 
ATOM   2952  H  HG21 . ILE A  1 211 ? 95.227  -78.319  -17.432 1.00 29.89  ? 191 ILE A HG21 1 
ATOM   2953  H  HG22 . ILE A  1 211 ? 93.591  -78.571  -16.852 1.00 30.56  ? 191 ILE A HG22 1 
ATOM   2954  H  HG23 . ILE A  1 211 ? 94.898  -79.616  -16.248 1.00 30.74  ? 191 ILE A HG23 1 
ATOM   2955  H  HD11 . ILE A  1 211 ? 97.343  -80.159  -19.852 1.00 47.62  ? 191 ILE A HD11 1 
ATOM   2956  H  HD12 . ILE A  1 211 ? 96.163  -78.822  -19.681 1.00 46.55  ? 191 ILE A HD12 1 
ATOM   2957  H  HD13 . ILE A  1 211 ? 97.142  -79.355  -18.279 1.00 47.11  ? 191 ILE A HD13 1 
HETATM 2958  N  N    . KCX A  1 212 ? 91.879  -80.433  -16.032 1.00 34.48  ? 192 KCX A N    1 
HETATM 2959  C  CA   . KCX A  1 212 ? 90.676  -79.777  -15.538 1.00 32.95  ? 192 KCX A CA   1 
HETATM 2960  C  CB   . KCX A  1 212 ? 89.896  -80.603  -14.518 1.00 33.40  ? 192 KCX A CB   1 
HETATM 2961  C  CG   . KCX A  1 212 ? 90.733  -81.410  -13.473 1.00 33.56  ? 192 KCX A CG   1 
HETATM 2962  C  CD   . KCX A  1 212 ? 89.851  -82.278  -12.543 1.00 33.80  ? 192 KCX A CD   1 
HETATM 2963  C  CE   . KCX A  1 212 ? 88.659  -81.499  -11.864 1.00 33.34  ? 192 KCX A CE   1 
HETATM 2964  N  NZ   . KCX A  1 212 ? 88.920  -80.316  -10.918 1.00 33.84  ? 192 KCX A NZ   1 
HETATM 2965  C  C    . KCX A  1 212 ? 91.094  -78.557  -14.804 1.00 38.31  ? 192 KCX A C    1 
HETATM 2966  O  O    . KCX A  1 212 ? 92.215  -78.466  -14.281 1.00 38.49  ? 192 KCX A O    1 
HETATM 2967  C  CX   . KCX A  1 212 ? 89.261  -80.568  -9.620  1.00 36.55  ? 192 KCX A CX   1 
HETATM 2968  O  OQ1  . KCX A  1 212 ? 89.412  -81.856  -9.188  1.00 38.99  ? 192 KCX A OQ1  1 
HETATM 2969  O  OQ2  . KCX A  1 212 ? 89.443  -79.717  -8.760  1.00 36.02  ? 192 KCX A OQ2  1 
ATOM   2970  N  N    . ASN A  1 213 ? 90.212  -77.589  -14.773 1.00 36.84  ? 193 ASN A N    1 
ATOM   2971  C  CA   . ASN A  1 213 ? 90.374  -76.482  -13.843 1.00 36.08  ? 193 ASN A CA   1 
ATOM   2972  C  C    . ASN A  1 213 ? 90.308  -77.040  -12.445 1.00 37.34  ? 193 ASN A C    1 
ATOM   2973  O  O    . ASN A  1 213 ? 89.463  -77.900  -12.170 1.00 34.43  ? 193 ASN A O    1 
ATOM   2974  C  CB   . ASN A  1 213 ? 89.221  -75.446  -13.959 1.00 30.10  ? 193 ASN A CB   1 
ATOM   2975  C  CG   . ASN A  1 213 ? 89.385  -74.360  -14.951 1.00 35.43  ? 193 ASN A CG   1 
ATOM   2976  O  OD1  . ASN A  1 213 ? 88.430  -74.016  -15.629 1.00 31.98  ? 193 ASN A OD1  1 
ATOM   2977  N  ND2  . ASN A  1 213 ? 90.487  -73.634  -14.884 1.00 34.16  ? 193 ASN A ND2  1 
ATOM   2978  H  H    . ASN A  1 213 ? 89.409  -77.529  -15.390 1.00 37.77  ? 193 ASN A H    1 
ATOM   2979  H  HA   . ASN A  1 213 ? 91.341  -76.016  -14.021 1.00 36.31  ? 193 ASN A HA   1 
ATOM   2980  H  HB2  . ASN A  1 213 ? 88.297  -75.975  -14.196 1.00 30.59  ? 193 ASN A HB2  1 
ATOM   2981  H  HB3  . ASN A  1 213 ? 89.088  -74.951  -13.001 1.00 30.67  ? 193 ASN A HB3  1 
ATOM   2982  H  HD21 . ASN A  1 213 ? 90.635  -72.869  -15.531 1.00 32.88  ? 193 ASN A HD21 1 
ATOM   2983  H  HD22 . ASN A  1 213 ? 91.145  -73.784  -14.126 1.00 35.77  ? 193 ASN A HD22 1 
ATOM   2984  N  N    . ASP A  1 214 ? 91.134  -76.529  -11.535 1.00 36.81  ? 194 ASP A N    1 
ATOM   2985  C  CA   . ASP A  1 214 ? 90.901  -76.796  -10.115 1.00 35.79  ? 194 ASP A CA   1 
ATOM   2986  C  C    . ASP A  1 214 ? 89.534  -76.144  -9.793  1.00 40.82  ? 194 ASP A C    1 
ATOM   2987  O  O    . ASP A  1 214 ? 89.233  -75.090  -10.350 1.00 39.52  ? 194 ASP A O    1 
ATOM   2988  C  CB   . ASP A  1 214 ? 92.027  -76.277  -9.227  1.00 36.22  ? 194 ASP A CB   1 
ATOM   2989  C  CG   . ASP A  1 214 ? 92.229  -77.154  -8.023  1.00 42.84  ? 194 ASP A CG   1 
ATOM   2990  O  OD1  . ASP A  1 214 ? 91.259  -77.850  -7.629  1.00 38.12  ? 194 ASP A OD1  1 
ATOM   2991  O  OD2  . ASP A  1 214 ? 93.381  -77.192  -7.494  1.00 47.83  ? 194 ASP A OD2  1 
ATOM   2992  H  H    . ASP A  1 214 ? 91.983  -76.022  -11.763 1.00 36.82  ? 194 ASP A H    1 
ATOM   2993  H  HA   . ASP A  1 214 ? 90.810  -77.873  -9.986  1.00 36.26  ? 194 ASP A HA   1 
ATOM   2994  H  HB2  . ASP A  1 214 ? 92.961  -76.283  -9.785  1.00 36.81  ? 194 ASP A HB2  1 
ATOM   2995  H  HB3  . ASP A  1 214 ? 91.797  -75.267  -8.891  1.00 35.98  ? 194 ASP A HB3  1 
ATOM   2996  N  N    . GLU A  1 215 ? 88.687  -76.798  -8.979  1.00 39.20  ? 195 GLU A N    1 
ATOM   2997  C  CA   . GLU A  1 215 ? 87.288  -76.394  -8.748  1.00 38.78  ? 195 GLU A CA   1 
ATOM   2998  C  C    . GLU A  1 215 ? 87.012  -74.889  -8.553  1.00 43.30  ? 195 GLU A C    1 
ATOM   2999  O  O    . GLU A  1 215 ? 85.954  -74.480  -9.002  1.00 43.84  ? 195 GLU A O    1 
ATOM   3000  C  CB   . GLU A  1 215 ? 86.616  -77.167  -7.593  1.00 39.94  ? 195 GLU A CB   1 
ATOM   3001  C  CG   . GLU A  1 215 ? 87.066  -76.904  -6.162  1.00 42.09  ? 195 GLU A CG   1 
ATOM   3002  C  CD   . GLU A  1 215 ? 88.374  -77.526  -5.709  1.00 51.89  ? 195 GLU A CD   1 
ATOM   3003  O  OE1  . GLU A  1 215 ? 88.766  -78.577  -6.264  1.00 41.87  ? 195 GLU A OE1  1 
ATOM   3004  O  OE2  . GLU A  1 215 ? 88.995  -76.976  -4.773  1.00 39.47  ? 195 GLU A OE2  1 
ATOM   3005  H  H    . GLU A  1 215 ? 88.960  -77.634  -8.471  1.00 40.80  ? 195 GLU A H    1 
ATOM   3006  H  HA   . GLU A  1 215 ? 86.741  -76.677  -9.647  1.00 38.83  ? 195 GLU A HA   1 
ATOM   3007  H  HB2  . GLU A  1 215 ? 85.554  -76.935  -7.628  1.00 40.07  ? 195 GLU A HB2  1 
ATOM   3008  H  HB3  . GLU A  1 215 ? 86.744  -78.227  -7.807  1.00 41.02  ? 195 GLU A HB3  1 
ATOM   3009  H  HG2  . GLU A  1 215 ? 87.138  -75.834  -5.979  1.00 42.68  ? 195 GLU A HG2  1 
ATOM   3010  H  HG3  . GLU A  1 215 ? 86.300  -77.318  -5.508  1.00 41.41  ? 195 GLU A HG3  1 
ATOM   3011  N  N    . PRO A  1 216 ? 87.841  -74.038  -7.903  1.00 39.52  ? 196 PRO A N    1 
ATOM   3012  C  CA   . PRO A  1 216 ? 87.448  -72.632  -7.748  1.00 38.38  ? 196 PRO A CA   1 
ATOM   3013  C  C    . PRO A  1 216 ? 87.938  -71.676  -8.849  1.00 40.87  ? 196 PRO A C    1 
ATOM   3014  O  O    . PRO A  1 216 ? 87.532  -70.505  -8.827  1.00 39.00  ? 196 PRO A O    1 
ATOM   3015  C  CB   . PRO A  1 216 ? 88.079  -72.257  -6.414  1.00 41.16  ? 196 PRO A CB   1 
ATOM   3016  C  CG   . PRO A  1 216 ? 89.220  -73.230  -6.221  1.00 45.91  ? 196 PRO A CG   1 
ATOM   3017  C  CD   . PRO A  1 216 ? 89.147  -74.279  -7.255  1.00 42.36  ? 196 PRO A CD   1 
ATOM   3018  H  HA   . PRO A  1 216 ? 86.369  -72.534  -7.642  1.00 38.22  ? 196 PRO A HA   1 
ATOM   3019  H  HB2  . PRO A  1 216 ? 88.444  -71.233  -6.428  1.00 41.18  ? 196 PRO A HB2  1 
ATOM   3020  H  HB3  . PRO A  1 216 ? 87.346  -72.385  -5.619  1.00 42.45  ? 196 PRO A HB3  1 
ATOM   3021  H  HG2  . PRO A  1 216 ? 90.156  -72.686  -6.317  1.00 45.90  ? 196 PRO A HG2  1 
ATOM   3022  H  HG3  . PRO A  1 216 ? 89.135  -73.673  -5.230  1.00 45.56  ? 196 PRO A HG3  1 
ATOM   3023  H  HD2  . PRO A  1 216 ? 89.956  -74.118  -7.965  1.00 43.06  ? 196 PRO A HD2  1 
ATOM   3024  H  HD3  . PRO A  1 216 ? 89.216  -75.266  -6.801  1.00 43.45  ? 196 PRO A HD3  1 
ATOM   3025  N  N    . GLN A  1 217 ? 88.789  -72.144  -9.793  1.00 37.57  ? 197 GLN A N    1 
ATOM   3026  C  CA   . GLN A  1 217 ? 89.348  -71.304  -10.861 1.00 37.70  ? 197 GLN A CA   1 
ATOM   3027  C  C    . GLN A  1 217 ? 88.265  -70.852  -11.805 1.00 42.62  ? 197 GLN A C    1 
ATOM   3028  O  O    . GLN A  1 217 ? 87.490  -71.672  -12.293 1.00 41.78  ? 197 GLN A O    1 
ATOM   3029  C  CB   . GLN A  1 217 ? 90.427  -72.064  -11.666 1.00 38.95  ? 197 GLN A CB   1 
ATOM   3030  C  CG   . GLN A  1 217 ? 91.669  -72.400  -10.851 1.00 42.80  ? 197 GLN A CG   1 
ATOM   3031  C  CD   . GLN A  1 217 ? 92.532  -73.477  -11.453 1.00 42.53  ? 197 GLN A CD   1 
ATOM   3032  O  OE1  . GLN A  1 217 ? 92.198  -74.096  -12.463 1.00 44.36  ? 197 GLN A OE1  1 
ATOM   3033  N  NE2  . GLN A  1 217 ? 93.707  -73.702  -10.904 1.00 37.39  ? 197 GLN A NE2  1 
ATOM   3034  H  H    . GLN A  1 217 ? 89.067  -73.118  -9.871  1.00 38.06  ? 197 GLN A H    1 
ATOM   3035  H  HA   . GLN A  1 217 ? 89.826  -70.437  -10.412 1.00 38.09  ? 197 GLN A HA   1 
ATOM   3036  H  HB2  . GLN A  1 217 ? 89.985  -72.997  -12.016 1.00 39.36  ? 197 GLN A HB2  1 
ATOM   3037  H  HB3  . GLN A  1 217 ? 90.734  -71.459  -12.517 1.00 37.47  ? 197 GLN A HB3  1 
ATOM   3038  H  HG2  . GLN A  1 217 ? 92.279  -71.502  -10.777 1.00 44.25  ? 197 GLN A HG2  1 
ATOM   3039  H  HG3  . GLN A  1 217 ? 91.358  -72.730  -9.862  1.00 41.83  ? 197 GLN A HG3  1 
ATOM   3040  H  HE21 . GLN A  1 217 ? 94.011  -73.150  -10.110 1.00 39.05  ? 197 GLN A HE21 1 
ATOM   3041  H  HE22 . GLN A  1 217 ? 94.311  -74.435  -11.265 1.00 36.96  ? 197 GLN A HE22 1 
ATOM   3042  N  N    . GLY A  1 218 ? 88.230  -69.570  -12.083 1.00 39.85  ? 198 GLY A N    1 
ATOM   3043  C  CA   . GLY A  1 218 ? 87.236  -69.027  -12.988 1.00 39.28  ? 198 GLY A CA   1 
ATOM   3044  C  C    . GLY A  1 218 ? 87.628  -67.671  -13.523 1.00 43.35  ? 198 GLY A C    1 
ATOM   3045  O  O    . GLY A  1 218 ? 88.399  -67.567  -14.476 1.00 44.35  ? 198 GLY A O    1 
ATOM   3046  H  H    . GLY A  1 218 ? 88.866  -68.878  -11.700 1.00 39.98  ? 198 GLY A H    1 
ATOM   3047  H  HA2  . GLY A  1 218 ? 87.093  -69.692  -13.837 1.00 38.98  ? 198 GLY A HA2  1 
ATOM   3048  H  HA3  . GLY A  1 218 ? 86.285  -68.946  -12.465 1.00 39.30  ? 198 GLY A HA3  1 
ATOM   3049  N  N    . ASN A  1 219 ? 87.104  -66.629  -12.891 1.00 37.93  ? 199 ASN A N    1 
ATOM   3050  C  CA   . ASN A  1 219 ? 87.284  -65.254  -13.290 1.00 37.26  ? 199 ASN A CA   1 
ATOM   3051  C  C    . ASN A  1 219 ? 87.827  -64.427  -12.123 1.00 41.35  ? 199 ASN A C    1 
ATOM   3052  O  O    . ASN A  1 219 ? 87.297  -63.374  -11.816 1.00 40.47  ? 199 ASN A O    1 
ATOM   3053  C  CB   . ASN A  1 219 ? 85.945  -64.698  -13.765 1.00 28.32  ? 199 ASN A CB   1 
ATOM   3054  C  CG   . ASN A  1 219 ? 86.035  -63.315  -14.385 1.00 46.12  ? 199 ASN A CG   1 
ATOM   3055  O  OD1  . ASN A  1 219 ? 86.983  -62.973  -15.098 1.00 43.30  ? 199 ASN A OD1  1 
ATOM   3056  N  ND2  . ASN A  1 219 ? 85.054  -62.494  -14.133 1.00 34.21  ? 199 ASN A ND2  1 
ATOM   3057  H  H    . ASN A  1 219 ? 86.545  -66.714  -12.050 1.00 39.19  ? 199 ASN A H    1 
ATOM   3058  H  HA   . ASN A  1 219 ? 88.015  -65.177  -14.092 1.00 37.88  ? 199 ASN A HA   1 
ATOM   3059  H  HB2  . ASN A  1 219 ? 85.513  -65.375  -14.500 1.00 29.56  ? 199 ASN A HB2  1 
ATOM   3060  H  HB3  . ASN A  1 219 ? 85.286  -64.655  -12.903 1.00 26.28  ? 199 ASN A HB3  1 
ATOM   3061  H  HD21 . ASN A  1 219 ? 85.074  -61.547  -14.497 1.00 35.58  ? 199 ASN A HD21 1 
ATOM   3062  H  HD22 . ASN A  1 219 ? 84.310  -62.762  -13.498 1.00 35.54  ? 199 ASN A HD22 1 
ATOM   3063  N  N    . GLN A  1 220 ? 88.915  -64.886  -11.519 1.00 38.62  ? 200 GLN A N    1 
ATOM   3064  C  CA   . GLN A  1 220 ? 89.545  -64.144  -10.425 1.00 37.52  ? 200 GLN A CA   1 
ATOM   3065  C  C    . GLN A  1 220 ? 90.180  -62.887  -11.003 1.00 37.92  ? 200 GLN A C    1 
ATOM   3066  O  O    . GLN A  1 220 ? 90.522  -62.857  -12.186 1.00 36.69  ? 200 GLN A O    1 
ATOM   3067  C  CB   . GLN A  1 220 ? 90.570  -65.003  -9.659  1.00 38.97  ? 200 GLN A CB   1 
ATOM   3068  C  CG   . GLN A  1 220 ? 89.936  -65.959  -8.639  1.00 37.78  ? 200 GLN A CG   1 
ATOM   3069  C  CD   . GLN A  1 220 ? 89.292  -67.190  -9.235  1.00 41.77  ? 200 GLN A CD   1 
ATOM   3070  O  OE1  . GLN A  1 220 ? 89.622  -67.644  -10.330 1.00 31.67  ? 200 GLN A OE1  1 
ATOM   3071  N  NE2  . GLN A  1 220 ? 88.378  -67.782  -8.509  1.00 37.77  ? 200 GLN A NE2  1 
ATOM   3072  H  H    . GLN A  1 220 ? 89.378  -65.753  -11.770 1.00 38.67  ? 200 GLN A H    1 
ATOM   3073  H  HA   . GLN A  1 220 ? 88.764  -63.846  -9.728  1.00 37.28  ? 200 GLN A HA   1 
ATOM   3074  H  HB2  . GLN A  1 220 ? 91.169  -65.581  -10.363 1.00 38.85  ? 200 GLN A HB2  1 
ATOM   3075  H  HB3  . GLN A  1 220 ? 91.228  -64.340  -9.101  1.00 39.20  ? 200 GLN A HB3  1 
ATOM   3076  H  HG2  . GLN A  1 220 ? 90.709  -66.300  -7.953  1.00 38.38  ? 200 GLN A HG2  1 
ATOM   3077  H  HG3  . GLN A  1 220 ? 89.165  -65.421  -8.092  1.00 37.78  ? 200 GLN A HG3  1 
ATOM   3078  H  HE21 . GLN A  1 220 ? 88.145  -67.427  -7.587  1.00 38.82  ? 200 GLN A HE21 1 
ATOM   3079  H  HE22 . GLN A  1 220 ? 87.918  -68.617  -8.856  1.00 37.54  ? 200 GLN A HE22 1 
ATOM   3080  N  N    . VAL A  1 221 ? 90.286  -61.836  -10.208 1.00 36.18  ? 201 VAL A N    1 
ATOM   3081  C  CA   . VAL A  1 221 ? 90.825  -60.544  -10.680 1.00 38.63  ? 201 VAL A CA   1 
ATOM   3082  C  C    . VAL A  1 221 ? 92.250  -60.668  -11.261 1.00 42.57  ? 201 VAL A C    1 
ATOM   3083  O  O    . VAL A  1 221 ? 92.583  -59.923  -12.172 1.00 41.01  ? 201 VAL A O    1 
ATOM   3084  C  CB   . VAL A  1 221 ? 90.771  -59.441  -9.576  1.00 44.15  ? 201 VAL A CB   1 
ATOM   3085  C  CG1  . VAL A  1 221 ? 89.316  -59.137  -9.179  1.00 43.71  ? 201 VAL A CG1  1 
ATOM   3086  C  CG2  . VAL A  1 221 ? 91.620  -59.797  -8.354  1.00 44.52  ? 201 VAL A CG2  1 
ATOM   3087  H  H    . VAL A  1 221 ? 89.981  -61.850  -9.240  1.00 36.19  ? 201 VAL A H    1 
ATOM   3088  H  HA   . VAL A  1 221 ? 90.198  -60.199  -11.500 1.00 37.78  ? 201 VAL A HA   1 
ATOM   3089  H  HB   . VAL A  1 221 ? 91.191  -58.530  -10.000 1.00 44.27  ? 201 VAL A HB   1 
ATOM   3090  H  HG11 . VAL A  1 221 ? 89.296  -58.223  -8.586  1.00 43.97  ? 201 VAL A HG11 1 
ATOM   3091  H  HG12 . VAL A  1 221 ? 88.715  -59.008  -10.078 1.00 42.90  ? 201 VAL A HG12 1 
ATOM   3092  H  HG13 . VAL A  1 221 ? 88.913  -59.953  -8.582  1.00 43.54  ? 201 VAL A HG13 1 
ATOM   3093  H  HG21 . VAL A  1 221 ? 91.549  -58.978  -7.638  1.00 44.12  ? 201 VAL A HG21 1 
ATOM   3094  H  HG22 . VAL A  1 221 ? 91.241  -60.707  -7.890  1.00 44.90  ? 201 VAL A HG22 1 
ATOM   3095  H  HG23 . VAL A  1 221 ? 92.661  -59.938  -8.640  1.00 44.25  ? 201 VAL A HG23 1 
ATOM   3096  N  N    . PHE A  1 222 ? 93.061  -61.624  -10.757 1.00 40.55  ? 202 PHE A N    1 
ATOM   3097  C  CA   . PHE A  1 222 ? 94.445  -61.842  -11.220 1.00 40.74  ? 202 PHE A CA   1 
ATOM   3098  C  C    . PHE A  1 222 ? 94.517  -62.821  -12.414 1.00 43.61  ? 202 PHE A C    1 
ATOM   3099  O  O    . PHE A  1 222 ? 95.578  -62.981  -12.991 1.00 45.22  ? 202 PHE A O    1 
ATOM   3100  C  CB   . PHE A  1 222 ? 95.336  -62.351  -10.069 1.00 42.52  ? 202 PHE A CB   1 
ATOM   3101  C  CG   . PHE A  1 222 ? 94.787  -63.533  -9.299  1.00 43.81  ? 202 PHE A CG   1 
ATOM   3102  C  CD1  . PHE A  1 222 ? 94.834  -64.816  -9.829  1.00 44.88  ? 202 PHE A CD1  1 
ATOM   3103  C  CD2  . PHE A  1 222 ? 94.218  -63.361  -8.051  1.00 44.64  ? 202 PHE A CD2  1 
ATOM   3104  C  CE1  . PHE A  1 222 ? 94.243  -65.881  -9.160  1.00 45.77  ? 202 PHE A CE1  1 
ATOM   3105  C  CE2  . PHE A  1 222 ? 93.658  -64.432  -7.371  1.00 47.54  ? 202 PHE A CE2  1 
ATOM   3106  C  CZ   . PHE A  1 222 ? 93.682  -65.689  -7.919  1.00 45.72  ? 202 PHE A CZ   1 
ATOM   3107  H  H    . PHE A  1 222 ? 92.761  -62.262  -10.029 1.00 39.31  ? 202 PHE A H    1 
ATOM   3108  H  HA   . PHE A  1 222 ? 94.869  -60.897  -11.554 1.00 41.35  ? 202 PHE A HA   1 
ATOM   3109  H  HB2  . PHE A  1 222 ? 96.304  -62.650  -10.467 1.00 42.98  ? 202 PHE A HB2  1 
ATOM   3110  H  HB3  . PHE A  1 222 ? 95.460  -61.530  -9.367  1.00 41.70  ? 202 PHE A HB3  1 
ATOM   3111  H  HD1  . PHE A  1 222 ? 95.261  -64.988  -10.814 1.00 44.17  ? 202 PHE A HD1  1 
ATOM   3112  H  HD2  . PHE A  1 222 ? 94.185  -62.364  -7.612  1.00 44.93  ? 202 PHE A HD2  1 
ATOM   3113  H  HE1  . PHE A  1 222 ? 94.267  -66.876  -9.596  1.00 45.66  ? 202 PHE A HE1  1 
ATOM   3114  H  HE2  . PHE A  1 222 ? 93.226  -64.274  -6.384  1.00 48.39  ? 202 PHE A HE2  1 
ATOM   3115  H  HZ   . PHE A  1 222 ? 93.262  -66.531  -7.373  1.00 44.84  ? 202 PHE A HZ   1 
ATOM   3116  N  N    . ALA A  1 223 ? 93.422  -63.517  -12.738 1.00 37.53  ? 203 ALA A N    1 
ATOM   3117  C  CA   . ALA A  1 223 ? 93.361  -64.437  -13.862 1.00 36.06  ? 203 ALA A CA   1 
ATOM   3118  C  C    . ALA A  1 223 ? 91.982  -64.347  -14.502 1.00 41.65  ? 203 ALA A C    1 
ATOM   3119  O  O    . ALA A  1 223 ? 91.148  -65.243  -14.323 1.00 43.92  ? 203 ALA A O    1 
ATOM   3120  C  CB   . ALA A  1 223 ? 93.661  -65.859  -13.402 1.00 37.33  ? 203 ALA A CB   1 
ATOM   3121  H  H    . ALA A  1 223 ? 92.567  -63.510  -12.191 1.00 38.22  ? 203 ALA A H    1 
ATOM   3122  H  HA   . ALA A  1 223 ? 94.093  -64.174  -14.622 1.00 35.09  ? 203 ALA A HA   1 
ATOM   3123  H  HB1  . ALA A  1 223 ? 93.607  -66.532  -14.259 1.00 37.09  ? 203 ALA A HB1  1 
ATOM   3124  H  HB2  . ALA A  1 223 ? 94.664  -65.888  -12.979 1.00 38.15  ? 203 ALA A HB2  1 
ATOM   3125  H  HB3  . ALA A  1 223 ? 92.941  -66.163  -12.644 1.00 36.16  ? 203 ALA A HB3  1 
ATOM   3126  N  N    . PRO A  1 224 ? 91.695  -63.213  -15.184 1.00 36.64  ? 204 PRO A N    1 
ATOM   3127  C  CA   . PRO A  1 224 ? 90.385  -63.054  -15.819 1.00 34.69  ? 204 PRO A CA   1 
ATOM   3128  C  C    . PRO A  1 224 ? 90.052  -64.208  -16.748 1.00 36.69  ? 204 PRO A C    1 
ATOM   3129  O  O    . PRO A  1 224 ? 90.915  -64.708  -17.474 1.00 35.69  ? 204 PRO A O    1 
ATOM   3130  C  CB   . PRO A  1 224 ? 90.523  -61.734  -16.598 1.00 36.31  ? 204 PRO A CB   1 
ATOM   3131  C  CG   . PRO A  1 224 ? 91.625  -61.008  -15.926 1.00 40.64  ? 204 PRO A CG   1 
ATOM   3132  C  CD   . PRO A  1 224 ? 92.566  -62.050  -15.469 1.00 37.22  ? 204 PRO A CD   1 
ATOM   3133  H  HA   . PRO A  1 224 ? 89.621  -62.957  -15.049 1.00 34.00  ? 204 PRO A HA   1 
ATOM   3134  H  HB2  . PRO A  1 224 ? 90.783  -61.935  -17.636 1.00 35.50  ? 204 PRO A HB2  1 
ATOM   3135  H  HB3  . PRO A  1 224 ? 89.592  -61.172  -16.534 1.00 35.40  ? 204 PRO A HB3  1 
ATOM   3136  H  HG2  . PRO A  1 224 ? 92.102  -60.347  -16.648 1.00 40.46  ? 204 PRO A HG2  1 
ATOM   3137  H  HG3  . PRO A  1 224 ? 91.234  -60.447  -15.078 1.00 39.82  ? 204 PRO A HG3  1 
ATOM   3138  H  HD2  . PRO A  1 224 ? 93.276  -62.294  -16.259 1.00 37.20  ? 204 PRO A HD2  1 
ATOM   3139  H  HD3  . PRO A  1 224 ? 93.067  -61.704  -14.567 1.00 37.55  ? 204 PRO A HD3  1 
ATOM   3140  N  N    . PHE A  1 225 ? 88.788  -64.627  -16.705 1.00 32.60  ? 205 PHE A N    1 
ATOM   3141  C  CA   . PHE A  1 225 ? 88.267  -65.778  -17.446 1.00 31.02  ? 205 PHE A CA   1 
ATOM   3142  C  C    . PHE A  1 225 ? 88.604  -65.767  -18.889 1.00 33.14  ? 205 PHE A C    1 
ATOM   3143  O  O    . PHE A  1 225 ? 89.161  -66.729  -19.372 1.00 33.97  ? 205 PHE A O    1 
ATOM   3144  C  CB   . PHE A  1 225 ? 86.749  -65.826  -17.287 1.00 32.89  ? 205 PHE A CB   1 
ATOM   3145  C  CG   . PHE A  1 225 ? 86.054  -66.923  -18.047 1.00 34.02  ? 205 PHE A CG   1 
ATOM   3146  C  CD1  . PHE A  1 225 ? 86.025  -68.223  -17.558 1.00 37.59  ? 205 PHE A CD1  1 
ATOM   3147  C  CD2  . PHE A  1 225 ? 85.390  -66.650  -19.223 1.00 36.62  ? 205 PHE A CD2  1 
ATOM   3148  C  CE1  . PHE A  1 225 ? 85.337  -69.216  -18.229 1.00 37.38  ? 205 PHE A CE1  1 
ATOM   3149  C  CE2  . PHE A  1 225 ? 84.736  -67.648  -19.913 1.00 38.09  ? 205 PHE A CE2  1 
ATOM   3150  C  CZ   . PHE A  1 225 ? 84.700  -68.924  -19.403 1.00 36.54  ? 205 PHE A CZ   1 
ATOM   3151  H  H    . PHE A  1 225 ? 88.076  -64.162  -16.153 1.00 31.57  ? 205 PHE A H    1 
ATOM   3152  H  HA   . PHE A  1 225 ? 88.678  -66.688  -17.008 1.00 31.15  ? 205 PHE A HA   1 
ATOM   3153  H  HB2  . PHE A  1 225 ? 86.534  -66.006  -16.232 1.00 33.51  ? 205 PHE A HB2  1 
ATOM   3154  H  HB3  . PHE A  1 225 ? 86.334  -64.871  -17.601 1.00 31.00  ? 205 PHE A HB3  1 
ATOM   3155  H  HD1  . PHE A  1 225 ? 86.509  -68.456  -16.609 1.00 38.61  ? 205 PHE A HD1  1 
ATOM   3156  H  HD2  . PHE A  1 225 ? 85.406  -65.638  -19.627 1.00 37.53  ? 205 PHE A HD2  1 
ATOM   3157  H  HE1  . PHE A  1 225 ? 85.330  -70.236  -17.842 1.00 38.04  ? 205 PHE A HE1  1 
ATOM   3158  H  HE2  . PHE A  1 225 ? 84.230  -67.417  -20.847 1.00 37.08  ? 205 PHE A HE2  1 
ATOM   3159  H  HZ   . PHE A  1 225 ? 84.180  -69.708  -19.950 1.00 35.96  ? 205 PHE A HZ   1 
ATOM   3160  N  N    . LYS A  1 226 ? 88.259  -64.701  -19.610 1.00 31.19  ? 206 LYS A N    1 
ATOM   3161  C  CA   . LYS A  1 226 ? 88.470  -64.669  -21.058 1.00 30.21  ? 206 LYS A CA   1 
ATOM   3162  C  C    . LYS A  1 226 ? 89.953  -64.727  -21.456 1.00 34.05  ? 206 LYS A C    1 
ATOM   3163  O  O    . LYS A  1 226 ? 90.290  -65.453  -22.410 1.00 31.29  ? 206 LYS A O    1 
ATOM   3164  C  CB   . LYS A  1 226 ? 87.792  -63.467  -21.694 1.00 33.96  ? 206 LYS A CB   1 
ATOM   3165  C  CG   . LYS A  1 226 ? 86.268  -63.557  -21.580 1.00 35.22  ? 206 LYS A CG   1 
ATOM   3166  C  CD   . LYS A  1 226 ? 85.609  -62.512  -22.473 1.00 33.20  ? 206 LYS A CD   1 
ATOM   3167  C  CE   . LYS A  1 226 ? 84.114  -62.708  -22.507 1.00 54.74  ? 206 LYS A CE   1 
ATOM   3168  N  NZ   . LYS A  1 226 ? 83.484  -61.958  -23.615 1.00 66.85  ? 206 LYS A NZ   1 
ATOM   3169  H  H    . LYS A  1 226 ? 87.851  -63.860  -19.215 1.00 32.99  ? 206 LYS A H    1 
ATOM   3170  H  HA   . LYS A  1 226 ? 88.004  -65.562  -21.471 1.00 29.82  ? 206 LYS A HA   1 
ATOM   3171  H  HB2  . LYS A  1 226 ? 88.120  -62.554  -21.199 1.00 34.53  ? 206 LYS A HB2  1 
ATOM   3172  H  HB3  . LYS A  1 226 ? 88.053  -63.432  -22.750 1.00 33.86  ? 206 LYS A HB3  1 
ATOM   3173  H  HG2  . LYS A  1 226 ? 85.933  -64.543  -21.890 1.00 33.63  ? 206 LYS A HG2  1 
ATOM   3174  H  HG3  . LYS A  1 226 ? 85.968  -63.366  -20.551 1.00 34.23  ? 206 LYS A HG3  1 
ATOM   3175  H  HD2  . LYS A  1 226 ? 85.813  -61.523  -22.065 1.00 31.84  ? 206 LYS A HD2  1 
ATOM   3176  H  HD3  . LYS A  1 226 ? 85.992  -62.592  -23.486 1.00 31.65  ? 206 LYS A HD3  1 
ATOM   3177  H  HE2  . LYS A  1 226 ? 83.882  -63.765  -22.633 1.00 53.89  ? 206 LYS A HE2  1 
ATOM   3178  H  HE3  . LYS A  1 226 ? 83.686  -62.346  -21.572 1.00 55.58  ? 206 LYS A HE3  1 
ATOM   3179  H  HZ1  . LYS A  1 226 ? 82.493  -61.849  -23.425 1.00 66.92  ? 206 LYS A HZ1  1 
ATOM   3180  H  HZ2  . LYS A  1 226 ? 83.909  -61.041  -23.709 1.00 66.94  ? 206 LYS A HZ2  1 
ATOM   3181  H  HZ3  . LYS A  1 226 ? 83.590  -62.468  -24.485 1.00 66.92  ? 206 LYS A HZ3  1 
ATOM   3182  N  N    . ASP A  1 227 ? 90.835  -64.057  -20.701 1.00 31.02  ? 207 ASP A N    1 
ATOM   3183  C  CA   . ASP A  1 227 ? 92.276  -64.122  -20.959 1.00 31.20  ? 207 ASP A CA   1 
ATOM   3184  C  C    . ASP A  1 227 ? 92.813  -65.517  -20.722 1.00 36.08  ? 207 ASP A C    1 
ATOM   3185  O  O    . ASP A  1 227 ? 93.637  -65.985  -21.509 1.00 33.69  ? 207 ASP A O    1 
ATOM   3186  C  CB   . ASP A  1 227 ? 93.048  -63.141  -20.086 1.00 34.60  ? 207 ASP A CB   1 
ATOM   3187  C  CG   . ASP A  1 227 ? 92.785  -61.674  -20.368 1.00 44.50  ? 207 ASP A CG   1 
ATOM   3188  O  OD1  . ASP A  1 227 ? 92.403  -61.342  -21.526 1.00 48.18  ? 207 ASP A OD1  1 
ATOM   3189  O  OD2  . ASP A  1 227 ? 92.991  -60.851  -19.444 1.00 50.80  ? 207 ASP A OD2  1 
ATOM   3190  H  H    . ASP A  1 227 ? 90.577  -63.474  -19.911 1.00 32.40  ? 207 ASP A H    1 
ATOM   3191  H  HA   . ASP A  1 227 ? 92.463  -63.888  -22.006 1.00 32.91  ? 207 ASP A HA   1 
ATOM   3192  H  HB2  . ASP A  1 227 ? 92.797  -63.327  -19.042 1.00 34.68  ? 207 ASP A HB2  1 
ATOM   3193  H  HB3  . ASP A  1 227 ? 94.114  -63.309  -20.230 1.00 35.58  ? 207 ASP A HB3  1 
ATOM   3194  N  N    . THR A  1 228 ? 92.342  -66.195  -19.656 1.00 35.06  ? 208 THR A N    1 
ATOM   3195  C  CA   . THR A  1 228 ? 92.797  -67.549  -19.352 1.00 34.71  ? 208 THR A CA   1 
ATOM   3196  C  C    . THR A  1 228 ? 92.299  -68.522  -20.417 1.00 36.22  ? 208 THR A C    1 
ATOM   3197  O  O    . THR A  1 228 ? 93.078  -69.352  -20.883 1.00 35.21  ? 208 THR A O    1 
ATOM   3198  C  CB   . THR A  1 228 ? 92.366  -67.976  -17.941 1.00 39.17  ? 208 THR A CB   1 
ATOM   3199  O  OG1  . THR A  1 228 ? 92.855  -67.001  -17.028 1.00 36.47  ? 208 THR A OG1  1 
ATOM   3200  C  CG2  . THR A  1 228 ? 92.918  -69.337  -17.563 1.00 38.40  ? 208 THR A CG2  1 
ATOM   3201  H  H    . THR A  1 228 ? 91.650  -65.837  -19.006 1.00 34.46  ? 208 THR A H    1 
ATOM   3202  H  HA   . THR A  1 228 ? 93.885  -67.574  -19.375 1.00 35.33  ? 208 THR A HA   1 
ATOM   3203  H  HB   . THR A  1 228 ? 91.280  -68.017  -17.887 1.00 38.22  ? 208 THR A HB   1 
ATOM   3204  H  HG1  . THR A  1 228 ? 92.133  -66.368  -16.778 1.00 36.81  ? 208 THR A HG1  1 
ATOM   3205  H  HG21 . THR A  1 228 ? 92.848  -69.480  -16.486 1.00 38.53  ? 208 THR A HG21 1 
ATOM   3206  H  HG22 . THR A  1 228 ? 92.355  -70.128  -18.057 1.00 38.14  ? 208 THR A HG22 1 
ATOM   3207  H  HG23 . THR A  1 228 ? 93.963  -69.416  -17.861 1.00 38.85  ? 208 THR A HG23 1 
ATOM   3208  N  N    . VAL A  1 229 ? 91.010  -68.441  -20.781 1.00 31.43  ? 209 VAL A N    1 
ATOM   3209  C  CA   . VAL A  1 229 ? 90.426  -69.320  -21.789 1.00 29.99  ? 209 VAL A CA   1 
ATOM   3210  C  C    . VAL A  1 229 ? 91.204  -69.195  -23.117 1.00 33.03  ? 209 VAL A C    1 
ATOM   3211  O  O    . VAL A  1 229 ? 91.576  -70.209  -23.691 1.00 35.46  ? 209 VAL A O    1 
ATOM   3212  C  CB   . VAL A  1 229 ? 88.908  -69.043  -21.972 1.00 32.86  ? 209 VAL A CB   1 
ATOM   3213  C  CG1  . VAL A  1 229 ? 88.350  -69.760  -23.207 1.00 31.63  ? 209 VAL A CG1  1 
ATOM   3214  C  CG2  . VAL A  1 229 ? 88.127  -69.468  -20.753 1.00 33.77  ? 209 VAL A CG2  1 
ATOM   3215  H  H    . VAL A  1 229 ? 90.363  -67.761  -20.394 1.00 30.97  ? 209 VAL A H    1 
ATOM   3216  H  HA   . VAL A  1 229 ? 90.529  -70.347  -21.444 1.00 31.10  ? 209 VAL A HA   1 
ATOM   3217  H  HB   . VAL A  1 229 ? 88.766  -67.972  -22.092 1.00 32.45  ? 209 VAL A HB   1 
ATOM   3218  H  HG11 . VAL A  1 229 ? 87.263  -69.754  -23.155 1.00 30.18  ? 209 VAL A HG11 1 
ATOM   3219  H  HG12 . VAL A  1 229 ? 88.663  -69.238  -24.112 1.00 34.16  ? 209 VAL A HG12 1 
ATOM   3220  H  HG13 . VAL A  1 229 ? 88.720  -70.782  -23.215 1.00 29.09  ? 209 VAL A HG13 1 
ATOM   3221  H  HG21 . VAL A  1 229 ? 87.150  -68.989  -20.791 1.00 33.99  ? 209 VAL A HG21 1 
ATOM   3222  H  HG22 . VAL A  1 229 ? 87.999  -70.550  -20.781 1.00 34.49  ? 209 VAL A HG22 1 
ATOM   3223  H  HG23 . VAL A  1 229 ? 88.656  -69.198  -19.842 1.00 35.53  ? 209 VAL A HG23 1 
ATOM   3224  N  N    . ARG A  1 230 ? 91.495  -67.962  -23.569 1.00 31.77  ? 210 ARG A N    1 
ATOM   3225  C  CA   . ARG A  1 230 ? 92.270  -67.745  -24.785 1.00 32.12  ? 210 ARG A CA   1 
ATOM   3226  C  C    . ARG A  1 230 ? 93.701  -68.323  -24.696 1.00 36.41  ? 210 ARG A C    1 
ATOM   3227  O  O    . ARG A  1 230 ? 94.199  -68.889  -25.678 1.00 32.21  ? 210 ARG A O    1 
ATOM   3228  C  CB   . ARG A  1 230 ? 92.363  -66.253  -25.133 1.00 31.25  ? 210 ARG A CB   1 
ATOM   3229  C  CG   . ARG A  1 230 ? 91.060  -65.668  -25.640 1.00 43.64  ? 210 ARG A CG   1 
ATOM   3230  C  CD   . ARG A  1 230 ? 91.264  -64.233  -26.086 1.00 49.70  ? 210 ARG A CD   1 
ATOM   3231  N  NE   . ARG A  1 230 ? 90.008  -63.480  -26.079 1.00 64.22  ? 210 ARG A NE   1 
ATOM   3232  C  CZ   . ARG A  1 230 ? 89.652  -62.537  -25.205 1.00 68.45  ? 210 ARG A CZ   1 
ATOM   3233  N  NH1  . ARG A  1 230 ? 90.477  -62.175  -24.222 1.00 53.61  ? 210 ARG A NH1  1 
ATOM   3234  N  NH2  . ARG A  1 230 ? 88.479  -61.934  -25.318 1.00 56.76  ? 210 ARG A NH2  1 
ATOM   3235  H  H    . ARG A  1 230 ? 91.194  -67.109  -23.107 1.00 30.87  ? 210 ARG A H    1 
ATOM   3236  H  HA   . ARG A  1 230 ? 91.766  -68.247  -25.609 1.00 33.62  ? 210 ARG A HA   1 
ATOM   3237  H  HB2  . ARG A  1 230 ? 92.657  -65.696  -24.244 1.00 33.25  ? 210 ARG A HB2  1 
ATOM   3238  H  HB3  . ARG A  1 230 ? 93.113  -66.109  -25.910 1.00 29.78  ? 210 ARG A HB3  1 
ATOM   3239  H  HG2  . ARG A  1 230 ? 90.734  -66.246  -26.503 1.00 43.22  ? 210 ARG A HG2  1 
ATOM   3240  H  HG3  . ARG A  1 230 ? 90.299  -65.697  -24.863 1.00 42.61  ? 210 ARG A HG3  1 
ATOM   3241  H  HD2  . ARG A  1 230 ? 92.026  -63.752  -25.477 1.00 49.06  ? 210 ARG A HD2  1 
ATOM   3242  H  HD3  . ARG A  1 230 ? 91.607  -64.258  -27.119 1.00 48.97  ? 210 ARG A HD3  1 
ATOM   3243  H  HE   . ARG A  1 230 ? 89.345  -63.707  -26.815 1.00 63.83  ? 210 ARG A HE   1 
ATOM   3244  H  HH11 . ARG A  1 230 ? 91.387  -62.596  -24.073 1.00 53.87  ? 210 ARG A HH11 1 
ATOM   3245  H  HH12 . ARG A  1 230 ? 90.182  -61.457  -23.567 1.00 52.98  ? 210 ARG A HH12 1 
ATOM   3246  H  HH21 . ARG A  1 230 ? 87.847  -62.190  -26.071 1.00 56.72  ? 210 ARG A HH21 1 
ATOM   3247  H  HH22 . ARG A  1 230 ? 88.208  -61.208  -24.662 1.00 56.83  ? 210 ARG A HH22 1 
ATOM   3248  N  N    . ALA A  1 231 ? 94.368  -68.150  -23.544 1.00 34.37  ? 211 ALA A N    1 
ATOM   3249  C  CA   . ALA A  1 231 ? 95.739  -68.654  -23.362 1.00 34.14  ? 211 ALA A CA   1 
ATOM   3250  C  C    . ALA A  1 231 ? 95.772  -70.182  -23.355 1.00 34.61  ? 211 ALA A C    1 
ATOM   3251  O  O    . ALA A  1 231 ? 96.685  -70.777  -23.927 1.00 35.31  ? 211 ALA A O    1 
ATOM   3252  C  CB   . ALA A  1 231 ? 96.338  -68.114  -22.092 1.00 34.47  ? 211 ALA A CB   1 
ATOM   3253  H  H    . ALA A  1 231 ? 93.988  -67.664  -22.739 1.00 34.40  ? 211 ALA A H    1 
ATOM   3254  H  HA   . ALA A  1 231 ? 96.361  -68.305  -24.187 1.00 35.87  ? 211 ALA A HA   1 
ATOM   3255  H  HB1  . ALA A  1 231 ? 97.390  -68.391  -22.053 1.00 35.07  ? 211 ALA A HB1  1 
ATOM   3256  H  HB2  . ALA A  1 231 ? 96.233  -67.031  -22.086 1.00 34.09  ? 211 ALA A HB2  1 
ATOM   3257  H  HB3  . ALA A  1 231 ? 95.807  -68.548  -21.245 1.00 35.13  ? 211 ALA A HB3  1 
ATOM   3258  N  N    . VAL A  1 232 ? 94.757  -70.805  -22.770 1.00 34.33  ? 212 VAL A N    1 
ATOM   3259  C  CA   . VAL A  1 232 ? 94.634  -72.282  -22.729 1.00 34.04  ? 212 VAL A CA   1 
ATOM   3260  C  C    . VAL A  1 232 ? 94.352  -72.794  -24.157 1.00 37.12  ? 212 VAL A C    1 
ATOM   3261  O  O    . VAL A  1 232 ? 94.909  -73.807  -24.533 1.00 35.88  ? 212 VAL A O    1 
ATOM   3262  C  CB   . VAL A  1 232 ? 93.561  -72.754  -21.711 1.00 34.87  ? 212 VAL A CB   1 
ATOM   3263  C  CG1  . VAL A  1 232 ? 93.304  -74.255  -21.824 1.00 32.23  ? 212 VAL A CG1  1 
ATOM   3264  C  CG2  . VAL A  1 232 ? 93.986  -72.413  -20.284 1.00 34.36  ? 212 VAL A CG2  1 
ATOM   3265  H  H    . VAL A  1 232 ? 94.007  -70.332  -22.277 1.00 35.18  ? 212 VAL A H    1 
ATOM   3266  H  HA   . VAL A  1 232 ? 95.583  -72.712  -22.409 1.00 35.25  ? 212 VAL A HA   1 
ATOM   3267  H  HB   . VAL A  1 232 ? 92.629  -72.228  -21.915 1.00 34.09  ? 212 VAL A HB   1 
ATOM   3268  H  HG11 . VAL A  1 232 ? 92.520  -74.517  -21.114 1.00 32.66  ? 212 VAL A HG11 1 
ATOM   3269  H  HG12 . VAL A  1 232 ? 92.974  -74.540  -22.820 1.00 32.97  ? 212 VAL A HG12 1 
ATOM   3270  H  HG13 . VAL A  1 232 ? 94.219  -74.791  -21.582 1.00 31.38  ? 212 VAL A HG13 1 
ATOM   3271  H  HG21 . VAL A  1 232 ? 93.105  -72.444  -19.646 1.00 34.05  ? 212 VAL A HG21 1 
ATOM   3272  H  HG22 . VAL A  1 232 ? 94.703  -73.165  -19.956 1.00 34.88  ? 212 VAL A HG22 1 
ATOM   3273  H  HG23 . VAL A  1 232 ? 94.449  -71.431  -20.246 1.00 33.53  ? 212 VAL A HG23 1 
ATOM   3274  N  N    . ALA A  1 233 ? 93.479  -72.111  -24.932 1.00 34.77  ? 213 ALA A N    1 
ATOM   3275  C  CA   . ALA A  1 233 ? 93.192  -72.540  -26.301 1.00 35.09  ? 213 ALA A CA   1 
ATOM   3276  C  C    . ALA A  1 233 ? 94.467  -72.513  -27.134 1.00 36.37  ? 213 ALA A C    1 
ATOM   3277  O  O    . ALA A  1 233 ? 94.702  -73.425  -27.915 1.00 34.86  ? 213 ALA A O    1 
ATOM   3278  C  CB   . ALA A  1 233 ? 92.120  -71.663  -26.932 1.00 36.47  ? 213 ALA A CB   1 
ATOM   3279  H  H    . ALA A  1 233 ? 92.955  -71.297  -24.626 1.00 34.17  ? 213 ALA A H    1 
ATOM   3280  H  HA   . ALA A  1 233 ? 92.841  -73.570  -26.302 1.00 35.85  ? 213 ALA A HA   1 
ATOM   3281  H  HB1  . ALA A  1 233 ? 91.866  -72.066  -27.913 1.00 35.97  ? 213 ALA A HB1  1 
ATOM   3282  H  HB2  . ALA A  1 233 ? 91.235  -71.652  -26.297 1.00 36.23  ? 213 ALA A HB2  1 
ATOM   3283  H  HB3  . ALA A  1 233 ? 92.511  -70.653  -27.043 1.00 37.89  ? 213 ALA A HB3  1 
ATOM   3284  N  N    . ASP A  1 234 ? 95.307  -71.483  -26.940 1.00 35.37  ? 214 ASP A N    1 
ATOM   3285  C  CA   . ASP A  1 234 ? 96.589  -71.383  -27.634 1.00 35.16  ? 214 ASP A CA   1 
ATOM   3286  C  C    . ASP A  1 234 ? 97.504  -72.541  -27.206 1.00 36.89  ? 214 ASP A C    1 
ATOM   3287  O  O    . ASP A  1 234 ? 98.131  -73.144  -28.058 1.00 36.80  ? 214 ASP A O    1 
ATOM   3288  C  CB   . ASP A  1 234 ? 97.246  -70.028  -27.360 1.00 37.05  ? 214 ASP A CB   1 
ATOM   3289  C  CG   . ASP A  1 234 ? 98.644  -69.923  -27.944 1.00 52.69  ? 214 ASP A CG   1 
ATOM   3290  O  OD1  . ASP A  1 234 ? 98.761  -69.910  -29.192 1.00 60.60  ? 214 ASP A OD1  1 
ATOM   3291  O  OD2  . ASP A  1 234 ? 99.632  -69.938  -27.148 1.00 44.74  ? 214 ASP A OD2  1 
ATOM   3292  H  H    . ASP A  1 234 ? 95.110  -70.695  -26.331 1.00 35.85  ? 214 ASP A H    1 
ATOM   3293  H  HA   . ASP A  1 234 ? 96.423  -71.470  -28.706 1.00 35.07  ? 214 ASP A HA   1 
ATOM   3294  H  HB2  . ASP A  1 234 ? 96.625  -69.246  -27.797 1.00 36.43  ? 214 ASP A HB2  1 
ATOM   3295  H  HB3  . ASP A  1 234 ? 97.328  -69.881  -26.285 1.00 36.21  ? 214 ASP A HB3  1 
ATOM   3296  N  N    . ALA A  1 235 ? 97.562  -72.852  -25.897 1.00 34.21  ? 215 ALA A N    1 
ATOM   3297  C  CA   . ALA A  1 235 ? 98.363  -73.971  -25.395 1.00 34.41  ? 215 ALA A CA   1 
ATOM   3298  C  C    . ALA A  1 235 ? 97.879  -75.312  -25.970 1.00 36.89  ? 215 ALA A C    1 
ATOM   3299  O  O    . ALA A  1 235 ? 98.710  -76.154  -26.288 1.00 35.79  ? 215 ALA A O    1 
ATOM   3300  C  CB   . ALA A  1 235 ? 98.328  -74.014  -23.893 1.00 35.04  ? 215 ALA A CB   1 
ATOM   3301  H  H    . ALA A  1 235 ? 97.089  -72.324  -25.171 1.00 33.67  ? 215 ALA A H    1 
ATOM   3302  H  HA   . ALA A  1 235 ? 99.400  -73.836  -25.699 1.00 35.24  ? 215 ALA A HA   1 
ATOM   3303  H  HB1  . ALA A  1 235 ? 98.824  -74.924  -23.555 1.00 36.57  ? 215 ALA A HB1  1 
ATOM   3304  H  HB2  . ALA A  1 235 ? 98.861  -73.145  -23.511 1.00 35.77  ? 215 ALA A HB2  1 
ATOM   3305  H  HB3  . ALA A  1 235 ? 97.297  -74.009  -23.543 1.00 34.91  ? 215 ALA A HB3  1 
ATOM   3306  N  N    . MET A  1 236 ? 96.533  -75.521  -26.090 1.00 31.83  ? 216 MET A N    1 
ATOM   3307  C  CA   . MET A  1 236 ? 95.982  -76.761  -26.668 1.00 29.09  ? 216 MET A CA   1 
ATOM   3308  C  C    . MET A  1 236 ? 96.447  -76.906  -28.112 1.00 35.44  ? 216 MET A C    1 
ATOM   3309  O  O    . MET A  1 236 ? 96.917  -77.976  -28.478 1.00 37.13  ? 216 MET A O    1 
ATOM   3310  C  CB   . MET A  1 236 ? 94.448  -76.796  -26.586 1.00 30.06  ? 216 MET A CB   1 
ATOM   3311  C  CG   . MET A  1 236 ? 93.837  -78.014  -27.244 1.00 34.31  ? 216 MET A CG   1 
ATOM   3312  S  SD   . MET A  1 236 ? 92.030  -78.171  -27.140 1.00 39.33  ? 216 MET A SD   1 
ATOM   3313  C  CE   . MET A  1 236 ? 91.835  -78.599  -25.409 1.00 35.31  ? 216 MET A CE   1 
ATOM   3314  H  H    . MET A  1 236 ? 95.826  -74.863  -25.776 1.00 31.37  ? 216 MET A H    1 
ATOM   3315  H  HA   . MET A  1 236 ? 96.365  -77.603  -26.093 1.00 30.34  ? 216 MET A HA   1 
ATOM   3316  H  HB2  . MET A  1 236 ? 94.156  -76.801  -25.537 1.00 30.08  ? 216 MET A HB2  1 
ATOM   3317  H  HB3  . MET A  1 236 ? 94.041  -75.911  -27.073 1.00 29.85  ? 216 MET A HB3  1 
ATOM   3318  H  HG2  . MET A  1 236 ? 94.068  -78.016  -28.308 1.00 35.55  ? 216 MET A HG2  1 
ATOM   3319  H  HG3  . MET A  1 236 ? 94.271  -78.898  -26.779 1.00 35.90  ? 216 MET A HG3  1 
ATOM   3320  H  HE1  . MET A  1 236 ? 90.808  -78.910  -25.227 1.00 33.27  ? 216 MET A HE1  1 
ATOM   3321  H  HE2  . MET A  1 236 ? 92.516  -79.416  -25.169 1.00 36.53  ? 216 MET A HE2  1 
ATOM   3322  H  HE3  . MET A  1 236 ? 92.078  -77.733  -24.796 1.00 35.86  ? 216 MET A HE3  1 
ATOM   3323  N  N    . ARG A  1 237 ? 96.331  -75.836  -28.928 1.00 31.51  ? 217 ARG A N    1 
ATOM   3324  C  CA   . ARG A  1 237 ? 96.775  -75.861  -30.302 1.00 32.04  ? 217 ARG A CA   1 
ATOM   3325  C  C    . ARG A  1 237 ? 98.264  -76.183  -30.413 1.00 34.79  ? 217 ARG A C    1 
ATOM   3326  O  O    . ARG A  1 237 ? 98.642  -77.035  -31.209 1.00 33.58  ? 217 ARG A O    1 
ATOM   3327  C  CB   . ARG A  1 237 ? 96.484  -74.513  -31.015 1.00 38.19  ? 217 ARG A CB   1 
ATOM   3328  C  CG   . ARG A  1 237 ? 95.013  -74.293  -31.315 1.00 48.94  ? 217 ARG A CG   1 
ATOM   3329  C  CD   . ARG A  1 237 ? 94.768  -73.105  -32.233 1.00 51.17  ? 217 ARG A CD   1 
ATOM   3330  N  NE   . ARG A  1 237 ? 94.947  -71.824  -31.531 1.00 63.06  ? 217 ARG A NE   1 
ATOM   3331  C  CZ   . ARG A  1 237 ? 94.028  -71.183  -30.796 1.00 68.66  ? 217 ARG A CZ   1 
ATOM   3332  N  NH1  . ARG A  1 237 ? 92.811  -71.700  -30.628 1.00 49.23  ? 217 ARG A NH1  1 
ATOM   3333  N  NH2  . ARG A  1 237 ? 94.321  -70.023  -30.227 1.00 49.39  ? 217 ARG A NH2  1 
ATOM   3334  H  H    . ARG A  1 237 ? 95.925  -74.954  -28.630 1.00 31.17  ? 217 ARG A H    1 
ATOM   3335  H  HA   . ARG A  1 237 ? 96.231  -76.642  -30.830 1.00 32.82  ? 217 ARG A HA   1 
ATOM   3336  H  HB2  . ARG A  1 237 ? 96.830  -73.694  -30.386 1.00 39.30  ? 217 ARG A HB2  1 
ATOM   3337  H  HB3  . ARG A  1 237 ? 97.020  -74.495  -31.964 1.00 37.54  ? 217 ARG A HB3  1 
ATOM   3338  H  HG2  . ARG A  1 237 ? 94.628  -75.195  -31.787 1.00 49.29  ? 217 ARG A HG2  1 
ATOM   3339  H  HG3  . ARG A  1 237 ? 94.485  -74.115  -30.381 1.00 49.28  ? 217 ARG A HG3  1 
ATOM   3340  H  HD2  . ARG A  1 237 ? 95.504  -73.121  -33.036 1.00 50.73  ? 217 ARG A HD2  1 
ATOM   3341  H  HD3  . ARG A  1 237 ? 93.772  -73.148  -32.669 1.00 50.60  ? 217 ARG A HD3  1 
ATOM   3342  H  HE   . ARG A  1 237 ? 95.855  -71.381  -31.628 1.00 63.50  ? 217 ARG A HE   1 
ATOM   3343  H  HH11 . ARG A  1 237 ? 92.522  -72.569  -31.063 1.00 49.72  ? 217 ARG A HH11 1 
ATOM   3344  H  HH12 . ARG A  1 237 ? 92.119  -71.186  -30.093 1.00 48.68  ? 217 ARG A HH12 1 
ATOM   3345  H  HH21 . ARG A  1 237 ? 95.247  -69.621  -30.340 1.00 49.68  ? 217 ARG A HH21 1 
ATOM   3346  H  HH22 . ARG A  1 237 ? 93.626  -69.531  -29.677 1.00 49.94  ? 217 ARG A HH22 1 
ATOM   3347  N  N    . ARG A  1 238 ? 99.103  -75.521  -29.612 1.00 32.99  ? 218 ARG A N    1 
ATOM   3348  C  CA   . ARG A  1 238 ? 100.558 -75.757  -29.653 1.00 33.66  ? 218 ARG A CA   1 
ATOM   3349  C  C    . ARG A  1 238 ? 100.919 -77.198  -29.228 1.00 38.96  ? 218 ARG A C    1 
ATOM   3350  O  O    . ARG A  1 238 ? 101.783 -77.788  -29.856 1.00 40.55  ? 218 ARG A O    1 
ATOM   3351  C  CB   . ARG A  1 238 ? 101.318 -74.763  -28.760 1.00 31.81  ? 218 ARG A CB   1 
ATOM   3352  C  CG   . ARG A  1 238 ? 101.284 -73.339  -29.293 1.00 39.27  ? 218 ARG A CG   1 
ATOM   3353  C  CD   . ARG A  1 238 ? 102.150 -72.395  -28.459 1.00 44.78  ? 218 ARG A CD   1 
ATOM   3354  N  NE   . ARG A  1 238 ? 101.654 -72.220  -27.094 1.00 40.75  ? 218 ARG A NE   1 
ATOM   3355  C  CZ   . ARG A  1 238 ? 102.236 -72.642  -25.968 1.00 50.93  ? 218 ARG A CZ   1 
ATOM   3356  N  NH1  . ARG A  1 238 ? 103.390 -73.310  -26.009 1.00 34.09  ? 218 ARG A NH1  1 
ATOM   3357  N  NH2  . ARG A  1 238 ? 101.672 -72.393  -24.789 1.00 44.09  ? 218 ARG A NH2  1 
ATOM   3358  H  H    . ARG A  1 238 ? 98.812  -74.841  -28.918 1.00 32.34  ? 218 ARG A H    1 
ATOM   3359  H  HA   . ARG A  1 238 ? 100.897 -75.610  -30.676 1.00 32.68  ? 218 ARG A HA   1 
ATOM   3360  H  HB2  . ARG A  1 238 ? 100.888 -74.768  -27.760 1.00 30.13  ? 218 ARG A HB2  1 
ATOM   3361  H  HB3  . ARG A  1 238 ? 102.361 -75.075  -28.712 1.00 32.01  ? 218 ARG A HB3  1 
ATOM   3362  H  HG2  . ARG A  1 238 ? 101.657 -73.329  -30.315 1.00 38.65  ? 218 ARG A HG2  1 
ATOM   3363  H  HG3  . ARG A  1 238 ? 100.265 -72.958  -29.278 1.00 39.60  ? 218 ARG A HG3  1 
ATOM   3364  H  HD2  . ARG A  1 238 ? 103.174 -72.759  -28.481 1.00 46.23  ? 218 ARG A HD2  1 
ATOM   3365  H  HD3  . ARG A  1 238 ? 102.113 -71.413  -28.927 1.00 44.16  ? 218 ARG A HD3  1 
ATOM   3366  H  HE   . ARG A  1 238 ? 100.767 -71.733  -27.003 1.00 40.68  ? 218 ARG A HE   1 
ATOM   3367  H  HH11 . ARG A  1 238 ? 103.889 -73.508  -26.869 1.00 34.11  ? 218 ARG A HH11 1 
ATOM   3368  H  HH12 . ARG A  1 238 ? 103.826 -73.597  -25.138 1.00 32.13  ? 218 ARG A HH12 1 
ATOM   3369  H  HH21 . ARG A  1 238 ? 100.783 -71.905  -24.743 1.00 43.88  ? 218 ARG A HH21 1 
ATOM   3370  H  HH22 . ARG A  1 238 ? 102.111 -72.712  -23.932 1.00 43.21  ? 218 ARG A HH22 1 
ATOM   3371  N  N    . ALA A  1 239 ? 100.260 -77.752  -28.187 1.00 34.87  ? 219 ALA A N    1 
ATOM   3372  C  CA   . ALA A  1 239 ? 100.549 -79.116  -27.709 1.00 36.17  ? 219 ALA A CA   1 
ATOM   3373  C  C    . ALA A  1 239 ? 100.095 -80.159  -28.730 1.00 37.21  ? 219 ALA A C    1 
ATOM   3374  O  O    . ALA A  1 239 ? 100.792 -81.140  -28.930 1.00 35.80  ? 219 ALA A O    1 
ATOM   3375  C  CB   . ALA A  1 239 ? 99.872  -79.373  -26.356 1.00 36.33  ? 219 ALA A CB   1 
ATOM   3376  H  H    . ALA A  1 239 ? 99.538  -77.274  -27.655 1.00 33.37  ? 219 ALA A H    1 
ATOM   3377  H  HA   . ALA A  1 239 ? 101.623 -79.233  -27.570 1.00 37.09  ? 219 ALA A HA   1 
ATOM   3378  H  HB1  . ALA A  1 239 ? 100.146 -80.369  -26.016 1.00 35.79  ? 219 ALA A HB1  1 
ATOM   3379  H  HB2  . ALA A  1 239 ? 100.215 -78.627  -25.643 1.00 36.26  ? 219 ALA A HB2  1 
ATOM   3380  H  HB3  . ALA A  1 239 ? 98.792  -79.303  -26.478 1.00 35.67  ? 219 ALA A HB3  1 
ATOM   3381  N  N    . GLN A  1 240 ? 98.934  -79.935  -29.376 1.00 31.02  ? 220 GLN A N    1 
ATOM   3382  C  CA   . GLN A  1 240 ? 98.424  -80.823  -30.391 1.00 31.06  ? 220 GLN A CA   1 
ATOM   3383  C  C    . GLN A  1 240 ? 99.351  -80.798  -31.637 1.00 40.69  ? 220 GLN A C    1 
ATOM   3384  O  O    . GLN A  1 240 ? 99.655  -81.854  -32.178 1.00 40.28  ? 220 GLN A O    1 
ATOM   3385  C  CB   . GLN A  1 240 ? 96.986  -80.467  -30.762 1.00 32.21  ? 220 GLN A CB   1 
ATOM   3386  C  CG   . GLN A  1 240 ? 96.020  -80.779  -29.645 1.00 35.26  ? 220 GLN A CG   1 
ATOM   3387  C  CD   . GLN A  1 240 ? 94.559  -80.564  -29.897 1.00 44.33  ? 220 GLN A CD   1 
ATOM   3388  O  OE1  . GLN A  1 240 ? 93.735  -81.107  -29.166 1.00 34.32  ? 220 GLN A OE1  1 
ATOM   3389  N  NE2  . GLN A  1 240 ? 94.166  -79.720  -30.820 1.00 40.73  ? 220 GLN A NE2  1 
ATOM   3390  H  H    . GLN A  1 240 ? 98.337  -79.138  -29.172 1.00 31.58  ? 220 GLN A H    1 
ATOM   3391  H  HA   . GLN A  1 240 ? 98.432  -81.838  -30.001 1.00 32.24  ? 220 GLN A HA   1 
ATOM   3392  H  HB2  . GLN A  1 240 ? 96.942  -79.400  -30.977 1.00 34.40  ? 220 GLN A HB2  1 
ATOM   3393  H  HB3  . GLN A  1 240 ? 96.688  -81.027  -31.647 1.00 31.53  ? 220 GLN A HB3  1 
ATOM   3394  H  HG2  . GLN A  1 240 ? 96.119  -81.838  -29.424 1.00 34.99  ? 220 GLN A HG2  1 
ATOM   3395  H  HG3  . GLN A  1 240 ? 96.286  -80.219  -28.751 1.00 36.13  ? 220 GLN A HG3  1 
ATOM   3396  H  HE21 . GLN A  1 240 ? 94.815  -79.181  -31.382 1.00 41.75  ? 220 GLN A HE21 1 
ATOM   3397  H  HE22 . GLN A  1 240 ? 93.171  -79.610  -30.981 1.00 40.97  ? 220 GLN A HE22 1 
ATOM   3398  N  N    . ASP A  1 241 ? 99.845  -79.606  -32.039 1.00 40.97  ? 221 ASP A N    1 
ATOM   3399  C  CA   . ASP A  1 241 ? 100.799 -79.487  -33.146 1.00 42.79  ? 221 ASP A CA   1 
ATOM   3400  C  C    . ASP A  1 241 ? 102.118 -80.213  -32.833 1.00 46.35  ? 221 ASP A C    1 
ATOM   3401  O  O    . ASP A  1 241 ? 102.684 -80.876  -33.697 1.00 46.24  ? 221 ASP A O    1 
ATOM   3402  C  CB   . ASP A  1 241 ? 101.121 -78.000  -33.450 1.00 45.81  ? 221 ASP A CB   1 
ATOM   3403  C  CG   . ASP A  1 241 ? 100.036 -77.231  -34.177 1.00 70.01  ? 221 ASP A CG   1 
ATOM   3404  O  OD1  . ASP A  1 241 ? 99.372  -77.827  -35.061 1.00 75.38  ? 221 ASP A OD1  1 
ATOM   3405  O  OD2  . ASP A  1 241 ? 99.903  -76.008  -33.925 1.00 76.03  ? 221 ASP A OD2  1 
ATOM   3406  H  H    . ASP A  1 241 ? 99.585  -78.721  -31.613 1.00 40.30  ? 221 ASP A H    1 
ATOM   3407  H  HA   . ASP A  1 241 ? 100.368 -79.947  -34.034 1.00 42.84  ? 221 ASP A HA   1 
ATOM   3408  H  HB2  . ASP A  1 241 ? 101.320 -77.482  -32.512 1.00 46.07  ? 221 ASP A HB2  1 
ATOM   3409  H  HB3  . ASP A  1 241 ? 102.014 -77.966  -34.072 1.00 45.65  ? 221 ASP A HB3  1 
ATOM   3410  N  N    . LYS A  1 242 ? 102.617 -80.057  -31.606 1.00 42.64  ? 222 LYS A N    1 
ATOM   3411  C  CA   . LYS A  1 242 ? 103.887 -80.644  -31.185 1.00 43.21  ? 222 LYS A CA   1 
ATOM   3412  C  C    . LYS A  1 242 ? 103.821 -82.181  -31.097 1.00 46.44  ? 222 LYS A C    1 
ATOM   3413  O  O    . LYS A  1 242 ? 104.734 -82.861  -31.585 1.00 44.56  ? 222 LYS A O    1 
ATOM   3414  C  CB   . LYS A  1 242 ? 104.296 -80.053  -29.818 1.00 45.04  ? 222 LYS A CB   1 
ATOM   3415  C  CG   . LYS A  1 242 ? 105.631 -80.545  -29.256 1.00 47.05  ? 222 LYS A CG   1 
ATOM   3416  C  CD   . LYS A  1 242 ? 106.801 -80.109  -30.101 1.00 49.02  ? 222 LYS A CD   1 
ATOM   3417  C  CE   . LYS A  1 242 ? 108.120 -80.390  -29.428 1.00 65.63  ? 222 LYS A CE   1 
ATOM   3418  N  NZ   . LYS A  1 242 ? 109.268 -79.999  -30.293 1.00 60.39  ? 222 LYS A NZ   1 
ATOM   3419  H  H    . LYS A  1 242 ? 102.163 -79.513  -30.881 1.00 42.18  ? 222 LYS A H    1 
ATOM   3420  H  HA   . LYS A  1 242 ? 104.648 -80.378  -31.917 1.00 43.47  ? 222 LYS A HA   1 
ATOM   3421  H  HB2  . LYS A  1 242 ? 104.357 -78.970  -29.916 1.00 43.70  ? 222 LYS A HB2  1 
ATOM   3422  H  HB3  . LYS A  1 242 ? 103.523 -80.307  -29.094 1.00 45.50  ? 222 LYS A HB3  1 
ATOM   3423  H  HG2  . LYS A  1 242 ? 105.764 -80.116  -28.263 1.00 47.62  ? 222 LYS A HG2  1 
ATOM   3424  H  HG3  . LYS A  1 242 ? 105.644 -81.631  -29.185 1.00 46.35  ? 222 LYS A HG3  1 
ATOM   3425  H  HD2  . LYS A  1 242 ? 106.787 -80.655  -31.043 1.00 49.56  ? 222 LYS A HD2  1 
ATOM   3426  H  HD3  . LYS A  1 242 ? 106.736 -79.038  -30.286 1.00 48.95  ? 222 LYS A HD3  1 
ATOM   3427  H  HE2  . LYS A  1 242 ? 108.174 -79.828  -28.497 1.00 65.74  ? 222 LYS A HE2  1 
ATOM   3428  H  HE3  . LYS A  1 242 ? 108.203 -81.457  -29.225 1.00 65.98  ? 222 LYS A HE3  1 
ATOM   3429  H  HZ1  . LYS A  1 242 ? 110.134 -80.074  -29.769 1.00 60.79  ? 222 LYS A HZ1  1 
ATOM   3430  H  HZ2  . LYS A  1 242 ? 109.321 -80.605  -31.104 1.00 59.91  ? 222 LYS A HZ2  1 
ATOM   3431  H  HZ3  . LYS A  1 242 ? 109.150 -79.039  -30.602 1.00 60.31  ? 222 LYS A HZ3  1 
ATOM   3432  N  N    . THR A  1 243 ? 102.741 -82.720  -30.509 1.00 42.18  ? 223 THR A N    1 
ATOM   3433  C  CA   . THR A  1 243 ? 102.602 -84.164  -30.271 1.00 41.09  ? 223 THR A CA   1 
ATOM   3434  C  C    . THR A  1 243 ? 101.849 -84.939  -31.356 1.00 43.14  ? 223 THR A C    1 
ATOM   3435  O  O    . THR A  1 243 ? 101.991 -86.155  -31.418 1.00 42.18  ? 223 THR A O    1 
ATOM   3436  C  CB   . THR A  1 243 ? 101.876 -84.410  -28.928 1.00 39.32  ? 223 THR A CB   1 
ATOM   3437  O  OG1  . THR A  1 243 ? 100.500 -83.985  -29.009 1.00 36.56  ? 223 THR A OG1  1 
ATOM   3438  C  CG2  . THR A  1 243 ? 102.593 -83.764  -27.742 1.00 35.89  ? 223 THR A CG2  1 
ATOM   3439  H  H    . THR A  1 243 ? 101.947 -82.180  -30.178 1.00 42.69  ? 223 THR A H    1 
ATOM   3440  H  HA   . THR A  1 243 ? 103.588 -84.617  -30.177 1.00 41.65  ? 223 THR A HA   1 
ATOM   3441  H  HB   . THR A  1 243 ? 101.872 -85.483  -28.745 1.00 40.03  ? 223 THR A HB   1 
ATOM   3442  H  HG1  . THR A  1 243 ? 100.384 -83.065  -28.655 1.00 36.24  ? 223 THR A HG1  1 
ATOM   3443  H  HG21 . THR A  1 243 ? 102.019 -83.950  -26.834 1.00 36.51  ? 223 THR A HG21 1 
ATOM   3444  H  HG22 . THR A  1 243 ? 103.587 -84.192  -27.623 1.00 34.49  ? 223 THR A HG22 1 
ATOM   3445  H  HG23 . THR A  1 243 ? 102.683 -82.687  -27.874 1.00 35.10  ? 223 THR A HG23 1 
ATOM   3446  N  N    . GLY A  1 244 ? 100.979 -84.281  -32.105 1.00 38.23  ? 224 GLY A N    1 
ATOM   3447  C  CA   . GLY A  1 244 ? 100.131 -84.972  -33.077 1.00 38.69  ? 224 GLY A CA   1 
ATOM   3448  C  C    . GLY A  1 244 ? 99.013  -85.781  -32.421 1.00 42.26  ? 224 GLY A C    1 
ATOM   3449  O  O    . GLY A  1 244 ? 98.447  -86.685  -33.027 1.00 43.46  ? 224 GLY A O    1 
ATOM   3450  H  H    . GLY A  1 244 ? 100.836 -83.278  -32.087 1.00 36.26  ? 224 GLY A H    1 
ATOM   3451  H  HA2  . GLY A  1 244 ? 99.683  -84.237  -33.745 1.00 38.71  ? 224 GLY A HA2  1 
ATOM   3452  H  HA3  . GLY A  1 244 ? 100.735 -85.649  -33.679 1.00 39.20  ? 224 GLY A HA3  1 
ATOM   3453  N  N    . GLU A  1 245 ? 98.704  -85.484  -31.160 1.00 39.42  ? 225 GLU A N    1 
ATOM   3454  C  CA   . GLU A  1 245 ? 97.659  -86.145  -30.389 1.00 37.38  ? 225 GLU A CA   1 
ATOM   3455  C  C    . GLU A  1 245 ? 96.632  -85.118  -29.943 1.00 36.92  ? 225 GLU A C    1 
ATOM   3456  O  O    . GLU A  1 245 ? 97.016  -83.991  -29.670 1.00 35.05  ? 225 GLU A O    1 
ATOM   3457  C  CB   . GLU A  1 245 ? 98.269  -86.839  -29.164 1.00 38.39  ? 225 GLU A CB   1 
ATOM   3458  C  CG   . GLU A  1 245 ? 99.275  -87.921  -29.485 1.00 51.37  ? 225 GLU A CG   1 
ATOM   3459  C  CD   . GLU A  1 245 ? 99.919  -88.588  -28.281 1.00 94.55  ? 225 GLU A CD   1 
ATOM   3460  O  OE1  . GLU A  1 245 ? 99.572  -88.227  -27.132 1.00 106.10 ? 225 GLU A OE1  1 
ATOM   3461  O  OE2  . GLU A  1 245 ? 100.796 -89.457  -28.491 1.00 97.84  ? 225 GLU A OE2  1 
ATOM   3462  H  H    . GLU A  1 245 ? 99.158  -84.762  -30.607 1.00 41.03  ? 225 GLU A H    1 
ATOM   3463  H  HA   . GLU A  1 245 ? 97.141  -86.893  -30.986 1.00 37.44  ? 225 GLU A HA   1 
ATOM   3464  H  HB2  . GLU A  1 245 ? 98.795  -86.093  -28.572 1.00 38.19  ? 225 GLU A HB2  1 
ATOM   3465  H  HB3  . GLU A  1 245 ? 97.465  -87.290  -28.587 1.00 38.20  ? 225 GLU A HB3  1 
ATOM   3466  H  HG2  . GLU A  1 245 ? 98.763  -88.686  -30.065 1.00 51.34  ? 225 GLU A HG2  1 
ATOM   3467  H  HG3  . GLU A  1 245 ? 100.077 -87.483  -30.075 1.00 52.12  ? 225 GLU A HG3  1 
ATOM   3468  N  N    . ALA A  1 246 ? 95.347  -85.511  -29.827 1.00 32.08  ? 226 ALA A N    1 
ATOM   3469  C  CA   . ALA A  1 246 ? 94.270  -84.638  -29.359 1.00 32.15  ? 226 ALA A CA   1 
ATOM   3470  C  C    . ALA A  1 246 ? 94.392  -84.444  -27.840 1.00 35.68  ? 226 ALA A C    1 
ATOM   3471  O  O    . ALA A  1 246 ? 94.778  -85.371  -27.114 1.00 35.64  ? 226 ALA A O    1 
ATOM   3472  C  CB   . ALA A  1 246 ? 92.913  -85.242  -29.705 1.00 33.16  ? 226 ALA A CB   1 
ATOM   3473  H  H    . ALA A  1 246 ? 95.041  -86.454  -30.045 1.00 34.44  ? 226 ALA A H    1 
ATOM   3474  H  HA   . ALA A  1 246 ? 94.347  -83.670  -29.844 1.00 30.73  ? 226 ALA A HA   1 
ATOM   3475  H  HB1  . ALA A  1 246 ? 92.135  -84.597  -29.301 1.00 32.96  ? 226 ALA A HB1  1 
ATOM   3476  H  HB2  . ALA A  1 246 ? 92.815  -85.336  -30.784 1.00 30.57  ? 226 ALA A HB2  1 
ATOM   3477  H  HB3  . ALA A  1 246 ? 92.843  -86.223  -29.234 1.00 32.99  ? 226 ALA A HB3  1 
ATOM   3478  N  N    . LYS A  1 247 ? 94.062  -83.257  -27.365 1.00 31.55  ? 227 LYS A N    1 
ATOM   3479  C  CA   . LYS A  1 247 ? 94.134  -82.904  -25.938 1.00 32.17  ? 227 LYS A CA   1 
ATOM   3480  C  C    . LYS A  1 247 ? 92.768  -82.416  -25.459 1.00 37.75  ? 227 LYS A C    1 
ATOM   3481  O  O    . LYS A  1 247 ? 92.023  -81.861  -26.256 1.00 39.29  ? 227 LYS A O    1 
ATOM   3482  C  CB   . LYS A  1 247 ? 95.212  -81.835  -25.744 1.00 31.83  ? 227 LYS A CB   1 
ATOM   3483  C  CG   . LYS A  1 247 ? 96.594  -82.262  -26.236 1.00 31.44  ? 227 LYS A CG   1 
ATOM   3484  C  CD   . LYS A  1 247 ? 97.177  -83.507  -25.542 1.00 30.27  ? 227 LYS A CD   1 
ATOM   3485  C  CE   . LYS A  1 247 ? 98.339  -84.083  -26.286 1.00 38.99  ? 227 LYS A CE   1 
ATOM   3486  N  NZ   . LYS A  1 247 ? 98.886  -85.279  -25.590 1.00 45.02  ? 227 LYS A NZ   1 
ATOM   3487  H  H    . LYS A  1 247 ? 93.705  -82.500  -27.935 1.00 32.09  ? 227 LYS A H    1 
ATOM   3488  H  HA   . LYS A  1 247 ? 94.370  -83.769  -25.319 1.00 31.67  ? 227 LYS A HA   1 
ATOM   3489  H  HB2  . LYS A  1 247 ? 94.922  -80.948  -26.301 1.00 30.20  ? 227 LYS A HB2  1 
ATOM   3490  H  HB3  . LYS A  1 247 ? 95.275  -81.594  -24.687 1.00 31.31  ? 227 LYS A HB3  1 
ATOM   3491  H  HG2  . LYS A  1 247 ? 96.551  -82.465  -27.302 1.00 31.27  ? 227 LYS A HG2  1 
ATOM   3492  H  HG3  . LYS A  1 247 ? 97.284  -81.438  -26.052 1.00 32.15  ? 227 LYS A HG3  1 
ATOM   3493  H  HD2  . LYS A  1 247 ? 97.535  -83.234  -24.550 1.00 31.30  ? 227 LYS A HD2  1 
ATOM   3494  H  HD3  . LYS A  1 247 ? 96.435  -84.296  -25.451 1.00 29.81  ? 227 LYS A HD3  1 
ATOM   3495  H  HE2  . LYS A  1 247 ? 97.999  -84.395  -27.272 1.00 40.81  ? 227 LYS A HE2  1 
ATOM   3496  H  HE3  . LYS A  1 247 ? 99.126  -83.337  -26.387 1.00 38.52  ? 227 LYS A HE3  1 
ATOM   3497  H  HZ1  . LYS A  1 247 ? 99.192  -85.023  -24.656 1.00 45.21  ? 227 LYS A HZ1  1 
ATOM   3498  H  HZ2  . LYS A  1 247 ? 98.175  -85.999  -25.517 1.00 44.62  ? 227 LYS A HZ2  1 
ATOM   3499  H  HZ3  . LYS A  1 247 ? 99.682  -85.648  -26.100 1.00 45.70  ? 227 LYS A HZ3  1 
ATOM   3500  N  N    . LEU A  1 248 ? 92.440  -82.636  -24.170 1.00 34.68  ? 228 LEU A N    1 
ATOM   3501  C  CA   . LEU A  1 248 ? 91.151  -82.288  -23.604 1.00 35.24  ? 228 LEU A CA   1 
ATOM   3502  C  C    . LEU A  1 248 ? 91.284  -81.339  -22.418 1.00 36.29  ? 228 LEU A C    1 
ATOM   3503  O  O    . LEU A  1 248 ? 92.243  -81.435  -21.652 1.00 32.94  ? 228 LEU A O    1 
ATOM   3504  C  CB   . LEU A  1 248 ? 90.425  -83.575  -23.144 1.00 35.69  ? 228 LEU A CB   1 
ATOM   3505  C  CG   . LEU A  1 248 ? 90.364  -84.722  -24.149 1.00 41.72  ? 228 LEU A CG   1 
ATOM   3506  C  CD1  . LEU A  1 248 ? 89.911  -86.013  -23.487 1.00 42.93  ? 228 LEU A CD1  1 
ATOM   3507  C  CD2  . LEU A  1 248 ? 89.485  -84.358  -25.327 1.00 41.66  ? 228 LEU A CD2  1 
ATOM   3508  H  H    . LEU A  1 248 ? 93.060  -83.064  -23.490 1.00 34.44  ? 228 LEU A H    1 
ATOM   3509  H  HA   . LEU A  1 248 ? 90.530  -81.803  -24.353 1.00 35.95  ? 228 LEU A HA   1 
ATOM   3510  H  HB2  . LEU A  1 248 ? 90.918  -83.952  -22.251 1.00 36.34  ? 228 LEU A HB2  1 
ATOM   3511  H  HB3  . LEU A  1 248 ? 89.398  -83.311  -22.893 1.00 36.45  ? 228 LEU A HB3  1 
ATOM   3512  H  HG   . LEU A  1 248 ? 91.366  -84.909  -24.534 1.00 42.89  ? 228 LEU A HG   1 
ATOM   3513  H  HD11 . LEU A  1 248 ? 89.762  -86.778  -24.246 1.00 42.84  ? 228 LEU A HD11 1 
ATOM   3514  H  HD12 . LEU A  1 248 ? 90.680  -86.340  -22.789 1.00 43.30  ? 228 LEU A HD12 1 
ATOM   3515  H  HD13 . LEU A  1 248 ? 88.980  -85.831  -22.951 1.00 43.68  ? 228 LEU A HD13 1 
ATOM   3516  H  HD21 . LEU A  1 248 ? 89.399  -85.227  -25.977 1.00 41.57  ? 228 LEU A HD21 1 
ATOM   3517  H  HD22 . LEU A  1 248 ? 88.501  -84.068  -24.964 1.00 41.06  ? 228 LEU A HD22 1 
ATOM   3518  H  HD23 . LEU A  1 248 ? 89.943  -83.535  -25.876 1.00 41.18  ? 228 LEU A HD23 1 
ATOM   3519  N  N    . PHE A  1 249 ? 90.315  -80.413  -22.275 1.00 32.34  ? 229 PHE A N    1 
ATOM   3520  C  CA   . PHE A  1 249 ? 90.257  -79.502  -21.128 1.00 29.65  ? 229 PHE A CA   1 
ATOM   3521  C  C    . PHE A  1 249 ? 88.839  -79.483  -20.581 1.00 34.10  ? 229 PHE A C    1 
ATOM   3522  O  O    . PHE A  1 249 ? 87.889  -79.378  -21.366 1.00 31.17  ? 229 PHE A O    1 
ATOM   3523  C  CB   . PHE A  1 249 ? 90.711  -78.070  -21.469 1.00 29.75  ? 229 PHE A CB   1 
ATOM   3524  C  CG   . PHE A  1 249 ? 91.109  -77.269  -20.247 1.00 32.13  ? 229 PHE A CG   1 
ATOM   3525  C  CD1  . PHE A  1 249 ? 90.149  -76.653  -19.456 1.00 30.84  ? 229 PHE A CD1  1 
ATOM   3526  C  CD2  . PHE A  1 249 ? 92.442  -77.182  -19.854 1.00 34.29  ? 229 PHE A CD2  1 
ATOM   3527  C  CE1  . PHE A  1 249 ? 90.506  -75.969  -18.302 1.00 31.85  ? 229 PHE A CE1  1 
ATOM   3528  C  CE2  . PHE A  1 249 ? 92.803  -76.487  -18.710 1.00 35.65  ? 229 PHE A CE2  1 
ATOM   3529  C  CZ   . PHE A  1 249 ? 91.832  -75.881  -17.936 1.00 33.53  ? 229 PHE A CZ   1 
ATOM   3530  H  H    . PHE A  1 249 ? 89.562  -80.274  -22.939 1.00 31.47  ? 229 PHE A H    1 
ATOM   3531  H  HA   . PHE A  1 249 ? 90.923  -79.868  -20.350 1.00 28.17  ? 229 PHE A HA   1 
ATOM   3532  H  HB2  . PHE A  1 249 ? 91.563  -78.102  -22.144 1.00 30.17  ? 229 PHE A HB2  1 
ATOM   3533  H  HB3  . PHE A  1 249 ? 89.886  -77.551  -21.954 1.00 28.41  ? 229 PHE A HB3  1 
ATOM   3534  H  HD1  . PHE A  1 249 ? 89.099  -76.748  -19.723 1.00 30.32  ? 229 PHE A HD1  1 
ATOM   3535  H  HD2  . PHE A  1 249 ? 93.212  -77.676  -20.442 1.00 34.54  ? 229 PHE A HD2  1 
ATOM   3536  H  HE1  . PHE A  1 249 ? 89.740  -75.492  -17.694 1.00 32.15  ? 229 PHE A HE1  1 
ATOM   3537  H  HE2  . PHE A  1 249 ? 93.846  -76.444  -18.404 1.00 35.76  ? 229 PHE A HE2  1 
ATOM   3538  H  HZ   . PHE A  1 249 ? 92.115  -75.342  -17.033 1.00 33.00  ? 229 PHE A HZ   1 
ATOM   3539  N  N    . SER A  1 250 ? 88.718  -79.530  -19.223 1.00 32.33  ? 230 SER A N    1 
ATOM   3540  C  CA   . SER A  1 250 ? 87.471  -79.412  -18.487 1.00 31.05  ? 230 SER A CA   1 
ATOM   3541  C  C    . SER A  1 250 ? 87.433  -78.058  -17.754 1.00 31.70  ? 230 SER A C    1 
ATOM   3542  O  O    . SER A  1 250 ? 88.140  -77.865  -16.780 1.00 31.59  ? 230 SER A O    1 
ATOM   3543  C  CB   . SER A  1 250 ? 87.300  -80.575  -17.524 1.00 34.50  ? 230 SER A CB   1 
ATOM   3544  O  OG   . SER A  1 250 ? 86.022  -80.555  -16.904 1.00 42.92  ? 230 SER A OG   1 
ATOM   3545  H  H    . SER A  1 250 ? 89.513  -79.632  -18.602 1.00 33.46  ? 230 SER A H    1 
ATOM   3546  H  HA   . SER A  1 250 ? 86.639  -79.442  -19.186 1.00 33.09  ? 230 SER A HA   1 
ATOM   3547  H  HB2  . SER A  1 250 ? 87.403  -81.494  -18.096 1.00 34.04  ? 230 SER A HB2  1 
ATOM   3548  H  HB3  . SER A  1 250 ? 88.067  -80.517  -16.755 1.00 34.70  ? 230 SER A HB3  1 
ATOM   3549  H  HG   . SER A  1 250 ? 85.334  -80.898  -17.534 1.00 42.65  ? 230 SER A HG   1 
ATOM   3550  N  N    . PHE A  1 251 ? 86.600  -77.113  -18.258 1.00 29.24  ? 231 PHE A N    1 
ATOM   3551  C  CA   . PHE A  1 251 ? 86.512  -75.745  -17.705 1.00 30.67  ? 231 PHE A CA   1 
ATOM   3552  C  C    . PHE A  1 251 ? 85.419  -75.575  -16.705 1.00 35.51  ? 231 PHE A C    1 
ATOM   3553  O  O    . PHE A  1 251 ? 84.259  -75.949  -16.963 1.00 33.28  ? 231 PHE A O    1 
ATOM   3554  C  CB   . PHE A  1 251 ? 86.250  -74.688  -18.804 1.00 32.14  ? 231 PHE A CB   1 
ATOM   3555  C  CG   . PHE A  1 251 ? 87.473  -74.260  -19.568 1.00 33.20  ? 231 PHE A CG   1 
ATOM   3556  C  CD1  . PHE A  1 251 ? 88.301  -73.238  -19.083 1.00 32.61  ? 231 PHE A CD1  1 
ATOM   3557  C  CD2  . PHE A  1 251 ? 87.773  -74.827  -20.802 1.00 31.93  ? 231 PHE A CD2  1 
ATOM   3558  C  CE1  . PHE A  1 251 ? 89.389  -72.788  -19.836 1.00 31.54  ? 231 PHE A CE1  1 
ATOM   3559  C  CE2  . PHE A  1 251 ? 88.878  -74.394  -21.542 1.00 33.15  ? 231 PHE A CE2  1 
ATOM   3560  C  CZ   . PHE A  1 251 ? 89.691  -73.394  -21.046 1.00 31.87  ? 231 PHE A CZ   1 
ATOM   3561  H  H    . PHE A  1 251 ? 85.958  -77.285  -19.024 1.00 28.25  ? 231 PHE A H    1 
ATOM   3562  H  HA   . PHE A  1 251 ? 87.465  -75.503  -17.239 1.00 29.94  ? 231 PHE A HA   1 
ATOM   3563  H  HB2  . PHE A  1 251 ? 85.544  -75.096  -19.525 1.00 31.09  ? 231 PHE A HB2  1 
ATOM   3564  H  HB3  . PHE A  1 251 ? 85.827  -73.790  -18.355 1.00 29.86  ? 231 PHE A HB3  1 
ATOM   3565  H  HD1  . PHE A  1 251 ? 88.066  -72.758  -18.136 1.00 31.67  ? 231 PHE A HD1  1 
ATOM   3566  H  HD2  . PHE A  1 251 ? 87.152  -75.640  -21.173 1.00 32.76  ? 231 PHE A HD2  1 
ATOM   3567  H  HE1  . PHE A  1 251 ? 90.032  -72.003  -19.442 1.00 31.61  ? 231 PHE A HE1  1 
ATOM   3568  H  HE2  . PHE A  1 251 ? 89.121  -74.885  -22.482 1.00 32.22  ? 231 PHE A HE2  1 
ATOM   3569  H  HZ   . PHE A  1 251 ? 90.561  -73.071  -21.616 1.00 32.42  ? 231 PHE A HZ   1 
ATOM   3570  N  N    . ASN A  1 252 ? 85.763  -74.932  -15.588 1.00 33.82  ? 232 ASN A N    1 
ATOM   3571  C  CA   . ASN A  1 252 ? 84.790  -74.598  -14.567 1.00 33.48  ? 232 ASN A CA   1 
ATOM   3572  C  C    . ASN A  1 252 ? 83.888  -73.477  -15.094 1.00 35.35  ? 232 ASN A C    1 
ATOM   3573  O  O    . ASN A  1 252 ? 84.386  -72.399  -15.402 1.00 33.82  ? 232 ASN A O    1 
ATOM   3574  C  CB   . ASN A  1 252 ? 85.471  -74.167  -13.277 1.00 32.64  ? 232 ASN A CB   1 
ATOM   3575  C  CG   . ASN A  1 252 ? 84.503  -73.633  -12.261 1.00 45.40  ? 232 ASN A CG   1 
ATOM   3576  O  OD1  . ASN A  1 252 ? 83.392  -74.143  -12.107 1.00 33.39  ? 232 ASN A OD1  1 
ATOM   3577  N  ND2  . ASN A  1 252 ? 84.841  -72.526  -11.619 1.00 38.48  ? 232 ASN A ND2  1 
ATOM   3578  H  H    . ASN A  1 252 ? 86.703  -74.614  -15.386 1.00 34.24  ? 232 ASN A H    1 
ATOM   3579  H  HA   . ASN A  1 252 ? 84.178  -75.468  -14.339 1.00 33.31  ? 232 ASN A HA   1 
ATOM   3580  H  HB2  . ASN A  1 252 ? 85.991  -75.021  -12.845 1.00 33.79  ? 232 ASN A HB2  1 
ATOM   3581  H  HB3  . ASN A  1 252 ? 86.189  -73.392  -13.537 1.00 33.97  ? 232 ASN A HB3  1 
ATOM   3582  H  HD21 . ASN A  1 252 ? 84.204  -72.127  -10.937 1.00 37.86  ? 232 ASN A HD21 1 
ATOM   3583  H  HD22 . ASN A  1 252 ? 85.712  -72.048  -11.831 1.00 39.14  ? 232 ASN A HD22 1 
ATOM   3584  N  N    . ILE A  1 253 ? 82.574  -73.755  -15.219 1.00 30.89  ? 233 ILE A N    1 
ATOM   3585  C  CA   . ILE A  1 253 ? 81.591  -72.758  -15.633 1.00 29.97  ? 233 ILE A CA   1 
ATOM   3586  C  C    . ILE A  1 253 ? 80.593  -72.495  -14.497 1.00 34.71  ? 233 ILE A C    1 
ATOM   3587  O  O    . ILE A  1 253 ? 79.574  -71.839  -14.728 1.00 34.42  ? 233 ILE A O    1 
ATOM   3588  C  CB   . ILE A  1 253 ? 80.877  -73.156  -16.945 1.00 33.81  ? 233 ILE A CB   1 
ATOM   3589  C  CG1  . ILE A  1 253 ? 80.026  -74.460  -16.796 1.00 33.89  ? 233 ILE A CG1  1 
ATOM   3590  C  CG2  . ILE A  1 253 ? 81.917  -73.301  -18.080 1.00 31.40  ? 233 ILE A CG2  1 
ATOM   3591  C  CD1  . ILE A  1 253 ? 79.037  -74.656  -17.959 1.00 35.43  ? 233 ILE A CD1  1 
ATOM   3592  H  H    . ILE A  1 253 ? 82.177  -74.669  -15.020 1.00 30.15  ? 233 ILE A H    1 
ATOM   3593  H  HA   . ILE A  1 253 ? 82.078  -71.805  -15.830 1.00 30.47  ? 233 ILE A HA   1 
ATOM   3594  H  HB   . ILE A  1 253 ? 80.204  -72.353  -17.235 1.00 32.55  ? 233 ILE A HB   1 
ATOM   3595  H  HG12 . ILE A  1 253 ? 80.695  -75.319  -16.769 1.00 32.58  ? 233 ILE A HG12 1 
ATOM   3596  H  HG13 . ILE A  1 253 ? 79.441  -74.422  -15.881 1.00 32.59  ? 233 ILE A HG13 1 
ATOM   3597  H  HG21 . ILE A  1 253 ? 81.405  -73.339  -19.038 1.00 30.24  ? 233 ILE A HG21 1 
ATOM   3598  H  HG22 . ILE A  1 253 ? 82.594  -72.449  -18.045 1.00 31.76  ? 233 ILE A HG22 1 
ATOM   3599  H  HG23 . ILE A  1 253 ? 82.478  -74.221  -17.923 1.00 32.38  ? 233 ILE A HG23 1 
ATOM   3600  H  HD11 . ILE A  1 253 ? 78.436  -75.541  -17.754 1.00 35.06  ? 233 ILE A HD11 1 
ATOM   3601  H  HD12 . ILE A  1 253 ? 78.394  -73.780  -18.032 1.00 34.78  ? 233 ILE A HD12 1 
ATOM   3602  H  HD13 . ILE A  1 253 ? 79.588  -74.783  -18.888 1.00 35.19  ? 233 ILE A HD13 1 
ATOM   3603  N  N    . THR A  1 254 ? 80.874  -72.986  -13.276 1.00 30.71  ? 234 THR A N    1 
ATOM   3604  C  CA   . THR A  1 254 ? 79.988  -72.793  -12.124 1.00 32.82  ? 234 THR A CA   1 
ATOM   3605  C  C    . THR A  1 254 ? 79.738  -71.328  -11.815 1.00 36.51  ? 234 THR A C    1 
ATOM   3606  O  O    . THR A  1 254 ? 80.675  -70.535  -11.719 1.00 35.75  ? 234 THR A O    1 
ATOM   3607  C  CB   . THR A  1 254 ? 80.578  -73.435  -10.843 1.00 39.81  ? 234 THR A CB   1 
ATOM   3608  O  OG1  . THR A  1 254 ? 80.984  -74.767  -11.137 1.00 37.45  ? 234 THR A OG1  1 
ATOM   3609  C  CG2  . THR A  1 254 ? 79.592  -73.446  -9.676  1.00 38.29  ? 234 THR A CG2  1 
ATOM   3610  H  H    . THR A  1 254 ? 81.721  -73.487  -13.032 1.00 29.60  ? 234 THR A H    1 
ATOM   3611  H  HA   . THR A  1 254 ? 79.040  -73.289  -12.331 1.00 34.11  ? 234 THR A HA   1 
ATOM   3612  H  HB   . THR A  1 254 ? 81.451  -72.863  -10.532 1.00 39.28  ? 234 THR A HB   1 
ATOM   3613  H  HG1  . THR A  1 254 ? 81.974  -74.835  -11.115 1.00 37.62  ? 234 THR A HG1  1 
ATOM   3614  H  HG21 . THR A  1 254 ? 80.114  -73.704  -8.757  1.00 39.22  ? 234 THR A HG21 1 
ATOM   3615  H  HG22 . THR A  1 254 ? 79.125  -72.478  -9.514  1.00 38.56  ? 234 THR A HG22 1 
ATOM   3616  H  HG23 . THR A  1 254 ? 78.809  -74.182  -9.854  1.00 38.13  ? 234 THR A HG23 1 
ATOM   3617  N  N    . ALA A  1 255 ? 78.477  -71.006  -11.564 1.00 35.19  ? 235 ALA A N    1 
ATOM   3618  C  CA   . ALA A  1 255 ? 78.061  -69.682  -11.122 1.00 35.16  ? 235 ALA A CA   1 
ATOM   3619  C  C    . ALA A  1 255 ? 76.702  -69.789  -10.475 1.00 37.88  ? 235 ALA A C    1 
ATOM   3620  O  O    . ALA A  1 255 ? 75.985  -70.775  -10.698 1.00 38.20  ? 235 ALA A O    1 
ATOM   3621  C  CB   . ALA A  1 255 ? 78.029  -68.709  -12.307 1.00 36.04  ? 235 ALA A CB   1 
ATOM   3622  H  H    . ALA A  1 255 ? 77.703  -71.657  -11.657 1.00 35.74  ? 235 ALA A H    1 
ATOM   3623  H  HA   . ALA A  1 255 ? 78.761  -69.303  -10.383 1.00 34.54  ? 235 ALA A HA   1 
ATOM   3624  H  HB1  . ALA A  1 255 ? 77.586  -67.771  -11.983 1.00 35.00  ? 235 ALA A HB1  1 
ATOM   3625  H  HB2  . ALA A  1 255 ? 79.048  -68.548  -12.653 1.00 34.60  ? 235 ALA A HB2  1 
ATOM   3626  H  HB3  . ALA A  1 255 ? 77.429  -69.145  -13.105 1.00 36.04  ? 235 ALA A HB3  1 
ATOM   3627  N  N    . ASP A  1 256 ? 76.372  -68.818  -9.637  1.00 35.19  ? 236 ASP A N    1 
ATOM   3628  C  CA   . ASP A  1 256 ? 75.034  -68.705  -9.046  1.00 35.29  ? 236 ASP A CA   1 
ATOM   3629  C  C    . ASP A  1 256 ? 74.029  -68.377  -10.168 1.00 33.57  ? 236 ASP A C    1 
ATOM   3630  O  O    . ASP A  1 256 ? 72.915  -68.905  -10.231 1.00 28.69  ? 236 ASP A O    1 
ATOM   3631  C  CB   . ASP A  1 256 ? 74.974  -67.572  -7.998  1.00 37.92  ? 236 ASP A CB   1 
ATOM   3632  C  CG   . ASP A  1 256 ? 75.745  -67.732  -6.709  1.00 44.42  ? 236 ASP A CG   1 
ATOM   3633  O  OD1  . ASP A  1 256 ? 76.421  -68.776  -6.552  1.00 43.84  ? 236 ASP A OD1  1 
ATOM   3634  O  OD2  . ASP A  1 256 ? 75.641  -66.808  -5.825  1.00 41.42  ? 236 ASP A OD2  1 
ATOM   3635  H  H    . ASP A  1 256 ? 77.006  -68.074  -9.362  1.00 34.93  ? 236 ASP A H    1 
ATOM   3636  H  HA   . ASP A  1 256 ? 74.751  -69.644  -8.572  1.00 35.61  ? 236 ASP A HA   1 
ATOM   3637  H  HB2  . ASP A  1 256 ? 75.325  -66.647  -8.451  1.00 37.42  ? 236 ASP A HB2  1 
ATOM   3638  H  HB3  . ASP A  1 256 ? 73.926  -67.459  -7.731  1.00 38.87  ? 236 ASP A HB3  1 
ATOM   3639  N  N    . ASP A  1 257 ? 74.436  -67.447  -11.035 1.00 31.59  ? 237 ASP A N    1 
ATOM   3640  C  CA   . ASP A  1 257 ? 73.596  -66.984  -12.116 1.00 29.22  ? 237 ASP A CA   1 
ATOM   3641  C  C    . ASP A  1 257 ? 73.690  -67.903  -13.334 1.00 32.25  ? 237 ASP A C    1 
ATOM   3642  O  O    . ASP A  1 257 ? 74.735  -68.034  -13.953 1.00 31.41  ? 237 ASP A O    1 
ATOM   3643  C  CB   . ASP A  1 257 ? 73.969  -65.541  -12.485 1.00 31.39  ? 237 ASP A CB   1 
ATOM   3644  C  CG   . ASP A  1 257 ? 73.041  -64.866  -13.488 1.00 36.50  ? 237 ASP A CG   1 
ATOM   3645  O  OD1  . ASP A  1 257 ? 72.119  -65.534  -14.001 1.00 35.92  ? 237 ASP A OD1  1 
ATOM   3646  O  OD2  . ASP A  1 257 ? 73.230  -63.688  -13.749 1.00 37.90  ? 237 ASP A OD2  1 
ATOM   3647  H  H    . ASP A  1 257 ? 75.336  -66.979  -11.000 1.00 32.20  ? 237 ASP A H    1 
ATOM   3648  H  HA   . ASP A  1 257 ? 72.562  -66.947  -11.777 1.00 28.47  ? 237 ASP A HA   1 
ATOM   3649  H  HB2  . ASP A  1 257 ? 73.960  -64.948  -11.575 1.00 31.83  ? 237 ASP A HB2  1 
ATOM   3650  H  HB3  . ASP A  1 257 ? 74.971  -65.538  -12.913 1.00 33.13  ? 237 ASP A HB3  1 
ATOM   3651  N  N    . HIS A  1 258 ? 72.540  -68.477  -13.704 1.00 28.85  ? 238 HIS A N    1 
ATOM   3652  C  CA   . HIS A  1 258 ? 72.326  -69.284  -14.892 1.00 28.13  ? 238 HIS A CA   1 
ATOM   3653  C  C    . HIS A  1 258 ? 72.920  -68.625  -16.130 1.00 31.11  ? 238 HIS A C    1 
ATOM   3654  O  O    . HIS A  1 258 ? 73.575  -69.296  -16.919 1.00 31.73  ? 238 HIS A O    1 
ATOM   3655  C  CB   . HIS A  1 258 ? 70.798  -69.477  -15.068 1.00 29.04  ? 238 HIS A CB   1 
ATOM   3656  C  CG   . HIS A  1 258 ? 70.403  -70.072  -16.379 1.00 31.40  ? 238 HIS A CG   1 
ATOM   3657  N  ND1  . HIS A  1 258 ? 70.373  -71.450  -16.569 1.00 33.25  ? 238 HIS A ND1  1 
ATOM   3658  C  CD2  . HIS A  1 258 ? 70.008  -69.462  -17.520 1.00 31.06  ? 238 HIS A CD2  1 
ATOM   3659  C  CE1  . HIS A  1 258 ? 69.982  -71.621  -17.821 1.00 31.80  ? 238 HIS A CE1  1 
ATOM   3660  N  NE2  . HIS A  1 258 ? 69.732  -70.454  -18.419 1.00 32.23  ? 238 HIS A NE2  1 
ATOM   3661  H  H    . HIS A  1 258 ? 71.705  -68.420  -13.128 1.00 29.44  ? 238 HIS A H    1 
ATOM   3662  H  HA   . HIS A  1 258 ? 72.782  -70.266  -14.762 1.00 27.57  ? 238 HIS A HA   1 
ATOM   3663  H  HB2  . HIS A  1 258 ? 70.427  -70.128  -14.278 1.00 28.67  ? 238 HIS A HB2  1 
ATOM   3664  H  HB3  . HIS A  1 258 ? 70.317  -68.501  -14.989 1.00 28.16  ? 238 HIS A HB3  1 
ATOM   3665  H  HD2  . HIS A  1 258 ? 69.911  -68.393  -17.683 1.00 31.48  ? 238 HIS A HD2  1 
ATOM   3666  H  HE1  . HIS A  1 258 ? 69.868  -72.590  -18.296 1.00 32.28  ? 238 HIS A HE1  1 
ATOM   3667  H  HE2  . HIS A  1 258 ? 69.403  -70.328  -19.368 1.00 33.76  ? 238 HIS A HE2  1 
ATOM   3668  N  N    . TYR A  1 259 ? 72.686  -67.307  -16.315 1.00 30.97  ? 239 TYR A N    1 
ATOM   3669  C  CA   . TYR A  1 259 ? 73.161  -66.578  -17.485 1.00 29.31  ? 239 TYR A CA   1 
ATOM   3670  C  C    . TYR A  1 259 ? 74.697  -66.429  -17.492 1.00 30.42  ? 239 TYR A C    1 
ATOM   3671  O  O    . TYR A  1 259 ? 75.277  -66.408  -18.561 1.00 29.04  ? 239 TYR A O    1 
ATOM   3672  C  CB   . TYR A  1 259 ? 72.456  -65.220  -17.631 1.00 30.61  ? 239 TYR A CB   1 
ATOM   3673  C  CG   . TYR A  1 259 ? 70.972  -65.424  -17.845 1.00 31.15  ? 239 TYR A CG   1 
ATOM   3674  C  CD1  . TYR A  1 259 ? 70.483  -65.925  -19.044 1.00 33.35  ? 239 TYR A CD1  1 
ATOM   3675  C  CD2  . TYR A  1 259 ? 70.080  -65.267  -16.804 1.00 33.29  ? 239 TYR A CD2  1 
ATOM   3676  C  CE1  . TYR A  1 259 ? 69.124  -66.222  -19.208 1.00 31.31  ? 239 TYR A CE1  1 
ATOM   3677  C  CE2  . TYR A  1 259 ? 68.727  -65.529  -16.960 1.00 34.15  ? 239 TYR A CE2  1 
ATOM   3678  C  CZ   . TYR A  1 259 ? 68.250  -66.018  -18.152 1.00 36.67  ? 239 TYR A CZ   1 
ATOM   3679  O  OH   . TYR A  1 259 ? 66.907  -66.320  -18.168 1.00 35.99  ? 239 TYR A OH   1 
ATOM   3680  H  H    . TYR A  1 259 ? 72.194  -66.733  -15.638 1.00 32.14  ? 239 TYR A H    1 
ATOM   3681  H  HA   . TYR A  1 259 ? 72.901  -67.164  -18.366 1.00 29.08  ? 239 TYR A HA   1 
ATOM   3682  H  HB2  . TYR A  1 259 ? 72.605  -64.650  -16.713 1.00 30.17  ? 239 TYR A HB2  1 
ATOM   3683  H  HB3  . TYR A  1 259 ? 72.868  -64.682  -18.482 1.00 28.72  ? 239 TYR A HB3  1 
ATOM   3684  H  HD1  . TYR A  1 259 ? 71.173  -66.076  -19.873 1.00 33.85  ? 239 TYR A HD1  1 
ATOM   3685  H  HD2  . TYR A  1 259 ? 70.434  -64.905  -15.839 1.00 34.19  ? 239 TYR A HD2  1 
ATOM   3686  H  HE1  . TYR A  1 259 ? 68.759  -66.575  -20.171 1.00 27.57  ? 239 TYR A HE1  1 
ATOM   3687  H  HE2  . TYR A  1 259 ? 68.047  -65.395  -16.120 1.00 34.88  ? 239 TYR A HE2  1 
ATOM   3688  H  HH   . TYR A  1 259 ? 66.593  -66.398  -19.108 1.00 37.32  ? 239 TYR A HH   1 
ATOM   3689  N  N    . GLU A  1 260 ? 75.348  -66.418  -16.332 1.00 29.25  ? 240 GLU A N    1 
ATOM   3690  C  CA   . GLU A  1 260 ? 76.814  -66.387  -16.250 1.00 30.84  ? 240 GLU A CA   1 
ATOM   3691  C  C    . GLU A  1 260 ? 77.369  -67.753  -16.720 1.00 36.19  ? 240 GLU A C    1 
ATOM   3692  O  O    . GLU A  1 260 ? 78.389  -67.800  -17.397 1.00 35.29  ? 240 GLU A O    1 
ATOM   3693  C  CB   . GLU A  1 260 ? 77.264  -66.056  -14.814 1.00 33.04  ? 240 GLU A CB   1 
ATOM   3694  C  CG   . GLU A  1 260 ? 78.761  -66.176  -14.566 1.00 31.37  ? 240 GLU A CG   1 
ATOM   3695  C  CD   . GLU A  1 260 ? 79.639  -65.192  -15.297 1.00 40.65  ? 240 GLU A CD   1 
ATOM   3696  O  OE1  . GLU A  1 260 ? 79.130  -64.175  -15.816 1.00 36.96  ? 240 GLU A OE1  1 
ATOM   3697  O  OE2  . GLU A  1 260 ? 80.874  -65.364  -15.227 1.00 41.35  ? 240 GLU A OE2  1 
ATOM   3698  H  H    . GLU A  1 260 ? 74.897  -66.397  -15.425 1.00 29.44  ? 240 GLU A H    1 
ATOM   3699  H  HA   . GLU A  1 260 ? 77.196  -65.611  -16.912 1.00 30.83  ? 240 GLU A HA   1 
ATOM   3700  H  HB2  . GLU A  1 260 ? 76.958  -65.039  -14.570 1.00 32.00  ? 240 GLU A HB2  1 
ATOM   3701  H  HB3  . GLU A  1 260 ? 76.785  -66.754  -14.129 1.00 33.86  ? 240 GLU A HB3  1 
ATOM   3702  H  HG2  . GLU A  1 260 ? 78.941  -66.051  -13.501 1.00 29.34  ? 240 GLU A HG2  1 
ATOM   3703  H  HG3  . GLU A  1 260 ? 79.096  -67.175  -14.845 1.00 33.76  ? 240 GLU A HG3  1 
ATOM   3704  N  N    . MET A  1 261 ? 76.699  -68.865  -16.333 1.00 31.55  ? 241 MET A N    1 
ATOM   3705  C  CA   . MET A  1 261 ? 77.109  -70.208  -16.758 1.00 32.23  ? 241 MET A CA   1 
ATOM   3706  C  C    . MET A  1 261 ? 77.035  -70.302  -18.292 1.00 35.24  ? 241 MET A C    1 
ATOM   3707  O  O    . MET A  1 261 ? 77.985  -70.766  -18.919 1.00 34.29  ? 241 MET A O    1 
ATOM   3708  C  CB   . MET A  1 261 ? 76.255  -71.304  -16.119 1.00 34.02  ? 241 MET A CB   1 
ATOM   3709  C  CG   . MET A  1 261 ? 76.353  -71.372  -14.607 1.00 37.55  ? 241 MET A CG   1 
ATOM   3710  S  SD   . MET A  1 261 ? 75.593  -72.866  -13.858 1.00 40.81  ? 241 MET A SD   1 
ATOM   3711  C  CE   . MET A  1 261 ? 76.564  -74.174  -14.618 1.00 38.86  ? 241 MET A CE   1 
ATOM   3712  H  H    . MET A  1 261 ? 75.873  -68.850  -15.748 1.00 30.52  ? 241 MET A H    1 
ATOM   3713  H  HA   . MET A  1 261 ? 78.144  -70.370  -16.454 1.00 33.32  ? 241 MET A HA   1 
ATOM   3714  H  HB2  . MET A  1 261 ? 75.211  -71.145  -16.382 1.00 34.40  ? 241 MET A HB2  1 
ATOM   3715  H  HB3  . MET A  1 261 ? 76.585  -72.258  -16.528 1.00 33.34  ? 241 MET A HB3  1 
ATOM   3716  H  HG2  . MET A  1 261 ? 77.395  -71.340  -14.297 1.00 38.62  ? 241 MET A HG2  1 
ATOM   3717  H  HG3  . MET A  1 261 ? 75.834  -70.512  -14.186 1.00 38.15  ? 241 MET A HG3  1 
ATOM   3718  H  HE1  . MET A  1 261 ? 76.535  -75.057  -13.980 1.00 39.51  ? 241 MET A HE1  1 
ATOM   3719  H  HE2  . MET A  1 261 ? 76.148  -74.414  -15.595 1.00 39.76  ? 241 MET A HE2  1 
ATOM   3720  H  HE3  . MET A  1 261 ? 77.590  -73.827  -14.719 1.00 39.45  ? 241 MET A HE3  1 
ATOM   3721  N  N    . LEU A  1 262 ? 75.944  -69.777  -18.887 1.00 33.48  ? 242 LEU A N    1 
ATOM   3722  C  CA   . LEU A  1 262 ? 75.783  -69.769  -20.342 1.00 32.29  ? 242 LEU A CA   1 
ATOM   3723  C  C    . LEU A  1 262 ? 76.844  -68.911  -20.997 1.00 37.49  ? 242 LEU A C    1 
ATOM   3724  O  O    . LEU A  1 262 ? 77.395  -69.317  -22.016 1.00 38.74  ? 242 LEU A O    1 
ATOM   3725  C  CB   . LEU A  1 262 ? 74.411  -69.250  -20.786 1.00 31.48  ? 242 LEU A CB   1 
ATOM   3726  C  CG   . LEU A  1 262 ? 73.167  -69.978  -20.318 1.00 36.56  ? 242 LEU A CG   1 
ATOM   3727  C  CD1  . LEU A  1 262 ? 71.945  -69.480  -21.073 1.00 36.53  ? 242 LEU A CD1  1 
ATOM   3728  C  CD2  . LEU A  1 262 ? 73.313  -71.471  -20.434 1.00 39.63  ? 242 LEU A CD2  1 
ATOM   3729  H  H    . LEU A  1 262 ? 75.165  -69.366  -18.384 1.00 33.29  ? 242 LEU A H    1 
ATOM   3730  H  HA   . LEU A  1 262 ? 75.910  -70.783  -20.713 1.00 32.00  ? 242 LEU A HA   1 
ATOM   3731  H  HB2  . LEU A  1 262 ? 74.321  -68.222  -20.438 1.00 32.98  ? 242 LEU A HB2  1 
ATOM   3732  H  HB3  . LEU A  1 262 ? 74.396  -69.258  -21.874 1.00 30.18  ? 242 LEU A HB3  1 
ATOM   3733  H  HG   . LEU A  1 262 ? 72.999  -69.750  -19.268 1.00 36.97  ? 242 LEU A HG   1 
ATOM   3734  H  HD11 . LEU A  1 262 ? 71.066  -70.020  -20.731 1.00 34.93  ? 242 LEU A HD11 1 
ATOM   3735  H  HD12 . LEU A  1 262 ? 71.826  -68.413  -20.883 1.00 35.53  ? 242 LEU A HD12 1 
ATOM   3736  H  HD13 . LEU A  1 262 ? 72.092  -69.653  -22.138 1.00 36.82  ? 242 LEU A HD13 1 
ATOM   3737  H  HD21 . LEU A  1 262 ? 72.343  -71.939  -20.282 1.00 39.15  ? 242 LEU A HD21 1 
ATOM   3738  H  HD22 . LEU A  1 262 ? 73.697  -71.703  -21.427 1.00 39.61  ? 242 LEU A HD22 1 
ATOM   3739  H  HD23 . LEU A  1 262 ? 74.010  -71.817  -19.672 1.00 39.61  ? 242 LEU A HD23 1 
ATOM   3740  N  N    . ALA A  1 263 ? 77.100  -67.711  -20.450 1.00 34.49  ? 243 ALA A N    1 
ATOM   3741  C  CA   . ALA A  1 263 ? 78.097  -66.779  -21.014 1.00 34.89  ? 243 ALA A CA   1 
ATOM   3742  C  C    . ALA A  1 263 ? 79.487  -67.418  -21.028 1.00 38.19  ? 243 ALA A C    1 
ATOM   3743  O  O    . ALA A  1 263 ? 80.193  -67.315  -22.039 1.00 34.99  ? 243 ALA A O    1 
ATOM   3744  C  CB   . ALA A  1 263 ? 78.124  -65.479  -20.237 1.00 35.78  ? 243 ALA A CB   1 
ATOM   3745  H  H    . ALA A  1 263 ? 76.616  -67.348  -19.634 1.00 35.62  ? 243 ALA A H    1 
ATOM   3746  H  HA   . ALA A  1 263 ? 77.824  -66.555  -22.044 1.00 34.54  ? 243 ALA A HA   1 
ATOM   3747  H  HB1  . ALA A  1 263 ? 78.953  -64.868  -20.590 1.00 34.82  ? 243 ALA A HB1  1 
ATOM   3748  H  HB2  . ALA A  1 263 ? 77.180  -64.960  -20.394 1.00 35.48  ? 243 ALA A HB2  1 
ATOM   3749  H  HB3  . ALA A  1 263 ? 78.250  -65.696  -19.175 1.00 36.13  ? 243 ALA A HB3  1 
ATOM   3750  N  N    . ARG A  1 264 ? 79.854  -68.130  -19.941 1.00 32.93  ? 244 ARG A N    1 
ATOM   3751  C  CA   . ARG A  1 264 ? 81.167  -68.804  -19.883 1.00 32.03  ? 244 ARG A CA   1 
ATOM   3752  C  C    . ARG A  1 264 ? 81.286  -69.938  -20.906 1.00 36.14  ? 244 ARG A C    1 
ATOM   3753  O  O    . ARG A  1 264 ? 82.272  -69.979  -21.650 1.00 34.54  ? 244 ARG A O    1 
ATOM   3754  C  CB   . ARG A  1 264 ? 81.431  -69.347  -18.486 1.00 29.37  ? 244 ARG A CB   1 
ATOM   3755  C  CG   . ARG A  1 264 ? 81.699  -68.219  -17.502 1.00 32.77  ? 244 ARG A CG   1 
ATOM   3756  C  CD   . ARG A  1 264 ? 82.110  -68.763  -16.152 1.00 42.14  ? 244 ARG A CD   1 
ATOM   3757  N  NE   . ARG A  1 264 ? 82.309  -67.646  -15.248 1.00 39.46  ? 244 ARG A NE   1 
ATOM   3758  C  CZ   . ARG A  1 264 ? 82.941  -67.679  -14.084 1.00 56.49  ? 244 ARG A CZ   1 
ATOM   3759  N  NH1  . ARG A  1 264 ? 83.472  -68.822  -13.635 1.00 46.62  ? 244 ARG A NH1  1 
ATOM   3760  N  NH2  . ARG A  1 264 ? 83.053  -66.574  -13.356 1.00 38.47  ? 244 ARG A NH2  1 
ATOM   3761  H  H    . ARG A  1 264 ? 79.288  -68.247  -19.108 1.00 31.94  ? 244 ARG A H    1 
ATOM   3762  H  HA   . ARG A  1 264 ? 81.940  -68.073  -20.113 1.00 31.82  ? 244 ARG A HA   1 
ATOM   3763  H  HB2  . ARG A  1 264 ? 80.551  -69.890  -18.143 1.00 30.18  ? 244 ARG A HB2  1 
ATOM   3764  H  HB3  . ARG A  1 264 ? 82.294  -70.008  -18.492 1.00 27.74  ? 244 ARG A HB3  1 
ATOM   3765  H  HG2  . ARG A  1 264 ? 82.513  -67.600  -17.873 1.00 31.14  ? 244 ARG A HG2  1 
ATOM   3766  H  HG3  . ARG A  1 264 ? 80.803  -67.615  -17.375 1.00 31.87  ? 244 ARG A HG3  1 
ATOM   3767  H  HD2  . ARG A  1 264 ? 81.340  -69.420  -15.747 1.00 42.74  ? 244 ARG A HD2  1 
ATOM   3768  H  HD3  . ARG A  1 264 ? 83.048  -69.302  -16.276 1.00 42.17  ? 244 ARG A HD3  1 
ATOM   3769  H  HE   . ARG A  1 264 ? 81.941  -66.747  -15.540 1.00 40.55  ? 244 ARG A HE   1 
ATOM   3770  H  HH11 . ARG A  1 264 ? 83.401  -69.700  -14.137 1.00 45.22  ? 244 ARG A HH11 1 
ATOM   3771  H  HH12 . ARG A  1 264 ? 83.942  -68.828  -12.735 1.00 47.87  ? 244 ARG A HH12 1 
ATOM   3772  H  HH21 . ARG A  1 264 ? 82.663  -65.699  -13.690 1.00 36.02  ? 244 ARG A HH21 1 
ATOM   3773  H  HH22 . ARG A  1 264 ? 83.540  -66.590  -12.467 1.00 39.80  ? 244 ARG A HH22 1 
ATOM   3774  N  N    . GLY A  1 265 ? 80.287  -70.826  -20.940 1.00 32.68  ? 245 GLY A N    1 
ATOM   3775  C  CA   . GLY A  1 265 ? 80.251  -71.963  -21.860 1.00 32.18  ? 245 GLY A CA   1 
ATOM   3776  C  C    . GLY A  1 265 ? 80.255  -71.568  -23.317 1.00 33.39  ? 245 GLY A C    1 
ATOM   3777  O  O    . GLY A  1 265 ? 81.046  -72.110  -24.093 1.00 30.50  ? 245 GLY A O    1 
ATOM   3778  H  H    . GLY A  1 265 ? 79.486  -70.792  -20.317 1.00 33.00  ? 245 GLY A H    1 
ATOM   3779  H  HA2  . GLY A  1 265 ? 81.118  -72.597  -21.686 1.00 31.60  ? 245 GLY A HA2  1 
ATOM   3780  H  HA3  . GLY A  1 265 ? 79.354  -72.547  -21.661 1.00 33.02  ? 245 GLY A HA3  1 
ATOM   3781  N  N    . GLU A  1 266 ? 79.416  -70.569  -23.697 1.00 29.17  ? 246 GLU A N    1 
ATOM   3782  C  CA   . GLU A  1 266 ? 79.355  -70.081  -25.083 1.00 28.70  ? 246 GLU A CA   1 
ATOM   3783  C  C    . GLU A  1 266 ? 80.690  -69.455  -25.517 1.00 26.80  ? 246 GLU A C    1 
ATOM   3784  O  O    . GLU A  1 266 ? 81.135  -69.684  -26.635 1.00 23.13  ? 246 GLU A O    1 
ATOM   3785  C  CB   . GLU A  1 266 ? 78.211  -69.073  -25.267 1.00 29.81  ? 246 GLU A CB   1 
ATOM   3786  C  CG   . GLU A  1 266 ? 76.837  -69.736  -25.159 1.00 41.03  ? 246 GLU A CG   1 
ATOM   3787  C  CD   . GLU A  1 266 ? 75.681  -68.780  -24.934 1.00 69.92  ? 246 GLU A CD   1 
ATOM   3788  O  OE1  . GLU A  1 266 ? 74.560  -69.250  -24.626 1.00 79.64  ? 246 GLU A OE1  1 
ATOM   3789  O  OE2  . GLU A  1 266 ? 75.902  -67.557  -25.059 1.00 49.71  ? 246 GLU A OE2  1 
ATOM   3790  H  H    . GLU A  1 266 ? 78.785  -70.097  -23.059 1.00 29.87  ? 246 GLU A H    1 
ATOM   3791  H  HA   . GLU A  1 266 ? 79.167  -70.935  -25.729 1.00 29.89  ? 246 GLU A HA   1 
ATOM   3792  H  HB2  . GLU A  1 266 ? 78.300  -68.304  -24.502 1.00 28.29  ? 246 GLU A HB2  1 
ATOM   3793  H  HB3  . GLU A  1 266 ? 78.295  -68.631  -26.257 1.00 28.45  ? 246 GLU A HB3  1 
ATOM   3794  H  HG2  . GLU A  1 266 ? 76.634  -70.268  -26.086 1.00 40.20  ? 246 GLU A HG2  1 
ATOM   3795  H  HG3  . GLU A  1 266 ? 76.831  -70.446  -24.332 1.00 40.82  ? 246 GLU A HG3  1 
ATOM   3796  N  N    . PHE A  1 267 ? 81.320  -68.667  -24.643 1.00 24.97  ? 247 PHE A N    1 
ATOM   3797  C  CA   . PHE A  1 267 ? 82.625  -68.064  -24.958 1.00 24.53  ? 247 PHE A CA   1 
ATOM   3798  C  C    . PHE A  1 267 ? 83.708  -69.145  -25.187 1.00 28.66  ? 247 PHE A C    1 
ATOM   3799  O  O    . PHE A  1 267 ? 84.487  -69.031  -26.135 1.00 28.90  ? 247 PHE A O    1 
ATOM   3800  C  CB   . PHE A  1 267 ? 83.077  -67.103  -23.848 1.00 25.64  ? 247 PHE A CB   1 
ATOM   3801  C  CG   . PHE A  1 267 ? 84.406  -66.458  -24.170 1.00 26.49  ? 247 PHE A CG   1 
ATOM   3802  C  CD1  . PHE A  1 267 ? 84.487  -65.407  -25.088 1.00 32.56  ? 247 PHE A CD1  1 
ATOM   3803  C  CD2  . PHE A  1 267 ? 85.581  -66.927  -23.604 1.00 26.23  ? 247 PHE A CD2  1 
ATOM   3804  C  CE1  . PHE A  1 267 ? 85.724  -64.836  -25.424 1.00 32.26  ? 247 PHE A CE1  1 
ATOM   3805  C  CE2  . PHE A  1 267 ? 86.819  -66.339  -23.927 1.00 28.76  ? 247 PHE A CE2  1 
ATOM   3806  C  CZ   . PHE A  1 267 ? 86.875  -65.293  -24.828 1.00 27.94  ? 247 PHE A CZ   1 
ATOM   3807  H  H    . PHE A  1 267 ? 80.962  -68.421  -23.725 1.00 26.04  ? 247 PHE A H    1 
ATOM   3808  H  HA   . PHE A  1 267 ? 82.525  -67.481  -25.868 1.00 23.08  ? 247 PHE A HA   1 
ATOM   3809  H  HB2  . PHE A  1 267 ? 82.328  -66.323  -23.731 1.00 25.07  ? 247 PHE A HB2  1 
ATOM   3810  H  HB3  . PHE A  1 267 ? 83.177  -67.663  -22.920 1.00 25.63  ? 247 PHE A HB3  1 
ATOM   3811  H  HD1  . PHE A  1 267 ? 83.576  -65.027  -25.550 1.00 32.53  ? 247 PHE A HD1  1 
ATOM   3812  H  HD2  . PHE A  1 267 ? 85.546  -67.761  -22.905 1.00 25.37  ? 247 PHE A HD2  1 
ATOM   3813  H  HE1  . PHE A  1 267 ? 85.769  -64.002  -26.121 1.00 32.42  ? 247 PHE A HE1  1 
ATOM   3814  H  HE2  . PHE A  1 267 ? 87.743  -66.715  -23.495 1.00 24.75  ? 247 PHE A HE2  1 
ATOM   3815  H  HZ   . PHE A  1 267 ? 87.833  -64.846  -25.086 1.00 27.71  ? 247 PHE A HZ   1 
ATOM   3816  N  N    . ILE A  1 268 ? 83.735  -70.185  -24.366 1.00 26.97  ? 248 ILE A N    1 
ATOM   3817  C  CA   . ILE A  1 268 ? 84.735  -71.265  -24.494 1.00 27.93  ? 248 ILE A CA   1 
ATOM   3818  C  C    . ILE A  1 268 ? 84.582  -72.001  -25.814 1.00 29.67  ? 248 ILE A C    1 
ATOM   3819  O  O    . ILE A  1 268 ? 85.575  -72.209  -26.510 1.00 26.86  ? 248 ILE A O    1 
ATOM   3820  C  CB   . ILE A  1 268 ? 84.648  -72.231  -23.276 1.00 29.91  ? 248 ILE A CB   1 
ATOM   3821  C  CG1  . ILE A  1 268 ? 85.184  -71.537  -22.005 1.00 28.90  ? 248 ILE A CG1  1 
ATOM   3822  C  CG2  . ILE A  1 268 ? 85.443  -73.541  -23.522 1.00 29.92  ? 248 ILE A CG2  1 
ATOM   3823  C  CD1  . ILE A  1 268 ? 84.698  -72.204  -20.728 1.00 37.03  ? 248 ILE A CD1  1 
ATOM   3824  H  H    . ILE A  1 268 ? 83.081  -70.330  -23.603 1.00 27.19  ? 248 ILE A H    1 
ATOM   3825  H  HA   . ILE A  1 268 ? 85.727  -70.817  -24.484 1.00 28.60  ? 248 ILE A HA   1 
ATOM   3826  H  HB   . ILE A  1 268 ? 83.604  -72.500  -23.118 1.00 30.05  ? 248 ILE A HB   1 
ATOM   3827  H  HG12 . ILE A  1 268 ? 86.271  -71.600  -22.001 1.00 29.01  ? 248 ILE A HG12 1 
ATOM   3828  H  HG13 . ILE A  1 268 ? 84.875  -70.496  -22.001 1.00 27.09  ? 248 ILE A HG13 1 
ATOM   3829  H  HG21 . ILE A  1 268 ? 85.472  -74.151  -22.622 1.00 25.30  ? 248 ILE A HG21 1 
ATOM   3830  H  HG22 . ILE A  1 268 ? 84.960  -74.108  -24.317 1.00 31.53  ? 248 ILE A HG22 1 
ATOM   3831  H  HG23 . ILE A  1 268 ? 86.455  -73.277  -23.820 1.00 31.39  ? 248 ILE A HG23 1 
ATOM   3832  H  HD11 . ILE A  1 268 ? 85.283  -71.814  -19.897 1.00 38.70  ? 248 ILE A HD11 1 
ATOM   3833  H  HD12 . ILE A  1 268 ? 83.648  -71.947  -20.588 1.00 38.47  ? 248 ILE A HD12 1 
ATOM   3834  H  HD13 . ILE A  1 268 ? 84.799  -73.283  -20.788 1.00 35.77  ? 248 ILE A HD13 1 
ATOM   3835  N  N    . LEU A  1 269 ? 83.343  -72.380  -26.186 1.00 29.43  ? 249 LEU A N    1 
ATOM   3836  C  CA   . LEU A  1 269 ? 83.118  -73.122  -27.416 1.00 29.67  ? 249 LEU A CA   1 
ATOM   3837  C  C    . LEU A  1 269 ? 83.471  -72.300  -28.653 1.00 34.38  ? 249 LEU A C    1 
ATOM   3838  O  O    . LEU A  1 269 ? 84.126  -72.799  -29.571 1.00 34.52  ? 249 LEU A O    1 
ATOM   3839  C  CB   . LEU A  1 269 ? 81.660  -73.634  -27.495 1.00 29.54  ? 249 LEU A CB   1 
ATOM   3840  C  CG   . LEU A  1 269 ? 81.238  -74.569  -26.370 1.00 31.49  ? 249 LEU A CG   1 
ATOM   3841  C  CD1  . LEU A  1 269 ? 79.771  -75.016  -26.532 1.00 30.37  ? 249 LEU A CD1  1 
ATOM   3842  C  CD2  . LEU A  1 269 ? 82.174  -75.755  -26.220 1.00 25.37  ? 249 LEU A CD2  1 
ATOM   3843  H  H    . LEU A  1 269 ? 82.503  -72.149  -25.666 1.00 30.81  ? 249 LEU A H    1 
ATOM   3844  H  HA   . LEU A  1 269 ? 83.787  -73.982  -27.432 1.00 31.31  ? 249 LEU A HA   1 
ATOM   3845  H  HB2  . LEU A  1 269 ? 80.988  -72.779  -27.490 1.00 29.07  ? 249 LEU A HB2  1 
ATOM   3846  H  HB3  . LEU A  1 269 ? 81.547  -74.183  -28.429 1.00 29.19  ? 249 LEU A HB3  1 
ATOM   3847  H  HG   . LEU A  1 269 ? 81.296  -74.021  -25.434 1.00 32.82  ? 249 LEU A HG   1 
ATOM   3848  H  HD11 . LEU A  1 269 ? 79.488  -75.585  -25.645 1.00 29.25  ? 249 LEU A HD11 1 
ATOM   3849  H  HD12 . LEU A  1 269 ? 79.145  -74.133  -26.630 1.00 29.92  ? 249 LEU A HD12 1 
ATOM   3850  H  HD13 . LEU A  1 269 ? 79.685  -75.639  -27.419 1.00 31.24  ? 249 LEU A HD13 1 
ATOM   3851  H  HD21 . LEU A  1 269 ? 81.736  -76.438  -25.494 1.00 27.30  ? 249 LEU A HD21 1 
ATOM   3852  H  HD22 . LEU A  1 269 ? 82.285  -76.246  -27.183 1.00 24.14  ? 249 LEU A HD22 1 
ATOM   3853  H  HD23 . LEU A  1 269 ? 83.138  -75.415  -25.845 1.00 23.29  ? 249 LEU A HD23 1 
ATOM   3854  N  N    . GLU A  1 270 ? 83.090  -71.036  -28.660 1.00 31.34  ? 250 GLU A N    1 
ATOM   3855  C  CA   . GLU A  1 270 ? 83.430  -70.149  -29.751 1.00 31.10  ? 250 GLU A CA   1 
ATOM   3856  C  C    . GLU A  1 270 ? 84.955  -69.970  -29.843 1.00 36.37  ? 250 GLU A C    1 
ATOM   3857  O  O    . GLU A  1 270 ? 85.523  -70.044  -30.936 1.00 34.85  ? 250 GLU A O    1 
ATOM   3858  C  CB   . GLU A  1 270 ? 82.734  -68.800  -29.556 1.00 32.07  ? 250 GLU A CB   1 
ATOM   3859  C  CG   . GLU A  1 270 ? 82.860  -67.851  -30.727 1.00 53.41  ? 250 GLU A CG   1 
ATOM   3860  C  CD   . GLU A  1 270 ? 81.887  -66.689  -30.627 1.00 74.72  ? 250 GLU A CD   1 
ATOM   3861  O  OE1  . GLU A  1 270 ? 82.342  -65.572  -30.289 1.00 62.45  ? 250 GLU A OE1  1 
ATOM   3862  O  OE2  . GLU A  1 270 ? 80.661  -66.927  -30.731 1.00 71.42  ? 250 GLU A OE2  1 
ATOM   3863  H  H    . GLU A  1 270 ? 82.544  -70.599  -27.923 1.00 31.90  ? 250 GLU A H    1 
ATOM   3864  H  HA   . GLU A  1 270 ? 83.076  -70.589  -30.682 1.00 31.08  ? 250 GLU A HA   1 
ATOM   3865  H  HB2  . GLU A  1 270 ? 81.675  -68.990  -29.387 1.00 32.61  ? 250 GLU A HB2  1 
ATOM   3866  H  HB3  . GLU A  1 270 ? 83.166  -68.307  -28.688 1.00 30.67  ? 250 GLU A HB3  1 
ATOM   3867  H  HG2  . GLU A  1 270 ? 83.866  -67.434  -30.739 1.00 53.84  ? 250 GLU A HG2  1 
ATOM   3868  H  HG3  . GLU A  1 270 ? 82.691  -68.409  -31.648 1.00 53.72  ? 250 GLU A HG3  1 
ATOM   3869  N  N    . THR A  1 271 ? 85.619  -69.775  -28.703 1.00 32.88  ? 251 THR A N    1 
ATOM   3870  C  CA   . THR A  1 271 ? 87.082  -69.585  -28.669 1.00 33.99  ? 251 THR A CA   1 
ATOM   3871  C  C    . THR A  1 271 ? 87.825  -70.840  -29.142 1.00 36.52  ? 251 THR A C    1 
ATOM   3872  O  O    . THR A  1 271 ? 88.732  -70.715  -29.940 1.00 35.02  ? 251 THR A O    1 
ATOM   3873  C  CB   . THR A  1 271 ? 87.527  -69.194  -27.256 1.00 39.56  ? 251 THR A CB   1 
ATOM   3874  O  OG1  . THR A  1 271 ? 86.820  -68.032  -26.924 1.00 36.60  ? 251 THR A OG1  1 
ATOM   3875  C  CG2  . THR A  1 271 ? 89.024  -68.934  -27.150 1.00 38.78  ? 251 THR A CG2  1 
ATOM   3876  H  H    . THR A  1 271 ? 85.176  -69.723  -27.792 1.00 32.46  ? 251 THR A H    1 
ATOM   3877  H  HA   . THR A  1 271 ? 87.350  -68.774  -29.345 1.00 33.53  ? 251 THR A HA   1 
ATOM   3878  H  HB   . THR A  1 271 ? 87.267  -69.982  -26.553 1.00 39.82  ? 251 THR A HB   1 
ATOM   3879  H  HG1  . THR A  1 271 ? 86.154  -68.206  -26.212 1.00 35.42  ? 251 THR A HG1  1 
ATOM   3880  H  HG21 . THR A  1 271 ? 89.231  -68.350  -26.254 1.00 38.58  ? 251 THR A HG21 1 
ATOM   3881  H  HG22 . THR A  1 271 ? 89.577  -69.868  -27.087 1.00 38.31  ? 251 THR A HG22 1 
ATOM   3882  H  HG23 . THR A  1 271 ? 89.367  -68.383  -28.025 1.00 39.56  ? 251 THR A HG23 1 
ATOM   3883  N  N    . PHE A  1 272 ? 87.439  -72.024  -28.656 1.00 33.03  ? 252 PHE A N    1 
ATOM   3884  C  CA   . PHE A  1 272 ? 88.112  -73.271  -29.031 1.00 32.88  ? 252 PHE A CA   1 
ATOM   3885  C  C    . PHE A  1 272 ? 87.821  -73.676  -30.483 1.00 34.12  ? 252 PHE A C    1 
ATOM   3886  O  O    . PHE A  1 272 ? 88.640  -74.363  -31.047 1.00 33.02  ? 252 PHE A O    1 
ATOM   3887  C  CB   . PHE A  1 272 ? 87.794  -74.404  -28.048 1.00 33.73  ? 252 PHE A CB   1 
ATOM   3888  C  CG   . PHE A  1 272 ? 88.738  -74.315  -26.865 1.00 34.37  ? 252 PHE A CG   1 
ATOM   3889  C  CD1  . PHE A  1 272 ? 88.537  -73.381  -25.864 1.00 37.12  ? 252 PHE A CD1  1 
ATOM   3890  C  CD2  . PHE A  1 272 ? 89.861  -75.126  -26.787 1.00 34.95  ? 252 PHE A CD2  1 
ATOM   3891  C  CE1  . PHE A  1 272 ? 89.441  -73.259  -24.805 1.00 36.75  ? 252 PHE A CE1  1 
ATOM   3892  C  CE2  . PHE A  1 272 ? 90.743  -75.026  -25.706 1.00 36.39  ? 252 PHE A CE2  1 
ATOM   3893  C  CZ   . PHE A  1 272 ? 90.545  -74.078  -24.743 1.00 33.64  ? 252 PHE A CZ   1 
ATOM   3894  H  H    . PHE A  1 272 ? 86.672  -72.139  -27.998 1.00 34.40  ? 252 PHE A H    1 
ATOM   3895  H  HA   . PHE A  1 272 ? 89.186  -73.100  -28.970 1.00 34.32  ? 252 PHE A HA   1 
ATOM   3896  H  HB2  . PHE A  1 272 ? 86.766  -74.334  -27.694 1.00 34.28  ? 252 PHE A HB2  1 
ATOM   3897  H  HB3  . PHE A  1 272 ? 87.944  -75.365  -28.538 1.00 33.13  ? 252 PHE A HB3  1 
ATOM   3898  H  HD1  . PHE A  1 272 ? 87.696  -72.696  -25.918 1.00 37.55  ? 252 PHE A HD1  1 
ATOM   3899  H  HD2  . PHE A  1 272 ? 90.037  -75.878  -27.556 1.00 35.70  ? 252 PHE A HD2  1 
ATOM   3900  H  HE1  . PHE A  1 272 ? 89.277  -72.522  -24.024 1.00 36.70  ? 252 PHE A HE1  1 
ATOM   3901  H  HE2  . PHE A  1 272 ? 91.625  -75.659  -25.657 1.00 36.90  ? 252 PHE A HE2  1 
ATOM   3902  H  HZ   . PHE A  1 272 ? 91.229  -73.988  -23.904 1.00 32.60  ? 252 PHE A HZ   1 
ATOM   3903  N  N    . ALA A  1 273 ? 86.710  -73.203  -31.079 1.00 34.73  ? 253 ALA A N    1 
ATOM   3904  C  CA   . ALA A  1 273 ? 86.378  -73.342  -32.499 1.00 38.53  ? 253 ALA A CA   1 
ATOM   3905  C  C    . ALA A  1 273 ? 86.486  -74.791  -32.990 1.00 38.06  ? 253 ALA A C    1 
ATOM   3906  O  O    . ALA A  1 273 ? 85.704  -75.607  -32.538 1.00 36.61  ? 253 ALA A O    1 
ATOM   3907  C  CB   . ALA A  1 273 ? 87.273  -72.404  -33.340 1.00 41.19  ? 253 ALA A CB   1 
ATOM   3908  H  H    . ALA A  1 273 ? 85.980  -72.701  -30.583 1.00 34.97  ? 253 ALA A H    1 
ATOM   3909  H  HA   . ALA A  1 273 ? 85.347  -73.018  -32.644 1.00 38.85  ? 253 ALA A HA   1 
ATOM   3910  H  HB1  . ALA A  1 273 ? 87.084  -72.569  -34.401 1.00 39.84  ? 253 ALA A HB1  1 
ATOM   3911  H  HB2  . ALA A  1 273 ? 87.021  -71.374  -33.088 1.00 40.57  ? 253 ALA A HB2  1 
ATOM   3912  H  HB3  . ALA A  1 273 ? 88.322  -72.580  -33.099 1.00 42.23  ? 253 ALA A HB3  1 
ATOM   3913  N  N    . ASP A  1 274 ? 87.463  -75.137  -33.821 1.00 37.01  ? 254 ASP A N    1 
ATOM   3914  C  CA   . ASP A  1 274 ? 87.590  -76.521  -34.343 1.00 36.91  ? 254 ASP A CA   1 
ATOM   3915  C  C    . ASP A  1 274 ? 88.015  -77.526  -33.251 1.00 37.28  ? 254 ASP A C    1 
ATOM   3916  O  O    . ASP A  1 274 ? 87.943  -78.716  -33.488 1.00 39.50  ? 254 ASP A O    1 
ATOM   3917  C  CB   . ASP A  1 274 ? 88.554  -76.594  -35.560 1.00 38.73  ? 254 ASP A CB   1 
ATOM   3918  C  CG   . ASP A  1 274 ? 89.889  -75.912  -35.345 1.00 51.54  ? 254 ASP A CG   1 
ATOM   3919  O  OD1  . ASP A  1 274 ? 89.890  -74.690  -35.025 1.00 53.91  ? 254 ASP A OD1  1 
ATOM   3920  O  OD2  . ASP A  1 274 ? 90.932  -76.582  -35.514 1.00 55.50  ? 254 ASP A OD2  1 
ATOM   3921  H  H    . ASP A  1 274 ? 88.189  -74.518  -34.166 1.00 37.51  ? 254 ASP A H    1 
ATOM   3922  H  HA   . ASP A  1 274 ? 86.608  -76.836  -34.692 1.00 36.58  ? 254 ASP A HA   1 
ATOM   3923  H  HB2  . ASP A  1 274 ? 88.744  -77.640  -35.790 1.00 40.04  ? 254 ASP A HB2  1 
ATOM   3924  H  HB3  . ASP A  1 274 ? 88.078  -76.112  -36.411 1.00 38.01  ? 254 ASP A HB3  1 
ATOM   3925  N  N    . ASN A  1 275 ? 88.414  -77.062  -32.067 1.00 30.94  ? 255 ASN A N    1 
ATOM   3926  C  CA   . ASN A  1 275 ? 88.690  -77.907  -30.909 1.00 29.01  ? 255 ASN A CA   1 
ATOM   3927  C  C    . ASN A  1 275 ? 87.553  -77.838  -29.885 1.00 32.60  ? 255 ASN A C    1 
ATOM   3928  O  O    . ASN A  1 275 ? 87.746  -78.252  -28.745 1.00 29.30  ? 255 ASN A O    1 
ATOM   3929  C  CB   . ASN A  1 275 ? 90.003  -77.473  -30.230 1.00 33.90  ? 255 ASN A CB   1 
ATOM   3930  C  CG   . ASN A  1 275 ? 91.203  -77.774  -31.054 1.00 40.34  ? 255 ASN A CG   1 
ATOM   3931  O  OD1  . ASN A  1 275 ? 91.353  -78.886  -31.534 1.00 31.50  ? 255 ASN A OD1  1 
ATOM   3932  N  ND2  . ASN A  1 275 ? 92.148  -76.858  -31.145 1.00 38.44  ? 255 ASN A ND2  1 
ATOM   3933  H  H    . ASN A  1 275 ? 88.629  -76.087  -31.882 1.00 31.52  ? 255 ASN A H    1 
ATOM   3934  H  HA   . ASN A  1 275 ? 88.803  -78.945  -31.209 1.00 28.57  ? 255 ASN A HA   1 
ATOM   3935  H  HB2  . ASN A  1 275 ? 89.972  -76.405  -30.018 1.00 34.73  ? 255 ASN A HB2  1 
ATOM   3936  H  HB3  . ASN A  1 275 ? 90.124  -78.026  -29.302 1.00 31.92  ? 255 ASN A HB3  1 
ATOM   3937  H  HD21 . ASN A  1 275 ? 92.977  -77.041  -31.702 1.00 38.77  ? 255 ASN A HD21 1 
ATOM   3938  H  HD22 . ASN A  1 275 ? 92.071  -75.981  -30.641 1.00 39.90  ? 255 ASN A HD22 1 
ATOM   3939  N  N    . ALA A  1 276 ? 86.361  -77.342  -30.266 1.00 30.88  ? 256 ALA A N    1 
ATOM   3940  C  CA   . ALA A  1 276 ? 85.236  -77.227  -29.311 1.00 30.41  ? 256 ALA A CA   1 
ATOM   3941  C  C    . ALA A  1 276 ? 84.763  -78.594  -28.780 1.00 34.76  ? 256 ALA A C    1 
ATOM   3942  O  O    . ALA A  1 276 ? 84.321  -78.666  -27.628 1.00 32.10  ? 256 ALA A O    1 
ATOM   3943  C  CB   . ALA A  1 276 ? 84.064  -76.483  -29.946 1.00 31.03  ? 256 ALA A CB   1 
ATOM   3944  H  H    . ALA A  1 276 ? 86.129  -77.032  -31.203 1.00 29.57  ? 256 ALA A H    1 
ATOM   3945  H  HA   . ALA A  1 276 ? 85.569  -76.642  -28.456 1.00 30.19  ? 256 ALA A HA   1 
ATOM   3946  H  HB1  . ALA A  1 276 ? 83.200  -76.546  -29.288 1.00 30.34  ? 256 ALA A HB1  1 
ATOM   3947  H  HB2  . ALA A  1 276 ? 84.343  -75.442  -30.090 1.00 31.09  ? 256 ALA A HB2  1 
ATOM   3948  H  HB3  . ALA A  1 276 ? 83.836  -76.940  -30.907 1.00 32.91  ? 256 ALA A HB3  1 
ATOM   3949  N  N    . ASP A  1 277 ? 84.918  -79.684  -29.542 1.00 33.70  ? 257 ASP A N    1 
ATOM   3950  C  CA   . ASP A  1 277 ? 84.511  -81.005  -29.027 1.00 31.77  ? 257 ASP A CA   1 
ATOM   3951  C  C    . ASP A  1 277 ? 85.582  -81.631  -28.080 1.00 34.89  ? 257 ASP A C    1 
ATOM   3952  O  O    . ASP A  1 277 ? 85.349  -82.701  -27.537 1.00 34.63  ? 257 ASP A O    1 
ATOM   3953  C  CB   . ASP A  1 277 ? 84.136  -81.967  -30.152 1.00 33.37  ? 257 ASP A CB   1 
ATOM   3954  C  CG   . ASP A  1 277 ? 85.226  -82.350  -31.113 1.00 41.38  ? 257 ASP A CG   1 
ATOM   3955  O  OD1  . ASP A  1 277 ? 86.139  -81.548  -31.299 1.00 37.42  ? 257 ASP A OD1  1 
ATOM   3956  O  OD2  . ASP A  1 277 ? 85.104  -83.430  -31.752 1.00 52.02  ? 257 ASP A OD2  1 
ATOM   3957  H  H    . ASP A  1 277 ? 85.301  -79.684  -30.483 1.00 35.57  ? 257 ASP A H    1 
ATOM   3958  H  HA   . ASP A  1 277 ? 83.602  -80.886  -28.441 1.00 29.42  ? 257 ASP A HA   1 
ATOM   3959  H  HB2  . ASP A  1 277 ? 83.753  -82.880  -29.694 1.00 34.28  ? 257 ASP A HB2  1 
ATOM   3960  H  HB3  . ASP A  1 277 ? 83.345  -81.511  -30.746 1.00 33.93  ? 257 ASP A HB3  1 
ATOM   3961  N  N    . HIS A  1 278 ? 86.714  -80.934  -27.842 1.00 31.60  ? 258 HIS A N    1 
ATOM   3962  C  CA   . HIS A  1 278 ? 87.742  -81.327  -26.887 1.00 31.00  ? 258 HIS A CA   1 
ATOM   3963  C  C    . HIS A  1 278 ? 87.442  -80.722  -25.495 1.00 35.60  ? 258 HIS A C    1 
ATOM   3964  O  O    . HIS A  1 278 ? 88.240  -80.878  -24.571 1.00 34.41  ? 258 HIS A O    1 
ATOM   3965  C  CB   . HIS A  1 278 ? 89.122  -80.819  -27.346 1.00 30.86  ? 258 HIS A CB   1 
ATOM   3966  C  CG   . HIS A  1 278 ? 89.612  -81.349  -28.658 1.00 35.29  ? 258 HIS A CG   1 
ATOM   3967  N  ND1  . HIS A  1 278 ? 90.967  -81.400  -28.954 1.00 36.45  ? 258 HIS A ND1  1 
ATOM   3968  C  CD2  . HIS A  1 278 ? 88.922  -81.787  -29.740 1.00 37.29  ? 258 HIS A CD2  1 
ATOM   3969  C  CE1  . HIS A  1 278 ? 91.050  -81.870  -30.186 1.00 35.46  ? 258 HIS A CE1  1 
ATOM   3970  N  NE2  . HIS A  1 278 ? 89.843  -82.108  -30.700 1.00 36.10  ? 258 HIS A NE2  1 
ATOM   3971  H  H    . HIS A  1 278 ? 86.972  -80.076  -28.316 1.00 31.53  ? 258 HIS A H    1 
ATOM   3972  H  HA   . HIS A  1 278 ? 87.781  -82.411  -26.794 1.00 30.23  ? 258 HIS A HA   1 
ATOM   3973  H  HB2  . HIS A  1 278 ? 89.113  -79.732  -27.390 1.00 29.23  ? 258 HIS A HB2  1 
ATOM   3974  H  HB3  . HIS A  1 278 ? 89.838  -81.119  -26.586 1.00 31.49  ? 258 HIS A HB3  1 
ATOM   3975  H  HD1  . HIS A  1 278 ? 91.733  -81.141  -28.339 1.00 36.01  ? 258 HIS A HD1  1 
ATOM   3976  H  HD2  . HIS A  1 278 ? 87.845  -81.904  -29.820 1.00 38.09  ? 258 HIS A HD2  1 
ATOM   3977  H  HE1  . HIS A  1 278 ? 91.985  -82.039  -30.717 1.00 34.79  ? 258 HIS A HE1  1 
ATOM   3978  N  N    . ILE A  1 279 ? 86.301  -80.016  -25.350 1.00 31.98  ? 259 ILE A N    1 
ATOM   3979  C  CA   . ILE A  1 279 ? 85.932  -79.332  -24.139 1.00 31.35  ? 259 ILE A CA   1 
ATOM   3980  C  C    . ILE A  1 279 ? 84.891  -80.061  -23.329 1.00 31.59  ? 259 ILE A C    1 
ATOM   3981  O  O    . ILE A  1 279 ? 83.823  -80.412  -23.836 1.00 26.81  ? 259 ILE A O    1 
ATOM   3982  C  CB   . ILE A  1 279 ? 85.421  -77.895  -24.508 1.00 33.20  ? 259 ILE A CB   1 
ATOM   3983  C  CG1  . ILE A  1 279 ? 86.559  -77.038  -25.129 1.00 34.21  ? 259 ILE A CG1  1 
ATOM   3984  C  CG2  . ILE A  1 279 ? 84.752  -77.202  -23.304 1.00 29.35  ? 259 ILE A CG2  1 
ATOM   3985  C  CD1  . ILE A  1 279 ? 87.788  -76.878  -24.273 1.00 34.55  ? 259 ILE A CD1  1 
ATOM   3986  H  H    . ILE A  1 279 ? 85.588  -79.902  -26.064 1.00 33.55  ? 259 ILE A H    1 
ATOM   3987  H  HA   . ILE A  1 279 ? 86.816  -79.197  -23.521 1.00 33.97  ? 259 ILE A HA   1 
ATOM   3988  H  HB   . ILE A  1 279 ? 84.644  -77.997  -25.264 1.00 33.07  ? 259 ILE A HB   1 
ATOM   3989  H  HG12 . ILE A  1 279 ? 86.873  -77.492  -26.066 1.00 33.92  ? 259 ILE A HG12 1 
ATOM   3990  H  HG13 . ILE A  1 279 ? 86.175  -76.038  -25.329 1.00 35.77  ? 259 ILE A HG13 1 
ATOM   3991  H  HG21 . ILE A  1 279 ? 84.607  -76.153  -23.550 1.00 29.21  ? 259 ILE A HG21 1 
ATOM   3992  H  HG22 . ILE A  1 279 ? 83.775  -77.650  -23.128 1.00 27.70  ? 259 ILE A HG22 1 
ATOM   3993  H  HG23 . ILE A  1 279 ? 85.381  -77.304  -22.423 1.00 28.52  ? 259 ILE A HG23 1 
ATOM   3994  H  HD11 . ILE A  1 279 ? 88.311  -75.975  -24.585 1.00 34.29  ? 259 ILE A HD11 1 
ATOM   3995  H  HD12 . ILE A  1 279 ? 87.504  -76.797  -23.225 1.00 35.99  ? 259 ILE A HD12 1 
ATOM   3996  H  HD13 . ILE A  1 279 ? 88.433  -77.743  -24.413 1.00 33.64  ? 259 ILE A HD13 1 
ATOM   3997  N  N    . ALA A  1 280 ? 85.172  -80.182  -22.029 1.00 31.53  ? 260 ALA A N    1 
ATOM   3998  C  CA   . ALA A  1 280 ? 84.242  -80.664  -21.004 1.00 32.64  ? 260 ALA A CA   1 
ATOM   3999  C  C    . ALA A  1 280 ? 83.883  -79.469  -20.123 1.00 34.98  ? 260 ALA A C    1 
ATOM   4000  O  O    . ALA A  1 280 ? 84.673  -78.518  -20.034 1.00 34.26  ? 260 ALA A O    1 
ATOM   4001  C  CB   . ALA A  1 280 ? 84.873  -81.772  -20.171 1.00 33.75  ? 260 ALA A CB   1 
ATOM   4002  H  H    . ALA A  1 280 ? 86.072  -79.942  -21.625 1.00 32.44  ? 260 ALA A H    1 
ATOM   4003  H  HA   . ALA A  1 280 ? 83.335  -81.059  -21.456 1.00 32.32  ? 260 ALA A HA   1 
ATOM   4004  H  HB1  . ALA A  1 280 ? 84.204  -82.006  -19.345 1.00 32.34  ? 260 ALA A HB1  1 
ATOM   4005  H  HB2  . ALA A  1 280 ? 85.027  -82.650  -20.794 1.00 34.31  ? 260 ALA A HB2  1 
ATOM   4006  H  HB3  . ALA A  1 280 ? 85.831  -81.414  -19.803 1.00 33.98  ? 260 ALA A HB3  1 
ATOM   4007  N  N    . PHE A  1 281 ? 82.681  -79.464  -19.546 1.00 30.83  ? 261 PHE A N    1 
ATOM   4008  C  CA   . PHE A  1 281 ? 82.279  -78.383  -18.614 1.00 31.09  ? 261 PHE A CA   1 
ATOM   4009  C  C    . PHE A  1 281 ? 82.165  -78.927  -17.206 1.00 33.68  ? 261 PHE A C    1 
ATOM   4010  O  O    . PHE A  1 281 ? 81.384  -79.840  -16.938 1.00 30.20  ? 261 PHE A O    1 
ATOM   4011  C  CB   . PHE A  1 281 ? 80.953  -77.715  -19.017 1.00 31.67  ? 261 PHE A CB   1 
ATOM   4012  C  CG   . PHE A  1 281 ? 81.024  -76.872  -20.273 1.00 31.72  ? 261 PHE A CG   1 
ATOM   4013  C  CD1  . PHE A  1 281 ? 82.116  -76.039  -20.519 1.00 32.91  ? 261 PHE A CD1  1 
ATOM   4014  C  CD2  . PHE A  1 281 ? 79.982  -76.872  -21.187 1.00 28.84  ? 261 PHE A CD2  1 
ATOM   4015  C  CE1  . PHE A  1 281 ? 82.184  -75.291  -21.677 1.00 31.05  ? 261 PHE A CE1  1 
ATOM   4016  C  CE2  . PHE A  1 281 ? 80.033  -76.076  -22.319 1.00 29.40  ? 261 PHE A CE2  1 
ATOM   4017  C  CZ   . PHE A  1 281 ? 81.144  -75.316  -22.571 1.00 27.39  ? 261 PHE A CZ   1 
ATOM   4018  H  H    . PHE A  1 281 ? 81.975  -80.180  -19.688 1.00 30.17  ? 261 PHE A H    1 
ATOM   4019  H  HA   . PHE A  1 281 ? 83.050  -77.619  -18.586 1.00 29.60  ? 261 PHE A HA   1 
ATOM   4020  H  HB2  . PHE A  1 281 ? 80.215  -78.500  -19.183 1.00 32.50  ? 261 PHE A HB2  1 
ATOM   4021  H  HB3  . PHE A  1 281 ? 80.621  -77.078  -18.203 1.00 32.36  ? 261 PHE A HB3  1 
ATOM   4022  H  HD1  . PHE A  1 281 ? 82.953  -75.983  -19.827 1.00 33.52  ? 261 PHE A HD1  1 
ATOM   4023  H  HD2  . PHE A  1 281 ? 79.112  -77.503  -21.021 1.00 30.02  ? 261 PHE A HD2  1 
ATOM   4024  H  HE1  . PHE A  1 281 ? 83.040  -74.643  -21.859 1.00 32.29  ? 261 PHE A HE1  1 
ATOM   4025  H  HE2  . PHE A  1 281 ? 79.239  -76.125  -23.060 1.00 28.75  ? 261 PHE A HE2  1 
ATOM   4026  H  HZ   . PHE A  1 281 ? 81.189  -74.701  -23.467 1.00 27.24  ? 261 PHE A HZ   1 
ATOM   4027  N  N    . LEU A  1 282 ? 82.919  -78.312  -16.300 1.00 32.06  ? 262 LEU A N    1 
ATOM   4028  C  CA   . LEU A  1 282 ? 82.937  -78.663  -14.895 1.00 30.38  ? 262 LEU A CA   1 
ATOM   4029  C  C    . LEU A  1 282 ? 81.931  -77.808  -14.116 1.00 33.44  ? 262 LEU A C    1 
ATOM   4030  O  O    . LEU A  1 282 ? 81.876  -76.580  -14.270 1.00 31.90  ? 262 LEU A O    1 
ATOM   4031  C  CB   . LEU A  1 282 ? 84.362  -78.498  -14.332 1.00 31.49  ? 262 LEU A CB   1 
ATOM   4032  C  CG   . LEU A  1 282 ? 84.555  -78.934  -12.863 1.00 35.54  ? 262 LEU A CG   1 
ATOM   4033  C  CD1  . LEU A  1 282 ? 85.920  -79.456  -12.654 1.00 37.37  ? 262 LEU A CD1  1 
ATOM   4034  C  CD2  . LEU A  1 282 ? 84.306  -77.791  -11.869 1.00 40.25  ? 262 LEU A CD2  1 
ATOM   4035  H  H    . LEU A  1 282 ? 83.521  -77.524  -16.514 1.00 32.54  ? 262 LEU A H    1 
ATOM   4036  H  HA   . LEU A  1 282 ? 82.670  -79.706  -14.778 1.00 29.85  ? 262 LEU A HA   1 
ATOM   4037  H  HB2  . LEU A  1 282 ? 85.025  -79.098  -14.952 1.00 30.08  ? 262 LEU A HB2  1 
ATOM   4038  H  HB3  . LEU A  1 282 ? 84.671  -77.458  -14.411 1.00 33.04  ? 262 LEU A HB3  1 
ATOM   4039  H  HG   . LEU A  1 282 ? 83.856  -79.740  -12.644 1.00 34.24  ? 262 LEU A HG   1 
ATOM   4040  H  HD11 . LEU A  1 282 ? 86.028  -79.751  -11.609 1.00 38.27  ? 262 LEU A HD11 1 
ATOM   4041  H  HD12 . LEU A  1 282 ? 86.066  -80.330  -13.289 1.00 38.13  ? 262 LEU A HD12 1 
ATOM   4042  H  HD13 . LEU A  1 282 ? 86.637  -78.676  -12.906 1.00 35.52  ? 262 LEU A HD13 1 
ATOM   4043  H  HD21 . LEU A  1 282 ? 84.502  -78.144  -10.858 1.00 40.44  ? 262 LEU A HD21 1 
ATOM   4044  H  HD22 . LEU A  1 282 ? 84.983  -76.969  -12.100 1.00 41.48  ? 262 LEU A HD22 1 
ATOM   4045  H  HD23 . LEU A  1 282 ? 83.277  -77.442  -11.924 1.00 40.56  ? 262 LEU A HD23 1 
ATOM   4046  N  N    . VAL A  1 283 ? 81.123  -78.473  -13.292 1.00 31.38  ? 263 VAL A N    1 
ATOM   4047  C  CA   . VAL A  1 283 ? 80.140  -77.823  -12.430 1.00 32.28  ? 263 VAL A CA   1 
ATOM   4048  C  C    . VAL A  1 283 ? 80.308  -78.333  -10.995 1.00 36.20  ? 263 VAL A C    1 
ATOM   4049  O  O    . VAL A  1 283 ? 80.333  -79.539  -10.778 1.00 36.47  ? 263 VAL A O    1 
ATOM   4050  C  CB   . VAL A  1 283 ? 78.698  -78.038  -12.944 1.00 35.64  ? 263 VAL A CB   1 
ATOM   4051  C  CG1  . VAL A  1 283 ? 77.695  -77.342  -12.031 1.00 35.44  ? 263 VAL A CG1  1 
ATOM   4052  C  CG2  . VAL A  1 283 ? 78.558  -77.529  -14.390 1.00 34.86  ? 263 VAL A CG2  1 
ATOM   4053  H  H    . VAL A  1 283 ? 81.109  -79.482  -13.203 1.00 31.84  ? 263 VAL A H    1 
ATOM   4054  H  HA   . VAL A  1 283 ? 80.302  -76.747  -12.434 1.00 32.21  ? 263 VAL A HA   1 
ATOM   4055  H  HB   . VAL A  1 283 ? 78.473  -79.103  -12.942 1.00 34.17  ? 263 VAL A HB   1 
ATOM   4056  H  HG11 . VAL A  1 283 ? 76.731  -77.308  -12.536 1.00 37.03  ? 263 VAL A HG11 1 
ATOM   4057  H  HG12 . VAL A  1 283 ? 77.589  -77.906  -11.106 1.00 35.89  ? 263 VAL A HG12 1 
ATOM   4058  H  HG13 . VAL A  1 283 ? 78.042  -76.333  -11.816 1.00 34.13  ? 263 VAL A HG13 1 
ATOM   4059  H  HG21 . VAL A  1 283 ? 77.509  -77.576  -14.682 1.00 34.92  ? 263 VAL A HG21 1 
ATOM   4060  H  HG22 . VAL A  1 283 ? 78.916  -76.503  -14.433 1.00 33.99  ? 263 VAL A HG22 1 
ATOM   4061  H  HG23 . VAL A  1 283 ? 79.145  -78.165  -15.050 1.00 33.67  ? 263 VAL A HG23 1 
ATOM   4062  N  N    . ASP A  1 284 ? 80.414  -77.412  -10.035 1.00 33.71  ? 264 ASP A N    1 
ATOM   4063  C  CA   . ASP A  1 284 ? 80.473  -77.712  -8.587  1.00 35.67  ? 264 ASP A CA   1 
ATOM   4064  C  C    . ASP A  1 284 ? 79.031  -77.979  -8.127  1.00 40.90  ? 264 ASP A C    1 
ATOM   4065  O  O    . ASP A  1 284 ? 78.367  -77.106  -7.573  1.00 41.06  ? 264 ASP A O    1 
ATOM   4066  C  CB   . ASP A  1 284 ? 81.118  -76.574  -7.800  1.00 37.70  ? 264 ASP A CB   1 
ATOM   4067  C  CG   . ASP A  1 284 ? 82.613  -76.676  -7.683  1.00 58.57  ? 264 ASP A CG   1 
ATOM   4068  O  OD1  . ASP A  1 284 ? 83.084  -77.589  -6.977  1.00 61.01  ? 264 ASP A OD1  1 
ATOM   4069  O  OD2  . ASP A  1 284 ? 83.315  -75.804  -8.251  1.00 71.59  ? 264 ASP A OD2  1 
ATOM   4070  H  H    . ASP A  1 284 ? 80.469  -76.418  -10.238 1.00 33.96  ? 264 ASP A H    1 
ATOM   4071  H  HA   . ASP A  1 284 ? 81.075  -78.603  -8.426  1.00 36.77  ? 264 ASP A HA   1 
ATOM   4072  H  HB2  . ASP A  1 284 ? 80.880  -75.621  -8.269  1.00 38.25  ? 264 ASP A HB2  1 
ATOM   4073  H  HB3  . ASP A  1 284 ? 80.734  -76.589  -6.783  1.00 38.66  ? 264 ASP A HB3  1 
ATOM   4074  N  N    . GLY A  1 285 ? 78.556  -79.171  -8.463  1.00 37.13  ? 265 GLY A N    1 
ATOM   4075  C  CA   . GLY A  1 285 ? 77.184  -79.595  -8.284  1.00 36.44  ? 265 GLY A CA   1 
ATOM   4076  C  C    . GLY A  1 285 ? 76.678  -79.700  -6.872  1.00 36.87  ? 265 GLY A C    1 
ATOM   4077  O  O    . GLY A  1 285 ? 75.484  -79.547  -6.668  1.00 36.76  ? 265 GLY A O    1 
ATOM   4078  H  H    . GLY A  1 285 ? 79.131  -79.907  -8.859  1.00 37.49  ? 265 GLY A H    1 
ATOM   4079  H  HA2  . GLY A  1 285 ? 76.547  -78.876  -8.797  1.00 37.04  ? 265 GLY A HA2  1 
ATOM   4080  H  HA3  . GLY A  1 285 ? 77.048  -80.564  -8.761  1.00 35.68  ? 265 GLY A HA3  1 
ATOM   4081  N  N    . TYR A  1 286 ? 77.548  -79.963  -5.896  1.00 34.96  ? 266 TYR A N    1 
ATOM   4082  C  CA   . TYR A  1 286 ? 77.092  -80.082  -4.506  1.00 34.29  ? 266 TYR A CA   1 
ATOM   4083  C  C    . TYR A  1 286 ? 76.885  -78.685  -3.912  1.00 39.91  ? 266 TYR A C    1 
ATOM   4084  O  O    . TYR A  1 286 ? 75.868  -78.471  -3.277  1.00 41.38  ? 266 TYR A O    1 
ATOM   4085  C  CB   . TYR A  1 286 ? 78.072  -80.929  -3.654  1.00 34.20  ? 266 TYR A CB   1 
ATOM   4086  C  CG   . TYR A  1 286 ? 77.586  -81.090  -2.231  1.00 36.90  ? 266 TYR A CG   1 
ATOM   4087  C  CD1  . TYR A  1 286 ? 76.637  -82.049  -1.905  1.00 39.72  ? 266 TYR A CD1  1 
ATOM   4088  C  CD2  . TYR A  1 286 ? 78.012  -80.233  -1.231  1.00 35.01  ? 266 TYR A CD2  1 
ATOM   4089  C  CE1  . TYR A  1 286 ? 76.139  -82.163  -0.608  1.00 38.03  ? 266 TYR A CE1  1 
ATOM   4090  C  CE2  . TYR A  1 286 ? 77.486  -80.306  0.053   1.00 38.00  ? 266 TYR A CE2  1 
ATOM   4091  C  CZ   . TYR A  1 286 ? 76.552  -81.281  0.367   1.00 43.59  ? 266 TYR A CZ   1 
ATOM   4092  O  OH   . TYR A  1 286 ? 76.056  -81.416  1.657   1.00 45.42  ? 266 TYR A OH   1 
ATOM   4093  H  H    . TYR A  1 286 ? 78.548  -80.092  -6.015  1.00 35.37  ? 266 TYR A H    1 
ATOM   4094  H  HA   . TYR A  1 286 ? 76.137  -80.606  -4.483  1.00 32.91  ? 266 TYR A HA   1 
ATOM   4095  H  HB2  . TYR A  1 286 ? 78.165  -81.919  -4.096  1.00 32.10  ? 266 TYR A HB2  1 
ATOM   4096  H  HB3  . TYR A  1 286 ? 79.047  -80.444  -3.629  1.00 34.24  ? 266 TYR A HB3  1 
ATOM   4097  H  HD1  . TYR A  1 286 ? 76.294  -82.741  -2.673  1.00 38.94  ? 266 TYR A HD1  1 
ATOM   4098  H  HD2  . TYR A  1 286 ? 78.712  -79.435  -1.467  1.00 34.82  ? 266 TYR A HD2  1 
ATOM   4099  H  HE1  . TYR A  1 286 ? 75.420  -82.942  -0.365  1.00 37.83  ? 266 TYR A HE1  1 
ATOM   4100  H  HE2  . TYR A  1 286 ? 77.832  -79.613  0.820   1.00 38.89  ? 266 TYR A HE2  1 
ATOM   4101  H  HH   . TYR A  1 286 ? 76.221  -80.604  2.203   1.00 45.34  ? 266 TYR A HH   1 
ATOM   4102  N  N    . VAL A  1 287 ? 77.824  -77.740  -4.097  1.00 38.07  ? 267 VAL A N    1 
ATOM   4103  C  CA   . VAL A  1 287 ? 77.674  -76.398  -3.517  1.00 36.41  ? 267 VAL A CA   1 
ATOM   4104  C  C    . VAL A  1 287 ? 76.756  -75.499  -4.346  1.00 35.13  ? 267 VAL A C    1 
ATOM   4105  O  O    . VAL A  1 287 ? 76.038  -74.699  -3.737  1.00 32.29  ? 267 VAL A O    1 
ATOM   4106  C  CB   . VAL A  1 287 ? 78.994  -75.651  -3.184  1.00 40.59  ? 267 VAL A CB   1 
ATOM   4107  C  CG1  . VAL A  1 287 ? 79.748  -76.373  -2.069  1.00 40.65  ? 267 VAL A CG1  1 
ATOM   4108  C  CG2  . VAL A  1 287 ? 79.886  -75.425  -4.391  1.00 41.01  ? 267 VAL A CG2  1 
ATOM   4109  H  H    . VAL A  1 287 ? 78.658  -77.877  -4.658  1.00 39.89  ? 267 VAL A H    1 
ATOM   4110  H  HA   . VAL A  1 287 ? 77.187  -76.516  -2.551  1.00 37.45  ? 267 VAL A HA   1 
ATOM   4111  H  HB   . VAL A  1 287 ? 78.734  -74.661  -2.812  1.00 40.61  ? 267 VAL A HB   1 
ATOM   4112  H  HG11 . VAL A  1 287 ? 80.799  -76.089  -2.105  1.00 41.72  ? 267 VAL A HG11 1 
ATOM   4113  H  HG12 . VAL A  1 287 ? 79.326  -76.082  -1.108  1.00 39.97  ? 267 VAL A HG12 1 
ATOM   4114  H  HG13 . VAL A  1 287 ? 79.641  -77.447  -2.201  1.00 40.14  ? 267 VAL A HG13 1 
ATOM   4115  H  HG21 . VAL A  1 287 ? 80.632  -74.691  -4.093  1.00 41.04  ? 267 VAL A HG21 1 
ATOM   4116  H  HG22 . VAL A  1 287 ? 80.384  -76.364  -4.633  1.00 42.14  ? 267 VAL A HG22 1 
ATOM   4117  H  HG23 . VAL A  1 287 ? 79.326  -75.054  -5.247  1.00 40.38  ? 267 VAL A HG23 1 
ATOM   4118  N  N    . ALA A  1 288 ? 76.815  -75.551  -5.688  1.00 30.67  ? 268 ALA A N    1 
ATOM   4119  C  CA   . ALA A  1 288 ? 75.963  -74.684  -6.529  1.00 31.44  ? 268 ALA A CA   1 
ATOM   4120  C  C    . ALA A  1 288 ? 74.548  -75.298  -6.658  1.00 37.10  ? 268 ALA A C    1 
ATOM   4121  O  O    . ALA A  1 288 ? 73.555  -74.579  -6.842  1.00 33.70  ? 268 ALA A O    1 
ATOM   4122  C  CB   . ALA A  1 288 ? 76.593  -74.476  -7.904  1.00 31.36  ? 268 ALA A CB   1 
ATOM   4123  H  H    . ALA A  1 288 ? 77.428  -76.163  -6.216  1.00 30.61  ? 268 ALA A H    1 
ATOM   4124  H  HA   . ALA A  1 288 ? 75.864  -73.701  -6.074  1.00 31.19  ? 268 ALA A HA   1 
ATOM   4125  H  HB1  . ALA A  1 288 ? 76.014  -73.722  -8.437  1.00 31.05  ? 268 ALA A HB1  1 
ATOM   4126  H  HB2  . ALA A  1 288 ? 77.619  -74.135  -7.773  1.00 29.71  ? 268 ALA A HB2  1 
ATOM   4127  H  HB3  . ALA A  1 288 ? 76.576  -75.415  -8.453  1.00 31.31  ? 268 ALA A HB3  1 
ATOM   4128  N  N    . GLY A  1 289 ? 74.499  -76.624  -6.554  1.00 34.31  ? 269 GLY A N    1 
ATOM   4129  C  CA   . GLY A  1 289 ? 73.278  -77.403  -6.527  1.00 34.05  ? 269 GLY A CA   1 
ATOM   4130  C  C    . GLY A  1 289 ? 72.852  -78.026  -7.831  1.00 39.01  ? 269 GLY A C    1 
ATOM   4131  O  O    . GLY A  1 289 ? 73.400  -77.729  -8.893  1.00 38.61  ? 269 GLY A O    1 
ATOM   4132  H  H    . GLY A  1 289 ? 75.317  -77.221  -6.510  1.00 34.74  ? 269 GLY A H    1 
ATOM   4133  H  HA2  . GLY A  1 289 ? 73.424  -78.192  -5.792  1.00 33.18  ? 269 GLY A HA2  1 
ATOM   4134  H  HA3  . GLY A  1 289 ? 72.453  -76.782  -6.182  1.00 34.28  ? 269 GLY A HA3  1 
ATOM   4135  N  N    . PRO A  1 290 ? 71.799  -78.874  -7.738  1.00 35.90  ? 270 PRO A N    1 
ATOM   4136  C  CA   . PRO A  1 290 ? 71.251  -79.531  -8.943  1.00 33.35  ? 270 PRO A CA   1 
ATOM   4137  C  C    . PRO A  1 290 ? 70.840  -78.553  -10.032 1.00 33.84  ? 270 PRO A C    1 
ATOM   4138  O  O    . PRO A  1 290 ? 70.894  -78.918  -11.200 1.00 29.84  ? 270 PRO A O    1 
ATOM   4139  C  CB   . PRO A  1 290 ? 70.019  -80.292  -8.438  1.00 35.08  ? 270 PRO A CB   1 
ATOM   4140  C  CG   . PRO A  1 290 ? 70.105  -80.289  -6.972  1.00 40.88  ? 270 PRO A CG   1 
ATOM   4141  C  CD   . PRO A  1 290 ? 71.128  -79.324  -6.500  1.00 36.48  ? 270 PRO A CD   1 
ATOM   4142  H  HA   . PRO A  1 290 ? 71.972  -80.238  -9.350  1.00 34.35  ? 270 PRO A HA   1 
ATOM   4143  H  HB2  . PRO A  1 290 ? 69.097  -79.812  -8.761  1.00 35.00  ? 270 PRO A HB2  1 
ATOM   4144  H  HB3  . PRO A  1 290 ? 70.061  -81.314  -8.805  1.00 35.90  ? 270 PRO A HB3  1 
ATOM   4145  H  HG2  . PRO A  1 290 ? 69.133  -80.002  -6.574  1.00 42.11  ? 270 PRO A HG2  1 
ATOM   4146  H  HG3  . PRO A  1 290 ? 70.359  -81.294  -6.639  1.00 39.98  ? 270 PRO A HG3  1 
ATOM   4147  H  HD2  . PRO A  1 290 ? 70.674  -78.482  -5.984  1.00 35.78  ? 270 PRO A HD2  1 
ATOM   4148  H  HD3  . PRO A  1 290 ? 71.835  -79.841  -5.854  1.00 36.09  ? 270 PRO A HD3  1 
ATOM   4149  N  N    . ALA A  1 291 ? 70.368  -77.339  -9.649  1.00 33.78  ? 271 ALA A N    1 
ATOM   4150  C  CA   . ALA A  1 291 ? 69.998  -76.296  -10.611 1.00 32.71  ? 271 ALA A CA   1 
ATOM   4151  C  C    . ALA A  1 291 ? 71.172  -75.965  -11.536 1.00 32.75  ? 271 ALA A C    1 
ATOM   4152  O  O    . ALA A  1 291 ? 70.978  -75.869  -12.734 1.00 33.78  ? 271 ALA A O    1 
ATOM   4153  C  CB   . ALA A  1 291 ? 69.500  -75.040  -9.887  1.00 33.84  ? 271 ALA A CB   1 
ATOM   4154  H  H    . ALA A  1 291 ? 70.209  -77.073  -8.683  1.00 34.02  ? 271 ALA A H    1 
ATOM   4155  H  HA   . ALA A  1 291 ? 69.185  -76.683  -11.220 1.00 33.30  ? 271 ALA A HA   1 
ATOM   4156  H  HB1  . ALA A  1 291 ? 69.436  -74.212  -10.588 1.00 31.41  ? 271 ALA A HB1  1 
ATOM   4157  H  HB2  . ALA A  1 291 ? 68.516  -75.259  -9.472  1.00 33.26  ? 271 ALA A HB2  1 
ATOM   4158  H  HB3  . ALA A  1 291 ? 70.181  -74.803  -9.073  1.00 35.39  ? 271 ALA A HB3  1 
ATOM   4159  N  N    . ALA A  1 292 ? 72.395  -75.830  -11.003 1.00 28.77  ? 272 ALA A N    1 
ATOM   4160  C  CA   . ALA A  1 292 ? 73.575  -75.512  -11.815 1.00 28.20  ? 272 ALA A CA   1 
ATOM   4161  C  C    . ALA A  1 292 ? 73.941  -76.691  -12.740 1.00 36.54  ? 272 ALA A C    1 
ATOM   4162  O  O    . ALA A  1 292 ? 74.316  -76.478  -13.895 1.00 39.18  ? 272 ALA A O    1 
ATOM   4163  C  CB   . ALA A  1 292 ? 74.751  -75.158  -10.908 1.00 28.58  ? 272 ALA A CB   1 
ATOM   4164  H  H    . ALA A  1 292 ? 72.585  -75.904  -10.010 1.00 29.26  ? 272 ALA A H    1 
ATOM   4165  H  HA   . ALA A  1 292 ? 73.370  -74.644  -12.441 1.00 28.67  ? 272 ALA A HA   1 
ATOM   4166  H  HB1  . ALA A  1 292 ? 75.628  -74.975  -11.529 1.00 30.14  ? 272 ALA A HB1  1 
ATOM   4167  H  HB2  . ALA A  1 292 ? 74.510  -74.257  -10.347 1.00 28.34  ? 272 ALA A HB2  1 
ATOM   4168  H  HB3  . ALA A  1 292 ? 74.944  -75.981  -10.223 1.00 27.55  ? 272 ALA A HB3  1 
ATOM   4169  N  N    . VAL A  1 293 ? 73.822  -77.928  -12.226 1.00 32.61  ? 273 VAL A N    1 
ATOM   4170  C  CA   . VAL A  1 293 ? 74.119  -79.157  -12.975 1.00 31.79  ? 273 VAL A CA   1 
ATOM   4171  C  C    . VAL A  1 293 ? 73.156  -79.222  -14.169 1.00 33.80  ? 273 VAL A C    1 
ATOM   4172  O  O    . VAL A  1 293 ? 73.590  -79.427  -15.311 1.00 32.07  ? 273 VAL A O    1 
ATOM   4173  C  CB   . VAL A  1 293 ? 74.016  -80.441  -12.082 1.00 35.41  ? 273 VAL A CB   1 
ATOM   4174  C  CG1  . VAL A  1 293 ? 74.222  -81.712  -12.897 1.00 34.36  ? 273 VAL A CG1  1 
ATOM   4175  C  CG2  . VAL A  1 293 ? 75.018  -80.404  -10.940 1.00 35.86  ? 273 VAL A CG2  1 
ATOM   4176  H  H    . VAL A  1 293 ? 73.488  -78.099  -11.283 1.00 32.00  ? 273 VAL A H    1 
ATOM   4177  H  HA   . VAL A  1 293 ? 75.136  -79.092  -13.358 1.00 31.72  ? 273 VAL A HA   1 
ATOM   4178  H  HB   . VAL A  1 293 ? 73.017  -80.486  -11.651 1.00 35.42  ? 273 VAL A HB   1 
ATOM   4179  H  HG11 . VAL A  1 293 ? 74.295  -82.553  -12.209 1.00 34.78  ? 273 VAL A HG11 1 
ATOM   4180  H  HG12 . VAL A  1 293 ? 73.377  -81.877  -13.564 1.00 33.77  ? 273 VAL A HG12 1 
ATOM   4181  H  HG13 . VAL A  1 293 ? 75.145  -81.623  -13.468 1.00 32.76  ? 273 VAL A HG13 1 
ATOM   4182  H  HG21 . VAL A  1 293 ? 74.911  -81.318  -10.357 1.00 37.03  ? 273 VAL A HG21 1 
ATOM   4183  H  HG22 . VAL A  1 293 ? 76.021  -80.341  -11.358 1.00 35.55  ? 273 VAL A HG22 1 
ATOM   4184  H  HG23 . VAL A  1 293 ? 74.822  -79.549  -10.294 1.00 36.02  ? 273 VAL A HG23 1 
ATOM   4185  N  N    . THR A  1 294 ? 71.852  -78.986  -13.905 1.00 28.34  ? 274 THR A N    1 
ATOM   4186  C  CA   . THR A  1 294 ? 70.826  -79.040  -14.955 1.00 29.15  ? 274 THR A CA   1 
ATOM   4187  C  C    . THR A  1 294 ? 71.029  -77.928  -15.978 1.00 34.51  ? 274 THR A C    1 
ATOM   4188  O  O    . THR A  1 294 ? 70.800  -78.153  -17.159 1.00 32.51  ? 274 THR A O    1 
ATOM   4189  C  CB   . THR A  1 294 ? 69.437  -79.019  -14.338 1.00 32.51  ? 274 THR A CB   1 
ATOM   4190  O  OG1  . THR A  1 294 ? 69.290  -80.237  -13.633 1.00 35.76  ? 274 THR A OG1  1 
ATOM   4191  C  CG2  . THR A  1 294 ? 68.333  -78.948  -15.367 1.00 28.12  ? 274 THR A CG2  1 
ATOM   4192  H  H    . THR A  1 294 ? 71.490  -78.779  -12.983 1.00 26.27  ? 274 THR A H    1 
ATOM   4193  H  HA   . THR A  1 294 ? 70.936  -79.992  -15.471 1.00 28.56  ? 274 THR A HA   1 
ATOM   4194  H  HB   . THR A  1 294 ? 69.354  -78.177  -13.652 1.00 33.03  ? 274 THR A HB   1 
ATOM   4195  H  HG1  . THR A  1 294 ? 69.659  -80.169  -12.715 1.00 36.17  ? 274 THR A HG1  1 
ATOM   4196  H  HG21 . THR A  1 294 ? 67.378  -79.184  -14.900 1.00 29.12  ? 274 THR A HG21 1 
ATOM   4197  H  HG22 . THR A  1 294 ? 68.268  -77.945  -15.792 1.00 29.91  ? 274 THR A HG22 1 
ATOM   4198  H  HG23 . THR A  1 294 ? 68.520  -79.661  -16.165 1.00 26.60  ? 274 THR A HG23 1 
ATOM   4199  N  N    . THR A  1 295 ? 71.506  -76.745  -15.550 1.00 30.74  ? 275 THR A N    1 
ATOM   4200  C  CA   . THR A  1 295 ? 71.774  -75.666  -16.496 1.00 28.42  ? 275 THR A CA   1 
ATOM   4201  C  C    . THR A  1 295 ? 72.794  -76.159  -17.568 1.00 33.46  ? 275 THR A C    1 
ATOM   4202  O  O    . THR A  1 295 ? 72.550  -75.966  -18.756 1.00 32.74  ? 275 THR A O    1 
ATOM   4203  C  CB   . THR A  1 295 ? 72.249  -74.375  -15.761 1.00 36.90  ? 275 THR A CB   1 
ATOM   4204  O  OG1  . THR A  1 295 ? 71.114  -73.724  -15.162 1.00 39.22  ? 275 THR A OG1  1 
ATOM   4205  C  CG2  . THR A  1 295 ? 72.972  -73.395  -16.686 1.00 37.46  ? 275 THR A CG2  1 
ATOM   4206  H  H    . THR A  1 295 ? 71.690  -76.519  -14.580 1.00 30.67  ? 275 THR A H    1 
ATOM   4207  H  HA   . THR A  1 295 ? 70.832  -75.443  -16.993 1.00 26.72  ? 275 THR A HA   1 
ATOM   4208  H  HB   . THR A  1 295 ? 72.947  -74.643  -14.970 1.00 37.30  ? 275 THR A HB   1 
ATOM   4209  H  HG1  . THR A  1 295 ? 70.502  -74.381  -14.734 1.00 39.40  ? 275 THR A HG1  1 
ATOM   4210  H  HG21 . THR A  1 295 ? 72.992  -72.404  -16.236 1.00 37.75  ? 275 THR A HG21 1 
ATOM   4211  H  HG22 . THR A  1 295 ? 73.998  -73.719  -16.850 1.00 37.90  ? 275 THR A HG22 1 
ATOM   4212  H  HG23 . THR A  1 295 ? 72.466  -73.331  -17.649 1.00 37.73  ? 275 THR A HG23 1 
ATOM   4213  N  N    . ALA A  1 296 ? 73.895  -76.784  -17.150 1.00 30.10  ? 276 ALA A N    1 
ATOM   4214  C  CA   . ALA A  1 296 ? 74.936  -77.300  -18.036 1.00 29.79  ? 276 ALA A CA   1 
ATOM   4215  C  C    . ALA A  1 296 ? 74.453  -78.477  -18.855 1.00 32.75  ? 276 ALA A C    1 
ATOM   4216  O  O    . ALA A  1 296 ? 74.731  -78.552  -20.049 1.00 32.90  ? 276 ALA A O    1 
ATOM   4217  C  CB   . ALA A  1 296 ? 76.161  -77.714  -17.230 1.00 30.79  ? 276 ALA A CB   1 
ATOM   4218  H  H    . ALA A  1 296 ? 74.091  -76.938  -16.166 1.00 32.10  ? 276 ALA A H    1 
ATOM   4219  H  HA   . ALA A  1 296 ? 75.235  -76.508  -18.721 1.00 31.23  ? 276 ALA A HA   1 
ATOM   4220  H  HB1  . ALA A  1 296 ? 76.834  -78.271  -17.880 1.00 30.42  ? 276 ALA A HB1  1 
ATOM   4221  H  HB2  . ALA A  1 296 ? 76.659  -76.815  -16.868 1.00 31.45  ? 276 ALA A HB2  1 
ATOM   4222  H  HB3  . ALA A  1 296 ? 75.863  -78.331  -16.383 1.00 31.20  ? 276 ALA A HB3  1 
ATOM   4223  N  N    . ARG A  1 297 ? 73.745  -79.419  -18.209 1.00 32.40  ? 277 ARG A N    1 
ATOM   4224  C  CA   . ARG A  1 297 ? 73.222  -80.620  -18.887 1.00 31.21  ? 277 ARG A CA   1 
ATOM   4225  C  C    . ARG A  1 297 ? 72.250  -80.253  -20.034 1.00 33.45  ? 277 ARG A C    1 
ATOM   4226  O  O    . ARG A  1 297 ? 72.360  -80.795  -21.145 1.00 32.15  ? 277 ARG A O    1 
ATOM   4227  C  CB   . ARG A  1 297 ? 72.543  -81.549  -17.879 1.00 29.57  ? 277 ARG A CB   1 
ATOM   4228  C  CG   . ARG A  1 297 ? 71.779  -82.737  -18.448 1.00 29.04  ? 277 ARG A CG   1 
ATOM   4229  C  CD   . ARG A  1 297 ? 72.603  -83.664  -19.329 1.00 37.18  ? 277 ARG A CD   1 
ATOM   4230  N  NE   . ARG A  1 297 ? 71.728  -84.708  -19.866 1.00 27.90  ? 277 ARG A NE   1 
ATOM   4231  C  CZ   . ARG A  1 297 ? 70.884  -84.554  -20.875 1.00 36.61  ? 277 ARG A CZ   1 
ATOM   4232  N  NH1  . ARG A  1 297 ? 70.841  -83.415  -21.548 1.00 39.32  ? 277 ARG A NH1  1 
ATOM   4233  N  NH2  . ARG A  1 297 ? 70.095  -85.549  -21.241 1.00 35.75  ? 277 ARG A NH2  1 
ATOM   4234  H  H    . ARG A  1 297 ? 73.520  -79.367  -17.220 1.00 33.70  ? 277 ARG A H    1 
ATOM   4235  H  HA   . ARG A  1 297 ? 74.066  -81.152  -19.326 1.00 32.72  ? 277 ARG A HA   1 
ATOM   4236  H  HB2  . ARG A  1 297 ? 73.287  -81.948  -17.195 1.00 29.22  ? 277 ARG A HB2  1 
ATOM   4237  H  HB3  . ARG A  1 297 ? 71.813  -80.960  -17.323 1.00 31.01  ? 277 ARG A HB3  1 
ATOM   4238  H  HG2  . ARG A  1 297 ? 71.409  -83.335  -17.618 1.00 27.65  ? 277 ARG A HG2  1 
ATOM   4239  H  HG3  . ARG A  1 297 ? 70.918  -82.388  -19.019 1.00 29.11  ? 277 ARG A HG3  1 
ATOM   4240  H  HD2  . ARG A  1 297 ? 73.098  -83.135  -20.139 1.00 36.39  ? 277 ARG A HD2  1 
ATOM   4241  H  HD3  . ARG A  1 297 ? 73.348  -84.143  -18.699 1.00 37.27  ? 277 ARG A HD3  1 
ATOM   4242  H  HE   . ARG A  1 297 ? 71.715  -85.589  -19.361 1.00 27.13  ? 277 ARG A HE   1 
ATOM   4243  H  HH11 . ARG A  1 297 ? 71.414  -82.613  -21.316 1.00 39.83  ? 277 ARG A HH11 1 
ATOM   4244  H  HH12 . ARG A  1 297 ? 70.214  -83.337  -22.342 1.00 40.89  ? 277 ARG A HH12 1 
ATOM   4245  H  HH21 . ARG A  1 297 ? 70.138  -86.439  -20.758 1.00 35.07  ? 277 ARG A HH21 1 
ATOM   4246  H  HH22 . ARG A  1 297 ? 69.487  -85.444  -22.048 1.00 36.85  ? 277 ARG A HH22 1 
ATOM   4247  N  N    . ARG A  1 298 ? 71.320  -79.330  -19.765 1.00 30.04  ? 278 ARG A N    1 
ATOM   4248  C  CA   . ARG A  1 298 ? 70.324  -78.936  -20.761 1.00 31.46  ? 278 ARG A CA   1 
ATOM   4249  C  C    . ARG A  1 298 ? 70.844  -77.897  -21.754 1.00 32.91  ? 278 ARG A C    1 
ATOM   4250  O  O    . ARG A  1 298 ? 70.444  -77.953  -22.901 1.00 34.82  ? 278 ARG A O    1 
ATOM   4251  C  CB   . ARG A  1 298 ? 69.042  -78.437  -20.055 1.00 31.24  ? 278 ARG A CB   1 
ATOM   4252  C  CG   . ARG A  1 298 ? 68.360  -79.574  -19.330 1.00 35.79  ? 278 ARG A CG   1 
ATOM   4253  C  CD   . ARG A  1 298 ? 66.956  -79.245  -18.817 1.00 38.84  ? 278 ARG A CD   1 
ATOM   4254  N  NE   . ARG A  1 298 ? 66.282  -80.493  -18.424 1.00 28.64  ? 278 ARG A NE   1 
ATOM   4255  C  CZ   . ARG A  1 298 ? 64.964  -80.687  -18.361 1.00 48.71  ? 278 ARG A CZ   1 
ATOM   4256  N  NH1  . ARG A  1 298 ? 64.126  -79.686  -18.578 1.00 37.54  ? 278 ARG A NH1  1 
ATOM   4257  N  NH2  . ARG A  1 298 ? 64.475  -81.885  -18.051 1.00 49.92  ? 278 ARG A NH2  1 
ATOM   4258  H  H    . ARG A  1 298 ? 71.239  -78.841  -18.882 1.00 28.75  ? 278 ARG A H    1 
ATOM   4259  H  HA   . ARG A  1 298 ? 70.036  -79.810  -21.343 1.00 31.51  ? 278 ARG A HA   1 
ATOM   4260  H  HB2  . ARG A  1 298 ? 69.295  -77.657  -19.340 1.00 31.23  ? 278 ARG A HB2  1 
ATOM   4261  H  HB3  . ARG A  1 298 ? 68.360  -78.039  -20.805 1.00 31.40  ? 278 ARG A HB3  1 
ATOM   4262  H  HG2  . ARG A  1 298 ? 68.258  -80.417  -20.010 1.00 34.95  ? 278 ARG A HG2  1 
ATOM   4263  H  HG3  . ARG A  1 298 ? 68.973  -79.862  -18.478 1.00 35.27  ? 278 ARG A HG3  1 
ATOM   4264  H  HD2  . ARG A  1 298 ? 67.018  -78.590  -17.951 1.00 38.71  ? 278 ARG A HD2  1 
ATOM   4265  H  HD3  . ARG A  1 298 ? 66.413  -78.767  -19.631 1.00 37.53  ? 278 ARG A HD3  1 
ATOM   4266  H  HE   . ARG A  1 298 ? 66.882  -81.295  -18.270 1.00 28.52  ? 278 ARG A HE   1 
ATOM   4267  H  HH11 . ARG A  1 298 ? 64.446  -78.755  -18.821 1.00 38.19  ? 278 ARG A HH11 1 
ATOM   4268  H  HH12 . ARG A  1 298 ? 63.128  -79.847  -18.496 1.00 37.36  ? 278 ARG A HH12 1 
ATOM   4269  H  HH21 . ARG A  1 298 ? 65.094  -82.668  -17.874 1.00 50.01  ? 278 ARG A HH21 1 
ATOM   4270  H  HH22 . ARG A  1 298 ? 63.472  -82.029  -17.982 1.00 49.67  ? 278 ARG A HH22 1 
ATOM   4271  N  N    . ALA A  1 299 ? 71.726  -76.962  -21.349 1.00 31.31  ? 279 ALA A N    1 
ATOM   4272  C  CA   . ALA A  1 299 ? 72.245  -75.951  -22.292 1.00 29.97  ? 279 ALA A CA   1 
ATOM   4273  C  C    . ALA A  1 299 ? 73.314  -76.506  -23.201 1.00 31.96  ? 279 ALA A C    1 
ATOM   4274  O  O    . ALA A  1 299 ? 73.422  -76.030  -24.316 1.00 30.23  ? 279 ALA A O    1 
ATOM   4275  C  CB   . ALA A  1 299 ? 72.821  -74.766  -21.566 1.00 29.92  ? 279 ALA A CB   1 
ATOM   4276  H  H    . ALA A  1 299 ? 72.078  -76.870  -20.403 1.00 31.97  ? 279 ALA A H    1 
ATOM   4277  H  HA   . ALA A  1 299 ? 71.430  -75.581  -22.912 1.00 31.05  ? 279 ALA A HA   1 
ATOM   4278  H  HB1  . ALA A  1 299 ? 73.123  -74.011  -22.290 1.00 28.65  ? 279 ALA A HB1  1 
ATOM   4279  H  HB2  . ALA A  1 299 ? 72.069  -74.354  -20.896 1.00 31.56  ? 279 ALA A HB2  1 
ATOM   4280  H  HB3  . ALA A  1 299 ? 73.695  -75.096  -21.006 1.00 29.84  ? 279 ALA A HB3  1 
ATOM   4281  N  N    . PHE A  1 300 ? 74.152  -77.451  -22.706 1.00 27.20  ? 280 PHE A N    1 
ATOM   4282  C  CA   . PHE A  1 300 ? 75.290  -77.973  -23.451 1.00 26.02  ? 280 PHE A CA   1 
ATOM   4283  C  C    . PHE A  1 300 ? 75.307  -79.519  -23.426 1.00 32.20  ? 280 PHE A C    1 
ATOM   4284  O  O    . PHE A  1 300 ? 76.281  -80.140  -22.969 1.00 28.80  ? 280 PHE A O    1 
ATOM   4285  C  CB   . PHE A  1 300 ? 76.587  -77.402  -22.829 1.00 27.22  ? 280 PHE A CB   1 
ATOM   4286  C  CG   . PHE A  1 300 ? 76.629  -75.891  -22.751 1.00 29.88  ? 280 PHE A CG   1 
ATOM   4287  C  CD1  . PHE A  1 300 ? 76.730  -75.119  -23.899 1.00 34.86  ? 280 PHE A CD1  1 
ATOM   4288  C  CD2  . PHE A  1 300 ? 76.587  -75.236  -21.521 1.00 32.10  ? 280 PHE A CD2  1 
ATOM   4289  C  CE1  . PHE A  1 300 ? 76.796  -73.716  -23.817 1.00 36.29  ? 280 PHE A CE1  1 
ATOM   4290  C  CE2  . PHE A  1 300 ? 76.656  -73.841  -21.447 1.00 35.10  ? 280 PHE A CE2  1 
ATOM   4291  C  CZ   . PHE A  1 300 ? 76.744  -73.091  -22.593 1.00 34.97  ? 280 PHE A CZ   1 
ATOM   4292  H  H    . PHE A  1 300 ? 74.072  -77.854  -21.777 1.00 26.86  ? 280 PHE A H    1 
ATOM   4293  H  HA   . PHE A  1 300 ? 75.246  -77.657  -24.490 1.00 24.87  ? 280 PHE A HA   1 
ATOM   4294  H  HB2  . PHE A  1 300 ? 76.695  -77.796  -21.822 1.00 23.33  ? 280 PHE A HB2  1 
ATOM   4295  H  HB3  . PHE A  1 300 ? 77.425  -77.720  -23.448 1.00 28.73  ? 280 PHE A HB3  1 
ATOM   4296  H  HD1  . PHE A  1 300 ? 76.765  -75.599  -24.875 1.00 34.70  ? 280 PHE A HD1  1 
ATOM   4297  H  HD2  . PHE A  1 300 ? 76.517  -75.823  -20.605 1.00 32.03  ? 280 PHE A HD2  1 
ATOM   4298  H  HE1  . PHE A  1 300 ? 76.884  -73.122  -24.725 1.00 35.75  ? 280 PHE A HE1  1 
ATOM   4299  H  HE2  . PHE A  1 300 ? 76.625  -73.349  -20.475 1.00 35.99  ? 280 PHE A HE2  1 
ATOM   4300  H  HZ   . PHE A  1 300 ? 76.811  -72.005  -22.533 1.00 35.32  ? 280 PHE A HZ   1 
ATOM   4301  N  N    . PRO A  1 301 ? 74.249  -80.165  -23.948 1.00 30.41  ? 281 PRO A N    1 
ATOM   4302  C  CA   . PRO A  1 301 ? 74.197  -81.639  -23.898 1.00 32.51  ? 281 PRO A CA   1 
ATOM   4303  C  C    . PRO A  1 301 ? 75.281  -82.369  -24.698 1.00 35.17  ? 281 PRO A C    1 
ATOM   4304  O  O    . PRO A  1 301 ? 75.537  -83.535  -24.393 1.00 35.12  ? 281 PRO A O    1 
ATOM   4305  C  CB   . PRO A  1 301 ? 72.799  -81.967  -24.452 1.00 33.68  ? 281 PRO A CB   1 
ATOM   4306  C  CG   . PRO A  1 301 ? 72.398  -80.776  -25.232 1.00 34.86  ? 281 PRO A CG   1 
ATOM   4307  C  CD   . PRO A  1 301 ? 73.046  -79.603  -24.592 1.00 29.80  ? 281 PRO A CD   1 
ATOM   4308  H  HA   . PRO A  1 301 ? 74.257  -81.962  -22.861 1.00 31.58  ? 281 PRO A HA   1 
ATOM   4309  H  HB2  . PRO A  1 301 ? 72.837  -82.854  -25.081 1.00 32.67  ? 281 PRO A HB2  1 
ATOM   4310  H  HB3  . PRO A  1 301 ? 72.118  -82.120  -23.616 1.00 34.36  ? 281 PRO A HB3  1 
ATOM   4311  H  HG2  . PRO A  1 301 ? 72.743  -80.888  -26.258 1.00 33.68  ? 281 PRO A HG2  1 
ATOM   4312  H  HG3  . PRO A  1 301 ? 71.316  -80.677  -25.196 1.00 33.94  ? 281 PRO A HG3  1 
ATOM   4313  H  HD2  . PRO A  1 301 ? 73.323  -78.879  -25.356 1.00 29.84  ? 281 PRO A HD2  1 
ATOM   4314  H  HD3  . PRO A  1 301 ? 72.382  -79.171  -23.850 1.00 29.18  ? 281 PRO A HD3  1 
ATOM   4315  N  N    . LYS A  1 302 ? 75.927  -81.699  -25.657 1.00 31.71  ? 282 LYS A N    1 
ATOM   4316  C  CA   . LYS A  1 302 ? 76.969  -82.297  -26.519 1.00 31.50  ? 282 LYS A CA   1 
ATOM   4317  C  C    . LYS A  1 302 ? 78.370  -82.051  -25.928 1.00 34.26  ? 282 LYS A C    1 
ATOM   4318  O  O    . LYS A  1 302 ? 79.357  -82.426  -26.543 1.00 33.35  ? 282 LYS A O    1 
ATOM   4319  C  CB   . LYS A  1 302 ? 76.865  -81.716  -27.934 1.00 33.11  ? 282 LYS A CB   1 
ATOM   4320  C  CG   . LYS A  1 302 ? 77.437  -82.601  -29.043 1.00 52.22  ? 282 LYS A CG   1 
ATOM   4321  C  CD   . LYS A  1 302 ? 76.465  -83.663  -29.468 1.00 54.15  ? 282 LYS A CD   1 
ATOM   4322  C  CE   . LYS A  1 302 ? 76.933  -84.421  -30.671 1.00 62.00  ? 282 LYS A CE   1 
ATOM   4323  N  NZ   . LYS A  1 302 ? 78.268  -85.059  -30.497 1.00 67.98  ? 282 LYS A NZ   1 
ATOM   4324  H  H    . LYS A  1 302 ? 75.751  -80.732  -25.904 1.00 31.53  ? 282 LYS A H    1 
ATOM   4325  H  HA   . LYS A  1 302 ? 76.824  -83.373  -26.592 1.00 31.56  ? 282 LYS A HA   1 
ATOM   4326  H  HB2  . LYS A  1 302 ? 75.811  -81.550  -28.153 1.00 31.86  ? 282 LYS A HB2  1 
ATOM   4327  H  HB3  . LYS A  1 302 ? 77.398  -80.766  -27.967 1.00 33.26  ? 282 LYS A HB3  1 
ATOM   4328  H  HG2  . LYS A  1 302 ? 77.657  -81.986  -29.914 1.00 52.43  ? 282 LYS A HG2  1 
ATOM   4329  H  HG3  . LYS A  1 302 ? 78.346  -83.089  -28.697 1.00 51.99  ? 282 LYS A HG3  1 
ATOM   4330  H  HD2  . LYS A  1 302 ? 76.339  -84.375  -28.654 1.00 54.46  ? 282 LYS A HD2  1 
ATOM   4331  H  HD3  . LYS A  1 302 ? 75.509  -83.205  -29.716 1.00 53.85  ? 282 LYS A HD3  1 
ATOM   4332  H  HE2  . LYS A  1 302 ? 76.214  -85.210  -30.879 1.00 61.82  ? 282 LYS A HE2  1 
ATOM   4333  H  HE3  . LYS A  1 302 ? 77.007  -83.727  -31.506 1.00 62.90  ? 282 LYS A HE3  1 
ATOM   4334  H  HZ1  . LYS A  1 302 ? 79.004  -84.398  -30.727 1.00 67.92  ? 282 LYS A HZ1  1 
ATOM   4335  H  HZ2  . LYS A  1 302 ? 78.391  -85.357  -29.536 1.00 68.10  ? 282 LYS A HZ2  1 
ATOM   4336  H  HZ3  . LYS A  1 302 ? 78.347  -85.871  -31.101 1.00 67.99  ? 282 LYS A HZ3  1 
ATOM   4337  N  N    . GLN A  1 303 ? 78.456  -81.415  -24.745 1.00 28.04  ? 283 GLN A N    1 
ATOM   4338  C  CA   . GLN A  1 303 ? 79.723  -81.216  -24.062 1.00 27.73  ? 283 GLN A CA   1 
ATOM   4339  C  C    . GLN A  1 303 ? 79.712  -82.093  -22.808 1.00 35.89  ? 283 GLN A C    1 
ATOM   4340  O  O    . GLN A  1 303 ? 78.732  -82.091  -22.043 1.00 38.48  ? 283 GLN A O    1 
ATOM   4341  C  CB   . GLN A  1 303 ? 79.952  -79.758  -23.708 1.00 27.94  ? 283 GLN A CB   1 
ATOM   4342  C  CG   . GLN A  1 303 ? 79.809  -78.770  -24.872 1.00 29.08  ? 283 GLN A CG   1 
ATOM   4343  C  CD   . GLN A  1 303 ? 80.710  -78.993  -26.053 1.00 33.70  ? 283 GLN A CD   1 
ATOM   4344  O  OE1  . GLN A  1 303 ? 80.310  -78.717  -27.186 1.00 29.06  ? 283 GLN A OE1  1 
ATOM   4345  N  NE2  . GLN A  1 303 ? 81.978  -79.357  -25.848 1.00 34.74  ? 283 GLN A NE2  1 
ATOM   4346  H  H    . GLN A  1 303 ? 77.683  -81.001  -24.238 1.00 26.70  ? 283 GLN A H    1 
ATOM   4347  H  HA   . GLN A  1 303 ? 80.558  -81.526  -24.689 1.00 29.07  ? 283 GLN A HA   1 
ATOM   4348  H  HB2  . GLN A  1 303 ? 79.202  -79.468  -22.970 1.00 28.68  ? 283 GLN A HB2  1 
ATOM   4349  H  HB3  . GLN A  1 303 ? 80.939  -79.645  -23.266 1.00 26.49  ? 283 GLN A HB3  1 
ATOM   4350  H  HG2  . GLN A  1 303 ? 78.780  -78.802  -25.228 1.00 27.86  ? 283 GLN A HG2  1 
ATOM   4351  H  HG3  . GLN A  1 303 ? 80.026  -77.772  -24.497 1.00 28.59  ? 283 GLN A HG3  1 
ATOM   4352  H  HE21 . GLN A  1 303 ? 82.363  -79.444  -24.912 1.00 36.26  ? 283 GLN A HE21 1 
ATOM   4353  H  HE22 . GLN A  1 303 ? 82.584  -79.513  -26.645 1.00 33.88  ? 283 GLN A HE22 1 
ATOM   4354  N  N    . TYR A  1 304 ? 80.789  -82.854  -22.601 1.00 33.06  ? 284 TYR A N    1 
ATOM   4355  C  CA   . TYR A  1 304 ? 80.939  -83.731  -21.439 1.00 32.30  ? 284 TYR A CA   1 
ATOM   4356  C  C    . TYR A  1 304 ? 80.761  -82.909  -20.168 1.00 36.20  ? 284 TYR A C    1 
ATOM   4357  O  O    . TYR A  1 304 ? 81.470  -81.903  -19.985 1.00 35.74  ? 284 TYR A O    1 
ATOM   4358  C  CB   . TYR A  1 304 ? 82.335  -84.387  -21.474 1.00 31.76  ? 284 TYR A CB   1 
ATOM   4359  C  CG   . TYR A  1 304 ? 82.572  -85.434  -20.416 1.00 27.94  ? 284 TYR A CG   1 
ATOM   4360  C  CD1  . TYR A  1 304 ? 82.957  -85.075  -19.125 1.00 28.94  ? 284 TYR A CD1  1 
ATOM   4361  C  CD2  . TYR A  1 304 ? 82.488  -86.789  -20.723 1.00 27.69  ? 284 TYR A CD2  1 
ATOM   4362  C  CE1  . TYR A  1 304 ? 83.165  -86.035  -18.139 1.00 25.78  ? 284 TYR A CE1  1 
ATOM   4363  C  CE2  . TYR A  1 304 ? 82.771  -87.762  -19.775 1.00 29.22  ? 284 TYR A CE2  1 
ATOM   4364  C  CZ   . TYR A  1 304 ? 83.118  -87.380  -18.481 1.00 30.65  ? 284 TYR A CZ   1 
ATOM   4365  O  OH   . TYR A  1 304 ? 83.337  -88.347  -17.540 1.00 29.10  ? 284 TYR A OH   1 
ATOM   4366  H  H    . TYR A  1 304 ? 81.583  -82.876  -23.233 1.00 34.14  ? 284 TYR A H    1 
ATOM   4367  H  HA   . TYR A  1 304 ? 80.190  -84.520  -21.476 1.00 31.32  ? 284 TYR A HA   1 
ATOM   4368  H  HB2  . TYR A  1 304 ? 82.463  -84.873  -22.441 1.00 33.02  ? 284 TYR A HB2  1 
ATOM   4369  H  HB3  . TYR A  1 304 ? 83.087  -83.608  -21.359 1.00 32.29  ? 284 TYR A HB3  1 
ATOM   4370  H  HD1  . TYR A  1 304 ? 83.052  -84.022  -18.861 1.00 30.47  ? 284 TYR A HD1  1 
ATOM   4371  H  HD2  . TYR A  1 304 ? 82.226  -87.104  -21.731 1.00 28.88  ? 284 TYR A HD2  1 
ATOM   4372  H  HE1  . TYR A  1 304 ? 83.497  -85.722  -17.150 1.00 21.61  ? 284 TYR A HE1  1 
ATOM   4373  H  HE2  . TYR A  1 304 ? 82.686  -88.817  -20.041 1.00 28.86  ? 284 TYR A HE2  1 
ATOM   4374  H  HH   . TYR A  1 304 ? 84.040  -88.044  -16.910 1.00 29.92  ? 284 TYR A HH   1 
ATOM   4375  N  N    . LEU A  1 305 ? 79.763  -83.301  -19.330 1.00 32.04  ? 285 LEU A N    1 
ATOM   4376  C  CA   . LEU A  1 305 ? 79.454  -82.642  -18.069 1.00 30.28  ? 285 LEU A CA   1 
ATOM   4377  C  C    . LEU A  1 305 ? 80.193  -83.318  -16.905 1.00 32.00  ? 285 LEU A C    1 
ATOM   4378  O  O    . LEU A  1 305 ? 79.879  -84.433  -16.478 1.00 30.98  ? 285 LEU A O    1 
ATOM   4379  C  CB   . LEU A  1 305 ? 77.942  -82.637  -17.842 1.00 30.92  ? 285 LEU A CB   1 
ATOM   4380  C  CG   . LEU A  1 305 ? 77.404  -82.008  -16.533 1.00 37.46  ? 285 LEU A CG   1 
ATOM   4381  C  CD1  . LEU A  1 305 ? 78.048  -80.669  -16.230 1.00 38.99  ? 285 LEU A CD1  1 
ATOM   4382  C  CD2  . LEU A  1 305 ? 75.895  -81.923  -16.597 1.00 35.56  ? 285 LEU A CD2  1 
ATOM   4383  H  H    . LEU A  1 305 ? 79.137  -84.071  -19.538 1.00 32.43  ? 285 LEU A H    1 
ATOM   4384  H  HA   . LEU A  1 305 ? 79.767  -81.600  -18.142 1.00 30.41  ? 285 LEU A HA   1 
ATOM   4385  H  HB2  . LEU A  1 305 ? 77.510  -82.048  -18.651 1.00 31.81  ? 285 LEU A HB2  1 
ATOM   4386  H  HB3  . LEU A  1 305 ? 77.557  -83.652  -17.899 1.00 29.16  ? 285 LEU A HB3  1 
ATOM   4387  H  HG   . LEU A  1 305 ? 77.650  -82.677  -15.709 1.00 38.29  ? 285 LEU A HG   1 
ATOM   4388  H  HD11 . LEU A  1 305 ? 77.479  -80.165  -15.447 1.00 40.25  ? 285 LEU A HD11 1 
ATOM   4389  H  HD12 . LEU A  1 305 ? 79.067  -80.823  -15.877 1.00 39.78  ? 285 LEU A HD12 1 
ATOM   4390  H  HD13 . LEU A  1 305 ? 78.066  -80.061  -17.132 1.00 37.62  ? 285 LEU A HD13 1 
ATOM   4391  H  HD21 . LEU A  1 305 ? 75.521  -81.404  -15.718 1.00 35.69  ? 285 LEU A HD21 1 
ATOM   4392  H  HD22 . LEU A  1 305 ? 75.601  -81.394  -17.501 1.00 34.58  ? 285 LEU A HD22 1 
ATOM   4393  H  HD23 . LEU A  1 305 ? 75.494  -82.937  -16.620 1.00 35.59  ? 285 LEU A HD23 1 
ATOM   4394  N  N    . HIS A  1 306 ? 81.206  -82.631  -16.414 1.00 28.53  ? 286 HIS A N    1 
ATOM   4395  C  CA   . HIS A  1 306 ? 82.073  -83.069  -15.342 1.00 28.67  ? 286 HIS A CA   1 
ATOM   4396  C  C    . HIS A  1 306 ? 81.511  -82.530  -13.979 1.00 34.00  ? 286 HIS A C    1 
ATOM   4397  O  O    . HIS A  1 306 ? 81.605  -81.336  -13.668 1.00 31.11  ? 286 HIS A O    1 
ATOM   4398  C  CB   . HIS A  1 306 ? 83.475  -82.559  -15.664 1.00 28.03  ? 286 HIS A CB   1 
ATOM   4399  C  CG   . HIS A  1 306 ? 84.579  -82.934  -14.724 1.00 31.32  ? 286 HIS A CG   1 
ATOM   4400  N  ND1  . HIS A  1 306 ? 85.883  -82.769  -15.097 1.00 32.95  ? 286 HIS A ND1  1 
ATOM   4401  C  CD2  . HIS A  1 306 ? 84.556  -83.337  -13.429 1.00 32.07  ? 286 HIS A CD2  1 
ATOM   4402  C  CE1  . HIS A  1 306 ? 86.623  -83.123  -14.058 1.00 32.57  ? 286 HIS A CE1  1 
ATOM   4403  N  NE2  . HIS A  1 306 ? 85.876  -83.444  -13.030 1.00 32.24  ? 286 HIS A NE2  1 
ATOM   4404  H  H    . HIS A  1 306 ? 81.431  -81.693  -16.727 1.00 30.36  ? 286 HIS A H    1 
ATOM   4405  H  HA   . HIS A  1 306 ? 82.111  -84.157  -15.305 1.00 28.81  ? 286 HIS A HA   1 
ATOM   4406  H  HB2  . HIS A  1 306 ? 83.743  -82.949  -16.642 1.00 28.13  ? 286 HIS A HB2  1 
ATOM   4407  H  HB3  . HIS A  1 306 ? 83.460  -81.471  -15.711 1.00 28.51  ? 286 HIS A HB3  1 
ATOM   4408  H  HD1  . HIS A  1 306 ? 86.214  -82.420  -15.988 1.00 34.56  ? 286 HIS A HD1  1 
ATOM   4409  H  HD2  . HIS A  1 306 ? 83.685  -83.568  -12.819 1.00 29.86  ? 286 HIS A HD2  1 
ATOM   4410  H  HE1  . HIS A  1 306 ? 87.712  -83.163  -14.067 1.00 33.95  ? 286 HIS A HE1  1 
ATOM   4411  H  HE2  . HIS A  1 306 ? 86.222  -83.737  -12.123 1.00 33.51  ? 286 HIS A HE2  1 
ATOM   4412  N  N    . TYR A  1 307 ? 80.937  -83.429  -13.174 1.00 31.30  ? 287 TYR A N    1 
ATOM   4413  C  CA   . TYR A  1 307 ? 80.369  -83.039  -11.882 1.00 30.66  ? 287 TYR A CA   1 
ATOM   4414  C  C    . TYR A  1 307 ? 81.472  -83.086  -10.815 1.00 33.45  ? 287 TYR A C    1 
ATOM   4415  O  O    . TYR A  1 307 ? 82.012  -84.146  -10.509 1.00 32.19  ? 287 TYR A O    1 
ATOM   4416  C  CB   . TYR A  1 307 ? 79.196  -84.009  -11.538 1.00 33.32  ? 287 TYR A CB   1 
ATOM   4417  C  CG   . TYR A  1 307 ? 78.336  -83.680  -10.340 1.00 35.01  ? 287 TYR A CG   1 
ATOM   4418  C  CD1  . TYR A  1 307 ? 78.905  -83.476  -9.086  1.00 38.64  ? 287 TYR A CD1  1 
ATOM   4419  C  CD2  . TYR A  1 307 ? 76.949  -83.812  -10.402 1.00 34.63  ? 287 TYR A CD2  1 
ATOM   4420  C  CE1  . TYR A  1 307 ? 78.117  -83.305  -7.947  1.00 40.19  ? 287 TYR A CE1  1 
ATOM   4421  C  CE2  . TYR A  1 307 ? 76.152  -83.656  -9.267  1.00 34.90  ? 287 TYR A CE2  1 
ATOM   4422  C  CZ   . TYR A  1 307 ? 76.741  -83.411  -8.040  1.00 43.02  ? 287 TYR A CZ   1 
ATOM   4423  O  OH   . TYR A  1 307 ? 75.986  -83.284  -6.902  1.00 44.94  ? 287 TYR A OH   1 
ATOM   4424  H  H    . TYR A  1 307 ? 80.873  -84.424  -13.368 1.00 29.64  ? 287 TYR A H    1 
ATOM   4425  H  HA   . TYR A  1 307 ? 79.949  -82.037  -11.942 1.00 28.15  ? 287 TYR A HA   1 
ATOM   4426  H  HB2  . TYR A  1 307 ? 78.537  -84.039  -12.405 1.00 33.61  ? 287 TYR A HB2  1 
ATOM   4427  H  HB3  . TYR A  1 307 ? 79.604  -85.006  -11.380 1.00 34.22  ? 287 TYR A HB3  1 
ATOM   4428  H  HD1  . TYR A  1 307 ? 79.984  -83.464  -8.958  1.00 39.68  ? 287 TYR A HD1  1 
ATOM   4429  H  HD2  . TYR A  1 307 ? 76.471  -84.016  -11.359 1.00 33.09  ? 287 TYR A HD2  1 
ATOM   4430  H  HE1  . TYR A  1 307 ? 78.590  -83.152  -6.978  1.00 39.14  ? 287 TYR A HE1  1 
ATOM   4431  H  HE2  . TYR A  1 307 ? 75.067  -83.697  -9.354  1.00 34.70  ? 287 TYR A HE2  1 
ATOM   4432  H  HH   . TYR A  1 307 ? 75.097  -82.896  -7.117  1.00 44.60  ? 287 TYR A HH   1 
ATOM   4433  N  N    . HIS A  1 308 ? 81.784  -81.930  -10.231 1.00 31.81  ? 288 HIS A N    1 
ATOM   4434  C  CA   . HIS A  1 308 ? 82.742  -81.810  -9.143  1.00 31.39  ? 288 HIS A CA   1 
ATOM   4435  C  C    . HIS A  1 308 ? 81.891  -81.667  -7.855  1.00 35.86  ? 288 HIS A C    1 
ATOM   4436  O  O    . HIS A  1 308 ? 80.891  -80.968  -7.859  1.00 35.34  ? 288 HIS A O    1 
ATOM   4437  C  CB   . HIS A  1 308 ? 83.714  -80.647  -9.377  1.00 31.54  ? 288 HIS A CB   1 
ATOM   4438  C  CG   . HIS A  1 308 ? 84.887  -80.704  -8.443  1.00 35.00  ? 288 HIS A CG   1 
ATOM   4439  N  ND1  . HIS A  1 308 ? 84.803  -80.235  -7.132  1.00 35.62  ? 288 HIS A ND1  1 
ATOM   4440  C  CD2  . HIS A  1 308 ? 86.118  -81.216  -8.640  1.00 36.21  ? 288 HIS A CD2  1 
ATOM   4441  C  CE1  . HIS A  1 308 ? 85.985  -80.489  -6.590  1.00 35.09  ? 288 HIS A CE1  1 
ATOM   4442  N  NE2  . HIS A  1 308 ? 86.799  -81.083  -7.445  1.00 35.47  ? 288 HIS A NE2  1 
ATOM   4443  H  H    . HIS A  1 308 ? 81.393  -81.033  -10.500 1.00 31.63  ? 288 HIS A H    1 
ATOM   4444  H  HA   . HIS A  1 308 ? 83.344  -82.714  -9.070  1.00 31.75  ? 288 HIS A HA   1 
ATOM   4445  H  HB2  . HIS A  1 308 ? 84.097  -80.706  -10.394 1.00 30.37  ? 288 HIS A HB2  1 
ATOM   4446  H  HB3  . HIS A  1 308 ? 83.189  -79.703  -9.235  1.00 30.94  ? 288 HIS A HB3  1 
ATOM   4447  H  HD2  . HIS A  1 308 ? 86.504  -81.647  -9.562  1.00 36.65  ? 288 HIS A HD2  1 
ATOM   4448  H  HE1  . HIS A  1 308 ? 86.269  -80.244  -5.569  1.00 35.73  ? 288 HIS A HE1  1 
ATOM   4449  H  HE2  . HIS A  1 308 ? 87.734  -81.423  -7.255  1.00 35.54  ? 288 HIS A HE2  1 
ATOM   4450  N  N    . ARG A  1 309 ? 82.216  -82.430  -6.821  1.00 32.31  ? 289 ARG A N    1 
ATOM   4451  C  CA   . ARG A  1 309 ? 81.380  -82.553  -5.618  1.00 32.20  ? 289 ARG A CA   1 
ATOM   4452  C  C    . ARG A  1 309 ? 81.953  -81.859  -4.370  1.00 36.11  ? 289 ARG A C    1 
ATOM   4453  O  O    . ARG A  1 309 ? 81.526  -82.191  -3.279  1.00 35.82  ? 289 ARG A O    1 
ATOM   4454  C  CB   . ARG A  1 309 ? 81.116  -84.042  -5.330  1.00 28.57  ? 289 ARG A CB   1 
ATOM   4455  C  CG   . ARG A  1 309 ? 82.397  -84.860  -5.141  1.00 35.68  ? 289 ARG A CG   1 
ATOM   4456  C  CD   . ARG A  1 309 ? 82.153  -86.277  -4.723  1.00 35.80  ? 289 ARG A CD   1 
ATOM   4457  N  NE   . ARG A  1 309 ? 83.405  -86.894  -4.283  1.00 35.17  ? 289 ARG A NE   1 
ATOM   4458  C  CZ   . ARG A  1 309 ? 83.515  -88.089  -3.722  1.00 37.72  ? 289 ARG A CZ   1 
ATOM   4459  N  NH1  . ARG A  1 309 ? 82.446  -88.856  -3.563  1.00 35.19  ? 289 ARG A NH1  1 
ATOM   4460  N  NH2  . ARG A  1 309 ? 84.699  -88.529  -3.311  1.00 38.56  ? 289 ARG A NH2  1 
ATOM   4461  H  H    . ARG A  1 309 ? 83.107  -82.911  -6.765  1.00 32.53  ? 289 ARG A H    1 
ATOM   4462  H  HA   . ARG A  1 309 ? 80.401  -82.112  -5.800  1.00 33.27  ? 289 ARG A HA   1 
ATOM   4463  H  HB2  . ARG A  1 309 ? 80.494  -84.153  -4.444  1.00 29.24  ? 289 ARG A HB2  1 
ATOM   4464  H  HB3  . ARG A  1 309 ? 80.594  -84.473  -6.183  1.00 27.19  ? 289 ARG A HB3  1 
ATOM   4465  H  HG2  . ARG A  1 309 ? 82.913  -84.933  -6.094  1.00 35.73  ? 289 ARG A HG2  1 
ATOM   4466  H  HG3  . ARG A  1 309 ? 83.040  -84.386  -4.401  1.00 36.36  ? 289 ARG A HG3  1 
ATOM   4467  H  HD2  . ARG A  1 309 ? 81.453  -86.271  -3.888  1.00 36.74  ? 289 ARG A HD2  1 
ATOM   4468  H  HD3  . ARG A  1 309 ? 81.739  -86.833  -5.561  1.00 35.05  ? 289 ARG A HD3  1 
ATOM   4469  H  HE   . ARG A  1 309 ? 84.252  -86.343  -4.364  1.00 34.54  ? 289 ARG A HE   1 
ATOM   4470  H  HH11 . ARG A  1 309 ? 81.520  -88.561  -3.850  1.00 35.39  ? 289 ARG A HH11 1 
ATOM   4471  H  HH12 . ARG A  1 309 ? 82.547  -89.767  -3.123  1.00 36.01  ? 289 ARG A HH12 1 
ATOM   4472  H  HH21 . ARG A  1 309 ? 85.528  -87.955  -3.417  1.00 38.92  ? 289 ARG A HH21 1 
ATOM   4473  H  HH22 . ARG A  1 309 ? 84.784  -89.445  -2.881  1.00 39.68  ? 289 ARG A HH22 1 
ATOM   4474  N  N    . ALA A  1 310 ? 82.809  -80.821  -4.518  1.00 33.08  ? 290 ALA A N    1 
ATOM   4475  C  CA   . ALA A  1 310 ? 83.367  -80.073  -3.378  1.00 34.20  ? 290 ALA A CA   1 
ATOM   4476  C  C    . ALA A  1 310 ? 82.276  -79.740  -2.347  1.00 38.30  ? 290 ALA A C    1 
ATOM   4477  O  O    . ALA A  1 310 ? 81.204  -79.276  -2.733  1.00 38.89  ? 290 ALA A O    1 
ATOM   4478  C  CB   . ALA A  1 310 ? 84.006  -78.766  -3.857  1.00 35.34  ? 290 ALA A CB   1 
ATOM   4479  H  H    . ALA A  1 310 ? 83.144  -80.495  -5.421  1.00 35.10  ? 290 ALA A H    1 
ATOM   4480  H  HA   . ALA A  1 310 ? 84.142  -80.670  -2.903  1.00 32.95  ? 290 ALA A HA   1 
ATOM   4481  H  HB1  . ALA A  1 310 ? 84.520  -78.306  -3.014  1.00 35.55  ? 290 ALA A HB1  1 
ATOM   4482  H  HB2  . ALA A  1 310 ? 84.718  -78.961  -4.656  1.00 35.38  ? 290 ALA A HB2  1 
ATOM   4483  H  HB3  . ALA A  1 310 ? 83.222  -78.097  -4.208  1.00 33.25  ? 290 ALA A HB3  1 
ATOM   4484  N  N    . GLY A  1 311 ? 82.521  -80.077  -1.090  1.00 36.24  ? 291 GLY A N    1 
ATOM   4485  C  CA   . GLY A  1 311 ? 81.591  -79.831  0.014   1.00 34.38  ? 291 GLY A CA   1 
ATOM   4486  C  C    . GLY A  1 311 ? 80.766  -81.020  0.454   1.00 36.06  ? 291 GLY A C    1 
ATOM   4487  O  O    . GLY A  1 311 ? 80.217  -80.991  1.557   1.00 34.28  ? 291 GLY A O    1 
ATOM   4488  H  H    . GLY A  1 311 ? 83.353  -80.578  -0.794  1.00 37.08  ? 291 GLY A H    1 
ATOM   4489  H  HA2  . GLY A  1 311 ? 82.159  -79.503  0.881   1.00 33.39  ? 291 GLY A HA2  1 
ATOM   4490  H  HA3  . GLY A  1 311 ? 80.897  -79.037  -0.256  1.00 34.33  ? 291 GLY A HA3  1 
ATOM   4491  N  N    . HIS A  1 312 ? 80.669  -82.076  -0.404  1.00 32.75  ? 292 HIS A N    1 
ATOM   4492  C  CA   . HIS A  1 312 ? 79.884  -83.287  -0.155  1.00 31.13  ? 292 HIS A CA   1 
ATOM   4493  C  C    . HIS A  1 312 ? 80.228  -83.956  1.168   1.00 33.66  ? 292 HIS A C    1 
ATOM   4494  O  O    . HIS A  1 312 ? 79.341  -84.508  1.814   1.00 30.14  ? 292 HIS A O    1 
ATOM   4495  C  CB   . HIS A  1 312 ? 80.073  -84.317  -1.290  1.00 31.47  ? 292 HIS A CB   1 
ATOM   4496  C  CG   . HIS A  1 312 ? 81.392  -85.041  -1.237  1.00 33.42  ? 292 HIS A CG   1 
ATOM   4497  N  ND1  . HIS A  1 312 ? 81.485  -86.302  -0.697  1.00 33.81  ? 292 HIS A ND1  1 
ATOM   4498  C  CD2  . HIS A  1 312 ? 82.637  -84.621  -1.576  1.00 34.79  ? 292 HIS A CD2  1 
ATOM   4499  C  CE1  . HIS A  1 312 ? 82.771  -86.626  -0.740  1.00 33.79  ? 292 HIS A CE1  1 
ATOM   4500  N  NE2  . HIS A  1 312 ? 83.499  -85.648  -1.273  1.00 34.52  ? 292 HIS A NE2  1 
ATOM   4501  H  H    . HIS A  1 312 ? 81.124  -82.101  -1.311  1.00 32.72  ? 292 HIS A H    1 
ATOM   4502  H  HA   . HIS A  1 312 ? 78.828  -83.022  -0.116  1.00 31.93  ? 292 HIS A HA   1 
ATOM   4503  H  HB2  . HIS A  1 312 ? 79.301  -85.075  -1.176  1.00 30.92  ? 292 HIS A HB2  1 
ATOM   4504  H  HB3  . HIS A  1 312 ? 79.949  -83.830  -2.256  1.00 32.95  ? 292 HIS A HB3  1 
ATOM   4505  H  HD2  . HIS A  1 312 ? 82.919  -83.662  -2.005  1.00 34.74  ? 292 HIS A HD2  1 
ATOM   4506  H  HE1  . HIS A  1 312 ? 83.179  -87.566  -0.368  1.00 33.34  ? 292 HIS A HE1  1 
ATOM   4507  H  HE2  . HIS A  1 312 ? 84.499  -85.660  -1.436  1.00 34.59  ? 292 HIS A HE2  1 
ATOM   4508  N  N    . GLY A  1 313 ? 81.505  -83.915  1.537   1.00 32.33  ? 293 GLY A N    1 
ATOM   4509  C  CA   . GLY A  1 313 ? 82.021  -84.544  2.743   1.00 31.84  ? 293 GLY A CA   1 
ATOM   4510  C  C    . GLY A  1 313 ? 81.332  -84.128  4.033   1.00 33.84  ? 293 GLY A C    1 
ATOM   4511  O  O    . GLY A  1 313 ? 81.377  -84.870  5.010   1.00 32.13  ? 293 GLY A O    1 
ATOM   4512  H  H    . GLY A  1 313 ? 82.235  -83.432  1.023   1.00 33.01  ? 293 GLY A H    1 
ATOM   4513  H  HA2  . GLY A  1 313 ? 81.916  -85.623  2.633   1.00 30.59  ? 293 GLY A HA2  1 
ATOM   4514  H  HA3  . GLY A  1 313 ? 83.084  -84.316  2.813   1.00 32.32  ? 293 GLY A HA3  1 
ATOM   4515  N  N    . ALA A  1 314 ? 80.676  -82.963  4.036   1.00 33.55  ? 294 ALA A N    1 
ATOM   4516  C  CA   . ALA A  1 314 ? 79.923  -82.468  5.196   1.00 36.00  ? 294 ALA A CA   1 
ATOM   4517  C  C    . ALA A  1 314 ? 78.772  -83.434  5.556   1.00 39.79  ? 294 ALA A C    1 
ATOM   4518  O  O    . ALA A  1 314 ? 78.374  -83.459  6.702   1.00 39.42  ? 294 ALA A O    1 
ATOM   4519  C  CB   . ALA A  1 314 ? 79.364  -81.076  4.918   1.00 36.54  ? 294 ALA A CB   1 
ATOM   4520  H  H    . ALA A  1 314 ? 80.716  -82.278  3.288   1.00 32.09  ? 294 ALA A H    1 
ATOM   4521  H  HA   . ALA A  1 314 ? 80.597  -82.391  6.046   1.00 35.66  ? 294 ALA A HA   1 
ATOM   4522  H  HB1  . ALA A  1 314 ? 78.817  -80.742  5.798   1.00 36.91  ? 294 ALA A HB1  1 
ATOM   4523  H  HB2  . ALA A  1 314 ? 80.194  -80.402  4.713   1.00 36.01  ? 294 ALA A HB2  1 
ATOM   4524  H  HB3  . ALA A  1 314 ? 78.697  -81.129  4.059   1.00 35.13  ? 294 ALA A HB3  1 
ATOM   4525  N  N    . VAL A  1 315 ? 78.231  -84.194  4.575   1.00 35.32  ? 295 VAL A N    1 
ATOM   4526  C  CA   . VAL A  1 315 ? 77.195  -85.199  4.847   1.00 35.31  ? 295 VAL A CA   1 
ATOM   4527  C  C    . VAL A  1 315 ? 77.663  -86.621  4.513   1.00 42.20  ? 295 VAL A C    1 
ATOM   4528  O  O    . VAL A  1 315 ? 77.271  -87.540  5.220   1.00 43.64  ? 295 VAL A O    1 
ATOM   4529  C  CB   . VAL A  1 315 ? 75.832  -84.931  4.149   1.00 37.28  ? 295 VAL A CB   1 
ATOM   4530  C  CG1  . VAL A  1 315 ? 75.232  -83.615  4.627   1.00 36.96  ? 295 VAL A CG1  1 
ATOM   4531  C  CG2  . VAL A  1 315 ? 75.921  -84.973  2.633   1.00 36.70  ? 295 VAL A CG2  1 
ATOM   4532  H  H    . VAL A  1 315 ? 78.455  -84.079  3.593   1.00 33.35  ? 295 VAL A H    1 
ATOM   4533  H  HA   . VAL A  1 315 ? 76.972  -85.206  5.913   1.00 35.58  ? 295 VAL A HA   1 
ATOM   4534  H  HB   . VAL A  1 315 ? 75.151  -85.727  4.443   1.00 36.12  ? 295 VAL A HB   1 
ATOM   4535  H  HG11 . VAL A  1 315 ? 74.247  -83.487  4.180   1.00 37.42  ? 295 VAL A HG11 1 
ATOM   4536  H  HG12 . VAL A  1 315 ? 75.143  -83.643  5.711   1.00 36.21  ? 295 VAL A HG12 1 
ATOM   4537  H  HG13 . VAL A  1 315 ? 75.882  -82.793  4.328   1.00 36.21  ? 295 VAL A HG13 1 
ATOM   4538  H  HG21 . VAL A  1 315 ? 74.974  -84.630  2.221   1.00 36.21  ? 295 VAL A HG21 1 
ATOM   4539  H  HG22 . VAL A  1 315 ? 76.723  -84.328  2.280   1.00 36.73  ? 295 VAL A HG22 1 
ATOM   4540  H  HG23 . VAL A  1 315 ? 76.096  -85.997  2.303   1.00 38.18  ? 295 VAL A HG23 1 
ATOM   4541  N  N    . THR A  1 316 ? 78.432  -86.833  3.417   1.00 38.57  ? 296 THR A N    1 
ATOM   4542  C  CA   . THR A  1 316 ? 78.770  -88.193  2.997   1.00 36.75  ? 296 THR A CA   1 
ATOM   4543  C  C    . THR A  1 316 ? 79.787  -88.873  3.894   1.00 40.65  ? 296 THR A C    1 
ATOM   4544  O  O    . THR A  1 316 ? 79.779  -90.104  3.936   1.00 39.93  ? 296 THR A O    1 
ATOM   4545  C  CB   . THR A  1 316 ? 79.257  -88.240  1.550   1.00 37.81  ? 296 THR A CB   1 
ATOM   4546  O  OG1  . THR A  1 316 ? 80.530  -87.603  1.413   1.00 31.15  ? 296 THR A OG1  1 
ATOM   4547  C  CG2  . THR A  1 316 ? 78.247  -87.676  0.587   1.00 32.75  ? 296 THR A CG2  1 
ATOM   4548  H  H    . THR A  1 316 ? 78.854  -86.108  2.846   1.00 38.75  ? 296 THR A H    1 
ATOM   4549  H  HA   . THR A  1 316 ? 77.870  -88.803  3.046   1.00 35.88  ? 296 THR A HA   1 
ATOM   4550  H  HB   . THR A  1 316 ? 79.397  -89.285  1.279   1.00 38.42  ? 296 THR A HB   1 
ATOM   4551  H  HG1  . THR A  1 316 ? 80.494  -86.932  0.683   1.00 29.70  ? 296 THR A HG1  1 
ATOM   4552  H  HG21 . THR A  1 316 ? 78.613  -87.802  -0.431  1.00 32.85  ? 296 THR A HG21 1 
ATOM   4553  H  HG22 . THR A  1 316 ? 77.295  -88.195  0.687   1.00 32.56  ? 296 THR A HG22 1 
ATOM   4554  H  HG23 . THR A  1 316 ? 78.086  -86.616  0.776   1.00 31.46  ? 296 THR A HG23 1 
ATOM   4555  N  N    . SER A  1 317 ? 80.665  -88.117  4.598   1.00 37.14  ? 297 SER A N    1 
ATOM   4556  C  CA   . SER A  1 317 ? 81.668  -88.733  5.468   1.00 36.87  ? 297 SER A CA   1 
ATOM   4557  C  C    . SER A  1 317 ? 81.031  -89.789  6.381   1.00 39.74  ? 297 SER A C    1 
ATOM   4558  O  O    . SER A  1 317 ? 79.993  -89.494  6.952   1.00 38.75  ? 297 SER A O    1 
ATOM   4559  C  CB   . SER A  1 317 ? 82.350  -87.684  6.348   1.00 39.88  ? 297 SER A CB   1 
ATOM   4560  O  OG   . SER A  1 317 ? 83.098  -88.263  7.416   1.00 38.12  ? 297 SER A OG   1 
ATOM   4561  H  H    . SER A  1 317 ? 80.707  -87.103  4.567   1.00 37.84  ? 297 SER A H    1 
ATOM   4562  H  HA   . SER A  1 317 ? 82.438  -89.173  4.837   1.00 36.80  ? 297 SER A HA   1 
ATOM   4563  H  HB2  . SER A  1 317 ? 83.003  -87.079  5.721   1.00 38.67  ? 297 SER A HB2  1 
ATOM   4564  H  HB3  . SER A  1 317 ? 81.574  -87.056  6.787   1.00 41.40  ? 297 SER A HB3  1 
ATOM   4565  H  HG   . SER A  1 317 ? 83.817  -88.835  7.037   1.00 38.94  ? 297 SER A HG   1 
ATOM   4566  N  N    . PRO A  1 318 ? 81.662  -90.967  6.599   1.00 37.37  ? 298 PRO A N    1 
ATOM   4567  C  CA   . PRO A  1 318 ? 81.128  -91.920  7.578   1.00 38.38  ? 298 PRO A CA   1 
ATOM   4568  C  C    . PRO A  1 318 ? 81.054  -91.341  9.010   1.00 43.21  ? 298 PRO A C    1 
ATOM   4569  O  O    . PRO A  1 318 ? 80.290  -91.849  9.840   1.00 42.32  ? 298 PRO A O    1 
ATOM   4570  C  CB   . PRO A  1 318 ? 82.126  -93.087  7.503   1.00 41.34  ? 298 PRO A CB   1 
ATOM   4571  C  CG   . PRO A  1 318 ? 82.745  -92.980  6.143   1.00 46.03  ? 298 PRO A CG   1 
ATOM   4572  C  CD   . PRO A  1 318 ? 82.886  -91.494  5.956   1.00 40.08  ? 298 PRO A CD   1 
ATOM   4573  H  HA   . PRO A  1 318 ? 80.140  -92.270  7.279   1.00 38.79  ? 298 PRO A HA   1 
ATOM   4574  H  HB2  . PRO A  1 318 ? 82.888  -92.977  8.273   1.00 41.94  ? 298 PRO A HB2  1 
ATOM   4575  H  HB3  . PRO A  1 318 ? 81.586  -94.026  7.625   1.00 41.81  ? 298 PRO A HB3  1 
ATOM   4576  H  HG2  . PRO A  1 318 ? 83.709  -93.486  6.103   1.00 46.22  ? 298 PRO A HG2  1 
ATOM   4577  H  HG3  . PRO A  1 318 ? 82.066  -93.388  5.395   1.00 46.39  ? 298 PRO A HG3  1 
ATOM   4578  H  HD2  . PRO A  1 318 ? 83.784  -91.134  6.455   1.00 40.64  ? 298 PRO A HD2  1 
ATOM   4579  H  HD3  . PRO A  1 318 ? 82.906  -91.273  4.889   1.00 39.16  ? 298 PRO A HD3  1 
ATOM   4580  N  N    . GLN A  1 319 ? 81.847  -90.271  9.304   1.00 39.22  ? 299 GLN A N    1 
ATOM   4581  C  CA   . GLN A  1 319 ? 81.790  -89.554  10.572  1.00 37.19  ? 299 GLN A CA   1 
ATOM   4582  C  C    . GLN A  1 319 ? 80.391  -88.888  10.730  1.00 39.27  ? 299 GLN A C    1 
ATOM   4583  O  O    . GLN A  1 319 ? 79.929  -88.677  11.838  1.00 35.78  ? 299 GLN A O    1 
ATOM   4584  C  CB   . GLN A  1 319 ? 82.916  -88.509  10.655  1.00 36.76  ? 299 GLN A CB   1 
ATOM   4585  C  CG   . GLN A  1 319 ? 83.140  -87.941  12.081  1.00 37.30  ? 299 GLN A CG   1 
ATOM   4586  C  CD   . GLN A  1 319 ? 82.247  -86.768  12.442  1.00 46.78  ? 299 GLN A CD   1 
ATOM   4587  O  OE1  . GLN A  1 319 ? 81.821  -85.980  11.591  1.00 37.12  ? 299 GLN A OE1  1 
ATOM   4588  N  NE2  . GLN A  1 319 ? 81.986  -86.582  13.722  1.00 44.03  ? 299 GLN A NE2  1 
ATOM   4589  H  H    . GLN A  1 319 ? 82.562  -89.904  8.684   1.00 39.78  ? 299 GLN A H    1 
ATOM   4590  H  HA   . GLN A  1 319 ? 81.925  -90.273  11.380  1.00 36.75  ? 299 GLN A HA   1 
ATOM   4591  H  HB2  . GLN A  1 319 ? 83.850  -88.983  10.356  1.00 35.83  ? 299 GLN A HB2  1 
ATOM   4592  H  HB3  . GLN A  1 319 ? 82.688  -87.694  9.972   1.00 35.50  ? 299 GLN A HB3  1 
ATOM   4593  H  HG2  . GLN A  1 319 ? 82.969  -88.732  12.808  1.00 36.33  ? 299 GLN A HG2  1 
ATOM   4594  H  HG3  . GLN A  1 319 ? 84.175  -87.603  12.146  1.00 38.09  ? 299 GLN A HG3  1 
ATOM   4595  H  HE21 . GLN A  1 319 ? 82.370  -87.211  14.420  1.00 44.69  ? 299 GLN A HE21 1 
ATOM   4596  H  HE22 . GLN A  1 319 ? 81.386  -85.813  14.004  1.00 43.67  ? 299 GLN A HE22 1 
ATOM   4597  N  N    . SER A  1 320 ? 79.731  -88.558  9.623   1.00 36.65  ? 300 SER A N    1 
ATOM   4598  C  CA   . SER A  1 320 ? 78.377  -88.005  9.664   1.00 37.06  ? 300 SER A CA   1 
ATOM   4599  C  C    . SER A  1 320 ? 77.347  -89.122  9.716   1.00 39.22  ? 300 SER A C    1 
ATOM   4600  O  O    . SER A  1 320 ? 77.425  -90.056  8.936   1.00 38.27  ? 300 SER A O    1 
ATOM   4601  C  CB   . SER A  1 320 ? 78.104  -87.122  8.446   1.00 40.33  ? 300 SER A CB   1 
ATOM   4602  O  OG   . SER A  1 320 ? 76.717  -86.887  8.277   1.00 46.25  ? 300 SER A OG   1 
ATOM   4603  H  H    . SER A  1 320 ? 80.122  -88.593  8.690   1.00 35.61  ? 300 SER A H    1 
ATOM   4604  H  HA   . SER A  1 320 ? 78.265  -87.381  10.550  1.00 37.52  ? 300 SER A HA   1 
ATOM   4605  H  HB2  . SER A  1 320 ? 78.608  -86.168  8.591   1.00 41.04  ? 300 SER A HB2  1 
ATOM   4606  H  HB3  . SER A  1 320 ? 78.477  -87.603  7.544   1.00 39.90  ? 300 SER A HB3  1 
ATOM   4607  H  HG   . SER A  1 320 ? 76.458  -87.037  7.331   1.00 44.97  ? 300 SER A HG   1 
ATOM   4608  N  N    . LYS A  1 321 ? 76.352  -88.991  10.611  1.00 35.85  ? 301 LYS A N    1 
ATOM   4609  C  CA   . LYS A  1 321 ? 75.217  -89.910  10.701  1.00 35.10  ? 301 LYS A CA   1 
ATOM   4610  C  C    . LYS A  1 321 ? 73.959  -89.260  10.112  1.00 37.26  ? 301 LYS A C    1 
ATOM   4611  O  O    . LYS A  1 321 ? 72.858  -89.767  10.308  1.00 37.09  ? 301 LYS A O    1 
ATOM   4612  C  CB   . LYS A  1 321 ? 75.001  -90.316  12.145  1.00 41.33  ? 301 LYS A CB   1 
ATOM   4613  C  CG   . LYS A  1 321 ? 76.191  -91.083  12.707  1.00 44.18  ? 301 LYS A CG   1 
ATOM   4614  C  CD   . LYS A  1 321 ? 75.836  -91.794  13.974  1.00 49.24  ? 301 LYS A CD   1 
ATOM   4615  C  CE   . LYS A  1 321 ? 77.039  -92.468  14.604  1.00 66.88  ? 301 LYS A CE   1 
ATOM   4616  N  NZ   . LYS A  1 321 ? 77.640  -93.504  13.712  1.00 78.38  ? 301 LYS A NZ   1 
ATOM   4617  H  H    . LYS A  1 321 ? 76.306  -88.245  11.298  1.00 36.66  ? 301 LYS A H    1 
ATOM   4618  H  HA   . LYS A  1 321 ? 75.413  -90.818  10.132  1.00 36.41  ? 301 LYS A HA   1 
ATOM   4619  H  HB2  . LYS A  1 321 ? 74.848  -89.423  12.753  1.00 41.37  ? 301 LYS A HB2  1 
ATOM   4620  H  HB3  . LYS A  1 321 ? 74.132  -90.968  12.204  1.00 42.59  ? 301 LYS A HB3  1 
ATOM   4621  H  HG2  . LYS A  1 321 ? 76.509  -91.817  11.969  1.00 42.51  ? 301 LYS A HG2  1 
ATOM   4622  H  HG3  . LYS A  1 321 ? 77.004  -90.390  12.919  1.00 44.76  ? 301 LYS A HG3  1 
ATOM   4623  H  HD2  . LYS A  1 321 ? 75.423  -91.081  14.686  1.00 49.49  ? 301 LYS A HD2  1 
ATOM   4624  H  HD3  . LYS A  1 321 ? 75.104  -92.567  13.747  1.00 48.98  ? 301 LYS A HD3  1 
ATOM   4625  H  HE2  . LYS A  1 321 ? 77.802  -91.717  14.804  1.00 67.05  ? 301 LYS A HE2  1 
ATOM   4626  H  HE3  . LYS A  1 321 ? 76.729  -92.947  15.532  1.00 67.44  ? 301 LYS A HE3  1 
ATOM   4627  H  HZ1  . LYS A  1 321 ? 78.239  -94.117  14.255  1.00 79.08  ? 301 LYS A HZ1  1 
ATOM   4628  H  HZ2  . LYS A  1 321 ? 76.909  -94.056  13.277  1.00 77.89  ? 301 LYS A HZ2  1 
ATOM   4629  H  HZ3  . LYS A  1 321 ? 78.204  -93.063  12.991  1.00 78.25  ? 301 LYS A HZ3  1 
ATOM   4630  N  N    . ARG A  1 322 ? 74.132  -88.206  9.304   1.00 33.73  ? 302 ARG A N    1 
ATOM   4631  C  CA   . ARG A  1 322 ? 73.053  -87.447  8.676   1.00 32.99  ? 302 ARG A CA   1 
ATOM   4632  C  C    . ARG A  1 322 ? 73.199  -87.350  7.178   1.00 38.54  ? 302 ARG A C    1 
ATOM   4633  O  O    . ARG A  1 322 ? 74.285  -87.546  6.652   1.00 36.09  ? 302 ARG A O    1 
ATOM   4634  C  CB   . ARG A  1 322 ? 73.079  -85.998  9.230   1.00 34.07  ? 302 ARG A CB   1 
ATOM   4635  C  CG   . ARG A  1 322 ? 73.168  -85.915  10.754  1.00 38.22  ? 302 ARG A CG   1 
ATOM   4636  C  CD   . ARG A  1 322 ? 73.084  -84.463  11.237  1.00 40.92  ? 302 ARG A CD   1 
ATOM   4637  N  NE   . ARG A  1 322 ? 71.706  -83.988  11.327  1.00 45.70  ? 302 ARG A NE   1 
ATOM   4638  C  CZ   . ARG A  1 322 ? 70.844  -84.298  12.291  1.00 53.79  ? 302 ARG A CZ   1 
ATOM   4639  N  NH1  . ARG A  1 322 ? 71.192  -85.127  13.267  1.00 40.40  ? 302 ARG A NH1  1 
ATOM   4640  N  NH2  . ARG A  1 322 ? 69.614  -83.813  12.265  1.00 37.66  ? 302 ARG A NH2  1 
ATOM   4641  H  H    . ARG A  1 322 ? 75.035  -87.833  9.026   1.00 34.97  ? 302 ARG A H    1 
ATOM   4642  H  HA   . ARG A  1 322 ? 72.083  -87.887  8.892   1.00 29.66  ? 302 ARG A HA   1 
ATOM   4643  H  HB2  . ARG A  1 322 ? 73.941  -85.470  8.828   1.00 32.40  ? 302 ARG A HB2  1 
ATOM   4644  H  HB3  . ARG A  1 322 ? 72.158  -85.505  8.922   1.00 33.86  ? 302 ARG A HB3  1 
ATOM   4645  H  HG2  . ARG A  1 322 ? 72.351  -86.488  11.189  1.00 36.82  ? 302 ARG A HG2  1 
ATOM   4646  H  HG3  . ARG A  1 322 ? 74.124  -86.320  11.077  1.00 38.68  ? 302 ARG A HG3  1 
ATOM   4647  H  HD2  . ARG A  1 322 ? 73.576  -84.332  12.199  1.00 42.13  ? 302 ARG A HD2  1 
ATOM   4648  H  HD3  . ARG A  1 322 ? 73.584  -83.833  10.508  1.00 40.27  ? 302 ARG A HD3  1 
ATOM   4649  H  HE   . ARG A  1 322 ? 71.386  -83.376  10.586  1.00 45.85  ? 302 ARG A HE   1 
ATOM   4650  H  HH11 . ARG A  1 322 ? 72.121  -85.526  13.341  1.00 39.55  ? 302 ARG A HH11 1 
ATOM   4651  H  HH12 . ARG A  1 322 ? 70.515  -85.344  13.992  1.00 41.48  ? 302 ARG A HH12 1 
ATOM   4652  H  HH21 . ARG A  1 322 ? 69.317  -83.194  11.520  1.00 37.15  ? 302 ARG A HH21 1 
ATOM   4653  H  HH22 . ARG A  1 322 ? 68.954  -84.065  12.996  1.00 39.25  ? 302 ARG A HH22 1 
ATOM   4654  N  N    . GLY A  1 323 ? 72.106  -86.947  6.529   1.00 38.26  ? 303 GLY A N    1 
ATOM   4655  C  CA   . GLY A  1 323 ? 72.062  -86.679  5.100   1.00 37.64  ? 303 GLY A CA   1 
ATOM   4656  C  C    . GLY A  1 323 ? 72.041  -87.925  4.250   1.00 38.90  ? 303 GLY A C    1 
ATOM   4657  O  O    . GLY A  1 323 ? 71.106  -88.718  4.324   1.00 39.71  ? 303 GLY A O    1 
ATOM   4658  H  H    . GLY A  1 323 ? 71.212  -86.797  6.985   1.00 38.99  ? 303 GLY A H    1 
ATOM   4659  H  HA2  . GLY A  1 323 ? 71.161  -86.106  4.884   1.00 37.39  ? 303 GLY A HA2  1 
ATOM   4660  H  HA3  . GLY A  1 323 ? 72.918  -86.061  4.835   1.00 37.01  ? 303 GLY A HA3  1 
ATOM   4661  N  N    . TYR A  1 324 ? 73.059  -88.108  3.446   1.00 34.40  ? 304 TYR A N    1 
ATOM   4662  C  CA   . TYR A  1 324 ? 73.156  -89.263  2.559   1.00 31.89  ? 304 TYR A CA   1 
ATOM   4663  C  C    . TYR A  1 324 ? 74.619  -89.588  2.295   1.00 35.85  ? 304 TYR A C    1 
ATOM   4664  O  O    . TYR A  1 324 ? 75.502  -88.774  2.569   1.00 33.58  ? 304 TYR A O    1 
ATOM   4665  C  CB   . TYR A  1 324 ? 72.368  -89.055  1.262   1.00 31.57  ? 304 TYR A CB   1 
ATOM   4666  C  CG   . TYR A  1 324 ? 72.629  -87.730  0.549   1.00 34.73  ? 304 TYR A CG   1 
ATOM   4667  C  CD1  . TYR A  1 324 ? 73.796  -87.521  -0.176  1.00 36.83  ? 304 TYR A CD1  1 
ATOM   4668  C  CD2  . TYR A  1 324 ? 71.699  -86.689  0.601   1.00 34.99  ? 304 TYR A CD2  1 
ATOM   4669  C  CE1  . TYR A  1 324 ? 74.057  -86.294  -0.786  1.00 37.04  ? 304 TYR A CE1  1 
ATOM   4670  C  CE2  . TYR A  1 324 ? 71.922  -85.482  -0.058  1.00 33.89  ? 304 TYR A CE2  1 
ATOM   4671  C  CZ   . TYR A  1 324 ? 73.105  -85.290  -0.758  1.00 40.87  ? 304 TYR A CZ   1 
ATOM   4672  O  OH   . TYR A  1 324 ? 73.377  -84.116  -1.433  1.00 38.98  ? 304 TYR A OH   1 
ATOM   4673  H  H    . TYR A  1 324 ? 73.854  -87.478  3.384   1.00 36.98  ? 304 TYR A H    1 
ATOM   4674  H  HA   . TYR A  1 324 ? 72.731  -90.126  3.066   1.00 33.22  ? 304 TYR A HA   1 
ATOM   4675  H  HB2  . TYR A  1 324 ? 72.623  -89.847  0.563   1.00 32.64  ? 304 TYR A HB2  1 
ATOM   4676  H  HB3  . TYR A  1 324 ? 71.305  -89.108  1.486   1.00 30.68  ? 304 TYR A HB3  1 
ATOM   4677  H  HD1  . TYR A  1 324 ? 74.562  -88.292  -0.218  1.00 36.12  ? 304 TYR A HD1  1 
ATOM   4678  H  HD2  . TYR A  1 324 ? 70.760  -86.836  1.131   1.00 36.40  ? 304 TYR A HD2  1 
ATOM   4679  H  HE1  . TYR A  1 324 ? 74.987  -86.153  -1.334  1.00 36.96  ? 304 TYR A HE1  1 
ATOM   4680  H  HE2  . TYR A  1 324 ? 71.160  -84.705  -0.017  1.00 32.10  ? 304 TYR A HE2  1 
ATOM   4681  H  HH   . TYR A  1 324 ? 72.587  -83.513  -1.432  1.00 39.49  ? 304 TYR A HH   1 
ATOM   4682  N  N    . THR A  1 325 ? 74.862  -90.819  1.823   1.00 34.59  ? 305 THR A N    1 
ATOM   4683  C  CA   . THR A  1 325 ? 76.203  -91.320  1.528   1.00 34.39  ? 305 THR A CA   1 
ATOM   4684  C  C    . THR A  1 325 ? 76.674  -90.862  0.146   1.00 37.59  ? 305 THR A C    1 
ATOM   4685  O  O    . THR A  1 325 ? 75.876  -90.382  -0.673  1.00 36.74  ? 305 THR A O    1 
ATOM   4686  C  CB   . THR A  1 325 ? 76.219  -92.855  1.597   1.00 43.21  ? 305 THR A CB   1 
ATOM   4687  O  OG1  . THR A  1 325 ? 75.375  -93.376  0.561   1.00 45.61  ? 305 THR A OG1  1 
ATOM   4688  C  CG2  . THR A  1 325 ? 75.784  -93.394  2.956   1.00 36.52  ? 305 THR A CG2  1 
ATOM   4689  H  H    . THR A  1 325 ? 74.120  -91.477  1.606   1.00 34.56  ? 305 THR A H    1 
ATOM   4690  H  HA   . THR A  1 325 ? 76.902  -90.949  2.275   1.00 33.90  ? 305 THR A HA   1 
ATOM   4691  H  HB   . THR A  1 325 ? 77.234  -93.204  1.425   1.00 43.11  ? 305 THR A HB   1 
ATOM   4692  H  HG1  . THR A  1 325 ? 75.301  -94.363  0.655   1.00 46.53  ? 305 THR A HG1  1 
ATOM   4693  H  HG21 . THR A  1 325 ? 75.787  -94.482  2.942   1.00 36.79  ? 305 THR A HG21 1 
ATOM   4694  H  HG22 . THR A  1 325 ? 76.473  -93.058  3.729   1.00 36.52  ? 305 THR A HG22 1 
ATOM   4695  H  HG23 . THR A  1 325 ? 74.780  -93.058  3.212   1.00 36.73  ? 305 THR A HG23 1 
ATOM   4696  N  N    . ALA A  1 326 ? 77.983  -91.010  -0.102  1.00 34.97  ? 306 ALA A N    1 
ATOM   4697  C  CA   . ALA A  1 326 ? 78.591  -90.762  -1.431  1.00 35.57  ? 306 ALA A CA   1 
ATOM   4698  C  C    . ALA A  1 326 ? 77.969  -91.709  -2.492  1.00 36.41  ? 306 ALA A C    1 
ATOM   4699  O  O    . ALA A  1 326 ? 77.833  -91.320  -3.623  1.00 35.37  ? 306 ALA A O    1 
ATOM   4700  C  CB   . ALA A  1 326 ? 80.100  -90.960  -1.359  1.00 36.30  ? 306 ALA A CB   1 
ATOM   4701  H  H    . ALA A  1 326 ? 78.647  -91.308  0.605   1.00 35.68  ? 306 ALA A H    1 
ATOM   4702  H  HA   . ALA A  1 326 ? 78.397  -89.742  -1.759  1.00 35.29  ? 306 ALA A HA   1 
ATOM   4703  H  HB1  . ALA A  1 326 ? 80.528  -90.735  -2.336  1.00 34.88  ? 306 ALA A HB1  1 
ATOM   4704  H  HB2  . ALA A  1 326 ? 80.508  -90.288  -0.605  1.00 36.01  ? 306 ALA A HB2  1 
ATOM   4705  H  HB3  . ALA A  1 326 ? 80.306  -91.990  -1.073  1.00 35.45  ? 306 ALA A HB3  1 
ATOM   4706  N  N    . PHE A  1 327 ? 77.566  -92.916  -2.122  1.00 33.40  ? 307 PHE A N    1 
ATOM   4707  C  CA   . PHE A  1 327 ? 76.887  -93.838  -3.047  1.00 32.76  ? 307 PHE A CA   1 
ATOM   4708  C  C    . PHE A  1 327 ? 75.557  -93.209  -3.538  1.00 35.86  ? 307 PHE A C    1 
ATOM   4709  O  O    . PHE A  1 327 ? 75.285  -93.214  -4.742  1.00 35.62  ? 307 PHE A O    1 
ATOM   4710  C  CB   . PHE A  1 327 ? 76.642  -95.192  -2.373  1.00 33.71  ? 307 PHE A CB   1 
ATOM   4711  C  CG   . PHE A  1 327 ? 75.849  -96.156  -3.213  1.00 34.23  ? 307 PHE A CG   1 
ATOM   4712  C  CD1  . PHE A  1 327 ? 74.465  -96.138  -3.196  1.00 36.60  ? 307 PHE A CD1  1 
ATOM   4713  C  CD2  . PHE A  1 327 ? 76.484  -97.054  -4.052  1.00 37.14  ? 307 PHE A CD2  1 
ATOM   4714  C  CE1  . PHE A  1 327 ? 73.733  -96.979  -4.023  1.00 38.93  ? 307 PHE A CE1  1 
ATOM   4715  C  CE2  . PHE A  1 327 ? 75.743  -97.924  -4.848  1.00 40.57  ? 307 PHE A CE2  1 
ATOM   4716  C  CZ   . PHE A  1 327 ? 74.371  -97.874  -4.825  1.00 37.85  ? 307 PHE A CZ   1 
ATOM   4717  H  H    . PHE A  1 327 ? 77.693  -93.305  -1.194  1.00 33.61  ? 307 PHE A H    1 
ATOM   4718  H  HA   . PHE A  1 327 ? 77.514  -93.997  -3.923  1.00 34.01  ? 307 PHE A HA   1 
ATOM   4719  H  HB2  . PHE A  1 327 ? 77.602  -95.655  -2.149  1.00 33.83  ? 307 PHE A HB2  1 
ATOM   4720  H  HB3  . PHE A  1 327 ? 76.089  -95.025  -1.450  1.00 33.81  ? 307 PHE A HB3  1 
ATOM   4721  H  HD1  . PHE A  1 327 ? 73.943  -95.422  -2.564  1.00 36.41  ? 307 PHE A HD1  1 
ATOM   4722  H  HD2  . PHE A  1 327 ? 77.570  -97.123  -4.064  1.00 36.90  ? 307 PHE A HD2  1 
ATOM   4723  H  HE1  . PHE A  1 327 ? 72.646  -96.958  -4.002  1.00 40.55  ? 307 PHE A HE1  1 
ATOM   4724  H  HE2  . PHE A  1 327 ? 76.253  -98.647  -5.484  1.00 41.23  ? 307 PHE A HE2  1 
ATOM   4725  H  HZ   . PHE A  1 327 ? 73.793  -98.576  -5.421  1.00 38.34  ? 307 PHE A HZ   1 
ATOM   4726  N  N    . VAL A  1 328 ? 74.775  -92.645  -2.624  1.00 31.37  ? 308 VAL A N    1 
ATOM   4727  C  CA   . VAL A  1 328 ? 73.501  -91.981  -2.934  1.00 32.02  ? 308 VAL A CA   1 
ATOM   4728  C  C    . VAL A  1 328 ? 73.752  -90.736  -3.800  1.00 36.21  ? 308 VAL A C    1 
ATOM   4729  O  O    . VAL A  1 328 ? 73.014  -90.513  -4.754  1.00 34.16  ? 308 VAL A O    1 
ATOM   4730  C  CB   . VAL A  1 328 ? 72.718  -91.636  -1.647  1.00 35.13  ? 308 VAL A CB   1 
ATOM   4731  C  CG1  . VAL A  1 328 ? 71.582  -90.657  -1.914  1.00 34.72  ? 308 VAL A CG1  1 
ATOM   4732  C  CG2  . VAL A  1 328 ? 72.177  -92.909  -0.996  1.00 35.48  ? 308 VAL A CG2  1 
ATOM   4733  H  H    . VAL A  1 328 ? 74.996  -92.644  -1.632  1.00 33.40  ? 308 VAL A H    1 
ATOM   4734  H  HA   . VAL A  1 328 ? 72.888  -92.669  -3.516  1.00 32.50  ? 308 VAL A HA   1 
ATOM   4735  H  HB   . VAL A  1 328 ? 73.402  -91.168  -0.941  1.00 33.82  ? 308 VAL A HB   1 
ATOM   4736  H  HG11 . VAL A  1 328 ? 70.882  -90.695  -1.080  1.00 35.56  ? 308 VAL A HG11 1 
ATOM   4737  H  HG12 . VAL A  1 328 ? 71.977  -89.645  -1.987  1.00 34.34  ? 308 VAL A HG12 1 
ATOM   4738  H  HG13 . VAL A  1 328 ? 71.066  -90.941  -2.829  1.00 33.88  ? 308 VAL A HG13 1 
ATOM   4739  H  HG21 . VAL A  1 328 ? 71.664  -92.653  -0.070  1.00 34.32  ? 308 VAL A HG21 1 
ATOM   4740  H  HG22 . VAL A  1 328 ? 71.478  -93.376  -1.688  1.00 36.63  ? 308 VAL A HG22 1 
ATOM   4741  H  HG23 . VAL A  1 328 ? 73.003  -93.588  -0.790  1.00 34.90  ? 308 VAL A HG23 1 
ATOM   4742  N  N    . LEU A  1 329 ? 74.779  -89.938  -3.463  1.00 34.71  ? 309 LEU A N    1 
ATOM   4743  C  CA   . LEU A  1 329 ? 75.134  -88.746  -4.230  1.00 33.81  ? 309 LEU A CA   1 
ATOM   4744  C  C    . LEU A  1 329 ? 75.458  -89.108  -5.699  1.00 37.95  ? 309 LEU A C    1 
ATOM   4745  O  O    . LEU A  1 329 ? 74.973  -88.468  -6.630  1.00 35.53  ? 309 LEU A O    1 
ATOM   4746  C  CB   . LEU A  1 329 ? 76.354  -88.059  -3.593  1.00 34.35  ? 309 LEU A CB   1 
ATOM   4747  C  CG   . LEU A  1 329 ? 76.894  -86.815  -4.337  1.00 39.17  ? 309 LEU A CG   1 
ATOM   4748  C  CD1  . LEU A  1 329 ? 75.867  -85.710  -4.356  1.00 39.51  ? 309 LEU A CD1  1 
ATOM   4749  C  CD2  . LEU A  1 329 ? 78.148  -86.306  -3.671  1.00 42.62  ? 309 LEU A CD2  1 
ATOM   4750  H  H    . LEU A  1 329 ? 75.363  -90.089  -2.644  1.00 35.06  ? 309 LEU A H    1 
ATOM   4751  H  HA   . LEU A  1 329 ? 74.295  -88.054  -4.214  1.00 32.19  ? 309 LEU A HA   1 
ATOM   4752  H  HB2  . LEU A  1 329 ? 76.091  -87.762  -2.578  1.00 35.69  ? 309 LEU A HB2  1 
ATOM   4753  H  HB3  . LEU A  1 329 ? 77.166  -88.782  -3.547  1.00 34.60  ? 309 LEU A HB3  1 
ATOM   4754  H  HG   . LEU A  1 329 ? 77.151  -87.062  -5.366  1.00 38.44  ? 309 LEU A HG   1 
ATOM   4755  H  HD11 . LEU A  1 329 ? 76.316  -84.829  -4.813  1.00 40.92  ? 309 LEU A HD11 1 
ATOM   4756  H  HD12 . LEU A  1 329 ? 75.002  -86.021  -4.940  1.00 40.12  ? 309 LEU A HD12 1 
ATOM   4757  H  HD13 . LEU A  1 329 ? 75.569  -85.475  -3.337  1.00 38.76  ? 309 LEU A HD13 1 
ATOM   4758  H  HD21 . LEU A  1 329 ? 78.554  -85.485  -4.260  1.00 41.56  ? 309 LEU A HD21 1 
ATOM   4759  H  HD22 . LEU A  1 329 ? 77.881  -85.957  -2.675  1.00 42.32  ? 309 LEU A HD22 1 
ATOM   4760  H  HD23 . LEU A  1 329 ? 78.874  -87.116  -3.602  1.00 42.71  ? 309 LEU A HD23 1 
ATOM   4761  N  N    . SER A  1 330 ? 76.274  -90.130  -5.879  1.00 34.20  ? 310 SER A N    1 
ATOM   4762  C  CA   . SER A  1 330 ? 76.711  -90.601  -7.203  1.00 33.28  ? 310 SER A CA   1 
ATOM   4763  C  C    . SER A  1 330 ? 75.557  -91.149  -8.035  1.00 35.90  ? 310 SER A C    1 
ATOM   4764  O  O    . SER A  1 330 ? 75.460  -90.871  -9.228  1.00 33.45  ? 310 SER A O    1 
ATOM   4765  C  CB   . SER A  1 330 ? 77.760  -91.688  -7.026  1.00 34.11  ? 310 SER A CB   1 
ATOM   4766  O  OG   . SER A  1 330 ? 78.878  -91.177  -6.319  1.00 36.34  ? 310 SER A OG   1 
ATOM   4767  H  H    . SER A  1 330 ? 76.661  -90.668  -5.111  1.00 34.23  ? 310 SER A H    1 
ATOM   4768  H  HA   . SER A  1 330 ? 77.160  -89.769  -7.740  1.00 31.58  ? 310 SER A HA   1 
ATOM   4769  H  HB2  . SER A  1 330 ? 77.320  -92.501  -6.452  1.00 33.04  ? 310 SER A HB2  1 
ATOM   4770  H  HB3  . SER A  1 330 ? 78.084  -92.038  -8.005  1.00 33.49  ? 310 SER A HB3  1 
ATOM   4771  H  HG   . SER A  1 330 ? 78.858  -91.480  -5.375  1.00 36.07  ? 310 SER A HG   1 
ATOM   4772  N  N    . LYS A  1 331 ? 74.686  -91.938  -7.407  1.00 32.50  ? 311 LYS A N    1 
ATOM   4773  C  CA   . LYS A  1 331 ? 73.512  -92.491  -8.073  1.00 32.52  ? 311 LYS A CA   1 
ATOM   4774  C  C    . LYS A  1 331 ? 72.574  -91.360  -8.573  1.00 35.69  ? 311 LYS A C    1 
ATOM   4775  O  O    . LYS A  1 331 ? 72.104  -91.398  -9.726  1.00 34.25  ? 311 LYS A O    1 
ATOM   4776  C  CB   . LYS A  1 331 ? 72.779  -93.438  -7.134  1.00 33.05  ? 311 LYS A CB   1 
ATOM   4777  C  CG   . LYS A  1 331 ? 71.700  -94.224  -7.836  1.00 42.37  ? 311 LYS A CG   1 
ATOM   4778  C  CD   . LYS A  1 331 ? 71.174  -95.389  -7.026  1.00 29.57  ? 311 LYS A CD   1 
ATOM   4779  C  CE   . LYS A  1 331 ? 70.078  -96.017  -7.818  1.00 44.80  ? 311 LYS A CE   1 
ATOM   4780  N  NZ   . LYS A  1 331 ? 69.435  -97.119  -7.110  1.00 39.13  ? 311 LYS A NZ   1 
ATOM   4781  H  H    . LYS A  1 331 ? 74.777  -92.211  -6.435  1.00 33.33  ? 311 LYS A H    1 
ATOM   4782  H  HA   . LYS A  1 331 ? 73.845  -93.050  -8.947  1.00 35.11  ? 311 LYS A HA   1 
ATOM   4783  H  HB2  . LYS A  1 331 ? 73.495  -94.149  -6.728  1.00 32.94  ? 311 LYS A HB2  1 
ATOM   4784  H  HB3  . LYS A  1 331 ? 72.321  -92.866  -6.329  1.00 33.28  ? 311 LYS A HB3  1 
ATOM   4785  H  HG2  . LYS A  1 331 ? 70.869  -93.562  -8.071  1.00 41.64  ? 311 LYS A HG2  1 
ATOM   4786  H  HG3  . LYS A  1 331 ? 72.118  -94.634  -8.754  1.00 43.23  ? 311 LYS A HG3  1 
ATOM   4787  H  HD2  . LYS A  1 331 ? 71.960  -96.124  -6.863  1.00 26.30  ? 311 LYS A HD2  1 
ATOM   4788  H  HD3  . LYS A  1 331 ? 70.773  -95.032  -6.077  1.00 30.90  ? 311 LYS A HD3  1 
ATOM   4789  H  HE2  . LYS A  1 331 ? 69.318  -95.272  -8.053  1.00 44.22  ? 311 LYS A HE2  1 
ATOM   4790  H  HE3  . LYS A  1 331 ? 70.514  -96.411  -8.735  1.00 46.01  ? 311 LYS A HE3  1 
ATOM   4791  H  HZ1  . LYS A  1 331 ? 70.070  -97.906  -7.023  1.00 39.40  ? 311 LYS A HZ1  1 
ATOM   4792  H  HZ2  . LYS A  1 331 ? 69.163  -96.813  -6.181  1.00 38.99  ? 311 LYS A HZ2  1 
ATOM   4793  H  HZ3  . LYS A  1 331 ? 68.600  -97.420  -7.602  1.00 39.80  ? 311 LYS A HZ3  1 
ATOM   4794  N  N    . MET A  1 332 ? 72.357  -90.337  -7.730  1.00 34.14  ? 312 MET A N    1 
ATOM   4795  C  CA   . MET A  1 332 ? 71.555  -89.171  -8.114  1.00 33.22  ? 312 MET A CA   1 
ATOM   4796  C  C    . MET A  1 332 ? 72.201  -88.440  -9.289  1.00 35.17  ? 312 MET A C    1 
ATOM   4797  O  O    . MET A  1 332 ? 71.484  -88.025  -10.176 1.00 34.15  ? 312 MET A O    1 
ATOM   4798  C  CB   . MET A  1 332 ? 71.353  -88.203  -6.941  1.00 35.07  ? 312 MET A CB   1 
ATOM   4799  C  CG   . MET A  1 332 ? 70.392  -88.696  -5.876  1.00 38.89  ? 312 MET A CG   1 
ATOM   4800  S  SD   . MET A  1 332 ? 70.009  -87.430  -4.645  1.00 42.24  ? 312 MET A SD   1 
ATOM   4801  C  CE   . MET A  1 332 ? 71.623  -87.174  -3.891  1.00 39.02  ? 312 MET A CE   1 
ATOM   4802  H  H    . MET A  1 332 ? 72.713  -90.289  -6.782  1.00 34.17  ? 312 MET A H    1 
ATOM   4803  H  HA   . MET A  1 332 ? 70.573  -89.519  -8.433  1.00 35.37  ? 312 MET A HA   1 
ATOM   4804  H  HB2  . MET A  1 332 ? 72.317  -88.012  -6.476  1.00 34.68  ? 312 MET A HB2  1 
ATOM   4805  H  HB3  . MET A  1 332 ? 70.940  -87.274  -7.333  1.00 36.15  ? 312 MET A HB3  1 
ATOM   4806  H  HG2  . MET A  1 332 ? 69.456  -88.999  -6.344  1.00 38.94  ? 312 MET A HG2  1 
ATOM   4807  H  HG3  . MET A  1 332 ? 70.820  -89.549  -5.352  1.00 39.73  ? 312 MET A HG3  1 
ATOM   4808  H  HE1  . MET A  1 332 ? 71.489  -86.678  -2.932  1.00 37.82  ? 312 MET A HE1  1 
ATOM   4809  H  HE2  . MET A  1 332 ? 72.069  -88.156  -3.737  1.00 40.73  ? 312 MET A HE2  1 
ATOM   4810  H  HE3  . MET A  1 332 ? 72.252  -86.574  -4.544  1.00 37.69  ? 312 MET A HE3  1 
ATOM   4811  N  N    . ALA A  1 333 ? 73.545  -88.289  -9.292  1.00 30.90  ? 313 ALA A N    1 
ATOM   4812  C  CA   . ALA A  1 333 ? 74.274  -87.585  -10.345 1.00 28.90  ? 313 ALA A CA   1 
ATOM   4813  C  C    . ALA A  1 333 ? 74.074  -88.241  -11.713 1.00 30.74  ? 313 ALA A C    1 
ATOM   4814  O  O    . ALA A  1 333 ? 73.946  -87.532  -12.698 1.00 28.06  ? 313 ALA A O    1 
ATOM   4815  C  CB   . ALA A  1 333 ? 75.760  -87.504  -9.998  1.00 30.42  ? 313 ALA A CB   1 
ATOM   4816  H  H    . ALA A  1 333 ? 74.144  -88.629  -8.544  1.00 31.43  ? 313 ALA A H    1 
ATOM   4817  H  HA   . ALA A  1 333 ? 73.898  -86.565  -10.406 1.00 29.64  ? 313 ALA A HA   1 
ATOM   4818  H  HB1  . ALA A  1 333 ? 76.259  -86.904  -10.758 1.00 31.02  ? 313 ALA A HB1  1 
ATOM   4819  H  HB2  . ALA A  1 333 ? 75.873  -87.037  -9.022  1.00 28.70  ? 313 ALA A HB2  1 
ATOM   4820  H  HB3  . ALA A  1 333 ? 76.190  -88.504  -9.987  1.00 30.65  ? 313 ALA A HB3  1 
ATOM   4821  N  N    . ARG A  1 334 ? 73.966  -89.584  -11.782 1.00 31.03  ? 314 ARG A N    1 
ATOM   4822  C  CA   . ARG A  1 334 ? 73.697  -90.263  -13.044 1.00 32.16  ? 314 ARG A CA   1 
ATOM   4823  C  C    . ARG A  1 334 ? 72.315  -89.868  -13.576 1.00 35.89  ? 314 ARG A C    1 
ATOM   4824  O  O    . ARG A  1 334 ? 72.204  -89.520  -14.754 1.00 35.51  ? 314 ARG A O    1 
ATOM   4825  C  CB   . ARG A  1 334 ? 73.818  -91.794  -12.902 1.00 32.22  ? 314 ARG A CB   1 
ATOM   4826  C  CG   . ARG A  1 334 ? 73.613  -92.555  -14.203 1.00 34.90  ? 314 ARG A CG   1 
ATOM   4827  C  CD   . ARG A  1 334 ? 74.092  -93.980  -14.074 1.00 31.94  ? 314 ARG A CD   1 
ATOM   4828  N  NE   . ARG A  1 334 ? 73.933  -94.745  -15.327 1.00 31.61  ? 314 ARG A NE   1 
ATOM   4829  C  CZ   . ARG A  1 334 ? 74.098  -96.066  -15.451 1.00 41.71  ? 314 ARG A CZ   1 
ATOM   4830  N  NH1  . ARG A  1 334 ? 74.423  -96.808  -14.398 1.00 31.18  ? 314 ARG A NH1  1 
ATOM   4831  N  NH2  . ARG A  1 334 ? 73.930  -96.654  -16.628 1.00 33.14  ? 314 ARG A NH2  1 
ATOM   4832  H  H    . ARG A  1 334 ? 74.060  -90.209  -10.989 1.00 31.97  ? 314 ARG A H    1 
ATOM   4833  H  HA   . ARG A  1 334 ? 74.430  -89.932  -13.780 1.00 33.31  ? 314 ARG A HA   1 
ATOM   4834  H  HB2  . ARG A  1 334 ? 74.814  -92.027  -12.530 1.00 32.45  ? 314 ARG A HB2  1 
ATOM   4835  H  HB3  . ARG A  1 334 ? 73.066  -92.140  -12.194 1.00 34.24  ? 314 ARG A HB3  1 
ATOM   4836  H  HG2  . ARG A  1 334 ? 72.552  -92.586  -14.449 1.00 36.33  ? 314 ARG A HG2  1 
ATOM   4837  H  HG3  . ARG A  1 334 ? 74.160  -92.065  -15.008 1.00 34.67  ? 314 ARG A HG3  1 
ATOM   4838  H  HD2  . ARG A  1 334 ? 75.151  -93.949  -13.829 1.00 32.41  ? 314 ARG A HD2  1 
ATOM   4839  H  HD3  . ARG A  1 334 ? 73.525  -94.469  -13.287 1.00 31.41  ? 314 ARG A HD3  1 
ATOM   4840  H  HE   . ARG A  1 334 ? 73.681  -94.218  -16.157 1.00 30.05  ? 314 ARG A HE   1 
ATOM   4841  H  HH11 . ARG A  1 334 ? 74.563  -96.409  -13.477 1.00 31.08  ? 314 ARG A HH11 1 
ATOM   4842  H  HH12 . ARG A  1 334 ? 74.541  -97.807  -14.520 1.00 30.36  ? 314 ARG A HH12 1 
ATOM   4843  H  HH21 . ARG A  1 334 ? 73.674  -96.104  -17.442 1.00 34.58  ? 314 ARG A HH21 1 
ATOM   4844  H  HH22 . ARG A  1 334 ? 74.054  -97.654  -16.726 1.00 32.93  ? 314 ARG A HH22 1 
ATOM   4845  N  N    . LEU A  1 335 ? 71.297  -89.834  -12.699 1.00 32.86  ? 315 LEU A N    1 
ATOM   4846  C  CA   . LEU A  1 335 ? 69.943  -89.406  -13.080 1.00 31.93  ? 315 LEU A CA   1 
ATOM   4847  C  C    . LEU A  1 335 ? 69.931  -87.939  -13.546 1.00 35.91  ? 315 LEU A C    1 
ATOM   4848  O  O    . LEU A  1 335 ? 69.260  -87.598  -14.529 1.00 34.03  ? 315 LEU A O    1 
ATOM   4849  C  CB   . LEU A  1 335 ? 68.977  -89.567  -11.895 1.00 31.63  ? 315 LEU A CB   1 
ATOM   4850  C  CG   . LEU A  1 335 ? 68.706  -90.983  -11.396 1.00 34.38  ? 315 LEU A CG   1 
ATOM   4851  C  CD1  . LEU A  1 335 ? 67.938  -90.935  -10.082 1.00 34.52  ? 315 LEU A CD1  1 
ATOM   4852  C  CD2  . LEU A  1 335 ? 67.922  -91.763  -12.380 1.00 35.89  ? 315 LEU A CD2  1 
ATOM   4853  H  H    . LEU A  1 335 ? 71.392  -90.090  -11.720 1.00 33.77  ? 315 LEU A H    1 
ATOM   4854  H  HA   . LEU A  1 335 ? 69.601  -90.022  -13.911 1.00 30.74  ? 315 LEU A HA   1 
ATOM   4855  H  HB2  . LEU A  1 335 ? 69.349  -88.992  -11.048 1.00 30.47  ? 315 LEU A HB2  1 
ATOM   4856  H  HB3  . LEU A  1 335 ? 68.016  -89.154  -12.191 1.00 33.34  ? 315 LEU A HB3  1 
ATOM   4857  H  HG   . LEU A  1 335 ? 69.647  -91.500  -11.214 1.00 33.53  ? 315 LEU A HG   1 
ATOM   4858  H  HD11 . LEU A  1 335 ? 67.698  -91.951  -9.774  1.00 35.43  ? 315 LEU A HD11 1 
ATOM   4859  H  HD12 . LEU A  1 335 ? 68.549  -90.444  -9.326  1.00 32.79  ? 315 LEU A HD12 1 
ATOM   4860  H  HD13 . LEU A  1 335 ? 67.019  -90.372  -10.239 1.00 34.25  ? 315 LEU A HD13 1 
ATOM   4861  H  HD21 . LEU A  1 335 ? 67.727  -92.746  -11.953 1.00 37.14  ? 315 LEU A HD21 1 
ATOM   4862  H  HD22 . LEU A  1 335 ? 66.980  -91.255  -12.575 1.00 35.78  ? 315 LEU A HD22 1 
ATOM   4863  H  HD23 . LEU A  1 335 ? 68.488  -91.872  -13.303 1.00 35.88  ? 315 LEU A HD23 1 
ATOM   4864  N  N    . GLN A  1 336 ? 70.708  -87.079  -12.872 1.00 33.87  ? 316 GLN A N    1 
ATOM   4865  C  CA   . GLN A  1 336 ? 70.784  -85.646  -13.222 1.00 33.07  ? 316 GLN A CA   1 
ATOM   4866  C  C    . GLN A  1 336 ? 71.412  -85.408  -14.587 1.00 36.54  ? 316 GLN A C    1 
ATOM   4867  O  O    . GLN A  1 336 ? 71.164  -84.374  -15.195 1.00 37.18  ? 316 GLN A O    1 
ATOM   4868  C  CB   . GLN A  1 336 ? 71.568  -84.862  -12.176 1.00 33.64  ? 316 GLN A CB   1 
ATOM   4869  C  CG   . GLN A  1 336 ? 70.844  -84.763  -10.843 1.00 33.31  ? 316 GLN A CG   1 
ATOM   4870  C  CD   . GLN A  1 336 ? 71.760  -84.182  -9.805  1.00 44.73  ? 316 GLN A CD   1 
ATOM   4871  O  OE1  . GLN A  1 336 ? 72.327  -84.954  -9.020  1.00 37.59  ? 316 GLN A OE1  1 
ATOM   4872  N  NE2  . GLN A  1 336 ? 72.003  -82.864  -9.783  1.00 28.74  ? 316 GLN A NE2  1 
ATOM   4873  H  H    . GLN A  1 336 ? 71.297  -87.347  -12.090 1.00 34.33  ? 316 GLN A H    1 
ATOM   4874  H  HA   . GLN A  1 336 ? 69.767  -85.258  -13.236 1.00 33.57  ? 316 GLN A HA   1 
ATOM   4875  H  HB2  . GLN A  1 336 ? 72.536  -85.331  -12.004 1.00 33.37  ? 316 GLN A HB2  1 
ATOM   4876  H  HB3  . GLN A  1 336 ? 71.712  -83.844  -12.534 1.00 30.92  ? 316 GLN A HB3  1 
ATOM   4877  H  HG2  . GLN A  1 336 ? 69.950  -84.152  -10.947 1.00 32.62  ? 316 GLN A HG2  1 
ATOM   4878  H  HG3  . GLN A  1 336 ? 70.540  -85.755  -10.513 1.00 34.23  ? 316 GLN A HG3  1 
ATOM   4879  H  HE21 . GLN A  1 336 ? 71.621  -82.240  -10.486 1.00 26.88  ? 316 GLN A HE21 1 
ATOM   4880  H  HE22 . GLN A  1 336 ? 72.641  -82.502  -9.078  1.00 29.67  ? 316 GLN A HE22 1 
ATOM   4881  N  N    . GLY A  1 337 ? 72.212  -86.358  -15.051 1.00 33.35  ? 317 GLY A N    1 
ATOM   4882  C  CA   . GLY A  1 337 ? 72.839  -86.304  -16.344 1.00 33.14  ? 317 GLY A CA   1 
ATOM   4883  C  C    . GLY A  1 337 ? 74.296  -85.909  -16.426 1.00 35.68  ? 317 GLY A C    1 
ATOM   4884  O  O    . GLY A  1 337 ? 74.786  -85.520  -17.509 1.00 31.41  ? 317 GLY A O    1 
ATOM   4885  H  H    . GLY A  1 337 ? 72.470  -87.198  -14.544 1.00 33.75  ? 317 GLY A H    1 
ATOM   4886  H  HA2  . GLY A  1 337 ? 72.819  -87.335  -16.684 1.00 32.56  ? 317 GLY A HA2  1 
ATOM   4887  H  HA3  . GLY A  1 337 ? 72.259  -85.696  -17.037 1.00 34.68  ? 317 GLY A HA3  1 
ATOM   4888  N  N    . ALA A  1 338 ? 75.021  -86.137  -15.330 1.00 32.13  ? 318 ALA A N    1 
ATOM   4889  C  CA   . ALA A  1 338 ? 76.468  -85.915  -15.294 1.00 31.42  ? 318 ALA A CA   1 
ATOM   4890  C  C    . ALA A  1 338 ? 77.164  -86.944  -16.207 1.00 33.71  ? 318 ALA A C    1 
ATOM   4891  O  O    . ALA A  1 338 ? 76.882  -88.138  -16.138 1.00 27.69  ? 318 ALA A O    1 
ATOM   4892  C  CB   . ALA A  1 338 ? 76.975  -86.077  -13.860 1.00 32.33  ? 318 ALA A CB   1 
ATOM   4893  H  H    . ALA A  1 338 ? 74.650  -86.498  -14.458 1.00 31.36  ? 318 ALA A H    1 
ATOM   4894  H  HA   . ALA A  1 338 ? 76.692  -84.907  -15.640 1.00 30.36  ? 318 ALA A HA   1 
ATOM   4895  H  HB1  . ALA A  1 338 ? 78.032  -85.817  -13.828 1.00 32.42  ? 318 ALA A HB1  1 
ATOM   4896  H  HB2  . ALA A  1 338 ? 76.401  -85.419  -13.209 1.00 32.36  ? 318 ALA A HB2  1 
ATOM   4897  H  HB3  . ALA A  1 338 ? 76.841  -87.113  -13.555 1.00 31.01  ? 318 ALA A HB3  1 
ATOM   4898  N  N    . SER A  1 339 ? 78.081  -86.487  -17.064 1.00 31.78  ? 319 SER A N    1 
ATOM   4899  C  CA   . SER A  1 339 ? 78.813  -87.408  -17.912 1.00 28.95  ? 319 SER A CA   1 
ATOM   4900  C  C    . SER A  1 339 ? 79.847  -88.171  -17.048 1.00 32.54  ? 319 SER A C    1 
ATOM   4901  O  O    . SER A  1 339 ? 80.197  -89.311  -17.345 1.00 32.89  ? 319 SER A O    1 
ATOM   4902  C  CB   . SER A  1 339 ? 79.478  -86.658  -19.047 1.00 33.36  ? 319 SER A CB   1 
ATOM   4903  O  OG   . SER A  1 339 ? 78.496  -85.888  -19.728 1.00 31.86  ? 319 SER A OG   1 
ATOM   4904  H  H    . SER A  1 339 ? 78.364  -85.517  -17.148 1.00 32.20  ? 319 SER A H    1 
ATOM   4905  H  HA   . SER A  1 339 ? 78.115  -88.117  -18.355 1.00 28.91  ? 319 SER A HA   1 
ATOM   4906  H  HB2  . SER A  1 339 ? 80.241  -86.005  -18.627 1.00 34.24  ? 319 SER A HB2  1 
ATOM   4907  H  HB3  . SER A  1 339 ? 79.928  -87.365  -19.742 1.00 33.96  ? 319 SER A HB3  1 
ATOM   4908  H  HG   . SER A  1 339 ? 77.717  -86.452  -19.975 1.00 31.68  ? 319 SER A HG   1 
ATOM   4909  N  N    . GLY A  1 340 ? 80.277  -87.532  -15.974 1.00 29.19  ? 320 GLY A N    1 
ATOM   4910  C  CA   . GLY A  1 340 ? 81.237  -88.068  -15.042 1.00 29.41  ? 320 GLY A CA   1 
ATOM   4911  C  C    . GLY A  1 340 ? 81.094  -87.402  -13.689 1.00 33.30  ? 320 GLY A C    1 
ATOM   4912  O  O    . GLY A  1 340 ? 80.664  -86.245  -13.590 1.00 33.34  ? 320 GLY A O    1 
ATOM   4913  H  H    . GLY A  1 340 ? 79.999  -86.589  -15.721 1.00 28.39  ? 320 GLY A H    1 
ATOM   4914  H  HA2  . GLY A  1 340 ? 81.084  -89.140  -14.936 1.00 30.59  ? 320 GLY A HA2  1 
ATOM   4915  H  HA3  . GLY A  1 340 ? 82.243  -87.903  -15.417 1.00 28.47  ? 320 GLY A HA3  1 
ATOM   4916  N  N    . ILE A  1 341 ? 81.462  -88.134  -12.635 1.00 29.09  ? 321 ILE A N    1 
ATOM   4917  C  CA   . ILE A  1 341 ? 81.422  -87.638  -11.277 1.00 30.21  ? 321 ILE A CA   1 
ATOM   4918  C  C    . ILE A  1 341 ? 82.587  -88.176  -10.515 1.00 33.22  ? 321 ILE A C    1 
ATOM   4919  O  O    . ILE A  1 341 ? 82.977  -89.341  -10.687 1.00 33.64  ? 321 ILE A O    1 
ATOM   4920  C  CB   . ILE A  1 341 ? 80.096  -87.912  -10.497 1.00 32.47  ? 321 ILE A CB   1 
ATOM   4921  C  CG1  . ILE A  1 341 ? 80.091  -87.063  -9.179  1.00 32.95  ? 321 ILE A CG1  1 
ATOM   4922  C  CG2  . ILE A  1 341 ? 79.889  -89.441  -10.206 1.00 31.79  ? 321 ILE A CG2  1 
ATOM   4923  C  CD1  . ILE A  1 341 ? 78.809  -86.931  -8.507  1.00 30.99  ? 321 ILE A CD1  1 
ATOM   4924  H  H    . ILE A  1 341 ? 81.782  -89.096  -12.702 1.00 30.80  ? 321 ILE A H    1 
ATOM   4925  H  HA   . ILE A  1 341 ? 81.543  -86.557  -11.324 1.00 32.32  ? 321 ILE A HA   1 
ATOM   4926  H  HB   . ILE A  1 341 ? 79.266  -87.566  -11.112 1.00 31.48  ? 321 ILE A HB   1 
ATOM   4927  H  HG12 . ILE A  1 341 ? 80.766  -87.502  -8.448  1.00 33.28  ? 321 ILE A HG12 1 
ATOM   4928  H  HG13 . ILE A  1 341 ? 80.430  -86.057  -9.417  1.00 33.05  ? 321 ILE A HG13 1 
ATOM   4929  H  HG21 . ILE A  1 341 ? 78.831  -89.658  -10.064 1.00 30.66  ? 321 ILE A HG21 1 
ATOM   4930  H  HG22 . ILE A  1 341 ? 80.274  -90.028  -11.039 1.00 31.04  ? 321 ILE A HG22 1 
ATOM   4931  H  HG23 . ILE A  1 341 ? 80.421  -89.697  -9.291  1.00 32.31  ? 321 ILE A HG23 1 
ATOM   4932  H  HD11 . ILE A  1 341 ? 78.960  -86.392  -7.573  1.00 30.64  ? 321 ILE A HD11 1 
ATOM   4933  H  HD12 . ILE A  1 341 ? 78.142  -86.366  -9.155  1.00 32.03  ? 321 ILE A HD12 1 
ATOM   4934  H  HD13 . ILE A  1 341 ? 78.390  -87.916  -8.313  1.00 30.85  ? 321 ILE A HD13 1 
ATOM   4935  N  N    . HIS A  1 342 ? 83.125  -87.317  -9.636  1.00 30.20  ? 322 HIS A N    1 
ATOM   4936  C  CA   . HIS A  1 342 ? 84.205  -87.712  -8.753  1.00 31.87  ? 322 HIS A CA   1 
ATOM   4937  C  C    . HIS A  1 342 ? 83.662  -88.761  -7.769  1.00 34.76  ? 322 HIS A C    1 
ATOM   4938  O  O    . HIS A  1 342 ? 82.697  -88.492  -7.097  1.00 35.70  ? 322 HIS A O    1 
ATOM   4939  C  CB   . HIS A  1 342 ? 84.779  -86.497  -8.018  1.00 32.70  ? 322 HIS A CB   1 
ATOM   4940  C  CG   . HIS A  1 342 ? 85.623  -85.634  -8.882  1.00 36.39  ? 322 HIS A CG   1 
ATOM   4941  N  ND1  . HIS A  1 342 ? 86.925  -85.359  -8.555  1.00 38.75  ? 322 HIS A ND1  1 
ATOM   4942  C  CD2  . HIS A  1 342 ? 85.328  -85.026  -10.053 1.00 38.78  ? 322 HIS A CD2  1 
ATOM   4943  C  CE1  . HIS A  1 342 ? 87.391  -84.585  -9.520  1.00 38.08  ? 322 HIS A CE1  1 
ATOM   4944  N  NE2  . HIS A  1 342 ? 86.458  -84.354  -10.445 1.00 38.35  ? 322 HIS A NE2  1 
ATOM   4945  H  H    . HIS A  1 342 ? 82.812  -86.361  -9.505  1.00 28.40  ? 322 HIS A H    1 
ATOM   4946  H  HA   . HIS A  1 342 ? 84.999  -88.153  -9.349  1.00 32.97  ? 322 HIS A HA   1 
ATOM   4947  H  HB2  . HIS A  1 342 ? 83.964  -85.889  -7.633  1.00 31.57  ? 322 HIS A HB2  1 
ATOM   4948  H  HB3  . HIS A  1 342 ? 85.394  -86.849  -7.192  1.00 33.37  ? 322 HIS A HB3  1 
ATOM   4949  H  HD1  . HIS A  1 342 ? 87.410  -85.674  -7.722  1.00 39.20  ? 322 HIS A HD1  1 
ATOM   4950  H  HD2  . HIS A  1 342 ? 84.387  -85.075  -10.596 1.00 39.24  ? 322 HIS A HD2  1 
ATOM   4951  H  HE1  . HIS A  1 342 ? 88.411  -84.208  -9.566  1.00 37.46  ? 322 HIS A HE1  1 
ATOM   4952  N  N    . THR A  1 343 ? 84.222  -89.953  -7.743  1.00 33.81  ? 323 THR A N    1 
ATOM   4953  C  CA   . THR A  1 343 ? 83.777  -91.025  -6.831  1.00 34.56  ? 323 THR A CA   1 
ATOM   4954  C  C    . THR A  1 343 ? 84.791  -91.262  -5.714  1.00 39.14  ? 323 THR A C    1 
ATOM   4955  O  O    . THR A  1 343 ? 84.583  -92.149  -4.887  1.00 35.15  ? 323 THR A O    1 
ATOM   4956  C  CB   . THR A  1 343 ? 83.589  -92.337  -7.590  1.00 38.47  ? 323 THR A CB   1 
ATOM   4957  O  OG1  . THR A  1 343 ? 84.849  -92.665  -8.174  1.00 34.47  ? 323 THR A OG1  1 
ATOM   4958  C  CG2  . THR A  1 343 ? 82.478  -92.263  -8.624  1.00 42.64  ? 323 THR A CG2  1 
ATOM   4959  H  H    . THR A  1 343 ? 84.990  -90.232  -8.345  1.00 34.81  ? 323 THR A H    1 
ATOM   4960  H  HA   . THR A  1 343 ? 82.825  -90.779  -6.362  1.00 34.63  ? 323 THR A HA   1 
ATOM   4961  H  HB   . THR A  1 343 ? 83.319  -93.124  -6.887  1.00 37.51  ? 323 THR A HB   1 
ATOM   4962  H  HG1  . THR A  1 343 ? 84.778  -92.771  -9.159  1.00 34.53  ? 323 THR A HG1  1 
ATOM   4963  H  HG21 . THR A  1 343 ? 82.224  -93.263  -8.974  1.00 42.46  ? 323 THR A HG21 1 
ATOM   4964  H  HG22 . THR A  1 343 ? 81.596  -91.810  -8.172  1.00 42.79  ? 323 THR A HG22 1 
ATOM   4965  H  HG23 . THR A  1 343 ? 82.781  -91.658  -9.477  1.00 42.81  ? 323 THR A HG23 1 
ATOM   4966  N  N    . GLY A  1 344 ? 85.896  -90.505  -5.743  1.00 38.30  ? 324 GLY A N    1 
ATOM   4967  C  CA   . GLY A  1 344 ? 86.979  -90.645  -4.792  1.00 38.17  ? 324 GLY A CA   1 
ATOM   4968  C  C    . GLY A  1 344 ? 87.951  -91.728  -5.184  1.00 43.88  ? 324 GLY A C    1 
ATOM   4969  O  O    . GLY A  1 344 ? 87.741  -92.455  -6.170  1.00 43.29  ? 324 GLY A O    1 
ATOM   4970  H  H    . GLY A  1 344 ? 86.086  -89.765  -6.411  1.00 37.67  ? 324 GLY A H    1 
ATOM   4971  H  HA2  . GLY A  1 344 ? 87.530  -89.707  -4.730  1.00 38.05  ? 324 GLY A HA2  1 
ATOM   4972  H  HA3  . GLY A  1 344 ? 86.579  -90.872  -3.805  1.00 39.57  ? 324 GLY A HA3  1 
ATOM   4973  N  N    . THR A  1 345 ? 88.980  -91.894  -4.342  1.00 42.63  ? 325 THR A N    1 
ATOM   4974  C  CA   . THR A  1 345 ? 90.084  -92.832  -4.589  1.00 41.30  ? 325 THR A CA   1 
ATOM   4975  C  C    . THR A  1 345 ? 89.901  -94.169  -3.887  1.00 40.09  ? 325 THR A C    1 
ATOM   4976  O  O    . THR A  1 345 ? 90.820  -94.975  -3.904  1.00 36.20  ? 325 THR A O    1 
ATOM   4977  C  CB   . THR A  1 345 ? 91.413  -92.190  -4.180  1.00 40.28  ? 325 THR A CB   1 
ATOM   4978  O  OG1  . THR A  1 345 ? 91.373  -91.908  -2.797  1.00 32.52  ? 325 THR A OG1  1 
ATOM   4979  C  CG2  . THR A  1 345 ? 91.716  -90.937  -4.981  1.00 39.59  ? 325 THR A CG2  1 
ATOM   4980  H  H    . THR A  1 345 ? 89.054  -91.408  -3.452  1.00 43.44  ? 325 THR A H    1 
ATOM   4981  H  HA   . THR A  1 345 ? 90.162  -93.038  -5.655  1.00 41.35  ? 325 THR A HA   1 
ATOM   4982  H  HB   . THR A  1 345 ? 92.221  -92.892  -4.375  1.00 40.43  ? 325 THR A HB   1 
ATOM   4983  H  HG1  . THR A  1 345 ? 91.208  -90.945  -2.605  1.00 33.16  ? 325 THR A HG1  1 
ATOM   4984  H  HG21 . THR A  1 345 ? 92.675  -90.533  -4.660  1.00 40.58  ? 325 THR A HG21 1 
ATOM   4985  H  HG22 . THR A  1 345 ? 91.762  -91.181  -6.042  1.00 38.33  ? 325 THR A HG22 1 
ATOM   4986  H  HG23 . THR A  1 345 ? 90.947  -90.186  -4.815  1.00 38.91  ? 325 THR A HG23 1 
ATOM   4987  N  N    . MET A  1 346 ? 88.748  -94.386  -3.250  1.00 38.90  ? 326 MET A N    1 
ATOM   4988  C  CA   . MET A  1 346 ? 88.378  -95.653  -2.602  1.00 38.17  ? 326 MET A CA   1 
ATOM   4989  C  C    . MET A  1 346 ? 89.465  -96.130  -1.580  1.00 42.10  ? 326 MET A C    1 
ATOM   4990  O  O    . MET A  1 346 ? 89.849  -97.301  -1.600  1.00 39.96  ? 326 MET A O    1 
ATOM   4991  C  CB   . MET A  1 346 ? 88.133  -96.720  -3.717  1.00 39.76  ? 326 MET A CB   1 
ATOM   4992  C  CG   . MET A  1 346 ? 87.191  -96.221  -4.810  1.00 42.30  ? 326 MET A CG   1 
ATOM   4993  S  SD   . MET A  1 346 ? 87.087  -97.283  -6.221  1.00 44.19  ? 326 MET A SD   1 
ATOM   4994  C  CE   . MET A  1 346 ? 85.826  -96.405  -7.129  1.00 38.63  ? 326 MET A CE   1 
ATOM   4995  H  H    . MET A  1 346 ? 88.020  -93.688  -3.133  1.00 38.86  ? 326 MET A H    1 
ATOM   4996  H  HA   . MET A  1 346 ? 87.441  -95.495  -2.069  1.00 37.33  ? 326 MET A HA   1 
ATOM   4997  H  HB2  . MET A  1 346 ? 89.076  -96.974  -4.197  1.00 40.10  ? 326 MET A HB2  1 
ATOM   4998  H  HB3  . MET A  1 346 ? 87.688  -97.614  -3.284  1.00 39.57  ? 326 MET A HB3  1 
ATOM   4999  H  HG2  . MET A  1 346 ? 86.185  -96.116  -4.409  1.00 42.77  ? 326 MET A HG2  1 
ATOM   5000  H  HG3  . MET A  1 346 ? 87.524  -95.258  -5.193  1.00 42.53  ? 326 MET A HG3  1 
ATOM   5001  H  HE1  . MET A  1 346 ? 85.792  -96.795  -8.145  1.00 39.32  ? 326 MET A HE1  1 
ATOM   5002  H  HE2  . MET A  1 346 ? 84.861  -96.546  -6.648  1.00 38.69  ? 326 MET A HE2  1 
ATOM   5003  H  HE3  . MET A  1 346 ? 86.075  -95.345  -7.143  1.00 38.20  ? 326 MET A HE3  1 
ATOM   5004  N  N    . GLY A  1 347 ? 89.996  -95.181  -0.799  1.00 39.63  ? 327 GLY A N    1 
ATOM   5005  C  CA   . GLY A  1 347 ? 91.015  -95.401  0.232   1.00 40.26  ? 327 GLY A CA   1 
ATOM   5006  C  C    . GLY A  1 347 ? 92.464  -95.389  -0.223  1.00 43.58  ? 327 GLY A C    1 
ATOM   5007  O  O    . GLY A  1 347 ? 93.360  -95.557  0.606   1.00 42.68  ? 327 GLY A O    1 
ATOM   5008  H  H    . GLY A  1 347 ? 89.713  -94.208  -0.847  1.00 38.81  ? 327 GLY A H    1 
ATOM   5009  H  HA2  . GLY A  1 347 ? 90.904  -94.632  0.996   1.00 39.72  ? 327 GLY A HA2  1 
ATOM   5010  H  HA3  . GLY A  1 347 ? 90.840  -96.359  0.718   1.00 40.84  ? 327 GLY A HA3  1 
ATOM   5011  N  N    . PHE A  1 348 ? 92.725  -95.157  -1.511  1.00 41.71  ? 328 PHE A N    1 
ATOM   5012  C  CA   . PHE A  1 348 ? 94.086  -95.179  -2.039  1.00 41.29  ? 328 PHE A CA   1 
ATOM   5013  C  C    . PHE A  1 348 ? 94.730  -93.785  -2.131  1.00 45.70  ? 328 PHE A C    1 
ATOM   5014  O  O    . PHE A  1 348 ? 95.944  -93.727  -2.325  1.00 45.74  ? 328 PHE A O    1 
ATOM   5015  C  CB   . PHE A  1 348 ? 94.111  -95.869  -3.408  1.00 41.91  ? 328 PHE A CB   1 
ATOM   5016  C  CG   . PHE A  1 348 ? 93.818  -97.352  -3.316  1.00 42.23  ? 328 PHE A CG   1 
ATOM   5017  C  CD1  . PHE A  1 348 ? 94.822  -98.258  -3.003  1.00 44.31  ? 328 PHE A CD1  1 
ATOM   5018  C  CD2  . PHE A  1 348 ? 92.527  -97.831  -3.459  1.00 42.12  ? 328 PHE A CD2  1 
ATOM   5019  C  CE1  . PHE A  1 348 ? 94.546  -99.622  -2.860  1.00 43.83  ? 328 PHE A CE1  1 
ATOM   5020  C  CE2  . PHE A  1 348 ? 92.251  -99.191  -3.314  1.00 43.71  ? 328 PHE A CE2  1 
ATOM   5021  C  CZ   . PHE A  1 348 ? 93.267  -100.082 -3.038  1.00 41.99  ? 328 PHE A CZ   1 
ATOM   5022  H  H    . PHE A  1 348 ? 92.033  -94.921  -2.215  1.00 41.66  ? 328 PHE A H    1 
ATOM   5023  H  HA   . PHE A  1 348 ? 94.723  -95.783  -1.394  1.00 41.84  ? 328 PHE A HA   1 
ATOM   5024  H  HB2  . PHE A  1 348 ? 93.387  -95.399  -4.074  1.00 42.38  ? 328 PHE A HB2  1 
ATOM   5025  H  HB3  . PHE A  1 348 ? 95.108  -95.774  -3.833  1.00 42.54  ? 328 PHE A HB3  1 
ATOM   5026  H  HD1  . PHE A  1 348 ? 95.842  -97.902  -2.877  1.00 45.19  ? 328 PHE A HD1  1 
ATOM   5027  H  HD2  . PHE A  1 348 ? 91.719  -97.139  -3.689  1.00 41.85  ? 328 PHE A HD2  1 
ATOM   5028  H  HE1  . PHE A  1 348 ? 95.357  -100.319 -2.658  1.00 43.55  ? 328 PHE A HE1  1 
ATOM   5029  H  HE2  . PHE A  1 348 ? 91.232  -99.547  -3.444  1.00 43.51  ? 328 PHE A HE2  1 
ATOM   5030  H  HZ   . PHE A  1 348 ? 93.048  -101.144 -2.932  1.00 42.17  ? 328 PHE A HZ   1 
ATOM   5031  N  N    . GLY A  1 349 ? 93.959  -92.707  -1.941  1.00 40.44  ? 329 GLY A N    1 
ATOM   5032  C  CA   . GLY A  1 349 ? 94.453  -91.333  -1.972  1.00 40.81  ? 329 GLY A CA   1 
ATOM   5033  C  C    . GLY A  1 349 ? 94.437  -90.616  -0.627  1.00 43.09  ? 329 GLY A C    1 
ATOM   5034  O  O    . GLY A  1 349 ? 94.493  -91.258  0.422   1.00 41.26  ? 329 GLY A O    1 
ATOM   5035  H  H    . GLY A  1 349 ? 92.964  -92.737  -1.748  1.00 40.64  ? 329 GLY A H    1 
ATOM   5036  H  HA2  . GLY A  1 349 ? 95.475  -91.294  -2.346  1.00 42.50  ? 329 GLY A HA2  1 
ATOM   5037  H  HA3  . GLY A  1 349 ? 93.821  -90.779  -2.660  1.00 39.50  ? 329 GLY A HA3  1 
ATOM   5038  N  N    . LYS A  1 350 ? 94.334  -89.278  -0.656  1.00 39.79  ? 330 LYS A N    1 
ATOM   5039  C  CA   . LYS A  1 350 ? 94.384  -88.414  0.541   1.00 39.66  ? 330 LYS A CA   1 
ATOM   5040  C  C    . LYS A  1 350 ? 93.044  -88.205  1.255   1.00 44.34  ? 330 LYS A C    1 
ATOM   5041  O  O    . LYS A  1 350 ? 93.045  -87.697  2.388   1.00 41.56  ? 330 LYS A O    1 
ATOM   5042  C  CB   . LYS A  1 350 ? 94.938  -87.009  0.182   1.00 40.88  ? 330 LYS A CB   1 
ATOM   5043  C  CG   . LYS A  1 350 ? 93.961  -86.067  -0.546  1.00 36.14  ? 330 LYS A CG   1 
ATOM   5044  C  CD   . LYS A  1 350 ? 94.628  -84.822  -1.092  1.00 32.76  ? 330 LYS A CD   1 
ATOM   5045  C  CE   . LYS A  1 350 ? 93.657  -83.896  -1.805  1.00 34.35  ? 330 LYS A CE   1 
ATOM   5046  N  NZ   . LYS A  1 350 ? 94.355  -82.760  -2.458  1.00 49.62  ? 330 LYS A NZ   1 
ATOM   5047  H  H    . LYS A  1 350 ? 94.221  -88.761  -1.521  1.00 40.36  ? 330 LYS A H    1 
ATOM   5048  H  HA   . LYS A  1 350 ? 95.072  -88.854  1.260   1.00 39.39  ? 330 LYS A HA   1 
ATOM   5049  H  HB2  . LYS A  1 350 ? 95.225  -86.510  1.106   1.00 40.85  ? 330 LYS A HB2  1 
ATOM   5050  H  HB3  . LYS A  1 350 ? 95.823  -87.133  -0.440  1.00 41.28  ? 330 LYS A HB3  1 
ATOM   5051  H  HG2  . LYS A  1 350 ? 93.485  -86.599  -1.368  1.00 36.80  ? 330 LYS A HG2  1 
ATOM   5052  H  HG3  . LYS A  1 350 ? 93.201  -85.718  0.150   1.00 36.53  ? 330 LYS A HG3  1 
ATOM   5053  H  HD2  . LYS A  1 350 ? 95.070  -84.276  -0.263  1.00 34.69  ? 330 LYS A HD2  1 
ATOM   5054  H  HD3  . LYS A  1 350 ? 95.404  -85.110  -1.801  1.00 34.99  ? 330 LYS A HD3  1 
ATOM   5055  H  HE2  . LYS A  1 350 ? 93.105  -84.447  -2.563  1.00 31.78  ? 330 LYS A HE2  1 
ATOM   5056  H  HE3  . LYS A  1 350 ? 92.964  -83.486  -1.072  1.00 35.80  ? 330 LYS A HE3  1 
ATOM   5057  H  HZ1  . LYS A  1 350 ? 94.884  -82.230  -1.772  1.00 49.40  ? 330 LYS A HZ1  1 
ATOM   5058  H  HZ2  . LYS A  1 350 ? 95.007  -83.117  -3.148  1.00 49.98  ? 330 LYS A HZ2  1 
ATOM   5059  H  HZ3  . LYS A  1 350 ? 93.691  -82.143  -2.916  1.00 49.08  ? 330 LYS A HZ3  1 
ATOM   5060  N  N    . ALA A  1 351 ? 91.912  -88.488  0.593   1.00 42.10  ? 331 ALA A N    1 
ATOM   5061  C  CA   . ALA A  1 351 ? 90.605  -88.192  1.185   1.00 42.05  ? 331 ALA A CA   1 
ATOM   5062  C  C    . ALA A  1 351 ? 90.018  -89.405  1.911   1.00 48.32  ? 331 ALA A C    1 
ATOM   5063  O  O    . ALA A  1 351 ? 90.556  -90.500  1.840   1.00 45.58  ? 331 ALA A O    1 
ATOM   5064  C  CB   . ALA A  1 351 ? 89.646  -87.734  0.093   1.00 41.86  ? 331 ALA A CB   1 
ATOM   5065  H  H    . ALA A  1 351 ? 91.858  -88.931  -0.320  1.00 41.91  ? 331 ALA A H    1 
ATOM   5066  H  HA   . ALA A  1 351 ? 90.687  -87.378  1.904   1.00 41.23  ? 331 ALA A HA   1 
ATOM   5067  H  HB1  . ALA A  1 351 ? 88.687  -87.452  0.525   1.00 41.73  ? 331 ALA A HB1  1 
ATOM   5068  H  HB2  . ALA A  1 351 ? 90.087  -86.874  -0.407  1.00 42.53  ? 331 ALA A HB2  1 
ATOM   5069  H  HB3  . ALA A  1 351 ? 89.503  -88.546  -0.617  1.00 40.95  ? 331 ALA A HB3  1 
ATOM   5070  N  N    . GLU A  1 352 ? 88.885  -89.184  2.593   1.00 47.15  ? 332 GLU A N    1 
ATOM   5071  C  CA   . GLU A  1 352 ? 88.123  -90.237  3.235   1.00 45.83  ? 332 GLU A CA   1 
ATOM   5072  C  C    . GLU A  1 352 ? 87.515  -91.075  2.098   1.00 50.19  ? 332 GLU A C    1 
ATOM   5073  O  O    . GLU A  1 352 ? 87.092  -90.525  1.092   1.00 51.38  ? 332 GLU A O    1 
ATOM   5074  C  CB   . GLU A  1 352 ? 87.028  -89.660  4.155   1.00 46.15  ? 332 GLU A CB   1 
ATOM   5075  C  CG   . GLU A  1 352 ? 87.570  -88.841  5.306   1.00 53.01  ? 332 GLU A CG   1 
ATOM   5076  C  CD   . GLU A  1 352 ? 86.557  -88.609  6.414   1.00 62.47  ? 332 GLU A CD   1 
ATOM   5077  O  OE1  . GLU A  1 352 ? 85.461  -88.081  6.122   1.00 44.08  ? 332 GLU A OE1  1 
ATOM   5078  O  OE2  . GLU A  1 352 ? 86.847  -88.977  7.574   1.00 61.61  ? 332 GLU A OE2  1 
ATOM   5079  H  H    . GLU A  1 352 ? 88.456  -88.267  2.673   1.00 48.27  ? 332 GLU A H    1 
ATOM   5080  H  HA   . GLU A  1 352 ? 88.798  -90.861  3.817   1.00 45.97  ? 332 GLU A HA   1 
ATOM   5081  H  HB2  . GLU A  1 352 ? 86.358  -89.034  3.568   1.00 44.30  ? 332 GLU A HB2  1 
ATOM   5082  H  HB3  . GLU A  1 352 ? 86.463  -90.492  4.573   1.00 47.01  ? 332 GLU A HB3  1 
ATOM   5083  H  HG2  . GLU A  1 352 ? 88.431  -89.360  5.723   1.00 53.39  ? 332 GLU A HG2  1 
ATOM   5084  H  HG3  . GLU A  1 352 ? 87.880  -87.868  4.929   1.00 53.25  ? 332 GLU A HG3  1 
ATOM   5085  N  N    . GLY A  1 353 ? 87.517  -92.371  2.258   1.00 44.57  ? 333 GLY A N    1 
ATOM   5086  C  CA   . GLY A  1 353 ? 87.042  -93.300  1.240   1.00 43.01  ? 333 GLY A CA   1 
ATOM   5087  C  C    . GLY A  1 353 ? 87.532  -94.695  1.575   1.00 43.10  ? 333 GLY A C    1 
ATOM   5088  O  O    . GLY A  1 353 ? 88.522  -94.844  2.302   1.00 40.05  ? 333 GLY A O    1 
ATOM   5089  H  H    . GLY A  1 353 ? 87.817  -92.819  3.118   1.00 45.50  ? 333 GLY A H    1 
ATOM   5090  H  HA2  . GLY A  1 353 ? 85.953  -93.298  1.211   1.00 42.98  ? 333 GLY A HA2  1 
ATOM   5091  H  HA3  . GLY A  1 353 ? 87.417  -93.014  0.259   1.00 43.83  ? 333 GLY A HA3  1 
ATOM   5092  N  N    . GLU A  1 354 ? 86.814  -95.724  1.104   1.00 40.59  ? 334 GLU A N    1 
ATOM   5093  C  CA   . GLU A  1 354 ? 87.159  -97.121  1.387   1.00 41.62  ? 334 GLU A CA   1 
ATOM   5094  C  C    . GLU A  1 354 ? 87.187  -97.949  0.113   1.00 43.23  ? 334 GLU A C    1 
ATOM   5095  O  O    . GLU A  1 354 ? 86.565  -97.570  -0.896  1.00 40.03  ? 334 GLU A O    1 
ATOM   5096  C  CB   . GLU A  1 354 ? 86.171  -97.772  2.370   1.00 43.60  ? 334 GLU A CB   1 
ATOM   5097  C  CG   . GLU A  1 354 ? 85.310  -96.841  3.206   1.00 67.13  ? 334 GLU A CG   1 
ATOM   5098  C  CD   . GLU A  1 354 ? 84.545  -97.550  4.300   1.00 100.82 ? 334 GLU A CD   1 
ATOM   5099  O  OE1  . GLU A  1 354 ? 84.966  -98.654  4.714   1.00 95.96  ? 334 GLU A OE1  1 
ATOM   5100  O  OE2  . GLU A  1 354 ? 83.474  -97.032  4.691   1.00 104.42 ? 334 GLU A OE2  1 
ATOM   5101  H  H    . GLU A  1 354 ? 85.998  -95.614  0.512   1.00 40.41  ? 334 GLU A H    1 
ATOM   5102  H  HA   . GLU A  1 354 ? 88.150  -97.191  1.834   1.00 42.57  ? 334 GLU A HA   1 
ATOM   5103  H  HB2  . GLU A  1 354 ? 85.440  -98.351  1.812   1.00 41.84  ? 334 GLU A HB2  1 
ATOM   5104  H  HB3  . GLU A  1 354 ? 86.734  -98.446  3.013   1.00 44.57  ? 334 GLU A HB3  1 
ATOM   5105  H  HG2  . GLU A  1 354 ? 85.895  -96.021  3.617   1.00 67.37  ? 334 GLU A HG2  1 
ATOM   5106  H  HG3  . GLU A  1 354 ? 84.544  -96.439  2.544   1.00 66.94  ? 334 GLU A HG3  1 
ATOM   5107  N  N    . ALA A  1 355 ? 87.851  -99.128  0.182   1.00 39.63  ? 335 ALA A N    1 
ATOM   5108  C  CA   . ALA A  1 355 ? 87.954  -100.084 -0.933  1.00 39.23  ? 335 ALA A CA   1 
ATOM   5109  C  C    . ALA A  1 355 ? 86.563  -100.491 -1.449  1.00 43.59  ? 335 ALA A C    1 
ATOM   5110  O  O    . ALA A  1 355 ? 86.364  -100.592 -2.657  1.00 42.56  ? 335 ALA A O    1 
ATOM   5111  C  CB   . ALA A  1 355 ? 88.716  -101.317 -0.477  1.00 39.50  ? 335 ALA A CB   1 
ATOM   5112  H  H    . ALA A  1 355 ? 88.306  -99.450  1.031   1.00 41.02  ? 335 ALA A H    1 
ATOM   5113  H  HA   . ALA A  1 355 ? 88.504  -99.630  -1.754  1.00 38.62  ? 335 ALA A HA   1 
ATOM   5114  H  HB1  . ALA A  1 355 ? 88.739  -102.038 -1.292  1.00 40.27  ? 335 ALA A HB1  1 
ATOM   5115  H  HB2  . ALA A  1 355 ? 89.730  -101.028 -0.210  1.00 38.59  ? 335 ALA A HB2  1 
ATOM   5116  H  HB3  . ALA A  1 355 ? 88.215  -101.752 0.385   1.00 37.91  ? 335 ALA A HB3  1 
ATOM   5117  N  N    . ALA A  1 356 ? 85.590  -100.644 -0.534  1.00 41.21  ? 336 ALA A N    1 
ATOM   5118  C  CA   . ALA A  1 356 ? 84.203  -101.011 -0.855  1.00 40.25  ? 336 ALA A CA   1 
ATOM   5119  C  C    . ALA A  1 356 ? 83.504  -99.972  -1.727  1.00 41.38  ? 336 ALA A C    1 
ATOM   5120  O  O    . ALA A  1 356 ? 82.492  -100.317 -2.339  1.00 41.89  ? 336 ALA A O    1 
ATOM   5121  C  CB   . ALA A  1 356 ? 83.411  -101.220 0.413   1.00 40.37  ? 336 ALA A CB   1 
ATOM   5122  H  H    . ALA A  1 356 ? 85.744  -100.548 0.465   1.00 41.89  ? 336 ALA A H    1 
ATOM   5123  H  HA   . ALA A  1 356 ? 84.207  -101.957 -1.396  1.00 40.21  ? 336 ALA A HA   1 
ATOM   5124  H  HB1  . ALA A  1 356 ? 82.393  -101.498 0.144   1.00 40.34  ? 336 ALA A HB1  1 
ATOM   5125  H  HB2  . ALA A  1 356 ? 83.871  -102.017 0.994   1.00 40.44  ? 336 ALA A HB2  1 
ATOM   5126  H  HB3  . ALA A  1 356 ? 83.410  -100.291 0.983   1.00 39.98  ? 336 ALA A HB3  1 
ATOM   5127  N  N    . ASP A  1 357 ? 84.020  -98.722  -1.824  1.00 36.13  ? 337 ASP A N    1 
ATOM   5128  C  CA   . ASP A  1 357 ? 83.419  -97.711  -2.729  1.00 35.50  ? 337 ASP A CA   1 
ATOM   5129  C  C    . ASP A  1 357 ? 83.560  -98.084  -4.207  1.00 36.17  ? 337 ASP A C    1 
ATOM   5130  O  O    . ASP A  1 357 ? 82.952  -97.422  -5.006  1.00 33.49  ? 337 ASP A O    1 
ATOM   5131  C  CB   . ASP A  1 357 ? 84.000  -96.296  -2.522  1.00 38.77  ? 337 ASP A CB   1 
ATOM   5132  C  CG   . ASP A  1 357 ? 83.670  -95.746  -1.161  1.00 46.96  ? 337 ASP A CG   1 
ATOM   5133  O  OD1  . ASP A  1 357 ? 82.674  -96.216  -0.565  1.00 47.15  ? 337 ASP A OD1  1 
ATOM   5134  O  OD2  . ASP A  1 357 ? 84.444  -94.875  -0.664  1.00 52.17  ? 337 ASP A OD2  1 
ATOM   5135  H  H    . ASP A  1 357 ? 84.810  -98.370  -1.295  1.00 35.34  ? 337 ASP A H    1 
ATOM   5136  H  HA   . ASP A  1 357 ? 82.349  -97.663  -2.532  1.00 34.44  ? 337 ASP A HA   1 
ATOM   5137  H  HB2  . ASP A  1 357 ? 85.085  -96.321  -2.614  1.00 39.60  ? 337 ASP A HB2  1 
ATOM   5138  H  HB3  . ASP A  1 357 ? 83.588  -95.619  -3.268  1.00 37.91  ? 337 ASP A HB3  1 
ATOM   5139  N  N    . ARG A  1 358 ? 84.260  -99.175  -4.576  1.00 37.23  ? 338 ARG A N    1 
ATOM   5140  C  CA   . ARG A  1 358 ? 84.238  -99.664  -5.961  1.00 36.81  ? 338 ARG A CA   1 
ATOM   5141  C  C    . ARG A  1 358 ? 82.778  -99.941  -6.410  1.00 37.31  ? 338 ARG A C    1 
ATOM   5142  O  O    . ARG A  1 358 ? 82.489  -99.835  -7.595  1.00 31.99  ? 338 ARG A O    1 
ATOM   5143  C  CB   . ARG A  1 358 ? 85.106  -100.911 -6.125  1.00 38.09  ? 338 ARG A CB   1 
ATOM   5144  C  CG   . ARG A  1 358 ? 84.628  -102.131 -5.322  1.00 44.36  ? 338 ARG A CG   1 
ATOM   5145  C  CD   . ARG A  1 358 ? 85.624  -103.276 -5.343  1.00 51.07  ? 338 ARG A CD   1 
ATOM   5146  N  NE   . ARG A  1 358 ? 85.105  -104.461 -4.654  1.00 68.38  ? 338 ARG A NE   1 
ATOM   5147  C  CZ   . ARG A  1 358 ? 85.251  -104.749 -3.361  1.00 77.95  ? 338 ARG A CZ   1 
ATOM   5148  N  NH1  . ARG A  1 358 ? 85.948  -103.948 -2.565  1.00 52.12  ? 338 ARG A NH1  1 
ATOM   5149  N  NH2  . ARG A  1 358 ? 84.721  -105.861 -2.858  1.00 76.96  ? 338 ARG A NH2  1 
ATOM   5150  H  H    . ARG A  1 358 ? 84.906  -99.685  -3.982  1.00 37.97  ? 338 ARG A H    1 
ATOM   5151  H  HA   . ARG A  1 358 ? 84.630  -98.901  -6.629  1.00 37.21  ? 338 ARG A HA   1 
ATOM   5152  H  HB2  . ARG A  1 358 ? 85.090  -101.197 -7.176  1.00 38.34  ? 338 ARG A HB2  1 
ATOM   5153  H  HB3  . ARG A  1 358 ? 86.123  -100.675 -5.821  1.00 36.67  ? 338 ARG A HB3  1 
ATOM   5154  H  HG2  . ARG A  1 358 ? 84.471  -101.847 -4.283  1.00 44.46  ? 338 ARG A HG2  1 
ATOM   5155  H  HG3  . ARG A  1 358 ? 83.698  -102.500 -5.751  1.00 43.70  ? 338 ARG A HG3  1 
ATOM   5156  H  HD2  . ARG A  1 358 ? 85.782  -103.568 -6.380  1.00 51.22  ? 338 ARG A HD2  1 
ATOM   5157  H  HD3  . ARG A  1 358 ? 86.575  -102.958 -4.924  1.00 50.86  ? 338 ARG A HD3  1 
ATOM   5158  H  HE   . ARG A  1 358 ? 84.588  -105.123 -5.223  1.00 68.93  ? 338 ARG A HE   1 
ATOM   5159  H  HH11 . ARG A  1 358 ? 86.336  -103.063 -2.870  1.00 52.25  ? 338 ARG A HH11 1 
ATOM   5160  H  HH12 . ARG A  1 358 ? 86.002  -104.180 -1.579  1.00 53.27  ? 338 ARG A HH12 1 
ATOM   5161  H  HH21 . ARG A  1 358 ? 84.208  -106.504 -3.452  1.00 77.39  ? 338 ARG A HH21 1 
ATOM   5162  H  HH22 . ARG A  1 358 ? 84.836  -106.086 -1.875  1.00 77.47  ? 338 ARG A HH22 1 
ATOM   5163  N  N    . ALA A  1 359 ? 81.866  -100.288 -5.459  1.00 35.92  ? 339 ALA A N    1 
ATOM   5164  C  CA   . ALA A  1 359 ? 80.451  -100.541 -5.777  1.00 37.34  ? 339 ALA A CA   1 
ATOM   5165  C  C    . ALA A  1 359 ? 79.754  -99.277  -6.295  1.00 42.36  ? 339 ALA A C    1 
ATOM   5166  O  O    . ALA A  1 359 ? 78.793  -99.397  -7.032  1.00 45.08  ? 339 ALA A O    1 
ATOM   5167  C  CB   . ALA A  1 359 ? 79.727  -101.081 -4.561  1.00 38.42  ? 339 ALA A CB   1 
ATOM   5168  H  H    . ALA A  1 359 ? 82.083  -100.445 -4.482  1.00 34.61  ? 339 ALA A H    1 
ATOM   5169  H  HA   . ALA A  1 359 ? 80.393  -101.296 -6.560  1.00 37.91  ? 339 ALA A HA   1 
ATOM   5170  H  HB1  . ALA A  1 359 ? 78.683  -101.245 -4.825  1.00 38.36  ? 339 ALA A HB1  1 
ATOM   5171  H  HB2  . ALA A  1 359 ? 80.189  -102.022 -4.267  1.00 38.26  ? 339 ALA A HB2  1 
ATOM   5172  H  HB3  . ALA A  1 359 ? 79.801  -100.356 -3.751  1.00 38.39  ? 339 ALA A HB3  1 
ATOM   5173  N  N    . ILE A  1 360 ? 80.230  -98.081  -5.909  1.00 37.20  ? 340 ILE A N    1 
ATOM   5174  C  CA   . ILE A  1 360 ? 79.714  -96.785  -6.405  1.00 37.23  ? 340 ILE A CA   1 
ATOM   5175  C  C    . ILE A  1 360 ? 79.979  -96.695  -7.922  1.00 40.67  ? 340 ILE A C    1 
ATOM   5176  O  O    . ILE A  1 360 ? 79.080  -96.347  -8.684  1.00 40.15  ? 340 ILE A O    1 
ATOM   5177  C  CB   . ILE A  1 360 ? 80.379  -95.588  -5.689  1.00 41.66  ? 340 ILE A CB   1 
ATOM   5178  C  CG1  . ILE A  1 360 ? 80.098  -95.601  -4.197  1.00 42.44  ? 340 ILE A CG1  1 
ATOM   5179  C  CG2  . ILE A  1 360 ? 79.959  -94.221  -6.363  1.00 44.88  ? 340 ILE A CG2  1 
ATOM   5180  C  CD1  . ILE A  1 360 ? 80.844  -94.559  -3.425  1.00 53.29  ? 340 ILE A CD1  1 
ATOM   5181  H  H    . ILE A  1 360 ? 80.999  -97.982  -5.257  1.00 37.33  ? 340 ILE A H    1 
ATOM   5182  H  HA   . ILE A  1 360 ? 78.640  -96.731  -6.230  1.00 35.75  ? 340 ILE A HA   1 
ATOM   5183  H  HB   . ILE A  1 360 ? 81.454  -95.685  -5.826  1.00 41.78  ? 340 ILE A HB   1 
ATOM   5184  H  HG12 . ILE A  1 360 ? 79.035  -95.427  -4.050  1.00 42.94  ? 340 ILE A HG12 1 
ATOM   5185  H  HG13 . ILE A  1 360 ? 80.365  -96.564  -3.766  1.00 42.56  ? 340 ILE A HG13 1 
ATOM   5186  H  HG21 . ILE A  1 360 ? 80.244  -93.381  -5.734  1.00 45.07  ? 340 ILE A HG21 1 
ATOM   5187  H  HG22 . ILE A  1 360 ? 80.456  -94.108  -7.326  1.00 44.32  ? 340 ILE A HG22 1 
ATOM   5188  H  HG23 . ILE A  1 360 ? 78.880  -94.232  -6.508  1.00 45.59  ? 340 ILE A HG23 1 
ATOM   5189  H  HD11 . ILE A  1 360 ? 80.950  -94.886  -2.392  1.00 53.55  ? 340 ILE A HD11 1 
ATOM   5190  H  HD12 . ILE A  1 360 ? 81.821  -94.412  -3.883  1.00 53.05  ? 340 ILE A HD12 1 
ATOM   5191  H  HD13 . ILE A  1 360 ? 80.278  -93.629  -3.453  1.00 52.88  ? 340 ILE A HD13 1 
ATOM   5192  N  N    . ALA A  1 361 ? 81.234  -97.028  -8.354  1.00 37.38  ? 341 ALA A N    1 
ATOM   5193  C  CA   . ALA A  1 361 ? 81.631  -97.021  -9.766  1.00 36.20  ? 341 ALA A CA   1 
ATOM   5194  C  C    . ALA A  1 361 ? 80.809  -98.024  -10.597 1.00 39.66  ? 341 ALA A C    1 
ATOM   5195  O  O    . ALA A  1 361 ? 80.395  -97.684  -11.691 1.00 39.55  ? 341 ALA A O    1 
ATOM   5196  C  CB   . ALA A  1 361 ? 83.110  -97.321  -9.911  1.00 36.65  ? 341 ALA A CB   1 
ATOM   5197  H  H    . ALA A  1 361 ? 81.994  -97.295  -7.735  1.00 38.07  ? 341 ALA A H    1 
ATOM   5198  H  HA   . ALA A  1 361 ? 81.469  -96.027  -10.178 1.00 36.55  ? 341 ALA A HA   1 
ATOM   5199  H  HB1  . ALA A  1 361 ? 83.383  -97.223  -10.961 1.00 36.37  ? 341 ALA A HB1  1 
ATOM   5200  H  HB2  . ALA A  1 361 ? 83.677  -96.617  -9.306  1.00 36.06  ? 341 ALA A HB2  1 
ATOM   5201  H  HB3  . ALA A  1 361 ? 83.300  -98.344  -9.591  1.00 37.63  ? 341 ALA A HB3  1 
ATOM   5202  N  N    . TYR A  1 362 ? 80.545  -99.215  -10.084 1.00 33.42  ? 342 TYR A N    1 
ATOM   5203  C  CA   . TYR A  1 362 ? 79.746  -100.174 -10.849 1.00 35.42  ? 342 TYR A CA   1 
ATOM   5204  C  C    . TYR A  1 362 ? 78.291  -99.702  -10.978 1.00 35.53  ? 342 TYR A C    1 
ATOM   5205  O  O    . TYR A  1 362 ? 77.714  -99.844  -12.049 1.00 31.94  ? 342 TYR A O    1 
ATOM   5206  C  CB   . TYR A  1 362 ? 79.790  -101.601 -10.265 1.00 37.78  ? 342 TYR A CB   1 
ATOM   5207  C  CG   . TYR A  1 362 ? 81.159  -102.098 -9.848  1.00 42.02  ? 342 TYR A CG   1 
ATOM   5208  C  CD1  . TYR A  1 362 ? 82.282  -101.859 -10.637 1.00 43.45  ? 342 TYR A CD1  1 
ATOM   5209  C  CD2  . TYR A  1 362 ? 81.319  -102.869 -8.702  1.00 44.56  ? 342 TYR A CD2  1 
ATOM   5210  C  CE1  . TYR A  1 362 ? 83.539  -102.327 -10.261 1.00 44.94  ? 342 TYR A CE1  1 
ATOM   5211  C  CE2  . TYR A  1 362 ? 82.562  -103.370 -8.336  1.00 46.24  ? 342 TYR A CE2  1 
ATOM   5212  C  CZ   . TYR A  1 362 ? 83.670  -103.100 -9.121  1.00 53.66  ? 342 TYR A CZ   1 
ATOM   5213  O  OH   . TYR A  1 362 ? 84.886  -103.621 -8.753  1.00 58.69  ? 342 TYR A OH   1 
ATOM   5214  H  H    . TYR A  1 362 ? 80.840  -99.524  -9.164  1.00 34.34  ? 342 TYR A H    1 
ATOM   5215  H  HA   . TYR A  1 362 ? 80.149  -100.231 -11.859 1.00 37.44  ? 342 TYR A HA   1 
ATOM   5216  H  HB2  . TYR A  1 362 ? 79.155  -101.623 -9.380  1.00 39.18  ? 342 TYR A HB2  1 
ATOM   5217  H  HB3  . TYR A  1 362 ? 79.410  -102.297 -11.011 1.00 36.02  ? 342 TYR A HB3  1 
ATOM   5218  H  HD1  . TYR A  1 362 ? 82.192  -101.294 -11.561 1.00 42.55  ? 342 TYR A HD1  1 
ATOM   5219  H  HD2  . TYR A  1 362 ? 80.459  -103.085 -8.070  1.00 45.02  ? 342 TYR A HD2  1 
ATOM   5220  H  HE1  . TYR A  1 362 ? 84.394  -102.151 -10.912 1.00 45.61  ? 342 TYR A HE1  1 
ATOM   5221  H  HE2  . TYR A  1 362 ? 82.661  -103.946 -7.417  1.00 46.77  ? 342 TYR A HE2  1 
ATOM   5222  H  HH   . TYR A  1 362 ? 85.618  -103.273 -9.327  1.00 59.18  ? 342 TYR A HH   1 
ATOM   5223  N  N    . MET A  1 363 ? 77.741  -99.065  -9.942  1.00 31.03  ? 343 MET A N    1 
ATOM   5224  C  CA   . MET A  1 363 ? 76.357  -98.542  -9.967  1.00 29.31  ? 343 MET A CA   1 
ATOM   5225  C  C    . MET A  1 363 ? 76.161  -97.452  -11.026 1.00 32.67  ? 343 MET A C    1 
ATOM   5226  O  O    . MET A  1 363 ? 75.078  -97.374  -11.624 1.00 32.08  ? 343 MET A O    1 
ATOM   5227  C  CB   . MET A  1 363 ? 75.964  -98.010  -8.564  1.00 29.78  ? 343 MET A CB   1 
ATOM   5228  C  CG   . MET A  1 363 ? 74.544  -97.408  -8.474  1.00 31.11  ? 343 MET A CG   1 
ATOM   5229  S  SD   . MET A  1 363 ? 73.172  -98.479  -9.041  1.00 33.93  ? 343 MET A SD   1 
ATOM   5230  C  CE   . MET A  1 363 ? 73.167  -99.742  -7.811  1.00 29.52  ? 343 MET A CE   1 
ATOM   5231  H  H    . MET A  1 363 ? 78.208  -98.905  -9.054  1.00 33.22  ? 343 MET A H    1 
ATOM   5232  H  HA   . MET A  1 363 ? 75.696  -99.371  -10.209 1.00 32.58  ? 343 MET A HA   1 
ATOM   5233  H  HB2  . MET A  1 363 ? 76.044  -98.825  -7.847  1.00 29.43  ? 343 MET A HB2  1 
ATOM   5234  H  HB3  . MET A  1 363 ? 76.667  -97.225  -8.296  1.00 29.02  ? 343 MET A HB3  1 
ATOM   5235  H  HG2  . MET A  1 363 ? 74.349  -97.157  -7.435  1.00 30.67  ? 343 MET A HG2  1 
ATOM   5236  H  HG3  . MET A  1 363 ? 74.508  -96.489  -9.059  1.00 29.36  ? 343 MET A HG3  1 
ATOM   5237  H  HE1  . MET A  1 363 ? 72.598  -100.584 -8.195  1.00 29.09  ? 343 MET A HE1  1 
ATOM   5238  H  HE2  . MET A  1 363 ? 74.183  -100.048 -7.569  1.00 29.90  ? 343 MET A HE2  1 
ATOM   5239  H  HE3  . MET A  1 363 ? 72.669  -99.365  -6.921  1.00 29.28  ? 343 MET A HE3  1 
ATOM   5240  N  N    . ILE A  1 364 ? 77.187  -96.581  -11.216 1.00 28.00  ? 344 ILE A N    1 
ATOM   5241  C  CA   . ILE A  1 364 ? 77.091  -95.485  -12.169 1.00 29.35  ? 344 ILE A CA   1 
ATOM   5242  C  C    . ILE A  1 364 ? 77.522  -95.901  -13.597 1.00 29.29  ? 344 ILE A C    1 
ATOM   5243  O  O    . ILE A  1 364 ? 77.200  -95.177  -14.528 1.00 26.95  ? 344 ILE A O    1 
ATOM   5244  C  CB   . ILE A  1 364 ? 77.841  -94.202  -11.704 1.00 33.24  ? 344 ILE A CB   1 
ATOM   5245  C  CG1  . ILE A  1 364 ? 79.378  -94.369  -11.644 1.00 33.55  ? 344 ILE A CG1  1 
ATOM   5246  C  CG2  . ILE A  1 364 ? 77.250  -93.681  -10.398 1.00 36.04  ? 344 ILE A CG2  1 
ATOM   5247  C  CD1  . ILE A  1 364 ? 80.099  -93.111  -11.344 1.00 40.86  ? 344 ILE A CD1  1 
ATOM   5248  H  H    . ILE A  1 364 ? 78.074  -96.641  -10.728 1.00 27.03  ? 344 ILE A H    1 
ATOM   5249  H  HA   . ILE A  1 364 ? 76.048  -95.185  -12.238 1.00 29.44  ? 344 ILE A HA   1 
ATOM   5250  H  HB   . ILE A  1 364 ? 77.639  -93.448  -12.458 1.00 33.79  ? 344 ILE A HB   1 
ATOM   5251  H  HG12 . ILE A  1 364 ? 79.630  -95.074  -10.855 1.00 32.68  ? 344 ILE A HG12 1 
ATOM   5252  H  HG13 . ILE A  1 364 ? 79.750  -94.731  -12.600 1.00 32.27  ? 344 ILE A HG13 1 
ATOM   5253  H  HG21 . ILE A  1 364 ? 77.600  -92.663  -10.235 1.00 35.76  ? 344 ILE A HG21 1 
ATOM   5254  H  HG22 . ILE A  1 364 ? 76.163  -93.690  -10.468 1.00 35.87  ? 344 ILE A HG22 1 
ATOM   5255  H  HG23 . ILE A  1 364 ? 77.569  -94.328  -9.582  1.00 36.49  ? 344 ILE A HG23 1 
ATOM   5256  H  HD11 . ILE A  1 364 ? 81.151  -93.242  -11.593 1.00 39.38  ? 344 ILE A HD11 1 
ATOM   5257  H  HD12 . ILE A  1 364 ? 79.665  -92.308  -11.938 1.00 41.05  ? 344 ILE A HD12 1 
ATOM   5258  H  HD13 . ILE A  1 364 ? 79.991  -92.887  -10.283 1.00 40.46  ? 344 ILE A HD13 1 
ATOM   5259  N  N    . THR A  1 365 ? 78.245  -97.012  -13.779 1.00 30.18  ? 345 THR A N    1 
ATOM   5260  C  CA   . THR A  1 365 ? 78.691  -97.434  -15.112 1.00 31.55  ? 345 THR A CA   1 
ATOM   5261  C  C    . THR A  1 365 ? 77.863  -98.585  -15.712 1.00 35.05  ? 345 THR A C    1 
ATOM   5262  O  O    . THR A  1 365 ? 77.781  -98.683  -16.938 1.00 33.16  ? 345 THR A O    1 
ATOM   5263  C  CB   . THR A  1 365 ? 80.164  -97.866  -15.105 1.00 41.49  ? 345 THR A CB   1 
ATOM   5264  O  OG1  . THR A  1 365 ? 80.307  -98.992  -14.279 1.00 43.56  ? 345 THR A OG1  1 
ATOM   5265  C  CG2  . THR A  1 365 ? 81.119  -96.757  -14.678 1.00 44.23  ? 345 THR A CG2  1 
ATOM   5266  H  H    . THR A  1 365 ? 78.554  -97.637  -13.043 1.00 31.98  ? 345 THR A H    1 
ATOM   5267  H  HA   . THR A  1 365 ? 78.634  -96.599  -15.808 1.00 30.10  ? 345 THR A HA   1 
ATOM   5268  H  HB   . THR A  1 365 ? 80.440  -98.154  -16.118 1.00 40.11  ? 345 THR A HB   1 
ATOM   5269  H  HG1  . THR A  1 365 ? 80.977  -98.834  -13.563 1.00 44.73  ? 345 THR A HG1  1 
ATOM   5270  H  HG21 . THR A  1 365 ? 82.140  -97.135  -14.649 1.00 44.43  ? 345 THR A HG21 1 
ATOM   5271  H  HG22 . THR A  1 365 ? 81.072  -95.947  -15.404 1.00 43.65  ? 345 THR A HG22 1 
ATOM   5272  H  HG23 . THR A  1 365 ? 80.857  -96.369  -13.697 1.00 43.56  ? 345 THR A HG23 1 
ATOM   5273  N  N    . GLU A  1 366 ? 77.305  -99.474  -14.900 1.00 30.35  ? 346 GLU A N    1 
ATOM   5274  C  CA   . GLU A  1 366 ? 76.639  -100.662 -15.452 1.00 31.23  ? 346 GLU A CA   1 
ATOM   5275  C  C    . GLU A  1 366 ? 75.158  -100.443 -15.696 1.00 32.70  ? 346 GLU A C    1 
ATOM   5276  O  O    . GLU A  1 366 ? 74.593  -99.510  -15.167 1.00 31.27  ? 346 GLU A O    1 
ATOM   5277  C  CB   . GLU A  1 366 ? 76.856  -101.862 -14.522 1.00 33.31  ? 346 GLU A CB   1 
ATOM   5278  C  CG   . GLU A  1 366 ? 78.329  -102.206 -14.295 1.00 51.46  ? 346 GLU A CG   1 
ATOM   5279  C  CD   . GLU A  1 366 ? 79.166  -102.446 -15.545 1.00 61.50  ? 346 GLU A CD   1 
ATOM   5280  O  OE1  . GLU A  1 366 ? 78.849  -103.389 -16.300 1.00 49.87  ? 346 GLU A OE1  1 
ATOM   5281  O  OE2  . GLU A  1 366 ? 80.129  -101.682 -15.780 1.00 52.92  ? 346 GLU A OE2  1 
ATOM   5282  H  H    . GLU A  1 366 ? 77.278  -99.413  -13.889 1.00 29.29  ? 346 GLU A H    1 
ATOM   5283  H  HA   . GLU A  1 366 ? 77.071  -100.933 -16.414 1.00 30.69  ? 346 GLU A HA   1 
ATOM   5284  H  HB2  . GLU A  1 366 ? 76.413  -101.634 -13.553 1.00 34.52  ? 346 GLU A HB2  1 
ATOM   5285  H  HB3  . GLU A  1 366 ? 76.367  -102.737 -14.945 1.00 32.79  ? 346 GLU A HB3  1 
ATOM   5286  H  HG2  . GLU A  1 366 ? 78.807  -101.397 -13.744 1.00 51.29  ? 346 GLU A HG2  1 
ATOM   5287  H  HG3  . GLU A  1 366 ? 78.373  -103.114 -13.694 1.00 52.22  ? 346 GLU A HG3  1 
ATOM   5288  N  N    . ASP A  1 367 ? 74.548  -101.289 -16.552 1.00 32.47  ? 347 ASP A N    1 
ATOM   5289  C  CA   . ASP A  1 367 ? 73.114  -101.215 -16.841 1.00 33.23  ? 347 ASP A CA   1 
ATOM   5290  C  C    . ASP A  1 367 ? 72.283  -101.838 -15.702 1.00 41.57  ? 347 ASP A C    1 
ATOM   5291  O  O    . ASP A  1 367 ? 71.088  -101.587 -15.616 1.00 41.02  ? 347 ASP A O    1 
ATOM   5292  C  CB   . ASP A  1 367 ? 72.759  -101.883 -18.171 1.00 34.61  ? 347 ASP A CB   1 
ATOM   5293  C  CG   . ASP A  1 367 ? 71.367  -101.515 -18.636 1.00 38.40  ? 347 ASP A CG   1 
ATOM   5294  O  OD1  . ASP A  1 367 ? 71.044  -100.284 -18.650 1.00 39.77  ? 347 ASP A OD1  1 
ATOM   5295  O  OD2  . ASP A  1 367 ? 70.558  -102.437 -18.865 1.00 41.22  ? 347 ASP A OD2  1 
ATOM   5296  H  H    . ASP A  1 367 ? 75.024  -102.054 -17.020 1.00 32.73  ? 347 ASP A H    1 
ATOM   5297  H  HA   . ASP A  1 367 ? 72.833  -100.167 -16.901 1.00 32.95  ? 347 ASP A HA   1 
ATOM   5298  H  HB2  . ASP A  1 367 ? 73.472  -101.562 -18.928 1.00 35.30  ? 347 ASP A HB2  1 
ATOM   5299  H  HB3  . ASP A  1 367 ? 72.806  -102.965 -18.055 1.00 35.80  ? 347 ASP A HB3  1 
ATOM   5300  N  N    . ALA A  1 368 ? 72.903  -102.700 -14.881 1.00 40.99  ? 348 ALA A N    1 
ATOM   5301  C  CA   . ALA A  1 368 ? 72.277  -103.340 -13.727 1.00 40.66  ? 348 ALA A CA   1 
ATOM   5302  C  C    . ALA A  1 368 ? 73.323  -103.473 -12.634 1.00 43.83  ? 348 ALA A C    1 
ATOM   5303  O  O    . ALA A  1 368 ? 74.462  -103.809 -12.922 1.00 42.97  ? 348 ALA A O    1 
ATOM   5304  C  CB   . ALA A  1 368 ? 71.699  -104.693 -14.092 1.00 41.81  ? 348 ALA A CB   1 
ATOM   5305  H  H    . ALA A  1 368 ? 73.865  -103.004 -15.009 1.00 42.38  ? 348 ALA A H    1 
ATOM   5306  H  HA   . ALA A  1 368 ? 71.469  -102.707 -13.370 1.00 40.41  ? 348 ALA A HA   1 
ATOM   5307  H  HB1  . ALA A  1 368 ? 71.165  -105.095 -13.233 1.00 40.32  ? 348 ALA A HB1  1 
ATOM   5308  H  HB2  . ALA A  1 368 ? 71.007  -104.554 -14.923 1.00 43.33  ? 348 ALA A HB2  1 
ATOM   5309  H  HB3  . ALA A  1 368 ? 72.502  -105.364 -14.390 1.00 41.61  ? 348 ALA A HB3  1 
ATOM   5310  N  N    . ALA A  1 369 ? 72.971  -103.119 -11.398 1.00 41.31  ? 349 ALA A N    1 
ATOM   5311  C  CA   . ALA A  1 369 ? 73.944  -103.155 -10.304 1.00 41.07  ? 349 ALA A CA   1 
ATOM   5312  C  C    . ALA A  1 369 ? 73.279  -103.231 -8.962  1.00 39.39  ? 349 ALA A C    1 
ATOM   5313  O  O    . ALA A  1 369 ? 72.109  -102.868 -8.811  1.00 34.22  ? 349 ALA A O    1 
ATOM   5314  C  CB   . ALA A  1 369 ? 74.829  -101.912 -10.359 1.00 40.70  ? 349 ALA A CB   1 
ATOM   5315  H  H    . ALA A  1 369 ? 72.045  -102.807 -11.127 1.00 40.66  ? 349 ALA A H    1 
ATOM   5316  H  HA   . ALA A  1 369 ? 74.575  -104.036 -10.406 1.00 42.51  ? 349 ALA A HA   1 
ATOM   5317  H  HB1  . ALA A  1 369 ? 75.476  -101.896 -9.483  1.00 41.33  ? 349 ALA A HB1  1 
ATOM   5318  H  HB2  . ALA A  1 369 ? 75.434  -101.939 -11.263 1.00 41.13  ? 349 ALA A HB2  1 
ATOM   5319  H  HB3  . ALA A  1 369 ? 74.177  -101.040 -10.368 1.00 38.07  ? 349 ALA A HB3  1 
ATOM   5320  N  N    . ASP A  1 370 ? 74.052  -103.670 -7.979  1.00 40.29  ? 350 ASP A N    1 
ATOM   5321  C  CA   . ASP A  1 370 ? 73.582  -103.797 -6.602  1.00 39.60  ? 350 ASP A CA   1 
ATOM   5322  C  C    . ASP A  1 370 ? 74.079  -102.645 -5.742  1.00 41.77  ? 350 ASP A C    1 
ATOM   5323  O  O    . ASP A  1 370 ? 75.267  -102.325 -5.733  1.00 41.48  ? 350 ASP A O    1 
ATOM   5324  C  CB   . ASP A  1 370 ? 74.039  -105.126 -5.995  1.00 42.80  ? 350 ASP A CB   1 
ATOM   5325  C  CG   . ASP A  1 370 ? 73.230  -106.301 -6.480  1.00 56.47  ? 350 ASP A CG   1 
ATOM   5326  O  OD1  . ASP A  1 370 ? 71.994  -106.276 -6.314  1.00 56.27  ? 350 ASP A OD1  1 
ATOM   5327  O  OD2  . ASP A  1 370 ? 73.832  -107.249 -7.004  1.00 70.11  ? 350 ASP A OD2  1 
ATOM   5328  H  H    . ASP A  1 370 ? 75.025  -103.932 -8.097  1.00 41.08  ? 350 ASP A H    1 
ATOM   5329  H  HA   . ASP A  1 370 ? 72.495  -103.789 -6.576  1.00 39.73  ? 350 ASP A HA   1 
ATOM   5330  H  HB2  . ASP A  1 370 ? 75.083  -105.301 -6.248  1.00 42.67  ? 350 ASP A HB2  1 
ATOM   5331  H  HB3  . ASP A  1 370 ? 73.924  -105.081 -4.913  1.00 41.89  ? 350 ASP A HB3  1 
ATOM   5332  N  N    . GLY A  1 371 ? 73.160  -102.057 -5.003  1.00 37.97  ? 351 GLY A N    1 
ATOM   5333  C  CA   . GLY A  1 371 ? 73.476  -101.060 -3.999  1.00 37.09  ? 351 GLY A CA   1 
ATOM   5334  C  C    . GLY A  1 371 ? 73.549  -101.784 -2.671  1.00 37.18  ? 351 GLY A C    1 
ATOM   5335  O  O    . GLY A  1 371 ? 73.321  -102.988 -2.623  1.00 34.81  ? 351 GLY A O    1 
ATOM   5336  H  H    . GLY A  1 371 ? 72.165  -102.242 -5.066  1.00 37.17  ? 351 GLY A H    1 
ATOM   5337  H  HA2  . GLY A  1 371 ? 74.435  -100.582 -4.192  1.00 39.32  ? 351 GLY A HA2  1 
ATOM   5338  H  HA3  . GLY A  1 371 ? 72.707  -100.291 -3.968  1.00 35.82  ? 351 GLY A HA3  1 
ATOM   5339  N  N    . PRO A  1 372 ? 73.818  -101.058 -1.559  1.00 36.35  ? 352 PRO A N    1 
ATOM   5340  C  CA   . PRO A  1 372 ? 73.847  -101.725 -0.228  1.00 36.13  ? 352 PRO A CA   1 
ATOM   5341  C  C    . PRO A  1 372 ? 72.518  -102.394 0.127   1.00 36.34  ? 352 PRO A C    1 
ATOM   5342  O  O    . PRO A  1 372 ? 72.526  -103.359 0.822   1.00 37.13  ? 352 PRO A O    1 
ATOM   5343  C  CB   . PRO A  1 372 ? 74.200  -100.602 0.742   1.00 37.75  ? 352 PRO A CB   1 
ATOM   5344  C  CG   . PRO A  1 372 ? 74.416  -99.396  -0.061  1.00 42.20  ? 352 PRO A CG   1 
ATOM   5345  C  CD   . PRO A  1 372 ? 74.137  -99.619  -1.484  1.00 37.57  ? 352 PRO A CD   1 
ATOM   5346  H  HA   . PRO A  1 372 ? 74.632  -102.477 -0.202  1.00 37.43  ? 352 PRO A HA   1 
ATOM   5347  H  HB2  . PRO A  1 372 ? 73.389  -100.435 1.449   1.00 38.61  ? 352 PRO A HB2  1 
ATOM   5348  H  HB3  . PRO A  1 372 ? 75.111  -100.872 1.273   1.00 38.49  ? 352 PRO A HB3  1 
ATOM   5349  H  HG2  . PRO A  1 372 ? 73.755  -98.617  0.314   1.00 43.27  ? 352 PRO A HG2  1 
ATOM   5350  H  HG3  . PRO A  1 372 ? 75.453  -99.084  0.060   1.00 42.45  ? 352 PRO A HG3  1 
ATOM   5351  H  HD2  . PRO A  1 372 ? 73.308  -99.007  -1.828  1.00 36.27  ? 352 PRO A HD2  1 
ATOM   5352  H  HD3  . PRO A  1 372 ? 75.033  -99.419  -2.074  1.00 37.26  ? 352 PRO A HD3  1 
ATOM   5353  N  N    . TYR A  1 373 ? 71.378  -101.867 -0.339  1.00 34.75  ? 353 TYR A N    1 
ATOM   5354  C  CA   . TYR A  1 373 ? 70.047  -102.444 -0.048  1.00 33.99  ? 353 TYR A CA   1 
ATOM   5355  C  C    . TYR A  1 373 ? 69.222  -102.770 -1.282  1.00 37.45  ? 353 TYR A C    1 
ATOM   5356  O  O    . TYR A  1 373 ? 68.394  -103.654 -1.186  1.00 38.42  ? 353 TYR A O    1 
ATOM   5357  C  CB   . TYR A  1 373 ? 69.233  -101.461 0.832   1.00 35.83  ? 353 TYR A CB   1 
ATOM   5358  C  CG   . TYR A  1 373 ? 69.842  -101.277 2.198   1.00 38.16  ? 353 TYR A CG   1 
ATOM   5359  C  CD1  . TYR A  1 373 ? 69.601  -102.188 3.222   1.00 40.65  ? 353 TYR A CD1  1 
ATOM   5360  C  CD2  . TYR A  1 373 ? 70.724  -100.238 2.449   1.00 39.29  ? 353 TYR A CD2  1 
ATOM   5361  C  CE1  . TYR A  1 373 ? 70.212  -102.056 4.467   1.00 42.05  ? 353 TYR A CE1  1 
ATOM   5362  C  CE2  . TYR A  1 373 ? 71.368  -100.119 3.672   1.00 40.20  ? 353 TYR A CE2  1 
ATOM   5363  C  CZ   . TYR A  1 373 ? 71.113  -101.034 4.680   1.00 48.68  ? 353 TYR A CZ   1 
ATOM   5364  O  OH   . TYR A  1 373 ? 71.720  -100.911 5.901   1.00 50.17  ? 353 TYR A OH   1 
ATOM   5365  H  H    . TYR A  1 373 ? 71.336  -100.996 -0.858  1.00 34.65  ? 353 TYR A H    1 
ATOM   5366  H  HA   . TYR A  1 373 ? 70.147  -103.366 0.520   1.00 35.15  ? 353 TYR A HA   1 
ATOM   5367  H  HB2  . TYR A  1 373 ? 69.194  -100.489 0.342   1.00 33.53  ? 353 TYR A HB2  1 
ATOM   5368  H  HB3  . TYR A  1 373 ? 68.227  -101.855 0.966   1.00 37.24  ? 353 TYR A HB3  1 
ATOM   5369  H  HD1  . TYR A  1 373 ? 68.918  -103.017 3.051   1.00 39.99  ? 353 TYR A HD1  1 
ATOM   5370  H  HD2  . TYR A  1 373 ? 70.967  -99.544  1.645   1.00 39.30  ? 353 TYR A HD2  1 
ATOM   5371  H  HE1  . TYR A  1 373 ? 70.020  -102.778 5.261   1.00 42.84  ? 353 TYR A HE1  1 
ATOM   5372  H  HE2  . TYR A  1 373 ? 72.070  -99.306  3.837   1.00 39.67  ? 353 TYR A HE2  1 
ATOM   5373  H  HH   . TYR A  1 373 ? 72.557  -100.380 5.853   1.00 49.78  ? 353 TYR A HH   1 
ATOM   5374  N  N    . PHE A  1 374 ? 69.413  -102.056 -2.440  1.00 31.09  ? 354 PHE A N    1 
ATOM   5375  C  CA   . PHE A  1 374 ? 68.564  -102.262 -3.597  1.00 32.71  ? 354 PHE A CA   1 
ATOM   5376  C  C    . PHE A  1 374 ? 69.323  -102.581 -4.873  1.00 37.69  ? 354 PHE A C    1 
ATOM   5377  O  O    . PHE A  1 374 ? 70.356  -101.968 -5.155  1.00 37.56  ? 354 PHE A O    1 
ATOM   5378  C  CB   . PHE A  1 374 ? 67.740  -101.005 -3.864  1.00 35.18  ? 354 PHE A CB   1 
ATOM   5379  C  CG   . PHE A  1 374 ? 66.950  -100.550 -2.663  1.00 38.06  ? 354 PHE A CG   1 
ATOM   5380  C  CD1  . PHE A  1 374 ? 65.932  -101.340 -2.141  1.00 40.12  ? 354 PHE A CD1  1 
ATOM   5381  C  CD2  . PHE A  1 374 ? 67.240  -99.350  -2.036  1.00 38.90  ? 354 PHE A CD2  1 
ATOM   5382  C  CE1  . PHE A  1 374 ? 65.222  -100.931 -1.013  1.00 42.26  ? 354 PHE A CE1  1 
ATOM   5383  C  CE2  . PHE A  1 374 ? 66.509  -98.931  -0.921  1.00 42.38  ? 354 PHE A CE2  1 
ATOM   5384  C  CZ   . PHE A  1 374 ? 65.513  -99.735  -0.402  1.00 41.58  ? 354 PHE A CZ   1 
ATOM   5385  H  H    . PHE A  1 374 ? 70.154  -101.384 -2.599  1.00 27.10  ? 354 PHE A H    1 
ATOM   5386  H  HA   . PHE A  1 374 ? 67.859  -103.073 -3.424  1.00 33.37  ? 354 PHE A HA   1 
ATOM   5387  H  HB2  . PHE A  1 374 ? 68.418  -100.202 -4.149  1.00 36.10  ? 354 PHE A HB2  1 
ATOM   5388  H  HB3  . PHE A  1 374 ? 67.049  -101.206 -4.680  1.00 33.83  ? 354 PHE A HB3  1 
ATOM   5389  H  HD1  . PHE A  1 374 ? 65.695  -102.291 -2.615  1.00 38.56  ? 354 PHE A HD1  1 
ATOM   5390  H  HD2  . PHE A  1 374 ? 68.015  -98.707  -2.441  1.00 38.78  ? 354 PHE A HD2  1 
ATOM   5391  H  HE1  . PHE A  1 374 ? 64.417  -101.551 -0.624  1.00 44.32  ? 354 PHE A HE1  1 
ATOM   5392  H  HE2  . PHE A  1 374 ? 66.743  -97.983  -0.438  1.00 42.19  ? 354 PHE A HE2  1 
ATOM   5393  H  HZ   . PHE A  1 374 ? 64.943  -99.415  0.470   1.00 41.81  ? 354 PHE A HZ   1 
ATOM   5394  N  N    . HIS A  1 375 ? 68.776  -103.519 -5.656  1.00 33.01  ? 355 HIS A N    1 
ATOM   5395  C  CA   . HIS A  1 375 ? 69.246  -103.805 -7.006  1.00 33.12  ? 355 HIS A CA   1 
ATOM   5396  C  C    . HIS A  1 375 ? 68.623  -102.748 -7.943  1.00 39.23  ? 355 HIS A C    1 
ATOM   5397  O  O    . HIS A  1 375 ? 67.441  -102.429 -7.794  1.00 43.15  ? 355 HIS A O    1 
ATOM   5398  C  CB   . HIS A  1 375 ? 68.878  -105.209 -7.447  1.00 34.64  ? 355 HIS A CB   1 
ATOM   5399  C  CG   . HIS A  1 375 ? 69.301  -105.511 -8.857  1.00 38.47  ? 355 HIS A CG   1 
ATOM   5400  N  ND1  . HIS A  1 375 ? 70.587  -105.940 -9.147  1.00 40.92  ? 355 HIS A ND1  1 
ATOM   5401  C  CD2  . HIS A  1 375 ? 68.603  -105.399 -10.010 1.00 40.87  ? 355 HIS A CD2  1 
ATOM   5402  C  CE1  . HIS A  1 375 ? 70.630  -106.050 -10.469 1.00 41.23  ? 355 HIS A CE1  1 
ATOM   5403  N  NE2  . HIS A  1 375 ? 69.441  -105.771 -11.019 1.00 41.22  ? 355 HIS A NE2  1 
ATOM   5404  H  H    . HIS A  1 375 ? 68.022  -104.128 -5.355  1.00 33.18  ? 355 HIS A H    1 
ATOM   5405  H  HA   . HIS A  1 375 ? 70.329  -103.710 -7.048  1.00 34.00  ? 355 HIS A HA   1 
ATOM   5406  H  HB2  . HIS A  1 375 ? 69.376  -105.920 -6.789  1.00 34.84  ? 355 HIS A HB2  1 
ATOM   5407  H  HB3  . HIS A  1 375 ? 67.798  -105.327 -7.393  1.00 34.30  ? 355 HIS A HB3  1 
ATOM   5408  H  HD2  . HIS A  1 375 ? 67.569  -105.075 -10.117 1.00 40.96  ? 355 HIS A HD2  1 
ATOM   5409  H  HE1  . HIS A  1 375 ? 71.520  -106.325 -11.032 1.00 40.39  ? 355 HIS A HE1  1 
ATOM   5410  H  HE2  . HIS A  1 375 ? 69.213  -105.821 -12.007 1.00 42.04  ? 355 HIS A HE2  1 
ATOM   5411  N  N    . GLN A  1 376 ? 69.392  -102.197 -8.866  1.00 31.48  ? 356 GLN A N    1 
ATOM   5412  C  CA   . GLN A  1 376 ? 68.871  -101.195 -9.803  1.00 30.90  ? 356 GLN A CA   1 
ATOM   5413  C  C    . GLN A  1 376 ? 69.094  -101.594 -11.265 1.00 35.25  ? 356 GLN A C    1 
ATOM   5414  O  O    . GLN A  1 376 ? 70.220  -101.870 -11.643 1.00 35.30  ? 356 GLN A O    1 
ATOM   5415  C  CB   . GLN A  1 376 ? 69.538  -99.823  -9.534  1.00 30.42  ? 356 GLN A CB   1 
ATOM   5416  C  CG   . GLN A  1 376 ? 68.984  -98.659  -10.350 1.00 32.52  ? 356 GLN A CG   1 
ATOM   5417  C  CD   . GLN A  1 376 ? 67.564  -98.297  -9.957  1.00 46.01  ? 356 GLN A CD   1 
ATOM   5418  O  OE1  . GLN A  1 376 ? 67.284  -97.923  -8.793  1.00 34.13  ? 356 GLN A OE1  1 
ATOM   5419  N  NE2  . GLN A  1 376 ? 66.623  -98.427  -10.887 1.00 33.58  ? 356 GLN A NE2  1 
ATOM   5420  H  H    . GLN A  1 376 ? 70.378  -102.401 -8.996  1.00 31.85  ? 356 GLN A H    1 
ATOM   5421  H  HA   . GLN A  1 376 ? 67.800  -101.067 -9.662  1.00 31.20  ? 356 GLN A HA   1 
ATOM   5422  H  HB2  . GLN A  1 376 ? 69.410  -99.589  -8.479  1.00 31.38  ? 356 GLN A HB2  1 
ATOM   5423  H  HB3  . GLN A  1 376 ? 70.600  -99.906  -9.759  1.00 31.26  ? 356 GLN A HB3  1 
ATOM   5424  H  HG2  . GLN A  1 376 ? 69.606  -97.785  -10.165 1.00 33.48  ? 356 GLN A HG2  1 
ATOM   5425  H  HG3  . GLN A  1 376 ? 69.016  -98.882  -11.415 1.00 32.02  ? 356 GLN A HG3  1 
ATOM   5426  H  HE21 . GLN A  1 376 ? 66.843  -98.759  -11.821 1.00 33.94  ? 356 GLN A HE21 1 
ATOM   5427  H  HE22 . GLN A  1 376 ? 65.661  -98.195  -10.660 1.00 34.40  ? 356 GLN A HE22 1 
ATOM   5428  N  N    . GLU A  1 377 ? 68.012  -101.588 -12.074 1.00 33.19  ? 357 GLU A N    1 
ATOM   5429  C  CA   . GLU A  1 377 ? 68.038  -101.701 -13.528 1.00 33.13  ? 357 GLU A CA   1 
ATOM   5430  C  C    . GLU A  1 377 ? 68.003  -100.260 -14.074 1.00 36.13  ? 357 GLU A C    1 
ATOM   5431  O  O    . GLU A  1 377 ? 67.180  -99.461  -13.604 1.00 33.17  ? 357 GLU A O    1 
ATOM   5432  C  CB   . GLU A  1 377 ? 66.850  -102.524 -14.071 1.00 35.05  ? 357 GLU A CB   1 
ATOM   5433  C  CG   . GLU A  1 377 ? 66.874  -103.990 -13.667 1.00 49.71  ? 357 GLU A CG   1 
ATOM   5434  C  CD   . GLU A  1 377 ? 67.870  -104.874 -14.402 1.00 66.71  ? 357 GLU A CD   1 
ATOM   5435  O  OE1  . GLU A  1 377 ? 68.393  -104.446 -15.458 1.00 66.32  ? 357 GLU A OE1  1 
ATOM   5436  O  OE2  . GLU A  1 377 ? 68.110  -106.011 -13.932 1.00 55.78  ? 357 GLU A OE2  1 
ATOM   5437  H  H    . GLU A  1 377 ? 67.065  -101.515 -11.715 1.00 34.23  ? 357 GLU A H    1 
ATOM   5438  H  HA   . GLU A  1 377 ? 68.959  -102.179 -13.856 1.00 33.33  ? 357 GLU A HA   1 
ATOM   5439  H  HB2  . GLU A  1 377 ? 65.926  -102.078 -13.706 1.00 33.96  ? 357 GLU A HB2  1 
ATOM   5440  H  HB3  . GLU A  1 377 ? 66.848  -102.463 -15.158 1.00 34.75  ? 357 GLU A HB3  1 
ATOM   5441  H  HG2  . GLU A  1 377 ? 67.108  -104.048 -12.605 1.00 50.27  ? 357 GLU A HG2  1 
ATOM   5442  H  HG3  . GLU A  1 377 ? 65.882  -104.407 -13.830 1.00 50.52  ? 357 GLU A HG3  1 
ATOM   5443  N  N    . TRP A  1 378 ? 68.925  -99.910  -14.990 1.00 31.44  ? 358 TRP A N    1 
ATOM   5444  C  CA   . TRP A  1 378 ? 69.040  -98.561  -15.528 1.00 30.92  ? 358 TRP A CA   1 
ATOM   5445  C  C    . TRP A  1 378 ? 68.318  -98.411  -16.872 1.00 34.65  ? 358 TRP A C    1 
ATOM   5446  O  O    . TRP A  1 378 ? 68.212  -97.286  -17.373 1.00 34.72  ? 358 TRP A O    1 
ATOM   5447  C  CB   . TRP A  1 378 ? 70.502  -98.145  -15.638 1.00 29.85  ? 358 TRP A CB   1 
ATOM   5448  C  CG   . TRP A  1 378 ? 71.124  -97.871  -14.308 1.00 31.09  ? 358 TRP A CG   1 
ATOM   5449  C  CD1  . TRP A  1 378 ? 71.748  -98.774  -13.497 1.00 33.95  ? 358 TRP A CD1  1 
ATOM   5450  C  CD2  . TRP A  1 378 ? 71.029  -96.651  -13.550 1.00 31.92  ? 358 TRP A CD2  1 
ATOM   5451  N  NE1  . TRP A  1 378 ? 72.167  -98.160  -12.341 1.00 32.89  ? 358 TRP A NE1  1 
ATOM   5452  C  CE2  . TRP A  1 378 ? 71.703  -96.865  -12.326 1.00 34.91  ? 358 TRP A CE2  1 
ATOM   5453  C  CE3  . TRP A  1 378 ? 70.515  -95.358  -13.820 1.00 33.28  ? 358 TRP A CE3  1 
ATOM   5454  C  CZ2  . TRP A  1 378 ? 71.865  -95.848  -11.368 1.00 33.89  ? 358 TRP A CZ2  1 
ATOM   5455  C  CZ3  . TRP A  1 378 ? 70.618  -94.385  -12.838 1.00 34.25  ? 358 TRP A CZ3  1 
ATOM   5456  C  CH2  . TRP A  1 378 ? 71.279  -94.644  -11.620 1.00 34.51  ? 358 TRP A CH2  1 
ATOM   5457  H  H    . TRP A  1 378 ? 69.606  -100.556 -15.377 1.00 33.32  ? 358 TRP A H    1 
ATOM   5458  H  HA   . TRP A  1 378 ? 68.586  -97.855  -14.832 1.00 31.72  ? 358 TRP A HA   1 
ATOM   5459  H  HB2  . TRP A  1 378 ? 71.064  -98.938  -16.125 1.00 31.18  ? 358 TRP A HB2  1 
ATOM   5460  H  HB3  . TRP A  1 378 ? 70.582  -97.233  -16.229 1.00 30.80  ? 358 TRP A HB3  1 
ATOM   5461  H  HD1  . TRP A  1 378 ? 71.996  -99.797  -13.772 1.00 34.53  ? 358 TRP A HD1  1 
ATOM   5462  H  HE1  . TRP A  1 378 ? 72.682  -98.607  -11.588 1.00 34.04  ? 358 TRP A HE1  1 
ATOM   5463  H  HE3  . TRP A  1 378 ? 69.960  -95.165  -14.735 1.00 33.08  ? 358 TRP A HE3  1 
ATOM   5464  H  HZ2  . TRP A  1 378 ? 72.393  -96.040  -10.435 1.00 34.78  ? 358 TRP A HZ2  1 
ATOM   5465  H  HZ3  . TRP A  1 378 ? 70.214  -93.393  -13.029 1.00 33.09  ? 358 TRP A HZ3  1 
ATOM   5466  H  HH2  . TRP A  1 378 ? 71.407  -93.837  -10.899 1.00 34.10  ? 358 TRP A HH2  1 
ATOM   5467  N  N    . LEU A  1 379 ? 67.790  -99.503  -17.437 1.00 34.79  ? 359 LEU A N    1 
ATOM   5468  C  CA   . LEU A  1 379 ? 67.004  -99.486  -18.684 1.00 36.36  ? 359 LEU A CA   1 
ATOM   5469  C  C    . LEU A  1 379 ? 67.724  -98.744  -19.840 1.00 34.89  ? 359 LEU A C    1 
ATOM   5470  O  O    . LEU A  1 379 ? 67.128  -97.952  -20.541 1.00 32.46  ? 359 LEU A O    1 
ATOM   5471  C  CB   . LEU A  1 379 ? 65.634  -98.819  -18.402 1.00 36.87  ? 359 LEU A CB   1 
ATOM   5472  C  CG   . LEU A  1 379 ? 64.859  -99.351  -17.198 1.00 44.54  ? 359 LEU A CG   1 
ATOM   5473  C  CD1  . LEU A  1 379 ? 63.553  -98.613  -17.035 1.00 46.87  ? 359 LEU A CD1  1 
ATOM   5474  C  CD2  . LEU A  1 379 ? 64.586  -100.804 -17.313 1.00 41.79  ? 359 LEU A CD2  1 
ATOM   5475  H  H    . LEU A  1 379 ? 67.910  -100.451 -17.095 1.00 35.80  ? 359 LEU A H    1 
ATOM   5476  H  HA   . LEU A  1 379 ? 66.835  -100.509 -19.017 1.00 36.08  ? 359 LEU A HA   1 
ATOM   5477  H  HB2  . LEU A  1 379 ? 65.786  -97.753  -18.249 1.00 34.36  ? 359 LEU A HB2  1 
ATOM   5478  H  HB3  . LEU A  1 379 ? 65.004  -98.975  -19.276 1.00 38.56  ? 359 LEU A HB3  1 
ATOM   5479  H  HG   . LEU A  1 379 ? 65.441  -99.188  -16.291 1.00 46.02  ? 359 LEU A HG   1 
ATOM   5480  H  HD11 . LEU A  1 379 ? 63.163  -98.853  -16.048 1.00 46.47  ? 359 LEU A HD11 1 
ATOM   5481  H  HD12 . LEU A  1 379 ? 63.720  -97.541  -17.127 1.00 47.15  ? 359 LEU A HD12 1 
ATOM   5482  H  HD13 . LEU A  1 379 ? 62.864  -98.950  -17.808 1.00 47.58  ? 359 LEU A HD13 1 
ATOM   5483  H  HD21 . LEU A  1 379 ? 63.883  -101.096 -16.536 1.00 40.56  ? 359 LEU A HD21 1 
ATOM   5484  H  HD22 . LEU A  1 379 ? 64.170  -101.001 -18.300 1.00 41.63  ? 359 LEU A HD22 1 
ATOM   5485  H  HD23 . LEU A  1 379 ? 65.517  -101.354 -17.186 1.00 42.34  ? 359 LEU A HD23 1 
ATOM   5486  N  N    . GLY A  1 380 ? 69.014  -98.974  -19.977 1.00 32.16  ? 360 GLY A N    1 
ATOM   5487  C  CA   . GLY A  1 380 ? 69.815  -98.360  -21.023 1.00 29.79  ? 360 GLY A CA   1 
ATOM   5488  C  C    . GLY A  1 380 ? 70.173  -96.896  -20.797 1.00 33.45  ? 360 GLY A C    1 
ATOM   5489  O  O    . GLY A  1 380 ? 70.737  -96.273  -21.683 1.00 31.91  ? 360 GLY A O    1 
ATOM   5490  H  H    . GLY A  1 380 ? 69.543  -99.611  -19.390 1.00 33.11  ? 360 GLY A H    1 
ATOM   5491  H  HA2  . GLY A  1 380 ? 70.744  -98.920  -21.119 1.00 26.49  ? 360 GLY A HA2  1 
ATOM   5492  H  HA3  . GLY A  1 380 ? 69.283  -98.446  -21.970 1.00 29.67  ? 360 GLY A HA3  1 
ATOM   5493  N  N    . MET A  1 381 ? 69.923  -96.328  -19.610 1.00 31.68  ? 361 MET A N    1 
ATOM   5494  C  CA   . MET A  1 381 ? 70.354  -94.959  -19.323 1.00 30.62  ? 361 MET A CA   1 
ATOM   5495  C  C    . MET A  1 381 ? 71.884  -94.934  -19.423 1.00 34.96  ? 361 MET A C    1 
ATOM   5496  O  O    . MET A  1 381 ? 72.543  -95.892  -19.030 1.00 33.60  ? 361 MET A O    1 
ATOM   5497  C  CB   . MET A  1 381 ? 69.854  -94.486  -17.936 1.00 31.46  ? 361 MET A CB   1 
ATOM   5498  C  CG   . MET A  1 381 ? 70.344  -93.094  -17.572 1.00 33.34  ? 361 MET A CG   1 
ATOM   5499  S  SD   . MET A  1 381 ? 69.659  -92.435  -16.052 1.00 35.81  ? 361 MET A SD   1 
ATOM   5500  C  CE   . MET A  1 381 ? 67.936  -92.192  -16.520 1.00 32.39  ? 361 MET A CE   1 
ATOM   5501  H  H    . MET A  1 381 ? 69.456  -96.770  -18.826 1.00 32.50  ? 361 MET A H    1 
ATOM   5502  H  HA   . MET A  1 381 ? 69.932  -94.296  -20.077 1.00 31.00  ? 361 MET A HA   1 
ATOM   5503  H  HB2  . MET A  1 381 ? 68.766  -94.484  -17.953 1.00 29.47  ? 361 MET A HB2  1 
ATOM   5504  H  HB3  . MET A  1 381 ? 70.210  -95.187  -17.183 1.00 31.03  ? 361 MET A HB3  1 
ATOM   5505  H  HG2  . MET A  1 381 ? 71.425  -93.107  -17.432 1.00 33.41  ? 361 MET A HG2  1 
ATOM   5506  H  HG3  . MET A  1 381 ? 70.083  -92.396  -18.364 1.00 32.74  ? 361 MET A HG3  1 
ATOM   5507  H  HE1  . MET A  1 381 ? 67.443  -91.621  -15.734 1.00 32.48  ? 361 MET A HE1  1 
ATOM   5508  H  HE2  . MET A  1 381 ? 67.904  -91.629  -17.453 1.00 31.99  ? 361 MET A HE2  1 
ATOM   5509  H  HE3  . MET A  1 381 ? 67.444  -93.155  -16.641 1.00 30.54  ? 361 MET A HE3  1 
ATOM   5510  N  N    . ASN A  1 382 ? 72.432  -93.909  -20.046 1.00 35.66  ? 362 ASN A N    1 
ATOM   5511  C  CA   . ASN A  1 382 ? 73.872  -93.824  -20.263 1.00 34.58  ? 362 ASN A CA   1 
ATOM   5512  C  C    . ASN A  1 382 ? 74.642  -93.896  -18.964 1.00 34.91  ? 362 ASN A C    1 
ATOM   5513  O  O    . ASN A  1 382 ? 74.158  -93.451  -17.924 1.00 31.09  ? 362 ASN A O    1 
ATOM   5514  C  CB   . ASN A  1 382 ? 74.267  -92.530  -20.998 1.00 37.08  ? 362 ASN A CB   1 
ATOM   5515  C  CG   . ASN A  1 382 ? 74.053  -92.587  -22.485 1.00 41.02  ? 362 ASN A CG   1 
ATOM   5516  O  OD1  . ASN A  1 382 ? 74.253  -93.595  -23.106 1.00 36.79  ? 362 ASN A OD1  1 
ATOM   5517  N  ND2  . ASN A  1 382 ? 73.805  -91.465  -23.113 1.00 30.71  ? 362 ASN A ND2  1 
ATOM   5518  H  H    . ASN A  1 382 ? 71.911  -93.107  -20.386 1.00 37.74  ? 362 ASN A H    1 
ATOM   5519  H  HA   . ASN A  1 382 ? 74.133  -94.686  -20.872 1.00 34.67  ? 362 ASN A HA   1 
ATOM   5520  H  HB2  . ASN A  1 382 ? 73.666  -91.709  -20.612 1.00 37.29  ? 362 ASN A HB2  1 
ATOM   5521  H  HB3  . ASN A  1 382 ? 75.320  -92.317  -20.821 1.00 36.57  ? 362 ASN A HB3  1 
ATOM   5522  H  HD21 . ASN A  1 382 ? 73.659  -91.471  -24.118 1.00 30.24  ? 362 ASN A HD21 1 
ATOM   5523  H  HD22 . ASN A  1 382 ? 73.789  -90.587  -22.607 1.00 30.43  ? 362 ASN A HD22 1 
ATOM   5524  N  N    . PRO A  1 383 ? 75.841  -94.495  -19.021 1.00 33.19  ? 363 PRO A N    1 
ATOM   5525  C  CA   . PRO A  1 383 ? 76.681  -94.541  -17.823 1.00 32.54  ? 363 PRO A CA   1 
ATOM   5526  C  C    . PRO A  1 383 ? 77.288  -93.171  -17.512 1.00 35.94  ? 363 PRO A C    1 
ATOM   5527  O  O    . PRO A  1 383 ? 77.290  -92.282  -18.355 1.00 37.62  ? 363 PRO A O    1 
ATOM   5528  C  CB   . PRO A  1 383 ? 77.747  -95.576  -18.209 1.00 33.65  ? 363 PRO A CB   1 
ATOM   5529  C  CG   . PRO A  1 383 ? 77.923  -95.356  -19.696 1.00 38.07  ? 363 PRO A CG   1 
ATOM   5530  C  CD   . PRO A  1 383 ? 76.541  -95.079  -20.199 1.00 33.23  ? 363 PRO A CD   1 
ATOM   5531  H  HA   . PRO A  1 383 ? 76.120  -94.905  -16.965 1.00 34.37  ? 363 PRO A HA   1 
ATOM   5532  H  HB2  . PRO A  1 383 ? 78.683  -95.389  -17.686 1.00 33.57  ? 363 PRO A HB2  1 
ATOM   5533  H  HB3  . PRO A  1 383 ? 77.359  -96.570  -18.003 1.00 31.83  ? 363 PRO A HB3  1 
ATOM   5534  H  HG2  . PRO A  1 383 ? 78.571  -94.496  -19.859 1.00 37.49  ? 363 PRO A HG2  1 
ATOM   5535  H  HG3  . PRO A  1 383 ? 78.334  -96.251  -20.159 1.00 38.34  ? 363 PRO A HG3  1 
ATOM   5536  H  HD2  . PRO A  1 383 ? 76.583  -94.365  -21.019 1.00 32.90  ? 363 PRO A HD2  1 
ATOM   5537  H  HD3  . PRO A  1 383 ? 76.066  -96.010  -20.504 1.00 31.10  ? 363 PRO A HD3  1 
ATOM   5538  N  N    . THR A  1 384 ? 77.712  -92.983  -16.273 1.00 32.53  ? 364 THR A N    1 
ATOM   5539  C  CA   . THR A  1 384 ? 78.465  -91.831  -15.756 1.00 30.63  ? 364 THR A CA   1 
ATOM   5540  C  C    . THR A  1 384 ? 79.884  -92.343  -15.462 1.00 35.33  ? 364 THR A C    1 
ATOM   5541  O  O    . THR A  1 384 ? 80.035  -93.350  -14.759 1.00 34.60  ? 364 THR A O    1 
ATOM   5542  C  CB   . THR A  1 384 ? 77.778  -91.243  -14.500 1.00 35.88  ? 364 THR A CB   1 
ATOM   5543  O  OG1  . THR A  1 384 ? 76.496  -90.727  -14.855 1.00 34.10  ? 364 THR A OG1  1 
ATOM   5544  C  CG2  . THR A  1 384 ? 78.607  -90.184  -13.815 1.00 36.13  ? 364 THR A CG2  1 
ATOM   5545  H  H    . THR A  1 384 ? 77.502  -93.647  -15.536 1.00 33.47  ? 364 THR A H    1 
ATOM   5546  H  HA   . THR A  1 384 ? 78.510  -91.040  -16.501 1.00 31.95  ? 364 THR A HA   1 
ATOM   5547  H  HB   . THR A  1 384 ? 77.622  -92.044  -13.781 1.00 36.90  ? 364 THR A HB   1 
ATOM   5548  H  HG1  . THR A  1 384 ? 76.591  -89.934  -15.442 1.00 33.95  ? 364 THR A HG1  1 
ATOM   5549  H  HG21 . THR A  1 384 ? 78.054  -89.785  -12.963 1.00 37.32  ? 364 THR A HG21 1 
ATOM   5550  H  HG22 . THR A  1 384 ? 79.562  -90.570  -13.463 1.00 33.57  ? 364 THR A HG22 1 
ATOM   5551  H  HG23 . THR A  1 384 ? 78.786  -89.362  -14.507 1.00 37.32  ? 364 THR A HG23 1 
ATOM   5552  N  N    . THR A  1 385 ? 80.913  -91.688  -15.996 1.00 33.19  ? 365 THR A N    1 
ATOM   5553  C  CA   . THR A  1 385 ? 82.296  -92.121  -15.745 1.00 34.35  ? 365 THR A CA   1 
ATOM   5554  C  C    . THR A  1 385 ? 82.757  -91.930  -14.279 1.00 40.73  ? 365 THR A C    1 
ATOM   5555  O  O    . THR A  1 385 ? 82.559  -90.844  -13.706 1.00 37.96  ? 365 THR A O    1 
ATOM   5556  C  CB   . THR A  1 385 ? 83.271  -91.277  -16.596 1.00 41.97  ? 365 THR A CB   1 
ATOM   5557  O  OG1  . THR A  1 385 ? 82.783  -91.092  -17.925 1.00 39.63  ? 365 THR A OG1  1 
ATOM   5558  C  CG2  . THR A  1 385 ? 84.692  -91.803  -16.584 1.00 43.29  ? 365 THR A CG2  1 
ATOM   5559  H  H    . THR A  1 385 ? 80.831  -90.896  -16.625 1.00 32.22  ? 365 THR A H    1 
ATOM   5560  H  HA   . THR A  1 385 ? 82.387  -93.162  -16.046 1.00 35.05  ? 365 THR A HA   1 
ATOM   5561  H  HB   . THR A  1 385 ? 83.328  -90.295  -16.130 1.00 42.95  ? 365 THR A HB   1 
ATOM   5562  H  HG1  . THR A  1 385 ? 83.192  -90.280  -18.323 1.00 37.87  ? 365 THR A HG1  1 
ATOM   5563  H  HG21 . THR A  1 385 ? 85.304  -91.210  -17.262 1.00 43.97  ? 365 THR A HG21 1 
ATOM   5564  H  HG22 . THR A  1 385 ? 85.121  -91.710  -15.589 1.00 43.25  ? 365 THR A HG22 1 
ATOM   5565  H  HG23 . THR A  1 385 ? 84.722  -92.847  -16.892 1.00 43.87  ? 365 THR A HG23 1 
ATOM   5566  N  N    . PRO A  1 386 ? 83.493  -92.882  -13.671 1.00 38.78  ? 366 PRO A N    1 
ATOM   5567  C  CA   . PRO A  1 386 ? 84.111  -92.559  -12.376 1.00 38.40  ? 366 PRO A CA   1 
ATOM   5568  C  C    . PRO A  1 386 ? 85.366  -91.668  -12.625 1.00 37.77  ? 366 PRO A C    1 
ATOM   5569  O  O    . PRO A  1 386 ? 86.239  -92.068  -13.401 1.00 37.56  ? 366 PRO A O    1 
ATOM   5570  C  CB   . PRO A  1 386 ? 84.470  -93.946  -11.794 1.00 40.77  ? 366 PRO A CB   1 
ATOM   5571  C  CG   . PRO A  1 386 ? 84.255  -94.909  -12.854 1.00 44.89  ? 366 PRO A CG   1 
ATOM   5572  C  CD   . PRO A  1 386 ? 83.922  -94.220  -14.131 1.00 40.17  ? 366 PRO A CD   1 
ATOM   5573  H  HA   . PRO A  1 386 ? 83.406  -92.063  -11.710 1.00 39.03  ? 366 PRO A HA   1 
ATOM   5574  H  HB2  . PRO A  1 386 ? 85.514  -93.958  -11.484 1.00 41.74  ? 366 PRO A HB2  1 
ATOM   5575  H  HB3  . PRO A  1 386 ? 83.821  -94.168  -10.947 1.00 41.49  ? 366 PRO A HB3  1 
ATOM   5576  H  HG2  . PRO A  1 386 ? 85.164  -95.495  -12.979 1.00 46.05  ? 366 PRO A HG2  1 
ATOM   5577  H  HG3  . PRO A  1 386 ? 83.429  -95.556  -12.565 1.00 45.49  ? 366 PRO A HG3  1 
ATOM   5578  H  HD2  . PRO A  1 386 ? 84.802  -94.160  -14.769 1.00 40.08  ? 366 PRO A HD2  1 
ATOM   5579  H  HD3  . PRO A  1 386 ? 83.112  -94.754  -14.624 1.00 39.98  ? 366 PRO A HD3  1 
ATOM   5580  N  N    . ILE A  1 387 ? 85.429  -90.471  -12.034 1.00 30.34  ? 367 ILE A N    1 
ATOM   5581  C  CA   . ILE A  1 387 ? 86.564  -89.541  -12.162 1.00 30.57  ? 367 ILE A CA   1 
ATOM   5582  C  C    . ILE A  1 387 ? 87.362  -89.689  -10.864 1.00 36.50  ? 367 ILE A C    1 
ATOM   5583  O  O    . ILE A  1 387 ? 86.862  -89.476  -9.742  1.00 35.62  ? 367 ILE A O    1 
ATOM   5584  C  CB   . ILE A  1 387 ? 86.134  -88.078  -12.498 1.00 33.42  ? 367 ILE A CB   1 
ATOM   5585  C  CG1  . ILE A  1 387 ? 85.266  -88.069  -13.767 1.00 33.74  ? 367 ILE A CG1  1 
ATOM   5586  C  CG2  . ILE A  1 387 ? 87.379  -87.144  -12.646 1.00 32.19  ? 367 ILE A CG2  1 
ATOM   5587  C  CD1  . ILE A  1 387 ? 84.750  -86.754  -14.212 1.00 36.12  ? 367 ILE A CD1  1 
ATOM   5588  H  H    . ILE A  1 387 ? 84.691  -90.111  -11.437 1.00 31.78  ? 367 ILE A H    1 
ATOM   5589  H  HA   . ILE A  1 387 ? 87.191  -89.854  -12.993 1.00 31.32  ? 367 ILE A HA   1 
ATOM   5590  H  HB   . ILE A  1 387 ? 85.528  -87.704  -11.674 1.00 34.46  ? 367 ILE A HB   1 
ATOM   5591  H  HG12 . ILE A  1 387 ? 85.842  -88.492  -14.588 1.00 33.11  ? 367 ILE A HG12 1 
ATOM   5592  H  HG13 . ILE A  1 387 ? 84.389  -88.686  -13.577 1.00 34.17  ? 367 ILE A HG13 1 
ATOM   5593  H  HG21 . ILE A  1 387 ? 87.083  -86.136  -12.930 1.00 30.75  ? 367 ILE A HG21 1 
ATOM   5594  H  HG22 . ILE A  1 387 ? 87.912  -87.104  -11.697 1.00 30.89  ? 367 ILE A HG22 1 
ATOM   5595  H  HG23 . ILE A  1 387 ? 88.028  -87.558  -13.414 1.00 33.99  ? 367 ILE A HG23 1 
ATOM   5596  H  HD11 . ILE A  1 387 ? 83.953  -86.905  -14.936 1.00 34.99  ? 367 ILE A HD11 1 
ATOM   5597  H  HD12 . ILE A  1 387 ? 84.367  -86.218  -13.345 1.00 36.96  ? 367 ILE A HD12 1 
ATOM   5598  H  HD13 . ILE A  1 387 ? 85.555  -86.186  -14.677 1.00 36.57  ? 367 ILE A HD13 1 
ATOM   5599  N  N    . ILE A  1 388 ? 88.587  -90.154  -11.009 1.00 35.32  ? 368 ILE A N    1 
ATOM   5600  C  CA   . ILE A  1 388 ? 89.395  -90.540  -9.872  1.00 34.97  ? 368 ILE A CA   1 
ATOM   5601  C  C    . ILE A  1 388 ? 90.362  -89.453  -9.567  1.00 36.87  ? 368 ILE A C    1 
ATOM   5602  O  O    . ILE A  1 388 ? 91.186  -89.114  -10.405 1.00 32.38  ? 368 ILE A O    1 
ATOM   5603  C  CB   . ILE A  1 388 ? 90.065  -91.895  -10.185 1.00 38.37  ? 368 ILE A CB   1 
ATOM   5604  C  CG1  . ILE A  1 388 ? 89.016  -92.933  -10.729 1.00 37.14  ? 368 ILE A CG1  1 
ATOM   5605  C  CG2  . ILE A  1 388 ? 90.833  -92.422  -8.965  1.00 37.46  ? 368 ILE A CG2  1 
ATOM   5606  C  CD1  . ILE A  1 388 ? 87.810  -93.158  -9.800  1.00 31.99  ? 368 ILE A CD1  1 
ATOM   5607  H  H    . ILE A  1 388 ? 89.069  -90.244  -11.898 1.00 35.86  ? 368 ILE A H    1 
ATOM   5608  H  HA   . ILE A  1 388 ? 88.771  -90.695  -8.993  1.00 36.01  ? 368 ILE A HA   1 
ATOM   5609  H  HB   . ILE A  1 388 ? 90.794  -91.725  -10.975 1.00 40.17  ? 368 ILE A HB   1 
ATOM   5610  H  HG12 . ILE A  1 388 ? 88.629  -92.607  -11.693 1.00 36.20  ? 368 ILE A HG12 1 
ATOM   5611  H  HG13 . ILE A  1 388 ? 89.519  -93.888  -10.870 1.00 38.09  ? 368 ILE A HG13 1 
ATOM   5612  H  HG21 . ILE A  1 388 ? 91.025  -93.485  -9.098  1.00 37.29  ? 368 ILE A HG21 1 
ATOM   5613  H  HG22 . ILE A  1 388 ? 91.782  -91.893  -8.892  1.00 37.42  ? 368 ILE A HG22 1 
ATOM   5614  H  HG23 . ILE A  1 388 ? 90.239  -92.257  -8.068  1.00 37.80  ? 368 ILE A HG23 1 
ATOM   5615  H  HD11 . ILE A  1 388 ? 87.361  -94.121  -10.040 1.00 31.84  ? 368 ILE A HD11 1 
ATOM   5616  H  HD12 . ILE A  1 388 ? 88.133  -93.145  -8.761  1.00 31.50  ? 368 ILE A HD12 1 
ATOM   5617  H  HD13 . ILE A  1 388 ? 87.077  -92.369  -9.958  1.00 31.33  ? 368 ILE A HD13 1 
ATOM   5618  N  N    . SER A  1 389 ? 90.255  -88.890  -8.347  1.00 36.83  ? 369 SER A N    1 
ATOM   5619  C  CA   . SER A  1 389 ? 91.075  -87.762  -7.927  1.00 36.48  ? 369 SER A CA   1 
ATOM   5620  C  C    . SER A  1 389 ? 91.197  -87.657  -6.404  1.00 37.69  ? 369 SER A C    1 
ATOM   5621  O  O    . SER A  1 389 ? 90.268  -88.008  -5.711  1.00 33.26  ? 369 SER A O    1 
ATOM   5622  C  CB   . SER A  1 389 ? 90.441  -86.482  -8.443  1.00 38.02  ? 369 SER A CB   1 
ATOM   5623  O  OG   . SER A  1 389 ? 91.292  -85.370  -8.265  1.00 49.25  ? 369 SER A OG   1 
ATOM   5624  H  H    . SER A  1 389 ? 89.601  -89.184  -7.625  1.00 37.70  ? 369 SER A H    1 
ATOM   5625  H  HA   . SER A  1 389 ? 92.074  -87.858  -8.347  1.00 37.23  ? 369 SER A HA   1 
ATOM   5626  H  HB2  . SER A  1 389 ? 90.209  -86.599  -9.500  1.00 38.26  ? 369 SER A HB2  1 
ATOM   5627  H  HB3  . SER A  1 389 ? 89.521  -86.310  -7.888  1.00 37.56  ? 369 SER A HB3  1 
ATOM   5628  H  HG   . SER A  1 389 ? 90.787  -84.534  -8.446  1.00 49.53  ? 369 SER A HG   1 
ATOM   5629  N  N    . GLY A  1 390 ? 92.306  -87.085  -5.941  1.00 36.27  ? 370 GLY A N    1 
ATOM   5630  C  CA   . GLY A  1 390 ? 92.541  -86.803  -4.533  1.00 36.72  ? 370 GLY A CA   1 
ATOM   5631  C  C    . GLY A  1 390 ? 93.787  -87.465  -3.979  1.00 41.59  ? 370 GLY A C    1 
ATOM   5632  O  O    . GLY A  1 390 ? 93.725  -88.561  -3.397  1.00 40.52  ? 370 GLY A O    1 
ATOM   5633  H  H    . GLY A  1 390 ? 93.083  -86.807  -6.535  1.00 36.28  ? 370 GLY A H    1 
ATOM   5634  H  HA2  . GLY A  1 390 ? 92.652  -85.728  -4.416  1.00 34.87  ? 370 GLY A HA2  1 
ATOM   5635  H  HA3  . GLY A  1 390 ? 91.694  -87.125  -3.929  1.00 37.07  ? 370 GLY A HA3  1 
ATOM   5636  N  N    . GLY A  1 391 ? 94.915  -86.775  -4.114  1.00 36.99  ? 371 GLY A N    1 
ATOM   5637  C  CA   . GLY A  1 391 ? 96.194  -87.283  -3.643  1.00 37.88  ? 371 GLY A CA   1 
ATOM   5638  C  C    . GLY A  1 391 ? 96.718  -88.479  -4.419  1.00 41.39  ? 371 GLY A C    1 
ATOM   5639  O  O    . GLY A  1 391 ? 97.535  -89.235  -3.895  1.00 43.73  ? 371 GLY A O    1 
ATOM   5640  H  H    . GLY A  1 391 ? 94.978  -85.869  -4.560  1.00 36.60  ? 371 GLY A H    1 
ATOM   5641  H  HA2  . GLY A  1 391 ? 96.935  -86.487  -3.695  1.00 36.66  ? 371 GLY A HA2  1 
ATOM   5642  H  HA3  . GLY A  1 391 ? 96.098  -87.592  -2.603  1.00 38.78  ? 371 GLY A HA3  1 
ATOM   5643  N  N    . MET A  1 392 ? 96.262  -88.686  -5.667  1.00 38.05  ? 372 MET A N    1 
ATOM   5644  C  CA   . MET A  1 392 ? 96.773  -89.795  -6.472  1.00 38.19  ? 372 MET A CA   1 
ATOM   5645  C  C    . MET A  1 392 ? 98.104  -89.423  -7.116  1.00 42.50  ? 372 MET A C    1 
ATOM   5646  O  O    . MET A  1 392 ? 98.403  -88.255  -7.359  1.00 39.59  ? 372 MET A O    1 
ATOM   5647  C  CB   . MET A  1 392 ? 95.782  -90.221  -7.562  1.00 40.50  ? 372 MET A CB   1 
ATOM   5648  C  CG   . MET A  1 392 ? 94.513  -90.817  -7.005  1.00 45.53  ? 372 MET A CG   1 
ATOM   5649  S  SD   . MET A  1 392 ? 94.798  -92.310  -5.992  1.00 52.20  ? 372 MET A SD   1 
ATOM   5650  C  CE   . MET A  1 392 ? 95.409  -93.444  -7.254  1.00 47.86  ? 372 MET A CE   1 
ATOM   5651  H  H    . MET A  1 392 ? 95.572  -88.116  -6.146  1.00 38.45  ? 372 MET A H    1 
ATOM   5652  H  HA   . MET A  1 392 ? 96.942  -90.659  -5.833  1.00 38.34  ? 372 MET A HA   1 
ATOM   5653  H  HB2  . MET A  1 392 ? 95.517  -89.350  -8.160  1.00 40.48  ? 372 MET A HB2  1 
ATOM   5654  H  HB3  . MET A  1 392 ? 96.255  -90.960  -8.207  1.00 39.74  ? 372 MET A HB3  1 
ATOM   5655  H  HG2  . MET A  1 392 ? 94.022  -90.061  -6.396  1.00 45.07  ? 372 MET A HG2  1 
ATOM   5656  H  HG3  . MET A  1 392 ? 93.862  -91.097  -7.834  1.00 46.46  ? 372 MET A HG3  1 
ATOM   5657  H  HE1  . MET A  1 392 ? 95.306  -94.463  -6.889  1.00 48.43  ? 372 MET A HE1  1 
ATOM   5658  H  HE2  . MET A  1 392 ? 94.817  -93.314  -8.158  1.00 47.45  ? 372 MET A HE2  1 
ATOM   5659  H  HE3  . MET A  1 392 ? 96.453  -93.214  -7.459  1.00 46.88  ? 372 MET A HE3  1 
ATOM   5660  N  N    . ASN A  1 393 ? 98.904  -90.446  -7.386  1.00 40.71  ? 373 ASN A N    1 
ATOM   5661  C  CA   . ASN A  1 393 ? 100.146 -90.301  -8.100  1.00 40.35  ? 373 ASN A CA   1 
ATOM   5662  C  C    . ASN A  1 393 ? 100.452 -91.650  -8.729  1.00 42.58  ? 373 ASN A C    1 
ATOM   5663  O  O    . ASN A  1 393 ? 99.721  -92.615  -8.499  1.00 42.35  ? 373 ASN A O    1 
ATOM   5664  C  CB   . ASN A  1 393 ? 101.262 -89.758  -7.202  1.00 37.10  ? 373 ASN A CB   1 
ATOM   5665  C  CG   . ASN A  1 393 ? 101.618 -90.619  -6.034  1.00 44.68  ? 373 ASN A CG   1 
ATOM   5666  O  OD1  . ASN A  1 393 ? 101.786 -91.823  -6.169  1.00 38.92  ? 373 ASN A OD1  1 
ATOM   5667  N  ND2  . ASN A  1 393 ? 101.808 -90.009  -4.862  1.00 31.89  ? 373 ASN A ND2  1 
ATOM   5668  H  H    . ASN A  1 393 ? 98.706  -91.399  -7.098  1.00 41.02  ? 373 ASN A H    1 
ATOM   5669  H  HA   . ASN A  1 393 ? 100.015 -89.598  -8.922  1.00 40.53  ? 373 ASN A HA   1 
ATOM   5670  H  HB2  . ASN A  1 393 ? 102.162 -89.652  -7.806  1.00 38.55  ? 373 ASN A HB2  1 
ATOM   5671  H  HB3  . ASN A  1 393 ? 100.963 -88.775  -6.843  1.00 35.33  ? 373 ASN A HB3  1 
ATOM   5672  H  HD21 . ASN A  1 393 ? 102.077 -90.559  -4.054  1.00 33.01  ? 373 ASN A HD21 1 
ATOM   5673  H  HD22 . ASN A  1 393 ? 101.738 -88.999  -4.782  1.00 32.28  ? 373 ASN A HD22 1 
ATOM   5674  N  N    . ALA A  1 394 ? 101.506 -91.714  -9.515  1.00 38.92  ? 374 ALA A N    1 
ATOM   5675  C  CA   . ALA A  1 394 ? 101.915 -92.938  -10.224 1.00 38.98  ? 374 ALA A CA   1 
ATOM   5676  C  C    . ALA A  1 394 ? 102.075 -94.151  -9.296  1.00 42.63  ? 374 ALA A C    1 
ATOM   5677  O  O    . ALA A  1 394 ? 101.648 -95.247  -9.656  1.00 42.52  ? 374 ALA A O    1 
ATOM   5678  C  CB   . ALA A  1 394 ? 103.221 -92.693  -10.959 1.00 39.60  ? 374 ALA A CB   1 
ATOM   5679  H  H    . ALA A  1 394 ? 102.106 -90.917  -9.705  1.00 39.17  ? 374 ALA A H    1 
ATOM   5680  H  HA   . ALA A  1 394 ? 101.171 -93.189  -10.980 1.00 38.64  ? 374 ALA A HA   1 
ATOM   5681  H  HB1  . ALA A  1 394 ? 103.540 -93.627  -11.415 1.00 40.10  ? 374 ALA A HB1  1 
ATOM   5682  H  HB2  . ALA A  1 394 ? 103.053 -91.943  -11.729 1.00 39.14  ? 374 ALA A HB2  1 
ATOM   5683  H  HB3  . ALA A  1 394 ? 103.974 -92.350  -10.251 1.00 39.36  ? 374 ALA A HB3  1 
ATOM   5684  N  N    . LEU A  1 395 ? 102.605 -93.940  -8.095  1.00 39.84  ? 375 LEU A N    1 
ATOM   5685  C  CA   . LEU A  1 395 ? 102.897 -95.017  -7.135  1.00 40.87  ? 375 LEU A CA   1 
ATOM   5686  C  C    . LEU A  1 395 ? 101.638 -95.669  -6.557  1.00 45.37  ? 375 LEU A C    1 
ATOM   5687  O  O    . LEU A  1 395 ? 101.664 -96.870  -6.261  1.00 47.08  ? 375 LEU A O    1 
ATOM   5688  C  CB   . LEU A  1 395 ? 103.750 -94.476  -5.959  1.00 41.58  ? 375 LEU A CB   1 
ATOM   5689  C  CG   . LEU A  1 395 ? 105.006 -93.699  -6.325  1.00 47.56  ? 375 LEU A CG   1 
ATOM   5690  C  CD1  . LEU A  1 395 ? 105.685 -93.200  -5.095  1.00 50.48  ? 375 LEU A CD1  1 
ATOM   5691  C  CD2  . LEU A  1 395 ? 105.934 -94.541  -7.159  1.00 51.67  ? 375 LEU A CD2  1 
ATOM   5692  H  H    . LEU A  1 395 ? 102.775 -93.010  -7.729  1.00 39.37  ? 375 LEU A H    1 
ATOM   5693  H  HA   . LEU A  1 395 ? 103.467 -95.800  -7.632  1.00 39.41  ? 375 LEU A HA   1 
ATOM   5694  H  HB2  . LEU A  1 395 ? 103.123 -93.823  -5.355  1.00 41.46  ? 375 LEU A HB2  1 
ATOM   5695  H  HB3  . LEU A  1 395 ? 104.064 -95.312  -5.338  1.00 41.49  ? 375 LEU A HB3  1 
ATOM   5696  H  HG   . LEU A  1 395 ? 104.750 -92.819  -6.911  1.00 46.99  ? 375 LEU A HG   1 
ATOM   5697  H  HD11 . LEU A  1 395 ? 106.509 -92.545  -5.374  1.00 50.91  ? 375 LEU A HD11 1 
ATOM   5698  H  HD12 . LEU A  1 395 ? 104.964 -92.648  -4.495  1.00 49.99  ? 375 LEU A HD12 1 
ATOM   5699  H  HD13 . LEU A  1 395 ? 106.058 -94.055  -4.532  1.00 51.65  ? 375 LEU A HD13 1 
ATOM   5700  H  HD21 . LEU A  1 395 ? 106.884 -94.018  -7.251  1.00 52.68  ? 375 LEU A HD21 1 
ATOM   5701  H  HD22 . LEU A  1 395 ? 106.074 -95.507  -6.677  1.00 51.06  ? 375 LEU A HD22 1 
ATOM   5702  H  HD23 . LEU A  1 395 ? 105.500 -94.671  -8.150  1.00 51.81  ? 375 LEU A HD23 1 
ATOM   5703  N  N    . ARG A  1 396 ? 100.572 -94.891  -6.367  1.00 38.31  ? 376 ARG A N    1 
ATOM   5704  C  CA   . ARG A  1 396 ? 99.323  -95.359  -5.765  1.00 36.70  ? 376 ARG A CA   1 
ATOM   5705  C  C    . ARG A  1 396 ? 98.357  -95.969  -6.767  1.00 39.35  ? 376 ARG A C    1 
ATOM   5706  O  O    . ARG A  1 396 ? 97.392  -96.608  -6.363  1.00 38.95  ? 376 ARG A O    1 
ATOM   5707  C  CB   . ARG A  1 396 ? 98.631  -94.176  -5.059  1.00 38.09  ? 376 ARG A CB   1 
ATOM   5708  C  CG   . ARG A  1 396 ? 99.410  -93.623  -3.868  1.00 41.62  ? 376 ARG A CG   1 
ATOM   5709  C  CD   . ARG A  1 396 ? 98.927  -92.257  -3.466  1.00 37.92  ? 376 ARG A CD   1 
ATOM   5710  N  NE   . ARG A  1 396 ? 99.562  -91.783  -2.230  1.00 41.16  ? 376 ARG A NE   1 
ATOM   5711  C  CZ   . ARG A  1 396 ? 99.060  -91.879  -0.998  1.00 52.91  ? 376 ARG A CZ   1 
ATOM   5712  N  NH1  . ARG A  1 396 ? 97.872  -92.438  -0.795  1.00 46.16  ? 376 ARG A NH1  1 
ATOM   5713  N  NH2  . ARG A  1 396 ? 99.732  -91.399  0.040   1.00 35.59  ? 376 ARG A NH2  1 
ATOM   5714  H  H    . ARG A  1 396 ? 100.549 -93.906  -6.615  1.00 38.61  ? 376 ARG A H    1 
ATOM   5715  H  HA   . ARG A  1 396 ? 99.543  -96.105  -5.004  1.00 36.11  ? 376 ARG A HA   1 
ATOM   5716  H  HB2  . ARG A  1 396 ? 98.488  -93.361  -5.768  1.00 37.97  ? 376 ARG A HB2  1 
ATOM   5717  H  HB3  . ARG A  1 396 ? 97.662  -94.511  -4.695  1.00 38.56  ? 376 ARG A HB3  1 
ATOM   5718  H  HG2  . ARG A  1 396 ? 99.286  -94.286  -3.014  1.00 43.59  ? 376 ARG A HG2  1 
ATOM   5719  H  HG3  . ARG A  1 396 ? 100.467 -93.544  -4.116  1.00 41.93  ? 376 ARG A HG3  1 
ATOM   5720  H  HD2  . ARG A  1 396 ? 99.235  -91.570  -4.253  1.00 39.51  ? 376 ARG A HD2  1 
ATOM   5721  H  HD3  . ARG A  1 396 ? 97.842  -92.230  -3.402  1.00 36.97  ? 376 ARG A HD3  1 
ATOM   5722  H  HE   . ARG A  1 396 ? 100.442 -91.291  -2.340  1.00 41.00  ? 376 ARG A HE   1 
ATOM   5723  H  HH11 . ARG A  1 396 ? 97.336  -92.861  -1.542  1.00 45.83  ? 376 ARG A HH11 1 
ATOM   5724  H  HH12 . ARG A  1 396 ? 97.528  -92.523  0.156   1.00 47.06  ? 376 ARG A HH12 1 
ATOM   5725  H  HH21 . ARG A  1 396 ? 100.608 -90.906  -0.093  1.00 35.63  ? 376 ARG A HH21 1 
ATOM   5726  H  HH22 . ARG A  1 396 ? 99.340  -91.453  0.975   1.00 35.77  ? 376 ARG A HH22 1 
ATOM   5727  N  N    . MET A  1 397 ? 98.605  -95.790  -8.065  1.00 37.59  ? 377 MET A N    1 
ATOM   5728  C  CA   . MET A  1 397 ? 97.675  -96.259  -9.112  1.00 36.99  ? 377 MET A CA   1 
ATOM   5729  C  C    . MET A  1 397 ? 97.543  -97.777  -9.273  1.00 40.43  ? 377 MET A C    1 
ATOM   5730  O  O    . MET A  1 397 ? 96.406  -98.240  -9.412  1.00 38.48  ? 377 MET A O    1 
ATOM   5731  C  CB   . MET A  1 397 ? 98.033  -95.635  -10.459 1.00 38.54  ? 377 MET A CB   1 
ATOM   5732  C  CG   . MET A  1 397 ? 97.610  -94.187  -10.522 1.00 40.06  ? 377 MET A CG   1 
ATOM   5733  S  SD   . MET A  1 397 ? 98.378  -93.321  -11.909 1.00 44.25  ? 377 MET A SD   1 
ATOM   5734  C  CE   . MET A  1 397 ? 97.623  -94.213  -13.252 1.00 40.92  ? 377 MET A CE   1 
ATOM   5735  H  H    . MET A  1 397 ? 99.431  -95.328  -8.428  1.00 36.88  ? 377 MET A H    1 
ATOM   5736  H  HA   . MET A  1 397 ? 96.687  -95.880  -8.851  1.00 37.70  ? 377 MET A HA   1 
ATOM   5737  H  HB2  . MET A  1 397 ? 99.109  -95.673  -10.626 1.00 39.11  ? 377 MET A HB2  1 
ATOM   5738  H  HB3  . MET A  1 397 ? 97.516  -96.169  -11.255 1.00 37.61  ? 377 MET A HB3  1 
ATOM   5739  H  HG2  . MET A  1 397 ? 96.533  -94.189  -10.663 1.00 38.10  ? 377 MET A HG2  1 
ATOM   5740  H  HG3  . MET A  1 397 ? 97.852  -93.681  -9.589  1.00 39.63  ? 377 MET A HG3  1 
ATOM   5741  H  HE1  . MET A  1 397 ? 97.668  -93.570  -14.128 1.00 42.13  ? 377 MET A HE1  1 
ATOM   5742  H  HE2  . MET A  1 397 ? 98.171  -95.136  -13.438 1.00 39.79  ? 377 MET A HE2  1 
ATOM   5743  H  HE3  . MET A  1 397 ? 96.583  -94.437  -13.017 1.00 40.12  ? 377 MET A HE3  1 
ATOM   5744  N  N    . PRO A  1 398 ? 98.615  -98.595  -9.259  1.00 39.90  ? 378 PRO A N    1 
ATOM   5745  C  CA   . PRO A  1 398 ? 98.418  -100.056 -9.441  1.00 41.06  ? 378 PRO A CA   1 
ATOM   5746  C  C    . PRO A  1 398 ? 97.494  -100.703 -8.406  1.00 44.01  ? 378 PRO A C    1 
ATOM   5747  O  O    . PRO A  1 398 ? 96.650  -101.532 -8.792  1.00 40.77  ? 378 PRO A O    1 
ATOM   5748  C  CB   . PRO A  1 398 ? 99.838  -100.611 -9.325  1.00 43.74  ? 378 PRO A CB   1 
ATOM   5749  C  CG   . PRO A  1 398 ? 100.709 -99.477  -9.749  1.00 46.65  ? 378 PRO A CG   1 
ATOM   5750  C  CD   . PRO A  1 398 ? 100.048 -98.268  -9.153  1.00 40.74  ? 378 PRO A CD   1 
ATOM   5751  H  HA   . PRO A  1 398 ? 98.021  -100.274 -10.432 1.00 40.88  ? 378 PRO A HA   1 
ATOM   5752  H  HB2  . PRO A  1 398 ? 100.045 -100.889 -8.292  1.00 42.89  ? 378 PRO A HB2  1 
ATOM   5753  H  HB3  . PRO A  1 398 ? 99.946  -101.464 -9.993  1.00 44.47  ? 378 PRO A HB3  1 
ATOM   5754  H  HG2  . PRO A  1 398 ? 101.709 -99.608  -9.340  1.00 47.19  ? 378 PRO A HG2  1 
ATOM   5755  H  HG3  . PRO A  1 398 ? 100.724 -99.419  -10.837 1.00 45.91  ? 378 PRO A HG3  1 
ATOM   5756  H  HD2  . PRO A  1 398 ? 100.341 -98.146  -8.113  1.00 40.87  ? 378 PRO A HD2  1 
ATOM   5757  H  HD3  . PRO A  1 398 ? 100.279 -97.390  -9.749  1.00 40.68  ? 378 PRO A HD3  1 
ATOM   5758  N  N    . GLY A  1 399 ? 97.640  -100.300 -7.128  1.00 41.18  ? 379 GLY A N    1 
ATOM   5759  C  CA   . GLY A  1 399 ? 96.783  -100.772 -6.048  1.00 40.15  ? 379 GLY A CA   1 
ATOM   5760  C  C    . GLY A  1 399 ? 95.344  -100.336 -6.257  1.00 42.75  ? 379 GLY A C    1 
ATOM   5761  O  O    . GLY A  1 399 ? 94.411  -101.130 -6.038  1.00 41.82  ? 379 GLY A O    1 
ATOM   5762  H  H    . GLY A  1 399 ? 98.360  -99.662  -6.807  1.00 41.10  ? 379 GLY A H    1 
ATOM   5763  H  HA2  . GLY A  1 399 ? 96.817  -101.860 -6.004  1.00 39.64  ? 379 GLY A HA2  1 
ATOM   5764  H  HA3  . GLY A  1 399 ? 97.136  -100.376 -5.097  1.00 41.09  ? 379 GLY A HA3  1 
ATOM   5765  N  N    . PHE A  1 400 ? 95.155  -99.089  -6.754  1.00 36.36  ? 380 PHE A N    1 
ATOM   5766  C  CA   . PHE A  1 400 ? 93.807  -98.563  -7.013  1.00 34.53  ? 380 PHE A CA   1 
ATOM   5767  C  C    . PHE A  1 400 ? 93.107  -99.414  -8.110  1.00 39.79  ? 380 PHE A C    1 
ATOM   5768  O  O    . PHE A  1 400 ? 91.931  -99.771  -7.950  1.00 38.43  ? 380 PHE A O    1 
ATOM   5769  C  CB   . PHE A  1 400 ? 93.830  -97.048  -7.385  1.00 34.62  ? 380 PHE A CB   1 
ATOM   5770  C  CG   . PHE A  1 400 ? 92.492  -96.569  -7.899  1.00 34.76  ? 380 PHE A CG   1 
ATOM   5771  C  CD1  . PHE A  1 400 ? 91.521  -96.105  -7.018  1.00 37.12  ? 380 PHE A CD1  1 
ATOM   5772  C  CD2  . PHE A  1 400 ? 92.135  -96.761  -9.234  1.00 34.37  ? 380 PHE A CD2  1 
ATOM   5773  C  CE1  . PHE A  1 400 ? 90.238  -95.792  -7.470  1.00 37.27  ? 380 PHE A CE1  1 
ATOM   5774  C  CE2  . PHE A  1 400 ? 90.832  -96.543  -9.667  1.00 36.73  ? 380 PHE A CE2  1 
ATOM   5775  C  CZ   . PHE A  1 400 ? 89.896  -96.030  -8.800  1.00 36.19  ? 380 PHE A CZ   1 
ATOM   5776  H  H    . PHE A  1 400 ? 95.903  -98.434  -6.959  1.00 35.25  ? 380 PHE A H    1 
ATOM   5777  H  HA   . PHE A  1 400 ? 93.215  -98.666  -6.106  1.00 35.03  ? 380 PHE A HA   1 
ATOM   5778  H  HB2  . PHE A  1 400 ? 94.061  -96.467  -6.493  1.00 33.23  ? 380 PHE A HB2  1 
ATOM   5779  H  HB3  . PHE A  1 400 ? 94.577  -96.858  -8.153  1.00 34.33  ? 380 PHE A HB3  1 
ATOM   5780  H  HD1  . PHE A  1 400 ? 91.781  -95.962  -5.971  1.00 36.94  ? 380 PHE A HD1  1 
ATOM   5781  H  HD2  . PHE A  1 400 ? 92.852  -97.208  -9.920  1.00 33.59  ? 380 PHE A HD2  1 
ATOM   5782  H  HE1  . PHE A  1 400 ? 89.498  -95.395  -6.777  1.00 35.75  ? 380 PHE A HE1  1 
ATOM   5783  H  HE2  . PHE A  1 400 ? 90.582  -96.672  -10.719 1.00 35.96  ? 380 PHE A HE2  1 
ATOM   5784  H  HZ   . PHE A  1 400 ? 88.908  -95.760  -9.170  1.00 35.64  ? 380 PHE A HZ   1 
ATOM   5785  N  N    . PHE A  1 401 ? 93.813  -99.720  -9.226  1.00 36.88  ? 381 PHE A N    1 
ATOM   5786  C  CA   . PHE A  1 401 ? 93.173  -100.479 -10.306 1.00 37.37  ? 381 PHE A CA   1 
ATOM   5787  C  C    . PHE A  1 401 ? 92.962  -101.946 -9.923  1.00 42.12  ? 381 PHE A C    1 
ATOM   5788  O  O    . PHE A  1 401 ? 91.993  -102.555 -10.404 1.00 41.89  ? 381 PHE A O    1 
ATOM   5789  C  CB   . PHE A  1 401 ? 93.982  -100.397 -11.593 1.00 39.34  ? 381 PHE A CB   1 
ATOM   5790  C  CG   . PHE A  1 401 ? 94.130  -99.020  -12.180 1.00 39.58  ? 381 PHE A CG   1 
ATOM   5791  C  CD1  . PHE A  1 401 ? 93.017  -98.316  -12.619 1.00 44.25  ? 381 PHE A CD1  1 
ATOM   5792  C  CD2  . PHE A  1 401 ? 95.381  -98.513  -12.484 1.00 40.32  ? 381 PHE A CD2  1 
ATOM   5793  C  CE1  . PHE A  1 401 ? 93.152  -97.089  -13.261 1.00 45.17  ? 381 PHE A CE1  1 
ATOM   5794  C  CE2  . PHE A  1 401 ? 95.515  -97.300  -13.155 1.00 44.34  ? 381 PHE A CE2  1 
ATOM   5795  C  CZ   . PHE A  1 401 ? 94.402  -96.596  -13.542 1.00 42.70  ? 381 PHE A CZ   1 
ATOM   5796  H  H    . PHE A  1 401 ? 94.783  -99.471  -9.390  1.00 35.45  ? 381 PHE A H    1 
ATOM   5797  H  HA   . PHE A  1 401 ? 92.193  -100.054 -10.517 1.00 35.89  ? 381 PHE A HA   1 
ATOM   5798  H  HB2  . PHE A  1 401 ? 94.975  -100.802 -11.404 1.00 40.04  ? 381 PHE A HB2  1 
ATOM   5799  H  HB3  . PHE A  1 401 ? 93.462  -101.004 -12.333 1.00 39.31  ? 381 PHE A HB3  1 
ATOM   5800  H  HD1  . PHE A  1 401 ? 92.019  -98.693  -12.401 1.00 44.51  ? 381 PHE A HD1  1 
ATOM   5801  H  HD2  . PHE A  1 401 ? 96.273  -99.083  -12.229 1.00 40.15  ? 381 PHE A HD2  1 
ATOM   5802  H  HE1  . PHE A  1 401 ? 92.263  -96.531  -13.551 1.00 44.90  ? 381 PHE A HE1  1 
ATOM   5803  H  HE2  . PHE A  1 401 ? 96.505  -96.896  -13.360 1.00 45.55  ? 381 PHE A HE2  1 
ATOM   5804  H  HZ   . PHE A  1 401 ? 94.510  -95.620  -14.012 1.00 42.14  ? 381 PHE A HZ   1 
ATOM   5805  N  N    . ASP A  1 402 ? 93.853  -102.528 -9.095  1.00 39.19  ? 382 ASP A N    1 
ATOM   5806  C  CA   . ASP A  1 402 ? 93.650  -103.896 -8.598  1.00 40.40  ? 382 ASP A CA   1 
ATOM   5807  C  C    . ASP A  1 402 ? 92.325  -104.025 -7.850  1.00 42.60  ? 382 ASP A C    1 
ATOM   5808  O  O    . ASP A  1 402 ? 91.607  -105.017 -8.035  1.00 40.88  ? 382 ASP A O    1 
ATOM   5809  C  CB   . ASP A  1 402 ? 94.790  -104.346 -7.656  1.00 43.07  ? 382 ASP A CB   1 
ATOM   5810  C  CG   . ASP A  1 402 ? 96.088  -104.729 -8.322  1.00 54.86  ? 382 ASP A CG   1 
ATOM   5811  O  OD1  . ASP A  1 402 ? 96.056  -105.100 -9.528  1.00 57.96  ? 382 ASP A OD1  1 
ATOM   5812  O  OD2  . ASP A  1 402 ? 97.139  -104.716 -7.624  1.00 59.90  ? 382 ASP A OD2  1 
ATOM   5813  H  H    . ASP A  1 402 ? 94.716  -102.101 -8.780  1.00 38.33  ? 382 ASP A H    1 
ATOM   5814  H  HA   . ASP A  1 402 ? 93.597  -104.572 -9.450  1.00 41.12  ? 382 ASP A HA   1 
ATOM   5815  H  HB2  . ASP A  1 402 ? 95.005  -103.537 -6.960  1.00 43.83  ? 382 ASP A HB2  1 
ATOM   5816  H  HB3  . ASP A  1 402 ? 94.456  -105.221 -7.100  1.00 43.33  ? 382 ASP A HB3  1 
ATOM   5817  N  N    . ASN A  1 403 ? 91.989  -103.017 -7.034  1.00 40.41  ? 383 ASN A N    1 
ATOM   5818  C  CA   . ASN A  1 403 ? 90.742  -103.008 -6.272  1.00 40.16  ? 383 ASN A CA   1 
ATOM   5819  C  C    . ASN A  1 403 ? 89.522  -102.746 -7.178  1.00 45.40  ? 383 ASN A C    1 
ATOM   5820  O  O    . ASN A  1 403 ? 88.498  -103.392 -6.980  1.00 43.63  ? 383 ASN A O    1 
ATOM   5821  C  CB   . ASN A  1 403 ? 90.806  -101.966 -5.141  1.00 43.17  ? 383 ASN A CB   1 
ATOM   5822  C  CG   . ASN A  1 403 ? 89.543  -101.898 -4.323  1.00 53.05  ? 383 ASN A CG   1 
ATOM   5823  O  OD1  . ASN A  1 403 ? 89.149  -102.876 -3.697  1.00 45.54  ? 383 ASN A OD1  1 
ATOM   5824  N  ND2  . ASN A  1 403 ? 88.832  -100.785 -4.368  1.00 41.14  ? 383 ASN A ND2  1 
ATOM   5825  H  H    . ASN A  1 403 ? 92.575  -102.204 -6.867  1.00 40.93  ? 383 ASN A H    1 
ATOM   5826  H  HA   . ASN A  1 403 ? 90.608  -103.982 -5.807  1.00 39.54  ? 383 ASN A HA   1 
ATOM   5827  H  HB2  . ASN A  1 403 ? 91.614  -102.239 -4.464  1.00 43.62  ? 383 ASN A HB2  1 
ATOM   5828  H  HB3  . ASN A  1 403 ? 91.016  -100.988 -5.569  1.00 43.42  ? 383 ASN A HB3  1 
ATOM   5829  H  HD21 . ASN A  1 403 ? 87.974  -100.719 -3.829  1.00 40.91  ? 383 ASN A HD21 1 
ATOM   5830  H  HD22 . ASN A  1 403 ? 89.128  -99.997  -4.935  1.00 40.65  ? 383 ASN A HD22 1 
ATOM   5831  N  N    . LEU A  1 404 ? 89.605  -101.817 -8.169  1.00 43.69  ? 384 LEU A N    1 
ATOM   5832  C  CA   . LEU A  1 404 ? 88.445  -101.530 -9.021  1.00 41.39  ? 384 LEU A CA   1 
ATOM   5833  C  C    . LEU A  1 404 ? 88.271  -102.634 -10.090 1.00 41.69  ? 384 LEU A C    1 
ATOM   5834  O  O    . LEU A  1 404 ? 87.140  -103.075 -10.309 1.00 40.22  ? 384 LEU A O    1 
ATOM   5835  C  CB   . LEU A  1 404 ? 88.538  -100.115 -9.669  1.00 40.20  ? 384 LEU A CB   1 
ATOM   5836  C  CG   . LEU A  1 404 ? 87.407  -99.736  -10.670 1.00 43.50  ? 384 LEU A CG   1 
ATOM   5837  C  CD1  . LEU A  1 404 ? 86.037  -99.582  -9.956  1.00 41.92  ? 384 LEU A CD1  1 
ATOM   5838  C  CD2  . LEU A  1 404 ? 87.779  -98.462  -11.494 1.00 48.87  ? 384 LEU A CD2  1 
ATOM   5839  H  H    . LEU A  1 404 ? 90.433  -101.277 -8.400  1.00 44.10  ? 384 LEU A H    1 
ATOM   5840  H  HA   . LEU A  1 404 ? 87.547  -101.534 -8.403  1.00 41.07  ? 384 LEU A HA   1 
ATOM   5841  H  HB2  . LEU A  1 404 ? 88.535  -99.368  -8.876  1.00 38.65  ? 384 LEU A HB2  1 
ATOM   5842  H  HB3  . LEU A  1 404 ? 89.481  -100.055 -10.210 1.00 41.05  ? 384 LEU A HB3  1 
ATOM   5843  H  HG   . LEU A  1 404 ? 87.290  -100.534 -11.401 1.00 42.84  ? 384 LEU A HG   1 
ATOM   5844  H  HD11 . LEU A  1 404 ? 85.301  -99.218  -10.671 1.00 41.18  ? 384 LEU A HD11 1 
ATOM   5845  H  HD12 . LEU A  1 404 ? 85.715  -100.547 -9.568  1.00 42.28  ? 384 LEU A HD12 1 
ATOM   5846  H  HD13 . LEU A  1 404 ? 86.141  -98.879  -9.131  1.00 41.55  ? 384 LEU A HD13 1 
ATOM   5847  H  HD21 . LEU A  1 404 ? 86.933  -98.169  -12.115 1.00 47.53  ? 384 LEU A HD21 1 
ATOM   5848  H  HD22 . LEU A  1 404 ? 88.031  -97.656  -10.807 1.00 49.49  ? 384 LEU A HD22 1 
ATOM   5849  H  HD23 . LEU A  1 404 ? 88.637  -98.685  -12.127 1.00 48.36  ? 384 LEU A HD23 1 
ATOM   5850  N  N    . GLY A  1 405 ? 89.346  -103.024 -10.771 1.00 37.79  ? 385 GLY A N    1 
ATOM   5851  C  CA   . GLY A  1 405 ? 89.286  -104.065 -11.801 1.00 38.15  ? 385 GLY A CA   1 
ATOM   5852  C  C    . GLY A  1 405 ? 89.325  -103.590 -13.244 1.00 41.55  ? 385 GLY A C    1 
ATOM   5853  O  O    . GLY A  1 405 ? 89.350  -104.405 -14.171 1.00 39.27  ? 385 GLY A O    1 
ATOM   5854  H  H    . GLY A  1 405 ? 90.279  -102.651 -10.641 1.00 36.92  ? 385 GLY A H    1 
ATOM   5855  H  HA2  . GLY A  1 405 ? 90.138  -104.725 -11.654 1.00 37.74  ? 385 GLY A HA2  1 
ATOM   5856  H  HA3  . GLY A  1 405 ? 88.393  -104.675 -11.669 1.00 39.25  ? 385 GLY A HA3  1 
ATOM   5857  N  N    . HIS A  1 406 ? 89.336  -102.273 -13.490 1.00 40.43  ? 386 HIS A N    1 
ATOM   5858  C  CA   . HIS A  1 406 ? 89.483  -101.792 -14.898 1.00 38.30  ? 386 HIS A CA   1 
ATOM   5859  C  C    . HIS A  1 406 ? 90.084  -100.412 -14.856 1.00 39.79  ? 386 HIS A C    1 
ATOM   5860  O  O    . HIS A  1 406 ? 90.239  -99.853  -13.778 1.00 39.78  ? 386 HIS A O    1 
ATOM   5861  C  CB   . HIS A  1 406 ? 88.153  -101.815 -15.659 1.00 37.41  ? 386 HIS A CB   1 
ATOM   5862  C  CG   . HIS A  1 406 ? 87.198  -100.776 -15.177 1.00 39.18  ? 386 HIS A CG   1 
ATOM   5863  N  ND1  . HIS A  1 406 ? 87.119  -99.530  -15.783 1.00 40.70  ? 386 HIS A ND1  1 
ATOM   5864  C  CD2  . HIS A  1 406 ? 86.361  -100.803 -14.121 1.00 40.00  ? 386 HIS A CD2  1 
ATOM   5865  C  CE1  . HIS A  1 406 ? 86.230  -98.846  -15.077 1.00 39.57  ? 386 HIS A CE1  1 
ATOM   5866  N  NE2  . HIS A  1 406 ? 85.761  -99.570  -14.057 1.00 39.33  ? 386 HIS A NE2  1 
ATOM   5867  H  H    . HIS A  1 406 ? 89.233  -101.541 -12.794 1.00 39.79  ? 386 HIS A H    1 
ATOM   5868  H  HA   . HIS A  1 406 ? 90.166  -102.421 -15.466 1.00 37.44  ? 386 HIS A HA   1 
ATOM   5869  H  HB2  . HIS A  1 406 ? 88.350  -101.651 -16.717 1.00 37.23  ? 386 HIS A HB2  1 
ATOM   5870  H  HB3  . HIS A  1 406 ? 87.684  -102.789 -15.528 1.00 38.42  ? 386 HIS A HB3  1 
ATOM   5871  H  HD2  . HIS A  1 406 ? 86.183  -101.645 -13.457 1.00 40.00  ? 386 HIS A HD2  1 
ATOM   5872  H  HE1  . HIS A  1 406 ? 85.917  -97.827  -15.304 1.00 38.12  ? 386 HIS A HE1  1 
ATOM   5873  H  HE2  . HIS A  1 406 ? 85.090  -99.267  -13.360 1.00 39.52  ? 386 HIS A HE2  1 
ATOM   5874  N  N    . SER A  1 407 ? 90.398  -99.868  -16.022 1.00 35.04  ? 387 SER A N    1 
ATOM   5875  C  CA   . SER A  1 407 ? 90.963  -98.544  -16.188 1.00 33.62  ? 387 SER A CA   1 
ATOM   5876  C  C    . SER A  1 407 ? 90.178  -97.750  -17.247 1.00 37.50  ? 387 SER A C    1 
ATOM   5877  O  O    . SER A  1 407 ? 90.728  -96.807  -17.764 1.00 37.58  ? 387 SER A O    1 
ATOM   5878  C  CB   . SER A  1 407 ? 92.435  -98.647  -16.576 1.00 32.55  ? 387 SER A CB   1 
ATOM   5879  O  OG   . SER A  1 407 ? 92.517  -99.184  -17.874 1.00 38.86  ? 387 SER A OG   1 
ATOM   5880  H  H    . SER A  1 407 ? 90.274  -100.346 -16.909 1.00 36.64  ? 387 SER A H    1 
ATOM   5881  H  HA   . SER A  1 407 ? 90.900  -97.977  -15.260 1.00 33.52  ? 387 SER A HA   1 
ATOM   5882  H  HB2  . SER A  1 407 ? 92.897  -97.662  -16.568 1.00 32.58  ? 387 SER A HB2  1 
ATOM   5883  H  HB3  . SER A  1 407 ? 92.954  -99.311  -15.886 1.00 32.54  ? 387 SER A HB3  1 
ATOM   5884  H  HG   . SER A  1 407 ? 93.432  -99.534  -18.032 1.00 39.83  ? 387 SER A HG   1 
ATOM   5885  N  N    . ASN A  1 408 ? 88.892  -98.055  -17.492 1.00 32.34  ? 388 ASN A N    1 
ATOM   5886  C  CA   . ASN A  1 408 ? 88.061  -97.285  -18.422 1.00 32.45  ? 388 ASN A CA   1 
ATOM   5887  C  C    . ASN A  1 408 ? 87.474  -96.072  -17.666 1.00 37.40  ? 388 ASN A C    1 
ATOM   5888  O  O    . ASN A  1 408 ? 86.283  -96.024  -17.305 1.00 33.06  ? 388 ASN A O    1 
ATOM   5889  C  CB   . ASN A  1 408 ? 86.964  -98.186  -18.993 1.00 32.55  ? 388 ASN A CB   1 
ATOM   5890  C  CG   . ASN A  1 408 ? 87.497  -99.248  -19.925 1.00 46.34  ? 388 ASN A CG   1 
ATOM   5891  O  OD1  . ASN A  1 408 ? 88.461  -99.035  -20.660 1.00 38.39  ? 388 ASN A OD1  1 
ATOM   5892  N  ND2  . ASN A  1 408 ? 86.859  -100.406 -19.955 1.00 47.92  ? 388 ASN A ND2  1 
ATOM   5893  H  H    . ASN A  1 408 ? 88.394  -98.820  -17.047 1.00 31.34  ? 388 ASN A H    1 
ATOM   5894  H  HA   . ASN A  1 408 ? 88.655  -96.891  -19.244 1.00 30.19  ? 388 ASN A HA   1 
ATOM   5895  H  HB2  . ASN A  1 408 ? 86.434  -98.663  -18.171 1.00 30.54  ? 388 ASN A HB2  1 
ATOM   5896  H  HB3  . ASN A  1 408 ? 86.272  -97.561  -19.555 1.00 32.77  ? 388 ASN A HB3  1 
ATOM   5897  H  HD21 . ASN A  1 408 ? 87.188  -101.149 -20.564 1.00 48.52  ? 388 ASN A HD21 1 
ATOM   5898  H  HD22 . ASN A  1 408 ? 86.048  -100.566 -19.366 1.00 48.68  ? 388 ASN A HD22 1 
ATOM   5899  N  N    . LEU A  1 409 ? 88.338  -95.081  -17.438 1.00 34.19  ? 389 LEU A N    1 
ATOM   5900  C  CA   . LEU A  1 409 ? 87.984  -93.926  -16.647 1.00 31.91  ? 389 LEU A CA   1 
ATOM   5901  C  C    . LEU A  1 409 ? 88.978  -92.764  -16.804 1.00 34.90  ? 389 LEU A C    1 
ATOM   5902  O  O    . LEU A  1 409 ? 90.034  -92.920  -17.404 1.00 33.98  ? 389 LEU A O    1 
ATOM   5903  C  CB   . LEU A  1 409 ? 87.966  -94.400  -15.161 1.00 30.42  ? 389 LEU A CB   1 
ATOM   5904  C  CG   . LEU A  1 409 ? 89.250  -95.067  -14.661 1.00 34.13  ? 389 LEU A CG   1 
ATOM   5905  C  CD1  . LEU A  1 409 ? 90.316  -94.023  -14.128 1.00 31.69  ? 389 LEU A CD1  1 
ATOM   5906  C  CD2  . LEU A  1 409 ? 88.949  -96.082  -13.571 1.00 34.85  ? 389 LEU A CD2  1 
ATOM   5907  H  H    . LEU A  1 409 ? 89.287  -95.063  -17.798 1.00 35.55  ? 389 LEU A H    1 
ATOM   5908  H  HA   . LEU A  1 409 ? 86.997  -93.562  -16.930 1.00 31.88  ? 389 LEU A HA   1 
ATOM   5909  H  HB2  . LEU A  1 409 ? 87.786  -93.547  -14.511 1.00 30.56  ? 389 LEU A HB2  1 
ATOM   5910  H  HB3  . LEU A  1 409 ? 87.147  -95.104  -15.026 1.00 29.57  ? 389 LEU A HB3  1 
ATOM   5911  H  HG   . LEU A  1 409 ? 89.727  -95.607  -15.476 1.00 34.47  ? 389 LEU A HG   1 
ATOM   5912  H  HD11 . LEU A  1 409 ? 90.948  -94.498  -13.379 1.00 30.82  ? 389 LEU A HD11 1 
ATOM   5913  H  HD12 . LEU A  1 409 ? 90.937  -93.697  -14.960 1.00 31.26  ? 389 LEU A HD12 1 
ATOM   5914  H  HD13 . LEU A  1 409 ? 89.812  -93.169  -13.679 1.00 32.16  ? 389 LEU A HD13 1 
ATOM   5915  H  HD21 . LEU A  1 409 ? 89.867  -96.632  -13.369 1.00 34.15  ? 389 LEU A HD21 1 
ATOM   5916  H  HD22 . LEU A  1 409 ? 88.614  -95.560  -12.675 1.00 33.25  ? 389 LEU A HD22 1 
ATOM   5917  H  HD23 . LEU A  1 409 ? 88.177  -96.766  -13.917 1.00 35.81  ? 389 LEU A HD23 1 
ATOM   5918  N  N    . ILE A  1 410 ? 88.651  -91.633  -16.181 1.00 33.22  ? 390 ILE A N    1 
ATOM   5919  C  CA   . ILE A  1 410 ? 89.504  -90.459  -16.128 1.00 34.86  ? 390 ILE A CA   1 
ATOM   5920  C  C    . ILE A  1 410 ? 90.124  -90.439  -14.751 1.00 40.46  ? 390 ILE A C    1 
ATOM   5921  O  O    . ILE A  1 410 ? 89.384  -90.566  -13.764 1.00 41.40  ? 390 ILE A O    1 
ATOM   5922  C  CB   . ILE A  1 410 ? 88.646  -89.179  -16.359 1.00 38.84  ? 390 ILE A CB   1 
ATOM   5923  C  CG1  . ILE A  1 410 ? 87.936  -89.190  -17.729 1.00 39.36  ? 390 ILE A CG1  1 
ATOM   5924  C  CG2  . ILE A  1 410 ? 89.455  -87.868  -16.111 1.00 38.51  ? 390 ILE A CG2  1 
ATOM   5925  C  CD1  . ILE A  1 410 ? 86.697  -88.215  -17.787 1.00 28.85  ? 390 ILE A CD1  1 
ATOM   5926  H  H    . ILE A  1 410 ? 87.768  -91.497  -15.700 1.00 31.38  ? 390 ILE A H    1 
ATOM   5927  H  HA   . ILE A  1 410 ? 90.296  -90.485  -16.873 1.00 35.13  ? 390 ILE A HA   1 
ATOM   5928  H  HB   . ILE A  1 410 ? 87.864  -89.201  -15.601 1.00 39.79  ? 390 ILE A HB   1 
ATOM   5929  H  HG12 . ILE A  1 410 ? 88.648  -88.889  -18.496 1.00 39.98  ? 390 ILE A HG12 1 
ATOM   5930  H  HG13 . ILE A  1 410 ? 87.564  -90.189  -17.947 1.00 39.80  ? 390 ILE A HG13 1 
ATOM   5931  H  HG21 . ILE A  1 410 ? 88.864  -87.013  -16.438 1.00 37.35  ? 390 ILE A HG21 1 
ATOM   5932  H  HG22 . ILE A  1 410 ? 89.685  -87.750  -15.053 1.00 37.26  ? 390 ILE A HG22 1 
ATOM   5933  H  HG23 . ILE A  1 410 ? 90.383  -87.927  -16.679 1.00 39.85  ? 390 ILE A HG23 1 
ATOM   5934  H  HD11 . ILE A  1 410 ? 85.873  -88.731  -18.275 1.00 28.23  ? 390 ILE A HD11 1 
ATOM   5935  H  HD12 . ILE A  1 410 ? 86.411  -87.918  -16.780 1.00 28.94  ? 390 ILE A HD12 1 
ATOM   5936  H  HD13 . ILE A  1 410 ? 86.976  -87.336  -18.364 1.00 27.95  ? 390 ILE A HD13 1 
ATOM   5937  N  N    . MET A  1 411 ? 91.431  -90.213  -14.648 1.00 35.32  ? 391 MET A N    1 
ATOM   5938  C  CA   . MET A  1 411 ? 92.050  -90.030  -13.327 1.00 35.42  ? 391 MET A CA   1 
ATOM   5939  C  C    . MET A  1 411 ? 92.840  -88.756  -13.383 1.00 41.26  ? 391 MET A C    1 
ATOM   5940  O  O    . MET A  1 411 ? 93.567  -88.529  -14.365 1.00 40.85  ? 391 MET A O    1 
ATOM   5941  C  CB   . MET A  1 411 ? 92.916  -91.209  -12.901 1.00 37.39  ? 391 MET A CB   1 
ATOM   5942  C  CG   . MET A  1 411 ? 93.688  -90.964  -11.595 1.00 42.75  ? 391 MET A CG   1 
ATOM   5943  S  SD   . MET A  1 411 ? 94.772  -92.255  -10.941 1.00 48.55  ? 391 MET A SD   1 
ATOM   5944  C  CE   . MET A  1 411 ? 93.735  -93.711  -11.105 1.00 43.26  ? 391 MET A CE   1 
ATOM   5945  H  H    . MET A  1 411 ? 92.076  -90.158  -15.429 1.00 34.92  ? 391 MET A H    1 
ATOM   5946  H  HA   . MET A  1 411 ? 91.271  -89.918  -12.577 1.00 35.06  ? 391 MET A HA   1 
ATOM   5947  H  HB2  . MET A  1 411 ? 92.278  -92.083  -12.798 1.00 35.25  ? 391 MET A HB2  1 
ATOM   5948  H  HB3  . MET A  1 411 ? 93.669  -91.339  -13.674 1.00 38.05  ? 391 MET A HB3  1 
ATOM   5949  H  HG2  . MET A  1 411 ? 94.337  -90.100  -11.732 1.00 42.46  ? 391 MET A HG2  1 
ATOM   5950  H  HG3  . MET A  1 411 ? 92.970  -90.758  -10.805 1.00 44.32  ? 391 MET A HG3  1 
ATOM   5951  H  HE1  . MET A  1 411 ? 94.213  -94.550  -10.604 1.00 42.71  ? 391 MET A HE1  1 
ATOM   5952  H  HE2  . MET A  1 411 ? 92.770  -93.503  -10.649 1.00 42.97  ? 391 MET A HE2  1 
ATOM   5953  H  HE3  . MET A  1 411 ? 93.606  -93.934  -12.163 1.00 42.51  ? 391 MET A HE3  1 
ATOM   5954  N  N    . THR A  1 412 ? 92.659  -87.880  -12.381 1.00 39.24  ? 392 THR A N    1 
ATOM   5955  C  CA   . THR A  1 412 ? 93.359  -86.605  -12.363 1.00 38.95  ? 392 THR A CA   1 
ATOM   5956  C  C    . THR A  1 412 ? 94.275  -86.588  -11.155 1.00 41.84  ? 392 THR A C    1 
ATOM   5957  O  O    . THR A  1 412 ? 93.872  -87.009  -10.069 1.00 44.27  ? 392 THR A O    1 
ATOM   5958  C  CB   . THR A  1 412 ? 92.431  -85.399  -12.451 1.00 39.09  ? 392 THR A CB   1 
ATOM   5959  O  OG1  . THR A  1 412 ? 91.475  -85.429  -11.415 1.00 34.67  ? 392 THR A OG1  1 
ATOM   5960  C  CG2  . THR A  1 412 ? 91.747  -85.282  -13.808 1.00 47.72  ? 392 THR A CG2  1 
ATOM   5961  H  H    . THR A  1 412 ? 92.070  -88.032  -11.568 1.00 40.09  ? 392 THR A H    1 
ATOM   5962  H  HA   . THR A  1 412 ? 93.982  -86.523  -13.248 1.00 40.48  ? 392 THR A HA   1 
ATOM   5963  H  HB   . THR A  1 412 ? 93.051  -84.514  -12.326 1.00 38.84  ? 392 THR A HB   1 
ATOM   5964  H  HG1  . THR A  1 412 ? 90.613  -85.790  -11.751 1.00 34.06  ? 392 THR A HG1  1 
ATOM   5965  H  HG21 . THR A  1 412 ? 91.044  -84.452  -13.811 1.00 48.19  ? 392 THR A HG21 1 
ATOM   5966  H  HG22 . THR A  1 412 ? 92.487  -85.106  -14.588 1.00 47.44  ? 392 THR A HG22 1 
ATOM   5967  H  HG23 . THR A  1 412 ? 91.200  -86.198  -14.029 1.00 49.09  ? 392 THR A HG23 1 
ATOM   5968  N  N    . ALA A  1 413 ? 95.544  -86.232  -11.389 1.00 35.89  ? 393 ALA A N    1 
ATOM   5969  C  CA   . ALA A  1 413 ? 96.555  -86.108  -10.350 1.00 37.06  ? 393 ALA A CA   1 
ATOM   5970  C  C    . ALA A  1 413 ? 97.218  -84.730  -10.449 1.00 43.56  ? 393 ALA A C    1 
ATOM   5971  O  O    . ALA A  1 413 ? 98.034  -84.503  -11.350 1.00 46.52  ? 393 ALA A O    1 
ATOM   5972  C  CB   . ALA A  1 413 ? 97.584  -87.222  -10.492 1.00 37.95  ? 393 ALA A CB   1 
ATOM   5973  H  H    . ALA A  1 413 ? 95.941  -86.104  -12.315 1.00 34.84  ? 393 ALA A H    1 
ATOM   5974  H  HA   . ALA A  1 413 ? 96.113  -86.195  -9.360  1.00 37.77  ? 393 ALA A HA   1 
ATOM   5975  H  HB1  . ALA A  1 413 ? 98.346  -87.088  -9.728  1.00 38.35  ? 393 ALA A HB1  1 
ATOM   5976  H  HB2  . ALA A  1 413 ? 97.093  -88.185  -10.362 1.00 37.42  ? 393 ALA A HB2  1 
ATOM   5977  H  HB3  . ALA A  1 413 ? 98.037  -87.173  -11.481 1.00 38.65  ? 393 ALA A HB3  1 
ATOM   5978  N  N    . GLY A  1 414 ? 96.791  -83.807  -9.586  1.00 39.44  ? 394 GLY A N    1 
ATOM   5979  C  CA   . GLY A  1 414 ? 97.305  -82.442  -9.511  1.00 38.14  ? 394 GLY A CA   1 
ATOM   5980  C  C    . GLY A  1 414 ? 98.712  -82.457  -8.950  1.00 41.12  ? 394 GLY A C    1 
ATOM   5981  O  O    . GLY A  1 414 ? 99.680  -82.242  -9.681  1.00 40.78  ? 394 GLY A O    1 
ATOM   5982  H  H    . GLY A  1 414 ? 96.073  -83.980  -8.890  1.00 39.77  ? 394 GLY A H    1 
ATOM   5983  H  HA2  . GLY A  1 414 ? 97.324  -81.975  -10.494 1.00 37.86  ? 394 GLY A HA2  1 
ATOM   5984  H  HA3  . GLY A  1 414 ? 96.662  -81.846  -8.866  1.00 37.30  ? 394 GLY A HA3  1 
ATOM   5985  N  N    . GLY A  1 415 ? 98.815  -82.701  -7.644  1.00 36.20  ? 395 GLY A N    1 
ATOM   5986  C  CA   . GLY A  1 415 ? 100.090 -82.856  -6.948  1.00 35.45  ? 395 GLY A CA   1 
ATOM   5987  C  C    . GLY A  1 415 ? 100.946 -83.965  -7.542  1.00 39.75  ? 395 GLY A C    1 
ATOM   5988  O  O    . GLY A  1 415 ? 102.168 -83.818  -7.659  1.00 39.13  ? 395 GLY A O    1 
ATOM   5989  H  H    . GLY A  1 415 ? 98.013  -82.739  -7.023  1.00 35.24  ? 395 GLY A H    1 
ATOM   5990  H  HA2  . GLY A  1 415 ? 100.654 -81.926  -6.980  1.00 35.32  ? 395 GLY A HA2  1 
ATOM   5991  H  HA3  . GLY A  1 415 ? 99.892  -83.091  -5.903  1.00 35.49  ? 395 GLY A HA3  1 
ATOM   5992  N  N    . GLY A  1 416 ? 100.306 -85.069  -7.945  1.00 37.01  ? 396 GLY A N    1 
ATOM   5993  C  CA   . GLY A  1 416 ? 100.987 -86.209  -8.564  1.00 38.08  ? 396 GLY A CA   1 
ATOM   5994  C  C    . GLY A  1 416 ? 101.701 -85.933  -9.873  1.00 40.35  ? 396 GLY A C    1 
ATOM   5995  O  O    . GLY A  1 416 ? 102.617 -86.677  -10.231 1.00 39.70  ? 396 GLY A O    1 
ATOM   5996  H  H    . GLY A  1 416 ? 99.310  -85.227  -7.833  1.00 36.44  ? 396 GLY A H    1 
ATOM   5997  H  HA2  . GLY A  1 416 ? 101.722 -86.597  -7.862  1.00 38.15  ? 396 GLY A HA2  1 
ATOM   5998  H  HA3  . GLY A  1 416 ? 100.269 -87.006  -8.747  1.00 39.19  ? 396 GLY A HA3  1 
ATOM   5999  N  N    . ALA A  1 417 ? 101.274 -84.892  -10.609 1.00 39.57  ? 397 ALA A N    1 
ATOM   6000  C  CA   . ALA A  1 417 ? 101.889 -84.480  -11.894 1.00 37.87  ? 397 ALA A CA   1 
ATOM   6001  C  C    . ALA A  1 417 ? 102.803 -83.281  -11.703 1.00 41.79  ? 397 ALA A C    1 
ATOM   6002  O  O    . ALA A  1 417 ? 103.944 -83.299  -12.164 1.00 40.49  ? 397 ALA A O    1 
ATOM   6003  C  CB   . ALA A  1 417 ? 100.822 -84.139  -12.913 1.00 37.12  ? 397 ALA A CB   1 
ATOM   6004  H  H    . ALA A  1 417 ? 100.468 -84.320  -10.377 1.00 41.17  ? 397 ALA A H    1 
ATOM   6005  H  HA   . ALA A  1 417 ? 102.479 -85.302  -12.294 1.00 38.65  ? 397 ALA A HA   1 
ATOM   6006  H  HB1  . ALA A  1 417 ? 101.299 -83.996  -13.881 1.00 37.76  ? 397 ALA A HB1  1 
ATOM   6007  H  HB2  . ALA A  1 417 ? 100.105 -84.957  -12.965 1.00 37.28  ? 397 ALA A HB2  1 
ATOM   6008  H  HB3  . ALA A  1 417 ? 100.328 -83.216  -12.615 1.00 36.70  ? 397 ALA A HB3  1 
ATOM   6009  N  N    . PHE A  1 418 ? 102.308 -82.233  -11.024 1.00 39.89  ? 398 PHE A N    1 
ATOM   6010  C  CA   . PHE A  1 418 ? 103.070 -80.989  -10.855 1.00 39.97  ? 398 PHE A CA   1 
ATOM   6011  C  C    . PHE A  1 418 ? 104.046 -81.052  -9.674  1.00 41.94  ? 398 PHE A C    1 
ATOM   6012  O  O    . PHE A  1 418 ? 104.836 -80.116  -9.500  1.00 39.98  ? 398 PHE A O    1 
ATOM   6013  C  CB   . PHE A  1 418 ? 102.127 -79.769  -10.763 1.00 40.92  ? 398 PHE A CB   1 
ATOM   6014  C  CG   . PHE A  1 418 ? 101.428 -79.525  -12.076 1.00 40.69  ? 398 PHE A CG   1 
ATOM   6015  C  CD1  . PHE A  1 418 ? 102.145 -79.115  -13.195 1.00 44.33  ? 398 PHE A CD1  1 
ATOM   6016  C  CD2  . PHE A  1 418 ? 100.077 -79.828  -12.233 1.00 42.22  ? 398 PHE A CD2  1 
ATOM   6017  C  CE1  . PHE A  1 418 ? 101.516 -78.966  -14.432 1.00 44.20  ? 398 PHE A CE1  1 
ATOM   6018  C  CE2  . PHE A  1 418 ? 99.441  -79.642  -13.463 1.00 45.53  ? 398 PHE A CE2  1 
ATOM   6019  C  CZ   . PHE A  1 418 ? 100.165 -79.215  -14.553 1.00 43.85  ? 398 PHE A CZ   1 
ATOM   6020  H  H    . PHE A  1 418 ? 101.389 -82.207  -10.595 1.00 39.68  ? 398 PHE A H    1 
ATOM   6021  H  HA   . PHE A  1 418 ? 103.687 -80.834  -11.740 1.00 40.60  ? 398 PHE A HA   1 
ATOM   6022  H  HB2  . PHE A  1 418 ? 101.379 -79.942  -9.990  1.00 40.58  ? 398 PHE A HB2  1 
ATOM   6023  H  HB3  . PHE A  1 418 ? 102.708 -78.878  -10.530 1.00 41.57  ? 398 PHE A HB3  1 
ATOM   6024  H  HD1  . PHE A  1 418 ? 103.215 -78.927  -13.116 1.00 45.09  ? 398 PHE A HD1  1 
ATOM   6025  H  HD2  . PHE A  1 418 ? 99.493  -80.162  -11.378 1.00 42.32  ? 398 PHE A HD2  1 
ATOM   6026  H  HE1  . PHE A  1 418 ? 102.085 -78.613  -15.292 1.00 44.67  ? 398 PHE A HE1  1 
ATOM   6027  H  HE2  . PHE A  1 418 ? 98.379  -79.851  -13.576 1.00 45.16  ? 398 PHE A HE2  1 
ATOM   6028  H  HZ   . PHE A  1 418 ? 99.670  -79.079  -15.513 1.00 44.58  ? 398 PHE A HZ   1 
ATOM   6029  N  N    . GLY A  1 419 ? 104.023 -82.153  -8.928  1.00 39.50  ? 399 GLY A N    1 
ATOM   6030  C  CA   . GLY A  1 419 ? 104.977 -82.444  -7.863  1.00 40.31  ? 399 GLY A CA   1 
ATOM   6031  C  C    . GLY A  1 419 ? 106.030 -83.424  -8.334  1.00 45.39  ? 399 GLY A C    1 
ATOM   6032  O  O    . GLY A  1 419 ? 106.907 -83.794  -7.556  1.00 45.41  ? 399 GLY A O    1 
ATOM   6033  H  H    . GLY A  1 419 ? 103.295 -82.860  -8.960  1.00 40.00  ? 399 GLY A H    1 
ATOM   6034  H  HA2  . GLY A  1 419 ? 105.478 -81.536  -7.528  1.00 39.38  ? 399 GLY A HA2  1 
ATOM   6035  H  HA3  . GLY A  1 419 ? 104.466 -82.880  -7.004  1.00 40.45  ? 399 GLY A HA3  1 
ATOM   6036  N  N    . HIS A  1 420 ? 105.950 -83.891  -9.610  1.00 42.26  ? 400 HIS A N    1 
ATOM   6037  C  CA   . HIS A  1 420 ? 106.969 -84.770  -10.183 1.00 41.05  ? 400 HIS A CA   1 
ATOM   6038  C  C    . HIS A  1 420 ? 108.248 -83.928  -10.343 1.00 47.32  ? 400 HIS A C    1 
ATOM   6039  O  O    . HIS A  1 420 ? 108.208 -82.809  -10.866 1.00 47.45  ? 400 HIS A O    1 
ATOM   6040  C  CB   . HIS A  1 420 ? 106.526 -85.376  -11.525 1.00 40.88  ? 400 HIS A CB   1 
ATOM   6041  C  CG   . HIS A  1 420 ? 107.404 -86.490  -12.010 1.00 43.35  ? 400 HIS A CG   1 
ATOM   6042  N  ND1  . HIS A  1 420 ? 108.704 -86.256  -12.467 1.00 44.80  ? 400 HIS A ND1  1 
ATOM   6043  C  CD2  . HIS A  1 420 ? 107.126 -87.807  -12.154 1.00 44.59  ? 400 HIS A CD2  1 
ATOM   6044  C  CE1  . HIS A  1 420 ? 109.173 -87.434  -12.847 1.00 44.06  ? 400 HIS A CE1  1 
ATOM   6045  N  NE2  . HIS A  1 420 ? 108.264 -88.398  -12.677 1.00 44.55  ? 400 HIS A NE2  1 
ATOM   6046  H  H    . HIS A  1 420 ? 105.203 -83.681  -10.263 1.00 42.88  ? 400 HIS A H    1 
ATOM   6047  H  HA   . HIS A  1 420 ? 107.149 -85.590  -9.493  1.00 40.14  ? 400 HIS A HA   1 
ATOM   6048  H  HB2  . HIS A  1 420 ? 105.517 -85.770  -11.410 1.00 41.36  ? 400 HIS A HB2  1 
ATOM   6049  H  HB3  . HIS A  1 420 ? 106.529 -84.593  -12.285 1.00 40.54  ? 400 HIS A HB3  1 
ATOM   6050  H  HD2  . HIS A  1 420 ? 106.188 -88.303  -11.912 1.00 43.58  ? 400 HIS A HD2  1 
ATOM   6051  H  HE1  . HIS A  1 420 ? 110.173 -87.599  -13.240 1.00 43.91  ? 400 HIS A HE1  1 
ATOM   6052  H  HE2  . HIS A  1 420 ? 108.385 -89.381  -12.893 1.00 45.21  ? 400 HIS A HE2  1 
ATOM   6053  N  N    . VAL A  1 421 ? 109.360 -84.460  -9.867  1.00 44.31  ? 401 VAL A N    1 
ATOM   6054  C  CA   . VAL A  1 421 ? 110.658 -83.770  -9.841  1.00 45.81  ? 401 VAL A CA   1 
ATOM   6055  C  C    . VAL A  1 421 ? 111.147 -83.312  -11.233 1.00 47.02  ? 401 VAL A C    1 
ATOM   6056  O  O    . VAL A  1 421 ? 111.837 -82.301  -11.306 1.00 46.04  ? 401 VAL A O    1 
ATOM   6057  C  CB   . VAL A  1 421 ? 111.716 -84.664  -9.128  1.00 51.97  ? 401 VAL A CB   1 
ATOM   6058  C  CG1  . VAL A  1 421 ? 112.080 -85.893  -9.961  1.00 51.63  ? 401 VAL A CG1  1 
ATOM   6059  C  CG2  . VAL A  1 421 ? 112.955 -83.867  -8.762  1.00 53.60  ? 401 VAL A CG2  1 
ATOM   6060  H  H    . VAL A  1 421 ? 109.376 -85.384  -9.450  1.00 44.03  ? 401 VAL A H    1 
ATOM   6061  H  HA   . VAL A  1 421 ? 110.544 -82.867  -9.244  1.00 45.48  ? 401 VAL A HA   1 
ATOM   6062  H  HB   . VAL A  1 421 ? 111.293 -85.014  -8.186  1.00 51.45  ? 401 VAL A HB   1 
ATOM   6063  H  HG11 . VAL A  1 421 ? 112.731 -86.530  -9.364  1.00 52.47  ? 401 VAL A HG11 1 
ATOM   6064  H  HG12 . VAL A  1 421 ? 111.180 -86.445  -10.229 1.00 51.61  ? 401 VAL A HG12 1 
ATOM   6065  H  HG13 . VAL A  1 421 ? 112.602 -85.584  -10.864 1.00 51.31  ? 401 VAL A HG13 1 
ATOM   6066  H  HG21 . VAL A  1 421 ? 113.586 -84.480  -8.121  1.00 54.12  ? 401 VAL A HG21 1 
ATOM   6067  H  HG22 . VAL A  1 421 ? 113.499 -83.606  -9.669  1.00 54.05  ? 401 VAL A HG22 1 
ATOM   6068  H  HG23 . VAL A  1 421 ? 112.649 -82.964  -8.235  1.00 54.15  ? 401 VAL A HG23 1 
ATOM   6069  N  N    . ASP A  1 422 ? 110.779 -84.014  -12.323 1.00 42.48  ? 402 ASP A N    1 
ATOM   6070  C  CA   . ASP A  1 422 ? 111.213 -83.633  -13.682 1.00 41.15  ? 402 ASP A CA   1 
ATOM   6071  C  C    . ASP A  1 422 ? 110.183 -82.795  -14.481 1.00 43.57  ? 402 ASP A C    1 
ATOM   6072  O  O    . ASP A  1 422 ? 110.404 -82.567  -15.678 1.00 43.52  ? 402 ASP A O    1 
ATOM   6073  C  CB   . ASP A  1 422 ? 111.576 -84.902  -14.471 1.00 42.91  ? 402 ASP A CB   1 
ATOM   6074  C  CG   . ASP A  1 422 ? 112.723 -85.654  -13.843 1.00 45.76  ? 402 ASP A CG   1 
ATOM   6075  O  OD1  . ASP A  1 422 ? 113.676 -84.999  -13.367 1.00 45.40  ? 402 ASP A OD1  1 
ATOM   6076  O  OD2  . ASP A  1 422 ? 112.638 -86.896  -13.753 1.00 56.24  ? 402 ASP A OD2  1 
ATOM   6077  H  H    . ASP A  1 422 ? 110.204 -84.850  -12.301 1.00 41.99  ? 402 ASP A H    1 
ATOM   6078  H  HA   . ASP A  1 422 ? 112.117 -83.028  -13.624 1.00 41.43  ? 402 ASP A HA   1 
ATOM   6079  H  HB2  . ASP A  1 422 ? 110.711 -85.563  -14.494 1.00 42.72  ? 402 ASP A HB2  1 
ATOM   6080  H  HB3  . ASP A  1 422 ? 111.867 -84.638  -15.487 1.00 44.14  ? 402 ASP A HB3  1 
ATOM   6081  N  N    . GLY A  1 423 ? 109.117 -82.317  -13.839 1.00 40.72  ? 403 GLY A N    1 
ATOM   6082  C  CA   . GLY A  1 423 ? 108.125 -81.462  -14.486 1.00 39.87  ? 403 GLY A CA   1 
ATOM   6083  C  C    . GLY A  1 423 ? 106.811 -82.118  -14.858 1.00 44.88  ? 403 GLY A C    1 
ATOM   6084  O  O    . GLY A  1 423 ? 106.644 -83.341  -14.732 1.00 44.73  ? 403 GLY A O    1 
ATOM   6085  H  H    . GLY A  1 423 ? 108.886 -82.510  -12.868 1.00 40.94  ? 403 GLY A H    1 
ATOM   6086  H  HA2  . GLY A  1 423 ? 107.881 -80.654  -13.798 1.00 41.02  ? 403 GLY A HA2  1 
ATOM   6087  H  HA3  . GLY A  1 423 ? 108.537 -81.010  -15.386 1.00 39.76  ? 403 GLY A HA3  1 
ATOM   6088  N  N    . GLY A  1 424 ? 105.883 -81.281  -15.331 1.00 42.62  ? 404 GLY A N    1 
ATOM   6089  C  CA   . GLY A  1 424 ? 104.530 -81.688  -15.712 1.00 43.31  ? 404 GLY A CA   1 
ATOM   6090  C  C    . GLY A  1 424 ? 104.446 -82.762  -16.776 1.00 46.87  ? 404 GLY A C    1 
ATOM   6091  O  O    . GLY A  1 424 ? 103.613 -83.661  -16.669 1.00 47.49  ? 404 GLY A O    1 
ATOM   6092  H  H    . GLY A  1 424 ? 106.043 -80.288  -15.466 1.00 41.94  ? 404 GLY A H    1 
ATOM   6093  H  HA2  . GLY A  1 424 ? 104.012 -82.062  -14.829 1.00 43.63  ? 404 GLY A HA2  1 
ATOM   6094  H  HA3  . GLY A  1 424 ? 103.984 -80.819  -16.075 1.00 43.04  ? 404 GLY A HA3  1 
ATOM   6095  N  N    . ALA A  1 425 ? 105.300 -82.680  -17.812 1.00 45.91  ? 405 ALA A N    1 
ATOM   6096  C  CA   . ALA A  1 425 ? 105.299 -83.657  -18.903 1.00 46.09  ? 405 ALA A CA   1 
ATOM   6097  C  C    . ALA A  1 425 ? 105.730 -85.030  -18.383 1.00 47.66  ? 405 ALA A C    1 
ATOM   6098  O  O    . ALA A  1 425 ? 105.079 -86.031  -18.685 1.00 45.23  ? 405 ALA A O    1 
ATOM   6099  C  CB   . ALA A  1 425 ? 106.213 -83.203  -20.030 1.00 47.89  ? 405 ALA A CB   1 
ATOM   6100  H  H    . ALA A  1 425 ? 106.012 -81.961  -17.900 1.00 47.24  ? 405 ALA A H    1 
ATOM   6101  H  HA   . ALA A  1 425 ? 104.289 -83.749  -19.299 1.00 46.14  ? 405 ALA A HA   1 
ATOM   6102  H  HB1  . ALA A  1 425 ? 106.002 -83.805  -20.913 1.00 47.48  ? 405 ALA A HB1  1 
ATOM   6103  H  HB2  . ALA A  1 425 ? 106.040 -82.147  -20.241 1.00 47.93  ? 405 ALA A HB2  1 
ATOM   6104  H  HB3  . ALA A  1 425 ? 107.250 -83.350  -19.733 1.00 49.42  ? 405 ALA A HB3  1 
ATOM   6105  N  N    . ALA A  1 426 ? 106.786 -85.056  -17.539 1.00 43.77  ? 406 ALA A N    1 
ATOM   6106  C  CA   . ALA A  1 426 ? 107.266 -86.285  -16.899 1.00 42.89  ? 406 ALA A CA   1 
ATOM   6107  C  C    . ALA A  1 426 ? 106.217 -86.804  -15.901 1.00 42.10  ? 406 ALA A C    1 
ATOM   6108  O  O    . ALA A  1 426 ? 106.014 -88.003  -15.802 1.00 39.25  ? 406 ALA A O    1 
ATOM   6109  C  CB   . ALA A  1 426 ? 108.601 -86.035  -16.200 1.00 44.14  ? 406 ALA A CB   1 
ATOM   6110  H  H    . ALA A  1 426 ? 107.330 -84.234  -17.299 1.00 43.43  ? 406 ALA A H    1 
ATOM   6111  H  HA   . ALA A  1 426 ? 107.419 -87.041  -17.667 1.00 43.78  ? 406 ALA A HA   1 
ATOM   6112  H  HB1  . ALA A  1 426 ? 108.992 -86.986  -15.841 1.00 44.12  ? 406 ALA A HB1  1 
ATOM   6113  H  HB2  . ALA A  1 426 ? 109.294 -85.587  -16.910 1.00 42.93  ? 406 ALA A HB2  1 
ATOM   6114  H  HB3  . ALA A  1 426 ? 108.437 -85.361  -15.360 1.00 43.95  ? 406 ALA A HB3  1 
ATOM   6115  N  N    . GLY A  1 427 ? 105.557 -85.883  -15.195 1.00 39.51  ? 407 GLY A N    1 
ATOM   6116  C  CA   . GLY A  1 427 ? 104.447 -86.185  -14.297 1.00 39.06  ? 407 GLY A CA   1 
ATOM   6117  C  C    . GLY A  1 427 ? 103.334 -86.917  -15.026 1.00 42.77  ? 407 GLY A C    1 
ATOM   6118  O  O    . GLY A  1 427 ? 102.909 -87.991  -14.601 1.00 41.78  ? 407 GLY A O    1 
ATOM   6119  H  H    . GLY A  1 427 ? 105.793 -84.895  -15.197 1.00 39.38  ? 407 GLY A H    1 
ATOM   6120  H  HA2  . GLY A  1 427 ? 104.789 -86.792  -13.461 1.00 39.67  ? 407 GLY A HA2  1 
ATOM   6121  H  HA3  . GLY A  1 427 ? 104.045 -85.249  -13.914 1.00 38.46  ? 407 GLY A HA3  1 
ATOM   6122  N  N    . ALA A  1 428 ? 102.926 -86.386  -16.193 1.00 39.32  ? 408 ALA A N    1 
ATOM   6123  C  CA   . ALA A  1 428 ? 101.903 -87.012  -17.047 1.00 38.96  ? 408 ALA A CA   1 
ATOM   6124  C  C    . ALA A  1 428 ? 102.334 -88.435  -17.505 1.00 40.79  ? 408 ALA A C    1 
ATOM   6125  O  O    . ALA A  1 428 ? 101.548 -89.373  -17.439 1.00 37.88  ? 408 ALA A O    1 
ATOM   6126  C  CB   . ALA A  1 428 ? 101.649 -86.142  -18.277 1.00 39.97  ? 408 ALA A CB   1 
ATOM   6127  H  H    . ALA A  1 428 ? 103.289 -85.511  -16.554 1.00 38.38  ? 408 ALA A H    1 
ATOM   6128  H  HA   . ALA A  1 428 ? 100.975 -87.099  -16.485 1.00 38.24  ? 408 ALA A HA   1 
ATOM   6129  H  HB1  . ALA A  1 428 ? 100.706 -86.455  -18.721 1.00 39.16  ? 408 ALA A HB1  1 
ATOM   6130  H  HB2  . ALA A  1 428 ? 101.610 -85.091  -17.997 1.00 39.98  ? 408 ALA A HB2  1 
ATOM   6131  H  HB3  . ALA A  1 428 ? 102.459 -86.287  -18.991 1.00 39.07  ? 408 ALA A HB3  1 
ATOM   6132  N  N    . LYS A  1 429 ? 103.576 -88.563  -17.983 1.00 38.05  ? 409 LYS A N    1 
ATOM   6133  C  CA   . LYS A  1 429 ? 104.120 -89.834  -18.454 1.00 39.13  ? 409 LYS A CA   1 
ATOM   6134  C  C    . LYS A  1 429 ? 104.219 -90.877  -17.333 1.00 42.95  ? 409 LYS A C    1 
ATOM   6135  O  O    . LYS A  1 429 ? 104.008 -92.072  -17.601 1.00 41.93  ? 409 LYS A O    1 
ATOM   6136  C  CB   . LYS A  1 429 ? 105.498 -89.634  -19.097 1.00 43.18  ? 409 LYS A CB   1 
ATOM   6137  C  CG   . LYS A  1 429 ? 105.408 -88.940  -20.460 1.00 60.59  ? 409 LYS A CG   1 
ATOM   6138  C  CD   . LYS A  1 429 ? 106.767 -88.596  -21.036 1.00 72.62  ? 409 LYS A CD   1 
ATOM   6139  C  CE   . LYS A  1 429 ? 106.625 -87.775  -22.294 1.00 82.96  ? 409 LYS A CE   1 
ATOM   6140  N  NZ   . LYS A  1 429 ? 107.939 -87.419  -22.873 1.00 92.75  ? 409 LYS A NZ   1 
ATOM   6141  H  H    . LYS A  1 429 ? 104.215 -87.777  -18.075 1.00 38.70  ? 409 LYS A H    1 
ATOM   6142  H  HA   . LYS A  1 429 ? 103.458 -90.233  -19.222 1.00 39.57  ? 409 LYS A HA   1 
ATOM   6143  H  HB2  . LYS A  1 429 ? 106.093 -89.004  -18.441 1.00 42.27  ? 409 LYS A HB2  1 
ATOM   6144  H  HB3  . LYS A  1 429 ? 105.979 -90.601  -19.238 1.00 43.34  ? 409 LYS A HB3  1 
ATOM   6145  H  HG2  . LYS A  1 429 ? 104.902 -89.598  -21.163 1.00 60.11  ? 409 LYS A HG2  1 
ATOM   6146  H  HG3  . LYS A  1 429 ? 104.848 -88.013  -20.351 1.00 59.91  ? 409 LYS A HG3  1 
ATOM   6147  H  HD2  . LYS A  1 429 ? 107.329 -88.011  -20.309 1.00 72.99  ? 409 LYS A HD2  1 
ATOM   6148  H  HD3  . LYS A  1 429 ? 107.300 -89.515  -21.277 1.00 72.81  ? 409 LYS A HD3  1 
ATOM   6149  H  HE2  . LYS A  1 429 ? 106.072 -88.351  -23.034 1.00 82.84  ? 409 LYS A HE2  1 
ATOM   6150  H  HE3  . LYS A  1 429 ? 106.096 -86.851  -22.063 1.00 82.69  ? 409 LYS A HE3  1 
ATOM   6151  H  HZ1  . LYS A  1 429 ? 107.808 -86.878  -23.722 1.00 92.86  ? 409 LYS A HZ1  1 
ATOM   6152  H  HZ2  . LYS A  1 429 ? 108.472 -86.866  -22.209 1.00 92.77  ? 409 LYS A HZ2  1 
ATOM   6153  H  HZ3  . LYS A  1 429 ? 108.457 -88.264  -23.094 1.00 93.05  ? 409 LYS A HZ3  1 
ATOM   6154  N  N    . SER A  1 430 ? 104.498 -90.447  -16.085 1.00 38.78  ? 410 SER A N    1 
ATOM   6155  C  CA   . SER A  1 430 ? 104.566 -91.392  -14.950 1.00 36.38  ? 410 SER A CA   1 
ATOM   6156  C  C    . SER A  1 430 ? 103.181 -92.017  -14.700 1.00 36.09  ? 410 SER A C    1 
ATOM   6157  O  O    . SER A  1 430 ? 103.106 -93.208  -14.400 1.00 33.45  ? 410 SER A O    1 
ATOM   6158  C  CB   . SER A  1 430 ? 105.107 -90.709  -13.697 1.00 39.12  ? 410 SER A CB   1 
ATOM   6159  O  OG   . SER A  1 430 ? 104.174 -89.881  -13.014 1.00 38.83  ? 410 SER A OG   1 
ATOM   6160  H  H    . SER A  1 430 ? 104.690 -89.482  -15.836 1.00 38.22  ? 410 SER A H    1 
ATOM   6161  H  HA   . SER A  1 430 ? 105.254 -92.196  -15.209 1.00 36.90  ? 410 SER A HA   1 
ATOM   6162  H  HB2  . SER A  1 430 ? 105.423 -91.487  -13.005 1.00 40.24  ? 410 SER A HB2  1 
ATOM   6163  H  HB3  . SER A  1 430 ? 105.974 -90.108  -13.972 1.00 39.59  ? 410 SER A HB3  1 
ATOM   6164  H  HG   . SER A  1 430 ? 103.646 -89.351  -13.667 1.00 39.47  ? 410 SER A HG   1 
ATOM   6165  N  N    . LEU A  1 431 ? 102.095 -91.245  -14.907 1.00 34.23  ? 411 LEU A N    1 
ATOM   6166  C  CA   . LEU A  1 431 ? 100.706 -91.711  -14.729 1.00 36.00  ? 411 LEU A CA   1 
ATOM   6167  C  C    . LEU A  1 431 ? 100.337 -92.657  -15.850 1.00 37.90  ? 411 LEU A C    1 
ATOM   6168  O  O    . LEU A  1 431 ? 99.772  -93.710  -15.590 1.00 36.45  ? 411 LEU A O    1 
ATOM   6169  C  CB   . LEU A  1 431 ? 99.714  -90.540  -14.691 1.00 36.77  ? 411 LEU A CB   1 
ATOM   6170  C  CG   . LEU A  1 431 ? 99.981  -89.428  -13.657 1.00 42.44  ? 411 LEU A CG   1 
ATOM   6171  C  CD1  . LEU A  1 431 ? 99.100  -88.219  -13.951 1.00 44.58  ? 411 LEU A CD1  1 
ATOM   6172  C  CD2  . LEU A  1 431 ? 99.808  -89.916  -12.239 1.00 40.65  ? 411 LEU A CD2  1 
ATOM   6173  H  H    . LEU A  1 431 ? 102.145 -90.283  -15.225 1.00 34.51  ? 411 LEU A H    1 
ATOM   6174  H  HA   . LEU A  1 431 ? 100.627 -92.252  -13.785 1.00 36.52  ? 411 LEU A HA   1 
ATOM   6175  H  HB2  . LEU A  1 431 ? 99.702  -90.079  -15.676 1.00 36.10  ? 411 LEU A HB2  1 
ATOM   6176  H  HB3  . LEU A  1 431 ? 98.729  -90.946  -14.468 1.00 37.26  ? 411 LEU A HB3  1 
ATOM   6177  H  HG   . LEU A  1 431 ? 101.013 -89.095  -13.737 1.00 42.87  ? 411 LEU A HG   1 
ATOM   6178  H  HD11 . LEU A  1 431 ? 99.392  -87.398  -13.298 1.00 44.70  ? 411 LEU A HD11 1 
ATOM   6179  H  HD12 . LEU A  1 431 ? 99.236  -87.918  -14.990 1.00 44.52  ? 411 LEU A HD12 1 
ATOM   6180  H  HD13 . LEU A  1 431 ? 98.059  -88.487  -13.775 1.00 44.75  ? 411 LEU A HD13 1 
ATOM   6181  H  HD21 . LEU A  1 431 ? 99.975  -89.082  -11.559 1.00 40.77  ? 411 LEU A HD21 1 
ATOM   6182  H  HD22 . LEU A  1 431 ? 98.795  -90.294  -12.111 1.00 40.21  ? 411 LEU A HD22 1 
ATOM   6183  H  HD23 . LEU A  1 431 ? 100.534 -90.702  -12.038 1.00 40.18  ? 411 LEU A HD23 1 
ATOM   6184  N  N    . ARG A  1 432 ? 100.721 -92.315  -17.097 1.00 35.58  ? 412 ARG A N    1 
ATOM   6185  C  CA   . ARG A  1 432 ? 100.528 -93.185  -18.275 1.00 34.01  ? 412 ARG A CA   1 
ATOM   6186  C  C    . ARG A  1 432 ? 101.203 -94.530  -18.043 1.00 38.38  ? 412 ARG A C    1 
ATOM   6187  O  O    . ARG A  1 432 ? 100.602 -95.585  -18.276 1.00 35.96  ? 412 ARG A O    1 
ATOM   6188  C  CB   . ARG A  1 432 ? 101.127 -92.502  -19.535 1.00 32.02  ? 412 ARG A CB   1 
ATOM   6189  C  CG   . ARG A  1 432 ? 101.000 -93.296  -20.843 1.00 34.46  ? 412 ARG A CG   1 
ATOM   6190  C  CD   . ARG A  1 432 ? 99.709  -92.993  -21.548 1.00 40.56  ? 412 ARG A CD   1 
ATOM   6191  N  NE   . ARG A  1 432 ? 99.681  -91.603  -22.013 1.00 44.74  ? 412 ARG A NE   1 
ATOM   6192  C  CZ   . ARG A  1 432 ? 98.580  -90.927  -22.320 1.00 56.39  ? 412 ARG A CZ   1 
ATOM   6193  N  NH1  . ARG A  1 432 ? 97.389  -91.519  -22.263 1.00 42.62  ? 412 ARG A NH1  1 
ATOM   6194  N  NH2  . ARG A  1 432 ? 98.656  -89.657  -22.685 1.00 49.25  ? 412 ARG A NH2  1 
ATOM   6195  H  H    . ARG A  1 432 ? 101.175 -91.436  -17.321 1.00 35.38  ? 412 ARG A H    1 
ATOM   6196  H  HA   . ARG A  1 432 ? 99.466  -93.362  -18.434 1.00 33.23  ? 412 ARG A HA   1 
ATOM   6197  H  HB2  . ARG A  1 432 ? 100.647 -91.533  -19.661 1.00 30.34  ? 412 ARG A HB2  1 
ATOM   6198  H  HB3  . ARG A  1 432 ? 102.192 -92.343  -19.377 1.00 32.39  ? 412 ARG A HB3  1 
ATOM   6199  H  HG2  . ARG A  1 432 ? 101.817 -93.024  -21.511 1.00 33.18  ? 412 ARG A HG2  1 
ATOM   6200  H  HG3  . ARG A  1 432 ? 101.020 -94.368  -20.653 1.00 35.47  ? 412 ARG A HG3  1 
ATOM   6201  H  HD2  . ARG A  1 432 ? 99.594  -93.657  -22.404 1.00 41.23  ? 412 ARG A HD2  1 
ATOM   6202  H  HD3  . ARG A  1 432 ? 98.914  -93.150  -20.822 1.00 38.72  ? 412 ARG A HD3  1 
ATOM   6203  H  HE   . ARG A  1 432 ? 100.570 -91.117  -22.076 1.00 44.83  ? 412 ARG A HE   1 
ATOM   6204  H  HH11 . ARG A  1 432 ? 97.274  -92.482  -21.967 1.00 42.91  ? 412 ARG A HH11 1 
ATOM   6205  H  HH12 . ARG A  1 432 ? 96.558  -90.990  -22.498 1.00 42.58  ? 412 ARG A HH12 1 
ATOM   6206  H  HH21 . ARG A  1 432 ? 99.564  -89.211  -22.770 1.00 50.26  ? 412 ARG A HH21 1 
ATOM   6207  H  HH22 . ARG A  1 432 ? 97.830  -89.144  -22.972 1.00 48.93  ? 412 ARG A HH22 1 
ATOM   6208  N  N    . GLN A  1 433 ? 102.481 -94.474  -17.619 1.00 36.29  ? 413 GLN A N    1 
ATOM   6209  C  CA   . GLN A  1 433 ? 103.307 -95.661  -17.385 1.00 37.22  ? 413 GLN A CA   1 
ATOM   6210  C  C    . GLN A  1 433 ? 102.773 -96.514  -16.210 1.00 44.80  ? 413 GLN A C    1 
ATOM   6211  O  O    . GLN A  1 433 ? 102.792 -97.744  -16.305 1.00 45.98  ? 413 GLN A O    1 
ATOM   6212  C  CB   . GLN A  1 433 ? 104.755 -95.244  -17.149 1.00 38.22  ? 413 GLN A CB   1 
ATOM   6213  C  CG   . GLN A  1 433 ? 105.440 -94.804  -18.430 1.00 30.42  ? 413 GLN A CG   1 
ATOM   6214  C  CD   . GLN A  1 433 ? 106.712 -94.029  -18.192 1.00 46.55  ? 413 GLN A CD   1 
ATOM   6215  O  OE1  . GLN A  1 433 ? 107.302 -94.046  -17.107 1.00 47.22  ? 413 GLN A OE1  1 
ATOM   6216  N  NE2  . GLN A  1 433 ? 107.173 -93.339  -19.212 1.00 43.57  ? 413 GLN A NE2  1 
ATOM   6217  H  H    . GLN A  1 433 ? 102.971 -93.601  -17.452 1.00 34.76  ? 413 GLN A H    1 
ATOM   6218  H  HA   . GLN A  1 433 ? 103.286 -96.285  -18.275 1.00 37.26  ? 413 GLN A HA   1 
ATOM   6219  H  HB2  . GLN A  1 433 ? 104.787 -94.420  -16.437 1.00 38.65  ? 413 GLN A HB2  1 
ATOM   6220  H  HB3  . GLN A  1 433 ? 105.311 -96.093  -16.755 1.00 38.83  ? 413 GLN A HB3  1 
ATOM   6221  H  HG2  . GLN A  1 433 ? 105.703 -95.693  -19.002 1.00 29.09  ? 413 GLN A HG2  1 
ATOM   6222  H  HG3  . GLN A  1 433 ? 104.758 -94.180  -19.002 1.00 29.90  ? 413 GLN A HG3  1 
ATOM   6223  H  HE21 . GLN A  1 433 ? 106.678 -93.331  -20.099 1.00 43.57  ? 413 GLN A HE21 1 
ATOM   6224  H  HE22 . GLN A  1 433 ? 108.022 -92.794  -19.106 1.00 44.50  ? 413 GLN A HE22 1 
ATOM   6225  N  N    . ALA A  1 434 ? 102.254 -95.880  -15.145 1.00 40.51  ? 414 ALA A N    1 
ATOM   6226  C  CA   . ALA A  1 434 ? 101.689 -96.610  -14.005 1.00 40.12  ? 414 ALA A CA   1 
ATOM   6227  C  C    . ALA A  1 434 ? 100.479 -97.481  -14.429 1.00 43.35  ? 414 ALA A C    1 
ATOM   6228  O  O    . ALA A  1 434 ? 100.340 -98.590  -13.939 1.00 43.84  ? 414 ALA A O    1 
ATOM   6229  C  CB   . ALA A  1 434 ? 101.255 -95.628  -12.925 1.00 40.82  ? 414 ALA A CB   1 
ATOM   6230  H  H    . ALA A  1 434 ? 102.210 -94.870  -15.048 1.00 40.44  ? 414 ALA A H    1 
ATOM   6231  H  HA   . ALA A  1 434 ? 102.451 -97.265  -13.585 1.00 39.88  ? 414 ALA A HA   1 
ATOM   6232  H  HB1  . ALA A  1 434 ? 100.907 -96.196  -12.062 1.00 41.99  ? 414 ALA A HB1  1 
ATOM   6233  H  HB2  . ALA A  1 434 ? 102.100 -95.002  -12.650 1.00 41.20  ? 414 ALA A HB2  1 
ATOM   6234  H  HB3  . ALA A  1 434 ? 100.450 -95.007  -13.314 1.00 38.94  ? 414 ALA A HB3  1 
ATOM   6235  N  N    . GLU A  1 435 ? 99.613  -96.987  -15.355 1.00 38.61  ? 415 GLU A N    1 
ATOM   6236  C  CA   . GLU A  1 435 ? 98.477  -97.779  -15.813 1.00 37.22  ? 415 GLU A CA   1 
ATOM   6237  C  C    . GLU A  1 435 ? 98.949  -98.875  -16.757 1.00 44.04  ? 415 GLU A C    1 
ATOM   6238  O  O    . GLU A  1 435 ? 98.330  -99.938  -16.816 1.00 43.18  ? 415 GLU A O    1 
ATOM   6239  C  CB   . GLU A  1 435 ? 97.402  -96.904  -16.475 1.00 37.51  ? 415 GLU A CB   1 
ATOM   6240  C  CG   . GLU A  1 435 ? 96.112  -97.666  -16.785 1.00 43.48  ? 415 GLU A CG   1 
ATOM   6241  C  CD   . GLU A  1 435 ? 96.031  -98.284  -18.172 1.00 55.14  ? 415 GLU A CD   1 
ATOM   6242  O  OE1  . GLU A  1 435 ? 96.971  -98.083  -18.974 1.00 41.89  ? 415 GLU A OE1  1 
ATOM   6243  O  OE2  . GLU A  1 435 ? 95.027  -98.973  -18.460 1.00 43.42  ? 415 GLU A OE2  1 
ATOM   6244  H  H    . GLU A  1 435 ? 99.675  -96.067  -15.779 1.00 38.04  ? 415 GLU A H    1 
ATOM   6245  H  HA   . GLU A  1 435 ? 98.017  -98.259  -14.950 1.00 36.25  ? 415 GLU A HA   1 
ATOM   6246  H  HB2  . GLU A  1 435 ? 97.146  -96.096  -15.791 1.00 36.74  ? 415 GLU A HB2  1 
ATOM   6247  H  HB3  . GLU A  1 435 ? 97.807  -96.477  -17.390 1.00 37.68  ? 415 GLU A HB3  1 
ATOM   6248  H  HG2  . GLU A  1 435 ? 96.007  -98.480  -16.070 1.00 43.52  ? 415 GLU A HG2  1 
ATOM   6249  H  HG3  . GLU A  1 435 ? 95.265  -96.996  -16.660 1.00 42.89  ? 415 GLU A HG3  1 
ATOM   6250  N  N    . GLN A  1 436 ? 99.998  -98.609  -17.545 1.00 42.79  ? 416 GLN A N    1 
ATOM   6251  C  CA   . GLN A  1 436 ? 100.549 -99.626  -18.453 1.00 42.36  ? 416 GLN A CA   1 
ATOM   6252  C  C    . GLN A  1 436 ? 101.117 -100.796 -17.637 1.00 45.74  ? 416 GLN A C    1 
ATOM   6253  O  O    . GLN A  1 436 ? 100.947 -101.956 -18.025 1.00 44.98  ? 416 GLN A O    1 
ATOM   6254  C  CB   . GLN A  1 436 ? 101.629 -99.031  -19.362 1.00 43.45  ? 416 GLN A CB   1 
ATOM   6255  C  CG   . GLN A  1 436 ? 101.046 -98.111  -20.433 1.00 51.57  ? 416 GLN A CG   1 
ATOM   6256  C  CD   . GLN A  1 436 ? 102.081 -97.230  -21.082 1.00 59.57  ? 416 GLN A CD   1 
ATOM   6257  O  OE1  . GLN A  1 436 ? 103.252 -97.198  -20.692 1.00 48.57  ? 416 GLN A OE1  1 
ATOM   6258  N  NE2  . GLN A  1 436 ? 101.678 -96.520  -22.115 1.00 54.14  ? 416 GLN A NE2  1 
ATOM   6259  H  H    . GLN A  1 436 ? 100.457 -97.707  -17.600 1.00 42.01  ? 416 GLN A H    1 
ATOM   6260  H  HA   . GLN A  1 436 ? 99.750  -100.012 -19.084 1.00 42.55  ? 416 GLN A HA   1 
ATOM   6261  H  HB2  . GLN A  1 436 ? 102.324 -98.461  -18.748 1.00 43.95  ? 416 GLN A HB2  1 
ATOM   6262  H  HB3  . GLN A  1 436 ? 102.158 -99.839  -19.863 1.00 43.47  ? 416 GLN A HB3  1 
ATOM   6263  H  HG2  . GLN A  1 436 ? 100.598 -98.727  -21.212 1.00 51.48  ? 416 GLN A HG2  1 
ATOM   6264  H  HG3  . GLN A  1 436 ? 100.281 -97.475  -19.990 1.00 51.76  ? 416 GLN A HG3  1 
ATOM   6265  H  HE21 . GLN A  1 436 ? 100.719 -96.585  -22.441 1.00 54.07  ? 416 GLN A HE21 1 
ATOM   6266  H  HE22 . GLN A  1 436 ? 102.335 -95.911  -22.594 1.00 54.90  ? 416 GLN A HE22 1 
ATOM   6267  N  N    . CYS A  1 437 ? 101.770 -100.479 -16.503 1.00 40.94  ? 417 CYS A N    1 
ATOM   6268  C  CA   . CYS A  1 437 ? 102.314 -101.462 -15.564 1.00 42.33  ? 417 CYS A CA   1 
ATOM   6269  C  C    . CYS A  1 437 ? 101.216 -102.354 -15.046 1.00 47.22  ? 417 CYS A C    1 
ATOM   6270  O  O    . CYS A  1 437 ? 101.370 -103.579 -15.023 1.00 49.67  ? 417 CYS A O    1 
ATOM   6271  C  CB   . CYS A  1 437 ? 103.015 -100.744 -14.416 1.00 43.38  ? 417 CYS A CB   1 
ATOM   6272  S  SG   . CYS A  1 437 ? 103.662 -101.834 -13.117 1.00 47.91  ? 417 CYS A SG   1 
ATOM   6273  H  H    . CYS A  1 437 ? 101.980 -99.523  -16.236 1.00 40.64  ? 417 CYS A H    1 
ATOM   6274  H  HA   . CYS A  1 437 ? 103.045 -102.092 -16.072 1.00 43.86  ? 417 CYS A HA   1 
ATOM   6275  H  HB2  . CYS A  1 437 ? 103.836 -100.166 -14.832 1.00 42.97  ? 417 CYS A HB2  1 
ATOM   6276  H  HB3  . CYS A  1 437 ? 102.301 -100.078 -13.934 1.00 42.96  ? 417 CYS A HB3  1 
ATOM   6277  H  HG   . CYS A  1 437 ? 102.653 -102.334 -12.398 1.00 48.01  ? 417 CYS A HG   1 
ATOM   6278  N  N    . TRP A  1 438 ? 100.128 -101.744 -14.582 1.00 40.67  ? 418 TRP A N    1 
ATOM   6279  C  CA   . TRP A  1 438 ? 98.971  -102.480 -14.074 1.00 40.55  ? 418 TRP A CA   1 
ATOM   6280  C  C    . TRP A  1 438 ? 98.349  -103.366 -15.195 1.00 42.51  ? 418 TRP A C    1 
ATOM   6281  O  O    . TRP A  1 438 ? 98.055  -104.530 -14.956 1.00 39.66  ? 418 TRP A O    1 
ATOM   6282  C  CB   . TRP A  1 438 ? 97.901  -101.529 -13.496 1.00 38.40  ? 418 TRP A CB   1 
ATOM   6283  C  CG   . TRP A  1 438 ? 96.698  -102.298 -13.052 1.00 38.58  ? 418 TRP A CG   1 
ATOM   6284  C  CD1  . TRP A  1 438 ? 96.618  -103.140 -11.983 1.00 41.62  ? 418 TRP A CD1  1 
ATOM   6285  C  CD2  . TRP A  1 438 ? 95.489  -102.475 -13.795 1.00 37.38  ? 418 TRP A CD2  1 
ATOM   6286  N  NE1  . TRP A  1 438 ? 95.394  -103.761 -11.962 1.00 40.22  ? 418 TRP A NE1  1 
ATOM   6287  C  CE2  . TRP A  1 438 ? 94.691  -103.400 -13.081 1.00 41.12  ? 418 TRP A CE2  1 
ATOM   6288  C  CE3  . TRP A  1 438 ? 94.971  -101.886 -14.956 1.00 37.61  ? 418 TRP A CE3  1 
ATOM   6289  C  CZ2  . TRP A  1 438 ? 93.398  -103.752 -13.497 1.00 39.83  ? 418 TRP A CZ2  1 
ATOM   6290  C  CZ3  . TRP A  1 438 ? 93.704  -102.253 -15.386 1.00 38.98  ? 418 TRP A CZ3  1 
ATOM   6291  C  CH2  . TRP A  1 438 ? 92.935  -103.184 -14.663 1.00 39.59  ? 418 TRP A CH2  1 
ATOM   6292  H  H    . TRP A  1 438 ? 100.016 -100.737 -14.543 1.00 41.71  ? 418 TRP A H    1 
ATOM   6293  H  HA   . TRP A  1 438 ? 99.291  -103.138 -13.267 1.00 41.34  ? 418 TRP A HA   1 
ATOM   6294  H  HB2  . TRP A  1 438 ? 98.312  -100.991 -12.643 1.00 38.54  ? 418 TRP A HB2  1 
ATOM   6295  H  HB3  . TRP A  1 438 ? 97.590  -100.822 -14.264 1.00 37.42  ? 418 TRP A HB3  1 
ATOM   6296  H  HD1  . TRP A  1 438 ? 97.393  -103.266 -11.230 1.00 42.00  ? 418 TRP A HD1  1 
ATOM   6297  H  HE1  . TRP A  1 438 ? 95.085  -104.420 -11.256 1.00 40.94  ? 418 TRP A HE1  1 
ATOM   6298  H  HE3  . TRP A  1 438 ? 95.577  -101.203 -15.548 1.00 37.20  ? 418 TRP A HE3  1 
ATOM   6299  H  HZ2  . TRP A  1 438 ? 92.774  -104.427 -12.915 1.00 39.25  ? 418 TRP A HZ2  1 
ATOM   6300  H  HZ3  . TRP A  1 438 ? 93.309  -101.821 -16.304 1.00 37.75  ? 418 TRP A HZ3  1 
ATOM   6301  H  HH2  . TRP A  1 438 ? 91.934  -103.436 -15.009 1.00 38.43  ? 418 TRP A HH2  1 
ATOM   6302  N  N    . LYS A  1 439 ? 98.169  -102.800 -16.399 1.00 41.45  ? 419 LYS A N    1 
ATOM   6303  C  CA   . LYS A  1 439 ? 97.576  -103.504 -17.548 1.00 41.99  ? 419 LYS A CA   1 
ATOM   6304  C  C    . LYS A  1 439 ? 98.433  -104.722 -17.964 1.00 50.41  ? 419 LYS A C    1 
ATOM   6305  O  O    . LYS A  1 439 ? 97.874  -105.775 -18.272 1.00 50.11  ? 419 LYS A O    1 
ATOM   6306  C  CB   . LYS A  1 439 ? 97.385  -102.537 -18.734 1.00 43.45  ? 419 LYS A CB   1 
ATOM   6307  H  H    . LYS A  1 439 ? 98.420  -101.836 -16.590 1.00 42.32  ? 419 LYS A H    1 
ATOM   6308  H  HA   . LYS A  1 439 ? 96.603  -103.890 -17.250 1.00 40.53  ? 419 LYS A HA   1 
ATOM   6309  N  N    . GLN A  1 440 ? 99.772  -104.586 -17.902 1.00 49.60  ? 420 GLN A N    1 
ATOM   6310  C  CA   . GLN A  1 440 ? 100.731 -105.657 -18.213 1.00 51.14  ? 420 GLN A CA   1 
ATOM   6311  C  C    . GLN A  1 440 ? 100.893 -106.679 -17.065 1.00 55.44  ? 420 GLN A C    1 
ATOM   6312  O  O    . GLN A  1 440 ? 101.525 -107.709 -17.268 1.00 56.70  ? 420 GLN A O    1 
ATOM   6313  C  CB   . GLN A  1 440 ? 102.119 -105.059 -18.553 1.00 53.03  ? 420 GLN A CB   1 
ATOM   6314  C  CG   . GLN A  1 440 ? 102.133 -104.284 -19.879 1.00 66.21  ? 420 GLN A CG   1 
ATOM   6315  C  CD   . GLN A  1 440 ? 103.306 -103.344 -19.995 1.00 81.25  ? 420 GLN A CD   1 
ATOM   6316  O  OE1  . GLN A  1 440 ? 104.378 -103.583 -19.427 1.00 72.89  ? 420 GLN A OE1  1 
ATOM   6317  N  NE2  . GLN A  1 440 ? 103.126 -102.246 -20.737 1.00 73.87  ? 420 GLN A NE2  1 
ATOM   6318  H  H    . GLN A  1 440 ? 100.225 -103.712 -17.650 1.00 50.32  ? 420 GLN A H    1 
ATOM   6319  H  HA   . GLN A  1 440 ? 100.379 -106.193 -19.094 1.00 51.78  ? 420 GLN A HA   1 
ATOM   6320  H  HB2  . GLN A  1 440 ? 102.432 -104.391 -17.752 1.00 52.45  ? 420 GLN A HB2  1 
ATOM   6321  H  HB3  . GLN A  1 440 ? 102.838 -105.871 -18.646 1.00 53.73  ? 420 GLN A HB3  1 
ATOM   6322  H  HG2  . GLN A  1 440 ? 102.203 -104.995 -20.701 1.00 66.67  ? 420 GLN A HG2  1 
ATOM   6323  H  HG3  . GLN A  1 440 ? 101.216 -103.705 -19.973 1.00 66.06  ? 420 GLN A HG3  1 
ATOM   6324  H  HE21 . GLN A  1 440 ? 102.240 -102.069 -21.198 1.00 73.00  ? 420 GLN A HE21 1 
ATOM   6325  H  HE22 . GLN A  1 440 ? 103.888 -101.585 -20.847 1.00 74.01  ? 420 GLN A HE22 1 
ATOM   6326  N  N    . GLY A  1 441 ? 100.357 -106.387 -15.882 1.00 52.03  ? 421 GLY A N    1 
ATOM   6327  C  CA   . GLY A  1 441 ? 100.462 -107.258 -14.721 1.00 51.34  ? 421 GLY A CA   1 
ATOM   6328  C  C    . GLY A  1 441 ? 101.861 -107.319 -14.155 1.00 57.41  ? 421 GLY A C    1 
ATOM   6329  O  O    . GLY A  1 441 ? 102.198 -108.279 -13.455 1.00 58.33  ? 421 GLY A O    1 
ATOM   6330  H  H    . GLY A  1 441 ? 99.865  -105.528 -15.662 1.00 52.63  ? 421 GLY A H    1 
ATOM   6331  H  HA2  . GLY A  1 441 ? 99.796  -106.897 -13.938 1.00 51.33  ? 421 GLY A HA2  1 
ATOM   6332  H  HA3  . GLY A  1 441 ? 100.158 -108.266 -14.994 1.00 51.25  ? 421 GLY A HA3  1 
ATOM   6333  N  N    . ALA A  1 442 ? 102.682 -106.284 -14.427 1.00 53.97  ? 422 ALA A N    1 
ATOM   6334  C  CA   . ALA A  1 442 ? 104.071 -106.246 -13.992 1.00 53.94  ? 422 ALA A CA   1 
ATOM   6335  C  C    . ALA A  1 442 ? 104.224 -105.799 -12.547 1.00 56.63  ? 422 ALA A C    1 
ATOM   6336  O  O    . ALA A  1 442 ? 103.336 -105.163 -11.983 1.00 54.51  ? 422 ALA A O    1 
ATOM   6337  C  CB   . ALA A  1 442 ? 104.866 -105.312 -14.890 1.00 54.63  ? 422 ALA A CB   1 
ATOM   6338  H  H    . ALA A  1 442 ? 102.401 -105.438 -14.915 1.00 54.39  ? 422 ALA A H    1 
ATOM   6339  H  HA   . ALA A  1 442 ? 104.502 -107.240 -14.090 1.00 54.77  ? 422 ALA A HA   1 
ATOM   6340  H  HB1  . ALA A  1 442 ? 105.904 -105.305 -14.562 1.00 55.40  ? 422 ALA A HB1  1 
ATOM   6341  H  HB2  . ALA A  1 442 ? 104.802 -105.668 -15.916 1.00 54.23  ? 422 ALA A HB2  1 
ATOM   6342  H  HB3  . ALA A  1 442 ? 104.455 -104.305 -14.817 1.00 54.58  ? 422 ALA A HB3  1 
ATOM   6343  N  N    . ASP A  1 443 ? 105.389 -106.127 -11.963 1.00 54.55  ? 423 ASP A N    1 
ATOM   6344  C  CA   . ASP A  1 443 ? 105.760 -105.689 -10.618 1.00 54.07  ? 423 ASP A CA   1 
ATOM   6345  C  C    . ASP A  1 443 ? 106.215 -104.227 -10.739 1.00 54.05  ? 423 ASP A C    1 
ATOM   6346  O  O    . ASP A  1 443 ? 107.130 -103.976 -11.518 1.00 51.40  ? 423 ASP A O    1 
ATOM   6347  C  CB   . ASP A  1 443 ? 106.865 -106.578 -10.016 1.00 57.19  ? 423 ASP A CB   1 
ATOM   6348  C  CG   . ASP A  1 443 ? 107.428 -106.028 -8.727  1.00 68.67  ? 423 ASP A CG   1 
ATOM   6349  O  OD1  . ASP A  1 443 ? 106.678 -105.953 -7.749  1.00 69.51  ? 423 ASP A OD1  1 
ATOM   6350  O  OD2  . ASP A  1 443 ? 108.599 -105.590 -8.730  1.00 78.64  ? 423 ASP A OD2  1 
ATOM   6351  H  H    . ASP A  1 443 ? 106.100 -106.683 -12.426 1.00 54.84  ? 423 ASP A H    1 
ATOM   6352  H  HA   . ASP A  1 443 ? 104.891 -105.781 -9.969  1.00 53.90  ? 423 ASP A HA   1 
ATOM   6353  H  HB2  . ASP A  1 443 ? 106.447 -107.561 -9.804  1.00 57.61  ? 423 ASP A HB2  1 
ATOM   6354  H  HB3  . ASP A  1 443 ? 107.686 -106.669 -10.725 1.00 57.60  ? 423 ASP A HB3  1 
ATOM   6355  N  N    . PRO A  1 444 ? 105.597 -103.258 -10.020 1.00 51.57  ? 424 PRO A N    1 
ATOM   6356  C  CA   . PRO A  1 444 ? 105.976 -101.840 -10.190 1.00 51.37  ? 424 PRO A CA   1 
ATOM   6357  C  C    . PRO A  1 444 ? 107.466 -101.516 -10.070 1.00 58.23  ? 424 PRO A C    1 
ATOM   6358  O  O    . PRO A  1 444 ? 107.960 -100.726 -10.872 1.00 59.66  ? 424 PRO A O    1 
ATOM   6359  C  CB   . PRO A  1 444 ? 105.187 -101.142 -9.089  1.00 52.11  ? 424 PRO A CB   1 
ATOM   6360  C  CG   . PRO A  1 444 ? 103.962 -101.964 -8.974  1.00 56.96  ? 424 PRO A CG   1 
ATOM   6361  C  CD   . PRO A  1 444 ? 104.462 -103.380 -9.083  1.00 53.16  ? 424 PRO A CD   1 
ATOM   6362  H  HA   . PRO A  1 444 ? 105.629 -101.481 -11.157 1.00 51.27  ? 424 PRO A HA   1 
ATOM   6363  H  HB2  . PRO A  1 444 ? 105.749 -101.151 -8.156  1.00 51.97  ? 424 PRO A HB2  1 
ATOM   6364  H  HB3  . PRO A  1 444 ? 104.954 -100.124 -9.396  1.00 51.69  ? 424 PRO A HB3  1 
ATOM   6365  H  HG2  . PRO A  1 444 ? 103.460 -101.790 -8.024  1.00 56.34  ? 424 PRO A HG2  1 
ATOM   6366  H  HG3  . PRO A  1 444 ? 103.297 -101.741 -9.807  1.00 56.77  ? 424 PRO A HG3  1 
ATOM   6367  H  HD2  . PRO A  1 444 ? 104.794 -103.748 -8.113  1.00 53.30  ? 424 PRO A HD2  1 
ATOM   6368  H  HD3  . PRO A  1 444 ? 103.684 -104.013 -9.510  1.00 53.18  ? 424 PRO A HD3  1 
ATOM   6369  N  N    . VAL A  1 445 ? 108.186 -102.139 -9.130  1.00 54.81  ? 425 VAL A N    1 
ATOM   6370  C  CA   . VAL A  1 445 ? 109.613 -101.854 -8.957  1.00 56.72  ? 425 VAL A CA   1 
ATOM   6371  C  C    . VAL A  1 445 ? 110.416 -102.397 -10.163 1.00 63.23  ? 425 VAL A C    1 
ATOM   6372  O  O    . VAL A  1 445 ? 111.287 -101.687 -10.678 1.00 63.65  ? 425 VAL A O    1 
ATOM   6373  C  CB   . VAL A  1 445 ? 110.152 -102.384 -7.616  1.00 62.24  ? 425 VAL A CB   1 
ATOM   6374  C  CG1  . VAL A  1 445 ? 111.659 -102.148 -7.496  1.00 63.40  ? 425 VAL A CG1  1 
ATOM   6375  C  CG2  . VAL A  1 445 ? 109.427 -101.720 -6.449  1.00 61.56  ? 425 VAL A CG2  1 
ATOM   6376  H  H    . VAL A  1 445 ? 107.816 -102.847 -8.506  1.00 54.43  ? 425 VAL A H    1 
ATOM   6377  H  HA   . VAL A  1 445 ? 109.748 -100.773 -8.942  1.00 56.76  ? 425 VAL A HA   1 
ATOM   6378  H  HB   . VAL A  1 445 ? 109.968 -103.456 -7.559  1.00 62.78  ? 425 VAL A HB   1 
ATOM   6379  H  HG11 . VAL A  1 445 ? 111.952 -102.236 -6.450  1.00 63.93  ? 425 VAL A HG11 1 
ATOM   6380  H  HG12 . VAL A  1 445 ? 112.188 -102.899 -8.080  1.00 63.98  ? 425 VAL A HG12 1 
ATOM   6381  H  HG13 . VAL A  1 445 ? 111.892 -101.149 -7.857  1.00 63.26  ? 425 VAL A HG13 1 
ATOM   6382  H  HG21 . VAL A  1 445 ? 109.868 -102.062 -5.513  1.00 62.16  ? 425 VAL A HG21 1 
ATOM   6383  H  HG22 . VAL A  1 445 ? 109.539 -100.640 -6.533  1.00 61.11  ? 425 VAL A HG22 1 
ATOM   6384  H  HG23 . VAL A  1 445 ? 108.372 -101.990 -6.467  1.00 61.22  ? 425 VAL A HG23 1 
ATOM   6385  N  N    . GLU A  1 446 ? 110.102 -103.619 -10.633 1.00 59.52  ? 426 GLU A N    1 
ATOM   6386  C  CA   . GLU A  1 446 ? 110.772 -104.205 -11.802 1.00 58.92  ? 426 GLU A CA   1 
ATOM   6387  C  C    . GLU A  1 446 ? 110.437 -103.393 -13.063 1.00 60.11  ? 426 GLU A C    1 
ATOM   6388  O  O    . GLU A  1 446 ? 111.323 -103.101 -13.865 1.00 60.59  ? 426 GLU A O    1 
ATOM   6389  C  CB   . GLU A  1 446 ? 110.369 -105.684 -11.991 1.00 60.69  ? 426 GLU A CB   1 
ATOM   6390  C  CG   . GLU A  1 446 ? 110.990 -106.688 -11.028 1.00 74.12  ? 426 GLU A CG   1 
ATOM   6391  C  CD   . GLU A  1 446 ? 112.433 -106.475 -10.621 1.00 93.07  ? 426 GLU A CD   1 
ATOM   6392  O  OE1  . GLU A  1 446 ? 113.283 -106.393 -11.534 1.00 73.03  ? 426 GLU A OE1  1 
ATOM   6393  O  OE2  . GLU A  1 446 ? 112.719 -106.429 -9.398  1.00 83.14  ? 426 GLU A OE2  1 
ATOM   6394  H  H    . GLU A  1 446 ? 109.396 -104.215 -10.215 1.00 59.51  ? 426 GLU A H    1 
ATOM   6395  H  HA   . GLU A  1 446 ? 111.850 -104.139 -11.664 1.00 59.50  ? 426 GLU A HA   1 
ATOM   6396  H  HB2  . GLU A  1 446 ? 109.296 -105.740 -11.840 1.00 60.32  ? 426 GLU A HB2  1 
ATOM   6397  H  HB3  . GLU A  1 446 ? 110.586 -105.978 -13.017 1.00 60.73  ? 426 GLU A HB3  1 
ATOM   6398  H  HG2  . GLU A  1 446 ? 110.405 -106.719 -10.111 1.00 74.02  ? 426 GLU A HG2  1 
ATOM   6399  H  HG3  . GLU A  1 446 ? 110.941 -107.663 -11.511 1.00 74.33  ? 426 GLU A HG3  1 
ATOM   6400  N  N    . PHE A  1 447 ? 109.168 -103.013 -13.221 1.00 54.22  ? 427 PHE A N    1 
ATOM   6401  C  CA   . PHE A  1 447 ? 108.702 -102.180 -14.330 1.00 53.62  ? 427 PHE A CA   1 
ATOM   6402  C  C    . PHE A  1 447 ? 109.421 -100.812 -14.379 1.00 53.90  ? 427 PHE A C    1 
ATOM   6403  O  O    . PHE A  1 447 ? 109.728 -100.332 -15.469 1.00 51.39  ? 427 PHE A O    1 
ATOM   6404  C  CB   . PHE A  1 447 ? 107.184 -101.959 -14.194 1.00 56.06  ? 427 PHE A CB   1 
ATOM   6405  C  CG   . PHE A  1 447 ? 106.575 -101.064 -15.244 1.00 58.06  ? 427 PHE A CG   1 
ATOM   6406  C  CD1  . PHE A  1 447 ? 106.490 -99.689  -15.049 1.00 61.39  ? 427 PHE A CD1  1 
ATOM   6407  C  CD2  . PHE A  1 447 ? 106.074 -101.594 -16.421 1.00 59.97  ? 427 PHE A CD2  1 
ATOM   6408  C  CE1  . PHE A  1 447 ? 105.913 -98.861  -16.013 1.00 61.56  ? 427 PHE A CE1  1 
ATOM   6409  C  CE2  . PHE A  1 447 ? 105.486 -100.766 -17.379 1.00 62.10  ? 427 PHE A CE2  1 
ATOM   6410  C  CZ   . PHE A  1 447 ? 105.406 -99.402  -17.166 1.00 59.50  ? 427 PHE A CZ   1 
ATOM   6411  H  H    . PHE A  1 447 ? 108.422 -103.304 -12.596 1.00 54.52  ? 427 PHE A H    1 
ATOM   6412  H  HA   . PHE A  1 447 ? 108.892 -102.695 -15.270 1.00 53.88  ? 427 PHE A HA   1 
ATOM   6413  H  HB2  . PHE A  1 447 ? 106.689 -102.927 -14.255 1.00 56.55  ? 427 PHE A HB2  1 
ATOM   6414  H  HB3  . PHE A  1 447 ? 106.980 -101.508 -13.224 1.00 55.63  ? 427 PHE A HB3  1 
ATOM   6415  H  HD1  . PHE A  1 447 ? 106.889 -99.256  -14.133 1.00 61.44  ? 427 PHE A HD1  1 
ATOM   6416  H  HD2  . PHE A  1 447 ? 106.116 -102.670 -16.580 1.00 59.91  ? 427 PHE A HD2  1 
ATOM   6417  H  HE1  . PHE A  1 447 ? 105.856 -97.789  -15.829 1.00 61.39  ? 427 PHE A HE1  1 
ATOM   6418  H  HE2  . PHE A  1 447 ? 105.093 -101.197 -18.297 1.00 61.42  ? 427 PHE A HE2  1 
ATOM   6419  H  HZ   . PHE A  1 447 ? 104.961 -98.754  -17.920 1.00 58.72  ? 427 PHE A HZ   1 
ATOM   6420  N  N    . ALA A  1 448 ? 109.658 -100.183 -13.203 1.00 48.00  ? 428 ALA A N    1 
ATOM   6421  C  CA   . ALA A  1 448 ? 110.326 -98.881  -13.097 1.00 47.97  ? 428 ALA A CA   1 
ATOM   6422  C  C    . ALA A  1 448 ? 111.771 -98.905  -13.620 1.00 53.38  ? 428 ALA A C    1 
ATOM   6423  O  O    . ALA A  1 448 ? 112.255 -97.871  -14.067 1.00 53.04  ? 428 ALA A O    1 
ATOM   6424  C  CB   . ALA A  1 448 ? 110.321 -98.408  -11.651 1.00 48.52  ? 428 ALA A CB   1 
ATOM   6425  H  H    . ALA A  1 448 ? 109.395 -100.574 -12.304 1.00 48.12  ? 428 ALA A H    1 
ATOM   6426  H  HA   . ALA A  1 448 ? 109.783 -98.155  -13.700 1.00 47.64  ? 428 ALA A HA   1 
ATOM   6427  H  HB1  . ALA A  1 448 ? 110.748 -97.408  -11.612 1.00 48.50  ? 428 ALA A HB1  1 
ATOM   6428  H  HB2  . ALA A  1 448 ? 109.300 -98.398  -11.272 1.00 47.85  ? 428 ALA A HB2  1 
ATOM   6429  H  HB3  . ALA A  1 448 ? 110.924 -99.090  -11.054 1.00 49.19  ? 428 ALA A HB3  1 
ATOM   6430  N  N    . LYS A  1 449 ? 112.442 -100.074 -13.616 1.00 50.95  ? 429 LYS A N    1 
ATOM   6431  C  CA   . LYS A  1 449 ? 113.804 -100.197 -14.141 1.00 51.37  ? 429 LYS A CA   1 
ATOM   6432  C  C    . LYS A  1 449 ? 113.888 -99.824  -15.628 1.00 54.75  ? 429 LYS A C    1 
ATOM   6433  O  O    . LYS A  1 449 ? 114.940 -99.359  -16.059 1.00 55.54  ? 429 LYS A O    1 
ATOM   6434  C  CB   . LYS A  1 449 ? 114.349 -101.624 -13.952 1.00 54.91  ? 429 LYS A CB   1 
ATOM   6435  C  CG   . LYS A  1 449 ? 114.535 -102.068 -12.501 1.00 58.13  ? 429 LYS A CG   1 
ATOM   6436  C  CD   . LYS A  1 449 ? 115.062 -103.493 -12.431 1.00 66.22  ? 429 LYS A CD   1 
ATOM   6437  C  CE   . LYS A  1 449 ? 115.309 -103.951 -11.014 1.00 82.11  ? 429 LYS A CE   1 
ATOM   6438  N  NZ   . LYS A  1 449 ? 115.817 -105.351 -10.937 1.00 97.23  ? 429 LYS A NZ   1 
ATOM   6439  H  H    . LYS A  1 449 ? 112.063 -100.944 -13.257 1.00 51.21  ? 429 LYS A H    1 
ATOM   6440  H  HA   . LYS A  1 449 ? 114.449 -99.514  -13.589 1.00 52.22  ? 429 LYS A HA   1 
ATOM   6441  H  HB2  . LYS A  1 449 ? 113.677 -102.327 -14.439 1.00 55.23  ? 429 LYS A HB2  1 
ATOM   6442  H  HB3  . LYS A  1 449 ? 115.327 -101.680 -14.429 1.00 56.06  ? 429 LYS A HB3  1 
ATOM   6443  H  HG2  . LYS A  1 449 ? 115.261 -101.411 -12.024 1.00 58.25  ? 429 LYS A HG2  1 
ATOM   6444  H  HG3  . LYS A  1 449 ? 113.585 -102.037 -11.971 1.00 57.45  ? 429 LYS A HG3  1 
ATOM   6445  H  HD2  . LYS A  1 449 ? 114.332 -104.158 -12.889 1.00 65.47  ? 429 LYS A HD2  1 
ATOM   6446  H  HD3  . LYS A  1 449 ? 116.008 -103.550 -12.968 1.00 67.15  ? 429 LYS A HD3  1 
ATOM   6447  H  HE2  . LYS A  1 449 ? 116.059 -103.304 -10.563 1.00 82.44  ? 429 LYS A HE2  1 
ATOM   6448  H  HE3  . LYS A  1 449 ? 114.376 -103.893 -10.455 1.00 81.72  ? 429 LYS A HE3  1 
ATOM   6449  H  HZ1  . LYS A  1 449 ? 115.518 -105.784 -10.069 1.00 97.31  ? 429 LYS A HZ1  1 
ATOM   6450  H  HZ2  . LYS A  1 449 ? 115.468 -105.901 -11.715 1.00 97.25  ? 429 LYS A HZ2  1 
ATOM   6451  H  HZ3  . LYS A  1 449 ? 116.832 -105.354 -10.956 1.00 97.77  ? 429 LYS A HZ3  1 
ATOM   6452  N  N    . ASP A  1 450 ? 112.793 -100.009 -16.401 1.00 50.88  ? 430 ASP A N    1 
ATOM   6453  C  CA   . ASP A  1 450 ? 112.758 -99.707  -17.842 1.00 52.31  ? 430 ASP A CA   1 
ATOM   6454  C  C    . ASP A  1 450 ? 111.836 -98.525  -18.208 1.00 53.98  ? 430 ASP A C    1 
ATOM   6455  O  O    . ASP A  1 450 ? 111.592 -98.303  -19.396 1.00 52.64  ? 430 ASP A O    1 
ATOM   6456  C  CB   . ASP A  1 450 ? 112.284 -100.967 -18.590 1.00 54.97  ? 430 ASP A CB   1 
ATOM   6457  C  CG   . ASP A  1 450 ? 113.153 -102.160 -18.296 1.00 62.68  ? 430 ASP A CG   1 
ATOM   6458  O  OD1  . ASP A  1 450 ? 114.397 -102.047 -18.467 1.00 61.82  ? 430 ASP A OD1  1 
ATOM   6459  O  OD2  . ASP A  1 450 ? 112.608 -103.184 -17.832 1.00 69.24  ? 430 ASP A OD2  1 
ATOM   6460  H  H    . ASP A  1 450 ? 111.919 -100.405 -16.075 1.00 49.35  ? 430 ASP A H    1 
ATOM   6461  H  HA   . ASP A  1 450 ? 113.754 -99.464  -18.212 1.00 52.98  ? 430 ASP A HA   1 
ATOM   6462  H  HB2  . ASP A  1 450 ? 111.265 -101.202 -18.287 1.00 54.42  ? 430 ASP A HB2  1 
ATOM   6463  H  HB3  . ASP A  1 450 ? 112.325 -100.785 -19.660 1.00 54.88  ? 430 ASP A HB3  1 
ATOM   6464  N  N    . HIS A  1 451 ? 111.335 -97.771  -17.207 1.00 50.16  ? 431 HIS A N    1 
ATOM   6465  C  CA   . HIS A  1 451 ? 110.408 -96.652  -17.410 1.00 49.11  ? 431 HIS A CA   1 
ATOM   6466  C  C    . HIS A  1 451 ? 110.830 -95.516  -16.473 1.00 49.78  ? 431 HIS A C    1 
ATOM   6467  O  O    . HIS A  1 451 ? 110.467 -95.520  -15.297 1.00 49.34  ? 431 HIS A O    1 
ATOM   6468  C  CB   . HIS A  1 451 ? 108.966 -97.146  -17.163 1.00 50.34  ? 431 HIS A CB   1 
ATOM   6469  C  CG   . HIS A  1 451 ? 108.521 -98.174  -18.160 1.00 54.63  ? 431 HIS A CG   1 
ATOM   6470  N  ND1  . HIS A  1 451 ? 108.709 -99.536  -17.938 1.00 57.59  ? 431 HIS A ND1  1 
ATOM   6471  C  CD2  . HIS A  1 451 ? 107.961 -98.011  -19.382 1.00 56.32  ? 431 HIS A CD2  1 
ATOM   6472  C  CE1  . HIS A  1 451 ? 108.233 -100.147 -19.013 1.00 57.06  ? 431 HIS A CE1  1 
ATOM   6473  N  NE2  . HIS A  1 451 ? 107.759 -99.269  -19.902 1.00 56.72  ? 431 HIS A NE2  1 
ATOM   6474  H  H    . HIS A  1 451 ? 111.561 -97.909  -16.227 1.00 50.37  ? 431 HIS A H    1 
ATOM   6475  H  HA   . HIS A  1 451 ? 110.457 -96.283  -18.433 1.00 49.33  ? 431 HIS A HA   1 
ATOM   6476  H  HB2  . HIS A  1 451 ? 108.913 -97.597  -16.172 1.00 50.78  ? 431 HIS A HB2  1 
ATOM   6477  H  HB3  . HIS A  1 451 ? 108.278 -96.306  -17.223 1.00 49.95  ? 431 HIS A HB3  1 
ATOM   6478  H  HD1  . HIS A  1 451 ? 109.135 -99.990  -17.137 1.00 58.16  ? 431 HIS A HD1  1 
ATOM   6479  H  HD2  . HIS A  1 451 ? 107.716 -97.068  -19.867 1.00 56.77  ? 431 HIS A HD2  1 
ATOM   6480  H  HE1  . HIS A  1 451 ? 108.227 -101.227 -19.154 1.00 57.57  ? 431 HIS A HE1  1 
ATOM   6481  N  N    . ARG A  1 452 ? 111.640 -94.574  -16.998 1.00 45.69  ? 432 ARG A N    1 
ATOM   6482  C  CA   . ARG A  1 452 ? 112.265 -93.489  -16.215 1.00 45.80  ? 432 ARG A CA   1 
ATOM   6483  C  C    . ARG A  1 452 ? 111.287 -92.574  -15.508 1.00 44.73  ? 432 ARG A C    1 
ATOM   6484  O  O    . ARG A  1 452 ? 111.501 -92.280  -14.339 1.00 42.03  ? 432 ARG A O    1 
ATOM   6485  C  CB   . ARG A  1 452 ? 113.192 -92.610  -17.087 1.00 46.94  ? 432 ARG A CB   1 
ATOM   6486  C  CG   . ARG A  1 452 ? 113.799 -91.439  -16.310 1.00 66.70  ? 432 ARG A CG   1 
ATOM   6487  C  CD   . ARG A  1 452 ? 115.140 -90.981  -16.825 1.00 81.67  ? 432 ARG A CD   1 
ATOM   6488  N  NE   . ARG A  1 452 ? 115.712 -89.927  -15.978 1.00 86.27  ? 432 ARG A NE   1 
ATOM   6489  C  CZ   . ARG A  1 452 ? 116.325 -90.118  -14.809 1.00 96.22  ? 432 ARG A CZ   1 
ATOM   6490  N  NH1  . ARG A  1 452 ? 116.447 -91.344  -14.299 1.00 83.08  ? 432 ARG A NH1  1 
ATOM   6491  N  NH2  . ARG A  1 452 ? 116.814 -89.086  -14.135 1.00 79.80  ? 432 ARG A NH2  1 
ATOM   6492  H  H    . ARG A  1 452 ? 111.872 -94.528  -17.985 1.00 45.65  ? 432 ARG A H    1 
ATOM   6493  H  HA   . ARG A  1 452 ? 112.886 -93.948  -15.448 1.00 46.39  ? 432 ARG A HA   1 
ATOM   6494  H  HB2  . ARG A  1 452 ? 114.007 -93.226  -17.467 1.00 47.49  ? 432 ARG A HB2  1 
ATOM   6495  H  HB3  . ARG A  1 452 ? 112.616 -92.201  -17.917 1.00 46.57  ? 432 ARG A HB3  1 
ATOM   6496  H  HG2  . ARG A  1 452 ? 113.126 -90.586  -16.373 1.00 66.65  ? 432 ARG A HG2  1 
ATOM   6497  H  HG3  . ARG A  1 452 ? 113.932 -91.733  -15.270 1.00 67.25  ? 432 ARG A HG3  1 
ATOM   6498  H  HD2  . ARG A  1 452 ? 115.830 -91.822  -16.887 1.00 82.27  ? 432 ARG A HD2  1 
ATOM   6499  H  HD3  . ARG A  1 452 ? 114.997 -90.557  -17.818 1.00 81.60  ? 432 ARG A HD3  1 
ATOM   6500  H  HE   . ARG A  1 452 ? 115.640 -88.975  -16.322 1.00 85.90  ? 432 ARG A HE   1 
ATOM   6501  H  HH11 . ARG A  1 452 ? 116.103 -92.175  -14.767 1.00 82.95  ? 432 ARG A HH11 1 
ATOM   6502  H  HH12 . ARG A  1 452 ? 116.920 -91.464  -13.409 1.00 83.36  ? 432 ARG A HH12 1 
ATOM   6503  H  HH21 . ARG A  1 452 ? 116.725 -88.146  -14.506 1.00 79.49  ? 432 ARG A HH21 1 
ATOM   6504  H  HH22 . ARG A  1 452 ? 117.279 -89.232  -13.245 1.00 80.20  ? 432 ARG A HH22 1 
ATOM   6505  N  N    . GLU A  1 453 ? 110.253 -92.091  -16.206 1.00 40.67  ? 433 GLU A N    1 
ATOM   6506  C  CA   . GLU A  1 453 ? 109.312 -91.147  -15.616 1.00 39.78  ? 433 GLU A CA   1 
ATOM   6507  C  C    . GLU A  1 453 ? 108.591 -91.801  -14.434 1.00 43.47  ? 433 GLU A C    1 
ATOM   6508  O  O    . GLU A  1 453 ? 108.450 -91.155  -13.398 1.00 42.04  ? 433 GLU A O    1 
ATOM   6509  C  CB   . GLU A  1 453 ? 108.321 -90.603  -16.662 1.00 40.65  ? 433 GLU A CB   1 
ATOM   6510  C  CG   . GLU A  1 453 ? 108.992 -89.769  -17.747 1.00 50.98  ? 433 GLU A CG   1 
ATOM   6511  C  CD   . GLU A  1 453 ? 109.666 -90.498  -18.902 1.00 68.67  ? 433 GLU A CD   1 
ATOM   6512  O  OE1  . GLU A  1 453 ? 109.534 -91.741  -18.999 1.00 47.08  ? 433 GLU A OE1  1 
ATOM   6513  O  OE2  . GLU A  1 453 ? 110.335 -89.819  -19.714 1.00 56.03  ? 433 GLU A OE2  1 
ATOM   6514  H  H    . GLU A  1 453 ? 110.020 -92.398  -17.144 1.00 41.18  ? 433 GLU A H    1 
ATOM   6515  H  HA   . GLU A  1 453 ? 109.874 -90.303  -15.217 1.00 40.40  ? 433 GLU A HA   1 
ATOM   6516  H  HB2  . GLU A  1 453 ? 107.788 -91.430  -17.127 1.00 40.89  ? 433 GLU A HB2  1 
ATOM   6517  H  HB3  . GLU A  1 453 ? 107.611 -89.957  -16.146 1.00 40.29  ? 433 GLU A HB3  1 
ATOM   6518  H  HG2  . GLU A  1 453 ? 108.243 -89.114  -18.185 1.00 50.32  ? 433 GLU A HG2  1 
ATOM   6519  H  HG3  . GLU A  1 453 ? 109.755 -89.152  -17.275 1.00 51.48  ? 433 GLU A HG3  1 
ATOM   6520  N  N    . PHE A  1 454 ? 108.228 -93.091  -14.563 1.00 41.32  ? 434 PHE A N    1 
ATOM   6521  C  CA   . PHE A  1 454 ? 107.621 -93.853  -13.484 1.00 41.78  ? 434 PHE A CA   1 
ATOM   6522  C  C    . PHE A  1 454 ? 108.638 -94.007  -12.336 1.00 46.42  ? 434 PHE A C    1 
ATOM   6523  O  O    . PHE A  1 454 ? 108.300 -93.736  -11.186 1.00 44.75  ? 434 PHE A O    1 
ATOM   6524  C  CB   . PHE A  1 454 ? 107.126 -95.215  -13.990 1.00 43.32  ? 434 PHE A CB   1 
ATOM   6525  C  CG   . PHE A  1 454 ? 106.360 -96.013  -12.959 1.00 44.12  ? 434 PHE A CG   1 
ATOM   6526  C  CD1  . PHE A  1 454 ? 105.127 -95.588  -12.509 1.00 44.72  ? 434 PHE A CD1  1 
ATOM   6527  C  CD2  . PHE A  1 454 ? 106.884 -97.183  -12.428 1.00 45.87  ? 434 PHE A CD2  1 
ATOM   6528  C  CE1  . PHE A  1 454 ? 104.434 -96.317  -11.540 1.00 45.07  ? 434 PHE A CE1  1 
ATOM   6529  C  CE2  . PHE A  1 454 ? 106.171 -97.923  -11.485 1.00 47.51  ? 434 PHE A CE2  1 
ATOM   6530  C  CZ   . PHE A  1 454 ? 104.957 -97.480  -11.044 1.00 44.08  ? 434 PHE A CZ   1 
ATOM   6531  H  H    . PHE A  1 454 ? 108.344 -93.629  -15.417 1.00 42.57  ? 434 PHE A H    1 
ATOM   6532  H  HA   . PHE A  1 454 ? 106.764 -93.306  -13.094 1.00 42.42  ? 434 PHE A HA   1 
ATOM   6533  H  HB2  . PHE A  1 454 ? 106.453 -95.046  -14.828 1.00 42.42  ? 434 PHE A HB2  1 
ATOM   6534  H  HB3  . PHE A  1 454 ? 107.980 -95.805  -14.320 1.00 44.36  ? 434 PHE A HB3  1 
ATOM   6535  H  HD1  . PHE A  1 454 ? 104.707 -94.672  -12.916 1.00 43.89  ? 434 PHE A HD1  1 
ATOM   6536  H  HD2  . PHE A  1 454 ? 107.846 -97.548  -12.780 1.00 46.74  ? 434 PHE A HD2  1 
ATOM   6537  H  HE1  . PHE A  1 454 ? 103.463 -95.977  -11.190 1.00 44.19  ? 434 PHE A HE1  1 
ATOM   6538  H  HE2  . PHE A  1 454 ? 106.592 -98.837  -11.068 1.00 48.11  ? 434 PHE A HE2  1 
ATOM   6539  H  HZ   . PHE A  1 454 ? 104.410 -98.046  -10.293 1.00 44.89  ? 434 PHE A HZ   1 
ATOM   6540  N  N    . ALA A  1 455 ? 109.897 -94.366  -12.666 1.00 44.25  ? 435 ALA A N    1 
ATOM   6541  C  CA   . ALA A  1 455 ? 110.957 -94.509  -11.671 1.00 44.45  ? 435 ALA A CA   1 
ATOM   6542  C  C    . ALA A  1 455 ? 111.188 -93.217  -10.913 1.00 44.21  ? 435 ALA A C    1 
ATOM   6543  O  O    . ALA A  1 455 ? 111.388 -93.262  -9.711  1.00 42.82  ? 435 ALA A O    1 
ATOM   6544  C  CB   . ALA A  1 455 ? 112.248 -94.940  -12.337 1.00 45.80  ? 435 ALA A CB   1 
ATOM   6545  H  H    . ALA A  1 455 ? 110.193 -94.578  -13.613 1.00 44.20  ? 435 ALA A H    1 
ATOM   6546  H  HA   . ALA A  1 455 ? 110.675 -95.265  -10.941 1.00 45.12  ? 435 ALA A HA   1 
ATOM   6547  H  HB1  . ALA A  1 455 ? 112.993 -95.137  -11.566 1.00 46.60  ? 435 ALA A HB1  1 
ATOM   6548  H  HB2  . ALA A  1 455 ? 112.060 -95.844  -12.911 1.00 46.06  ? 435 ALA A HB2  1 
ATOM   6549  H  HB3  . ALA A  1 455 ? 112.604 -94.149  -12.995 1.00 45.32  ? 435 ALA A HB3  1 
ATOM   6550  N  N    . ARG A  1 456 ? 111.145 -92.070  -11.611 1.00 40.23  ? 436 ARG A N    1 
ATOM   6551  C  CA   . ARG A  1 456 ? 111.379 -90.772  -10.976 1.00 39.21  ? 436 ARG A CA   1 
ATOM   6552  C  C    . ARG A  1 456 ? 110.202 -90.325  -10.091 1.00 40.31  ? 436 ARG A C    1 
ATOM   6553  O  O    . ARG A  1 456 ? 110.397 -89.424  -9.279  1.00 37.92  ? 436 ARG A O    1 
ATOM   6554  C  CB   . ARG A  1 456 ? 111.726 -89.727  -12.029 1.00 38.33  ? 436 ARG A CB   1 
ATOM   6555  C  CG   . ARG A  1 456 ? 113.119 -89.985  -12.640 1.00 49.27  ? 436 ARG A CG   1 
ATOM   6556  C  CD   . ARG A  1 456 ? 114.236 -89.485  -11.741 1.00 41.48  ? 436 ARG A CD   1 
ATOM   6557  N  NE   . ARG A  1 456 ? 114.358 -88.036  -11.775 1.00 43.37  ? 436 ARG A NE   1 
ATOM   6558  C  CZ   . ARG A  1 456 ? 115.216 -87.320  -11.049 1.00 59.10  ? 436 ARG A CZ   1 
ATOM   6559  N  NH1  . ARG A  1 456 ? 116.039 -87.918  -10.196 1.00 41.16  ? 436 ARG A NH1  1 
ATOM   6560  N  NH2  . ARG A  1 456 ? 115.258 -85.994  -11.170 1.00 46.76  ? 436 ARG A NH2  1 
ATOM   6561  H  H    . ARG A  1 456 ? 110.965 -92.017  -12.609 1.00 40.05  ? 436 ARG A H    1 
ATOM   6562  H  HA   . ARG A  1 456 ? 112.230 -90.868  -10.304 1.00 40.33  ? 436 ARG A HA   1 
ATOM   6563  H  HB2  . ARG A  1 456 ? 110.993 -89.758  -12.835 1.00 37.90  ? 436 ARG A HB2  1 
ATOM   6564  H  HB3  . ARG A  1 456 ? 111.737 -88.743  -11.566 1.00 37.88  ? 436 ARG A HB3  1 
ATOM   6565  H  HG2  . ARG A  1 456 ? 113.268 -91.055  -12.770 1.00 48.44  ? 436 ARG A HG2  1 
ATOM   6566  H  HG3  . ARG A  1 456 ? 113.195 -89.486  -13.604 1.00 49.39  ? 436 ARG A HG3  1 
ATOM   6567  H  HD2  . ARG A  1 456 ? 114.028 -89.770  -10.713 1.00 41.03  ? 436 ARG A HD2  1 
ATOM   6568  H  HD3  . ARG A  1 456 ? 115.178 -89.921  -12.072 1.00 42.18  ? 436 ARG A HD3  1 
ATOM   6569  H  HE   . ARG A  1 456 ? 113.770 -87.542  -12.437 1.00 43.98  ? 436 ARG A HE   1 
ATOM   6570  H  HH11 . ARG A  1 456 ? 116.039 -88.924  -10.066 1.00 41.59  ? 436 ARG A HH11 1 
ATOM   6571  H  HH12 . ARG A  1 456 ? 116.671 -87.355  -9.637  1.00 41.67  ? 436 ARG A HH12 1 
ATOM   6572  H  HH21 . ARG A  1 456 ? 114.662 -85.516  -11.838 1.00 46.00  ? 436 ARG A HH21 1 
ATOM   6573  H  HH22 . ARG A  1 456 ? 115.907 -85.451  -10.611 1.00 46.91  ? 436 ARG A HH22 1 
ATOM   6574  N  N    . ALA A  1 457 ? 109.009 -90.980  -10.199 1.00 36.49  ? 437 ALA A N    1 
ATOM   6575  C  CA   . ALA A  1 457 ? 107.888 -90.698  -9.307  1.00 36.53  ? 437 ALA A CA   1 
ATOM   6576  C  C    . ALA A  1 457 ? 108.187 -91.270  -7.907  1.00 38.05  ? 437 ALA A C    1 
ATOM   6577  O  O    . ALA A  1 457 ? 107.677 -90.731  -6.918  1.00 38.47  ? 437 ALA A O    1 
ATOM   6578  C  CB   . ALA A  1 457 ? 106.591 -91.283  -9.870  1.00 37.83  ? 437 ALA A CB   1 
ATOM   6579  H  H    . ALA A  1 457 ? 108.793 -91.679  -10.900 1.00 35.33  ? 437 ALA A H    1 
ATOM   6580  H  HA   . ALA A  1 457 ? 107.754 -89.621  -9.227  1.00 35.55  ? 437 ALA A HA   1 
ATOM   6581  H  HB1  . ALA A  1 457 ? 105.755 -90.872  -9.306  1.00 38.56  ? 437 ALA A HB1  1 
ATOM   6582  H  HB2  . ALA A  1 457 ? 106.501 -91.023  -10.923 1.00 35.95  ? 437 ALA A HB2  1 
ATOM   6583  H  HB3  . ALA A  1 457 ? 106.608 -92.366  -9.749  1.00 39.10  ? 437 ALA A HB3  1 
ATOM   6584  N  N    . PHE A  1 458 ? 109.081 -92.300  -7.810  1.00 34.71  ? 438 PHE A N    1 
ATOM   6585  C  CA   . PHE A  1 458 ? 109.516 -92.874  -6.538  1.00 36.03  ? 438 PHE A CA   1 
ATOM   6586  C  C    . PHE A  1 458 ? 110.351 -91.842  -5.771  1.00 43.22  ? 438 PHE A C    1 
ATOM   6587  O  O    . PHE A  1 458 ? 110.173 -91.670  -4.570  1.00 43.14  ? 438 PHE A O    1 
ATOM   6588  C  CB   . PHE A  1 458 ? 110.337 -94.175  -6.721  1.00 39.19  ? 438 PHE A CB   1 
ATOM   6589  C  CG   . PHE A  1 458 ? 109.555 -95.408  -7.130  1.00 40.88  ? 438 PHE A CG   1 
ATOM   6590  C  CD1  . PHE A  1 458 ? 109.001 -95.511  -8.394  1.00 44.26  ? 438 PHE A CD1  1 
ATOM   6591  C  CD2  . PHE A  1 458 ? 109.433 -96.492  -6.269  1.00 42.66  ? 438 PHE A CD2  1 
ATOM   6592  C  CE1  . PHE A  1 458 ? 108.284 -96.649  -8.768  1.00 45.20  ? 438 PHE A CE1  1 
ATOM   6593  C  CE2  . PHE A  1 458 ? 108.710 -97.625  -6.638  1.00 44.87  ? 438 PHE A CE2  1 
ATOM   6594  C  CZ   . PHE A  1 458 ? 108.136 -97.696  -7.882  1.00 43.21  ? 438 PHE A CZ   1 
ATOM   6595  H  H    . PHE A  1 458 ? 109.534 -92.726  -8.610  1.00 34.76  ? 438 PHE A H    1 
ATOM   6596  H  HA   . PHE A  1 458 ? 108.645 -93.112  -5.931  1.00 36.35  ? 438 PHE A HA   1 
ATOM   6597  H  HB2  . PHE A  1 458 ? 111.127 -94.012  -7.451  1.00 40.04  ? 438 PHE A HB2  1 
ATOM   6598  H  HB3  . PHE A  1 458 ? 110.799 -94.400  -5.761  1.00 38.75  ? 438 PHE A HB3  1 
ATOM   6599  H  HD1  . PHE A  1 458 ? 109.110 -94.697  -9.106  1.00 43.50  ? 438 PHE A HD1  1 
ATOM   6600  H  HD2  . PHE A  1 458 ? 109.864 -96.440  -5.272  1.00 44.42  ? 438 PHE A HD2  1 
ATOM   6601  H  HE1  . PHE A  1 458 ? 107.851 -96.699  -9.765  1.00 44.39  ? 438 PHE A HE1  1 
ATOM   6602  H  HE2  . PHE A  1 458 ? 108.610 -98.455  -5.940  1.00 44.72  ? 438 PHE A HE2  1 
ATOM   6603  H  HZ   . PHE A  1 458 ? 107.596 -98.593  -8.180  1.00 43.56  ? 438 PHE A HZ   1 
ATOM   6604  N  N    . GLU A  1 459 ? 111.259 -91.165  -6.485  1.00 41.45  ? 439 GLU A N    1 
ATOM   6605  C  CA   . GLU A  1 459 ? 112.107 -90.112  -5.933  1.00 42.62  ? 439 GLU A CA   1 
ATOM   6606  C  C    . GLU A  1 459 ? 111.283 -88.809  -5.662  1.00 44.80  ? 439 GLU A C    1 
ATOM   6607  O  O    . GLU A  1 459 ? 111.683 -88.000  -4.831  1.00 42.20  ? 439 GLU A O    1 
ATOM   6608  C  CB   . GLU A  1 459 ? 113.282 -89.819  -6.888  1.00 44.56  ? 439 GLU A CB   1 
ATOM   6609  C  CG   . GLU A  1 459 ? 114.221 -90.996  -7.035  1.00 65.14  ? 439 GLU A CG   1 
ATOM   6610  C  CD   . GLU A  1 459 ? 115.433 -90.737  -7.905  1.00 94.12  ? 439 GLU A CD   1 
ATOM   6611  O  OE1  . GLU A  1 459 ? 115.450 -91.214  -9.064  1.00 79.16  ? 439 GLU A OE1  1 
ATOM   6612  O  OE2  . GLU A  1 459 ? 116.360 -90.038  -7.431  1.00 92.01  ? 439 GLU A OE2  1 
ATOM   6613  H  H    . GLU A  1 459 ? 111.419 -91.333  -7.473  1.00 41.82  ? 439 GLU A H    1 
ATOM   6614  H  HA   . GLU A  1 459 ? 112.520 -90.451  -4.986  1.00 42.72  ? 439 GLU A HA   1 
ATOM   6615  H  HB2  . GLU A  1 459 ? 112.890 -89.577  -7.875  1.00 43.87  ? 439 GLU A HB2  1 
ATOM   6616  H  HB3  . GLU A  1 459 ? 113.851 -88.976  -6.497  1.00 44.49  ? 439 GLU A HB3  1 
ATOM   6617  H  HG2  . GLU A  1 459 ? 114.586 -91.263  -6.044  1.00 66.08  ? 439 GLU A HG2  1 
ATOM   6618  H  HG3  . GLU A  1 459 ? 113.680 -91.837  -7.462  1.00 65.19  ? 439 GLU A HG3  1 
ATOM   6619  N  N    . SER A  1 460 ? 110.161 -88.599  -6.388  1.00 39.57  ? 440 SER A N    1 
ATOM   6620  C  CA   . SER A  1 460 ? 109.312 -87.418  -6.185  1.00 39.26  ? 440 SER A CA   1 
ATOM   6621  C  C    . SER A  1 460 ? 108.453 -87.553  -4.918  1.00 43.67  ? 440 SER A C    1 
ATOM   6622  O  O    . SER A  1 460 ? 108.230 -86.561  -4.207  1.00 41.17  ? 440 SER A O    1 
ATOM   6623  C  CB   . SER A  1 460 ? 108.397 -87.198  -7.386  1.00 40.15  ? 440 SER A CB   1 
ATOM   6624  O  OG   . SER A  1 460 ? 109.134 -86.957  -8.572  1.00 38.01  ? 440 SER A OG   1 
ATOM   6625  H  H    . SER A  1 460 ? 109.847 -89.204  -7.137  1.00 38.08  ? 440 SER A H    1 
ATOM   6626  H  HA   . SER A  1 460 ? 109.936 -86.531  -6.080  1.00 39.47  ? 440 SER A HA   1 
ATOM   6627  H  HB2  . SER A  1 460 ? 107.779 -88.084  -7.520  1.00 40.06  ? 440 SER A HB2  1 
ATOM   6628  H  HB3  . SER A  1 460 ? 107.759 -86.339  -7.179  1.00 39.04  ? 440 SER A HB3  1 
ATOM   6629  H  HG   . SER A  1 460 ? 109.398 -87.811  -9.002  1.00 37.64  ? 440 SER A HG   1 
ATOM   6630  N  N    . PHE A  1 461 ? 107.949 -88.777  -4.647  1.00 40.47  ? 441 PHE A N    1 
ATOM   6631  C  CA   . PHE A  1 461 ? 107.096 -89.061  -3.471  1.00 38.94  ? 441 PHE A CA   1 
ATOM   6632  C  C    . PHE A  1 461 ? 107.734 -90.218  -2.682  1.00 44.78  ? 441 PHE A C    1 
ATOM   6633  O  O    . PHE A  1 461 ? 107.233 -91.352  -2.699  1.00 43.03  ? 441 PHE A O    1 
ATOM   6634  C  CB   . PHE A  1 461 ? 105.659 -89.379  -3.953  1.00 39.42  ? 441 PHE A CB   1 
ATOM   6635  C  CG   . PHE A  1 461 ? 105.174 -88.394  -4.998  1.00 40.28  ? 441 PHE A CG   1 
ATOM   6636  C  CD1  . PHE A  1 461 ? 104.973 -87.059  -4.679  1.00 42.11  ? 441 PHE A CD1  1 
ATOM   6637  C  CD2  . PHE A  1 461 ? 105.000 -88.787  -6.319  1.00 42.55  ? 441 PHE A CD2  1 
ATOM   6638  C  CE1  . PHE A  1 461 ? 104.569 -86.144  -5.654  1.00 42.77  ? 441 PHE A CE1  1 
ATOM   6639  C  CE2  . PHE A  1 461 ? 104.600 -87.868  -7.290  1.00 44.43  ? 441 PHE A CE2  1 
ATOM   6640  C  CZ   . PHE A  1 461 ? 104.390 -86.556  -6.947  1.00 41.94  ? 441 PHE A CZ   1 
ATOM   6641  H  H    . PHE A  1 461 ? 108.096 -89.592  -5.233  1.00 40.04  ? 441 PHE A H    1 
ATOM   6642  H  HA   . PHE A  1 461 ? 107.030 -88.194  -2.818  1.00 38.47  ? 441 PHE A HA   1 
ATOM   6643  H  HB2  . PHE A  1 461 ? 105.629 -90.371  -4.398  1.00 38.41  ? 441 PHE A HB2  1 
ATOM   6644  H  HB3  . PHE A  1 461 ? 104.981 -89.327  -3.104  1.00 39.44  ? 441 PHE A HB3  1 
ATOM   6645  H  HD1  . PHE A  1 461 ? 105.128 -86.720  -3.656  1.00 41.94  ? 441 PHE A HD1  1 
ATOM   6646  H  HD2  . PHE A  1 461 ? 105.165 -89.824  -6.606  1.00 43.14  ? 441 PHE A HD2  1 
ATOM   6647  H  HE1  . PHE A  1 461 ? 104.407 -85.098  -5.394  1.00 42.04  ? 441 PHE A HE1  1 
ATOM   6648  H  HE2  . PHE A  1 461 ? 104.454 -88.193  -8.319  1.00 43.74  ? 441 PHE A HE2  1 
ATOM   6649  H  HZ   . PHE A  1 461 ? 104.074 -85.841  -7.708  1.00 43.29  ? 441 PHE A HZ   1 
ATOM   6650  N  N    . PRO A  1 462 ? 108.914 -89.974  -2.051  1.00 41.76  ? 442 PRO A N    1 
ATOM   6651  C  CA   . PRO A  1 462 ? 109.636 -91.072  -1.385  1.00 41.54  ? 442 PRO A CA   1 
ATOM   6652  C  C    . PRO A  1 462 ? 108.923 -91.662  -0.169  1.00 46.32  ? 442 PRO A C    1 
ATOM   6653  O  O    . PRO A  1 462 ? 109.133 -92.843  0.098   1.00 46.91  ? 442 PRO A O    1 
ATOM   6654  C  CB   . PRO A  1 462 ? 110.967 -90.425  -0.975  1.00 43.42  ? 442 PRO A CB   1 
ATOM   6655  C  CG   . PRO A  1 462 ? 110.653 -88.993  -0.854  1.00 46.61  ? 442 PRO A CG   1 
ATOM   6656  C  CD   . PRO A  1 462 ? 109.669 -88.710  -1.948  1.00 42.10  ? 442 PRO A CD   1 
ATOM   6657  H  HA   . PRO A  1 462 ? 109.840 -91.876  -2.090  1.00 41.06  ? 442 PRO A HA   1 
ATOM   6658  H  HB2  . PRO A  1 462 ? 111.326 -90.839  -0.034  1.00 42.89  ? 442 PRO A HB2  1 
ATOM   6659  H  HB3  . PRO A  1 462 ? 111.696 -90.586  -1.767  1.00 44.04  ? 442 PRO A HB3  1 
ATOM   6660  H  HG2  . PRO A  1 462 ? 110.209 -88.803  0.122   1.00 47.70  ? 442 PRO A HG2  1 
ATOM   6661  H  HG3  . PRO A  1 462 ? 111.557 -88.401  -0.985  1.00 47.20  ? 442 PRO A HG3  1 
ATOM   6662  H  HD2  . PRO A  1 462 ? 109.013 -87.888  -1.669  1.00 42.43  ? 442 PRO A HD2  1 
ATOM   6663  H  HD3  . PRO A  1 462 ? 110.193 -88.502  -2.879  1.00 41.97  ? 442 PRO A HD3  1 
ATOM   6664  N  N    . GLN A  1 463 ? 108.105 -90.871  0.557   1.00 43.61  ? 443 GLN A N    1 
ATOM   6665  C  CA   . GLN A  1 463 ? 107.339 -91.382  1.702   1.00 44.12  ? 443 GLN A CA   1 
ATOM   6666  C  C    . GLN A  1 463 ? 106.303 -92.406  1.222   1.00 47.90  ? 443 GLN A C    1 
ATOM   6667  O  O    . GLN A  1 463 ? 106.139 -93.446  1.861   1.00 48.27  ? 443 GLN A O    1 
ATOM   6668  C  CB   . GLN A  1 463 ? 106.651 -90.246  2.479   1.00 45.28  ? 443 GLN A CB   1 
ATOM   6669  H  H    . GLN A  1 463 ? 107.957 -89.885  0.369   1.00 43.91  ? 443 GLN A H    1 
ATOM   6670  H  HA   . GLN A  1 463 ? 108.027 -91.898  2.371   1.00 44.25  ? 443 GLN A HA   1 
ATOM   6671  N  N    . ASP A  1 464 ? 105.658 -92.144  0.072   1.00 43.16  ? 444 ASP A N    1 
ATOM   6672  C  CA   . ASP A  1 464 ? 104.725 -93.105  -0.530  1.00 43.40  ? 444 ASP A CA   1 
ATOM   6673  C  C    . ASP A  1 464 ? 105.463 -94.362  -1.027  1.00 45.67  ? 444 ASP A C    1 
ATOM   6674  O  O    . ASP A  1 464 ? 104.973 -95.481  -0.832  1.00 40.79  ? 444 ASP A O    1 
ATOM   6675  C  CB   . ASP A  1 464 ? 103.969 -92.471  -1.710  1.00 44.67  ? 444 ASP A CB   1 
ATOM   6676  C  CG   . ASP A  1 464 ? 102.948 -91.419  -1.332  1.00 55.50  ? 444 ASP A CG   1 
ATOM   6677  O  OD1  . ASP A  1 464 ? 102.652 -91.278  -0.118  1.00 56.35  ? 444 ASP A OD1  1 
ATOM   6678  O  OD2  . ASP A  1 464 ? 102.392 -90.777  -2.251  1.00 56.70  ? 444 ASP A OD2  1 
ATOM   6679  H  H    . ASP A  1 464 ? 105.750 -91.278  -0.447  1.00 42.33  ? 444 ASP A H    1 
ATOM   6680  H  HA   . ASP A  1 464 ? 103.999 -93.428  0.216   1.00 44.16  ? 444 ASP A HA   1 
ATOM   6681  H  HB2  . ASP A  1 464 ? 104.689 -91.993  -2.370  1.00 44.85  ? 444 ASP A HB2  1 
ATOM   6682  H  HB3  . ASP A  1 464 ? 103.445 -93.256  -2.256  1.00 44.98  ? 444 ASP A HB3  1 
ATOM   6683  N  N    . ALA A  1 465 ? 106.628 -94.178  -1.708  1.00 43.17  ? 445 ALA A N    1 
ATOM   6684  C  CA   . ALA A  1 465 ? 107.408 -95.304  -2.236  1.00 41.56  ? 445 ALA A CA   1 
ATOM   6685  C  C    . ALA A  1 465 ? 107.863 -96.208  -1.099  1.00 44.93  ? 445 ALA A C    1 
ATOM   6686  O  O    . ALA A  1 465 ? 107.784 -97.442  -1.246  1.00 42.52  ? 445 ALA A O    1 
ATOM   6687  C  CB   . ALA A  1 465 ? 108.614 -94.808  -3.023  1.00 41.81  ? 445 ALA A CB   1 
ATOM   6688  H  H    . ALA A  1 465 ? 107.040 -93.268  -1.892  1.00 43.35  ? 445 ALA A H    1 
ATOM   6689  H  HA   . ALA A  1 465 ? 106.784 -95.890  -2.909  1.00 41.30  ? 445 ALA A HA   1 
ATOM   6690  H  HB1  . ALA A  1 465 ? 109.170 -95.672  -3.382  1.00 40.91  ? 445 ALA A HB1  1 
ATOM   6691  H  HB2  . ALA A  1 465 ? 108.272 -94.208  -3.865  1.00 41.61  ? 445 ALA A HB2  1 
ATOM   6692  H  HB3  . ALA A  1 465 ? 109.249 -94.205  -2.376  1.00 41.97  ? 445 ALA A HB3  1 
ATOM   6693  N  N    . ASP A  1 466 ? 108.312 -95.611  0.045   1.00 43.24  ? 446 ASP A N    1 
ATOM   6694  C  CA   . ASP A  1 466 ? 108.782 -96.397  1.197   1.00 45.97  ? 446 ASP A CA   1 
ATOM   6695  C  C    . ASP A  1 466 ? 107.664 -97.264  1.771   1.00 50.54  ? 446 ASP A C    1 
ATOM   6696  O  O    . ASP A  1 466 ? 107.924 -98.412  2.101   1.00 52.82  ? 446 ASP A O    1 
ATOM   6697  C  CB   . ASP A  1 466 ? 109.349 -95.488  2.315   1.00 49.16  ? 446 ASP A CB   1 
ATOM   6698  C  CG   . ASP A  1 466 ? 110.632 -94.734  1.981   1.00 54.03  ? 446 ASP A CG   1 
ATOM   6699  O  OD1  . ASP A  1 466 ? 111.283 -95.075  0.967   1.00 53.82  ? 446 ASP A OD1  1 
ATOM   6700  O  OD2  . ASP A  1 466 ? 110.956 -93.778  2.710   1.00 58.78  ? 446 ASP A OD2  1 
ATOM   6701  H  H    . ASP A  1 466 ? 108.349 -94.610  0.202   1.00 42.28  ? 446 ASP A H    1 
ATOM   6702  H  HA   . ASP A  1 466 ? 109.580 -97.066  0.876   1.00 46.50  ? 446 ASP A HA   1 
ATOM   6703  H  HB2  . ASP A  1 466 ? 108.592 -94.750  2.574   1.00 48.70  ? 446 ASP A HB2  1 
ATOM   6704  H  HB3  . ASP A  1 466 ? 109.556 -96.110  3.186   1.00 49.76  ? 446 ASP A HB3  1 
ATOM   6705  N  N    . LYS A  1 467 ? 106.423 -96.745  1.862   1.00 47.07  ? 447 LYS A N    1 
ATOM   6706  C  CA   . LYS A  1 467 ? 105.301 -97.524  2.416   1.00 47.34  ? 447 LYS A CA   1 
ATOM   6707  C  C    . LYS A  1 467 ? 104.807 -98.547  1.389   1.00 48.17  ? 447 LYS A C    1 
ATOM   6708  O  O    . LYS A  1 467 ? 104.607 -99.687  1.750   1.00 48.98  ? 447 LYS A O    1 
ATOM   6709  C  CB   . LYS A  1 467 ? 104.148 -96.612  2.955   1.00 49.66  ? 447 LYS A CB   1 
ATOM   6710  C  CG   . LYS A  1 467 ? 102.845 -96.522  2.143   1.00 62.16  ? 447 LYS A CG   1 
ATOM   6711  C  CD   . LYS A  1 467 ? 101.935 -95.344  2.559   1.00 59.88  ? 447 LYS A CD   1 
ATOM   6712  C  CE   . LYS A  1 467 ? 100.660 -95.311  1.743   1.00 66.98  ? 447 LYS A CE   1 
ATOM   6713  N  NZ   . LYS A  1 467 ? 99.625  -94.416  2.331   1.00 69.37  ? 447 LYS A NZ   1 
ATOM   6714  H  H    . LYS A  1 467 ? 106.173 -95.808  1.565   1.00 46.51  ? 447 LYS A H    1 
ATOM   6715  H  HA   . LYS A  1 467 ? 105.654 -98.092  3.276   1.00 47.67  ? 447 LYS A HA   1 
ATOM   6716  H  HB2  . LYS A  1 467 ? 103.878 -96.983  3.943   1.00 49.37  ? 447 LYS A HB2  1 
ATOM   6717  H  HB3  . LYS A  1 467 ? 104.521 -95.594  3.056   1.00 50.21  ? 447 LYS A HB3  1 
ATOM   6718  H  HG2  . LYS A  1 467 ? 103.090 -96.346  1.098   1.00 62.47  ? 447 LYS A HG2  1 
ATOM   6719  H  HG3  . LYS A  1 467 ? 102.277 -97.444  2.264   1.00 61.85  ? 447 LYS A HG3  1 
ATOM   6720  H  HD2  . LYS A  1 467 ? 101.667 -95.443  3.610   1.00 60.36  ? 447 LYS A HD2  1 
ATOM   6721  H  HD3  . LYS A  1 467 ? 102.467 -94.408  2.393   1.00 59.55  ? 447 LYS A HD3  1 
ATOM   6722  H  HE2  . LYS A  1 467 ? 100.886 -94.957  0.738   1.00 66.60  ? 447 LYS A HE2  1 
ATOM   6723  H  HE3  . LYS A  1 467 ? 100.245 -96.317  1.696   1.00 67.32  ? 447 LYS A HE3  1 
ATOM   6724  H  HZ1  . LYS A  1 467 ? 98.834  -94.343  1.700   1.00 68.69  ? 447 LYS A HZ1  1 
ATOM   6725  H  HZ2  . LYS A  1 467 ? 99.303  -94.790  3.218   1.00 69.55  ? 447 LYS A HZ2  1 
ATOM   6726  H  HZ3  . LYS A  1 467 ? 100.013 -93.492  2.488   1.00 69.46  ? 447 LYS A HZ3  1 
ATOM   6727  N  N    . LEU A  1 468 ? 104.644 -98.167  0.136   1.00 44.84  ? 448 LEU A N    1 
ATOM   6728  C  CA   . LEU A  1 468 ? 104.112 -99.075  -0.895  1.00 44.42  ? 448 LEU A CA   1 
ATOM   6729  C  C    . LEU A  1 468 ? 105.133 -100.092 -1.452  1.00 51.42  ? 448 LEU A C    1 
ATOM   6730  O  O    . LEU A  1 468 ? 104.746 -101.220 -1.769  1.00 49.77  ? 448 LEU A O    1 
ATOM   6731  C  CB   . LEU A  1 468 ? 103.535 -98.270  -2.062  1.00 42.78  ? 448 LEU A CB   1 
ATOM   6732  C  CG   . LEU A  1 468 ? 102.277 -97.470  -1.735  1.00 49.00  ? 448 LEU A CG   1 
ATOM   6733  C  CD1  . LEU A  1 468 ? 102.012 -96.424  -2.788  1.00 50.04  ? 448 LEU A CD1  1 
ATOM   6734  C  CD2  . LEU A  1 468 ? 101.056 -98.376  -1.570  1.00 51.97  ? 448 LEU A CD2  1 
ATOM   6735  H  H    . LEU A  1 468 ? 104.848 -97.233  -0.205  1.00 44.98  ? 448 LEU A H    1 
ATOM   6736  H  HA   . LEU A  1 468 ? 103.304 -99.658  -0.455  1.00 45.60  ? 448 LEU A HA   1 
ATOM   6737  H  HB2  . LEU A  1 468 ? 104.295 -97.574  -2.415  1.00 41.83  ? 448 LEU A HB2  1 
ATOM   6738  H  HB3  . LEU A  1 468 ? 103.283 -98.960  -2.863  1.00 42.35  ? 448 LEU A HB3  1 
ATOM   6739  H  HG   . LEU A  1 468 ? 102.424 -96.948  -0.792  1.00 48.75  ? 448 LEU A HG   1 
ATOM   6740  H  HD11 . LEU A  1 468 ? 101.103 -95.881  -2.534  1.00 49.67  ? 448 LEU A HD11 1 
ATOM   6741  H  HD12 . LEU A  1 468 ? 102.853 -95.734  -2.830  1.00 51.11  ? 448 LEU A HD12 1 
ATOM   6742  H  HD13 . LEU A  1 468 ? 101.892 -96.929  -3.744  1.00 49.90  ? 448 LEU A HD13 1 
ATOM   6743  H  HD21 . LEU A  1 468 ? 100.160 -97.759  -1.512  1.00 50.59  ? 448 LEU A HD21 1 
ATOM   6744  H  HD22 . LEU A  1 468 ? 100.997 -99.063  -2.412  1.00 50.69  ? 448 LEU A HD22 1 
ATOM   6745  H  HD23 . LEU A  1 468 ? 101.156 -98.941  -0.644  1.00 53.13  ? 448 LEU A HD23 1 
ATOM   6746  N  N    . TYR A  1 469 ? 106.404 -99.683  -1.626  1.00 50.92  ? 449 TYR A N    1 
ATOM   6747  C  CA   . TYR A  1 469 ? 107.438 -100.526 -2.221  1.00 51.68  ? 449 TYR A CA   1 
ATOM   6748  C  C    . TYR A  1 469 ? 108.708 -100.503 -1.350  1.00 57.95  ? 449 TYR A C    1 
ATOM   6749  O  O    . TYR A  1 469 ? 109.710 -99.915  -1.745  1.00 57.28  ? 449 TYR A O    1 
ATOM   6750  C  CB   . TYR A  1 469 ? 107.728 -100.038 -3.661  1.00 51.49  ? 449 TYR A CB   1 
ATOM   6751  C  CG   . TYR A  1 469 ? 106.475 -99.848  -4.492  1.00 51.53  ? 449 TYR A CG   1 
ATOM   6752  C  CD1  . TYR A  1 469 ? 105.692 -100.935 -4.862  1.00 53.44  ? 449 TYR A CD1  1 
ATOM   6753  C  CD2  . TYR A  1 469 ? 106.005 -98.573  -4.804  1.00 51.36  ? 449 TYR A CD2  1 
ATOM   6754  C  CE1  . TYR A  1 469 ? 104.503 -100.767 -5.573  1.00 53.41  ? 449 TYR A CE1  1 
ATOM   6755  C  CE2  . TYR A  1 469 ? 104.807 -98.392  -5.498  1.00 51.14  ? 449 TYR A CE2  1 
ATOM   6756  C  CZ   . TYR A  1 469 ? 104.067 -99.493  -5.897  1.00 58.98  ? 449 TYR A CZ   1 
ATOM   6757  O  OH   . TYR A  1 469 ? 102.901 -99.337  -6.603  1.00 63.51  ? 449 TYR A OH   1 
ATOM   6758  H  H    . TYR A  1 469 ? 106.750 -98.767  -1.356  1.00 51.08  ? 449 TYR A H    1 
ATOM   6759  H  HA   . TYR A  1 469 ? 107.111 -101.562 -2.287  1.00 53.19  ? 449 TYR A HA   1 
ATOM   6760  H  HB2  . TYR A  1 469 ? 108.237 -99.076  -3.625  1.00 51.44  ? 449 TYR A HB2  1 
ATOM   6761  H  HB3  . TYR A  1 469 ? 108.360 -100.773 -4.153  1.00 51.61  ? 449 TYR A HB3  1 
ATOM   6762  H  HD1  . TYR A  1 469 ? 106.024 -101.941 -4.607  1.00 55.12  ? 449 TYR A HD1  1 
ATOM   6763  H  HD2  . TYR A  1 469 ? 106.580 -97.698  -4.507  1.00 51.03  ? 449 TYR A HD2  1 
ATOM   6764  H  HE1  . TYR A  1 469 ? 103.919 -101.639 -5.862  1.00 53.35  ? 449 TYR A HE1  1 
ATOM   6765  H  HE2  . TYR A  1 469 ? 104.488 -97.391  -5.779  1.00 50.50  ? 449 TYR A HE2  1 
ATOM   6766  H  HH   . TYR A  1 469 ? 102.796 -98.405  -6.932  1.00 63.59  ? 449 TYR A HH   1 
ATOM   6767  N  N    . PRO A  1 470 ? 108.693 -101.148 -0.166  1.00 57.57  ? 450 PRO A N    1 
ATOM   6768  C  CA   . PRO A  1 470 ? 109.893 -101.138 0.703   1.00 58.23  ? 450 PRO A CA   1 
ATOM   6769  C  C    . PRO A  1 470 ? 111.176 -101.589 -0.034  1.00 61.94  ? 450 PRO A C    1 
ATOM   6770  O  O    . PRO A  1 470 ? 111.083 -102.547 -0.816  1.00 61.69  ? 450 PRO A O    1 
ATOM   6771  C  CB   . PRO A  1 470 ? 109.551 -102.173 1.780   1.00 60.49  ? 450 PRO A CB   1 
ATOM   6772  C  CG   . PRO A  1 470 ? 108.095 -102.184 1.869   1.00 64.42  ? 450 PRO A CG   1 
ATOM   6773  C  CD   . PRO A  1 470 ? 107.576 -101.871 0.477   1.00 60.10  ? 450 PRO A CD   1 
ATOM   6774  H  HA   . PRO A  1 470 ? 109.951 -100.163 1.189   1.00 58.27  ? 450 PRO A HA   1 
ATOM   6775  H  HB2  . PRO A  1 470 ? 109.911 -103.154 1.470   1.00 60.53  ? 450 PRO A HB2  1 
ATOM   6776  H  HB3  . PRO A  1 470 ? 110.008 -101.882 2.724   1.00 61.02  ? 450 PRO A HB3  1 
ATOM   6777  H  HG2  . PRO A  1 470 ? 107.755 -103.169 2.184   1.00 64.40  ? 450 PRO A HG2  1 
ATOM   6778  H  HG3  . PRO A  1 470 ? 107.777 -101.428 2.583   1.00 63.38  ? 450 PRO A HG3  1 
ATOM   6779  H  HD2  . PRO A  1 470 ? 107.337 -102.784 -0.067  1.00 60.11  ? 450 PRO A HD2  1 
ATOM   6780  H  HD3  . PRO A  1 470 ? 106.709 -101.220 0.574   1.00 60.39  ? 450 PRO A HD3  1 
ATOM   6781  N  N    . ASN A  1 471 ? 112.348 -100.966 0.209   1.00 57.70  ? 451 ASN A N    1 
ATOM   6782  C  CA   . ASN A  1 471 ? 113.628 -101.346 -0.446  1.00 57.27  ? 451 ASN A CA   1 
ATOM   6783  C  C    . ASN A  1 471 ? 113.668 -101.104 -2.018  1.00 57.39  ? 451 ASN A C    1 
ATOM   6784  O  O    . ASN A  1 471 ? 114.551 -101.648 -2.701  1.00 55.95  ? 451 ASN A O    1 
ATOM   6785  C  CB   . ASN A  1 471 ? 114.028 -102.813 -0.119  1.00 62.82  ? 451 ASN A CB   1 
ATOM   6786  H  H    . ASN A  1 471 ? 112.447 -100.196 0.863   1.00 57.12  ? 451 ASN A H    1 
ATOM   6787  H  HA   . ASN A  1 471 ? 114.402 -100.711 -0.019  1.00 57.76  ? 451 ASN A HA   1 
ATOM   6788  N  N    . TRP A  1 472 ? 112.783 -100.216 -2.556  1.00 52.25  ? 452 TRP A N    1 
ATOM   6789  C  CA   . TRP A  1 472 ? 112.796 -99.743  -3.956  1.00 50.98  ? 452 TRP A CA   1 
ATOM   6790  C  C    . TRP A  1 472 ? 114.159 -99.107  -4.311  1.00 53.85  ? 452 TRP A C    1 
ATOM   6791  O  O    . TRP A  1 472 ? 114.629 -99.265  -5.443  1.00 52.21  ? 452 TRP A O    1 
ATOM   6792  C  CB   . TRP A  1 472 ? 111.659 -98.719  -4.226  1.00 48.88  ? 452 TRP A CB   1 
ATOM   6793  C  CG   . TRP A  1 472 ? 111.762 -97.424  -3.454  1.00 49.85  ? 452 TRP A CG   1 
ATOM   6794  C  CD1  . TRP A  1 472 ? 111.251 -97.153  -2.215  1.00 52.60  ? 452 TRP A CD1  1 
ATOM   6795  C  CD2  . TRP A  1 472 ? 112.366 -96.215  -3.913  1.00 49.71  ? 452 TRP A CD2  1 
ATOM   6796  N  NE1  . TRP A  1 472 ? 111.534 -95.859  -1.857  1.00 51.97  ? 452 TRP A NE1  1 
ATOM   6797  C  CE2  . TRP A  1 472 ? 112.200 -95.250  -2.889  1.00 53.76  ? 452 TRP A CE2  1 
ATOM   6798  C  CE3  . TRP A  1 472 ? 113.076 -95.860  -5.074  1.00 50.94  ? 452 TRP A CE3  1 
ATOM   6799  C  CZ2  . TRP A  1 472 ? 112.718 -93.960  -2.991  1.00 52.57  ? 452 TRP A CZ2  1 
ATOM   6800  C  CZ3  . TRP A  1 472 ? 113.577 -94.571  -5.178  1.00 52.31  ? 452 TRP A CZ3  1 
ATOM   6801  C  CH2  . TRP A  1 472 ? 113.405 -93.641  -4.140  1.00 52.65  ? 452 TRP A CH2  1 
ATOM   6802  H  H    . TRP A  1 472 ? 112.052 -99.785  -2.005  1.00 52.35  ? 452 TRP A H    1 
ATOM   6803  H  HA   . TRP A  1 472 ? 112.644 -100.578 -4.637  1.00 51.59  ? 452 TRP A HA   1 
ATOM   6804  H  HB2  . TRP A  1 472 ? 111.674 -98.454  -5.281  1.00 47.88  ? 452 TRP A HB2  1 
ATOM   6805  H  HB3  . TRP A  1 472 ? 110.697 -99.172  -3.993  1.00 48.73  ? 452 TRP A HB3  1 
ATOM   6806  H  HD1  . TRP A  1 472 ? 110.695 -97.844  -1.586  1.00 52.43  ? 452 TRP A HD1  1 
ATOM   6807  H  HE1  . TRP A  1 472 ? 111.242 -95.406  -0.996  1.00 51.72  ? 452 TRP A HE1  1 
ATOM   6808  H  HE3  . TRP A  1 472 ? 113.230 -96.581  -5.876  1.00 50.99  ? 452 TRP A HE3  1 
ATOM   6809  H  HZ2  . TRP A  1 472 ? 112.540 -93.229  -2.204  1.00 52.49  ? 452 TRP A HZ2  1 
ATOM   6810  H  HZ3  . TRP A  1 472 ? 114.120 -94.282  -6.077  1.00 52.38  ? 452 TRP A HZ3  1 
ATOM   6811  H  HH2  . TRP A  1 472 ? 113.793 -92.630  -4.258  1.00 53.05  ? 452 TRP A HH2  1 
ATOM   6812  N  N    . ARG A  1 473 ? 114.793 -98.406  -3.355  1.00 50.76  ? 453 ARG A N    1 
ATOM   6813  C  CA   . ARG A  1 473 ? 116.094 -97.746  -3.591  1.00 51.78  ? 453 ARG A CA   1 
ATOM   6814  C  C    . ARG A  1 473 ? 117.194 -98.731  -3.990  1.00 56.52  ? 453 ARG A C    1 
ATOM   6815  O  O    . ARG A  1 473 ? 117.957 -98.443  -4.915  1.00 54.60  ? 453 ARG A O    1 
ATOM   6816  C  CB   . ARG A  1 473 ? 116.553 -96.964  -2.349  1.00 53.07  ? 453 ARG A CB   1 
ATOM   6817  C  CG   . ARG A  1 473 ? 115.709 -95.745  -2.084  1.00 62.24  ? 453 ARG A CG   1 
ATOM   6818  C  CD   . ARG A  1 473 ? 116.194 -94.979  -0.861  1.00 80.67  ? 453 ARG A CD   1 
ATOM   6819  N  NE   . ARG A  1 473 ? 115.197 -93.999  -0.432  1.00 77.76  ? 453 ARG A NE   1 
ATOM   6820  C  CZ   . ARG A  1 473 ? 115.011 -92.805  -0.990  1.00 84.58  ? 453 ARG A CZ   1 
ATOM   6821  N  NH1  . ARG A  1 473 ? 115.778 -92.405  -2.007  1.00 61.96  ? 453 ARG A NH1  1 
ATOM   6822  N  NH2  . ARG A  1 473 ? 114.062 -91.995  -0.530  1.00 75.12  ? 453 ARG A NH2  1 
ATOM   6823  H  H    . ARG A  1 473 ? 114.434 -98.294  -2.412  1.00 50.40  ? 453 ARG A H    1 
ATOM   6824  H  HA   . ARG A  1 473 ? 115.975 -97.030  -4.402  1.00 51.48  ? 453 ARG A HA   1 
ATOM   6825  H  HB2  . ARG A  1 473 ? 116.485 -97.610  -1.475  1.00 53.54  ? 453 ARG A HB2  1 
ATOM   6826  H  HB3  . ARG A  1 473 ? 117.582 -96.637  -2.491  1.00 53.60  ? 453 ARG A HB3  1 
ATOM   6827  H  HG2  . ARG A  1 473 ? 115.740 -95.091  -2.953  1.00 61.04  ? 453 ARG A HG2  1 
ATOM   6828  H  HG3  . ARG A  1 473 ? 114.687 -96.059  -1.877  1.00 61.81  ? 453 ARG A HG3  1 
ATOM   6829  H  HD2  . ARG A  1 473 ? 116.323 -95.680  -0.038  1.00 81.51  ? 453 ARG A HD2  1 
ATOM   6830  H  HD3  . ARG A  1 473 ? 117.146 -94.494  -1.069  1.00 81.05  ? 453 ARG A HD3  1 
ATOM   6831  H  HE   . ARG A  1 473 ? 114.580 -94.269  0.328   1.00 77.19  ? 453 ARG A HE   1 
ATOM   6832  H  HH11 . ARG A  1 473 ? 116.521 -92.969  -2.403  1.00 61.48  ? 453 ARG A HH11 1 
ATOM   6833  H  HH12 . ARG A  1 473 ? 115.632 -91.480  -2.400  1.00 61.93  ? 453 ARG A HH12 1 
ATOM   6834  H  HH21 . ARG A  1 473 ? 113.467 -92.283  0.242   1.00 74.78  ? 453 ARG A HH21 1 
ATOM   6835  H  HH22 . ARG A  1 473 ? 113.938 -91.073  -0.934  1.00 74.96  ? 453 ARG A HH22 1 
ATOM   6836  N  N    . ALA A  1 474 ? 117.269 -99.893  -3.305  1.00 55.37  ? 454 ALA A N    1 
ATOM   6837  C  CA   . ALA A  1 474 ? 118.258 -100.926 -3.612  1.00 57.06  ? 454 ALA A CA   1 
ATOM   6838  C  C    . ALA A  1 474 ? 118.068 -101.504 -5.031  1.00 62.30  ? 454 ALA A C    1 
ATOM   6839  O  O    . ALA A  1 474 ? 119.055 -101.868 -5.674  1.00 64.03  ? 454 ALA A O    1 
ATOM   6840  C  CB   . ALA A  1 474 ? 118.173 -102.052 -2.593  1.00 58.80  ? 454 ALA A CB   1 
ATOM   6841  H  H    . ALA A  1 474 ? 116.640 -100.145 -2.549  1.00 55.30  ? 454 ALA A H    1 
ATOM   6842  H  HA   . ALA A  1 474 ? 119.253 -100.488 -3.561  1.00 57.27  ? 454 ALA A HA   1 
ATOM   6843  H  HB1  . ALA A  1 474 ? 118.905 -102.818 -2.848  1.00 59.40  ? 454 ALA A HB1  1 
ATOM   6844  H  HB2  . ALA A  1 474 ? 118.386 -101.647 -1.605  1.00 59.22  ? 454 ALA A HB2  1 
ATOM   6845  H  HB3  . ALA A  1 474 ? 117.172 -102.480 -2.614  1.00 58.46  ? 454 ALA A HB3  1 
ATOM   6846  N  N    . LYS A  1 475 ? 116.808 -101.561 -5.510  1.00 56.54  ? 455 LYS A N    1 
ATOM   6847  C  CA   . LYS A  1 475 ? 116.458 -102.074 -6.829  1.00 74.73  ? 455 LYS A CA   1 
ATOM   6848  C  C    . LYS A  1 475 ? 116.417 -100.939 -7.867  1.00 96.56  ? 455 LYS A C    1 
ATOM   6849  O  O    . LYS A  1 475 ? 117.007 -99.877  -7.692  1.00 71.04  ? 455 LYS A O    1 
ATOM   6850  C  CB   . LYS A  1 475 ? 115.093 -102.787 -6.758  1.00 76.49  ? 455 LYS A CB   1 
ATOM   6851  C  CG   . LYS A  1 475 ? 115.020 -103.852 -5.652  1.00 83.56  ? 455 LYS A CG   1 
ATOM   6852  C  CD   . LYS A  1 475 ? 113.704 -104.632 -5.642  1.00 96.42  ? 455 LYS A CD   1 
ATOM   6853  C  CE   . LYS A  1 475 ? 112.984 -104.591 -4.309  1.00 105.49 ? 455 LYS A CE   1 
ATOM   6854  N  NZ   . LYS A  1 475 ? 111.641 -105.232 -4.383  1.00 107.09 ? 455 LYS A NZ   1 
ATOM   6855  H  H    . LYS A  1 475 ? 115.994 -101.262 -4.985  1.00 56.38  ? 455 LYS A H    1 
ATOM   6856  H  HA   . LYS A  1 475 ? 117.193 -102.812 -7.146  1.00 75.28  ? 455 LYS A HA   1 
ATOM   6857  H  HB2  . LYS A  1 475 ? 114.329 -102.039 -6.556  1.00 75.91  ? 455 LYS A HB2  1 
ATOM   6858  H  HB3  . LYS A  1 475 ? 114.899 -103.273 -7.713  1.00 76.55  ? 455 LYS A HB3  1 
ATOM   6859  H  HG2  . LYS A  1 475 ? 115.822 -104.570 -5.818  1.00 84.18  ? 455 LYS A HG2  1 
ATOM   6860  H  HG3  . LYS A  1 475 ? 115.140 -103.387 -4.676  1.00 83.11  ? 455 LYS A HG3  1 
ATOM   6861  H  HD2  . LYS A  1 475 ? 113.033 -104.239 -6.403  1.00 95.95  ? 455 LYS A HD2  1 
ATOM   6862  H  HD3  . LYS A  1 475 ? 113.924 -105.674 -5.867  1.00 97.06  ? 455 LYS A HD3  1 
ATOM   6863  H  HE2  . LYS A  1 475 ? 113.577 -105.122 -3.565  1.00 106.39 ? 455 LYS A HE2  1 
ATOM   6864  H  HE3  . LYS A  1 475 ? 112.850 -103.557 -3.997  1.00 105.35 ? 455 LYS A HE3  1 
ATOM   6865  H  HZ1  . LYS A  1 475 ? 111.215 -105.246 -3.461  1.00 107.05 ? 455 LYS A HZ1  1 
ATOM   6866  H  HZ2  . LYS A  1 475 ? 111.043 -104.714 -5.018  1.00 106.67 ? 455 LYS A HZ2  1 
ATOM   6867  H  HZ3  . LYS A  1 475 ? 111.729 -106.184 -4.723  1.00 107.29 ? 455 LYS A HZ3  1 
ATOM   6868  N  N    . MET B  1 21  ? 103.197 -83.936  5.028   1.00 60.03  ? 1   MET B N    1 
ATOM   6869  C  CA   . MET B  1 21  ? 103.932 -82.691  4.800   1.00 59.33  ? 1   MET B CA   1 
ATOM   6870  C  C    . MET B  1 21  ? 103.457 -81.572  5.741   1.00 57.86  ? 1   MET B C    1 
ATOM   6871  O  O    . MET B  1 21  ? 102.258 -81.281  5.781   1.00 56.33  ? 1   MET B O    1 
ATOM   6872  C  CB   . MET B  1 21  ? 103.755 -82.235  3.343   1.00 61.68  ? 1   MET B CB   1 
ATOM   6873  C  CG   . MET B  1 21  ? 104.525 -80.967  2.992   1.00 66.12  ? 1   MET B CG   1 
ATOM   6874  S  SD   . MET B  1 21  ? 104.027 -80.348  1.381   1.00 69.58  ? 1   MET B SD   1 
ATOM   6875  C  CE   . MET B  1 21  ? 105.041 -78.864  1.292   1.00 66.85  ? 1   MET B CE   1 
ATOM   6876  H  HA   . MET B  1 21  ? 104.992 -82.878  4.962   1.00 60.18  ? 1   MET B HA   1 
ATOM   6877  H  HB2  . MET B  1 21  ? 104.109 -83.026  2.684   1.00 62.37  ? 1   MET B HB2  1 
ATOM   6878  H  HB3  . MET B  1 21  ? 102.699 -82.043  3.162   1.00 60.81  ? 1   MET B HB3  1 
ATOM   6879  H  HG2  . MET B  1 21  ? 104.323 -80.172  3.708   1.00 66.30  ? 1   MET B HG2  1 
ATOM   6880  H  HG3  . MET B  1 21  ? 105.593 -81.184  2.966   1.00 66.69  ? 1   MET B HG3  1 
ATOM   6881  H  HE1  . MET B  1 21  ? 104.785 -78.315  0.387   1.00 66.48  ? 1   MET B HE1  1 
ATOM   6882  H  HE2  . MET B  1 21  ? 104.843 -78.247  2.167   1.00 67.03  ? 1   MET B HE2  1 
ATOM   6883  H  HE3  . MET B  1 21  ? 106.092 -79.147  1.272   1.00 67.41  ? 1   MET B HE3  1 
ATOM   6884  N  N    . ASP B  1 22  ? 104.406 -80.897  6.423   1.00 50.87  ? 2   ASP B N    1 
ATOM   6885  C  CA   . ASP B  1 22  ? 104.094 -79.775  7.315   1.00 49.25  ? 2   ASP B CA   1 
ATOM   6886  C  C    . ASP B  1 22  ? 104.088 -78.459  6.505   1.00 53.80  ? 2   ASP B C    1 
ATOM   6887  O  O    . ASP B  1 22  ? 105.145 -77.984  6.109   1.00 54.71  ? 2   ASP B O    1 
ATOM   6888  C  CB   . ASP B  1 22  ? 105.108 -79.707  8.479   1.00 50.54  ? 2   ASP B CB   1 
ATOM   6889  C  CG   . ASP B  1 22  ? 104.828 -78.619  9.506   1.00 52.78  ? 2   ASP B CG   1 
ATOM   6890  O  OD1  . ASP B  1 22  ? 103.918 -77.791  9.270   1.00 48.91  ? 2   ASP B OD1  1 
ATOM   6891  O  OD2  . ASP B  1 22  ? 105.486 -78.621  10.568  1.00 66.84  ? 2   ASP B OD2  1 
ATOM   6892  H  H    . ASP B  1 22  ? 105.399 -81.100  6.372   1.00 51.20  ? 2   ASP B H    1 
ATOM   6893  H  HA   . ASP B  1 22  ? 103.112 -79.919  7.764   1.00 48.76  ? 2   ASP B HA   1 
ATOM   6894  H  HB2  . ASP B  1 22  ? 105.092 -80.661  9.002   1.00 50.95  ? 2   ASP B HB2  1 
ATOM   6895  H  HB3  . ASP B  1 22  ? 106.102 -79.532  8.069   1.00 50.81  ? 2   ASP B HB3  1 
ATOM   6896  N  N    . GLN B  1 23  ? 102.908 -77.856  6.314   1.00 49.87  ? 3   GLN B N    1 
ATOM   6897  C  CA   . GLN B  1 23  ? 102.754 -76.599  5.574   1.00 48.89  ? 3   GLN B CA   1 
ATOM   6898  C  C    . GLN B  1 23  ? 102.439 -75.390  6.500   1.00 50.43  ? 3   GLN B C    1 
ATOM   6899  O  O    . GLN B  1 23  ? 101.979 -74.356  6.016   1.00 49.09  ? 3   GLN B O    1 
ATOM   6900  C  CB   . GLN B  1 23  ? 101.633 -76.749  4.535   1.00 49.98  ? 3   GLN B CB   1 
ATOM   6901  C  CG   . GLN B  1 23  ? 101.721 -78.027  3.706   1.00 66.56  ? 3   GLN B CG   1 
ATOM   6902  C  CD   . GLN B  1 23  ? 100.877 -77.943  2.455   1.00 66.63  ? 3   GLN B CD   1 
ATOM   6903  O  OE1  . GLN B  1 23  ? 101.145 -77.137  1.561   1.00 63.85  ? 3   GLN B OE1  1 
ATOM   6904  N  NE2  . GLN B  1 23  ? 99.855  -78.779  2.344   1.00 48.25  ? 3   GLN B NE2  1 
ATOM   6905  H  H    . GLN B  1 23  ? 102.027 -78.227  6.655   1.00 49.82  ? 3   GLN B H    1 
ATOM   6906  H  HA   . GLN B  1 23  ? 103.661 -76.366  5.018   1.00 49.59  ? 3   GLN B HA   1 
ATOM   6907  H  HB2  . GLN B  1 23  ? 100.670 -76.738  5.046   1.00 49.64  ? 3   GLN B HB2  1 
ATOM   6908  H  HB3  . GLN B  1 23  ? 101.708 -75.918  3.836   1.00 49.72  ? 3   GLN B HB3  1 
ATOM   6909  H  HG2  . GLN B  1 23  ? 102.755 -78.180  3.402   1.00 67.79  ? 3   GLN B HG2  1 
ATOM   6910  H  HG3  . GLN B  1 23  ? 101.386 -78.870  4.309   1.00 66.96  ? 3   GLN B HG3  1 
ATOM   6911  H  HE21 . GLN B  1 23  ? 99.647  -79.454  3.073   1.00 48.39  ? 3   GLN B HE21 1 
ATOM   6912  H  HE22 . GLN B  1 23  ? 99.271  -78.746  1.515   1.00 47.55  ? 3   GLN B HE22 1 
ATOM   6913  N  N    . SER B  1 24  ? 102.695 -75.498  7.810   1.00 45.49  ? 4   SER B N    1 
ATOM   6914  C  CA   . SER B  1 24  ? 102.369 -74.412  8.751   1.00 45.18  ? 4   SER B CA   1 
ATOM   6915  C  C    . SER B  1 24  ? 103.238 -73.183  8.565   1.00 50.42  ? 4   SER B C    1 
ATOM   6916  O  O    . SER B  1 24  ? 102.724 -72.095  8.797   1.00 50.74  ? 4   SER B O    1 
ATOM   6917  C  CB   . SER B  1 24  ? 102.458 -74.895  10.194  1.00 46.67  ? 4   SER B CB   1 
ATOM   6918  O  OG   . SER B  1 24  ? 103.749 -75.401  10.472  1.00 51.16  ? 4   SER B OG   1 
ATOM   6919  H  H    . SER B  1 24  ? 103.139 -76.299  8.249   1.00 45.60  ? 4   SER B H    1 
ATOM   6920  H  HA   . SER B  1 24  ? 101.352 -74.067  8.584   1.00 44.27  ? 4   SER B HA   1 
ATOM   6921  H  HB2  . SER B  1 24  ? 102.253 -74.059  10.861  1.00 46.74  ? 4   SER B HB2  1 
ATOM   6922  H  HB3  . SER B  1 24  ? 101.728 -75.688  10.354  1.00 45.54  ? 4   SER B HB3  1 
ATOM   6923  H  HG   . SER B  1 24  ? 103.672 -76.264  10.958  1.00 51.61  ? 4   SER B HG   1 
ATOM   6924  N  N    . ASN B  1 25  ? 104.511 -73.312  8.110   1.00 48.08  ? 5   ASN B N    1 
ATOM   6925  C  CA   . ASN B  1 25  ? 105.339 -72.121  7.907   1.00 49.10  ? 5   ASN B CA   1 
ATOM   6926  C  C    . ASN B  1 25  ? 104.744 -71.214  6.810   1.00 51.40  ? 5   ASN B C    1 
ATOM   6927  O  O    . ASN B  1 25  ? 104.810 -69.996  6.938   1.00 50.59  ? 5   ASN B O    1 
ATOM   6928  C  CB   . ASN B  1 25  ? 106.790 -72.487  7.560   1.00 55.05  ? 5   ASN B CB   1 
ATOM   6929  C  CG   . ASN B  1 25  ? 107.566 -73.145  8.685   1.00 91.32  ? 5   ASN B CG   1 
ATOM   6930  O  OD1  . ASN B  1 25  ? 108.079 -74.248  8.518   1.00 93.25  ? 5   ASN B OD1  1 
ATOM   6931  N  ND2  . ASN B  1 25  ? 107.729 -72.483  9.838   1.00 78.80  ? 5   ASN B ND2  1 
ATOM   6932  H  H    . ASN B  1 25  ? 104.969 -74.187  7.876   1.00 48.53  ? 5   ASN B H    1 
ATOM   6933  H  HA   . ASN B  1 25  ? 105.346 -71.539  8.827   1.00 49.06  ? 5   ASN B HA   1 
ATOM   6934  H  HB2  . ASN B  1 25  ? 106.783 -73.178  6.719   1.00 54.36  ? 5   ASN B HB2  1 
ATOM   6935  H  HB3  . ASN B  1 25  ? 107.323 -71.581  7.274   1.00 55.23  ? 5   ASN B HB3  1 
ATOM   6936  H  HD21 . ASN B  1 25  ? 108.256 -72.909  10.595  1.00 79.47  ? 5   ASN B HD21 1 
ATOM   6937  H  HD22 . ASN B  1 25  ? 107.354 -71.547  9.956   1.00 78.57  ? 5   ASN B HD22 1 
ATOM   6938  N  N    . ARG B  1 26  ? 104.117 -71.806  5.780   1.00 45.33  ? 6   ARG B N    1 
ATOM   6939  C  CA   . ARG B  1 26  ? 103.512 -71.043  4.698   1.00 42.79  ? 6   ARG B CA   1 
ATOM   6940  C  C    . ARG B  1 26  ? 102.088 -70.595  5.020   1.00 43.66  ? 6   ARG B C    1 
ATOM   6941  O  O    . ARG B  1 26  ? 101.770 -69.431  4.796   1.00 42.56  ? 6   ARG B O    1 
ATOM   6942  C  CB   . ARG B  1 26  ? 103.498 -71.896  3.404   1.00 40.21  ? 6   ARG B CB   1 
ATOM   6943  C  CG   . ARG B  1 26  ? 102.886 -71.183  2.206   1.00 46.27  ? 6   ARG B CG   1 
ATOM   6944  C  CD   . ARG B  1 26  ? 103.036 -71.998  0.955   1.00 50.95  ? 6   ARG B CD   1 
ATOM   6945  N  NE   . ARG B  1 26  ? 102.236 -71.428  -0.125  1.00 48.42  ? 6   ARG B NE   1 
ATOM   6946  C  CZ   . ARG B  1 26  ? 101.977 -72.027  -1.281  1.00 57.04  ? 6   ARG B CZ   1 
ATOM   6947  N  NH1  . ARG B  1 26  ? 102.463 -73.236  -1.536  1.00 41.37  ? 6   ARG B NH1  1 
ATOM   6948  N  NH2  . ARG B  1 26  ? 101.222 -71.426  -2.190  1.00 54.56  ? 6   ARG B NH2  1 
ATOM   6949  H  H    . ARG B  1 26  ? 104.026 -72.811  5.670   1.00 45.17  ? 6   ARG B H    1 
ATOM   6950  H  HA   . ARG B  1 26  ? 104.103 -70.153  4.489   1.00 42.63  ? 6   ARG B HA   1 
ATOM   6951  H  HB2  . ARG B  1 26  ? 104.524 -72.154  3.146   1.00 41.26  ? 6   ARG B HB2  1 
ATOM   6952  H  HB3  . ARG B  1 26  ? 102.923 -72.804  3.581   1.00 38.99  ? 6   ARG B HB3  1 
ATOM   6953  H  HG2  . ARG B  1 26  ? 101.817 -71.045  2.359   1.00 45.33  ? 6   ARG B HG2  1 
ATOM   6954  H  HG3  . ARG B  1 26  ? 103.375 -70.223  2.049   1.00 46.52  ? 6   ARG B HG3  1 
ATOM   6955  H  HD2  . ARG B  1 26  ? 104.080 -72.010  0.645   1.00 51.91  ? 6   ARG B HD2  1 
ATOM   6956  H  HD3  . ARG B  1 26  ? 102.683 -73.006  1.168   1.00 50.99  ? 6   ARG B HD3  1 
ATOM   6957  H  HE   . ARG B  1 26  ? 101.861 -70.499  0.024   1.00 48.86  ? 6   ARG B HE   1 
ATOM   6958  H  HH11 . ARG B  1 26  ? 103.046 -73.742  -0.877  1.00 41.29  ? 6   ARG B HH11 1 
ATOM   6959  H  HH12 . ARG B  1 26  ? 102.252 -73.679  -2.425  1.00 42.44  ? 6   ARG B HH12 1 
ATOM   6960  H  HH21 . ARG B  1 26  ? 100.853 -70.496  -2.016  1.00 54.31  ? 6   ARG B HH21 1 
ATOM   6961  H  HH22 . ARG B  1 26  ? 101.026 -71.878  -3.078  1.00 54.99  ? 6   ARG B HH22 1 
ATOM   6962  N  N    . TYR B  1 27  ? 101.214 -71.528  5.450   1.00 39.61  ? 7   TYR B N    1 
ATOM   6963  C  CA   . TYR B  1 27  ? 99.779  -71.258  5.610   1.00 39.75  ? 7   TYR B CA   1 
ATOM   6964  C  C    . TYR B  1 27  ? 99.327  -70.845  7.029   1.00 42.68  ? 7   TYR B C    1 
ATOM   6965  O  O    . TYR B  1 27  ? 98.126  -70.693  7.241   1.00 41.10  ? 7   TYR B O    1 
ATOM   6966  C  CB   . TYR B  1 27  ? 98.967  -72.472  5.162   1.00 39.80  ? 7   TYR B CB   1 
ATOM   6967  C  CG   . TYR B  1 27  ? 99.045  -72.685  3.675   1.00 42.35  ? 7   TYR B CG   1 
ATOM   6968  C  CD1  . TYR B  1 27  ? 98.218  -71.984  2.807   1.00 42.97  ? 7   TYR B CD1  1 
ATOM   6969  C  CD2  . TYR B  1 27  ? 99.970  -73.566  3.125   1.00 43.70  ? 7   TYR B CD2  1 
ATOM   6970  C  CE1  . TYR B  1 27  ? 98.295  -72.166  1.430   1.00 41.21  ? 7   TYR B CE1  1 
ATOM   6971  C  CE2  . TYR B  1 27  ? 100.018 -73.801  1.754   1.00 44.04  ? 7   TYR B CE2  1 
ATOM   6972  C  CZ   . TYR B  1 27  ? 99.171  -73.106  0.906   1.00 49.20  ? 7   TYR B CZ   1 
ATOM   6973  O  OH   . TYR B  1 27  ? 99.231  -73.361  -0.454  1.00 46.30  ? 7   TYR B OH   1 
ATOM   6974  H  H    . TYR B  1 27  ? 101.484 -72.470  5.714   1.00 39.24  ? 7   TYR B H    1 
ATOM   6975  H  HA   . TYR B  1 27  ? 99.488  -70.447  4.943   1.00 39.16  ? 7   TYR B HA   1 
ATOM   6976  H  HB2  . TYR B  1 27  ? 99.347  -73.366  5.652   1.00 39.65  ? 7   TYR B HB2  1 
ATOM   6977  H  HB3  . TYR B  1 27  ? 97.916  -72.340  5.414   1.00 39.62  ? 7   TYR B HB3  1 
ATOM   6978  H  HD1  . TYR B  1 27  ? 97.487  -71.288  3.211   1.00 42.73  ? 7   TYR B HD1  1 
ATOM   6979  H  HD2  . TYR B  1 27  ? 100.623 -74.124  3.792   1.00 44.05  ? 7   TYR B HD2  1 
ATOM   6980  H  HE1  . TYR B  1 27  ? 97.588  -71.639  0.793   1.00 41.05  ? 7   TYR B HE1  1 
ATOM   6981  H  HE2  . TYR B  1 27  ? 100.738 -74.509  1.348   1.00 44.88  ? 7   TYR B HE2  1 
ATOM   6982  H  HH   . TYR B  1 27  ? 98.423  -72.998  -0.904  1.00 46.34  ? 7   TYR B HH   1 
ATOM   6983  N  N    . ALA B  1 28  ? 100.243 -70.651  7.967   1.00 42.42  ? 8   ALA B N    1 
ATOM   6984  C  CA   . ALA B  1 28  ? 99.874  -70.187  9.307   1.00 43.03  ? 8   ALA B CA   1 
ATOM   6985  C  C    . ALA B  1 28  ? 100.684 -68.967  9.659   1.00 50.49  ? 8   ALA B C    1 
ATOM   6986  O  O    . ALA B  1 28  ? 101.903 -68.981  9.496   1.00 52.32  ? 8   ALA B O    1 
ATOM   6987  C  CB   . ALA B  1 28  ? 100.099 -71.281  10.354  1.00 44.42  ? 8   ALA B CB   1 
ATOM   6988  H  H    . ALA B  1 28  ? 101.240 -70.803  7.854   1.00 43.89  ? 8   ALA B H    1 
ATOM   6989  H  HA   . ALA B  1 28  ? 98.821  -69.920  9.350   1.00 41.44  ? 8   ALA B HA   1 
ATOM   6990  H  HB1  . ALA B  1 28  ? 99.489  -71.048  11.226  1.00 45.26  ? 8   ALA B HB1  1 
ATOM   6991  H  HB2  . ALA B  1 28  ? 99.807  -72.242  9.940   1.00 44.66  ? 8   ALA B HB2  1 
ATOM   6992  H  HB3  . ALA B  1 28  ? 101.146 -71.299  10.652  1.00 45.01  ? 8   ALA B HB3  1 
ATOM   6993  N  N    . ASN B  1 29  ? 100.006 -67.901  10.107  1.00 47.45  ? 9   ASN B N    1 
ATOM   6994  C  CA   . ASN B  1 29  ? 100.649 -66.709  10.628  1.00 48.83  ? 9   ASN B CA   1 
ATOM   6995  C  C    . ASN B  1 29  ? 99.828  -66.238  11.820  1.00 52.21  ? 9   ASN B C    1 
ATOM   6996  O  O    . ASN B  1 29  ? 98.965  -65.379  11.689  1.00 49.40  ? 9   ASN B O    1 
ATOM   6997  C  CB   . ASN B  1 29  ? 100.837 -65.601  9.578   1.00 50.87  ? 9   ASN B CB   1 
ATOM   6998  C  CG   . ASN B  1 29  ? 101.709 -64.469  10.100  1.00 57.67  ? 9   ASN B CG   1 
ATOM   6999  O  OD1  . ASN B  1 29  ? 102.155 -64.470  11.256  1.00 51.38  ? 9   ASN B OD1  1 
ATOM   7000  N  ND2  . ASN B  1 29  ? 101.945 -63.465  9.286   1.00 47.83  ? 9   ASN B ND2  1 
ATOM   7001  H  H    . ASN B  1 29  ? 98.992  -67.840  10.099  1.00 46.68  ? 9   ASN B H    1 
ATOM   7002  H  HA   . ASN B  1 29  ? 101.638 -66.969  11.003  1.00 49.35  ? 9   ASN B HA   1 
ATOM   7003  H  HB2  . ASN B  1 29  ? 101.330 -66.027  8.705   1.00 50.60  ? 9   ASN B HB2  1 
ATOM   7004  H  HB3  . ASN B  1 29  ? 99.869  -65.193  9.291   1.00 50.26  ? 9   ASN B HB3  1 
ATOM   7005  H  HD21 . ASN B  1 29  ? 102.518 -62.686  9.594   1.00 47.96  ? 9   ASN B HD21 1 
ATOM   7006  H  HD22 . ASN B  1 29  ? 101.543 -63.459  8.354   1.00 48.23  ? 9   ASN B HD22 1 
ATOM   7007  N  N    . LEU B  1 30  ? 100.145 -66.788  12.995  1.00 52.29  ? 10  LEU B N    1 
ATOM   7008  C  CA   . LEU B  1 30  ? 99.436  -66.479  14.229  1.00 52.01  ? 10  LEU B CA   1 
ATOM   7009  C  C    . LEU B  1 30  ? 99.791  -65.083  14.781  1.00 57.12  ? 10  LEU B C    1 
ATOM   7010  O  O    . LEU B  1 30  ? 99.096  -64.617  15.681  1.00 57.17  ? 10  LEU B O    1 
ATOM   7011  C  CB   . LEU B  1 30  ? 99.693  -67.567  15.285  1.00 52.14  ? 10  LEU B CB   1 
ATOM   7012  C  CG   . LEU B  1 30  ? 99.305  -69.000  14.872  1.00 55.92  ? 10  LEU B CG   1 
ATOM   7013  C  CD1  . LEU B  1 30  ? 99.621  -69.978  15.986  1.00 58.40  ? 10  LEU B CD1  1 
ATOM   7014  C  CD2  . LEU B  1 30  ? 97.833  -69.110  14.481  1.00 52.09  ? 10  LEU B CD2  1 
ATOM   7015  H  H    . LEU B  1 30  ? 100.924 -67.426  13.123  1.00 53.31  ? 10  LEU B H    1 
ATOM   7016  H  HA   . LEU B  1 30  ? 98.370  -66.466  14.013  1.00 50.69  ? 10  LEU B HA   1 
ATOM   7017  H  HB2  . LEU B  1 30  ? 100.755 -67.570  15.526  1.00 51.96  ? 10  LEU B HB2  1 
ATOM   7018  H  HB3  . LEU B  1 30  ? 99.118  -67.318  16.175  1.00 52.60  ? 10  LEU B HB3  1 
ATOM   7019  H  HG   . LEU B  1 30  ? 99.897  -69.293  14.006  1.00 56.00  ? 10  LEU B HG   1 
ATOM   7020  H  HD11 . LEU B  1 30  ? 99.398  -70.988  15.646  1.00 58.12  ? 10  LEU B HD11 1 
ATOM   7021  H  HD12 . LEU B  1 30  ? 100.676 -69.896  16.246  1.00 59.36  ? 10  LEU B HD12 1 
ATOM   7022  H  HD13 . LEU B  1 30  ? 99.009  -69.735  16.854  1.00 58.74  ? 10  LEU B HD13 1 
ATOM   7023  H  HD21 . LEU B  1 30  ? 97.554  -70.161  14.427  1.00 51.06  ? 10  LEU B HD21 1 
ATOM   7024  H  HD22 . LEU B  1 30  ? 97.223  -68.599  15.226  1.00 51.83  ? 10  LEU B HD22 1 
ATOM   7025  H  HD23 . LEU B  1 30  ? 97.688  -68.652  13.504  1.00 51.58  ? 10  LEU B HD23 1 
ATOM   7026  N  N    . ASN B  1 31  ? 100.807 -64.395  14.219  1.00 54.43  ? 11  ASN B N    1 
ATOM   7027  C  CA   . ASN B  1 31  ? 101.134 -63.019  14.607  1.00 54.28  ? 11  ASN B CA   1 
ATOM   7028  C  C    . ASN B  1 31  ? 100.215 -62.001  13.901  1.00 57.64  ? 11  ASN B C    1 
ATOM   7029  O  O    . ASN B  1 31  ? 100.253 -60.824  14.264  1.00 59.07  ? 11  ASN B O    1 
ATOM   7030  C  CB   . ASN B  1 31  ? 102.598 -62.688  14.334  1.00 53.67  ? 11  ASN B CB   1 
ATOM   7031  C  CG   . ASN B  1 31  ? 103.589 -63.586  15.049  1.00 73.91  ? 11  ASN B CG   1 
ATOM   7032  O  OD1  . ASN B  1 31  ? 104.578 -63.986  14.440  1.00 72.97  ? 11  ASN B OD1  1 
ATOM   7033  N  ND2  . ASN B  1 31  ? 103.403 -63.922  16.337  1.00 60.62  ? 11  ASN B ND2  1 
ATOM   7034  H  H    . ASN B  1 31  ? 101.449 -64.766  13.526  1.00 54.99  ? 11  ASN B H    1 
ATOM   7035  H  HA   . ASN B  1 31  ? 100.969 -62.901  15.676  1.00 54.79  ? 11  ASN B HA   1 
ATOM   7036  H  HB2  . ASN B  1 31  ? 102.784 -62.803  13.268  1.00 52.65  ? 11  ASN B HB2  1 
ATOM   7037  H  HB3  . ASN B  1 31  ? 102.801 -61.660  14.628  1.00 53.45  ? 11  ASN B HB3  1 
ATOM   7038  H  HD21 . ASN B  1 31  ? 104.083 -64.525  16.789  1.00 61.62  ? 11  ASN B HD21 1 
ATOM   7039  H  HD22 . ASN B  1 31  ? 102.621 -63.579  16.885  1.00 60.19  ? 11  ASN B HD22 1 
ATOM   7040  N  N    . LEU B  1 32  ? 99.380  -62.421  12.924  1.00 52.10  ? 12  LEU B N    1 
ATOM   7041  C  CA   . LEU B  1 32  ? 98.409  -61.499  12.334  1.00 51.31  ? 12  LEU B CA   1 
ATOM   7042  C  C    . LEU B  1 32  ? 97.330  -61.154  13.367  1.00 53.74  ? 12  LEU B C    1 
ATOM   7043  O  O    . LEU B  1 32  ? 96.862  -62.038  14.084  1.00 53.03  ? 12  LEU B O    1 
ATOM   7044  C  CB   . LEU B  1 32  ? 97.735  -62.093  11.093  1.00 50.61  ? 12  LEU B CB   1 
ATOM   7045  C  CG   . LEU B  1 32  ? 98.615  -62.337  9.879   1.00 55.02  ? 12  LEU B CG   1 
ATOM   7046  C  CD1  . LEU B  1 32  ? 97.893  -63.184  8.867   1.00 52.90  ? 12  LEU B CD1  1 
ATOM   7047  C  CD2  . LEU B  1 32  ? 99.073  -61.022  9.247   1.00 59.51  ? 12  LEU B CD2  1 
ATOM   7048  H  H    . LEU B  1 32  ? 99.369  -63.349  12.513  1.00 51.14  ? 12  LEU B H    1 
ATOM   7049  H  HA   . LEU B  1 32  ? 98.914  -60.580  12.043  1.00 51.78  ? 12  LEU B HA   1 
ATOM   7050  H  HB2  . LEU B  1 32  ? 97.317  -63.056  11.376  1.00 50.21  ? 12  LEU B HB2  1 
ATOM   7051  H  HB3  . LEU B  1 32  ? 96.928  -61.426  10.792  1.00 50.43  ? 12  LEU B HB3  1 
ATOM   7052  H  HG   . LEU B  1 32  ? 99.503  -62.874  10.204  1.00 54.96  ? 12  LEU B HG   1 
ATOM   7053  H  HD11 . LEU B  1 32  ? 98.520  -63.297  7.984   1.00 52.38  ? 12  LEU B HD11 1 
ATOM   7054  H  HD12 . LEU B  1 32  ? 97.697  -64.159  9.310   1.00 52.51  ? 12  LEU B HD12 1 
ATOM   7055  H  HD13 . LEU B  1 32  ? 96.953  -62.700  8.603   1.00 51.56  ? 12  LEU B HD13 1 
ATOM   7056  H  HD21 . LEU B  1 32  ? 99.573  -61.235  8.304   1.00 59.75  ? 12  LEU B HD21 1 
ATOM   7057  H  HD22 . LEU B  1 32  ? 98.202  -60.392  9.072   1.00 59.29  ? 12  LEU B HD22 1 
ATOM   7058  H  HD23 . LEU B  1 32  ? 99.773  -60.526  9.918   1.00 60.10  ? 12  LEU B HD23 1 
ATOM   7059  N  N    . LYS B  1 33  ? 96.943  -59.883  13.446  1.00 48.48  ? 13  LYS B N    1 
ATOM   7060  C  CA   . LYS B  1 33  ? 95.916  -59.431  14.378  1.00 48.42  ? 13  LYS B CA   1 
ATOM   7061  C  C    . LYS B  1 33  ? 94.580  -59.349  13.659  1.00 48.44  ? 13  LYS B C    1 
ATOM   7062  O  O    . LYS B  1 33  ? 94.503  -58.759  12.580  1.00 45.42  ? 13  LYS B O    1 
ATOM   7063  C  CB   . LYS B  1 33  ? 96.291  -58.070  14.968  1.00 52.58  ? 13  LYS B CB   1 
ATOM   7064  C  CG   . LYS B  1 33  ? 97.558  -58.117  15.818  1.00 65.08  ? 13  LYS B CG   1 
ATOM   7065  C  CD   . LYS B  1 33  ? 97.867  -56.756  16.395  1.00 80.34  ? 13  LYS B CD   1 
ATOM   7066  C  CE   . LYS B  1 33  ? 98.993  -56.771  17.399  1.00 98.79  ? 13  LYS B CE   1 
ATOM   7067  N  NZ   . LYS B  1 33  ? 99.412  -55.393  17.776  1.00 113.00 ? 13  LYS B NZ   1 
ATOM   7068  H  H    . LYS B  1 33  ? 97.317  -59.144  12.860  1.00 48.03  ? 13  LYS B H    1 
ATOM   7069  H  HA   . LYS B  1 33  ? 95.825  -60.122  15.213  1.00 48.76  ? 13  LYS B HA   1 
ATOM   7070  H  HB2  . LYS B  1 33  ? 96.459  -57.372  14.149  1.00 53.02  ? 13  LYS B HB2  1 
ATOM   7071  H  HB3  . LYS B  1 33  ? 95.476  -57.710  15.594  1.00 52.65  ? 13  LYS B HB3  1 
ATOM   7072  H  HG2  . LYS B  1 33  ? 97.423  -58.822  16.636  1.00 64.99  ? 13  LYS B HG2  1 
ATOM   7073  H  HG3  . LYS B  1 33  ? 98.400  -58.419  15.197  1.00 65.15  ? 13  LYS B HG3  1 
ATOM   7074  H  HD2  . LYS B  1 33  ? 98.152  -56.085  15.586  1.00 80.47  ? 13  LYS B HD2  1 
ATOM   7075  H  HD3  . LYS B  1 33  ? 96.974  -56.386  16.894  1.00 79.86  ? 13  LYS B HD3  1 
ATOM   7076  H  HE2  . LYS B  1 33  ? 98.663  -57.288  18.299  1.00 99.11  ? 13  LYS B HE2  1 
ATOM   7077  H  HE3  . LYS B  1 33  ? 99.854  -57.279  16.967  1.00 99.11  ? 13  LYS B HE3  1 
ATOM   7078  H  HZ1  . LYS B  1 33  ? 100.120 -55.431  18.502  1.00 114.00 ? 13  LYS B HZ1  1 
ATOM   7079  H  HZ2  . LYS B  1 33  ? 99.797  -54.916  16.966  1.00 113.18 ? 13  LYS B HZ2  1 
ATOM   7080  H  HZ3  . LYS B  1 33  ? 98.615  -54.866  18.117  1.00 113.05 ? 13  LYS B HZ3  1 
ATOM   7081  N  N    . GLU B  1 34  ? 93.531  -59.924  14.266  1.00 44.75  ? 14  GLU B N    1 
ATOM   7082  C  CA   . GLU B  1 34  ? 92.181  -59.935  13.694  1.00 44.59  ? 14  GLU B CA   1 
ATOM   7083  C  C    . GLU B  1 34  ? 91.656  -58.526  13.456  1.00 46.87  ? 14  GLU B C    1 
ATOM   7084  O  O    . GLU B  1 34  ? 91.036  -58.277  12.424  1.00 43.14  ? 14  GLU B O    1 
ATOM   7085  C  CB   . GLU B  1 34  ? 91.212  -60.685  14.618  1.00 46.31  ? 14  GLU B CB   1 
ATOM   7086  C  CG   . GLU B  1 34  ? 89.871  -60.962  13.961  1.00 50.89  ? 14  GLU B CG   1 
ATOM   7087  C  CD   . GLU B  1 34  ? 88.926  -61.747  14.837  1.00 57.89  ? 14  GLU B CD   1 
ATOM   7088  O  OE1  . GLU B  1 34  ? 88.936  -62.993  14.741  1.00 44.05  ? 14  GLU B OE1  1 
ATOM   7089  O  OE2  . GLU B  1 34  ? 88.214  -61.123  15.656  1.00 56.13  ? 14  GLU B OE2  1 
ATOM   7090  H  H    . GLU B  1 34  ? 93.595  -60.396  15.162  1.00 45.29  ? 14  GLU B H    1 
ATOM   7091  H  HA   . GLU B  1 34  ? 92.201  -60.451  12.735  1.00 44.54  ? 14  GLU B HA   1 
ATOM   7092  H  HB2  . GLU B  1 34  ? 91.655  -61.632  14.919  1.00 47.17  ? 14  GLU B HB2  1 
ATOM   7093  H  HB3  . GLU B  1 34  ? 91.031  -60.079  15.505  1.00 46.97  ? 14  GLU B HB3  1 
ATOM   7094  H  HG2  . GLU B  1 34  ? 89.376  -60.020  13.735  1.00 50.59  ? 14  GLU B HG2  1 
ATOM   7095  H  HG3  . GLU B  1 34  ? 90.039  -61.529  13.047  1.00 49.82  ? 14  GLU B HG3  1 
ATOM   7096  N  N    . SER B  1 35  ? 91.896  -57.613  14.407  1.00 45.42  ? 15  SER B N    1 
ATOM   7097  C  CA   . SER B  1 35  ? 91.451  -56.224  14.281  1.00 45.76  ? 15  SER B CA   1 
ATOM   7098  C  C    . SER B  1 35  ? 92.107  -55.521  13.072  1.00 51.18  ? 15  SER B C    1 
ATOM   7099  O  O    . SER B  1 35  ? 91.482  -54.650  12.465  1.00 50.72  ? 15  SER B O    1 
ATOM   7100  C  CB   . SER B  1 35  ? 91.746  -55.457  15.557  1.00 48.12  ? 15  SER B CB   1 
ATOM   7101  O  OG   . SER B  1 35  ? 93.114  -55.595  15.869  1.00 53.69  ? 15  SER B OG   1 
ATOM   7102  H  H    . SER B  1 35  ? 92.394  -57.811  15.269  1.00 46.73  ? 15  SER B H    1 
ATOM   7103  H  HA   . SER B  1 35  ? 90.373  -56.214  14.130  1.00 46.10  ? 15  SER B HA   1 
ATOM   7104  H  HB2  . SER B  1 35  ? 91.515  -54.403  15.413  1.00 48.95  ? 15  SER B HB2  1 
ATOM   7105  H  HB3  . SER B  1 35  ? 91.157  -55.869  16.375  1.00 48.57  ? 15  SER B HB3  1 
ATOM   7106  H  HG   . SER B  1 35  ? 93.234  -56.144  16.687  1.00 54.09  ? 15  SER B HG   1 
ATOM   7107  N  N    . GLU B  1 36  ? 93.370  -55.883  12.746  1.00 48.10  ? 16  GLU B N    1 
ATOM   7108  C  CA   . GLU B  1 36  ? 94.074  -55.330  11.587  1.00 46.34  ? 16  GLU B CA   1 
ATOM   7109  C  C    . GLU B  1 36  ? 93.543  -55.970  10.299  1.00 47.66  ? 16  GLU B C    1 
ATOM   7110  O  O    . GLU B  1 36  ? 93.409  -55.286  9.276   1.00 45.26  ? 16  GLU B O    1 
ATOM   7111  C  CB   . GLU B  1 36  ? 95.597  -55.540  11.698  1.00 48.23  ? 16  GLU B CB   1 
ATOM   7112  C  CG   . GLU B  1 36  ? 96.249  -54.837  12.863  1.00 66.46  ? 16  GLU B CG   1 
ATOM   7113  C  CD   . GLU B  1 36  ? 97.759  -55.031  12.969  1.00 105.30 ? 16  GLU B CD   1 
ATOM   7114  O  OE1  . GLU B  1 36  ? 98.305  -55.951  12.329  1.00 102.48 ? 16  GLU B OE1  1 
ATOM   7115  O  OE2  . GLU B  1 36  ? 98.398  -54.294  13.742  1.00 115.79 ? 16  GLU B OE2  1 
ATOM   7116  H  H    . GLU B  1 36  ? 93.931  -56.534  13.287  1.00 48.94  ? 16  GLU B H    1 
ATOM   7117  H  HA   . GLU B  1 36  ? 93.891  -54.258  11.532  1.00 46.61  ? 16  GLU B HA   1 
ATOM   7118  H  HB2  . GLU B  1 36  ? 95.798  -56.605  11.796  1.00 48.30  ? 16  GLU B HB2  1 
ATOM   7119  H  HB3  . GLU B  1 36  ? 96.060  -55.158  10.789  1.00 47.79  ? 16  GLU B HB3  1 
ATOM   7120  H  HG2  . GLU B  1 36  ? 96.036  -53.773  12.764  1.00 67.32  ? 16  GLU B HG2  1 
ATOM   7121  H  HG3  . GLU B  1 36  ? 95.797  -55.197  13.787  1.00 66.69  ? 16  GLU B HG3  1 
ATOM   7122  N  N    . LEU B  1 37  ? 93.261  -57.283  10.336  1.00 45.00  ? 17  LEU B N    1 
ATOM   7123  C  CA   . LEU B  1 37  ? 92.706  -57.985  9.175   1.00 44.36  ? 17  LEU B CA   1 
ATOM   7124  C  C    . LEU B  1 37  ? 91.311  -57.413  8.824   1.00 46.40  ? 17  LEU B C    1 
ATOM   7125  O  O    . LEU B  1 37  ? 91.000  -57.232  7.639   1.00 42.42  ? 17  LEU B O    1 
ATOM   7126  C  CB   . LEU B  1 37  ? 92.627  -59.510  9.425   1.00 44.12  ? 17  LEU B CB   1 
ATOM   7127  C  CG   . LEU B  1 37  ? 93.964  -60.267  9.484   1.00 48.04  ? 17  LEU B CG   1 
ATOM   7128  C  CD1  . LEU B  1 37  ? 93.782  -61.645  10.082  1.00 47.76  ? 17  LEU B CD1  1 
ATOM   7129  C  CD2  . LEU B  1 37  ? 94.589  -60.397  8.103   1.00 49.51  ? 17  LEU B CD2  1 
ATOM   7130  H  H    . LEU B  1 37  ? 93.420  -57.883  11.141  1.00 45.78  ? 17  LEU B H    1 
ATOM   7131  H  HA   . LEU B  1 37  ? 93.350  -57.802  8.316   1.00 45.00  ? 17  LEU B HA   1 
ATOM   7132  H  HB2  . LEU B  1 37  ? 92.104  -59.688  10.363  1.00 44.11  ? 17  LEU B HB2  1 
ATOM   7133  H  HB3  . LEU B  1 37  ? 92.050  -59.950  8.613   1.00 44.26  ? 17  LEU B HB3  1 
ATOM   7134  H  HG   . LEU B  1 37  ? 94.662  -59.717  10.112  1.00 48.07  ? 17  LEU B HG   1 
ATOM   7135  H  HD11 . LEU B  1 37  ? 94.711  -62.206  9.978   1.00 48.08  ? 17  LEU B HD11 1 
ATOM   7136  H  HD12 . LEU B  1 37  ? 93.528  -61.547  11.136  1.00 48.04  ? 17  LEU B HD12 1 
ATOM   7137  H  HD13 . LEU B  1 37  ? 92.977  -62.154  9.553   1.00 47.62  ? 17  LEU B HD13 1 
ATOM   7138  H  HD21 . LEU B  1 37  ? 95.551  -60.898  8.200   1.00 49.93  ? 17  LEU B HD21 1 
ATOM   7139  H  HD22 . LEU B  1 37  ? 93.926  -60.983  7.470   1.00 48.37  ? 17  LEU B HD22 1 
ATOM   7140  H  HD23 . LEU B  1 37  ? 94.742  -59.407  7.677   1.00 49.25  ? 17  LEU B HD23 1 
ATOM   7141  N  N    . ILE B  1 38  ? 90.507  -57.078  9.858   1.00 46.16  ? 18  ILE B N    1 
ATOM   7142  C  CA   . ILE B  1 38  ? 89.190  -56.459  9.666   1.00 45.19  ? 18  ILE B CA   1 
ATOM   7143  C  C    . ILE B  1 38  ? 89.384  -55.042  9.118   1.00 48.65  ? 18  ILE B C    1 
ATOM   7144  O  O    . ILE B  1 38  ? 88.805  -54.703  8.091   1.00 47.95  ? 18  ILE B O    1 
ATOM   7145  C  CB   . ILE B  1 38  ? 88.354  -56.459  10.980  1.00 47.75  ? 18  ILE B CB   1 
ATOM   7146  C  CG1  . ILE B  1 38  ? 87.911  -57.892  11.341  1.00 47.56  ? 18  ILE B CG1  1 
ATOM   7147  C  CG2  . ILE B  1 38  ? 87.130  -55.521  10.853  1.00 48.58  ? 18  ILE B CG2  1 
ATOM   7148  C  CD1  . ILE B  1 38  ? 87.575  -58.104  12.723  1.00 57.38  ? 18  ILE B CD1  1 
ATOM   7149  H  H    . ILE B  1 38  ? 90.738  -57.245  10.833  1.00 46.87  ? 18  ILE B H    1 
ATOM   7150  H  HA   . ILE B  1 38  ? 88.637  -57.031  8.923   1.00 44.40  ? 18  ILE B HA   1 
ATOM   7151  H  HB   . ILE B  1 38  ? 88.979  -56.079  11.784  1.00 48.88  ? 18  ILE B HB   1 
ATOM   7152  H  HG12 . ILE B  1 38  ? 87.032  -58.144  10.751  1.00 46.91  ? 18  ILE B HG12 1 
ATOM   7153  H  HG13 . ILE B  1 38  ? 88.718  -58.580  11.099  1.00 47.90  ? 18  ILE B HG13 1 
ATOM   7154  H  HG21 . ILE B  1 38  ? 86.403  -55.750  11.629  1.00 48.60  ? 18  ILE B HG21 1 
ATOM   7155  H  HG22 . ILE B  1 38  ? 87.452  -54.487  10.966  1.00 48.90  ? 18  ILE B HG22 1 
ATOM   7156  H  HG23 . ILE B  1 38  ? 86.677  -55.661  9.873   1.00 48.52  ? 18  ILE B HG23 1 
ATOM   7157  H  HD11 . ILE B  1 38  ? 87.346  -59.159  12.866  1.00 58.10  ? 18  ILE B HD11 1 
ATOM   7158  H  HD12 . ILE B  1 38  ? 88.431  -57.825  13.335  1.00 57.60  ? 18  ILE B HD12 1 
ATOM   7159  H  HD13 . ILE B  1 38  ? 86.706  -57.507  12.994  1.00 57.50  ? 18  ILE B HD13 1 
ATOM   7160  N  N    . ALA B  1 39  ? 90.202  -54.230  9.798   1.00 46.05  ? 19  ALA B N    1 
ATOM   7161  C  CA   . ALA B  1 39  ? 90.442  -52.828  9.400   1.00 44.27  ? 19  ALA B CA   1 
ATOM   7162  C  C    . ALA B  1 39  ? 90.962  -52.720  7.956   1.00 45.53  ? 19  ALA B C    1 
ATOM   7163  O  O    . ALA B  1 39  ? 90.544  -51.817  7.220   1.00 43.43  ? 19  ALA B O    1 
ATOM   7164  C  CB   . ALA B  1 39  ? 91.418  -52.171  10.363  1.00 44.95  ? 19  ALA B CB   1 
ATOM   7165  H  H    . ALA B  1 39  ? 90.706  -54.512  10.635  1.00 47.11  ? 19  ALA B H    1 
ATOM   7166  H  HA   . ALA B  1 39  ? 89.502  -52.283  9.462   1.00 44.29  ? 19  ALA B HA   1 
ATOM   7167  H  HB1  . ALA B  1 39  ? 91.587  -51.145  10.041  1.00 44.17  ? 19  ALA B HB1  1 
ATOM   7168  H  HB2  . ALA B  1 39  ? 90.986  -52.183  11.362  1.00 44.31  ? 19  ALA B HB2  1 
ATOM   7169  H  HB3  . ALA B  1 39  ? 92.354  -52.730  10.361  1.00 44.65  ? 19  ALA B HB3  1 
ATOM   7170  N  N    . GLY B  1 40  ? 91.813  -53.668  7.548   1.00 42.24  ? 20  GLY B N    1 
ATOM   7171  C  CA   . GLY B  1 40  ? 92.352  -53.720  6.194   1.00 40.62  ? 20  GLY B CA   1 
ATOM   7172  C  C    . GLY B  1 40  ? 91.310  -53.849  5.096   1.00 45.16  ? 20  GLY B C    1 
ATOM   7173  O  O    . GLY B  1 40  ? 91.501  -53.326  3.997   1.00 45.99  ? 20  GLY B O    1 
ATOM   7174  H  H    . GLY B  1 40  ? 92.156  -54.421  8.136   1.00 42.47  ? 20  GLY B H    1 
ATOM   7175  H  HA2  . GLY B  1 40  ? 92.923  -52.811  6.009   1.00 40.67  ? 20  GLY B HA2  1 
ATOM   7176  H  HA3  . GLY B  1 40  ? 93.035  -54.566  6.123   1.00 40.47  ? 20  GLY B HA3  1 
ATOM   7177  N  N    . GLY B  1 41  ? 90.212  -54.562  5.379   1.00 41.35  ? 21  GLY B N    1 
ATOM   7178  C  CA   . GLY B  1 41  ? 89.124  -54.766  4.423   1.00 40.74  ? 21  GLY B CA   1 
ATOM   7179  C  C    . GLY B  1 41  ? 89.475  -55.595  3.195   1.00 44.88  ? 21  GLY B C    1 
ATOM   7180  O  O    . GLY B  1 41  ? 88.751  -55.543  2.203   1.00 45.15  ? 21  GLY B O    1 
ATOM   7181  H  H    . GLY B  1 41  ? 90.036  -55.016  6.267   1.00 40.62  ? 21  GLY B H    1 
ATOM   7182  H  HA2  . GLY B  1 41  ? 88.291  -55.245  4.934   1.00 39.52  ? 21  GLY B HA2  1 
ATOM   7183  H  HA3  . GLY B  1 41  ? 88.784  -53.794  4.068   1.00 40.20  ? 21  GLY B HA3  1 
ATOM   7184  N  N    . ARG B  1 42  ? 90.563  -56.387  3.253   1.00 40.29  ? 22  ARG B N    1 
ATOM   7185  C  CA   . ARG B  1 42  ? 91.050  -57.193  2.131   1.00 39.59  ? 22  ARG B CA   1 
ATOM   7186  C  C    . ARG B  1 42  ? 90.871  -58.699  2.361   1.00 38.78  ? 22  ARG B C    1 
ATOM   7187  O  O    . ARG B  1 42  ? 91.317  -59.474  1.510   1.00 33.85  ? 22  ARG B O    1 
ATOM   7188  C  CB   . ARG B  1 42  ? 92.559  -56.901  1.897   1.00 41.70  ? 22  ARG B CB   1 
ATOM   7189  C  CG   . ARG B  1 42  ? 92.922  -55.461  1.544   1.00 59.36  ? 22  ARG B CG   1 
ATOM   7190  C  CD   . ARG B  1 42  ? 92.117  -54.868  0.394   1.00 75.40  ? 22  ARG B CD   1 
ATOM   7191  N  NE   . ARG B  1 42  ? 92.234  -55.657  -0.837  1.00 85.88  ? 22  ARG B NE   1 
ATOM   7192  C  CZ   . ARG B  1 42  ? 91.451  -55.531  -1.913  1.00 98.60  ? 22  ARG B CZ   1 
ATOM   7193  N  NH1  . ARG B  1 42  ? 90.457  -54.643  -1.926  1.00 81.77  ? 22  ARG B NH1  1 
ATOM   7194  N  NH2  . ARG B  1 42  ? 91.647  -56.302  -2.979  1.00 83.23  ? 22  ARG B NH2  1 
ATOM   7195  H  H    . ARG B  1 42  ? 91.124  -56.535  4.085   1.00 40.26  ? 22  ARG B H    1 
ATOM   7196  H  HA   . ARG B  1 42  ? 90.507  -56.959  1.218   1.00 39.05  ? 22  ARG B HA   1 
ATOM   7197  H  HB2  . ARG B  1 42  ? 93.108  -57.148  2.804   1.00 41.42  ? 22  ARG B HB2  1 
ATOM   7198  H  HB3  . ARG B  1 42  ? 92.921  -57.520  1.079   1.00 42.33  ? 22  ARG B HB3  1 
ATOM   7199  H  HG2  . ARG B  1 42  ? 92.772  -54.835  2.422   1.00 59.51  ? 22  ARG B HG2  1 
ATOM   7200  H  HG3  . ARG B  1 42  ? 93.972  -55.440  1.255   1.00 59.79  ? 22  ARG B HG3  1 
ATOM   7201  H  HD2  . ARG B  1 42  ? 91.073  -54.810  0.694   1.00 75.08  ? 22  ARG B HD2  1 
ATOM   7202  H  HD3  . ARG B  1 42  ? 92.492  -53.867  0.183   1.00 76.09  ? 22  ARG B HD3  1 
ATOM   7203  H  HE   . ARG B  1 42  ? 92.987  -56.337  -0.884  1.00 85.96  ? 22  ARG B HE   1 
ATOM   7204  H  HH11 . ARG B  1 42  ? 90.266  -54.026  -1.144  1.00 82.11  ? 22  ARG B HH11 1 
ATOM   7205  H  HH12 . ARG B  1 42  ? 89.868  -54.565  -2.749  1.00 81.09  ? 22  ARG B HH12 1 
ATOM   7206  H  HH21 . ARG B  1 42  ? 92.402  -56.981  -2.988  1.00 83.13  ? 22  ARG B HH21 1 
ATOM   7207  H  HH22 . ARG B  1 42  ? 91.052  -56.210  -3.796  1.00 82.87  ? 22  ARG B HH22 1 
ATOM   7208  N  N    . HIS B  1 43  ? 90.236  -59.125  3.486   1.00 35.92  ? 23  HIS B N    1 
ATOM   7209  C  CA   . HIS B  1 43  ? 90.079  -60.545  3.796   1.00 33.78  ? 23  HIS B CA   1 
ATOM   7210  C  C    . HIS B  1 43  ? 88.702  -60.942  4.290   1.00 38.01  ? 23  HIS B C    1 
ATOM   7211  O  O    . HIS B  1 43  ? 88.139  -60.304  5.183   1.00 38.58  ? 23  HIS B O    1 
ATOM   7212  C  CB   . HIS B  1 43  ? 91.069  -60.975  4.883   1.00 35.10  ? 23  HIS B CB   1 
ATOM   7213  C  CG   . HIS B  1 43  ? 92.500  -60.903  4.497   1.00 39.28  ? 23  HIS B CG   1 
ATOM   7214  N  ND1  . HIS B  1 43  ? 93.204  -59.719  4.570   1.00 42.32  ? 23  HIS B ND1  1 
ATOM   7215  C  CD2  . HIS B  1 43  ? 93.331  -61.884  4.082   1.00 42.59  ? 23  HIS B CD2  1 
ATOM   7216  C  CE1  . HIS B  1 43  ? 94.438  -60.003  4.180   1.00 43.43  ? 23  HIS B CE1  1 
ATOM   7217  N  NE2  . HIS B  1 43  ? 94.568  -61.303  3.894   1.00 43.82  ? 23  HIS B NE2  1 
ATOM   7218  H  H    . HIS B  1 43  ? 89.815  -58.522  4.183   1.00 35.97  ? 23  HIS B H    1 
ATOM   7219  H  HA   . HIS B  1 43  ? 90.300  -61.134  2.909   1.00 33.87  ? 23  HIS B HA   1 
ATOM   7220  H  HB2  . HIS B  1 43  ? 90.922  -60.352  5.764   1.00 35.13  ? 23  HIS B HB2  1 
ATOM   7221  H  HB3  . HIS B  1 43  ? 90.865  -62.014  5.147   1.00 36.69  ? 23  HIS B HB3  1 
ATOM   7222  H  HD2  . HIS B  1 43  ? 93.078  -62.932  3.930   1.00 42.59  ? 23  HIS B HD2  1 
ATOM   7223  H  HE1  . HIS B  1 43  ? 95.238  -59.270  4.083   1.00 44.27  ? 23  HIS B HE1  1 
ATOM   7224  H  HE2  . HIS B  1 43  ? 95.421  -61.777  3.611   1.00 44.49  ? 23  HIS B HE2  1 
ATOM   7225  N  N    . VAL B  1 44  ? 88.242  -62.108  3.825   1.00 35.42  ? 24  VAL B N    1 
ATOM   7226  C  CA   . VAL B  1 44  ? 87.077  -62.770  4.376   1.00 34.89  ? 24  VAL B CA   1 
ATOM   7227  C  C    . VAL B  1 44  ? 87.633  -63.609  5.538   1.00 36.72  ? 24  VAL B C    1 
ATOM   7228  O  O    . VAL B  1 44  ? 88.687  -64.205  5.388   1.00 39.38  ? 24  VAL B O    1 
ATOM   7229  C  CB   . VAL B  1 44  ? 86.323  -63.617  3.323   1.00 38.00  ? 24  VAL B CB   1 
ATOM   7230  C  CG1  . VAL B  1 44  ? 85.408  -64.660  3.990   1.00 38.00  ? 24  VAL B CG1  1 
ATOM   7231  C  CG2  . VAL B  1 44  ? 85.528  -62.733  2.385   1.00 37.99  ? 24  VAL B CG2  1 
ATOM   7232  H  H    . VAL B  1 44  ? 88.658  -62.611  3.047   1.00 35.87  ? 24  VAL B H    1 
ATOM   7233  H  HA   . VAL B  1 44  ? 86.380  -62.033  4.769   1.00 34.09  ? 24  VAL B HA   1 
ATOM   7234  H  HB   . VAL B  1 44  ? 87.046  -64.169  2.725   1.00 37.61  ? 24  VAL B HB   1 
ATOM   7235  H  HG11 . VAL B  1 44  ? 84.666  -64.970  3.256   1.00 38.41  ? 24  VAL B HG11 1 
ATOM   7236  H  HG12 . VAL B  1 44  ? 85.998  -65.528  4.286   1.00 36.92  ? 24  VAL B HG12 1 
ATOM   7237  H  HG13 . VAL B  1 44  ? 84.912  -64.223  4.855   1.00 37.52  ? 24  VAL B HG13 1 
ATOM   7238  H  HG21 . VAL B  1 44  ? 85.473  -63.215  1.409   1.00 38.58  ? 24  VAL B HG21 1 
ATOM   7239  H  HG22 . VAL B  1 44  ? 84.523  -62.606  2.786   1.00 38.26  ? 24  VAL B HG22 1 
ATOM   7240  H  HG23 . VAL B  1 44  ? 86.013  -61.763  2.301   1.00 38.93  ? 24  VAL B HG23 1 
ATOM   7241  N  N    . LEU B  1 45  ? 86.975  -63.611  6.684   1.00 34.05  ? 25  LEU B N    1 
ATOM   7242  C  CA   . LEU B  1 45  ? 87.409  -64.394  7.838   1.00 34.37  ? 25  LEU B CA   1 
ATOM   7243  C  C    . LEU B  1 45  ? 86.383  -65.465  8.142   1.00 41.03  ? 25  LEU B C    1 
ATOM   7244  O  O    . LEU B  1 45  ? 85.195  -65.183  8.069   1.00 38.77  ? 25  LEU B O    1 
ATOM   7245  C  CB   . LEU B  1 45  ? 87.609  -63.520  9.076   1.00 33.95  ? 25  LEU B CB   1 
ATOM   7246  C  CG   . LEU B  1 45  ? 88.403  -62.246  8.899   1.00 38.70  ? 25  LEU B CG   1 
ATOM   7247  C  CD1  . LEU B  1 45  ? 88.438  -61.464  10.182  1.00 38.21  ? 25  LEU B CD1  1 
ATOM   7248  C  CD2  . LEU B  1 45  ? 89.816  -62.527  8.411   1.00 40.74  ? 25  LEU B CD2  1 
ATOM   7249  H  H    . LEU B  1 45  ? 86.141  -63.058  6.865   1.00 35.55  ? 25  LEU B H    1 
ATOM   7250  H  HA   . LEU B  1 45  ? 88.367  -64.875  7.647   1.00 34.55  ? 25  LEU B HA   1 
ATOM   7251  H  HB2  . LEU B  1 45  ? 86.631  -63.262  9.476   1.00 34.14  ? 25  LEU B HB2  1 
ATOM   7252  H  HB3  . LEU B  1 45  ? 88.141  -64.124  9.811   1.00 33.76  ? 25  LEU B HB3  1 
ATOM   7253  H  HG   . LEU B  1 45  ? 87.912  -61.620  8.155   1.00 39.58  ? 25  LEU B HG   1 
ATOM   7254  H  HD11 . LEU B  1 45  ? 89.014  -60.555  10.017  1.00 38.85  ? 25  LEU B HD11 1 
ATOM   7255  H  HD12 . LEU B  1 45  ? 87.417  -61.216  10.465  1.00 36.67  ? 25  LEU B HD12 1 
ATOM   7256  H  HD13 . LEU B  1 45  ? 88.909  -62.071  10.953  1.00 37.40  ? 25  LEU B HD13 1 
ATOM   7257  H  HD21 . LEU B  1 45  ? 90.441  -61.651  8.574   1.00 41.39  ? 25  LEU B HD21 1 
ATOM   7258  H  HD22 . LEU B  1 45  ? 90.220  -63.377  8.956   1.00 41.20  ? 25  LEU B HD22 1 
ATOM   7259  H  HD23 . LEU B  1 45  ? 89.775  -62.746  7.346   1.00 39.46  ? 25  LEU B HD23 1 
ATOM   7260  N  N    . CYS B  1 46  ? 86.839  -66.692  8.461   1.00 40.97  ? 26  CYS B N    1 
ATOM   7261  C  CA   . CYS B  1 46  ? 85.953  -67.796  8.818   1.00 40.46  ? 26  CYS B CA   1 
ATOM   7262  C  C    . CYS B  1 46  ? 86.407  -68.403  10.110  1.00 41.64  ? 26  CYS B C    1 
ATOM   7263  O  O    . CYS B  1 46  ? 87.600  -68.585  10.324  1.00 39.97  ? 26  CYS B O    1 
ATOM   7264  C  CB   . CYS B  1 46  ? 85.890  -68.842  7.703   1.00 38.88  ? 26  CYS B CB   1 
ATOM   7265  S  SG   . CYS B  1 46  ? 85.317  -68.186  6.116   1.00 42.14  ? 26  CYS B SG   1 
ATOM   7266  H  H    . CYS B  1 46  ? 87.816  -66.964  8.434   1.00 41.56  ? 26  CYS B H    1 
ATOM   7267  H  HA   . CYS B  1 46  ? 84.941  -67.423  8.965   1.00 41.65  ? 26  CYS B HA   1 
ATOM   7268  H  HB2  . CYS B  1 46  ? 86.882  -69.268  7.570   1.00 37.26  ? 26  CYS B HB2  1 
ATOM   7269  H  HB3  . CYS B  1 46  ? 85.196  -69.622  8.017   1.00 38.34  ? 26  CYS B HB3  1 
ATOM   7270  H  HG   . CYS B  1 46  ? 85.980  -68.872  5.181   1.00 41.64  ? 26  CYS B HG   1 
ATOM   7271  N  N    . ALA B  1 47  ? 85.443  -68.720  10.977  1.00 38.90  ? 27  ALA B N    1 
ATOM   7272  C  CA   . ALA B  1 47  ? 85.684  -69.335  12.268  1.00 36.49  ? 27  ALA B CA   1 
ATOM   7273  C  C    . ALA B  1 47  ? 85.150  -70.757  12.252  1.00 38.31  ? 27  ALA B C    1 
ATOM   7274  O  O    . ALA B  1 47  ? 83.983  -70.975  11.924  1.00 36.77  ? 27  ALA B O    1 
ATOM   7275  C  CB   . ALA B  1 47  ? 85.013  -68.515  13.351  1.00 37.00  ? 27  ALA B CB   1 
ATOM   7276  H  H    . ALA B  1 47  ? 84.455  -68.561  10.805  1.00 39.54  ? 27  ALA B H    1 
ATOM   7277  H  HA   . ALA B  1 47  ? 86.750  -69.364  12.488  1.00 37.29  ? 27  ALA B HA   1 
ATOM   7278  H  HB1  . ALA B  1 47  ? 85.153  -69.005  14.313  1.00 37.70  ? 27  ALA B HB1  1 
ATOM   7279  H  HB2  . ALA B  1 47  ? 85.474  -67.529  13.375  1.00 37.28  ? 27  ALA B HB2  1 
ATOM   7280  H  HB3  . ALA B  1 47  ? 83.953  -68.428  13.122  1.00 36.48  ? 27  ALA B HB3  1 
ATOM   7281  N  N    . TYR B  1 48  ? 86.016  -71.731  12.539  1.00 37.21  ? 28  TYR B N    1 
ATOM   7282  C  CA   . TYR B  1 48  ? 85.663  -73.153  12.527  1.00 37.82  ? 28  TYR B CA   1 
ATOM   7283  C  C    . TYR B  1 48  ? 85.937  -73.837  13.834  1.00 42.98  ? 28  TYR B C    1 
ATOM   7284  O  O    . TYR B  1 48  ? 86.919  -73.519  14.509  1.00 44.34  ? 28  TYR B O    1 
ATOM   7285  C  CB   . TYR B  1 48  ? 86.472  -73.936  11.466  1.00 38.18  ? 28  TYR B CB   1 
ATOM   7286  C  CG   . TYR B  1 48  ? 86.479  -73.364  10.070  1.00 37.19  ? 28  TYR B CG   1 
ATOM   7287  C  CD1  . TYR B  1 48  ? 87.438  -72.431  9.682   1.00 38.34  ? 28  TYR B CD1  1 
ATOM   7288  C  CD2  . TYR B  1 48  ? 85.603  -73.837  9.102   1.00 36.73  ? 28  TYR B CD2  1 
ATOM   7289  C  CE1  . TYR B  1 48  ? 87.526  -71.989  8.369   1.00 38.12  ? 28  TYR B CE1  1 
ATOM   7290  C  CE2  . TYR B  1 48  ? 85.647  -73.366  7.795   1.00 36.44  ? 28  TYR B CE2  1 
ATOM   7291  C  CZ   . TYR B  1 48  ? 86.603  -72.428  7.435   1.00 42.77  ? 28  TYR B CZ   1 
ATOM   7292  O  OH   . TYR B  1 48  ? 86.634  -71.920  6.168   1.00 42.28  ? 28  TYR B OH   1 
ATOM   7293  H  H    . TYR B  1 48  ? 86.982  -71.570  12.805  1.00 38.52  ? 28  TYR B H    1 
ATOM   7294  H  HA   . TYR B  1 48  ? 84.608  -73.265  12.288  1.00 38.28  ? 28  TYR B HA   1 
ATOM   7295  H  HB2  . TYR B  1 48  ? 87.507  -73.984  11.803  1.00 39.15  ? 28  TYR B HB2  1 
ATOM   7296  H  HB3  . TYR B  1 48  ? 86.058  -74.941  11.402  1.00 37.29  ? 28  TYR B HB3  1 
ATOM   7297  H  HD1  . TYR B  1 48  ? 88.171  -72.083  10.408  1.00 38.91  ? 28  TYR B HD1  1 
ATOM   7298  H  HD2  . TYR B  1 48  ? 84.844  -74.566  9.384   1.00 36.38  ? 28  TYR B HD2  1 
ATOM   7299  H  HE1  . TYR B  1 48  ? 88.261  -71.231  8.102   1.00 36.98  ? 28  TYR B HE1  1 
ATOM   7300  H  HE2  . TYR B  1 48  ? 84.909  -73.722  7.078   1.00 35.12  ? 28  TYR B HE2  1 
ATOM   7301  H  HH   . TYR B  1 48  ? 85.860  -72.247  5.641   1.00 41.83  ? 28  TYR B HH   1 
ATOM   7302  N  N    . ILE B  1 49  ? 85.114  -74.843  14.151  1.00 40.18  ? 29  ILE B N    1 
ATOM   7303  C  CA   . ILE B  1 49  ? 85.340  -75.778  15.253  1.00 40.33  ? 29  ILE B CA   1 
ATOM   7304  C  C    . ILE B  1 49  ? 85.841  -77.055  14.561  1.00 44.67  ? 29  ILE B C    1 
ATOM   7305  O  O    . ILE B  1 49  ? 85.062  -77.720  13.859  1.00 41.60  ? 29  ILE B O    1 
ATOM   7306  C  CB   . ILE B  1 49  ? 84.099  -76.001  16.136  1.00 44.44  ? 29  ILE B CB   1 
ATOM   7307  C  CG1  . ILE B  1 49  ? 83.695  -74.695  16.851  1.00 45.81  ? 29  ILE B CG1  1 
ATOM   7308  C  CG2  . ILE B  1 49  ? 84.333  -77.127  17.136  1.00 45.61  ? 29  ILE B CG2  1 
ATOM   7309  C  CD1  . ILE B  1 49  ? 84.754  -74.075  17.798  1.00 54.45  ? 29  ILE B CD1  1 
ATOM   7310  H  H    . ILE B  1 49  ? 84.249  -75.034  13.653  1.00 40.31  ? 29  ILE B H    1 
ATOM   7311  H  HA   . ILE B  1 49  ? 86.130  -75.402  15.896  1.00 40.42  ? 29  ILE B HA   1 
ATOM   7312  H  HB   . ILE B  1 49  ? 83.277  -76.297  15.485  1.00 44.40  ? 29  ILE B HB   1 
ATOM   7313  H  HG12 . ILE B  1 49  ? 83.462  -73.947  16.096  1.00 44.50  ? 29  ILE B HG12 1 
ATOM   7314  H  HG13 . ILE B  1 49  ? 82.810  -74.893  17.453  1.00 46.76  ? 29  ILE B HG13 1 
ATOM   7315  H  HG21 . ILE B  1 49  ? 83.606  -77.043  17.943  1.00 46.26  ? 29  ILE B HG21 1 
ATOM   7316  H  HG22 . ILE B  1 49  ? 84.210  -78.094  16.649  1.00 45.32  ? 29  ILE B HG22 1 
ATOM   7317  H  HG23 . ILE B  1 49  ? 85.344  -77.039  17.530  1.00 46.57  ? 29  ILE B HG23 1 
ATOM   7318  H  HD11 . ILE B  1 49  ? 84.280  -73.289  18.383  1.00 54.12  ? 29  ILE B HD11 1 
ATOM   7319  H  HD12 . ILE B  1 49  ? 85.153  -74.842  18.458  1.00 54.59  ? 29  ILE B HD12 1 
ATOM   7320  H  HD13 . ILE B  1 49  ? 85.554  -73.641  17.199  1.00 54.40  ? 29  ILE B HD13 1 
ATOM   7321  N  N    . MET B  1 50  ? 87.152  -77.346  14.709  1.00 39.97  ? 30  MET B N    1 
ATOM   7322  C  CA   . MET B  1 50  ? 87.830  -78.430  14.012  1.00 37.99  ? 30  MET B CA   1 
ATOM   7323  C  C    . MET B  1 50  ? 88.566  -79.362  14.985  1.00 43.86  ? 30  MET B C    1 
ATOM   7324  O  O    . MET B  1 50  ? 89.069  -78.926  16.008  1.00 41.84  ? 30  MET B O    1 
ATOM   7325  C  CB   . MET B  1 50  ? 88.827  -77.789  13.020  1.00 39.29  ? 30  MET B CB   1 
ATOM   7326  C  CG   . MET B  1 50  ? 89.626  -78.774  12.136  1.00 43.01  ? 30  MET B CG   1 
ATOM   7327  S  SD   . MET B  1 50  ? 91.154  -79.473  12.850  1.00 47.29  ? 30  MET B SD   1 
ATOM   7328  C  CE   . MET B  1 50  ? 92.254  -78.080  12.776  1.00 43.82  ? 30  MET B CE   1 
ATOM   7329  H  H    . MET B  1 50  ? 87.769  -76.849  15.344  1.00 40.72  ? 30  MET B H    1 
ATOM   7330  H  HA   . MET B  1 50  ? 87.106  -79.014  13.450  1.00 36.95  ? 30  MET B HA   1 
ATOM   7331  H  HB2  . MET B  1 50  ? 88.247  -77.160  12.346  1.00 39.09  ? 30  MET B HB2  1 
ATOM   7332  H  HB3  . MET B  1 50  ? 89.532  -77.174  13.575  1.00 38.93  ? 30  MET B HB3  1 
ATOM   7333  H  HG2  . MET B  1 50  ? 88.978  -79.610  11.876  1.00 42.75  ? 30  MET B HG2  1 
ATOM   7334  H  HG3  . MET B  1 50  ? 89.915  -78.250  11.228  1.00 41.82  ? 30  MET B HG3  1 
ATOM   7335  H  HE1  . MET B  1 50  ? 93.219  -78.368  13.189  1.00 43.27  ? 30  MET B HE1  1 
ATOM   7336  H  HE2  . MET B  1 50  ? 92.371  -77.791  11.732  1.00 43.13  ? 30  MET B HE2  1 
ATOM   7337  H  HE3  . MET B  1 50  ? 91.841  -77.253  13.351  1.00 42.97  ? 30  MET B HE3  1 
ATOM   7338  N  N    . LYS B  1 51  ? 88.641  -80.640  14.630  1.00 42.90  ? 31  LYS B N    1 
ATOM   7339  C  CA   . LYS B  1 51  ? 89.376  -81.644  15.384  1.00 41.86  ? 31  LYS B CA   1 
ATOM   7340  C  C    . LYS B  1 51  ? 90.213  -82.477  14.432  1.00 45.97  ? 31  LYS B C    1 
ATOM   7341  O  O    . LYS B  1 51  ? 89.636  -83.107  13.533  1.00 45.52  ? 31  LYS B O    1 
ATOM   7342  C  CB   . LYS B  1 51  ? 88.434  -82.546  16.187  1.00 44.13  ? 31  LYS B CB   1 
ATOM   7343  C  CG   . LYS B  1 51  ? 89.178  -83.470  17.148  1.00 50.63  ? 31  LYS B CG   1 
ATOM   7344  C  CD   . LYS B  1 51  ? 88.249  -84.428  17.871  1.00 65.11  ? 31  LYS B CD   1 
ATOM   7345  C  CE   . LYS B  1 51  ? 89.000  -85.350  18.794  1.00 85.34  ? 31  LYS B CE   1 
ATOM   7346  N  NZ   . LYS B  1 51  ? 88.177  -86.524  19.184  1.00 100.25 ? 31  LYS B NZ   1 
ATOM   7347  H  H    . LYS B  1 51  ? 88.190  -81.019  13.802  1.00 43.18  ? 31  LYS B H    1 
ATOM   7348  H  HA   . LYS B  1 51  ? 90.019  -81.157  16.113  1.00 43.51  ? 31  LYS B HA   1 
ATOM   7349  H  HB2  . LYS B  1 51  ? 87.775  -81.915  16.781  1.00 44.84  ? 31  LYS B HB2  1 
ATOM   7350  H  HB3  . LYS B  1 51  ? 87.842  -83.155  15.505  1.00 44.14  ? 31  LYS B HB3  1 
ATOM   7351  H  HG2  . LYS B  1 51  ? 89.897  -84.071  16.595  1.00 51.45  ? 31  LYS B HG2  1 
ATOM   7352  H  HG3  . LYS B  1 51  ? 89.694  -82.872  17.898  1.00 51.04  ? 31  LYS B HG3  1 
ATOM   7353  H  HD2  . LYS B  1 51  ? 87.542  -83.858  18.471  1.00 64.72  ? 31  LYS B HD2  1 
ATOM   7354  H  HD3  . LYS B  1 51  ? 87.718  -85.035  17.138  1.00 64.96  ? 31  LYS B HD3  1 
ATOM   7355  H  HE2  . LYS B  1 51  ? 89.896  -85.714  18.295  1.00 85.73  ? 31  LYS B HE2  1 
ATOM   7356  H  HE3  . LYS B  1 51  ? 89.270  -84.805  19.698  1.00 86.08  ? 31  LYS B HE3  1 
ATOM   7357  H  HZ1  . LYS B  1 51  ? 88.674  -87.082  19.872  1.00 101.18 ? 31  LYS B HZ1  1 
ATOM   7358  H  HZ2  . LYS B  1 51  ? 87.298  -86.213  19.583  1.00 100.28 ? 31  LYS B HZ2  1 
ATOM   7359  H  HZ3  . LYS B  1 51  ? 87.986  -87.099  18.370  1.00 99.71  ? 31  LYS B HZ3  1 
ATOM   7360  N  N    . PRO B  1 52  ? 91.556  -82.499  14.577  1.00 43.57  ? 32  PRO B N    1 
ATOM   7361  C  CA   . PRO B  1 52  ? 92.362  -83.372  13.718  1.00 44.56  ? 32  PRO B CA   1 
ATOM   7362  C  C    . PRO B  1 52  ? 92.086  -84.847  14.004  1.00 50.86  ? 32  PRO B C    1 
ATOM   7363  O  O    . PRO B  1 52  ? 91.775  -85.222  15.140  1.00 48.43  ? 32  PRO B O    1 
ATOM   7364  C  CB   . PRO B  1 52  ? 93.817  -83.027  14.116  1.00 47.67  ? 32  PRO B CB   1 
ATOM   7365  C  CG   . PRO B  1 52  ? 93.740  -81.767  14.855  1.00 51.66  ? 32  PRO B CG   1 
ATOM   7366  C  CD   . PRO B  1 52  ? 92.417  -81.806  15.553  1.00 47.08  ? 32  PRO B CD   1 
ATOM   7367  H  HA   . PRO B  1 52  ? 92.204  -83.148  12.666  1.00 42.82  ? 32  PRO B HA   1 
ATOM   7368  H  HB2  . PRO B  1 52  ? 94.229  -83.806  14.757  1.00 47.52  ? 32  PRO B HB2  1 
ATOM   7369  H  HB3  . PRO B  1 52  ? 94.425  -82.921  13.221  1.00 48.60  ? 32  PRO B HB3  1 
ATOM   7370  H  HG2  . PRO B  1 52  ? 94.555  -81.710  15.574  1.00 52.63  ? 32  PRO B HG2  1 
ATOM   7371  H  HG3  . PRO B  1 52  ? 93.784  -80.932  14.157  1.00 51.07  ? 32  PRO B HG3  1 
ATOM   7372  H  HD2  . PRO B  1 52  ? 92.487  -82.366  16.484  1.00 47.58  ? 32  PRO B HD2  1 
ATOM   7373  H  HD3  . PRO B  1 52  ? 92.080  -80.783  15.718  1.00 46.88  ? 32  PRO B HD3  1 
ATOM   7374  N  N    . LYS B  1 53  ? 92.226  -85.687  12.984  1.00 48.99  ? 33  LYS B N    1 
ATOM   7375  C  CA   . LYS B  1 53  ? 92.067  -87.124  13.172  1.00 49.86  ? 33  LYS B CA   1 
ATOM   7376  C  C    . LYS B  1 53  ? 93.335  -87.608  13.880  1.00 57.70  ? 33  LYS B C    1 
ATOM   7377  O  O    . LYS B  1 53  ? 94.394  -86.996  13.714  1.00 57.28  ? 33  LYS B O    1 
ATOM   7378  C  CB   . LYS B  1 53  ? 91.835  -87.821  11.819  1.00 51.90  ? 33  LYS B CB   1 
ATOM   7379  C  CG   . LYS B  1 53  ? 91.084  -89.124  11.931  1.00 56.78  ? 33  LYS B CG   1 
ATOM   7380  C  CD   . LYS B  1 53  ? 90.830  -89.750  10.575  1.00 53.34  ? 33  LYS B CD   1 
ATOM   7381  C  CE   . LYS B  1 53  ? 89.680  -89.131  9.837   1.00 60.23  ? 33  LYS B CE   1 
ATOM   7382  N  NZ   . LYS B  1 53  ? 89.368  -89.898  8.614   1.00 74.23  ? 33  LYS B NZ   1 
ATOM   7383  H  H    . LYS B  1 53  ? 92.462  -85.396  12.042  1.00 48.46  ? 33  LYS B H    1 
ATOM   7384  H  HA   . LYS B  1 53  ? 91.207  -87.334  13.806  1.00 49.65  ? 33  LYS B HA   1 
ATOM   7385  H  HB2  . LYS B  1 53  ? 91.260  -87.159  11.173  1.00 51.62  ? 33  LYS B HB2  1 
ATOM   7386  H  HB3  . LYS B  1 53  ? 92.800  -88.025  11.360  1.00 52.15  ? 33  LYS B HB3  1 
ATOM   7387  H  HG2  . LYS B  1 53  ? 91.676  -89.823  12.521  1.00 57.34  ? 33  LYS B HG2  1 
ATOM   7388  H  HG3  . LYS B  1 53  ? 90.122  -88.940  12.405  1.00 56.55  ? 33  LYS B HG3  1 
ATOM   7389  H  HD2  . LYS B  1 53  ? 91.718  -89.630  9.958   1.00 53.20  ? 33  LYS B HD2  1 
ATOM   7390  H  HD3  . LYS B  1 53  ? 90.615  -90.809  10.708  1.00 53.87  ? 33  LYS B HD3  1 
ATOM   7391  H  HE2  . LYS B  1 53  ? 88.796  -89.128  10.472  1.00 59.71  ? 33  LYS B HE2  1 
ATOM   7392  H  HE3  . LYS B  1 53  ? 89.939  -88.119  9.531   1.00 59.91  ? 33  LYS B HE3  1 
ATOM   7393  H  HZ1  . LYS B  1 53  ? 88.761  -89.345  8.019   1.00 73.95  ? 33  LYS B HZ1  1 
ATOM   7394  H  HZ2  . LYS B  1 53  ? 90.220  -90.116  8.106   1.00 74.62  ? 33  LYS B HZ2  1 
ATOM   7395  H  HZ3  . LYS B  1 53  ? 88.896  -90.762  8.858   1.00 74.47  ? 33  LYS B HZ3  1 
ATOM   7396  N  N    . ALA B  1 54  ? 93.223  -88.633  14.730  1.00 57.36  ? 34  ALA B N    1 
ATOM   7397  C  CA   . ALA B  1 54  ? 94.386  -89.154  15.440  1.00 59.28  ? 34  ALA B CA   1 
ATOM   7398  C  C    . ALA B  1 54  ? 95.363  -89.840  14.475  1.00 66.99  ? 34  ALA B C    1 
ATOM   7399  O  O    . ALA B  1 54  ? 94.937  -90.463  13.494  1.00 67.63  ? 34  ALA B O    1 
ATOM   7400  C  CB   . ALA B  1 54  ? 93.956  -90.130  16.523  1.00 60.84  ? 34  ALA B CB   1 
ATOM   7401  H  H    . ALA B  1 54  ? 92.349  -89.104  14.943  1.00 57.24  ? 34  ALA B H    1 
ATOM   7402  H  HA   . ALA B  1 54  ? 94.896  -88.321  15.921  1.00 59.86  ? 34  ALA B HA   1 
ATOM   7403  H  HB1  . ALA B  1 54  ? 94.823  -90.383  17.131  1.00 61.77  ? 34  ALA B HB1  1 
ATOM   7404  H  HB2  . ALA B  1 54  ? 93.194  -89.662  17.144  1.00 60.22  ? 34  ALA B HB2  1 
ATOM   7405  H  HB3  . ALA B  1 54  ? 93.562  -91.028  16.050  1.00 61.06  ? 34  ALA B HB3  1 
ATOM   7406  N  N    . GLY B  1 55  ? 96.657  -89.662  14.736  1.00 65.02  ? 35  GLY B N    1 
ATOM   7407  C  CA   . GLY B  1 55  ? 97.729  -90.261  13.954  1.00 65.48  ? 35  GLY B CA   1 
ATOM   7408  C  C    . GLY B  1 55  ? 98.311  -89.456  12.810  1.00 69.40  ? 35  GLY B C    1 
ATOM   7409  O  O    . GLY B  1 55  ? 99.182  -89.976  12.103  1.00 70.64  ? 35  GLY B O    1 
ATOM   7410  H  H    . GLY B  1 55  ? 97.008  -89.093  15.500  1.00 65.42  ? 35  GLY B H    1 
ATOM   7411  H  HA2  . GLY B  1 55  ? 98.549  -90.484  14.633  1.00 66.52  ? 35  GLY B HA2  1 
ATOM   7412  H  HA3  . GLY B  1 55  ? 97.381  -91.204  13.537  1.00 66.00  ? 35  GLY B HA3  1 
ATOM   7413  N  N    . PHE B  1 56  ? 97.858  -88.203  12.594  1.00 63.52  ? 36  PHE B N    1 
ATOM   7414  C  CA   . PHE B  1 56  ? 98.380  -87.377  11.501  1.00 61.37  ? 36  PHE B CA   1 
ATOM   7415  C  C    . PHE B  1 56  ? 99.169  -86.227  12.138  1.00 64.87  ? 36  PHE B C    1 
ATOM   7416  O  O    . PHE B  1 56  ? 99.999  -86.499  13.003  1.00 66.07  ? 36  PHE B O    1 
ATOM   7417  C  CB   . PHE B  1 56  ? 97.240  -86.920  10.566  1.00 61.75  ? 36  PHE B CB   1 
ATOM   7418  C  CG   . PHE B  1 56  ? 96.473  -88.053  9.926   1.00 63.42  ? 36  PHE B CG   1 
ATOM   7419  C  CD1  . PHE B  1 56  ? 96.910  -88.637  8.741   1.00 66.37  ? 36  PHE B CD1  1 
ATOM   7420  C  CD2  . PHE B  1 56  ? 95.339  -88.557  10.522  1.00 65.79  ? 36  PHE B CD2  1 
ATOM   7421  C  CE1  . PHE B  1 56  ? 96.213  -89.703  8.168   1.00 67.14  ? 36  PHE B CE1  1 
ATOM   7422  C  CE2  . PHE B  1 56  ? 94.610  -89.578  9.914   1.00 68.50  ? 36  PHE B CE2  1 
ATOM   7423  C  CZ   . PHE B  1 56  ? 95.049  -90.139  8.734   1.00 66.42  ? 36  PHE B CZ   1 
ATOM   7424  H  H    . PHE B  1 56  ? 97.172  -87.723  13.166  1.00 63.16  ? 36  PHE B H    1 
ATOM   7425  H  HA   . PHE B  1 56  ? 99.080  -87.938  10.885  1.00 61.52  ? 36  PHE B HA   1 
ATOM   7426  H  HB2  . PHE B  1 56  ? 96.522  -86.340  11.144  1.00 61.23  ? 36  PHE B HB2  1 
ATOM   7427  H  HB3  . PHE B  1 56  ? 97.644  -86.320  9.753   1.00 61.19  ? 36  PHE B HB3  1 
ATOM   7428  H  HD1  . PHE B  1 56  ? 97.837  -88.303  8.279   1.00 66.72  ? 36  PHE B HD1  1 
ATOM   7429  H  HD2  . PHE B  1 56  ? 94.984  -88.085  11.437  1.00 65.36  ? 36  PHE B HD2  1 
ATOM   7430  H  HE1  . PHE B  1 56  ? 96.551  -90.140  7.231   1.00 66.50  ? 36  PHE B HE1  1 
ATOM   7431  H  HE2  . PHE B  1 56  ? 93.720  -89.964  10.406  1.00 68.59  ? 36  PHE B HE2  1 
ATOM   7432  H  HZ   . PHE B  1 56  ? 94.504  -90.960  8.270   1.00 66.44  ? 36  PHE B HZ   1 
ATOM   7433  N  N    . GLY B  1 57  ? 98.904  -84.978  11.756  1.00 59.19  ? 37  GLY B N    1 
ATOM   7434  C  CA   . GLY B  1 57  ? 99.632  -83.835  12.278  1.00 56.94  ? 37  GLY B CA   1 
ATOM   7435  C  C    . GLY B  1 57  ? 98.949  -83.277  13.493  1.00 56.57  ? 37  GLY B C    1 
ATOM   7436  O  O    . GLY B  1 57  ? 97.800  -83.625  13.784  1.00 55.87  ? 37  GLY B O    1 
ATOM   7437  H  H    . GLY B  1 57  ? 98.157  -84.679  11.136  1.00 58.99  ? 37  GLY B H    1 
ATOM   7438  H  HA2  . GLY B  1 57  ? 100.659 -84.095  12.530  1.00 57.33  ? 37  GLY B HA2  1 
ATOM   7439  H  HA3  . GLY B  1 57  ? 99.654  -83.049  11.522  1.00 56.85  ? 37  GLY B HA3  1 
ATOM   7440  N  N    . ASN B  1 58  ? 99.649  -82.365  14.172  1.00 49.95  ? 38  ASN B N    1 
ATOM   7441  C  CA   . ASN B  1 58  ? 99.129  -81.659  15.340  1.00 48.00  ? 38  ASN B CA   1 
ATOM   7442  C  C    . ASN B  1 58  ? 98.049  -80.629  14.883  1.00 47.54  ? 38  ASN B C    1 
ATOM   7443  O  O    . ASN B  1 58  ? 97.693  -80.584  13.698  1.00 44.04  ? 38  ASN B O    1 
ATOM   7444  C  CB   . ASN B  1 58  ? 100.291 -81.013  16.133  1.00 45.07  ? 38  ASN B CB   1 
ATOM   7445  C  CG   . ASN B  1 58  ? 101.024 -79.895  15.438  1.00 72.73  ? 38  ASN B CG   1 
ATOM   7446  O  OD1  . ASN B  1 58  ? 100.562 -79.327  14.459  1.00 68.69  ? 38  ASN B OD1  1 
ATOM   7447  N  ND2  . ASN B  1 58  ? 102.186 -79.540  15.942  1.00 68.83  ? 38  ASN B ND2  1 
ATOM   7448  H  H    . ASN B  1 58  ? 100.599 -82.112  13.917  1.00 50.38  ? 38  ASN B H    1 
ATOM   7449  H  HA   . ASN B  1 58  ? 98.643  -82.378  15.998  1.00 48.28  ? 38  ASN B HA   1 
ATOM   7450  H  HB2  . ASN B  1 58  ? 99.924  -80.637  17.084  1.00 44.87  ? 38  ASN B HB2  1 
ATOM   7451  H  HB3  . ASN B  1 58  ? 101.027 -81.794  16.319  1.00 46.01  ? 38  ASN B HB3  1 
ATOM   7452  H  HD21 . ASN B  1 58  ? 102.714 -78.788  15.510  1.00 69.12  ? 38  ASN B HD21 1 
ATOM   7453  H  HD22 . ASN B  1 58  ? 102.551 -80.006  16.767  1.00 69.83  ? 38  ASN B HD22 1 
ATOM   7454  N  N    . PHE B  1 59  ? 97.535  -79.814  15.807  1.00 45.51  ? 39  PHE B N    1 
ATOM   7455  C  CA   . PHE B  1 59  ? 96.456  -78.874  15.490  1.00 44.34  ? 39  PHE B CA   1 
ATOM   7456  C  C    . PHE B  1 59  ? 96.849  -77.824  14.443  1.00 47.95  ? 39  PHE B C    1 
ATOM   7457  O  O    . PHE B  1 59  ? 96.114  -77.654  13.476  1.00 47.67  ? 39  PHE B O    1 
ATOM   7458  C  CB   . PHE B  1 59  ? 95.962  -78.182  16.762  1.00 45.87  ? 39  PHE B CB   1 
ATOM   7459  C  CG   . PHE B  1 59  ? 94.605  -77.547  16.604  1.00 46.38  ? 39  PHE B CG   1 
ATOM   7460  C  CD1  . PHE B  1 59  ? 93.452  -78.309  16.690  1.00 48.92  ? 39  PHE B CD1  1 
ATOM   7461  C  CD2  . PHE B  1 59  ? 94.481  -76.186  16.373  1.00 47.97  ? 39  PHE B CD2  1 
ATOM   7462  C  CE1  . PHE B  1 59  ? 92.199  -77.722  16.561  1.00 49.09  ? 39  PHE B CE1  1 
ATOM   7463  C  CE2  . PHE B  1 59  ? 93.223  -75.598  16.237  1.00 51.00  ? 39  PHE B CE2  1 
ATOM   7464  C  CZ   . PHE B  1 59  ? 92.089  -76.371  16.322  1.00 48.79  ? 39  PHE B CZ   1 
ATOM   7465  H  H    . PHE B  1 59  ? 97.844  -79.778  16.774  1.00 46.51  ? 39  PHE B H    1 
ATOM   7466  H  HA   . PHE B  1 59  ? 95.623  -79.447  15.085  1.00 44.57  ? 39  PHE B HA   1 
ATOM   7467  H  HB2  . PHE B  1 59  ? 95.864  -78.937  17.540  1.00 45.80  ? 39  PHE B HB2  1 
ATOM   7468  H  HB3  . PHE B  1 59  ? 96.674  -77.417  17.063  1.00 46.10  ? 39  PHE B HB3  1 
ATOM   7469  H  HD1  . PHE B  1 59  ? 93.531  -79.376  16.893  1.00 49.35  ? 39  PHE B HD1  1 
ATOM   7470  H  HD2  . PHE B  1 59  ? 95.378  -75.576  16.280  1.00 47.47  ? 39  PHE B HD2  1 
ATOM   7471  H  HE1  . PHE B  1 59  ? 91.309  -78.338  16.661  1.00 48.56  ? 39  PHE B HE1  1 
ATOM   7472  H  HE2  . PHE B  1 59  ? 93.137  -74.533  16.029  1.00 50.92  ? 39  PHE B HE2  1 
ATOM   7473  H  HZ   . PHE B  1 59  ? 91.108  -75.910  16.219  1.00 48.38  ? 39  PHE B HZ   1 
ATOM   7474  N  N    . ILE B  1 60  ? 97.989  -77.136  14.623  1.00 46.42  ? 40  ILE B N    1 
ATOM   7475  C  CA   . ILE B  1 60  ? 98.424  -76.079  13.706  1.00 44.89  ? 40  ILE B CA   1 
ATOM   7476  C  C    . ILE B  1 60  ? 98.797  -76.659  12.327  1.00 48.02  ? 40  ILE B C    1 
ATOM   7477  O  O    . ILE B  1 60  ? 98.491  -76.026  11.305  1.00 47.66  ? 40  ILE B O    1 
ATOM   7478  C  CB   . ILE B  1 60  ? 99.575  -75.200  14.301  1.00 48.35  ? 40  ILE B CB   1 
ATOM   7479  C  CG1  . ILE B  1 60  ? 99.749  -73.892  13.502  1.00 49.15  ? 40  ILE B CG1  1 
ATOM   7480  C  CG2  . ILE B  1 60  ? 100.926 -75.948  14.389  1.00 48.35  ? 40  ILE B CG2  1 
ATOM   7481  C  CD1  . ILE B  1 60  ? 98.529  -72.965  13.478  1.00 55.39  ? 40  ILE B CD1  1 
ATOM   7482  H  H    . ILE B  1 60  ? 98.603  -77.278  15.421  1.00 48.62  ? 40  ILE B H    1 
ATOM   7483  H  HA   . ILE B  1 60  ? 97.563  -75.432  13.554  1.00 44.49  ? 40  ILE B HA   1 
ATOM   7484  H  HB   . ILE B  1 60  ? 99.283  -74.925  15.314  1.00 47.82  ? 40  ILE B HB   1 
ATOM   7485  H  HG12 . ILE B  1 60  ? 100.563 -73.328  13.958  1.00 50.07  ? 40  ILE B HG12 1 
ATOM   7486  H  HG13 . ILE B  1 60  ? 100.012 -74.126  12.472  1.00 47.89  ? 40  ILE B HG13 1 
ATOM   7487  H  HG21 . ILE B  1 60  ? 101.646 -75.294  14.878  1.00 48.30  ? 40  ILE B HG21 1 
ATOM   7488  H  HG22 . ILE B  1 60  ? 100.801 -76.851  14.983  1.00 49.08  ? 40  ILE B HG22 1 
ATOM   7489  H  HG23 . ILE B  1 60  ? 101.290 -76.199  13.396  1.00 47.54  ? 40  ILE B HG23 1 
ATOM   7490  H  HD11 . ILE B  1 60  ? 98.863  -71.949  13.274  1.00 55.61  ? 40  ILE B HD11 1 
ATOM   7491  H  HD12 . ILE B  1 60  ? 97.852  -73.290  12.690  1.00 54.27  ? 40  ILE B HD12 1 
ATOM   7492  H  HD13 . ILE B  1 60  ? 98.028  -73.004  14.444  1.00 55.77  ? 40  ILE B HD13 1 
ATOM   7493  N  N    . GLN B  1 61  ? 99.434  -77.838  12.282  1.00 44.36  ? 41  GLN B N    1 
ATOM   7494  C  CA   . GLN B  1 61  ? 99.766  -78.514  11.005  1.00 43.88  ? 41  GLN B CA   1 
ATOM   7495  C  C    . GLN B  1 61  ? 98.510  -78.854  10.222  1.00 45.27  ? 41  GLN B C    1 
ATOM   7496  O  O    . GLN B  1 61  ? 98.453  -78.641  9.008   1.00 43.02  ? 41  GLN B O    1 
ATOM   7497  C  CB   . GLN B  1 61  ? 100.561 -79.805  11.261  1.00 45.98  ? 41  GLN B CB   1 
ATOM   7498  C  CG   . GLN B  1 61  ? 101.991 -79.539  11.706  1.00 59.73  ? 41  GLN B CG   1 
ATOM   7499  C  CD   . GLN B  1 61  ? 102.711 -80.744  12.270  1.00 72.98  ? 41  GLN B CD   1 
ATOM   7500  O  OE1  . GLN B  1 61  ? 102.113 -81.753  12.656  1.00 61.57  ? 41  GLN B OE1  1 
ATOM   7501  N  NE2  . GLN B  1 61  ? 104.024 -80.641  12.375  1.00 66.86  ? 41  GLN B NE2  1 
ATOM   7502  H  H    . GLN B  1 61  ? 99.740  -78.344  13.107  1.00 45.74  ? 41  GLN B H    1 
ATOM   7503  H  HA   . GLN B  1 61  ? 100.376 -77.846  10.400  1.00 43.89  ? 41  GLN B HA   1 
ATOM   7504  H  HB2  . GLN B  1 61  ? 100.054 -80.383  12.032  1.00 46.52  ? 41  GLN B HB2  1 
ATOM   7505  H  HB3  . GLN B  1 61  ? 100.607 -80.377  10.336  1.00 45.55  ? 41  GLN B HB3  1 
ATOM   7506  H  HG2  . GLN B  1 61  ? 102.538 -79.220  10.822  1.00 59.61  ? 41  GLN B HG2  1 
ATOM   7507  H  HG3  . GLN B  1 61  ? 102.010 -78.745  12.451  1.00 59.94  ? 41  GLN B HG3  1 
ATOM   7508  H  HE21 . GLN B  1 61  ? 104.494 -79.787  12.092  1.00 66.99  ? 41  GLN B HE21 1 
ATOM   7509  H  HE22 . GLN B  1 61  ? 104.566 -81.419  12.737  1.00 67.56  ? 41  GLN B HE22 1 
ATOM   7510  N  N    . THR B  1 62  ? 97.498  -79.379  10.927  1.00 42.41  ? 42  THR B N    1 
ATOM   7511  C  CA   . THR B  1 62  ? 96.222  -79.758  10.323  1.00 42.00  ? 42  THR B CA   1 
ATOM   7512  C  C    . THR B  1 62  ? 95.468  -78.517  9.854   1.00 43.81  ? 42  THR B C    1 
ATOM   7513  O  O    . THR B  1 62  ? 94.902  -78.530  8.760   1.00 41.72  ? 42  THR B O    1 
ATOM   7514  C  CB   . THR B  1 62  ? 95.400  -80.572  11.315  1.00 53.97  ? 42  THR B CB   1 
ATOM   7515  O  OG1  . THR B  1 62  ? 96.184  -81.698  11.727  1.00 63.09  ? 42  THR B OG1  1 
ATOM   7516  C  CG2  . THR B  1 62  ? 94.082  -81.026  10.726  1.00 49.34  ? 42  THR B CG2  1 
ATOM   7517  H  H    . THR B  1 62  ? 97.548  -79.583  11.920  1.00 42.57  ? 42  THR B H    1 
ATOM   7518  H  HA   . THR B  1 62  ? 96.412  -80.384  9.452   1.00 42.15  ? 42  THR B HA   1 
ATOM   7519  H  HB   . THR B  1 62  ? 95.183  -79.959  12.187  1.00 54.32  ? 42  THR B HB   1 
ATOM   7520  H  HG1  . THR B  1 62  ? 96.381  -81.640  12.698  1.00 63.59  ? 42  THR B HG1  1 
ATOM   7521  H  HG21 . THR B  1 62  ? 93.725  -81.910  11.253  1.00 50.56  ? 42  THR B HG21 1 
ATOM   7522  H  HG22 . THR B  1 62  ? 93.338  -80.238  10.831  1.00 48.27  ? 42  THR B HG22 1 
ATOM   7523  H  HG23 . THR B  1 62  ? 94.204  -81.263  9.670   1.00 48.21  ? 42  THR B HG23 1 
ATOM   7524  N  N    . ALA B  1 63  ? 95.469  -77.446  10.668  1.00 40.08  ? 43  ALA B N    1 
ATOM   7525  C  CA   . ALA B  1 63  ? 94.816  -76.187  10.299  1.00 38.56  ? 43  ALA B CA   1 
ATOM   7526  C  C    . ALA B  1 63  ? 95.504  -75.564  9.066   1.00 42.09  ? 43  ALA B C    1 
ATOM   7527  O  O    . ALA B  1 63  ? 94.815  -75.033  8.204   1.00 42.50  ? 43  ALA B O    1 
ATOM   7528  C  CB   . ALA B  1 63  ? 94.841  -75.215  11.474  1.00 38.94  ? 43  ALA B CB   1 
ATOM   7529  H  H    . ALA B  1 63  ? 95.887  -77.432  11.592  1.00 40.23  ? 43  ALA B H    1 
ATOM   7530  H  HA   . ALA B  1 63  ? 93.781  -76.394  10.035  1.00 37.06  ? 43  ALA B HA   1 
ATOM   7531  H  HB1  . ALA B  1 63  ? 94.401  -74.269  11.165  1.00 37.25  ? 43  ALA B HB1  1 
ATOM   7532  H  HB2  . ALA B  1 63  ? 94.266  -75.638  12.297  1.00 39.54  ? 43  ALA B HB2  1 
ATOM   7533  H  HB3  . ALA B  1 63  ? 95.872  -75.065  11.788  1.00 38.94  ? 43  ALA B HB3  1 
ATOM   7534  N  N    . ALA B  1 64  ? 96.843  -75.665  8.967   1.00 37.53  ? 44  ALA B N    1 
ATOM   7535  C  CA   . ALA B  1 64  ? 97.598  -75.153  7.824   1.00 37.53  ? 44  ALA B CA   1 
ATOM   7536  C  C    . ALA B  1 64  ? 97.265  -75.930  6.544   1.00 42.87  ? 44  ALA B C    1 
ATOM   7537  O  O    . ALA B  1 64  ? 97.096  -75.317  5.481   1.00 40.43  ? 44  ALA B O    1 
ATOM   7538  C  CB   . ALA B  1 64  ? 99.079  -75.238  8.104   1.00 38.67  ? 44  ALA B CB   1 
ATOM   7539  H  H    . ALA B  1 64  ? 97.428  -76.095  9.678   1.00 38.57  ? 44  ALA B H    1 
ATOM   7540  H  HA   . ALA B  1 64  ? 97.334  -74.109  7.660   1.00 36.85  ? 44  ALA B HA   1 
ATOM   7541  H  HB1  . ALA B  1 64  ? 99.630  -74.794  7.278   1.00 37.50  ? 44  ALA B HB1  1 
ATOM   7542  H  HB2  . ALA B  1 64  ? 99.264  -74.693  9.029   1.00 37.48  ? 44  ALA B HB2  1 
ATOM   7543  H  HB3  . ALA B  1 64  ? 99.364  -76.282  8.218   1.00 38.03  ? 44  ALA B HB3  1 
ATOM   7544  N  N    . HIS B  1 65  ? 97.158  -77.268  6.641   1.00 40.73  ? 45  HIS B N    1 
ATOM   7545  C  CA   . HIS B  1 65  ? 96.770  -78.074  5.475   1.00 40.97  ? 45  HIS B CA   1 
ATOM   7546  C  C    . HIS B  1 65  ? 95.325  -77.722  5.065   1.00 41.36  ? 45  HIS B C    1 
ATOM   7547  O  O    . HIS B  1 65  ? 95.021  -77.656  3.876   1.00 37.64  ? 45  HIS B O    1 
ATOM   7548  C  CB   . HIS B  1 65  ? 96.906  -79.573  5.764   1.00 42.89  ? 45  HIS B CB   1 
ATOM   7549  C  CG   . HIS B  1 65  ? 96.615  -80.446  4.575   1.00 46.67  ? 45  HIS B CG   1 
ATOM   7550  N  ND1  . HIS B  1 65  ? 96.211  -81.753  4.733   1.00 49.33  ? 45  HIS B ND1  1 
ATOM   7551  C  CD2  . HIS B  1 65  ? 96.701  -80.172  3.250   1.00 49.99  ? 45  HIS B CD2  1 
ATOM   7552  C  CE1  . HIS B  1 65  ? 96.023  -82.228  3.511   1.00 49.73  ? 45  HIS B CE1  1 
ATOM   7553  N  NE2  . HIS B  1 65  ? 96.300  -81.305  2.583   1.00 50.13  ? 45  HIS B NE2  1 
ATOM   7554  H  H    . HIS B  1 65  ? 97.332  -77.808  7.482   1.00 40.81  ? 45  HIS B H    1 
ATOM   7555  H  HA   . HIS B  1 65  ? 97.428  -77.824  4.643   1.00 41.48  ? 45  HIS B HA   1 
ATOM   7556  H  HB2  . HIS B  1 65  ? 97.923  -79.777  6.095   1.00 44.22  ? 45  HIS B HB2  1 
ATOM   7557  H  HB3  . HIS B  1 65  ? 96.209  -79.845  6.557   1.00 42.69  ? 45  HIS B HB3  1 
ATOM   7558  H  HD1  . HIS B  1 65  ? 96.087  -82.245  5.613   1.00 50.29  ? 45  HIS B HD1  1 
ATOM   7559  H  HD2  . HIS B  1 65  ? 97.034  -79.241  2.794   1.00 50.37  ? 45  HIS B HD2  1 
ATOM   7560  H  HE1  . HIS B  1 65  ? 95.690  -83.241  3.290   1.00 50.57  ? 45  HIS B HE1  1 
ATOM   7561  H  HE2  . HIS B  1 65  ? 96.224  -81.415  1.577   1.00 50.19  ? 45  HIS B HE2  1 
ATOM   7562  N  N    . PHE B  1 66  ? 94.454  -77.485  6.056   1.00 39.69  ? 46  PHE B N    1 
ATOM   7563  C  CA   . PHE B  1 66  ? 93.061  -77.093  5.824   1.00 38.38  ? 46  PHE B CA   1 
ATOM   7564  C  C    . PHE B  1 66  ? 93.014  -75.776  5.024   1.00 42.11  ? 46  PHE B C    1 
ATOM   7565  O  O    . PHE B  1 66  ? 92.294  -75.684  4.028   1.00 40.92  ? 46  PHE B O    1 
ATOM   7566  C  CB   . PHE B  1 66  ? 92.325  -76.960  7.176   1.00 39.75  ? 46  PHE B CB   1 
ATOM   7567  C  CG   . PHE B  1 66  ? 90.835  -76.779  7.098   1.00 38.96  ? 46  PHE B CG   1 
ATOM   7568  C  CD1  . PHE B  1 66  ? 90.286  -75.535  6.835   1.00 40.03  ? 46  PHE B CD1  1 
ATOM   7569  C  CD2  . PHE B  1 66  ? 89.979  -77.830  7.391   1.00 38.90  ? 46  PHE B CD2  1 
ATOM   7570  C  CE1  . PHE B  1 66  ? 88.908  -75.351  6.833   1.00 39.75  ? 46  PHE B CE1  1 
ATOM   7571  C  CE2  . PHE B  1 66  ? 88.604  -77.642  7.397   1.00 39.59  ? 46  PHE B CE2  1 
ATOM   7572  C  CZ   . PHE B  1 66  ? 88.078  -76.399  7.125   1.00 37.65  ? 46  PHE B CZ   1 
ATOM   7573  H  H    . PHE B  1 66  ? 94.692  -77.563  7.041   1.00 40.50  ? 46  PHE B H    1 
ATOM   7574  H  HA   . PHE B  1 66  ? 92.570  -77.854  5.222   1.00 38.07  ? 46  PHE B HA   1 
ATOM   7575  H  HB2  . PHE B  1 66  ? 92.510  -77.857  7.764   1.00 39.36  ? 46  PHE B HB2  1 
ATOM   7576  H  HB3  . PHE B  1 66  ? 92.704  -76.090  7.707   1.00 39.70  ? 46  PHE B HB3  1 
ATOM   7577  H  HD1  . PHE B  1 66  ? 90.938  -74.685  6.638   1.00 39.51  ? 46  PHE B HD1  1 
ATOM   7578  H  HD2  . PHE B  1 66  ? 90.390  -78.814  7.609   1.00 38.93  ? 46  PHE B HD2  1 
ATOM   7579  H  HE1  . PHE B  1 66  ? 88.496  -74.366  6.616   1.00 39.85  ? 46  PHE B HE1  1 
ATOM   7580  H  HE2  . PHE B  1 66  ? 87.949  -78.494  7.560   1.00 37.59  ? 46  PHE B HE2  1 
ATOM   7581  H  HZ   . PHE B  1 66  ? 86.999  -76.262  7.077   1.00 38.28  ? 46  PHE B HZ   1 
ATOM   7582  N  N    . ALA B  1 67  ? 93.831  -74.795  5.425   1.00 40.02  ? 47  ALA B N    1 
ATOM   7583  C  CA   . ALA B  1 67  ? 93.921  -73.514  4.726   1.00 40.06  ? 47  ALA B CA   1 
ATOM   7584  C  C    . ALA B  1 67  ? 94.462  -73.683  3.302   1.00 41.57  ? 47  ALA B C    1 
ATOM   7585  O  O    . ALA B  1 67  ? 93.935  -73.043  2.393   1.00 40.00  ? 47  ALA B O    1 
ATOM   7586  C  CB   . ALA B  1 67  ? 94.783  -72.539  5.504   1.00 40.99  ? 47  ALA B CB   1 
ATOM   7587  H  H    . ALA B  1 67  ? 94.430  -74.866  6.242   1.00 41.28  ? 47  ALA B H    1 
ATOM   7588  H  HA   . ALA B  1 67  ? 92.922  -73.086  4.652   1.00 41.81  ? 47  ALA B HA   1 
ATOM   7589  H  HB1  . ALA B  1 67  ? 94.905  -71.633  4.909   1.00 42.23  ? 47  ALA B HB1  1 
ATOM   7590  H  HB2  . ALA B  1 67  ? 94.297  -72.303  6.448   1.00 40.26  ? 47  ALA B HB2  1 
ATOM   7591  H  HB3  . ALA B  1 67  ? 95.754  -72.998  5.684   1.00 42.03  ? 47  ALA B HB3  1 
ATOM   7592  N  N    . ALA B  1 68  ? 95.456  -74.585  3.094   1.00 39.19  ? 48  ALA B N    1 
ATOM   7593  C  CA   . ALA B  1 68  ? 96.020  -74.880  1.770   1.00 37.91  ? 48  ALA B CA   1 
ATOM   7594  C  C    . ALA B  1 68  ? 94.967  -75.475  0.833   1.00 40.21  ? 48  ALA B C    1 
ATOM   7595  O  O    . ALA B  1 68  ? 94.801  -74.991  -0.287  1.00 39.71  ? 48  ALA B O    1 
ATOM   7596  C  CB   . ALA B  1 68  ? 97.207  -75.832  1.894   1.00 38.11  ? 48  ALA B CB   1 
ATOM   7597  H  H    . ALA B  1 68  ? 95.899  -75.107  3.844   1.00 40.92  ? 48  ALA B H    1 
ATOM   7598  H  HA   . ALA B  1 68  ? 96.364  -73.952  1.316   1.00 38.08  ? 48  ALA B HA   1 
ATOM   7599  H  HB1  . ALA B  1 68  ? 97.729  -75.876  0.940   1.00 37.86  ? 48  ALA B HB1  1 
ATOM   7600  H  HB2  . ALA B  1 68  ? 97.884  -75.466  2.664   1.00 37.78  ? 48  ALA B HB2  1 
ATOM   7601  H  HB3  . ALA B  1 68  ? 96.844  -76.823  2.159   1.00 38.04  ? 48  ALA B HB3  1 
ATOM   7602  N  N    . GLU B  1 69  ? 94.215  -76.461  1.309   1.00 37.35  ? 49  GLU B N    1 
ATOM   7603  C  CA   . GLU B  1 69  ? 93.152  -77.122  0.514   1.00 36.49  ? 49  GLU B CA   1 
ATOM   7604  C  C    . GLU B  1 69  ? 91.936  -76.207  0.285   1.00 39.24  ? 49  GLU B C    1 
ATOM   7605  O  O    . GLU B  1 69  ? 91.057  -76.543  -0.500  1.00 36.77  ? 49  GLU B O    1 
ATOM   7606  C  CB   . GLU B  1 69  ? 92.695  -78.425  1.212   1.00 37.24  ? 49  GLU B CB   1 
ATOM   7607  C  CG   . GLU B  1 69  ? 93.770  -79.500  1.264   1.00 51.47  ? 49  GLU B CG   1 
ATOM   7608  C  CD   . GLU B  1 69  ? 94.064  -80.253  -0.022  1.00 66.64  ? 49  GLU B CD   1 
ATOM   7609  O  OE1  . GLU B  1 69  ? 94.874  -81.210  0.030   1.00 58.36  ? 49  GLU B OE1  1 
ATOM   7610  O  OE2  . GLU B  1 69  ? 93.488  -79.899  -1.078  1.00 57.19  ? 49  GLU B OE2  1 
ATOM   7611  H  H    . GLU B  1 69  ? 94.310  -76.832  2.249   1.00 38.12  ? 49  GLU B H    1 
ATOM   7612  H  HA   . GLU B  1 69  ? 93.550  -77.375  -0.466  1.00 36.70  ? 49  GLU B HA   1 
ATOM   7613  H  HB2  . GLU B  1 69  ? 92.408  -78.193  2.237   1.00 36.43  ? 49  GLU B HB2  1 
ATOM   7614  H  HB3  . GLU B  1 69  ? 91.834  -78.832  0.686   1.00 35.85  ? 49  GLU B HB3  1 
ATOM   7615  H  HG2  . GLU B  1 69  ? 94.708  -79.039  1.567   1.00 52.39  ? 49  GLU B HG2  1 
ATOM   7616  H  HG3  . GLU B  1 69  ? 93.477  -80.236  2.012   1.00 51.89  ? 49  GLU B HG3  1 
ATOM   7617  N  N    . SER B  1 70  ? 91.866  -75.073  1.017   1.00 36.01  ? 50  SER B N    1 
ATOM   7618  C  CA   . SER B  1 70  ? 90.786  -74.106  0.911   1.00 33.84  ? 50  SER B CA   1 
ATOM   7619  C  C    . SER B  1 70  ? 91.224  -72.841  0.144   1.00 38.72  ? 50  SER B C    1 
ATOM   7620  O  O    . SER B  1 70  ? 90.450  -71.883  0.089   1.00 38.05  ? 50  SER B O    1 
ATOM   7621  C  CB   . SER B  1 70  ? 90.319  -73.746  2.317   1.00 38.87  ? 50  SER B CB   1 
ATOM   7622  O  OG   . SER B  1 70  ? 89.843  -74.897  3.003   1.00 41.75  ? 50  SER B OG   1 
ATOM   7623  H  H    . SER B  1 70  ? 92.530  -74.816  1.737   1.00 36.04  ? 50  SER B H    1 
ATOM   7624  H  HA   . SER B  1 70  ? 89.932  -74.530  0.385   1.00 33.79  ? 50  SER B HA   1 
ATOM   7625  H  HB2  . SER B  1 70  ? 91.155  -73.329  2.876   1.00 39.11  ? 50  SER B HB2  1 
ATOM   7626  H  HB3  . SER B  1 70  ? 89.513  -73.017  2.264   1.00 38.80  ? 50  SER B HB3  1 
ATOM   7627  H  HG   . SER B  1 70  ? 90.601  -75.398  3.402   1.00 41.46  ? 50  SER B HG   1 
ATOM   7628  N  N    . SER B  1 71  ? 92.438  -72.822  -0.470  1.00 36.16  ? 51  SER B N    1 
ATOM   7629  C  CA   . SER B  1 71  ? 92.879  -71.623  -1.176  1.00 35.50  ? 51  SER B CA   1 
ATOM   7630  C  C    . SER B  1 71  ? 93.800  -71.891  -2.373  1.00 37.85  ? 51  SER B C    1 
ATOM   7631  O  O    . SER B  1 71  ? 93.336  -71.794  -3.498  1.00 36.39  ? 51  SER B O    1 
ATOM   7632  C  CB   . SER B  1 71  ? 93.562  -70.662  -0.206  1.00 36.92  ? 51  SER B CB   1 
ATOM   7633  O  OG   . SER B  1 71  ? 94.725  -71.204  0.407   1.00 37.12  ? 51  SER B OG   1 
ATOM   7634  H  H    . SER B  1 71  ? 93.107  -73.585  -0.505  1.00 37.38  ? 51  SER B H    1 
ATOM   7635  H  HA   . SER B  1 71  ? 92.018  -71.097  -1.585  1.00 35.42  ? 51  SER B HA   1 
ATOM   7636  H  HB2  . SER B  1 71  ? 93.840  -69.761  -0.751  1.00 36.79  ? 51  SER B HB2  1 
ATOM   7637  H  HB3  . SER B  1 71  ? 92.826  -70.418  0.557   1.00 35.60  ? 51  SER B HB3  1 
ATOM   7638  H  HG   . SER B  1 71  ? 94.458  -71.844  1.119   1.00 37.89  ? 51  SER B HG   1 
ATOM   7639  N  N    . THR B  1 72  ? 95.099  -72.134  -2.147  1.00 33.61  ? 52  THR B N    1 
ATOM   7640  C  CA   . THR B  1 72  ? 96.073  -72.259  -3.228  1.00 32.42  ? 52  THR B CA   1 
ATOM   7641  C  C    . THR B  1 72  ? 96.839  -73.577  -3.324  1.00 38.38  ? 52  THR B C    1 
ATOM   7642  O  O    . THR B  1 72  ? 97.580  -73.765  -4.293  1.00 39.39  ? 52  THR B O    1 
ATOM   7643  C  CB   . THR B  1 72  ? 97.127  -71.174  -3.033  1.00 34.21  ? 52  THR B CB   1 
ATOM   7644  O  OG1  . THR B  1 72  ? 97.718  -71.359  -1.766  1.00 37.66  ? 52  THR B OG1  1 
ATOM   7645  C  CG2  . THR B  1 72  ? 96.559  -69.798  -3.128  1.00 35.64  ? 52  THR B CG2  1 
ATOM   7646  H  H    . THR B  1 72  ? 95.503  -72.250  -1.223  1.00 33.50  ? 52  THR B H    1 
ATOM   7647  H  HA   . THR B  1 72  ? 95.602  -72.076  -4.191  1.00 32.79  ? 52  THR B HA   1 
ATOM   7648  H  HB   . THR B  1 72  ? 97.905  -71.261  -3.790  1.00 35.33  ? 52  THR B HB   1 
ATOM   7649  H  HG1  . THR B  1 72  ? 98.536  -70.801  -1.684  1.00 39.12  ? 52  THR B HG1  1 
ATOM   7650  H  HG21 . THR B  1 72  ? 97.374  -69.079  -3.192  1.00 35.92  ? 52  THR B HG21 1 
ATOM   7651  H  HG22 . THR B  1 72  ? 95.919  -69.712  -4.004  1.00 35.05  ? 52  THR B HG22 1 
ATOM   7652  H  HG23 . THR B  1 72  ? 95.966  -69.578  -2.242  1.00 35.52  ? 52  THR B HG23 1 
ATOM   7653  N  N    . GLY B  1 73  ? 96.725  -74.454  -2.333  1.00 34.65  ? 53  GLY B N    1 
ATOM   7654  C  CA   . GLY B  1 73  ? 97.546  -75.645  -2.296  1.00 36.68  ? 53  GLY B CA   1 
ATOM   7655  C  C    . GLY B  1 73  ? 96.869  -76.975  -2.496  1.00 42.81  ? 53  GLY B C    1 
ATOM   7656  O  O    . GLY B  1 73  ? 95.731  -77.079  -2.953  1.00 41.07  ? 53  GLY B O    1 
ATOM   7657  H  H    . GLY B  1 73  ? 96.051  -74.408  -1.577  1.00 33.96  ? 53  GLY B H    1 
ATOM   7658  H  HA2  . GLY B  1 73  ? 98.357  -75.588  -3.022  1.00 39.09  ? 53  GLY B HA2  1 
ATOM   7659  H  HA3  . GLY B  1 73  ? 98.016  -75.674  -1.316  1.00 38.09  ? 53  GLY B HA3  1 
ATOM   7660  N  N    . THR B  1 74  ? 97.646  -77.998  -2.202  1.00 42.35  ? 54  THR B N    1 
ATOM   7661  C  CA   . THR B  1 74  ? 97.237  -79.391  -2.224  1.00 42.51  ? 54  THR B CA   1 
ATOM   7662  C  C    . THR B  1 74  ? 97.991  -80.045  -1.056  1.00 44.07  ? 54  THR B C    1 
ATOM   7663  O  O    . THR B  1 74  ? 98.376  -79.322  -0.128  1.00 45.35  ? 54  THR B O    1 
ATOM   7664  C  CB   . THR B  1 74  ? 97.419  -80.013  -3.624  1.00 55.51  ? 54  THR B CB   1 
ATOM   7665  O  OG1  . THR B  1 74  ? 97.004  -81.382  -3.571  1.00 54.69  ? 54  THR B OG1  1 
ATOM   7666  C  CG2  . THR B  1 74  ? 98.851  -79.884  -4.182  1.00 55.27  ? 54  THR B CG2  1 
ATOM   7667  H  H    . THR B  1 74  ? 98.621  -77.882  -1.941  1.00 43.66  ? 54  THR B H    1 
ATOM   7668  H  HA   . THR B  1 74  ? 96.178  -79.450  -1.974  1.00 43.20  ? 54  THR B HA   1 
ATOM   7669  H  HB   . THR B  1 74  ? 96.762  -79.487  -4.316  1.00 55.84  ? 54  THR B HB   1 
ATOM   7670  H  HG1  . THR B  1 74  ? 97.412  -81.905  -4.312  1.00 55.20  ? 54  THR B HG1  1 
ATOM   7671  H  HG21 . THR B  1 74  ? 98.878  -80.262  -5.204  1.00 54.84  ? 54  THR B HG21 1 
ATOM   7672  H  HG22 . THR B  1 74  ? 99.171  -78.843  -4.191  1.00 55.63  ? 54  THR B HG22 1 
ATOM   7673  H  HG23 . THR B  1 74  ? 99.549  -80.466  -3.587  1.00 55.41  ? 54  THR B HG23 1 
ATOM   7674  N  N    . ASN B  1 75  ? 98.156  -81.378  -1.056  1.00 38.77  ? 55  ASN B N    1 
ATOM   7675  C  CA   . ASN B  1 75  ? 98.783  -82.100  0.070   1.00 39.00  ? 55  ASN B CA   1 
ATOM   7676  C  C    . ASN B  1 75  ? 100.296 -82.329  -0.108  1.00 44.34  ? 55  ASN B C    1 
ATOM   7677  O  O    . ASN B  1 75  ? 100.918 -82.953  0.741   1.00 44.29  ? 55  ASN B O    1 
ATOM   7678  C  CB   . ASN B  1 75  ? 98.088  -83.439  0.264   1.00 35.18  ? 55  ASN B CB   1 
ATOM   7679  C  CG   . ASN B  1 75  ? 98.322  -84.455  -0.846  1.00 47.99  ? 55  ASN B CG   1 
ATOM   7680  O  OD1  . ASN B  1 75  ? 98.517  -84.122  -2.035  1.00 40.86  ? 55  ASN B OD1  1 
ATOM   7681  N  ND2  . ASN B  1 75  ? 98.293  -85.716  -0.497  1.00 36.58  ? 55  ASN B ND2  1 
ATOM   7682  H  H    . ASN B  1 75  ? 97.858  -81.979  -1.816  1.00 37.83  ? 55  ASN B H    1 
ATOM   7683  H  HA   . ASN B  1 75  ? 98.646  -81.545  0.998   1.00 39.25  ? 55  ASN B HA   1 
ATOM   7684  H  HB2  . ASN B  1 75  ? 98.433  -83.862  1.206   1.00 35.76  ? 55  ASN B HB2  1 
ATOM   7685  H  HB3  . ASN B  1 75  ? 97.018  -83.252  0.323   1.00 35.04  ? 55  ASN B HB3  1 
ATOM   7686  H  HD21 . ASN B  1 75  ? 98.452  -86.433  -1.197  1.00 36.40  ? 55  ASN B HD21 1 
ATOM   7687  H  HD22 . ASN B  1 75  ? 98.111  -85.979  0.466   1.00 37.40  ? 55  ASN B HD22 1 
ATOM   7688  N  N    . VAL B  1 76  ? 100.871 -81.839  -1.205  1.00 41.62  ? 56  VAL B N    1 
ATOM   7689  C  CA   . VAL B  1 76  ? 102.278 -81.991  -1.535  1.00 42.75  ? 56  VAL B CA   1 
ATOM   7690  C  C    . VAL B  1 76  ? 102.767 -80.674  -2.165  1.00 48.10  ? 56  VAL B C    1 
ATOM   7691  O  O    . VAL B  1 76  ? 101.947 -79.851  -2.603  1.00 45.90  ? 56  VAL B O    1 
ATOM   7692  C  CB   . VAL B  1 76  ? 102.401 -83.225  -2.488  1.00 48.18  ? 56  VAL B CB   1 
ATOM   7693  C  CG1  . VAL B  1 76  ? 102.045 -82.882  -3.942  1.00 46.52  ? 56  VAL B CG1  1 
ATOM   7694  C  CG2  . VAL B  1 76  ? 103.775 -83.852  -2.402  1.00 50.37  ? 56  VAL B CG2  1 
ATOM   7695  H  H    . VAL B  1 76  ? 100.374 -81.321  -1.919  1.00 41.50  ? 56  VAL B H    1 
ATOM   7696  H  HA   . VAL B  1 76  ? 102.868 -82.187  -0.643  1.00 42.90  ? 56  VAL B HA   1 
ATOM   7697  H  HB   . VAL B  1 76  ? 101.697 -83.987  -2.157  1.00 48.13  ? 56  VAL B HB   1 
ATOM   7698  H  HG11 . VAL B  1 76  ? 101.869 -83.811  -4.481  1.00 45.62  ? 56  VAL B HG11 1 
ATOM   7699  H  HG12 . VAL B  1 76  ? 101.146 -82.267  -3.960  1.00 45.41  ? 56  VAL B HG12 1 
ATOM   7700  H  HG13 . VAL B  1 76  ? 102.873 -82.351  -4.406  1.00 46.57  ? 56  VAL B HG13 1 
ATOM   7701  H  HG21 . VAL B  1 76  ? 103.767 -84.779  -2.973  1.00 51.55  ? 56  VAL B HG21 1 
ATOM   7702  H  HG22 . VAL B  1 76  ? 104.500 -83.162  -2.828  1.00 50.91  ? 56  VAL B HG22 1 
ATOM   7703  H  HG23 . VAL B  1 76  ? 104.010 -84.067  -1.360  1.00 51.66  ? 56  VAL B HG23 1 
ATOM   7704  N  N    . GLU B  1 77  ? 104.089 -80.479  -2.222  1.00 48.43  ? 57  GLU B N    1 
ATOM   7705  C  CA   . GLU B  1 77  ? 104.693 -79.320  -2.888  1.00 49.16  ? 57  GLU B CA   1 
ATOM   7706  C  C    . GLU B  1 77  ? 104.574 -79.481  -4.414  1.00 48.57  ? 57  GLU B C    1 
ATOM   7707  O  O    . GLU B  1 77  ? 104.767 -80.581  -4.927  1.00 45.80  ? 57  GLU B O    1 
ATOM   7708  C  CB   . GLU B  1 77  ? 106.183 -79.174  -2.490  1.00 52.04  ? 57  GLU B CB   1 
ATOM   7709  C  CG   . GLU B  1 77  ? 106.958 -78.124  -3.281  1.00 67.31  ? 57  GLU B CG   1 
ATOM   7710  C  CD   . GLU B  1 77  ? 108.366 -77.846  -2.789  1.00 103.61 ? 57  GLU B CD   1 
ATOM   7711  O  OE1  . GLU B  1 77  ? 108.776 -76.665  -2.825  1.00 113.35 ? 57  GLU B OE1  1 
ATOM   7712  O  OE2  . GLU B  1 77  ? 109.069 -78.801  -2.387  1.00 101.94 ? 57  GLU B OE2  1 
ATOM   7713  H  H    . GLU B  1 77  ? 104.764 -81.110  -1.803  1.00 49.65  ? 57  GLU B H    1 
ATOM   7714  H  HA   . GLU B  1 77  ? 104.170 -78.413  -2.587  1.00 48.58  ? 57  GLU B HA   1 
ATOM   7715  H  HB2  . GLU B  1 77  ? 106.236 -78.911  -1.435  1.00 51.99  ? 57  GLU B HB2  1 
ATOM   7716  H  HB3  . GLU B  1 77  ? 106.680 -80.128  -2.663  1.00 52.46  ? 57  GLU B HB3  1 
ATOM   7717  H  HG2  . GLU B  1 77  ? 107.062 -78.457  -4.313  1.00 67.24  ? 57  GLU B HG2  1 
ATOM   7718  H  HG3  . GLU B  1 77  ? 106.407 -77.185  -3.252  1.00 66.61  ? 57  GLU B HG3  1 
ATOM   7719  N  N    . VAL B  1 78  ? 104.269 -78.380  -5.124  1.00 44.74  ? 58  VAL B N    1 
ATOM   7720  C  CA   . VAL B  1 78  ? 104.193 -78.355  -6.587  1.00 42.13  ? 58  VAL B CA   1 
ATOM   7721  C  C    . VAL B  1 78  ? 105.176 -77.295  -7.049  1.00 44.70  ? 58  VAL B C    1 
ATOM   7722  O  O    . VAL B  1 78  ? 105.275 -76.224  -6.431  1.00 41.33  ? 58  VAL B O    1 
ATOM   7723  C  CB   . VAL B  1 78  ? 102.769 -78.154  -7.165  1.00 44.73  ? 58  VAL B CB   1 
ATOM   7724  C  CG1  . VAL B  1 78  ? 101.884 -79.348  -6.834  1.00 44.77  ? 58  VAL B CG1  1 
ATOM   7725  C  CG2  . VAL B  1 78  ? 102.132 -76.859  -6.686  1.00 43.41  ? 58  VAL B CG2  1 
ATOM   7726  H  H    . VAL B  1 78  ? 104.081 -77.476  -4.700  1.00 45.03  ? 58  VAL B H    1 
ATOM   7727  H  HA   . VAL B  1 78  ? 104.542 -79.307  -6.979  1.00 42.30  ? 58  VAL B HA   1 
ATOM   7728  H  HB   . VAL B  1 78  ? 102.843 -78.104  -8.251  1.00 45.06  ? 58  VAL B HB   1 
ATOM   7729  H  HG11 . VAL B  1 78  ? 100.922 -79.226  -7.331  1.00 42.97  ? 58  VAL B HG11 1 
ATOM   7730  H  HG12 . VAL B  1 78  ? 102.372 -80.256  -7.185  1.00 45.26  ? 58  VAL B HG12 1 
ATOM   7731  H  HG13 . VAL B  1 78  ? 101.747 -79.398  -5.754  1.00 44.12  ? 58  VAL B HG13 1 
ATOM   7732  H  HG21 . VAL B  1 78  ? 101.125 -76.809  -7.098  1.00 43.78  ? 58  VAL B HG21 1 
ATOM   7733  H  HG22 . VAL B  1 78  ? 102.080 -76.852  -5.599  1.00 43.73  ? 58  VAL B HG22 1 
ATOM   7734  H  HG23 . VAL B  1 78  ? 102.708 -76.013  -7.054  1.00 43.77  ? 58  VAL B HG23 1 
ATOM   7735  N  N    . PHE B  1 79  ? 105.911 -77.590  -8.134  1.00 41.82  ? 59  PHE B N    1 
ATOM   7736  C  CA   . PHE B  1 79  ? 106.975 -76.710  -8.625  1.00 42.71  ? 59  PHE B CA   1 
ATOM   7737  C  C    . PHE B  1 79  ? 106.455 -75.562  -9.508  1.00 45.53  ? 59  PHE B C    1 
ATOM   7738  O  O    . PHE B  1 79  ? 107.249 -74.693  -9.872  1.00 45.23  ? 59  PHE B O    1 
ATOM   7739  C  CB   . PHE B  1 79  ? 108.044 -77.535  -9.350  1.00 45.35  ? 59  PHE B CB   1 
ATOM   7740  C  CG   . PHE B  1 79  ? 108.589 -78.607  -8.438  1.00 47.63  ? 59  PHE B CG   1 
ATOM   7741  C  CD1  . PHE B  1 79  ? 109.224 -78.267  -7.248  1.00 52.70  ? 59  PHE B CD1  1 
ATOM   7742  C  CD2  . PHE B  1 79  ? 108.323 -79.950  -8.680  1.00 49.24  ? 59  PHE B CD2  1 
ATOM   7743  C  CE1  . PHE B  1 79  ? 109.641 -79.254  -6.349  1.00 55.31  ? 59  PHE B CE1  1 
ATOM   7744  C  CE2  . PHE B  1 79  ? 108.745 -80.936  -7.786  1.00 54.05  ? 59  PHE B CE2  1 
ATOM   7745  C  CZ   . PHE B  1 79  ? 109.409 -80.584  -6.632  1.00 53.88  ? 59  PHE B CZ   1 
ATOM   7746  H  H    . PHE B  1 79  ? 105.768 -78.419  -8.702  1.00 42.00  ? 59  PHE B H    1 
ATOM   7747  H  HA   . PHE B  1 79  ? 107.454 -76.235  -7.770  1.00 43.66  ? 59  PHE B HA   1 
ATOM   7748  H  HB2  . PHE B  1 79  ? 107.594 -78.014  -10.218 1.00 45.49  ? 59  PHE B HB2  1 
ATOM   7749  H  HB3  . PHE B  1 79  ? 108.864 -76.888  -9.654  1.00 45.46  ? 59  PHE B HB3  1 
ATOM   7750  H  HD1  . PHE B  1 79  ? 109.391 -77.219  -7.005  1.00 52.92  ? 59  PHE B HD1  1 
ATOM   7751  H  HD2  . PHE B  1 79  ? 107.827 -80.252  -9.601  1.00 48.10  ? 59  PHE B HD2  1 
ATOM   7752  H  HE1  . PHE B  1 79  ? 110.156 -78.972  -5.431  1.00 56.29  ? 59  PHE B HE1  1 
ATOM   7753  H  HE2  . PHE B  1 79  ? 108.609 -81.987  -8.034  1.00 54.71  ? 59  PHE B HE2  1 
ATOM   7754  H  HZ   . PHE B  1 79  ? 109.760 -81.356  -5.950  1.00 54.96  ? 59  PHE B HZ   1 
ATOM   7755  N  N    . THR B  1 80  ? 105.130 -75.499  -9.751  1.00 40.69  ? 60  THR B N    1 
ATOM   7756  C  CA   . THR B  1 80  ? 104.489 -74.416  -10.491 1.00 40.60  ? 60  THR B CA   1 
ATOM   7757  C  C    . THR B  1 80  ? 104.142 -73.221  -9.558  1.00 45.87  ? 60  THR B C    1 
ATOM   7758  O  O    . THR B  1 80  ? 103.739 -72.163  -10.047 1.00 45.60  ? 60  THR B O    1 
ATOM   7759  C  CB   . THR B  1 80  ? 103.238 -74.951  -11.162 1.00 47.95  ? 60  THR B CB   1 
ATOM   7760  O  OG1  . THR B  1 80  ? 102.554 -75.772  -10.215 1.00 41.15  ? 60  THR B OG1  1 
ATOM   7761  C  CG2  . THR B  1 80  ? 103.554 -75.728  -12.409 1.00 50.43  ? 60  THR B CG2  1 
ATOM   7762  H  H    . THR B  1 80  ? 104.456 -76.196  -9.452  1.00 40.19  ? 60  THR B H    1 
ATOM   7763  H  HA   . THR B  1 80  ? 105.156 -74.052  -11.270 1.00 41.31  ? 60  THR B HA   1 
ATOM   7764  H  HB   . THR B  1 80  ? 102.590 -74.124  -11.448 1.00 48.73  ? 60  THR B HB   1 
ATOM   7765  H  HG1  . THR B  1 80  ? 101.774 -76.219  -10.638 1.00 40.68  ? 60  THR B HG1  1 
ATOM   7766  H  HG21 . THR B  1 80  ? 102.633 -76.082  -12.870 1.00 49.96  ? 60  THR B HG21 1 
ATOM   7767  H  HG22 . THR B  1 80  ? 104.089 -75.097  -13.116 1.00 50.25  ? 60  THR B HG22 1 
ATOM   7768  H  HG23 . THR B  1 80  ? 104.175 -76.586  -12.153 1.00 51.64  ? 60  THR B HG23 1 
ATOM   7769  N  N    . THR B  1 81  ? 104.252 -73.391  -8.229  1.00 41.97  ? 61  THR B N    1 
ATOM   7770  C  CA   . THR B  1 81  ? 103.997 -72.300  -7.278  1.00 41.32  ? 61  THR B CA   1 
ATOM   7771  C  C    . THR B  1 81  ? 105.018 -71.156  -7.474  1.00 42.93  ? 61  THR B C    1 
ATOM   7772  O  O    . THR B  1 81  ? 106.217 -71.410  -7.556  1.00 42.64  ? 61  THR B O    1 
ATOM   7773  C  CB   . THR B  1 81  ? 104.068 -72.825  -5.814  1.00 45.90  ? 61  THR B CB   1 
ATOM   7774  O  OG1  . THR B  1 81  ? 103.047 -73.798  -5.626  1.00 52.11  ? 61  THR B OG1  1 
ATOM   7775  C  CG2  . THR B  1 81  ? 103.900 -71.699  -4.765  1.00 44.51  ? 61  THR B CG2  1 
ATOM   7776  H  H    . THR B  1 81  ? 104.515 -74.259  -7.774  1.00 42.28  ? 61  THR B H    1 
ATOM   7777  H  HA   . THR B  1 81  ? 102.999 -71.902  -7.453  1.00 40.05  ? 61  THR B HA   1 
ATOM   7778  H  HB   . THR B  1 81  ? 105.035 -73.297  -5.652  1.00 44.96  ? 61  THR B HB   1 
ATOM   7779  H  HG1  . THR B  1 81  ? 103.110 -74.210  -4.726  1.00 52.08  ? 61  THR B HG1  1 
ATOM   7780  H  HG21 . THR B  1 81  ? 103.716 -72.131  -3.782  1.00 44.05  ? 61  THR B HG21 1 
ATOM   7781  H  HG22 . THR B  1 81  ? 104.802 -71.093  -4.712  1.00 44.25  ? 61  THR B HG22 1 
ATOM   7782  H  HG23 . THR B  1 81  ? 103.059 -71.061  -5.033  1.00 43.91  ? 61  THR B HG23 1 
ATOM   7783  N  N    . ASP B  1 82  ? 104.526 -69.916  -7.504  1.00 38.91  ? 62  ASP B N    1 
ATOM   7784  C  CA   . ASP B  1 82  ? 105.351 -68.704  -7.608  1.00 39.84  ? 62  ASP B CA   1 
ATOM   7785  C  C    . ASP B  1 82  ? 105.027 -67.796  -6.420  1.00 43.23  ? 62  ASP B C    1 
ATOM   7786  O  O    . ASP B  1 82  ? 104.134 -68.116  -5.634  1.00 40.29  ? 62  ASP B O    1 
ATOM   7787  C  CB   . ASP B  1 82  ? 105.146 -67.986  -8.961  1.00 40.79  ? 62  ASP B CB   1 
ATOM   7788  C  CG   . ASP B  1 82  ? 103.708 -67.614  -9.332  1.00 51.96  ? 62  ASP B CG   1 
ATOM   7789  O  OD1  . ASP B  1 82  ? 102.810 -67.739  -8.462  1.00 48.67  ? 62  ASP B OD1  1 
ATOM   7790  O  OD2  . ASP B  1 82  ? 103.472 -67.249  -10.510 1.00 60.90  ? 62  ASP B OD2  1 
ATOM   7791  H  H    . ASP B  1 82  ? 103.535 -69.710  -7.428  1.00 38.10  ? 62  ASP B H    1 
ATOM   7792  H  HA   . ASP B  1 82  ? 106.408 -68.954  -7.533  1.00 41.64  ? 62  ASP B HA   1 
ATOM   7793  H  HB2  . ASP B  1 82  ? 105.734 -67.070  -8.966  1.00 41.59  ? 62  ASP B HB2  1 
ATOM   7794  H  HB3  . ASP B  1 82  ? 105.511 -68.647  -9.745  1.00 41.25  ? 62  ASP B HB3  1 
ATOM   7795  N  N    . ASP B  1 83  ? 105.754 -66.679  -6.274  1.00 42.90  ? 63  ASP B N    1 
ATOM   7796  C  CA   . ASP B  1 83  ? 105.520 -65.767  -5.156  1.00 42.80  ? 63  ASP B CA   1 
ATOM   7797  C  C    . ASP B  1 83  ? 104.189 -65.061  -5.271  1.00 42.99  ? 63  ASP B C    1 
ATOM   7798  O  O    . ASP B  1 83  ? 103.626 -64.741  -4.250  1.00 38.16  ? 63  ASP B O    1 
ATOM   7799  C  CB   . ASP B  1 83  ? 106.643 -64.739  -5.023  1.00 46.40  ? 63  ASP B CB   1 
ATOM   7800  C  CG   . ASP B  1 83  ? 107.926 -65.260  -4.380  1.00 62.67  ? 63  ASP B CG   1 
ATOM   7801  O  OD1  . ASP B  1 83  ? 107.949 -66.454  -3.953  1.00 61.21  ? 63  ASP B OD1  1 
ATOM   7802  O  OD2  . ASP B  1 83  ? 108.863 -64.450  -4.195  1.00 72.54  ? 63  ASP B OD2  1 
ATOM   7803  H  H    . ASP B  1 83  ? 106.502 -66.403  -6.901  1.00 44.23  ? 63  ASP B H    1 
ATOM   7804  H  HA   . ASP B  1 83  ? 105.478 -66.348  -4.235  1.00 43.77  ? 63  ASP B HA   1 
ATOM   7805  H  HB2  . ASP B  1 83  ? 106.883 -64.356  -6.014  1.00 46.36  ? 63  ASP B HB2  1 
ATOM   7806  H  HB3  . ASP B  1 83  ? 106.287 -63.929  -4.388  1.00 46.26  ? 63  ASP B HB3  1 
ATOM   7807  N  N    . PHE B  1 84  ? 103.664 -64.837  -6.490  1.00 43.17  ? 64  PHE B N    1 
ATOM   7808  C  CA   . PHE B  1 84  ? 102.340 -64.222  -6.634  1.00 42.60  ? 64  PHE B CA   1 
ATOM   7809  C  C    . PHE B  1 84  ? 101.280 -65.122  -5.972  1.00 44.11  ? 64  PHE B C    1 
ATOM   7810  O  O    . PHE B  1 84  ? 100.396 -64.632  -5.271  1.00 41.94  ? 64  PHE B O    1 
ATOM   7811  C  CB   . PHE B  1 84  ? 101.990 -63.962  -8.109  1.00 45.27  ? 64  PHE B CB   1 
ATOM   7812  C  CG   . PHE B  1 84  ? 100.701 -63.198  -8.248  1.00 48.04  ? 64  PHE B CG   1 
ATOM   7813  C  CD1  . PHE B  1 84  ? 99.480  -63.863  -8.251  1.00 51.86  ? 64  PHE B CD1  1 
ATOM   7814  C  CD2  . PHE B  1 84  ? 100.697 -61.805  -8.244  1.00 52.23  ? 64  PHE B CD2  1 
ATOM   7815  C  CE1  . PHE B  1 84  ? 98.282  -63.159  -8.272  1.00 53.96  ? 64  PHE B CE1  1 
ATOM   7816  C  CE2  . PHE B  1 84  ? 99.499  -61.097  -8.308  1.00 56.02  ? 64  PHE B CE2  1 
ATOM   7817  C  CZ   . PHE B  1 84  ? 98.297  -61.776  -8.294  1.00 54.30  ? 64  PHE B CZ   1 
ATOM   7818  H  H    . PHE B  1 84  ? 104.124 -65.046  -7.371  1.00 43.47  ? 64  PHE B H    1 
ATOM   7819  H  HA   . PHE B  1 84  ? 102.345 -63.262  -6.119  1.00 42.52  ? 64  PHE B HA   1 
ATOM   7820  H  HB2  . PHE B  1 84  ? 102.780 -63.370  -8.570  1.00 46.27  ? 64  PHE B HB2  1 
ATOM   7821  H  HB3  . PHE B  1 84  ? 101.882 -64.913  -8.628  1.00 45.41  ? 64  PHE B HB3  1 
ATOM   7822  H  HD1  . PHE B  1 84  ? 99.465  -64.948  -8.165  1.00 52.08  ? 64  PHE B HD1  1 
ATOM   7823  H  HD2  . PHE B  1 84  ? 101.640 -61.262  -8.244  1.00 52.20  ? 64  PHE B HD2  1 
ATOM   7824  H  HE1  . PHE B  1 84  ? 97.341  -63.706  -8.271  1.00 53.05  ? 64  PHE B HE1  1 
ATOM   7825  H  HE2  . PHE B  1 84  ? 99.509  -60.009  -8.345  1.00 56.59  ? 64  PHE B HE2  1 
ATOM   7826  H  HZ   . PHE B  1 84  ? 97.368  -61.213  -8.351  1.00 54.27  ? 64  PHE B HZ   1 
ATOM   7827  N  N    . THR B  1 85  ? 101.388 -66.442  -6.177  1.00 43.01  ? 65  THR B N    1 
ATOM   7828  C  CA   . THR B  1 85  ? 100.471 -67.429  -5.579  1.00 41.52  ? 65  THR B CA   1 
ATOM   7829  C  C    . THR B  1 85  ? 100.539 -67.368  -4.066  1.00 42.27  ? 65  THR B C    1 
ATOM   7830  O  O    . THR B  1 85  ? 99.492  -67.396  -3.409  1.00 39.11  ? 65  THR B O    1 
ATOM   7831  C  CB   . THR B  1 85  ? 100.824 -68.852  -6.045  1.00 42.15  ? 65  THR B CB   1 
ATOM   7832  O  OG1  . THR B  1 85  ? 100.587 -68.937  -7.433  1.00 44.04  ? 65  THR B OG1  1 
ATOM   7833  C  CG2  . THR B  1 85  ? 100.037 -69.931  -5.296  1.00 41.85  ? 65  THR B CG2  1 
ATOM   7834  H  H    . THR B  1 85  ? 102.094 -66.865  -6.771  1.00 44.37  ? 65  THR B H    1 
ATOM   7835  H  HA   . THR B  1 85  ? 99.451  -67.199  -5.882  1.00 40.61  ? 65  THR B HA   1 
ATOM   7836  H  HB   . THR B  1 85  ? 101.876 -69.054  -5.853  1.00 42.24  ? 65  THR B HB   1 
ATOM   7837  H  HG1  . THR B  1 85  ? 101.434 -68.817  -7.940  1.00 45.33  ? 65  THR B HG1  1 
ATOM   7838  H  HG21 . THR B  1 85  ? 100.344 -70.909  -5.662  1.00 42.63  ? 65  THR B HG21 1 
ATOM   7839  H  HG22 . THR B  1 85  ? 100.245 -69.912  -4.227  1.00 41.00  ? 65  THR B HG22 1 
ATOM   7840  H  HG23 . THR B  1 85  ? 98.969  -69.792  -5.457  1.00 40.39  ? 65  THR B HG23 1 
ATOM   7841  N  N    . ARG B  1 86  ? 101.769 -67.307  -3.512  1.00 38.95  ? 66  ARG B N    1 
ATOM   7842  C  CA   . ARG B  1 86  ? 101.961 -67.248  -2.063  1.00 39.06  ? 66  ARG B CA   1 
ATOM   7843  C  C    . ARG B  1 86  ? 101.248 -66.022  -1.446  1.00 43.32  ? 66  ARG B C    1 
ATOM   7844  O  O    . ARG B  1 86  ? 100.717 -66.124  -0.346  1.00 44.09  ? 66  ARG B O    1 
ATOM   7845  C  CB   . ARG B  1 86  ? 103.459 -67.242  -1.702  1.00 39.96  ? 66  ARG B CB   1 
ATOM   7846  C  CG   . ARG B  1 86  ? 104.151 -68.590  -1.947  1.00 47.27  ? 66  ARG B CG   1 
ATOM   7847  C  CD   . ARG B  1 86  ? 105.662 -68.507  -1.746  1.00 58.37  ? 66  ARG B CD   1 
ATOM   7848  N  NE   . ARG B  1 86  ? 106.381 -69.392  -2.678  1.00 65.18  ? 66  ARG B NE   1 
ATOM   7849  C  CZ   . ARG B  1 86  ? 106.605 -70.691  -2.491  1.00 82.17  ? 66  ARG B CZ   1 
ATOM   7850  N  NH1  . ARG B  1 86  ? 106.169 -71.303  -1.386  1.00 81.20  ? 66  ARG B NH1  1 
ATOM   7851  N  NH2  . ARG B  1 86  ? 107.264 -71.393  -3.404  1.00 62.20  ? 66  ARG B NH2  1 
ATOM   7852  H  H    . ARG B  1 86  ? 102.629 -67.308  -4.049  1.00 39.63  ? 66  ARG B H    1 
ATOM   7853  H  HA   . ARG B  1 86  ? 101.529 -68.150  -1.635  1.00 37.97  ? 66  ARG B HA   1 
ATOM   7854  H  HB2  . ARG B  1 86  ? 103.961 -66.480  -2.294  1.00 39.13  ? 66  ARG B HB2  1 
ATOM   7855  H  HB3  . ARG B  1 86  ? 103.555 -67.014  -0.641  1.00 40.66  ? 66  ARG B HB3  1 
ATOM   7856  H  HG2  . ARG B  1 86  ? 103.761 -69.328  -1.246  1.00 46.71  ? 66  ARG B HG2  1 
ATOM   7857  H  HG3  . ARG B  1 86  ? 103.961 -68.907  -2.971  1.00 45.72  ? 66  ARG B HG3  1 
ATOM   7858  H  HD2  . ARG B  1 86  ? 105.993 -67.492  -1.963  1.00 58.89  ? 66  ARG B HD2  1 
ATOM   7859  H  HD3  . ARG B  1 86  ? 105.920 -68.746  -0.715  1.00 57.98  ? 66  ARG B HD3  1 
ATOM   7860  H  HE   . ARG B  1 86  ? 106.737 -68.972  -3.532  1.00 64.68  ? 66  ARG B HE   1 
ATOM   7861  H  HH11 . ARG B  1 86  ? 105.647 -70.823  -0.660  1.00 81.15  ? 66  ARG B HH11 1 
ATOM   7862  H  HH12 . ARG B  1 86  ? 106.344 -72.295  -1.264  1.00 81.20  ? 66  ARG B HH12 1 
ATOM   7863  H  HH21 . ARG B  1 86  ? 107.608 -70.941  -4.245  1.00 62.98  ? 66  ARG B HH21 1 
ATOM   7864  H  HH22 . ARG B  1 86  ? 107.439 -72.383  -3.262  1.00 62.40  ? 66  ARG B HH22 1 
ATOM   7865  N  N    . GLY B  1 87  ? 101.184 -64.914  -2.175  1.00 39.72  ? 67  GLY B N    1 
ATOM   7866  C  CA   . GLY B  1 87  ? 100.519 -63.703  -1.704  1.00 41.06  ? 67  GLY B CA   1 
ATOM   7867  C  C    . GLY B  1 87  ? 99.011  -63.818  -1.546  1.00 46.93  ? 67  GLY B C    1 
ATOM   7868  O  O    . GLY B  1 87  ? 98.419  -63.055  -0.780  1.00 48.16  ? 67  GLY B O    1 
ATOM   7869  H  H    . GLY B  1 87  ? 101.594 -64.803  -3.096  1.00 38.98  ? 67  GLY B H    1 
ATOM   7870  H  HA2  . GLY B  1 87  ? 100.939 -63.422  -0.739  1.00 41.32  ? 67  GLY B HA2  1 
ATOM   7871  H  HA3  . GLY B  1 87  ? 100.717 -62.892  -2.404  1.00 41.19  ? 67  GLY B HA3  1 
ATOM   7872  N  N    . VAL B  1 88  ? 98.369  -64.775  -2.252  1.00 42.37  ? 68  VAL B N    1 
ATOM   7873  C  CA   . VAL B  1 88  ? 96.919  -64.967  -2.144  1.00 41.45  ? 68  VAL B CA   1 
ATOM   7874  C  C    . VAL B  1 88  ? 96.593  -66.207  -1.280  1.00 42.67  ? 68  VAL B C    1 
ATOM   7875  O  O    . VAL B  1 88  ? 95.426  -66.588  -1.207  1.00 40.72  ? 68  VAL B O    1 
ATOM   7876  C  CB   . VAL B  1 88  ? 96.203  -65.006  -3.531  1.00 47.36  ? 68  VAL B CB   1 
ATOM   7877  C  CG1  . VAL B  1 88  ? 96.420  -63.703  -4.293  1.00 47.78  ? 68  VAL B CG1  1 
ATOM   7878  C  CG2  . VAL B  1 88  ? 96.626  -66.195  -4.389  1.00 47.99  ? 68  VAL B CG2  1 
ATOM   7879  H  H    . VAL B  1 88  ? 98.827  -65.419  -2.887  1.00 41.03  ? 68  VAL B H    1 
ATOM   7880  H  HA   . VAL B  1 88  ? 96.479  -64.117  -1.627  1.00 40.40  ? 68  VAL B HA   1 
ATOM   7881  H  HB   . VAL B  1 88  ? 95.131  -65.095  -3.365  1.00 47.17  ? 68  VAL B HB   1 
ATOM   7882  H  HG11 . VAL B  1 88  ? 95.869  -63.747  -5.231  1.00 47.11  ? 68  VAL B HG11 1 
ATOM   7883  H  HG12 . VAL B  1 88  ? 96.066  -62.874  -3.683  1.00 47.97  ? 68  VAL B HG12 1 
ATOM   7884  H  HG13 . VAL B  1 88  ? 97.484  -63.585  -4.496  1.00 48.39  ? 68  VAL B HG13 1 
ATOM   7885  H  HG21 . VAL B  1 88  ? 96.015  -66.188  -5.291  1.00 48.28  ? 68  VAL B HG21 1 
ATOM   7886  H  HG22 . VAL B  1 88  ? 97.671  -66.087  -4.673  1.00 49.16  ? 68  VAL B HG22 1 
ATOM   7887  H  HG23 . VAL B  1 88  ? 96.462  -67.125  -3.850  1.00 47.51  ? 68  VAL B HG23 1 
ATOM   7888  N  N    . ASP B  1 89  ? 97.582  -66.798  -0.570  1.00 39.53  ? 69  ASP B N    1 
ATOM   7889  C  CA   . ASP B  1 89  ? 97.296  -67.929  0.318   1.00 39.27  ? 69  ASP B CA   1 
ATOM   7890  C  C    . ASP B  1 89  ? 96.318  -67.528  1.407   1.00 44.61  ? 69  ASP B C    1 
ATOM   7891  O  O    . ASP B  1 89  ? 96.428  -66.420  1.949   1.00 43.96  ? 69  ASP B O    1 
ATOM   7892  C  CB   . ASP B  1 89  ? 98.565  -68.443  1.031   1.00 41.39  ? 69  ASP B CB   1 
ATOM   7893  C  CG   . ASP B  1 89  ? 99.660  -69.072  0.201   1.00 52.36  ? 69  ASP B CG   1 
ATOM   7894  O  OD1  . ASP B  1 89  ? 99.361  -69.549  -0.932  1.00 53.07  ? 69  ASP B OD1  1 
ATOM   7895  O  OD2  . ASP B  1 89  ? 100.825 -69.133  0.699   1.00 50.21  ? 69  ASP B OD2  1 
ATOM   7896  H  H    . ASP B  1 89  ? 98.557  -66.517  -0.571  1.00 40.56  ? 69  ASP B H    1 
ATOM   7897  H  HA   . ASP B  1 89  ? 96.871  -68.746  -0.263  1.00 39.59  ? 69  ASP B HA   1 
ATOM   7898  H  HB2  . ASP B  1 89  ? 99.015  -67.601  1.556   1.00 41.10  ? 69  ASP B HB2  1 
ATOM   7899  H  HB3  . ASP B  1 89  ? 98.263  -69.194  1.760   1.00 41.37  ? 69  ASP B HB3  1 
ATOM   7900  N  N    . ALA B  1 90  ? 95.410  -68.443  1.777   1.00 42.01  ? 70  ALA B N    1 
ATOM   7901  C  CA   . ALA B  1 90  ? 94.565  -68.270  2.958   1.00 41.47  ? 70  ALA B CA   1 
ATOM   7902  C  C    . ALA B  1 90  ? 95.465  -68.570  4.148   1.00 45.72  ? 70  ALA B C    1 
ATOM   7903  O  O    . ALA B  1 90  ? 96.354  -69.428  4.032   1.00 44.07  ? 70  ALA B O    1 
ATOM   7904  C  CB   . ALA B  1 90  ? 93.359  -69.202  2.930   1.00 41.33  ? 70  ALA B CB   1 
ATOM   7905  H  H    . ALA B  1 90  ? 95.273  -69.324  1.290   1.00 42.90  ? 70  ALA B H    1 
ATOM   7906  H  HA   . ALA B  1 90  ? 94.217  -67.242  3.008   1.00 41.09  ? 70  ALA B HA   1 
ATOM   7907  H  HB1  . ALA B  1 90  ? 92.868  -69.156  3.900   1.00 40.60  ? 70  ALA B HB1  1 
ATOM   7908  H  HB2  . ALA B  1 90  ? 92.670  -68.851  2.164   1.00 40.99  ? 70  ALA B HB2  1 
ATOM   7909  H  HB3  . ALA B  1 90  ? 93.684  -70.221  2.728   1.00 40.86  ? 70  ALA B HB3  1 
ATOM   7910  N  N    . LEU B  1 91  ? 95.300  -67.847  5.248   1.00 43.00  ? 71  LEU B N    1 
ATOM   7911  C  CA   . LEU B  1 91  ? 96.188  -68.019  6.398   1.00 44.81  ? 71  LEU B CA   1 
ATOM   7912  C  C    . LEU B  1 91  ? 95.468  -68.301  7.687   1.00 46.23  ? 71  LEU B C    1 
ATOM   7913  O  O    . LEU B  1 91  ? 94.527  -67.598  8.018   1.00 45.53  ? 71  LEU B O    1 
ATOM   7914  C  CB   . LEU B  1 91  ? 97.016  -66.746  6.596   1.00 45.51  ? 71  LEU B CB   1 
ATOM   7915  C  CG   . LEU B  1 91  ? 97.940  -66.346  5.442   1.00 49.97  ? 71  LEU B CG   1 
ATOM   7916  C  CD1  . LEU B  1 91  ? 98.528  -64.975  5.686   1.00 49.74  ? 71  LEU B CD1  1 
ATOM   7917  C  CD2  . LEU B  1 91  ? 99.053  -67.359  5.241   1.00 49.45  ? 71  LEU B CD2  1 
ATOM   7918  H  H    . LEU B  1 91  ? 94.573  -67.152  5.380   1.00 42.13  ? 71  LEU B H    1 
ATOM   7919  H  HA   . LEU B  1 91  ? 96.885  -68.837  6.225   1.00 45.76  ? 71  LEU B HA   1 
ATOM   7920  H  HB2  . LEU B  1 91  ? 96.323  -65.923  6.763   1.00 45.83  ? 71  LEU B HB2  1 
ATOM   7921  H  HB3  . LEU B  1 91  ? 97.638  -66.882  7.479   1.00 45.17  ? 71  LEU B HB3  1 
ATOM   7922  H  HG   . LEU B  1 91  ? 97.365  -66.294  4.517   1.00 50.13  ? 71  LEU B HG   1 
ATOM   7923  H  HD11 . LEU B  1 91  ? 99.070  -64.662  4.795   1.00 49.96  ? 71  LEU B HD11 1 
ATOM   7924  H  HD12 . LEU B  1 91  ? 97.725  -64.272  5.901   1.00 48.43  ? 71  LEU B HD12 1 
ATOM   7925  H  HD13 . LEU B  1 91  ? 99.214  -65.040  6.529   1.00 50.08  ? 71  LEU B HD13 1 
ATOM   7926  H  HD21 . LEU B  1 91  ? 99.795  -66.936  4.566   1.00 48.56  ? 71  LEU B HD21 1 
ATOM   7927  H  HD22 . LEU B  1 91  ? 99.509  -67.580  6.205   1.00 50.50  ? 71  LEU B HD22 1 
ATOM   7928  H  HD23 . LEU B  1 91  ? 98.637  -68.266  4.809   1.00 48.15  ? 71  LEU B HD23 1 
ATOM   7929  N  N    . VAL B  1 92  ? 95.974  -69.273  8.465   1.00 43.66  ? 72  VAL B N    1 
ATOM   7930  C  CA   . VAL B  1 92  ? 95.471  -69.556  9.809   1.00 42.76  ? 72  VAL B CA   1 
ATOM   7931  C  C    . VAL B  1 92  ? 96.042  -68.447  10.670  1.00 46.63  ? 72  VAL B C    1 
ATOM   7932  O  O    . VAL B  1 92  ? 97.267  -68.361  10.789  1.00 46.21  ? 72  VAL B O    1 
ATOM   7933  C  CB   . VAL B  1 92  ? 95.882  -70.961  10.340  1.00 47.26  ? 72  VAL B CB   1 
ATOM   7934  C  CG1  . VAL B  1 92  ? 95.347  -71.181  11.754  1.00 47.43  ? 72  VAL B CG1  1 
ATOM   7935  C  CG2  . VAL B  1 92  ? 95.432  -72.090  9.404   1.00 46.39  ? 72  VAL B CG2  1 
ATOM   7936  H  H    . VAL B  1 92  ? 96.747  -69.872  8.191   1.00 44.64  ? 72  VAL B H    1 
ATOM   7937  H  HA   . VAL B  1 92  ? 94.384  -69.503  9.814   1.00 41.24  ? 72  VAL B HA   1 
ATOM   7938  H  HB   . VAL B  1 92  ? 96.970  -71.006  10.394  1.00 48.73  ? 72  VAL B HB   1 
ATOM   7939  H  HG11 . VAL B  1 92  ? 95.399  -72.242  11.996  1.00 48.53  ? 72  VAL B HG11 1 
ATOM   7940  H  HG12 . VAL B  1 92  ? 95.955  -70.622  12.463  1.00 48.15  ? 72  VAL B HG12 1 
ATOM   7941  H  HG13 . VAL B  1 92  ? 94.313  -70.840  11.808  1.00 47.43  ? 72  VAL B HG13 1 
ATOM   7942  H  HG21 . VAL B  1 92  ? 95.916  -73.002  9.747   1.00 46.22  ? 72  VAL B HG21 1 
ATOM   7943  H  HG22 . VAL B  1 92  ? 94.351  -72.204  9.474   1.00 46.11  ? 72  VAL B HG22 1 
ATOM   7944  H  HG23 . VAL B  1 92  ? 95.725  -71.884  8.375   1.00 46.16  ? 72  VAL B HG23 1 
ATOM   7945  N  N    . TYR B  1 93  ? 95.196  -67.552  11.202  1.00 42.52  ? 73  TYR B N    1 
ATOM   7946  C  CA   . TYR B  1 93  ? 95.687  -66.414  11.987  1.00 41.84  ? 73  TYR B CA   1 
ATOM   7947  C  C    . TYR B  1 93  ? 95.393  -66.546  13.496  1.00 48.22  ? 73  TYR B C    1 
ATOM   7948  O  O    . TYR B  1 93  ? 95.942  -65.782  14.288  1.00 45.79  ? 73  TYR B O    1 
ATOM   7949  C  CB   . TYR B  1 93  ? 95.126  -65.085  11.452  1.00 42.89  ? 73  TYR B CB   1 
ATOM   7950  C  CG   . TYR B  1 93  ? 93.643  -64.854  11.664  1.00 43.77  ? 73  TYR B CG   1 
ATOM   7951  C  CD1  . TYR B  1 93  ? 93.174  -64.209  12.802  1.00 46.97  ? 73  TYR B CD1  1 
ATOM   7952  C  CD2  . TYR B  1 93  ? 92.715  -65.229  10.702  1.00 42.42  ? 73  TYR B CD2  1 
ATOM   7953  C  CE1  . TYR B  1 93  ? 91.812  -64.001  13.007  1.00 47.48  ? 73  TYR B CE1  1 
ATOM   7954  C  CE2  . TYR B  1 93  ? 91.347  -65.043  10.906  1.00 41.92  ? 73  TYR B CE2  1 
ATOM   7955  C  CZ   . TYR B  1 93  ? 90.902  -64.394  12.041  1.00 46.91  ? 73  TYR B CZ   1 
ATOM   7956  O  OH   . TYR B  1 93  ? 89.550  -64.226  12.229  1.00 43.07  ? 73  TYR B OH   1 
ATOM   7957  H  H    . TYR B  1 93  ? 94.188  -67.596  11.091  1.00 42.14  ? 73  TYR B H    1 
ATOM   7958  H  HA   . TYR B  1 93  ? 96.770  -66.344  11.912  1.00 41.37  ? 73  TYR B HA   1 
ATOM   7959  H  HB2  . TYR B  1 93  ? 95.634  -64.283  11.985  1.00 43.53  ? 73  TYR B HB2  1 
ATOM   7960  H  HB3  . TYR B  1 93  ? 95.332  -65.012  10.385  1.00 42.23  ? 73  TYR B HB3  1 
ATOM   7961  H  HD1  . TYR B  1 93  ? 93.879  -63.907  13.576  1.00 47.43  ? 73  TYR B HD1  1 
ATOM   7962  H  HD2  . TYR B  1 93  ? 93.062  -65.730  9.801   1.00 41.61  ? 73  TYR B HD2  1 
ATOM   7963  H  HE1  . TYR B  1 93  ? 91.467  -63.542  13.932  1.00 48.36  ? 73  TYR B HE1  1 
ATOM   7964  H  HE2  . TYR B  1 93  ? 90.629  -65.357  10.151  1.00 41.34  ? 73  TYR B HE2  1 
ATOM   7965  H  HH   . TYR B  1 93  ? 89.342  -64.054  13.184  1.00 43.42  ? 73  TYR B HH   1 
ATOM   7966  N  N    . GLU B  1 94  ? 94.546  -67.488  13.895  1.00 46.17  ? 74  GLU B N    1 
ATOM   7967  C  CA   . GLU B  1 94  ? 94.219  -67.668  15.302  1.00 47.57  ? 74  GLU B CA   1 
ATOM   7968  C  C    . GLU B  1 94  ? 93.759  -69.094  15.550  1.00 52.28  ? 74  GLU B C    1 
ATOM   7969  O  O    . GLU B  1 94  ? 92.939  -69.630  14.783  1.00 48.96  ? 74  GLU B O    1 
ATOM   7970  C  CB   . GLU B  1 94  ? 93.116  -66.675  15.697  1.00 48.57  ? 74  GLU B CB   1 
ATOM   7971  C  CG   . GLU B  1 94  ? 92.940  -66.449  17.177  1.00 60.71  ? 74  GLU B CG   1 
ATOM   7972  C  CD   . GLU B  1 94  ? 91.885  -65.397  17.475  1.00 73.00  ? 74  GLU B CD   1 
ATOM   7973  O  OE1  . GLU B  1 94  ? 90.887  -65.735  18.152  1.00 57.83  ? 74  GLU B OE1  1 
ATOM   7974  O  OE2  . GLU B  1 94  ? 92.033  -64.246  17.001  1.00 57.93  ? 74  GLU B OE2  1 
ATOM   7975  H  H    . GLU B  1 94  ? 94.052  -68.135  13.288  1.00 45.60  ? 74  GLU B H    1 
ATOM   7976  H  HA   . GLU B  1 94  ? 95.098  -67.473  15.914  1.00 48.73  ? 74  GLU B HA   1 
ATOM   7977  H  HB2  . GLU B  1 94  ? 93.337  -65.710  15.243  1.00 49.20  ? 74  GLU B HB2  1 
ATOM   7978  H  HB3  . GLU B  1 94  ? 92.165  -67.047  15.325  1.00 47.72  ? 74  GLU B HB3  1 
ATOM   7979  H  HG2  . GLU B  1 94  ? 92.635  -67.386  17.643  1.00 61.31  ? 74  GLU B HG2  1 
ATOM   7980  H  HG3  . GLU B  1 94  ? 93.886  -66.114  17.601  1.00 61.61  ? 74  GLU B HG3  1 
ATOM   7981  N  N    . VAL B  1 95  ? 94.314  -69.719  16.596  1.00 51.97  ? 75  VAL B N    1 
ATOM   7982  C  CA   . VAL B  1 95  ? 93.933  -71.057  17.016  1.00 53.27  ? 75  VAL B CA   1 
ATOM   7983  C  C    . VAL B  1 95  ? 93.722  -71.065  18.525  1.00 59.20  ? 75  VAL B C    1 
ATOM   7984  O  O    . VAL B  1 95  ? 94.273  -70.227  19.249  1.00 59.58  ? 75  VAL B O    1 
ATOM   7985  C  CB   . VAL B  1 95  ? 94.945  -72.161  16.588  1.00 57.91  ? 75  VAL B CB   1 
ATOM   7986  C  CG1  . VAL B  1 95  ? 94.927  -72.375  15.080  1.00 56.74  ? 75  VAL B CG1  1 
ATOM   7987  C  CG2  . VAL B  1 95  ? 96.363  -71.870  17.082  1.00 58.63  ? 75  VAL B CG2  1 
ATOM   7988  H  H    . VAL B  1 95  ? 95.048  -69.322  17.172  1.00 53.15  ? 75  VAL B H    1 
ATOM   7989  H  HA   . VAL B  1 95  ? 92.982  -71.310  16.552  1.00 53.15  ? 75  VAL B HA   1 
ATOM   7990  H  HB   . VAL B  1 95  ? 94.637  -73.095  17.054  1.00 58.39  ? 75  VAL B HB   1 
ATOM   7991  H  HG11 . VAL B  1 95  ? 95.616  -73.180  14.827  1.00 56.76  ? 75  VAL B HG11 1 
ATOM   7992  H  HG12 . VAL B  1 95  ? 93.917  -72.635  14.769  1.00 56.18  ? 75  VAL B HG12 1 
ATOM   7993  H  HG13 . VAL B  1 95  ? 95.242  -71.453  14.595  1.00 57.03  ? 75  VAL B HG13 1 
ATOM   7994  H  HG21 . VAL B  1 95  ? 97.017  -72.670  16.737  1.00 58.73  ? 75  VAL B HG21 1 
ATOM   7995  H  HG22 . VAL B  1 95  ? 96.704  -70.923  16.669  1.00 58.38  ? 75  VAL B HG22 1 
ATOM   7996  H  HG23 . VAL B  1 95  ? 96.371  -71.833  18.171  1.00 58.97  ? 75  VAL B HG23 1 
ATOM   7997  N  N    . ASP B  1 96  ? 92.917  -72.028  18.989  1.00 55.71  ? 76  ASP B N    1 
ATOM   7998  C  CA   . ASP B  1 96  ? 92.664  -72.284  20.417  1.00 55.49  ? 76  ASP B CA   1 
ATOM   7999  C  C    . ASP B  1 96  ? 92.293  -73.748  20.508  1.00 57.76  ? 76  ASP B C    1 
ATOM   8000  O  O    . ASP B  1 96  ? 91.112  -74.095  20.475  1.00 55.48  ? 76  ASP B O    1 
ATOM   8001  C  CB   . ASP B  1 96  ? 91.585  -71.344  20.986  1.00 57.69  ? 76  ASP B CB   1 
ATOM   8002  C  CG   . ASP B  1 96  ? 91.315  -71.505  22.473  1.00 66.19  ? 76  ASP B CG   1 
ATOM   8003  O  OD1  . ASP B  1 96  ? 92.092  -72.214  23.148  1.00 69.29  ? 76  ASP B OD1  1 
ATOM   8004  O  OD2  . ASP B  1 96  ? 90.301  -70.956  22.955  1.00 65.78  ? 76  ASP B OD2  1 
ATOM   8005  H  H    . ASP B  1 96  ? 92.418  -72.661  18.372  1.00 54.49  ? 76  ASP B H    1 
ATOM   8006  H  HA   . ASP B  1 96  ? 93.583  -72.126  20.980  1.00 55.18  ? 76  ASP B HA   1 
ATOM   8007  H  HB2  . ASP B  1 96  ? 91.897  -70.316  20.805  1.00 57.82  ? 76  ASP B HB2  1 
ATOM   8008  H  HB3  . ASP B  1 96  ? 90.642  -71.527  20.476  1.00 57.64  ? 76  ASP B HB3  1 
ATOM   8009  N  N    . GLU B  1 97  ? 93.332  -74.610  20.533  1.00 55.84  ? 77  GLU B N    1 
ATOM   8010  C  CA   . GLU B  1 97  ? 93.199  -76.063  20.516  1.00 56.49  ? 77  GLU B CA   1 
ATOM   8011  C  C    . GLU B  1 97  ? 92.327  -76.574  21.653  1.00 62.60  ? 77  GLU B C    1 
ATOM   8012  O  O    . GLU B  1 97  ? 91.592  -77.543  21.436  1.00 63.95  ? 77  GLU B O    1 
ATOM   8013  C  CB   . GLU B  1 97  ? 94.580  -76.747  20.555  1.00 58.61  ? 77  GLU B CB   1 
ATOM   8014  C  CG   . GLU B  1 97  ? 94.516  -78.262  20.402  1.00 70.47  ? 77  GLU B CG   1 
ATOM   8015  C  CD   . GLU B  1 97  ? 95.843  -78.987  20.278  1.00 93.65  ? 77  GLU B CD   1 
ATOM   8016  O  OE1  . GLU B  1 97  ? 96.902  -78.318  20.292  1.00 90.76  ? 77  GLU B OE1  1 
ATOM   8017  O  OE2  . GLU B  1 97  ? 95.819  -80.229  20.120  1.00 83.27  ? 77  GLU B OE2  1 
ATOM   8018  H  H    . GLU B  1 97  ? 94.299  -74.303  20.583  1.00 56.39  ? 77  GLU B H    1 
ATOM   8019  H  HA   . GLU B  1 97  ? 92.716  -76.354  19.583  1.00 56.46  ? 77  GLU B HA   1 
ATOM   8020  H  HB2  . GLU B  1 97  ? 95.182  -76.358  19.735  1.00 58.33  ? 77  GLU B HB2  1 
ATOM   8021  H  HB3  . GLU B  1 97  ? 95.063  -76.527  21.505  1.00 59.36  ? 77  GLU B HB3  1 
ATOM   8022  H  HG2  . GLU B  1 97  ? 94.019  -78.691  21.271  1.00 70.63  ? 77  GLU B HG2  1 
ATOM   8023  H  HG3  . GLU B  1 97  ? 93.933  -78.489  19.511  1.00 69.91  ? 77  GLU B HG3  1 
ATOM   8024  N  N    . ALA B  1 98  ? 92.371  -75.933  22.840  1.00 58.86  ? 78  ALA B N    1 
ATOM   8025  C  CA   . ALA B  1 98  ? 91.554  -76.365  23.977  1.00 58.93  ? 78  ALA B CA   1 
ATOM   8026  C  C    . ALA B  1 98  ? 90.054  -76.265  23.659  1.00 58.39  ? 78  ALA B C    1 
ATOM   8027  O  O    . ALA B  1 98  ? 89.291  -77.115  24.102  1.00 57.33  ? 78  ALA B O    1 
ATOM   8028  C  CB   . ALA B  1 98  ? 91.888  -75.539  25.219  1.00 60.67  ? 78  ALA B CB   1 
ATOM   8029  H  H    . ALA B  1 98  ? 92.957  -75.128  23.035  1.00 58.93  ? 78  ALA B H    1 
ATOM   8030  H  HA   . ALA B  1 98  ? 91.776  -77.408  24.199  1.00 60.14  ? 78  ALA B HA   1 
ATOM   8031  H  HB1  . ALA B  1 98  ? 91.242  -75.857  26.036  1.00 60.62  ? 78  ALA B HB1  1 
ATOM   8032  H  HB2  . ALA B  1 98  ? 92.930  -75.712  25.484  1.00 61.26  ? 78  ALA B HB2  1 
ATOM   8033  H  HB3  . ALA B  1 98  ? 91.731  -74.485  24.997  1.00 60.18  ? 78  ALA B HB3  1 
ATOM   8034  N  N    . ASN B  1 99  ? 89.654  -75.276  22.837  1.00 52.58  ? 79  ASN B N    1 
ATOM   8035  C  CA   . ASN B  1 99  ? 88.266  -75.076  22.410  1.00 49.09  ? 79  ASN B CA   1 
ATOM   8036  C  C    . ASN B  1 99  ? 88.040  -75.503  20.954  1.00 50.34  ? 79  ASN B C    1 
ATOM   8037  O  O    . ASN B  1 99  ? 86.962  -75.248  20.419  1.00 49.74  ? 79  ASN B O    1 
ATOM   8038  C  CB   . ASN B  1 99  ? 87.878  -73.617  22.617  1.00 44.43  ? 79  ASN B CB   1 
ATOM   8039  C  CG   . ASN B  1 99  ? 87.801  -73.293  24.101  1.00 61.47  ? 79  ASN B CG   1 
ATOM   8040  O  OD1  . ASN B  1 99  ? 87.143  -73.995  24.858  1.00 55.96  ? 79  ASN B OD1  1 
ATOM   8041  N  ND2  . ASN B  1 99  ? 88.453  -72.236  24.550  1.00 50.11  ? 79  ASN B ND2  1 
ATOM   8042  H  H    . ASN B  1 99  ? 90.281  -74.582  22.442  1.00 53.46  ? 79  ASN B H    1 
ATOM   8043  H  HA   . ASN B  1 99  ? 87.600  -75.688  23.016  1.00 49.59  ? 79  ASN B HA   1 
ATOM   8044  H  HB2  . ASN B  1 99  ? 88.613  -72.972  22.140  1.00 42.97  ? 79  ASN B HB2  1 
ATOM   8045  H  HB3  . ASN B  1 99  ? 86.891  -73.428  22.197  1.00 43.56  ? 79  ASN B HB3  1 
ATOM   8046  H  HD21 . ASN B  1 99  ? 88.411  -71.993  25.534  1.00 50.41  ? 79  ASN B HD21 1 
ATOM   8047  H  HD22 . ASN B  1 99  ? 88.957  -71.635  23.904  1.00 50.62  ? 79  ASN B HD22 1 
ATOM   8048  N  N    . SER B  1 100 ? 89.015  -76.210  20.339  1.00 44.56  ? 80  SER B N    1 
ATOM   8049  C  CA   . SER B  1 100 ? 88.947  -76.728  18.975  1.00 43.70  ? 80  SER B CA   1 
ATOM   8050  C  C    . SER B  1 100 ? 88.690  -75.599  17.948  1.00 44.59  ? 80  SER B C    1 
ATOM   8051  O  O    . SER B  1 100 ? 88.118  -75.857  16.905  1.00 42.51  ? 80  SER B O    1 
ATOM   8052  C  CB   . SER B  1 100 ? 87.855  -77.797  18.890  1.00 47.20  ? 80  SER B CB   1 
ATOM   8053  O  OG   . SER B  1 100 ? 88.113  -78.858  19.794  1.00 56.52  ? 80  SER B OG   1 
ATOM   8054  H  H    . SER B  1 100 ? 89.889  -76.472  20.778  1.00 45.44  ? 80  SER B H    1 
ATOM   8055  H  HA   . SER B  1 100 ? 89.899  -77.196  18.724  1.00 44.06  ? 80  SER B HA   1 
ATOM   8056  H  HB2  . SER B  1 100 ? 86.891  -77.364  19.148  1.00 46.35  ? 80  SER B HB2  1 
ATOM   8057  H  HB3  . SER B  1 100 ? 87.803  -78.208  17.884  1.00 46.07  ? 80  SER B HB3  1 
ATOM   8058  H  HG   . SER B  1 100 ? 87.567  -79.649  19.541  1.00 56.86  ? 80  SER B HG   1 
ATOM   8059  N  N    . LEU B  1 101 ? 89.150  -74.368  18.242  1.00 42.72  ? 81  LEU B N    1 
ATOM   8060  C  CA   . LEU B  1 101 ? 88.901  -73.196  17.408  1.00 42.93  ? 81  LEU B CA   1 
ATOM   8061  C  C    . LEU B  1 101 ? 90.049  -72.919  16.435  1.00 45.89  ? 81  LEU B C    1 
ATOM   8062  O  O    . LEU B  1 101 ? 91.221  -72.913  16.818  1.00 46.46  ? 81  LEU B O    1 
ATOM   8063  C  CB   . LEU B  1 101 ? 88.676  -71.973  18.280  1.00 42.92  ? 81  LEU B CB   1 
ATOM   8064  C  CG   . LEU B  1 101 ? 88.318  -70.659  17.567  1.00 46.04  ? 81  LEU B CG   1 
ATOM   8065  C  CD1  . LEU B  1 101 ? 86.994  -70.772  16.808  1.00 45.30  ? 81  LEU B CD1  1 
ATOM   8066  C  CD2  . LEU B  1 101 ? 88.266  -69.513  18.559  1.00 47.46  ? 81  LEU B CD2  1 
ATOM   8067  H  H    . LEU B  1 101 ? 89.739  -74.154  19.040  1.00 43.76  ? 81  LEU B H    1 
ATOM   8068  H  HA   . LEU B  1 101 ? 87.983  -73.360  16.848  1.00 43.59  ? 81  LEU B HA   1 
ATOM   8069  H  HB2  . LEU B  1 101 ? 87.891  -72.202  18.999  1.00 43.37  ? 81  LEU B HB2  1 
ATOM   8070  H  HB3  . LEU B  1 101 ? 89.612  -71.791  18.804  1.00 43.64  ? 81  LEU B HB3  1 
ATOM   8071  H  HG   . LEU B  1 101 ? 89.093  -70.405  16.845  1.00 46.28  ? 81  LEU B HG   1 
ATOM   8072  H  HD11 . LEU B  1 101 ? 86.620  -69.772  16.589  1.00 45.00  ? 81  LEU B HD11 1 
ATOM   8073  H  HD12 . LEU B  1 101 ? 87.166  -71.294  15.868  1.00 44.66  ? 81  LEU B HD12 1 
ATOM   8074  H  HD13 . LEU B  1 101 ? 86.275  -71.320  17.416  1.00 44.63  ? 81  LEU B HD13 1 
ATOM   8075  H  HD21 . LEU B  1 101 ? 88.078  -68.584  18.022  1.00 47.36  ? 81  LEU B HD21 1 
ATOM   8076  H  HD22 . LEU B  1 101 ? 87.467  -69.702  19.274  1.00 46.54  ? 81  LEU B HD22 1 
ATOM   8077  H  HD23 . LEU B  1 101 ? 89.222  -69.455  19.076  1.00 48.34  ? 81  LEU B HD23 1 
ATOM   8078  N  N    . MET B  1 102 ? 89.677  -72.678  15.192  1.00 40.34  ? 82  MET B N    1 
ATOM   8079  C  CA   . MET B  1 102 ? 90.549  -72.350  14.080  1.00 40.71  ? 82  MET B CA   1 
ATOM   8080  C  C    . MET B  1 102 ? 89.934  -71.162  13.324  1.00 43.71  ? 82  MET B C    1 
ATOM   8081  O  O    . MET B  1 102 ? 88.770  -71.238  12.932  1.00 41.77  ? 82  MET B O    1 
ATOM   8082  C  CB   . MET B  1 102 ? 90.648  -73.607  13.175  1.00 42.77  ? 82  MET B CB   1 
ATOM   8083  C  CG   . MET B  1 102 ? 91.243  -73.374  11.812  1.00 47.27  ? 82  MET B CG   1 
ATOM   8084  S  SD   . MET B  1 102 ? 91.481  -74.946  10.962  1.00 51.93  ? 82  MET B SD   1 
ATOM   8085  C  CE   . MET B  1 102 ? 89.809  -75.279  10.378  1.00 48.77  ? 82  MET B CE   1 
ATOM   8086  H  H    . MET B  1 102 ? 88.710  -72.728  14.889  1.00 40.30  ? 82  MET B H    1 
ATOM   8087  H  HA   . MET B  1 102 ? 91.550  -72.088  14.420  1.00 41.07  ? 82  MET B HA   1 
ATOM   8088  H  HB2  . MET B  1 102 ? 91.279  -74.338  13.678  1.00 43.16  ? 82  MET B HB2  1 
ATOM   8089  H  HB3  . MET B  1 102 ? 89.649  -74.011  13.022  1.00 41.21  ? 82  MET B HB3  1 
ATOM   8090  H  HG2  . MET B  1 102 ? 90.573  -72.764  11.208  1.00 46.76  ? 82  MET B HG2  1 
ATOM   8091  H  HG3  . MET B  1 102 ? 92.215  -72.892  11.914  1.00 48.26  ? 82  MET B HG3  1 
ATOM   8092  H  HE1  . MET B  1 102 ? 89.811  -76.205  9.805   1.00 48.03  ? 82  MET B HE1  1 
ATOM   8093  H  HE2  . MET B  1 102 ? 89.165  -75.387  11.248  1.00 49.10  ? 82  MET B HE2  1 
ATOM   8094  H  HE3  . MET B  1 102 ? 89.465  -74.456  9.753   1.00 47.69  ? 82  MET B HE3  1 
ATOM   8095  N  N    . LYS B  1 103 ? 90.693  -70.080  13.122  1.00 41.42  ? 83  LYS B N    1 
ATOM   8096  C  CA   . LYS B  1 103 ? 90.224  -68.941  12.324  1.00 40.87  ? 83  LYS B CA   1 
ATOM   8097  C  C    . LYS B  1 103 ? 91.156  -68.752  11.124  1.00 43.21  ? 83  LYS B C    1 
ATOM   8098  O  O    . LYS B  1 103 ? 92.369  -68.750  11.291  1.00 43.77  ? 83  LYS B O    1 
ATOM   8099  C  CB   . LYS B  1 103 ? 90.131  -67.667  13.147  1.00 43.94  ? 83  LYS B CB   1 
ATOM   8100  C  CG   . LYS B  1 103 ? 89.090  -67.730  14.264  1.00 52.99  ? 83  LYS B CG   1 
ATOM   8101  C  CD   . LYS B  1 103 ? 89.285  -66.590  15.223  1.00 67.93  ? 83  LYS B CD   1 
ATOM   8102  C  CE   . LYS B  1 103 ? 88.017  -66.097  15.854  1.00 78.35  ? 83  LYS B CE   1 
ATOM   8103  N  NZ   . LYS B  1 103 ? 88.277  -64.906  16.702  1.00 85.92  ? 83  LYS B NZ   1 
ATOM   8104  H  H    . LYS B  1 103 ? 91.624  -69.947  13.507  1.00 42.35  ? 83  LYS B H    1 
ATOM   8105  H  HA   . LYS B  1 103 ? 89.223  -69.147  11.952  1.00 40.56  ? 83  LYS B HA   1 
ATOM   8106  H  HB2  . LYS B  1 103 ? 91.106  -67.441  13.573  1.00 44.38  ? 83  LYS B HB2  1 
ATOM   8107  H  HB3  . LYS B  1 103 ? 89.821  -66.873  12.472  1.00 43.48  ? 83  LYS B HB3  1 
ATOM   8108  H  HG2  . LYS B  1 103 ? 88.093  -67.663  13.834  1.00 51.50  ? 83  LYS B HG2  1 
ATOM   8109  H  HG3  . LYS B  1 103 ? 89.197  -68.660  14.821  1.00 53.54  ? 83  LYS B HG3  1 
ATOM   8110  H  HD2  . LYS B  1 103 ? 89.929  -66.938  16.029  1.00 69.00  ? 83  LYS B HD2  1 
ATOM   8111  H  HD3  . LYS B  1 103 ? 89.753  -65.756  14.703  1.00 67.86  ? 83  LYS B HD3  1 
ATOM   8112  H  HE2  . LYS B  1 103 ? 87.310  -65.816  15.075  1.00 77.87  ? 83  LYS B HE2  1 
ATOM   8113  H  HE3  . LYS B  1 103 ? 87.598  -66.883  16.480  1.00 78.43  ? 83  LYS B HE3  1 
ATOM   8114  H  HZ1  . LYS B  1 103 ? 87.401  -64.512  17.032  1.00 85.86  ? 83  LYS B HZ1  1 
ATOM   8115  H  HZ2  . LYS B  1 103 ? 88.841  -65.168  17.503  1.00 86.77  ? 83  LYS B HZ2  1 
ATOM   8116  H  HZ3  . LYS B  1 103 ? 88.777  -64.203  16.168  1.00 85.76  ? 83  LYS B HZ3  1 
ATOM   8117  N  N    . ILE B  1 104 ? 90.596  -68.575  9.925   1.00 39.22  ? 84  ILE B N    1 
ATOM   8118  C  CA   . ILE B  1 104 ? 91.385  -68.455  8.702   1.00 38.09  ? 84  ILE B CA   1 
ATOM   8119  C  C    . ILE B  1 104 ? 90.992  -67.183  7.935   1.00 41.66  ? 84  ILE B C    1 
ATOM   8120  O  O    . ILE B  1 104 ? 89.809  -66.906  7.782   1.00 41.02  ? 84  ILE B O    1 
ATOM   8121  C  CB   . ILE B  1 104 ? 91.201  -69.734  7.835   1.00 40.15  ? 84  ILE B CB   1 
ATOM   8122  C  CG1  . ILE B  1 104 ? 91.869  -70.995  8.485   1.00 41.11  ? 84  ILE B CG1  1 
ATOM   8123  C  CG2  . ILE B  1 104 ? 91.750  -69.539  6.405   1.00 35.59  ? 84  ILE B CG2  1 
ATOM   8124  C  CD1  . ILE B  1 104 ? 91.169  -72.263  8.146   1.00 40.87  ? 84  ILE B CD1  1 
ATOM   8125  H  H    . ILE B  1 104 ? 89.598  -68.493  9.764   1.00 39.81  ? 84  ILE B H    1 
ATOM   8126  H  HA   . ILE B  1 104 ? 92.442  -68.392  8.950   1.00 38.84  ? 84  ILE B HA   1 
ATOM   8127  H  HB   . ILE B  1 104 ? 90.132  -69.925  7.763   1.00 41.43  ? 84  ILE B HB   1 
ATOM   8128  H  HG12 . ILE B  1 104 ? 92.888  -71.084  8.112   1.00 40.75  ? 84  ILE B HG12 1 
ATOM   8129  H  HG13 . ILE B  1 104 ? 91.882  -70.911  9.570   1.00 41.13  ? 84  ILE B HG13 1 
ATOM   8130  H  HG21 . ILE B  1 104 ? 91.736  -70.502  5.897   1.00 35.21  ? 84  ILE B HG21 1 
ATOM   8131  H  HG22 . ILE B  1 104 ? 91.132  -68.835  5.852   1.00 34.56  ? 84  ILE B HG22 1 
ATOM   8132  H  HG23 . ILE B  1 104 ? 92.772  -69.166  6.462   1.00 34.21  ? 84  ILE B HG23 1 
ATOM   8133  H  HD11 . ILE B  1 104 ? 91.827  -73.100  8.370   1.00 40.90  ? 84  ILE B HD11 1 
ATOM   8134  H  HD12 . ILE B  1 104 ? 90.270  -72.333  8.757   1.00 41.08  ? 84  ILE B HD12 1 
ATOM   8135  H  HD13 . ILE B  1 104 ? 90.901  -72.267  7.091   1.00 40.14  ? 84  ILE B HD13 1 
ATOM   8136  N  N    . ALA B  1 105 ? 92.003  -66.421  7.449   1.00 39.84  ? 85  ALA B N    1 
ATOM   8137  C  CA   . ALA B  1 105 ? 91.840  -65.206  6.623   1.00 38.72  ? 85  ALA B CA   1 
ATOM   8138  C  C    . ALA B  1 105 ? 91.988  -65.570  5.146   1.00 43.28  ? 85  ALA B C    1 
ATOM   8139  O  O    . ALA B  1 105 ? 93.018  -66.098  4.739   1.00 43.31  ? 85  ALA B O    1 
ATOM   8140  C  CB   . ALA B  1 105 ? 92.876  -64.166  7.007   1.00 39.99  ? 85  ALA B CB   1 
ATOM   8141  H  H    . ALA B  1 105 ? 92.982  -66.627  7.622   1.00 41.27  ? 85  ALA B H    1 
ATOM   8142  H  HA   . ALA B  1 105 ? 90.860  -64.763  6.793   1.00 37.36  ? 85  ALA B HA   1 
ATOM   8143  H  HB1  . ALA B  1 105 ? 92.666  -63.246  6.465   1.00 38.88  ? 85  ALA B HB1  1 
ATOM   8144  H  HB2  . ALA B  1 105 ? 92.814  -63.990  8.080   1.00 40.34  ? 85  ALA B HB2  1 
ATOM   8145  H  HB3  . ALA B  1 105 ? 93.867  -64.539  6.751   1.00 39.88  ? 85  ALA B HB3  1 
ATOM   8146  N  N    . TYR B  1 106 ? 90.962  -65.286  4.358   1.00 39.59  ? 86  TYR B N    1 
ATOM   8147  C  CA   . TYR B  1 106 ? 90.922  -65.547  2.933   1.00 38.66  ? 86  TYR B CA   1 
ATOM   8148  C  C    . TYR B  1 106 ? 91.066  -64.247  2.133   1.00 41.30  ? 86  TYR B C    1 
ATOM   8149  O  O    . TYR B  1 106 ? 90.116  -63.463  2.093   1.00 35.60  ? 86  TYR B O    1 
ATOM   8150  C  CB   . TYR B  1 106 ? 89.577  -66.204  2.561   1.00 38.55  ? 86  TYR B CB   1 
ATOM   8151  C  CG   . TYR B  1 106 ? 89.403  -67.599  3.095   1.00 38.16  ? 86  TYR B CG   1 
ATOM   8152  C  CD1  . TYR B  1 106 ? 88.851  -67.822  4.347   1.00 38.55  ? 86  TYR B CD1  1 
ATOM   8153  C  CD2  . TYR B  1 106 ? 89.737  -68.711  2.321   1.00 38.09  ? 86  TYR B CD2  1 
ATOM   8154  C  CE1  . TYR B  1 106 ? 88.671  -69.114  4.841   1.00 37.40  ? 86  TYR B CE1  1 
ATOM   8155  C  CE2  . TYR B  1 106 ? 89.595  -70.005  2.821   1.00 38.61  ? 86  TYR B CE2  1 
ATOM   8156  C  CZ   . TYR B  1 106 ? 89.021  -70.208  4.063   1.00 40.15  ? 86  TYR B CZ   1 
ATOM   8157  O  OH   . TYR B  1 106 ? 88.851  -71.514  4.512   1.00 36.10  ? 86  TYR B OH   1 
ATOM   8158  H  H    . TYR B  1 106 ? 90.113  -64.845  4.696   1.00 40.67  ? 86  TYR B H    1 
ATOM   8159  H  HA   . TYR B  1 106 ? 91.704  -66.247  2.639   1.00 38.30  ? 86  TYR B HA   1 
ATOM   8160  H  HB2  . TYR B  1 106 ? 88.759  -65.600  2.947   1.00 37.93  ? 86  TYR B HB2  1 
ATOM   8161  H  HB3  . TYR B  1 106 ? 89.509  -66.258  1.475   1.00 39.10  ? 86  TYR B HB3  1 
ATOM   8162  H  HD1  . TYR B  1 106 ? 88.550  -66.965  4.950   1.00 38.97  ? 86  TYR B HD1  1 
ATOM   8163  H  HD2  . TYR B  1 106 ? 90.191  -68.569  1.344   1.00 36.07  ? 86  TYR B HD2  1 
ATOM   8164  H  HE1  . TYR B  1 106 ? 88.245  -69.258  5.832   1.00 35.99  ? 86  TYR B HE1  1 
ATOM   8165  H  HE2  . TYR B  1 106 ? 89.881  -70.858  2.212   1.00 38.50  ? 86  TYR B HE2  1 
ATOM   8166  H  HH   . TYR B  1 106 ? 88.437  -71.527  5.415   1.00 36.77  ? 86  TYR B HH   1 
ATOM   8167  N  N    . PRO B  1 107 ? 92.197  -64.008  1.432   1.00 38.98  ? 87  PRO B N    1 
ATOM   8168  C  CA   . PRO B  1 107 ? 92.284  -62.804  0.584   1.00 37.95  ? 87  PRO B CA   1 
ATOM   8169  C  C    . PRO B  1 107 ? 91.092  -62.748  -0.386  1.00 42.05  ? 87  PRO B C    1 
ATOM   8170  O  O    . PRO B  1 107 ? 90.743  -63.761  -1.019  1.00 39.34  ? 87  PRO B O    1 
ATOM   8171  C  CB   . PRO B  1 107 ? 93.626  -62.988  -0.136  1.00 39.18  ? 87  PRO B CB   1 
ATOM   8172  C  CG   . PRO B  1 107 ? 94.436  -63.774  0.824   1.00 43.93  ? 87  PRO B CG   1 
ATOM   8173  C  CD   . PRO B  1 107 ? 93.455  -64.782  1.383   1.00 39.42  ? 87  PRO B CD   1 
ATOM   8174  H  HA   . PRO B  1 107 ? 92.314  -61.913  1.207   1.00 38.11  ? 87  PRO B HA   1 
ATOM   8175  H  HB2  . PRO B  1 107 ? 93.479  -63.544  -1.061  1.00 37.43  ? 87  PRO B HB2  1 
ATOM   8176  H  HB3  . PRO B  1 107 ? 94.089  -62.022  -0.333  1.00 39.82  ? 87  PRO B HB3  1 
ATOM   8177  H  HG2  . PRO B  1 107 ? 95.255  -64.268  0.306   1.00 43.90  ? 87  PRO B HG2  1 
ATOM   8178  H  HG3  . PRO B  1 107 ? 94.805  -63.116  1.608   1.00 44.07  ? 87  PRO B HG3  1 
ATOM   8179  H  HD2  . PRO B  1 107 ? 93.366  -65.642  0.723   1.00 38.31  ? 87  PRO B HD2  1 
ATOM   8180  H  HD3  . PRO B  1 107 ? 93.757  -65.069  2.388   1.00 39.31  ? 87  PRO B HD3  1 
ATOM   8181  N  N    . ILE B  1 108 ? 90.430  -61.590  -0.466  1.00 39.75  ? 88  ILE B N    1 
ATOM   8182  C  CA   . ILE B  1 108 ? 89.193  -61.472  -1.260  1.00 38.65  ? 88  ILE B CA   1 
ATOM   8183  C  C    . ILE B  1 108 ? 89.399  -61.706  -2.770  1.00 37.95  ? 88  ILE B C    1 
ATOM   8184  O  O    . ILE B  1 108 ? 88.426  -62.064  -3.440  1.00 36.31  ? 88  ILE B O    1 
ATOM   8185  C  CB   . ILE B  1 108 ? 88.413  -60.178  -0.995  1.00 41.25  ? 88  ILE B CB   1 
ATOM   8186  C  CG1  . ILE B  1 108 ? 89.211  -58.896  -1.375  1.00 40.96  ? 88  ILE B CG1  1 
ATOM   8187  C  CG2  . ILE B  1 108 ? 87.939  -60.169  0.464   1.00 44.52  ? 88  ILE B CG2  1 
ATOM   8188  C  CD1  . ILE B  1 108 ? 88.369  -57.655  -1.279  1.00 51.35  ? 88  ILE B CD1  1 
ATOM   8189  H  H    . ILE B  1 108 ? 90.732  -60.740  -0.005  1.00 40.02  ? 88  ILE B H    1 
ATOM   8190  H  HA   . ILE B  1 108 ? 88.551  -62.279  -0.913  1.00 39.75  ? 88  ILE B HA   1 
ATOM   8191  H  HB   . ILE B  1 108 ? 87.522  -60.205  -1.619  1.00 40.80  ? 88  ILE B HB   1 
ATOM   8192  H  HG12 . ILE B  1 108 ? 90.049  -58.766  -0.693  1.00 42.03  ? 88  ILE B HG12 1 
ATOM   8193  H  HG13 . ILE B  1 108 ? 89.579  -58.968  -2.395  1.00 40.35  ? 88  ILE B HG13 1 
ATOM   8194  H  HG21 . ILE B  1 108 ? 87.293  -59.312  0.646   1.00 44.48  ? 88  ILE B HG21 1 
ATOM   8195  H  HG22 . ILE B  1 108 ? 87.384  -61.089  0.644   1.00 44.53  ? 88  ILE B HG22 1 
ATOM   8196  H  HG23 . ILE B  1 108 ? 88.799  -60.133  1.128   1.00 44.33  ? 88  ILE B HG23 1 
ATOM   8197  H  HD11 . ILE B  1 108 ? 88.861  -56.853  -1.827  1.00 52.34  ? 88  ILE B HD11 1 
ATOM   8198  H  HD12 . ILE B  1 108 ? 87.387  -57.855  -1.706  1.00 50.76  ? 88  ILE B HD12 1 
ATOM   8199  H  HD13 . ILE B  1 108 ? 88.265  -57.373  -0.233  1.00 51.36  ? 88  ILE B HD13 1 
ATOM   8200  N  N    . GLU B  1 109 ? 90.644  -61.564  -3.278  1.00 32.98  ? 89  GLU B N    1 
ATOM   8201  C  CA   . GLU B  1 109 ? 90.997  -61.864  -4.684  1.00 33.72  ? 89  GLU B CA   1 
ATOM   8202  C  C    . GLU B  1 109 ? 90.756  -63.336  -5.062  1.00 32.36  ? 89  GLU B C    1 
ATOM   8203  O  O    . GLU B  1 109 ? 90.663  -63.658  -6.260  1.00 31.54  ? 89  GLU B O    1 
ATOM   8204  C  CB   . GLU B  1 109 ? 92.487  -61.523  -4.962  1.00 36.83  ? 89  GLU B CB   1 
ATOM   8205  C  CG   . GLU B  1 109 ? 92.833  -60.052  -4.789  1.00 56.99  ? 89  GLU B CG   1 
ATOM   8206  C  CD   . GLU B  1 109 ? 93.389  -59.649  -3.430  1.00 75.46  ? 89  GLU B CD   1 
ATOM   8207  O  OE1  . GLU B  1 109 ? 93.078  -60.336  -2.429  1.00 35.13  ? 89  GLU B OE1  1 
ATOM   8208  O  OE2  . GLU B  1 109 ? 94.089  -58.610  -3.362  1.00 74.08  ? 89  GLU B OE2  1 
ATOM   8209  H  H    . GLU B  1 109 ? 91.434  -61.257  -2.725  1.00 31.57  ? 89  GLU B H    1 
ATOM   8210  H  HA   . GLU B  1 109 ? 90.382  -61.248  -5.338  1.00 34.95  ? 89  GLU B HA   1 
ATOM   8211  H  HB2  . GLU B  1 109 ? 93.121  -62.111  -4.299  1.00 35.46  ? 89  GLU B HB2  1 
ATOM   8212  H  HB3  . GLU B  1 109 ? 92.703  -61.781  -5.997  1.00 36.26  ? 89  GLU B HB3  1 
ATOM   8213  H  HG2  . GLU B  1 109 ? 93.573  -59.787  -5.542  1.00 57.16  ? 89  GLU B HG2  1 
ATOM   8214  H  HG3  . GLU B  1 109 ? 91.930  -59.463  -4.949  1.00 57.38  ? 89  GLU B HG3  1 
ATOM   8215  N  N    . LEU B  1 110 ? 90.740  -64.260  -4.072  1.00 27.50  ? 90  LEU B N    1 
ATOM   8216  C  CA   . LEU B  1 110 ? 90.511  -65.674  -4.348  1.00 30.92  ? 90  LEU B CA   1 
ATOM   8217  C  C    . LEU B  1 110 ? 89.096  -65.958  -4.892  1.00 34.41  ? 90  LEU B C    1 
ATOM   8218  O  O    . LEU B  1 110 ? 88.903  -66.919  -5.609  1.00 34.78  ? 90  LEU B O    1 
ATOM   8219  C  CB   . LEU B  1 110 ? 90.671  -66.504  -3.051  1.00 33.02  ? 90  LEU B CB   1 
ATOM   8220  C  CG   . LEU B  1 110 ? 92.045  -66.598  -2.397  1.00 39.81  ? 90  LEU B CG   1 
ATOM   8221  C  CD1  . LEU B  1 110 ? 91.940  -67.293  -1.056  1.00 40.72  ? 90  LEU B CD1  1 
ATOM   8222  C  CD2  . LEU B  1 110 ? 93.031  -67.328  -3.312  1.00 43.66  ? 90  LEU B CD2  1 
ATOM   8223  H  H    . LEU B  1 110 ? 90.907  -64.056  -3.095  1.00 27.78  ? 90  LEU B H    1 
ATOM   8224  H  HA   . LEU B  1 110 ? 91.228  -66.026  -5.089  1.00 29.97  ? 90  LEU B HA   1 
ATOM   8225  H  HB2  . LEU B  1 110 ? 90.001  -66.079  -2.306  1.00 33.07  ? 90  LEU B HB2  1 
ATOM   8226  H  HB3  . LEU B  1 110 ? 90.358  -67.525  -3.264  1.00 32.82  ? 90  LEU B HB3  1 
ATOM   8227  H  HG   . LEU B  1 110 ? 92.425  -65.593  -2.221  1.00 39.74  ? 90  LEU B HG   1 
ATOM   8228  H  HD11 . LEU B  1 110 ? 92.936  -67.469  -0.654  1.00 42.05  ? 90  LEU B HD11 1 
ATOM   8229  H  HD12 . LEU B  1 110 ? 91.375  -66.657  -0.378  1.00 40.33  ? 90  LEU B HD12 1 
ATOM   8230  H  HD13 . LEU B  1 110 ? 91.425  -68.242  -1.197  1.00 40.10  ? 90  LEU B HD13 1 
ATOM   8231  H  HD21 . LEU B  1 110 ? 93.933  -67.580  -2.759  1.00 44.21  ? 90  LEU B HD21 1 
ATOM   8232  H  HD22 . LEU B  1 110 ? 92.567  -68.242  -3.674  1.00 43.61  ? 90  LEU B HD22 1 
ATOM   8233  H  HD23 . LEU B  1 110 ? 93.280  -66.678  -4.150  1.00 43.07  ? 90  LEU B HD23 1 
ATOM   8234  N  N    . PHE B  1 111 ? 88.106  -65.166  -4.485  1.00 31.32  ? 91  PHE B N    1 
ATOM   8235  C  CA   . PHE B  1 111 ? 86.702  -65.451  -4.793  1.00 31.11  ? 91  PHE B CA   1 
ATOM   8236  C  C    . PHE B  1 111 ? 86.315  -65.083  -6.235  1.00 37.25  ? 91  PHE B C    1 
ATOM   8237  O  O    . PHE B  1 111 ? 86.628  -64.005  -6.731  1.00 35.85  ? 91  PHE B O    1 
ATOM   8238  C  CB   . PHE B  1 111 ? 85.774  -64.761  -3.761  1.00 32.94  ? 91  PHE B CB   1 
ATOM   8239  C  CG   . PHE B  1 111 ? 86.053  -65.247  -2.347  1.00 33.76  ? 91  PHE B CG   1 
ATOM   8240  C  CD1  . PHE B  1 111 ? 85.672  -66.515  -1.946  1.00 39.23  ? 91  PHE B CD1  1 
ATOM   8241  C  CD2  . PHE B  1 111 ? 86.803  -64.483  -1.471  1.00 36.93  ? 91  PHE B CD2  1 
ATOM   8242  C  CE1  . PHE B  1 111 ? 86.009  -66.994  -0.672  1.00 41.75  ? 91  PHE B CE1  1 
ATOM   8243  C  CE2  . PHE B  1 111 ? 87.119  -64.947  -0.191  1.00 41.16  ? 91  PHE B CE2  1 
ATOM   8244  C  CZ   . PHE B  1 111 ? 86.698  -66.187  0.212   1.00 39.81  ? 91  PHE B CZ   1 
ATOM   8245  H  H    . PHE B  1 111 ? 88.236  -64.311  -3.955  1.00 30.95  ? 91  PHE B H    1 
ATOM   8246  H  HA   . PHE B  1 111 ? 86.550  -66.522  -4.664  1.00 30.86  ? 91  PHE B HA   1 
ATOM   8247  H  HB2  . PHE B  1 111 ? 85.926  -63.683  -3.788  1.00 32.57  ? 91  PHE B HB2  1 
ATOM   8248  H  HB3  . PHE B  1 111 ? 84.742  -65.005  -4.003  1.00 31.98  ? 91  PHE B HB3  1 
ATOM   8249  H  HD1  . PHE B  1 111 ? 85.131  -67.160  -2.637  1.00 38.87  ? 91  PHE B HD1  1 
ATOM   8250  H  HD2  . PHE B  1 111 ? 87.096  -63.479  -1.772  1.00 37.44  ? 91  PHE B HD2  1 
ATOM   8251  H  HE1  . PHE B  1 111 ? 85.702  -67.992  -0.361  1.00 42.26  ? 91  PHE B HE1  1 
ATOM   8252  H  HE2  . PHE B  1 111 ? 87.670  -64.309  0.498   1.00 42.12  ? 91  PHE B HE2  1 
ATOM   8253  H  HZ   . PHE B  1 111 ? 86.952  -66.560  1.204   1.00 39.41  ? 91  PHE B HZ   1 
ATOM   8254  N  N    . ASP B  1 112 ? 85.638  -66.037  -6.909  1.00 34.56  ? 92  ASP B N    1 
ATOM   8255  C  CA   . ASP B  1 112 ? 85.182  -65.880  -8.266  1.00 33.07  ? 92  ASP B CA   1 
ATOM   8256  C  C    . ASP B  1 112 ? 84.135  -64.751  -8.385  1.00 34.36  ? 92  ASP B C    1 
ATOM   8257  O  O    . ASP B  1 112 ? 83.396  -64.458  -7.450  1.00 33.53  ? 92  ASP B O    1 
ATOM   8258  C  CB   . ASP B  1 112 ? 84.605  -67.227  -8.806  1.00 34.27  ? 92  ASP B CB   1 
ATOM   8259  C  CG   . ASP B  1 112 ? 84.611  -67.342  -10.325 1.00 38.40  ? 92  ASP B CG   1 
ATOM   8260  O  OD1  . ASP B  1 112 ? 84.938  -66.354  -10.985 1.00 38.22  ? 92  ASP B OD1  1 
ATOM   8261  O  OD2  . ASP B  1 112 ? 84.251  -68.435  -10.863 1.00 39.48  ? 92  ASP B OD2  1 
ATOM   8262  H  H    . ASP B  1 112 ? 85.382  -66.924  -6.489  1.00 33.74  ? 92  ASP B H    1 
ATOM   8263  H  HA   . ASP B  1 112 ? 86.049  -65.616  -8.868  1.00 33.84  ? 92  ASP B HA   1 
ATOM   8264  H  HB2  . ASP B  1 112 ? 85.206  -68.044  -8.409  1.00 34.56  ? 92  ASP B HB2  1 
ATOM   8265  H  HB3  . ASP B  1 112 ? 83.574  -67.310  -8.472  1.00 32.10  ? 92  ASP B HB3  1 
ATOM   8266  N  N    . ARG B  1 113 ? 84.100  -64.134  -9.557  1.00 35.16  ? 93  ARG B N    1 
ATOM   8267  C  CA   . ARG B  1 113 ? 83.221  -63.018  -9.920  1.00 36.20  ? 93  ARG B CA   1 
ATOM   8268  C  C    . ARG B  1 113 ? 82.584  -63.263  -11.273 1.00 39.72  ? 93  ARG B C    1 
ATOM   8269  O  O    . ARG B  1 113 ? 83.228  -63.806  -12.149 1.00 37.24  ? 93  ARG B O    1 
ATOM   8270  C  CB   . ARG B  1 113 ? 84.019  -61.700  -10.015 1.00 36.75  ? 93  ARG B CB   1 
ATOM   8271  C  CG   . ARG B  1 113 ? 85.108  -61.474  -8.972  1.00 48.65  ? 93  ARG B CG   1 
ATOM   8272  C  CD   . ARG B  1 113 ? 84.542  -61.198  -7.590  1.00 50.33  ? 93  ARG B CD   1 
ATOM   8273  N  NE   . ARG B  1 113 ? 85.623  -61.112  -6.606  1.00 57.88  ? 93  ARG B NE   1 
ATOM   8274  C  CZ   . ARG B  1 113 ? 86.388  -60.039  -6.380  1.00 67.71  ? 93  ARG B CZ   1 
ATOM   8275  N  NH1  . ARG B  1 113 ? 86.203  -58.920  -7.067  1.00 63.77  ? 93  ARG B NH1  1 
ATOM   8276  N  NH2  . ARG B  1 113 ? 87.340  -60.079  -5.461  1.00 56.24  ? 93  ARG B NH2  1 
ATOM   8277  H  H    . ARG B  1 113 ? 84.723  -64.377  -10.323 1.00 37.28  ? 93  ARG B H    1 
ATOM   8278  H  HA   . ARG B  1 113 ? 82.441  -62.902  -9.172  1.00 36.18  ? 93  ARG B HA   1 
ATOM   8279  H  HB2  . ARG B  1 113 ? 84.511  -61.656  -10.986 1.00 35.59  ? 93  ARG B HB2  1 
ATOM   8280  H  HB3  . ARG B  1 113 ? 83.305  -60.881  -9.934  1.00 38.83  ? 93  ARG B HB3  1 
ATOM   8281  H  HG2  . ARG B  1 113 ? 85.765  -62.340  -8.916  1.00 48.30  ? 93  ARG B HG2  1 
ATOM   8282  H  HG3  . ARG B  1 113 ? 85.698  -60.607  -9.264  1.00 49.02  ? 93  ARG B HG3  1 
ATOM   8283  H  HD2  . ARG B  1 113 ? 83.950  -60.284  -7.588  1.00 49.91  ? 93  ARG B HD2  1 
ATOM   8284  H  HD3  . ARG B  1 113 ? 83.897  -62.025  -7.297  1.00 50.78  ? 93  ARG B HD3  1 
ATOM   8285  H  HE   . ARG B  1 113 ? 85.795  -61.944  -6.049  1.00 57.84  ? 93  ARG B HE   1 
ATOM   8286  H  HH11 . ARG B  1 113 ? 85.497  -58.830  -7.789  1.00 63.88  ? 93  ARG B HH11 1 
ATOM   8287  H  HH12 . ARG B  1 113 ? 86.800  -58.119  -6.888  1.00 64.81  ? 93  ARG B HH12 1 
ATOM   8288  H  HH21 . ARG B  1 113 ? 87.488  -60.922  -4.915  1.00 55.99  ? 93  ARG B HH21 1 
ATOM   8289  H  HH22 . ARG B  1 113 ? 87.919  -59.262  -5.292  1.00 56.96  ? 93  ARG B HH22 1 
ATOM   8290  N  N    . ASN B  1 114 ? 81.390  -62.757  -11.491 1.00 37.50  ? 94  ASN B N    1 
ATOM   8291  C  CA   . ASN B  1 114 ? 80.757  -62.915  -12.789 1.00 36.78  ? 94  ASN B CA   1 
ATOM   8292  C  C    . ASN B  1 114 ? 81.440  -62.111  -13.882 1.00 37.04  ? 94  ASN B C    1 
ATOM   8293  O  O    . ASN B  1 114 ? 81.741  -60.945  -13.697 1.00 36.80  ? 94  ASN B O    1 
ATOM   8294  C  CB   . ASN B  1 114 ? 79.309  -62.471  -12.757 1.00 40.70  ? 94  ASN B CB   1 
ATOM   8295  C  CG   . ASN B  1 114 ? 78.419  -63.266  -11.859 1.00 54.67  ? 94  ASN B CG   1 
ATOM   8296  O  OD1  . ASN B  1 114 ? 78.619  -64.469  -11.658 1.00 39.21  ? 94  ASN B OD1  1 
ATOM   8297  N  ND2  . ASN B  1 114 ? 77.376  -62.618  -11.356 1.00 50.34  ? 94  ASN B ND2  1 
ATOM   8298  H  H    . ASN B  1 114 ? 80.854  -62.247  -10.794 1.00 38.25  ? 94  ASN B H    1 
ATOM   8299  H  HA   . ASN B  1 114 ? 80.774  -63.972  -13.044 1.00 37.67  ? 94  ASN B HA   1 
ATOM   8300  H  HB2  . ASN B  1 114 ? 79.322  -61.440  -12.411 1.00 42.19  ? 94  ASN B HB2  1 
ATOM   8301  H  HB3  . ASN B  1 114 ? 78.896  -62.520  -13.761 1.00 39.35  ? 94  ASN B HB3  1 
ATOM   8302  H  HD21 . ASN B  1 114 ? 76.738  -63.105  -10.734 1.00 50.93  ? 94  ASN B HD21 1 
ATOM   8303  H  HD22 . ASN B  1 114 ? 77.209  -61.644  -11.585 1.00 50.23  ? 94  ASN B HD22 1 
ATOM   8304  N  N    . VAL B  1 115 ? 81.668  -62.748  -15.036 1.00 32.77  ? 95  VAL B N    1 
ATOM   8305  C  CA   . VAL B  1 115 ? 82.178  -62.097  -16.251 1.00 33.43  ? 95  VAL B CA   1 
ATOM   8306  C  C    . VAL B  1 115 ? 81.141  -61.050  -16.746 1.00 33.60  ? 95  VAL B C    1 
ATOM   8307  O  O    . VAL B  1 115 ? 81.537  -59.976  -17.186 1.00 30.78  ? 95  VAL B O    1 
ATOM   8308  C  CB   . VAL B  1 115 ? 82.484  -63.167  -17.348 1.00 36.39  ? 95  VAL B CB   1 
ATOM   8309  C  CG1  . VAL B  1 115 ? 82.768  -62.522  -18.703 1.00 36.68  ? 95  VAL B CG1  1 
ATOM   8310  C  CG2  . VAL B  1 115 ? 83.659  -64.070  -16.927 1.00 35.73  ? 95  VAL B CG2  1 
ATOM   8311  H  H    . VAL B  1 115 ? 81.553  -63.748  -15.136 1.00 31.84  ? 95  VAL B H    1 
ATOM   8312  H  HA   . VAL B  1 115 ? 83.102  -61.567  -16.024 1.00 34.61  ? 95  VAL B HA   1 
ATOM   8313  H  HB   . VAL B  1 115 ? 81.604  -63.797  -17.473 1.00 35.10  ? 95  VAL B HB   1 
ATOM   8314  H  HG11 . VAL B  1 115 ? 83.281  -63.242  -19.338 1.00 36.65  ? 95  VAL B HG11 1 
ATOM   8315  H  HG12 . VAL B  1 115 ? 81.831  -62.230  -19.174 1.00 35.52  ? 95  VAL B HG12 1 
ATOM   8316  H  HG13 . VAL B  1 115 ? 83.406  -61.653  -18.547 1.00 37.73  ? 95  VAL B HG13 1 
ATOM   8317  H  HG21 . VAL B  1 115 ? 83.791  -64.838  -17.688 1.00 35.86  ? 95  VAL B HG21 1 
ATOM   8318  H  HG22 . VAL B  1 115 ? 84.558  -63.461  -16.857 1.00 35.25  ? 95  VAL B HG22 1 
ATOM   8319  H  HG23 . VAL B  1 115 ? 83.455  -64.543  -15.969 1.00 34.70  ? 95  VAL B HG23 1 
ATOM   8320  N  N    . ILE B  1 116 ? 79.825  -61.384  -16.662 1.00 31.69  ? 96  ILE B N    1 
ATOM   8321  C  CA   . ILE B  1 116 ? 78.748  -60.540  -17.182 1.00 33.38  ? 96  ILE B CA   1 
ATOM   8322  C  C    . ILE B  1 116 ? 78.544  -59.235  -16.402 1.00 38.73  ? 96  ILE B C    1 
ATOM   8323  O  O    . ILE B  1 116 ? 78.212  -58.245  -17.042 1.00 41.98  ? 96  ILE B O    1 
ATOM   8324  C  CB   . ILE B  1 116 ? 77.374  -61.273  -17.313 1.00 36.92  ? 96  ILE B CB   1 
ATOM   8325  C  CG1  . ILE B  1 116 ? 76.736  -61.645  -15.965 1.00 37.30  ? 96  ILE B CG1  1 
ATOM   8326  C  CG2  . ILE B  1 116 ? 77.474  -62.487  -18.271 1.00 39.74  ? 96  ILE B CG2  1 
ATOM   8327  C  CD1  . ILE B  1 116 ? 75.386  -62.418  -16.061 1.00 51.86  ? 96  ILE B CD1  1 
ATOM   8328  H  H    . ILE B  1 116 ? 79.494  -62.245  -16.237 1.00 31.46  ? 96  ILE B H    1 
ATOM   8329  H  HA   . ILE B  1 116 ? 79.040  -60.261  -18.193 1.00 32.83  ? 96  ILE B HA   1 
ATOM   8330  H  HB   . ILE B  1 116 ? 76.696  -60.564  -17.787 1.00 36.68  ? 96  ILE B HB   1 
ATOM   8331  H  HG12 . ILE B  1 116 ? 77.414  -62.285  -15.408 1.00 37.10  ? 96  ILE B HG12 1 
ATOM   8332  H  HG13 . ILE B  1 116 ? 76.522  -60.738  -15.400 1.00 37.19  ? 96  ILE B HG13 1 
ATOM   8333  H  HG21 . ILE B  1 116 ? 76.477  -62.867  -18.489 1.00 39.26  ? 96  ILE B HG21 1 
ATOM   8334  H  HG22 . ILE B  1 116 ? 77.953  -62.158  -19.194 1.00 40.00  ? 96  ILE B HG22 1 
ATOM   8335  H  HG23 . ILE B  1 116 ? 78.069  -63.277  -17.819 1.00 40.11  ? 96  ILE B HG23 1 
ATOM   8336  H  HD11 . ILE B  1 116 ? 74.917  -62.397  -15.080 1.00 51.35  ? 96  ILE B HD11 1 
ATOM   8337  H  HD12 . ILE B  1 116 ? 74.742  -61.920  -16.785 1.00 52.85  ? 96  ILE B HD12 1 
ATOM   8338  H  HD13 . ILE B  1 116 ? 75.571  -63.444  -16.376 1.00 51.50  ? 96  ILE B HD13 1 
ATOM   8339  N  N    . ASP B  1 117 ? 78.663  -59.223  -15.069 1.00 34.05  ? 97  ASP B N    1 
ATOM   8340  C  CA   . ASP B  1 117 ? 78.409  -57.998  -14.271 1.00 34.18  ? 97  ASP B CA   1 
ATOM   8341  C  C    . ASP B  1 117 ? 79.410  -57.733  -13.126 1.00 38.61  ? 97  ASP B C    1 
ATOM   8342  O  O    . ASP B  1 117 ? 79.155  -56.843  -12.300 1.00 38.34  ? 97  ASP B O    1 
ATOM   8343  C  CB   . ASP B  1 117 ? 76.969  -58.055  -13.694 1.00 35.52  ? 97  ASP B CB   1 
ATOM   8344  C  CG   . ASP B  1 117 ? 76.667  -59.209  -12.751 1.00 39.98  ? 97  ASP B CG   1 
ATOM   8345  O  OD1  . ASP B  1 117 ? 77.608  -59.892  -12.341 1.00 36.68  ? 97  ASP B OD1  1 
ATOM   8346  O  OD2  . ASP B  1 117 ? 75.476  -59.383  -12.376 1.00 43.61  ? 97  ASP B OD2  1 
ATOM   8347  H  H    . ASP B  1 117 ? 78.890  -60.039  -14.510 1.00 34.84  ? 97  ASP B H    1 
ATOM   8348  H  HA   . ASP B  1 117 ? 78.458  -57.118  -14.908 1.00 33.28  ? 97  ASP B HA   1 
ATOM   8349  H  HB2  . ASP B  1 117 ? 76.754  -57.133  -13.158 1.00 34.96  ? 97  ASP B HB2  1 
ATOM   8350  H  HB3  . ASP B  1 117 ? 76.282  -58.153  -14.534 1.00 35.70  ? 97  ASP B HB3  1 
ATOM   8351  N  N    . GLY B  1 118 ? 80.521  -58.471  -13.057 1.00 36.55  ? 98  GLY B N    1 
ATOM   8352  C  CA   . GLY B  1 118 ? 81.518  -58.281  -11.995 1.00 36.29  ? 98  GLY B CA   1 
ATOM   8353  C  C    . GLY B  1 118 ? 81.065  -58.523  -10.564 1.00 36.60  ? 98  GLY B C    1 
ATOM   8354  O  O    . GLY B  1 118 ? 81.792  -58.167  -9.638  1.00 34.14  ? 98  GLY B O    1 
ATOM   8355  H  H    . GLY B  1 118 ? 80.800  -59.190  -13.714 1.00 36.18  ? 98  GLY B H    1 
ATOM   8356  H  HA2  . GLY B  1 118 ? 82.383  -58.913  -12.185 1.00 35.64  ? 98  GLY B HA2  1 
ATOM   8357  H  HA3  . GLY B  1 118 ? 81.847  -57.245  -12.016 1.00 35.79  ? 98  GLY B HA3  1 
ATOM   8358  N  N    . ARG B  1 119 ? 79.898  -59.157  -10.367 1.00 30.16  ? 99  ARG B N    1 
ATOM   8359  C  CA   . ARG B  1 119 ? 79.361  -59.386  -9.030  1.00 29.80  ? 99  ARG B CA   1 
ATOM   8360  C  C    . ARG B  1 119 ? 79.822  -60.715  -8.447  1.00 35.60  ? 99  ARG B C    1 
ATOM   8361  O  O    . ARG B  1 119 ? 80.286  -61.617  -9.159  1.00 35.24  ? 99  ARG B O    1 
ATOM   8362  C  CB   . ARG B  1 119 ? 77.828  -59.312  -9.056  1.00 27.85  ? 99  ARG B CB   1 
ATOM   8363  C  CG   . ARG B  1 119 ? 77.268  -57.944  -9.489  1.00 39.65  ? 99  ARG B CG   1 
ATOM   8364  C  CD   . ARG B  1 119 ? 78.028  -56.747  -8.921  1.00 42.05  ? 99  ARG B CD   1 
ATOM   8365  N  NE   . ARG B  1 119 ? 77.213  -55.536  -8.851  1.00 40.85  ? 99  ARG B NE   1 
ATOM   8366  C  CZ   . ARG B  1 119 ? 76.964  -54.688  -9.852  1.00 36.81  ? 99  ARG B CZ   1 
ATOM   8367  N  NH1  . ARG B  1 119 ? 77.434  -54.923  -11.068 1.00 32.34  ? 99  ARG B NH1  1 
ATOM   8368  N  NH2  . ARG B  1 119 ? 76.210  -53.617  -9.647  1.00 31.27  ? 99  ARG B NH2  1 
ATOM   8369  H  H    . ARG B  1 119 ? 79.319  -59.559  -11.096 1.00 29.10  ? 99  ARG B H    1 
ATOM   8370  H  HA   . ARG B  1 119 ? 79.732  -58.625  -8.345  1.00 29.84  ? 99  ARG B HA   1 
ATOM   8371  H  HB2  . ARG B  1 119 ? 77.463  -60.065  -9.753  1.00 29.47  ? 99  ARG B HB2  1 
ATOM   8372  H  HB3  . ARG B  1 119 ? 77.448  -59.540  -8.065  1.00 26.86  ? 99  ARG B HB3  1 
ATOM   8373  H  HG2  . ARG B  1 119 ? 77.324  -57.867  -10.573 1.00 40.06  ? 99  ARG B HG2  1 
ATOM   8374  H  HG3  . ARG B  1 119 ? 76.230  -57.866  -9.170  1.00 39.34  ? 99  ARG B HG3  1 
ATOM   8375  H  HD2  . ARG B  1 119 ? 78.313  -56.972  -7.896  1.00 41.52  ? 99  ARG B HD2  1 
ATOM   8376  H  HD3  . ARG B  1 119 ? 78.923  -56.554  -9.512  1.00 42.93  ? 99  ARG B HD3  1 
ATOM   8377  H  HE   . ARG B  1 119 ? 76.825  -55.311  -7.940  1.00 40.66  ? 99  ARG B HE   1 
ATOM   8378  H  HH11 . ARG B  1 119 ? 78.009  -55.727  -11.296 1.00 32.78  ? 99  ARG B HH11 1 
ATOM   8379  H  HH12 . ARG B  1 119 ? 77.217  -54.272  -11.816 1.00 33.85  ? 99  ARG B HH12 1 
ATOM   8380  H  HH21 . ARG B  1 119 ? 75.837  -53.429  -8.722  1.00 32.59  ? 99  ARG B HH21 1 
ATOM   8381  H  HH22 . ARG B  1 119 ? 76.006  -52.972  -10.402 1.00 32.08  ? 99  ARG B HH22 1 
ATOM   8382  N  N    . ALA B  1 120 ? 79.691  -60.824  -7.120  1.00 32.53  ? 100 ALA B N    1 
ATOM   8383  C  CA   . ALA B  1 120 ? 80.119  -62.011  -6.380  1.00 32.55  ? 100 ALA B CA   1 
ATOM   8384  C  C    . ALA B  1 120 ? 79.123  -63.137  -6.540  1.00 38.91  ? 100 ALA B C    1 
ATOM   8385  O  O    . ALA B  1 120 ? 77.985  -62.928  -6.982  1.00 36.52  ? 100 ALA B O    1 
ATOM   8386  C  CB   . ALA B  1 120 ? 80.301  -61.683  -4.904  1.00 33.37  ? 100 ALA B CB   1 
ATOM   8387  H  H    . ALA B  1 120 ? 79.245  -60.120  -6.543  1.00 32.34  ? 100 ALA B H    1 
ATOM   8388  H  HA   . ALA B  1 120 ? 81.080  -62.350  -6.765  1.00 33.22  ? 100 ALA B HA   1 
ATOM   8389  H  HB1  . ALA B  1 120 ? 80.588  -62.588  -4.372  1.00 33.11  ? 100 ALA B HB1  1 
ATOM   8390  H  HB2  . ALA B  1 120 ? 81.079  -60.928  -4.806  1.00 34.75  ? 100 ALA B HB2  1 
ATOM   8391  H  HB3  . ALA B  1 120 ? 79.365  -61.299  -4.501  1.00 32.59  ? 100 ALA B HB3  1 
ATOM   8392  N  N    . MET B  1 121 ? 79.575  -64.345  -6.183  1.00 37.36  ? 101 MET B N    1 
ATOM   8393  C  CA   . MET B  1 121 ? 78.759  -65.552  -6.227  1.00 37.16  ? 101 MET B CA   1 
ATOM   8394  C  C    . MET B  1 121 ? 79.021  -66.339  -4.959  1.00 40.82  ? 101 MET B C    1 
ATOM   8395  O  O    . MET B  1 121 ? 80.180  -66.508  -4.567  1.00 41.25  ? 101 MET B O    1 
ATOM   8396  C  CB   . MET B  1 121 ? 79.055  -66.386  -7.485  1.00 38.74  ? 101 MET B CB   1 
ATOM   8397  C  CG   . MET B  1 121 ? 80.500  -66.738  -7.687  1.00 42.83  ? 101 MET B CG   1 
ATOM   8398  S  SD   . MET B  1 121 ? 80.731  -67.921  -9.016  1.00 46.91  ? 101 MET B SD   1 
ATOM   8399  C  CE   . MET B  1 121 ? 80.841  -66.823  -10.379 1.00 41.10  ? 101 MET B CE   1 
ATOM   8400  H  H    . MET B  1 121 ? 80.530  -64.509  -5.879  1.00 37.34  ? 101 MET B H    1 
ATOM   8401  H  HA   . MET B  1 121 ? 77.705  -65.283  -6.263  1.00 36.89  ? 101 MET B HA   1 
ATOM   8402  H  HB2  . MET B  1 121 ? 78.500  -67.322  -7.421  1.00 39.89  ? 101 MET B HB2  1 
ATOM   8403  H  HB3  . MET B  1 121 ? 78.729  -65.825  -8.360  1.00 39.29  ? 101 MET B HB3  1 
ATOM   8404  H  HG2  . MET B  1 121 ? 81.040  -65.832  -7.957  1.00 42.89  ? 101 MET B HG2  1 
ATOM   8405  H  HG3  . MET B  1 121 ? 80.935  -67.184  -6.796  1.00 43.48  ? 101 MET B HG3  1 
ATOM   8406  H  HE1  . MET B  1 121 ? 80.778  -67.385  -11.310 1.00 42.24  ? 101 MET B HE1  1 
ATOM   8407  H  HE2  . MET B  1 121 ? 80.018  -66.116  -10.310 1.00 39.39  ? 101 MET B HE2  1 
ATOM   8408  H  HE3  . MET B  1 121 ? 81.793  -66.295  -10.330 1.00 41.63  ? 101 MET B HE3  1 
ATOM   8409  N  N    . ILE B  1 122 ? 77.959  -66.753  -4.271  1.00 37.49  ? 102 ILE B N    1 
ATOM   8410  C  CA   . ILE B  1 122 ? 78.105  -67.517  -3.023  1.00 37.01  ? 102 ILE B CA   1 
ATOM   8411  C  C    . ILE B  1 122 ? 78.692  -68.921  -3.313  1.00 39.70  ? 102 ILE B C    1 
ATOM   8412  O  O    . ILE B  1 122 ? 79.335  -69.475  -2.432  1.00 38.97  ? 102 ILE B O    1 
ATOM   8413  C  CB   . ILE B  1 122 ? 76.777  -67.598  -2.232  1.00 41.25  ? 102 ILE B CB   1 
ATOM   8414  C  CG1  . ILE B  1 122 ? 77.043  -67.712  -0.729  1.00 42.55  ? 102 ILE B CG1  1 
ATOM   8415  C  CG2  . ILE B  1 122 ? 75.896  -68.751  -2.689  1.00 45.08  ? 102 ILE B CG2  1 
ATOM   8416  C  CD1  . ILE B  1 122 ? 77.603  -66.417  -0.073  1.00 39.56  ? 102 ILE B CD1  1 
ATOM   8417  H  H    . ILE B  1 122 ? 76.999  -66.556  -4.530  1.00 37.54  ? 102 ILE B H    1 
ATOM   8418  H  HA   . ILE B  1 122 ? 78.836  -66.999  -2.406  1.00 36.14  ? 102 ILE B HA   1 
ATOM   8419  H  HB   . ILE B  1 122 ? 76.220  -66.679  -2.400  1.00 41.42  ? 102 ILE B HB   1 
ATOM   8420  H  HG12 . ILE B  1 122 ? 76.103  -67.952  -0.233  1.00 43.09  ? 102 ILE B HG12 1 
ATOM   8421  H  HG13 . ILE B  1 122 ? 77.756  -68.516  -0.559  1.00 42.63  ? 102 ILE B HG13 1 
ATOM   8422  H  HG21 . ILE B  1 122 ? 74.913  -68.611  -2.244  1.00 44.62  ? 102 ILE B HG21 1 
ATOM   8423  H  HG22 . ILE B  1 122 ? 75.826  -68.759  -3.776  1.00 43.77  ? 102 ILE B HG22 1 
ATOM   8424  H  HG23 . ILE B  1 122 ? 76.305  -69.693  -2.324  1.00 46.45  ? 102 ILE B HG23 1 
ATOM   8425  H  HD11 . ILE B  1 122 ? 77.411  -66.453  0.997   1.00 39.28  ? 102 ILE B HD11 1 
ATOM   8426  H  HD12 . ILE B  1 122 ? 78.678  -66.361  -0.241  1.00 40.03  ? 102 ILE B HD12 1 
ATOM   8427  H  HD13 . ILE B  1 122 ? 77.112  -65.550  -0.511  1.00 39.45  ? 102 ILE B HD13 1 
ATOM   8428  N  N    . ALA B  1 123 ? 78.502  -69.479  -4.532  1.00 36.62  ? 103 ALA B N    1 
ATOM   8429  C  CA   . ALA B  1 123 ? 79.059  -70.802  -4.876  1.00 35.19  ? 103 ALA B CA   1 
ATOM   8430  C  C    . ALA B  1 123 ? 80.593  -70.829  -4.722  1.00 37.20  ? 103 ALA B C    1 
ATOM   8431  O  O    . ALA B  1 123 ? 81.142  -71.825  -4.289  1.00 37.64  ? 103 ALA B O    1 
ATOM   8432  C  CB   . ALA B  1 123 ? 78.666  -71.197  -6.281  1.00 35.48  ? 103 ALA B CB   1 
ATOM   8433  H  H    . ALA B  1 123 ? 77.954  -69.061  -5.277  1.00 37.05  ? 103 ALA B H    1 
ATOM   8434  H  HA   . ALA B  1 123 ? 78.651  -71.547  -4.195  1.00 35.20  ? 103 ALA B HA   1 
ATOM   8435  H  HB1  . ALA B  1 123 ? 79.106  -72.166  -6.509  1.00 35.75  ? 103 ALA B HB1  1 
ATOM   8436  H  HB2  . ALA B  1 123 ? 77.581  -71.248  -6.337  1.00 33.32  ? 103 ALA B HB2  1 
ATOM   8437  H  HB3  . ALA B  1 123 ? 79.044  -70.450  -6.979  1.00 35.76  ? 103 ALA B HB3  1 
ATOM   8438  N  N    . SER B  1 124 ? 81.267  -69.763  -5.059  1.00 35.01  ? 104 SER B N    1 
ATOM   8439  C  CA   . SER B  1 124 ? 82.716  -69.663  -4.898  1.00 34.54  ? 104 SER B CA   1 
ATOM   8440  C  C    . SER B  1 124 ? 83.087  -69.577  -3.437  1.00 37.83  ? 104 SER B C    1 
ATOM   8441  O  O    . SER B  1 124 ? 84.065  -70.196  -3.073  1.00 38.54  ? 104 SER B O    1 
ATOM   8442  C  CB   . SER B  1 124 ? 83.252  -68.440  -5.627  1.00 37.59  ? 104 SER B CB   1 
ATOM   8443  O  OG   . SER B  1 124 ? 84.659  -68.334  -5.482  1.00 41.63  ? 104 SER B OG   1 
ATOM   8444  H  H    . SER B  1 124 ? 80.840  -68.927  -5.443  1.00 36.40  ? 104 SER B H    1 
ATOM   8445  H  HA   . SER B  1 124 ? 83.191  -70.550  -5.312  1.00 35.30  ? 104 SER B HA   1 
ATOM   8446  H  HB2  . SER B  1 124 ? 82.993  -68.531  -6.681  1.00 37.55  ? 104 SER B HB2  1 
ATOM   8447  H  HB3  . SER B  1 124 ? 82.783  -67.554  -5.203  1.00 37.22  ? 104 SER B HB3  1 
ATOM   8448  H  HG   . SER B  1 124 ? 85.092  -69.226  -5.544  1.00 41.59  ? 104 SER B HG   1 
ATOM   8449  N  N    . PHE B  1 125 ? 82.367  -68.745  -2.625  1.00 35.07  ? 105 PHE B N    1 
ATOM   8450  C  CA   . PHE B  1 125 ? 82.582  -68.640  -1.175  1.00 36.07  ? 105 PHE B CA   1 
ATOM   8451  C  C    . PHE B  1 125 ? 82.503  -70.045  -0.570  1.00 39.13  ? 105 PHE B C    1 
ATOM   8452  O  O    . PHE B  1 125 ? 83.421  -70.453  0.136   1.00 39.68  ? 105 PHE B O    1 
ATOM   8453  C  CB   . PHE B  1 125 ? 81.559  -67.688  -0.522  1.00 37.54  ? 105 PHE B CB   1 
ATOM   8454  C  CG   . PHE B  1 125 ? 81.542  -67.721  0.986   1.00 38.41  ? 105 PHE B CG   1 
ATOM   8455  C  CD1  . PHE B  1 125 ? 82.533  -67.082  1.723   1.00 41.59  ? 105 PHE B CD1  1 
ATOM   8456  C  CD2  . PHE B  1 125 ? 80.579  -68.451  1.673   1.00 38.77  ? 105 PHE B CD2  1 
ATOM   8457  C  CE1  . PHE B  1 125 ? 82.554  -67.168  3.115   1.00 41.36  ? 105 PHE B CE1  1 
ATOM   8458  C  CE2  . PHE B  1 125 ? 80.615  -68.547  3.063   1.00 40.91  ? 105 PHE B CE2  1 
ATOM   8459  C  CZ   . PHE B  1 125 ? 81.592  -67.895  3.775   1.00 39.87  ? 105 PHE B CZ   1 
ATOM   8460  H  H    . PHE B  1 125 ? 81.639  -68.124  -2.965  1.00 34.70  ? 105 PHE B H    1 
ATOM   8461  H  HA   . PHE B  1 125 ? 83.574  -68.241  -0.979  1.00 37.64  ? 105 PHE B HA   1 
ATOM   8462  H  HB2  . PHE B  1 125 ? 81.809  -66.671  -0.815  1.00 38.60  ? 105 PHE B HB2  1 
ATOM   8463  H  HB3  . PHE B  1 125 ? 80.557  -67.931  -0.872  1.00 37.84  ? 105 PHE B HB3  1 
ATOM   8464  H  HD1  . PHE B  1 125 ? 83.295  -66.501  1.204   1.00 42.50  ? 105 PHE B HD1  1 
ATOM   8465  H  HD2  . PHE B  1 125 ? 79.822  -69.001  1.114   1.00 38.53  ? 105 PHE B HD2  1 
ATOM   8466  H  HE1  . PHE B  1 125 ? 83.321  -66.653  3.688   1.00 42.49  ? 105 PHE B HE1  1 
ATOM   8467  H  HE2  . PHE B  1 125 ? 79.868  -69.134  3.594   1.00 40.86  ? 105 PHE B HE2  1 
ATOM   8468  H  HZ   . PHE B  1 125 ? 81.609  -67.967  4.861   1.00 39.45  ? 105 PHE B HZ   1 
ATOM   8469  N  N    . LEU B  1 126 ? 81.428  -70.799  -0.909  1.00 32.89  ? 106 LEU B N    1 
ATOM   8470  C  CA   . LEU B  1 126 ? 81.218  -72.150  -0.411  1.00 33.52  ? 106 LEU B CA   1 
ATOM   8471  C  C    . LEU B  1 126 ? 82.312  -73.116  -0.874  1.00 38.21  ? 106 LEU B C    1 
ATOM   8472  O  O    . LEU B  1 126 ? 82.826  -73.889  -0.070  1.00 40.00  ? 106 LEU B O    1 
ATOM   8473  C  CB   . LEU B  1 126 ? 79.846  -72.678  -0.886  1.00 33.72  ? 106 LEU B CB   1 
ATOM   8474  C  CG   . LEU B  1 126 ? 78.619  -72.025  -0.247  1.00 37.82  ? 106 LEU B CG   1 
ATOM   8475  C  CD1  . LEU B  1 126 ? 77.371  -72.328  -1.061  1.00 37.75  ? 106 LEU B CD1  1 
ATOM   8476  C  CD2  . LEU B  1 126 ? 78.439  -72.505  1.202   1.00 37.72  ? 106 LEU B CD2  1 
ATOM   8477  H  H    . LEU B  1 126 ? 80.694  -70.466  -1.527  1.00 31.50  ? 106 LEU B H    1 
ATOM   8478  H  HA   . LEU B  1 126 ? 81.224  -72.135  0.679   1.00 34.00  ? 106 LEU B HA   1 
ATOM   8479  H  HB2  . LEU B  1 126 ? 79.771  -72.533  -1.962  1.00 33.27  ? 106 LEU B HB2  1 
ATOM   8480  H  HB3  . LEU B  1 126 ? 79.799  -73.744  -0.670  1.00 32.52  ? 106 LEU B HB3  1 
ATOM   8481  H  HG   . LEU B  1 126 ? 78.762  -70.947  -0.220  1.00 36.90  ? 106 LEU B HG   1 
ATOM   8482  H  HD11 . LEU B  1 126 ? 76.500  -71.910  -0.559  1.00 37.69  ? 106 LEU B HD11 1 
ATOM   8483  H  HD12 . LEU B  1 126 ? 77.477  -71.877  -2.046  1.00 37.84  ? 106 LEU B HD12 1 
ATOM   8484  H  HD13 . LEU B  1 126 ? 77.261  -73.408  -1.156  1.00 37.11  ? 106 LEU B HD13 1 
ATOM   8485  H  HD21 . LEU B  1 126 ? 77.428  -72.271  1.523   1.00 36.06  ? 106 LEU B HD21 1 
ATOM   8486  H  HD22 . LEU B  1 126 ? 78.593  -73.582  1.242   1.00 38.25  ? 106 LEU B HD22 1 
ATOM   8487  H  HD23 . LEU B  1 126 ? 79.171  -71.999  1.828   1.00 38.04  ? 106 LEU B HD23 1 
ATOM   8488  N  N    . THR B  1 127 ? 82.645  -73.090  -2.158  1.00 31.46  ? 107 THR B N    1 
ATOM   8489  C  CA   . THR B  1 127 ? 83.667  -73.957  -2.729  1.00 34.03  ? 107 THR B CA   1 
ATOM   8490  C  C    . THR B  1 127 ? 84.991  -73.843  -1.984  1.00 38.84  ? 107 THR B C    1 
ATOM   8491  O  O    . THR B  1 127 ? 85.649  -74.862  -1.746  1.00 38.86  ? 107 THR B O    1 
ATOM   8492  C  CB   . THR B  1 127 ? 83.916  -73.623  -4.245  1.00 44.04  ? 107 THR B CB   1 
ATOM   8493  O  OG1  . THR B  1 127 ? 82.707  -73.826  -4.977  1.00 46.14  ? 107 THR B OG1  1 
ATOM   8494  C  CG2  . THR B  1 127 ? 84.982  -74.489  -4.859  1.00 42.86  ? 107 THR B CG2  1 
ATOM   8495  H  H    . THR B  1 127 ? 82.231  -72.448  -2.828  1.00 31.51  ? 107 THR B H    1 
ATOM   8496  H  HA   . THR B  1 127 ? 83.325  -74.988  -2.668  1.00 33.89  ? 107 THR B HA   1 
ATOM   8497  H  HB   . THR B  1 127 ? 84.231  -72.586  -4.351  1.00 42.14  ? 107 THR B HB   1 
ATOM   8498  H  HG1  . THR B  1 127 ? 82.756  -73.358  -5.851  1.00 46.16  ? 107 THR B HG1  1 
ATOM   8499  H  HG21 . THR B  1 127 ? 84.905  -74.445  -5.944  1.00 43.40  ? 107 THR B HG21 1 
ATOM   8500  H  HG22 . THR B  1 127 ? 85.973  -74.140  -4.578  1.00 42.71  ? 107 THR B HG22 1 
ATOM   8501  H  HG23 . THR B  1 127 ? 84.851  -75.520  -4.530  1.00 42.20  ? 107 THR B HG23 1 
ATOM   8502  N  N    . LEU B  1 128 ? 85.419  -72.626  -1.696  1.00 35.39  ? 108 LEU B N    1 
ATOM   8503  C  CA   . LEU B  1 128 ? 86.703  -72.438  -1.027  1.00 37.80  ? 108 LEU B CA   1 
ATOM   8504  C  C    . LEU B  1 128 ? 86.634  -72.674  0.479   1.00 43.10  ? 108 LEU B C    1 
ATOM   8505  O  O    . LEU B  1 128 ? 87.436  -73.440  1.017   1.00 44.19  ? 108 LEU B O    1 
ATOM   8506  C  CB   . LEU B  1 128 ? 87.239  -71.036  -1.310  1.00 38.19  ? 108 LEU B CB   1 
ATOM   8507  C  CG   . LEU B  1 128 ? 87.732  -70.806  -2.747  1.00 42.82  ? 108 LEU B CG   1 
ATOM   8508  C  CD1  . LEU B  1 128 ? 87.861  -69.347  -3.031  1.00 44.42  ? 108 LEU B CD1  1 
ATOM   8509  C  CD2  . LEU B  1 128 ? 89.064  -71.491  -2.998  1.00 44.39  ? 108 LEU B CD2  1 
ATOM   8510  H  H    . LEU B  1 128 ? 84.922  -71.769  -1.912  1.00 34.76  ? 108 LEU B H    1 
ATOM   8511  H  HA   . LEU B  1 128 ? 87.425  -73.153  -1.418  1.00 38.98  ? 108 LEU B HA   1 
ATOM   8512  H  HB2  . LEU B  1 128 ? 86.456  -70.308  -1.103  1.00 37.60  ? 108 LEU B HB2  1 
ATOM   8513  H  HB3  . LEU B  1 128 ? 88.086  -70.853  -0.650  1.00 39.97  ? 108 LEU B HB3  1 
ATOM   8514  H  HG   . LEU B  1 128 ? 86.998  -71.218  -3.439  1.00 41.72  ? 108 LEU B HG   1 
ATOM   8515  H  HD11 . LEU B  1 128 ? 88.266  -69.211  -4.033  1.00 44.95  ? 108 LEU B HD11 1 
ATOM   8516  H  HD12 . LEU B  1 128 ? 86.877  -68.883  -2.971  1.00 45.12  ? 108 LEU B HD12 1 
ATOM   8517  H  HD13 . LEU B  1 128 ? 88.528  -68.904  -2.292  1.00 44.88  ? 108 LEU B HD13 1 
ATOM   8518  H  HD21 . LEU B  1 128 ? 89.376  -71.291  -4.022  1.00 45.01  ? 108 LEU B HD21 1 
ATOM   8519  H  HD22 . LEU B  1 128 ? 89.804  -71.089  -2.310  1.00 43.72  ? 108 LEU B HD22 1 
ATOM   8520  H  HD23 . LEU B  1 128 ? 88.974  -72.567  -2.862  1.00 44.51  ? 108 LEU B HD23 1 
ATOM   8521  N  N    . THR B  1 129 ? 85.667  -72.052  1.152   1.00 40.04  ? 109 THR B N    1 
ATOM   8522  C  CA   . THR B  1 129 ? 85.609  -72.053  2.624   1.00 38.03  ? 109 THR B CA   1 
ATOM   8523  C  C    . THR B  1 129 ? 84.999  -73.312  3.243   1.00 39.73  ? 109 THR B C    1 
ATOM   8524  O  O    . THR B  1 129 ? 85.267  -73.571  4.434   1.00 36.07  ? 109 THR B O    1 
ATOM   8525  C  CB   . THR B  1 129 ? 84.883  -70.808  3.143   1.00 39.71  ? 109 THR B CB   1 
ATOM   8526  O  OG1  . THR B  1 129 ? 83.471  -70.874  2.917   1.00 39.22  ? 109 THR B OG1  1 
ATOM   8527  C  CG2  . THR B  1 129 ? 85.469  -69.512  2.614   1.00 38.44  ? 109 THR B CG2  1 
ATOM   8528  H  H    . THR B  1 129 ? 84.907  -71.555  0.699   1.00 40.19  ? 109 THR B H    1 
ATOM   8529  H  HA   . THR B  1 129 ? 86.627  -71.985  3.004   1.00 38.02  ? 109 THR B HA   1 
ATOM   8530  H  HB   . THR B  1 129 ? 85.041  -70.780  4.219   1.00 41.13  ? 109 THR B HB   1 
ATOM   8531  H  HG1  . THR B  1 129 ? 83.234  -71.371  2.091   1.00 39.15  ? 109 THR B HG1  1 
ATOM   8532  H  HG21 . THR B  1 129 ? 84.962  -68.664  3.073   1.00 38.22  ? 109 THR B HG21 1 
ATOM   8533  H  HG22 . THR B  1 129 ? 86.528  -69.459  2.861   1.00 37.83  ? 109 THR B HG22 1 
ATOM   8534  H  HG23 . THR B  1 129 ? 85.358  -69.433  1.534   1.00 38.29  ? 109 THR B HG23 1 
ATOM   8535  N  N    . ILE B  1 130 ? 84.185  -74.085  2.511   1.00 38.26  ? 110 ILE B N    1 
ATOM   8536  C  CA   . ILE B  1 130 ? 83.593  -75.298  3.086   1.00 38.90  ? 110 ILE B CA   1 
ATOM   8537  C  C    . ILE B  1 130 ? 83.366  -76.351  1.990   1.00 41.31  ? 110 ILE B C    1 
ATOM   8538  O  O    . ILE B  1 130 ? 82.388  -77.094  2.013   1.00 42.17  ? 110 ILE B O    1 
ATOM   8539  C  CB   . ILE B  1 130 ? 82.321  -74.919  3.896   1.00 42.19  ? 110 ILE B CB   1 
ATOM   8540  C  CG1  . ILE B  1 130 ? 82.035  -75.971  5.011   1.00 42.47  ? 110 ILE B CG1  1 
ATOM   8541  C  CG2  . ILE B  1 130 ? 81.100  -74.618  3.026   1.00 42.56  ? 110 ILE B CG2  1 
ATOM   8542  C  CD1  . ILE B  1 130 ? 82.974  -75.839  6.225   1.00 44.34  ? 110 ILE B CD1  1 
ATOM   8543  H  H    . ILE B  1 130 ? 83.895  -73.890  1.558   1.00 38.84  ? 110 ILE B H    1 
ATOM   8544  H  HA   . ILE B  1 130 ? 84.306  -75.756  3.769   1.00 40.35  ? 110 ILE B HA   1 
ATOM   8545  H  HB   . ILE B  1 130 ? 82.541  -73.991  4.420   1.00 41.79  ? 110 ILE B HB   1 
ATOM   8546  H  HG12 . ILE B  1 130 ? 81.014  -75.831  5.361   1.00 41.48  ? 110 ILE B HG12 1 
ATOM   8547  H  HG13 . ILE B  1 130 ? 82.153  -76.975  4.605   1.00 42.50  ? 110 ILE B HG13 1 
ATOM   8548  H  HG21 . ILE B  1 130 ? 80.462  -73.916  3.559   1.00 41.45  ? 110 ILE B HG21 1 
ATOM   8549  H  HG22 . ILE B  1 130 ? 81.422  -74.185  2.082   1.00 41.91  ? 110 ILE B HG22 1 
ATOM   8550  H  HG23 . ILE B  1 130 ? 80.548  -75.541  2.848   1.00 43.07  ? 110 ILE B HG23 1 
ATOM   8551  H  HD11 . ILE B  1 130 ? 82.776  -76.652  6.920   1.00 44.85  ? 110 ILE B HD11 1 
ATOM   8552  H  HD12 . ILE B  1 130 ? 84.015  -75.883  5.908   1.00 44.48  ? 110 ILE B HD12 1 
ATOM   8553  H  HD13 . ILE B  1 130 ? 82.781  -74.882  6.707   1.00 44.43  ? 110 ILE B HD13 1 
ATOM   8554  N  N    . GLY B  1 131 ? 84.354  -76.471  1.110   1.00 35.31  ? 111 GLY B N    1 
ATOM   8555  C  CA   . GLY B  1 131 ? 84.307  -77.376  -0.028  1.00 33.13  ? 111 GLY B CA   1 
ATOM   8556  C  C    . GLY B  1 131 ? 85.072  -78.647  0.207   1.00 34.12  ? 111 GLY B C    1 
ATOM   8557  O  O    . GLY B  1 131 ? 84.662  -79.470  1.037   1.00 31.83  ? 111 GLY B O    1 
ATOM   8558  H  H    . GLY B  1 131 ? 85.237  -75.975  1.173   1.00 35.64  ? 111 GLY B H    1 
ATOM   8559  H  HA2  . GLY B  1 131 ? 83.275  -77.629  -0.265  1.00 34.59  ? 111 GLY B HA2  1 
ATOM   8560  H  HA3  . GLY B  1 131 ? 84.715  -76.879  -0.904  1.00 32.51  ? 111 GLY B HA3  1 
ATOM   8561  N  N    . ASN B  1 132 ? 86.208  -78.807  -0.500  1.00 28.69  ? 112 ASN B N    1 
ATOM   8562  C  CA   . ASN B  1 132 ? 87.068  -79.989  -0.368  1.00 29.98  ? 112 ASN B CA   1 
ATOM   8563  C  C    . ASN B  1 132 ? 87.611  -80.195  1.010   1.00 35.13  ? 112 ASN B C    1 
ATOM   8564  O  O    . ASN B  1 132 ? 87.936  -81.334  1.359   1.00 39.46  ? 112 ASN B O    1 
ATOM   8565  C  CB   . ASN B  1 132 ? 88.260  -79.921  -1.332  1.00 35.24  ? 112 ASN B CB   1 
ATOM   8566  C  CG   . ASN B  1 132 ? 87.938  -80.242  -2.756  1.00 41.45  ? 112 ASN B CG   1 
ATOM   8567  O  OD1  . ASN B  1 132 ? 86.844  -80.726  -3.091  1.00 48.84  ? 112 ASN B OD1  1 
ATOM   8568  N  ND2  . ASN B  1 132 ? 88.914  -80.043  -3.613  1.00 38.75  ? 112 ASN B ND2  1 
ATOM   8569  H  H    . ASN B  1 132 ? 86.563  -78.115  -1.152  1.00 27.46  ? 112 ASN B H    1 
ATOM   8570  H  HA   . ASN B  1 132 ? 86.469  -80.869  -0.600  1.00 31.58  ? 112 ASN B HA   1 
ATOM   8571  H  HB2  . ASN B  1 132 ? 88.688  -78.920  -1.296  1.00 35.33  ? 112 ASN B HB2  1 
ATOM   8572  H  HB3  . ASN B  1 132 ? 89.010  -80.646  -1.017  1.00 36.70  ? 112 ASN B HB3  1 
ATOM   8573  H  HD21 . ASN B  1 132 ? 88.770  -80.237  -4.600  1.00 38.77  ? 112 ASN B HD21 1 
ATOM   8574  H  HD22 . ASN B  1 132 ? 89.821  -79.718  -3.295  1.00 39.52  ? 112 ASN B HD22 1 
ATOM   8575  N  N    . ASN B  1 133 ? 87.707  -79.125  1.824   1.00 32.88  ? 113 ASN B N    1 
ATOM   8576  C  CA   . ASN B  1 133 ? 88.187  -79.269  3.189   1.00 34.37  ? 113 ASN B CA   1 
ATOM   8577  C  C    . ASN B  1 133 ? 87.271  -80.217  4.043   1.00 41.23  ? 113 ASN B C    1 
ATOM   8578  O  O    . ASN B  1 133 ? 87.739  -80.745  5.046   1.00 41.28  ? 113 ASN B O    1 
ATOM   8579  C  CB   . ASN B  1 133 ? 88.388  -77.921  3.852   1.00 39.50  ? 113 ASN B CB   1 
ATOM   8580  C  CG   . ASN B  1 133 ? 87.161  -77.051  4.075   1.00 43.88  ? 113 ASN B CG   1 
ATOM   8581  O  OD1  . ASN B  1 133 ? 86.084  -77.493  4.468   1.00 32.70  ? 113 ASN B OD1  1 
ATOM   8582  N  ND2  . ASN B  1 133 ? 87.331  -75.770  3.893   1.00 48.04  ? 113 ASN B ND2  1 
ATOM   8583  H  H    . ASN B  1 133 ? 87.515  -78.169  1.547   1.00 32.51  ? 113 ASN B H    1 
ATOM   8584  H  HA   . ASN B  1 133 ? 89.171  -79.729  3.138   1.00 35.45  ? 113 ASN B HA   1 
ATOM   8585  H  HB2  . ASN B  1 133 ? 88.876  -78.094  4.809   1.00 40.45  ? 113 ASN B HB2  1 
ATOM   8586  H  HB3  . ASN B  1 133 ? 89.070  -77.373  3.205   1.00 40.14  ? 113 ASN B HB3  1 
ATOM   8587  H  HD21 . ASN B  1 133 ? 86.549  -75.143  4.052   1.00 49.03  ? 113 ASN B HD21 1 
ATOM   8588  H  HD22 . ASN B  1 133 ? 88.231  -75.385  3.629   1.00 48.26  ? 113 ASN B HD22 1 
ATOM   8589  N  N    . GLN B  1 134 ? 86.018  -80.485  3.595   1.00 35.24  ? 114 GLN B N    1 
ATOM   8590  C  CA   . GLN B  1 134 ? 85.095  -81.393  4.277   1.00 33.67  ? 114 GLN B CA   1 
ATOM   8591  C  C    . GLN B  1 134 ? 85.350  -82.886  3.986   1.00 39.52  ? 114 GLN B C    1 
ATOM   8592  O  O    . GLN B  1 134 ? 84.718  -83.726  4.622   1.00 42.07  ? 114 GLN B O    1 
ATOM   8593  C  CB   . GLN B  1 134 ? 83.645  -81.030  3.907   1.00 34.33  ? 114 GLN B CB   1 
ATOM   8594  C  CG   . GLN B  1 134 ? 83.242  -79.643  4.382   1.00 47.57  ? 114 GLN B CG   1 
ATOM   8595  C  CD   . GLN B  1 134 ? 83.233  -79.590  5.887   1.00 47.64  ? 114 GLN B CD   1 
ATOM   8596  O  OE1  . GLN B  1 134 ? 82.412  -80.233  6.539   1.00 40.67  ? 114 GLN B OE1  1 
ATOM   8597  N  NE2  . GLN B  1 134 ? 84.200  -78.914  6.478   1.00 39.61  ? 114 GLN B NE2  1 
ATOM   8598  H  H    . GLN B  1 134 ? 85.599  -80.042  2.784   1.00 34.87  ? 114 GLN B H    1 
ATOM   8599  H  HA   . GLN B  1 134 ? 85.207  -81.268  5.351   1.00 34.47  ? 114 GLN B HA   1 
ATOM   8600  H  HB2  . GLN B  1 134 ? 83.504  -81.059  2.828   1.00 33.53  ? 114 GLN B HB2  1 
ATOM   8601  H  HB3  . GLN B  1 134 ? 82.979  -81.745  4.387   1.00 34.71  ? 114 GLN B HB3  1 
ATOM   8602  H  HG2  . GLN B  1 134 ? 83.921  -78.891  3.984   1.00 47.08  ? 114 GLN B HG2  1 
ATOM   8603  H  HG3  . GLN B  1 134 ? 82.234  -79.431  4.030   1.00 48.31  ? 114 GLN B HG3  1 
ATOM   8604  H  HE21 . GLN B  1 134 ? 84.915  -78.442  5.933   1.00 40.52  ? 114 GLN B HE21 1 
ATOM   8605  H  HE22 . GLN B  1 134 ? 84.227  -78.859  7.491   1.00 40.12  ? 114 GLN B HE22 1 
ATOM   8606  N  N    . GLY B  1 135 ? 86.260  -83.213  3.058   1.00 35.33  ? 115 GLY B N    1 
ATOM   8607  C  CA   . GLY B  1 135 ? 86.626  -84.587  2.747   1.00 34.85  ? 115 GLY B CA   1 
ATOM   8608  C  C    . GLY B  1 135 ? 88.065  -84.932  3.109   1.00 39.61  ? 115 GLY B C    1 
ATOM   8609  O  O    . GLY B  1 135 ? 88.556  -85.985  2.714   1.00 39.66  ? 115 GLY B O    1 
ATOM   8610  H  H    . GLY B  1 135 ? 86.765  -82.543  2.484   1.00 35.47  ? 115 GLY B H    1 
ATOM   8611  H  HA2  . GLY B  1 135 ? 85.983  -85.293  3.266   1.00 35.73  ? 115 GLY B HA2  1 
ATOM   8612  H  HA3  . GLY B  1 135 ? 86.503  -84.745  1.676   1.00 35.12  ? 115 GLY B HA3  1 
ATOM   8613  N  N    . MET B  1 136 ? 88.748  -84.089  3.897   1.00 35.39  ? 116 MET B N    1 
ATOM   8614  C  CA   . MET B  1 136 ? 90.143  -84.333  4.260   1.00 36.85  ? 116 MET B CA   1 
ATOM   8615  C  C    . MET B  1 136 ? 90.313  -85.581  5.120   1.00 44.27  ? 116 MET B C    1 
ATOM   8616  O  O    . MET B  1 136 ? 89.595  -85.758  6.101   1.00 45.12  ? 116 MET B O    1 
ATOM   8617  C  CB   . MET B  1 136 ? 90.704  -83.117  5.003   1.00 38.72  ? 116 MET B CB   1 
ATOM   8618  C  CG   . MET B  1 136 ? 90.821  -81.889  4.099   1.00 39.68  ? 116 MET B CG   1 
ATOM   8619  S  SD   . MET B  1 136 ? 91.294  -80.399  5.006   1.00 43.65  ? 116 MET B SD   1 
ATOM   8620  C  CE   . MET B  1 136 ? 93.027  -80.814  5.358   1.00 40.56  ? 116 MET B CE   1 
ATOM   8621  H  H    . MET B  1 136 ? 88.339  -83.277  4.348   1.00 34.14  ? 116 MET B H    1 
ATOM   8622  H  HA   . MET B  1 136 ? 90.713  -84.453  3.341   1.00 36.48  ? 116 MET B HA   1 
ATOM   8623  H  HB2  . MET B  1 136 ? 90.046  -82.859  5.831   1.00 38.81  ? 116 MET B HB2  1 
ATOM   8624  H  HB3  . MET B  1 136 ? 91.695  -83.359  5.386   1.00 38.98  ? 116 MET B HB3  1 
ATOM   8625  H  HG2  . MET B  1 136 ? 91.575  -82.089  3.342   1.00 38.34  ? 116 MET B HG2  1 
ATOM   8626  H  HG3  . MET B  1 136 ? 89.861  -81.713  3.621   1.00 38.49  ? 116 MET B HG3  1 
ATOM   8627  H  HE1  . MET B  1 136 ? 93.054  -81.537  6.172   1.00 40.23  ? 116 MET B HE1  1 
ATOM   8628  H  HE2  . MET B  1 136 ? 93.479  -81.232  4.459   1.00 40.46  ? 116 MET B HE2  1 
ATOM   8629  H  HE3  . MET B  1 136 ? 93.562  -79.914  5.652   1.00 41.45  ? 116 MET B HE3  1 
ATOM   8630  N  N    . GLY B  1 137 ? 91.254  -86.439  4.737   1.00 42.99  ? 117 GLY B N    1 
ATOM   8631  C  CA   . GLY B  1 137 ? 91.504  -87.693  5.452   1.00 43.91  ? 117 GLY B CA   1 
ATOM   8632  C  C    . GLY B  1 137 ? 92.135  -87.526  6.829   1.00 47.27  ? 117 GLY B C    1 
ATOM   8633  O  O    . GLY B  1 137 ? 91.990  -88.401  7.677   1.00 44.08  ? 117 GLY B O    1 
ATOM   8634  H  H    . GLY B  1 137 ? 91.862  -86.310  3.935   1.00 42.83  ? 117 GLY B H    1 
ATOM   8635  H  HA2  . GLY B  1 137 ? 90.562  -88.225  5.584   1.00 43.93  ? 117 GLY B HA2  1 
ATOM   8636  H  HA3  . GLY B  1 137 ? 92.157  -88.325  4.853   1.00 43.65  ? 117 GLY B HA3  1 
ATOM   8637  N  N    . ASP B  1 138 ? 92.842  -86.407  7.064   1.00 44.12  ? 118 ASP B N    1 
ATOM   8638  C  CA   . ASP B  1 138 ? 93.547  -86.141  8.320   1.00 45.64  ? 118 ASP B CA   1 
ATOM   8639  C  C    . ASP B  1 138 ? 92.727  -85.272  9.297   1.00 48.93  ? 118 ASP B C    1 
ATOM   8640  O  O    . ASP B  1 138 ? 93.245  -84.904  10.353  1.00 47.81  ? 118 ASP B O    1 
ATOM   8641  C  CB   . ASP B  1 138 ? 94.913  -85.470  8.048   1.00 48.34  ? 118 ASP B CB   1 
ATOM   8642  C  CG   . ASP B  1 138 ? 94.876  -84.172  7.220   1.00 57.64  ? 118 ASP B CG   1 
ATOM   8643  O  OD1  . ASP B  1 138 ? 93.967  -84.036  6.351   1.00 58.82  ? 118 ASP B OD1  1 
ATOM   8644  O  OD2  . ASP B  1 138 ? 95.808  -83.352  7.361   1.00 58.37  ? 118 ASP B OD2  1 
ATOM   8645  H  H    . ASP B  1 138 ? 92.932  -85.660  6.385   1.00 43.49  ? 118 ASP B H    1 
ATOM   8646  H  HA   . ASP B  1 138 ? 93.758  -87.079  8.828   1.00 46.79  ? 118 ASP B HA   1 
ATOM   8647  H  HB2  . ASP B  1 138 ? 95.389  -85.263  9.006   1.00 47.88  ? 118 ASP B HB2  1 
ATOM   8648  H  HB3  . ASP B  1 138 ? 95.524  -86.180  7.493   1.00 48.78  ? 118 ASP B HB3  1 
ATOM   8649  N  N    . VAL B  1 139 ? 91.468  -84.944  8.955   1.00 44.41  ? 119 VAL B N    1 
ATOM   8650  C  CA   . VAL B  1 139 ? 90.595  -84.123  9.792   1.00 41.41  ? 119 VAL B CA   1 
ATOM   8651  C  C    . VAL B  1 139 ? 89.442  -85.001  10.249  1.00 43.65  ? 119 VAL B C    1 
ATOM   8652  O  O    . VAL B  1 139 ? 88.808  -85.642  9.401   1.00 41.25  ? 119 VAL B O    1 
ATOM   8653  C  CB   . VAL B  1 139 ? 90.104  -82.870  9.002   1.00 40.97  ? 119 VAL B CB   1 
ATOM   8654  C  CG1  . VAL B  1 139 ? 89.058  -82.087  9.804   1.00 40.83  ? 119 VAL B CG1  1 
ATOM   8655  C  CG2  . VAL B  1 139 ? 91.275  -81.973  8.642   1.00 40.00  ? 119 VAL B CG2  1 
ATOM   8656  H  H    . VAL B  1 139 ? 91.004  -85.216  8.093   1.00 45.15  ? 119 VAL B H    1 
ATOM   8657  H  HA   . VAL B  1 139 ? 91.124  -83.769  10.675  1.00 41.09  ? 119 VAL B HA   1 
ATOM   8658  H  HB   . VAL B  1 139 ? 89.631  -83.198  8.079   1.00 39.27  ? 119 VAL B HB   1 
ATOM   8659  H  HG11 . VAL B  1 139 ? 88.991  -81.074  9.412   1.00 40.27  ? 119 VAL B HG11 1 
ATOM   8660  H  HG12 . VAL B  1 139 ? 88.090  -82.573  9.705   1.00 40.84  ? 119 VAL B HG12 1 
ATOM   8661  H  HG13 . VAL B  1 139 ? 89.355  -82.062  10.852  1.00 41.80  ? 119 VAL B HG13 1 
ATOM   8662  H  HG21 . VAL B  1 139 ? 90.926  -81.169  7.995   1.00 39.64  ? 119 VAL B HG21 1 
ATOM   8663  H  HG22 . VAL B  1 139 ? 91.671  -81.549  9.563   1.00 40.29  ? 119 VAL B HG22 1 
ATOM   8664  H  HG23 . VAL B  1 139 ? 92.048  -82.548  8.133   1.00 40.31  ? 119 VAL B HG23 1 
ATOM   8665  N  N    . GLU B  1 140 ? 89.157  -85.027  11.568  1.00 40.74  ? 120 GLU B N    1 
ATOM   8666  C  CA   . GLU B  1 140 ? 88.011  -85.778  12.070  1.00 40.76  ? 120 GLU B CA   1 
ATOM   8667  C  C    . GLU B  1 140 ? 86.734  -85.045  11.657  1.00 42.85  ? 120 GLU B C    1 
ATOM   8668  O  O    . GLU B  1 140 ? 85.831  -85.645  11.067  1.00 41.68  ? 120 GLU B O    1 
ATOM   8669  C  CB   . GLU B  1 140 ? 88.077  -85.971  13.580  1.00 43.27  ? 120 GLU B CB   1 
ATOM   8670  C  CG   . GLU B  1 140 ? 87.182  -87.112  14.052  1.00 55.58  ? 120 GLU B CG   1 
ATOM   8671  C  CD   . GLU B  1 140 ? 87.337  -87.428  15.528  1.00 81.54  ? 120 GLU B CD   1 
ATOM   8672  O  OE1  . GLU B  1 140 ? 88.476  -87.723  15.956  1.00 78.99  ? 120 GLU B OE1  1 
ATOM   8673  O  OE2  . GLU B  1 140 ? 86.320  -87.393  16.258  1.00 72.44  ? 120 GLU B OE2  1 
ATOM   8674  H  H    . GLU B  1 140 ? 89.680  -84.536  12.286  1.00 41.12  ? 120 GLU B H    1 
ATOM   8675  H  HA   . GLU B  1 140 ? 88.003  -86.767  11.613  1.00 40.92  ? 120 GLU B HA   1 
ATOM   8676  H  HB2  . GLU B  1 140 ? 89.101  -86.211  13.862  1.00 43.61  ? 120 GLU B HB2  1 
ATOM   8677  H  HB3  . GLU B  1 140 ? 87.754  -85.056  14.075  1.00 42.39  ? 120 GLU B HB3  1 
ATOM   8678  H  HG2  . GLU B  1 140 ? 86.142  -86.846  13.871  1.00 54.68  ? 120 GLU B HG2  1 
ATOM   8679  H  HG3  . GLU B  1 140 ? 87.427  -88.014  13.493  1.00 54.95  ? 120 GLU B HG3  1 
ATOM   8680  N  N    . TYR B  1 141 ? 86.699  -83.726  11.889  1.00 37.61  ? 121 TYR B N    1 
ATOM   8681  C  CA   . TYR B  1 141 ? 85.559  -82.882  11.513  1.00 34.66  ? 121 TYR B CA   1 
ATOM   8682  C  C    . TYR B  1 141 ? 85.945  -81.419  11.568  1.00 38.61  ? 121 TYR B C    1 
ATOM   8683  O  O    . TYR B  1 141 ? 86.900  -81.065  12.253  1.00 38.26  ? 121 TYR B O    1 
ATOM   8684  C  CB   . TYR B  1 141 ? 84.341  -83.151  12.436  1.00 35.44  ? 121 TYR B CB   1 
ATOM   8685  C  CG   . TYR B  1 141 ? 84.619  -83.026  13.917  1.00 36.92  ? 121 TYR B CG   1 
ATOM   8686  C  CD1  . TYR B  1 141 ? 84.722  -81.773  14.526  1.00 38.12  ? 121 TYR B CD1  1 
ATOM   8687  C  CD2  . TYR B  1 141 ? 84.710  -84.156  14.730  1.00 37.80  ? 121 TYR B CD2  1 
ATOM   8688  C  CE1  . TYR B  1 141 ? 84.970  -81.649  15.879  1.00 36.45  ? 121 TYR B CE1  1 
ATOM   8689  C  CE2  . TYR B  1 141 ? 84.943  -84.041  16.100  1.00 40.09  ? 121 TYR B CE2  1 
ATOM   8690  C  CZ   . TYR B  1 141 ? 85.049  -82.782  16.673  1.00 47.22  ? 121 TYR B CZ   1 
ATOM   8691  O  OH   . TYR B  1 141 ? 85.283  -82.628  18.009  1.00 49.30  ? 121 TYR B OH   1 
ATOM   8692  H  H    . TYR B  1 141 ? 87.438  -83.218  12.364  1.00 39.08  ? 121 TYR B H    1 
ATOM   8693  H  HA   . TYR B  1 141 ? 85.268  -83.112  10.489  1.00 34.58  ? 121 TYR B HA   1 
ATOM   8694  H  HB2  . TYR B  1 141 ? 83.561  -82.441  12.174  1.00 35.12  ? 121 TYR B HB2  1 
ATOM   8695  H  HB3  . TYR B  1 141 ? 83.972  -84.160  12.254  1.00 36.06  ? 121 TYR B HB3  1 
ATOM   8696  H  HD1  . TYR B  1 141 ? 84.634  -80.869  13.926  1.00 37.44  ? 121 TYR B HD1  1 
ATOM   8697  H  HD2  . TYR B  1 141 ? 84.616  -85.147  14.290  1.00 36.69  ? 121 TYR B HD2  1 
ATOM   8698  H  HE1  . TYR B  1 141 ? 85.050  -80.661  16.329  1.00 37.23  ? 121 TYR B HE1  1 
ATOM   8699  H  HE2  . TYR B  1 141 ? 85.031  -84.936  16.714  1.00 39.80  ? 121 TYR B HE2  1 
ATOM   8700  H  HH   . TYR B  1 141 ? 85.067  -83.457  18.511  1.00 50.36  ? 121 TYR B HH   1 
ATOM   8701  N  N    . ALA B  1 142 ? 85.200  -80.578  10.838  1.00 36.37  ? 122 ALA B N    1 
ATOM   8702  C  CA   . ALA B  1 142 ? 85.362  -79.115  10.821  1.00 36.07  ? 122 ALA B CA   1 
ATOM   8703  C  C    . ALA B  1 142 ? 84.066  -78.473  10.381  1.00 38.03  ? 122 ALA B C    1 
ATOM   8704  O  O    . ALA B  1 142 ? 83.528  -78.838  9.333   1.00 36.56  ? 122 ALA B O    1 
ATOM   8705  C  CB   . ALA B  1 142 ? 86.491  -78.696  9.902   1.00 36.34  ? 122 ALA B CB   1 
ATOM   8706  H  H    . ALA B  1 142 ? 84.463  -80.904  10.223  1.00 35.15  ? 122 ALA B H    1 
ATOM   8707  H  HA   . ALA B  1 142 ? 85.613  -78.777  11.823  1.00 36.18  ? 122 ALA B HA   1 
ATOM   8708  H  HB1  . ALA B  1 142 ? 86.671  -77.628  10.013  1.00 34.44  ? 122 ALA B HB1  1 
ATOM   8709  H  HB2  . ALA B  1 142 ? 87.390  -79.258  10.155  1.00 37.59  ? 122 ALA B HB2  1 
ATOM   8710  H  HB3  . ALA B  1 142 ? 86.196  -78.922  8.878   1.00 37.42  ? 122 ALA B HB3  1 
ATOM   8711  N  N    . LYS B  1 143 ? 83.534  -77.564  11.192  1.00 34.77  ? 123 LYS B N    1 
ATOM   8712  C  CA   . LYS B  1 143 ? 82.261  -76.898  10.932  1.00 33.95  ? 123 LYS B CA   1 
ATOM   8713  C  C    . LYS B  1 143 ? 82.450  -75.416  11.065  1.00 36.99  ? 123 LYS B C    1 
ATOM   8714  O  O    . LYS B  1 143 ? 83.068  -74.990  12.021  1.00 36.93  ? 123 LYS B O    1 
ATOM   8715  C  CB   . LYS B  1 143 ? 81.206  -77.402  11.944  1.00 36.98  ? 123 LYS B CB   1 
ATOM   8716  C  CG   . LYS B  1 143 ? 79.807  -76.812  11.781  1.00 31.46  ? 123 LYS B CG   1 
ATOM   8717  C  CD   . LYS B  1 143 ? 78.828  -77.563  12.665  1.00 35.44  ? 123 LYS B CD   1 
ATOM   8718  C  CE   . LYS B  1 143 ? 77.408  -77.396  12.203  1.00 35.88  ? 123 LYS B CE   1 
ATOM   8719  N  NZ   . LYS B  1 143 ? 76.470  -78.234  12.990  1.00 42.10  ? 123 LYS B NZ   1 
ATOM   8720  H  H    . LYS B  1 143 ? 83.959  -77.258  12.062  1.00 35.97  ? 123 LYS B H    1 
ATOM   8721  H  HA   . LYS B  1 143 ? 81.902  -77.130  9.931   1.00 32.17  ? 123 LYS B HA   1 
ATOM   8722  H  HB2  . LYS B  1 143 ? 81.111  -78.473  11.783  1.00 36.84  ? 123 LYS B HB2  1 
ATOM   8723  H  HB3  . LYS B  1 143 ? 81.552  -77.204  12.955  1.00 36.04  ? 123 LYS B HB3  1 
ATOM   8724  H  HG2  . LYS B  1 143 ? 79.809  -75.762  12.069  1.00 31.45  ? 123 LYS B HG2  1 
ATOM   8725  H  HG3  . LYS B  1 143 ? 79.495  -76.918  10.743  1.00 31.85  ? 123 LYS B HG3  1 
ATOM   8726  H  HD2  . LYS B  1 143 ? 79.054  -78.627  12.661  1.00 35.27  ? 123 LYS B HD2  1 
ATOM   8727  H  HD3  . LYS B  1 143 ? 78.901  -77.175  13.681  1.00 36.00  ? 123 LYS B HD3  1 
ATOM   8728  H  HE2  . LYS B  1 143 ? 77.118  -76.353  12.318  1.00 36.48  ? 123 LYS B HE2  1 
ATOM   8729  H  HE3  . LYS B  1 143 ? 77.334  -77.692  11.160  1.00 35.96  ? 123 LYS B HE3  1 
ATOM   8730  H  HZ1  . LYS B  1 143 ? 76.531  -79.202  12.693  1.00 43.02  ? 123 LYS B HZ1  1 
ATOM   8731  H  HZ2  . LYS B  1 143 ? 76.703  -78.181  13.977  1.00 42.85  ? 123 LYS B HZ2  1 
ATOM   8732  H  HZ3  . LYS B  1 143 ? 75.521  -77.902  12.861  1.00 41.57  ? 123 LYS B HZ3  1 
ATOM   8733  N  N    . MET B  1 144 ? 81.944  -74.631  10.101  1.00 34.17  ? 124 MET B N    1 
ATOM   8734  C  CA   . MET B  1 144 ? 82.035  -73.179  10.155  1.00 34.04  ? 124 MET B CA   1 
ATOM   8735  C  C    . MET B  1 144 ? 80.901  -72.624  11.042  1.00 38.30  ? 124 MET B C    1 
ATOM   8736  O  O    . MET B  1 144 ? 79.726  -72.979  10.859  1.00 35.13  ? 124 MET B O    1 
ATOM   8737  C  CB   . MET B  1 144 ? 81.981  -72.578  8.749   1.00 35.57  ? 124 MET B CB   1 
ATOM   8738  C  CG   . MET B  1 144 ? 82.329  -71.086  8.732   1.00 39.71  ? 124 MET B CG   1 
ATOM   8739  S  SD   . MET B  1 144 ? 81.943  -70.271  7.196   1.00 42.58  ? 124 MET B SD   1 
ATOM   8740  C  CE   . MET B  1 144 ? 82.972  -71.102  6.155   1.00 40.35  ? 124 MET B CE   1 
ATOM   8741  H  H    . MET B  1 144 ? 81.454  -74.980  9.283   1.00 32.78  ? 124 MET B H    1 
ATOM   8742  H  HA   . MET B  1 144 ? 83.001  -72.902  10.573  1.00 35.17  ? 124 MET B HA   1 
ATOM   8743  H  HB2  . MET B  1 144 ? 82.711  -73.102  8.135   1.00 34.19  ? 124 MET B HB2  1 
ATOM   8744  H  HB3  . MET B  1 144 ? 80.979  -72.704  8.345   1.00 34.28  ? 124 MET B HB3  1 
ATOM   8745  H  HG2  . MET B  1 144 ? 81.774  -70.563  9.509   1.00 40.54  ? 124 MET B HG2  1 
ATOM   8746  H  HG3  . MET B  1 144 ? 83.398  -70.970  8.906   1.00 41.36  ? 124 MET B HG3  1 
ATOM   8747  H  HE1  . MET B  1 144 ? 83.135  -70.436  5.310   1.00 42.20  ? 124 MET B HE1  1 
ATOM   8748  H  HE2  . MET B  1 144 ? 83.914  -71.310  6.659   1.00 40.73  ? 124 MET B HE2  1 
ATOM   8749  H  HE3  . MET B  1 144 ? 82.499  -72.024  5.821   1.00 39.93  ? 124 MET B HE3  1 
ATOM   8750  N  N    . TYR B  1 145 ? 81.271  -71.782  12.024  1.00 37.79  ? 125 TYR B N    1 
ATOM   8751  C  CA   . TYR B  1 145 ? 80.332  -71.153  12.972  1.00 36.76  ? 125 TYR B CA   1 
ATOM   8752  C  C    . TYR B  1 145 ? 80.069  -69.694  12.643  1.00 41.62  ? 125 TYR B C    1 
ATOM   8753  O  O    . TYR B  1 145 ? 79.049  -69.149  13.067  1.00 44.36  ? 125 TYR B O    1 
ATOM   8754  C  CB   . TYR B  1 145 ? 80.869  -71.272  14.412  1.00 37.36  ? 125 TYR B CB   1 
ATOM   8755  C  CG   . TYR B  1 145 ? 80.498  -72.589  15.057  1.00 40.05  ? 125 TYR B CG   1 
ATOM   8756  C  CD1  . TYR B  1 145 ? 81.034  -73.786  14.596  1.00 40.98  ? 125 TYR B CD1  1 
ATOM   8757  C  CD2  . TYR B  1 145 ? 79.551  -72.648  16.074  1.00 41.54  ? 125 TYR B CD2  1 
ATOM   8758  C  CE1  . TYR B  1 145 ? 80.670  -75.005  15.157  1.00 40.25  ? 125 TYR B CE1  1 
ATOM   8759  C  CE2  . TYR B  1 145 ? 79.181  -73.861  16.649  1.00 42.84  ? 125 TYR B CE2  1 
ATOM   8760  C  CZ   . TYR B  1 145 ? 79.733  -75.043  16.175  1.00 48.98  ? 125 TYR B CZ   1 
ATOM   8761  O  OH   . TYR B  1 145 ? 79.363  -76.257  16.715  1.00 49.92  ? 125 TYR B OH   1 
ATOM   8762  H  H    . TYR B  1 145 ? 82.237  -71.528  12.201  1.00 38.40  ? 125 TYR B H    1 
ATOM   8763  H  HA   . TYR B  1 145 ? 79.368  -71.660  12.943  1.00 36.65  ? 125 TYR B HA   1 
ATOM   8764  H  HB2  . TYR B  1 145 ? 81.955  -71.192  14.410  1.00 37.35  ? 125 TYR B HB2  1 
ATOM   8765  H  HB3  . TYR B  1 145 ? 80.449  -70.476  15.026  1.00 36.78  ? 125 TYR B HB3  1 
ATOM   8766  H  HD1  . TYR B  1 145 ? 81.779  -73.759  13.802  1.00 41.07  ? 125 TYR B HD1  1 
ATOM   8767  H  HD2  . TYR B  1 145 ? 79.087  -71.733  16.436  1.00 41.25  ? 125 TYR B HD2  1 
ATOM   8768  H  HE1  . TYR B  1 145 ? 81.114  -75.929  14.791  1.00 40.04  ? 125 TYR B HE1  1 
ATOM   8769  H  HE2  . TYR B  1 145 ? 78.431  -73.878  17.438  1.00 42.51  ? 125 TYR B HE2  1 
ATOM   8770  H  HH   . TYR B  1 145 ? 78.443  -76.221  17.086  1.00 49.45  ? 125 TYR B HH   1 
ATOM   8771  N  N    . ASP B  1 146 ? 80.989  -69.039  11.937  1.00 38.38  ? 126 ASP B N    1 
ATOM   8772  C  CA   . ASP B  1 146 ? 80.814  -67.624  11.598  1.00 37.31  ? 126 ASP B CA   1 
ATOM   8773  C  C    . ASP B  1 146 ? 81.754  -67.245  10.478  1.00 39.62  ? 126 ASP B C    1 
ATOM   8774  O  O    . ASP B  1 146 ? 82.743  -67.923  10.247  1.00 39.55  ? 126 ASP B O    1 
ATOM   8775  C  CB   . ASP B  1 146 ? 81.078  -66.739  12.856  1.00 39.46  ? 126 ASP B CB   1 
ATOM   8776  C  CG   . ASP B  1 146 ? 80.406  -65.368  12.877  1.00 44.77  ? 126 ASP B CG   1 
ATOM   8777  O  OD1  . ASP B  1 146 ? 79.866  -64.949  11.827  1.00 47.74  ? 126 ASP B OD1  1 
ATOM   8778  O  OD2  . ASP B  1 146 ? 80.466  -64.688  13.939  1.00 40.52  ? 126 ASP B OD2  1 
ATOM   8779  H  H    . ASP B  1 146 ? 81.863  -69.428  11.599  1.00 37.40  ? 126 ASP B H    1 
ATOM   8780  H  HA   . ASP B  1 146 ? 79.794  -67.457  11.257  1.00 37.63  ? 126 ASP B HA   1 
ATOM   8781  H  HB2  . ASP B  1 146 ? 80.733  -67.260  13.746  1.00 38.70  ? 126 ASP B HB2  1 
ATOM   8782  H  HB3  . ASP B  1 146 ? 82.153  -66.580  12.933  1.00 39.73  ? 126 ASP B HB3  1 
ATOM   8783  N  N    . PHE B  1 147 ? 81.436  -66.159  9.791   1.00 36.09  ? 127 PHE B N    1 
ATOM   8784  C  CA   . PHE B  1 147 ? 82.281  -65.580  8.749   1.00 36.40  ? 127 PHE B CA   1 
ATOM   8785  C  C    . PHE B  1 147 ? 82.104  -64.066  8.733   1.00 41.83  ? 127 PHE B C    1 
ATOM   8786  O  O    . PHE B  1 147 ? 81.066  -63.558  9.157   1.00 41.43  ? 127 PHE B O    1 
ATOM   8787  C  CB   . PHE B  1 147 ? 82.039  -66.195  7.352   1.00 36.07  ? 127 PHE B CB   1 
ATOM   8788  C  CG   . PHE B  1 147 ? 80.697  -65.923  6.722   1.00 35.67  ? 127 PHE B CG   1 
ATOM   8789  C  CD1  . PHE B  1 147 ? 79.620  -66.774  6.942   1.00 36.16  ? 127 PHE B CD1  1 
ATOM   8790  C  CD2  . PHE B  1 147 ? 80.525  -64.850  5.856   1.00 38.02  ? 127 PHE B CD2  1 
ATOM   8791  C  CE1  . PHE B  1 147 ? 78.382  -66.525  6.346   1.00 37.06  ? 127 PHE B CE1  1 
ATOM   8792  C  CE2  . PHE B  1 147 ? 79.293  -64.611  5.252   1.00 40.56  ? 127 PHE B CE2  1 
ATOM   8793  C  CZ   . PHE B  1 147 ? 78.232  -65.461  5.490   1.00 37.49  ? 127 PHE B CZ   1 
ATOM   8794  H  H    . PHE B  1 147 ? 80.573  -65.647  9.941   1.00 35.63  ? 127 PHE B H    1 
ATOM   8795  H  HA   . PHE B  1 147 ? 83.313  -65.780  9.026   1.00 38.33  ? 127 PHE B HA   1 
ATOM   8796  H  HB2  . PHE B  1 147 ? 82.796  -65.798  6.678   1.00 35.39  ? 127 PHE B HB2  1 
ATOM   8797  H  HB3  . PHE B  1 147 ? 82.152  -67.275  7.425   1.00 36.59  ? 127 PHE B HB3  1 
ATOM   8798  H  HD1  . PHE B  1 147 ? 79.724  -67.626  7.614   1.00 35.59  ? 127 PHE B HD1  1 
ATOM   8799  H  HD2  . PHE B  1 147 ? 81.359  -64.178  5.657   1.00 38.00  ? 127 PHE B HD2  1 
ATOM   8800  H  HE1  . PHE B  1 147 ? 77.533  -67.177  6.546   1.00 37.25  ? 127 PHE B HE1  1 
ATOM   8801  H  HE2  . PHE B  1 147 ? 79.173  -63.753  4.592   1.00 40.14  ? 127 PHE B HE2  1 
ATOM   8802  H  HZ   . PHE B  1 147 ? 77.265  -65.266  5.031   1.00 37.52  ? 127 PHE B HZ   1 
ATOM   8803  N  N    . TYR B  1 148 ? 83.153  -63.357  8.326   1.00 39.90  ? 128 TYR B N    1 
ATOM   8804  C  CA   . TYR B  1 148 ? 83.152  -61.906  8.203   1.00 40.11  ? 128 TYR B CA   1 
ATOM   8805  C  C    . TYR B  1 148 ? 83.361  -61.534  6.740   1.00 40.18  ? 128 TYR B C    1 
ATOM   8806  O  O    . TYR B  1 148 ? 84.306  -62.003  6.124   1.00 37.03  ? 128 TYR B O    1 
ATOM   8807  C  CB   . TYR B  1 148 ? 84.250  -61.269  9.076   1.00 42.62  ? 128 TYR B CB   1 
ATOM   8808  C  CG   . TYR B  1 148 ? 84.351  -59.780  8.850   1.00 44.21  ? 128 TYR B CG   1 
ATOM   8809  C  CD1  . TYR B  1 148 ? 83.372  -58.915  9.332   1.00 45.24  ? 128 TYR B CD1  1 
ATOM   8810  C  CD2  . TYR B  1 148 ? 85.369  -59.242  8.067   1.00 45.17  ? 128 TYR B CD2  1 
ATOM   8811  C  CE1  . TYR B  1 148 ? 83.400  -57.553  9.040   1.00 41.85  ? 128 TYR B CE1  1 
ATOM   8812  C  CE2  . TYR B  1 148 ? 85.419  -57.876  7.787   1.00 46.07  ? 128 TYR B CE2  1 
ATOM   8813  C  CZ   . TYR B  1 148 ? 84.431  -57.035  8.275   1.00 49.19  ? 128 TYR B CZ   1 
ATOM   8814  O  OH   . TYR B  1 148 ? 84.439  -55.692  7.962   1.00 52.76  ? 128 TYR B OH   1 
ATOM   8815  H  H    . TYR B  1 148 ? 84.041  -63.773  8.063   1.00 40.47  ? 128 TYR B H    1 
ATOM   8816  H  HA   . TYR B  1 148 ? 82.203  -61.489  8.537   1.00 40.11  ? 128 TYR B HA   1 
ATOM   8817  H  HB2  . TYR B  1 148 ? 84.019  -61.442  10.124  1.00 42.26  ? 128 TYR B HB2  1 
ATOM   8818  H  HB3  . TYR B  1 148 ? 85.207  -61.716  8.811   1.00 43.50  ? 128 TYR B HB3  1 
ATOM   8819  H  HD1  . TYR B  1 148 ? 82.542  -59.319  9.909   1.00 45.89  ? 128 TYR B HD1  1 
ATOM   8820  H  HD2  . TYR B  1 148 ? 86.141  -59.895  7.664   1.00 44.30  ? 128 TYR B HD2  1 
ATOM   8821  H  HE1  . TYR B  1 148 ? 82.617  -56.903  9.427   1.00 41.54  ? 128 TYR B HE1  1 
ATOM   8822  H  HE2  . TYR B  1 148 ? 86.232  -57.482  7.179   1.00 46.74  ? 128 TYR B HE2  1 
ATOM   8823  H  HH   . TYR B  1 148 ? 85.299  -55.410  7.554   1.00 52.68  ? 128 TYR B HH   1 
ATOM   8824  N  N    . VAL B  1 149 ? 82.534  -60.634  6.212   1.00 38.65  ? 129 VAL B N    1 
ATOM   8825  C  CA   . VAL B  1 149 ? 82.665  -60.203  4.829   1.00 38.88  ? 129 VAL B CA   1 
ATOM   8826  C  C    . VAL B  1 149 ? 82.976  -58.687  4.854   1.00 39.26  ? 129 VAL B C    1 
ATOM   8827  O  O    . VAL B  1 149 ? 82.210  -57.900  5.410   1.00 36.34  ? 129 VAL B O    1 
ATOM   8828  C  CB   . VAL B  1 149 ? 81.445  -60.626  3.948   1.00 44.16  ? 129 VAL B CB   1 
ATOM   8829  C  CG1  . VAL B  1 149 ? 80.116  -60.277  4.590   1.00 45.28  ? 129 VAL B CG1  1 
ATOM   8830  C  CG2  . VAL B  1 149 ? 81.535  -60.042  2.550   1.00 45.05  ? 129 VAL B CG2  1 
ATOM   8831  H  H    . VAL B  1 149 ? 81.799  -60.159  6.727   1.00 39.32  ? 129 VAL B H    1 
ATOM   8832  H  HA   . VAL B  1 149 ? 83.511  -60.714  4.374   1.00 39.96  ? 129 VAL B HA   1 
ATOM   8833  H  HB   . VAL B  1 149 ? 81.466  -61.709  3.834   1.00 42.69  ? 129 VAL B HB   1 
ATOM   8834  H  HG11 . VAL B  1 149 ? 79.326  -60.514  3.880   1.00 45.62  ? 129 VAL B HG11 1 
ATOM   8835  H  HG12 . VAL B  1 149 ? 79.976  -60.871  5.493   1.00 45.32  ? 129 VAL B HG12 1 
ATOM   8836  H  HG13 . VAL B  1 149 ? 80.089  -59.214  4.825   1.00 45.88  ? 129 VAL B HG13 1 
ATOM   8837  H  HG21 . VAL B  1 149 ? 81.114  -60.746  1.834   1.00 44.39  ? 129 VAL B HG21 1 
ATOM   8838  H  HG22 . VAL B  1 149 ? 80.970  -59.114  2.537   1.00 45.77  ? 129 VAL B HG22 1 
ATOM   8839  H  HG23 . VAL B  1 149 ? 82.577  -59.837  2.315   1.00 46.52  ? 129 VAL B HG23 1 
ATOM   8840  N  N    . PRO B  1 150 ? 84.168  -58.281  4.355   1.00 37.35  ? 130 PRO B N    1 
ATOM   8841  C  CA   . PRO B  1 150 ? 84.506  -56.849  4.360   1.00 37.87  ? 130 PRO B CA   1 
ATOM   8842  C  C    . PRO B  1 150 ? 83.701  -56.052  3.313   1.00 40.34  ? 130 PRO B C    1 
ATOM   8843  O  O    . PRO B  1 150 ? 83.141  -56.652  2.399   1.00 37.25  ? 130 PRO B O    1 
ATOM   8844  C  CB   . PRO B  1 150 ? 86.008  -56.849  4.025   1.00 39.86  ? 130 PRO B CB   1 
ATOM   8845  C  CG   . PRO B  1 150 ? 86.191  -58.041  3.143   1.00 43.45  ? 130 PRO B CG   1 
ATOM   8846  C  CD   . PRO B  1 150 ? 85.206  -59.073  3.650   1.00 39.07  ? 130 PRO B CD   1 
ATOM   8847  H  HA   . PRO B  1 150 ? 84.352  -56.441  5.357   1.00 38.08  ? 130 PRO B HA   1 
ATOM   8848  H  HB2  . PRO B  1 150 ? 86.287  -55.932  3.511   1.00 38.95  ? 130 PRO B HB2  1 
ATOM   8849  H  HB3  . PRO B  1 150 ? 86.578  -56.963  4.945   1.00 40.27  ? 130 PRO B HB3  1 
ATOM   8850  H  HG2  . PRO B  1 150 ? 85.965  -57.765  2.116   1.00 42.46  ? 130 PRO B HG2  1 
ATOM   8851  H  HG3  . PRO B  1 150 ? 87.210  -58.417  3.222   1.00 43.04  ? 130 PRO B HG3  1 
ATOM   8852  H  HD2  . PRO B  1 150 ? 84.788  -59.612  2.801   1.00 38.27  ? 130 PRO B HD2  1 
ATOM   8853  H  HD3  . PRO B  1 150 ? 85.688  -59.754  4.349   1.00 39.31  ? 130 PRO B HD3  1 
ATOM   8854  N  N    . PRO B  1 151 ? 83.677  -54.699  3.406   1.00 39.90  ? 131 PRO B N    1 
ATOM   8855  C  CA   . PRO B  1 151 ? 82.900  -53.893  2.436   1.00 38.96  ? 131 PRO B CA   1 
ATOM   8856  C  C    . PRO B  1 151 ? 83.185  -54.160  0.959   1.00 41.49  ? 131 PRO B C    1 
ATOM   8857  O  O    . PRO B  1 151 ? 82.237  -54.263  0.185   1.00 39.47  ? 131 PRO B O    1 
ATOM   8858  C  CB   . PRO B  1 151 ? 83.290  -52.457  2.791   1.00 41.26  ? 131 PRO B CB   1 
ATOM   8859  C  CG   . PRO B  1 151 ? 83.592  -52.505  4.240   1.00 46.36  ? 131 PRO B CG   1 
ATOM   8860  C  CD   . PRO B  1 151 ? 84.270  -53.834  4.451   1.00 42.57  ? 131 PRO B CD   1 
ATOM   8861  H  HA   . PRO B  1 151 ? 81.836  -54.035  2.614   1.00 39.81  ? 131 PRO B HA   1 
ATOM   8862  H  HB2  . PRO B  1 151 ? 84.178  -52.165  2.233   1.00 40.96  ? 131 PRO B HB2  1 
ATOM   8863  H  HB3  . PRO B  1 151 ? 82.466  -51.775  2.586   1.00 41.27  ? 131 PRO B HB3  1 
ATOM   8864  H  HG2  . PRO B  1 151 ? 84.255  -51.686  4.510   1.00 45.62  ? 131 PRO B HG2  1 
ATOM   8865  H  HG3  . PRO B  1 151 ? 82.665  -52.460  4.809   1.00 46.67  ? 131 PRO B HG3  1 
ATOM   8866  H  HD2  . PRO B  1 151 ? 85.346  -53.739  4.315   1.00 43.57  ? 131 PRO B HD2  1 
ATOM   8867  H  HD3  . PRO B  1 151 ? 84.026  -54.209  5.443   1.00 43.34  ? 131 PRO B HD3  1 
ATOM   8868  N  N    . ALA B  1 152 ? 84.474  -54.282  0.562   1.00 39.86  ? 132 ALA B N    1 
ATOM   8869  C  CA   . ALA B  1 152 ? 84.838  -54.497  -0.840  1.00 40.13  ? 132 ALA B CA   1 
ATOM   8870  C  C    . ALA B  1 152 ? 84.233  -55.791  -1.426  1.00 42.68  ? 132 ALA B C    1 
ATOM   8871  O  O    . ALA B  1 152 ? 84.017  -55.854  -2.620  1.00 39.48  ? 132 ALA B O    1 
ATOM   8872  C  CB   . ALA B  1 152 ? 86.345  -54.521  -1.005  1.00 41.63  ? 132 ALA B CB   1 
ATOM   8873  H  H    . ALA B  1 152 ? 85.263  -54.238  1.198   1.00 40.83  ? 132 ALA B H    1 
ATOM   8874  H  HA   . ALA B  1 152 ? 84.459  -53.658  -1.418  1.00 37.79  ? 132 ALA B HA   1 
ATOM   8875  H  HB1  . ALA B  1 152 ? 86.582  -54.776  -2.038  1.00 39.93  ? 132 ALA B HB1  1 
ATOM   8876  H  HB2  . ALA B  1 152 ? 86.740  -53.536  -0.766  1.00 40.95  ? 132 ALA B HB2  1 
ATOM   8877  H  HB3  . ALA B  1 152 ? 86.766  -55.273  -0.339  1.00 42.22  ? 132 ALA B HB3  1 
ATOM   8878  N  N    . TYR B  1 153 ? 83.955  -56.800  -0.596  1.00 40.53  ? 133 TYR B N    1 
ATOM   8879  C  CA   . TYR B  1 153 ? 83.357  -58.029  -1.064  1.00 38.77  ? 133 TYR B CA   1 
ATOM   8880  C  C    . TYR B  1 153 ? 81.834  -57.989  -0.844  1.00 41.23  ? 133 TYR B C    1 
ATOM   8881  O  O    . TYR B  1 153 ? 81.076  -58.351  -1.752  1.00 39.49  ? 133 TYR B O    1 
ATOM   8882  C  CB   . TYR B  1 153 ? 84.030  -59.218  -0.356  1.00 40.34  ? 133 TYR B CB   1 
ATOM   8883  C  CG   . TYR B  1 153 ? 83.651  -60.591  -0.891  1.00 40.38  ? 133 TYR B CG   1 
ATOM   8884  C  CD1  . TYR B  1 153 ? 83.671  -60.863  -2.258  1.00 40.67  ? 133 TYR B CD1  1 
ATOM   8885  C  CD2  . TYR B  1 153 ? 83.363  -61.637  -0.026  1.00 40.42  ? 133 TYR B CD2  1 
ATOM   8886  C  CE1  . TYR B  1 153 ? 83.337  -62.122  -2.748  1.00 36.76  ? 133 TYR B CE1  1 
ATOM   8887  C  CE2  . TYR B  1 153 ? 83.047  -62.904  -0.501  1.00 39.99  ? 133 TYR B CE2  1 
ATOM   8888  C  CZ   . TYR B  1 153 ? 83.012  -63.136  -1.862  1.00 43.53  ? 133 TYR B CZ   1 
ATOM   8889  O  OH   . TYR B  1 153 ? 82.691  -64.377  -2.323  1.00 44.56  ? 133 TYR B OH   1 
ATOM   8890  H  H    . TYR B  1 153 ? 84.162  -56.810  0.399   1.00 42.14  ? 133 TYR B H    1 
ATOM   8891  H  HA   . TYR B  1 153 ? 83.525  -58.130  -2.133  1.00 39.34  ? 133 TYR B HA   1 
ATOM   8892  H  HB2  . TYR B  1 153 ? 85.108  -59.115  -0.474  1.00 41.55  ? 133 TYR B HB2  1 
ATOM   8893  H  HB3  . TYR B  1 153 ? 83.782  -59.184  0.702   1.00 39.78  ? 133 TYR B HB3  1 
ATOM   8894  H  HD1  . TYR B  1 153 ? 83.915  -60.078  -2.971  1.00 40.79  ? 133 TYR B HD1  1 
ATOM   8895  H  HD2  . TYR B  1 153 ? 83.374  -61.468  1.048   1.00 40.45  ? 133 TYR B HD2  1 
ATOM   8896  H  HE1  . TYR B  1 153 ? 83.327  -62.306  -3.820  1.00 35.86  ? 133 TYR B HE1  1 
ATOM   8897  H  HE2  . TYR B  1 153 ? 82.791  -63.697  0.201   1.00 38.75  ? 133 TYR B HE2  1 
ATOM   8898  H  HH   . TYR B  1 153 ? 82.103  -64.862  -1.691  1.00 44.04  ? 133 TYR B HH   1 
ATOM   8899  N  N    . LEU B  1 154 ? 81.386  -57.527  0.346   1.00 39.15  ? 134 LEU B N    1 
ATOM   8900  C  CA   . LEU B  1 154 ? 79.961  -57.405  0.681   1.00 40.31  ? 134 LEU B CA   1 
ATOM   8901  C  C    . LEU B  1 154 ? 79.144  -56.685  -0.396  1.00 41.77  ? 134 LEU B C    1 
ATOM   8902  O  O    . LEU B  1 154 ? 78.088  -57.167  -0.788  1.00 39.58  ? 134 LEU B O    1 
ATOM   8903  C  CB   . LEU B  1 154 ? 79.817  -56.621  2.008   1.00 41.82  ? 134 LEU B CB   1 
ATOM   8904  C  CG   . LEU B  1 154 ? 78.399  -56.374  2.520   1.00 47.99  ? 134 LEU B CG   1 
ATOM   8905  C  CD1  . LEU B  1 154 ? 77.651  -57.634  2.667   1.00 49.45  ? 134 LEU B CD1  1 
ATOM   8906  C  CD2  . LEU B  1 154 ? 78.427  -55.677  3.842   1.00 53.73  ? 134 LEU B CD2  1 
ATOM   8907  H  H    . LEU B  1 154 ? 82.000  -57.259  1.105   1.00 37.69  ? 134 LEU B H    1 
ATOM   8908  H  HA   . LEU B  1 154 ? 79.546  -58.407  0.807   1.00 41.10  ? 134 LEU B HA   1 
ATOM   8909  H  HB2  . LEU B  1 154 ? 80.364  -57.124  2.803   1.00 41.13  ? 134 LEU B HB2  1 
ATOM   8910  H  HB3  . LEU B  1 154 ? 80.263  -55.642  1.844   1.00 42.41  ? 134 LEU B HB3  1 
ATOM   8911  H  HG   . LEU B  1 154 ? 77.853  -55.738  1.825   1.00 47.37  ? 134 LEU B HG   1 
ATOM   8912  H  HD11 . LEU B  1 154 ? 76.771  -57.460  3.284   1.00 51.10  ? 134 LEU B HD11 1 
ATOM   8913  H  HD12 . LEU B  1 154 ? 77.347  -57.981  1.681   1.00 48.99  ? 134 LEU B HD12 1 
ATOM   8914  H  HD13 . LEU B  1 154 ? 78.296  -58.368  3.147   1.00 50.38  ? 134 LEU B HD13 1 
ATOM   8915  H  HD21 . LEU B  1 154 ? 77.427  -55.300  4.047   1.00 54.03  ? 134 LEU B HD21 1 
ATOM   8916  H  HD22 . LEU B  1 154 ? 78.721  -56.384  4.617   1.00 54.54  ? 134 LEU B HD22 1 
ATOM   8917  H  HD23 . LEU B  1 154 ? 79.137  -54.851  3.800   1.00 54.41  ? 134 LEU B HD23 1 
ATOM   8918  N  N    . LYS B  1 155 ? 79.651  -55.546  -0.880  1.00 40.09  ? 135 LYS B N    1 
ATOM   8919  C  CA   . LYS B  1 155 ? 78.942  -54.722  -1.867  1.00 40.69  ? 135 LYS B CA   1 
ATOM   8920  C  C    . LYS B  1 155 ? 78.773  -55.381  -3.237  1.00 39.49  ? 135 LYS B C    1 
ATOM   8921  O  O    . LYS B  1 155 ? 77.988  -54.865  -4.025  1.00 40.81  ? 135 LYS B O    1 
ATOM   8922  C  CB   . LYS B  1 155 ? 79.630  -53.350  -2.038  1.00 43.11  ? 135 LYS B CB   1 
ATOM   8923  C  CG   . LYS B  1 155 ? 80.924  -53.365  -2.850  1.00 41.60  ? 135 LYS B CG   1 
ATOM   8924  C  CD   . LYS B  1 155 ? 81.499  -51.962  -2.868  1.00 50.95  ? 135 LYS B CD   1 
ATOM   8925  C  CE   . LYS B  1 155 ? 82.870  -51.890  -3.473  1.00 59.51  ? 135 LYS B CE   1 
ATOM   8926  N  NZ   . LYS B  1 155 ? 82.875  -52.095  -4.947  1.00 58.30  ? 135 LYS B NZ   1 
ATOM   8927  H  H    . LYS B  1 155 ? 80.573  -55.198  -0.639  1.00 39.60  ? 135 LYS B H    1 
ATOM   8928  H  HA   . LYS B  1 155 ? 77.943  -54.527  -1.480  1.00 41.87  ? 135 LYS B HA   1 
ATOM   8929  H  HB2  . LYS B  1 155 ? 78.935  -52.685  -2.546  1.00 43.51  ? 135 LYS B HB2  1 
ATOM   8930  H  HB3  . LYS B  1 155 ? 79.856  -52.960  -1.047  1.00 41.78  ? 135 LYS B HB3  1 
ATOM   8931  H  HG2  . LYS B  1 155 ? 81.644  -54.044  -2.396  1.00 42.19  ? 135 LYS B HG2  1 
ATOM   8932  H  HG3  . LYS B  1 155 ? 80.721  -53.653  -3.878  1.00 40.83  ? 135 LYS B HG3  1 
ATOM   8933  H  HD2  . LYS B  1 155 ? 80.838  -51.320  -3.448  1.00 51.09  ? 135 LYS B HD2  1 
ATOM   8934  H  HD3  . LYS B  1 155 ? 81.565  -51.592  -1.845  1.00 51.36  ? 135 LYS B HD3  1 
ATOM   8935  H  HE2  . LYS B  1 155 ? 83.291  -50.909  -3.262  1.00 59.85  ? 135 LYS B HE2  1 
ATOM   8936  H  HE3  . LYS B  1 155 ? 83.489  -52.670  -3.035  1.00 59.46  ? 135 LYS B HE3  1 
ATOM   8937  H  HZ1  . LYS B  1 155 ? 82.579  -53.041  -5.167  1.00 58.43  ? 135 LYS B HZ1  1 
ATOM   8938  H  HZ2  . LYS B  1 155 ? 82.244  -51.433  -5.387  1.00 57.82  ? 135 LYS B HZ2  1 
ATOM   8939  H  HZ3  . LYS B  1 155 ? 83.811  -51.954  -5.312  1.00 58.48  ? 135 LYS B HZ3  1 
ATOM   8940  N  N    . LEU B  1 156 ? 79.495  -56.473  -3.528  1.00 32.59  ? 136 LEU B N    1 
ATOM   8941  C  CA   . LEU B  1 156 ? 79.380  -57.209  -4.779  1.00 31.96  ? 136 LEU B CA   1 
ATOM   8942  C  C    . LEU B  1 156 ? 78.254  -58.261  -4.727  1.00 34.95  ? 136 LEU B C    1 
ATOM   8943  O  O    . LEU B  1 156 ? 77.971  -58.873  -5.761  1.00 33.09  ? 136 LEU B O    1 
ATOM   8944  C  CB   . LEU B  1 156 ? 80.716  -57.878  -5.135  1.00 31.41  ? 136 LEU B CB   1 
ATOM   8945  C  CG   . LEU B  1 156 ? 81.884  -56.895  -5.281  1.00 36.50  ? 136 LEU B CG   1 
ATOM   8946  C  CD1  . LEU B  1 156 ? 83.165  -57.642  -5.568  1.00 35.70  ? 136 LEU B CD1  1 
ATOM   8947  C  CD2  . LEU B  1 156 ? 81.615  -55.876  -6.411  1.00 37.29  ? 136 LEU B CD2  1 
ATOM   8948  H  H    . LEU B  1 156 ? 80.212  -56.870  -2.930  1.00 33.66  ? 136 LEU B H    1 
ATOM   8949  H  HA   . LEU B  1 156 ? 79.124  -56.532  -5.592  1.00 31.76  ? 136 LEU B HA   1 
ATOM   8950  H  HB2  . LEU B  1 156 ? 80.975  -58.598  -4.362  1.00 32.68  ? 136 LEU B HB2  1 
ATOM   8951  H  HB3  . LEU B  1 156 ? 80.609  -58.396  -6.086  1.00 29.57  ? 136 LEU B HB3  1 
ATOM   8952  H  HG   . LEU B  1 156 ? 82.022  -56.340  -4.356  1.00 35.60  ? 136 LEU B HG   1 
ATOM   8953  H  HD11 . LEU B  1 156 ? 83.988  -56.931  -5.596  1.00 34.98  ? 136 LEU B HD11 1 
ATOM   8954  H  HD12 . LEU B  1 156 ? 83.321  -58.373  -4.776  1.00 35.49  ? 136 LEU B HD12 1 
ATOM   8955  H  HD13 . LEU B  1 156 ? 83.071  -58.152  -6.526  1.00 34.74  ? 136 LEU B HD13 1 
ATOM   8956  H  HD21 . LEU B  1 156 ? 82.542  -55.358  -6.648  1.00 37.83  ? 136 LEU B HD21 1 
ATOM   8957  H  HD22 . LEU B  1 156 ? 81.247  -56.408  -7.288  1.00 35.81  ? 136 LEU B HD22 1 
ATOM   8958  H  HD23 . LEU B  1 156 ? 80.877  -55.154  -6.067  1.00 36.79  ? 136 LEU B HD23 1 
ATOM   8959  N  N    . PHE B  1 157 ? 77.591  -58.443  -3.579  1.00 31.35  ? 137 PHE B N    1 
ATOM   8960  C  CA   . PHE B  1 157 ? 76.501  -59.409  -3.481  1.00 32.13  ? 137 PHE B CA   1 
ATOM   8961  C  C    . PHE B  1 157 ? 75.170  -58.750  -3.849  1.00 38.28  ? 137 PHE B C    1 
ATOM   8962  O  O    . PHE B  1 157 ? 75.012  -57.554  -3.686  1.00 37.05  ? 137 PHE B O    1 
ATOM   8963  C  CB   . PHE B  1 157 ? 76.442  -60.035  -2.084  1.00 33.97  ? 137 PHE B CB   1 
ATOM   8964  C  CG   . PHE B  1 157 ? 77.472  -61.114  -1.896  1.00 34.52  ? 137 PHE B CG   1 
ATOM   8965  C  CD1  . PHE B  1 157 ? 77.234  -62.409  -2.343  1.00 34.68  ? 137 PHE B CD1  1 
ATOM   8966  C  CD2  . PHE B  1 157 ? 78.720  -60.818  -1.368  1.00 36.43  ? 137 PHE B CD2  1 
ATOM   8967  C  CE1  . PHE B  1 157 ? 78.203  -63.408  -2.193  1.00 36.21  ? 137 PHE B CE1  1 
ATOM   8968  C  CE2  . PHE B  1 157 ? 79.688  -61.817  -1.221  1.00 37.51  ? 137 PHE B CE2  1 
ATOM   8969  C  CZ   . PHE B  1 157 ? 79.422  -63.103  -1.622  1.00 34.56  ? 137 PHE B CZ   1 
ATOM   8970  H  H    . PHE B  1 157 ? 77.788  -57.975  -2.703  1.00 31.70  ? 137 PHE B H    1 
ATOM   8971  H  HA   . PHE B  1 157 ? 76.658  -60.224  -4.186  1.00 30.47  ? 137 PHE B HA   1 
ATOM   8972  H  HB2  . PHE B  1 157 ? 76.599  -59.278  -1.318  1.00 35.29  ? 137 PHE B HB2  1 
ATOM   8973  H  HB3  . PHE B  1 157 ? 75.470  -60.505  -1.947  1.00 34.14  ? 137 PHE B HB3  1 
ATOM   8974  H  HD1  . PHE B  1 157 ? 76.271  -62.656  -2.784  1.00 33.98  ? 137 PHE B HD1  1 
ATOM   8975  H  HD2  . PHE B  1 157 ? 78.933  -59.807  -1.022  1.00 37.40  ? 137 PHE B HD2  1 
ATOM   8976  H  HE1  . PHE B  1 157 ? 78.002  -64.424  -2.530  1.00 35.59  ? 137 PHE B HE1  1 
ATOM   8977  H  HE2  . PHE B  1 157 ? 80.644  -61.566  -0.768  1.00 37.57  ? 137 PHE B HE2  1 
ATOM   8978  H  HZ   . PHE B  1 157 ? 80.172  -63.884  -1.517  1.00 34.58  ? 137 PHE B HZ   1 
ATOM   8979  N  N    . ASP B  1 158 ? 74.214  -59.546  -4.383  1.00 34.18  ? 138 ASP B N    1 
ATOM   8980  C  CA   . ASP B  1 158 ? 72.908  -59.017  -4.767  1.00 31.02  ? 138 ASP B CA   1 
ATOM   8981  C  C    . ASP B  1 158 ? 72.175  -58.358  -3.595  1.00 34.82  ? 138 ASP B C    1 
ATOM   8982  O  O    . ASP B  1 158 ? 71.614  -57.270  -3.742  1.00 33.72  ? 138 ASP B O    1 
ATOM   8983  C  CB   . ASP B  1 158 ? 72.014  -60.132  -5.345  1.00 30.53  ? 138 ASP B CB   1 
ATOM   8984  C  CG   . ASP B  1 158 ? 72.315  -60.500  -6.795  1.00 36.58  ? 138 ASP B CG   1 
ATOM   8985  O  OD1  . ASP B  1 158 ? 72.995  -59.708  -7.488  1.00 37.33  ? 138 ASP B OD1  1 
ATOM   8986  O  OD2  . ASP B  1 158 ? 71.826  -61.545  -7.261  1.00 35.97  ? 138 ASP B OD2  1 
ATOM   8987  H  H    . ASP B  1 158 ? 74.331  -60.543  -4.531  1.00 32.65  ? 138 ASP B H    1 
ATOM   8988  H  HA   . ASP B  1 158 ? 73.047  -58.241  -5.516  1.00 29.84  ? 138 ASP B HA   1 
ATOM   8989  H  HB2  . ASP B  1 158 ? 72.122  -61.035  -4.745  1.00 29.24  ? 138 ASP B HB2  1 
ATOM   8990  H  HB3  . ASP B  1 158 ? 70.979  -59.797  -5.305  1.00 29.28  ? 138 ASP B HB3  1 
ATOM   8991  N  N    . GLY B  1 159 ? 72.108  -59.057  -2.473  1.00 31.87  ? 139 GLY B N    1 
ATOM   8992  C  CA   . GLY B  1 159 ? 71.317  -58.617  -1.332  1.00 32.01  ? 139 GLY B CA   1 
ATOM   8993  C  C    . GLY B  1 159 ? 69.827  -58.687  -1.655  1.00 32.94  ? 139 GLY B C    1 
ATOM   8994  O  O    . GLY B  1 159 ? 69.453  -58.899  -2.813  1.00 32.16  ? 139 GLY B O    1 
ATOM   8995  H  H    . GLY B  1 159 ? 72.580  -59.942  -2.316  1.00 31.53  ? 139 GLY B H    1 
ATOM   8996  H  HA2  . GLY B  1 159 ? 71.541  -59.255  -0.482  1.00 32.75  ? 139 GLY B HA2  1 
ATOM   8997  H  HA3  . GLY B  1 159 ? 71.574  -57.590  -1.075  1.00 32.37  ? 139 GLY B HA3  1 
ATOM   8998  N  N    . PRO B  1 160 ? 68.933  -58.461  -0.687  1.00 30.52  ? 140 PRO B N    1 
ATOM   8999  C  CA   . PRO B  1 160 ? 67.490  -58.549  -1.006  1.00 30.85  ? 140 PRO B CA   1 
ATOM   9000  C  C    . PRO B  1 160 ? 66.977  -57.324  -1.766  1.00 36.00  ? 140 PRO B C    1 
ATOM   9001  O  O    . PRO B  1 160 ? 67.446  -56.214  -1.534  1.00 39.21  ? 140 PRO B O    1 
ATOM   9002  C  CB   . PRO B  1 160 ? 66.825  -58.687  0.375   1.00 31.46  ? 140 PRO B CB   1 
ATOM   9003  C  CG   . PRO B  1 160 ? 67.956  -58.981  1.323   1.00 33.56  ? 140 PRO B CG   1 
ATOM   9004  C  CD   . PRO B  1 160 ? 69.151  -58.320  0.768   1.00 29.47  ? 140 PRO B CD   1 
ATOM   9005  H  HA   . PRO B  1 160 ? 67.287  -59.449  -1.585  1.00 30.78  ? 140 PRO B HA   1 
ATOM   9006  H  HB2  . PRO B  1 160 ? 66.328  -57.760  0.658   1.00 31.21  ? 140 PRO B HB2  1 
ATOM   9007  H  HB3  . PRO B  1 160 ? 66.107  -59.506  0.355   1.00 30.07  ? 140 PRO B HB3  1 
ATOM   9008  H  HG2  . PRO B  1 160 ? 67.711  -58.592  2.310   1.00 33.51  ? 140 PRO B HG2  1 
ATOM   9009  H  HG3  . PRO B  1 160 ? 68.123  -60.055  1.368   1.00 33.61  ? 140 PRO B HG3  1 
ATOM   9010  H  HD2  . PRO B  1 160 ? 69.182  -57.271  1.055   1.00 31.47  ? 140 PRO B HD2  1 
ATOM   9011  H  HD3  . PRO B  1 160 ? 70.045  -58.834  1.114   1.00 26.87  ? 140 PRO B HD3  1 
ATOM   9012  N  N    . SER B  1 161 ? 66.136  -57.551  -2.764  1.00 33.53  ? 141 SER B N    1 
ATOM   9013  C  CA   . SER B  1 161 ? 65.521  -56.488  -3.557  1.00 34.03  ? 141 SER B CA   1 
ATOM   9014  C  C    . SER B  1 161 ? 64.131  -56.154  -3.003  1.00 40.47  ? 141 SER B C    1 
ATOM   9015  O  O    . SER B  1 161 ? 63.706  -54.996  -3.116  1.00 43.47  ? 141 SER B O    1 
ATOM   9016  C  CB   . SER B  1 161 ? 65.405  -56.873  -5.037  1.00 33.69  ? 141 SER B CB   1 
ATOM   9017  O  OG   . SER B  1 161 ? 64.953  -58.206  -5.194  1.00 47.50  ? 141 SER B OG   1 
ATOM   9018  H  H    . SER B  1 161 ? 65.885  -58.484  -3.084  1.00 35.16  ? 141 SER B H    1 
ATOM   9019  H  HA   . SER B  1 161 ? 66.133  -55.589  -3.515  1.00 33.33  ? 141 SER B HA   1 
ATOM   9020  H  HB2  . SER B  1 161 ? 64.692  -56.208  -5.523  1.00 30.78  ? 141 SER B HB2  1 
ATOM   9021  H  HB3  . SER B  1 161 ? 66.380  -56.756  -5.507  1.00 33.34  ? 141 SER B HB3  1 
ATOM   9022  H  HG   . SER B  1 161 ? 63.984  -58.274  -4.993  1.00 47.71  ? 141 SER B HG   1 
ATOM   9023  N  N    . THR B  1 162 ? 63.419  -57.161  -2.472  1.00 34.40  ? 142 THR B N    1 
ATOM   9024  C  CA   . THR B  1 162 ? 62.092  -57.024  -1.853  1.00 34.60  ? 142 THR B CA   1 
ATOM   9025  C  C    . THR B  1 162 ? 62.227  -57.445  -0.374  1.00 39.03  ? 142 THR B C    1 
ATOM   9026  O  O    . THR B  1 162 ? 63.047  -58.311  -0.055  1.00 37.86  ? 142 THR B O    1 
ATOM   9027  C  CB   . THR B  1 162 ? 61.064  -57.866  -2.636  1.00 40.28  ? 142 THR B CB   1 
ATOM   9028  O  OG1  . THR B  1 162 ? 60.968  -57.321  -3.955  1.00 35.73  ? 142 THR B OG1  1 
ATOM   9029  C  CG2  . THR B  1 162 ? 59.672  -57.843  -2.002  1.00 41.65  ? 142 THR B CG2  1 
ATOM   9030  H  H    . THR B  1 162 ? 63.722  -58.129  -2.445  1.00 34.56  ? 142 THR B H    1 
ATOM   9031  H  HA   . THR B  1 162 ? 61.767  -55.986  -1.890  1.00 33.15  ? 142 THR B HA   1 
ATOM   9032  H  HB   . THR B  1 162 ? 61.412  -58.896  -2.698  1.00 38.75  ? 142 THR B HB   1 
ATOM   9033  H  HG1  . THR B  1 162 ? 61.706  -57.660  -4.522  1.00 35.74  ? 142 THR B HG1  1 
ATOM   9034  H  HG21 . THR B  1 162 ? 59.001  -58.487  -2.568  1.00 42.68  ? 142 THR B HG21 1 
ATOM   9035  H  HG22 . THR B  1 162 ? 59.683  -58.186  -0.969  1.00 42.00  ? 142 THR B HG22 1 
ATOM   9036  H  HG23 . THR B  1 162 ? 59.275  -56.831  -2.044  1.00 41.14  ? 142 THR B HG23 1 
ATOM   9037  N  N    . THR B  1 163 ? 61.473  -56.787  0.511   1.00 36.61  ? 143 THR B N    1 
ATOM   9038  C  CA   . THR B  1 163 ? 61.507  -57.026  1.952   1.00 37.73  ? 143 THR B CA   1 
ATOM   9039  C  C    . THR B  1 163 ? 60.082  -57.117  2.498   1.00 42.83  ? 143 THR B C    1 
ATOM   9040  O  O    . THR B  1 163 ? 59.122  -56.999  1.738   1.00 43.71  ? 143 THR B O    1 
ATOM   9041  C  CB   . THR B  1 163 ? 62.296  -55.900  2.661   1.00 40.44  ? 143 THR B CB   1 
ATOM   9042  O  OG1  . THR B  1 163 ? 61.561  -54.690  2.581   1.00 39.03  ? 143 THR B OG1  1 
ATOM   9043  C  CG2  . THR B  1 163 ? 63.703  -55.671  2.078   1.00 38.58  ? 143 THR B CG2  1 
ATOM   9044  H  H    . THR B  1 163 ? 60.815  -56.057  0.251   1.00 37.04  ? 143 THR B H    1 
ATOM   9045  H  HA   . THR B  1 163 ? 61.990  -57.978  2.167   1.00 38.74  ? 143 THR B HA   1 
ATOM   9046  H  HB   . THR B  1 163 ? 62.419  -56.149  3.713   1.00 40.75  ? 143 THR B HB   1 
ATOM   9047  H  HG1  . THR B  1 163 ? 61.750  -54.134  3.381   1.00 40.29  ? 143 THR B HG1  1 
ATOM   9048  H  HG21 . THR B  1 163 ? 64.200  -54.876  2.631   1.00 38.34  ? 143 THR B HG21 1 
ATOM   9049  H  HG22 . THR B  1 163 ? 64.307  -56.573  2.151   1.00 38.96  ? 143 THR B HG22 1 
ATOM   9050  H  HG23 . THR B  1 163 ? 63.651  -55.361  1.036   1.00 38.61  ? 143 THR B HG23 1 
ATOM   9051  N  N    . ILE B  1 164 ? 59.949  -57.323  3.809   1.00 39.61  ? 144 ILE B N    1 
ATOM   9052  C  CA   . ILE B  1 164 ? 58.645  -57.345  4.482   1.00 39.01  ? 144 ILE B CA   1 
ATOM   9053  C  C    . ILE B  1 164 ? 57.906  -56.006  4.287   1.00 39.19  ? 144 ILE B C    1 
ATOM   9054  O  O    . ILE B  1 164 ? 56.679  -56.009  4.284   1.00 38.70  ? 144 ILE B O    1 
ATOM   9055  C  CB   . ILE B  1 164 ? 58.770  -57.720  5.994   1.00 41.42  ? 144 ILE B CB   1 
ATOM   9056  C  CG1  . ILE B  1 164 ? 57.398  -58.080  6.588   1.00 40.48  ? 144 ILE B CG1  1 
ATOM   9057  C  CG2  . ILE B  1 164 ? 59.474  -56.633  6.803   1.00 40.86  ? 144 ILE B CG2  1 
ATOM   9058  C  CD1  . ILE B  1 164 ? 57.458  -58.738  7.912   1.00 30.98  ? 144 ILE B CD1  1 
ATOM   9059  H  H    . ILE B  1 164 ? 60.733  -57.525  4.422   1.00 40.44  ? 144 ILE B H    1 
ATOM   9060  H  HA   . ILE B  1 164 ? 58.040  -58.116  4.010   1.00 37.60  ? 144 ILE B HA   1 
ATOM   9061  H  HB   . ILE B  1 164 ? 59.390  -58.612  6.054   1.00 42.01  ? 144 ILE B HB   1 
ATOM   9062  H  HG12 . ILE B  1 164 ? 56.802  -57.177  6.692   1.00 41.34  ? 144 ILE B HG12 1 
ATOM   9063  H  HG13 . ILE B  1 164 ? 56.889  -58.772  5.920   1.00 39.88  ? 144 ILE B HG13 1 
ATOM   9064  H  HG21 . ILE B  1 164 ? 59.790  -57.045  7.760   1.00 39.10  ? 144 ILE B HG21 1 
ATOM   9065  H  HG22 . ILE B  1 164 ? 60.333  -56.255  6.248   1.00 40.13  ? 144 ILE B HG22 1 
ATOM   9066  H  HG23 . ILE B  1 164 ? 58.768  -55.823  6.962   1.00 42.15  ? 144 ILE B HG23 1 
ATOM   9067  H  HD11 . ILE B  1 164 ? 56.453  -59.017  8.221   1.00 31.53  ? 144 ILE B HD11 1 
ATOM   9068  H  HD12 . ILE B  1 164 ? 58.078  -59.628  7.832   1.00 29.63  ? 144 ILE B HD12 1 
ATOM   9069  H  HD13 . ILE B  1 164 ? 57.889  -58.057  8.644   1.00 30.43  ? 144 ILE B HD13 1 
ATOM   9070  N  N    . LYS B  1 165 ? 58.629  -54.882  4.080   1.00 37.61  ? 145 LYS B N    1 
ATOM   9071  C  CA   . LYS B  1 165 ? 58.006  -53.567  3.796   1.00 38.62  ? 145 LYS B CA   1 
ATOM   9072  C  C    . LYS B  1 165 ? 57.004  -53.664  2.668   1.00 38.67  ? 145 LYS B C    1 
ATOM   9073  O  O    . LYS B  1 165 ? 55.932  -53.069  2.739   1.00 36.26  ? 145 LYS B O    1 
ATOM   9074  C  CB   . LYS B  1 165 ? 59.044  -52.507  3.364   1.00 41.15  ? 145 LYS B CB   1 
ATOM   9075  C  CG   . LYS B  1 165 ? 60.033  -52.024  4.398   1.00 64.78  ? 145 LYS B CG   1 
ATOM   9076  C  CD   . LYS B  1 165 ? 61.129  -51.121  3.801   1.00 71.62  ? 145 LYS B CD   1 
ATOM   9077  C  CE   . LYS B  1 165 ? 60.624  -49.947  2.996   1.00 87.46  ? 145 LYS B CE   1 
ATOM   9078  N  NZ   . LYS B  1 165 ? 61.732  -49.077  2.520   1.00 105.39 ? 145 LYS B NZ   1 
ATOM   9079  H  H    . LYS B  1 165 ? 59.640  -54.835  4.148   1.00 37.44  ? 145 LYS B H    1 
ATOM   9080  H  HA   . LYS B  1 165 ? 57.480  -53.206  4.678   1.00 38.80  ? 145 LYS B HA   1 
ATOM   9081  H  HB2  . LYS B  1 165 ? 59.611  -52.908  2.528   1.00 41.17  ? 145 LYS B HB2  1 
ATOM   9082  H  HB3  . LYS B  1 165 ? 58.480  -51.636  3.032   1.00 39.99  ? 145 LYS B HB3  1 
ATOM   9083  H  HG2  . LYS B  1 165 ? 59.497  -51.433  5.134   1.00 66.34  ? 145 LYS B HG2  1 
ATOM   9084  H  HG3  . LYS B  1 165 ? 60.506  -52.869  4.896   1.00 65.03  ? 145 LYS B HG3  1 
ATOM   9085  H  HD2  . LYS B  1 165 ? 61.736  -50.727  4.614   1.00 71.66  ? 145 LYS B HD2  1 
ATOM   9086  H  HD3  . LYS B  1 165 ? 61.756  -51.723  3.147   1.00 71.33  ? 145 LYS B HD3  1 
ATOM   9087  H  HE2  . LYS B  1 165 ? 60.097  -50.297  2.111   1.00 86.88  ? 145 LYS B HE2  1 
ATOM   9088  H  HE3  . LYS B  1 165 ? 59.952  -49.349  3.610   1.00 88.10  ? 145 LYS B HE3  1 
ATOM   9089  H  HZ1  . LYS B  1 165 ? 61.363  -48.322  1.950   1.00 105.78 ? 145 LYS B HZ1  1 
ATOM   9090  H  HZ2  . LYS B  1 165 ? 62.228  -48.676  3.309   1.00 105.94 ? 145 LYS B HZ2  1 
ATOM   9091  H  HZ3  . LYS B  1 165 ? 62.384  -49.618  1.962   1.00 104.93 ? 145 LYS B HZ3  1 
ATOM   9092  N  N    . ASP B  1 166 ? 57.378  -54.420  1.619   1.00 36.40  ? 146 ASP B N    1 
ATOM   9093  C  CA   . ASP B  1 166 ? 56.553  -54.602  0.427   1.00 37.82  ? 146 ASP B CA   1 
ATOM   9094  C  C    . ASP B  1 166 ? 55.307  -55.473  0.724   1.00 38.73  ? 146 ASP B C    1 
ATOM   9095  O  O    . ASP B  1 166 ? 54.271  -55.258  0.099   1.00 36.68  ? 146 ASP B O    1 
ATOM   9096  C  CB   . ASP B  1 166 ? 57.411  -55.180  -0.721  1.00 40.34  ? 146 ASP B CB   1 
ATOM   9097  C  CG   . ASP B  1 166 ? 58.618  -54.292  -1.019  1.00 53.31  ? 146 ASP B CG   1 
ATOM   9098  O  OD1  . ASP B  1 166 ? 58.408  -53.139  -1.417  1.00 57.77  ? 146 ASP B OD1  1 
ATOM   9099  O  OD2  . ASP B  1 166 ? 59.770  -54.713  -0.714  1.00 55.27  ? 146 ASP B OD2  1 
ATOM   9100  H  H    . ASP B  1 166 ? 58.253  -54.931  1.587   1.00 34.61  ? 146 ASP B H    1 
ATOM   9101  H  HA   . ASP B  1 166 ? 56.191  -53.629  0.100   1.00 38.30  ? 146 ASP B HA   1 
ATOM   9102  H  HB2  . ASP B  1 166 ? 57.765  -56.168  -0.427  1.00 40.17  ? 146 ASP B HB2  1 
ATOM   9103  H  HB3  . ASP B  1 166 ? 56.803  -55.250  -1.620  1.00 39.50  ? 146 ASP B HB3  1 
ATOM   9104  N  N    . LEU B  1 167 ? 55.376  -56.371  1.722   1.00 36.30  ? 147 LEU B N    1 
ATOM   9105  C  CA   . LEU B  1 167 ? 54.211  -57.140  2.155   1.00 35.78  ? 147 LEU B CA   1 
ATOM   9106  C  C    . LEU B  1 167 ? 53.329  -56.275  3.055   1.00 38.73  ? 147 LEU B C    1 
ATOM   9107  O  O    . LEU B  1 167 ? 52.119  -56.252  2.853   1.00 37.63  ? 147 LEU B O    1 
ATOM   9108  C  CB   . LEU B  1 167 ? 54.616  -58.436  2.863   1.00 35.87  ? 147 LEU B CB   1 
ATOM   9109  C  CG   . LEU B  1 167 ? 55.513  -59.404  2.053   1.00 39.19  ? 147 LEU B CG   1 
ATOM   9110  C  CD1  . LEU B  1 167 ? 55.736  -60.671  2.815   1.00 37.07  ? 147 LEU B CD1  1 
ATOM   9111  C  CD2  . LEU B  1 167 ? 54.921  -59.730  0.656   1.00 37.09  ? 147 LEU B CD2  1 
ATOM   9112  H  H    . LEU B  1 167 ? 56.224  -56.602  2.228   1.00 37.15  ? 147 LEU B H    1 
ATOM   9113  H  HA   . LEU B  1 167 ? 53.608  -57.409  1.291   1.00 36.56  ? 147 LEU B HA   1 
ATOM   9114  H  HB2  . LEU B  1 167 ? 55.148  -58.175  3.776   1.00 36.91  ? 147 LEU B HB2  1 
ATOM   9115  H  HB3  . LEU B  1 167 ? 53.702  -58.970  3.121   1.00 37.01  ? 147 LEU B HB3  1 
ATOM   9116  H  HG   . LEU B  1 167 ? 56.482  -58.933  1.894   1.00 40.39  ? 147 LEU B HG   1 
ATOM   9117  H  HD11 . LEU B  1 167 ? 56.407  -61.320  2.255   1.00 36.50  ? 147 LEU B HD11 1 
ATOM   9118  H  HD12 . LEU B  1 167 ? 56.179  -60.428  3.778   1.00 37.37  ? 147 LEU B HD12 1 
ATOM   9119  H  HD13 . LEU B  1 167 ? 54.777  -61.167  2.966   1.00 36.36  ? 147 LEU B HD13 1 
ATOM   9120  H  HD21 . LEU B  1 167 ? 55.480  -60.556  0.220   1.00 37.20  ? 147 LEU B HD21 1 
ATOM   9121  H  HD22 . LEU B  1 167 ? 53.874  -60.003  0.773   1.00 36.63  ? 147 LEU B HD22 1 
ATOM   9122  H  HD23 . LEU B  1 167 ? 55.005  -58.866  -0.002  1.00 37.45  ? 147 LEU B HD23 1 
ATOM   9123  N  N    . TRP B  1 168 ? 53.928  -55.537  4.014   1.00 33.95  ? 148 TRP B N    1 
ATOM   9124  C  CA   . TRP B  1 168 ? 53.197  -54.595  4.856   1.00 35.23  ? 148 TRP B CA   1 
ATOM   9125  C  C    . TRP B  1 168 ? 52.438  -53.573  4.004   1.00 37.80  ? 148 TRP B C    1 
ATOM   9126  O  O    . TRP B  1 168 ? 51.249  -53.358  4.230   1.00 33.24  ? 148 TRP B O    1 
ATOM   9127  C  CB   . TRP B  1 168 ? 54.159  -53.850  5.829   1.00 34.37  ? 148 TRP B CB   1 
ATOM   9128  C  CG   . TRP B  1 168 ? 54.662  -54.672  6.985   1.00 34.88  ? 148 TRP B CG   1 
ATOM   9129  C  CD1  . TRP B  1 168 ? 54.005  -55.678  7.636   1.00 37.62  ? 148 TRP B CD1  1 
ATOM   9130  C  CD2  . TRP B  1 168 ? 55.908  -54.503  7.661   1.00 34.87  ? 148 TRP B CD2  1 
ATOM   9131  N  NE1  . TRP B  1 168 ? 54.789  -56.181  8.648   1.00 36.89  ? 148 TRP B NE1  1 
ATOM   9132  C  CE2  . TRP B  1 168 ? 55.953  -55.458  8.706   1.00 38.45  ? 148 TRP B CE2  1 
ATOM   9133  C  CE3  . TRP B  1 168 ? 56.977  -53.598  7.518   1.00 36.86  ? 148 TRP B CE3  1 
ATOM   9134  C  CZ2  . TRP B  1 168 ? 57.038  -55.564  9.581   1.00 37.25  ? 148 TRP B CZ2  1 
ATOM   9135  C  CZ3  . TRP B  1 168 ? 58.051  -53.684  8.405   1.00 37.80  ? 148 TRP B CZ3  1 
ATOM   9136  C  CH2  . TRP B  1 168 ? 58.082  -54.672  9.409   1.00 38.39  ? 148 TRP B CH2  1 
ATOM   9137  H  H    . TRP B  1 168 ? 54.920  -55.596  4.221   1.00 33.45  ? 148 TRP B H    1 
ATOM   9138  H  HA   . TRP B  1 168 ? 52.443  -55.131  5.431   1.00 37.02  ? 148 TRP B HA   1 
ATOM   9139  H  HB2  . TRP B  1 168 ? 55.029  -53.524  5.260   1.00 35.39  ? 148 TRP B HB2  1 
ATOM   9140  H  HB3  . TRP B  1 168 ? 53.661  -52.973  6.238   1.00 33.83  ? 148 TRP B HB3  1 
ATOM   9141  H  HD1  . TRP B  1 168 ? 53.046  -56.102  7.341   1.00 38.21  ? 148 TRP B HD1  1 
ATOM   9142  H  HE1  . TRP B  1 168 ? 54.543  -56.957  9.254   1.00 35.32  ? 148 TRP B HE1  1 
ATOM   9143  H  HE3  . TRP B  1 168 ? 56.939  -52.824  6.751   1.00 36.70  ? 148 TRP B HE3  1 
ATOM   9144  H  HZ2  . TRP B  1 168 ? 57.054  -56.321  10.365  1.00 35.79  ? 148 TRP B HZ2  1 
ATOM   9145  H  HZ3  . TRP B  1 168 ? 58.903  -53.015  8.276   1.00 35.75  ? 148 TRP B HZ3  1 
ATOM   9146  H  HH2  . TRP B  1 168 ? 58.944  -54.745  10.072  1.00 38.32  ? 148 TRP B HH2  1 
ATOM   9147  N  N    . ARG B  1 169 ? 53.107  -52.997  2.975   1.00 37.48  ? 149 ARG B N    1 
ATOM   9148  C  CA   . ARG B  1 169 ? 52.462  -52.022  2.094   1.00 36.50  ? 149 ARG B CA   1 
ATOM   9149  C  C    . ARG B  1 169 ? 51.207  -52.622  1.427   1.00 40.14  ? 149 ARG B C    1 
ATOM   9150  O  O    . ARG B  1 169 ? 50.152  -51.983  1.441   1.00 37.49  ? 149 ARG B O    1 
ATOM   9151  C  CB   . ARG B  1 169 ? 53.444  -51.508  1.034   1.00 38.24  ? 149 ARG B CB   1 
ATOM   9152  C  CG   . ARG B  1 169 ? 52.937  -50.288  0.269   1.00 36.82  ? 149 ARG B CG   1 
ATOM   9153  C  CD   . ARG B  1 169 ? 53.871  -49.891  -0.835  1.00 30.56  ? 149 ARG B CD   1 
ATOM   9154  N  NE   . ARG B  1 169 ? 55.222  -49.568  -0.345  1.00 30.78  ? 149 ARG B NE   1 
ATOM   9155  C  CZ   . ARG B  1 169 ? 56.327  -50.279  -0.542  1.00 44.36  ? 149 ARG B CZ   1 
ATOM   9156  N  NH1  . ARG B  1 169 ? 56.283  -51.420  -1.223  1.00 43.73  ? 149 ARG B NH1  1 
ATOM   9157  N  NH2  . ARG B  1 169 ? 57.491  -49.859  -0.053  1.00 35.29  ? 149 ARG B NH2  1 
ATOM   9158  H  H    . ARG B  1 169 ? 54.078  -53.192  2.755   1.00 37.21  ? 149 ARG B H    1 
ATOM   9159  H  HA   . ARG B  1 169 ? 52.131  -51.168  2.682   1.00 36.77  ? 149 ARG B HA   1 
ATOM   9160  H  HB2  . ARG B  1 169 ? 54.378  -51.238  1.524   1.00 37.64  ? 149 ARG B HB2  1 
ATOM   9161  H  HB3  . ARG B  1 169 ? 53.624  -52.302  0.311   1.00 39.76  ? 149 ARG B HB3  1 
ATOM   9162  H  HG2  . ARG B  1 169 ? 51.968  -50.497  -0.180  1.00 37.42  ? 149 ARG B HG2  1 
ATOM   9163  H  HG3  . ARG B  1 169 ? 52.833  -49.456  0.966   1.00 37.11  ? 149 ARG B HG3  1 
ATOM   9164  H  HD2  . ARG B  1 169 ? 53.871  -50.644  -1.616  1.00 28.36  ? 149 ARG B HD2  1 
ATOM   9165  H  HD3  . ARG B  1 169 ? 53.479  -48.966  -1.258  1.00 32.77  ? 149 ARG B HD3  1 
ATOM   9166  H  HE   . ARG B  1 169 ? 55.319  -48.708  0.186   1.00 30.75  ? 149 ARG B HE   1 
ATOM   9167  H  HH11 . ARG B  1 169 ? 55.433  -51.803  -1.622  1.00 43.95  ? 149 ARG B HH11 1 
ATOM   9168  H  HH12 . ARG B  1 169 ? 57.141  -51.948  -1.346  1.00 44.13  ? 149 ARG B HH12 1 
ATOM   9169  H  HH21 . ARG B  1 169 ? 57.546  -49.002  0.487   1.00 35.24  ? 149 ARG B HH21 1 
ATOM   9170  H  HH22 . ARG B  1 169 ? 58.328  -50.418  -0.184  1.00 34.82  ? 149 ARG B HH22 1 
ATOM   9171  N  N    . VAL B  1 170 ? 51.305  -53.857  0.928   1.00 38.62  ? 150 VAL B N    1 
ATOM   9172  C  CA   . VAL B  1 170 ? 50.176  -54.552  0.289   1.00 38.67  ? 150 VAL B CA   1 
ATOM   9173  C  C    . VAL B  1 170 ? 49.033  -54.791  1.325   1.00 44.48  ? 150 VAL B C    1 
ATOM   9174  O  O    . VAL B  1 170 ? 47.868  -54.622  0.981   1.00 45.34  ? 150 VAL B O    1 
ATOM   9175  C  CB   . VAL B  1 170 ? 50.648  -55.862  -0.400  1.00 40.75  ? 150 VAL B CB   1 
ATOM   9176  C  CG1  . VAL B  1 170 ? 49.473  -56.774  -0.757  1.00 41.01  ? 150 VAL B CG1  1 
ATOM   9177  C  CG2  . VAL B  1 170 ? 51.458  -55.544  -1.640  1.00 41.55  ? 150 VAL B CG2  1 
ATOM   9178  H  H    . VAL B  1 170 ? 52.165  -54.399  0.937   1.00 39.11  ? 150 VAL B H    1 
ATOM   9179  H  HA   . VAL B  1 170 ? 49.779  -53.902  -0.490  1.00 39.56  ? 150 VAL B HA   1 
ATOM   9180  H  HB   . VAL B  1 170 ? 51.301  -56.413  0.275   1.00 40.31  ? 150 VAL B HB   1 
ATOM   9181  H  HG11 . VAL B  1 170 ? 49.837  -57.561  -1.417  1.00 42.35  ? 150 VAL B HG11 1 
ATOM   9182  H  HG12 . VAL B  1 170 ? 49.071  -57.236  0.145   1.00 41.72  ? 150 VAL B HG12 1 
ATOM   9183  H  HG13 . VAL B  1 170 ? 48.699  -56.197  -1.259  1.00 41.32  ? 150 VAL B HG13 1 
ATOM   9184  H  HG21 . VAL B  1 170 ? 52.067  -56.406  -1.905  1.00 41.75  ? 150 VAL B HG21 1 
ATOM   9185  H  HG22 . VAL B  1 170 ? 50.773  -55.313  -2.455  1.00 42.30  ? 150 VAL B HG22 1 
ATOM   9186  H  HG23 . VAL B  1 170 ? 52.100  -54.685  -1.456  1.00 42.57  ? 150 VAL B HG23 1 
ATOM   9187  N  N    . LEU B  1 171 ? 49.362  -55.075  2.592   1.00 40.30  ? 151 LEU B N    1 
ATOM   9188  C  CA   . LEU B  1 171 ? 48.372  -55.329  3.627   1.00 39.03  ? 151 LEU B CA   1 
ATOM   9189  C  C    . LEU B  1 171 ? 47.789  -54.044  4.209   1.00 44.71  ? 151 LEU B C    1 
ATOM   9190  O  O    . LEU B  1 171 ? 46.822  -54.137  4.954   1.00 46.13  ? 151 LEU B O    1 
ATOM   9191  C  CB   . LEU B  1 171 ? 48.980  -56.199  4.751   1.00 39.21  ? 151 LEU B CB   1 
ATOM   9192  C  CG   . LEU B  1 171 ? 49.353  -57.645  4.372   1.00 42.50  ? 151 LEU B CG   1 
ATOM   9193  C  CD1  . LEU B  1 171 ? 50.109  -58.309  5.510   1.00 42.86  ? 151 LEU B CD1  1 
ATOM   9194  C  CD2  . LEU B  1 171 ? 48.078  -58.497  4.067   1.00 40.57  ? 151 LEU B CD2  1 
ATOM   9195  H  H    . LEU B  1 171 ? 50.318  -55.150  2.923   1.00 42.12  ? 151 LEU B H    1 
ATOM   9196  H  HA   . LEU B  1 171 ? 47.530  -55.877  3.210   1.00 38.87  ? 151 LEU B HA   1 
ATOM   9197  H  HB2  . LEU B  1 171 ? 49.874  -55.710  5.135   1.00 39.94  ? 151 LEU B HB2  1 
ATOM   9198  H  HB3  . LEU B  1 171 ? 48.250  -56.274  5.555   1.00 39.76  ? 151 LEU B HB3  1 
ATOM   9199  H  HG   . LEU B  1 171 ? 49.992  -57.647  3.490   1.00 41.24  ? 151 LEU B HG   1 
ATOM   9200  H  HD11 . LEU B  1 171 ? 50.515  -59.257  5.159   1.00 41.64  ? 151 LEU B HD11 1 
ATOM   9201  H  HD12 . LEU B  1 171 ? 50.913  -57.651  5.836   1.00 42.89  ? 151 LEU B HD12 1 
ATOM   9202  H  HD13 . LEU B  1 171 ? 49.419  -58.481  6.334   1.00 42.05  ? 151 LEU B HD13 1 
ATOM   9203  H  HD21 . LEU B  1 171 ? 48.370  -59.537  3.940   1.00 40.17  ? 151 LEU B HD21 1 
ATOM   9204  H  HD22 . LEU B  1 171 ? 47.388  -58.409  4.905   1.00 41.51  ? 151 LEU B HD22 1 
ATOM   9205  H  HD23 . LEU B  1 171 ? 47.597  -58.145  3.156   1.00 40.69  ? 151 LEU B HD23 1 
ATOM   9206  N  N    . GLY B  1 172 ? 48.326  -52.879  3.847   1.00 40.72  ? 152 GLY B N    1 
ATOM   9207  C  CA   . GLY B  1 172 ? 47.856  -51.587  4.350   1.00 41.79  ? 152 GLY B CA   1 
ATOM   9208  C  C    . GLY B  1 172 ? 48.408  -51.270  5.725   1.00 45.25  ? 152 GLY B C    1 
ATOM   9209  O  O    . GLY B  1 172 ? 47.839  -50.466  6.449   1.00 46.61  ? 152 GLY B O    1 
ATOM   9210  H  H    . GLY B  1 172 ? 49.122  -52.768  3.227   1.00 41.42  ? 152 GLY B H    1 
ATOM   9211  H  HA2  . GLY B  1 172 ? 48.182  -50.803  3.667   1.00 42.40  ? 152 GLY B HA2  1 
ATOM   9212  H  HA3  . GLY B  1 172 ? 46.768  -51.568  4.389   1.00 41.39  ? 152 GLY B HA3  1 
ATOM   9213  N  N    . ARG B  1 173 ? 49.527  -51.902  6.092   1.00 42.40  ? 153 ARG B N    1 
ATOM   9214  C  CA   . ARG B  1 173 ? 50.203  -51.706  7.360   1.00 41.43  ? 153 ARG B CA   1 
ATOM   9215  C  C    . ARG B  1 173 ? 51.282  -50.646  7.240   1.00 42.04  ? 153 ARG B C    1 
ATOM   9216  O  O    . ARG B  1 173 ? 51.815  -50.440  6.149   1.00 39.94  ? 153 ARG B O    1 
ATOM   9217  C  CB   . ARG B  1 173 ? 50.894  -53.006  7.828   1.00 43.24  ? 153 ARG B CB   1 
ATOM   9218  C  CG   . ARG B  1 173 ? 50.044  -54.272  7.852   1.00 50.29  ? 153 ARG B CG   1 
ATOM   9219  C  CD   . ARG B  1 173 ? 49.228  -54.447  9.112   1.00 45.47  ? 153 ARG B CD   1 
ATOM   9220  N  NE   . ARG B  1 173 ? 48.780  -55.840  9.202   1.00 60.33  ? 153 ARG B NE   1 
ATOM   9221  C  CZ   . ARG B  1 173 ? 49.471  -56.851  9.733   1.00 68.62  ? 153 ARG B CZ   1 
ATOM   9222  N  NH1  . ARG B  1 173 ? 50.673  -56.640  10.269  1.00 53.64  ? 153 ARG B NH1  1 
ATOM   9223  N  NH2  . ARG B  1 173 ? 48.964  -58.080  9.738   1.00 52.35  ? 153 ARG B NH2  1 
ATOM   9224  H  H    . ARG B  1 173 ? 50.022  -52.565  5.503   1.00 43.34  ? 153 ARG B H    1 
ATOM   9225  H  HA   . ARG B  1 173 ? 49.471  -51.423  8.115   1.00 43.34  ? 153 ARG B HA   1 
ATOM   9226  H  HB2  . ARG B  1 173 ? 51.712  -53.204  7.139   1.00 43.29  ? 153 ARG B HB2  1 
ATOM   9227  H  HB3  . ARG B  1 173 ? 51.294  -52.864  8.830   1.00 44.13  ? 153 ARG B HB3  1 
ATOM   9228  H  HG2  . ARG B  1 173 ? 49.348  -54.269  7.015   1.00 50.99  ? 153 ARG B HG2  1 
ATOM   9229  H  HG3  . ARG B  1 173 ? 50.705  -55.132  7.748   1.00 49.12  ? 153 ARG B HG3  1 
ATOM   9230  H  HD2  . ARG B  1 173 ? 49.785  -54.153  9.998   1.00 43.81  ? 153 ARG B HD2  1 
ATOM   9231  H  HD3  . ARG B  1 173 ? 48.336  -53.829  9.025   1.00 45.42  ? 153 ARG B HD3  1 
ATOM   9232  H  HE   . ARG B  1 173 ? 47.885  -56.056  8.776   1.00 60.36  ? 153 ARG B HE   1 
ATOM   9233  H  HH11 . ARG B  1 173 ? 51.106  -55.723  10.296  1.00 54.61  ? 153 ARG B HH11 1 
ATOM   9234  H  HH12 . ARG B  1 173 ? 51.178  -57.412  10.690  1.00 53.39  ? 153 ARG B HH12 1 
ATOM   9235  H  HH21 . ARG B  1 173 ? 48.055  -58.259  9.323   1.00 52.19  ? 153 ARG B HH21 1 
ATOM   9236  H  HH22 . ARG B  1 173 ? 49.483  -58.852  10.141  1.00 52.29  ? 153 ARG B HH22 1 
ATOM   9237  N  N    . PRO B  1 174 ? 51.724  -50.039  8.360   1.00 40.46  ? 154 PRO B N    1 
ATOM   9238  C  CA   . PRO B  1 174 ? 52.877  -49.118  8.281   1.00 40.62  ? 154 PRO B CA   1 
ATOM   9239  C  C    . PRO B  1 174 ? 54.087  -49.836  7.671   1.00 45.69  ? 154 PRO B C    1 
ATOM   9240  O  O    . PRO B  1 174 ? 54.301  -51.007  7.971   1.00 43.67  ? 154 PRO B O    1 
ATOM   9241  C  CB   . PRO B  1 174 ? 53.134  -48.746  9.750   1.00 42.59  ? 154 PRO B CB   1 
ATOM   9242  C  CG   . PRO B  1 174 ? 51.833  -48.981  10.429  1.00 45.54  ? 154 PRO B CG   1 
ATOM   9243  C  CD   . PRO B  1 174 ? 51.232  -50.165  9.748   1.00 40.87  ? 154 PRO B CD   1 
ATOM   9244  H  HA   . PRO B  1 174 ? 52.626  -48.228  7.704   1.00 39.10  ? 154 PRO B HA   1 
ATOM   9245  H  HB2  . PRO B  1 174 ? 53.912  -49.386  10.165  1.00 40.79  ? 154 PRO B HB2  1 
ATOM   9246  H  HB3  . PRO B  1 174 ? 53.426  -47.699  9.820   1.00 43.20  ? 154 PRO B HB3  1 
ATOM   9247  H  HG2  . PRO B  1 174 ? 52.014  -49.199  11.480  1.00 46.13  ? 154 PRO B HG2  1 
ATOM   9248  H  HG3  . PRO B  1 174 ? 51.188  -48.113  10.310  1.00 45.18  ? 154 PRO B HG3  1 
ATOM   9249  H  HD2  . PRO B  1 174 ? 51.589  -51.083  10.209  1.00 39.66  ? 154 PRO B HD2  1 
ATOM   9250  H  HD3  . PRO B  1 174 ? 50.147  -50.089  9.790   1.00 39.90  ? 154 PRO B HD3  1 
ATOM   9251  N  N    . VAL B  1 175 ? 54.841  -49.168  6.798   1.00 43.44  ? 155 VAL B N    1 
ATOM   9252  C  CA   . VAL B  1 175 ? 55.995  -49.794  6.157   1.00 43.27  ? 155 VAL B CA   1 
ATOM   9253  C  C    . VAL B  1 175 ? 57.202  -49.868  7.098   1.00 45.55  ? 155 VAL B C    1 
ATOM   9254  O  O    . VAL B  1 175 ? 58.163  -50.572  6.771   1.00 43.79  ? 155 VAL B O    1 
ATOM   9255  C  CB   . VAL B  1 175 ? 56.371  -49.141  4.806   1.00 46.82  ? 155 VAL B CB   1 
ATOM   9256  C  CG1  . VAL B  1 175 ? 55.228  -49.332  3.815   1.00 47.46  ? 155 VAL B CG1  1 
ATOM   9257  C  CG2  . VAL B  1 175 ? 56.733  -47.663  4.955   1.00 46.73  ? 155 VAL B CG2  1 
ATOM   9258  H  H    . VAL B  1 175 ? 54.685  -48.195  6.557   1.00 43.77  ? 155 VAL B H    1 
ATOM   9259  H  HA   . VAL B  1 175 ? 55.736  -50.824  5.920   1.00 42.55  ? 155 VAL B HA   1 
ATOM   9260  H  HB   . VAL B  1 175 ? 57.249  -49.645  4.403   1.00 45.13  ? 155 VAL B HB   1 
ATOM   9261  H  HG11 . VAL B  1 175 ? 55.488  -48.869  2.865   1.00 48.33  ? 155 VAL B HG11 1 
ATOM   9262  H  HG12 . VAL B  1 175 ? 55.071  -50.401  3.674   1.00 47.43  ? 155 VAL B HG12 1 
ATOM   9263  H  HG13 . VAL B  1 175 ? 54.322  -48.880  4.214   1.00 48.09  ? 155 VAL B HG13 1 
ATOM   9264  H  HG21 . VAL B  1 175 ? 57.334  -47.368  4.096   1.00 46.42  ? 155 VAL B HG21 1 
ATOM   9265  H  HG22 . VAL B  1 175 ? 55.818  -47.073  4.967   1.00 47.33  ? 155 VAL B HG22 1 
ATOM   9266  H  HG23 . VAL B  1 175 ? 57.296  -47.495  5.871   1.00 46.68  ? 155 VAL B HG23 1 
ATOM   9267  N  N    . ILE B  1 176 ? 57.176  -49.155  8.216   1.00 42.43  ? 156 ILE B N    1 
ATOM   9268  C  CA   . ILE B  1 176 ? 58.200  -49.257  9.253   1.00 43.05  ? 156 ILE B CA   1 
ATOM   9269  C  C    . ILE B  1 176 ? 57.493  -49.897  10.446  1.00 43.24  ? 156 ILE B C    1 
ATOM   9270  O  O    . ILE B  1 176 ? 56.451  -49.386  10.848  1.00 42.96  ? 156 ILE B O    1 
ATOM   9271  C  CB   . ILE B  1 176 ? 58.861  -47.896  9.586   1.00 46.42  ? 156 ILE B CB   1 
ATOM   9272  C  CG1  . ILE B  1 176 ? 59.702  -47.420  8.379   1.00 47.42  ? 156 ILE B CG1  1 
ATOM   9273  C  CG2  . ILE B  1 176 ? 59.721  -48.016  10.851  1.00 45.79  ? 156 ILE B CG2  1 
ATOM   9274  C  CD1  . ILE B  1 176 ? 60.277  -45.983  8.497   1.00 55.00  ? 156 ILE B CD1  1 
ATOM   9275  H  H    . ILE B  1 176 ? 56.473  -48.460  8.452   1.00 43.62  ? 156 ILE B H    1 
ATOM   9276  H  HA   . ILE B  1 176 ? 59.006  -49.920  8.948   1.00 40.72  ? 156 ILE B HA   1 
ATOM   9277  H  HB   . ILE B  1 176 ? 58.069  -47.167  9.754   1.00 47.83  ? 156 ILE B HB   1 
ATOM   9278  H  HG12 . ILE B  1 176 ? 60.545  -48.101  8.267   1.00 47.91  ? 156 ILE B HG12 1 
ATOM   9279  H  HG13 . ILE B  1 176 ? 59.082  -47.449  7.485   1.00 46.60  ? 156 ILE B HG13 1 
ATOM   9280  H  HG21 . ILE B  1 176 ? 60.375  -47.152  10.949  1.00 46.97  ? 156 ILE B HG21 1 
ATOM   9281  H  HG22 . ILE B  1 176 ? 59.073  -48.043  11.727  1.00 48.34  ? 156 ILE B HG22 1 
ATOM   9282  H  HG23 . ILE B  1 176 ? 60.314  -48.927  10.814  1.00 44.62  ? 156 ILE B HG23 1 
ATOM   9283  H  HD11 . ILE B  1 176 ? 60.565  -45.632  7.508   1.00 54.88  ? 156 ILE B HD11 1 
ATOM   9284  H  HD12 . ILE B  1 176 ? 59.514  -45.331  8.921   1.00 55.13  ? 156 ILE B HD12 1 
ATOM   9285  H  HD13 . ILE B  1 176 ? 61.155  -46.000  9.141   1.00 55.10  ? 156 ILE B HD13 1 
ATOM   9286  N  N    . ASN B  1 177 ? 58.000  -51.056  10.938  1.00 38.19  ? 157 ASN B N    1 
ATOM   9287  C  CA   . ASN B  1 177 ? 57.406  -51.789  12.080  1.00 38.40  ? 157 ASN B CA   1 
ATOM   9288  C  C    . ASN B  1 177 ? 55.890  -52.057  11.845  1.00 41.94  ? 157 ASN B C    1 
ATOM   9289  O  O    . ASN B  1 177 ? 55.063  -51.774  12.686  1.00 41.23  ? 157 ASN B O    1 
ATOM   9290  C  CB   . ASN B  1 177 ? 57.644  -51.043  13.389  1.00 39.74  ? 157 ASN B CB   1 
ATOM   9291  C  CG   . ASN B  1 177 ? 59.104  -50.927  13.771  1.00 53.64  ? 157 ASN B CG   1 
ATOM   9292  O  OD1  . ASN B  1 177 ? 59.903  -51.847  13.554  1.00 49.51  ? 157 ASN B OD1  1 
ATOM   9293  N  ND2  . ASN B  1 177 ? 59.485  -49.828  14.404  1.00 44.08  ? 157 ASN B ND2  1 
ATOM   9294  H  H    . ASN B  1 177 ? 58.825  -51.515  10.568  1.00 35.92  ? 157 ASN B H    1 
ATOM   9295  H  HA   . ASN B  1 177 ? 57.886  -52.763  12.149  1.00 38.70  ? 157 ASN B HA   1 
ATOM   9296  H  HB2  . ASN B  1 177 ? 57.207  -50.049  13.322  1.00 38.45  ? 157 ASN B HB2  1 
ATOM   9297  H  HB3  . ASN B  1 177 ? 57.155  -51.588  14.195  1.00 41.37  ? 157 ASN B HB3  1 
ATOM   9298  H  HD21 . ASN B  1 177 ? 60.456  -49.711  14.675  1.00 43.94  ? 157 ASN B HD21 1 
ATOM   9299  H  HD22 . ASN B  1 177 ? 58.818  -49.091  14.612  1.00 45.26  ? 157 ASN B HD22 1 
ATOM   9300  N  N    . GLY B  1 178 ? 55.567  -52.586  10.664  1.00 39.17  ? 158 GLY B N    1 
ATOM   9301  C  CA   . GLY B  1 178 ? 54.209  -52.961  10.283  1.00 38.06  ? 158 GLY B CA   1 
ATOM   9302  C  C    . GLY B  1 178 ? 53.591  -54.108  11.055  1.00 43.22  ? 158 GLY B C    1 
ATOM   9303  O  O    . GLY B  1 178 ? 52.396  -54.356  10.925  1.00 45.63  ? 158 GLY B O    1 
ATOM   9304  H  H    . GLY B  1 178 ? 56.240  -52.721  9.920   1.00 38.59  ? 158 GLY B H    1 
ATOM   9305  H  HA2  . GLY B  1 178 ? 53.575  -52.091  10.433  1.00 37.79  ? 158 GLY B HA2  1 
ATOM   9306  H  HA3  . GLY B  1 178 ? 54.172  -53.215  9.226   1.00 37.36  ? 158 GLY B HA3  1 
ATOM   9307  N  N    . GLY B  1 179 ? 54.377  -54.811  11.857  1.00 38.48  ? 159 GLY B N    1 
ATOM   9308  C  CA   . GLY B  1 179 ? 53.847  -55.848  12.721  1.00 37.88  ? 159 GLY B CA   1 
ATOM   9309  C  C    . GLY B  1 179 ? 53.750  -57.256  12.149  1.00 40.22  ? 159 GLY B C    1 
ATOM   9310  O  O    . GLY B  1 179 ? 54.299  -57.578  11.092  1.00 38.48  ? 159 GLY B O    1 
ATOM   9311  H  H    . GLY B  1 179 ? 55.389  -54.742  11.900  1.00 38.43  ? 159 GLY B H    1 
ATOM   9312  H  HA2  . GLY B  1 179 ? 54.492  -55.903  13.596  1.00 37.53  ? 159 GLY B HA2  1 
ATOM   9313  H  HA3  . GLY B  1 179 ? 52.863  -55.558  13.084  1.00 36.03  ? 159 GLY B HA3  1 
ATOM   9314  N  N    . PHE B  1 180 ? 53.030  -58.113  12.904  1.00 38.69  ? 160 PHE B N    1 
ATOM   9315  C  CA   . PHE B  1 180 ? 52.928  -59.543  12.681  1.00 38.61  ? 160 PHE B CA   1 
ATOM   9316  C  C    . PHE B  1 180 ? 52.081  -59.920  11.466  1.00 41.43  ? 160 PHE B C    1 
ATOM   9317  O  O    . PHE B  1 180 ? 50.944  -59.500  11.348  1.00 41.66  ? 160 PHE B O    1 
ATOM   9318  C  CB   . PHE B  1 180 ? 52.344  -60.203  13.946  1.00 41.96  ? 160 PHE B CB   1 
ATOM   9319  C  CG   . PHE B  1 180 ? 52.273  -61.717  13.945  1.00 43.67  ? 160 PHE B CG   1 
ATOM   9320  C  CD1  . PHE B  1 180 ? 53.428  -62.482  13.841  1.00 46.27  ? 160 PHE B CD1  1 
ATOM   9321  C  CD2  . PHE B  1 180 ? 51.073  -62.373  14.168  1.00 47.34  ? 160 PHE B CD2  1 
ATOM   9322  C  CE1  . PHE B  1 180 ? 53.380  -63.875  13.897  1.00 46.60  ? 160 PHE B CE1  1 
ATOM   9323  C  CE2  . PHE B  1 180 ? 51.021  -63.783  14.215  1.00 50.48  ? 160 PHE B CE2  1 
ATOM   9324  C  CZ   . PHE B  1 180 ? 52.179  -64.519  14.121  1.00 47.66  ? 160 PHE B CZ   1 
ATOM   9325  H  H    . PHE B  1 180 ? 52.476  -57.804  13.696  1.00 39.42  ? 160 PHE B H    1 
ATOM   9326  H  HA   . PHE B  1 180 ? 53.927  -59.942  12.521  1.00 38.08  ? 160 PHE B HA   1 
ATOM   9327  H  HB2  . PHE B  1 180 ? 52.961  -59.897  14.788  1.00 42.23  ? 160 PHE B HB2  1 
ATOM   9328  H  HB3  . PHE B  1 180 ? 51.335  -59.822  14.099  1.00 42.86  ? 160 PHE B HB3  1 
ATOM   9329  H  HD1  . PHE B  1 180 ? 54.386  -61.983  13.710  1.00 46.74  ? 160 PHE B HD1  1 
ATOM   9330  H  HD2  . PHE B  1 180 ? 50.154  -61.798  14.270  1.00 47.18  ? 160 PHE B HD2  1 
ATOM   9331  H  HE1  . PHE B  1 180 ? 54.311  -64.435  13.840  1.00 45.38  ? 160 PHE B HE1  1 
ATOM   9332  H  HE2  . PHE B  1 180 ? 50.079  -64.299  14.389  1.00 50.48  ? 160 PHE B HE2  1 
ATOM   9333  H  HZ   . PHE B  1 180 ? 52.129  -65.606  14.170  1.00 46.94  ? 160 PHE B HZ   1 
ATOM   9334  N  N    . ILE B  1 181 ? 52.621  -60.761  10.589  1.00 38.05  ? 161 ILE B N    1 
ATOM   9335  C  CA   . ILE B  1 181 ? 51.867  -61.274  9.468   1.00 36.68  ? 161 ILE B CA   1 
ATOM   9336  C  C    . ILE B  1 181 ? 51.427  -62.743  9.830   1.00 38.73  ? 161 ILE B C    1 
ATOM   9337  O  O    . ILE B  1 181 ? 52.241  -63.650  9.970   1.00 35.95  ? 161 ILE B O    1 
ATOM   9338  C  CB   . ILE B  1 181 ? 52.682  -61.158  8.171   1.00 37.90  ? 161 ILE B CB   1 
ATOM   9339  C  CG1  . ILE B  1 181 ? 53.018  -59.651  7.919   1.00 38.36  ? 161 ILE B CG1  1 
ATOM   9340  C  CG2  . ILE B  1 181 ? 51.897  -61.805  7.016   1.00 33.95  ? 161 ILE B CG2  1 
ATOM   9341  C  CD1  . ILE B  1 181 ? 53.850  -59.327  6.514   1.00 37.36  ? 161 ILE B CD1  1 
ATOM   9342  H  H    . ILE B  1 181 ? 53.578  -61.098  10.621  1.00 38.14  ? 161 ILE B H    1 
ATOM   9343  H  HA   . ILE B  1 181 ? 50.972  -60.673  9.311   1.00 36.65  ? 161 ILE B HA   1 
ATOM   9344  H  HB   . ILE B  1 181 ? 53.622  -61.690  8.303   1.00 37.95  ? 161 ILE B HB   1 
ATOM   9345  H  HG12 . ILE B  1 181 ? 52.087  -59.088  7.900   1.00 38.06  ? 161 ILE B HG12 1 
ATOM   9346  H  HG13 . ILE B  1 181 ? 53.633  -59.295  8.745   1.00 36.75  ? 161 ILE B HG13 1 
ATOM   9347  H  HG21 . ILE B  1 181 ? 52.451  -61.672  6.089   1.00 34.27  ? 161 ILE B HG21 1 
ATOM   9348  H  HG22 . ILE B  1 181 ? 51.768  -62.872  7.186   1.00 33.80  ? 161 ILE B HG22 1 
ATOM   9349  H  HG23 . ILE B  1 181 ? 50.920  -61.329  6.944   1.00 33.73  ? 161 ILE B HG23 1 
ATOM   9350  H  HD11 . ILE B  1 181 ? 54.136  -58.276  6.496   1.00 37.26  ? 161 ILE B HD11 1 
ATOM   9351  H  HD12 . ILE B  1 181 ? 54.745  -59.944  6.471   1.00 37.78  ? 161 ILE B HD12 1 
ATOM   9352  H  HD13 . ILE B  1 181 ? 53.214  -59.544  5.658   1.00 36.71  ? 161 ILE B HD13 1 
ATOM   9353  N  N    . VAL B  1 182 ? 50.119  -62.924  9.972   1.00 35.98  ? 162 VAL B N    1 
ATOM   9354  C  CA   . VAL B  1 182 ? 49.519  -64.182  10.360  1.00 36.63  ? 162 VAL B CA   1 
ATOM   9355  C  C    . VAL B  1 182 ? 49.533  -65.122  9.158   1.00 37.53  ? 162 VAL B C    1 
ATOM   9356  O  O    . VAL B  1 182 ? 48.916  -64.812  8.146   1.00 34.53  ? 162 VAL B O    1 
ATOM   9357  C  CB   . VAL B  1 182 ? 48.083  -63.982  10.904  1.00 41.49  ? 162 VAL B CB   1 
ATOM   9358  C  CG1  . VAL B  1 182 ? 47.372  -65.317  11.113  1.00 42.08  ? 162 VAL B CG1  1 
ATOM   9359  C  CG2  . VAL B  1 182 ? 48.105  -63.194  12.201  1.00 43.17  ? 162 VAL B CG2  1 
ATOM   9360  H  H    . VAL B  1 182 ? 49.439  -62.193  9.786   1.00 36.29  ? 162 VAL B H    1 
ATOM   9361  H  HA   . VAL B  1 182 ? 50.115  -64.619  11.161  1.00 38.89  ? 162 VAL B HA   1 
ATOM   9362  H  HB   . VAL B  1 182 ? 47.500  -63.424  10.171  1.00 40.40  ? 162 VAL B HB   1 
ATOM   9363  H  HG11 . VAL B  1 182 ? 46.565  -65.172  11.828  1.00 42.48  ? 162 VAL B HG11 1 
ATOM   9364  H  HG12 . VAL B  1 182 ? 46.953  -65.662  10.168  1.00 41.99  ? 162 VAL B HG12 1 
ATOM   9365  H  HG13 . VAL B  1 182 ? 48.082  -66.049  11.493  1.00 42.54  ? 162 VAL B HG13 1 
ATOM   9366  H  HG21 . VAL B  1 182 ? 47.080  -62.924  12.448  1.00 44.05  ? 162 VAL B HG21 1 
ATOM   9367  H  HG22 . VAL B  1 182 ? 48.509  -63.833  12.982  1.00 42.75  ? 162 VAL B HG22 1 
ATOM   9368  H  HG23 . VAL B  1 182 ? 48.708  -62.296  12.080  1.00 43.67  ? 162 VAL B HG23 1 
ATOM   9369  N  N    . GLY B  1 183 ? 50.085  -66.302  9.335   1.00 34.65  ? 163 GLY B N    1 
ATOM   9370  C  CA   . GLY B  1 183 ? 50.168  -67.214  8.220   1.00 34.19  ? 163 GLY B CA   1 
ATOM   9371  C  C    . GLY B  1 183 ? 50.071  -68.688  8.498   1.00 39.54  ? 163 GLY B C    1 
ATOM   9372  O  O    . GLY B  1 183 ? 50.059  -69.142  9.648   1.00 39.28  ? 163 GLY B O    1 
ATOM   9373  H  H    . GLY B  1 183 ? 50.468  -66.659  10.205  1.00 34.86  ? 163 GLY B H    1 
ATOM   9374  H  HA2  . GLY B  1 183 ? 49.347  -67.003  7.540   1.00 33.89  ? 163 GLY B HA2  1 
ATOM   9375  H  HA3  . GLY B  1 183 ? 51.107  -67.022  7.702   1.00 32.91  ? 163 GLY B HA3  1 
ATOM   9376  N  N    . THR B  1 184 ? 50.020  -69.443  7.396   1.00 34.37  ? 164 THR B N    1 
ATOM   9377  C  CA   . THR B  1 184 ? 49.921  -70.891  7.438   1.00 35.63  ? 164 THR B CA   1 
ATOM   9378  C  C    . THR B  1 184 ? 50.543  -71.508  6.233   1.00 36.35  ? 164 THR B C    1 
ATOM   9379  O  O    . THR B  1 184 ? 50.971  -70.821  5.305   1.00 36.97  ? 164 THR B O    1 
ATOM   9380  C  CB   . THR B  1 184 ? 48.447  -71.370  7.541   1.00 47.81  ? 164 THR B CB   1 
ATOM   9381  O  OG1  . THR B  1 184 ? 48.414  -72.766  7.867   1.00 42.89  ? 164 THR B OG1  1 
ATOM   9382  C  CG2  . THR B  1 184 ? 47.661  -71.174  6.247   1.00 40.60  ? 164 THR B CG2  1 
ATOM   9383  H  H    . THR B  1 184 ? 50.042  -69.067  6.453   1.00 33.81  ? 164 THR B H    1 
ATOM   9384  H  HA   . THR B  1 184 ? 50.456  -71.284  8.299   1.00 36.78  ? 164 THR B HA   1 
ATOM   9385  H  HB   . THR B  1 184 ? 47.965  -70.818  8.346   1.00 49.05  ? 164 THR B HB   1 
ATOM   9386  H  HG1  . THR B  1 184 ? 48.394  -72.863  8.854   1.00 43.52  ? 164 THR B HG1  1 
ATOM   9387  H  HG21 . THR B  1 184 ? 46.640  -71.521  6.388   1.00 40.30  ? 164 THR B HG21 1 
ATOM   9388  H  HG22 . THR B  1 184 ? 47.659  -70.116  5.993   1.00 41.16  ? 164 THR B HG22 1 
ATOM   9389  H  HG23 . THR B  1 184 ? 48.088  -71.743  5.424   1.00 39.59  ? 164 THR B HG23 1 
ATOM   9390  N  N    . ILE B  1 185 ? 50.602  -72.832  6.278   1.00 34.45  ? 165 ILE B N    1 
ATOM   9391  C  CA   . ILE B  1 185 ? 51.026  -73.714  5.193   1.00 34.29  ? 165 ILE B CA   1 
ATOM   9392  C  C    . ILE B  1 185 ? 49.835  -74.579  4.877   1.00 40.24  ? 165 ILE B C    1 
ATOM   9393  O  O    . ILE B  1 185 ? 49.198  -75.072  5.811   1.00 40.43  ? 165 ILE B O    1 
ATOM   9394  C  CB   . ILE B  1 185 ? 52.232  -74.569  5.634   1.00 37.25  ? 165 ILE B CB   1 
ATOM   9395  C  CG1  . ILE B  1 185 ? 53.386  -73.702  6.200   1.00 37.30  ? 165 ILE B CG1  1 
ATOM   9396  C  CG2  . ILE B  1 185 ? 52.696  -75.487  4.517   1.00 34.83  ? 165 ILE B CG2  1 
ATOM   9397  C  CD1  . ILE B  1 185 ? 53.582  -73.928  7.665   1.00 34.88  ? 165 ILE B CD1  1 
ATOM   9398  H  H    . ILE B  1 185 ? 50.364  -73.361  7.108   1.00 34.41  ? 165 ILE B H    1 
ATOM   9399  H  HA   . ILE B  1 185 ? 51.304  -73.146  4.309   1.00 31.65  ? 165 ILE B HA   1 
ATOM   9400  H  HB   . ILE B  1 185 ? 51.860  -75.192  6.444   1.00 38.24  ? 165 ILE B HB   1 
ATOM   9401  H  HG12 . ILE B  1 185 ? 54.316  -73.941  5.689   1.00 36.35  ? 165 ILE B HG12 1 
ATOM   9402  H  HG13 . ILE B  1 185 ? 53.163  -72.649  6.047   1.00 36.71  ? 165 ILE B HG13 1 
ATOM   9403  H  HG21 . ILE B  1 185 ? 53.708  -75.826  4.725   1.00 34.78  ? 165 ILE B HG21 1 
ATOM   9404  H  HG22 . ILE B  1 185 ? 52.033  -76.349  4.477   1.00 35.09  ? 165 ILE B HG22 1 
ATOM   9405  H  HG23 . ILE B  1 185 ? 52.663  -74.948  3.573   1.00 34.21  ? 165 ILE B HG23 1 
ATOM   9406  H  HD11 . ILE B  1 185 ? 54.480  -73.398  7.977   1.00 35.35  ? 165 ILE B HD11 1 
ATOM   9407  H  HD12 . ILE B  1 185 ? 52.713  -73.542  8.196   1.00 36.01  ? 165 ILE B HD12 1 
ATOM   9408  H  HD13 . ILE B  1 185 ? 53.690  -74.994  7.854   1.00 34.00  ? 165 ILE B HD13 1 
ATOM   9409  N  N    . ILE B  1 186 ? 49.536  -74.809  3.599   1.00 38.45  ? 166 ILE B N    1 
ATOM   9410  C  CA   . ILE B  1 186 ? 48.428  -75.700  3.265   1.00 38.83  ? 166 ILE B CA   1 
ATOM   9411  C  C    . ILE B  1 186 ? 48.831  -77.137  3.624   1.00 41.39  ? 166 ILE B C    1 
ATOM   9412  O  O    . ILE B  1 186 ? 49.862  -77.630  3.163   1.00 39.03  ? 166 ILE B O    1 
ATOM   9413  C  CB   . ILE B  1 186 ? 47.995  -75.580  1.779   1.00 40.86  ? 166 ILE B CB   1 
ATOM   9414  C  CG1  . ILE B  1 186 ? 47.483  -74.150  1.471   1.00 41.36  ? 166 ILE B CG1  1 
ATOM   9415  C  CG2  . ILE B  1 186 ? 46.927  -76.631  1.444   1.00 43.26  ? 166 ILE B CG2  1 
ATOM   9416  C  CD1  . ILE B  1 186 ? 46.292  -73.652  2.428   1.00 53.05  ? 166 ILE B CD1  1 
ATOM   9417  H  H    . ILE B  1 186 ? 50.032  -74.419  2.804   1.00 37.96  ? 166 ILE B H    1 
ATOM   9418  H  HA   . ILE B  1 186 ? 47.570  -75.438  3.880   1.00 39.65  ? 166 ILE B HA   1 
ATOM   9419  H  HB   . ILE B  1 186 ? 48.872  -75.772  1.161   1.00 40.23  ? 166 ILE B HB   1 
ATOM   9420  H  HG12 . ILE B  1 186 ? 48.314  -73.455  1.579   1.00 41.09  ? 166 ILE B HG12 1 
ATOM   9421  H  HG13 . ILE B  1 186 ? 47.118  -74.112  0.447   1.00 40.59  ? 166 ILE B HG13 1 
ATOM   9422  H  HG21 . ILE B  1 186 ? 46.394  -76.327  0.545   1.00 44.26  ? 166 ILE B HG21 1 
ATOM   9423  H  HG22 . ILE B  1 186 ? 47.416  -77.587  1.255   1.00 44.30  ? 166 ILE B HG22 1 
ATOM   9424  H  HG23 . ILE B  1 186 ? 46.229  -76.728  2.274   1.00 42.67  ? 166 ILE B HG23 1 
ATOM   9425  H  HD11 . ILE B  1 186 ? 45.817  -72.776  1.991   1.00 53.57  ? 166 ILE B HD11 1 
ATOM   9426  H  HD12 . ILE B  1 186 ? 45.558  -74.448  2.542   1.00 53.47  ? 166 ILE B HD12 1 
ATOM   9427  H  HD13 . ILE B  1 186 ? 46.706  -73.382  3.397   1.00 53.34  ? 166 ILE B HD13 1 
ATOM   9428  N  N    . LYS B  1 187 ? 48.042  -77.756  4.496   1.00 40.37  ? 167 LYS B N    1 
ATOM   9429  C  CA   . LYS B  1 187 ? 48.191  -79.146  4.942   1.00 39.71  ? 167 LYS B CA   1 
ATOM   9430  C  C    . LYS B  1 187 ? 46.928  -79.884  4.542   1.00 45.23  ? 167 LYS B C    1 
ATOM   9431  O  O    . LYS B  1 187 ? 45.858  -79.282  4.668   1.00 45.90  ? 167 LYS B O    1 
ATOM   9432  C  CB   . LYS B  1 187 ? 48.403  -79.254  6.463   1.00 39.59  ? 167 LYS B CB   1 
ATOM   9433  C  CG   . LYS B  1 187 ? 49.620  -78.523  6.997   1.00 44.48  ? 167 LYS B CG   1 
ATOM   9434  C  CD   . LYS B  1 187 ? 50.935  -79.066  6.473   1.00 30.04  ? 167 LYS B CD   1 
ATOM   9435  C  CE   . LYS B  1 187 ? 52.070  -78.335  7.108   1.00 31.77  ? 167 LYS B CE   1 
ATOM   9436  N  NZ   . LYS B  1 187 ? 53.397  -78.815  6.724   1.00 43.14  ? 167 LYS B NZ   1 
ATOM   9437  H  H    . LYS B  1 187 ? 47.246  -77.310  4.939   1.00 41.41  ? 167 LYS B H    1 
ATOM   9438  H  HA   . LYS B  1 187 ? 49.064  -79.580  4.462   1.00 40.55  ? 167 LYS B HA   1 
ATOM   9439  H  HB2  . LYS B  1 187 ? 47.521  -78.852  6.959   1.00 39.61  ? 167 LYS B HB2  1 
ATOM   9440  H  HB3  . LYS B  1 187 ? 48.525  -80.304  6.722   1.00 38.81  ? 167 LYS B HB3  1 
ATOM   9441  H  HG2  . LYS B  1 187 ? 49.562  -77.468  6.727   1.00 45.32  ? 167 LYS B HG2  1 
ATOM   9442  H  HG3  . LYS B  1 187 ? 49.627  -78.617  8.082   1.00 45.04  ? 167 LYS B HG3  1 
ATOM   9443  H  HD2  . LYS B  1 187 ? 51.018  -80.124  6.706   1.00 31.07  ? 167 LYS B HD2  1 
ATOM   9444  H  HD3  . LYS B  1 187 ? 50.999  -78.893  5.401   1.00 30.35  ? 167 LYS B HD3  1 
ATOM   9445  H  HE2  . LYS B  1 187 ? 52.004  -77.287  6.823   1.00 32.68  ? 167 LYS B HE2  1 
ATOM   9446  H  HE3  . LYS B  1 187 ? 51.976  -78.434  8.187   1.00 31.70  ? 167 LYS B HE3  1 
ATOM   9447  H  HZ1  . LYS B  1 187 ? 53.833  -79.295  7.505   1.00 42.75  ? 167 LYS B HZ1  1 
ATOM   9448  H  HZ2  . LYS B  1 187 ? 53.323  -79.462  5.947   1.00 43.33  ? 167 LYS B HZ2  1 
ATOM   9449  H  HZ3  . LYS B  1 187 ? 53.980  -78.032  6.447   1.00 42.41  ? 167 LYS B HZ3  1 
ATOM   9450  N  N    . PRO B  1 188 ? 46.946  -81.151  4.084   1.00 41.15  ? 168 PRO B N    1 
ATOM   9451  C  CA   . PRO B  1 188 ? 48.084  -82.069  3.875   1.00 40.41  ? 168 PRO B CA   1 
ATOM   9452  C  C    . PRO B  1 188 ? 49.251  -81.510  3.060   1.00 41.50  ? 168 PRO B C    1 
ATOM   9453  O  O    . PRO B  1 188 ? 49.036  -80.707  2.165   1.00 39.30  ? 168 PRO B O    1 
ATOM   9454  C  CB   . PRO B  1 188 ? 47.456  -83.203  3.056   1.00 41.50  ? 168 PRO B CB   1 
ATOM   9455  C  CG   . PRO B  1 188 ? 46.030  -83.221  3.440   1.00 45.44  ? 168 PRO B CG   1 
ATOM   9456  C  CD   . PRO B  1 188 ? 45.655  -81.818  3.795   1.00 41.52  ? 168 PRO B CD   1 
ATOM   9457  H  HA   . PRO B  1 188 ? 48.442  -82.460  4.826   1.00 41.17  ? 168 PRO B HA   1 
ATOM   9458  H  HB2  . PRO B  1 188 ? 47.549  -82.989  1.992   1.00 40.82  ? 168 PRO B HB2  1 
ATOM   9459  H  HB3  . PRO B  1 188 ? 47.956  -84.136  3.313   1.00 41.13  ? 168 PRO B HB3  1 
ATOM   9460  H  HG2  . PRO B  1 188 ? 45.424  -83.578  2.609   1.00 43.62  ? 168 PRO B HG2  1 
ATOM   9461  H  HG3  . PRO B  1 188 ? 45.914  -83.870  4.307   1.00 47.55  ? 168 PRO B HG3  1 
ATOM   9462  H  HD2  . PRO B  1 188 ? 45.142  -81.327  2.972   1.00 41.62  ? 168 PRO B HD2  1 
ATOM   9463  H  HD3  . PRO B  1 188 ? 45.031  -81.838  4.686   1.00 40.85  ? 168 PRO B HD3  1 
ATOM   9464  N  N    . LYS B  1 189 ? 50.480  -81.963  3.368   1.00 38.73  ? 169 LYS B N    1 
ATOM   9465  C  CA   . LYS B  1 189 ? 51.704  -81.548  2.666   1.00 36.92  ? 169 LYS B CA   1 
ATOM   9466  C  C    . LYS B  1 189 ? 51.575  -81.831  1.166   1.00 40.25  ? 169 LYS B C    1 
ATOM   9467  O  O    . LYS B  1 189 ? 51.995  -81.027  0.351   1.00 40.58  ? 169 LYS B O    1 
ATOM   9468  C  CB   . LYS B  1 189 ? 52.942  -82.257  3.272   1.00 38.92  ? 169 LYS B CB   1 
ATOM   9469  C  CG   . LYS B  1 189 ? 54.248  -82.069  2.481   1.00 42.69  ? 169 LYS B CG   1 
ATOM   9470  C  CD   . LYS B  1 189 ? 55.446  -82.817  3.072   1.00 47.31  ? 169 LYS B CD   1 
ATOM   9471  C  CE   . LYS B  1 189 ? 55.715  -82.549  4.505   1.00 45.19  ? 169 LYS B CE   1 
ATOM   9472  N  NZ   . LYS B  1 189 ? 55.958  -81.122  4.771   1.00 45.04  ? 169 LYS B NZ   1 
ATOM   9473  H  H    . LYS B  1 189 ? 50.651  -82.612  4.129   1.00 39.49  ? 169 LYS B H    1 
ATOM   9474  H  HA   . LYS B  1 189 ? 51.814  -80.472  2.777   1.00 35.41  ? 169 LYS B HA   1 
ATOM   9475  H  HB2  . LYS B  1 189 ? 53.080  -81.858  4.276   1.00 39.27  ? 169 LYS B HB2  1 
ATOM   9476  H  HB3  . LYS B  1 189 ? 52.753  -83.326  3.332   1.00 38.61  ? 169 LYS B HB3  1 
ATOM   9477  H  HG2  . LYS B  1 189 ? 54.112  -82.465  1.476   1.00 42.53  ? 169 LYS B HG2  1 
ATOM   9478  H  HG3  . LYS B  1 189 ? 54.507  -81.014  2.420   1.00 42.65  ? 169 LYS B HG3  1 
ATOM   9479  H  HD2  . LYS B  1 189 ? 55.288  -83.890  2.984   1.00 48.87  ? 169 LYS B HD2  1 
ATOM   9480  H  HD3  . LYS B  1 189 ? 56.343  -82.547  2.517   1.00 47.04  ? 169 LYS B HD3  1 
ATOM   9481  H  HE2  . LYS B  1 189 ? 54.892  -82.895  5.126   1.00 45.17  ? 169 LYS B HE2  1 
ATOM   9482  H  HE3  . LYS B  1 189 ? 56.623  -83.084  4.767   1.00 45.61  ? 169 LYS B HE3  1 
ATOM   9483  H  HZ1  . LYS B  1 189 ? 56.506  -81.015  5.618   1.00 44.59  ? 169 LYS B HZ1  1 
ATOM   9484  H  HZ2  . LYS B  1 189 ? 56.462  -80.700  3.997   1.00 45.62  ? 169 LYS B HZ2  1 
ATOM   9485  H  HZ3  . LYS B  1 189 ? 55.071  -80.644  4.887   1.00 45.17  ? 169 LYS B HZ3  1 
ATOM   9486  N  N    . LEU B  1 190 ? 50.972  -82.958  0.821   1.00 37.39  ? 170 LEU B N    1 
ATOM   9487  C  CA   . LEU B  1 190 ? 50.641  -83.372  -0.540  1.00 35.80  ? 170 LEU B CA   1 
ATOM   9488  C  C    . LEU B  1 190 ? 49.365  -84.196  -0.433  1.00 40.44  ? 170 LEU B C    1 
ATOM   9489  O  O    . LEU B  1 190 ? 49.136  -84.807  0.605   1.00 40.35  ? 170 LEU B O    1 
ATOM   9490  C  CB   . LEU B  1 190 ? 51.782  -84.179  -1.193  1.00 35.59  ? 170 LEU B CB   1 
ATOM   9491  C  CG   . LEU B  1 190 ? 53.032  -83.408  -1.627  1.00 38.53  ? 170 LEU B CG   1 
ATOM   9492  C  CD1  . LEU B  1 190 ? 54.156  -84.360  -1.994  1.00 39.86  ? 170 LEU B CD1  1 
ATOM   9493  C  CD2  . LEU B  1 190 ? 52.719  -82.462  -2.794  1.00 37.09  ? 170 LEU B CD2  1 
ATOM   9494  H  H    . LEU B  1 190 ? 50.675  -83.643  1.508   1.00 38.27  ? 170 LEU B H    1 
ATOM   9495  H  HA   . LEU B  1 190 ? 50.423  -82.495  -1.146  1.00 36.08  ? 170 LEU B HA   1 
ATOM   9496  H  HB2  . LEU B  1 190 ? 52.109  -84.940  -0.485  1.00 37.06  ? 170 LEU B HB2  1 
ATOM   9497  H  HB3  . LEU B  1 190 ? 51.378  -84.680  -2.070  1.00 35.19  ? 170 LEU B HB3  1 
ATOM   9498  H  HG   . LEU B  1 190 ? 53.400  -82.808  -0.798  1.00 38.32  ? 170 LEU B HG   1 
ATOM   9499  H  HD11 . LEU B  1 190 ? 55.010  -83.789  -2.356  1.00 39.97  ? 170 LEU B HD11 1 
ATOM   9500  H  HD12 . LEU B  1 190 ? 54.444  -84.928  -1.113  1.00 39.86  ? 170 LEU B HD12 1 
ATOM   9501  H  HD13 . LEU B  1 190 ? 53.802  -85.029  -2.778  1.00 39.72  ? 170 LEU B HD13 1 
ATOM   9502  H  HD21 . LEU B  1 190 ? 53.652  -82.036  -3.160  1.00 35.08  ? 170 LEU B HD21 1 
ATOM   9503  H  HD22 . LEU B  1 190 ? 52.228  -83.033  -3.581  1.00 37.10  ? 170 LEU B HD22 1 
ATOM   9504  H  HD23 . LEU B  1 190 ? 52.062  -81.669  -2.447  1.00 36.66  ? 170 LEU B HD23 1 
ATOM   9505  N  N    . GLY B  1 191 ? 48.523  -84.156  -1.447  1.00 38.25  ? 171 GLY B N    1 
ATOM   9506  C  CA   . GLY B  1 191 ? 47.295  -84.940  -1.482  1.00 38.45  ? 171 GLY B CA   1 
ATOM   9507  C  C    . GLY B  1 191 ? 46.040  -84.174  -1.826  1.00 41.53  ? 171 GLY B C    1 
ATOM   9508  O  O    . GLY B  1 191 ? 45.086  -84.776  -2.324  1.00 42.64  ? 171 GLY B O    1 
ATOM   9509  H  H    . GLY B  1 191 ? 48.638  -83.543  -2.246  1.00 38.69  ? 171 GLY B H    1 
ATOM   9510  H  HA2  . GLY B  1 191 ? 47.415  -85.728  -2.221  1.00 37.50  ? 171 GLY B HA2  1 
ATOM   9511  H  HA3  . GLY B  1 191 ? 47.119  -85.427  -0.525  1.00 40.68  ? 171 GLY B HA3  1 
ATOM   9512  N  N    . LEU B  1 192 ? 45.994  -82.863  -1.547  1.00 38.26  ? 172 LEU B N    1 
ATOM   9513  C  CA   . LEU B  1 192 ? 44.803  -82.085  -1.912  1.00 37.90  ? 172 LEU B CA   1 
ATOM   9514  C  C    . LEU B  1 192 ? 44.794  -81.844  -3.420  1.00 40.22  ? 172 LEU B C    1 
ATOM   9515  O  O    . LEU B  1 192 ? 45.816  -81.460  -3.997  1.00 37.26  ? 172 LEU B O    1 
ATOM   9516  C  CB   . LEU B  1 192 ? 44.701  -80.747  -1.167  1.00 36.47  ? 172 LEU B CB   1 
ATOM   9517  C  CG   . LEU B  1 192 ? 44.463  -80.821  0.325   1.00 41.74  ? 172 LEU B CG   1 
ATOM   9518  C  CD1  . LEU B  1 192 ? 44.309  -79.430  0.922   1.00 43.71  ? 172 LEU B CD1  1 
ATOM   9519  C  CD2  . LEU B  1 192 ? 43.213  -81.624  0.653   1.00 44.99  ? 172 LEU B CD2  1 
ATOM   9520  H  H    . LEU B  1 192 ? 46.717  -82.325  -1.082  1.00 37.69  ? 172 LEU B H    1 
ATOM   9521  H  HA   . LEU B  1 192 ? 43.912  -82.659  -1.663  1.00 39.47  ? 172 LEU B HA   1 
ATOM   9522  H  HB2  . LEU B  1 192 ? 45.627  -80.197  -1.326  1.00 36.25  ? 172 LEU B HB2  1 
ATOM   9523  H  HB3  . LEU B  1 192 ? 43.872  -80.180  -1.588  1.00 34.73  ? 172 LEU B HB3  1 
ATOM   9524  H  HG   . LEU B  1 192 ? 45.326  -81.299  0.784   1.00 41.32  ? 172 LEU B HG   1 
ATOM   9525  H  HD11 . LEU B  1 192 ? 44.258  -79.496  2.008   1.00 43.57  ? 172 LEU B HD11 1 
ATOM   9526  H  HD12 . LEU B  1 192 ? 45.158  -78.816  0.626   1.00 43.58  ? 172 LEU B HD12 1 
ATOM   9527  H  HD13 . LEU B  1 192 ? 43.384  -78.995  0.548   1.00 44.20  ? 172 LEU B HD13 1 
ATOM   9528  H  HD21 . LEU B  1 192 ? 42.895  -81.397  1.670   1.00 45.53  ? 172 LEU B HD21 1 
ATOM   9529  H  HD22 . LEU B  1 192 ? 42.421  -81.361  -0.046  1.00 44.40  ? 172 LEU B HD22 1 
ATOM   9530  H  HD23 . LEU B  1 192 ? 43.440  -82.687  0.580   1.00 45.23  ? 172 LEU B HD23 1 
ATOM   9531  N  N    . ARG B  1 193 ? 43.637  -82.069  -4.053  1.00 36.27  ? 173 ARG B N    1 
ATOM   9532  C  CA   . ARG B  1 193 ? 43.451  -81.799  -5.473  1.00 35.27  ? 173 ARG B CA   1 
ATOM   9533  C  C    . ARG B  1 193 ? 43.188  -80.283  -5.583  1.00 38.12  ? 173 ARG B C    1 
ATOM   9534  O  O    . ARG B  1 193 ? 43.033  -79.648  -4.536  1.00 36.54  ? 173 ARG B O    1 
ATOM   9535  C  CB   . ARG B  1 193 ? 42.347  -82.704  -6.065  1.00 37.27  ? 173 ARG B CB   1 
ATOM   9536  C  CG   . ARG B  1 193 ? 42.858  -84.155  -6.229  1.00 52.51  ? 173 ARG B CG   1 
ATOM   9537  C  CD   . ARG B  1 193 ? 41.786  -85.210  -6.076  1.00 72.78  ? 173 ARG B CD   1 
ATOM   9538  N  NE   . ARG B  1 193 ? 41.217  -85.242  -4.730  1.00 77.73  ? 173 ARG B NE   1 
ATOM   9539  C  CZ   . ARG B  1 193 ? 40.203  -86.017  -4.352  1.00 99.22  ? 173 ARG B CZ   1 
ATOM   9540  N  NH1  . ARG B  1 193 ? 39.631  -86.848  -5.218  1.00 93.56  ? 173 ARG B NH1  1 
ATOM   9541  N  NH2  . ARG B  1 193 ? 39.751  -85.967  -3.104  1.00 89.70  ? 173 ARG B NH2  1 
ATOM   9542  H  H    . ARG B  1 193 ? 42.810  -82.443  -3.597  1.00 37.47  ? 173 ARG B H    1 
ATOM   9543  H  HA   . ARG B  1 193 ? 44.373  -82.033  -6.003  1.00 35.43  ? 173 ARG B HA   1 
ATOM   9544  H  HB2  . ARG B  1 193 ? 41.480  -82.701  -5.406  1.00 37.13  ? 173 ARG B HB2  1 
ATOM   9545  H  HB3  . ARG B  1 193 ? 42.057  -82.352  -7.052  1.00 36.46  ? 173 ARG B HB3  1 
ATOM   9546  H  HG2  . ARG B  1 193 ? 43.253  -84.272  -7.236  1.00 52.35  ? 173 ARG B HG2  1 
ATOM   9547  H  HG3  . ARG B  1 193 ? 43.642  -84.362  -5.500  1.00 51.99  ? 173 ARG B HG3  1 
ATOM   9548  H  HD2  . ARG B  1 193 ? 40.984  -84.991  -6.778  1.00 73.19  ? 173 ARG B HD2  1 
ATOM   9549  H  HD3  . ARG B  1 193 ? 42.218  -86.188  -6.288  1.00 73.09  ? 173 ARG B HD3  1 
ATOM   9550  H  HE   . ARG B  1 193 ? 41.634  -84.631  -4.036  1.00 77.77  ? 173 ARG B HE   1 
ATOM   9551  H  HH11 . ARG B  1 193 ? 39.944  -86.919  -6.180  1.00 93.61  ? 173 ARG B HH11 1 
ATOM   9552  H  HH12 . ARG B  1 193 ? 38.857  -87.431  -4.916  1.00 94.18  ? 173 ARG B HH12 1 
ATOM   9553  H  HH21 . ARG B  1 193 ? 40.179  -85.342  -2.428  1.00 89.47  ? 173 ARG B HH21 1