data_5HF5
# 
_entry.id   5HF5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5HF5         
WWPDB D_1000216487 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 5HF6 PDB . 
unspecified 5HF8 PDB . 
unspecified 5HF9 PDB . 
unspecified 5HFA PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5HF5 
_pdbx_database_status.recvd_initial_deposition_date   2016-01-06 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Franklin, M.F.' 1 
'Rudolph, M.J.'  2 
'Ginter, C.'     3 
'Cassidy, M.S.'  4 
'Cheung, J.'     5 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Proteins 
_citation.journal_id_ASTM           PSFGEY 
_citation.journal_id_CSD            0867 
_citation.journal_id_ISSN           1097-0134 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            84 
_citation.language                  ? 
_citation.page_first                1246 
_citation.page_last                 1256 
_citation.title                     
'Structures of paraoxon-inhibited human acetylcholinesterase reveal perturbations of the acyl loop and the dimer interface.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1002/prot.25073 
_citation.pdbx_database_id_PubMed   27191504 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Franklin, M.C.' 1 ? 
primary 'Rudolph, M.J.'  2 ? 
primary 'Ginter, C.'     3 ? 
primary 'Cassidy, M.S.'  4 ? 
primary 'Cheung, J.'     5 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5HF5 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     104.917 
_cell.length_a_esd                 ? 
_cell.length_b                     104.917 
_cell.length_b_esd                 ? 
_cell.length_c                     322.798 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        12 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5HF5 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Acetylcholinesterase 59447.105 2   3.1.1.7 none 'catalytic domain, UNP residues 33 to 574' ? 
2 branched    man 
'2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose' 570.542   2 
?       ?    ?                                          ? 
3 non-polymer syn 'DIETHYL PHOSPHONATE' 138.102   2   ?       ?    ?                                          ? 
4 non-polymer syn 1,2-ETHANEDIOL 62.068    4   ?       ?    ?                                          ? 
5 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   1   ?       ?    ?                                          ? 
6 non-polymer syn 3,6,9,12,15,18,21-HEPTAOXATRICOSANE-1,23-DIOL 370.436   1   ?       ?    ? ? 
7 non-polymer syn 'NITRATE ION' 62.005    1   ?       ?    ?                                          ? 
8 water       nat water 18.015    706 ?       ?    ?                                          ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        AChE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFE
GTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLAL
PGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGM
GEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDF
HGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDV
VGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWA
NFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFE
GTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLAL
PGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGM
GEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDF
HGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDV
VGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWA
NFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ARG n 
1 3   GLU n 
1 4   ASP n 
1 5   ALA n 
1 6   GLU n 
1 7   LEU n 
1 8   LEU n 
1 9   VAL n 
1 10  THR n 
1 11  VAL n 
1 12  ARG n 
1 13  GLY n 
1 14  GLY n 
1 15  ARG n 
1 16  LEU n 
1 17  ARG n 
1 18  GLY n 
1 19  ILE n 
1 20  ARG n 
1 21  LEU n 
1 22  LYS n 
1 23  THR n 
1 24  PRO n 
1 25  GLY n 
1 26  GLY n 
1 27  PRO n 
1 28  VAL n 
1 29  SER n 
1 30  ALA n 
1 31  PHE n 
1 32  LEU n 
1 33  GLY n 
1 34  ILE n 
1 35  PRO n 
1 36  PHE n 
1 37  ALA n 
1 38  GLU n 
1 39  PRO n 
1 40  PRO n 
1 41  MET n 
1 42  GLY n 
1 43  PRO n 
1 44  ARG n 
1 45  ARG n 
1 46  PHE n 
1 47  LEU n 
1 48  PRO n 
1 49  PRO n 
1 50  GLU n 
1 51  PRO n 
1 52  LYS n 
1 53  GLN n 
1 54  PRO n 
1 55  TRP n 
1 56  SER n 
1 57  GLY n 
1 58  VAL n 
1 59  VAL n 
1 60  ASP n 
1 61  ALA n 
1 62  THR n 
1 63  THR n 
1 64  PHE n 
1 65  GLN n 
1 66  SER n 
1 67  VAL n 
1 68  CYS n 
1 69  TYR n 
1 70  GLN n 
1 71  TYR n 
1 72  VAL n 
1 73  ASP n 
1 74  THR n 
1 75  LEU n 
1 76  TYR n 
1 77  PRO n 
1 78  GLY n 
1 79  PHE n 
1 80  GLU n 
1 81  GLY n 
1 82  THR n 
1 83  GLU n 
1 84  MET n 
1 85  TRP n 
1 86  ASN n 
1 87  PRO n 
1 88  ASN n 
1 89  ARG n 
1 90  GLU n 
1 91  LEU n 
1 92  SER n 
1 93  GLU n 
1 94  ASP n 
1 95  CYS n 
1 96  LEU n 
1 97  TYR n 
1 98  LEU n 
1 99  ASN n 
1 100 VAL n 
1 101 TRP n 
1 102 THR n 
1 103 PRO n 
1 104 TYR n 
1 105 PRO n 
1 106 ARG n 
1 107 PRO n 
1 108 THR n 
1 109 SER n 
1 110 PRO n 
1 111 THR n 
1 112 PRO n 
1 113 VAL n 
1 114 LEU n 
1 115 VAL n 
1 116 TRP n 
1 117 ILE n 
1 118 TYR n 
1 119 GLY n 
1 120 GLY n 
1 121 GLY n 
1 122 PHE n 
1 123 TYR n 
1 124 SER n 
1 125 GLY n 
1 126 ALA n 
1 127 SER n 
1 128 SER n 
1 129 LEU n 
1 130 ASP n 
1 131 VAL n 
1 132 TYR n 
1 133 ASP n 
1 134 GLY n 
1 135 ARG n 
1 136 PHE n 
1 137 LEU n 
1 138 VAL n 
1 139 GLN n 
1 140 ALA n 
1 141 GLU n 
1 142 ARG n 
1 143 THR n 
1 144 VAL n 
1 145 LEU n 
1 146 VAL n 
1 147 SER n 
1 148 MET n 
1 149 ASN n 
1 150 TYR n 
1 151 ARG n 
1 152 VAL n 
1 153 GLY n 
1 154 ALA n 
1 155 PHE n 
1 156 GLY n 
1 157 PHE n 
1 158 LEU n 
1 159 ALA n 
1 160 LEU n 
1 161 PRO n 
1 162 GLY n 
1 163 SER n 
1 164 ARG n 
1 165 GLU n 
1 166 ALA n 
1 167 PRO n 
1 168 GLY n 
1 169 ASN n 
1 170 VAL n 
1 171 GLY n 
1 172 LEU n 
1 173 LEU n 
1 174 ASP n 
1 175 GLN n 
1 176 ARG n 
1 177 LEU n 
1 178 ALA n 
1 179 LEU n 
1 180 GLN n 
1 181 TRP n 
1 182 VAL n 
1 183 GLN n 
1 184 GLU n 
1 185 ASN n 
1 186 VAL n 
1 187 ALA n 
1 188 ALA n 
1 189 PHE n 
1 190 GLY n 
1 191 GLY n 
1 192 ASP n 
1 193 PRO n 
1 194 THR n 
1 195 SER n 
1 196 VAL n 
1 197 THR n 
1 198 LEU n 
1 199 PHE n 
1 200 GLY n 
1 201 GLU n 
1 202 SER n 
1 203 ALA n 
1 204 GLY n 
1 205 ALA n 
1 206 ALA n 
1 207 SER n 
1 208 VAL n 
1 209 GLY n 
1 210 MET n 
1 211 HIS n 
1 212 LEU n 
1 213 LEU n 
1 214 SER n 
1 215 PRO n 
1 216 PRO n 
1 217 SER n 
1 218 ARG n 
1 219 GLY n 
1 220 LEU n 
1 221 PHE n 
1 222 HIS n 
1 223 ARG n 
1 224 ALA n 
1 225 VAL n 
1 226 LEU n 
1 227 GLN n 
1 228 SER n 
1 229 GLY n 
1 230 ALA n 
1 231 PRO n 
1 232 ASN n 
1 233 GLY n 
1 234 PRO n 
1 235 TRP n 
1 236 ALA n 
1 237 THR n 
1 238 VAL n 
1 239 GLY n 
1 240 MET n 
1 241 GLY n 
1 242 GLU n 
1 243 ALA n 
1 244 ARG n 
1 245 ARG n 
1 246 ARG n 
1 247 ALA n 
1 248 THR n 
1 249 GLN n 
1 250 LEU n 
1 251 ALA n 
1 252 HIS n 
1 253 LEU n 
1 254 VAL n 
1 255 GLY n 
1 256 CYS n 
1 257 PRO n 
1 258 PRO n 
1 259 GLY n 
1 260 GLY n 
1 261 THR n 
1 262 GLY n 
1 263 GLY n 
1 264 ASN n 
1 265 ASP n 
1 266 THR n 
1 267 GLU n 
1 268 LEU n 
1 269 VAL n 
1 270 ALA n 
1 271 CYS n 
1 272 LEU n 
1 273 ARG n 
1 274 THR n 
1 275 ARG n 
1 276 PRO n 
1 277 ALA n 
1 278 GLN n 
1 279 VAL n 
1 280 LEU n 
1 281 VAL n 
1 282 ASN n 
1 283 HIS n 
1 284 GLU n 
1 285 TRP n 
1 286 HIS n 
1 287 VAL n 
1 288 LEU n 
1 289 PRO n 
1 290 GLN n 
1 291 GLU n 
1 292 SER n 
1 293 VAL n 
1 294 PHE n 
1 295 ARG n 
1 296 PHE n 
1 297 SER n 
1 298 PHE n 
1 299 VAL n 
1 300 PRO n 
1 301 VAL n 
1 302 VAL n 
1 303 ASP n 
1 304 GLY n 
1 305 ASP n 
1 306 PHE n 
1 307 LEU n 
1 308 SER n 
1 309 ASP n 
1 310 THR n 
1 311 PRO n 
1 312 GLU n 
1 313 ALA n 
1 314 LEU n 
1 315 ILE n 
1 316 ASN n 
1 317 ALA n 
1 318 GLY n 
1 319 ASP n 
1 320 PHE n 
1 321 HIS n 
1 322 GLY n 
1 323 LEU n 
1 324 GLN n 
1 325 VAL n 
1 326 LEU n 
1 327 VAL n 
1 328 GLY n 
1 329 VAL n 
1 330 VAL n 
1 331 LYS n 
1 332 ASP n 
1 333 GLU n 
1 334 GLY n 
1 335 SER n 
1 336 TYR n 
1 337 PHE n 
1 338 LEU n 
1 339 VAL n 
1 340 TYR n 
1 341 GLY n 
1 342 ALA n 
1 343 PRO n 
1 344 GLY n 
1 345 PHE n 
1 346 SER n 
1 347 LYS n 
1 348 ASP n 
1 349 ASN n 
1 350 GLU n 
1 351 SER n 
1 352 LEU n 
1 353 ILE n 
1 354 SER n 
1 355 ARG n 
1 356 ALA n 
1 357 GLU n 
1 358 PHE n 
1 359 LEU n 
1 360 ALA n 
1 361 GLY n 
1 362 VAL n 
1 363 ARG n 
1 364 VAL n 
1 365 GLY n 
1 366 VAL n 
1 367 PRO n 
1 368 GLN n 
1 369 VAL n 
1 370 SER n 
1 371 ASP n 
1 372 LEU n 
1 373 ALA n 
1 374 ALA n 
1 375 GLU n 
1 376 ALA n 
1 377 VAL n 
1 378 VAL n 
1 379 LEU n 
1 380 HIS n 
1 381 TYR n 
1 382 THR n 
1 383 ASP n 
1 384 TRP n 
1 385 LEU n 
1 386 HIS n 
1 387 PRO n 
1 388 GLU n 
1 389 ASP n 
1 390 PRO n 
1 391 ALA n 
1 392 ARG n 
1 393 LEU n 
1 394 ARG n 
1 395 GLU n 
1 396 ALA n 
1 397 LEU n 
1 398 SER n 
1 399 ASP n 
1 400 VAL n 
1 401 VAL n 
1 402 GLY n 
1 403 ASP n 
1 404 HIS n 
1 405 ASN n 
1 406 VAL n 
1 407 VAL n 
1 408 CYS n 
1 409 PRO n 
1 410 VAL n 
1 411 ALA n 
1 412 GLN n 
1 413 LEU n 
1 414 ALA n 
1 415 GLY n 
1 416 ARG n 
1 417 LEU n 
1 418 ALA n 
1 419 ALA n 
1 420 GLN n 
1 421 GLY n 
1 422 ALA n 
1 423 ARG n 
1 424 VAL n 
1 425 TYR n 
1 426 ALA n 
1 427 TYR n 
1 428 VAL n 
1 429 PHE n 
1 430 GLU n 
1 431 HIS n 
1 432 ARG n 
1 433 ALA n 
1 434 SER n 
1 435 THR n 
1 436 LEU n 
1 437 SER n 
1 438 TRP n 
1 439 PRO n 
1 440 LEU n 
1 441 TRP n 
1 442 MET n 
1 443 GLY n 
1 444 VAL n 
1 445 PRO n 
1 446 HIS n 
1 447 GLY n 
1 448 TYR n 
1 449 GLU n 
1 450 ILE n 
1 451 GLU n 
1 452 PHE n 
1 453 ILE n 
1 454 PHE n 
1 455 GLY n 
1 456 ILE n 
1 457 PRO n 
1 458 LEU n 
1 459 ASP n 
1 460 PRO n 
1 461 SER n 
1 462 ARG n 
1 463 ASN n 
1 464 TYR n 
1 465 THR n 
1 466 ALA n 
1 467 GLU n 
1 468 GLU n 
1 469 LYS n 
1 470 ILE n 
1 471 PHE n 
1 472 ALA n 
1 473 GLN n 
1 474 ARG n 
1 475 LEU n 
1 476 MET n 
1 477 ARG n 
1 478 TYR n 
1 479 TRP n 
1 480 ALA n 
1 481 ASN n 
1 482 PHE n 
1 483 ALA n 
1 484 ARG n 
1 485 THR n 
1 486 GLY n 
1 487 ASP n 
1 488 PRO n 
1 489 ASN n 
1 490 GLU n 
1 491 PRO n 
1 492 ARG n 
1 493 ASP n 
1 494 PRO n 
1 495 LYS n 
1 496 ALA n 
1 497 PRO n 
1 498 GLN n 
1 499 TRP n 
1 500 PRO n 
1 501 PRO n 
1 502 TYR n 
1 503 THR n 
1 504 ALA n 
1 505 GLY n 
1 506 ALA n 
1 507 GLN n 
1 508 GLN n 
1 509 TYR n 
1 510 VAL n 
1 511 SER n 
1 512 LEU n 
1 513 ASP n 
1 514 LEU n 
1 515 ARG n 
1 516 PRO n 
1 517 LEU n 
1 518 GLU n 
1 519 VAL n 
1 520 ARG n 
1 521 ARG n 
1 522 GLY n 
1 523 LEU n 
1 524 ARG n 
1 525 ALA n 
1 526 GLN n 
1 527 ALA n 
1 528 CYS n 
1 529 ALA n 
1 530 PHE n 
1 531 TRP n 
1 532 ASN n 
1 533 ARG n 
1 534 PHE n 
1 535 LEU n 
1 536 PRO n 
1 537 LYS n 
1 538 LEU n 
1 539 LEU n 
1 540 SER n 
1 541 ALA n 
1 542 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   542 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ACHE 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_HUMAN 
_struct_ref.pdbx_db_accession          P22303 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFE
GTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLAL
PGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGM
GEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDF
HGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDV
VGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWA
NFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT
;
_struct_ref.pdbx_align_begin           33 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5HF5 A 1 ? 542 ? P22303 33 ? 574 ? 2 543 
2 1 5HF5 B 1 ? 542 ? P22303 33 ? 574 ? 2 543 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                       ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE                                      ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                                    ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                               ?                 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'           y CYSTEINE                                      ?                 'C3 H7 N O2 S'   121.158 
DEP non-polymer                   . 'DIETHYL PHOSPHONATE'                         ?                 'C4 H11 O3 P'    138.102 
EDO non-polymer                   . 1,2-ETHANEDIOL                                'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose                          ?                 'C6 H12 O5'      164.156 
GLN 'L-peptide linking'           y GLUTAMINE                                     ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                               ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                                       ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE                                     ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                                         ?                 'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                                    ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE                                       ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                                        ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'           y METHIONINE                                    ?                 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose      ?                 'C8 H15 N O6'    221.208 
NO3 non-polymer                   . 'NITRATE ION'                                 ?                 'N O3 -1'        62.005  
PE8 non-polymer                   . 3,6,9,12,15,18,21-HEPTAOXATRICOSANE-1,23-DIOL ?                 'C16 H34 O9'     370.436 
PHE 'L-peptide linking'           y PHENYLALANINE                                 ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE                                       ?                 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                                        ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE                                     ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                                    ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                                      ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                                        ?                 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5HF5 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            4.33 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         71.56 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '15 - 18% PEG3350, 0.2M potassium nitrate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-03-21 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.075 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'NSLS BEAMLINE X29A' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.075 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X29A 
_diffrn_source.pdbx_synchrotron_site       NSLS 
# 
_reflns.B_iso_Wilson_estimate            36.940 
_reflns.entry_id                         5HF5 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.150 
_reflns.d_resolution_low                 100.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       112438 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.900 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  4.700 
_reflns.pdbx_Rmerge_I_obs                0.092 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         16.803 
_reflns.pdbx_netI_over_sigmaI            7.300 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 1.009 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.095 
_reflns.pdbx_Rpim_I_all                  0.046 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         533464 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
2.150 2.190   ? ? ? ? ? 5558 ? 100.000 ? ? ? ? 0.904 ? ? ? ? ? ? ? ? 4.100 ? 0.634 ? ? ?     0.497 0 1  1 0.596 ? 
2.190 2.230   ? ? ? ? ? 5561 ? 100.000 ? ? ? ? 0.820 ? ? ? ? ? ? ? ? 4.700 ? 0.646 ? ? 0.923 0.417 0 2  1 0.719 ? 
2.230 2.270   ? ? ? ? ? 5548 ? 99.700  ? ? ? ? 0.941 ? ? ? ? ? ? ? ? 4.700 ? 1.087 ? ? ?     0.484 0 3  1 0.792 ? 
2.270 2.320   ? ? ? ? ? 5494 ? 100.000 ? ? ? ? 0.596 ? ? ? ? ? ? ? ? 4.900 ? 0.672 ? ? 0.669 0.298 0 4  1 0.828 ? 
2.320 2.370   ? ? ? ? ? 5558 ? 100.000 ? ? ? ? 0.520 ? ? ? ? ? ? ? ? 4.800 ? 0.680 ? ? 0.583 0.260 0 5  1 0.857 ? 
2.370 2.420   ? ? ? ? ? 5581 ? 100.000 ? ? ? ? 0.438 ? ? ? ? ? ? ? ? 4.800 ? 0.683 ? ? 0.491 0.220 0 6  1 0.887 ? 
2.420 2.480   ? ? ? ? ? 5582 ? 100.000 ? ? ? ? 0.368 ? ? ? ? ? ? ? ? 4.800 ? 0.688 ? ? 0.413 0.184 0 7  1 0.919 ? 
2.480 2.550   ? ? ? ? ? 5574 ? 100.000 ? ? ? ? 0.305 ? ? ? ? ? ? ? ? 4.800 ? 0.699 ? ? 0.343 0.153 0 8  1 0.935 ? 
2.550 2.620   ? ? ? ? ? 5593 ? 100.000 ? ? ? ? 0.256 ? ? ? ? ? ? ? ? 4.800 ? 0.720 ? ? 0.288 0.128 0 9  1 0.956 ? 
2.620 2.710   ? ? ? ? ? 5551 ? 100.000 ? ? ? ? 0.218 ? ? ? ? ? ? ? ? 4.800 ? 0.801 ? ? 0.245 0.109 0 10 1 0.968 ? 
2.710 2.810   ? ? ? ? ? 5580 ? 100.000 ? ? ? ? 0.179 ? ? ? ? ? ? ? ? 4.800 ? 0.775 ? ? 0.200 0.089 0 11 1 0.976 ? 
2.810 2.920   ? ? ? ? ? 5600 ? 100.000 ? ? ? ? 0.143 ? ? ? ? ? ? ? ? 4.800 ? 0.809 ? ? 0.161 0.071 0 12 1 0.986 ? 
2.920 3.050   ? ? ? ? ? 5596 ? 100.000 ? ? ? ? 0.110 ? ? ? ? ? ? ? ? 4.800 ? 0.876 ? ? 0.123 0.055 0 13 1 0.991 ? 
3.050 3.210   ? ? ? ? ? 5599 ? 99.900  ? ? ? ? 0.091 ? ? ? ? ? ? ? ? 4.800 ? 0.955 ? ? 0.102 0.045 0 14 1 0.993 ? 
3.210 3.410   ? ? ? ? ? 5632 ? 99.900  ? ? ? ? 0.075 ? ? ? ? ? ? ? ? 4.800 ? 1.071 ? ? 0.084 0.037 0 15 1 0.995 ? 
3.410 3.680   ? ? ? ? ? 5647 ? 99.900  ? ? ? ? 0.064 ? ? ? ? ? ? ? ? 4.700 ? 1.361 ? ? 0.072 0.032 0 16 1 0.996 ? 
3.680 4.050   ? ? ? ? ? 5686 ? 99.800  ? ? ? ? 0.060 ? ? ? ? ? ? ? ? 4.600 ? 1.728 ? ? 0.067 0.030 0 17 1 0.996 ? 
4.050 4.630   ? ? ? ? ? 5674 ? 99.700  ? ? ? ? 0.056 ? ? ? ? ? ? ? ? 4.600 ? 2.004 ? ? 0.062 0.028 0 18 1 0.996 ? 
4.630 5.840   ? ? ? ? ? 5795 ? 99.800  ? ? ? ? 0.049 ? ? ? ? ? ? ? ? 4.700 ? 1.664 ? ? 0.055 0.025 0 19 1 0.996 ? 
5.840 100.000 ? ? ? ? ? 6029 ? 99.500  ? ? ? ? 0.040 ? ? ? ? ? ? ? ? 5.100 ? 1.537 ? ? 0.044 0.019 0 20 1 0.998 ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                119.800 
_refine.B_iso_mean                               42.3244 
_refine.B_iso_min                                19.770 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5HF5 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.1520 
_refine.ls_d_res_low                             49.8890 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     112280 
_refine.ls_number_reflns_R_free                  5674 
_refine.ls_number_reflns_R_work                  106606 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.6800 
_refine.ls_percent_reflns_R_free                 5.0500 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1758 
_refine.ls_R_factor_R_free                       0.2060 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1742 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.360 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4EY4 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 21.4300 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.2200 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.1520 
_refine_hist.d_res_low                        49.8890 
_refine_hist.pdbx_number_atoms_ligand         151 
_refine_hist.number_atoms_solvent             706 
_refine_hist.number_atoms_total               9192 
_refine_hist.pdbx_number_residues_total       1071 
_refine_hist.pdbx_B_iso_mean_ligand           68.03 
_refine_hist.pdbx_B_iso_mean_solvent          47.45 
_refine_hist.pdbx_number_atoms_protein        8335 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.011  ? 8821  ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.277  ? 12052 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.055  ? 1292  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.007  ? 1587  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 14.359 ? 3192  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.1524 2.1769  3503 . 171 3332 94.0000  . . . 0.3205 . 0.2788 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.1769 2.2025  3675 . 206 3469 100.0000 . . . 0.3030 . 0.2704 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.2025 2.2294  3755 . 197 3558 100.0000 . . . 0.3122 . 0.2686 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.2294 2.2576  3581 . 193 3388 99.0000  . . . 0.3704 . 0.3454 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.2576 2.2873  3747 . 180 3567 100.0000 . . . 0.2877 . 0.2611 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.2873 2.3186  3671 . 196 3475 100.0000 . . . 0.2648 . 0.2329 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.3186 2.3518  3728 . 188 3540 100.0000 . . . 0.2545 . 0.2155 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.3518 2.3869  3731 . 195 3536 100.0000 . . . 0.2315 . 0.2142 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.3869 2.4242  3705 . 187 3518 100.0000 . . . 0.2626 . 0.2037 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.4242 2.4639  3695 . 193 3502 100.0000 . . . 0.2454 . 0.2020 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.4639 2.5064  3735 . 214 3521 100.0000 . . . 0.2339 . 0.1985 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.5064 2.5520  3718 . 171 3547 100.0000 . . . 0.2031 . 0.1946 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.5520 2.6010  3713 . 180 3533 100.0000 . . . 0.2571 . 0.1935 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.6010 2.6541  3708 . 207 3501 100.0000 . . . 0.2506 . 0.1912 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.6541 2.7118  3742 . 188 3554 100.0000 . . . 0.2232 . 0.1870 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.7118 2.7749  3733 . 180 3553 100.0000 . . . 0.2454 . 0.1806 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.7749 2.8443  3751 . 198 3553 100.0000 . . . 0.2226 . 0.1788 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.8443 2.9212  3737 . 170 3567 100.0000 . . . 0.2356 . 0.1827 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.9212 3.0071  3736 . 185 3551 100.0000 . . . 0.2416 . 0.1732 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.0071 3.1042  3724 . 184 3540 100.0000 . . . 0.2155 . 0.1761 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.1042 3.2151  3721 . 179 3542 100.0000 . . . 0.2308 . 0.1766 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.2151 3.3438  3775 . 186 3589 100.0000 . . . 0.1871 . 0.1749 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.3438 3.4960  3801 . 202 3599 100.0000 . . . 0.2071 . 0.1723 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.4960 3.6802  3713 . 180 3533 100.0000 . . . 0.2027 . 0.1622 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.6802 3.9107  3793 . 197 3596 100.0000 . . . 0.1627 . 0.1489 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.9107 4.2125  3811 . 180 3631 100.0000 . . . 0.1571 . 0.1361 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 4.2125 4.6362  3785 . 191 3594 100.0000 . . . 0.1448 . 0.1290 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 4.6362 5.3064  3841 . 175 3666 100.0000 . . . 0.1651 . 0.1399 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 5.3064 6.6830  3873 . 213 3660 100.0000 . . . 0.1917 . 0.1616 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 6.6830 49.9029 4079 . 188 3891 100.0000 . . . 0.1835 . 0.1724 . . . . . . 30 . . . 
# 
_struct.entry_id                     5HF5 
_struct.title                        
'Crystal structure of human acetylcholinesterase in complex with paraoxon in the unaged state (predominant acyl loop conformation)' 
_struct.pdbx_descriptor              'Acetylcholinesterase (E.C.3.1.1.7)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5HF5 
_struct_keywords.text            'acetylcholinesterase, hydrolase' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
H N N 5 ? 
I N N 6 ? 
J N N 3 ? 
K N N 4 ? 
L N N 4 ? 
M N N 7 ? 
N N N 8 ? 
O N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 4   ? GLU A 6   ? ASP A 5   GLU A 7   5 ? 3  
HELX_P HELX_P2  AA2 MET A 41  ? ARG A 45  ? MET A 42  ARG A 46  5 ? 5  
HELX_P HELX_P3  AA3 PHE A 79  ? MET A 84  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P4  AA4 LEU A 129 ? ASP A 133 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P5  AA5 GLY A 134 ? ARG A 142 ? GLY A 135 ARG A 143 1 ? 9  
HELX_P HELX_P6  AA6 VAL A 152 ? LEU A 158 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P7  AA7 ASN A 169 ? VAL A 186 ? ASN A 170 VAL A 187 1 ? 18 
HELX_P HELX_P8  AA8 ALA A 187 ? PHE A 189 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P9  AA9 SER A 202 ? LEU A 213 ? SER A 203 LEU A 214 1 ? 12 
HELX_P HELX_P10 AB1 SER A 214 ? GLY A 219 ? SER A 215 GLY A 220 1 ? 6  
HELX_P HELX_P11 AB2 MET A 240 ? VAL A 254 ? MET A 241 VAL A 255 1 ? 15 
HELX_P HELX_P12 AB3 ASP A 265 ? ARG A 275 ? ASP A 266 ARG A 276 1 ? 11 
HELX_P HELX_P13 AB4 PRO A 276 ? TRP A 285 ? PRO A 277 TRP A 286 1 ? 10 
HELX_P HELX_P14 AB5 HIS A 286 ? LEU A 288 ? HIS A 287 LEU A 289 5 ? 3  
HELX_P HELX_P15 AB6 THR A 310 ? GLY A 318 ? THR A 311 GLY A 319 1 ? 9  
HELX_P HELX_P16 AB7 GLY A 334 ? VAL A 339 ? GLY A 335 VAL A 340 1 ? 6  
HELX_P HELX_P17 AB8 SER A 354 ? VAL A 366 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P18 AB9 SER A 370 ? THR A 382 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P19 AC1 ASP A 389 ? VAL A 406 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P20 AC2 VAL A 406 ? GLN A 420 ? VAL A 407 GLN A 421 1 ? 15 
HELX_P HELX_P21 AC3 PRO A 439 ? GLY A 443 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P22 AC4 GLU A 449 ? PHE A 454 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P23 AC5 GLY A 455 ? ASP A 459 ? GLY A 456 ASP A 460 5 ? 5  
HELX_P HELX_P24 AC6 THR A 465 ? GLY A 486 ? THR A 466 GLY A 487 1 ? 22 
HELX_P HELX_P25 AC7 ARG A 524 ? ARG A 533 ? ARG A 525 ARG A 534 1 ? 10 
HELX_P HELX_P26 AC8 ARG A 533 ? ALA A 541 ? ARG A 534 ALA A 542 1 ? 9  
HELX_P HELX_P27 AC9 ASP B 4   ? GLU B 6   ? ASP B 5   GLU B 7   5 ? 3  
HELX_P HELX_P28 AD1 MET B 41  ? ARG B 45  ? MET B 42  ARG B 46  5 ? 5  
HELX_P HELX_P29 AD2 PHE B 79  ? MET B 84  ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P30 AD3 LEU B 129 ? ASP B 133 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P31 AD4 GLY B 134 ? ARG B 142 ? GLY B 135 ARG B 143 1 ? 9  
HELX_P HELX_P32 AD5 VAL B 152 ? LEU B 158 ? VAL B 153 LEU B 159 1 ? 7  
HELX_P HELX_P33 AD6 ASN B 169 ? VAL B 186 ? ASN B 170 VAL B 187 1 ? 18 
HELX_P HELX_P34 AD7 ALA B 187 ? PHE B 189 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P35 AD8 SER B 202 ? LEU B 213 ? SER B 203 LEU B 214 1 ? 12 
HELX_P HELX_P36 AD9 SER B 214 ? GLY B 219 ? SER B 215 GLY B 220 1 ? 6  
HELX_P HELX_P37 AE1 MET B 240 ? VAL B 254 ? MET B 241 VAL B 255 1 ? 15 
HELX_P HELX_P38 AE2 ASN B 264 ? ARG B 273 ? ASN B 265 ARG B 274 1 ? 10 
HELX_P HELX_P39 AE3 PRO B 276 ? GLU B 284 ? PRO B 277 GLU B 285 1 ? 9  
HELX_P HELX_P40 AE4 TRP B 285 ? LEU B 288 ? TRP B 286 LEU B 289 5 ? 4  
HELX_P HELX_P41 AE5 THR B 310 ? ALA B 317 ? THR B 311 ALA B 318 1 ? 8  
HELX_P HELX_P42 AE6 GLY B 334 ? VAL B 339 ? GLY B 335 VAL B 340 1 ? 6  
HELX_P HELX_P43 AE7 SER B 354 ? VAL B 366 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P44 AE8 SER B 370 ? THR B 382 ? SER B 371 THR B 383 1 ? 13 
HELX_P HELX_P45 AE9 ASP B 389 ? VAL B 406 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P46 AF1 VAL B 406 ? GLN B 420 ? VAL B 407 GLN B 421 1 ? 15 
HELX_P HELX_P47 AF2 PRO B 439 ? GLY B 443 ? PRO B 440 GLY B 444 5 ? 5  
HELX_P HELX_P48 AF3 GLU B 449 ? PHE B 454 ? GLU B 450 PHE B 455 1 ? 6  
HELX_P HELX_P49 AF4 GLY B 455 ? ASP B 459 ? GLY B 456 ASP B 460 5 ? 5  
HELX_P HELX_P50 AF5 THR B 465 ? GLY B 486 ? THR B 466 GLY B 487 1 ? 22 
HELX_P HELX_P51 AF6 ARG B 524 ? ARG B 533 ? ARG B 525 ARG B 534 1 ? 10 
HELX_P HELX_P52 AF7 PHE B 534 ? ALA B 541 ? PHE B 535 ALA B 542 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 68  SG  ? ? ? 1_555 A CYS 95  SG ? ? A CYS 69  A CYS 96  1_555 ? ? ? ? ? ? ? 2.074 ? ?               
disulf2 disulf ?    ? A CYS 256 SG  ? ? ? 1_555 A CYS 271 SG ? ? A CYS 257 A CYS 272 1_555 ? ? ? ? ? ? ? 2.058 ? ?               
disulf3 disulf ?    ? A CYS 408 SG  ? ? ? 1_555 A CYS 528 SG ? ? A CYS 409 A CYS 529 1_555 ? ? ? ? ? ? ? 2.017 ? ?               
disulf4 disulf ?    ? B CYS 68  SG  ? ? ? 1_555 B CYS 95  SG ? ? B CYS 69  B CYS 96  1_555 ? ? ? ? ? ? ? 2.054 ? ?               
disulf5 disulf ?    ? B CYS 256 SG  ? ? ? 1_555 B CYS 271 SG ? ? B CYS 257 B CYS 272 1_555 ? ? ? ? ? ? ? 2.064 ? ?               
disulf6 disulf ?    ? B CYS 408 SG  ? ? ? 1_555 B CYS 528 SG ? ? B CYS 409 B CYS 529 1_555 ? ? ? ? ? ? ? 2.025 ? ?               
covale1 covale one  ? A SER 202 OG  ? ? ? 1_555 E DEP .   P  ? ? A SER 203 A DEP 604 1_555 ? ? ? ? ? ? ? 1.583 ? ?               
covale2 covale one  ? A ASN 349 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 350 C NAG 1   1_555 ? ? ? ? ? ? ? 1.433 ? N-Glycosylation 
covale3 covale one  ? B SER 202 OG  ? ? ? 1_555 J DEP .   P  ? ? B SER 203 B DEP 606 1_555 ? ? ? ? ? ? ? 1.578 ? ?               
covale4 covale one  ? B ASN 264 ND2 ? ? ? 1_555 H NAG .   C1 ? ? B ASN 265 B NAG 604 1_555 ? ? ? ? ? ? ? 1.452 ? N-Glycosylation 
covale5 covale one  ? B ASN 349 ND2 ? ? ? 1_555 D NAG .   C1 ? ? B ASN 350 D NAG 1   1_555 ? ? ? ? ? ? ? 1.452 ? N-Glycosylation 
covale6 covale both ? C NAG .   O4  ? ? ? 1_555 C NAG .   C1 ? ? C NAG 1   C NAG 2   1_555 ? ? ? ? ? ? ? 1.444 ? ?               
covale7 covale one  ? C NAG .   O6  ? ? ? 1_555 C FUC .   C1 ? ? C NAG 1   C FUC 3   1_555 ? ? ? ? ? ? ? 1.452 ? ?               
covale8 covale both ? D NAG .   O4  ? ? ? 1_555 D NAG .   C1 ? ? D NAG 1   D NAG 2   1_555 ? ? ? ? ? ? ? 1.459 ? ?               
covale9 covale one  ? D NAG .   O6  ? ? ? 1_555 D FUC .   C1 ? ? D NAG 1   D FUC 3   1_555 ? ? ? ? ? ? ? 1.451 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 104 A . ? TYR 105 A PRO 105 A ? PRO 106 A 1 -4.47 
2 TYR 104 B . ? TYR 105 B PRO 105 B ? PRO 106 B 1 5.64  
3 CYS 256 B . ? CYS 257 B PRO 257 B ? PRO 258 B 1 -9.63 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3  ? 
AA2 ? 11 ? 
AA3 ? 2  ? 
AA4 ? 3  ? 
AA5 ? 11 ? 
AA6 ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? parallel      
AA2 1  2  ? anti-parallel 
AA2 2  3  ? anti-parallel 
AA2 3  4  ? anti-parallel 
AA2 4  5  ? parallel      
AA2 5  6  ? parallel      
AA2 6  7  ? parallel      
AA2 7  8  ? parallel      
AA2 8  9  ? parallel      
AA2 9  10 ? parallel      
AA2 10 11 ? anti-parallel 
AA3 1  2  ? parallel      
AA4 1  2  ? anti-parallel 
AA4 2  3  ? parallel      
AA5 1  2  ? anti-parallel 
AA5 2  3  ? anti-parallel 
AA5 3  4  ? anti-parallel 
AA5 4  5  ? parallel      
AA5 5  6  ? parallel      
AA5 6  7  ? parallel      
AA5 7  8  ? parallel      
AA5 8  9  ? parallel      
AA5 9  10 ? parallel      
AA5 10 11 ? anti-parallel 
AA6 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  LEU A 8   ? VAL A 11  ? LEU A 9   VAL A 12  
AA1 2  GLY A 14  ? ARG A 17  ? GLY A 15  ARG A 18  
AA1 3  VAL A 58  ? ASP A 60  ? VAL A 59  ASP A 61  
AA2 1  ILE A 19  ? LEU A 21  ? ILE A 20  LEU A 22  
AA2 2  VAL A 28  ? PRO A 35  ? VAL A 29  PRO A 36  
AA2 3  TYR A 97  ? PRO A 103 ? TYR A 98  PRO A 104 
AA2 4  VAL A 144 ? MET A 148 ? VAL A 145 MET A 149 
AA2 5  THR A 111 ? ILE A 117 ? THR A 112 ILE A 118 
AA2 6  GLY A 191 ? GLU A 201 ? GLY A 192 GLU A 202 
AA2 7  ARG A 223 ? GLN A 227 ? ARG A 224 GLN A 228 
AA2 8  GLN A 324 ? VAL A 330 ? GLN A 325 VAL A 331 
AA2 9  ARG A 423 ? PHE A 429 ? ARG A 424 PHE A 430 
AA2 10 GLN A 508 ? LEU A 512 ? GLN A 509 LEU A 513 
AA2 11 GLU A 518 ? ARG A 521 ? GLU A 519 ARG A 522 
AA3 1  VAL A 238 ? GLY A 239 ? VAL A 239 GLY A 240 
AA3 2  VAL A 301 ? VAL A 302 ? VAL A 302 VAL A 303 
AA4 1  LEU B 8   ? VAL B 11  ? LEU B 9   VAL B 12  
AA4 2  GLY B 14  ? ARG B 17  ? GLY B 15  ARG B 18  
AA4 3  VAL B 58  ? ASP B 60  ? VAL B 59  ASP B 61  
AA5 1  ILE B 19  ? LEU B 21  ? ILE B 20  LEU B 22  
AA5 2  VAL B 28  ? PRO B 35  ? VAL B 29  PRO B 36  
AA5 3  TYR B 97  ? PRO B 103 ? TYR B 98  PRO B 104 
AA5 4  VAL B 144 ? MET B 148 ? VAL B 145 MET B 149 
AA5 5  THR B 111 ? ILE B 117 ? THR B 112 ILE B 118 
AA5 6  GLY B 191 ? GLU B 201 ? GLY B 192 GLU B 202 
AA5 7  ARG B 223 ? GLN B 227 ? ARG B 224 GLN B 228 
AA5 8  GLN B 324 ? VAL B 330 ? GLN B 325 VAL B 331 
AA5 9  ARG B 423 ? PHE B 429 ? ARG B 424 PHE B 430 
AA5 10 GLN B 508 ? LEU B 512 ? GLN B 509 LEU B 513 
AA5 11 GLU B 518 ? ARG B 521 ? GLU B 519 ARG B 522 
AA6 1  VAL B 238 ? GLY B 239 ? VAL B 239 GLY B 240 
AA6 2  VAL B 301 ? VAL B 302 ? VAL B 302 VAL B 303 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  N VAL A 11  ? N VAL A 12  O GLY A 14  ? O GLY A 15  
AA1 2  3  N ARG A 15  ? N ARG A 16  O VAL A 59  ? O VAL A 60  
AA2 1  2  N LEU A 21  ? N LEU A 22  O VAL A 28  ? O VAL A 29  
AA2 2  3  N SER A 29  ? N SER A 30  O THR A 102 ? O THR A 103 
AA2 3  4  N TRP A 101 ? N TRP A 102 O LEU A 145 ? O LEU A 146 
AA2 4  5  O VAL A 146 ? O VAL A 147 N TRP A 116 ? N TRP A 117 
AA2 5  6  N VAL A 113 ? N VAL A 114 O THR A 197 ? O THR A 198 
AA2 6  7  N GLY A 200 ? N GLY A 201 O GLN A 227 ? O GLN A 228 
AA2 7  8  N LEU A 226 ? N LEU A 227 O LEU A 326 ? O LEU A 327 
AA2 8  9  N VAL A 327 ? N VAL A 328 O TYR A 425 ? O TYR A 426 
AA2 9  10 N VAL A 428 ? N VAL A 429 O LEU A 512 ? O LEU A 513 
AA2 10 11 N TYR A 509 ? N TYR A 510 O ARG A 520 ? O ARG A 521 
AA3 1  2  N VAL A 238 ? N VAL A 239 O VAL A 302 ? O VAL A 303 
AA4 1  2  N VAL B 11  ? N VAL B 12  O GLY B 14  ? O GLY B 15  
AA4 2  3  N ARG B 15  ? N ARG B 16  O VAL B 59  ? O VAL B 60  
AA5 1  2  N LEU B 21  ? N LEU B 22  O VAL B 28  ? O VAL B 29  
AA5 2  3  N ILE B 34  ? N ILE B 35  O LEU B 98  ? O LEU B 99  
AA5 3  4  N TRP B 101 ? N TRP B 102 O LEU B 145 ? O LEU B 146 
AA5 4  5  O VAL B 144 ? O VAL B 145 N LEU B 114 ? N LEU B 115 
AA5 5  6  N THR B 111 ? N THR B 112 O ASP B 192 ? O ASP B 193 
AA5 6  7  N GLY B 200 ? N GLY B 201 O GLN B 227 ? O GLN B 228 
AA5 7  8  N LEU B 226 ? N LEU B 227 O LEU B 326 ? O LEU B 327 
AA5 8  9  N VAL B 327 ? N VAL B 328 O TYR B 425 ? O TYR B 426 
AA5 9  10 N VAL B 428 ? N VAL B 429 O LEU B 512 ? O LEU B 513 
AA5 10 11 N TYR B 509 ? N TYR B 510 O ARG B 520 ? O ARG B 521 
AA6 1  2  N VAL B 238 ? N VAL B 239 O VAL B 302 ? O VAL B 303 
# 
_atom_sites.entry_id                    5HF5 
_atom_sites.fract_transf_matrix[1][1]   0.009531 
_atom_sites.fract_transf_matrix[1][2]   0.005503 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011006 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003098 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 3   ? 2.193   -35.474 69.974  1.00 82.87  ? 4    GLU A N   1 
ATOM   2    C CA  . GLU A 1 3   ? 2.020   -34.904 68.633  1.00 91.48  ? 4    GLU A CA  1 
ATOM   3    C C   . GLU A 1 3   ? 3.141   -35.333 67.671  1.00 80.70  ? 4    GLU A C   1 
ATOM   4    O O   . GLU A 1 3   ? 4.315   -35.411 68.056  1.00 79.65  ? 4    GLU A O   1 
ATOM   5    C CB  . GLU A 1 3   ? 1.943   -33.371 68.715  1.00 92.25  ? 4    GLU A CB  1 
ATOM   6    C CG  . GLU A 1 3   ? 1.683   -32.660 67.382  1.00 85.65  ? 4    GLU A CG  1 
ATOM   7    C CD  . GLU A 1 3   ? 0.263   -32.873 66.851  1.00 94.80  ? 4    GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 3   ? -0.514  -33.622 67.493  1.00 88.42  ? 4    GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 3   ? -0.077  -32.286 65.790  1.00 85.34  ? 4    GLU A OE2 1 
ATOM   10   N N   . ASP A 1 4   ? 2.780   -35.613 66.420  1.00 68.35  ? 5    ASP A N   1 
ATOM   11   C CA  . ASP A 1 4   ? 3.753   -36.149 65.474  1.00 65.56  ? 5    ASP A CA  1 
ATOM   12   C C   . ASP A 1 4   ? 4.301   -35.087 64.508  1.00 65.55  ? 5    ASP A C   1 
ATOM   13   O O   . ASP A 1 4   ? 3.640   -34.722 63.535  1.00 53.33  ? 5    ASP A O   1 
ATOM   14   C CB  . ASP A 1 4   ? 3.142   -37.306 64.684  1.00 53.08  ? 5    ASP A CB  1 
ATOM   15   C CG  . ASP A 1 4   ? 4.190   -38.128 63.956  1.00 57.73  ? 5    ASP A CG  1 
ATOM   16   O OD1 . ASP A 1 4   ? 5.331   -37.633 63.790  1.00 55.31  ? 5    ASP A OD1 1 
ATOM   17   O OD2 . ASP A 1 4   ? 3.879   -39.277 63.555  1.00 57.74  ? 5    ASP A OD2 1 
ATOM   18   N N   . ALA A 1 5   ? 5.531   -34.642 64.773  1.00 56.33  ? 6    ALA A N   1 
ATOM   19   C CA  . ALA A 1 5   ? 6.189   -33.592 64.002  1.00 58.50  ? 6    ALA A CA  1 
ATOM   20   C C   . ALA A 1 5   ? 6.422   -33.988 62.548  1.00 59.71  ? 6    ALA A C   1 
ATOM   21   O O   . ALA A 1 5   ? 6.511   -33.125 61.679  1.00 51.18  ? 6    ALA A O   1 
ATOM   22   C CB  . ALA A 1 5   ? 7.524   -33.217 64.648  1.00 45.15  ? 6    ALA A CB  1 
ATOM   23   N N   . GLU A 1 6   ? 6.553   -35.283 62.280  1.00 50.47  ? 7    GLU A N   1 
ATOM   24   C CA  . GLU A 1 6   ? 6.778   -35.732 60.909  1.00 55.08  ? 7    GLU A CA  1 
ATOM   25   C C   . GLU A 1 6   ? 5.620   -35.343 59.989  1.00 46.21  ? 7    GLU A C   1 
ATOM   26   O O   . GLU A 1 6   ? 5.785   -35.188 58.780  1.00 51.30  ? 7    GLU A O   1 
ATOM   27   C CB  . GLU A 1 6   ? 6.996   -37.238 60.875  1.00 51.95  ? 7    GLU A CB  1 
ATOM   28   C CG  . GLU A 1 6   ? 8.301   -37.667 61.526  1.00 50.68  ? 7    GLU A CG  1 
ATOM   29   C CD  . GLU A 1 6   ? 9.540   -37.096 60.836  1.00 56.40  ? 7    GLU A CD  1 
ATOM   30   O OE1 . GLU A 1 6   ? 9.504   -36.824 59.615  1.00 56.85  ? 7    GLU A OE1 1 
ATOM   31   O OE2 . GLU A 1 6   ? 10.566  -36.921 61.521  1.00 65.79  ? 7    GLU A OE2 1 
ATOM   32   N N   . LEU A 1 7   ? 4.454   -35.164 60.583  1.00 41.89  ? 8    LEU A N   1 
ATOM   33   C CA  . LEU A 1 7   ? 3.242   -34.862 59.848  1.00 42.89  ? 8    LEU A CA  1 
ATOM   34   C C   . LEU A 1 7   ? 2.939   -33.358 59.820  1.00 39.40  ? 8    LEU A C   1 
ATOM   35   O O   . LEU A 1 7   ? 1.863   -32.944 59.406  1.00 37.81  ? 8    LEU A O   1 
ATOM   36   C CB  . LEU A 1 7   ? 2.070   -35.632 60.466  1.00 38.05  ? 8    LEU A CB  1 
ATOM   37   C CG  . LEU A 1 7   ? 2.275   -37.153 60.568  1.00 42.08  ? 8    LEU A CG  1 
ATOM   38   C CD1 . LEU A 1 7   ? 1.008   -37.827 61.113  1.00 38.66  ? 8    LEU A CD1 1 
ATOM   39   C CD2 . LEU A 1 7   ? 2.703   -37.780 59.210  1.00 42.73  ? 8    LEU A CD2 1 
ATOM   40   N N   . LEU A 1 8   ? 3.877   -32.536 60.270  1.00 39.93  ? 9    LEU A N   1 
ATOM   41   C CA  . LEU A 1 8   ? 3.644   -31.098 60.256  1.00 40.00  ? 9    LEU A CA  1 
ATOM   42   C C   . LEU A 1 8   ? 4.643   -30.507 59.292  1.00 43.77  ? 9    LEU A C   1 
ATOM   43   O O   . LEU A 1 8   ? 5.837   -30.807 59.353  1.00 42.11  ? 9    LEU A O   1 
ATOM   44   C CB  . LEU A 1 8   ? 3.775   -30.488 61.654  1.00 44.93  ? 9    LEU A CB  1 
ATOM   45   C CG  . LEU A 1 8   ? 2.726   -30.955 62.667  1.00 51.03  ? 9    LEU A CG  1 
ATOM   46   C CD1 . LEU A 1 8   ? 2.969   -30.382 64.094  1.00 51.13  ? 9    LEU A CD1 1 
ATOM   47   C CD2 . LEU A 1 8   ? 1.321   -30.615 62.198  1.00 40.72  ? 9    LEU A CD2 1 
ATOM   48   N N   . VAL A 1 9   ? 4.142   -29.731 58.341  1.00 36.95  ? 10   VAL A N   1 
ATOM   49   C CA  . VAL A 1 9   ? 5.000   -29.154 57.316  1.00 35.17  ? 10   VAL A CA  1 
ATOM   50   C C   . VAL A 1 9   ? 4.539   -27.723 57.084  1.00 34.85  ? 10   VAL A C   1 
ATOM   51   O O   . VAL A 1 9   ? 3.343   -27.421 57.133  1.00 34.50  ? 10   VAL A O   1 
ATOM   52   C CB  . VAL A 1 9   ? 4.946   -29.957 55.972  1.00 35.92  ? 10   VAL A CB  1 
ATOM   53   C CG1 . VAL A 1 9   ? 5.939   -29.407 54.952  1.00 40.53  ? 10   VAL A CG1 1 
ATOM   54   C CG2 . VAL A 1 9   ? 5.263   -31.409 56.204  1.00 41.35  ? 10   VAL A CG2 1 
ATOM   55   N N   . THR A 1 10  ? 5.486   -26.847 56.810  1.00 37.27  ? 11   THR A N   1 
ATOM   56   C CA  . THR A 1 10  ? 5.157   -25.482 56.441  1.00 39.27  ? 11   THR A CA  1 
ATOM   57   C C   . THR A 1 10  ? 5.570   -25.274 54.998  1.00 34.81  ? 11   THR A C   1 
ATOM   58   O O   . THR A 1 10  ? 6.711   -25.531 54.635  1.00 35.88  ? 11   THR A O   1 
ATOM   59   C CB  . THR A 1 10  ? 5.860   -24.447 57.377  1.00 37.45  ? 11   THR A CB  1 
ATOM   60   O OG1 . THR A 1 10  ? 5.373   -24.620 58.712  1.00 39.99  ? 11   THR A OG1 1 
ATOM   61   C CG2 . THR A 1 10  ? 5.568   -23.022 56.931  1.00 35.43  ? 11   THR A CG2 1 
ATOM   62   N N   . VAL A 1 11  ? 4.634   -24.834 54.171  1.00 31.84  ? 12   VAL A N   1 
ATOM   63   C CA  . VAL A 1 11  ? 4.956   -24.496 52.786  1.00 36.41  ? 12   VAL A CA  1 
ATOM   64   C C   . VAL A 1 11  ? 4.813   -22.989 52.674  1.00 39.44  ? 12   VAL A C   1 
ATOM   65   O O   . VAL A 1 11  ? 4.452   -22.352 53.653  1.00 40.38  ? 12   VAL A O   1 
ATOM   66   C CB  . VAL A 1 11  ? 4.043   -25.235 51.773  1.00 32.32  ? 12   VAL A CB  1 
ATOM   67   C CG1 . VAL A 1 11  ? 4.399   -26.721 51.762  1.00 32.11  ? 12   VAL A CG1 1 
ATOM   68   C CG2 . VAL A 1 11  ? 2.570   -25.030 52.098  1.00 25.29  ? 12   VAL A CG2 1 
ATOM   69   N N   . ARG A 1 12  ? 5.088   -22.411 51.514  1.00 35.00  ? 13   ARG A N   1 
ATOM   70   C CA  . ARG A 1 12  ? 5.058   -20.958 51.417  1.00 40.63  ? 13   ARG A CA  1 
ATOM   71   C C   . ARG A 1 12  ? 3.712   -20.352 51.814  1.00 45.00  ? 13   ARG A C   1 
ATOM   72   O O   . ARG A 1 12  ? 3.666   -19.285 52.403  1.00 46.36  ? 13   ARG A O   1 
ATOM   73   C CB  . ARG A 1 12  ? 5.421   -20.511 50.004  1.00 41.77  ? 13   ARG A CB  1 
ATOM   74   C CG  . ARG A 1 12  ? 6.875   -20.841 49.657  1.00 48.36  ? 13   ARG A CG  1 
ATOM   75   C CD  . ARG A 1 12  ? 7.416   -19.984 48.512  1.00 60.79  ? 13   ARG A CD  1 
ATOM   76   N NE  . ARG A 1 12  ? 8.714   -20.487 48.066  1.00 64.97  ? 13   ARG A NE  1 
ATOM   77   C CZ  . ARG A 1 12  ? 9.421   -19.969 47.068  1.00 72.74  ? 13   ARG A CZ  1 
ATOM   78   N NH1 . ARG A 1 12  ? 8.961   -18.911 46.409  1.00 72.76  ? 13   ARG A NH1 1 
ATOM   79   N NH2 . ARG A 1 12  ? 10.589  -20.510 46.733  1.00 75.43  ? 13   ARG A NH2 1 
ATOM   80   N N   . GLY A 1 13  ? 2.621   -21.030 51.491  1.00 40.22  ? 14   GLY A N   1 
ATOM   81   C CA  . GLY A 1 13  ? 1.307   -20.504 51.805  1.00 32.58  ? 14   GLY A CA  1 
ATOM   82   C C   . GLY A 1 13  ? 0.915   -20.669 53.268  1.00 36.12  ? 14   GLY A C   1 
ATOM   83   O O   . GLY A 1 13  ? -0.070  -20.081 53.727  1.00 37.84  ? 14   GLY A O   1 
ATOM   84   N N   . GLY A 1 14  ? 1.661   -21.484 54.007  1.00 30.30  ? 15   GLY A N   1 
ATOM   85   C CA  . GLY A 1 14  ? 1.273   -21.764 55.371  1.00 35.50  ? 15   GLY A CA  1 
ATOM   86   C C   . GLY A 1 14  ? 1.520   -23.179 55.831  1.00 35.00  ? 15   GLY A C   1 
ATOM   87   O O   . GLY A 1 14  ? 2.309   -23.914 55.237  1.00 36.23  ? 15   GLY A O   1 
ATOM   88   N N   . ARG A 1 15  ? 0.819   -23.548 56.897  1.00 36.69  ? 16   ARG A N   1 
ATOM   89   C CA  . ARG A 1 15  ? 1.056   -24.790 57.621  1.00 38.71  ? 16   ARG A CA  1 
ATOM   90   C C   . ARG A 1 15  ? 0.059   -25.876 57.238  1.00 35.26  ? 16   ARG A C   1 
ATOM   91   O O   . ARG A 1 15  ? -1.119  -25.591 56.994  1.00 34.20  ? 16   ARG A O   1 
ATOM   92   C CB  . ARG A 1 15  ? 0.986   -24.536 59.145  1.00 35.59  ? 16   ARG A CB  1 
ATOM   93   C CG  . ARG A 1 15  ? 2.212   -23.788 59.716  1.00 48.62  ? 16   ARG A CG  1 
ATOM   94   C CD  . ARG A 1 15  ? 2.133   -23.597 61.260  1.00 54.66  ? 16   ARG A CD  1 
ATOM   95   N NE  . ARG A 1 15  ? 1.007   -22.740 61.619  1.00 51.35  ? 16   ARG A NE  1 
ATOM   96   C CZ  . ARG A 1 15  ? 0.282   -22.879 62.724  1.00 62.70  ? 16   ARG A CZ  1 
ATOM   97   N NH1 . ARG A 1 15  ? 0.577   -23.840 63.592  1.00 58.24  ? 16   ARG A NH1 1 
ATOM   98   N NH2 . ARG A 1 15  ? -0.735  -22.053 62.960  1.00 57.11  ? 16   ARG A NH2 1 
ATOM   99   N N   . LEU A 1 16  ? 0.548   -27.115 57.238  1.00 33.31  ? 17   LEU A N   1 
ATOM   100  C CA  . LEU A 1 16  ? -0.197  -28.309 56.830  1.00 41.27  ? 17   LEU A CA  1 
ATOM   101  C C   . LEU A 1 16  ? -0.088  -29.437 57.843  1.00 33.54  ? 17   LEU A C   1 
ATOM   102  O O   . LEU A 1 16  ? 0.978   -29.623 58.449  1.00 38.15  ? 17   LEU A O   1 
ATOM   103  C CB  . LEU A 1 16  ? 0.341   -28.853 55.506  1.00 33.07  ? 17   LEU A CB  1 
ATOM   104  C CG  . LEU A 1 16  ? 0.444   -27.942 54.305  1.00 35.85  ? 17   LEU A CG  1 
ATOM   105  C CD1 . LEU A 1 16  ? 1.220   -28.681 53.246  1.00 30.40  ? 17   LEU A CD1 1 
ATOM   106  C CD2 . LEU A 1 16  ? -0.956  -27.591 53.827  1.00 35.74  ? 17   LEU A CD2 1 
ATOM   107  N N   A ARG A 1 17  ? -1.167  -30.204 57.993  0.48 32.55  ? 18   ARG A N   1 
ATOM   108  N N   B ARG A 1 17  ? -1.159  -30.209 58.016  0.52 33.29  ? 18   ARG A N   1 
ATOM   109  C CA  A ARG A 1 17  ? -1.152  -31.403 58.824  0.48 35.94  ? 18   ARG A CA  1 
ATOM   110  C CA  B ARG A 1 17  ? -1.078  -31.407 58.846  0.52 35.88  ? 18   ARG A CA  1 
ATOM   111  C C   A ARG A 1 17  ? -1.380  -32.635 57.951  0.48 32.66  ? 18   ARG A C   1 
ATOM   112  C C   B ARG A 1 17  ? -1.377  -32.636 57.993  0.52 32.67  ? 18   ARG A C   1 
ATOM   113  O O   A ARG A 1 17  ? -2.420  -32.759 57.295  0.48 38.17  ? 18   ARG A O   1 
ATOM   114  O O   B ARG A 1 17  ? -2.452  -32.756 57.398  0.52 38.21  ? 18   ARG A O   1 
ATOM   115  C CB  A ARG A 1 17  ? -2.219  -31.315 59.935  0.48 33.25  ? 18   ARG A CB  1 
ATOM   116  C CB  B ARG A 1 17  ? -2.038  -31.323 60.051  0.52 33.37  ? 18   ARG A CB  1 
ATOM   117  C CG  A ARG A 1 17  ? -2.487  -32.638 60.666  0.48 38.91  ? 18   ARG A CG  1 
ATOM   118  C CG  B ARG A 1 17  ? -1.884  -32.473 61.065  0.52 36.27  ? 18   ARG A CG  1 
ATOM   119  C CD  A ARG A 1 17  ? -3.647  -32.517 61.688  0.48 44.55  ? 18   ARG A CD  1 
ATOM   120  C CD  B ARG A 1 17  ? -2.799  -32.299 62.304  0.52 41.94  ? 18   ARG A CD  1 
ATOM   121  N NE  A ARG A 1 17  ? -4.345  -31.232 61.583  0.48 45.17  ? 18   ARG A NE  1 
ATOM   122  N NE  B ARG A 1 17  ? -2.399  -31.159 63.125  0.52 39.77  ? 18   ARG A NE  1 
ATOM   123  C CZ  A ARG A 1 17  ? -5.569  -31.072 61.089  0.48 42.95  ? 18   ARG A CZ  1 
ATOM   124  C CZ  B ARG A 1 17  ? -3.081  -30.022 63.250  0.52 37.61  ? 18   ARG A CZ  1 
ATOM   125  N NH1 A ARG A 1 17  ? -6.258  -32.123 60.668  0.48 49.06  ? 18   ARG A NH1 1 
ATOM   126  N NH1 B ARG A 1 17  ? -4.237  -29.847 62.628  0.52 39.11  ? 18   ARG A NH1 1 
ATOM   127  N NH2 A ARG A 1 17  ? -6.106  -29.858 61.031  0.48 39.44  ? 18   ARG A NH2 1 
ATOM   128  N NH2 B ARG A 1 17  ? -2.600  -29.050 64.010  0.52 34.94  ? 18   ARG A NH2 1 
ATOM   129  N N   . GLY A 1 18  ? -0.406  -33.536 57.927  1.00 34.97  ? 19   GLY A N   1 
ATOM   130  C CA  . GLY A 1 18  ? -0.532  -34.763 57.155  1.00 33.48  ? 19   GLY A CA  1 
ATOM   131  C C   . GLY A 1 18  ? -1.055  -35.954 57.946  1.00 43.64  ? 19   GLY A C   1 
ATOM   132  O O   . GLY A 1 18  ? -1.554  -35.819 59.055  1.00 39.21  ? 19   GLY A O   1 
ATOM   133  N N   . ILE A 1 19  ? -0.931  -37.134 57.359  1.00 37.85  ? 20   ILE A N   1 
ATOM   134  C CA  . ILE A 1 19  ? -1.375  -38.359 57.985  1.00 32.07  ? 20   ILE A CA  1 
ATOM   135  C C   . ILE A 1 19  ? -0.352  -39.450 57.701  1.00 32.76  ? 20   ILE A C   1 
ATOM   136  O O   . ILE A 1 19  ? 0.256   -39.476 56.634  1.00 36.97  ? 20   ILE A O   1 
ATOM   137  C CB  . ILE A 1 19  ? -2.768  -38.772 57.477  1.00 40.88  ? 20   ILE A CB  1 
ATOM   138  C CG1 . ILE A 1 19  ? -3.289  -40.006 58.221  1.00 42.11  ? 20   ILE A CG1 1 
ATOM   139  C CG2 . ILE A 1 19  ? -2.768  -39.008 55.940  1.00 33.68  ? 20   ILE A CG2 1 
ATOM   140  C CD1 . ILE A 1 19  ? -4.791  -40.282 57.945  1.00 35.76  ? 20   ILE A CD1 1 
ATOM   141  N N   . ARG A 1 20  ? -0.145  -40.332 58.671  1.00 37.18  ? 21   ARG A N   1 
ATOM   142  C CA  . ARG A 1 20  ? 0.734   -41.485 58.520  1.00 34.61  ? 21   ARG A CA  1 
ATOM   143  C C   . ARG A 1 20  ? -0.075  -42.625 57.914  1.00 36.39  ? 21   ARG A C   1 
ATOM   144  O O   . ARG A 1 20  ? -1.166  -42.888 58.374  1.00 38.12  ? 21   ARG A O   1 
ATOM   145  C CB  . ARG A 1 20  ? 1.302   -41.884 59.879  1.00 43.30  ? 21   ARG A CB  1 
ATOM   146  C CG  . ARG A 1 20  ? 2.472   -42.842 59.846  1.00 45.65  ? 21   ARG A CG  1 
ATOM   147  C CD  . ARG A 1 20  ? 3.099   -42.937 61.264  1.00 50.10  ? 21   ARG A CD  1 
ATOM   148  N NE  . ARG A 1 20  ? 2.104   -43.352 62.251  1.00 46.67  ? 21   ARG A NE  1 
ATOM   149  C CZ  . ARG A 1 20  ? 1.705   -42.631 63.297  1.00 59.70  ? 21   ARG A CZ  1 
ATOM   150  N NH1 . ARG A 1 20  ? 2.233   -41.426 63.553  1.00 50.92  ? 21   ARG A NH1 1 
ATOM   151  N NH2 . ARG A 1 20  ? 0.769   -43.135 64.097  1.00 59.49  ? 21   ARG A NH2 1 
ATOM   152  N N   . LEU A 1 21  ? 0.426   -43.260 56.857  1.00 37.98  ? 22   LEU A N   1 
ATOM   153  C CA  . LEU A 1 21  ? -0.284  -44.373 56.238  1.00 39.39  ? 22   LEU A CA  1 
ATOM   154  C C   . LEU A 1 21  ? 0.500   -45.634 56.446  1.00 42.09  ? 22   LEU A C   1 
ATOM   155  O O   . LEU A 1 21  ? 1.722   -45.576 56.527  1.00 45.59  ? 22   LEU A O   1 
ATOM   156  C CB  . LEU A 1 21  ? -0.483  -44.159 54.728  1.00 35.07  ? 22   LEU A CB  1 
ATOM   157  C CG  . LEU A 1 21  ? -1.181  -42.882 54.262  1.00 40.68  ? 22   LEU A CG  1 
ATOM   158  C CD1 . LEU A 1 21  ? -1.185  -42.844 52.755  1.00 37.59  ? 22   LEU A CD1 1 
ATOM   159  C CD2 . LEU A 1 21  ? -2.594  -42.786 54.825  1.00 36.61  ? 22   LEU A CD2 1 
ATOM   160  N N   . LYS A 1 22  ? -0.196  -46.771 56.486  1.00 39.05  ? 23   LYS A N   1 
ATOM   161  C CA  . LYS A 1 22  ? 0.451   -48.086 56.551  1.00 37.82  ? 23   LYS A CA  1 
ATOM   162  C C   . LYS A 1 22  ? 0.634   -48.726 55.180  1.00 34.00  ? 23   LYS A C   1 
ATOM   163  O O   . LYS A 1 22  ? -0.196  -48.577 54.286  1.00 34.71  ? 23   LYS A O   1 
ATOM   164  C CB  . LYS A 1 22  ? -0.364  -49.038 57.441  1.00 41.68  ? 23   LYS A CB  1 
ATOM   165  C CG  . LYS A 1 22  ? -0.480  -48.596 58.900  1.00 46.45  ? 23   LYS A CG  1 
ATOM   166  C CD  . LYS A 1 22  ? -1.303  -49.604 59.748  1.00 45.82  ? 23   LYS A CD  1 
ATOM   167  C CE  . LYS A 1 22  ? -2.685  -49.857 59.140  1.00 57.20  ? 23   LYS A CE  1 
ATOM   168  N NZ  . LYS A 1 22  ? -3.335  -51.128 59.627  1.00 63.18  ? 23   LYS A NZ  1 
ATOM   169  N N   . THR A 1 23  ? 1.731   -49.446 55.017  1.00 30.95  ? 24   THR A N   1 
ATOM   170  C CA  . THR A 1 23  ? 1.898   -50.332 53.892  1.00 35.90  ? 24   THR A CA  1 
ATOM   171  C C   . THR A 1 23  ? 2.473   -51.597 54.492  1.00 34.54  ? 24   THR A C   1 
ATOM   172  O O   . THR A 1 23  ? 3.036   -51.544 55.581  1.00 36.97  ? 24   THR A O   1 
ATOM   173  C CB  . THR A 1 23  ? 2.860   -49.748 52.810  1.00 35.60  ? 24   THR A CB  1 
ATOM   174  O OG1 . THR A 1 23  ? 4.223   -49.959 53.214  1.00 31.43  ? 24   THR A OG1 1 
ATOM   175  C CG2 . THR A 1 23  ? 2.612   -48.263 52.628  1.00 35.91  ? 24   THR A CG2 1 
ATOM   176  N N   . PRO A 1 24  ? 2.387   -52.722 53.774  1.00 33.58  ? 25   PRO A N   1 
ATOM   177  C CA  . PRO A 1 24  ? 3.061   -53.960 54.184  1.00 34.50  ? 25   PRO A CA  1 
ATOM   178  C C   . PRO A 1 24  ? 4.554   -53.792 54.389  1.00 38.67  ? 25   PRO A C   1 
ATOM   179  O O   . PRO A 1 24  ? 5.155   -54.598 55.082  1.00 42.76  ? 25   PRO A O   1 
ATOM   180  C CB  . PRO A 1 24  ? 2.812   -54.903 53.001  1.00 35.18  ? 25   PRO A CB  1 
ATOM   181  C CG  . PRO A 1 24  ? 1.635   -54.357 52.321  1.00 38.35  ? 25   PRO A CG  1 
ATOM   182  C CD  . PRO A 1 24  ? 1.680   -52.885 52.490  1.00 36.71  ? 25   PRO A CD  1 
ATOM   183  N N   . GLY A 1 25  ? 5.153   -52.776 53.773  1.00 35.05  ? 26   GLY A N   1 
ATOM   184  C CA  . GLY A 1 25  ? 6.575   -52.551 53.936  1.00 37.34  ? 26   GLY A CA  1 
ATOM   185  C C   . GLY A 1 25  ? 6.921   -51.516 54.999  1.00 35.74  ? 26   GLY A C   1 
ATOM   186  O O   . GLY A 1 25  ? 8.093   -51.176 55.172  1.00 35.44  ? 26   GLY A O   1 
ATOM   187  N N   . GLY A 1 26  ? 5.916   -50.994 55.703  1.00 30.69  ? 27   GLY A N   1 
ATOM   188  C CA  . GLY A 1 26  ? 6.163   -49.930 56.671  1.00 28.73  ? 27   GLY A CA  1 
ATOM   189  C C   . GLY A 1 26  ? 5.440   -48.619 56.406  1.00 35.05  ? 27   GLY A C   1 
ATOM   190  O O   . GLY A 1 26  ? 4.794   -48.437 55.381  1.00 37.61  ? 27   GLY A O   1 
ATOM   191  N N   . PRO A 1 27  ? 5.539   -47.678 57.344  1.00 34.53  ? 28   PRO A N   1 
ATOM   192  C CA  . PRO A 1 27  ? 4.774   -46.439 57.182  1.00 30.36  ? 28   PRO A CA  1 
ATOM   193  C C   . PRO A 1 27  ? 5.261   -45.488 56.077  1.00 33.16  ? 28   PRO A C   1 
ATOM   194  O O   . PRO A 1 27  ? 6.391   -45.552 55.589  1.00 27.71  ? 28   PRO A O   1 
ATOM   195  C CB  . PRO A 1 27  ? 4.925   -45.764 58.544  1.00 32.66  ? 28   PRO A CB  1 
ATOM   196  C CG  . PRO A 1 27  ? 6.197   -46.306 59.092  1.00 30.14  ? 28   PRO A CG  1 
ATOM   197  C CD  . PRO A 1 27  ? 6.279   -47.723 58.619  1.00 25.71  ? 28   PRO A CD  1 
ATOM   198  N N   . VAL A 1 28  ? 4.381   -44.559 55.734  1.00 28.15  ? 29   VAL A N   1 
ATOM   199  C CA  . VAL A 1 28  ? 4.631   -43.548 54.736  1.00 26.77  ? 29   VAL A CA  1 
ATOM   200  C C   . VAL A 1 28  ? 3.933   -42.277 55.237  1.00 31.09  ? 29   VAL A C   1 
ATOM   201  O O   . VAL A 1 28  ? 2.943   -42.380 55.968  1.00 33.25  ? 29   VAL A O   1 
ATOM   202  C CB  . VAL A 1 28  ? 4.094   -44.040 53.373  1.00 32.17  ? 29   VAL A CB  1 
ATOM   203  C CG1 . VAL A 1 28  ? 3.372   -42.966 52.625  1.00 34.63  ? 29   VAL A CG1 1 
ATOM   204  C CG2 . VAL A 1 28  ? 5.226   -44.671 52.568  1.00 29.69  ? 29   VAL A CG2 1 
ATOM   205  N N   . SER A 1 29  ? 4.433   -41.092 54.886  1.00 27.12  ? 30   SER A N   1 
ATOM   206  C CA  . SER A 1 29  ? 3.735   -39.852 55.246  1.00 33.30  ? 30   SER A CA  1 
ATOM   207  C C   . SER A 1 29  ? 2.957   -39.356 54.029  1.00 35.32  ? 30   SER A C   1 
ATOM   208  O O   . SER A 1 29  ? 3.441   -39.452 52.923  1.00 34.27  ? 30   SER A O   1 
ATOM   209  C CB  . SER A 1 29  ? 4.709   -38.757 55.702  1.00 36.02  ? 30   SER A CB  1 
ATOM   210  O OG  . SER A 1 29  ? 5.734   -39.256 56.532  1.00 42.00  ? 30   SER A OG  1 
ATOM   211  N N   . ALA A 1 30  ? 1.759   -38.831 54.238  1.00 34.85  ? 31   ALA A N   1 
ATOM   212  C CA  . ALA A 1 30  ? 0.950   -38.371 53.136  1.00 31.77  ? 31   ALA A CA  1 
ATOM   213  C C   . ALA A 1 30  ? 0.346   -37.036 53.485  1.00 36.56  ? 31   ALA A C   1 
ATOM   214  O O   . ALA A 1 30  ? -0.109  -36.831 54.614  1.00 30.38  ? 31   ALA A O   1 
ATOM   215  C CB  . ALA A 1 30  ? -0.141  -39.373 52.803  1.00 31.20  ? 31   ALA A CB  1 
ATOM   216  N N   . PHE A 1 31  ? 0.350   -36.129 52.513  1.00 27.39  ? 32   PHE A N   1 
ATOM   217  C CA  . PHE A 1 31  ? -0.291  -34.834 52.666  1.00 31.43  ? 32   PHE A CA  1 
ATOM   218  C C   . PHE A 1 31  ? -1.243  -34.710 51.497  1.00 31.56  ? 32   PHE A C   1 
ATOM   219  O O   . PHE A 1 31  ? -0.820  -34.497 50.354  1.00 30.69  ? 32   PHE A O   1 
ATOM   220  C CB  . PHE A 1 31  ? 0.753   -33.704 52.714  1.00 25.84  ? 32   PHE A CB  1 
ATOM   221  C CG  . PHE A 1 31  ? 1.796   -33.929 53.772  1.00 30.52  ? 32   PHE A CG  1 
ATOM   222  C CD1 . PHE A 1 31  ? 2.837   -34.811 53.562  1.00 30.39  ? 32   PHE A CD1 1 
ATOM   223  C CD2 . PHE A 1 31  ? 1.708   -33.298 54.990  1.00 28.87  ? 32   PHE A CD2 1 
ATOM   224  C CE1 . PHE A 1 31  ? 3.780   -35.053 54.548  1.00 37.39  ? 32   PHE A CE1 1 
ATOM   225  C CE2 . PHE A 1 31  ? 2.648   -33.541 55.979  1.00 37.33  ? 32   PHE A CE2 1 
ATOM   226  C CZ  . PHE A 1 31  ? 3.681   -34.422 55.747  1.00 30.47  ? 32   PHE A CZ  1 
ATOM   227  N N   . LEU A 1 32  ? -2.523  -34.908 51.783  1.00 29.74  ? 33   LEU A N   1 
ATOM   228  C CA  . LEU A 1 32  ? -3.533  -35.064 50.748  1.00 31.34  ? 33   LEU A CA  1 
ATOM   229  C C   . LEU A 1 32  ? -4.431  -33.866 50.765  1.00 30.06  ? 33   LEU A C   1 
ATOM   230  O O   . LEU A 1 32  ? -4.808  -33.417 51.828  1.00 31.53  ? 33   LEU A O   1 
ATOM   231  C CB  . LEU A 1 32  ? -4.353  -36.338 50.978  1.00 29.93  ? 33   LEU A CB  1 
ATOM   232  C CG  . LEU A 1 32  ? -3.536  -37.598 51.235  1.00 35.20  ? 33   LEU A CG  1 
ATOM   233  C CD1 . LEU A 1 32  ? -4.450  -38.797 51.590  1.00 32.54  ? 33   LEU A CD1 1 
ATOM   234  C CD2 . LEU A 1 32  ? -2.710  -37.901 49.972  1.00 29.42  ? 33   LEU A CD2 1 
ATOM   235  N N   . GLY A 1 33  ? -4.798  -33.344 49.603  1.00 26.22  ? 34   GLY A N   1 
ATOM   236  C CA  . GLY A 1 33  ? -5.715  -32.220 49.588  1.00 24.72  ? 34   GLY A CA  1 
ATOM   237  C C   . GLY A 1 33  ? -5.050  -30.883 49.905  1.00 28.47  ? 34   GLY A C   1 
ATOM   238  O O   . GLY A 1 33  ? -5.652  -30.031 50.539  1.00 33.90  ? 34   GLY A O   1 
ATOM   239  N N   . ILE A 1 34  ? -3.812  -30.693 49.445  1.00 30.56  ? 35   ILE A N   1 
ATOM   240  C CA  . ILE A 1 34  ? -3.137  -29.404 49.589  1.00 29.98  ? 35   ILE A CA  1 
ATOM   241  C C   . ILE A 1 34  ? -3.609  -28.423 48.519  1.00 30.91  ? 35   ILE A C   1 
ATOM   242  O O   . ILE A 1 34  ? -3.465  -28.668 47.336  1.00 30.24  ? 35   ILE A O   1 
ATOM   243  C CB  . ILE A 1 34  ? -1.620  -29.546 49.476  1.00 31.83  ? 35   ILE A CB  1 
ATOM   244  C CG1 . ILE A 1 34  ? -1.106  -30.592 50.462  1.00 26.89  ? 35   ILE A CG1 1 
ATOM   245  C CG2 . ILE A 1 34  ? -0.950  -28.181 49.666  1.00 30.28  ? 35   ILE A CG2 1 
ATOM   246  C CD1 . ILE A 1 34  ? 0.366   -30.942 50.248  1.00 26.77  ? 35   ILE A CD1 1 
ATOM   247  N N   . PRO A 1 35  ? -4.178  -27.301 48.931  1.00 31.76  ? 36   PRO A N   1 
ATOM   248  C CA  . PRO A 1 35  ? -4.617  -26.333 47.917  1.00 25.07  ? 36   PRO A CA  1 
ATOM   249  C C   . PRO A 1 35  ? -3.444  -25.671 47.178  1.00 28.84  ? 36   PRO A C   1 
ATOM   250  O O   . PRO A 1 35  ? -2.551  -25.164 47.848  1.00 28.80  ? 36   PRO A O   1 
ATOM   251  C CB  . PRO A 1 35  ? -5.394  -25.292 48.738  1.00 30.94  ? 36   PRO A CB  1 
ATOM   252  C CG  . PRO A 1 35  ? -4.794  -25.380 50.124  1.00 34.25  ? 36   PRO A CG  1 
ATOM   253  C CD  . PRO A 1 35  ? -4.373  -26.834 50.316  1.00 28.18  ? 36   PRO A CD  1 
ATOM   254  N N   . PHE A 1 36  ? -3.432  -25.676 45.842  1.00 27.00  ? 37   PHE A N   1 
ATOM   255  C CA  . PHE A 1 36  ? -2.328  -25.040 45.126  1.00 26.49  ? 37   PHE A CA  1 
ATOM   256  C C   . PHE A 1 36  ? -2.810  -23.879 44.262  1.00 31.80  ? 37   PHE A C   1 
ATOM   257  O O   . PHE A 1 36  ? -2.006  -23.109 43.761  1.00 31.85  ? 37   PHE A O   1 
ATOM   258  C CB  . PHE A 1 36  ? -1.525  -26.068 44.290  1.00 29.87  ? 37   PHE A CB  1 
ATOM   259  C CG  . PHE A 1 36  ? -2.244  -26.608 43.055  1.00 29.37  ? 37   PHE A CG  1 
ATOM   260  C CD1 . PHE A 1 36  ? -2.176  -25.938 41.834  1.00 25.63  ? 37   PHE A CD1 1 
ATOM   261  C CD2 . PHE A 1 36  ? -2.928  -27.825 43.110  1.00 26.16  ? 37   PHE A CD2 1 
ATOM   262  C CE1 . PHE A 1 36  ? -2.840  -26.442 40.699  1.00 27.83  ? 37   PHE A CE1 1 
ATOM   263  C CE2 . PHE A 1 36  ? -3.563  -28.355 41.988  1.00 23.08  ? 37   PHE A CE2 1 
ATOM   264  C CZ  . PHE A 1 36  ? -3.509  -27.667 40.771  1.00 24.27  ? 37   PHE A CZ  1 
ATOM   265  N N   . ALA A 1 37  ? -4.123  -23.721 44.136  1.00 29.13  ? 38   ALA A N   1 
ATOM   266  C CA  . ALA A 1 37  ? -4.688  -22.590 43.413  1.00 30.36  ? 38   ALA A CA  1 
ATOM   267  C C   . ALA A 1 37  ? -5.844  -22.017 44.208  1.00 34.30  ? 38   ALA A C   1 
ATOM   268  O O   . ALA A 1 37  ? -6.421  -22.714 45.037  1.00 28.10  ? 38   ALA A O   1 
ATOM   269  C CB  . ALA A 1 37  ? -5.172  -23.014 41.996  1.00 21.49  ? 38   ALA A CB  1 
ATOM   270  N N   . GLU A 1 38  ? -6.194  -20.761 43.948  1.00 33.25  ? 39   GLU A N   1 
ATOM   271  C CA  . GLU A 1 38  ? -7.511  -20.254 44.345  1.00 37.31  ? 39   GLU A CA  1 
ATOM   272  C C   . GLU A 1 38  ? -8.612  -21.053 43.649  1.00 34.81  ? 39   GLU A C   1 
ATOM   273  O O   . GLU A 1 38  ? -8.482  -21.400 42.475  1.00 32.77  ? 39   GLU A O   1 
ATOM   274  C CB  . GLU A 1 38  ? -7.658  -18.768 43.997  1.00 34.90  ? 39   GLU A CB  1 
ATOM   275  C CG  . GLU A 1 38  ? -6.772  -17.868 44.837  1.00 41.83  ? 39   GLU A CG  1 
ATOM   276  C CD  . GLU A 1 38  ? -7.146  -17.933 46.299  1.00 39.49  ? 39   GLU A CD  1 
ATOM   277  O OE1 . GLU A 1 38  ? -8.346  -17.772 46.608  1.00 44.61  ? 39   GLU A OE1 1 
ATOM   278  O OE2 . GLU A 1 38  ? -6.258  -18.190 47.135  1.00 38.01  ? 39   GLU A OE2 1 
ATOM   279  N N   . PRO A 1 39  ? -9.707  -21.342 44.370  1.00 39.61  ? 40   PRO A N   1 
ATOM   280  C CA  . PRO A 1 39  ? -10.799 -22.107 43.757  1.00 31.26  ? 40   PRO A CA  1 
ATOM   281  C C   . PRO A 1 39  ? -11.294 -21.456 42.472  1.00 36.36  ? 40   PRO A C   1 
ATOM   282  O O   . PRO A 1 39  ? -11.694 -20.298 42.513  1.00 39.42  ? 40   PRO A O   1 
ATOM   283  C CB  . PRO A 1 39  ? -11.881 -22.093 44.842  1.00 36.92  ? 40   PRO A CB  1 
ATOM   284  C CG  . PRO A 1 39  ? -11.078 -22.008 46.151  1.00 31.71  ? 40   PRO A CG  1 
ATOM   285  C CD  . PRO A 1 39  ? -9.931  -21.081 45.812  1.00 31.52  ? 40   PRO A CD  1 
ATOM   286  N N   . PRO A 1 40  ? -11.254 -22.184 41.344  1.00 33.36  ? 41   PRO A N   1 
ATOM   287  C CA  . PRO A 1 40  ? -11.579 -21.569 40.057  1.00 34.88  ? 41   PRO A CA  1 
ATOM   288  C C   . PRO A 1 40  ? -13.088 -21.479 39.821  1.00 40.59  ? 41   PRO A C   1 
ATOM   289  O O   . PRO A 1 40  ? -13.598 -22.098 38.888  1.00 37.09  ? 41   PRO A O   1 
ATOM   290  C CB  . PRO A 1 40  ? -10.926 -22.520 39.050  1.00 33.68  ? 41   PRO A CB  1 
ATOM   291  C CG  . PRO A 1 40  ? -10.983 -23.847 39.722  1.00 31.76  ? 41   PRO A CG  1 
ATOM   292  C CD  . PRO A 1 40  ? -10.864 -23.601 41.195  1.00 33.93  ? 41   PRO A CD  1 
ATOM   293  N N   . MET A 1 41  ? -13.779 -20.707 40.653  1.00 39.80  ? 42   MET A N   1 
ATOM   294  C CA  . MET A 1 41  ? -15.244 -20.686 40.666  1.00 44.82  ? 42   MET A CA  1 
ATOM   295  C C   . MET A 1 41  ? -15.809 -19.311 40.357  1.00 41.50  ? 42   MET A C   1 
ATOM   296  O O   . MET A 1 41  ? -15.117 -18.297 40.484  1.00 42.87  ? 42   MET A O   1 
ATOM   297  C CB  . MET A 1 41  ? -15.764 -21.137 42.030  1.00 51.55  ? 42   MET A CB  1 
ATOM   298  C CG  . MET A 1 41  ? -15.051 -22.342 42.564  1.00 45.08  ? 42   MET A CG  1 
ATOM   299  S SD  . MET A 1 41  ? -16.008 -23.125 43.835  1.00 64.53  ? 42   MET A SD  1 
ATOM   300  C CE  . MET A 1 41  ? -17.617 -23.200 43.064  1.00 54.73  ? 42   MET A CE  1 
ATOM   301  N N   . GLY A 1 42  ? -17.087 -19.286 39.996  1.00 36.90  ? 43   GLY A N   1 
ATOM   302  C CA  . GLY A 1 42  ? -17.753 -18.053 39.628  1.00 39.81  ? 43   GLY A CA  1 
ATOM   303  C C   . GLY A 1 42  ? -17.091 -17.369 38.449  1.00 43.26  ? 43   GLY A C   1 
ATOM   304  O O   . GLY A 1 42  ? -17.006 -17.925 37.343  1.00 39.65  ? 43   GLY A O   1 
ATOM   305  N N   . PRO A 1 43  ? -16.631 -16.134 38.679  1.00 44.19  ? 44   PRO A N   1 
ATOM   306  C CA  . PRO A 1 43  ? -15.928 -15.342 37.664  1.00 37.40  ? 44   PRO A CA  1 
ATOM   307  C C   . PRO A 1 43  ? -14.607 -16.002 37.220  1.00 41.27  ? 44   PRO A C   1 
ATOM   308  O O   . PRO A 1 43  ? -14.131 -15.709 36.124  1.00 39.15  ? 44   PRO A O   1 
ATOM   309  C CB  . PRO A 1 43  ? -15.682 -14.005 38.370  1.00 41.80  ? 44   PRO A CB  1 
ATOM   310  C CG  . PRO A 1 43  ? -15.784 -14.325 39.859  1.00 31.81  ? 44   PRO A CG  1 
ATOM   311  C CD  . PRO A 1 43  ? -16.774 -15.429 39.969  1.00 35.37  ? 44   PRO A CD  1 
ATOM   312  N N   . ARG A 1 44  ? -14.044 -16.891 38.041  1.00 37.56  ? 45   ARG A N   1 
ATOM   313  C CA  . ARG A 1 44  ? -12.804 -17.600 37.673  1.00 40.30  ? 45   ARG A CA  1 
ATOM   314  C C   . ARG A 1 44  ? -12.998 -18.885 36.841  1.00 38.97  ? 45   ARG A C   1 
ATOM   315  O O   . ARG A 1 44  ? -12.021 -19.550 36.503  1.00 35.72  ? 45   ARG A O   1 
ATOM   316  C CB  . ARG A 1 44  ? -12.005 -17.975 38.924  1.00 32.58  ? 45   ARG A CB  1 
ATOM   317  C CG  . ARG A 1 44  ? -11.484 -16.814 39.709  1.00 35.85  ? 45   ARG A CG  1 
ATOM   318  C CD  . ARG A 1 44  ? -10.673 -17.359 40.889  1.00 56.28  ? 45   ARG A CD  1 
ATOM   319  N NE  . ARG A 1 44  ? -10.520 -16.390 41.974  1.00 69.17  ? 45   ARG A NE  1 
ATOM   320  C CZ  . ARG A 1 44  ? -9.708  -15.344 41.907  1.00 70.16  ? 45   ARG A CZ  1 
ATOM   321  N NH1 . ARG A 1 44  ? -8.996  -15.141 40.806  1.00 66.93  ? 45   ARG A NH1 1 
ATOM   322  N NH2 . ARG A 1 44  ? -9.609  -14.506 42.926  1.00 69.56  ? 45   ARG A NH2 1 
ATOM   323  N N   . ARG A 1 45  ? -14.239 -19.267 36.550  1.00 38.29  ? 46   ARG A N   1 
ATOM   324  C CA  . ARG A 1 45  ? -14.467 -20.401 35.665  1.00 36.07  ? 46   ARG A CA  1 
ATOM   325  C C   . ARG A 1 45  ? -13.915 -20.067 34.275  1.00 36.39  ? 46   ARG A C   1 
ATOM   326  O O   . ARG A 1 45  ? -14.124 -18.956 33.800  1.00 38.12  ? 46   ARG A O   1 
ATOM   327  C CB  . ARG A 1 45  ? -15.951 -20.731 35.590  1.00 35.25  ? 46   ARG A CB  1 
ATOM   328  C CG  . ARG A 1 45  ? -16.279 -21.918 34.723  1.00 31.27  ? 46   ARG A CG  1 
ATOM   329  C CD  . ARG A 1 45  ? -17.785 -22.125 34.579  1.00 30.05  ? 46   ARG A CD  1 
ATOM   330  N NE  . ARG A 1 45  ? -18.383 -22.861 35.700  1.00 31.98  ? 46   ARG A NE  1 
ATOM   331  C CZ  . ARG A 1 45  ? -19.691 -23.069 35.807  1.00 35.21  ? 46   ARG A CZ  1 
ATOM   332  N NH1 . ARG A 1 45  ? -20.506 -22.603 34.866  1.00 33.70  ? 46   ARG A NH1 1 
ATOM   333  N NH2 . ARG A 1 45  ? -20.188 -23.741 36.832  1.00 31.70  ? 46   ARG A NH2 1 
ATOM   334  N N   . PHE A 1 46  ? -13.205 -21.020 33.666  1.00 30.59  ? 47   PHE A N   1 
ATOM   335  C CA  . PHE A 1 46  ? -12.566 -20.901 32.348  1.00 34.86  ? 47   PHE A CA  1 
ATOM   336  C C   . PHE A 1 46  ? -11.268 -20.073 32.364  1.00 30.81  ? 47   PHE A C   1 
ATOM   337  O O   . PHE A 1 46  ? -10.573 -19.985 31.352  1.00 36.69  ? 47   PHE A O   1 
ATOM   338  C CB  . PHE A 1 46  ? -13.531 -20.303 31.311  1.00 31.21  ? 47   PHE A CB  1 
ATOM   339  C CG  . PHE A 1 46  ? -14.822 -21.049 31.191  1.00 35.56  ? 47   PHE A CG  1 
ATOM   340  C CD1 . PHE A 1 46  ? -14.829 -22.425 31.020  1.00 27.99  ? 47   PHE A CD1 1 
ATOM   341  C CD2 . PHE A 1 46  ? -16.033 -20.376 31.249  1.00 36.44  ? 47   PHE A CD2 1 
ATOM   342  C CE1 . PHE A 1 46  ? -16.016 -23.111 30.908  1.00 33.95  ? 47   PHE A CE1 1 
ATOM   343  C CE2 . PHE A 1 46  ? -17.227 -21.059 31.136  1.00 30.89  ? 47   PHE A CE2 1 
ATOM   344  C CZ  . PHE A 1 46  ? -17.224 -22.421 30.968  1.00 29.04  ? 47   PHE A CZ  1 
ATOM   345  N N   . LEU A 1 47  ? -10.950 -19.473 33.501  1.00 28.53  ? 48   LEU A N   1 
ATOM   346  C CA  . LEU A 1 47  ? -9.773  -18.628 33.601  1.00 34.82  ? 48   LEU A CA  1 
ATOM   347  C C   . LEU A 1 47  ? -8.552  -19.412 34.078  1.00 31.83  ? 48   LEU A C   1 
ATOM   348  O O   . LEU A 1 47  ? -8.687  -20.410 34.780  1.00 32.12  ? 48   LEU A O   1 
ATOM   349  C CB  . LEU A 1 47  ? -10.037 -17.469 34.557  1.00 33.85  ? 48   LEU A CB  1 
ATOM   350  C CG  . LEU A 1 47  ? -11.020 -16.377 34.157  1.00 40.83  ? 48   LEU A CG  1 
ATOM   351  C CD1 . LEU A 1 47  ? -10.889 -15.238 35.173  1.00 35.23  ? 48   LEU A CD1 1 
ATOM   352  C CD2 . LEU A 1 47  ? -10.727 -15.895 32.749  1.00 33.37  ? 48   LEU A CD2 1 
ATOM   353  N N   . PRO A 1 48  ? -7.350  -18.950 33.701  1.00 41.17  ? 49   PRO A N   1 
ATOM   354  C CA  . PRO A 1 48  ? -6.093  -19.489 34.233  1.00 30.33  ? 49   PRO A CA  1 
ATOM   355  C C   . PRO A 1 48  ? -6.145  -19.585 35.732  1.00 36.25  ? 49   PRO A C   1 
ATOM   356  O O   . PRO A 1 48  ? -6.782  -18.749 36.367  1.00 31.52  ? 49   PRO A O   1 
ATOM   357  C CB  . PRO A 1 48  ? -5.053  -18.451 33.793  1.00 34.08  ? 49   PRO A CB  1 
ATOM   358  C CG  . PRO A 1 48  ? -5.617  -17.902 32.495  1.00 35.24  ? 49   PRO A CG  1 
ATOM   359  C CD  . PRO A 1 48  ? -7.121  -17.886 32.701  1.00 37.73  ? 49   PRO A CD  1 
ATOM   360  N N   . PRO A 1 49  ? -5.484  -20.590 36.305  1.00 30.38  ? 50   PRO A N   1 
ATOM   361  C CA  . PRO A 1 49  ? -5.449  -20.707 37.764  1.00 27.48  ? 50   PRO A CA  1 
ATOM   362  C C   . PRO A 1 49  ? -4.655  -19.576 38.414  1.00 37.63  ? 50   PRO A C   1 
ATOM   363  O O   . PRO A 1 49  ? -3.647  -19.142 37.872  1.00 38.52  ? 50   PRO A O   1 
ATOM   364  C CB  . PRO A 1 49  ? -4.738  -22.041 37.997  1.00 31.24  ? 50   PRO A CB  1 
ATOM   365  C CG  . PRO A 1 49  ? -3.850  -22.199 36.762  1.00 27.17  ? 50   PRO A CG  1 
ATOM   366  C CD  . PRO A 1 49  ? -4.648  -21.596 35.628  1.00 27.59  ? 50   PRO A CD  1 
ATOM   367  N N   . GLU A 1 50  ? -5.108  -19.109 39.566  1.00 33.62  ? 51   GLU A N   1 
ATOM   368  C CA  . GLU A 1 50  ? -4.319  -18.174 40.354  1.00 39.12  ? 51   GLU A CA  1 
ATOM   369  C C   . GLU A 1 50  ? -3.701  -18.898 41.521  1.00 35.24  ? 51   GLU A C   1 
ATOM   370  O O   . GLU A 1 50  ? -4.357  -19.731 42.138  1.00 36.89  ? 51   GLU A O   1 
ATOM   371  C CB  . GLU A 1 50  ? -5.181  -17.022 40.855  1.00 41.92  ? 51   GLU A CB  1 
ATOM   372  C CG  . GLU A 1 50  ? -5.690  -16.124 39.738  1.00 54.71  ? 51   GLU A CG  1 
ATOM   373  C CD  . GLU A 1 50  ? -6.192  -14.804 40.274  1.00 80.77  ? 51   GLU A CD  1 
ATOM   374  O OE1 . GLU A 1 50  ? -6.755  -14.798 41.398  1.00 80.65  ? 51   GLU A OE1 1 
ATOM   375  O OE2 . GLU A 1 50  ? -6.019  -13.773 39.585  1.00 100.23 ? 51   GLU A OE2 1 
ATOM   376  N N   . PRO A 1 51  ? -2.433  -18.590 41.824  1.00 40.13  ? 52   PRO A N   1 
ATOM   377  C CA  . PRO A 1 51  ? -1.771  -19.190 42.985  1.00 35.07  ? 52   PRO A CA  1 
ATOM   378  C C   . PRO A 1 51  ? -2.625  -19.055 44.247  1.00 35.50  ? 52   PRO A C   1 
ATOM   379  O O   . PRO A 1 51  ? -3.310  -18.051 44.443  1.00 37.18  ? 52   PRO A O   1 
ATOM   380  C CB  . PRO A 1 51  ? -0.473  -18.387 43.110  1.00 36.09  ? 52   PRO A CB  1 
ATOM   381  C CG  . PRO A 1 51  ? -0.224  -17.842 41.728  1.00 36.35  ? 52   PRO A CG  1 
ATOM   382  C CD  . PRO A 1 51  ? -1.568  -17.632 41.101  1.00 32.84  ? 52   PRO A CD  1 
ATOM   383  N N   . LYS A 1 52  ? -2.613  -20.090 45.071  1.00 32.32  ? 53   LYS A N   1 
ATOM   384  C CA  . LYS A 1 52  ? -3.360  -20.080 46.308  1.00 34.26  ? 53   LYS A CA  1 
ATOM   385  C C   . LYS A 1 52  ? -2.790  -18.995 47.226  1.00 38.86  ? 53   LYS A C   1 
ATOM   386  O O   . LYS A 1 52  ? -1.594  -18.930 47.448  1.00 34.23  ? 53   LYS A O   1 
ATOM   387  C CB  . LYS A 1 52  ? -3.287  -21.455 46.980  1.00 31.84  ? 53   LYS A CB  1 
ATOM   388  C CG  . LYS A 1 52  ? -3.915  -21.507 48.378  1.00 33.63  ? 53   LYS A CG  1 
ATOM   389  C CD  . LYS A 1 52  ? -5.443  -21.401 48.311  1.00 33.66  ? 53   LYS A CD  1 
ATOM   390  C CE  . LYS A 1 52  ? -6.071  -21.546 49.726  1.00 35.58  ? 53   LYS A CE  1 
ATOM   391  N NZ  . LYS A 1 52  ? -7.580  -21.583 49.609  1.00 36.78  ? 53   LYS A NZ  1 
ATOM   392  N N   A GLN A 1 53  ? -3.659  -18.140 47.743  0.45 38.36  ? 54   GLN A N   1 
ATOM   393  N N   B GLN A 1 53  ? -3.650  -18.120 47.727  0.55 38.42  ? 54   GLN A N   1 
ATOM   394  C CA  A GLN A 1 53  ? -3.240  -17.106 48.681  0.45 40.55  ? 54   GLN A CA  1 
ATOM   395  C CA  B GLN A 1 53  ? -3.210  -17.105 48.677  0.55 40.55  ? 54   GLN A CA  1 
ATOM   396  C C   A GLN A 1 53  ? -2.939  -17.741 50.047  0.45 40.17  ? 54   GLN A C   1 
ATOM   397  C C   B GLN A 1 53  ? -2.910  -17.759 50.029  0.55 40.12  ? 54   GLN A C   1 
ATOM   398  O O   A GLN A 1 53  ? -3.592  -18.711 50.433  0.45 38.20  ? 54   GLN A O   1 
ATOM   399  O O   B GLN A 1 53  ? -3.543  -18.752 50.393  0.55 38.18  ? 54   GLN A O   1 
ATOM   400  C CB  A GLN A 1 53  ? -4.324  -16.021 48.785  0.45 39.33  ? 54   GLN A CB  1 
ATOM   401  C CB  B GLN A 1 53  ? -4.266  -16.000 48.826  0.55 39.36  ? 54   GLN A CB  1 
ATOM   402  C CG  A GLN A 1 53  ? -4.736  -15.454 47.416  0.45 41.10  ? 54   GLN A CG  1 
ATOM   403  C CG  B GLN A 1 53  ? -4.348  -15.035 47.636  0.55 41.98  ? 54   GLN A CG  1 
ATOM   404  C CD  A GLN A 1 53  ? -5.790  -14.359 47.492  0.45 47.57  ? 54   GLN A CD  1 
ATOM   405  C CD  B GLN A 1 53  ? -3.098  -14.176 47.477  0.55 44.42  ? 54   GLN A CD  1 
ATOM   406  O OE1 A GLN A 1 53  ? -5.961  -13.716 48.529  0.45 47.15  ? 54   GLN A OE1 1 
ATOM   407  O OE1 B GLN A 1 53  ? -2.647  -13.531 48.427  0.55 51.82  ? 54   GLN A OE1 1 
ATOM   408  N NE2 A GLN A 1 53  ? -6.501  -14.139 46.380  0.45 51.00  ? 54   GLN A NE2 1 
ATOM   409  N NE2 B GLN A 1 53  ? -2.535  -14.167 46.274  0.55 37.69  ? 54   GLN A NE2 1 
ATOM   410  N N   . PRO A 1 54  ? -1.923  -17.215 50.762  1.00 40.38  ? 55   PRO A N   1 
ATOM   411  C CA  . PRO A 1 54  ? -1.529  -17.723 52.086  1.00 38.58  ? 55   PRO A CA  1 
ATOM   412  C C   . PRO A 1 54  ? -2.683  -17.820 53.067  1.00 39.86  ? 55   PRO A C   1 
ATOM   413  O O   . PRO A 1 54  ? -3.604  -17.011 53.034  1.00 38.59  ? 55   PRO A O   1 
ATOM   414  C CB  . PRO A 1 54  ? -0.515  -16.683 52.571  1.00 38.99  ? 55   PRO A CB  1 
ATOM   415  C CG  . PRO A 1 54  ? 0.097   -16.168 51.325  1.00 38.38  ? 55   PRO A CG  1 
ATOM   416  C CD  . PRO A 1 54  ? -1.018  -16.139 50.303  1.00 34.91  ? 55   PRO A CD  1 
ATOM   417  N N   . TRP A 1 55  ? -2.626  -18.820 53.934  1.00 41.43  ? 56   TRP A N   1 
ATOM   418  C CA  . TRP A 1 55  ? -3.660  -19.010 54.945  1.00 35.91  ? 56   TRP A CA  1 
ATOM   419  C C   . TRP A 1 55  ? -3.057  -18.971 56.349  1.00 37.62  ? 56   TRP A C   1 
ATOM   420  O O   . TRP A 1 55  ? -1.851  -19.198 56.552  1.00 41.06  ? 56   TRP A O   1 
ATOM   421  C CB  . TRP A 1 55  ? -4.387  -20.343 54.728  1.00 35.71  ? 56   TRP A CB  1 
ATOM   422  C CG  . TRP A 1 55  ? -3.440  -21.509 54.788  1.00 38.07  ? 56   TRP A CG  1 
ATOM   423  C CD1 . TRP A 1 55  ? -3.055  -22.187 55.896  1.00 37.19  ? 56   TRP A CD1 1 
ATOM   424  C CD2 . TRP A 1 55  ? -2.734  -22.102 53.685  1.00 35.40  ? 56   TRP A CD2 1 
ATOM   425  N NE1 . TRP A 1 55  ? -2.162  -23.171 55.567  1.00 39.13  ? 56   TRP A NE1 1 
ATOM   426  C CE2 . TRP A 1 55  ? -1.949  -23.142 54.211  1.00 36.39  ? 56   TRP A CE2 1 
ATOM   427  C CE3 . TRP A 1 55  ? -2.704  -21.865 52.304  1.00 33.49  ? 56   TRP A CE3 1 
ATOM   428  C CZ2 . TRP A 1 55  ? -1.144  -23.943 53.416  1.00 29.80  ? 56   TRP A CZ2 1 
ATOM   429  C CZ3 . TRP A 1 55  ? -1.892  -22.663 51.509  1.00 35.96  ? 56   TRP A CZ3 1 
ATOM   430  C CH2 . TRP A 1 55  ? -1.119  -23.684 52.070  1.00 34.76  ? 56   TRP A CH2 1 
ATOM   431  N N   . SER A 1 56  ? -3.897  -18.681 57.327  1.00 43.32  ? 57   SER A N   1 
ATOM   432  C CA  . SER A 1 56  ? -3.448  -18.730 58.701  1.00 51.04  ? 57   SER A CA  1 
ATOM   433  C C   . SER A 1 56  ? -3.956  -20.036 59.269  1.00 46.51  ? 57   SER A C   1 
ATOM   434  O O   . SER A 1 56  ? -4.900  -20.622 58.737  1.00 48.66  ? 57   SER A O   1 
ATOM   435  C CB  . SER A 1 56  ? -3.962  -17.537 59.493  1.00 52.92  ? 57   SER A CB  1 
ATOM   436  O OG  . SER A 1 56  ? -5.373  -17.556 59.506  1.00 50.74  ? 57   SER A OG  1 
ATOM   437  N N   . GLY A 1 57  ? -3.326  -20.508 60.333  1.00 52.65  ? 58   GLY A N   1 
ATOM   438  C CA  . GLY A 1 57  ? -3.758  -21.756 60.928  1.00 48.32  ? 58   GLY A CA  1 
ATOM   439  C C   . GLY A 1 57  ? -3.253  -22.941 60.129  1.00 54.28  ? 58   GLY A C   1 
ATOM   440  O O   . GLY A 1 57  ? -2.366  -22.808 59.277  1.00 42.93  ? 58   GLY A O   1 
ATOM   441  N N   . VAL A 1 58  ? -3.818  -24.108 60.403  1.00 46.62  ? 59   VAL A N   1 
ATOM   442  C CA  . VAL A 1 58  ? -3.297  -25.336 59.832  1.00 48.15  ? 59   VAL A CA  1 
ATOM   443  C C   . VAL A 1 58  ? -4.307  -25.980 58.890  1.00 48.77  ? 59   VAL A C   1 
ATOM   444  O O   . VAL A 1 58  ? -5.415  -26.337 59.305  1.00 46.41  ? 59   VAL A O   1 
ATOM   445  C CB  . VAL A 1 58  ? -2.908  -26.319 60.934  1.00 47.17  ? 59   VAL A CB  1 
ATOM   446  C CG1 . VAL A 1 58  ? -2.209  -27.549 60.335  1.00 37.59  ? 59   VAL A CG1 1 
ATOM   447  C CG2 . VAL A 1 58  ? -2.002  -25.613 61.952  1.00 45.94  ? 59   VAL A CG2 1 
ATOM   448  N N   . VAL A 1 59  ? -3.929  -26.096 57.614  1.00 42.86  ? 60   VAL A N   1 
ATOM   449  C CA  . VAL A 1 59  ? -4.767  -26.793 56.645  1.00 38.00  ? 60   VAL A CA  1 
ATOM   450  C C   . VAL A 1 59  ? -4.743  -28.285 56.964  1.00 36.42  ? 60   VAL A C   1 
ATOM   451  O O   . VAL A 1 59  ? -3.690  -28.879 57.191  1.00 38.12  ? 60   VAL A O   1 
ATOM   452  C CB  . VAL A 1 59  ? -4.315  -26.546 55.182  1.00 41.48  ? 60   VAL A CB  1 
ATOM   453  C CG1 . VAL A 1 59  ? -4.964  -27.579 54.231  1.00 41.13  ? 60   VAL A CG1 1 
ATOM   454  C CG2 . VAL A 1 59  ? -4.673  -25.131 54.755  1.00 35.51  ? 60   VAL A CG2 1 
ATOM   455  N N   . ASP A 1 60  ? -5.926  -28.868 57.034  1.00 39.91  ? 61   ASP A N   1 
ATOM   456  C CA  . ASP A 1 60  ? -6.069  -30.298 57.231  1.00 43.77  ? 61   ASP A CA  1 
ATOM   457  C C   . ASP A 1 60  ? -5.716  -31.021 55.931  1.00 39.41  ? 61   ASP A C   1 
ATOM   458  O O   . ASP A 1 60  ? -6.457  -30.898 54.963  1.00 41.42  ? 61   ASP A O   1 
ATOM   459  C CB  . ASP A 1 60  ? -7.514  -30.610 57.654  1.00 51.30  ? 61   ASP A CB  1 
ATOM   460  C CG  . ASP A 1 60  ? -7.816  -32.091 57.685  1.00 55.19  ? 61   ASP A CG  1 
ATOM   461  O OD1 . ASP A 1 60  ? -6.906  -32.869 58.034  1.00 56.35  ? 61   ASP A OD1 1 
ATOM   462  O OD2 . ASP A 1 60  ? -8.966  -32.472 57.372  1.00 63.97  ? 61   ASP A OD2 1 
ATOM   463  N N   . ALA A 1 61  ? -4.592  -31.737 55.879  1.00 35.16  ? 62   ALA A N   1 
ATOM   464  C CA  . ALA A 1 61  ? -4.258  -32.468 54.642  1.00 34.67  ? 62   ALA A CA  1 
ATOM   465  C C   . ALA A 1 61  ? -4.203  -33.979 54.889  1.00 35.60  ? 62   ALA A C   1 
ATOM   466  O O   . ALA A 1 61  ? -3.187  -34.636 54.625  1.00 32.11  ? 62   ALA A O   1 
ATOM   467  C CB  . ALA A 1 61  ? -2.937  -31.985 54.060  1.00 32.45  ? 62   ALA A CB  1 
ATOM   468  N N   . THR A 1 62  ? -5.303  -34.524 55.398  1.00 34.45  ? 63   THR A N   1 
ATOM   469  C CA  . THR A 1 62  ? -5.340  -35.912 55.849  1.00 38.79  ? 63   THR A CA  1 
ATOM   470  C C   . THR A 1 62  ? -6.261  -36.732 54.967  1.00 33.82  ? 63   THR A C   1 
ATOM   471  O O   . THR A 1 62  ? -6.366  -37.942 55.134  1.00 34.67  ? 63   THR A O   1 
ATOM   472  C CB  . THR A 1 62  ? -5.855  -36.034 57.298  1.00 36.41  ? 63   THR A CB  1 
ATOM   473  O OG1 . THR A 1 62  ? -7.193  -35.520 57.329  1.00 36.18  ? 63   THR A OG1 1 
ATOM   474  C CG2 . THR A 1 62  ? -4.983  -35.228 58.240  1.00 33.41  ? 63   THR A CG2 1 
ATOM   475  N N   . THR A 1 63  ? -6.941  -36.065 54.039  1.00 37.87  ? 64   THR A N   1 
ATOM   476  C CA  . THR A 1 63  ? -7.854  -36.764 53.154  1.00 34.29  ? 64   THR A CA  1 
ATOM   477  C C   . THR A 1 63  ? -7.878  -36.132 51.743  1.00 33.73  ? 64   THR A C   1 
ATOM   478  O O   . THR A 1 63  ? -7.609  -34.940 51.577  1.00 33.30  ? 64   THR A O   1 
ATOM   479  C CB  . THR A 1 63  ? -9.287  -36.803 53.788  1.00 36.75  ? 64   THR A CB  1 
ATOM   480  O OG1 . THR A 1 63  ? -10.142 -37.673 53.033  1.00 48.64  ? 64   THR A OG1 1 
ATOM   481  C CG2 . THR A 1 63  ? -9.884  -35.419 53.863  1.00 30.48  ? 64   THR A CG2 1 
ATOM   482  N N   . PHE A 1 64  ? -8.195  -36.949 50.737  1.00 29.03  ? 65   PHE A N   1 
ATOM   483  C CA  . PHE A 1 64  ? -8.289  -36.482 49.369  1.00 30.84  ? 65   PHE A CA  1 
ATOM   484  C C   . PHE A 1 64  ? -9.363  -35.423 49.289  1.00 34.44  ? 65   PHE A C   1 
ATOM   485  O O   . PHE A 1 64  ? -10.344 -35.483 50.008  1.00 34.40  ? 65   PHE A O   1 
ATOM   486  C CB  . PHE A 1 64  ? -8.605  -37.636 48.419  1.00 32.46  ? 65   PHE A CB  1 
ATOM   487  C CG  . PHE A 1 64  ? -7.428  -38.514 48.121  1.00 30.91  ? 65   PHE A CG  1 
ATOM   488  C CD1 . PHE A 1 64  ? -6.290  -37.992 47.524  1.00 25.42  ? 65   PHE A CD1 1 
ATOM   489  C CD2 . PHE A 1 64  ? -7.479  -39.862 48.385  1.00 30.66  ? 65   PHE A CD2 1 
ATOM   490  C CE1 . PHE A 1 64  ? -5.213  -38.792 47.240  1.00 29.09  ? 65   PHE A CE1 1 
ATOM   491  C CE2 . PHE A 1 64  ? -6.402  -40.672 48.111  1.00 24.93  ? 65   PHE A CE2 1 
ATOM   492  C CZ  . PHE A 1 64  ? -5.269  -40.149 47.535  1.00 30.70  ? 65   PHE A CZ  1 
ATOM   493  N N   . GLN A 1 65  ? -9.165  -34.448 48.417  1.00 30.68  ? 66   GLN A N   1 
ATOM   494  C CA  . GLN A 1 65  ? -10.148 -33.403 48.207  1.00 26.14  ? 66   GLN A CA  1 
ATOM   495  C C   . GLN A 1 65  ? -11.061 -33.749 47.038  1.00 29.67  ? 66   GLN A C   1 
ATOM   496  O O   . GLN A 1 65  ? -10.918 -34.806 46.398  1.00 30.39  ? 66   GLN A O   1 
ATOM   497  C CB  . GLN A 1 65  ? -9.440  -32.064 47.954  1.00 34.61  ? 66   GLN A CB  1 
ATOM   498  C CG  . GLN A 1 65  ? -9.237  -31.214 49.187  1.00 30.78  ? 66   GLN A CG  1 
ATOM   499  C CD  . GLN A 1 65  ? -10.521 -30.532 49.624  1.00 36.56  ? 66   GLN A CD  1 
ATOM   500  O OE1 . GLN A 1 65  ? -11.531 -30.549 48.905  1.00 38.80  ? 66   GLN A OE1 1 
ATOM   501  N NE2 . GLN A 1 65  ? -10.486 -29.909 50.797  1.00 40.10  ? 66   GLN A NE2 1 
ATOM   502  N N   . SER A 1 66  ? -11.983 -32.842 46.740  1.00 25.85  ? 67   SER A N   1 
ATOM   503  C CA  . SER A 1 66  ? -12.973 -33.050 45.678  1.00 29.04  ? 67   SER A CA  1 
ATOM   504  C C   . SER A 1 66  ? -12.426 -33.349 44.294  1.00 35.73  ? 67   SER A C   1 
ATOM   505  O O   . SER A 1 66  ? -11.339 -32.899 43.934  1.00 31.03  ? 67   SER A O   1 
ATOM   506  C CB  . SER A 1 66  ? -13.865 -31.813 45.572  1.00 29.13  ? 67   SER A CB  1 
ATOM   507  O OG  . SER A 1 66  ? -14.397 -31.497 46.854  1.00 36.22  ? 67   SER A OG  1 
ATOM   508  N N   . VAL A 1 67  ? -13.221 -34.080 43.510  1.00 33.00  ? 68   VAL A N   1 
ATOM   509  C CA  . VAL A 1 67  ? -12.933 -34.361 42.102  1.00 29.26  ? 68   VAL A CA  1 
ATOM   510  C C   . VAL A 1 67  ? -13.467 -33.232 41.222  1.00 27.85  ? 68   VAL A C   1 
ATOM   511  O O   . VAL A 1 67  ? -14.572 -32.744 41.431  1.00 31.85  ? 68   VAL A O   1 
ATOM   512  C CB  . VAL A 1 67  ? -13.562 -35.718 41.669  1.00 26.80  ? 68   VAL A CB  1 
ATOM   513  C CG1 . VAL A 1 67  ? -13.253 -36.034 40.198  1.00 27.52  ? 68   VAL A CG1 1 
ATOM   514  C CG2 . VAL A 1 67  ? -13.060 -36.818 42.562  1.00 27.39  ? 68   VAL A CG2 1 
ATOM   515  N N   . CYS A 1 68  ? -12.681 -32.806 40.244  1.00 26.61  ? 69   CYS A N   1 
ATOM   516  C CA  . CYS A 1 68  ? -13.133 -31.783 39.307  1.00 26.86  ? 69   CYS A CA  1 
ATOM   517  C C   . CYS A 1 68  ? -14.344 -32.300 38.556  1.00 33.65  ? 69   CYS A C   1 
ATOM   518  O O   . CYS A 1 68  ? -14.374 -33.471 38.209  1.00 30.03  ? 69   CYS A O   1 
ATOM   519  C CB  . CYS A 1 68  ? -12.016 -31.424 38.323  1.00 29.68  ? 69   CYS A CB  1 
ATOM   520  S SG  . CYS A 1 68  ? -10.581 -30.676 39.140  1.00 32.25  ? 69   CYS A SG  1 
ATOM   521  N N   . TYR A 1 69  ? -15.320 -31.430 38.295  1.00 30.90  ? 70   TYR A N   1 
ATOM   522  C CA  . TYR A 1 69  ? -16.533 -31.809 37.586  1.00 34.19  ? 70   TYR A CA  1 
ATOM   523  C C   . TYR A 1 69  ? -16.273 -32.561 36.287  1.00 34.80  ? 70   TYR A C   1 
ATOM   524  O O   . TYR A 1 69  ? -15.458 -32.137 35.462  1.00 34.01  ? 70   TYR A O   1 
ATOM   525  C CB  . TYR A 1 69  ? -17.383 -30.569 37.288  1.00 37.87  ? 70   TYR A CB  1 
ATOM   526  C CG  . TYR A 1 69  ? -18.502 -30.411 38.286  1.00 35.67  ? 70   TYR A CG  1 
ATOM   527  C CD1 . TYR A 1 69  ? -19.729 -31.047 38.098  1.00 39.18  ? 70   TYR A CD1 1 
ATOM   528  C CD2 . TYR A 1 69  ? -18.321 -29.658 39.438  1.00 37.69  ? 70   TYR A CD2 1 
ATOM   529  C CE1 . TYR A 1 69  ? -20.765 -30.929 39.038  1.00 38.20  ? 70   TYR A CE1 1 
ATOM   530  C CE2 . TYR A 1 69  ? -19.347 -29.520 40.380  1.00 37.37  ? 70   TYR A CE2 1 
ATOM   531  C CZ  . TYR A 1 69  ? -20.558 -30.163 40.172  1.00 41.06  ? 70   TYR A CZ  1 
ATOM   532  O OH  . TYR A 1 69  ? -21.560 -30.019 41.093  1.00 55.19  ? 70   TYR A OH  1 
ATOM   533  N N   . GLN A 1 70  ? -16.991 -33.663 36.101  1.00 30.27  ? 71   GLN A N   1 
ATOM   534  C CA  . GLN A 1 70  ? -16.811 -34.516 34.932  1.00 31.90  ? 71   GLN A CA  1 
ATOM   535  C C   . GLN A 1 70  ? -17.977 -35.471 34.824  1.00 38.49  ? 71   GLN A C   1 
ATOM   536  O O   . GLN A 1 70  ? -18.685 -35.693 35.800  1.00 32.98  ? 71   GLN A O   1 
ATOM   537  C CB  . GLN A 1 70  ? -15.523 -35.312 35.028  1.00 26.44  ? 71   GLN A CB  1 
ATOM   538  C CG  . GLN A 1 70  ? -15.493 -36.197 36.284  1.00 28.10  ? 71   GLN A CG  1 
ATOM   539  C CD  . GLN A 1 70  ? -14.117 -36.743 36.569  1.00 30.05  ? 71   GLN A CD  1 
ATOM   540  O OE1 . GLN A 1 70  ? -13.846 -37.935 36.389  1.00 28.43  ? 71   GLN A OE1 1 
ATOM   541  N NE2 . GLN A 1 70  ? -13.235 -35.872 37.027  1.00 26.07  ? 71   GLN A NE2 1 
ATOM   542  N N   . TYR A 1 71  ? -18.160 -36.018 33.628  1.00 34.01  ? 72   TYR A N   1 
ATOM   543  C CA  . TYR A 1 71  ? -19.155 -37.031 33.346  1.00 38.87  ? 72   TYR A CA  1 
ATOM   544  C C   . TYR A 1 71  ? -18.844 -38.280 34.146  1.00 37.07  ? 72   TYR A C   1 
ATOM   545  O O   . TYR A 1 71  ? -17.672 -38.615 34.333  1.00 47.28  ? 72   TYR A O   1 
ATOM   546  C CB  . TYR A 1 71  ? -19.175 -37.329 31.831  1.00 38.97  ? 72   TYR A CB  1 
ATOM   547  C CG  . TYR A 1 71  ? -19.963 -38.556 31.446  1.00 50.09  ? 72   TYR A CG  1 
ATOM   548  C CD1 . TYR A 1 71  ? -21.359 -38.502 31.351  1.00 59.13  ? 72   TYR A CD1 1 
ATOM   549  C CD2 . TYR A 1 71  ? -19.325 -39.767 31.169  1.00 47.55  ? 72   TYR A CD2 1 
ATOM   550  C CE1 . TYR A 1 71  ? -22.109 -39.621 30.996  1.00 58.07  ? 72   TYR A CE1 1 
ATOM   551  C CE2 . TYR A 1 71  ? -20.066 -40.904 30.809  1.00 47.20  ? 72   TYR A CE2 1 
ATOM   552  C CZ  . TYR A 1 71  ? -21.464 -40.819 30.727  1.00 65.71  ? 72   TYR A CZ  1 
ATOM   553  O OH  . TYR A 1 71  ? -22.236 -41.913 30.381  1.00 64.03  ? 72   TYR A OH  1 
ATOM   554  N N   . VAL A 1 72  ? -19.874 -38.970 34.626  1.00 39.30  ? 73   VAL A N   1 
ATOM   555  C CA  . VAL A 1 72  ? -19.679 -40.245 35.331  1.00 33.30  ? 73   VAL A CA  1 
ATOM   556  C C   . VAL A 1 72  ? -20.106 -41.396 34.399  1.00 41.44  ? 73   VAL A C   1 
ATOM   557  O O   . VAL A 1 72  ? -21.232 -41.424 33.895  1.00 42.51  ? 73   VAL A O   1 
ATOM   558  C CB  . VAL A 1 72  ? -20.468 -40.287 36.647  1.00 34.52  ? 73   VAL A CB  1 
ATOM   559  C CG1 . VAL A 1 72  ? -20.299 -41.634 37.371  1.00 36.71  ? 73   VAL A CG1 1 
ATOM   560  C CG2 . VAL A 1 72  ? -20.045 -39.142 37.543  1.00 35.82  ? 73   VAL A CG2 1 
ATOM   561  N N   . ASP A 1 73  ? -19.186 -42.319 34.142  1.00 44.09  ? 74   ASP A N   1 
ATOM   562  C CA  . ASP A 1 73  ? -19.420 -43.420 33.204  1.00 41.41  ? 74   ASP A CA  1 
ATOM   563  C C   . ASP A 1 73  ? -20.454 -44.392 33.770  1.00 46.37  ? 74   ASP A C   1 
ATOM   564  O O   . ASP A 1 73  ? -20.251 -44.956 34.844  1.00 42.46  ? 74   ASP A O   1 
ATOM   565  C CB  . ASP A 1 73  ? -18.104 -44.134 32.916  1.00 46.35  ? 74   ASP A CB  1 
ATOM   566  C CG  . ASP A 1 73  ? -18.258 -45.358 32.009  1.00 50.94  ? 74   ASP A CG  1 
ATOM   567  O OD1 . ASP A 1 73  ? -19.247 -45.488 31.264  1.00 51.17  ? 74   ASP A OD1 1 
ATOM   568  O OD2 . ASP A 1 73  ? -17.338 -46.198 32.029  1.00 59.87  ? 74   ASP A OD2 1 
ATOM   569  N N   . THR A 1 74  ? -21.560 -44.580 33.054  1.00 41.11  ? 75   THR A N   1 
ATOM   570  C CA  . THR A 1 74  ? -22.590 -45.525 33.502  1.00 56.57  ? 75   THR A CA  1 
ATOM   571  C C   . THR A 1 74  ? -22.842 -46.687 32.535  1.00 49.39  ? 75   THR A C   1 
ATOM   572  O O   . THR A 1 74  ? -23.903 -47.299 32.574  1.00 47.64  ? 75   THR A O   1 
ATOM   573  C CB  . THR A 1 74  ? -23.942 -44.822 33.741  1.00 41.24  ? 75   THR A CB  1 
ATOM   574  O OG1 . THR A 1 74  ? -24.279 -44.049 32.589  1.00 47.74  ? 75   THR A OG1 1 
ATOM   575  C CG2 . THR A 1 74  ? -23.885 -43.918 34.981  1.00 41.76  ? 75   THR A CG2 1 
ATOM   576  N N   . LEU A 1 75  ? -21.871 -46.996 31.682  1.00 52.06  ? 76   LEU A N   1 
ATOM   577  C CA  . LEU A 1 75  ? -22.023 -48.092 30.726  1.00 53.45  ? 76   LEU A CA  1 
ATOM   578  C C   . LEU A 1 75  ? -22.328 -49.421 31.417  1.00 55.38  ? 76   LEU A C   1 
ATOM   579  O O   . LEU A 1 75  ? -23.218 -50.164 30.986  1.00 55.19  ? 76   LEU A O   1 
ATOM   580  C CB  . LEU A 1 75  ? -20.768 -48.244 29.875  1.00 53.75  ? 76   LEU A CB  1 
ATOM   581  C CG  . LEU A 1 75  ? -20.896 -49.250 28.738  1.00 54.47  ? 76   LEU A CG  1 
ATOM   582  C CD1 . LEU A 1 75  ? -22.035 -48.838 27.846  1.00 46.75  ? 76   LEU A CD1 1 
ATOM   583  C CD2 . LEU A 1 75  ? -19.597 -49.309 27.954  1.00 58.33  ? 76   LEU A CD2 1 
ATOM   584  N N   . TYR A 1 76  ? -21.591 -49.714 32.485  1.00 45.49  ? 77   TYR A N   1 
ATOM   585  C CA  . TYR A 1 76  ? -21.783 -50.956 33.230  1.00 41.28  ? 77   TYR A CA  1 
ATOM   586  C C   . TYR A 1 76  ? -21.841 -50.659 34.723  1.00 45.00  ? 77   TYR A C   1 
ATOM   587  O O   . TYR A 1 76  ? -20.853 -50.838 35.440  1.00 45.21  ? 77   TYR A O   1 
ATOM   588  C CB  . TYR A 1 76  ? -20.665 -51.955 32.945  1.00 39.37  ? 77   TYR A CB  1 
ATOM   589  C CG  . TYR A 1 76  ? -20.526 -52.380 31.497  1.00 52.91  ? 77   TYR A CG  1 
ATOM   590  C CD1 . TYR A 1 76  ? -21.525 -53.117 30.868  1.00 54.84  ? 77   TYR A CD1 1 
ATOM   591  C CD2 . TYR A 1 76  ? -19.374 -52.080 30.768  1.00 46.20  ? 77   TYR A CD2 1 
ATOM   592  C CE1 . TYR A 1 76  ? -21.395 -53.527 29.553  1.00 47.80  ? 77   TYR A CE1 1 
ATOM   593  C CE2 . TYR A 1 76  ? -19.236 -52.482 29.445  1.00 47.81  ? 77   TYR A CE2 1 
ATOM   594  C CZ  . TYR A 1 76  ? -20.256 -53.206 28.844  1.00 51.22  ? 77   TYR A CZ  1 
ATOM   595  O OH  . TYR A 1 76  ? -20.141 -53.613 27.529  1.00 56.36  ? 77   TYR A OH  1 
ATOM   596  N N   . PRO A 1 77  ? -23.002 -50.190 35.198  1.00 47.86  ? 78   PRO A N   1 
ATOM   597  C CA  . PRO A 1 77  ? -23.101 -49.721 36.591  1.00 48.83  ? 78   PRO A CA  1 
ATOM   598  C C   . PRO A 1 77  ? -22.687 -50.794 37.597  1.00 45.07  ? 78   PRO A C   1 
ATOM   599  O O   . PRO A 1 77  ? -23.129 -51.924 37.477  1.00 50.90  ? 78   PRO A O   1 
ATOM   600  C CB  . PRO A 1 77  ? -24.579 -49.342 36.741  1.00 44.27  ? 78   PRO A CB  1 
ATOM   601  C CG  . PRO A 1 77  ? -25.273 -49.846 35.505  1.00 53.81  ? 78   PRO A CG  1 
ATOM   602  C CD  . PRO A 1 77  ? -24.242 -49.977 34.433  1.00 45.44  ? 78   PRO A CD  1 
ATOM   603  N N   . GLY A 1 78  ? -21.801 -50.442 38.529  1.00 46.38  ? 79   GLY A N   1 
ATOM   604  C CA  . GLY A 1 78  ? -21.319 -51.365 39.551  1.00 38.86  ? 79   GLY A CA  1 
ATOM   605  C C   . GLY A 1 78  ? -20.204 -52.312 39.125  1.00 41.48  ? 79   GLY A C   1 
ATOM   606  O O   . GLY A 1 78  ? -19.637 -53.016 39.936  1.00 42.24  ? 79   GLY A O   1 
ATOM   607  N N   . PHE A 1 79  ? -19.890 -52.345 37.837  1.00 41.12  ? 80   PHE A N   1 
ATOM   608  C CA  . PHE A 1 79  ? -18.793 -53.177 37.357  1.00 38.03  ? 80   PHE A CA  1 
ATOM   609  C C   . PHE A 1 79  ? -17.438 -52.545 37.711  1.00 37.05  ? 80   PHE A C   1 
ATOM   610  O O   . PHE A 1 79  ? -17.225 -51.350 37.481  1.00 37.65  ? 80   PHE A O   1 
ATOM   611  C CB  . PHE A 1 79  ? -18.942 -53.376 35.836  1.00 38.15  ? 80   PHE A CB  1 
ATOM   612  C CG  . PHE A 1 79  ? -17.794 -54.084 35.195  1.00 39.50  ? 80   PHE A CG  1 
ATOM   613  C CD1 . PHE A 1 79  ? -17.456 -55.371 35.570  1.00 38.40  ? 80   PHE A CD1 1 
ATOM   614  C CD2 . PHE A 1 79  ? -17.059 -53.466 34.187  1.00 35.17  ? 80   PHE A CD2 1 
ATOM   615  C CE1 . PHE A 1 79  ? -16.400 -56.035 34.953  1.00 42.84  ? 80   PHE A CE1 1 
ATOM   616  C CE2 . PHE A 1 79  ? -15.996 -54.122 33.573  1.00 33.01  ? 80   PHE A CE2 1 
ATOM   617  C CZ  . PHE A 1 79  ? -15.662 -55.402 33.955  1.00 35.68  ? 80   PHE A CZ  1 
ATOM   618  N N   . GLU A 1 80  ? -16.528 -53.341 38.261  1.00 35.83  ? 81   GLU A N   1 
ATOM   619  C CA  . GLU A 1 80  ? -15.246 -52.843 38.729  1.00 37.75  ? 81   GLU A CA  1 
ATOM   620  C C   . GLU A 1 80  ? -14.424 -52.176 37.625  1.00 47.36  ? 81   GLU A C   1 
ATOM   621  O O   . GLU A 1 80  ? -13.772 -51.153 37.853  1.00 40.86  ? 81   GLU A O   1 
ATOM   622  C CB  . GLU A 1 80  ? -14.439 -53.978 39.352  1.00 42.28  ? 81   GLU A CB  1 
ATOM   623  C CG  . GLU A 1 80  ? -13.590 -53.536 40.539  1.00 68.04  ? 81   GLU A CG  1 
ATOM   624  C CD  . GLU A 1 80  ? -12.095 -53.508 40.234  1.00 71.96  ? 81   GLU A CD  1 
ATOM   625  O OE1 . GLU A 1 80  ? -11.656 -54.204 39.288  1.00 78.46  ? 81   GLU A OE1 1 
ATOM   626  O OE2 . GLU A 1 80  ? -11.358 -52.790 40.955  1.00 75.35  ? 81   GLU A OE2 1 
ATOM   627  N N   . GLY A 1 81  ? -14.472 -52.754 36.429  1.00 44.75  ? 82   GLY A N   1 
ATOM   628  C CA  . GLY A 1 81  ? -13.648 -52.302 35.331  1.00 39.55  ? 82   GLY A CA  1 
ATOM   629  C C   . GLY A 1 81  ? -13.962 -50.890 34.891  1.00 39.36  ? 82   GLY A C   1 
ATOM   630  O O   . GLY A 1 81  ? -13.092 -50.203 34.365  1.00 42.36  ? 82   GLY A O   1 
ATOM   631  N N   . THR A 1 82  ? -15.199 -50.446 35.080  1.00 35.70  ? 83   THR A N   1 
ATOM   632  C CA  . THR A 1 82  ? -15.522 -49.056 34.772  1.00 34.54  ? 83   THR A CA  1 
ATOM   633  C C   . THR A 1 82  ? -15.526 -48.174 36.056  1.00 40.00  ? 83   THR A C   1 
ATOM   634  O O   . THR A 1 82  ? -15.112 -47.013 36.015  1.00 37.31  ? 83   THR A O   1 
ATOM   635  C CB  . THR A 1 82  ? -16.882 -48.927 34.078  1.00 42.38  ? 83   THR A CB  1 
ATOM   636  O OG1 . THR A 1 82  ? -17.858 -49.615 34.864  1.00 46.62  ? 83   THR A OG1 1 
ATOM   637  C CG2 . THR A 1 82  ? -16.853 -49.517 32.646  1.00 43.23  ? 83   THR A CG2 1 
ATOM   638  N N   . GLU A 1 83  ? -15.988 -48.719 37.182  1.00 31.99  ? 84   GLU A N   1 
ATOM   639  C CA  . GLU A 1 83  ? -16.131 -47.917 38.398  1.00 40.88  ? 84   GLU A CA  1 
ATOM   640  C C   . GLU A 1 83  ? -14.778 -47.493 38.979  1.00 32.64  ? 84   GLU A C   1 
ATOM   641  O O   . GLU A 1 83  ? -14.681 -46.458 39.623  1.00 34.77  ? 84   GLU A O   1 
ATOM   642  C CB  . GLU A 1 83  ? -16.933 -48.668 39.482  1.00 36.74  ? 84   GLU A CB  1 
ATOM   643  C CG  . GLU A 1 83  ? -18.400 -48.940 39.117  1.00 45.68  ? 84   GLU A CG  1 
ATOM   644  C CD  . GLU A 1 83  ? -19.257 -47.689 38.960  1.00 52.90  ? 84   GLU A CD  1 
ATOM   645  O OE1 . GLU A 1 83  ? -20.421 -47.844 38.504  1.00 50.13  ? 84   GLU A OE1 1 
ATOM   646  O OE2 . GLU A 1 83  ? -18.791 -46.562 39.291  1.00 43.02  ? 84   GLU A OE2 1 
ATOM   647  N N   . MET A 1 84  ? -13.741 -48.287 38.746  1.00 31.72  ? 85   MET A N   1 
ATOM   648  C CA  . MET A 1 84  ? -12.417 -47.954 39.234  1.00 32.27  ? 85   MET A CA  1 
ATOM   649  C C   . MET A 1 84  ? -11.904 -46.642 38.628  1.00 36.38  ? 85   MET A C   1 
ATOM   650  O O   . MET A 1 84  ? -10.938 -46.092 39.136  1.00 34.02  ? 85   MET A O   1 
ATOM   651  C CB  . MET A 1 84  ? -11.431 -49.082 38.937  1.00 31.37  ? 85   MET A CB  1 
ATOM   652  C CG  . MET A 1 84  ? -11.192 -49.311 37.417  1.00 29.29  ? 85   MET A CG  1 
ATOM   653  S SD  . MET A 1 84  ? -10.067 -50.691 37.131  1.00 36.82  ? 85   MET A SD  1 
ATOM   654  C CE  . MET A 1 84  ? -8.495  -49.988 37.701  1.00 34.53  ? 85   MET A CE  1 
ATOM   655  N N   . TRP A 1 85  ? -12.538 -46.145 37.553  1.00 31.20  ? 86   TRP A N   1 
ATOM   656  C CA  . TRP A 1 85  ? -12.101 -44.883 36.940  1.00 29.14  ? 86   TRP A CA  1 
ATOM   657  C C   . TRP A 1 85  ? -13.015 -43.732 37.319  1.00 33.11  ? 86   TRP A C   1 
ATOM   658  O O   . TRP A 1 85  ? -12.706 -42.589 37.053  1.00 31.95  ? 86   TRP A O   1 
ATOM   659  C CB  . TRP A 1 85  ? -12.019 -45.002 35.402  1.00 29.39  ? 86   TRP A CB  1 
ATOM   660  C CG  . TRP A 1 85  ? -11.194 -46.183 34.967  1.00 34.10  ? 86   TRP A CG  1 
ATOM   661  C CD1 . TRP A 1 85  ? -11.655 -47.328 34.380  1.00 29.05  ? 86   TRP A CD1 1 
ATOM   662  C CD2 . TRP A 1 85  ? -9.771  -46.358 35.131  1.00 35.85  ? 86   TRP A CD2 1 
ATOM   663  N NE1 . TRP A 1 85  ? -10.608 -48.191 34.140  1.00 33.05  ? 86   TRP A NE1 1 
ATOM   664  C CE2 . TRP A 1 85  ? -9.443  -47.628 34.593  1.00 35.37  ? 86   TRP A CE2 1 
ATOM   665  C CE3 . TRP A 1 85  ? -8.745  -45.562 35.670  1.00 29.92  ? 86   TRP A CE3 1 
ATOM   666  C CZ2 . TRP A 1 85  ? -8.126  -48.128 34.576  1.00 31.06  ? 86   TRP A CZ2 1 
ATOM   667  C CZ3 . TRP A 1 85  ? -7.430  -46.056 35.654  1.00 29.27  ? 86   TRP A CZ3 1 
ATOM   668  C CH2 . TRP A 1 85  ? -7.137  -47.332 35.109  1.00 29.98  ? 86   TRP A CH2 1 
ATOM   669  N N   . ASN A 1 86  ? -14.149 -44.027 37.937  1.00 35.05  ? 87   ASN A N   1 
ATOM   670  C CA  . ASN A 1 86  ? -15.125 -42.982 38.217  1.00 32.39  ? 87   ASN A CA  1 
ATOM   671  C C   . ASN A 1 86  ? -14.732 -42.176 39.451  1.00 31.80  ? 87   ASN A C   1 
ATOM   672  O O   . ASN A 1 86  ? -13.937 -42.645 40.264  1.00 29.10  ? 87   ASN A O   1 
ATOM   673  C CB  . ASN A 1 86  ? -16.516 -43.596 38.401  1.00 36.02  ? 87   ASN A CB  1 
ATOM   674  C CG  . ASN A 1 86  ? -17.259 -43.789 37.073  1.00 40.31  ? 87   ASN A CG  1 
ATOM   675  O OD1 . ASN A 1 86  ? -16.989 -43.118 36.061  1.00 37.42  ? 87   ASN A OD1 1 
ATOM   676  N ND2 . ASN A 1 86  ? -18.224 -44.693 37.087  1.00 41.92  ? 87   ASN A ND2 1 
ATOM   677  N N   . PRO A 1 87  ? -15.275 -40.955 39.583  1.00 27.76  ? 88   PRO A N   1 
ATOM   678  C CA  . PRO A 1 87  ? -15.037 -40.119 40.770  1.00 31.64  ? 88   PRO A CA  1 
ATOM   679  C C   . PRO A 1 87  ? -15.275 -40.889 42.055  1.00 44.94  ? 88   PRO A C   1 
ATOM   680  O O   . PRO A 1 87  ? -16.308 -41.549 42.168  1.00 39.51  ? 88   PRO A O   1 
ATOM   681  C CB  . PRO A 1 87  ? -16.069 -39.004 40.632  1.00 26.31  ? 88   PRO A CB  1 
ATOM   682  C CG  . PRO A 1 87  ? -16.270 -38.880 39.101  1.00 26.54  ? 88   PRO A CG  1 
ATOM   683  C CD  . PRO A 1 87  ? -16.075 -40.264 38.546  1.00 29.42  ? 88   PRO A CD  1 
ATOM   684  N N   . ASN A 1 88  ? -14.349 -40.814 43.001  1.00 34.52  ? 89   ASN A N   1 
ATOM   685  C CA  . ASN A 1 88  ? -14.549 -41.490 44.271  1.00 31.48  ? 89   ASN A CA  1 
ATOM   686  C C   . ASN A 1 88  ? -14.576 -40.477 45.421  1.00 31.43  ? 89   ASN A C   1 
ATOM   687  O O   . ASN A 1 88  ? -14.308 -40.822 46.570  1.00 36.22  ? 89   ASN A O   1 
ATOM   688  C CB  . ASN A 1 88  ? -13.451 -42.534 44.490  1.00 34.18  ? 89   ASN A CB  1 
ATOM   689  C CG  . ASN A 1 88  ? -12.074 -41.898 44.602  1.00 38.48  ? 89   ASN A CG  1 
ATOM   690  O OD1 . ASN A 1 88  ? -11.845 -40.791 44.104  1.00 34.15  ? 89   ASN A OD1 1 
ATOM   691  N ND2 . ASN A 1 88  ? -11.151 -42.595 45.246  1.00 37.03  ? 89   ASN A ND2 1 
ATOM   692  N N   . ARG A 1 89  ? -14.831 -39.215 45.080  1.00 33.96  ? 90   ARG A N   1 
ATOM   693  C CA  . ARG A 1 89  ? -15.104 -38.148 46.050  1.00 33.96  ? 90   ARG A CA  1 
ATOM   694  C C   . ARG A 1 89  ? -16.156 -37.328 45.381  1.00 33.66  ? 90   ARG A C   1 
ATOM   695  O O   . ARG A 1 89  ? -16.369 -37.472 44.168  1.00 34.42  ? 90   ARG A O   1 
ATOM   696  C CB  . ARG A 1 89  ? -13.869 -37.274 46.381  1.00 27.50  ? 90   ARG A CB  1 
ATOM   697  C CG  . ARG A 1 89  ? -12.748 -37.996 47.128  1.00 31.17  ? 90   ARG A CG  1 
ATOM   698  C CD  . ARG A 1 89  ? -13.165 -38.332 48.594  1.00 28.82  ? 90   ARG A CD  1 
ATOM   699  N NE  . ARG A 1 89  ? -12.065 -38.934 49.332  1.00 35.13  ? 90   ARG A NE  1 
ATOM   700  C CZ  . ARG A 1 89  ? -11.727 -40.218 49.255  1.00 39.54  ? 90   ARG A CZ  1 
ATOM   701  N NH1 . ARG A 1 89  ? -12.396 -41.031 48.452  1.00 39.70  ? 90   ARG A NH1 1 
ATOM   702  N NH2 . ARG A 1 89  ? -10.703 -40.689 49.961  1.00 36.16  ? 90   ARG A NH2 1 
ATOM   703  N N   . GLU A 1 90  ? -16.795 -36.447 46.134  1.00 33.58  ? 91   GLU A N   1 
ATOM   704  C CA  . GLU A 1 90  ? -17.803 -35.578 45.539  1.00 33.12  ? 91   GLU A CA  1 
ATOM   705  C C   . GLU A 1 90  ? -17.182 -34.646 44.497  1.00 35.35  ? 91   GLU A C   1 
ATOM   706  O O   . GLU A 1 90  ? -16.009 -34.255 44.597  1.00 35.69  ? 91   GLU A O   1 
ATOM   707  C CB  . GLU A 1 90  ? -18.518 -34.755 46.621  1.00 35.40  ? 91   GLU A CB  1 
ATOM   708  C CG  . GLU A 1 90  ? -17.618 -33.719 47.289  1.00 56.46  ? 91   GLU A CG  1 
ATOM   709  C CD  . GLU A 1 90  ? -18.394 -32.685 48.136  1.00 84.03  ? 91   GLU A CD  1 
ATOM   710  O OE1 . GLU A 1 90  ? -19.546 -32.986 48.552  1.00 76.94  ? 91   GLU A OE1 1 
ATOM   711  O OE2 . GLU A 1 90  ? -17.846 -31.573 48.380  1.00 73.90  ? 91   GLU A OE2 1 
ATOM   712  N N   . LEU A 1 91  ? -17.991 -34.279 43.519  1.00 30.73  ? 92   LEU A N   1 
ATOM   713  C CA  . LEU A 1 91  ? -17.615 -33.353 42.482  1.00 32.96  ? 92   LEU A CA  1 
ATOM   714  C C   . LEU A 1 91  ? -17.648 -31.934 42.966  1.00 35.65  ? 92   LEU A C   1 
ATOM   715  O O   . LEU A 1 91  ? -18.559 -31.539 43.674  1.00 38.83  ? 92   LEU A O   1 
ATOM   716  C CB  . LEU A 1 91  ? -18.560 -33.483 41.283  1.00 29.85  ? 92   LEU A CB  1 
ATOM   717  C CG  . LEU A 1 91  ? -18.641 -34.857 40.609  1.00 35.62  ? 92   LEU A CG  1 
ATOM   718  C CD1 . LEU A 1 91  ? -19.605 -34.789 39.430  1.00 28.19  ? 92   LEU A CD1 1 
ATOM   719  C CD2 . LEU A 1 91  ? -17.265 -35.322 40.129  1.00 28.92  ? 92   LEU A CD2 1 
ATOM   720  N N   . SER A 1 92  ? -16.680 -31.139 42.537  1.00 31.97  ? 93   SER A N   1 
ATOM   721  C CA  . SER A 1 92  ? -16.728 -29.711 42.801  1.00 30.40  ? 93   SER A CA  1 
ATOM   722  C C   . SER A 1 92  ? -15.830 -28.948 41.822  1.00 32.79  ? 93   SER A C   1 
ATOM   723  O O   . SER A 1 92  ? -14.854 -29.502 41.328  1.00 33.43  ? 93   SER A O   1 
ATOM   724  C CB  . SER A 1 92  ? -16.288 -29.442 44.249  1.00 29.99  ? 93   SER A CB  1 
ATOM   725  O OG  . SER A 1 92  ? -16.337 -28.058 44.509  1.00 29.34  ? 93   SER A OG  1 
ATOM   726  N N   . GLU A 1 93  ? -16.154 -27.693 41.538  1.00 29.21  ? 94   GLU A N   1 
ATOM   727  C CA  . GLU A 1 93  ? -15.236 -26.838 40.813  1.00 28.23  ? 94   GLU A CA  1 
ATOM   728  C C   . GLU A 1 93  ? -14.093 -26.394 41.718  1.00 32.40  ? 94   GLU A C   1 
ATOM   729  O O   . GLU A 1 93  ? -13.040 -25.999 41.251  1.00 33.56  ? 94   GLU A O   1 
ATOM   730  C CB  . GLU A 1 93  ? -15.956 -25.618 40.249  1.00 31.01  ? 94   GLU A CB  1 
ATOM   731  C CG  . GLU A 1 93  ? -16.803 -25.926 39.007  1.00 32.03  ? 94   GLU A CG  1 
ATOM   732  C CD  . GLU A 1 93  ? -17.375 -24.653 38.404  1.00 39.17  ? 94   GLU A CD  1 
ATOM   733  O OE1 . GLU A 1 93  ? -16.760 -24.114 37.456  1.00 35.34  ? 94   GLU A OE1 1 
ATOM   734  O OE2 . GLU A 1 93  ? -18.430 -24.180 38.892  1.00 35.53  ? 94   GLU A OE2 1 
ATOM   735  N N   . ASP A 1 94  ? -14.315 -26.455 43.025  1.00 29.71  ? 95   ASP A N   1 
ATOM   736  C CA  . ASP A 1 94  ? -13.257 -26.215 43.992  1.00 28.53  ? 95   ASP A CA  1 
ATOM   737  C C   . ASP A 1 94  ? -12.467 -27.520 44.098  1.00 27.28  ? 95   ASP A C   1 
ATOM   738  O O   . ASP A 1 94  ? -12.715 -28.316 44.993  1.00 29.13  ? 95   ASP A O   1 
ATOM   739  C CB  . ASP A 1 94  ? -13.873 -25.780 45.330  1.00 28.89  ? 95   ASP A CB  1 
ATOM   740  C CG  . ASP A 1 94  ? -12.840 -25.466 46.400  1.00 32.90  ? 95   ASP A CG  1 
ATOM   741  O OD1 . ASP A 1 94  ? -11.622 -25.746 46.224  1.00 35.51  ? 95   ASP A OD1 1 
ATOM   742  O OD2 . ASP A 1 94  ? -13.271 -24.949 47.449  1.00 36.42  ? 95   ASP A OD2 1 
ATOM   743  N N   . CYS A 1 95  ? -11.560 -27.771 43.150  1.00 29.76  ? 96   CYS A N   1 
ATOM   744  C CA  . CYS A 1 95  ? -10.933 -29.103 43.043  1.00 27.16  ? 96   CYS A CA  1 
ATOM   745  C C   . CYS A 1 95  ? -9.426  -29.044 42.824  1.00 25.57  ? 96   CYS A C   1 
ATOM   746  O O   . CYS A 1 95  ? -8.766  -30.069 42.645  1.00 28.13  ? 96   CYS A O   1 
ATOM   747  C CB  . CYS A 1 95  ? -11.573 -29.896 41.901  1.00 27.42  ? 96   CYS A CB  1 
ATOM   748  S SG  . CYS A 1 95  ? -11.338 -29.112 40.273  1.00 29.68  ? 96   CYS A SG  1 
ATOM   749  N N   . LEU A 1 96  ? -8.870  -27.850 42.856  1.00 26.47  ? 97   LEU A N   1 
ATOM   750  C CA  . LEU A 1 96  ? -7.476  -27.704 42.524  1.00 26.01  ? 97   LEU A CA  1 
ATOM   751  C C   . LEU A 1 96  ? -6.638  -27.956 43.768  1.00 29.17  ? 97   LEU A C   1 
ATOM   752  O O   . LEU A 1 96  ? -6.219  -27.020 44.466  1.00 27.68  ? 97   LEU A O   1 
ATOM   753  C CB  . LEU A 1 96  ? -7.224  -26.319 41.906  1.00 26.89  ? 97   LEU A CB  1 
ATOM   754  C CG  . LEU A 1 96  ? -7.818  -26.192 40.493  1.00 31.80  ? 97   LEU A CG  1 
ATOM   755  C CD1 . LEU A 1 96  ? -7.340  -24.904 39.758  1.00 32.18  ? 97   LEU A CD1 1 
ATOM   756  C CD2 . LEU A 1 96  ? -7.515  -27.450 39.624  1.00 24.24  ? 97   LEU A CD2 1 
ATOM   757  N N   . TYR A 1 97  ? -6.412  -29.243 44.042  1.00 27.09  ? 98   TYR A N   1 
ATOM   758  C CA  . TYR A 1 97  ? -5.598  -29.674 45.172  1.00 23.59  ? 98   TYR A CA  1 
ATOM   759  C C   . TYR A 1 97  ? -4.557  -30.649 44.668  1.00 25.69  ? 98   TYR A C   1 
ATOM   760  O O   . TYR A 1 97  ? -4.715  -31.244 43.595  1.00 25.99  ? 98   TYR A O   1 
ATOM   761  C CB  . TYR A 1 97  ? -6.467  -30.317 46.289  1.00 24.61  ? 98   TYR A CB  1 
ATOM   762  C CG  . TYR A 1 97  ? -7.451  -29.329 46.829  1.00 27.15  ? 98   TYR A CG  1 
ATOM   763  C CD1 . TYR A 1 97  ? -8.636  -29.067 46.144  1.00 27.52  ? 98   TYR A CD1 1 
ATOM   764  C CD2 . TYR A 1 97  ? -7.191  -28.619 48.001  1.00 31.64  ? 98   TYR A CD2 1 
ATOM   765  C CE1 . TYR A 1 97  ? -9.534  -28.141 46.611  1.00 29.89  ? 98   TYR A CE1 1 
ATOM   766  C CE2 . TYR A 1 97  ? -8.098  -27.694 48.490  1.00 29.85  ? 98   TYR A CE2 1 
ATOM   767  C CZ  . TYR A 1 97  ? -9.266  -27.456 47.785  1.00 32.46  ? 98   TYR A CZ  1 
ATOM   768  O OH  . TYR A 1 97  ? -10.184 -26.530 48.227  1.00 31.05  ? 98   TYR A OH  1 
ATOM   769  N N   . LEU A 1 98  ? -3.484  -30.823 45.430  1.00 24.01  ? 99   LEU A N   1 
ATOM   770  C CA  . LEU A 1 98  ? -2.488  -31.815 45.050  1.00 24.67  ? 99   LEU A CA  1 
ATOM   771  C C   . LEU A 1 98  ? -2.129  -32.609 46.287  1.00 25.57  ? 99   LEU A C   1 
ATOM   772  O O   . LEU A 1 98  ? -2.545  -32.267 47.409  1.00 27.72  ? 99   LEU A O   1 
ATOM   773  C CB  . LEU A 1 98  ? -1.246  -31.163 44.374  1.00 25.64  ? 99   LEU A CB  1 
ATOM   774  C CG  . LEU A 1 98  ? -0.479  -30.015 45.058  1.00 28.55  ? 99   LEU A CG  1 
ATOM   775  C CD1 . LEU A 1 98  ? 0.348   -30.507 46.239  1.00 23.83  ? 99   LEU A CD1 1 
ATOM   776  C CD2 . LEU A 1 98  ? 0.413   -29.265 44.054  1.00 21.70  ? 99   LEU A CD2 1 
ATOM   777  N N   . ASN A 1 99  ? -1.393  -33.695 46.072  1.00 25.36  ? 100  ASN A N   1 
ATOM   778  C CA  . ASN A 1 99  ? -1.081  -34.634 47.136  1.00 29.91  ? 100  ASN A CA  1 
ATOM   779  C C   . ASN A 1 99  ? 0.388   -34.940 47.122  1.00 29.26  ? 100  ASN A C   1 
ATOM   780  O O   . ASN A 1 99  ? 0.997   -35.000 46.053  1.00 28.39  ? 100  ASN A O   1 
ATOM   781  C CB  . ASN A 1 99  ? -1.897  -35.928 46.964  1.00 24.63  ? 100  ASN A CB  1 
ATOM   782  C CG  . ASN A 1 99  ? -3.319  -35.654 46.519  1.00 30.12  ? 100  ASN A CG  1 
ATOM   783  O OD1 . ASN A 1 99  ? -4.141  -35.142 47.293  1.00 30.79  ? 100  ASN A OD1 1 
ATOM   784  N ND2 . ASN A 1 99  ? -3.618  -35.964 45.252  1.00 26.35  ? 100  ASN A ND2 1 
ATOM   785  N N   . VAL A 1 100 ? 0.964   -35.133 48.304  1.00 28.64  ? 101  VAL A N   1 
ATOM   786  C CA  . VAL A 1 100 ? 2.360   -35.522 48.422  1.00 26.89  ? 101  VAL A CA  1 
ATOM   787  C C   . VAL A 1 100 ? 2.502   -36.736 49.308  1.00 30.87  ? 101  VAL A C   1 
ATOM   788  O O   . VAL A 1 100 ? 2.020   -36.735 50.452  1.00 28.93  ? 101  VAL A O   1 
ATOM   789  C CB  . VAL A 1 100 ? 3.232   -34.382 49.026  1.00 31.48  ? 101  VAL A CB  1 
ATOM   790  C CG1 . VAL A 1 100 ? 4.689   -34.774 49.028  1.00 27.74  ? 101  VAL A CG1 1 
ATOM   791  C CG2 . VAL A 1 100 ? 2.997   -33.064 48.288  1.00 24.67  ? 101  VAL A CG2 1 
ATOM   792  N N   . TRP A 1 101 ? 3.167   -37.771 48.798  1.00 28.94  ? 102  TRP A N   1 
ATOM   793  C CA  . TRP A 1 101 ? 3.566   -38.879 49.652  1.00 29.92  ? 102  TRP A CA  1 
ATOM   794  C C   . TRP A 1 101 ? 5.074   -38.815 49.807  1.00 34.85  ? 102  TRP A C   1 
ATOM   795  O O   . TRP A 1 101 ? 5.792   -38.522 48.853  1.00 28.53  ? 102  TRP A O   1 
ATOM   796  C CB  . TRP A 1 101 ? 3.185   -40.253 49.083  1.00 29.66  ? 102  TRP A CB  1 
ATOM   797  C CG  . TRP A 1 101 ? 1.709   -40.566 48.955  1.00 29.63  ? 102  TRP A CG  1 
ATOM   798  C CD1 . TRP A 1 101 ? 0.948   -41.329 49.803  1.00 27.50  ? 102  TRP A CD1 1 
ATOM   799  C CD2 . TRP A 1 101 ? 0.838   -40.155 47.897  1.00 27.25  ? 102  TRP A CD2 1 
ATOM   800  N NE1 . TRP A 1 101 ? -0.353  -41.381 49.357  1.00 29.36  ? 102  TRP A NE1 1 
ATOM   801  C CE2 . TRP A 1 101 ? -0.443  -40.690 48.176  1.00 32.46  ? 102  TRP A CE2 1 
ATOM   802  C CE3 . TRP A 1 101 ? 1.012   -39.383 46.745  1.00 32.68  ? 102  TRP A CE3 1 
ATOM   803  C CZ2 . TRP A 1 101 ? -1.543  -40.477 47.340  1.00 29.39  ? 102  TRP A CZ2 1 
ATOM   804  C CZ3 . TRP A 1 101 ? -0.084  -39.181 45.904  1.00 30.74  ? 102  TRP A CZ3 1 
ATOM   805  C CH2 . TRP A 1 101 ? -1.347  -39.714 46.216  1.00 28.28  ? 102  TRP A CH2 1 
ATOM   806  N N   . THR A 1 102 ? 5.558   -39.145 50.992  1.00 31.24  ? 103  THR A N   1 
ATOM   807  C CA  . THR A 1 102 ? 6.980   -39.103 51.254  1.00 35.91  ? 103  THR A CA  1 
ATOM   808  C C   . THR A 1 102 ? 7.286   -40.245 52.217  1.00 32.80  ? 103  THR A C   1 
ATOM   809  O O   . THR A 1 102 ? 6.369   -40.737 52.883  1.00 33.76  ? 103  THR A O   1 
ATOM   810  C CB  . THR A 1 102 ? 7.377   -37.723 51.842  1.00 34.93  ? 103  THR A CB  1 
ATOM   811  O OG1 . THR A 1 102 ? 8.753   -37.467 51.576  1.00 55.60  ? 103  THR A OG1 1 
ATOM   812  C CG2 . THR A 1 102 ? 7.123   -37.699 53.339  1.00 28.44  ? 103  THR A CG2 1 
ATOM   813  N N   . PRO A 1 103 ? 8.537   -40.739 52.238  1.00 29.91  ? 104  PRO A N   1 
ATOM   814  C CA  . PRO A 1 103 ? 8.899   -41.760 53.241  1.00 31.51  ? 104  PRO A CA  1 
ATOM   815  C C   . PRO A 1 103 ? 8.669   -41.296 54.689  1.00 39.41  ? 104  PRO A C   1 
ATOM   816  O O   . PRO A 1 103 ? 8.509   -40.097 54.935  1.00 37.89  ? 104  PRO A O   1 
ATOM   817  C CB  . PRO A 1 103 ? 10.383  -41.992 52.984  1.00 32.66  ? 104  PRO A CB  1 
ATOM   818  C CG  . PRO A 1 103 ? 10.530  -41.734 51.471  1.00 30.26  ? 104  PRO A CG  1 
ATOM   819  C CD  . PRO A 1 103 ? 9.596   -40.545 51.231  1.00 29.11  ? 104  PRO A CD  1 
ATOM   820  N N   . TYR A 1 104 ? 8.598   -42.249 55.617  1.00 34.65  ? 105  TYR A N   1 
ATOM   821  C CA  . TYR A 1 104 ? 8.456   -41.952 57.043  1.00 35.18  ? 105  TYR A CA  1 
ATOM   822  C C   . TYR A 1 104 ? 9.629   -42.590 57.802  1.00 47.27  ? 105  TYR A C   1 
ATOM   823  O O   . TYR A 1 104 ? 9.908   -43.790 57.631  1.00 39.32  ? 105  TYR A O   1 
ATOM   824  C CB  . TYR A 1 104 ? 7.124   -42.460 57.586  1.00 36.03  ? 105  TYR A CB  1 
ATOM   825  C CG  . TYR A 1 104 ? 6.831   -42.024 59.009  1.00 43.28  ? 105  TYR A CG  1 
ATOM   826  C CD1 . TYR A 1 104 ? 7.462   -42.631 60.103  1.00 41.66  ? 105  TYR A CD1 1 
ATOM   827  C CD2 . TYR A 1 104 ? 5.907   -41.017 59.258  1.00 42.89  ? 105  TYR A CD2 1 
ATOM   828  C CE1 . TYR A 1 104 ? 7.191   -42.211 61.419  1.00 39.88  ? 105  TYR A CE1 1 
ATOM   829  C CE2 . TYR A 1 104 ? 5.613   -40.601 60.546  1.00 40.50  ? 105  TYR A CE2 1 
ATOM   830  C CZ  . TYR A 1 104 ? 6.255   -41.201 61.628  1.00 51.53  ? 105  TYR A CZ  1 
ATOM   831  O OH  . TYR A 1 104 ? 5.950   -40.776 62.908  1.00 46.36  ? 105  TYR A OH  1 
ATOM   832  N N   . PRO A 1 105 ? 10.363  -41.781 58.589  1.00 46.31  ? 106  PRO A N   1 
ATOM   833  C CA  . PRO A 1 105 ? 10.202  -40.329 58.717  1.00 51.63  ? 106  PRO A CA  1 
ATOM   834  C C   . PRO A 1 105 ? 10.656  -39.607 57.438  1.00 40.28  ? 106  PRO A C   1 
ATOM   835  O O   . PRO A 1 105 ? 11.358  -40.217 56.628  1.00 34.48  ? 106  PRO A O   1 
ATOM   836  C CB  . PRO A 1 105 ? 11.121  -39.984 59.901  1.00 47.02  ? 106  PRO A CB  1 
ATOM   837  C CG  . PRO A 1 105 ? 12.247  -40.940 59.737  1.00 42.65  ? 106  PRO A CG  1 
ATOM   838  C CD  . PRO A 1 105 ? 11.605  -42.241 59.245  1.00 42.39  ? 106  PRO A CD  1 
ATOM   839  N N   . ARG A 1 106 ? 10.265  -38.343 57.274  1.00 46.07  ? 107  ARG A N   1 
ATOM   840  C CA  . ARG A 1 106 ? 10.564  -37.587 56.060  1.00 48.78  ? 107  ARG A CA  1 
ATOM   841  C C   . ARG A 1 106 ? 12.042  -37.608 55.789  1.00 45.70  ? 107  ARG A C   1 
ATOM   842  O O   . ARG A 1 106 ? 12.830  -37.533 56.713  1.00 54.38  ? 107  ARG A O   1 
ATOM   843  C CB  . ARG A 1 106 ? 10.075  -36.141 56.167  1.00 47.77  ? 107  ARG A CB  1 
ATOM   844  C CG  . ARG A 1 106 ? 8.578   -36.033 56.490  1.00 57.96  ? 107  ARG A CG  1 
ATOM   845  C CD  . ARG A 1 106 ? 7.961   -34.762 55.903  1.00 54.42  ? 107  ARG A CD  1 
ATOM   846  N NE  . ARG A 1 106 ? 8.703   -33.542 56.234  1.00 45.69  ? 107  ARG A NE  1 
ATOM   847  C CZ  . ARG A 1 106 ? 8.409   -32.749 57.261  1.00 56.45  ? 107  ARG A CZ  1 
ATOM   848  N NH1 . ARG A 1 106 ? 7.396   -33.061 58.066  1.00 47.75  ? 107  ARG A NH1 1 
ATOM   849  N NH2 . ARG A 1 106 ? 9.128   -31.651 57.489  1.00 51.47  ? 107  ARG A NH2 1 
ATOM   850  N N   . PRO A 1 107 ? 12.419  -37.737 54.511  1.00 43.68  ? 108  PRO A N   1 
ATOM   851  C CA  . PRO A 1 107 ? 13.833  -37.714 54.141  1.00 49.23  ? 108  PRO A CA  1 
ATOM   852  C C   . PRO A 1 107 ? 14.477  -36.431 54.645  1.00 50.04  ? 108  PRO A C   1 
ATOM   853  O O   . PRO A 1 107 ? 13.809  -35.395 54.715  1.00 45.62  ? 108  PRO A O   1 
ATOM   854  C CB  . PRO A 1 107 ? 13.810  -37.753 52.606  1.00 41.54  ? 108  PRO A CB  1 
ATOM   855  C CG  . PRO A 1 107 ? 12.481  -38.331 52.253  1.00 44.26  ? 108  PRO A CG  1 
ATOM   856  C CD  . PRO A 1 107 ? 11.534  -37.877 53.341  1.00 41.22  ? 108  PRO A CD  1 
ATOM   857  N N   . THR A 1 108 ? 15.750  -36.501 55.003  1.00 53.48  ? 109  THR A N   1 
ATOM   858  C CA  . THR A 1 108 ? 16.458  -35.314 55.466  1.00 60.73  ? 109  THR A CA  1 
ATOM   859  C C   . THR A 1 108 ? 17.527  -34.939 54.455  1.00 60.45  ? 109  THR A C   1 
ATOM   860  O O   . THR A 1 108 ? 18.260  -33.969 54.659  1.00 60.81  ? 109  THR A O   1 
ATOM   861  C CB  . THR A 1 108 ? 17.097  -35.517 56.864  1.00 57.50  ? 109  THR A CB  1 
ATOM   862  O OG1 . THR A 1 108 ? 17.837  -36.748 56.886  1.00 53.55  ? 109  THR A OG1 1 
ATOM   863  C CG2 . THR A 1 108 ? 16.017  -35.525 57.961  1.00 48.23  ? 109  THR A CG2 1 
ATOM   864  N N   . SER A 1 109 ? 17.604  -35.709 53.366  1.00 51.06  ? 110  SER A N   1 
ATOM   865  C CA  . SER A 1 109 ? 18.376  -35.295 52.192  1.00 51.76  ? 110  SER A CA  1 
ATOM   866  C C   . SER A 1 109 ? 17.513  -35.383 50.923  1.00 51.87  ? 110  SER A C   1 
ATOM   867  O O   . SER A 1 109 ? 16.612  -36.216 50.841  1.00 47.99  ? 110  SER A O   1 
ATOM   868  C CB  . SER A 1 109 ? 19.647  -36.144 52.051  1.00 54.71  ? 110  SER A CB  1 
ATOM   869  O OG  . SER A 1 109 ? 19.354  -37.519 52.127  1.00 50.40  ? 110  SER A OG  1 
ATOM   870  N N   . PRO A 1 110 ? 17.779  -34.516 49.934  1.00 46.59  ? 111  PRO A N   1 
ATOM   871  C CA  . PRO A 1 110 ? 17.001  -34.437 48.684  1.00 49.87  ? 111  PRO A CA  1 
ATOM   872  C C   . PRO A 1 110 ? 16.679  -35.799 48.047  1.00 46.23  ? 111  PRO A C   1 
ATOM   873  O O   . PRO A 1 110 ? 17.566  -36.551 47.692  1.00 48.74  ? 111  PRO A O   1 
ATOM   874  C CB  . PRO A 1 110 ? 17.910  -33.621 47.770  1.00 42.86  ? 111  PRO A CB  1 
ATOM   875  C CG  . PRO A 1 110 ? 18.652  -32.719 48.720  1.00 48.12  ? 111  PRO A CG  1 
ATOM   876  C CD  . PRO A 1 110 ? 18.906  -33.564 49.938  1.00 46.09  ? 111  PRO A CD  1 
ATOM   877  N N   . THR A 1 111 ? 15.391  -36.099 47.945  1.00 42.44  ? 112  THR A N   1 
ATOM   878  C CA  . THR A 1 111 ? 14.888  -37.331 47.357  1.00 40.84  ? 112  THR A CA  1 
ATOM   879  C C   . THR A 1 111 ? 14.273  -37.038 45.974  1.00 40.87  ? 112  THR A C   1 
ATOM   880  O O   . THR A 1 111 ? 13.546  -36.054 45.825  1.00 36.29  ? 112  THR A O   1 
ATOM   881  C CB  . THR A 1 111 ? 13.826  -37.941 48.270  1.00 44.16  ? 112  THR A CB  1 
ATOM   882  O OG1 . THR A 1 111 ? 14.329  -37.994 49.609  1.00 44.36  ? 112  THR A OG1 1 
ATOM   883  C CG2 . THR A 1 111 ? 13.441  -39.311 47.827  1.00 40.67  ? 112  THR A CG2 1 
ATOM   884  N N   . PRO A 1 112 ? 14.549  -37.886 44.964  1.00 39.68  ? 113  PRO A N   1 
ATOM   885  C CA  . PRO A 1 112 ? 13.929  -37.715 43.633  1.00 35.50  ? 113  PRO A CA  1 
ATOM   886  C C   . PRO A 1 112 ? 12.398  -37.652 43.683  1.00 30.32  ? 113  PRO A C   1 
ATOM   887  O O   . PRO A 1 112 ? 11.746  -38.342 44.478  1.00 34.01  ? 113  PRO A O   1 
ATOM   888  C CB  . PRO A 1 112 ? 14.391  -38.952 42.859  1.00 36.75  ? 113  PRO A CB  1 
ATOM   889  C CG  . PRO A 1 112 ? 14.797  -39.931 43.905  1.00 53.81  ? 113  PRO A CG  1 
ATOM   890  C CD  . PRO A 1 112 ? 15.375  -39.100 45.022  1.00 46.73  ? 113  PRO A CD  1 
ATOM   891  N N   . VAL A 1 113 ? 11.831  -36.792 42.850  1.00 28.78  ? 114  VAL A N   1 
ATOM   892  C CA  . VAL A 1 113 ? 10.388  -36.585 42.848  1.00 29.77  ? 114  VAL A CA  1 
ATOM   893  C C   . VAL A 1 113 ? 9.747   -37.168 41.573  1.00 32.66  ? 114  VAL A C   1 
ATOM   894  O O   . VAL A 1 113 ? 10.227  -36.947 40.450  1.00 29.79  ? 114  VAL A O   1 
ATOM   895  C CB  . VAL A 1 113 ? 10.090  -35.086 42.987  1.00 30.04  ? 114  VAL A CB  1 
ATOM   896  C CG1 . VAL A 1 113 ? 8.586   -34.794 42.966  1.00 22.18  ? 114  VAL A CG1 1 
ATOM   897  C CG2 . VAL A 1 113 ? 10.740  -34.570 44.284  1.00 28.48  ? 114  VAL A CG2 1 
ATOM   898  N N   . LEU A 1 114 ? 8.692   -37.952 41.772  1.00 28.89  ? 115  LEU A N   1 
ATOM   899  C CA  . LEU A 1 114 ? 7.820   -38.416 40.680  1.00 30.13  ? 115  LEU A CA  1 
ATOM   900  C C   . LEU A 1 114 ? 6.537   -37.600 40.732  1.00 25.12  ? 115  LEU A C   1 
ATOM   901  O O   . LEU A 1 114 ? 5.948   -37.435 41.812  1.00 28.90  ? 115  LEU A O   1 
ATOM   902  C CB  . LEU A 1 114 ? 7.517   -39.919 40.814  1.00 28.64  ? 115  LEU A CB  1 
ATOM   903  C CG  . LEU A 1 114 ? 8.592   -40.870 40.267  1.00 30.46  ? 115  LEU A CG  1 
ATOM   904  C CD1 . LEU A 1 114 ? 8.546   -42.196 40.976  1.00 36.15  ? 115  LEU A CD1 1 
ATOM   905  C CD2 . LEU A 1 114 ? 8.432   -41.086 38.754  1.00 31.60  ? 115  LEU A CD2 1 
ATOM   906  N N   . VAL A 1 115 ? 6.122   -37.038 39.600  1.00 23.23  ? 116  VAL A N   1 
ATOM   907  C CA  . VAL A 1 115 ? 4.865   -36.290 39.554  1.00 25.19  ? 116  VAL A CA  1 
ATOM   908  C C   . VAL A 1 115 ? 3.900   -36.951 38.581  1.00 28.17  ? 116  VAL A C   1 
ATOM   909  O O   . VAL A 1 115 ? 4.183   -37.071 37.397  1.00 27.94  ? 116  VAL A O   1 
ATOM   910  C CB  . VAL A 1 115 ? 5.077   -34.802 39.158  1.00 26.34  ? 116  VAL A CB  1 
ATOM   911  C CG1 . VAL A 1 115 ? 3.762   -34.060 39.194  1.00 22.18  ? 116  VAL A CG1 1 
ATOM   912  C CG2 . VAL A 1 115 ? 6.016   -34.154 40.141  1.00 23.80  ? 116  VAL A CG2 1 
ATOM   913  N N   . TRP A 1 116 ? 2.766   -37.400 39.106  1.00 28.56  ? 117  TRP A N   1 
ATOM   914  C CA  . TRP A 1 116 ? 1.794   -38.174 38.328  1.00 25.51  ? 117  TRP A CA  1 
ATOM   915  C C   . TRP A 1 116 ? 0.730   -37.258 37.744  1.00 28.18  ? 117  TRP A C   1 
ATOM   916  O O   . TRP A 1 116 ? 0.169   -36.430 38.469  1.00 22.90  ? 117  TRP A O   1 
ATOM   917  C CB  . TRP A 1 116 ? 1.142   -39.248 39.217  1.00 24.43  ? 117  TRP A CB  1 
ATOM   918  C CG  . TRP A 1 116 ? 0.018   -39.973 38.546  1.00 27.68  ? 117  TRP A CG  1 
ATOM   919  C CD1 . TRP A 1 116 ? -1.312  -39.852 38.817  1.00 24.63  ? 117  TRP A CD1 1 
ATOM   920  C CD2 . TRP A 1 116 ? 0.126   -40.934 37.473  1.00 23.94  ? 117  TRP A CD2 1 
ATOM   921  N NE1 . TRP A 1 116 ? -2.035  -40.682 37.999  1.00 28.76  ? 117  TRP A NE1 1 
ATOM   922  C CE2 . TRP A 1 116 ? -1.181  -41.345 37.154  1.00 27.45  ? 117  TRP A CE2 1 
ATOM   923  C CE3 . TRP A 1 116 ? 1.202   -41.483 36.759  1.00 23.35  ? 117  TRP A CE3 1 
ATOM   924  C CZ2 . TRP A 1 116 ? -1.452  -42.290 36.147  1.00 23.63  ? 117  TRP A CZ2 1 
ATOM   925  C CZ3 . TRP A 1 116 ? 0.935   -42.422 35.760  1.00 30.91  ? 117  TRP A CZ3 1 
ATOM   926  C CH2 . TRP A 1 116 ? -0.388  -42.813 35.469  1.00 24.79  ? 117  TRP A CH2 1 
ATOM   927  N N   . ILE A 1 117 ? 0.474   -37.376 36.439  1.00 26.34  ? 118  ILE A N   1 
ATOM   928  C CA  . ILE A 1 117 ? -0.651  -36.674 35.821  1.00 23.80  ? 118  ILE A CA  1 
ATOM   929  C C   . ILE A 1 117 ? -1.647  -37.705 35.293  1.00 26.75  ? 118  ILE A C   1 
ATOM   930  O O   . ILE A 1 117 ? -1.302  -38.490 34.402  1.00 25.70  ? 118  ILE A O   1 
ATOM   931  C CB  . ILE A 1 117 ? -0.184  -35.765 34.663  1.00 24.21  ? 118  ILE A CB  1 
ATOM   932  C CG1 . ILE A 1 117 ? 0.933   -34.814 35.141  1.00 27.35  ? 118  ILE A CG1 1 
ATOM   933  C CG2 . ILE A 1 117 ? -1.369  -35.027 34.067  1.00 20.54  ? 118  ILE A CG2 1 
ATOM   934  C CD1 . ILE A 1 117 ? 1.489   -33.941 34.005  1.00 27.50  ? 118  ILE A CD1 1 
ATOM   935  N N   . TYR A 1 118 ? -2.861  -37.740 35.834  1.00 25.99  ? 119  TYR A N   1 
ATOM   936  C CA  . TYR A 1 118 ? -3.794  -38.808 35.430  1.00 25.43  ? 119  TYR A CA  1 
ATOM   937  C C   . TYR A 1 118 ? -4.331  -38.600 34.018  1.00 25.15  ? 119  TYR A C   1 
ATOM   938  O O   . TYR A 1 118 ? -4.394  -37.465 33.538  1.00 23.47  ? 119  TYR A O   1 
ATOM   939  C CB  . TYR A 1 118 ? -4.980  -38.920 36.408  1.00 23.09  ? 119  TYR A CB  1 
ATOM   940  C CG  . TYR A 1 118 ? -5.750  -37.623 36.643  1.00 27.31  ? 119  TYR A CG  1 
ATOM   941  C CD1 . TYR A 1 118 ? -6.648  -37.122 35.690  1.00 27.37  ? 119  TYR A CD1 1 
ATOM   942  C CD2 . TYR A 1 118 ? -5.593  -36.917 37.838  1.00 22.82  ? 119  TYR A CD2 1 
ATOM   943  C CE1 . TYR A 1 118 ? -7.358  -35.917 35.919  1.00 25.97  ? 119  TYR A CE1 1 
ATOM   944  C CE2 . TYR A 1 118 ? -6.281  -35.721 38.070  1.00 21.87  ? 119  TYR A CE2 1 
ATOM   945  C CZ  . TYR A 1 118 ? -7.161  -35.235 37.126  1.00 27.46  ? 119  TYR A CZ  1 
ATOM   946  O OH  . TYR A 1 118 ? -7.840  -34.046 37.399  1.00 25.65  ? 119  TYR A OH  1 
ATOM   947  N N   . GLY A 1 119 ? -4.757  -39.691 33.371  1.00 24.29  ? 120  GLY A N   1 
ATOM   948  C CA  . GLY A 1 119 ? -5.489  -39.602 32.108  1.00 25.35  ? 120  GLY A CA  1 
ATOM   949  C C   . GLY A 1 119 ? -7.007  -39.618 32.304  1.00 30.02  ? 120  GLY A C   1 
ATOM   950  O O   . GLY A 1 119 ? -7.503  -39.422 33.414  1.00 28.61  ? 120  GLY A O   1 
ATOM   951  N N   . GLY A 1 120 ? -7.746  -39.848 31.222  1.00 29.23  ? 121  GLY A N   1 
ATOM   952  C CA  . GLY A 1 120 ? -9.191  -39.715 31.226  1.00 23.87  ? 121  GLY A CA  1 
ATOM   953  C C   . GLY A 1 120 ? -9.715  -38.853 30.089  1.00 26.76  ? 121  GLY A C   1 
ATOM   954  O O   . GLY A 1 120 ? -10.770 -38.247 30.219  1.00 30.00  ? 121  GLY A O   1 
ATOM   955  N N   . GLY A 1 121 ? -8.956  -38.766 28.991  1.00 28.98  ? 122  GLY A N   1 
ATOM   956  C CA  . GLY A 1 121 ? -9.406  -38.137 27.750  1.00 25.44  ? 122  GLY A CA  1 
ATOM   957  C C   . GLY A 1 121 ? -9.561  -36.631 27.819  1.00 30.70  ? 122  GLY A C   1 
ATOM   958  O O   . GLY A 1 121 ? -10.190 -36.030 26.946  1.00 26.45  ? 122  GLY A O   1 
ATOM   959  N N   . PHE A 1 122 ? -8.991  -36.022 28.867  1.00 26.95  ? 123  PHE A N   1 
ATOM   960  C CA  . PHE A 1 122 ? -9.212  -34.618 29.200  1.00 25.51  ? 123  PHE A CA  1 
ATOM   961  C C   . PHE A 1 122 ? -10.671 -34.314 29.581  1.00 29.08  ? 123  PHE A C   1 
ATOM   962  O O   . PHE A 1 122 ? -11.018 -33.137 29.722  1.00 27.47  ? 123  PHE A O   1 
ATOM   963  C CB  . PHE A 1 122 ? -8.769  -33.665 28.042  1.00 24.80  ? 123  PHE A CB  1 
ATOM   964  C CG  . PHE A 1 122 ? -7.281  -33.718 27.728  1.00 24.21  ? 123  PHE A CG  1 
ATOM   965  C CD1 . PHE A 1 122 ? -6.338  -33.261 28.645  1.00 26.66  ? 123  PHE A CD1 1 
ATOM   966  C CD2 . PHE A 1 122 ? -6.829  -34.249 26.521  1.00 29.70  ? 123  PHE A CD2 1 
ATOM   967  C CE1 . PHE A 1 122 ? -4.976  -33.316 28.355  1.00 26.47  ? 123  PHE A CE1 1 
ATOM   968  C CE2 . PHE A 1 122 ? -5.463  -34.322 26.227  1.00 28.68  ? 123  PHE A CE2 1 
ATOM   969  C CZ  . PHE A 1 122 ? -4.539  -33.847 27.121  1.00 24.82  ? 123  PHE A CZ  1 
ATOM   970  N N   . TYR A 1 123 ? -11.509 -35.343 29.760  1.00 24.37  ? 124  TYR A N   1 
ATOM   971  C CA  . TYR A 1 123 ? -12.898 -35.130 30.216  1.00 31.51  ? 124  TYR A CA  1 
ATOM   972  C C   . TYR A 1 123 ? -13.149 -35.790 31.574  1.00 29.45  ? 124  TYR A C   1 
ATOM   973  O O   . TYR A 1 123 ? -14.238 -35.651 32.131  1.00 32.56  ? 124  TYR A O   1 
ATOM   974  C CB  . TYR A 1 123 ? -13.958 -35.659 29.201  1.00 29.59  ? 124  TYR A CB  1 
ATOM   975  C CG  . TYR A 1 123 ? -13.914 -37.161 29.004  1.00 30.47  ? 124  TYR A CG  1 
ATOM   976  C CD1 . TYR A 1 123 ? -14.627 -38.014 29.833  1.00 34.57  ? 124  TYR A CD1 1 
ATOM   977  C CD2 . TYR A 1 123 ? -13.152 -37.724 27.992  1.00 38.51  ? 124  TYR A CD2 1 
ATOM   978  C CE1 . TYR A 1 123 ? -14.560 -39.393 29.680  1.00 39.59  ? 124  TYR A CE1 1 
ATOM   979  C CE2 . TYR A 1 123 ? -13.094 -39.101 27.819  1.00 37.31  ? 124  TYR A CE2 1 
ATOM   980  C CZ  . TYR A 1 123 ? -13.787 -39.926 28.673  1.00 44.75  ? 124  TYR A CZ  1 
ATOM   981  O OH  . TYR A 1 123 ? -13.731 -41.296 28.506  1.00 67.04  ? 124  TYR A OH  1 
ATOM   982  N N   . SER A 1 124 ? -12.169 -36.519 32.098  1.00 27.42  ? 125  SER A N   1 
ATOM   983  C CA  . SER A 1 124 ? -12.354 -37.196 33.376  1.00 28.23  ? 125  SER A CA  1 
ATOM   984  C C   . SER A 1 124 ? -11.030 -37.464 34.089  1.00 30.99  ? 125  SER A C   1 
ATOM   985  O O   . SER A 1 124 ? -9.959  -37.235 33.539  1.00 27.49  ? 125  SER A O   1 
ATOM   986  C CB  . SER A 1 124 ? -13.072 -38.524 33.163  1.00 29.20  ? 125  SER A CB  1 
ATOM   987  O OG  . SER A 1 124 ? -12.287 -39.380 32.369  1.00 28.42  ? 125  SER A OG  1 
ATOM   988  N N   . GLY A 1 125 ? -11.124 -37.995 35.297  1.00 24.18  ? 126  GLY A N   1 
ATOM   989  C CA  . GLY A 1 125 ? -9.963  -38.424 36.040  1.00 28.02  ? 126  GLY A CA  1 
ATOM   990  C C   . GLY A 1 125 ? -9.889  -37.731 37.389  1.00 22.54  ? 126  GLY A C   1 
ATOM   991  O O   . GLY A 1 125 ? -10.566 -36.724 37.632  1.00 26.81  ? 126  GLY A O   1 
ATOM   992  N N   . ALA A 1 126 ? -9.013  -38.238 38.238  1.00 23.44  ? 127  ALA A N   1 
ATOM   993  C CA  . ALA A 1 126 ? -8.832  -37.686 39.581  1.00 29.66  ? 127  ALA A CA  1 
ATOM   994  C C   . ALA A 1 126 ? -7.590  -38.268 40.204  1.00 24.19  ? 127  ALA A C   1 
ATOM   995  O O   . ALA A 1 126 ? -7.229  -39.435 39.948  1.00 25.22  ? 127  ALA A O   1 
ATOM   996  C CB  . ALA A 1 126 ? -10.029 -37.977 40.469  1.00 25.52  ? 127  ALA A CB  1 
ATOM   997  N N   . SER A 1 127 ? -6.936  -37.488 41.055  1.00 25.50  ? 128  SER A N   1 
ATOM   998  C CA  . SER A 1 127 ? -5.704  -37.990 41.643  1.00 26.89  ? 128  SER A CA  1 
ATOM   999  C C   . SER A 1 127 ? -6.015  -38.892 42.834  1.00 29.86  ? 128  SER A C   1 
ATOM   1000 O O   . SER A 1 127 ? -5.118  -39.548 43.405  1.00 27.26  ? 128  SER A O   1 
ATOM   1001 C CB  . SER A 1 127 ? -4.795  -36.820 42.042  1.00 28.98  ? 128  SER A CB  1 
ATOM   1002 O OG  . SER A 1 127 ? -5.424  -35.971 42.993  1.00 32.12  ? 128  SER A OG  1 
ATOM   1003 N N   . SER A 1 128 ? -7.291  -38.958 43.193  1.00 28.15  ? 129  SER A N   1 
ATOM   1004 C CA  . SER A 1 128 ? -7.696  -39.705 44.393  1.00 30.58  ? 129  SER A CA  1 
ATOM   1005 C C   . SER A 1 128 ? -8.098  -41.159 44.105  1.00 32.74  ? 129  SER A C   1 
ATOM   1006 O O   . SER A 1 128 ? -8.418  -41.873 45.044  1.00 30.33  ? 129  SER A O   1 
ATOM   1007 C CB  . SER A 1 128 ? -8.864  -39.014 45.081  1.00 25.76  ? 129  SER A CB  1 
ATOM   1008 O OG  . SER A 1 128 ? -9.900  -38.721 44.144  1.00 27.90  ? 129  SER A OG  1 
ATOM   1009 N N   . LEU A 1 129 ? -8.107  -41.586 42.831  1.00 28.95  ? 130  LEU A N   1 
ATOM   1010 C CA  . LEU A 1 129 ? -8.479  -42.980 42.492  1.00 29.12  ? 130  LEU A CA  1 
ATOM   1011 C C   . LEU A 1 129 ? -7.542  -43.954 43.198  1.00 32.89  ? 130  LEU A C   1 
ATOM   1012 O O   . LEU A 1 129 ? -6.335  -43.691 43.317  1.00 29.34  ? 130  LEU A O   1 
ATOM   1013 C CB  . LEU A 1 129 ? -8.430  -43.234 40.980  1.00 28.69  ? 130  LEU A CB  1 
ATOM   1014 C CG  . LEU A 1 129 ? -9.255  -42.287 40.101  1.00 33.45  ? 130  LEU A CG  1 
ATOM   1015 C CD1 . LEU A 1 129 ? -9.246  -42.758 38.624  1.00 29.78  ? 130  LEU A CD1 1 
ATOM   1016 C CD2 . LEU A 1 129 ? -10.673 -42.114 40.624  1.00 32.26  ? 130  LEU A CD2 1 
ATOM   1017 N N   . ASP A 1 130 ? -8.087  -45.071 43.668  1.00 31.81  ? 131  ASP A N   1 
ATOM   1018 C CA  . ASP A 1 130 ? -7.292  -46.056 44.409  1.00 27.11  ? 131  ASP A CA  1 
ATOM   1019 C C   . ASP A 1 130 ? -6.098  -46.486 43.626  1.00 25.49  ? 131  ASP A C   1 
ATOM   1020 O O   . ASP A 1 130 ? -5.064  -46.789 44.190  1.00 31.98  ? 131  ASP A O   1 
ATOM   1021 C CB  . ASP A 1 130 ? -8.107  -47.317 44.737  1.00 33.86  ? 131  ASP A CB  1 
ATOM   1022 C CG  . ASP A 1 130 ? -9.223  -47.056 45.727  1.00 39.26  ? 131  ASP A CG  1 
ATOM   1023 O OD1 . ASP A 1 130 ? -9.325  -45.926 46.253  1.00 37.93  ? 131  ASP A OD1 1 
ATOM   1024 O OD2 . ASP A 1 130 ? -10.011 -47.993 45.962  1.00 47.11  ? 131  ASP A OD2 1 
ATOM   1025 N N   . VAL A 1 131 ? -6.247  -46.556 42.307  1.00 26.23  ? 132  VAL A N   1 
ATOM   1026 C CA  . VAL A 1 131 ? -5.196  -47.156 41.507  1.00 25.16  ? 132  VAL A CA  1 
ATOM   1027 C C   . VAL A 1 131 ? -3.990  -46.191 41.358  1.00 26.46  ? 132  VAL A C   1 
ATOM   1028 O O   . VAL A 1 131 ? -2.932  -46.591 40.851  1.00 26.74  ? 132  VAL A O   1 
ATOM   1029 C CB  . VAL A 1 131 ? -5.776  -47.618 40.142  1.00 34.09  ? 132  VAL A CB  1 
ATOM   1030 C CG1 . VAL A 1 131 ? -5.945  -46.453 39.192  1.00 28.97  ? 132  VAL A CG1 1 
ATOM   1031 C CG2 . VAL A 1 131 ? -4.947  -48.704 39.539  1.00 39.20  ? 132  VAL A CG2 1 
ATOM   1032 N N   . TYR A 1 132 ? -4.130  -44.943 41.825  1.00 26.01  ? 133  TYR A N   1 
ATOM   1033 C CA  . TYR A 1 132 ? -3.024  -43.967 41.783  1.00 28.50  ? 133  TYR A CA  1 
ATOM   1034 C C   . TYR A 1 132 ? -2.453  -43.686 43.183  1.00 28.73  ? 133  TYR A C   1 
ATOM   1035 O O   . TYR A 1 132 ? -1.767  -42.677 43.395  1.00 28.37  ? 133  TYR A O   1 
ATOM   1036 C CB  . TYR A 1 132 ? -3.463  -42.628 41.181  1.00 22.49  ? 133  TYR A CB  1 
ATOM   1037 C CG  . TYR A 1 132 ? -4.147  -42.675 39.837  1.00 24.45  ? 133  TYR A CG  1 
ATOM   1038 C CD1 . TYR A 1 132 ? -3.832  -43.649 38.885  1.00 25.16  ? 133  TYR A CD1 1 
ATOM   1039 C CD2 . TYR A 1 132 ? -5.115  -41.718 39.511  1.00 25.39  ? 133  TYR A CD2 1 
ATOM   1040 C CE1 . TYR A 1 132 ? -4.475  -43.651 37.628  1.00 24.20  ? 133  TYR A CE1 1 
ATOM   1041 C CE2 . TYR A 1 132 ? -5.745  -41.720 38.275  1.00 24.85  ? 133  TYR A CE2 1 
ATOM   1042 C CZ  . TYR A 1 132 ? -5.427  -42.692 37.339  1.00 24.52  ? 133  TYR A CZ  1 
ATOM   1043 O OH  . TYR A 1 132 ? -6.071  -42.669 36.101  1.00 22.85  ? 133  TYR A OH  1 
ATOM   1044 N N   . ASP A 1 133 ? -2.760  -44.562 44.129  1.00 28.53  ? 134  ASP A N   1 
ATOM   1045 C CA  . ASP A 1 133 ? -2.268  -44.465 45.522  1.00 30.41  ? 134  ASP A CA  1 
ATOM   1046 C C   . ASP A 1 133 ? -0.746  -44.521 45.600  1.00 29.95  ? 134  ASP A C   1 
ATOM   1047 O O   . ASP A 1 133 ? -0.151  -45.575 45.346  1.00 26.81  ? 134  ASP A O   1 
ATOM   1048 C CB  . ASP A 1 133 ? -2.874  -45.610 46.327  1.00 28.81  ? 134  ASP A CB  1 
ATOM   1049 C CG  . ASP A 1 133 ? -2.532  -45.572 47.824  1.00 46.29  ? 134  ASP A CG  1 
ATOM   1050 O OD1 . ASP A 1 133 ? -1.706  -44.732 48.302  1.00 31.42  ? 134  ASP A OD1 1 
ATOM   1051 O OD2 . ASP A 1 133 ? -3.124  -46.446 48.514  1.00 43.59  ? 134  ASP A OD2 1 
ATOM   1052 N N   . GLY A 1 134 ? -0.114  -43.405 45.960  1.00 25.91  ? 135  GLY A N   1 
ATOM   1053 C CA  . GLY A 1 134 ? 1.338   -43.324 45.943  1.00 21.32  ? 135  GLY A CA  1 
ATOM   1054 C C   . GLY A 1 134 ? 2.122   -44.032 47.054  1.00 29.99  ? 135  GLY A C   1 
ATOM   1055 O O   . GLY A 1 134 ? 3.351   -44.061 47.015  1.00 28.79  ? 135  GLY A O   1 
ATOM   1056 N N   . ARG A 1 135 ? 1.433   -44.649 48.016  1.00 24.92  ? 136  ARG A N   1 
ATOM   1057 C CA  . ARG A 1 135 ? 2.112   -45.163 49.198  1.00 31.29  ? 136  ARG A CA  1 
ATOM   1058 C C   . ARG A 1 135 ? 3.078   -46.314 48.934  1.00 34.80  ? 136  ARG A C   1 
ATOM   1059 O O   . ARG A 1 135 ? 4.099   -46.399 49.615  1.00 31.47  ? 136  ARG A O   1 
ATOM   1060 C CB  . ARG A 1 135 ? 1.083   -45.601 50.252  1.00 31.65  ? 136  ARG A CB  1 
ATOM   1061 C CG  . ARG A 1 135 ? 0.429   -46.936 49.967  1.00 31.00  ? 136  ARG A CG  1 
ATOM   1062 C CD  . ARG A 1 135 ? -0.554  -47.260 51.082  1.00 35.05  ? 136  ARG A CD  1 
ATOM   1063 N NE  . ARG A 1 135 ? -1.748  -46.428 50.987  1.00 30.70  ? 136  ARG A NE  1 
ATOM   1064 C CZ  . ARG A 1 135 ? -2.672  -46.353 51.936  1.00 41.44  ? 136  ARG A CZ  1 
ATOM   1065 N NH1 . ARG A 1 135 ? -2.525  -47.045 53.082  1.00 39.91  ? 136  ARG A NH1 1 
ATOM   1066 N NH2 . ARG A 1 135 ? -3.721  -45.565 51.755  1.00 36.84  ? 136  ARG A NH2 1 
ATOM   1067 N N   . PHE A 1 136 ? 2.797   -47.187 47.962  1.00 29.58  ? 137  PHE A N   1 
ATOM   1068 C CA  . PHE A 1 136 ? 3.691   -48.341 47.737  1.00 28.32  ? 137  PHE A CA  1 
ATOM   1069 C C   . PHE A 1 136 ? 4.992   -47.946 47.014  1.00 33.49  ? 137  PHE A C   1 
ATOM   1070 O O   . PHE A 1 136 ? 6.078   -48.440 47.342  1.00 32.44  ? 137  PHE A O   1 
ATOM   1071 C CB  . PHE A 1 136 ? 2.972   -49.451 46.943  1.00 28.14  ? 137  PHE A CB  1 
ATOM   1072 C CG  . PHE A 1 136 ? 1.682   -49.870 47.555  1.00 30.51  ? 137  PHE A CG  1 
ATOM   1073 C CD1 . PHE A 1 136 ? 1.675   -50.652 48.699  1.00 34.22  ? 137  PHE A CD1 1 
ATOM   1074 C CD2 . PHE A 1 136 ? 0.474   -49.421 47.048  1.00 34.87  ? 137  PHE A CD2 1 
ATOM   1075 C CE1 . PHE A 1 136 ? 0.486   -51.002 49.306  1.00 33.00  ? 137  PHE A CE1 1 
ATOM   1076 C CE2 . PHE A 1 136 ? -0.719  -49.774 47.660  1.00 33.24  ? 137  PHE A CE2 1 
ATOM   1077 C CZ  . PHE A 1 136 ? -0.704  -50.566 48.792  1.00 31.72  ? 137  PHE A CZ  1 
ATOM   1078 N N   . LEU A 1 137 ? 4.882   -47.062 46.026  1.00 33.46  ? 138  LEU A N   1 
ATOM   1079 C CA  . LEU A 1 137 ? 6.055   -46.550 45.308  1.00 34.47  ? 138  LEU A CA  1 
ATOM   1080 C C   . LEU A 1 137 ? 7.004   -45.836 46.249  1.00 32.45  ? 138  LEU A C   1 
ATOM   1081 O O   . LEU A 1 137 ? 8.214   -46.021 46.231  1.00 31.01  ? 138  LEU A O   1 
ATOM   1082 C CB  . LEU A 1 137 ? 5.630   -45.564 44.222  1.00 26.91  ? 138  LEU A CB  1 
ATOM   1083 C CG  . LEU A 1 137 ? 5.689   -46.099 42.821  1.00 31.67  ? 138  LEU A CG  1 
ATOM   1084 C CD1 . LEU A 1 137 ? 5.003   -45.072 41.899  1.00 31.53  ? 138  LEU A CD1 1 
ATOM   1085 C CD2 . LEU A 1 137 ? 7.142   -46.307 42.474  1.00 28.66  ? 138  LEU A CD2 1 
ATOM   1086 N N   . VAL A 1 138 ? 6.429   -44.967 47.054  1.00 27.54  ? 139  VAL A N   1 
ATOM   1087 C CA  . VAL A 1 138 ? 7.220   -44.194 47.969  1.00 30.96  ? 139  VAL A CA  1 
ATOM   1088 C C   . VAL A 1 138 ? 7.910   -45.059 49.031  1.00 30.92  ? 139  VAL A C   1 
ATOM   1089 O O   . VAL A 1 138 ? 9.094   -44.875 49.304  1.00 31.22  ? 139  VAL A O   1 
ATOM   1090 C CB  . VAL A 1 138 ? 6.334   -43.126 48.593  1.00 34.27  ? 139  VAL A CB  1 
ATOM   1091 C CG1 . VAL A 1 138 ? 6.972   -42.522 49.806  1.00 28.60  ? 139  VAL A CG1 1 
ATOM   1092 C CG2 . VAL A 1 138 ? 6.032   -42.066 47.511  1.00 29.97  ? 139  VAL A CG2 1 
ATOM   1093 N N   . GLN A 1 139 ? 7.210   -46.029 49.606  1.00 34.19  ? 140  GLN A N   1 
ATOM   1094 C CA  . GLN A 1 139 ? 7.857   -46.866 50.610  1.00 30.66  ? 140  GLN A CA  1 
ATOM   1095 C C   . GLN A 1 139 ? 8.923   -47.734 49.962  1.00 32.46  ? 140  GLN A C   1 
ATOM   1096 O O   . GLN A 1 139 ? 10.043  -47.846 50.469  1.00 37.52  ? 140  GLN A O   1 
ATOM   1097 C CB  . GLN A 1 139 ? 6.839   -47.742 51.348  1.00 29.71  ? 140  GLN A CB  1 
ATOM   1098 C CG  . GLN A 1 139 ? 7.408   -48.455 52.583  1.00 31.02  ? 140  GLN A CG  1 
ATOM   1099 C CD  . GLN A 1 139 ? 8.258   -49.663 52.240  1.00 34.14  ? 140  GLN A CD  1 
ATOM   1100 O OE1 . GLN A 1 139 ? 7.902   -50.457 51.374  1.00 36.52  ? 140  GLN A OE1 1 
ATOM   1101 N NE2 . GLN A 1 139 ? 9.400   -49.798 52.909  1.00 34.74  ? 140  GLN A NE2 1 
ATOM   1102 N N   . ALA A 1 140 ? 8.577   -48.356 48.844  1.00 31.64  ? 141  ALA A N   1 
ATOM   1103 C CA  . ALA A 1 140 ? 9.467   -49.324 48.213  1.00 36.53  ? 141  ALA A CA  1 
ATOM   1104 C C   . ALA A 1 140 ? 10.702  -48.682 47.595  1.00 37.01  ? 141  ALA A C   1 
ATOM   1105 O O   . ALA A 1 140 ? 11.800  -49.231 47.663  1.00 32.80  ? 141  ALA A O   1 
ATOM   1106 C CB  . ALA A 1 140 ? 8.719   -50.106 47.146  1.00 33.70  ? 141  ALA A CB  1 
ATOM   1107 N N   . GLU A 1 141 ? 10.529  -47.522 46.984  1.00 30.42  ? 142  GLU A N   1 
ATOM   1108 C CA  . GLU A 1 141 ? 11.607  -46.966 46.163  1.00 28.66  ? 142  GLU A CA  1 
ATOM   1109 C C   . GLU A 1 141 ? 12.161  -45.652 46.702  1.00 32.64  ? 142  GLU A C   1 
ATOM   1110 O O   . GLU A 1 141 ? 13.125  -45.109 46.153  1.00 35.35  ? 142  GLU A O   1 
ATOM   1111 C CB  . GLU A 1 141 ? 11.118  -46.767 44.718  1.00 29.03  ? 142  GLU A CB  1 
ATOM   1112 C CG  . GLU A 1 141 ? 10.960  -48.086 43.953  1.00 31.54  ? 142  GLU A CG  1 
ATOM   1113 C CD  . GLU A 1 141 ? 12.258  -48.867 43.859  1.00 31.59  ? 142  GLU A CD  1 
ATOM   1114 O OE1 . GLU A 1 141 ? 13.338  -48.242 43.785  1.00 35.11  ? 142  GLU A OE1 1 
ATOM   1115 O OE2 . GLU A 1 141 ? 12.204  -50.115 43.843  1.00 37.43  ? 142  GLU A OE2 1 
ATOM   1116 N N   . ARG A 1 142 ? 11.546  -45.147 47.769  1.00 36.28  ? 143  ARG A N   1 
ATOM   1117 C CA  . ARG A 1 142 ? 12.061  -43.994 48.494  1.00 36.52  ? 143  ARG A CA  1 
ATOM   1118 C C   . ARG A 1 142 ? 12.206  -42.811 47.575  1.00 37.38  ? 143  ARG A C   1 
ATOM   1119 O O   . ARG A 1 142 ? 13.278  -42.257 47.385  1.00 35.11  ? 143  ARG A O   1 
ATOM   1120 C CB  . ARG A 1 142 ? 13.369  -44.366 49.181  1.00 34.59  ? 143  ARG A CB  1 
ATOM   1121 C CG  . ARG A 1 142 ? 13.093  -45.437 50.242  1.00 43.04  ? 143  ARG A CG  1 
ATOM   1122 C CD  . ARG A 1 142 ? 14.231  -45.630 51.196  1.00 42.72  ? 143  ARG A CD  1 
ATOM   1123 N NE  . ARG A 1 142 ? 14.481  -44.440 52.001  1.00 49.79  ? 143  ARG A NE  1 
ATOM   1124 C CZ  . ARG A 1 142 ? 13.854  -44.179 53.147  1.00 54.93  ? 143  ARG A CZ  1 
ATOM   1125 N NH1 . ARG A 1 142 ? 12.917  -45.011 53.602  1.00 33.18  ? 143  ARG A NH1 1 
ATOM   1126 N NH2 . ARG A 1 142 ? 14.144  -43.074 53.814  1.00 47.54  ? 143  ARG A NH2 1 
ATOM   1127 N N   . THR A 1 143 ? 11.090  -42.479 46.947  1.00 40.14  ? 144  THR A N   1 
ATOM   1128 C CA  . THR A 1 143 ? 10.968  -41.287 46.139  1.00 32.28  ? 144  THR A CA  1 
ATOM   1129 C C   . THR A 1 143 ? 9.980   -40.411 46.859  1.00 28.54  ? 144  THR A C   1 
ATOM   1130 O O   . THR A 1 143 ? 9.284   -40.873 47.757  1.00 31.19  ? 144  THR A O   1 
ATOM   1131 C CB  . THR A 1 143 ? 10.425  -41.589 44.740  1.00 39.12  ? 144  THR A CB  1 
ATOM   1132 O OG1 . THR A 1 143 ? 9.299   -42.473 44.880  1.00 42.83  ? 144  THR A OG1 1 
ATOM   1133 C CG2 . THR A 1 143 ? 11.483  -42.249 43.896  1.00 38.42  ? 144  THR A CG2 1 
ATOM   1134 N N   . VAL A 1 144 ? 9.888   -39.154 46.463  1.00 27.35  ? 145  VAL A N   1 
ATOM   1135 C CA  . VAL A 1 144 ? 8.726   -38.387 46.843  1.00 26.54  ? 145  VAL A CA  1 
ATOM   1136 C C   . VAL A 1 144 ? 7.743   -38.462 45.650  1.00 30.69  ? 145  VAL A C   1 
ATOM   1137 O O   . VAL A 1 144 ? 8.161   -38.435 44.484  1.00 34.59  ? 145  VAL A O   1 
ATOM   1138 C CB  . VAL A 1 144 ? 9.107   -36.932 47.218  1.00 31.32  ? 145  VAL A CB  1 
ATOM   1139 C CG1 . VAL A 1 144 ? 7.835   -36.073 47.476  1.00 27.80  ? 145  VAL A CG1 1 
ATOM   1140 C CG2 . VAL A 1 144 ? 10.022  -36.946 48.476  1.00 28.53  ? 145  VAL A CG2 1 
ATOM   1141 N N   . LEU A 1 145 ? 6.454   -38.609 45.933  1.00 28.68  ? 146  LEU A N   1 
ATOM   1142 C CA  . LEU A 1 145 ? 5.484   -38.692 44.856  1.00 28.31  ? 146  LEU A CA  1 
ATOM   1143 C C   . LEU A 1 145 ? 4.436   -37.608 45.019  1.00 27.15  ? 146  LEU A C   1 
ATOM   1144 O O   . LEU A 1 145 ? 3.897   -37.406 46.109  1.00 30.06  ? 146  LEU A O   1 
ATOM   1145 C CB  . LEU A 1 145 ? 4.827   -40.068 44.797  1.00 25.78  ? 146  LEU A CB  1 
ATOM   1146 C CG  . LEU A 1 145 ? 4.037   -40.267 43.487  1.00 36.77  ? 146  LEU A CG  1 
ATOM   1147 C CD1 . LEU A 1 145 ? 4.213   -41.668 42.981  1.00 42.98  ? 146  LEU A CD1 1 
ATOM   1148 C CD2 . LEU A 1 145 ? 2.546   -39.962 43.662  1.00 32.26  ? 146  LEU A CD2 1 
ATOM   1149 N N   . VAL A 1 146 ? 4.182   -36.889 43.932  1.00 25.61  ? 147  VAL A N   1 
ATOM   1150 C CA  . VAL A 1 146 ? 3.200   -35.807 43.921  1.00 24.85  ? 147  VAL A CA  1 
ATOM   1151 C C   . VAL A 1 146 ? 2.167   -36.076 42.832  1.00 29.30  ? 147  VAL A C   1 
ATOM   1152 O O   . VAL A 1 146 ? 2.523   -36.535 41.732  1.00 27.04  ? 147  VAL A O   1 
ATOM   1153 C CB  . VAL A 1 146 ? 3.868   -34.417 43.660  1.00 26.11  ? 147  VAL A CB  1 
ATOM   1154 C CG1 . VAL A 1 146 ? 2.820   -33.302 43.697  1.00 21.16  ? 147  VAL A CG1 1 
ATOM   1155 C CG2 . VAL A 1 146 ? 4.999   -34.135 44.702  1.00 27.33  ? 147  VAL A CG2 1 
ATOM   1156 N N   . SER A 1 147 ? 0.894   -35.801 43.119  1.00 25.56  ? 148  SER A N   1 
ATOM   1157 C CA  . SER A 1 147 ? -0.116  -35.825 42.066  1.00 28.32  ? 148  SER A CA  1 
ATOM   1158 C C   . SER A 1 147 ? -1.086  -34.674 42.268  1.00 29.82  ? 148  SER A C   1 
ATOM   1159 O O   . SER A 1 147 ? -1.345  -34.274 43.399  1.00 30.74  ? 148  SER A O   1 
ATOM   1160 C CB  . SER A 1 147 ? -0.856  -37.171 42.047  1.00 28.64  ? 148  SER A CB  1 
ATOM   1161 O OG  . SER A 1 147 ? -1.587  -37.328 43.253  1.00 28.34  ? 148  SER A OG  1 
ATOM   1162 N N   . MET A 1 148 ? -1.606  -34.133 41.167  1.00 25.77  ? 149  MET A N   1 
ATOM   1163 C CA  . MET A 1 148 ? -2.495  -33.001 41.235  1.00 24.08  ? 149  MET A CA  1 
ATOM   1164 C C   . MET A 1 148 ? -3.792  -33.300 40.528  1.00 29.28  ? 149  MET A C   1 
ATOM   1165 O O   . MET A 1 148 ? -3.842  -34.114 39.600  1.00 26.05  ? 149  MET A O   1 
ATOM   1166 C CB  . MET A 1 148 ? -1.855  -31.737 40.618  1.00 24.43  ? 149  MET A CB  1 
ATOM   1167 C CG  . MET A 1 148 ? -2.068  -31.540 39.076  1.00 23.59  ? 149  MET A CG  1 
ATOM   1168 S SD  . MET A 1 148 ? -1.198  -32.831 38.154  1.00 26.34  ? 149  MET A SD  1 
ATOM   1169 C CE  . MET A 1 148 ? 0.522   -32.435 38.455  1.00 25.64  ? 149  MET A CE  1 
ATOM   1170 N N   . ASN A 1 149 ? -4.845  -32.638 40.985  1.00 27.14  ? 150  ASN A N   1 
ATOM   1171 C CA  . ASN A 1 149 ? -6.047  -32.552 40.200  1.00 30.47  ? 150  ASN A CA  1 
ATOM   1172 C C   . ASN A 1 149 ? -5.909  -31.395 39.212  1.00 27.57  ? 150  ASN A C   1 
ATOM   1173 O O   . ASN A 1 149 ? -5.333  -30.363 39.541  1.00 29.89  ? 150  ASN A O   1 
ATOM   1174 C CB  . ASN A 1 149 ? -7.258  -32.336 41.094  1.00 26.51  ? 150  ASN A CB  1 
ATOM   1175 C CG  . ASN A 1 149 ? -7.822  -33.626 41.662  1.00 27.70  ? 150  ASN A CG  1 
ATOM   1176 O OD1 . ASN A 1 149 ? -7.262  -34.712 41.512  1.00 25.27  ? 150  ASN A OD1 1 
ATOM   1177 N ND2 . ASN A 1 149 ? -8.953  -33.498 42.339  1.00 30.75  ? 150  ASN A ND2 1 
ATOM   1178 N N   . TYR A 1 150 ? -6.443  -31.548 38.008  1.00 26.14  ? 151  TYR A N   1 
ATOM   1179 C CA  . TYR A 1 150 ? -6.502  -30.427 37.074  1.00 26.84  ? 151  TYR A CA  1 
ATOM   1180 C C   . TYR A 1 150 ? -7.876  -30.418 36.455  1.00 26.43  ? 151  TYR A C   1 
ATOM   1181 O O   . TYR A 1 150 ? -8.501  -31.465 36.351  1.00 23.77  ? 151  TYR A O   1 
ATOM   1182 C CB  . TYR A 1 150 ? -5.428  -30.526 35.988  1.00 24.67  ? 151  TYR A CB  1 
ATOM   1183 C CG  . TYR A 1 150 ? -5.485  -31.774 35.147  1.00 25.15  ? 151  TYR A CG  1 
ATOM   1184 C CD1 . TYR A 1 150 ? -4.848  -32.938 35.569  1.00 21.60  ? 151  TYR A CD1 1 
ATOM   1185 C CD2 . TYR A 1 150 ? -6.177  -31.793 33.930  1.00 27.39  ? 151  TYR A CD2 1 
ATOM   1186 C CE1 . TYR A 1 150 ? -4.896  -34.098 34.817  1.00 25.36  ? 151  TYR A CE1 1 
ATOM   1187 C CE2 . TYR A 1 150 ? -6.234  -32.963 33.154  1.00 23.89  ? 151  TYR A CE2 1 
ATOM   1188 C CZ  . TYR A 1 150 ? -5.582  -34.101 33.603  1.00 26.82  ? 151  TYR A CZ  1 
ATOM   1189 O OH  . TYR A 1 150 ? -5.616  -35.254 32.846  1.00 26.08  ? 151  TYR A OH  1 
ATOM   1190 N N   . ARG A 1 151 ? -8.341  -29.250 36.026  1.00 22.94  ? 152  ARG A N   1 
ATOM   1191 C CA  . ARG A 1 151 ? -9.686  -29.154 35.473  1.00 24.99  ? 152  ARG A CA  1 
ATOM   1192 C C   . ARG A 1 151 ? -9.809  -29.913 34.155  1.00 30.91  ? 152  ARG A C   1 
ATOM   1193 O O   . ARG A 1 151 ? -8.908  -29.868 33.316  1.00 27.34  ? 152  ARG A O   1 
ATOM   1194 C CB  . ARG A 1 151 ? -10.070 -27.690 35.278  1.00 25.33  ? 152  ARG A CB  1 
ATOM   1195 C CG  . ARG A 1 151 ? -10.356 -26.947 36.595  1.00 26.87  ? 152  ARG A CG  1 
ATOM   1196 C CD  . ARG A 1 151 ? -10.502 -25.455 36.323  1.00 28.70  ? 152  ARG A CD  1 
ATOM   1197 N NE  . ARG A 1 151 ? -9.198  -24.798 36.198  1.00 29.51  ? 152  ARG A NE  1 
ATOM   1198 C CZ  . ARG A 1 151 ? -9.046  -23.519 35.861  1.00 33.60  ? 152  ARG A CZ  1 
ATOM   1199 N NH1 . ARG A 1 151 ? -10.122 -22.772 35.580  1.00 25.85  ? 152  ARG A NH1 1 
ATOM   1200 N NH2 . ARG A 1 151 ? -7.822  -22.990 35.804  1.00 26.65  ? 152  ARG A NH2 1 
ATOM   1201 N N   . VAL A 1 152 ? -10.925 -30.611 33.977  1.00 27.09  ? 153  VAL A N   1 
ATOM   1202 C CA  . VAL A 1 152 ? -11.159 -31.383 32.756  1.00 25.69  ? 153  VAL A CA  1 
ATOM   1203 C C   . VAL A 1 152 ? -12.445 -30.898 32.093  1.00 29.44  ? 153  VAL A C   1 
ATOM   1204 O O   . VAL A 1 152 ? -13.118 -30.015 32.620  1.00 28.88  ? 153  VAL A O   1 
ATOM   1205 C CB  . VAL A 1 152 ? -11.240 -32.897 33.039  1.00 25.19  ? 153  VAL A CB  1 
ATOM   1206 C CG1 . VAL A 1 152 ? -9.859  -33.449 33.475  1.00 22.63  ? 153  VAL A CG1 1 
ATOM   1207 C CG2 . VAL A 1 152 ? -12.287 -33.203 34.136  1.00 25.42  ? 153  VAL A CG2 1 
ATOM   1208 N N   . GLY A 1 153 ? -12.776 -31.451 30.927  1.00 31.39  ? 154  GLY A N   1 
ATOM   1209 C CA  . GLY A 1 153 ? -13.975 -31.064 30.205  1.00 21.38  ? 154  GLY A CA  1 
ATOM   1210 C C   . GLY A 1 153 ? -13.957 -29.592 29.872  1.00 30.35  ? 154  GLY A C   1 
ATOM   1211 O O   . GLY A 1 153 ? -12.888 -28.993 29.749  1.00 31.47  ? 154  GLY A O   1 
ATOM   1212 N N   . ALA A 1 154 ? -15.140 -28.996 29.770  1.00 29.17  ? 155  ALA A N   1 
ATOM   1213 C CA  . ALA A 1 154 ? -15.261 -27.589 29.469  1.00 28.93  ? 155  ALA A CA  1 
ATOM   1214 C C   . ALA A 1 154 ? -14.506 -26.732 30.485  1.00 31.62  ? 155  ALA A C   1 
ATOM   1215 O O   . ALA A 1 154 ? -13.900 -25.736 30.111  1.00 31.47  ? 155  ALA A O   1 
ATOM   1216 C CB  . ALA A 1 154 ? -16.757 -27.171 29.402  1.00 27.25  ? 155  ALA A CB  1 
ATOM   1217 N N   . PHE A 1 155 ? -14.527 -27.123 31.758  1.00 26.58  ? 156  PHE A N   1 
ATOM   1218 C CA  . PHE A 1 155 ? -13.879 -26.324 32.807  1.00 27.92  ? 156  PHE A CA  1 
ATOM   1219 C C   . PHE A 1 155 ? -12.389 -26.185 32.603  1.00 29.32  ? 156  PHE A C   1 
ATOM   1220 O O   . PHE A 1 155 ? -11.803 -25.171 32.995  1.00 28.49  ? 156  PHE A O   1 
ATOM   1221 C CB  . PHE A 1 155 ? -14.162 -26.938 34.179  1.00 22.38  ? 156  PHE A CB  1 
ATOM   1222 C CG  . PHE A 1 155 ? -15.591 -27.303 34.349  1.00 34.23  ? 156  PHE A CG  1 
ATOM   1223 C CD1 . PHE A 1 155 ? -16.046 -28.569 33.977  1.00 29.83  ? 156  PHE A CD1 1 
ATOM   1224 C CD2 . PHE A 1 155 ? -16.505 -26.358 34.802  1.00 28.89  ? 156  PHE A CD2 1 
ATOM   1225 C CE1 . PHE A 1 155 ? -17.388 -28.894 34.078  1.00 35.25  ? 156  PHE A CE1 1 
ATOM   1226 C CE2 . PHE A 1 155 ? -17.859 -26.691 34.922  1.00 33.81  ? 156  PHE A CE2 1 
ATOM   1227 C CZ  . PHE A 1 155 ? -18.292 -27.960 34.562  1.00 31.39  ? 156  PHE A CZ  1 
ATOM   1228 N N   . GLY A 1 156 ? -11.772 -27.198 32.000  1.00 28.01  ? 157  GLY A N   1 
ATOM   1229 C CA  . GLY A 1 156 ? -10.340 -27.168 31.761  1.00 27.85  ? 157  GLY A CA  1 
ATOM   1230 C C   . GLY A 1 156 ? -9.951  -26.727 30.357  1.00 31.34  ? 157  GLY A C   1 
ATOM   1231 O O   . GLY A 1 156 ? -8.856  -26.194 30.157  1.00 31.34  ? 157  GLY A O   1 
ATOM   1232 N N   . PHE A 1 157 ? -10.839 -26.936 29.383  1.00 28.16  ? 158  PHE A N   1 
ATOM   1233 C CA  . PHE A 1 157 ? -10.422 -26.865 27.966  1.00 25.40  ? 158  PHE A CA  1 
ATOM   1234 C C   . PHE A 1 157 ? -11.402 -26.220 27.001  1.00 28.27  ? 158  PHE A C   1 
ATOM   1235 O O   . PHE A 1 157 ? -11.174 -26.248 25.779  1.00 30.72  ? 158  PHE A O   1 
ATOM   1236 C CB  . PHE A 1 157 ? -10.059 -28.281 27.482  1.00 25.38  ? 158  PHE A CB  1 
ATOM   1237 C CG  . PHE A 1 157 ? -8.911  -28.855 28.245  1.00 33.12  ? 158  PHE A CG  1 
ATOM   1238 C CD1 . PHE A 1 157 ? -7.613  -28.426 27.978  1.00 28.87  ? 158  PHE A CD1 1 
ATOM   1239 C CD2 . PHE A 1 157 ? -9.128  -29.714 29.319  1.00 27.91  ? 158  PHE A CD2 1 
ATOM   1240 C CE1 . PHE A 1 157 ? -6.542  -28.877 28.739  1.00 29.29  ? 158  PHE A CE1 1 
ATOM   1241 C CE2 . PHE A 1 157 ? -8.052  -30.197 30.098  1.00 28.32  ? 158  PHE A CE2 1 
ATOM   1242 C CZ  . PHE A 1 157 ? -6.755  -29.783 29.809  1.00 26.72  ? 158  PHE A CZ  1 
ATOM   1243 N N   . LEU A 1 158 ? -12.473 -25.619 27.522  1.00 31.84  ? 159  LEU A N   1 
ATOM   1244 C CA  . LEU A 1 158 ? -13.331 -24.796 26.674  1.00 32.39  ? 159  LEU A CA  1 
ATOM   1245 C C   . LEU A 1 158 ? -12.508 -23.606 26.205  1.00 35.85  ? 159  LEU A C   1 
ATOM   1246 O O   . LEU A 1 158 ? -11.871 -22.963 27.019  1.00 34.17  ? 159  LEU A O   1 
ATOM   1247 C CB  . LEU A 1 158 ? -14.563 -24.297 27.416  1.00 31.48  ? 159  LEU A CB  1 
ATOM   1248 C CG  . LEU A 1 158 ? -15.525 -23.548 26.490  1.00 36.10  ? 159  LEU A CG  1 
ATOM   1249 C CD1 . LEU A 1 158 ? -16.937 -24.136 26.578  1.00 31.35  ? 159  LEU A CD1 1 
ATOM   1250 C CD2 . LEU A 1 158 ? -15.519 -22.037 26.741  1.00 29.07  ? 159  LEU A CD2 1 
ATOM   1251 N N   . ALA A 1 159 ? -12.516 -23.307 24.908  1.00 37.91  ? 160  ALA A N   1 
ATOM   1252 C CA  . ALA A 1 159 ? -11.717 -22.195 24.398  1.00 35.68  ? 160  ALA A CA  1 
ATOM   1253 C C   . ALA A 1 159 ? -12.474 -21.361 23.373  1.00 35.19  ? 160  ALA A C   1 
ATOM   1254 O O   . ALA A 1 159 ? -13.005 -21.889 22.410  1.00 36.95  ? 160  ALA A O   1 
ATOM   1255 C CB  . ALA A 1 159 ? -10.408 -22.718 23.777  1.00 32.53  ? 160  ALA A CB  1 
ATOM   1256 N N   . LEU A 1 160 ? -12.519 -20.057 23.607  1.00 36.96  ? 161  LEU A N   1 
ATOM   1257 C CA  . LEU A 1 160 ? -12.849 -19.075 22.576  1.00 39.15  ? 161  LEU A CA  1 
ATOM   1258 C C   . LEU A 1 160 ? -11.535 -18.355 22.235  1.00 39.34  ? 161  LEU A C   1 
ATOM   1259 O O   . LEU A 1 160 ? -11.189 -17.347 22.859  1.00 38.79  ? 161  LEU A O   1 
ATOM   1260 C CB  . LEU A 1 160 ? -13.924 -18.093 23.070  1.00 38.40  ? 161  LEU A CB  1 
ATOM   1261 C CG  . LEU A 1 160 ? -15.305 -18.717 23.298  1.00 44.49  ? 161  LEU A CG  1 
ATOM   1262 C CD1 . LEU A 1 160 ? -16.223 -17.768 24.054  1.00 45.55  ? 161  LEU A CD1 1 
ATOM   1263 C CD2 . LEU A 1 160 ? -15.945 -19.129 21.952  1.00 33.73  ? 161  LEU A CD2 1 
ATOM   1264 N N   . PRO A 1 161 ? -10.771 -18.905 21.278  1.00 41.02  ? 162  PRO A N   1 
ATOM   1265 C CA  . PRO A 1 161 ? -9.397  -18.424 21.063  1.00 44.05  ? 162  PRO A CA  1 
ATOM   1266 C C   . PRO A 1 161 ? -9.327  -16.919 20.792  1.00 42.94  ? 162  PRO A C   1 
ATOM   1267 O O   . PRO A 1 161 ? -10.126 -16.360 20.047  1.00 44.38  ? 162  PRO A O   1 
ATOM   1268 C CB  . PRO A 1 161 ? -8.930  -19.237 19.857  1.00 40.64  ? 162  PRO A CB  1 
ATOM   1269 C CG  . PRO A 1 161 ? -9.736  -20.530 19.957  1.00 39.25  ? 162  PRO A CG  1 
ATOM   1270 C CD  . PRO A 1 161 ? -11.091 -20.077 20.441  1.00 30.62  ? 162  PRO A CD  1 
ATOM   1271 N N   . GLY A 1 162 ? -8.395  -16.263 21.462  1.00 47.88  ? 163  GLY A N   1 
ATOM   1272 C CA  . GLY A 1 162 ? -8.280  -14.829 21.361  1.00 52.49  ? 163  GLY A CA  1 
ATOM   1273 C C   . GLY A 1 162 ? -8.949  -14.105 22.509  1.00 55.63  ? 163  GLY A C   1 
ATOM   1274 O O   . GLY A 1 162 ? -8.550  -12.991 22.829  1.00 53.75  ? 163  GLY A O   1 
ATOM   1275 N N   . SER A 1 163 ? -9.961  -14.722 23.126  1.00 51.85  ? 164  SER A N   1 
ATOM   1276 C CA  . SER A 1 163 ? -10.665 -14.082 24.246  1.00 53.30  ? 164  SER A CA  1 
ATOM   1277 C C   . SER A 1 163 ? -9.881  -14.159 25.553  1.00 50.55  ? 164  SER A C   1 
ATOM   1278 O O   . SER A 1 163 ? -9.095  -15.079 25.771  1.00 50.18  ? 164  SER A O   1 
ATOM   1279 C CB  . SER A 1 163 ? -12.041 -14.712 24.460  1.00 53.60  ? 164  SER A CB  1 
ATOM   1280 O OG  . SER A 1 163 ? -11.926 -15.927 25.174  1.00 50.79  ? 164  SER A OG  1 
ATOM   1281 N N   . ARG A 1 164 ? -10.099 -13.190 26.430  1.00 53.19  ? 165  ARG A N   1 
ATOM   1282 C CA  . ARG A 1 164 ? -9.455  -13.229 27.725  1.00 59.96  ? 165  ARG A CA  1 
ATOM   1283 C C   . ARG A 1 164 ? -10.303 -14.065 28.684  1.00 50.73  ? 165  ARG A C   1 
ATOM   1284 O O   . ARG A 1 164 ? -9.801  -14.595 29.669  1.00 54.87  ? 165  ARG A O   1 
ATOM   1285 C CB  . ARG A 1 164 ? -9.236  -11.809 28.267  1.00 70.29  ? 165  ARG A CB  1 
ATOM   1286 C CG  . ARG A 1 164 ? -8.307  -11.755 29.484  1.00 87.53  ? 165  ARG A CG  1 
ATOM   1287 C CD  . ARG A 1 164 ? -7.862  -10.331 29.854  1.00 96.25  ? 165  ARG A CD  1 
ATOM   1288 N NE  . ARG A 1 164 ? -7.208  -10.307 31.167  1.00 103.46 ? 165  ARG A NE  1 
ATOM   1289 C CZ  . ARG A 1 164 ? -6.682  -9.221  31.729  1.00 111.88 ? 165  ARG A CZ  1 
ATOM   1290 N NH1 . ARG A 1 164 ? -6.724  -8.054  31.091  1.00 112.82 ? 165  ARG A NH1 1 
ATOM   1291 N NH2 . ARG A 1 164 ? -6.112  -9.302  32.929  1.00 109.42 ? 165  ARG A NH2 1 
ATOM   1292 N N   . GLU A 1 165 ? -11.587 -14.195 28.369  1.00 48.62  ? 166  GLU A N   1 
ATOM   1293 C CA  . GLU A 1 165 ? -12.550 -14.798 29.283  1.00 50.21  ? 166  GLU A CA  1 
ATOM   1294 C C   . GLU A 1 165 ? -12.505 -16.315 29.229  1.00 46.66  ? 166  GLU A C   1 
ATOM   1295 O O   . GLU A 1 165 ? -12.858 -16.976 30.194  1.00 43.48  ? 166  GLU A O   1 
ATOM   1296 C CB  . GLU A 1 165 ? -13.968 -14.315 28.969  1.00 50.62  ? 166  GLU A CB  1 
ATOM   1297 C CG  . GLU A 1 165 ? -14.182 -12.813 29.128  1.00 56.05  ? 166  GLU A CG  1 
ATOM   1298 C CD  . GLU A 1 165 ? -13.992 -12.055 27.815  1.00 70.78  ? 166  GLU A CD  1 
ATOM   1299 O OE1 . GLU A 1 165 ? -13.525 -12.668 26.817  1.00 64.73  ? 166  GLU A OE1 1 
ATOM   1300 O OE2 . GLU A 1 165 ? -14.318 -10.843 27.779  1.00 76.76  ? 166  GLU A OE2 1 
ATOM   1301 N N   . ALA A 1 166 ? -12.086 -16.865 28.093  1.00 43.75  ? 167  ALA A N   1 
ATOM   1302 C CA  . ALA A 1 166 ? -11.897 -18.311 27.963  1.00 39.51  ? 167  ALA A CA  1 
ATOM   1303 C C   . ALA A 1 166 ? -10.783 -18.611 26.961  1.00 32.94  ? 167  ALA A C   1 
ATOM   1304 O O   . ALA A 1 166 ? -11.046 -19.024 25.828  1.00 34.95  ? 167  ALA A O   1 
ATOM   1305 C CB  . ALA A 1 166 ? -13.219 -19.002 27.547  1.00 32.80  ? 167  ALA A CB  1 
ATOM   1306 N N   . PRO A 1 167 ? -9.524  -18.417 27.384  1.00 37.04  ? 168  PRO A N   1 
ATOM   1307 C CA  . PRO A 1 167 ? -8.364  -18.580 26.496  1.00 34.13  ? 168  PRO A CA  1 
ATOM   1308 C C   . PRO A 1 167 ? -8.043  -20.032 26.114  1.00 42.62  ? 168  PRO A C   1 
ATOM   1309 O O   . PRO A 1 167 ? -7.325  -20.250 25.139  1.00 36.06  ? 168  PRO A O   1 
ATOM   1310 C CB  . PRO A 1 167 ? -7.219  -17.976 27.313  1.00 38.28  ? 168  PRO A CB  1 
ATOM   1311 C CG  . PRO A 1 167 ? -7.648  -18.200 28.754  1.00 39.74  ? 168  PRO A CG  1 
ATOM   1312 C CD  . PRO A 1 167 ? -9.134  -18.063 28.764  1.00 34.00  ? 168  PRO A CD  1 
ATOM   1313 N N   . GLY A 1 168 ? -8.554  -21.011 26.857  1.00 38.66  ? 169  GLY A N   1 
ATOM   1314 C CA  . GLY A 1 168 ? -8.244  -22.400 26.579  1.00 34.07  ? 169  GLY A CA  1 
ATOM   1315 C C   . GLY A 1 168 ? -7.010  -22.888 27.331  1.00 31.83  ? 169  GLY A C   1 
ATOM   1316 O O   . GLY A 1 168 ? -6.221  -22.090 27.837  1.00 33.70  ? 169  GLY A O   1 
ATOM   1317 N N   . ASN A 1 169 ? -6.863  -24.206 27.410  1.00 30.53  ? 170  ASN A N   1 
ATOM   1318 C CA  . ASN A 1 169 ? -5.693  -24.847 28.009  1.00 28.55  ? 170  ASN A CA  1 
ATOM   1319 C C   . ASN A 1 169 ? -5.483  -24.586 29.497  1.00 27.99  ? 170  ASN A C   1 
ATOM   1320 O O   . ASN A 1 169 ? -4.409  -24.851 30.008  1.00 32.57  ? 170  ASN A O   1 
ATOM   1321 C CB  . ASN A 1 169 ? -4.426  -24.432 27.245  1.00 26.76  ? 170  ASN A CB  1 
ATOM   1322 C CG  . ASN A 1 169 ? -4.442  -24.910 25.816  1.00 32.45  ? 170  ASN A CG  1 
ATOM   1323 O OD1 . ASN A 1 169 ? -5.056  -25.940 25.503  1.00 33.95  ? 170  ASN A OD1 1 
ATOM   1324 N ND2 . ASN A 1 169 ? -3.767  -24.183 24.936  1.00 29.79  ? 170  ASN A ND2 1 
ATOM   1325 N N   . VAL A 1 170 ? -6.502  -24.117 30.208  1.00 30.84  ? 171  VAL A N   1 
ATOM   1326 C CA  . VAL A 1 170 ? -6.300  -23.758 31.609  1.00 28.10  ? 171  VAL A CA  1 
ATOM   1327 C C   . VAL A 1 170 ? -6.112  -25.026 32.500  1.00 25.35  ? 171  VAL A C   1 
ATOM   1328 O O   . VAL A 1 170 ? -5.477  -24.978 33.549  1.00 29.15  ? 171  VAL A O   1 
ATOM   1329 C CB  . VAL A 1 170 ? -7.468  -22.833 32.110  1.00 33.31  ? 171  VAL A CB  1 
ATOM   1330 C CG1 . VAL A 1 170 ? -7.565  -21.596 31.220  1.00 27.88  ? 171  VAL A CG1 1 
ATOM   1331 C CG2 . VAL A 1 170 ? -8.827  -23.555 32.151  1.00 29.48  ? 171  VAL A CG2 1 
ATOM   1332 N N   . GLY A 1 171 ? -6.609  -26.167 32.041  1.00 25.20  ? 172  GLY A N   1 
ATOM   1333 C CA  . GLY A 1 171 ? -6.313  -27.433 32.685  1.00 23.80  ? 172  GLY A CA  1 
ATOM   1334 C C   . GLY A 1 171 ? -4.829  -27.752 32.610  1.00 26.38  ? 172  GLY A C   1 
ATOM   1335 O O   . GLY A 1 171 ? -4.242  -28.272 33.573  1.00 24.48  ? 172  GLY A O   1 
ATOM   1336 N N   . LEU A 1 172 ? -4.209  -27.462 31.469  1.00 27.77  ? 173  LEU A N   1 
ATOM   1337 C CA  . LEU A 1 172 ? -2.748  -27.613 31.381  1.00 25.24  ? 173  LEU A CA  1 
ATOM   1338 C C   . LEU A 1 172 ? -2.028  -26.605 32.288  1.00 23.78  ? 173  LEU A C   1 
ATOM   1339 O O   . LEU A 1 172 ? -1.005  -26.930 32.925  1.00 27.77  ? 173  LEU A O   1 
ATOM   1340 C CB  . LEU A 1 172 ? -2.276  -27.453 29.935  1.00 21.09  ? 173  LEU A CB  1 
ATOM   1341 C CG  . LEU A 1 172 ? -2.518  -28.646 29.030  1.00 24.16  ? 173  LEU A CG  1 
ATOM   1342 C CD1 . LEU A 1 172 ? -2.235  -28.274 27.558  1.00 20.73  ? 173  LEU A CD1 1 
ATOM   1343 C CD2 . LEU A 1 172 ? -1.641  -29.833 29.458  1.00 22.93  ? 173  LEU A CD2 1 
ATOM   1344 N N   . LEU A 1 173 ? -2.572  -25.395 32.378  1.00 22.86  ? 174  LEU A N   1 
ATOM   1345 C CA  . LEU A 1 173 ? -1.988  -24.415 33.281  1.00 26.41  ? 174  LEU A CA  1 
ATOM   1346 C C   . LEU A 1 173 ? -2.177  -24.833 34.739  1.00 28.43  ? 174  LEU A C   1 
ATOM   1347 O O   . LEU A 1 173 ? -1.308  -24.562 35.563  1.00 27.49  ? 174  LEU A O   1 
ATOM   1348 C CB  . LEU A 1 173 ? -2.569  -23.030 33.031  1.00 27.34  ? 174  LEU A CB  1 
ATOM   1349 C CG  . LEU A 1 173 ? -2.249  -22.395 31.663  1.00 33.01  ? 174  LEU A CG  1 
ATOM   1350 C CD1 . LEU A 1 173 ? -2.892  -21.013 31.547  1.00 29.22  ? 174  LEU A CD1 1 
ATOM   1351 C CD2 . LEU A 1 173 ? -0.753  -22.308 31.435  1.00 29.98  ? 174  LEU A CD2 1 
ATOM   1352 N N   . ASP A 1 174 ? -3.266  -25.542 35.050  1.00 29.24  ? 175  ASP A N   1 
ATOM   1353 C CA  . ASP A 1 174 ? -3.419  -26.124 36.385  1.00 25.75  ? 175  ASP A CA  1 
ATOM   1354 C C   . ASP A 1 174 ? -2.243  -27.046 36.649  1.00 29.10  ? 175  ASP A C   1 
ATOM   1355 O O   . ASP A 1 174 ? -1.638  -27.002 37.721  1.00 23.49  ? 175  ASP A O   1 
ATOM   1356 C CB  . ASP A 1 174 ? -4.722  -26.932 36.543  1.00 24.78  ? 175  ASP A CB  1 
ATOM   1357 C CG  . ASP A 1 174 ? -5.969  -26.076 36.436  1.00 28.87  ? 175  ASP A CG  1 
ATOM   1358 O OD1 . ASP A 1 174 ? -5.872  -24.839 36.649  1.00 29.87  ? 175  ASP A OD1 1 
ATOM   1359 O OD2 . ASP A 1 174 ? -7.056  -26.656 36.166  1.00 31.56  ? 175  ASP A OD2 1 
ATOM   1360 N N   . GLN A 1 175 ? -1.929  -27.902 35.681  1.00 25.29  ? 176  GLN A N   1 
ATOM   1361 C CA  . GLN A 1 175 ? -0.816  -28.826 35.877  1.00 33.73  ? 176  GLN A CA  1 
ATOM   1362 C C   . GLN A 1 175 ? 0.518   -28.058 36.048  1.00 28.72  ? 176  GLN A C   1 
ATOM   1363 O O   . GLN A 1 175 ? 1.361   -28.432 36.874  1.00 27.76  ? 176  GLN A O   1 
ATOM   1364 C CB  . GLN A 1 175 ? -0.713  -29.816 34.709  1.00 26.43  ? 176  GLN A CB  1 
ATOM   1365 C CG  . GLN A 1 175 ? -1.946  -30.683 34.491  1.00 27.39  ? 176  GLN A CG  1 
ATOM   1366 C CD  . GLN A 1 175 ? -1.853  -31.427 33.156  1.00 26.84  ? 176  GLN A CD  1 
ATOM   1367 O OE1 . GLN A 1 175 ? -0.804  -31.386 32.503  1.00 29.47  ? 176  GLN A OE1 1 
ATOM   1368 N NE2 . GLN A 1 175 ? -2.944  -32.086 32.736  1.00 23.60  ? 176  GLN A NE2 1 
ATOM   1369 N N   . ARG A 1 176 ? 0.690   -26.973 35.294  1.00 25.77  ? 177  ARG A N   1 
ATOM   1370 C CA  . ARG A 1 176 ? 1.945   -26.214 35.334  1.00 27.24  ? 177  ARG A CA  1 
ATOM   1371 C C   . ARG A 1 176 ? 2.105   -25.510 36.664  1.00 29.19  ? 177  ARG A C   1 
ATOM   1372 O O   . ARG A 1 176 ? 3.196   -25.470 37.232  1.00 27.04  ? 177  ARG A O   1 
ATOM   1373 C CB  . ARG A 1 176 ? 2.016   -25.191 34.201  1.00 24.78  ? 177  ARG A CB  1 
ATOM   1374 C CG  . ARG A 1 176 ? 3.239   -24.256 34.296  1.00 32.11  ? 177  ARG A CG  1 
ATOM   1375 C CD  . ARG A 1 176 ? 3.216   -23.209 33.165  1.00 26.60  ? 177  ARG A CD  1 
ATOM   1376 N NE  . ARG A 1 176 ? 3.511   -23.857 31.891  1.00 33.87  ? 177  ARG A NE  1 
ATOM   1377 C CZ  . ARG A 1 176 ? 3.365   -23.273 30.708  1.00 34.83  ? 177  ARG A CZ  1 
ATOM   1378 N NH1 . ARG A 1 176 ? 2.904   -22.024 30.629  1.00 33.95  ? 177  ARG A NH1 1 
ATOM   1379 N NH2 . ARG A 1 176 ? 3.681   -23.940 29.613  1.00 31.37  ? 177  ARG A NH2 1 
ATOM   1380 N N   . LEU A 1 177 ? 1.001   -24.971 37.162  1.00 26.17  ? 178  LEU A N   1 
ATOM   1381 C CA  . LEU A 1 177 ? 0.999   -24.315 38.454  1.00 29.49  ? 178  LEU A CA  1 
ATOM   1382 C C   . LEU A 1 177 ? 1.367   -25.312 39.551  1.00 29.47  ? 178  LEU A C   1 
ATOM   1383 O O   . LEU A 1 177 ? 2.117   -24.979 40.475  1.00 31.91  ? 178  LEU A O   1 
ATOM   1384 C CB  . LEU A 1 177 ? -0.365  -23.661 38.723  1.00 29.37  ? 178  LEU A CB  1 
ATOM   1385 C CG  . LEU A 1 177 ? -0.495  -22.934 40.064  1.00 32.73  ? 178  LEU A CG  1 
ATOM   1386 C CD1 . LEU A 1 177 ? 0.550   -21.825 40.203  1.00 27.70  ? 178  LEU A CD1 1 
ATOM   1387 C CD2 . LEU A 1 177 ? -1.897  -22.389 40.266  1.00 30.76  ? 178  LEU A CD2 1 
ATOM   1388 N N   . ALA A 1 178 ? 0.884   -26.546 39.440  1.00 29.71  ? 179  ALA A N   1 
ATOM   1389 C CA  . ALA A 1 178 ? 1.259   -27.583 40.420  1.00 29.81  ? 179  ALA A CA  1 
ATOM   1390 C C   . ALA A 1 178 ? 2.758   -27.898 40.330  1.00 25.75  ? 179  ALA A C   1 
ATOM   1391 O O   . ALA A 1 178 ? 3.410   -28.078 41.332  1.00 25.55  ? 179  ALA A O   1 
ATOM   1392 C CB  . ALA A 1 178 ? 0.422   -28.863 40.203  1.00 23.92  ? 179  ALA A CB  1 
ATOM   1393 N N   . LEU A 1 179 ? 3.298   -27.972 39.117  1.00 26.56  ? 180  LEU A N   1 
ATOM   1394 C CA  . LEU A 1 179 ? 4.745   -28.142 38.926  1.00 28.27  ? 180  LEU A CA  1 
ATOM   1395 C C   . LEU A 1 179 ? 5.569   -26.950 39.477  1.00 28.54  ? 180  LEU A C   1 
ATOM   1396 O O   . LEU A 1 179 ? 6.649   -27.150 40.004  1.00 32.89  ? 180  LEU A O   1 
ATOM   1397 C CB  . LEU A 1 179 ? 5.063   -28.352 37.440  1.00 29.16  ? 180  LEU A CB  1 
ATOM   1398 C CG  . LEU A 1 179 ? 4.438   -29.605 36.803  1.00 28.93  ? 180  LEU A CG  1 
ATOM   1399 C CD1 . LEU A 1 179 ? 4.836   -29.694 35.328  1.00 22.72  ? 180  LEU A CD1 1 
ATOM   1400 C CD2 . LEU A 1 179 ? 4.881   -30.853 37.606  1.00 23.93  ? 180  LEU A CD2 1 
ATOM   1401 N N   . GLN A 1 180 ? 5.056   -25.727 39.349  1.00 29.26  ? 181  GLN A N   1 
ATOM   1402 C CA  . GLN A 1 180 ? 5.697   -24.569 39.955  1.00 28.44  ? 181  GLN A CA  1 
ATOM   1403 C C   . GLN A 1 180 ? 5.633   -24.725 41.464  1.00 32.21  ? 181  GLN A C   1 
ATOM   1404 O O   . GLN A 1 180 ? 6.610   -24.442 42.173  1.00 34.42  ? 181  GLN A O   1 
ATOM   1405 C CB  . GLN A 1 180 ? 5.032   -23.264 39.492  1.00 28.45  ? 181  GLN A CB  1 
ATOM   1406 C CG  . GLN A 1 180 ? 5.189   -23.057 37.989  1.00 37.38  ? 181  GLN A CG  1 
ATOM   1407 C CD  . GLN A 1 180 ? 4.455   -21.816 37.450  1.00 48.19  ? 181  GLN A CD  1 
ATOM   1408 O OE1 . GLN A 1 180 ? 3.497   -21.341 38.049  1.00 50.71  ? 181  GLN A OE1 1 
ATOM   1409 N NE2 . GLN A 1 180 ? 4.919   -21.296 36.315  1.00 42.55  ? 181  GLN A NE2 1 
ATOM   1410 N N   . TRP A 1 181 ? 4.495   -25.217 41.953  1.00 28.80  ? 182  TRP A N   1 
ATOM   1411 C CA  . TRP A 1 181 ? 4.327   -25.458 43.386  1.00 29.86  ? 182  TRP A CA  1 
ATOM   1412 C C   . TRP A 1 181 ? 5.365   -26.459 43.875  1.00 29.74  ? 182  TRP A C   1 
ATOM   1413 O O   . TRP A 1 181 ? 5.895   -26.343 44.988  1.00 31.46  ? 182  TRP A O   1 
ATOM   1414 C CB  . TRP A 1 181 ? 2.903   -25.960 43.690  1.00 26.62  ? 182  TRP A CB  1 
ATOM   1415 C CG  . TRP A 1 181 ? 2.579   -26.063 45.156  1.00 27.48  ? 182  TRP A CG  1 
ATOM   1416 C CD1 . TRP A 1 181 ? 1.909   -25.133 45.910  1.00 27.02  ? 182  TRP A CD1 1 
ATOM   1417 C CD2 . TRP A 1 181 ? 2.892   -27.154 46.049  1.00 22.47  ? 182  TRP A CD2 1 
ATOM   1418 N NE1 . TRP A 1 181 ? 1.779   -25.583 47.209  1.00 28.86  ? 182  TRP A NE1 1 
ATOM   1419 C CE2 . TRP A 1 181 ? 2.374   -26.815 47.321  1.00 26.24  ? 182  TRP A CE2 1 
ATOM   1420 C CE3 . TRP A 1 181 ? 3.550   -28.380 45.896  1.00 27.08  ? 182  TRP A CE3 1 
ATOM   1421 C CZ2 . TRP A 1 181 ? 2.510   -27.652 48.437  1.00 27.89  ? 182  TRP A CZ2 1 
ATOM   1422 C CZ3 . TRP A 1 181 ? 3.685   -29.207 46.999  1.00 25.50  ? 182  TRP A CZ3 1 
ATOM   1423 C CH2 . TRP A 1 181 ? 3.172   -28.839 48.257  1.00 25.72  ? 182  TRP A CH2 1 
ATOM   1424 N N   . VAL A 1 182 ? 5.657   -27.454 43.044  1.00 27.80  ? 183  VAL A N   1 
ATOM   1425 C CA  . VAL A 1 182 ? 6.616   -28.468 43.430  1.00 29.25  ? 183  VAL A CA  1 
ATOM   1426 C C   . VAL A 1 182 ? 8.032   -27.858 43.503  1.00 34.30  ? 183  VAL A C   1 
ATOM   1427 O O   . VAL A 1 182 ? 8.758   -28.107 44.476  1.00 33.06  ? 183  VAL A O   1 
ATOM   1428 C CB  . VAL A 1 182 ? 6.578   -29.664 42.450  1.00 28.81  ? 183  VAL A CB  1 
ATOM   1429 C CG1 . VAL A 1 182 ? 7.803   -30.547 42.619  1.00 21.99  ? 183  VAL A CG1 1 
ATOM   1430 C CG2 . VAL A 1 182 ? 5.300   -30.465 42.672  1.00 22.56  ? 183  VAL A CG2 1 
ATOM   1431 N N   . GLN A 1 183 ? 8.408   -27.056 42.496  1.00 29.24  ? 184  GLN A N   1 
ATOM   1432 C CA  . GLN A 1 183 ? 9.668   -26.305 42.546  1.00 35.90  ? 184  GLN A CA  1 
ATOM   1433 C C   . GLN A 1 183 ? 9.785   -25.515 43.844  1.00 33.37  ? 184  GLN A C   1 
ATOM   1434 O O   . GLN A 1 183 ? 10.789  -25.612 44.544  1.00 35.93  ? 184  GLN A O   1 
ATOM   1435 C CB  . GLN A 1 183 ? 9.802   -25.362 41.346  1.00 29.69  ? 184  GLN A CB  1 
ATOM   1436 C CG  . GLN A 1 183 ? 10.120  -26.119 40.053  1.00 30.87  ? 184  GLN A CG  1 
ATOM   1437 C CD  . GLN A 1 183 ? 11.411  -26.926 40.188  1.00 41.24  ? 184  GLN A CD  1 
ATOM   1438 O OE1 . GLN A 1 183 ? 12.487  -26.362 40.405  1.00 46.05  ? 184  GLN A OE1 1 
ATOM   1439 N NE2 . GLN A 1 183 ? 11.305  -28.249 40.084  1.00 32.50  ? 184  GLN A NE2 1 
ATOM   1440 N N   . GLU A 1 184 ? 8.741   -24.787 44.204  1.00 29.30  ? 185  GLU A N   1 
ATOM   1441 C CA  . GLU A 1 184 ? 8.824   -23.941 45.395  1.00 33.30  ? 185  GLU A CA  1 
ATOM   1442 C C   . GLU A 1 184 ? 8.705   -24.687 46.717  1.00 36.48  ? 185  GLU A C   1 
ATOM   1443 O O   . GLU A 1 184 ? 9.263   -24.236 47.704  1.00 40.40  ? 185  GLU A O   1 
ATOM   1444 C CB  . GLU A 1 184 ? 7.770   -22.841 45.333  1.00 36.22  ? 185  GLU A CB  1 
ATOM   1445 C CG  . GLU A 1 184 ? 8.072   -21.865 44.176  1.00 52.91  ? 185  GLU A CG  1 
ATOM   1446 C CD  . GLU A 1 184 ? 7.008   -20.788 43.962  1.00 64.07  ? 185  GLU A CD  1 
ATOM   1447 O OE1 . GLU A 1 184 ? 6.944   -20.248 42.829  1.00 57.10  ? 185  GLU A OE1 1 
ATOM   1448 O OE2 . GLU A 1 184 ? 6.249   -20.476 44.914  1.00 61.03  ? 185  GLU A OE2 1 
ATOM   1449 N N   . ASN A 1 185 ? 8.032   -25.838 46.758  1.00 34.81  ? 186  ASN A N   1 
ATOM   1450 C CA  . ASN A 1 185 ? 7.693   -26.403 48.056  1.00 32.42  ? 186  ASN A CA  1 
ATOM   1451 C C   . ASN A 1 185 ? 8.107   -27.825 48.355  1.00 32.92  ? 186  ASN A C   1 
ATOM   1452 O O   . ASN A 1 185 ? 7.988   -28.263 49.507  1.00 33.97  ? 186  ASN A O   1 
ATOM   1453 C CB  . ASN A 1 185 ? 6.181   -26.305 48.262  1.00 33.49  ? 186  ASN A CB  1 
ATOM   1454 C CG  . ASN A 1 185 ? 5.703   -24.877 48.285  1.00 40.32  ? 186  ASN A CG  1 
ATOM   1455 O OD1 . ASN A 1 185 ? 6.007   -24.149 49.219  1.00 34.28  ? 186  ASN A OD1 1 
ATOM   1456 N ND2 . ASN A 1 185 ? 4.957   -24.463 47.255  1.00 31.88  ? 186  ASN A ND2 1 
ATOM   1457 N N   . VAL A 1 186 ? 8.568   -28.566 47.357  1.00 31.09  ? 187  VAL A N   1 
ATOM   1458 C CA  . VAL A 1 186 ? 8.744   -29.992 47.585  1.00 32.54  ? 187  VAL A CA  1 
ATOM   1459 C C   . VAL A 1 186 ? 9.906   -30.265 48.548  1.00 34.36  ? 187  VAL A C   1 
ATOM   1460 O O   . VAL A 1 186 ? 9.876   -31.262 49.284  1.00 33.55  ? 187  VAL A O   1 
ATOM   1461 C CB  . VAL A 1 186 ? 8.914   -30.776 46.258  1.00 29.63  ? 187  VAL A CB  1 
ATOM   1462 C CG1 . VAL A 1 186 ? 10.322  -30.611 45.635  1.00 27.72  ? 187  VAL A CG1 1 
ATOM   1463 C CG2 . VAL A 1 186 ? 8.540   -32.268 46.467  1.00 23.30  ? 187  VAL A CG2 1 
ATOM   1464 N N   . ALA A 1 187 ? 10.906  -29.377 48.578  1.00 37.72  ? 188  ALA A N   1 
ATOM   1465 C CA  . ALA A 1 187 ? 12.030  -29.539 49.515  1.00 35.01  ? 188  ALA A CA  1 
ATOM   1466 C C   . ALA A 1 187 ? 11.544  -29.583 50.960  1.00 32.93  ? 188  ALA A C   1 
ATOM   1467 O O   . ALA A 1 187 ? 12.110  -30.319 51.770  1.00 37.22  ? 188  ALA A O   1 
ATOM   1468 C CB  . ALA A 1 187 ? 13.054  -28.426 49.345  1.00 38.71  ? 188  ALA A CB  1 
ATOM   1469 N N   . ALA A 1 188 ? 10.485  -28.834 51.280  1.00 31.77  ? 189  ALA A N   1 
ATOM   1470 C CA  . ALA A 1 188 ? 9.925   -28.871 52.644  1.00 31.81  ? 189  ALA A CA  1 
ATOM   1471 C C   . ALA A 1 188 ? 9.462   -30.274 53.031  1.00 33.10  ? 189  ALA A C   1 
ATOM   1472 O O   . ALA A 1 188 ? 9.223   -30.534 54.206  1.00 34.42  ? 189  ALA A O   1 
ATOM   1473 C CB  . ALA A 1 188 ? 8.746   -27.879 52.782  1.00 31.56  ? 189  ALA A CB  1 
ATOM   1474 N N   . PHE A 1 189 ? 9.326   -31.170 52.046  1.00 37.03  ? 190  PHE A N   1 
ATOM   1475 C CA  . PHE A 1 189 ? 8.933   -32.568 52.300  1.00 36.67  ? 190  PHE A CA  1 
ATOM   1476 C C   . PHE A 1 189 ? 10.094  -33.530 52.159  1.00 33.38  ? 190  PHE A C   1 
ATOM   1477 O O   . PHE A 1 189 ? 9.925   -34.729 52.354  1.00 35.97  ? 190  PHE A O   1 
ATOM   1478 C CB  . PHE A 1 189 ? 7.801   -33.015 51.346  1.00 31.86  ? 190  PHE A CB  1 
ATOM   1479 C CG  . PHE A 1 189 ? 6.543   -32.180 51.451  1.00 31.53  ? 190  PHE A CG  1 
ATOM   1480 C CD1 . PHE A 1 189 ? 6.411   -30.999 50.721  1.00 26.71  ? 190  PHE A CD1 1 
ATOM   1481 C CD2 . PHE A 1 189 ? 5.497   -32.583 52.258  1.00 30.42  ? 190  PHE A CD2 1 
ATOM   1482 C CE1 . PHE A 1 189 ? 5.277   -30.242 50.806  1.00 32.12  ? 190  PHE A CE1 1 
ATOM   1483 C CE2 . PHE A 1 189 ? 4.336   -31.809 52.362  1.00 30.57  ? 190  PHE A CE2 1 
ATOM   1484 C CZ  . PHE A 1 189 ? 4.228   -30.638 51.633  1.00 33.11  ? 190  PHE A CZ  1 
ATOM   1485 N N   . GLY A 1 190 ? 11.269  -33.017 51.793  1.00 35.57  ? 191  GLY A N   1 
ATOM   1486 C CA  . GLY A 1 190 ? 12.437  -33.862 51.594  1.00 30.96  ? 191  GLY A CA  1 
ATOM   1487 C C   . GLY A 1 190 ? 12.655  -34.180 50.118  1.00 34.97  ? 191  GLY A C   1 
ATOM   1488 O O   . GLY A 1 190 ? 13.522  -34.989 49.733  1.00 32.03  ? 191  GLY A O   1 
ATOM   1489 N N   . GLY A 1 191 ? 11.873  -33.520 49.271  1.00 30.88  ? 192  GLY A N   1 
ATOM   1490 C CA  . GLY A 1 191 ? 11.964  -33.775 47.848  1.00 34.58  ? 192  GLY A CA  1 
ATOM   1491 C C   . GLY A 1 191 ? 13.014  -32.893 47.237  1.00 41.07  ? 192  GLY A C   1 
ATOM   1492 O O   . GLY A 1 191 ? 13.286  -31.805 47.726  1.00 41.24  ? 192  GLY A O   1 
ATOM   1493 N N   . ASP A 1 192 ? 13.596  -33.372 46.154  1.00 32.58  ? 193  ASP A N   1 
ATOM   1494 C CA  . ASP A 1 192 ? 14.585  -32.628 45.436  1.00 29.20  ? 193  ASP A CA  1 
ATOM   1495 C C   . ASP A 1 192 ? 14.002  -31.974 44.193  1.00 33.16  ? 193  ASP A C   1 
ATOM   1496 O O   . ASP A 1 192 ? 13.741  -32.646 43.204  1.00 36.25  ? 193  ASP A O   1 
ATOM   1497 C CB  . ASP A 1 192 ? 15.718  -33.568 45.075  1.00 33.72  ? 193  ASP A CB  1 
ATOM   1498 C CG  . ASP A 1 192 ? 16.805  -32.911 44.268  1.00 34.72  ? 193  ASP A CG  1 
ATOM   1499 O OD1 . ASP A 1 192 ? 16.763  -31.685 43.969  1.00 41.42  ? 193  ASP A OD1 1 
ATOM   1500 O OD2 . ASP A 1 192 ? 17.719  -33.660 43.918  1.00 40.69  ? 193  ASP A OD2 1 
ATOM   1501 N N   . PRO A 1 193 ? 13.855  -30.647 44.215  1.00 34.25  ? 194  PRO A N   1 
ATOM   1502 C CA  . PRO A 1 193 ? 13.283  -29.940 43.066  1.00 32.21  ? 194  PRO A CA  1 
ATOM   1503 C C   . PRO A 1 193 ? 14.157  -29.970 41.824  1.00 36.43  ? 194  PRO A C   1 
ATOM   1504 O O   . PRO A 1 193 ? 13.651  -29.637 40.741  1.00 30.98  ? 194  PRO A O   1 
ATOM   1505 C CB  . PRO A 1 193 ? 13.126  -28.498 43.570  1.00 35.49  ? 194  PRO A CB  1 
ATOM   1506 C CG  . PRO A 1 193 ? 14.096  -28.382 44.716  1.00 35.24  ? 194  PRO A CG  1 
ATOM   1507 C CD  . PRO A 1 193 ? 14.187  -29.745 45.337  1.00 35.77  ? 194  PRO A CD  1 
ATOM   1508 N N   . THR A 1 194 ? 15.421  -30.372 41.958  1.00 34.98  ? 195  THR A N   1 
ATOM   1509 C CA  . THR A 1 194 ? 16.305  -30.493 40.790  1.00 37.85  ? 195  THR A CA  1 
ATOM   1510 C C   . THR A 1 194 ? 16.256  -31.890 40.135  1.00 40.96  ? 195  THR A C   1 
ATOM   1511 O O   . THR A 1 194 ? 16.908  -32.121 39.120  1.00 35.29  ? 195  THR A O   1 
ATOM   1512 C CB  . THR A 1 194 ? 17.783  -30.190 41.148  1.00 45.17  ? 195  THR A CB  1 
ATOM   1513 O OG1 . THR A 1 194 ? 18.311  -31.266 41.935  1.00 39.07  ? 195  THR A OG1 1 
ATOM   1514 C CG2 . THR A 1 194 ? 17.923  -28.829 41.904  1.00 35.00  ? 195  THR A CG2 1 
ATOM   1515 N N   . SER A 1 195 ? 15.503  -32.819 40.723  1.00 34.37  ? 196  SER A N   1 
ATOM   1516 C CA  . SER A 1 195 ? 15.260  -34.133 40.103  1.00 35.59  ? 196  SER A CA  1 
ATOM   1517 C C   . SER A 1 195 ? 13.754  -34.487 40.067  1.00 35.41  ? 196  SER A C   1 
ATOM   1518 O O   . SER A 1 195 ? 13.228  -35.185 40.942  1.00 30.56  ? 196  SER A O   1 
ATOM   1519 C CB  . SER A 1 195 ? 16.025  -35.221 40.857  1.00 42.46  ? 196  SER A CB  1 
ATOM   1520 O OG  . SER A 1 195 ? 15.826  -36.490 40.241  1.00 43.93  ? 196  SER A OG  1 
ATOM   1521 N N   . VAL A 1 196 ? 13.052  -33.967 39.076  1.00 29.07  ? 197  VAL A N   1 
ATOM   1522 C CA  . VAL A 1 196 ? 11.618  -34.181 38.981  1.00 27.61  ? 197  VAL A CA  1 
ATOM   1523 C C   . VAL A 1 196 ? 11.288  -34.947 37.696  1.00 33.55  ? 197  VAL A C   1 
ATOM   1524 O O   . VAL A 1 196 ? 11.613  -34.502 36.584  1.00 25.88  ? 197  VAL A O   1 
ATOM   1525 C CB  . VAL A 1 196 ? 10.854  -32.834 39.023  1.00 33.89  ? 197  VAL A CB  1 
ATOM   1526 C CG1 . VAL A 1 196 ? 9.334   -33.035 38.781  1.00 28.01  ? 197  VAL A CG1 1 
ATOM   1527 C CG2 . VAL A 1 196 ? 11.111  -32.125 40.353  1.00 29.82  ? 197  VAL A CG2 1 
ATOM   1528 N N   . THR A 1 197 ? 10.658  -36.109 37.859  1.00 34.58  ? 198  THR A N   1 
ATOM   1529 C CA  . THR A 1 197 ? 10.232  -36.931 36.727  1.00 29.66  ? 198  THR A CA  1 
ATOM   1530 C C   . THR A 1 197 ? 8.706   -36.898 36.620  1.00 30.72  ? 198  THR A C   1 
ATOM   1531 O O   . THR A 1 197 ? 7.997   -37.261 37.568  1.00 29.59  ? 198  THR A O   1 
ATOM   1532 C CB  . THR A 1 197 ? 10.724  -38.382 36.872  1.00 31.37  ? 198  THR A CB  1 
ATOM   1533 O OG1 . THR A 1 197 ? 12.158  -38.384 36.994  1.00 31.44  ? 198  THR A OG1 1 
ATOM   1534 C CG2 . THR A 1 197 ? 10.325  -39.256 35.641  1.00 23.69  ? 198  THR A CG2 1 
ATOM   1535 N N   . LEU A 1 198 ? 8.206   -36.395 35.494  1.00 29.68  ? 199  LEU A N   1 
ATOM   1536 C CA  . LEU A 1 198 ? 6.783   -36.440 35.169  1.00 28.89  ? 199  LEU A CA  1 
ATOM   1537 C C   . LEU A 1 198 ? 6.402   -37.812 34.617  1.00 29.76  ? 199  LEU A C   1 
ATOM   1538 O O   . LEU A 1 198 ? 7.084   -38.316 33.727  1.00 30.76  ? 199  LEU A O   1 
ATOM   1539 C CB  . LEU A 1 198 ? 6.436   -35.405 34.106  1.00 32.87  ? 199  LEU A CB  1 
ATOM   1540 C CG  . LEU A 1 198 ? 6.622   -33.922 34.346  1.00 36.08  ? 199  LEU A CG  1 
ATOM   1541 C CD1 . LEU A 1 198 ? 5.921   -33.134 33.240  1.00 27.75  ? 199  LEU A CD1 1 
ATOM   1542 C CD2 . LEU A 1 198 ? 6.063   -33.563 35.707  1.00 35.51  ? 199  LEU A CD2 1 
ATOM   1543 N N   . PHE A 1 199 ? 5.319   -38.410 35.101  1.00 25.05  ? 200  PHE A N   1 
ATOM   1544 C CA  . PHE A 1 199 ? 4.805   -39.599 34.435  1.00 25.13  ? 200  PHE A CA  1 
ATOM   1545 C C   . PHE A 1 199 ? 3.295   -39.481 34.385  1.00 28.55  ? 200  PHE A C   1 
ATOM   1546 O O   . PHE A 1 199 ? 2.696   -38.798 35.204  1.00 28.76  ? 200  PHE A O   1 
ATOM   1547 C CB  . PHE A 1 199 ? 5.301   -40.931 35.066  1.00 23.32  ? 200  PHE A CB  1 
ATOM   1548 C CG  . PHE A 1 199 ? 4.815   -41.251 36.483  1.00 27.44  ? 200  PHE A CG  1 
ATOM   1549 C CD1 . PHE A 1 199 ? 4.809   -40.306 37.497  1.00 28.38  ? 200  PHE A CD1 1 
ATOM   1550 C CD2 . PHE A 1 199 ? 4.474   -42.569 36.800  1.00 24.82  ? 200  PHE A CD2 1 
ATOM   1551 C CE1 . PHE A 1 199 ? 4.411   -40.645 38.796  1.00 28.68  ? 200  PHE A CE1 1 
ATOM   1552 C CE2 . PHE A 1 199 ? 4.077   -42.923 38.100  1.00 33.24  ? 200  PHE A CE2 1 
ATOM   1553 C CZ  . PHE A 1 199 ? 4.042   -41.961 39.098  1.00 30.35  ? 200  PHE A CZ  1 
ATOM   1554 N N   . GLY A 1 200 ? 2.701   -40.082 33.360  1.00 25.31  ? 201  GLY A N   1 
ATOM   1555 C CA  . GLY A 1 200 ? 1.279   -39.937 33.098  1.00 26.71  ? 201  GLY A CA  1 
ATOM   1556 C C   . GLY A 1 200 ? 0.835   -40.997 32.110  1.00 28.45  ? 201  GLY A C   1 
ATOM   1557 O O   . GLY A 1 200 ? 1.652   -41.551 31.381  1.00 26.99  ? 201  GLY A O   1 
ATOM   1558 N N   . GLU A 1 201 ? -0.462  -41.289 32.106  1.00 29.73  ? 202  GLU A N   1 
ATOM   1559 C CA  . GLU A 1 201 ? -1.015  -42.343 31.272  1.00 27.86  ? 202  GLU A CA  1 
ATOM   1560 C C   . GLU A 1 201 ? -2.136  -41.743 30.420  1.00 30.09  ? 202  GLU A C   1 
ATOM   1561 O O   . GLU A 1 201 ? -2.891  -40.896 30.883  1.00 26.53  ? 202  GLU A O   1 
ATOM   1562 C CB  . GLU A 1 201 ? -1.495  -43.518 32.139  1.00 30.00  ? 202  GLU A CB  1 
ATOM   1563 C CG  . GLU A 1 201 ? -1.821  -44.801 31.367  1.00 31.59  ? 202  GLU A CG  1 
ATOM   1564 C CD  . GLU A 1 201 ? -3.279  -44.845 30.936  1.00 34.94  ? 202  GLU A CD  1 
ATOM   1565 O OE1 . GLU A 1 201 ? -4.052  -43.962 31.379  1.00 29.42  ? 202  GLU A OE1 1 
ATOM   1566 O OE2 . GLU A 1 201 ? -3.645  -45.754 30.157  1.00 35.88  ? 202  GLU A OE2 1 
ATOM   1567 N N   . SER A 1 202 ? -2.178  -42.129 29.146  1.00 31.94  ? 203  SER A N   1 
ATOM   1568 C CA  . SER A 1 202 ? -3.181  -41.650 28.198  1.00 32.20  ? 203  SER A CA  1 
ATOM   1569 C C   . SER A 1 202 ? -3.176  -40.114 28.037  1.00 28.17  ? 203  SER A C   1 
ATOM   1570 O O   . SER A 1 202 ? -2.176  -39.560 27.588  1.00 30.16  ? 203  SER A O   1 
ATOM   1571 C CB  . SER A 1 202 ? -4.572  -42.176 28.599  1.00 39.41  ? 203  SER A CB  1 
ATOM   1572 O OG  . SER A 1 202 ? -5.414  -42.235 27.449  1.00 45.83  ? 203  SER A OG  1 
ATOM   1573 N N   . ALA A 1 203 ? -4.276  -39.430 28.356  1.00 26.63  ? 204  ALA A N   1 
ATOM   1574 C CA  . ALA A 1 203 ? -4.301  -37.962 28.328  1.00 25.96  ? 204  ALA A CA  1 
ATOM   1575 C C   . ALA A 1 203 ? -3.267  -37.371 29.289  1.00 25.55  ? 204  ALA A C   1 
ATOM   1576 O O   . ALA A 1 203 ? -2.803  -36.239 29.103  1.00 24.14  ? 204  ALA A O   1 
ATOM   1577 C CB  . ALA A 1 203 ? -5.685  -37.441 28.678  1.00 22.78  ? 204  ALA A CB  1 
ATOM   1578 N N   . GLY A 1 204 ? -2.957  -38.134 30.342  1.00 25.90  ? 205  GLY A N   1 
ATOM   1579 C CA  . GLY A 1 204 ? -1.877  -37.804 31.260  1.00 26.74  ? 205  GLY A CA  1 
ATOM   1580 C C   . GLY A 1 204 ? -0.527  -37.839 30.534  1.00 26.05  ? 205  GLY A C   1 
ATOM   1581 O O   . GLY A 1 204 ? 0.309   -36.946 30.709  1.00 25.35  ? 205  GLY A O   1 
ATOM   1582 N N   . ALA A 1 205 ? -0.319  -38.866 29.712  1.00 27.61  ? 206  ALA A N   1 
ATOM   1583 C CA  . ALA A 1 205 ? 0.890   -38.948 28.885  1.00 30.00  ? 206  ALA A CA  1 
ATOM   1584 C C   . ALA A 1 205 ? 0.927   -37.832 27.848  1.00 29.93  ? 206  ALA A C   1 
ATOM   1585 O O   . ALA A 1 205 ? 1.976   -37.224 27.612  1.00 26.96  ? 206  ALA A O   1 
ATOM   1586 C CB  . ALA A 1 205 ? 0.983   -40.297 28.208  1.00 25.99  ? 206  ALA A CB  1 
ATOM   1587 N N   . ALA A 1 206 ? -0.215  -37.563 27.222  1.00 27.27  ? 207  ALA A N   1 
ATOM   1588 C CA  . ALA A 1 206 ? -0.301  -36.462 26.261  1.00 30.69  ? 207  ALA A CA  1 
ATOM   1589 C C   . ALA A 1 206 ? 0.081   -35.133 26.941  1.00 29.01  ? 207  ALA A C   1 
ATOM   1590 O O   . ALA A 1 206 ? 0.792   -34.297 26.359  1.00 29.73  ? 207  ALA A O   1 
ATOM   1591 C CB  . ALA A 1 206 ? -1.718  -36.379 25.642  1.00 24.72  ? 207  ALA A CB  1 
ATOM   1592 N N   . SER A 1 207 ? -0.391  -34.953 28.171  1.00 29.34  ? 208  SER A N   1 
ATOM   1593 C CA  . SER A 1 207 ? -0.063  -33.785 28.969  1.00 27.61  ? 208  SER A CA  1 
ATOM   1594 C C   . SER A 1 207 ? 1.443   -33.692 29.230  1.00 27.27  ? 208  SER A C   1 
ATOM   1595 O O   . SER A 1 207 ? 2.037   -32.646 29.049  1.00 24.99  ? 208  SER A O   1 
ATOM   1596 C CB  . SER A 1 207 ? -0.800  -33.824 30.310  1.00 25.76  ? 208  SER A CB  1 
ATOM   1597 O OG  . SER A 1 207 ? -2.193  -33.650 30.164  1.00 25.45  ? 208  SER A OG  1 
ATOM   1598 N N   . VAL A 1 208 ? 2.048   -34.788 29.681  1.00 24.38  ? 209  VAL A N   1 
ATOM   1599 C CA  . VAL A 1 208 ? 3.488   -34.820 29.886  1.00 25.03  ? 209  VAL A CA  1 
ATOM   1600 C C   . VAL A 1 208 ? 4.203   -34.349 28.603  1.00 29.04  ? 209  VAL A C   1 
ATOM   1601 O O   . VAL A 1 208 ? 5.015   -33.431 28.650  1.00 29.60  ? 209  VAL A O   1 
ATOM   1602 C CB  . VAL A 1 208 ? 3.974   -36.226 30.308  1.00 26.69  ? 209  VAL A CB  1 
ATOM   1603 C CG1 . VAL A 1 208 ? 5.482   -36.286 30.293  1.00 25.83  ? 209  VAL A CG1 1 
ATOM   1604 C CG2 . VAL A 1 208 ? 3.445   -36.578 31.715  1.00 25.34  ? 209  VAL A CG2 1 
ATOM   1605 N N   . GLY A 1 209 ? 3.847   -34.938 27.463  1.00 29.54  ? 210  GLY A N   1 
ATOM   1606 C CA  . GLY A 1 209 ? 4.350   -34.531 26.159  1.00 24.91  ? 210  GLY A CA  1 
ATOM   1607 C C   . GLY A 1 209 ? 4.165   -33.051 25.876  1.00 28.71  ? 210  GLY A C   1 
ATOM   1608 O O   . GLY A 1 209 ? 5.041   -32.400 25.322  1.00 31.64  ? 210  GLY A O   1 
ATOM   1609 N N   . MET A 1 210 ? 3.032   -32.492 26.286  1.00 29.04  ? 211  MET A N   1 
ATOM   1610 C CA  . MET A 1 210 ? 2.794   -31.085 26.015  1.00 27.18  ? 211  MET A CA  1 
ATOM   1611 C C   . MET A 1 210 ? 3.664   -30.176 26.862  1.00 34.58  ? 211  MET A C   1 
ATOM   1612 O O   . MET A 1 210 ? 4.088   -29.133 26.373  1.00 30.23  ? 211  MET A O   1 
ATOM   1613 C CB  . MET A 1 210 ? 1.314   -30.748 26.197  1.00 27.07  ? 211  MET A CB  1 
ATOM   1614 C CG  . MET A 1 210 ? 0.500   -31.250 24.974  1.00 32.60  ? 211  MET A CG  1 
ATOM   1615 S SD  . MET A 1 210 ? -1.258  -31.095 25.234  1.00 36.81  ? 211  MET A SD  1 
ATOM   1616 C CE  . MET A 1 210 ? -1.929  -32.409 24.145  1.00 29.88  ? 211  MET A CE  1 
ATOM   1617 N N   . HIS A 1 211 ? 3.945   -30.574 28.106  1.00 25.42  ? 212  HIS A N   1 
ATOM   1618 C CA  . HIS A 1 211 ? 4.881   -29.846 28.934  1.00 32.98  ? 212  HIS A CA  1 
ATOM   1619 C C   . HIS A 1 211 ? 6.305   -29.914 28.349  1.00 31.31  ? 212  HIS A C   1 
ATOM   1620 O O   . HIS A 1 211 ? 7.038   -28.932 28.416  1.00 28.73  ? 212  HIS A O   1 
ATOM   1621 C CB  . HIS A 1 211 ? 4.842   -30.370 30.390  1.00 25.70  ? 212  HIS A CB  1 
ATOM   1622 C CG  . HIS A 1 211 ? 3.556   -30.060 31.094  1.00 25.71  ? 212  HIS A CG  1 
ATOM   1623 N ND1 . HIS A 1 211 ? 3.143   -28.769 31.359  1.00 23.69  ? 212  HIS A ND1 1 
ATOM   1624 C CD2 . HIS A 1 211 ? 2.578   -30.872 31.565  1.00 28.03  ? 212  HIS A CD2 1 
ATOM   1625 C CE1 . HIS A 1 211 ? 1.975   -28.802 31.975  1.00 22.87  ? 212  HIS A CE1 1 
ATOM   1626 N NE2 . HIS A 1 211 ? 1.609   -30.066 32.108  1.00 24.14  ? 212  HIS A NE2 1 
ATOM   1627 N N   . LEU A 1 212 ? 6.683   -31.059 27.782  1.00 27.27  ? 213  LEU A N   1 
ATOM   1628 C CA  . LEU A 1 212 ? 7.937   -31.185 27.035  1.00 35.24  ? 213  LEU A CA  1 
ATOM   1629 C C   . LEU A 1 212 ? 8.063   -30.136 25.926  1.00 40.51  ? 213  LEU A C   1 
ATOM   1630 O O   . LEU A 1 212 ? 9.148   -29.605 25.684  1.00 38.83  ? 213  LEU A O   1 
ATOM   1631 C CB  . LEU A 1 212 ? 8.061   -32.575 26.390  1.00 33.34  ? 213  LEU A CB  1 
ATOM   1632 C CG  . LEU A 1 212 ? 8.597   -33.646 27.318  1.00 39.78  ? 213  LEU A CG  1 
ATOM   1633 C CD1 . LEU A 1 212 ? 8.542   -34.981 26.608  1.00 37.02  ? 213  LEU A CD1 1 
ATOM   1634 C CD2 . LEU A 1 212 ? 10.027  -33.309 27.773  1.00 41.21  ? 213  LEU A CD2 1 
ATOM   1635 N N   . LEU A 1 213 ? 6.944   -29.862 25.255  1.00 33.76  ? 214  LEU A N   1 
ATOM   1636 C CA  . LEU A 1 213 ? 6.931   -29.053 24.040  1.00 31.48  ? 214  LEU A CA  1 
ATOM   1637 C C   . LEU A 1 213 ? 6.566   -27.604 24.318  1.00 33.78  ? 214  LEU A C   1 
ATOM   1638 O O   . LEU A 1 213 ? 6.429   -26.796 23.391  1.00 36.40  ? 214  LEU A O   1 
ATOM   1639 C CB  . LEU A 1 213 ? 5.955   -29.648 23.022  1.00 24.31  ? 214  LEU A CB  1 
ATOM   1640 C CG  . LEU A 1 213 ? 6.269   -31.087 22.600  1.00 32.52  ? 214  LEU A CG  1 
ATOM   1641 C CD1 . LEU A 1 213 ? 5.170   -31.633 21.711  1.00 28.83  ? 214  LEU A CD1 1 
ATOM   1642 C CD2 . LEU A 1 213 ? 7.625   -31.181 21.856  1.00 35.33  ? 214  LEU A CD2 1 
ATOM   1643 N N   . SER A 1 214 ? 6.414   -27.262 25.591  1.00 31.42  ? 215  SER A N   1 
ATOM   1644 C CA  . SER A 1 214 ? 6.057   -25.889 25.953  1.00 31.12  ? 215  SER A CA  1 
ATOM   1645 C C   . SER A 1 214 ? 7.127   -25.284 26.860  1.00 36.59  ? 215  SER A C   1 
ATOM   1646 O O   . SER A 1 214 ? 7.255   -25.689 28.033  1.00 34.38  ? 215  SER A O   1 
ATOM   1647 C CB  . SER A 1 214 ? 4.686   -25.863 26.636  1.00 33.08  ? 215  SER A CB  1 
ATOM   1648 O OG  . SER A 1 214 ? 4.288   -24.534 26.912  1.00 34.05  ? 215  SER A OG  1 
ATOM   1649 N N   . PRO A 1 215 ? 7.925   -24.335 26.321  1.00 36.89  ? 216  PRO A N   1 
ATOM   1650 C CA  . PRO A 1 215 ? 9.118   -23.855 27.059  1.00 38.03  ? 216  PRO A CA  1 
ATOM   1651 C C   . PRO A 1 215 ? 8.889   -23.420 28.518  1.00 34.71  ? 216  PRO A C   1 
ATOM   1652 O O   . PRO A 1 215 ? 9.681   -23.806 29.373  1.00 35.02  ? 216  PRO A O   1 
ATOM   1653 C CB  . PRO A 1 215 ? 9.610   -22.689 26.192  1.00 38.45  ? 216  PRO A CB  1 
ATOM   1654 C CG  . PRO A 1 215 ? 9.299   -23.192 24.760  1.00 36.03  ? 216  PRO A CG  1 
ATOM   1655 C CD  . PRO A 1 215 ? 7.920   -23.861 24.918  1.00 37.52  ? 216  PRO A CD  1 
ATOM   1656 N N   . PRO A 1 216 ? 7.807   -22.689 28.827  1.00 33.89  ? 217  PRO A N   1 
ATOM   1657 C CA  . PRO A 1 216 ? 7.619   -22.369 30.256  1.00 32.21  ? 217  PRO A CA  1 
ATOM   1658 C C   . PRO A 1 216 ? 7.437   -23.574 31.195  1.00 34.25  ? 217  PRO A C   1 
ATOM   1659 O O   . PRO A 1 216 ? 7.596   -23.389 32.407  1.00 33.08  ? 217  PRO A O   1 
ATOM   1660 C CB  . PRO A 1 216 ? 6.338   -21.533 30.265  1.00 32.91  ? 217  PRO A CB  1 
ATOM   1661 C CG  . PRO A 1 216 ? 6.208   -21.019 28.860  1.00 35.01  ? 217  PRO A CG  1 
ATOM   1662 C CD  . PRO A 1 216 ? 6.798   -22.047 27.973  1.00 28.41  ? 217  PRO A CD  1 
ATOM   1663 N N   . SER A 1 217 ? 7.076   -24.752 30.679  1.00 29.49  ? 218  SER A N   1 
ATOM   1664 C CA  . SER A 1 217 ? 6.964   -25.953 31.531  1.00 32.95  ? 218  SER A CA  1 
ATOM   1665 C C   . SER A 1 217 ? 8.296   -26.689 31.645  1.00 38.29  ? 218  SER A C   1 
ATOM   1666 O O   . SER A 1 217 ? 8.522   -27.442 32.588  1.00 34.07  ? 218  SER A O   1 
ATOM   1667 C CB  . SER A 1 217 ? 5.909   -26.939 30.991  1.00 27.01  ? 218  SER A CB  1 
ATOM   1668 O OG  . SER A 1 217 ? 4.580   -26.457 31.159  1.00 30.91  ? 218  SER A OG  1 
ATOM   1669 N N   . ARG A 1 218 ? 9.164   -26.477 30.662  1.00 33.39  ? 219  ARG A N   1 
ATOM   1670 C CA  . ARG A 1 218 ? 10.290  -27.354 30.455  1.00 37.43  ? 219  ARG A CA  1 
ATOM   1671 C C   . ARG A 1 218 ? 11.326  -27.154 31.572  1.00 39.69  ? 219  ARG A C   1 
ATOM   1672 O O   . ARG A 1 218 ? 12.061  -28.072 31.929  1.00 39.68  ? 219  ARG A O   1 
ATOM   1673 C CB  . ARG A 1 218 ? 10.846  -27.117 29.035  1.00 46.01  ? 219  ARG A CB  1 
ATOM   1674 C CG  . ARG A 1 218 ? 11.848  -28.134 28.500  1.00 55.77  ? 219  ARG A CG  1 
ATOM   1675 C CD  . ARG A 1 218 ? 11.385  -29.573 28.569  1.00 47.58  ? 219  ARG A CD  1 
ATOM   1676 N NE  . ARG A 1 218 ? 12.526  -30.501 28.521  1.00 54.11  ? 219  ARG A NE  1 
ATOM   1677 C CZ  . ARG A 1 218 ? 13.196  -30.955 29.590  1.00 57.49  ? 219  ARG A CZ  1 
ATOM   1678 N NH1 . ARG A 1 218 ? 12.857  -30.582 30.821  1.00 39.41  ? 219  ARG A NH1 1 
ATOM   1679 N NH2 . ARG A 1 218 ? 14.215  -31.793 29.430  1.00 53.43  ? 219  ARG A NH2 1 
ATOM   1680 N N   . GLY A 1 219 ? 11.339  -25.976 32.184  1.00 38.01  ? 220  GLY A N   1 
ATOM   1681 C CA  . GLY A 1 219 ? 12.234  -25.763 33.297  1.00 32.42  ? 220  GLY A CA  1 
ATOM   1682 C C   . GLY A 1 219 ? 11.688  -26.286 34.607  1.00 44.70  ? 220  GLY A C   1 
ATOM   1683 O O   . GLY A 1 219 ? 12.307  -26.093 35.647  1.00 44.19  ? 220  GLY A O   1 
ATOM   1684 N N   . LEU A 1 220 ? 10.538  -26.965 34.578  1.00 38.61  ? 221  LEU A N   1 
ATOM   1685 C CA  . LEU A 1 220 ? 9.922   -27.410 35.829  1.00 34.04  ? 221  LEU A CA  1 
ATOM   1686 C C   . LEU A 1 220 ? 10.130  -28.895 36.086  1.00 32.83  ? 221  LEU A C   1 
ATOM   1687 O O   . LEU A 1 220 ? 9.668   -29.422 37.091  1.00 34.97  ? 221  LEU A O   1 
ATOM   1688 C CB  . LEU A 1 220 ? 8.419   -27.079 35.834  1.00 32.39  ? 221  LEU A CB  1 
ATOM   1689 C CG  . LEU A 1 220 ? 8.080   -25.604 35.584  1.00 38.60  ? 221  LEU A CG  1 
ATOM   1690 C CD1 . LEU A 1 220 ? 6.568   -25.381 35.454  1.00 28.46  ? 221  LEU A CD1 1 
ATOM   1691 C CD2 . LEU A 1 220 ? 8.656   -24.722 36.695  1.00 31.48  ? 221  LEU A CD2 1 
ATOM   1692 N N   . PHE A 1 221 ? 10.810  -29.583 35.184  1.00 31.17  ? 222  PHE A N   1 
ATOM   1693 C CA  . PHE A 1 221 ? 11.064  -31.004 35.400  1.00 31.47  ? 222  PHE A CA  1 
ATOM   1694 C C   . PHE A 1 221 ? 12.261  -31.429 34.580  1.00 33.34  ? 222  PHE A C   1 
ATOM   1695 O O   . PHE A 1 221 ? 12.775  -30.646 33.788  1.00 33.78  ? 222  PHE A O   1 
ATOM   1696 C CB  . PHE A 1 221 ? 9.831   -31.864 35.040  1.00 28.47  ? 222  PHE A CB  1 
ATOM   1697 C CG  . PHE A 1 221 ? 9.433   -31.804 33.579  1.00 27.39  ? 222  PHE A CG  1 
ATOM   1698 C CD1 . PHE A 1 221 ? 8.768   -30.698 33.072  1.00 30.51  ? 222  PHE A CD1 1 
ATOM   1699 C CD2 . PHE A 1 221 ? 9.699   -32.870 32.729  1.00 31.50  ? 222  PHE A CD2 1 
ATOM   1700 C CE1 . PHE A 1 221 ? 8.385   -30.649 31.748  1.00 30.77  ? 222  PHE A CE1 1 
ATOM   1701 C CE2 . PHE A 1 221 ? 9.303   -32.833 31.376  1.00 28.35  ? 222  PHE A CE2 1 
ATOM   1702 C CZ  . PHE A 1 221 ? 8.660   -31.724 30.892  1.00 32.75  ? 222  PHE A CZ  1 
ATOM   1703 N N   . HIS A 1 222 ? 12.678  -32.678 34.743  1.00 29.83  ? 223  HIS A N   1 
ATOM   1704 C CA  . HIS A 1 222 ? 13.928  -33.118 34.157  1.00 39.01  ? 223  HIS A CA  1 
ATOM   1705 C C   . HIS A 1 222 ? 13.786  -34.337 33.277  1.00 34.66  ? 223  HIS A C   1 
ATOM   1706 O O   . HIS A 1 222 ? 14.524  -34.480 32.326  1.00 39.41  ? 223  HIS A O   1 
ATOM   1707 C CB  . HIS A 1 222 ? 14.932  -33.346 35.292  1.00 34.46  ? 223  HIS A CB  1 
ATOM   1708 C CG  . HIS A 1 222 ? 14.999  -32.164 36.201  1.00 46.51  ? 223  HIS A CG  1 
ATOM   1709 N ND1 . HIS A 1 222 ? 14.179  -32.028 37.306  1.00 38.70  ? 223  HIS A ND1 1 
ATOM   1710 C CD2 . HIS A 1 222 ? 15.673  -30.995 36.085  1.00 42.72  ? 223  HIS A CD2 1 
ATOM   1711 C CE1 . HIS A 1 222 ? 14.387  -30.847 37.860  1.00 41.53  ? 223  HIS A CE1 1 
ATOM   1712 N NE2 . HIS A 1 222 ? 15.292  -30.202 37.140  1.00 40.31  ? 223  HIS A NE2 1 
ATOM   1713 N N   . ARG A 1 223 ? 12.837  -35.210 33.583  1.00 31.93  ? 224  ARG A N   1 
ATOM   1714 C CA  . ARG A 1 223 ? 12.643  -36.419 32.792  1.00 33.70  ? 224  ARG A CA  1 
ATOM   1715 C C   . ARG A 1 223 ? 11.162  -36.679 32.627  1.00 28.26  ? 224  ARG A C   1 
ATOM   1716 O O   . ARG A 1 223 ? 10.353  -36.114 33.352  1.00 28.90  ? 224  ARG A O   1 
ATOM   1717 C CB  . ARG A 1 223 ? 13.286  -37.622 33.455  1.00 34.08  ? 224  ARG A CB  1 
ATOM   1718 C CG  . ARG A 1 223 ? 14.741  -37.556 33.619  1.00 39.05  ? 224  ARG A CG  1 
ATOM   1719 C CD  . ARG A 1 223 ? 15.150  -38.610 34.654  1.00 41.63  ? 224  ARG A CD  1 
ATOM   1720 N NE  . ARG A 1 223 ? 16.560  -38.500 34.949  1.00 55.37  ? 224  ARG A NE  1 
ATOM   1721 C CZ  . ARG A 1 223 ? 17.058  -37.671 35.854  1.00 64.21  ? 224  ARG A CZ  1 
ATOM   1722 N NH1 . ARG A 1 223 ? 16.239  -36.896 36.571  1.00 57.63  ? 224  ARG A NH1 1 
ATOM   1723 N NH2 . ARG A 1 223 ? 18.378  -37.636 36.048  1.00 72.49  ? 224  ARG A NH2 1 
ATOM   1724 N N   . ALA A 1 224 ? 10.812  -37.560 31.697  1.00 29.54  ? 225  ALA A N   1 
ATOM   1725 C CA  . ALA A 1 224 ? 9.414   -37.753 31.339  1.00 32.13  ? 225  ALA A CA  1 
ATOM   1726 C C   . ALA A 1 224 ? 9.080   -39.218 31.076  1.00 30.96  ? 225  ALA A C   1 
ATOM   1727 O O   . ALA A 1 224 ? 9.863   -39.953 30.462  1.00 28.82  ? 225  ALA A O   1 
ATOM   1728 C CB  . ALA A 1 224 ? 9.074   -36.906 30.129  1.00 31.96  ? 225  ALA A CB  1 
ATOM   1729 N N   . VAL A 1 225 ? 7.921   -39.648 31.561  1.00 28.72  ? 226  VAL A N   1 
ATOM   1730 C CA  . VAL A 1 225 ? 7.410   -40.973 31.239  1.00 23.83  ? 226  VAL A CA  1 
ATOM   1731 C C   . VAL A 1 225 ? 6.048   -40.826 30.576  1.00 30.89  ? 226  VAL A C   1 
ATOM   1732 O O   . VAL A 1 225 ? 5.148   -40.173 31.116  1.00 25.12  ? 226  VAL A O   1 
ATOM   1733 C CB  . VAL A 1 225 ? 7.272   -41.859 32.471  1.00 29.30  ? 226  VAL A CB  1 
ATOM   1734 C CG1 . VAL A 1 225 ? 6.808   -43.283 32.049  1.00 25.70  ? 226  VAL A CG1 1 
ATOM   1735 C CG2 . VAL A 1 225 ? 8.583   -41.909 33.225  1.00 23.00  ? 226  VAL A CG2 1 
ATOM   1736 N N   . LEU A 1 226 ? 5.910   -41.405 29.389  1.00 24.77  ? 227  LEU A N   1 
ATOM   1737 C CA  . LEU A 1 226 ? 4.656   -41.345 28.671  1.00 28.94  ? 227  LEU A CA  1 
ATOM   1738 C C   . LEU A 1 226 ? 4.107   -42.755 28.514  1.00 28.94  ? 227  LEU A C   1 
ATOM   1739 O O   . LEU A 1 226 ? 4.598   -43.535 27.702  1.00 30.32  ? 227  LEU A O   1 
ATOM   1740 C CB  . LEU A 1 226 ? 4.820   -40.678 27.300  1.00 30.02  ? 227  LEU A CB  1 
ATOM   1741 C CG  . LEU A 1 226 ? 5.079   -39.169 27.332  1.00 30.54  ? 227  LEU A CG  1 
ATOM   1742 C CD1 . LEU A 1 226 ? 6.559   -38.893 27.570  1.00 21.32  ? 227  LEU A CD1 1 
ATOM   1743 C CD2 . LEU A 1 226 ? 4.602   -38.567 26.024  1.00 29.23  ? 227  LEU A CD2 1 
ATOM   1744 N N   . GLN A 1 227 ? 3.066   -43.058 29.277  1.00 27.05  ? 228  GLN A N   1 
ATOM   1745 C CA  . GLN A 1 227 ? 2.417   -44.377 29.235  1.00 26.58  ? 228  GLN A CA  1 
ATOM   1746 C C   . GLN A 1 227 ? 1.154   -44.327 28.367  1.00 24.96  ? 228  GLN A C   1 
ATOM   1747 O O   . GLN A 1 227 ? 0.207   -43.605 28.717  1.00 28.97  ? 228  GLN A O   1 
ATOM   1748 C CB  . GLN A 1 227 ? 2.072   -44.827 30.664  1.00 23.25  ? 228  GLN A CB  1 
ATOM   1749 C CG  . GLN A 1 227 ? 3.315   -44.877 31.586  1.00 24.39  ? 228  GLN A CG  1 
ATOM   1750 C CD  . GLN A 1 227 ? 2.978   -45.068 33.064  1.00 31.83  ? 228  GLN A CD  1 
ATOM   1751 O OE1 . GLN A 1 227 ? 3.734   -44.641 33.938  1.00 31.07  ? 228  GLN A OE1 1 
ATOM   1752 N NE2 . GLN A 1 227 ? 1.868   -45.738 33.351  1.00 32.02  ? 228  GLN A NE2 1 
ATOM   1753 N N   . SER A 1 228 ? 1.157   -45.038 27.227  1.00 28.63  ? 229  SER A N   1 
ATOM   1754 C CA  . SER A 1 228 ? -0.053  -45.193 26.384  1.00 24.83  ? 229  SER A CA  1 
ATOM   1755 C C   . SER A 1 228 ? -0.694  -43.882 26.008  1.00 28.56  ? 229  SER A C   1 
ATOM   1756 O O   . SER A 1 228 ? -1.931  -43.733 26.086  1.00 28.69  ? 229  SER A O   1 
ATOM   1757 C CB  . SER A 1 228 ? -1.122  -46.055 27.097  1.00 25.75  ? 229  SER A CB  1 
ATOM   1758 O OG  . SER A 1 228 ? -0.590  -47.325 27.430  1.00 27.94  ? 229  SER A OG  1 
ATOM   1759 N N   . GLY A 1 229 ? 0.124   -42.917 25.615  1.00 24.95  ? 230  GLY A N   1 
ATOM   1760 C CA  . GLY A 1 229 ? -0.427  -41.658 25.162  1.00 24.50  ? 230  GLY A CA  1 
ATOM   1761 C C   . GLY A 1 229 ? 0.701   -40.799 24.667  1.00 30.22  ? 230  GLY A C   1 
ATOM   1762 O O   . GLY A 1 229 ? 1.864   -41.044 25.007  1.00 29.89  ? 230  GLY A O   1 
ATOM   1763 N N   . ALA A 1 230 ? 0.354   -39.810 23.852  1.00 23.78  ? 231  ALA A N   1 
ATOM   1764 C CA  . ALA A 1 230 ? 1.330   -38.933 23.223  1.00 29.21  ? 231  ALA A CA  1 
ATOM   1765 C C   . ALA A 1 230 ? 0.618   -37.627 22.861  1.00 26.49  ? 231  ALA A C   1 
ATOM   1766 O O   . ALA A 1 230 ? -0.575  -37.629 22.584  1.00 31.63  ? 231  ALA A O   1 
ATOM   1767 C CB  . ALA A 1 230 ? 1.955   -39.602 21.986  1.00 27.16  ? 231  ALA A CB  1 
ATOM   1768 N N   . PRO A 1 231 ? 1.341   -36.501 22.886  1.00 26.15  ? 232  PRO A N   1 
ATOM   1769 C CA  . PRO A 1 231 ? 0.725   -35.199 22.582  1.00 28.63  ? 232  PRO A CA  1 
ATOM   1770 C C   . PRO A 1 231 ? 0.285   -35.096 21.130  1.00 30.12  ? 232  PRO A C   1 
ATOM   1771 O O   . PRO A 1 231 ? -0.572  -34.253 20.786  1.00 29.83  ? 232  PRO A O   1 
ATOM   1772 C CB  . PRO A 1 231 ? 1.855   -34.188 22.893  1.00 23.83  ? 232  PRO A CB  1 
ATOM   1773 C CG  . PRO A 1 231 ? 3.140   -34.985 22.732  1.00 24.97  ? 232  PRO A CG  1 
ATOM   1774 C CD  . PRO A 1 231 ? 2.781   -36.389 23.207  1.00 28.13  ? 232  PRO A CD  1 
ATOM   1775 N N   . ASN A 1 232 ? 0.871   -35.940 20.282  1.00 31.72  ? 233  ASN A N   1 
ATOM   1776 C CA  . ASN A 1 232 ? 0.508   -35.973 18.858  1.00 34.14  ? 233  ASN A CA  1 
ATOM   1777 C C   . ASN A 1 232 ? -0.602  -36.997 18.529  1.00 34.50  ? 233  ASN A C   1 
ATOM   1778 O O   . ASN A 1 232 ? -0.996  -37.157 17.363  1.00 34.03  ? 233  ASN A O   1 
ATOM   1779 C CB  . ASN A 1 232 ? 1.758   -36.254 18.007  1.00 31.98  ? 233  ASN A CB  1 
ATOM   1780 C CG  . ASN A 1 232 ? 2.611   -37.362 18.589  1.00 29.18  ? 233  ASN A CG  1 
ATOM   1781 O OD1 . ASN A 1 232 ? 2.977   -37.316 19.769  1.00 33.78  ? 233  ASN A OD1 1 
ATOM   1782 N ND2 . ASN A 1 232 ? 2.885   -38.391 17.792  1.00 26.37  ? 233  ASN A ND2 1 
ATOM   1783 N N   . GLY A 1 233 ? -1.123  -37.698 19.535  1.00 37.46  ? 234  GLY A N   1 
ATOM   1784 C CA  . GLY A 1 233 ? -2.364  -38.455 19.330  1.00 43.26  ? 234  GLY A CA  1 
ATOM   1785 C C   . GLY A 1 233 ? -3.448  -37.612 18.644  1.00 43.28  ? 234  GLY A C   1 
ATOM   1786 O O   . GLY A 1 233 ? -3.585  -36.427 18.955  1.00 41.62  ? 234  GLY A O   1 
ATOM   1787 N N   . PRO A 1 234 ? -4.191  -38.200 17.677  1.00 42.22  ? 235  PRO A N   1 
ATOM   1788 C CA  . PRO A 1 234 ? -5.229  -37.468 16.928  1.00 33.81  ? 235  PRO A CA  1 
ATOM   1789 C C   . PRO A 1 234 ? -6.392  -36.943 17.811  1.00 35.63  ? 235  PRO A C   1 
ATOM   1790 O O   . PRO A 1 234 ? -7.161  -36.089 17.391  1.00 37.43  ? 235  PRO A O   1 
ATOM   1791 C CB  . PRO A 1 234 ? -5.754  -38.510 15.942  1.00 30.99  ? 235  PRO A CB  1 
ATOM   1792 C CG  . PRO A 1 234 ? -5.520  -39.806 16.590  1.00 31.39  ? 235  PRO A CG  1 
ATOM   1793 C CD  . PRO A 1 234 ? -4.231  -39.645 17.399  1.00 33.78  ? 235  PRO A CD  1 
ATOM   1794 N N   . TRP A 1 235 ? -6.527  -37.474 19.018  1.00 33.74  ? 236  TRP A N   1 
ATOM   1795 C CA  . TRP A 1 235 ? -7.561  -37.017 19.939  1.00 33.88  ? 236  TRP A CA  1 
ATOM   1796 C C   . TRP A 1 235 ? -7.058  -35.938 20.913  1.00 38.91  ? 236  TRP A C   1 
ATOM   1797 O O   . TRP A 1 235 ? -7.835  -35.363 21.667  1.00 36.16  ? 236  TRP A O   1 
ATOM   1798 C CB  . TRP A 1 235 ? -8.079  -38.211 20.734  1.00 30.54  ? 236  TRP A CB  1 
ATOM   1799 C CG  . TRP A 1 235 ? -6.920  -39.037 21.293  1.00 35.50  ? 236  TRP A CG  1 
ATOM   1800 C CD1 . TRP A 1 235 ? -6.324  -40.124 20.705  1.00 34.92  ? 236  TRP A CD1 1 
ATOM   1801 C CD2 . TRP A 1 235 ? -6.199  -38.795 22.506  1.00 30.89  ? 236  TRP A CD2 1 
ATOM   1802 N NE1 . TRP A 1 235 ? -5.292  -40.587 21.487  1.00 30.66  ? 236  TRP A NE1 1 
ATOM   1803 C CE2 . TRP A 1 235 ? -5.195  -39.784 22.600  1.00 30.73  ? 236  TRP A CE2 1 
ATOM   1804 C CE3 . TRP A 1 235 ? -6.311  -37.846 23.532  1.00 33.95  ? 236  TRP A CE3 1 
ATOM   1805 C CZ2 . TRP A 1 235 ? -4.316  -39.853 23.681  1.00 30.16  ? 236  TRP A CZ2 1 
ATOM   1806 C CZ3 . TRP A 1 235 ? -5.425  -37.908 24.599  1.00 31.48  ? 236  TRP A CZ3 1 
ATOM   1807 C CH2 . TRP A 1 235 ? -4.444  -38.910 24.667  1.00 32.38  ? 236  TRP A CH2 1 
ATOM   1808 N N   . ALA A 1 236 ? -5.750  -35.690 20.930  1.00 34.77  ? 237  ALA A N   1 
ATOM   1809 C CA  . ALA A 1 236 ? -5.158  -34.930 22.037  1.00 29.78  ? 237  ALA A CA  1 
ATOM   1810 C C   . ALA A 1 236 ? -5.222  -33.415 21.850  1.00 31.00  ? 237  ALA A C   1 
ATOM   1811 O O   . ALA A 1 236 ? -5.092  -32.674 22.819  1.00 29.86  ? 237  ALA A O   1 
ATOM   1812 C CB  . ALA A 1 236 ? -3.705  -35.367 22.254  1.00 29.70  ? 237  ALA A CB  1 
ATOM   1813 N N   . THR A 1 237 ? -5.412  -32.942 20.621  1.00 25.34  ? 238  THR A N   1 
ATOM   1814 C CA  . THR A 1 237 ? -5.469  -31.501 20.433  1.00 31.01  ? 238  THR A CA  1 
ATOM   1815 C C   . THR A 1 237 ? -6.566  -31.112 19.458  1.00 32.05  ? 238  THR A C   1 
ATOM   1816 O O   . THR A 1 237 ? -7.082  -31.937 18.718  1.00 29.81  ? 238  THR A O   1 
ATOM   1817 C CB  . THR A 1 237 ? -4.125  -30.912 19.892  1.00 33.55  ? 238  THR A CB  1 
ATOM   1818 O OG1 . THR A 1 237 ? -3.805  -31.563 18.660  1.00 29.37  ? 238  THR A OG1 1 
ATOM   1819 C CG2 . THR A 1 237 ? -2.980  -31.107 20.890  1.00 30.45  ? 238  THR A CG2 1 
ATOM   1820 N N   . VAL A 1 238 ? -6.883  -29.828 19.442  1.00 33.59  ? 239  VAL A N   1 
ATOM   1821 C CA  . VAL A 1 238 ? -7.874  -29.319 18.526  1.00 37.34  ? 239  VAL A CA  1 
ATOM   1822 C C   . VAL A 1 238 ? -7.378  -27.970 17.992  1.00 37.32  ? 239  VAL A C   1 
ATOM   1823 O O   . VAL A 1 238 ? -6.615  -27.255 18.675  1.00 35.50  ? 239  VAL A O   1 
ATOM   1824 C CB  . VAL A 1 238 ? -9.278  -29.228 19.236  1.00 38.73  ? 239  VAL A CB  1 
ATOM   1825 C CG1 . VAL A 1 238 ? -9.304  -28.136 20.301  1.00 31.00  ? 239  VAL A CG1 1 
ATOM   1826 C CG2 . VAL A 1 238 ? -10.349 -29.005 18.264  1.00 41.14  ? 239  VAL A CG2 1 
ATOM   1827 N N   . GLY A 1 239 ? -7.743  -27.645 16.748  1.00 38.98  ? 240  GLY A N   1 
ATOM   1828 C CA  . GLY A 1 239 ? -7.380  -26.356 16.178  1.00 30.89  ? 240  GLY A CA  1 
ATOM   1829 C C   . GLY A 1 239 ? -8.283  -25.247 16.696  1.00 38.02  ? 240  GLY A C   1 
ATOM   1830 O O   . GLY A 1 239 ? -9.364  -25.513 17.257  1.00 38.39  ? 240  GLY A O   1 
ATOM   1831 N N   . MET A 1 240 ? -7.841  -24.004 16.524  1.00 33.29  ? 241  MET A N   1 
ATOM   1832 C CA  . MET A 1 240 ? -8.561  -22.850 17.053  1.00 37.26  ? 241  MET A CA  1 
ATOM   1833 C C   . MET A 1 240 ? -10.000 -22.757 16.532  1.00 46.77  ? 241  MET A C   1 
ATOM   1834 O O   . MET A 1 240 ? -10.930 -22.461 17.290  1.00 40.39  ? 241  MET A O   1 
ATOM   1835 C CB  . MET A 1 240 ? -7.821  -21.566 16.720  1.00 37.61  ? 241  MET A CB  1 
ATOM   1836 C CG  . MET A 1 240 ? -6.729  -21.219 17.703  1.00 45.67  ? 241  MET A CG  1 
ATOM   1837 S SD  . MET A 1 240 ? -5.702  -19.824 17.200  1.00 53.71  ? 241  MET A SD  1 
ATOM   1838 C CE  . MET A 1 240 ? -6.843  -18.433 17.169  1.00 67.15  ? 241  MET A CE  1 
ATOM   1839 N N   . GLY A 1 241 ? -10.175 -23.032 15.244  1.00 43.08  ? 242  GLY A N   1 
ATOM   1840 C CA  . GLY A 1 241 ? -11.476 -22.907 14.612  1.00 40.01  ? 242  GLY A CA  1 
ATOM   1841 C C   . GLY A 1 241 ? -12.433 -23.946 15.155  1.00 44.87  ? 242  GLY A C   1 
ATOM   1842 O O   . GLY A 1 241 ? -13.593 -23.658 15.451  1.00 37.97  ? 242  GLY A O   1 
ATOM   1843 N N   . GLU A 1 242 ? -11.950 -25.171 15.292  1.00 35.15  ? 243  GLU A N   1 
ATOM   1844 C CA  . GLU A 1 242 ? -12.812 -26.233 15.762  1.00 34.98  ? 243  GLU A CA  1 
ATOM   1845 C C   . GLU A 1 242 ? -13.113 -26.045 17.263  1.00 39.29  ? 243  GLU A C   1 
ATOM   1846 O O   . GLU A 1 242 ? -14.217 -26.348 17.723  1.00 42.75  ? 243  GLU A O   1 
ATOM   1847 C CB  . GLU A 1 242 ? -12.180 -27.601 15.468  1.00 33.68  ? 243  GLU A CB  1 
ATOM   1848 C CG  . GLU A 1 242 ? -12.894 -28.816 16.088  1.00 41.15  ? 243  GLU A CG  1 
ATOM   1849 C CD  . GLU A 1 242 ? -14.293 -29.040 15.565  1.00 48.24  ? 243  GLU A CD  1 
ATOM   1850 O OE1 . GLU A 1 242 ? -14.732 -28.273 14.680  1.00 53.66  ? 243  GLU A OE1 1 
ATOM   1851 O OE2 . GLU A 1 242 ? -14.961 -29.994 16.041  1.00 50.35  ? 243  GLU A OE2 1 
ATOM   1852 N N   . ALA A 1 243 ? -12.146 -25.526 18.017  1.00 37.30  ? 244  ALA A N   1 
ATOM   1853 C CA  . ALA A 1 243 ? -12.371 -25.247 19.439  1.00 40.11  ? 244  ALA A CA  1 
ATOM   1854 C C   . ALA A 1 243 ? -13.485 -24.221 19.599  1.00 39.60  ? 244  ALA A C   1 
ATOM   1855 O O   . ALA A 1 243 ? -14.365 -24.393 20.435  1.00 39.26  ? 244  ALA A O   1 
ATOM   1856 C CB  . ALA A 1 243 ? -11.099 -24.753 20.119  1.00 29.71  ? 244  ALA A CB  1 
ATOM   1857 N N   . ARG A 1 244 ? -13.443 -23.159 18.793  1.00 41.00  ? 245  ARG A N   1 
ATOM   1858 C CA  . ARG A 1 244 ? -14.463 -22.107 18.848  1.00 43.58  ? 245  ARG A CA  1 
ATOM   1859 C C   . ARG A 1 244 ? -15.839 -22.670 18.524  1.00 42.23  ? 245  ARG A C   1 
ATOM   1860 O O   . ARG A 1 244 ? -16.831 -22.334 19.164  1.00 42.28  ? 245  ARG A O   1 
ATOM   1861 C CB  . ARG A 1 244 ? -14.127 -20.963 17.891  1.00 42.69  ? 245  ARG A CB  1 
ATOM   1862 C CG  . ARG A 1 244 ? -15.216 -19.901 17.762  1.00 46.07  ? 245  ARG A CG  1 
ATOM   1863 C CD  . ARG A 1 244 ? -14.692 -18.629 17.077  1.00 37.49  ? 245  ARG A CD  1 
ATOM   1864 N NE  . ARG A 1 244 ? -13.721 -17.921 17.909  1.00 41.11  ? 245  ARG A NE  1 
ATOM   1865 C CZ  . ARG A 1 244 ? -14.042 -17.112 18.914  1.00 44.31  ? 245  ARG A CZ  1 
ATOM   1866 N NH1 . ARG A 1 244 ? -15.316 -16.908 19.221  1.00 50.68  ? 245  ARG A NH1 1 
ATOM   1867 N NH2 . ARG A 1 244 ? -13.089 -16.513 19.622  1.00 44.52  ? 245  ARG A NH2 1 
ATOM   1868 N N   . ARG A 1 245 ? -15.886 -23.561 17.552  1.00 37.36  ? 246  ARG A N   1 
ATOM   1869 C CA  . ARG A 1 245 ? -17.142 -24.172 17.171  1.00 46.46  ? 246  ARG A CA  1 
ATOM   1870 C C   . ARG A 1 245 ? -17.735 -25.001 18.310  1.00 45.28  ? 246  ARG A C   1 
ATOM   1871 O O   . ARG A 1 245 ? -18.936 -24.941 18.561  1.00 47.65  ? 246  ARG A O   1 
ATOM   1872 C CB  . ARG A 1 245 ? -16.976 -25.051 15.934  1.00 41.41  ? 246  ARG A CB  1 
ATOM   1873 C CG  . ARG A 1 245 ? -18.307 -25.438 15.338  1.00 50.25  ? 246  ARG A CG  1 
ATOM   1874 C CD  . ARG A 1 245 ? -18.219 -26.636 14.421  1.00 49.47  ? 246  ARG A CD  1 
ATOM   1875 N NE  . ARG A 1 245 ? -17.819 -27.878 15.087  1.00 51.83  ? 246  ARG A NE  1 
ATOM   1876 C CZ  . ARG A 1 245 ? -18.619 -28.655 15.818  1.00 57.81  ? 246  ARG A CZ  1 
ATOM   1877 N NH1 . ARG A 1 245 ? -19.889 -28.321 16.030  1.00 59.90  ? 246  ARG A NH1 1 
ATOM   1878 N NH2 . ARG A 1 245 ? -18.138 -29.774 16.353  1.00 53.91  ? 246  ARG A NH2 1 
ATOM   1879 N N   . ARG A 1 246 ? -16.896 -25.783 18.983  1.00 41.29  ? 247  ARG A N   1 
ATOM   1880 C CA  . ARG A 1 246 ? -17.375 -26.634 20.061  1.00 43.68  ? 247  ARG A CA  1 
ATOM   1881 C C   . ARG A 1 246 ? -17.837 -25.803 21.255  1.00 37.31  ? 247  ARG A C   1 
ATOM   1882 O O   . ARG A 1 246 ? -18.883 -26.091 21.833  1.00 36.53  ? 247  ARG A O   1 
ATOM   1883 C CB  . ARG A 1 246 ? -16.304 -27.626 20.489  1.00 41.65  ? 247  ARG A CB  1 
ATOM   1884 C CG  . ARG A 1 246 ? -15.998 -28.683 19.445  1.00 37.69  ? 247  ARG A CG  1 
ATOM   1885 C CD  . ARG A 1 246 ? -14.850 -29.583 19.914  1.00 43.49  ? 247  ARG A CD  1 
ATOM   1886 N NE  . ARG A 1 246 ? -14.367 -30.452 18.852  1.00 40.39  ? 247  ARG A NE  1 
ATOM   1887 C CZ  . ARG A 1 246 ? -13.547 -31.478 19.042  1.00 50.48  ? 247  ARG A CZ  1 
ATOM   1888 N NH1 . ARG A 1 246 ? -13.126 -31.775 20.267  1.00 37.49  ? 247  ARG A NH1 1 
ATOM   1889 N NH2 . ARG A 1 246 ? -13.151 -32.213 18.004  1.00 42.70  ? 247  ARG A NH2 1 
ATOM   1890 N N   . ALA A 1 247 ? -17.076 -24.767 21.607  1.00 34.78  ? 248  ALA A N   1 
ATOM   1891 C CA  . ALA A 1 247 ? -17.495 -23.846 22.673  1.00 35.03  ? 248  ALA A CA  1 
ATOM   1892 C C   . ALA A 1 247 ? -18.848 -23.224 22.353  1.00 45.63  ? 248  ALA A C   1 
ATOM   1893 O O   . ALA A 1 247 ? -19.724 -23.131 23.206  1.00 40.31  ? 248  ALA A O   1 
ATOM   1894 C CB  . ALA A 1 247 ? -16.473 -22.758 22.877  1.00 34.25  ? 248  ALA A CB  1 
ATOM   1895 N N   . THR A 1 248 ? -19.004 -22.799 21.105  1.00 36.66  ? 249  THR A N   1 
ATOM   1896 C CA  . THR A 1 248 ? -20.215 -22.147 20.657  1.00 35.73  ? 249  THR A CA  1 
ATOM   1897 C C   . THR A 1 248 ? -21.387 -23.131 20.672  1.00 39.71  ? 249  THR A C   1 
ATOM   1898 O O   . THR A 1 248 ? -22.490 -22.780 21.092  1.00 43.75  ? 249  THR A O   1 
ATOM   1899 C CB  . THR A 1 248 ? -19.998 -21.532 19.251  1.00 44.60  ? 249  THR A CB  1 
ATOM   1900 O OG1 . THR A 1 248 ? -19.016 -20.493 19.360  1.00 40.50  ? 249  THR A OG1 1 
ATOM   1901 C CG2 . THR A 1 248 ? -21.290 -20.940 18.698  1.00 41.81  ? 249  THR A CG2 1 
ATOM   1902 N N   A GLN A 1 249 ? -21.149 -24.367 20.245  0.41 37.41  ? 250  GLN A N   1 
ATOM   1903 N N   B GLN A 1 249 ? -21.152 -24.361 20.233  0.59 37.19  ? 250  GLN A N   1 
ATOM   1904 C CA  A GLN A 1 249 ? -22.206 -25.370 20.299  0.41 39.45  ? 250  GLN A CA  1 
ATOM   1905 C CA  B GLN A 1 249 ? -22.201 -25.370 20.298  0.59 39.34  ? 250  GLN A CA  1 
ATOM   1906 C C   A GLN A 1 249 ? -22.635 -25.669 21.742  0.41 40.86  ? 250  GLN A C   1 
ATOM   1907 C C   B GLN A 1 249 ? -22.635 -25.656 21.744  0.59 40.86  ? 250  GLN A C   1 
ATOM   1908 O O   A GLN A 1 249 ? -23.827 -25.843 22.011  0.41 39.03  ? 250  GLN A O   1 
ATOM   1909 O O   B GLN A 1 249 ? -23.832 -25.801 22.016  0.59 39.08  ? 250  GLN A O   1 
ATOM   1910 C CB  A GLN A 1 249 ? -21.781 -26.667 19.600  0.41 38.76  ? 250  GLN A CB  1 
ATOM   1911 C CB  B GLN A 1 249 ? -21.750 -26.663 19.610  0.59 38.82  ? 250  GLN A CB  1 
ATOM   1912 C CG  A GLN A 1 249 ? -22.960 -27.616 19.401  0.41 44.12  ? 250  GLN A CG  1 
ATOM   1913 C CG  B GLN A 1 249 ? -22.801 -27.779 19.624  0.59 43.72  ? 250  GLN A CG  1 
ATOM   1914 C CD  A GLN A 1 249 ? -22.611 -28.894 18.662  0.41 49.09  ? 250  GLN A CD  1 
ATOM   1915 C CD  B GLN A 1 249 ? -24.101 -27.415 18.899  0.59 44.92  ? 250  GLN A CD  1 
ATOM   1916 O OE1 A GLN A 1 249 ? -21.452 -29.145 18.324  0.41 53.47  ? 250  GLN A OE1 1 
ATOM   1917 O OE1 B GLN A 1 249 ? -24.206 -26.372 18.244  0.59 45.26  ? 250  GLN A OE1 1 
ATOM   1918 N NE2 A GLN A 1 249 ? -23.622 -29.717 18.412  0.41 49.69  ? 250  GLN A NE2 1 
ATOM   1919 N NE2 B GLN A 1 249 ? -25.102 -28.283 19.023  0.59 48.06  ? 250  GLN A NE2 1 
ATOM   1920 N N   . LEU A 1 250 ? -21.676 -25.723 22.669  1.00 37.30  ? 251  LEU A N   1 
ATOM   1921 C CA  . LEU A 1 250 ? -22.017 -25.983 24.080  1.00 41.46  ? 251  LEU A CA  1 
ATOM   1922 C C   . LEU A 1 250 ? -22.941 -24.872 24.563  1.00 40.72  ? 251  LEU A C   1 
ATOM   1923 O O   . LEU A 1 250 ? -23.989 -25.149 25.140  1.00 39.42  ? 251  LEU A O   1 
ATOM   1924 C CB  . LEU A 1 250 ? -20.778 -26.082 24.999  1.00 36.79  ? 251  LEU A CB  1 
ATOM   1925 C CG  . LEU A 1 250 ? -21.077 -26.342 26.497  1.00 37.20  ? 251  LEU A CG  1 
ATOM   1926 C CD1 . LEU A 1 250 ? -21.845 -27.638 26.667  1.00 35.36  ? 251  LEU A CD1 1 
ATOM   1927 C CD2 . LEU A 1 250 ? -19.814 -26.382 27.354  1.00 35.68  ? 251  LEU A CD2 1 
ATOM   1928 N N   . ALA A 1 251 ? -22.554 -23.628 24.289  1.00 34.93  ? 252  ALA A N   1 
ATOM   1929 C CA  . ALA A 1 251 ? -23.335 -22.471 24.701  1.00 46.36  ? 252  ALA A CA  1 
ATOM   1930 C C   . ALA A 1 251 ? -24.786 -22.598 24.241  1.00 45.57  ? 252  ALA A C   1 
ATOM   1931 O O   . ALA A 1 251 ? -25.714 -22.465 25.046  1.00 45.39  ? 252  ALA A O   1 
ATOM   1932 C CB  . ALA A 1 251 ? -22.722 -21.198 24.162  1.00 36.82  ? 252  ALA A CB  1 
ATOM   1933 N N   . HIS A 1 252 ? -24.964 -22.886 22.954  1.00 43.18  ? 253  HIS A N   1 
ATOM   1934 C CA  . HIS A 1 252 ? -26.290 -23.034 22.365  1.00 48.45  ? 253  HIS A CA  1 
ATOM   1935 C C   . HIS A 1 252 ? -27.098 -24.144 23.047  1.00 44.81  ? 253  HIS A C   1 
ATOM   1936 O O   . HIS A 1 252 ? -28.283 -23.966 23.327  1.00 41.99  ? 253  HIS A O   1 
ATOM   1937 C CB  . HIS A 1 252 ? -26.191 -23.312 20.856  1.00 45.39  ? 253  HIS A CB  1 
ATOM   1938 C CG  . HIS A 1 252 ? -27.511 -23.646 20.228  1.00 66.21  ? 253  HIS A CG  1 
ATOM   1939 N ND1 . HIS A 1 252 ? -27.905 -24.943 19.956  1.00 57.00  ? 253  HIS A ND1 1 
ATOM   1940 C CD2 . HIS A 1 252 ? -28.541 -22.851 19.847  1.00 63.19  ? 253  HIS A CD2 1 
ATOM   1941 C CE1 . HIS A 1 252 ? -29.116 -24.928 19.424  1.00 57.98  ? 253  HIS A CE1 1 
ATOM   1942 N NE2 . HIS A 1 252 ? -29.522 -23.671 19.346  1.00 66.74  ? 253  HIS A NE2 1 
ATOM   1943 N N   . LEU A 1 253 ? -26.450 -25.279 23.307  1.00 38.49  ? 254  LEU A N   1 
ATOM   1944 C CA  . LEU A 1 253 ? -27.107 -26.418 23.951  1.00 40.26  ? 254  LEU A CA  1 
ATOM   1945 C C   . LEU A 1 253 ? -27.558 -26.148 25.388  1.00 40.34  ? 254  LEU A C   1 
ATOM   1946 O O   . LEU A 1 253 ? -28.408 -26.873 25.892  1.00 38.61  ? 254  LEU A O   1 
ATOM   1947 C CB  . LEU A 1 253 ? -26.193 -27.659 23.954  1.00 36.68  ? 254  LEU A CB  1 
ATOM   1948 C CG  . LEU A 1 253 ? -25.861 -28.388 22.634  1.00 47.25  ? 254  LEU A CG  1 
ATOM   1949 C CD1 . LEU A 1 253 ? -24.743 -29.422 22.837  1.00 46.10  ? 254  LEU A CD1 1 
ATOM   1950 C CD2 . LEU A 1 253 ? -27.083 -29.072 22.014  1.00 40.51  ? 254  LEU A CD2 1 
ATOM   1951 N N   . VAL A 1 254 ? -26.988 -25.143 26.053  1.00 38.02  ? 255  VAL A N   1 
ATOM   1952 C CA  . VAL A 1 254 ? -27.351 -24.860 27.458  1.00 41.97  ? 255  VAL A CA  1 
ATOM   1953 C C   . VAL A 1 254 ? -28.109 -23.528 27.557  1.00 42.82  ? 255  VAL A C   1 
ATOM   1954 O O   . VAL A 1 254 ? -28.265 -22.944 28.652  1.00 40.10  ? 255  VAL A O   1 
ATOM   1955 C CB  . VAL A 1 254 ? -26.097 -24.847 28.431  1.00 36.37  ? 255  VAL A CB  1 
ATOM   1956 C CG1 . VAL A 1 254 ? -25.389 -26.195 28.417  1.00 34.15  ? 255  VAL A CG1 1 
ATOM   1957 C CG2 . VAL A 1 254 ? -25.120 -23.741 28.082  1.00 34.58  ? 255  VAL A CG2 1 
ATOM   1958 N N   . GLY A 1 255 ? -28.590 -23.061 26.404  1.00 39.52  ? 256  GLY A N   1 
ATOM   1959 C CA  . GLY A 1 255 ? -29.429 -21.876 26.336  1.00 40.82  ? 256  GLY A CA  1 
ATOM   1960 C C   . GLY A 1 255 ? -28.729 -20.536 26.413  1.00 39.38  ? 256  GLY A C   1 
ATOM   1961 O O   . GLY A 1 255 ? -29.318 -19.539 26.812  1.00 47.80  ? 256  GLY A O   1 
ATOM   1962 N N   . CYS A 1 256 ? -27.467 -20.505 26.028  1.00 40.75  ? 257  CYS A N   1 
ATOM   1963 C CA  . CYS A 1 256 ? -26.705 -19.265 26.023  1.00 44.02  ? 257  CYS A CA  1 
ATOM   1964 C C   . CYS A 1 256 ? -26.573 -18.826 24.577  1.00 48.97  ? 257  CYS A C   1 
ATOM   1965 O O   . CYS A 1 256 ? -26.668 -19.651 23.692  1.00 52.28  ? 257  CYS A O   1 
ATOM   1966 C CB  . CYS A 1 256 ? -25.335 -19.472 26.687  1.00 40.89  ? 257  CYS A CB  1 
ATOM   1967 S SG  . CYS A 1 256 ? -25.505 -19.712 28.465  1.00 45.49  ? 257  CYS A SG  1 
ATOM   1968 N N   . PRO A 1 257 ? -26.375 -17.525 24.330  1.00 67.90  ? 258  PRO A N   1 
ATOM   1969 C CA  . PRO A 1 257 ? -26.262 -17.100 22.930  1.00 67.82  ? 258  PRO A CA  1 
ATOM   1970 C C   . PRO A 1 257 ? -24.836 -17.224 22.370  1.00 67.26  ? 258  PRO A C   1 
ATOM   1971 O O   . PRO A 1 257 ? -24.667 -17.277 21.138  1.00 83.87  ? 258  PRO A O   1 
ATOM   1972 C CB  . PRO A 1 257 ? -26.712 -15.638 22.980  1.00 62.46  ? 258  PRO A CB  1 
ATOM   1973 C CG  . PRO A 1 257 ? -26.520 -15.196 24.453  1.00 68.79  ? 258  PRO A CG  1 
ATOM   1974 C CD  . PRO A 1 257 ? -26.172 -16.405 25.272  1.00 58.83  ? 258  PRO A CD  1 
ATOM   1975 N N   . ASN A 1 264 ? -20.637 -12.228 20.553  1.00 63.91  ? 265  ASN A N   1 
ATOM   1976 C CA  . ASN A 1 264 ? -19.637 -11.628 21.429  1.00 60.28  ? 265  ASN A CA  1 
ATOM   1977 C C   . ASN A 1 264 ? -19.168 -12.606 22.525  1.00 63.27  ? 265  ASN A C   1 
ATOM   1978 O O   . ASN A 1 264 ? -19.952 -13.032 23.382  1.00 54.39  ? 265  ASN A O   1 
ATOM   1979 C CB  . ASN A 1 264 ? -20.196 -10.345 22.046  1.00 67.30  ? 265  ASN A CB  1 
ATOM   1980 C CG  . ASN A 1 264 ? -19.153 -9.552  22.821  1.00 76.39  ? 265  ASN A CG  1 
ATOM   1981 O OD1 . ASN A 1 264 ? -18.425 -10.097 23.648  1.00 74.18  ? 265  ASN A OD1 1 
ATOM   1982 N ND2 . ASN A 1 264 ? -19.086 -8.247  22.557  1.00 86.76  ? 265  ASN A ND2 1 
ATOM   1983 N N   . ASP A 1 265 ? -17.879 -12.941 22.490  1.00 55.12  ? 266  ASP A N   1 
ATOM   1984 C CA  . ASP A 1 265 ? -17.286 -13.905 23.410  1.00 55.46  ? 266  ASP A CA  1 
ATOM   1985 C C   . ASP A 1 265 ? -17.545 -13.550 24.881  1.00 52.00  ? 266  ASP A C   1 
ATOM   1986 O O   . ASP A 1 265 ? -17.868 -14.425 25.677  1.00 48.74  ? 266  ASP A O   1 
ATOM   1987 C CB  . ASP A 1 265 ? -15.777 -14.025 23.153  1.00 44.35  ? 266  ASP A CB  1 
ATOM   1988 C CG  . ASP A 1 265 ? -15.455 -14.708 21.824  1.00 49.93  ? 266  ASP A CG  1 
ATOM   1989 O OD1 . ASP A 1 265 ? -16.351 -15.360 21.239  1.00 53.01  ? 266  ASP A OD1 1 
ATOM   1990 O OD2 . ASP A 1 265 ? -14.293 -14.603 21.365  1.00 51.57  ? 266  ASP A OD2 1 
ATOM   1991 N N   . THR A 1 266 ? -17.423 -12.272 25.232  1.00 48.72  ? 267  THR A N   1 
ATOM   1992 C CA  . THR A 1 266 ? -17.681 -11.821 26.592  1.00 44.54  ? 267  THR A CA  1 
ATOM   1993 C C   . THR A 1 266 ? -19.079 -12.209 27.082  1.00 49.47  ? 267  THR A C   1 
ATOM   1994 O O   . THR A 1 266 ? -19.225 -12.746 28.185  1.00 51.31  ? 267  THR A O   1 
ATOM   1995 C CB  . THR A 1 266 ? -17.513 -10.298 26.716  1.00 52.72  ? 267  THR A CB  1 
ATOM   1996 O OG1 . THR A 1 266 ? -16.181 -9.943  26.342  1.00 56.78  ? 267  THR A OG1 1 
ATOM   1997 C CG2 . THR A 1 266 ? -17.746 -9.843  28.152  1.00 43.16  ? 267  THR A CG2 1 
ATOM   1998 N N   . GLU A 1 267 ? -20.095 -11.945 26.264  1.00 49.18  ? 268  GLU A N   1 
ATOM   1999 C CA  . GLU A 1 267 ? -21.480 -12.262 26.616  1.00 45.84  ? 268  GLU A CA  1 
ATOM   2000 C C   . GLU A 1 267 ? -21.683 -13.771 26.689  1.00 48.14  ? 268  GLU A C   1 
ATOM   2001 O O   . GLU A 1 267 ? -22.392 -14.275 27.565  1.00 50.16  ? 268  GLU A O   1 
ATOM   2002 C CB  . GLU A 1 267 ? -22.463 -11.652 25.601  1.00 53.85  ? 268  GLU A CB  1 
ATOM   2003 C CG  . GLU A 1 267 ? -22.551 -10.119 25.636  1.00 73.13  ? 268  GLU A CG  1 
ATOM   2004 C CD  . GLU A 1 267 ? -23.205 -9.512  24.378  1.00 92.28  ? 268  GLU A CD  1 
ATOM   2005 O OE1 . GLU A 1 267 ? -23.738 -8.378  24.465  1.00 88.48  ? 268  GLU A OE1 1 
ATOM   2006 O OE2 . GLU A 1 267 ? -23.175 -10.157 23.300  1.00 96.66  ? 268  GLU A OE2 1 
ATOM   2007 N N   . LEU A 1 268 ? -21.059 -14.491 25.762  1.00 44.76  ? 269  LEU A N   1 
ATOM   2008 C CA  . LEU A 1 268 ? -21.195 -15.944 25.709  1.00 45.47  ? 269  LEU A CA  1 
ATOM   2009 C C   . LEU A 1 268 ? -20.590 -16.596 26.968  1.00 41.78  ? 269  LEU A C   1 
ATOM   2010 O O   . LEU A 1 268 ? -21.200 -17.467 27.565  1.00 42.18  ? 269  LEU A O   1 
ATOM   2011 C CB  . LEU A 1 268 ? -20.549 -16.495 24.425  1.00 42.56  ? 269  LEU A CB  1 
ATOM   2012 C CG  . LEU A 1 268 ? -20.726 -17.988 24.100  1.00 47.11  ? 269  LEU A CG  1 
ATOM   2013 C CD1 . LEU A 1 268 ? -20.593 -18.282 22.621  1.00 50.22  ? 269  LEU A CD1 1 
ATOM   2014 C CD2 . LEU A 1 268 ? -19.705 -18.825 24.852  1.00 48.52  ? 269  LEU A CD2 1 
ATOM   2015 N N   . VAL A 1 269 ? -19.399 -16.167 27.368  1.00 43.46  ? 270  VAL A N   1 
ATOM   2016 C CA  . VAL A 1 269 ? -18.744 -16.760 28.527  1.00 44.35  ? 270  VAL A CA  1 
ATOM   2017 C C   . VAL A 1 269 ? -19.472 -16.374 29.798  1.00 44.94  ? 270  VAL A C   1 
ATOM   2018 O O   . VAL A 1 269 ? -19.618 -17.195 30.718  1.00 43.90  ? 270  VAL A O   1 
ATOM   2019 C CB  . VAL A 1 269 ? -17.262 -16.337 28.639  1.00 44.61  ? 270  VAL A CB  1 
ATOM   2020 C CG1 . VAL A 1 269 ? -16.608 -17.024 29.819  1.00 38.20  ? 270  VAL A CG1 1 
ATOM   2021 C CG2 . VAL A 1 269 ? -16.514 -16.721 27.376  1.00 43.63  ? 270  VAL A CG2 1 
ATOM   2022 N N   . ALA A 1 270 ? -19.928 -15.127 29.866  1.00 40.01  ? 271  ALA A N   1 
ATOM   2023 C CA  . ALA A 1 270 ? -20.689 -14.693 31.044  1.00 45.96  ? 271  ALA A CA  1 
ATOM   2024 C C   . ALA A 1 270 ? -21.944 -15.559 31.223  1.00 44.24  ? 271  ALA A C   1 
ATOM   2025 O O   . ALA A 1 270 ? -22.301 -15.950 32.336  1.00 41.51  ? 271  ALA A O   1 
ATOM   2026 C CB  . ALA A 1 270 ? -21.062 -13.218 30.932  1.00 48.60  ? 271  ALA A CB  1 
ATOM   2027 N N   . CYS A 1 271 ? -22.602 -15.887 30.119  1.00 47.02  ? 272  CYS A N   1 
ATOM   2028 C CA  . CYS A 1 271 ? -23.771 -16.747 30.195  1.00 41.59  ? 272  CYS A CA  1 
ATOM   2029 C C   . CYS A 1 271 ? -23.375 -18.146 30.668  1.00 44.90  ? 272  CYS A C   1 
ATOM   2030 O O   . CYS A 1 271 ? -23.998 -18.685 31.579  1.00 43.81  ? 272  CYS A O   1 
ATOM   2031 C CB  . CYS A 1 271 ? -24.492 -16.824 28.841  1.00 47.76  ? 272  CYS A CB  1 
ATOM   2032 S SG  . CYS A 1 271 ? -26.042 -17.777 28.916  1.00 48.75  ? 272  CYS A SG  1 
ATOM   2033 N N   . LEU A 1 272 ? -22.337 -18.725 30.059  1.00 42.90  ? 273  LEU A N   1 
ATOM   2034 C CA  . LEU A 1 272 ? -21.844 -20.036 30.487  1.00 39.77  ? 273  LEU A CA  1 
ATOM   2035 C C   . LEU A 1 272 ? -21.506 -20.044 31.979  1.00 36.59  ? 273  LEU A C   1 
ATOM   2036 O O   . LEU A 1 272 ? -21.730 -21.051 32.659  1.00 38.64  ? 273  LEU A O   1 
ATOM   2037 C CB  . LEU A 1 272 ? -20.608 -20.467 29.681  1.00 37.83  ? 273  LEU A CB  1 
ATOM   2038 C CG  . LEU A 1 272 ? -20.800 -20.874 28.216  1.00 42.73  ? 273  LEU A CG  1 
ATOM   2039 C CD1 . LEU A 1 272 ? -19.445 -21.034 27.547  1.00 36.62  ? 273  LEU A CD1 1 
ATOM   2040 C CD2 . LEU A 1 272 ? -21.612 -22.166 28.066  1.00 38.30  ? 273  LEU A CD2 1 
ATOM   2041 N N   . ARG A 1 273 ? -20.996 -18.925 32.498  1.00 33.23  ? 274  ARG A N   1 
ATOM   2042 C CA  . ARG A 1 273 ? -20.617 -18.884 33.900  1.00 32.31  ? 274  ARG A CA  1 
ATOM   2043 C C   . ARG A 1 273 ? -21.840 -18.861 34.845  1.00 40.49  ? 274  ARG A C   1 
ATOM   2044 O O   . ARG A 1 273 ? -21.696 -19.101 36.045  1.00 35.78  ? 274  ARG A O   1 
ATOM   2045 C CB  . ARG A 1 273 ? -19.705 -17.686 34.179  1.00 34.58  ? 274  ARG A CB  1 
ATOM   2046 C CG  . ARG A 1 273 ? -18.310 -17.852 33.577  1.00 42.87  ? 274  ARG A CG  1 
ATOM   2047 C CD  . ARG A 1 273 ? -17.272 -16.970 34.257  1.00 39.88  ? 274  ARG A CD  1 
ATOM   2048 N NE  . ARG A 1 273 ? -16.953 -15.795 33.466  1.00 60.13  ? 274  ARG A NE  1 
ATOM   2049 C CZ  . ARG A 1 273 ? -15.780 -15.564 32.873  1.00 63.04  ? 274  ARG A CZ  1 
ATOM   2050 N NH1 . ARG A 1 273 ? -14.774 -16.431 32.968  1.00 48.61  ? 274  ARG A NH1 1 
ATOM   2051 N NH2 . ARG A 1 273 ? -15.612 -14.443 32.179  1.00 66.73  ? 274  ARG A NH2 1 
ATOM   2052 N N   . THR A 1 274 ? -23.036 -18.597 34.322  1.00 36.39  ? 275  THR A N   1 
ATOM   2053 C CA  . THR A 1 274 ? -24.226 -18.604 35.186  1.00 39.78  ? 275  THR A CA  1 
ATOM   2054 C C   . THR A 1 274 ? -24.790 -20.007 35.303  1.00 38.95  ? 275  THR A C   1 
ATOM   2055 O O   . THR A 1 274 ? -25.645 -20.254 36.122  1.00 42.59  ? 275  THR A O   1 
ATOM   2056 C CB  . THR A 1 274 ? -25.353 -17.682 34.669  1.00 39.00  ? 275  THR A CB  1 
ATOM   2057 O OG1 . THR A 1 274 ? -25.893 -18.210 33.452  1.00 42.75  ? 275  THR A OG1 1 
ATOM   2058 C CG2 . THR A 1 274 ? -24.857 -16.249 34.465  1.00 36.37  ? 275  THR A CG2 1 
ATOM   2059 N N   . ARG A 1 275 ? -24.312 -20.926 34.465  1.00 36.37  ? 276  ARG A N   1 
ATOM   2060 C CA  . ARG A 1 275 ? -24.836 -22.286 34.456  1.00 35.12  ? 276  ARG A CA  1 
ATOM   2061 C C   . ARG A 1 275 ? -24.218 -23.177 35.529  1.00 37.48  ? 276  ARG A C   1 
ATOM   2062 O O   . ARG A 1 275 ? -23.008 -23.132 35.755  1.00 37.23  ? 276  ARG A O   1 
ATOM   2063 C CB  . ARG A 1 275 ? -24.613 -22.913 33.081  1.00 35.09  ? 276  ARG A CB  1 
ATOM   2064 C CG  . ARG A 1 275 ? -25.367 -22.206 31.939  1.00 44.89  ? 276  ARG A CG  1 
ATOM   2065 C CD  . ARG A 1 275 ? -26.842 -22.309 32.162  1.00 42.52  ? 276  ARG A CD  1 
ATOM   2066 N NE  . ARG A 1 275 ? -27.625 -21.906 31.008  1.00 39.09  ? 276  ARG A NE  1 
ATOM   2067 C CZ  . ARG A 1 275 ? -28.216 -20.722 30.870  1.00 44.52  ? 276  ARG A CZ  1 
ATOM   2068 N NH1 . ARG A 1 275 ? -28.091 -19.806 31.819  1.00 41.01  ? 276  ARG A NH1 1 
ATOM   2069 N NH2 . ARG A 1 275 ? -28.931 -20.456 29.776  1.00 42.06  ? 276  ARG A NH2 1 
ATOM   2070 N N   . PRO A 1 276 ? -25.043 -23.998 36.200  1.00 39.78  ? 277  PRO A N   1 
ATOM   2071 C CA  . PRO A 1 276 ? -24.466 -24.993 37.112  1.00 34.13  ? 277  PRO A CA  1 
ATOM   2072 C C   . PRO A 1 276 ? -23.463 -25.871 36.381  1.00 39.49  ? 277  PRO A C   1 
ATOM   2073 O O   . PRO A 1 276 ? -23.664 -26.184 35.196  1.00 36.54  ? 277  PRO A O   1 
ATOM   2074 C CB  . PRO A 1 276 ? -25.678 -25.817 37.568  1.00 35.83  ? 277  PRO A CB  1 
ATOM   2075 C CG  . PRO A 1 276 ? -26.853 -24.881 37.403  1.00 41.39  ? 277  PRO A CG  1 
ATOM   2076 C CD  . PRO A 1 276 ? -26.517 -24.007 36.217  1.00 39.45  ? 277  PRO A CD  1 
ATOM   2077 N N   . ALA A 1 277 ? -22.394 -26.247 37.078  1.00 33.14  ? 278  ALA A N   1 
ATOM   2078 C CA  . ALA A 1 277 ? -21.363 -27.082 36.486  1.00 33.75  ? 278  ALA A CA  1 
ATOM   2079 C C   . ALA A 1 277 ? -21.966 -28.345 35.857  1.00 32.74  ? 278  ALA A C   1 
ATOM   2080 O O   . ALA A 1 277 ? -21.607 -28.716 34.731  1.00 35.04  ? 278  ALA A O   1 
ATOM   2081 C CB  . ALA A 1 277 ? -20.309 -27.448 37.542  1.00 31.10  ? 278  ALA A CB  1 
ATOM   2082 N N   . GLN A 1 278 ? -22.896 -28.985 36.573  1.00 35.87  ? 279  GLN A N   1 
ATOM   2083 C CA  . GLN A 1 278 ? -23.461 -30.260 36.138  1.00 31.86  ? 279  GLN A CA  1 
ATOM   2084 C C   . GLN A 1 278 ? -24.188 -30.122 34.796  1.00 33.94  ? 279  GLN A C   1 
ATOM   2085 O O   . GLN A 1 278 ? -24.244 -31.067 34.018  1.00 30.69  ? 279  GLN A O   1 
ATOM   2086 C CB  . GLN A 1 278 ? -24.403 -30.822 37.204  1.00 37.04  ? 279  GLN A CB  1 
ATOM   2087 C CG  . GLN A 1 278 ? -24.870 -32.247 36.939  1.00 34.51  ? 279  GLN A CG  1 
ATOM   2088 C CD  . GLN A 1 278 ? -23.736 -33.252 36.747  1.00 44.10  ? 279  GLN A CD  1 
ATOM   2089 O OE1 . GLN A 1 278 ? -22.919 -33.465 37.634  1.00 44.58  ? 279  GLN A OE1 1 
ATOM   2090 N NE2 . GLN A 1 278 ? -23.703 -33.888 35.583  1.00 38.64  ? 279  GLN A NE2 1 
ATOM   2091 N N   . VAL A 1 279 ? -24.719 -28.933 34.533  1.00 30.78  ? 280  VAL A N   1 
ATOM   2092 C CA  . VAL A 1 279 ? -25.382 -28.659 33.280  1.00 33.05  ? 280  VAL A CA  1 
ATOM   2093 C C   . VAL A 1 279 ? -24.374 -28.666 32.116  1.00 34.21  ? 280  VAL A C   1 
ATOM   2094 O O   . VAL A 1 279 ? -24.685 -29.159 31.029  1.00 35.50  ? 280  VAL A O   1 
ATOM   2095 C CB  . VAL A 1 279 ? -26.149 -27.299 33.342  1.00 35.30  ? 280  VAL A CB  1 
ATOM   2096 C CG1 . VAL A 1 279 ? -26.698 -26.906 31.965  1.00 32.90  ? 280  VAL A CG1 1 
ATOM   2097 C CG2 . VAL A 1 279 ? -27.286 -27.405 34.336  1.00 29.69  ? 280  VAL A CG2 1 
ATOM   2098 N N   . LEU A 1 280 ? -23.164 -28.153 32.335  1.00 35.82  ? 281  LEU A N   1 
ATOM   2099 C CA  . LEU A 1 280 ? -22.171 -28.177 31.259  1.00 31.78  ? 281  LEU A CA  1 
ATOM   2100 C C   . LEU A 1 280 ? -21.788 -29.623 31.036  1.00 30.64  ? 281  LEU A C   1 
ATOM   2101 O O   . LEU A 1 280 ? -21.695 -30.089 29.892  1.00 37.19  ? 281  LEU A O   1 
ATOM   2102 C CB  . LEU A 1 280 ? -20.945 -27.323 31.591  1.00 28.65  ? 281  LEU A CB  1 
ATOM   2103 C CG  . LEU A 1 280 ? -21.268 -25.858 31.890  1.00 35.00  ? 281  LEU A CG  1 
ATOM   2104 C CD1 . LEU A 1 280 ? -19.969 -25.068 31.975  1.00 37.47  ? 281  LEU A CD1 1 
ATOM   2105 C CD2 . LEU A 1 280 ? -22.215 -25.264 30.841  1.00 35.62  ? 281  LEU A CD2 1 
ATOM   2106 N N   . VAL A 1 281 ? -21.600 -30.349 32.134  1.00 33.64  ? 282  VAL A N   1 
ATOM   2107 C CA  . VAL A 1 281 ? -21.241 -31.752 32.035  1.00 35.54  ? 282  VAL A CA  1 
ATOM   2108 C C   . VAL A 1 281 ? -22.292 -32.510 31.240  1.00 41.85  ? 282  VAL A C   1 
ATOM   2109 O O   . VAL A 1 281 ? -21.948 -33.313 30.369  1.00 40.74  ? 282  VAL A O   1 
ATOM   2110 C CB  . VAL A 1 281 ? -21.057 -32.407 33.409  1.00 33.32  ? 282  VAL A CB  1 
ATOM   2111 C CG1 . VAL A 1 281 ? -20.814 -33.884 33.249  1.00 30.77  ? 282  VAL A CG1 1 
ATOM   2112 C CG2 . VAL A 1 281 ? -19.873 -31.775 34.127  1.00 34.34  ? 282  VAL A CG2 1 
ATOM   2113 N N   . ASN A 1 282 ? -23.566 -32.227 31.500  1.00 39.07  ? 283  ASN A N   1 
ATOM   2114 C CA  . ASN A 1 282 ? -24.644 -32.987 30.873  1.00 39.91  ? 283  ASN A CA  1 
ATOM   2115 C C   . ASN A 1 282 ? -24.676 -32.863 29.355  1.00 46.14  ? 283  ASN A C   1 
ATOM   2116 O O   . ASN A 1 282 ? -25.126 -33.784 28.678  1.00 45.75  ? 283  ASN A O   1 
ATOM   2117 C CB  . ASN A 1 282 ? -25.994 -32.564 31.441  1.00 43.84  ? 283  ASN A CB  1 
ATOM   2118 C CG  . ASN A 1 282 ? -26.214 -33.072 32.863  1.00 42.19  ? 283  ASN A CG  1 
ATOM   2119 O OD1 . ASN A 1 282 ? -25.479 -33.929 33.360  1.00 43.93  ? 283  ASN A OD1 1 
ATOM   2120 N ND2 . ASN A 1 282 ? -27.236 -32.548 33.517  1.00 41.62  ? 283  ASN A ND2 1 
ATOM   2121 N N   . HIS A 1 283 ? -24.190 -31.745 28.818  1.00 38.35  ? 284  HIS A N   1 
ATOM   2122 C CA  . HIS A 1 283 ? -24.256 -31.518 27.373  1.00 44.93  ? 284  HIS A CA  1 
ATOM   2123 C C   . HIS A 1 283 ? -22.930 -31.682 26.606  1.00 51.40  ? 284  HIS A C   1 
ATOM   2124 O O   . HIS A 1 283 ? -22.915 -31.627 25.367  1.00 44.37  ? 284  HIS A O   1 
ATOM   2125 C CB  . HIS A 1 283 ? -24.815 -30.116 27.106  1.00 42.79  ? 284  HIS A CB  1 
ATOM   2126 C CG  . HIS A 1 283 ? -26.257 -29.979 27.464  1.00 54.69  ? 284  HIS A CG  1 
ATOM   2127 N ND1 . HIS A 1 283 ? -27.274 -30.290 26.585  1.00 49.10  ? 284  HIS A ND1 1 
ATOM   2128 C CD2 . HIS A 1 283 ? -26.859 -29.606 28.619  1.00 45.20  ? 284  HIS A CD2 1 
ATOM   2129 C CE1 . HIS A 1 283 ? -28.438 -30.091 27.175  1.00 52.45  ? 284  HIS A CE1 1 
ATOM   2130 N NE2 . HIS A 1 283 ? -28.215 -29.672 28.408  1.00 51.60  ? 284  HIS A NE2 1 
ATOM   2131 N N   . GLU A 1 284 ? -21.831 -31.885 27.331  1.00 44.41  ? 285  GLU A N   1 
ATOM   2132 C CA  . GLU A 1 284 ? -20.507 -31.827 26.723  1.00 47.29  ? 285  GLU A CA  1 
ATOM   2133 C C   . GLU A 1 284 ? -20.330 -32.914 25.679  1.00 51.56  ? 285  GLU A C   1 
ATOM   2134 O O   . GLU A 1 284 ? -19.645 -32.706 24.693  1.00 47.01  ? 285  GLU A O   1 
ATOM   2135 C CB  . GLU A 1 284 ? -19.398 -31.934 27.774  1.00 51.66  ? 285  GLU A CB  1 
ATOM   2136 C CG  . GLU A 1 284 ? -19.226 -33.313 28.362  1.00 49.71  ? 285  GLU A CG  1 
ATOM   2137 C CD  . GLU A 1 284 ? -17.780 -33.603 28.754  1.00 76.10  ? 285  GLU A CD  1 
ATOM   2138 O OE1 . GLU A 1 284 ? -17.024 -32.623 29.004  1.00 68.43  ? 285  GLU A OE1 1 
ATOM   2139 O OE2 . GLU A 1 284 ? -17.405 -34.806 28.800  1.00 71.78  ? 285  GLU A OE2 1 
ATOM   2140 N N   . TRP A 1 285 ? -20.983 -34.052 25.872  1.00 55.83  ? 286  TRP A N   1 
ATOM   2141 C CA  . TRP A 1 285 ? -20.843 -35.147 24.940  1.00 52.17  ? 286  TRP A CA  1 
ATOM   2142 C C   . TRP A 1 285 ? -21.375 -34.802 23.537  1.00 60.80  ? 286  TRP A C   1 
ATOM   2143 O O   . TRP A 1 285 ? -20.731 -35.160 22.547  1.00 61.35  ? 286  TRP A O   1 
ATOM   2144 C CB  . TRP A 1 285 ? -21.531 -36.403 25.485  1.00 63.77  ? 286  TRP A CB  1 
ATOM   2145 C CG  . TRP A 1 285 ? -23.030 -36.414 25.340  1.00 80.76  ? 286  TRP A CG  1 
ATOM   2146 C CD1 . TRP A 1 285 ? -23.957 -35.983 26.258  1.00 71.68  ? 286  TRP A CD1 1 
ATOM   2147 C CD2 . TRP A 1 285 ? -23.780 -36.888 24.207  1.00 87.16  ? 286  TRP A CD2 1 
ATOM   2148 N NE1 . TRP A 1 285 ? -25.233 -36.160 25.762  1.00 75.07  ? 286  TRP A NE1 1 
ATOM   2149 C CE2 . TRP A 1 285 ? -25.152 -36.711 24.506  1.00 80.62  ? 286  TRP A CE2 1 
ATOM   2150 C CE3 . TRP A 1 285 ? -23.421 -37.445 22.967  1.00 83.91  ? 286  TRP A CE3 1 
ATOM   2151 C CZ2 . TRP A 1 285 ? -26.164 -37.060 23.609  1.00 75.51  ? 286  TRP A CZ2 1 
ATOM   2152 C CZ3 . TRP A 1 285 ? -24.429 -37.799 22.079  1.00 79.03  ? 286  TRP A CZ3 1 
ATOM   2153 C CH2 . TRP A 1 285 ? -25.785 -37.605 22.406  1.00 88.89  ? 286  TRP A CH2 1 
ATOM   2154 N N   . HIS A 1 286 ? -22.508 -34.106 23.409  1.00 59.57  ? 287  HIS A N   1 
ATOM   2155 C CA  . HIS A 1 286 ? -22.989 -33.896 22.050  1.00 62.04  ? 287  HIS A CA  1 
ATOM   2156 C C   . HIS A 1 286 ? -22.551 -32.575 21.434  1.00 57.44  ? 287  HIS A C   1 
ATOM   2157 O O   . HIS A 1 286 ? -23.299 -31.970 20.675  1.00 69.04  ? 287  HIS A O   1 
ATOM   2158 C CB  . HIS A 1 286 ? -24.531 -34.075 21.898  1.00 69.20  ? 287  HIS A CB  1 
ATOM   2159 C CG  . HIS A 1 286 ? -25.391 -33.458 22.965  1.00 76.89  ? 287  HIS A CG  1 
ATOM   2160 N ND1 . HIS A 1 286 ? -25.302 -33.796 24.298  1.00 83.99  ? 287  HIS A ND1 1 
ATOM   2161 C CD2 . HIS A 1 286 ? -26.454 -32.617 22.870  1.00 83.02  ? 287  HIS A CD2 1 
ATOM   2162 C CE1 . HIS A 1 286 ? -26.232 -33.150 24.986  1.00 78.24  ? 287  HIS A CE1 1 
ATOM   2163 N NE2 . HIS A 1 286 ? -26.942 -32.422 24.144  1.00 69.00  ? 287  HIS A NE2 1 
ATOM   2164 N N   . VAL A 1 287 ? -21.308 -32.168 21.689  1.00 55.76  ? 288  VAL A N   1 
ATOM   2165 C CA  . VAL A 1 287 ? -20.686 -31.136 20.849  1.00 56.12  ? 288  VAL A CA  1 
ATOM   2166 C C   . VAL A 1 287 ? -19.734 -31.739 19.800  1.00 57.52  ? 288  VAL A C   1 
ATOM   2167 O O   . VAL A 1 287 ? -19.259 -31.040 18.902  1.00 61.83  ? 288  VAL A O   1 
ATOM   2168 C CB  . VAL A 1 287 ? -19.908 -30.089 21.684  1.00 54.02  ? 288  VAL A CB  1 
ATOM   2169 C CG1 . VAL A 1 287 ? -20.644 -29.788 22.987  1.00 53.34  ? 288  VAL A CG1 1 
ATOM   2170 C CG2 . VAL A 1 287 ? -18.509 -30.559 21.971  1.00 44.54  ? 288  VAL A CG2 1 
ATOM   2171 N N   . LEU A 1 288 ? -19.452 -33.033 19.912  1.00 59.39  ? 289  LEU A N   1 
ATOM   2172 C CA  . LEU A 1 288 ? -18.583 -33.705 18.945  1.00 61.21  ? 289  LEU A CA  1 
ATOM   2173 C C   . LEU A 1 288 ? -19.239 -33.740 17.570  1.00 65.29  ? 289  LEU A C   1 
ATOM   2174 O O   . LEU A 1 288 ? -20.453 -33.979 17.460  1.00 66.11  ? 289  LEU A O   1 
ATOM   2175 C CB  . LEU A 1 288 ? -18.247 -35.131 19.395  1.00 59.97  ? 289  LEU A CB  1 
ATOM   2176 C CG  . LEU A 1 288 ? -17.130 -35.305 20.427  1.00 62.69  ? 289  LEU A CG  1 
ATOM   2177 C CD1 . LEU A 1 288 ? -16.883 -36.783 20.734  1.00 57.21  ? 289  LEU A CD1 1 
ATOM   2178 C CD2 . LEU A 1 288 ? -15.849 -34.608 19.972  1.00 52.82  ? 289  LEU A CD2 1 
ATOM   2179 N N   . PRO A 1 289 ? -18.427 -33.505 16.517  1.00 73.31  ? 290  PRO A N   1 
ATOM   2180 C CA  . PRO A 1 289 ? -18.841 -33.435 15.108  1.00 62.42  ? 290  PRO A CA  1 
ATOM   2181 C C   . PRO A 1 289 ? -19.221 -34.795 14.521  1.00 62.06  ? 290  PRO A C   1 
ATOM   2182 O O   . PRO A 1 289 ? -20.040 -34.853 13.608  1.00 76.24  ? 290  PRO A O   1 
ATOM   2183 C CB  . PRO A 1 289 ? -17.599 -32.870 14.410  1.00 64.50  ? 290  PRO A CB  1 
ATOM   2184 C CG  . PRO A 1 289 ? -16.455 -33.346 15.255  1.00 66.05  ? 290  PRO A CG  1 
ATOM   2185 C CD  . PRO A 1 289 ? -16.972 -33.288 16.671  1.00 66.27  ? 290  PRO A CD  1 
ATOM   2186 N N   . GLN A 1 290 ? -18.634 -35.870 15.035  1.00 69.29  ? 291  GLN A N   1 
ATOM   2187 C CA  . GLN A 1 290 ? -18.992 -37.221 14.594  1.00 79.01  ? 291  GLN A CA  1 
ATOM   2188 C C   . GLN A 1 290 ? -19.132 -38.146 15.800  1.00 76.62  ? 291  GLN A C   1 
ATOM   2189 O O   . GLN A 1 290 ? -18.490 -37.923 16.832  1.00 75.37  ? 291  GLN A O   1 
ATOM   2190 C CB  . GLN A 1 290 ? -17.941 -37.772 13.618  1.00 80.65  ? 291  GLN A CB  1 
ATOM   2191 C CG  . GLN A 1 290 ? -18.281 -39.136 13.033  1.00 88.15  ? 291  GLN A CG  1 
ATOM   2192 C CD  . GLN A 1 290 ? -17.129 -39.768 12.264  1.00 97.94  ? 291  GLN A CD  1 
ATOM   2193 O OE1 . GLN A 1 290 ? -16.237 -39.072 11.751  1.00 90.53  ? 291  GLN A OE1 1 
ATOM   2194 N NE2 . GLN A 1 290 ? -17.145 -41.103 12.179  1.00 87.69  ? 291  GLN A NE2 1 
ATOM   2195 N N   . GLU A 1 291 ? -19.967 -39.176 15.686  1.00 70.34  ? 292  GLU A N   1 
ATOM   2196 C CA  . GLU A 1 291 ? -20.040 -40.179 16.743  1.00 77.73  ? 292  GLU A CA  1 
ATOM   2197 C C   . GLU A 1 291 ? -18.694 -40.911 16.850  1.00 78.38  ? 292  GLU A C   1 
ATOM   2198 O O   . GLU A 1 291 ? -18.005 -41.132 15.848  1.00 73.60  ? 292  GLU A O   1 
ATOM   2199 C CB  . GLU A 1 291 ? -21.184 -41.167 16.493  1.00 74.30  ? 292  GLU A CB  1 
ATOM   2200 C CG  . GLU A 1 291 ? -20.956 -42.117 15.325  1.00 87.65  ? 292  GLU A CG  1 
ATOM   2201 C CD  . GLU A 1 291 ? -22.230 -42.834 14.884  1.00 96.66  ? 292  GLU A CD  1 
ATOM   2202 O OE1 . GLU A 1 291 ? -23.214 -42.835 15.659  1.00 101.58 ? 292  GLU A OE1 1 
ATOM   2203 O OE2 . GLU A 1 291 ? -22.246 -43.388 13.759  1.00 91.79  ? 292  GLU A OE2 1 
ATOM   2204 N N   . SER A 1 292 ? -18.313 -41.263 18.074  1.00 72.01  ? 293  SER A N   1 
ATOM   2205 C CA  . SER A 1 292 ? -17.019 -41.885 18.327  1.00 66.83  ? 293  SER A CA  1 
ATOM   2206 C C   . SER A 1 292 ? -17.066 -42.792 19.549  1.00 65.93  ? 293  SER A C   1 
ATOM   2207 O O   . SER A 1 292 ? -17.917 -42.625 20.423  1.00 73.62  ? 293  SER A O   1 
ATOM   2208 C CB  . SER A 1 292 ? -15.939 -40.818 18.528  1.00 66.33  ? 293  SER A CB  1 
ATOM   2209 O OG  . SER A 1 292 ? -14.674 -41.420 18.775  1.00 64.55  ? 293  SER A OG  1 
ATOM   2210 N N   . VAL A 1 293 ? -16.145 -43.747 19.612  1.00 59.80  ? 294  VAL A N   1 
ATOM   2211 C CA  . VAL A 1 293 ? -15.981 -44.538 20.822  1.00 70.76  ? 294  VAL A CA  1 
ATOM   2212 C C   . VAL A 1 293 ? -15.311 -43.688 21.909  1.00 76.85  ? 294  VAL A C   1 
ATOM   2213 O O   . VAL A 1 293 ? -15.386 -44.005 23.102  1.00 76.46  ? 294  VAL A O   1 
ATOM   2214 C CB  . VAL A 1 293 ? -15.162 -45.815 20.568  1.00 59.87  ? 294  VAL A CB  1 
ATOM   2215 C CG1 . VAL A 1 293 ? -16.045 -46.892 19.916  1.00 57.95  ? 294  VAL A CG1 1 
ATOM   2216 C CG2 . VAL A 1 293 ? -13.936 -45.510 19.729  1.00 49.26  ? 294  VAL A CG2 1 
ATOM   2217 N N   . PHE A 1 294 ? -14.672 -42.601 21.479  1.00 70.69  ? 295  PHE A N   1 
ATOM   2218 C CA  . PHE A 1 294 ? -14.077 -41.622 22.385  1.00 75.36  ? 295  PHE A CA  1 
ATOM   2219 C C   . PHE A 1 294 ? -15.071 -40.492 22.704  1.00 74.10  ? 295  PHE A C   1 
ATOM   2220 O O   . PHE A 1 294 ? -15.811 -40.025 21.830  1.00 73.71  ? 295  PHE A O   1 
ATOM   2221 C CB  . PHE A 1 294 ? -12.775 -41.067 21.775  1.00 65.64  ? 295  PHE A CB  1 
ATOM   2222 C CG  . PHE A 1 294 ? -11.752 -42.142 21.462  1.00 70.49  ? 295  PHE A CG  1 
ATOM   2223 C CD1 . PHE A 1 294 ? -11.697 -42.724 20.206  1.00 61.09  ? 295  PHE A CD1 1 
ATOM   2224 C CD2 . PHE A 1 294 ? -10.872 -42.597 22.439  1.00 69.57  ? 295  PHE A CD2 1 
ATOM   2225 C CE1 . PHE A 1 294 ? -10.775 -43.731 19.927  1.00 53.62  ? 295  PHE A CE1 1 
ATOM   2226 C CE2 . PHE A 1 294 ? -9.937  -43.602 22.159  1.00 63.19  ? 295  PHE A CE2 1 
ATOM   2227 C CZ  . PHE A 1 294 ? -9.897  -44.173 20.904  1.00 49.13  ? 295  PHE A CZ  1 
ATOM   2228 N N   . ARG A 1 295 ? -15.089 -40.071 23.968  1.00 73.07  ? 296  ARG A N   1 
ATOM   2229 C CA  . ARG A 1 295 ? -15.979 -39.001 24.448  1.00 65.84  ? 296  ARG A CA  1 
ATOM   2230 C C   . ARG A 1 295 ? -15.237 -37.673 24.696  1.00 64.21  ? 296  ARG A C   1 
ATOM   2231 O O   . ARG A 1 295 ? -15.318 -37.113 25.799  1.00 69.81  ? 296  ARG A O   1 
ATOM   2232 C CB  . ARG A 1 295 ? -16.666 -39.446 25.738  1.00 65.34  ? 296  ARG A CB  1 
ATOM   2233 C CG  . ARG A 1 295 ? -17.858 -38.606 26.150  1.00 76.76  ? 296  ARG A CG  1 
ATOM   2234 C CD  . ARG A 1 295 ? -17.991 -38.558 27.663  1.00 56.18  ? 296  ARG A CD  1 
ATOM   2235 N NE  . ARG A 1 295 ? -19.179 -37.797 28.041  1.00 63.44  ? 296  ARG A NE  1 
ATOM   2236 C CZ  . ARG A 1 295 ? -20.410 -38.307 28.078  1.00 79.80  ? 296  ARG A CZ  1 
ATOM   2237 N NH1 . ARG A 1 295 ? -20.620 -39.587 27.758  1.00 78.07  ? 296  ARG A NH1 1 
ATOM   2238 N NH2 . ARG A 1 295 ? -21.435 -37.535 28.430  1.00 78.52  ? 296  ARG A NH2 1 
ATOM   2239 N N   . PHE A 1 296 ? -14.538 -37.163 23.676  1.00 64.86  ? 297  PHE A N   1 
ATOM   2240 C CA  . PHE A 1 296 ? -13.497 -36.144 23.888  1.00 51.58  ? 297  PHE A CA  1 
ATOM   2241 C C   . PHE A 1 296 ? -13.824 -34.751 23.367  1.00 57.52  ? 297  PHE A C   1 
ATOM   2242 O O   . PHE A 1 296 ? -13.166 -34.256 22.432  1.00 51.76  ? 297  PHE A O   1 
ATOM   2243 C CB  . PHE A 1 296 ? -12.178 -36.562 23.226  1.00 56.69  ? 297  PHE A CB  1 
ATOM   2244 C CG  . PHE A 1 296 ? -11.524 -37.772 23.831  1.00 56.61  ? 297  PHE A CG  1 
ATOM   2245 C CD1 . PHE A 1 296 ? -12.253 -38.732 24.513  1.00 67.27  ? 297  PHE A CD1 1 
ATOM   2246 C CD2 . PHE A 1 296 ? -10.172 -37.955 23.696  1.00 47.48  ? 297  PHE A CD2 1 
ATOM   2247 C CE1 . PHE A 1 296 ? -11.641 -39.855 25.029  1.00 67.97  ? 297  PHE A CE1 1 
ATOM   2248 C CE2 . PHE A 1 296 ? -9.556  -39.071 24.196  1.00 44.34  ? 297  PHE A CE2 1 
ATOM   2249 C CZ  . PHE A 1 296 ? -10.286 -40.021 24.871  1.00 62.87  ? 297  PHE A CZ  1 
ATOM   2250 N N   . SER A 1 297 ? -14.773 -34.076 23.995  1.00 46.56  ? 298  SER A N   1 
ATOM   2251 C CA  . SER A 1 297 ? -15.184 -32.768 23.481  1.00 49.77  ? 298  SER A CA  1 
ATOM   2252 C C   . SER A 1 297 ? -14.183 -31.606 23.655  1.00 40.83  ? 298  SER A C   1 
ATOM   2253 O O   . SER A 1 297 ? -13.892 -30.889 22.699  1.00 40.19  ? 298  SER A O   1 
ATOM   2254 C CB  . SER A 1 297 ? -16.521 -32.393 24.123  1.00 53.87  ? 298  SER A CB  1 
ATOM   2255 O OG  . SER A 1 297 ? -17.550 -33.216 23.575  1.00 62.18  ? 298  SER A OG  1 
ATOM   2256 N N   . PHE A 1 298 ? -13.693 -31.389 24.873  1.00 32.87  ? 299  PHE A N   1 
ATOM   2257 C CA  . PHE A 1 298 ? -12.814 -30.256 25.110  1.00 33.04  ? 299  PHE A CA  1 
ATOM   2258 C C   . PHE A 1 298 ? -11.412 -30.741 25.456  1.00 37.71  ? 299  PHE A C   1 
ATOM   2259 O O   . PHE A 1 298 ? -11.218 -31.448 26.452  1.00 29.75  ? 299  PHE A O   1 
ATOM   2260 C CB  . PHE A 1 298 ? -13.400 -29.360 26.193  1.00 29.13  ? 299  PHE A CB  1 
ATOM   2261 C CG  . PHE A 1 298 ? -14.716 -28.769 25.793  1.00 31.13  ? 299  PHE A CG  1 
ATOM   2262 C CD1 . PHE A 1 298 ? -14.759 -27.704 24.889  1.00 29.67  ? 299  PHE A CD1 1 
ATOM   2263 C CD2 . PHE A 1 298 ? -15.918 -29.325 26.255  1.00 32.24  ? 299  PHE A CD2 1 
ATOM   2264 C CE1 . PHE A 1 298 ? -15.976 -27.161 24.469  1.00 32.76  ? 299  PHE A CE1 1 
ATOM   2265 C CE2 . PHE A 1 298 ? -17.143 -28.801 25.840  1.00 33.12  ? 299  PHE A CE2 1 
ATOM   2266 C CZ  . PHE A 1 298 ? -17.174 -27.715 24.951  1.00 34.84  ? 299  PHE A CZ  1 
ATOM   2267 N N   . VAL A 1 299 ? -10.459 -30.395 24.588  1.00 28.26  ? 300  VAL A N   1 
ATOM   2268 C CA  . VAL A 1 299 ? -9.078  -30.879 24.689  1.00 27.21  ? 300  VAL A CA  1 
ATOM   2269 C C   . VAL A 1 299 ? -8.120  -29.701 24.473  1.00 27.71  ? 300  VAL A C   1 
ATOM   2270 O O   . VAL A 1 299 ? -8.568  -28.608 24.132  1.00 27.36  ? 300  VAL A O   1 
ATOM   2271 C CB  . VAL A 1 299 ? -8.795  -32.027 23.669  1.00 28.41  ? 300  VAL A CB  1 
ATOM   2272 C CG1 . VAL A 1 299 ? -9.721  -33.221 23.942  1.00 27.03  ? 300  VAL A CG1 1 
ATOM   2273 C CG2 . VAL A 1 299 ? -8.910  -31.530 22.205  1.00 25.06  ? 300  VAL A CG2 1 
ATOM   2274 N N   . PRO A 1 300 ? -6.809  -29.888 24.731  1.00 31.07  ? 301  PRO A N   1 
ATOM   2275 C CA  . PRO A 1 300 ? -5.873  -28.778 24.499  1.00 30.97  ? 301  PRO A CA  1 
ATOM   2276 C C   . PRO A 1 300 ? -5.999  -28.166 23.100  1.00 28.68  ? 301  PRO A C   1 
ATOM   2277 O O   . PRO A 1 300 ? -6.232  -28.884 22.120  1.00 28.48  ? 301  PRO A O   1 
ATOM   2278 C CB  . PRO A 1 300 ? -4.510  -29.442 24.691  1.00 30.66  ? 301  PRO A CB  1 
ATOM   2279 C CG  . PRO A 1 300 ? -4.782  -30.409 25.804  1.00 29.84  ? 301  PRO A CG  1 
ATOM   2280 C CD  . PRO A 1 300 ? -6.139  -31.011 25.410  1.00 27.59  ? 301  PRO A CD  1 
ATOM   2281 N N   . VAL A 1 301 ? -5.918  -26.840 23.022  1.00 31.61  ? 302  VAL A N   1 
ATOM   2282 C CA  . VAL A 1 301 ? -6.055  -26.157 21.741  1.00 32.20  ? 302  VAL A CA  1 
ATOM   2283 C C   . VAL A 1 301 ? -4.666  -25.662 21.294  1.00 31.57  ? 302  VAL A C   1 
ATOM   2284 O O   . VAL A 1 301 ? -3.875  -25.143 22.111  1.00 33.06  ? 302  VAL A O   1 
ATOM   2285 C CB  . VAL A 1 301 ? -7.072  -24.960 21.823  1.00 33.27  ? 302  VAL A CB  1 
ATOM   2286 C CG1 . VAL A 1 301 ? -6.657  -23.937 22.873  1.00 33.47  ? 302  VAL A CG1 1 
ATOM   2287 C CG2 . VAL A 1 301 ? -7.235  -24.265 20.453  1.00 36.28  ? 302  VAL A CG2 1 
ATOM   2288 N N   . VAL A 1 302 ? -4.365  -25.830 20.013  1.00 34.56  ? 303  VAL A N   1 
ATOM   2289 C CA  . VAL A 1 302 ? -3.163  -25.224 19.439  1.00 34.24  ? 303  VAL A CA  1 
ATOM   2290 C C   . VAL A 1 302 ? -3.460  -23.795 19.011  1.00 35.61  ? 303  VAL A C   1 
ATOM   2291 O O   . VAL A 1 302 ? -4.088  -23.557 17.978  1.00 39.73  ? 303  VAL A O   1 
ATOM   2292 C CB  . VAL A 1 302 ? -2.632  -26.020 18.234  1.00 35.22  ? 303  VAL A CB  1 
ATOM   2293 C CG1 . VAL A 1 302 ? -1.354  -25.357 17.691  1.00 34.90  ? 303  VAL A CG1 1 
ATOM   2294 C CG2 . VAL A 1 302 ? -2.320  -27.434 18.653  1.00 31.55  ? 303  VAL A CG2 1 
ATOM   2295 N N   . ASP A 1 303 ? -2.998  -22.835 19.794  1.00 43.31  ? 304  ASP A N   1 
ATOM   2296 C CA  . ASP A 1 303 ? -3.319  -21.449 19.493  1.00 46.48  ? 304  ASP A CA  1 
ATOM   2297 C C   . ASP A 1 303 ? -2.114  -20.510 19.574  1.00 45.87  ? 304  ASP A C   1 
ATOM   2298 O O   . ASP A 1 303 ? -2.282  -19.305 19.736  1.00 51.22  ? 304  ASP A O   1 
ATOM   2299 C CB  . ASP A 1 303 ? -4.402  -20.967 20.447  1.00 41.81  ? 304  ASP A CB  1 
ATOM   2300 C CG  . ASP A 1 303 ? -3.877  -20.764 21.870  1.00 52.32  ? 304  ASP A CG  1 
ATOM   2301 O OD1 . ASP A 1 303 ? -2.821  -21.364 22.240  1.00 44.49  ? 304  ASP A OD1 1 
ATOM   2302 O OD2 . ASP A 1 303 ? -4.537  -19.999 22.616  1.00 59.45  ? 304  ASP A OD2 1 
ATOM   2303 N N   . GLY A 1 304 ? -0.905  -21.059 19.512  1.00 39.33  ? 305  GLY A N   1 
ATOM   2304 C CA  . GLY A 1 304 ? 0.287   -20.226 19.520  1.00 41.84  ? 305  GLY A CA  1 
ATOM   2305 C C   . GLY A 1 304 ? 0.851   -19.911 20.894  1.00 53.45  ? 305  GLY A C   1 
ATOM   2306 O O   . GLY A 1 304 ? 2.009   -19.487 21.011  1.00 47.38  ? 305  GLY A O   1 
ATOM   2307 N N   . ASP A 1 305 ? 0.056   -20.120 21.944  1.00 40.49  ? 306  ASP A N   1 
ATOM   2308 C CA  . ASP A 1 305 ? 0.498   -19.726 23.272  1.00 42.23  ? 306  ASP A CA  1 
ATOM   2309 C C   . ASP A 1 305 ? 1.133   -20.927 23.994  1.00 45.41  ? 306  ASP A C   1 
ATOM   2310 O O   . ASP A 1 305 ? 2.339   -21.105 23.913  1.00 36.67  ? 306  ASP A O   1 
ATOM   2311 C CB  . ASP A 1 305 ? -0.661  -19.125 24.076  1.00 45.44  ? 306  ASP A CB  1 
ATOM   2312 C CG  . ASP A 1 305 ? -0.189  -18.433 25.336  1.00 47.65  ? 306  ASP A CG  1 
ATOM   2313 O OD1 . ASP A 1 305 ? 1.043   -18.288 25.495  1.00 51.60  ? 306  ASP A OD1 1 
ATOM   2314 O OD2 . ASP A 1 305 ? -1.039  -18.032 26.166  1.00 51.45  ? 306  ASP A OD2 1 
ATOM   2315 N N   . PHE A 1 306 ? 0.344   -21.761 24.673  1.00 36.36  ? 307  PHE A N   1 
ATOM   2316 C CA  . PHE A 1 306 ? 0.913   -22.940 25.323  1.00 35.16  ? 307  PHE A CA  1 
ATOM   2317 C C   . PHE A 1 306 ? 1.695   -23.789 24.348  1.00 33.48  ? 307  PHE A C   1 
ATOM   2318 O O   . PHE A 1 306 ? 2.811   -24.225 24.638  1.00 35.48  ? 307  PHE A O   1 
ATOM   2319 C CB  . PHE A 1 306 ? -0.168  -23.806 25.966  1.00 32.62  ? 307  PHE A CB  1 
ATOM   2320 C CG  . PHE A 1 306 ? 0.362   -24.719 27.032  1.00 30.75  ? 307  PHE A CG  1 
ATOM   2321 C CD1 . PHE A 1 306 ? 0.978   -25.922 26.702  1.00 29.77  ? 307  PHE A CD1 1 
ATOM   2322 C CD2 . PHE A 1 306 ? 0.258   -24.365 28.363  1.00 26.02  ? 307  PHE A CD2 1 
ATOM   2323 C CE1 . PHE A 1 306 ? 1.482   -26.764 27.706  1.00 30.08  ? 307  PHE A CE1 1 
ATOM   2324 C CE2 . PHE A 1 306 ? 0.740   -25.202 29.362  1.00 32.32  ? 307  PHE A CE2 1 
ATOM   2325 C CZ  . PHE A 1 306 ? 1.357   -26.401 29.028  1.00 30.18  ? 307  PHE A CZ  1 
ATOM   2326 N N   . LEU A 1 307 ? 1.079   -24.034 23.203  1.00 35.32  ? 308  LEU A N   1 
ATOM   2327 C CA  . LEU A 1 307 ? 1.693   -24.750 22.105  1.00 40.37  ? 308  LEU A CA  1 
ATOM   2328 C C   . LEU A 1 307 ? 1.828   -23.770 20.927  1.00 39.30  ? 308  LEU A C   1 
ATOM   2329 O O   . LEU A 1 307 ? 0.821   -23.353 20.364  1.00 40.19  ? 308  LEU A O   1 
ATOM   2330 C CB  . LEU A 1 307 ? 0.843   -25.966 21.705  1.00 34.93  ? 308  LEU A CB  1 
ATOM   2331 C CG  . LEU A 1 307 ? 0.545   -27.054 22.737  1.00 38.49  ? 308  LEU A CG  1 
ATOM   2332 C CD1 . LEU A 1 307 ? -0.522  -28.019 22.206  1.00 36.39  ? 308  LEU A CD1 1 
ATOM   2333 C CD2 . LEU A 1 307 ? 1.830   -27.835 23.088  1.00 32.44  ? 308  LEU A CD2 1 
ATOM   2334 N N   . SER A 1 308 ? 3.053   -23.380 20.581  1.00 39.17  ? 309  SER A N   1 
ATOM   2335 C CA  . SER A 1 308 ? 3.283   -22.416 19.498  1.00 41.14  ? 309  SER A CA  1 
ATOM   2336 C C   . SER A 1 308 ? 3.030   -23.035 18.119  1.00 40.22  ? 309  SER A C   1 
ATOM   2337 O O   . SER A 1 308 ? 2.863   -22.327 17.141  1.00 47.19  ? 309  SER A O   1 
ATOM   2338 C CB  . SER A 1 308 ? 4.705   -21.854 19.571  1.00 44.97  ? 309  SER A CB  1 
ATOM   2339 O OG  . SER A 1 308 ? 5.666   -22.867 19.332  1.00 48.00  ? 309  SER A OG  1 
ATOM   2340 N N   . ASP A 1 309 ? 2.966   -24.360 18.058  1.00 40.23  ? 310  ASP A N   1 
ATOM   2341 C CA  . ASP A 1 309 ? 2.614   -25.054 16.820  1.00 38.92  ? 310  ASP A CA  1 
ATOM   2342 C C   . ASP A 1 309 ? 1.995   -26.396 17.192  1.00 37.71  ? 310  ASP A C   1 
ATOM   2343 O O   . ASP A 1 309 ? 1.934   -26.719 18.363  1.00 40.75  ? 310  ASP A O   1 
ATOM   2344 C CB  . ASP A 1 309 ? 3.857   -25.242 15.939  1.00 44.22  ? 310  ASP A CB  1 
ATOM   2345 C CG  . ASP A 1 309 ? 3.535   -25.219 14.447  1.00 48.87  ? 310  ASP A CG  1 
ATOM   2346 O OD1 . ASP A 1 309 ? 2.416   -25.628 14.064  1.00 41.86  ? 310  ASP A OD1 1 
ATOM   2347 O OD2 . ASP A 1 309 ? 4.415   -24.794 13.664  1.00 58.97  ? 310  ASP A OD2 1 
ATOM   2348 N N   . THR A 1 310 ? 1.557   -27.188 16.222  1.00 38.34  ? 311  THR A N   1 
ATOM   2349 C CA  . THR A 1 310 ? 1.076   -28.535 16.530  1.00 36.50  ? 311  THR A CA  1 
ATOM   2350 C C   . THR A 1 310 ? 2.172   -29.367 17.212  1.00 38.39  ? 311  THR A C   1 
ATOM   2351 O O   . THR A 1 310 ? 3.349   -29.140 16.973  1.00 36.97  ? 311  THR A O   1 
ATOM   2352 C CB  . THR A 1 310 ? 0.641   -29.280 15.277  1.00 40.75  ? 311  THR A CB  1 
ATOM   2353 O OG1 . THR A 1 310 ? 1.816   -29.690 14.563  1.00 45.56  ? 311  THR A OG1 1 
ATOM   2354 C CG2 . THR A 1 310 ? -0.241  -28.388 14.404  1.00 34.52  ? 311  THR A CG2 1 
ATOM   2355 N N   . PRO A 1 311 ? 1.787   -30.323 18.072  1.00 40.86  ? 312  PRO A N   1 
ATOM   2356 C CA  . PRO A 1 311 ? 2.818   -31.158 18.694  1.00 39.85  ? 312  PRO A CA  1 
ATOM   2357 C C   . PRO A 1 311 ? 3.675   -31.878 17.641  1.00 38.65  ? 312  PRO A C   1 
ATOM   2358 O O   . PRO A 1 311 ? 4.854   -32.082 17.860  1.00 39.63  ? 312  PRO A O   1 
ATOM   2359 C CB  . PRO A 1 311 ? 2.005   -32.152 19.541  1.00 33.26  ? 312  PRO A CB  1 
ATOM   2360 C CG  . PRO A 1 311 ? 0.765   -31.361 19.915  1.00 36.65  ? 312  PRO A CG  1 
ATOM   2361 C CD  . PRO A 1 311 ? 0.468   -30.485 18.715  1.00 36.29  ? 312  PRO A CD  1 
ATOM   2362 N N   . GLU A 1 312 ? 3.079   -32.271 16.529  1.00 45.45  ? 313  GLU A N   1 
ATOM   2363 C CA  A GLU A 1 312 ? 3.838   -32.867 15.439  0.58 43.37  ? 313  GLU A CA  1 
ATOM   2364 C CA  B GLU A 1 312 ? 3.828   -32.849 15.406  0.42 43.42  ? 313  GLU A CA  1 
ATOM   2365 C C   . GLU A 1 312 ? 4.944   -31.925 14.951  1.00 42.84  ? 313  GLU A C   1 
ATOM   2366 O O   . GLU A 1 312 ? 6.113   -32.312 14.885  1.00 42.19  ? 313  GLU A O   1 
ATOM   2367 C CB  A GLU A 1 312 ? 2.900   -33.220 14.297  0.58 44.89  ? 313  GLU A CB  1 
ATOM   2368 C CB  B GLU A 1 312 ? 2.909   -33.124 14.214  0.42 44.90  ? 313  GLU A CB  1 
ATOM   2369 C CG  A GLU A 1 312 ? 3.602   -33.475 12.999  0.58 50.71  ? 313  GLU A CG  1 
ATOM   2370 C CG  B GLU A 1 312 ? 1.896   -34.226 14.415  0.42 47.65  ? 313  GLU A CG  1 
ATOM   2371 C CD  A GLU A 1 312 ? 2.634   -33.743 11.882  0.58 48.88  ? 313  GLU A CD  1 
ATOM   2372 C CD  B GLU A 1 312 ? 2.477   -35.606 14.274  0.42 49.84  ? 313  GLU A CD  1 
ATOM   2373 O OE1 A GLU A 1 312 ? 1.681   -34.522 12.098  0.58 50.70  ? 313  GLU A OE1 1 
ATOM   2374 O OE1 B GLU A 1 312 ? 3.711   -35.750 14.430  0.42 48.54  ? 313  GLU A OE1 1 
ATOM   2375 O OE2 A GLU A 1 312 ? 2.826   -33.165 10.796  0.58 48.15  ? 313  GLU A OE2 1 
ATOM   2376 O OE2 B GLU A 1 312 ? 1.689   -36.544 14.003  0.42 46.38  ? 313  GLU A OE2 1 
ATOM   2377 N N   . ALA A 1 313 ? 4.568   -30.694 14.617  1.00 36.01  ? 314  ALA A N   1 
ATOM   2378 C CA  . ALA A 1 313 ? 5.539   -29.700 14.181  1.00 37.00  ? 314  ALA A CA  1 
ATOM   2379 C C   . ALA A 1 313 ? 6.617   -29.471 15.237  1.00 45.95  ? 314  ALA A C   1 
ATOM   2380 O O   . ALA A 1 313 ? 7.807   -29.367 14.911  1.00 43.03  ? 314  ALA A O   1 
ATOM   2381 C CB  . ALA A 1 313 ? 4.849   -28.398 13.854  1.00 41.69  ? 314  ALA A CB  1 
ATOM   2382 N N   . LEU A 1 314 ? 6.196   -29.379 16.501  1.00 42.20  ? 315  LEU A N   1 
ATOM   2383 C CA  . LEU A 1 314 ? 7.107   -29.056 17.585  1.00 36.42  ? 315  LEU A CA  1 
ATOM   2384 C C   . LEU A 1 314 ? 8.074   -30.201 17.791  1.00 40.40  ? 315  LEU A C   1 
ATOM   2385 O O   . LEU A 1 314 ? 9.254   -29.987 18.079  1.00 37.88  ? 315  LEU A O   1 
ATOM   2386 C CB  . LEU A 1 314 ? 6.342   -28.753 18.875  1.00 39.23  ? 315  LEU A CB  1 
ATOM   2387 C CG  . LEU A 1 314 ? 5.603   -27.422 18.839  1.00 42.90  ? 315  LEU A CG  1 
ATOM   2388 C CD1 . LEU A 1 314 ? 4.788   -27.229 20.091  1.00 38.78  ? 315  LEU A CD1 1 
ATOM   2389 C CD2 . LEU A 1 314 ? 6.609   -26.285 18.655  1.00 46.75  ? 315  LEU A CD2 1 
ATOM   2390 N N   . ILE A 1 315 ? 7.571   -31.419 17.615  1.00 38.28  ? 316  ILE A N   1 
ATOM   2391 C CA  . ILE A 1 315 ? 8.380   -32.613 17.796  1.00 37.83  ? 316  ILE A CA  1 
ATOM   2392 C C   . ILE A 1 315 ? 9.453   -32.702 16.701  1.00 48.01  ? 316  ILE A C   1 
ATOM   2393 O O   . ILE A 1 315 ? 10.612  -32.949 17.007  1.00 45.47  ? 316  ILE A O   1 
ATOM   2394 C CB  . ILE A 1 315 ? 7.496   -33.882 17.823  1.00 37.44  ? 316  ILE A CB  1 
ATOM   2395 C CG1 . ILE A 1 315 ? 6.795   -34.000 19.175  1.00 44.15  ? 316  ILE A CG1 1 
ATOM   2396 C CG2 . ILE A 1 315 ? 8.315   -35.154 17.676  1.00 37.77  ? 316  ILE A CG2 1 
ATOM   2397 C CD1 . ILE A 1 315 ? 5.553   -34.869 19.117  1.00 37.25  ? 316  ILE A CD1 1 
ATOM   2398 N N   . ASN A 1 316 ? 9.077   -32.477 15.440  1.00 43.47  ? 317  ASN A N   1 
ATOM   2399 C CA  . ASN A 1 316 ? 10.035  -32.525 14.325  1.00 49.58  ? 317  ASN A CA  1 
ATOM   2400 C C   . ASN A 1 316 ? 11.129  -31.460 14.395  1.00 47.19  ? 317  ASN A C   1 
ATOM   2401 O O   . ASN A 1 316 ? 12.254  -31.700 13.973  1.00 58.42  ? 317  ASN A O   1 
ATOM   2402 C CB  . ASN A 1 316 ? 9.297   -32.406 12.996  1.00 44.31  ? 317  ASN A CB  1 
ATOM   2403 C CG  . ASN A 1 316 ? 8.362   -33.571 12.756  1.00 44.87  ? 317  ASN A CG  1 
ATOM   2404 O OD1 . ASN A 1 316 ? 8.533   -34.643 13.339  1.00 52.86  ? 317  ASN A OD1 1 
ATOM   2405 N ND2 . ASN A 1 316 ? 7.364   -33.370 11.901  1.00 52.63  ? 317  ASN A ND2 1 
ATOM   2406 N N   . ALA A 1 317 ? 10.806  -30.305 14.962  1.00 42.40  ? 318  ALA A N   1 
ATOM   2407 C CA  . ALA A 1 317 ? 11.727  -29.179 15.010  1.00 47.46  ? 318  ALA A CA  1 
ATOM   2408 C C   . ALA A 1 317 ? 12.660  -29.203 16.225  1.00 56.26  ? 318  ALA A C   1 
ATOM   2409 O O   . ALA A 1 317 ? 13.567  -28.375 16.348  1.00 55.64  ? 318  ALA A O   1 
ATOM   2410 C CB  . ALA A 1 317 ? 10.941  -27.874 15.004  1.00 43.68  ? 318  ALA A CB  1 
ATOM   2411 N N   . GLY A 1 318 ? 12.435  -30.138 17.133  1.00 48.46  ? 319  GLY A N   1 
ATOM   2412 C CA  . GLY A 1 318 ? 12.999  -29.992 18.458  1.00 39.91  ? 319  GLY A CA  1 
ATOM   2413 C C   . GLY A 1 318 ? 14.375  -30.581 18.597  1.00 33.07  ? 319  GLY A C   1 
ATOM   2414 O O   . GLY A 1 318 ? 14.699  -31.583 17.967  1.00 39.75  ? 319  GLY A O   1 
ATOM   2415 N N   . ASP A 1 319 ? 15.183  -29.943 19.428  1.00 41.54  ? 320  ASP A N   1 
ATOM   2416 C CA  . ASP A 1 319 ? 16.492  -30.461 19.793  1.00 45.51  ? 320  ASP A CA  1 
ATOM   2417 C C   . ASP A 1 319 ? 16.302  -31.195 21.106  1.00 44.02  ? 320  ASP A C   1 
ATOM   2418 O O   . ASP A 1 319 ? 16.092  -30.552 22.125  1.00 37.73  ? 320  ASP A O   1 
ATOM   2419 C CB  . ASP A 1 319 ? 17.510  -29.315 19.931  1.00 40.97  ? 320  ASP A CB  1 
ATOM   2420 C CG  . ASP A 1 319 ? 18.919  -29.794 20.321  1.00 46.90  ? 320  ASP A CG  1 
ATOM   2421 O OD1 . ASP A 1 319 ? 19.072  -30.951 20.765  1.00 46.84  ? 320  ASP A OD1 1 
ATOM   2422 O OD2 . ASP A 1 319 ? 19.889  -28.999 20.175  1.00 49.56  ? 320  ASP A OD2 1 
ATOM   2423 N N   . PHE A 1 320 ? 16.380  -32.522 21.120  1.00 37.90  ? 321  PHE A N   1 
ATOM   2424 C CA  . PHE A 1 320 ? 16.104  -33.178 22.396  1.00 40.67  ? 321  PHE A CA  1 
ATOM   2425 C C   . PHE A 1 320 ? 17.313  -33.850 23.048  1.00 45.72  ? 321  PHE A C   1 
ATOM   2426 O O   . PHE A 1 320 ? 17.143  -34.763 23.851  1.00 39.73  ? 321  PHE A O   1 
ATOM   2427 C CB  . PHE A 1 320 ? 14.956  -34.187 22.232  1.00 38.51  ? 321  PHE A CB  1 
ATOM   2428 C CG  . PHE A 1 320 ? 13.656  -33.550 21.808  1.00 40.61  ? 321  PHE A CG  1 
ATOM   2429 C CD1 . PHE A 1 320 ? 12.846  -32.923 22.742  1.00 34.27  ? 321  PHE A CD1 1 
ATOM   2430 C CD2 . PHE A 1 320 ? 13.271  -33.538 20.470  1.00 37.96  ? 321  PHE A CD2 1 
ATOM   2431 C CE1 . PHE A 1 320 ? 11.656  -32.326 22.368  1.00 34.50  ? 321  PHE A CE1 1 
ATOM   2432 C CE2 . PHE A 1 320 ? 12.071  -32.942 20.077  1.00 40.59  ? 321  PHE A CE2 1 
ATOM   2433 C CZ  . PHE A 1 320 ? 11.267  -32.332 21.020  1.00 40.20  ? 321  PHE A CZ  1 
ATOM   2434 N N   . HIS A 1 321 ? 18.525  -33.395 22.728  1.00 46.60  ? 322  HIS A N   1 
ATOM   2435 C CA  . HIS A 1 321 ? 19.711  -33.822 23.479  1.00 42.39  ? 322  HIS A CA  1 
ATOM   2436 C C   . HIS A 1 321 ? 19.548  -33.402 24.936  1.00 37.95  ? 322  HIS A C   1 
ATOM   2437 O O   . HIS A 1 321 ? 19.110  -32.290 25.228  1.00 39.75  ? 322  HIS A O   1 
ATOM   2438 C CB  . HIS A 1 321 ? 21.002  -33.228 22.897  1.00 43.28  ? 322  HIS A CB  1 
ATOM   2439 C CG  . HIS A 1 321 ? 21.378  -33.825 21.585  1.00 35.63  ? 322  HIS A CG  1 
ATOM   2440 N ND1 . HIS A 1 321 ? 21.005  -33.265 20.379  1.00 39.22  ? 322  HIS A ND1 1 
ATOM   2441 C CD2 . HIS A 1 321 ? 22.005  -34.989 21.288  1.00 36.37  ? 322  HIS A CD2 1 
ATOM   2442 C CE1 . HIS A 1 321 ? 21.420  -34.043 19.395  1.00 38.20  ? 322  HIS A CE1 1 
ATOM   2443 N NE2 . HIS A 1 321 ? 22.029  -35.093 19.918  1.00 38.05  ? 322  HIS A NE2 1 
ATOM   2444 N N   . GLY A 1 322 ? 19.888  -34.301 25.849  1.00 36.93  ? 323  GLY A N   1 
ATOM   2445 C CA  . GLY A 1 322 ? 19.731  -34.007 27.262  1.00 43.71  ? 323  GLY A CA  1 
ATOM   2446 C C   . GLY A 1 322 ? 18.437  -34.557 27.837  1.00 43.78  ? 323  GLY A C   1 
ATOM   2447 O O   . GLY A 1 322 ? 18.274  -34.607 29.039  1.00 46.55  ? 323  GLY A O   1 
ATOM   2448 N N   . LEU A 1 323 ? 17.515  -34.979 26.975  1.00 44.91  ? 324  LEU A N   1 
ATOM   2449 C CA  . LEU A 1 323 ? 16.263  -35.560 27.440  1.00 39.35  ? 324  LEU A CA  1 
ATOM   2450 C C   . LEU A 1 323 ? 16.356  -37.087 27.534  1.00 34.37  ? 324  LEU A C   1 
ATOM   2451 O O   . LEU A 1 323 ? 16.847  -37.757 26.612  1.00 37.97  ? 324  LEU A O   1 
ATOM   2452 C CB  . LEU A 1 323 ? 15.114  -35.167 26.501  1.00 42.56  ? 324  LEU A CB  1 
ATOM   2453 C CG  . LEU A 1 323 ? 13.711  -35.614 26.921  1.00 36.31  ? 324  LEU A CG  1 
ATOM   2454 C CD1 . LEU A 1 323 ? 13.344  -34.957 28.248  1.00 39.44  ? 324  LEU A CD1 1 
ATOM   2455 C CD2 . LEU A 1 323 ? 12.665  -35.288 25.832  1.00 34.81  ? 324  LEU A CD2 1 
ATOM   2456 N N   . GLN A 1 324 ? 15.878  -37.633 28.644  1.00 31.57  ? 325  GLN A N   1 
ATOM   2457 C CA  . GLN A 1 324 ? 15.585  -39.061 28.726  1.00 36.04  ? 325  GLN A CA  1 
ATOM   2458 C C   . GLN A 1 324 ? 14.088  -39.248 28.892  1.00 36.16  ? 325  GLN A C   1 
ATOM   2459 O O   . GLN A 1 324 ? 13.434  -38.529 29.672  1.00 29.14  ? 325  GLN A O   1 
ATOM   2460 C CB  . GLN A 1 324 ? 16.310  -39.744 29.885  1.00 38.24  ? 325  GLN A CB  1 
ATOM   2461 C CG  . GLN A 1 324 ? 17.832  -39.679 29.814  1.00 44.84  ? 325  GLN A CG  1 
ATOM   2462 C CD  . GLN A 1 324 ? 18.372  -38.447 30.497  1.00 43.91  ? 325  GLN A CD  1 
ATOM   2463 O OE1 . GLN A 1 324 ? 18.031  -38.158 31.650  1.00 44.59  ? 325  GLN A OE1 1 
ATOM   2464 N NE2 . GLN A 1 324 ? 19.205  -37.696 29.783  1.00 45.73  ? 325  GLN A NE2 1 
ATOM   2465 N N   . VAL A 1 325 ? 13.553  -40.224 28.171  1.00 29.68  ? 326  VAL A N   1 
ATOM   2466 C CA  . VAL A 1 325 ? 12.118  -40.450 28.145  1.00 33.50  ? 326  VAL A CA  1 
ATOM   2467 C C   . VAL A 1 325 ? 11.872  -41.944 28.187  1.00 32.91  ? 326  VAL A C   1 
ATOM   2468 O O   . VAL A 1 325 ? 12.591  -42.723 27.557  1.00 37.20  ? 326  VAL A O   1 
ATOM   2469 C CB  . VAL A 1 325 ? 11.456  -39.819 26.881  1.00 40.31  ? 326  VAL A CB  1 
ATOM   2470 C CG1 . VAL A 1 325 ? 10.018  -40.082 26.862  1.00 38.05  ? 326  VAL A CG1 1 
ATOM   2471 C CG2 . VAL A 1 325 ? 11.565  -38.350 26.949  1.00 41.94  ? 326  VAL A CG2 1 
ATOM   2472 N N   . LEU A 1 326 ? 10.876  -42.337 28.968  1.00 31.64  ? 327  LEU A N   1 
ATOM   2473 C CA  . LEU A 1 326 ? 10.427  -43.716 29.049  1.00 31.39  ? 327  LEU A CA  1 
ATOM   2474 C C   . LEU A 1 326 ? 9.021   -43.742 28.446  1.00 33.75  ? 327  LEU A C   1 
ATOM   2475 O O   . LEU A 1 326 ? 8.161   -42.963 28.867  1.00 30.24  ? 327  LEU A O   1 
ATOM   2476 C CB  . LEU A 1 326 ? 10.452  -44.186 30.506  1.00 27.48  ? 327  LEU A CB  1 
ATOM   2477 C CG  . LEU A 1 326 ? 9.849   -45.527 30.953  1.00 31.45  ? 327  LEU A CG  1 
ATOM   2478 C CD1 . LEU A 1 326 ? 10.496  -46.684 30.287  1.00 26.76  ? 327  LEU A CD1 1 
ATOM   2479 C CD2 . LEU A 1 326 ? 9.967   -45.693 32.488  1.00 31.13  ? 327  LEU A CD2 1 
ATOM   2480 N N   . VAL A 1 327 ? 8.790   -44.571 27.422  1.00 26.49  ? 328  VAL A N   1 
ATOM   2481 C CA  . VAL A 1 327 ? 7.477   -44.602 26.775  1.00 27.03  ? 328  VAL A CA  1 
ATOM   2482 C C   . VAL A 1 327 ? 7.043   -46.030 26.553  1.00 29.07  ? 328  VAL A C   1 
ATOM   2483 O O   . VAL A 1 327 ? 7.862   -46.941 26.446  1.00 29.34  ? 328  VAL A O   1 
ATOM   2484 C CB  . VAL A 1 327 ? 7.444   -43.841 25.386  1.00 31.44  ? 328  VAL A CB  1 
ATOM   2485 C CG1 . VAL A 1 327 ? 7.995   -42.442 25.531  1.00 26.74  ? 328  VAL A CG1 1 
ATOM   2486 C CG2 . VAL A 1 327 ? 8.215   -44.596 24.302  1.00 22.36  ? 328  VAL A CG2 1 
ATOM   2487 N N   . GLY A 1 328 ? 5.742   -46.251 26.495  1.00 29.22  ? 329  GLY A N   1 
ATOM   2488 C CA  . GLY A 1 328 ? 5.285   -47.583 26.166  1.00 26.52  ? 329  GLY A CA  1 
ATOM   2489 C C   . GLY A 1 328 ? 3.796   -47.683 26.023  1.00 27.17  ? 329  GLY A C   1 
ATOM   2490 O O   . GLY A 1 328 ? 3.069   -46.684 26.134  1.00 29.42  ? 329  GLY A O   1 
ATOM   2491 N N   . VAL A 1 329 ? 3.348   -48.917 25.805  1.00 30.51  ? 330  VAL A N   1 
ATOM   2492 C CA  . VAL A 1 329 ? 1.952   -49.218 25.508  1.00 26.43  ? 330  VAL A CA  1 
ATOM   2493 C C   . VAL A 1 329 ? 1.603   -50.525 26.157  1.00 28.70  ? 330  VAL A C   1 
ATOM   2494 O O   . VAL A 1 329 ? 2.504   -51.270 26.539  1.00 27.90  ? 330  VAL A O   1 
ATOM   2495 C CB  . VAL A 1 329 ? 1.716   -49.340 23.988  1.00 27.66  ? 330  VAL A CB  1 
ATOM   2496 C CG1 . VAL A 1 329 ? 2.024   -48.018 23.293  1.00 23.56  ? 330  VAL A CG1 1 
ATOM   2497 C CG2 . VAL A 1 329 ? 2.598   -50.468 23.416  1.00 25.52  ? 330  VAL A CG2 1 
ATOM   2498 N N   . VAL A 1 330 ? 0.309   -50.820 26.288  1.00 29.67  ? 331  VAL A N   1 
ATOM   2499 C CA  . VAL A 1 330 ? -0.103  -52.162 26.697  1.00 29.54  ? 331  VAL A CA  1 
ATOM   2500 C C   . VAL A 1 330 ? -0.304  -53.020 25.447  1.00 33.95  ? 331  VAL A C   1 
ATOM   2501 O O   . VAL A 1 330 ? -0.334  -52.508 24.323  1.00 31.11  ? 331  VAL A O   1 
ATOM   2502 C CB  . VAL A 1 330 ? -1.406  -52.165 27.517  1.00 33.20  ? 331  VAL A CB  1 
ATOM   2503 C CG1 . VAL A 1 330 ? -1.204  -51.442 28.865  1.00 27.52  ? 331  VAL A CG1 1 
ATOM   2504 C CG2 . VAL A 1 330 ? -2.557  -51.558 26.697  1.00 28.61  ? 331  VAL A CG2 1 
ATOM   2505 N N   . LYS A 1 331 ? -0.448  -54.321 25.642  1.00 34.86  ? 332  LYS A N   1 
ATOM   2506 C CA  . LYS A 1 331 ? -0.493  -55.250 24.516  1.00 36.91  ? 332  LYS A CA  1 
ATOM   2507 C C   . LYS A 1 331 ? -1.745  -55.055 23.667  1.00 36.09  ? 332  LYS A C   1 
ATOM   2508 O O   . LYS A 1 331 ? -1.680  -55.191 22.465  1.00 31.46  ? 332  LYS A O   1 
ATOM   2509 C CB  . LYS A 1 331 ? -0.404  -56.694 25.016  1.00 38.05  ? 332  LYS A CB  1 
ATOM   2510 C CG  . LYS A 1 331 ? -0.205  -57.745 23.919  1.00 39.42  ? 332  LYS A CG  1 
ATOM   2511 C CD  . LYS A 1 331 ? -0.119  -59.146 24.552  1.00 49.74  ? 332  LYS A CD  1 
ATOM   2512 C CE  . LYS A 1 331 ? 0.170   -60.235 23.515  1.00 58.30  ? 332  LYS A CE  1 
ATOM   2513 N NZ  . LYS A 1 331 ? -0.942  -60.406 22.525  1.00 55.37  ? 332  LYS A NZ  1 
ATOM   2514 N N   . ASP A 1 332 ? -2.872  -54.695 24.276  1.00 35.51  ? 333  ASP A N   1 
ATOM   2515 C CA  . ASP A 1 332 ? -4.086  -54.473 23.493  1.00 30.08  ? 333  ASP A CA  1 
ATOM   2516 C C   . ASP A 1 332 ? -4.735  -53.109 23.738  1.00 34.93  ? 333  ASP A C   1 
ATOM   2517 O O   . ASP A 1 332 ? -5.792  -53.036 24.382  1.00 33.95  ? 333  ASP A O   1 
ATOM   2518 C CB  . ASP A 1 332 ? -5.118  -55.577 23.788  1.00 35.33  ? 333  ASP A CB  1 
ATOM   2519 C CG  . ASP A 1 332 ? -4.550  -56.976 23.584  1.00 40.57  ? 333  ASP A CG  1 
ATOM   2520 O OD1 . ASP A 1 332 ? -4.531  -57.436 22.421  1.00 40.38  ? 333  ASP A OD1 1 
ATOM   2521 O OD2 . ASP A 1 332 ? -4.109  -57.602 24.588  1.00 41.01  ? 333  ASP A OD2 1 
ATOM   2522 N N   . GLU A 1 333 ? -4.137  -52.048 23.193  1.00 27.52  ? 334  GLU A N   1 
ATOM   2523 C CA  . GLU A 1 333 ? -4.621  -50.687 23.428  1.00 33.18  ? 334  GLU A CA  1 
ATOM   2524 C C   . GLU A 1 333 ? -6.042  -50.417 22.965  1.00 32.86  ? 334  GLU A C   1 
ATOM   2525 O O   . GLU A 1 333 ? -6.743  -49.611 23.584  1.00 39.39  ? 334  GLU A O   1 
ATOM   2526 C CB  . GLU A 1 333 ? -3.697  -49.669 22.760  1.00 30.18  ? 334  GLU A CB  1 
ATOM   2527 C CG  . GLU A 1 333 ? -2.304  -49.550 23.416  1.00 34.93  ? 334  GLU A CG  1 
ATOM   2528 C CD  . GLU A 1 333 ? -2.346  -48.803 24.755  1.00 34.50  ? 334  GLU A CD  1 
ATOM   2529 O OE1 . GLU A 1 333 ? -3.426  -48.237 25.085  1.00 33.26  ? 334  GLU A OE1 1 
ATOM   2530 O OE2 . GLU A 1 333 ? -1.313  -48.791 25.472  1.00 30.38  ? 334  GLU A OE2 1 
ATOM   2531 N N   . GLY A 1 334 ? -6.478  -51.058 21.882  1.00 30.61  ? 335  GLY A N   1 
ATOM   2532 C CA  . GLY A 1 334 ? -7.767  -50.703 21.313  1.00 29.73  ? 335  GLY A CA  1 
ATOM   2533 C C   . GLY A 1 334 ? -8.988  -51.361 21.967  1.00 31.61  ? 335  GLY A C   1 
ATOM   2534 O O   . GLY A 1 334 ? -10.098 -50.842 21.876  1.00 32.12  ? 335  GLY A O   1 
ATOM   2535 N N   . SER A 1 335 ? -8.782  -52.488 22.635  1.00 31.26  ? 336  SER A N   1 
ATOM   2536 C CA  . SER A 1 335 ? -9.894  -53.373 22.979  1.00 39.17  ? 336  SER A CA  1 
ATOM   2537 C C   . SER A 1 335 ? -10.912 -52.749 23.949  1.00 43.30  ? 336  SER A C   1 
ATOM   2538 O O   . SER A 1 335 ? -12.116 -52.854 23.742  1.00 37.30  ? 336  SER A O   1 
ATOM   2539 C CB  . SER A 1 335 ? -9.339  -54.664 23.560  1.00 35.30  ? 336  SER A CB  1 
ATOM   2540 O OG  . SER A 1 335 ? -8.758  -54.426 24.831  1.00 40.36  ? 336  SER A OG  1 
ATOM   2541 N N   . TYR A 1 336 ? -10.418 -52.100 24.999  1.00 36.29  ? 337  TYR A N   1 
ATOM   2542 C CA  . TYR A 1 336 ? -11.247 -51.403 25.990  1.00 40.12  ? 337  TYR A CA  1 
ATOM   2543 C C   . TYR A 1 336 ? -12.236 -50.424 25.358  1.00 39.11  ? 337  TYR A C   1 
ATOM   2544 O O   . TYR A 1 336 ? -13.393 -50.339 25.753  1.00 37.44  ? 337  TYR A O   1 
ATOM   2545 C CB  . TYR A 1 336 ? -10.324 -50.655 26.985  1.00 37.93  ? 337  TYR A CB  1 
ATOM   2546 C CG  . TYR A 1 336 ? -11.000 -49.699 27.945  1.00 41.40  ? 337  TYR A CG  1 
ATOM   2547 C CD1 . TYR A 1 336 ? -11.417 -50.124 29.217  1.00 56.14  ? 337  TYR A CD1 1 
ATOM   2548 C CD2 . TYR A 1 336 ? -11.172 -48.356 27.617  1.00 47.57  ? 337  TYR A CD2 1 
ATOM   2549 C CE1 . TYR A 1 336 ? -12.022 -49.234 30.123  1.00 47.78  ? 337  TYR A CE1 1 
ATOM   2550 C CE2 . TYR A 1 336 ? -11.779 -47.468 28.501  1.00 55.08  ? 337  TYR A CE2 1 
ATOM   2551 C CZ  . TYR A 1 336 ? -12.209 -47.907 29.747  1.00 55.34  ? 337  TYR A CZ  1 
ATOM   2552 O OH  . TYR A 1 336 ? -12.805 -47.018 30.628  1.00 72.15  ? 337  TYR A OH  1 
ATOM   2553 N N   . PHE A 1 337 ? -11.775 -49.665 24.379  1.00 36.01  ? 338  PHE A N   1 
ATOM   2554 C CA  . PHE A 1 337 ? -12.607 -48.613 23.819  1.00 37.51  ? 338  PHE A CA  1 
ATOM   2555 C C   . PHE A 1 337 ? -13.740 -49.134 22.950  1.00 45.11  ? 338  PHE A C   1 
ATOM   2556 O O   . PHE A 1 337 ? -14.717 -48.412 22.708  1.00 39.09  ? 338  PHE A O   1 
ATOM   2557 C CB  . PHE A 1 337 ? -11.744 -47.651 22.990  1.00 43.12  ? 338  PHE A CB  1 
ATOM   2558 C CG  . PHE A 1 337 ? -10.625 -47.039 23.766  1.00 43.90  ? 338  PHE A CG  1 
ATOM   2559 C CD1 . PHE A 1 337 ? -10.859 -45.966 24.609  1.00 45.17  ? 338  PHE A CD1 1 
ATOM   2560 C CD2 . PHE A 1 337 ? -9.339  -47.538 23.656  1.00 38.74  ? 338  PHE A CD2 1 
ATOM   2561 C CE1 . PHE A 1 337 ? -9.823  -45.395 25.342  1.00 47.75  ? 338  PHE A CE1 1 
ATOM   2562 C CE2 . PHE A 1 337 ? -8.301  -46.981 24.379  1.00 48.36  ? 338  PHE A CE2 1 
ATOM   2563 C CZ  . PHE A 1 337 ? -8.539  -45.905 25.224  1.00 45.80  ? 338  PHE A CZ  1 
ATOM   2564 N N   . LEU A 1 338 ? -13.608 -50.369 22.461  1.00 38.78  ? 339  LEU A N   1 
ATOM   2565 C CA  . LEU A 1 338 ? -14.581 -50.881 21.496  1.00 43.92  ? 339  LEU A CA  1 
ATOM   2566 C C   . LEU A 1 338 ? -15.976 -51.092 22.110  1.00 44.49  ? 339  LEU A C   1 
ATOM   2567 O O   . LEU A 1 338 ? -16.985 -50.960 21.407  1.00 44.55  ? 339  LEU A O   1 
ATOM   2568 C CB  . LEU A 1 338 ? -14.073 -52.181 20.872  1.00 38.69  ? 339  LEU A CB  1 
ATOM   2569 C CG  . LEU A 1 338 ? -12.795 -52.002 20.043  1.00 44.47  ? 339  LEU A CG  1 
ATOM   2570 C CD1 . LEU A 1 338 ? -12.334 -53.308 19.429  1.00 39.54  ? 339  LEU A CD1 1 
ATOM   2571 C CD2 . LEU A 1 338 ? -13.017 -50.979 18.970  1.00 32.88  ? 339  LEU A CD2 1 
ATOM   2572 N N   . VAL A 1 339 ? -16.060 -51.383 23.412  1.00 45.14  ? 340  VAL A N   1 
ATOM   2573 C CA  . VAL A 1 339 ? -17.388 -51.515 24.037  1.00 48.99  ? 340  VAL A CA  1 
ATOM   2574 C C   . VAL A 1 339 ? -18.140 -50.193 24.294  1.00 48.32  ? 340  VAL A C   1 
ATOM   2575 O O   . VAL A 1 339 ? -19.280 -50.210 24.732  1.00 55.32  ? 340  VAL A O   1 
ATOM   2576 C CB  . VAL A 1 339 ? -17.308 -52.266 25.353  1.00 46.47  ? 340  VAL A CB  1 
ATOM   2577 C CG1 . VAL A 1 339 ? -16.744 -53.665 25.107  1.00 48.63  ? 340  VAL A CG1 1 
ATOM   2578 C CG2 . VAL A 1 339 ? -16.470 -51.498 26.353  1.00 54.02  ? 340  VAL A CG2 1 
ATOM   2579 N N   . TYR A 1 340 ? -17.532 -49.057 23.984  1.00 45.95  ? 341  TYR A N   1 
ATOM   2580 C CA  . TYR A 1 340 ? -18.225 -47.769 24.118  1.00 44.56  ? 341  TYR A CA  1 
ATOM   2581 C C   . TYR A 1 340 ? -18.813 -47.240 22.810  1.00 51.36  ? 341  TYR A C   1 
ATOM   2582 O O   . TYR A 1 340 ? -18.891 -46.026 22.604  1.00 59.74  ? 341  TYR A O   1 
ATOM   2583 C CB  . TYR A 1 340 ? -17.280 -46.716 24.702  1.00 44.34  ? 341  TYR A CB  1 
ATOM   2584 C CG  . TYR A 1 340 ? -17.012 -46.957 26.164  1.00 46.44  ? 341  TYR A CG  1 
ATOM   2585 C CD1 . TYR A 1 340 ? -16.118 -47.943 26.565  1.00 38.66  ? 341  TYR A CD1 1 
ATOM   2586 C CD2 . TYR A 1 340 ? -17.684 -46.226 27.148  1.00 43.20  ? 341  TYR A CD2 1 
ATOM   2587 C CE1 . TYR A 1 340 ? -15.887 -48.195 27.906  1.00 50.04  ? 341  TYR A CE1 1 
ATOM   2588 C CE2 . TYR A 1 340 ? -17.454 -46.465 28.493  1.00 46.13  ? 341  TYR A CE2 1 
ATOM   2589 C CZ  . TYR A 1 340 ? -16.557 -47.452 28.861  1.00 48.16  ? 341  TYR A CZ  1 
ATOM   2590 O OH  . TYR A 1 340 ? -16.318 -47.707 30.179  1.00 56.34  ? 341  TYR A OH  1 
ATOM   2591 N N   . GLY A 1 341 ? -19.225 -48.138 21.923  1.00 54.46  ? 342  GLY A N   1 
ATOM   2592 C CA  . GLY A 1 341 ? -19.951 -47.703 20.746  1.00 54.70  ? 342  GLY A CA  1 
ATOM   2593 C C   . GLY A 1 341 ? -19.630 -48.389 19.439  1.00 54.32  ? 342  GLY A C   1 
ATOM   2594 O O   . GLY A 1 341 ? -20.265 -48.100 18.425  1.00 52.33  ? 342  GLY A O   1 
ATOM   2595 N N   . ALA A 1 342 ? -18.642 -49.278 19.430  1.00 52.54  ? 343  ALA A N   1 
ATOM   2596 C CA  . ALA A 1 342 ? -18.414 -50.053 18.217  1.00 50.09  ? 343  ALA A CA  1 
ATOM   2597 C C   . ALA A 1 342 ? -19.519 -51.099 18.147  1.00 51.05  ? 343  ALA A C   1 
ATOM   2598 O O   . ALA A 1 342 ? -19.728 -51.843 19.117  1.00 49.07  ? 343  ALA A O   1 
ATOM   2599 C CB  . ALA A 1 342 ? -17.030 -50.697 18.210  1.00 39.47  ? 343  ALA A CB  1 
ATOM   2600 N N   . PRO A 1 343 ? -20.256 -51.132 17.018  1.00 50.85  ? 344  PRO A N   1 
ATOM   2601 C CA  . PRO A 1 343 ? -21.365 -52.083 16.835  1.00 45.99  ? 344  PRO A CA  1 
ATOM   2602 C C   . PRO A 1 343 ? -20.955 -53.537 16.997  1.00 44.44  ? 344  PRO A C   1 
ATOM   2603 O O   . PRO A 1 343 ? -19.946 -53.963 16.424  1.00 49.45  ? 344  PRO A O   1 
ATOM   2604 C CB  . PRO A 1 343 ? -21.834 -51.809 15.401  1.00 46.63  ? 344  PRO A CB  1 
ATOM   2605 C CG  . PRO A 1 343 ? -20.832 -50.848 14.811  1.00 54.13  ? 344  PRO A CG  1 
ATOM   2606 C CD  . PRO A 1 343 ? -20.222 -50.123 15.942  1.00 50.51  ? 344  PRO A CD  1 
ATOM   2607 N N   . GLY A 1 344 ? -21.720 -54.287 17.783  1.00 48.14  ? 345  GLY A N   1 
ATOM   2608 C CA  . GLY A 1 344 ? -21.460 -55.709 17.971  1.00 43.49  ? 345  GLY A CA  1 
ATOM   2609 C C   . GLY A 1 344 ? -20.620 -56.026 19.195  1.00 50.07  ? 345  GLY A C   1 
ATOM   2610 O O   . GLY A 1 344 ? -20.435 -57.198 19.560  1.00 50.67  ? 345  GLY A O   1 
ATOM   2611 N N   . PHE A 1 345 ? -20.107 -54.990 19.850  1.00 50.45  ? 346  PHE A N   1 
ATOM   2612 C CA  . PHE A 1 345 ? -19.211 -55.218 20.980  1.00 44.06  ? 346  PHE A CA  1 
ATOM   2613 C C   . PHE A 1 345 ? -19.908 -55.143 22.335  1.00 44.47  ? 346  PHE A C   1 
ATOM   2614 O O   . PHE A 1 345 ? -20.750 -54.267 22.567  1.00 45.68  ? 346  PHE A O   1 
ATOM   2615 C CB  . PHE A 1 345 ? -18.056 -54.225 20.943  1.00 40.31  ? 346  PHE A CB  1 
ATOM   2616 C CG  . PHE A 1 345 ? -16.989 -54.593 19.962  1.00 42.12  ? 346  PHE A CG  1 
ATOM   2617 C CD1 . PHE A 1 345 ? -17.121 -54.253 18.625  1.00 37.75  ? 346  PHE A CD1 1 
ATOM   2618 C CD2 . PHE A 1 345 ? -15.863 -55.300 20.372  1.00 40.00  ? 346  PHE A CD2 1 
ATOM   2619 C CE1 . PHE A 1 345 ? -16.138 -54.592 17.707  1.00 43.12  ? 346  PHE A CE1 1 
ATOM   2620 C CE2 . PHE A 1 345 ? -14.876 -55.651 19.462  1.00 40.10  ? 346  PHE A CE2 1 
ATOM   2621 C CZ  . PHE A 1 345 ? -15.020 -55.293 18.120  1.00 39.22  ? 346  PHE A CZ  1 
ATOM   2622 N N   . SER A 1 346 ? -19.535 -56.070 23.217  1.00 47.56  ? 347  SER A N   1 
ATOM   2623 C CA  . SER A 1 346 ? -19.948 -56.049 24.620  1.00 49.25  ? 347  SER A CA  1 
ATOM   2624 C C   . SER A 1 346 ? -18.902 -56.746 25.470  1.00 45.88  ? 347  SER A C   1 
ATOM   2625 O O   . SER A 1 346 ? -18.202 -57.642 24.994  1.00 43.40  ? 347  SER A O   1 
ATOM   2626 C CB  . SER A 1 346 ? -21.314 -56.723 24.812  1.00 46.11  ? 347  SER A CB  1 
ATOM   2627 O OG  . SER A 1 346 ? -21.607 -56.900 26.193  1.00 55.35  ? 347  SER A OG  1 
ATOM   2628 N N   . LYS A 1 347 ? -18.797 -56.364 26.739  1.00 41.37  ? 348  LYS A N   1 
ATOM   2629 C CA  . LYS A 1 347 ? -17.869 -57.066 27.614  1.00 47.77  ? 348  LYS A CA  1 
ATOM   2630 C C   . LYS A 1 347 ? -18.466 -58.423 27.973  1.00 39.89  ? 348  LYS A C   1 
ATOM   2631 O O   . LYS A 1 347 ? -17.770 -59.313 28.442  1.00 40.31  ? 348  LYS A O   1 
ATOM   2632 C CB  . LYS A 1 347 ? -17.573 -56.259 28.893  1.00 44.40  ? 348  LYS A CB  1 
ATOM   2633 C CG  . LYS A 1 347 ? -18.655 -56.404 29.957  1.00 40.95  ? 348  LYS A CG  1 
ATOM   2634 C CD  . LYS A 1 347 ? -18.352 -55.622 31.235  1.00 48.01  ? 348  LYS A CD  1 
ATOM   2635 C CE  . LYS A 1 347 ? -19.326 -56.024 32.345  1.00 38.17  ? 348  LYS A CE  1 
ATOM   2636 N NZ  . LYS A 1 347 ? -19.061 -57.444 32.761  1.00 42.38  ? 348  LYS A NZ  1 
ATOM   2637 N N   . ASP A 1 348 ? -19.769 -58.575 27.764  1.00 44.00  ? 349  ASP A N   1 
ATOM   2638 C CA  . ASP A 1 348 ? -20.453 -59.777 28.250  1.00 51.65  ? 349  ASP A CA  1 
ATOM   2639 C C   . ASP A 1 348 ? -20.603 -60.888 27.215  1.00 57.35  ? 349  ASP A C   1 
ATOM   2640 O O   . ASP A 1 348 ? -21.101 -61.967 27.541  1.00 54.47  ? 349  ASP A O   1 
ATOM   2641 C CB  . ASP A 1 348 ? -21.818 -59.400 28.806  1.00 45.90  ? 349  ASP A CB  1 
ATOM   2642 C CG  . ASP A 1 348 ? -21.703 -58.604 30.079  1.00 45.90  ? 349  ASP A CG  1 
ATOM   2643 O OD1 . ASP A 1 348 ? -20.898 -59.015 30.950  1.00 42.14  ? 349  ASP A OD1 1 
ATOM   2644 O OD2 . ASP A 1 348 ? -22.373 -57.551 30.182  1.00 44.86  ? 349  ASP A OD2 1 
ATOM   2645 N N   . ASN A 1 349 ? -20.177 -60.640 25.977  1.00 50.20  ? 350  ASN A N   1 
ATOM   2646 C CA  . ASN A 1 349 ? -20.009 -61.755 25.044  1.00 56.76  ? 350  ASN A CA  1 
ATOM   2647 C C   . ASN A 1 349 ? -18.665 -61.709 24.314  1.00 57.11  ? 350  ASN A C   1 
ATOM   2648 O O   . ASN A 1 349 ? -17.752 -60.995 24.733  1.00 53.98  ? 350  ASN A O   1 
ATOM   2649 C CB  . ASN A 1 349 ? -21.178 -61.816 24.060  1.00 44.14  ? 350  ASN A CB  1 
ATOM   2650 C CG  . ASN A 1 349 ? -21.300 -60.588 23.170  1.00 55.09  ? 350  ASN A CG  1 
ATOM   2651 O OD1 . ASN A 1 349 ? -20.312 -59.964 22.764  1.00 52.28  ? 350  ASN A OD1 1 
ATOM   2652 N ND2 . ASN A 1 349 ? -22.541 -60.249 22.849  1.00 49.18  ? 350  ASN A ND2 1 
ATOM   2653 N N   . GLU A 1 350 ? -18.539 -62.479 23.239  1.00 49.97  ? 351  GLU A N   1 
ATOM   2654 C CA  . GLU A 1 350 ? -17.243 -62.651 22.595  1.00 48.37  ? 351  GLU A CA  1 
ATOM   2655 C C   . GLU A 1 350 ? -16.993 -61.565 21.570  1.00 43.56  ? 351  GLU A C   1 
ATOM   2656 O O   . GLU A 1 350 ? -15.906 -61.477 21.008  1.00 43.23  ? 351  GLU A O   1 
ATOM   2657 C CB  . GLU A 1 350 ? -17.137 -64.023 21.936  1.00 50.17  ? 351  GLU A CB  1 
ATOM   2658 C CG  . GLU A 1 350 ? -16.901 -65.155 22.915  1.00 56.66  ? 351  GLU A CG  1 
ATOM   2659 C CD  . GLU A 1 350 ? -15.598 -65.001 23.673  1.00 64.28  ? 351  GLU A CD  1 
ATOM   2660 O OE1 . GLU A 1 350 ? -14.531 -65.342 23.110  1.00 76.22  ? 351  GLU A OE1 1 
ATOM   2661 O OE2 . GLU A 1 350 ? -15.637 -64.537 24.832  1.00 67.06  ? 351  GLU A OE2 1 
ATOM   2662 N N   . SER A 1 351 ? -18.015 -60.760 21.321  1.00 40.98  ? 352  SER A N   1 
ATOM   2663 C CA  . SER A 1 351 ? -17.905 -59.655 20.381  1.00 45.56  ? 352  SER A CA  1 
ATOM   2664 C C   . SER A 1 351 ? -17.398 -60.138 19.019  1.00 52.64  ? 352  SER A C   1 
ATOM   2665 O O   . SER A 1 351 ? -16.580 -59.470 18.389  1.00 45.65  ? 352  SER A O   1 
ATOM   2666 C CB  . SER A 1 351 ? -16.978 -58.567 20.946  1.00 47.05  ? 352  SER A CB  1 
ATOM   2667 O OG  . SER A 1 351 ? -17.557 -57.919 22.073  1.00 47.43  ? 352  SER A OG  1 
ATOM   2668 N N   . LEU A 1 352 ? -17.866 -61.308 18.582  1.00 50.98  ? 353  LEU A N   1 
ATOM   2669 C CA  . LEU A 1 352 ? -17.514 -61.825 17.267  1.00 46.68  ? 353  LEU A CA  1 
ATOM   2670 C C   . LEU A 1 352 ? -18.318 -61.068 16.224  1.00 46.69  ? 353  LEU A C   1 
ATOM   2671 O O   . LEU A 1 352 ? -19.482 -61.360 15.995  1.00 60.07  ? 353  LEU A O   1 
ATOM   2672 C CB  . LEU A 1 352 ? -17.784 -63.318 17.193  1.00 45.10  ? 353  LEU A CB  1 
ATOM   2673 C CG  . LEU A 1 352 ? -16.960 -64.103 18.207  1.00 49.88  ? 353  LEU A CG  1 
ATOM   2674 C CD1 . LEU A 1 352 ? -17.484 -65.524 18.352  1.00 46.92  ? 353  LEU A CD1 1 
ATOM   2675 C CD2 . LEU A 1 352 ? -15.504 -64.120 17.785  1.00 45.27  ? 353  LEU A CD2 1 
ATOM   2676 N N   . ILE A 1 353 ? -17.700 -60.070 15.609  1.00 42.13  ? 354  ILE A N   1 
ATOM   2677 C CA  . ILE A 1 353 ? -18.423 -59.170 14.726  1.00 44.31  ? 354  ILE A CA  1 
ATOM   2678 C C   . ILE A 1 353 ? -18.389 -59.627 13.261  1.00 46.79  ? 354  ILE A C   1 
ATOM   2679 O O   . ILE A 1 353 ? -17.563 -60.455 12.847  1.00 46.33  ? 354  ILE A O   1 
ATOM   2680 C CB  . ILE A 1 353 ? -17.862 -57.734 14.830  1.00 49.38  ? 354  ILE A CB  1 
ATOM   2681 C CG1 . ILE A 1 353 ? -16.373 -57.714 14.459  1.00 41.44  ? 354  ILE A CG1 1 
ATOM   2682 C CG2 . ILE A 1 353 ? -18.034 -57.224 16.256  1.00 48.28  ? 354  ILE A CG2 1 
ATOM   2683 C CD1 . ILE A 1 353 ? -15.842 -56.329 14.160  1.00 36.80  ? 354  ILE A CD1 1 
ATOM   2684 N N   . SER A 1 354 ? -19.304 -59.070 12.484  1.00 45.66  ? 355  SER A N   1 
ATOM   2685 C CA  . SER A 1 354 ? -19.408 -59.372 11.064  1.00 41.36  ? 355  SER A CA  1 
ATOM   2686 C C   . SER A 1 354 ? -18.628 -58.318 10.294  1.00 52.90  ? 355  SER A C   1 
ATOM   2687 O O   . SER A 1 354 ? -18.228 -57.293 10.861  1.00 43.48  ? 355  SER A O   1 
ATOM   2688 C CB  . SER A 1 354 ? -20.873 -59.362 10.620  1.00 40.48  ? 355  SER A CB  1 
ATOM   2689 O OG  . SER A 1 354 ? -21.342 -58.017 10.555  1.00 48.44  ? 355  SER A OG  1 
ATOM   2690 N N   . ARG A 1 355 ? -18.441 -58.541 8.997   1.00 45.94  ? 356  ARG A N   1 
ATOM   2691 C CA  . ARG A 1 355 ? -17.630 -57.631 8.233   1.00 45.55  ? 356  ARG A CA  1 
ATOM   2692 C C   . ARG A 1 355 ? -18.325 -56.271 8.123   1.00 45.34  ? 356  ARG A C   1 
ATOM   2693 O O   . ARG A 1 355 ? -17.672 -55.226 8.125   1.00 50.70  ? 356  ARG A O   1 
ATOM   2694 C CB  . ARG A 1 355 ? -17.302 -58.218 6.862   1.00 44.12  ? 356  ARG A CB  1 
ATOM   2695 C CG  . ARG A 1 355 ? -16.445 -57.272 6.069   1.00 42.77  ? 356  ARG A CG  1 
ATOM   2696 C CD  . ARG A 1 355 ? -15.500 -57.965 5.170   1.00 48.02  ? 356  ARG A CD  1 
ATOM   2697 N NE  . ARG A 1 355 ? -14.746 -56.958 4.445   1.00 48.37  ? 356  ARG A NE  1 
ATOM   2698 C CZ  . ARG A 1 355 ? -13.505 -56.614 4.745   1.00 42.97  ? 356  ARG A CZ  1 
ATOM   2699 N NH1 . ARG A 1 355 ? -12.872 -57.238 5.734   1.00 44.39  ? 356  ARG A NH1 1 
ATOM   2700 N NH2 . ARG A 1 355 ? -12.896 -55.672 4.040   1.00 39.96  ? 356  ARG A NH2 1 
ATOM   2701 N N   . ALA A 1 356 ? -19.650 -56.269 8.084   1.00 47.02  ? 357  ALA A N   1 
ATOM   2702 C CA  . ALA A 1 356 ? -20.379 -55.005 8.059   1.00 43.06  ? 357  ALA A CA  1 
ATOM   2703 C C   . ALA A 1 356 ? -20.153 -54.232 9.368   1.00 43.80  ? 357  ALA A C   1 
ATOM   2704 O O   . ALA A 1 356 ? -20.000 -53.001 9.364   1.00 45.39  ? 357  ALA A O   1 
ATOM   2705 C CB  . ALA A 1 356 ? -21.865 -55.253 7.819   1.00 44.28  ? 357  ALA A CB  1 
ATOM   2706 N N   . GLU A 1 357 ? -20.115 -54.957 10.485  1.00 42.68  ? 358  GLU A N   1 
ATOM   2707 C CA  . GLU A 1 357 ? -19.859 -54.330 11.776  1.00 50.09  ? 358  GLU A CA  1 
ATOM   2708 C C   . GLU A 1 357 ? -18.431 -53.789 11.828  1.00 52.33  ? 358  GLU A C   1 
ATOM   2709 O O   . GLU A 1 357 ? -18.193 -52.687 12.324  1.00 48.52  ? 358  GLU A O   1 
ATOM   2710 C CB  . GLU A 1 357 ? -20.125 -55.317 12.913  1.00 44.32  ? 358  GLU A CB  1 
ATOM   2711 C CG  . GLU A 1 357 ? -21.620 -55.684 13.008  1.00 44.63  ? 358  GLU A CG  1 
ATOM   2712 C CD  . GLU A 1 357 ? -21.947 -56.668 14.103  1.00 39.64  ? 358  GLU A CD  1 
ATOM   2713 O OE1 . GLU A 1 357 ? -21.220 -57.674 14.273  1.00 46.67  ? 358  GLU A OE1 1 
ATOM   2714 O OE2 . GLU A 1 357 ? -22.954 -56.438 14.801  1.00 62.09  ? 358  GLU A OE2 1 
ATOM   2715 N N   . PHE A 1 358 ? -17.494 -54.558 11.284  1.00 46.59  ? 359  PHE A N   1 
ATOM   2716 C CA  . PHE A 1 358 ? -16.102 -54.138 11.179  1.00 41.62  ? 359  PHE A CA  1 
ATOM   2717 C C   . PHE A 1 358 ? -15.986 -52.813 10.432  1.00 45.38  ? 359  PHE A C   1 
ATOM   2718 O O   . PHE A 1 358 ? -15.351 -51.875 10.922  1.00 46.48  ? 359  PHE A O   1 
ATOM   2719 C CB  . PHE A 1 358 ? -15.278 -55.230 10.490  1.00 34.91  ? 359  PHE A CB  1 
ATOM   2720 C CG  . PHE A 1 358 ? -13.847 -54.856 10.243  1.00 43.50  ? 359  PHE A CG  1 
ATOM   2721 C CD1 . PHE A 1 358 ? -12.914 -54.881 11.270  1.00 41.05  ? 359  PHE A CD1 1 
ATOM   2722 C CD2 . PHE A 1 358 ? -13.425 -54.493 8.980   1.00 42.46  ? 359  PHE A CD2 1 
ATOM   2723 C CE1 . PHE A 1 358 ? -11.594 -54.547 11.028  1.00 43.13  ? 359  PHE A CE1 1 
ATOM   2724 C CE2 . PHE A 1 358 ? -12.105 -54.163 8.738   1.00 41.30  ? 359  PHE A CE2 1 
ATOM   2725 C CZ  . PHE A 1 358 ? -11.194 -54.188 9.757   1.00 40.47  ? 359  PHE A CZ  1 
ATOM   2726 N N   . LEU A 1 359 ? -16.608 -52.729 9.259   1.00 42.52  ? 360  LEU A N   1 
ATOM   2727 C CA  . LEU A 1 359 ? -16.567 -51.499 8.460   1.00 47.61  ? 360  LEU A CA  1 
ATOM   2728 C C   . LEU A 1 359 ? -17.148 -50.344 9.275   1.00 48.33  ? 360  LEU A C   1 
ATOM   2729 O O   . LEU A 1 359 ? -16.558 -49.262 9.347   1.00 48.73  ? 360  LEU A O   1 
ATOM   2730 C CB  . LEU A 1 359 ? -17.327 -51.670 7.123   1.00 42.59  ? 360  LEU A CB  1 
ATOM   2731 C CG  . LEU A 1 359 ? -16.824 -52.789 6.179   1.00 52.11  ? 360  LEU A CG  1 
ATOM   2732 C CD1 . LEU A 1 359 ? -17.667 -52.944 4.896   1.00 48.83  ? 360  LEU A CD1 1 
ATOM   2733 C CD2 . LEU A 1 359 ? -15.350 -52.613 5.808   1.00 51.56  ? 360  LEU A CD2 1 
ATOM   2734 N N   . ALA A 1 360 ? -18.301 -50.582 9.900   1.00 44.59  ? 361  ALA A N   1 
ATOM   2735 C CA  . ALA A 1 360 ? -18.914 -49.582 10.764  1.00 49.32  ? 361  ALA A CA  1 
ATOM   2736 C C   . ALA A 1 360 ? -17.980 -49.191 11.913  1.00 48.63  ? 361  ALA A C   1 
ATOM   2737 O O   . ALA A 1 360 ? -17.872 -48.020 12.269  1.00 50.61  ? 361  ALA A O   1 
ATOM   2738 C CB  . ALA A 1 360 ? -20.223 -50.099 11.318  1.00 48.83  ? 361  ALA A CB  1 
ATOM   2739 N N   . GLY A 1 361 ? -17.323 -50.184 12.499  1.00 43.62  ? 362  GLY A N   1 
ATOM   2740 C CA  . GLY A 1 361 ? -16.455 -49.955 13.642  1.00 46.48  ? 362  GLY A CA  1 
ATOM   2741 C C   . GLY A 1 361 ? -15.336 -49.009 13.272  1.00 49.39  ? 362  GLY A C   1 
ATOM   2742 O O   . GLY A 1 361 ? -14.996 -48.100 14.028  1.00 43.04  ? 362  GLY A O   1 
ATOM   2743 N N   . VAL A 1 362 ? -14.786 -49.208 12.079  1.00 45.97  ? 363  VAL A N   1 
ATOM   2744 C CA  . VAL A 1 362 ? -13.694 -48.387 11.595  1.00 47.31  ? 363  VAL A CA  1 
ATOM   2745 C C   . VAL A 1 362 ? -14.062 -46.900 11.538  1.00 51.00  ? 363  VAL A C   1 
ATOM   2746 O O   . VAL A 1 362 ? -13.242 -46.046 11.901  1.00 49.08  ? 363  VAL A O   1 
ATOM   2747 C CB  . VAL A 1 362 ? -13.237 -48.866 10.221  1.00 45.57  ? 363  VAL A CB  1 
ATOM   2748 C CG1 . VAL A 1 362 ? -12.328 -47.855 9.576   1.00 36.60  ? 363  VAL A CG1 1 
ATOM   2749 C CG2 . VAL A 1 362 ? -12.549 -50.228 10.350  1.00 46.81  ? 363  VAL A CG2 1 
ATOM   2750 N N   . ARG A 1 363 ? -15.282 -46.577 11.112  1.00 50.77  ? 364  ARG A N   1 
ATOM   2751 C CA  . ARG A 1 363 ? -15.682 -45.169 11.037  1.00 51.57  ? 364  ARG A CA  1 
ATOM   2752 C C   . ARG A 1 363 ? -15.816 -44.544 12.435  1.00 56.16  ? 364  ARG A C   1 
ATOM   2753 O O   . ARG A 1 363 ? -15.666 -43.339 12.587  1.00 55.42  ? 364  ARG A O   1 
ATOM   2754 C CB  . ARG A 1 363 ? -16.992 -44.996 10.276  1.00 53.76  ? 364  ARG A CB  1 
ATOM   2755 C CG  . ARG A 1 363 ? -16.906 -45.199 8.764   1.00 58.83  ? 364  ARG A CG  1 
ATOM   2756 C CD  . ARG A 1 363 ? -15.551 -44.769 8.189   1.00 68.36  ? 364  ARG A CD  1 
ATOM   2757 N NE  . ARG A 1 363 ? -15.483 -43.392 7.672   1.00 71.98  ? 364  ARG A NE  1 
ATOM   2758 C CZ  . ARG A 1 363 ? -15.722 -43.043 6.403   1.00 77.68  ? 364  ARG A CZ  1 
ATOM   2759 N NH1 . ARG A 1 363 ? -16.081 -43.965 5.511   1.00 70.31  ? 364  ARG A NH1 1 
ATOM   2760 N NH2 . ARG A 1 363 ? -15.609 -41.770 6.019   1.00 65.44  ? 364  ARG A NH2 1 
ATOM   2761 N N   . VAL A 1 364 ? -16.085 -45.369 13.446  1.00 47.79  ? 365  VAL A N   1 
ATOM   2762 C CA  . VAL A 1 364 ? -16.269 -44.900 14.820  1.00 53.01  ? 365  VAL A CA  1 
ATOM   2763 C C   . VAL A 1 364 ? -14.941 -44.857 15.586  1.00 59.83  ? 365  VAL A C   1 
ATOM   2764 O O   . VAL A 1 364 ? -14.734 -44.024 16.482  1.00 56.39  ? 365  VAL A O   1 
ATOM   2765 C CB  . VAL A 1 364 ? -17.268 -45.803 15.586  1.00 53.73  ? 365  VAL A CB  1 
ATOM   2766 C CG1 . VAL A 1 364 ? -17.440 -45.322 16.992  1.00 62.10  ? 365  VAL A CG1 1 
ATOM   2767 C CG2 . VAL A 1 364 ? -18.614 -45.819 14.892  1.00 57.40  ? 365  VAL A CG2 1 
ATOM   2768 N N   . GLY A 1 365 ? -14.039 -45.767 15.242  1.00 48.49  ? 366  GLY A N   1 
ATOM   2769 C CA  . GLY A 1 365 ? -12.758 -45.828 15.918  1.00 50.00  ? 366  GLY A CA  1 
ATOM   2770 C C   . GLY A 1 365 ? -11.767 -44.853 15.312  1.00 50.03  ? 366  GLY A C   1 
ATOM   2771 O O   . GLY A 1 365 ? -10.803 -44.449 15.967  1.00 47.14  ? 366  GLY A O   1 
ATOM   2772 N N   . VAL A 1 366 ? -12.006 -44.479 14.058  1.00 43.99  ? 367  VAL A N   1 
ATOM   2773 C CA  . VAL A 1 366 ? -11.140 -43.543 13.333  1.00 49.89  ? 367  VAL A CA  1 
ATOM   2774 C C   . VAL A 1 366 ? -11.980 -42.383 12.803  1.00 48.44  ? 367  VAL A C   1 
ATOM   2775 O O   . VAL A 1 366 ? -12.110 -42.204 11.596  1.00 44.63  ? 367  VAL A O   1 
ATOM   2776 C CB  . VAL A 1 366 ? -10.411 -44.228 12.161  1.00 42.16  ? 367  VAL A CB  1 
ATOM   2777 C CG1 . VAL A 1 366 ? -9.256  -43.358 11.606  1.00 36.65  ? 367  VAL A CG1 1 
ATOM   2778 C CG2 . VAL A 1 366 ? -9.892  -45.586 12.589  1.00 42.27  ? 367  VAL A CG2 1 
ATOM   2779 N N   . PRO A 1 367 ? -12.555 -41.583 13.713  1.00 52.13  ? 368  PRO A N   1 
ATOM   2780 C CA  . PRO A 1 367 ? -13.494 -40.544 13.288  1.00 53.76  ? 368  PRO A CA  1 
ATOM   2781 C C   . PRO A 1 367 ? -12.816 -39.444 12.479  1.00 51.06  ? 368  PRO A C   1 
ATOM   2782 O O   . PRO A 1 367 ? -11.607 -39.226 12.609  1.00 61.33  ? 368  PRO A O   1 
ATOM   2783 C CB  . PRO A 1 367 ? -14.021 -39.999 14.613  1.00 59.43  ? 368  PRO A CB  1 
ATOM   2784 C CG  . PRO A 1 367 ? -12.883 -40.197 15.563  1.00 51.43  ? 368  PRO A CG  1 
ATOM   2785 C CD  . PRO A 1 367 ? -12.260 -41.502 15.155  1.00 55.49  ? 368  PRO A CD  1 
ATOM   2786 N N   . GLN A 1 368 ? -13.599 -38.786 11.637  1.00 55.94  ? 369  GLN A N   1 
ATOM   2787 C CA  . GLN A 1 368 ? -13.183 -37.566 10.947  1.00 72.20  ? 369  GLN A CA  1 
ATOM   2788 C C   . GLN A 1 368 ? -12.086 -37.752 9.890   1.00 68.47  ? 369  GLN A C   1 
ATOM   2789 O O   . GLN A 1 368 ? -11.341 -36.817 9.605   1.00 69.18  ? 369  GLN A O   1 
ATOM   2790 C CB  . GLN A 1 368 ? -12.734 -36.510 11.977  1.00 76.35  ? 369  GLN A CB  1 
ATOM   2791 C CG  . GLN A 1 368 ? -13.862 -36.009 12.908  1.00 77.58  ? 369  GLN A CG  1 
ATOM   2792 C CD  . GLN A 1 368 ? -14.980 -35.288 12.149  1.00 88.45  ? 369  GLN A CD  1 
ATOM   2793 O OE1 . GLN A 1 368 ? -14.852 -34.105 11.806  1.00 92.90  ? 369  GLN A OE1 1 
ATOM   2794 N NE2 . GLN A 1 368 ? -16.077 -36.000 11.878  1.00 74.29  ? 369  GLN A NE2 1 
ATOM   2795 N N   . VAL A 1 369 ? -11.987 -38.942 9.303   1.00 66.48  ? 370  VAL A N   1 
ATOM   2796 C CA  . VAL A 1 369 ? -11.160 -39.104 8.107   1.00 59.12  ? 370  VAL A CA  1 
ATOM   2797 C C   . VAL A 1 369 ? -12.059 -39.353 6.898   1.00 61.67  ? 370  VAL A C   1 
ATOM   2798 O O   . VAL A 1 369 ? -13.188 -39.807 7.040   1.00 62.42  ? 370  VAL A O   1 
ATOM   2799 C CB  . VAL A 1 369 ? -10.121 -40.255 8.229   1.00 61.81  ? 370  VAL A CB  1 
ATOM   2800 C CG1 . VAL A 1 369 ? -9.040  -39.897 9.237   1.00 52.07  ? 370  VAL A CG1 1 
ATOM   2801 C CG2 . VAL A 1 369 ? -10.786 -41.603 8.551   1.00 48.40  ? 370  VAL A CG2 1 
ATOM   2802 N N   . SER A 1 370 ? -11.550 -39.042 5.709   1.00 65.76  ? 371  SER A N   1 
ATOM   2803 C CA  . SER A 1 370 ? -12.311 -39.216 4.476   1.00 64.82  ? 371  SER A CA  1 
ATOM   2804 C C   . SER A 1 370 ? -12.613 -40.676 4.179   1.00 66.89  ? 371  SER A C   1 
ATOM   2805 O O   . SER A 1 370 ? -12.021 -41.586 4.769   1.00 63.00  ? 371  SER A O   1 
ATOM   2806 C CB  . SER A 1 370 ? -11.557 -38.612 3.290   1.00 67.77  ? 371  SER A CB  1 
ATOM   2807 O OG  . SER A 1 370 ? -10.271 -39.199 3.154   1.00 67.77  ? 371  SER A OG  1 
ATOM   2808 N N   . ASP A 1 371 ? -13.535 -40.888 3.247   1.00 68.48  ? 372  ASP A N   1 
ATOM   2809 C CA  . ASP A 1 371 ? -13.886 -42.230 2.802   1.00 65.59  ? 372  ASP A CA  1 
ATOM   2810 C C   . ASP A 1 371 ? -12.661 -42.916 2.209   1.00 57.54  ? 372  ASP A C   1 
ATOM   2811 O O   . ASP A 1 371 ? -12.377 -44.076 2.511   1.00 50.72  ? 372  ASP A O   1 
ATOM   2812 C CB  . ASP A 1 371 ? -15.028 -42.170 1.782   1.00 72.55  ? 372  ASP A CB  1 
ATOM   2813 C CG  . ASP A 1 371 ? -16.335 -41.705 2.400   1.00 72.80  ? 372  ASP A CG  1 
ATOM   2814 O OD1 . ASP A 1 371 ? -16.425 -41.721 3.649   1.00 76.98  ? 372  ASP A OD1 1 
ATOM   2815 O OD2 . ASP A 1 371 ? -17.267 -41.333 1.646   1.00 72.22  ? 372  ASP A OD2 1 
ATOM   2816 N N   . LEU A 1 372 ? -11.932 -42.183 1.372   1.00 56.15  ? 373  LEU A N   1 
ATOM   2817 C CA  . LEU A 1 372 ? -10.679 -42.691 0.834   1.00 65.93  ? 373  LEU A CA  1 
ATOM   2818 C C   . LEU A 1 372 ? -9.757  -43.161 1.972   1.00 61.63  ? 373  LEU A C   1 
ATOM   2819 O O   . LEU A 1 372 ? -9.161  -44.244 1.902   1.00 57.24  ? 373  LEU A O   1 
ATOM   2820 C CB  . LEU A 1 372 ? -9.986  -41.631 -0.018  1.00 53.81  ? 373  LEU A CB  1 
ATOM   2821 C CG  . LEU A 1 372 ? -8.733  -42.144 -0.729  1.00 64.93  ? 373  LEU A CG  1 
ATOM   2822 C CD1 . LEU A 1 372 ? -9.067  -43.266 -1.722  1.00 59.22  ? 373  LEU A CD1 1 
ATOM   2823 C CD2 . LEU A 1 372 ? -8.009  -41.003 -1.413  1.00 69.42  ? 373  LEU A CD2 1 
ATOM   2824 N N   . ALA A 1 373 ? -9.672  -42.361 3.032   1.00 63.40  ? 374  ALA A N   1 
ATOM   2825 C CA  . ALA A 1 373 ? -8.842  -42.705 4.173   1.00 54.44  ? 374  ALA A CA  1 
ATOM   2826 C C   . ALA A 1 373 ? -9.336  -43.997 4.827   1.00 48.01  ? 374  ALA A C   1 
ATOM   2827 O O   . ALA A 1 373 ? -8.547  -44.915 5.069   1.00 45.66  ? 374  ALA A O   1 
ATOM   2828 C CB  . ALA A 1 373 ? -8.818  -41.562 5.174   1.00 51.57  ? 374  ALA A CB  1 
ATOM   2829 N N   . ALA A 1 374 ? -10.635 -44.073 5.089   1.00 42.26  ? 375  ALA A N   1 
ATOM   2830 C CA  . ALA A 1 374 ? -11.208 -45.241 5.732   1.00 41.04  ? 375  ALA A CA  1 
ATOM   2831 C C   . ALA A 1 374 ? -10.979 -46.500 4.901   1.00 58.57  ? 375  ALA A C   1 
ATOM   2832 O O   . ALA A 1 374 ? -10.626 -47.551 5.458   1.00 51.72  ? 375  ALA A O   1 
ATOM   2833 C CB  . ALA A 1 374 ? -12.679 -45.035 5.987   1.00 41.73  ? 375  ALA A CB  1 
ATOM   2834 N N   . GLU A 1 375 ? -11.168 -46.387 3.579   1.00 48.79  ? 376  GLU A N   1 
ATOM   2835 C CA  . GLU A 1 375 ? -10.897 -47.489 2.663   1.00 43.95  ? 376  GLU A CA  1 
ATOM   2836 C C   . GLU A 1 375 ? -9.484  -47.989 2.806   1.00 44.00  ? 376  GLU A C   1 
ATOM   2837 O O   . GLU A 1 375 ? -9.241  -49.194 2.886   1.00 47.68  ? 376  GLU A O   1 
ATOM   2838 C CB  . GLU A 1 375 ? -11.114 -47.063 1.200   1.00 61.65  ? 376  GLU A CB  1 
ATOM   2839 C CG  . GLU A 1 375 ? -12.551 -46.796 0.805   1.00 67.67  ? 376  GLU A CG  1 
ATOM   2840 C CD  . GLU A 1 375 ? -13.271 -48.033 0.334   1.00 79.40  ? 376  GLU A CD  1 
ATOM   2841 O OE1 . GLU A 1 375 ? -12.826 -49.159 0.662   1.00 75.35  ? 376  GLU A OE1 1 
ATOM   2842 O OE2 . GLU A 1 375 ? -14.287 -47.875 -0.375  1.00 99.81  ? 376  GLU A OE2 1 
ATOM   2843 N N   . ALA A 1 376 ? -8.536  -47.064 2.812   1.00 38.10  ? 377  ALA A N   1 
ATOM   2844 C CA  . ALA A 1 376 ? -7.151  -47.459 3.020   1.00 47.81  ? 377  ALA A CA  1 
ATOM   2845 C C   . ALA A 1 376 ? -6.979  -48.227 4.348   1.00 47.42  ? 377  ALA A C   1 
ATOM   2846 O O   . ALA A 1 376 ? -6.105  -49.115 4.447   1.00 43.90  ? 377  ALA A O   1 
ATOM   2847 C CB  . ALA A 1 376 ? -6.225  -46.232 2.972   1.00 39.75  ? 377  ALA A CB  1 
ATOM   2848 N N   . VAL A 1 377 ? -7.806  -47.906 5.357   1.00 42.93  ? 378  VAL A N   1 
ATOM   2849 C CA  . VAL A 1 377 ? -7.681  -48.576 6.648   1.00 35.30  ? 378  VAL A CA  1 
ATOM   2850 C C   . VAL A 1 377 ? -8.147  -50.018 6.508   1.00 35.07  ? 378  VAL A C   1 
ATOM   2851 O O   . VAL A 1 377 ? -7.438  -50.965 6.869   1.00 31.45  ? 378  VAL A O   1 
ATOM   2852 C CB  . VAL A 1 377 ? -8.489  -47.872 7.771   1.00 37.34  ? 378  VAL A CB  1 
ATOM   2853 C CG1 . VAL A 1 377 ? -8.431  -48.696 9.033   1.00 32.90  ? 378  VAL A CG1 1 
ATOM   2854 C CG2 . VAL A 1 377 ? -7.962  -46.455 8.021   1.00 33.93  ? 378  VAL A CG2 1 
ATOM   2855 N N   . VAL A 1 378 ? -9.340  -50.173 5.955   1.00 41.26  ? 379  VAL A N   1 
ATOM   2856 C CA  . VAL A 1 378 ? -9.912  -51.493 5.686   1.00 43.57  ? 379  VAL A CA  1 
ATOM   2857 C C   . VAL A 1 378 ? -9.016  -52.368 4.806   1.00 47.62  ? 379  VAL A C   1 
ATOM   2858 O O   . VAL A 1 378 ? -8.898  -53.577 5.025   1.00 46.56  ? 379  VAL A O   1 
ATOM   2859 C CB  . VAL A 1 378 ? -11.264 -51.346 5.025   1.00 54.42  ? 379  VAL A CB  1 
ATOM   2860 C CG1 . VAL A 1 378 ? -11.745 -52.687 4.489   1.00 54.99  ? 379  VAL A CG1 1 
ATOM   2861 C CG2 . VAL A 1 378 ? -12.248 -50.755 6.028   1.00 44.13  ? 379  VAL A CG2 1 
ATOM   2862 N N   . LEU A 1 379 ? -8.374  -51.748 3.823   1.00 44.57  ? 380  LEU A N   1 
ATOM   2863 C CA  . LEU A 1 379 ? -7.388  -52.446 3.010   1.00 48.97  ? 380  LEU A CA  1 
ATOM   2864 C C   . LEU A 1 379 ? -6.307  -53.031 3.873   1.00 44.44  ? 380  LEU A C   1 
ATOM   2865 O O   . LEU A 1 379 ? -6.058  -54.237 3.842   1.00 45.80  ? 380  LEU A O   1 
ATOM   2866 C CB  . LEU A 1 379 ? -6.716  -51.514 1.972   1.00 43.38  ? 380  LEU A CB  1 
ATOM   2867 C CG  . LEU A 1 379 ? -5.345  -51.965 1.385   1.00 49.24  ? 380  LEU A CG  1 
ATOM   2868 C CD1 . LEU A 1 379 ? -5.437  -53.176 0.417   1.00 37.90  ? 380  LEU A CD1 1 
ATOM   2869 C CD2 . LEU A 1 379 ? -4.584  -50.806 0.726   1.00 52.21  ? 380  LEU A CD2 1 
ATOM   2870 N N   A HIS A 1 380 ? -5.635  -52.160 4.619   0.48 38.16  ? 381  HIS A N   1 
ATOM   2871 N N   B HIS A 1 380 ? -5.645  -52.171 4.638   0.52 38.23  ? 381  HIS A N   1 
ATOM   2872 C CA  A HIS A 1 380 ? -4.473  -52.559 5.395   0.48 41.12  ? 381  HIS A CA  1 
ATOM   2873 C CA  B HIS A 1 380 ? -4.465  -52.590 5.373   0.52 41.33  ? 381  HIS A CA  1 
ATOM   2874 C C   A HIS A 1 380 ? -4.833  -53.657 6.393   0.48 40.31  ? 381  HIS A C   1 
ATOM   2875 C C   B HIS A 1 380 ? -4.775  -53.546 6.518   0.52 40.41  ? 381  HIS A C   1 
ATOM   2876 O O   A HIS A 1 380 ? -4.069  -54.603 6.593   0.48 42.17  ? 381  HIS A O   1 
ATOM   2877 O O   B HIS A 1 380 ? -3.893  -54.277 6.972   0.52 43.26  ? 381  HIS A O   1 
ATOM   2878 C CB  A HIS A 1 380 ? -3.873  -51.343 6.128   0.48 39.87  ? 381  HIS A CB  1 
ATOM   2879 C CB  B HIS A 1 380 ? -3.716  -51.365 5.914   0.52 40.39  ? 381  HIS A CB  1 
ATOM   2880 C CG  A HIS A 1 380 ? -2.522  -51.601 6.723   0.48 39.59  ? 381  HIS A CG  1 
ATOM   2881 C CG  B HIS A 1 380 ? -2.650  -50.867 4.993   0.52 42.32  ? 381  HIS A CG  1 
ATOM   2882 N ND1 A HIS A 1 380 ? -1.349  -51.236 6.097   0.48 39.15  ? 381  HIS A ND1 1 
ATOM   2883 N ND1 B HIS A 1 380 ? -2.882  -49.896 4.043   0.52 43.93  ? 381  HIS A ND1 1 
ATOM   2884 C CD2 A HIS A 1 380 ? -2.158  -52.208 7.878   0.48 44.91  ? 381  HIS A CD2 1 
ATOM   2885 C CD2 B HIS A 1 380 ? -1.350  -51.221 4.862   0.52 38.82  ? 381  HIS A CD2 1 
ATOM   2886 C CE1 A HIS A 1 380 ? -0.320  -51.600 6.846   0.48 40.07  ? 381  HIS A CE1 1 
ATOM   2887 C CE1 B HIS A 1 380 ? -1.768  -49.668 3.371   0.52 46.45  ? 381  HIS A CE1 1 
ATOM   2888 N NE2 A HIS A 1 380 ? -0.785  -52.195 7.931   0.48 42.97  ? 381  HIS A NE2 1 
ATOM   2889 N NE2 B HIS A 1 380 ? -0.822  -50.458 3.849   0.52 47.80  ? 381  HIS A NE2 1 
ATOM   2890 N N   . TYR A 1 381 ? -6.018  -53.547 6.991   1.00 36.33  ? 382  TYR A N   1 
ATOM   2891 C CA  . TYR A 1 381 ? -6.350  -54.352 8.170   1.00 37.77  ? 382  TYR A CA  1 
ATOM   2892 C C   . TYR A 1 381 ? -7.217  -55.553 7.861   1.00 38.87  ? 382  TYR A C   1 
ATOM   2893 O O   . TYR A 1 381 ? -7.568  -56.320 8.749   1.00 36.57  ? 382  TYR A O   1 
ATOM   2894 C CB  . TYR A 1 381 ? -7.026  -53.484 9.221   1.00 32.68  ? 382  TYR A CB  1 
ATOM   2895 C CG  . TYR A 1 381 ? -6.042  -52.620 9.965   1.00 36.80  ? 382  TYR A CG  1 
ATOM   2896 C CD1 . TYR A 1 381 ? -5.463  -53.074 11.148  1.00 33.32  ? 382  TYR A CD1 1 
ATOM   2897 C CD2 . TYR A 1 381 ? -5.681  -51.350 9.487   1.00 30.94  ? 382  TYR A CD2 1 
ATOM   2898 C CE1 . TYR A 1 381 ? -4.566  -52.298 11.848  1.00 35.76  ? 382  TYR A CE1 1 
ATOM   2899 C CE2 . TYR A 1 381 ? -4.767  -50.561 10.183  1.00 34.10  ? 382  TYR A CE2 1 
ATOM   2900 C CZ  . TYR A 1 381 ? -4.229  -51.051 11.385  1.00 37.39  ? 382  TYR A CZ  1 
ATOM   2901 O OH  . TYR A 1 381 ? -3.325  -50.335 12.129  1.00 31.21  ? 382  TYR A OH  1 
ATOM   2902 N N   . THR A 1 382 ? -7.535  -55.744 6.593   1.00 37.43  ? 383  THR A N   1 
ATOM   2903 C CA  . THR A 1 382 ? -8.195  -56.974 6.201   1.00 33.55  ? 383  THR A CA  1 
ATOM   2904 C C   . THR A 1 382 ? -7.159  -58.034 5.857   1.00 36.04  ? 383  THR A C   1 
ATOM   2905 O O   . THR A 1 382 ? -6.176  -57.759 5.151   1.00 35.44  ? 383  THR A O   1 
ATOM   2906 C CB  . THR A 1 382 ? -9.116  -56.752 4.992   1.00 38.08  ? 383  THR A CB  1 
ATOM   2907 O OG1 . THR A 1 382 ? -10.189 -55.888 5.378   1.00 35.21  ? 383  THR A OG1 1 
ATOM   2908 C CG2 . THR A 1 382 ? -9.665  -58.077 4.469   1.00 36.73  ? 383  THR A CG2 1 
ATOM   2909 N N   . ASP A 1 383 ? -7.383  -59.240 6.360   1.00 32.54  ? 384  ASP A N   1 
ATOM   2910 C CA  . ASP A 1 383 ? -6.719  -60.414 5.836   1.00 40.24  ? 384  ASP A CA  1 
ATOM   2911 C C   . ASP A 1 383 ? -7.519  -60.927 4.634   1.00 38.96  ? 384  ASP A C   1 
ATOM   2912 O O   . ASP A 1 383 ? -8.589  -61.511 4.799   1.00 38.05  ? 384  ASP A O   1 
ATOM   2913 C CB  . ASP A 1 383 ? -6.616  -61.489 6.910   1.00 41.01  ? 384  ASP A CB  1 
ATOM   2914 C CG  . ASP A 1 383 ? -5.899  -62.722 6.427   1.00 40.87  ? 384  ASP A CG  1 
ATOM   2915 O OD1 . ASP A 1 383 ? -5.904  -63.003 5.203   1.00 42.52  ? 384  ASP A OD1 1 
ATOM   2916 O OD2 . ASP A 1 383 ? -5.323  -63.422 7.275   1.00 42.61  ? 384  ASP A OD2 1 
ATOM   2917 N N   . TRP A 1 384 ? -7.007  -60.737 3.427   1.00 36.79  ? 385  TRP A N   1 
ATOM   2918 C CA  . TRP A 1 384 ? -7.818  -61.043 2.245   1.00 34.21  ? 385  TRP A CA  1 
ATOM   2919 C C   . TRP A 1 384 ? -7.929  -62.544 1.924   1.00 35.17  ? 385  TRP A C   1 
ATOM   2920 O O   . TRP A 1 384 ? -8.632  -62.933 0.995   1.00 38.48  ? 385  TRP A O   1 
ATOM   2921 C CB  . TRP A 1 384 ? -7.280  -60.252 1.052   1.00 36.60  ? 385  TRP A CB  1 
ATOM   2922 C CG  . TRP A 1 384 ? -7.465  -58.770 1.297   1.00 31.26  ? 385  TRP A CG  1 
ATOM   2923 C CD1 . TRP A 1 384 ? -6.517  -57.881 1.754   1.00 35.44  ? 385  TRP A CD1 1 
ATOM   2924 C CD2 . TRP A 1 384 ? -8.682  -58.026 1.176   1.00 31.00  ? 385  TRP A CD2 1 
ATOM   2925 N NE1 . TRP A 1 384 ? -7.065  -56.621 1.873   1.00 30.85  ? 385  TRP A NE1 1 
ATOM   2926 C CE2 . TRP A 1 384 ? -8.396  -56.687 1.544   1.00 31.95  ? 385  TRP A CE2 1 
ATOM   2927 C CE3 . TRP A 1 384 ? -9.987  -58.357 0.790   1.00 35.86  ? 385  TRP A CE3 1 
ATOM   2928 C CZ2 . TRP A 1 384 ? -9.363  -55.688 1.531   1.00 31.76  ? 385  TRP A CZ2 1 
ATOM   2929 C CZ3 . TRP A 1 384 ? -10.950 -57.350 0.768   1.00 32.48  ? 385  TRP A CZ3 1 
ATOM   2930 C CH2 . TRP A 1 384 ? -10.632 -56.035 1.139   1.00 40.55  ? 385  TRP A CH2 1 
ATOM   2931 N N   . LEU A 1 385 ? -7.255  -63.380 2.707   1.00 36.71  ? 386  LEU A N   1 
ATOM   2932 C CA  . LEU A 1 385 ? -7.514  -64.822 2.714   1.00 35.41  ? 386  LEU A CA  1 
ATOM   2933 C C   . LEU A 1 385 ? -8.638  -65.215 3.690   1.00 46.23  ? 386  LEU A C   1 
ATOM   2934 O O   . LEU A 1 385 ? -9.203  -66.300 3.581   1.00 41.76  ? 386  LEU A O   1 
ATOM   2935 C CB  . LEU A 1 385 ? -6.227  -65.589 3.044   1.00 37.66  ? 386  LEU A CB  1 
ATOM   2936 C CG  . LEU A 1 385 ? -5.228  -65.552 1.862   1.00 47.16  ? 386  LEU A CG  1 
ATOM   2937 C CD1 . LEU A 1 385 ? -4.039  -66.450 2.085   1.00 47.29  ? 386  LEU A CD1 1 
ATOM   2938 C CD2 . LEU A 1 385 ? -5.933  -65.945 0.587   1.00 42.47  ? 386  LEU A CD2 1 
ATOM   2939 N N   . HIS A 1 386 ? -8.966  -64.326 4.631   1.00 42.61  ? 387  HIS A N   1 
ATOM   2940 C CA  . HIS A 1 386 ? -10.060 -64.558 5.577   1.00 44.27  ? 387  HIS A CA  1 
ATOM   2941 C C   . HIS A 1 386 ? -10.817 -63.272 5.851   1.00 37.89  ? 387  HIS A C   1 
ATOM   2942 O O   . HIS A 1 386 ? -10.861 -62.812 6.981   1.00 47.63  ? 387  HIS A O   1 
ATOM   2943 C CB  . HIS A 1 386 ? -9.541  -65.107 6.912   1.00 37.76  ? 387  HIS A CB  1 
ATOM   2944 C CG  . HIS A 1 386 ? -8.565  -66.228 6.777   1.00 47.46  ? 387  HIS A CG  1 
ATOM   2945 N ND1 . HIS A 1 386 ? -8.953  -67.550 6.729   1.00 49.51  ? 387  HIS A ND1 1 
ATOM   2946 C CD2 . HIS A 1 386 ? -7.213  -66.228 6.700   1.00 43.53  ? 387  HIS A CD2 1 
ATOM   2947 C CE1 . HIS A 1 386 ? -7.881  -68.317 6.619   1.00 46.40  ? 387  HIS A CE1 1 
ATOM   2948 N NE2 . HIS A 1 386 ? -6.812  -67.540 6.601   1.00 45.73  ? 387  HIS A NE2 1 
ATOM   2949 N N   . PRO A 1 387 ? -11.416 -62.682 4.822   1.00 44.33  ? 388  PRO A N   1 
ATOM   2950 C CA  . PRO A 1 387 ? -11.957 -61.331 5.003   1.00 39.15  ? 388  PRO A CA  1 
ATOM   2951 C C   . PRO A 1 387 ? -13.179 -61.247 5.915   1.00 45.74  ? 388  PRO A C   1 
ATOM   2952 O O   . PRO A 1 387 ? -13.549 -60.130 6.287   1.00 45.53  ? 388  PRO A O   1 
ATOM   2953 C CB  . PRO A 1 387 ? -12.328 -60.913 3.578   1.00 37.74  ? 388  PRO A CB  1 
ATOM   2954 C CG  . PRO A 1 387 ? -12.628 -62.226 2.885   1.00 44.10  ? 388  PRO A CG  1 
ATOM   2955 C CD  . PRO A 1 387 ? -11.649 -63.209 3.463   1.00 38.74  ? 388  PRO A CD  1 
ATOM   2956 N N   . GLU A 1 388 ? -13.779 -62.381 6.283   1.00 47.33  ? 389  GLU A N   1 
ATOM   2957 C CA  . GLU A 1 388 ? -15.044 -62.346 7.025   1.00 49.54  ? 389  GLU A CA  1 
ATOM   2958 C C   . GLU A 1 388 ? -15.032 -63.140 8.324   1.00 44.68  ? 389  GLU A C   1 
ATOM   2959 O O   . GLU A 1 388 ? -16.080 -63.351 8.930   1.00 47.66  ? 389  GLU A O   1 
ATOM   2960 C CB  . GLU A 1 388 ? -16.181 -62.844 6.136   1.00 52.29  ? 389  GLU A CB  1 
ATOM   2961 C CG  . GLU A 1 388 ? -16.254 -62.097 4.811   1.00 59.77  ? 389  GLU A CG  1 
ATOM   2962 C CD  . GLU A 1 388 ? -17.665 -61.858 4.335   1.00 66.67  ? 389  GLU A CD  1 
ATOM   2963 O OE1 . GLU A 1 388 ? -18.560 -61.615 5.178   1.00 75.17  ? 389  GLU A OE1 1 
ATOM   2964 O OE2 . GLU A 1 388 ? -17.877 -61.911 3.111   1.00 81.80  ? 389  GLU A OE2 1 
ATOM   2965 N N   . ASP A 1 389 ? -13.854 -63.569 8.755   1.00 36.68  ? 390  ASP A N   1 
ATOM   2966 C CA  . ASP A 1 389 ? -13.742 -64.333 9.976   1.00 40.26  ? 390  ASP A CA  1 
ATOM   2967 C C   . ASP A 1 389 ? -13.962 -63.420 11.191  1.00 49.84  ? 390  ASP A C   1 
ATOM   2968 O O   . ASP A 1 389 ? -13.178 -62.509 11.427  1.00 46.84  ? 390  ASP A O   1 
ATOM   2969 C CB  . ASP A 1 389 ? -12.378 -65.016 10.061  1.00 38.52  ? 390  ASP A CB  1 
ATOM   2970 C CG  . ASP A 1 389 ? -12.173 -65.714 11.378  1.00 47.94  ? 390  ASP A CG  1 
ATOM   2971 O OD1 . ASP A 1 389 ? -13.180 -66.117 11.987  1.00 57.82  ? 390  ASP A OD1 1 
ATOM   2972 O OD2 . ASP A 1 389 ? -11.014 -65.864 11.818  1.00 58.21  ? 390  ASP A OD2 1 
ATOM   2973 N N   . PRO A 1 390 ? -15.041 -63.665 11.957  1.00 55.31  ? 391  PRO A N   1 
ATOM   2974 C CA  . PRO A 1 390 ? -15.445 -62.792 13.075  1.00 46.42  ? 391  PRO A CA  1 
ATOM   2975 C C   . PRO A 1 390 ? -14.361 -62.542 14.115  1.00 43.38  ? 391  PRO A C   1 
ATOM   2976 O O   . PRO A 1 390 ? -14.160 -61.376 14.432  1.00 42.95  ? 391  PRO A O   1 
ATOM   2977 C CB  . PRO A 1 390 ? -16.628 -63.544 13.686  1.00 47.83  ? 391  PRO A CB  1 
ATOM   2978 C CG  . PRO A 1 390 ? -17.243 -64.245 12.469  1.00 58.52  ? 391  PRO A CG  1 
ATOM   2979 C CD  . PRO A 1 390 ? -16.035 -64.729 11.706  1.00 45.70  ? 391  PRO A CD  1 
ATOM   2980 N N   . ALA A 1 391 ? -13.673 -63.572 14.606  1.00 38.30  ? 392  ALA A N   1 
ATOM   2981 C CA  . ALA A 1 391 ? -12.602 -63.367 15.580  1.00 45.64  ? 392  ALA A CA  1 
ATOM   2982 C C   . ALA A 1 391 ? -11.465 -62.487 15.031  1.00 49.28  ? 392  ALA A C   1 
ATOM   2983 O O   . ALA A 1 391 ? -10.939 -61.619 15.744  1.00 44.18  ? 392  ALA A O   1 
ATOM   2984 C CB  . ALA A 1 391 ? -12.039 -64.711 16.055  1.00 43.45  ? 392  ALA A CB  1 
ATOM   2985 N N   . ARG A 1 392 ? -11.082 -62.709 13.775  1.00 43.24  ? 393  ARG A N   1 
ATOM   2986 C CA  . ARG A 1 392 ? -10.020 -61.908 13.162  1.00 44.84  ? 393  ARG A CA  1 
ATOM   2987 C C   . ARG A 1 392 ? -10.476 -60.471 12.960  1.00 37.17  ? 393  ARG A C   1 
ATOM   2988 O O   . ARG A 1 392 ? -9.686  -59.549 13.094  1.00 40.04  ? 393  ARG A O   1 
ATOM   2989 C CB  . ARG A 1 392 ? -9.568  -62.496 11.820  1.00 42.35  ? 393  ARG A CB  1 
ATOM   2990 C CG  . ARG A 1 392 ? -8.533  -63.628 11.889  1.00 42.90  ? 393  ARG A CG  1 
ATOM   2991 C CD  . ARG A 1 392 ? -8.201  -64.067 10.422  1.00 47.48  ? 393  ARG A CD  1 
ATOM   2992 N NE  . ARG A 1 392 ? -7.149  -65.081 10.300  1.00 44.48  ? 393  ARG A NE  1 
ATOM   2993 C CZ  . ARG A 1 392 ? -7.373  -66.400 10.257  1.00 51.53  ? 393  ARG A CZ  1 
ATOM   2994 N NH1 . ARG A 1 392 ? -8.606  -66.886 10.355  1.00 49.33  ? 393  ARG A NH1 1 
ATOM   2995 N NH2 . ARG A 1 392 ? -6.357  -67.239 10.125  1.00 47.51  ? 393  ARG A NH2 1 
ATOM   2996 N N   . LEU A 1 393 ? -11.753 -60.280 12.653  1.00 34.24  ? 394  LEU A N   1 
ATOM   2997 C CA  . LEU A 1 393 ? -12.287 -58.934 12.485  1.00 37.98  ? 394  LEU A CA  1 
ATOM   2998 C C   . LEU A 1 393 ? -12.300 -58.179 13.819  1.00 36.36  ? 394  LEU A C   1 
ATOM   2999 O O   . LEU A 1 393 ? -12.043 -56.959 13.867  1.00 37.74  ? 394  LEU A O   1 
ATOM   3000 C CB  . LEU A 1 393 ? -13.696 -58.972 11.888  1.00 32.81  ? 394  LEU A CB  1 
ATOM   3001 C CG  . LEU A 1 393 ? -13.823 -59.389 10.408  1.00 45.04  ? 394  LEU A CG  1 
ATOM   3002 C CD1 . LEU A 1 393 ? -15.278 -59.596 10.000  1.00 35.09  ? 394  LEU A CD1 1 
ATOM   3003 C CD2 . LEU A 1 393 ? -13.202 -58.362 9.495   1.00 34.95  ? 394  LEU A CD2 1 
ATOM   3004 N N   . ARG A 1 394 ? -12.618 -58.899 14.892  1.00 33.78  ? 395  ARG A N   1 
ATOM   3005 C CA  . ARG A 1 394 ? -12.629 -58.316 16.223  1.00 37.20  ? 395  ARG A CA  1 
ATOM   3006 C C   . ARG A 1 394 ? -11.213 -57.836 16.571  1.00 33.19  ? 395  ARG A C   1 
ATOM   3007 O O   . ARG A 1 394 ? -11.013 -56.680 16.899  1.00 32.95  ? 395  ARG A O   1 
ATOM   3008 C CB  . ARG A 1 394 ? -13.124 -59.329 17.250  1.00 40.34  ? 395  ARG A CB  1 
ATOM   3009 C CG  . ARG A 1 394 ? -13.250 -58.771 18.667  1.00 37.75  ? 395  ARG A CG  1 
ATOM   3010 C CD  . ARG A 1 394 ? -13.420 -59.888 19.665  1.00 33.29  ? 395  ARG A CD  1 
ATOM   3011 N NE  . ARG A 1 394 ? -12.292 -60.819 19.639  1.00 43.04  ? 395  ARG A NE  1 
ATOM   3012 C CZ  . ARG A 1 394 ? -12.385 -62.114 19.939  1.00 44.26  ? 395  ARG A CZ  1 
ATOM   3013 N NH1 . ARG A 1 394 ? -13.559 -62.632 20.265  1.00 44.89  ? 395  ARG A NH1 1 
ATOM   3014 N NH2 . ARG A 1 394 ? -11.313 -62.897 19.914  1.00 43.38  ? 395  ARG A NH2 1 
ATOM   3015 N N   . GLU A 1 395 ? -10.241 -58.735 16.454  1.00 34.17  ? 396  GLU A N   1 
ATOM   3016 C CA  . GLU A 1 395 ? -8.839  -58.409 16.656  1.00 39.23  ? 396  GLU A CA  1 
ATOM   3017 C C   . GLU A 1 395 ? -8.372  -57.269 15.743  1.00 43.26  ? 396  GLU A C   1 
ATOM   3018 O O   . GLU A 1 395 ? -7.671  -56.371 16.201  1.00 37.46  ? 396  GLU A O   1 
ATOM   3019 C CB  . GLU A 1 395 ? -7.965  -59.651 16.434  1.00 36.91  ? 396  GLU A CB  1 
ATOM   3020 C CG  . GLU A 1 395 ? -7.485  -60.375 17.686  1.00 52.70  ? 396  GLU A CG  1 
ATOM   3021 C CD  . GLU A 1 395 ? -8.617  -60.919 18.568  1.00 66.87  ? 396  GLU A CD  1 
ATOM   3022 O OE1 . GLU A 1 395 ? -9.191  -60.127 19.360  1.00 70.83  ? 396  GLU A OE1 1 
ATOM   3023 O OE2 . GLU A 1 395 ? -8.919  -62.139 18.489  1.00 63.37  ? 396  GLU A OE2 1 
ATOM   3024 N N   . ALA A 1 396 ? -8.758  -57.287 14.466  1.00 35.50  ? 397  ALA A N   1 
ATOM   3025 C CA  . ALA A 1 396 ? -8.315  -56.240 13.553  1.00 33.02  ? 397  ALA A CA  1 
ATOM   3026 C C   . ALA A 1 396 ? -8.860  -54.875 13.945  1.00 33.09  ? 397  ALA A C   1 
ATOM   3027 O O   . ALA A 1 396 ? -8.146  -53.879 13.822  1.00 34.25  ? 397  ALA A O   1 
ATOM   3028 C CB  . ALA A 1 396 ? -8.718  -56.569 12.056  1.00 29.60  ? 397  ALA A CB  1 
ATOM   3029 N N   . LEU A 1 397 ? -10.120 -54.810 14.377  1.00 29.91  ? 398  LEU A N   1 
ATOM   3030 C CA  . LEU A 1 397 ? -10.697 -53.515 14.703  1.00 34.13  ? 398  LEU A CA  1 
ATOM   3031 C C   . LEU A 1 397 ? -10.056 -53.002 16.007  1.00 37.65  ? 398  LEU A C   1 
ATOM   3032 O O   . LEU A 1 397 ? -9.829  -51.802 16.182  1.00 33.91  ? 398  LEU A O   1 
ATOM   3033 C CB  . LEU A 1 397 ? -12.215 -53.593 14.833  1.00 31.89  ? 398  LEU A CB  1 
ATOM   3034 C CG  . LEU A 1 397 ? -12.856 -52.248 15.156  1.00 35.98  ? 398  LEU A CG  1 
ATOM   3035 C CD1 . LEU A 1 397 ? -12.568 -51.247 14.039  1.00 33.18  ? 398  LEU A CD1 1 
ATOM   3036 C CD2 . LEU A 1 397 ? -14.354 -52.375 15.405  1.00 38.26  ? 398  LEU A CD2 1 
ATOM   3037 N N   . SER A 1 398 ? -9.726  -53.925 16.900  1.00 34.11  ? 399  SER A N   1 
ATOM   3038 C CA  . SER A 1 398 ? -8.976  -53.583 18.100  1.00 39.72  ? 399  SER A CA  1 
ATOM   3039 C C   . SER A 1 398 ? -7.632  -52.936 17.701  1.00 39.46  ? 399  SER A C   1 
ATOM   3040 O O   . SER A 1 398 ? -7.310  -51.831 18.160  1.00 36.19  ? 399  SER A O   1 
ATOM   3041 C CB  . SER A 1 398 ? -8.775  -54.828 18.963  1.00 34.06  ? 399  SER A CB  1 
ATOM   3042 O OG  . SER A 1 398 ? -8.084  -54.522 20.164  1.00 46.16  ? 399  SER A OG  1 
ATOM   3043 N N   . ASP A 1 399 ? -6.881  -53.616 16.827  1.00 36.86  ? 400  ASP A N   1 
ATOM   3044 C CA  . ASP A 1 399 ? -5.658  -53.082 16.213  1.00 34.51  ? 400  ASP A CA  1 
ATOM   3045 C C   . ASP A 1 399 ? -5.851  -51.703 15.603  1.00 35.12  ? 400  ASP A C   1 
ATOM   3046 O O   . ASP A 1 399 ? -5.046  -50.810 15.828  1.00 32.16  ? 400  ASP A O   1 
ATOM   3047 C CB  . ASP A 1 399 ? -5.140  -54.009 15.103  1.00 37.02  ? 400  ASP A CB  1 
ATOM   3048 C CG  . ASP A 1 399 ? -4.547  -55.286 15.637  1.00 42.04  ? 400  ASP A CG  1 
ATOM   3049 O OD1 . ASP A 1 399 ? -4.230  -55.338 16.841  1.00 43.72  ? 400  ASP A OD1 1 
ATOM   3050 O OD2 . ASP A 1 399 ? -4.402  -56.242 14.845  1.00 47.59  ? 400  ASP A OD2 1 
ATOM   3051 N N   . VAL A 1 400 ? -6.899  -51.534 14.802  1.00 32.71  ? 401  VAL A N   1 
ATOM   3052 C CA  . VAL A 1 400 ? -7.125  -50.244 14.153  1.00 31.81  ? 401  VAL A CA  1 
ATOM   3053 C C   . VAL A 1 400 ? -7.199  -49.122 15.189  1.00 36.94  ? 401  VAL A C   1 
ATOM   3054 O O   . VAL A 1 400 ? -6.498  -48.111 15.085  1.00 36.82  ? 401  VAL A O   1 
ATOM   3055 C CB  . VAL A 1 400 ? -8.409  -50.253 13.301  1.00 30.50  ? 401  VAL A CB  1 
ATOM   3056 C CG1 . VAL A 1 400 ? -8.808  -48.839 12.911  1.00 25.16  ? 401  VAL A CG1 1 
ATOM   3057 C CG2 . VAL A 1 400 ? -8.217  -51.142 12.026  1.00 28.35  ? 401  VAL A CG2 1 
ATOM   3058 N N   . VAL A 1 401 ? -8.037  -49.332 16.198  1.00 33.14  ? 402  VAL A N   1 
ATOM   3059 C CA  . VAL A 1 401 ? -8.331  -48.321 17.186  1.00 35.59  ? 402  VAL A CA  1 
ATOM   3060 C C   . VAL A 1 401 ? -7.092  -48.013 18.045  1.00 28.12  ? 402  VAL A C   1 
ATOM   3061 O O   . VAL A 1 401 ? -6.739  -46.840 18.227  1.00 28.94  ? 402  VAL A O   1 
ATOM   3062 C CB  . VAL A 1 401 ? -9.538  -48.775 18.058  1.00 32.24  ? 402  VAL A CB  1 
ATOM   3063 C CG1 . VAL A 1 401 ? -9.672  -47.901 19.310  1.00 28.95  ? 402  VAL A CG1 1 
ATOM   3064 C CG2 . VAL A 1 401 ? -10.823 -48.742 17.206  1.00 33.58  ? 402  VAL A CG2 1 
ATOM   3065 N N   . GLY A 1 402 ? -6.427  -49.065 18.526  1.00 27.64  ? 403  GLY A N   1 
ATOM   3066 C CA  . GLY A 1 402 ? -5.205  -48.918 19.307  1.00 32.85  ? 403  GLY A CA  1 
ATOM   3067 C C   . GLY A 1 402 ? -4.038  -48.312 18.534  1.00 34.65  ? 403  GLY A C   1 
ATOM   3068 O O   . GLY A 1 402 ? -3.275  -47.501 19.068  1.00 32.30  ? 403  GLY A O   1 
ATOM   3069 N N   . ASP A 1 403 ? -3.895  -48.701 17.270  1.00 34.76  ? 404  ASP A N   1 
ATOM   3070 C CA  . ASP A 1 403 ? -2.777  -48.226 16.445  1.00 29.69  ? 404  ASP A CA  1 
ATOM   3071 C C   . ASP A 1 403 ? -2.927  -46.739 16.215  1.00 29.43  ? 404  ASP A C   1 
ATOM   3072 O O   . ASP A 1 403 ? -2.000  -45.954 16.444  1.00 30.48  ? 404  ASP A O   1 
ATOM   3073 C CB  . ASP A 1 403 ? -2.713  -48.970 15.089  1.00 29.61  ? 404  ASP A CB  1 
ATOM   3074 C CG  . ASP A 1 403 ? -2.250  -50.432 15.234  1.00 35.00  ? 404  ASP A CG  1 
ATOM   3075 O OD1 . ASP A 1 403 ? -1.802  -50.840 16.320  1.00 35.02  ? 404  ASP A OD1 1 
ATOM   3076 O OD2 . ASP A 1 403 ? -2.326  -51.176 14.246  1.00 35.92  ? 404  ASP A OD2 1 
ATOM   3077 N N   . HIS A 1 404 ? -4.119  -46.361 15.768  1.00 29.17  ? 405  HIS A N   1 
ATOM   3078 C CA  . HIS A 1 404 ? -4.415  -44.985 15.422  1.00 28.71  ? 405  HIS A CA  1 
ATOM   3079 C C   . HIS A 1 404 ? -4.342  -44.032 16.614  1.00 31.21  ? 405  HIS A C   1 
ATOM   3080 O O   . HIS A 1 404 ? -3.810  -42.929 16.511  1.00 30.31  ? 405  HIS A O   1 
ATOM   3081 C CB  . HIS A 1 404 ? -5.808  -44.909 14.794  1.00 28.46  ? 405  HIS A CB  1 
ATOM   3082 C CG  . HIS A 1 404 ? -6.254  -43.520 14.452  1.00 28.61  ? 405  HIS A CG  1 
ATOM   3083 N ND1 . HIS A 1 404 ? -5.489  -42.654 13.700  1.00 34.34  ? 405  HIS A ND1 1 
ATOM   3084 C CD2 . HIS A 1 404 ? -7.401  -42.856 14.738  1.00 32.72  ? 405  HIS A CD2 1 
ATOM   3085 C CE1 . HIS A 1 404 ? -6.144  -41.517 13.535  1.00 29.06  ? 405  HIS A CE1 1 
ATOM   3086 N NE2 . HIS A 1 404 ? -7.316  -41.620 14.140  1.00 32.99  ? 405  HIS A NE2 1 
ATOM   3087 N N   . ASN A 1 405 ? -4.911  -44.440 17.735  1.00 25.97  ? 406  ASN A N   1 
ATOM   3088 C CA  . ASN A 1 405 ? -5.030  -43.506 18.839  1.00 31.91  ? 406  ASN A CA  1 
ATOM   3089 C C   . ASN A 1 405 ? -3.890  -43.566 19.839  1.00 27.99  ? 406  ASN A C   1 
ATOM   3090 O O   . ASN A 1 405 ? -3.671  -42.597 20.537  1.00 32.24  ? 406  ASN A O   1 
ATOM   3091 C CB  . ASN A 1 405 ? -6.359  -43.732 19.573  1.00 31.92  ? 406  ASN A CB  1 
ATOM   3092 C CG  . ASN A 1 405 ? -7.542  -43.409 18.706  1.00 31.23  ? 406  ASN A CG  1 
ATOM   3093 O OD1 . ASN A 1 405 ? -7.873  -42.250 18.520  1.00 32.57  ? 406  ASN A OD1 1 
ATOM   3094 N ND2 . ASN A 1 405 ? -8.166  -44.432 18.144  1.00 28.85  ? 406  ASN A ND2 1 
ATOM   3095 N N   . VAL A 1 406 ? -3.187  -44.694 19.926  1.00 28.85  ? 407  VAL A N   1 
ATOM   3096 C CA  . VAL A 1 406 ? -2.168  -44.837 20.954  1.00 29.32  ? 407  VAL A CA  1 
ATOM   3097 C C   . VAL A 1 406 ? -0.797  -45.307 20.448  1.00 29.24  ? 407  VAL A C   1 
ATOM   3098 O O   . VAL A 1 406 ? 0.191   -44.578 20.581  1.00 28.90  ? 407  VAL A O   1 
ATOM   3099 C CB  . VAL A 1 406 ? -2.623  -45.806 22.057  1.00 29.08  ? 407  VAL A CB  1 
ATOM   3100 C CG1 . VAL A 1 406 ? -1.547  -45.850 23.158  1.00 25.75  ? 407  VAL A CG1 1 
ATOM   3101 C CG2 . VAL A 1 406 ? -3.962  -45.337 22.674  1.00 29.47  ? 407  VAL A CG2 1 
ATOM   3102 N N   . VAL A 1 407 ? -0.732  -46.500 19.849  1.00 30.08  ? 408  VAL A N   1 
ATOM   3103 C CA  . VAL A 1 407 ? 0.562   -47.102 19.507  1.00 27.46  ? 408  VAL A CA  1 
ATOM   3104 C C   . VAL A 1 407 ? 1.360   -46.279 18.489  1.00 30.24  ? 408  VAL A C   1 
ATOM   3105 O O   . VAL A 1 407 ? 2.536   -46.000 18.688  1.00 30.49  ? 408  VAL A O   1 
ATOM   3106 C CB  . VAL A 1 407 ? 0.390   -48.544 18.980  1.00 31.27  ? 408  VAL A CB  1 
ATOM   3107 C CG1 . VAL A 1 407 ? 1.776   -49.182 18.716  1.00 31.82  ? 408  VAL A CG1 1 
ATOM   3108 C CG2 . VAL A 1 407 ? -0.380  -49.385 20.002  1.00 29.60  ? 408  VAL A CG2 1 
ATOM   3109 N N   . CYS A 1 408 ? 0.724   -45.841 17.416  1.00 27.52  ? 409  CYS A N   1 
ATOM   3110 C CA  . CYS A 1 408 ? 1.508   -45.180 16.392  1.00 30.65  ? 409  CYS A CA  1 
ATOM   3111 C C   . CYS A 1 408 ? 1.858   -43.752 16.776  1.00 30.34  ? 409  CYS A C   1 
ATOM   3112 O O   . CYS A 1 408 ? 2.949   -43.292 16.453  1.00 34.32  ? 409  CYS A O   1 
ATOM   3113 C CB  . CYS A 1 408 ? 0.773   -45.255 15.033  1.00 29.64  ? 409  CYS A CB  1 
ATOM   3114 S SG  . CYS A 1 408 ? 0.612   -46.983 14.549  1.00 29.31  ? 409  CYS A SG  1 
ATOM   3115 N N   . PRO A 1 409 ? 0.952   -43.036 17.469  1.00 28.55  ? 410  PRO A N   1 
ATOM   3116 C CA  . PRO A 1 409 ? 1.462   -41.754 17.973  1.00 34.05  ? 410  PRO A CA  1 
ATOM   3117 C C   . PRO A 1 409 ? 2.655   -41.901 18.948  1.00 33.54  ? 410  PRO A C   1 
ATOM   3118 O O   . PRO A 1 409 ? 3.574   -41.077 18.899  1.00 32.38  ? 410  PRO A O   1 
ATOM   3119 C CB  . PRO A 1 409 ? 0.241   -41.154 18.682  1.00 32.47  ? 410  PRO A CB  1 
ATOM   3120 C CG  . PRO A 1 409 ? -0.912  -41.683 17.901  1.00 29.79  ? 410  PRO A CG  1 
ATOM   3121 C CD  . PRO A 1 409 ? -0.518  -43.116 17.586  1.00 30.18  ? 410  PRO A CD  1 
ATOM   3122 N N   . VAL A 1 410 ? 2.643   -42.912 19.810  1.00 27.64  ? 411  VAL A N   1 
ATOM   3123 C CA  . VAL A 1 410 ? 3.759   -43.124 20.726  1.00 29.53  ? 411  VAL A CA  1 
ATOM   3124 C C   . VAL A 1 410 ? 5.016   -43.528 19.947  1.00 33.61  ? 411  VAL A C   1 
ATOM   3125 O O   . VAL A 1 410 ? 6.096   -43.023 20.212  1.00 34.50  ? 411  VAL A O   1 
ATOM   3126 C CB  . VAL A 1 410 ? 3.426   -44.194 21.804  1.00 29.18  ? 411  VAL A CB  1 
ATOM   3127 C CG1 . VAL A 1 410 ? 4.691   -44.742 22.478  1.00 25.00  ? 411  VAL A CG1 1 
ATOM   3128 C CG2 . VAL A 1 410 ? 2.452   -43.634 22.869  1.00 22.34  ? 411  VAL A CG2 1 
ATOM   3129 N N   . ALA A 1 411 ? 4.867   -44.414 18.970  1.00 33.28  ? 412  ALA A N   1 
ATOM   3130 C CA  . ALA A 1 411 ? 5.996   -44.835 18.147  1.00 36.27  ? 412  ALA A CA  1 
ATOM   3131 C C   . ALA A 1 411 ? 6.583   -43.648 17.401  1.00 30.51  ? 412  ALA A C   1 
ATOM   3132 O O   . ALA A 1 411 ? 7.794   -43.498 17.315  1.00 33.81  ? 412  ALA A O   1 
ATOM   3133 C CB  . ALA A 1 411 ? 5.581   -45.925 17.175  1.00 30.41  ? 412  ALA A CB  1 
ATOM   3134 N N   . GLN A 1 412 ? 5.728   -42.781 16.888  1.00 31.92  ? 413  GLN A N   1 
ATOM   3135 C CA  . GLN A 1 412 ? 6.233   -41.622 16.175  1.00 29.26  ? 413  GLN A CA  1 
ATOM   3136 C C   . GLN A 1 412 ? 6.979   -40.674 17.101  1.00 32.63  ? 413  GLN A C   1 
ATOM   3137 O O   . GLN A 1 412 ? 8.018   -40.140 16.744  1.00 33.45  ? 413  GLN A O   1 
ATOM   3138 C CB  . GLN A 1 412 ? 5.102   -40.871 15.488  1.00 30.19  ? 413  GLN A CB  1 
ATOM   3139 C CG  . GLN A 1 412 ? 5.579   -39.558 14.922  1.00 34.93  ? 413  GLN A CG  1 
ATOM   3140 C CD  . GLN A 1 412 ? 4.648   -38.992 13.923  1.00 46.19  ? 413  GLN A CD  1 
ATOM   3141 O OE1 . GLN A 1 412 ? 3.608   -38.437 14.273  1.00 60.17  ? 413  GLN A OE1 1 
ATOM   3142 N NE2 . GLN A 1 412 ? 4.989   -39.149 12.651  1.00 66.74  ? 413  GLN A NE2 1 
ATOM   3143 N N   . LEU A 1 413 ? 6.424   -40.436 18.284  1.00 36.03  ? 414  LEU A N   1 
ATOM   3144 C CA  . LEU A 1 413 ? 7.101   -39.611 19.282  1.00 30.68  ? 414  LEU A CA  1 
ATOM   3145 C C   . LEU A 1 413 ? 8.459   -40.230 19.648  1.00 30.39  ? 414  LEU A C   1 
ATOM   3146 O O   . LEU A 1 413 ? 9.479   -39.548 19.687  1.00 28.74  ? 414  LEU A O   1 
ATOM   3147 C CB  . LEU A 1 413 ? 6.226   -39.457 20.533  1.00 25.68  ? 414  LEU A CB  1 
ATOM   3148 C CG  . LEU A 1 413 ? 6.898   -38.728 21.709  1.00 33.86  ? 414  LEU A CG  1 
ATOM   3149 C CD1 . LEU A 1 413 ? 6.813   -37.213 21.538  1.00 34.32  ? 414  LEU A CD1 1 
ATOM   3150 C CD2 . LEU A 1 413 ? 6.271   -39.110 22.969  1.00 32.71  ? 414  LEU A CD2 1 
ATOM   3151 N N   . ALA A 1 414 ? 8.454   -41.526 19.929  1.00 26.47  ? 415  ALA A N   1 
ATOM   3152 C CA  . ALA A 1 414 ? 9.672   -42.229 20.296  1.00 29.74  ? 415  ALA A CA  1 
ATOM   3153 C C   . ALA A 1 414 ? 10.763  -42.076 19.221  1.00 36.99  ? 415  ALA A C   1 
ATOM   3154 O O   . ALA A 1 414 ? 11.896  -41.716 19.525  1.00 37.00  ? 415  ALA A O   1 
ATOM   3155 C CB  . ALA A 1 414 ? 9.366   -43.723 20.553  1.00 25.16  ? 415  ALA A CB  1 
ATOM   3156 N N   . GLY A 1 415 ? 10.405  -42.314 17.961  1.00 37.95  ? 416  GLY A N   1 
ATOM   3157 C CA  . GLY A 1 415 ? 11.368  -42.255 16.873  1.00 30.13  ? 416  GLY A CA  1 
ATOM   3158 C C   . GLY A 1 415 ? 11.949  -40.885 16.622  1.00 31.79  ? 416  GLY A C   1 
ATOM   3159 O O   . GLY A 1 415 ? 13.159  -40.720 16.449  1.00 32.38  ? 416  GLY A O   1 
ATOM   3160 N N   . ARG A 1 416 ? 11.083  -39.884 16.606  1.00 32.17  ? 417  ARG A N   1 
ATOM   3161 C CA  . ARG A 1 416 ? 11.540  -38.515 16.425  1.00 31.63  ? 417  ARG A CA  1 
ATOM   3162 C C   . ARG A 1 416 ? 12.428  -38.062 17.597  1.00 40.65  ? 417  ARG A C   1 
ATOM   3163 O O   . ARG A 1 416 ? 13.504  -37.498 17.381  1.00 41.09  ? 417  ARG A O   1 
ATOM   3164 C CB  . ARG A 1 416 ? 10.344  -37.574 16.254  1.00 30.27  ? 417  ARG A CB  1 
ATOM   3165 C CG  . ARG A 1 416 ? 9.730   -37.616 14.885  1.00 43.83  ? 417  ARG A CG  1 
ATOM   3166 C CD  . ARG A 1 416 ? 10.839  -37.595 13.808  1.00 45.05  ? 417  ARG A CD  1 
ATOM   3167 N NE  . ARG A 1 416 ? 10.369  -37.102 12.524  1.00 63.17  ? 417  ARG A NE  1 
ATOM   3168 C CZ  . ARG A 1 416 ? 10.865  -36.036 11.897  1.00 64.56  ? 417  ARG A CZ  1 
ATOM   3169 N NH1 . ARG A 1 416 ? 11.854  -35.335 12.439  1.00 59.01  ? 417  ARG A NH1 1 
ATOM   3170 N NH2 . ARG A 1 416 ? 10.365  -35.671 10.718  1.00 62.37  ? 417  ARG A NH2 1 
ATOM   3171 N N   . LEU A 1 417 ? 12.000  -38.309 18.836  1.00 36.73  ? 418  LEU A N   1 
ATOM   3172 C CA  . LEU A 1 417 ? 12.804  -37.856 19.974  1.00 35.54  ? 418  LEU A CA  1 
ATOM   3173 C C   . LEU A 1 417 ? 14.169  -38.536 19.934  1.00 33.03  ? 418  LEU A C   1 
ATOM   3174 O O   . LEU A 1 417 ? 15.179  -37.877 20.141  1.00 40.69  ? 418  LEU A O   1 
ATOM   3175 C CB  . LEU A 1 417 ? 12.110  -38.130 21.335  1.00 31.46  ? 418  LEU A CB  1 
ATOM   3176 C CG  . LEU A 1 417 ? 10.816  -37.377 21.665  1.00 37.00  ? 418  LEU A CG  1 
ATOM   3177 C CD1 . LEU A 1 417 ? 10.304  -37.727 23.050  1.00 36.73  ? 418  LEU A CD1 1 
ATOM   3178 C CD2 . LEU A 1 417 ? 10.993  -35.911 21.559  1.00 38.91  ? 418  LEU A CD2 1 
ATOM   3179 N N   . ALA A 1 418 ? 14.209  -39.843 19.669  1.00 32.18  ? 419  ALA A N   1 
ATOM   3180 C CA  . ALA A 1 418 ? 15.491  -40.561 19.636  1.00 36.48  ? 419  ALA A CA  1 
ATOM   3181 C C   . ALA A 1 418 ? 16.422  -40.033 18.523  1.00 42.61  ? 419  ALA A C   1 
ATOM   3182 O O   . ALA A 1 418 ? 17.630  -39.884 18.711  1.00 41.02  ? 419  ALA A O   1 
ATOM   3183 C CB  . ALA A 1 418 ? 15.263  -42.062 19.460  1.00 31.91  ? 419  ALA A CB  1 
ATOM   3184 N N   . ALA A 1 419 ? 15.850  -39.748 17.365  1.00 38.04  ? 420  ALA A N   1 
ATOM   3185 C CA  . ALA A 1 419 ? 16.648  -39.280 16.234  1.00 42.75  ? 420  ALA A CA  1 
ATOM   3186 C C   . ALA A 1 419 ? 17.131  -37.856 16.454  1.00 44.85  ? 420  ALA A C   1 
ATOM   3187 O O   . ALA A 1 419 ? 18.062  -37.409 15.801  1.00 50.31  ? 420  ALA A O   1 
ATOM   3188 C CB  . ALA A 1 419 ? 15.839  -39.370 14.934  1.00 30.12  ? 420  ALA A CB  1 
ATOM   3189 N N   . GLN A 1 420 ? 16.498  -37.145 17.380  1.00 41.96  ? 421  GLN A N   1 
ATOM   3190 C CA  . GLN A 1 420 ? 16.838  -35.748 17.614  1.00 34.06  ? 421  GLN A CA  1 
ATOM   3191 C C   . GLN A 1 420 ? 17.433  -35.497 18.982  1.00 34.32  ? 421  GLN A C   1 
ATOM   3192 O O   . GLN A 1 420 ? 17.314  -34.398 19.543  1.00 33.76  ? 421  GLN A O   1 
ATOM   3193 C CB  . GLN A 1 420 ? 15.609  -34.888 17.391  1.00 36.10  ? 421  GLN A CB  1 
ATOM   3194 C CG  . GLN A 1 420 ? 15.246  -34.927 15.919  1.00 47.97  ? 421  GLN A CG  1 
ATOM   3195 C CD  . GLN A 1 420 ? 13.831  -34.514 15.655  1.00 48.15  ? 421  GLN A CD  1 
ATOM   3196 O OE1 . GLN A 1 420 ? 13.175  -35.079 14.790  1.00 53.93  ? 421  GLN A OE1 1 
ATOM   3197 N NE2 . GLN A 1 420 ? 13.347  -33.519 16.397  1.00 44.58  ? 421  GLN A NE2 1 
ATOM   3198 N N   . GLY A 1 421 ? 18.103  -36.524 19.494  1.00 34.22  ? 422  GLY A N   1 
ATOM   3199 C CA  . GLY A 1 421 ? 18.974  -36.358 20.636  1.00 37.83  ? 422  GLY A CA  1 
ATOM   3200 C C   . GLY A 1 421 ? 18.503  -36.959 21.942  1.00 40.31  ? 422  GLY A C   1 
ATOM   3201 O O   . GLY A 1 421 ? 19.279  -37.038 22.883  1.00 39.74  ? 422  GLY A O   1 
ATOM   3202 N N   . ALA A 1 422 ? 17.241  -37.372 22.031  1.00 38.50  ? 423  ALA A N   1 
ATOM   3203 C CA  . ALA A 1 422 ? 16.738  -37.869 23.310  1.00 37.42  ? 423  ALA A CA  1 
ATOM   3204 C C   . ALA A 1 422 ? 17.255  -39.275 23.519  1.00 29.76  ? 423  ALA A C   1 
ATOM   3205 O O   . ALA A 1 422 ? 17.545  -39.967 22.552  1.00 36.40  ? 423  ALA A O   1 
ATOM   3206 C CB  . ALA A 1 422 ? 15.193  -37.832 23.356  1.00 34.37  ? 423  ALA A CB  1 
ATOM   3207 N N   . ARG A 1 423 ? 17.416  -39.690 24.770  1.00 33.30  ? 424  ARG A N   1 
ATOM   3208 C CA  . ARG A 1 423 ? 17.597  -41.113 25.040  1.00 31.58  ? 424  ARG A CA  1 
ATOM   3209 C C   . ARG A 1 423 ? 16.238  -41.702 25.453  1.00 37.26  ? 424  ARG A C   1 
ATOM   3210 O O   . ARG A 1 423 ? 15.637  -41.265 26.432  1.00 37.24  ? 424  ARG A O   1 
ATOM   3211 C CB  . ARG A 1 423 ? 18.664  -41.357 26.123  1.00 32.24  ? 424  ARG A CB  1 
ATOM   3212 C CG  . ARG A 1 423 ? 19.091  -42.840 26.197  1.00 41.30  ? 424  ARG A CG  1 
ATOM   3213 C CD  . ARG A 1 423 ? 20.383  -43.066 26.980  1.00 49.15  ? 424  ARG A CD  1 
ATOM   3214 N NE  . ARG A 1 423 ? 20.132  -43.095 28.428  1.00 61.60  ? 424  ARG A NE  1 
ATOM   3215 C CZ  . ARG A 1 423 ? 20.676  -42.255 29.304  1.00 48.87  ? 424  ARG A CZ  1 
ATOM   3216 N NH1 . ARG A 1 423 ? 21.523  -41.312 28.898  1.00 55.38  ? 424  ARG A NH1 1 
ATOM   3217 N NH2 . ARG A 1 423 ? 20.383  -42.363 30.586  1.00 45.75  ? 424  ARG A NH2 1 
ATOM   3218 N N   . VAL A 1 424 ? 15.765  -42.683 24.693  1.00 35.94  ? 425  VAL A N   1 
ATOM   3219 C CA  . VAL A 1 424 ? 14.417  -43.208 24.810  1.00 31.51  ? 425  VAL A CA  1 
ATOM   3220 C C   . VAL A 1 424 ? 14.436  -44.663 25.245  1.00 33.59  ? 425  VAL A C   1 
ATOM   3221 O O   . VAL A 1 424 ? 15.206  -45.446 24.697  1.00 31.46  ? 425  VAL A O   1 
ATOM   3222 C CB  . VAL A 1 424 ? 13.675  -43.101 23.444  1.00 37.52  ? 425  VAL A CB  1 
ATOM   3223 C CG1 . VAL A 1 424 ? 12.226  -43.618 23.552  1.00 27.98  ? 425  VAL A CG1 1 
ATOM   3224 C CG2 . VAL A 1 424 ? 13.692  -41.672 22.969  1.00 28.38  ? 425  VAL A CG2 1 
ATOM   3225 N N   . TYR A 1 425 ? 13.605  -45.028 26.222  1.00 30.40  ? 426  TYR A N   1 
ATOM   3226 C CA  . TYR A 1 425 ? 13.364  -46.443 26.530  1.00 29.48  ? 426  TYR A CA  1 
ATOM   3227 C C   . TYR A 1 425 ? 11.899  -46.725 26.229  1.00 35.65  ? 426  TYR A C   1 
ATOM   3228 O O   . TYR A 1 425 ? 11.037  -45.899 26.547  1.00 34.98  ? 426  TYR A O   1 
ATOM   3229 C CB  . TYR A 1 425 ? 13.712  -46.780 27.999  1.00 28.79  ? 426  TYR A CB  1 
ATOM   3230 C CG  . TYR A 1 425 ? 15.172  -46.536 28.297  1.00 31.39  ? 426  TYR A CG  1 
ATOM   3231 C CD1 . TYR A 1 425 ? 16.114  -47.562 28.153  1.00 31.76  ? 426  TYR A CD1 1 
ATOM   3232 C CD2 . TYR A 1 425 ? 15.627  -45.263 28.662  1.00 31.71  ? 426  TYR A CD2 1 
ATOM   3233 C CE1 . TYR A 1 425 ? 17.478  -47.329 28.389  1.00 29.68  ? 426  TYR A CE1 1 
ATOM   3234 C CE2 . TYR A 1 425 ? 16.978  -45.018 28.920  1.00 29.89  ? 426  TYR A CE2 1 
ATOM   3235 C CZ  . TYR A 1 425 ? 17.895  -46.054 28.782  1.00 35.51  ? 426  TYR A CZ  1 
ATOM   3236 O OH  . TYR A 1 425 ? 19.223  -45.815 29.038  1.00 35.38  ? 426  TYR A OH  1 
ATOM   3237 N N   . ALA A 1 426 ? 11.632  -47.867 25.595  1.00 27.40  ? 427  ALA A N   1 
ATOM   3238 C CA  . ALA A 1 426 ? 10.299  -48.244 25.162  1.00 27.06  ? 427  ALA A CA  1 
ATOM   3239 C C   . ALA A 1 426 ? 9.918   -49.611 25.718  1.00 30.57  ? 427  ALA A C   1 
ATOM   3240 O O   . ALA A 1 426 ? 10.771  -50.511 25.815  1.00 31.39  ? 427  ALA A O   1 
ATOM   3241 C CB  . ALA A 1 426 ? 10.216  -48.250 23.595  1.00 26.73  ? 427  ALA A CB  1 
ATOM   3242 N N   . TYR A 1 427 ? 8.645   -49.776 26.078  1.00 26.47  ? 428  TYR A N   1 
ATOM   3243 C CA  . TYR A 1 427 ? 8.155   -51.073 26.553  1.00 25.63  ? 428  TYR A CA  1 
ATOM   3244 C C   . TYR A 1 427 ? 6.796   -51.412 25.935  1.00 31.13  ? 428  TYR A C   1 
ATOM   3245 O O   . TYR A 1 427 ? 6.056   -50.536 25.500  1.00 29.09  ? 428  TYR A O   1 
ATOM   3246 C CB  . TYR A 1 427 ? 8.010   -51.092 28.097  1.00 25.73  ? 428  TYR A CB  1 
ATOM   3247 C CG  . TYR A 1 427 ? 6.938   -50.122 28.574  1.00 26.33  ? 428  TYR A CG  1 
ATOM   3248 C CD1 . TYR A 1 427 ? 5.594   -50.498 28.628  1.00 26.29  ? 428  TYR A CD1 1 
ATOM   3249 C CD2 . TYR A 1 427 ? 7.275   -48.816 28.944  1.00 23.30  ? 428  TYR A CD2 1 
ATOM   3250 C CE1 . TYR A 1 427 ? 4.607   -49.597 29.042  1.00 26.62  ? 428  TYR A CE1 1 
ATOM   3251 C CE2 . TYR A 1 427 ? 6.306   -47.914 29.375  1.00 26.26  ? 428  TYR A CE2 1 
ATOM   3252 C CZ  . TYR A 1 427 ? 4.974   -48.307 29.415  1.00 28.63  ? 428  TYR A CZ  1 
ATOM   3253 O OH  . TYR A 1 427 ? 4.018   -47.395 29.804  1.00 30.67  ? 428  TYR A OH  1 
ATOM   3254 N N   . VAL A 1 428 ? 6.455   -52.691 25.965  1.00 29.42  ? 429  VAL A N   1 
ATOM   3255 C CA  . VAL A 1 428 ? 5.090   -53.121 25.763  1.00 30.34  ? 429  VAL A CA  1 
ATOM   3256 C C   . VAL A 1 428 ? 4.714   -53.922 26.975  1.00 30.18  ? 429  VAL A C   1 
ATOM   3257 O O   . VAL A 1 428 ? 5.434   -54.845 27.356  1.00 30.75  ? 429  VAL A O   1 
ATOM   3258 C CB  . VAL A 1 428 ? 4.930   -53.974 24.487  1.00 33.03  ? 429  VAL A CB  1 
ATOM   3259 C CG1 . VAL A 1 428 ? 3.499   -54.398 24.341  1.00 31.06  ? 429  VAL A CG1 1 
ATOM   3260 C CG2 . VAL A 1 428 ? 5.341   -53.151 23.271  1.00 31.49  ? 429  VAL A CG2 1 
ATOM   3261 N N   . PHE A 1 429 ? 3.602   -53.562 27.604  1.00 32.20  ? 430  PHE A N   1 
ATOM   3262 C CA  . PHE A 1 429 ? 3.217   -54.216 28.846  1.00 32.19  ? 430  PHE A CA  1 
ATOM   3263 C C   . PHE A 1 429 ? 2.284   -55.368 28.488  1.00 31.81  ? 430  PHE A C   1 
ATOM   3264 O O   . PHE A 1 429 ? 1.213   -55.158 27.899  1.00 32.61  ? 430  PHE A O   1 
ATOM   3265 C CB  . PHE A 1 429 ? 2.558   -53.222 29.810  1.00 30.86  ? 430  PHE A CB  1 
ATOM   3266 C CG  . PHE A 1 429 ? 2.079   -53.842 31.087  1.00 31.95  ? 430  PHE A CG  1 
ATOM   3267 C CD1 . PHE A 1 429 ? 0.798   -54.349 31.183  1.00 33.04  ? 430  PHE A CD1 1 
ATOM   3268 C CD2 . PHE A 1 429 ? 2.898   -53.891 32.201  1.00 33.07  ? 430  PHE A CD2 1 
ATOM   3269 C CE1 . PHE A 1 429 ? 0.343   -54.921 32.356  1.00 33.21  ? 430  PHE A CE1 1 
ATOM   3270 C CE2 . PHE A 1 429 ? 2.442   -54.456 33.402  1.00 34.39  ? 430  PHE A CE2 1 
ATOM   3271 C CZ  . PHE A 1 429 ? 1.170   -54.980 33.470  1.00 33.86  ? 430  PHE A CZ  1 
ATOM   3272 N N   . GLU A 1 430 ? 2.686   -56.585 28.834  1.00 32.88  ? 431  GLU A N   1 
ATOM   3273 C CA  . GLU A 1 430 ? 2.010   -57.756 28.265  1.00 40.61  ? 431  GLU A CA  1 
ATOM   3274 C C   . GLU A 1 430 ? 1.455   -58.715 29.293  1.00 39.87  ? 431  GLU A C   1 
ATOM   3275 O O   . GLU A 1 430 ? 1.202   -59.853 28.966  1.00 36.14  ? 431  GLU A O   1 
ATOM   3276 C CB  . GLU A 1 430 ? 2.963   -58.521 27.352  1.00 30.94  ? 431  GLU A CB  1 
ATOM   3277 C CG  . GLU A 1 430 ? 3.338   -57.741 26.128  1.00 37.46  ? 431  GLU A CG  1 
ATOM   3278 C CD  . GLU A 1 430 ? 4.069   -58.566 25.069  1.00 42.83  ? 431  GLU A CD  1 
ATOM   3279 O OE1 . GLU A 1 430 ? 4.190   -58.062 23.934  1.00 56.47  ? 431  GLU A OE1 1 
ATOM   3280 O OE2 . GLU A 1 430 ? 4.538   -59.687 25.366  1.00 46.71  ? 431  GLU A OE2 1 
ATOM   3281 N N   . HIS A 1 431 ? 1.283   -58.260 30.530  1.00 38.01  ? 432  HIS A N   1 
ATOM   3282 C CA  . HIS A 1 431 ? 0.732   -59.111 31.570  1.00 30.46  ? 432  HIS A CA  1 
ATOM   3283 C C   . HIS A 1 431 ? -0.747  -58.850 31.812  1.00 37.49  ? 432  HIS A C   1 
ATOM   3284 O O   . HIS A 1 431 ? -1.144  -57.741 32.133  1.00 35.87  ? 432  HIS A O   1 
ATOM   3285 C CB  . HIS A 1 431 ? 1.463   -58.924 32.892  1.00 37.31  ? 432  HIS A CB  1 
ATOM   3286 C CG  . HIS A 1 431 ? 0.914   -59.788 33.976  1.00 40.66  ? 432  HIS A CG  1 
ATOM   3287 N ND1 . HIS A 1 431 ? 0.950   -61.165 33.907  1.00 44.55  ? 432  HIS A ND1 1 
ATOM   3288 C CD2 . HIS A 1 431 ? 0.249   -59.481 35.116  1.00 34.38  ? 432  HIS A CD2 1 
ATOM   3289 C CE1 . HIS A 1 431 ? 0.375   -61.669 34.985  1.00 44.31  ? 432  HIS A CE1 1 
ATOM   3290 N NE2 . HIS A 1 431 ? -0.072  -60.670 35.727  1.00 41.78  ? 432  HIS A NE2 1 
ATOM   3291 N N   . ARG A 1 432 ? -1.566  -59.882 31.671  1.00 41.67  ? 433  ARG A N   1 
ATOM   3292 C CA  . ARG A 1 432 ? -2.971  -59.752 32.011  1.00 40.82  ? 433  ARG A CA  1 
ATOM   3293 C C   . ARG A 1 432 ? -3.121  -60.075 33.494  1.00 43.13  ? 433  ARG A C   1 
ATOM   3294 O O   . ARG A 1 432 ? -2.750  -61.170 33.933  1.00 40.46  ? 433  ARG A O   1 
ATOM   3295 C CB  . ARG A 1 432 ? -3.825  -60.682 31.149  1.00 44.99  ? 433  ARG A CB  1 
ATOM   3296 C CG  . ARG A 1 432 ? -5.287  -60.460 31.338  1.00 44.74  ? 433  ARG A CG  1 
ATOM   3297 C CD  . ARG A 1 432 ? -6.121  -61.484 30.596  1.00 45.90  ? 433  ARG A CD  1 
ATOM   3298 N NE  . ARG A 1 432 ? -7.461  -61.483 31.169  1.00 47.08  ? 433  ARG A NE  1 
ATOM   3299 C CZ  . ARG A 1 432 ? -8.473  -60.763 30.704  1.00 52.73  ? 433  ARG A CZ  1 
ATOM   3300 N NH1 . ARG A 1 432 ? -8.306  -60.000 29.612  1.00 40.24  ? 433  ARG A NH1 1 
ATOM   3301 N NH2 . ARG A 1 432 ? -9.659  -60.831 31.320  1.00 45.34  ? 433  ARG A NH2 1 
ATOM   3302 N N   . ALA A 1 433 ? -3.630  -59.118 34.264  1.00 39.03  ? 434  ALA A N   1 
ATOM   3303 C CA  . ALA A 1 433 ? -3.742  -59.297 35.713  1.00 44.09  ? 434  ALA A CA  1 
ATOM   3304 C C   . ALA A 1 433 ? -4.633  -60.485 36.049  1.00 47.82  ? 434  ALA A C   1 
ATOM   3305 O O   . ALA A 1 433 ? -5.725  -60.623 35.480  1.00 41.95  ? 434  ALA A O   1 
ATOM   3306 C CB  . ALA A 1 433 ? -4.292  -58.033 36.366  1.00 34.09  ? 434  ALA A CB  1 
ATOM   3307 N N   . SER A 1 434 ? -4.187  -61.322 36.988  1.00 43.92  ? 435  SER A N   1 
ATOM   3308 C CA  . SER A 1 434 ? -5.026  -62.413 37.495  1.00 40.45  ? 435  SER A CA  1 
ATOM   3309 C C   . SER A 1 434 ? -6.364  -61.876 38.021  1.00 43.29  ? 435  SER A C   1 
ATOM   3310 O O   . SER A 1 434 ? -7.374  -62.567 37.977  1.00 47.69  ? 435  SER A O   1 
ATOM   3311 C CB  . SER A 1 434 ? -4.298  -63.203 38.595  1.00 43.51  ? 435  SER A CB  1 
ATOM   3312 O OG  . SER A 1 434 ? -4.240  -62.464 39.808  1.00 45.86  ? 435  SER A OG  1 
ATOM   3313 N N   . THR A 1 435 ? -6.379  -60.625 38.469  1.00 45.73  ? 436  THR A N   1 
ATOM   3314 C CA  . THR A 1 435 ? -7.594  -60.005 39.020  1.00 46.45  ? 436  THR A CA  1 
ATOM   3315 C C   . THR A 1 435 ? -8.500  -59.282 38.001  1.00 42.88  ? 436  THR A C   1 
ATOM   3316 O O   . THR A 1 435 ? -9.532  -58.720 38.376  1.00 42.16  ? 436  THR A O   1 
ATOM   3317 C CB  . THR A 1 435 ? -7.221  -58.965 40.102  1.00 46.91  ? 436  THR A CB  1 
ATOM   3318 O OG1 . THR A 1 435 ? -6.452  -57.911 39.495  1.00 43.52  ? 436  THR A OG1 1 
ATOM   3319 C CG2 . THR A 1 435 ? -6.400  -59.616 41.231  1.00 42.92  ? 436  THR A CG2 1 
ATOM   3320 N N   . LEU A 1 436 ? -8.123  -59.288 36.723  1.00 39.96  ? 437  LEU A N   1 
ATOM   3321 C CA  . LEU A 1 436 ? -8.818  -58.469 35.718  1.00 36.75  ? 437  LEU A CA  1 
ATOM   3322 C C   . LEU A 1 436 ? -10.296 -58.823 35.554  1.00 44.71  ? 437  LEU A C   1 
ATOM   3323 O O   . LEU A 1 436 ? -10.647 -59.992 35.379  1.00 39.61  ? 437  LEU A O   1 
ATOM   3324 C CB  . LEU A 1 436 ? -8.110  -58.602 34.358  1.00 47.45  ? 437  LEU A CB  1 
ATOM   3325 C CG  . LEU A 1 436 ? -8.356  -57.496 33.328  1.00 50.74  ? 437  LEU A CG  1 
ATOM   3326 C CD1 . LEU A 1 436 ? -7.953  -56.159 33.901  1.00 44.13  ? 437  LEU A CD1 1 
ATOM   3327 C CD2 . LEU A 1 436 ? -7.583  -57.756 32.034  1.00 42.99  ? 437  LEU A CD2 1 
ATOM   3328 N N   . SER A 1 437 ? -11.154 -57.807 35.581  1.00 38.13  ? 438  SER A N   1 
ATOM   3329 C CA  . SER A 1 437 ? -12.599 -58.025 35.514  1.00 43.37  ? 438  SER A CA  1 
ATOM   3330 C C   . SER A 1 437 ? -13.187 -57.960 34.097  1.00 46.30  ? 438  SER A C   1 
ATOM   3331 O O   . SER A 1 437 ? -14.338 -58.358 33.887  1.00 46.09  ? 438  SER A O   1 
ATOM   3332 C CB  . SER A 1 437 ? -13.315 -57.007 36.412  1.00 47.78  ? 438  SER A CB  1 
ATOM   3333 O OG  . SER A 1 437 ? -12.992 -55.674 36.026  1.00 54.03  ? 438  SER A OG  1 
ATOM   3334 N N   . TRP A 1 438 ? -12.415 -57.446 33.133  1.00 46.59  ? 439  TRP A N   1 
ATOM   3335 C CA  . TRP A 1 438 ? -12.834 -57.447 31.721  1.00 43.49  ? 439  TRP A CA  1 
ATOM   3336 C C   . TRP A 1 438 ? -12.614 -58.827 31.106  1.00 41.64  ? 439  TRP A C   1 
ATOM   3337 O O   . TRP A 1 438 ? -11.730 -59.563 31.545  1.00 38.60  ? 439  TRP A O   1 
ATOM   3338 C CB  . TRP A 1 438 ? -12.068 -56.399 30.903  1.00 43.44  ? 439  TRP A CB  1 
ATOM   3339 C CG  . TRP A 1 438 ? -12.263 -55.000 31.350  1.00 40.52  ? 439  TRP A CG  1 
ATOM   3340 C CD1 . TRP A 1 438 ? -11.441 -54.282 32.185  1.00 31.41  ? 439  TRP A CD1 1 
ATOM   3341 C CD2 . TRP A 1 438 ? -13.332 -54.121 30.987  1.00 34.90  ? 439  TRP A CD2 1 
ATOM   3342 N NE1 . TRP A 1 438 ? -11.950 -53.024 32.373  1.00 35.74  ? 439  TRP A NE1 1 
ATOM   3343 C CE2 . TRP A 1 438 ? -13.100 -52.889 31.642  1.00 33.47  ? 439  TRP A CE2 1 
ATOM   3344 C CE3 . TRP A 1 438 ? -14.449 -54.244 30.154  1.00 36.22  ? 439  TRP A CE3 1 
ATOM   3345 C CZ2 . TRP A 1 438 ? -13.949 -51.787 31.500  1.00 34.28  ? 439  TRP A CZ2 1 
ATOM   3346 C CZ3 . TRP A 1 438 ? -15.300 -53.139 30.012  1.00 36.91  ? 439  TRP A CZ3 1 
ATOM   3347 C CH2 . TRP A 1 438 ? -15.039 -51.927 30.688  1.00 41.32  ? 439  TRP A CH2 1 
ATOM   3348 N N   . PRO A 1 439 ? -13.397 -59.178 30.066  1.00 42.75  ? 440  PRO A N   1 
ATOM   3349 C CA  . PRO A 1 439 ? -13.324 -60.539 29.526  1.00 39.86  ? 440  PRO A CA  1 
ATOM   3350 C C   . PRO A 1 439 ? -11.986 -60.854 28.889  1.00 49.84  ? 440  PRO A C   1 
ATOM   3351 O O   . PRO A 1 439 ? -11.234 -59.951 28.518  1.00 51.59  ? 440  PRO A O   1 
ATOM   3352 C CB  . PRO A 1 439 ? -14.428 -60.551 28.471  1.00 41.65  ? 440  PRO A CB  1 
ATOM   3353 C CG  . PRO A 1 439 ? -14.513 -59.139 28.026  1.00 47.40  ? 440  PRO A CG  1 
ATOM   3354 C CD  . PRO A 1 439 ? -14.309 -58.332 29.275  1.00 43.24  ? 440  PRO A CD  1 
ATOM   3355 N N   . LEU A 1 440 ? -11.719 -62.144 28.743  1.00 52.54  ? 441  LEU A N   1 
ATOM   3356 C CA  . LEU A 1 440 ? -10.485 -62.630 28.148  1.00 50.20  ? 441  LEU A CA  1 
ATOM   3357 C C   . LEU A 1 440 ? -10.179 -62.071 26.749  1.00 50.34  ? 441  LEU A C   1 
ATOM   3358 O O   . LEU A 1 440 ? -9.004  -61.893 26.401  1.00 47.43  ? 441  LEU A O   1 
ATOM   3359 C CB  . LEU A 1 440 ? -10.526 -64.154 28.086  1.00 55.65  ? 441  LEU A CB  1 
ATOM   3360 C CG  . LEU A 1 440 ? -9.179  -64.867 28.089  1.00 58.56  ? 441  LEU A CG  1 
ATOM   3361 C CD1 . LEU A 1 440 ? -8.567  -64.713 29.461  1.00 54.70  ? 441  LEU A CD1 1 
ATOM   3362 C CD2 . LEU A 1 440 ? -9.347  -66.336 27.739  1.00 63.90  ? 441  LEU A CD2 1 
ATOM   3363 N N   . TRP A 1 441 ? -11.202 -61.794 25.938  1.00 46.18  ? 442  TRP A N   1 
ATOM   3364 C CA  . TRP A 1 441 ? -10.916 -61.393 24.559  1.00 48.36  ? 442  TRP A CA  1 
ATOM   3365 C C   . TRP A 1 441 ? -10.281 -60.003 24.497  1.00 45.74  ? 442  TRP A C   1 
ATOM   3366 O O   . TRP A 1 441 ? -9.683  -59.633 23.487  1.00 46.89  ? 442  TRP A O   1 
ATOM   3367 C CB  . TRP A 1 441 ? -12.172 -61.450 23.662  1.00 43.68  ? 442  TRP A CB  1 
ATOM   3368 C CG  . TRP A 1 441 ? -13.259 -60.431 23.942  1.00 41.15  ? 442  TRP A CG  1 
ATOM   3369 C CD1 . TRP A 1 441 ? -14.417 -60.641 24.638  1.00 45.59  ? 442  TRP A CD1 1 
ATOM   3370 C CD2 . TRP A 1 441 ? -13.296 -59.058 23.515  1.00 42.09  ? 442  TRP A CD2 1 
ATOM   3371 N NE1 . TRP A 1 441 ? -15.167 -59.483 24.681  1.00 42.84  ? 442  TRP A NE1 1 
ATOM   3372 C CE2 . TRP A 1 441 ? -14.503 -58.500 23.995  1.00 37.77  ? 442  TRP A CE2 1 
ATOM   3373 C CE3 . TRP A 1 441 ? -12.427 -58.247 22.777  1.00 39.38  ? 442  TRP A CE3 1 
ATOM   3374 C CZ2 . TRP A 1 441 ? -14.854 -57.171 23.770  1.00 41.82  ? 442  TRP A CZ2 1 
ATOM   3375 C CZ3 . TRP A 1 441 ? -12.783 -56.928 22.549  1.00 33.25  ? 442  TRP A CZ3 1 
ATOM   3376 C CH2 . TRP A 1 441 ? -13.977 -56.402 23.046  1.00 44.75  ? 442  TRP A CH2 1 
ATOM   3377 N N   . MET A 1 442 ? -10.412 -59.226 25.564  1.00 48.78  ? 443  MET A N   1 
ATOM   3378 C CA  . MET A 1 442 ? -9.846  -57.880 25.561  1.00 45.26  ? 443  MET A CA  1 
ATOM   3379 C C   . MET A 1 442 ? -8.327  -57.871 25.777  1.00 38.63  ? 443  MET A C   1 
ATOM   3380 O O   . MET A 1 442 ? -7.682  -56.852 25.560  1.00 38.40  ? 443  MET A O   1 
ATOM   3381 C CB  . MET A 1 442 ? -10.522 -57.015 26.613  1.00 41.69  ? 443  MET A CB  1 
ATOM   3382 C CG  . MET A 1 442 ? -11.946 -56.599 26.271  1.00 44.15  ? 443  MET A CG  1 
ATOM   3383 S SD  . MET A 1 442 ? -12.440 -55.306 27.440  1.00 45.85  ? 443  MET A SD  1 
ATOM   3384 C CE  . MET A 1 442 ? -13.909 -54.636 26.711  1.00 47.70  ? 443  MET A CE  1 
ATOM   3385 N N   . GLY A 1 443 ? -7.774  -59.001 26.207  1.00 37.05  ? 444  GLY A N   1 
ATOM   3386 C CA  . GLY A 1 443 ? -6.345  -59.146 26.417  1.00 39.86  ? 444  GLY A CA  1 
ATOM   3387 C C   . GLY A 1 443 ? -5.807  -58.308 27.579  1.00 43.01  ? 444  GLY A C   1 
ATOM   3388 O O   . GLY A 1 443 ? -6.332  -58.368 28.700  1.00 38.74  ? 444  GLY A O   1 
ATOM   3389 N N   . VAL A 1 444 ? -4.738  -57.549 27.315  1.00 40.67  ? 445  VAL A N   1 
ATOM   3390 C CA  . VAL A 1 444 ? -4.219  -56.568 28.279  1.00 34.51  ? 445  VAL A CA  1 
ATOM   3391 C C   . VAL A 1 444 ? -4.710  -55.190 27.871  1.00 29.69  ? 445  VAL A C   1 
ATOM   3392 O O   . VAL A 1 444 ? -4.140  -54.565 26.996  1.00 32.11  ? 445  VAL A O   1 
ATOM   3393 C CB  . VAL A 1 444 ? -2.688  -56.592 28.332  1.00 38.56  ? 445  VAL A CB  1 
ATOM   3394 C CG1 . VAL A 1 444 ? -2.161  -55.664 29.439  1.00 35.77  ? 445  VAL A CG1 1 
ATOM   3395 C CG2 . VAL A 1 444 ? -2.208  -58.020 28.535  1.00 36.31  ? 445  VAL A CG2 1 
ATOM   3396 N N   . PRO A 1 445 ? -5.804  -54.722 28.475  1.00 32.43  ? 446  PRO A N   1 
ATOM   3397 C CA  . PRO A 1 445 ? -6.382  -53.498 27.928  1.00 35.25  ? 446  PRO A CA  1 
ATOM   3398 C C   . PRO A 1 445 ? -5.714  -52.235 28.445  1.00 37.60  ? 446  PRO A C   1 
ATOM   3399 O O   . PRO A 1 445 ? -4.944  -52.235 29.400  1.00 27.78  ? 446  PRO A O   1 
ATOM   3400 C CB  . PRO A 1 445 ? -7.852  -53.542 28.398  1.00 29.75  ? 446  PRO A CB  1 
ATOM   3401 C CG  . PRO A 1 445 ? -8.015  -54.879 29.126  1.00 31.20  ? 446  PRO A CG  1 
ATOM   3402 C CD  . PRO A 1 445 ? -6.624  -55.269 29.561  1.00 31.92  ? 446  PRO A CD  1 
ATOM   3403 N N   . HIS A 1 446 ? -6.054  -51.146 27.774  1.00 30.60  ? 447  HIS A N   1 
ATOM   3404 C CA  . HIS A 1 446 ? -5.601  -49.823 28.106  1.00 32.52  ? 447  HIS A CA  1 
ATOM   3405 C C   . HIS A 1 446 ? -5.866  -49.474 29.568  1.00 35.76  ? 447  HIS A C   1 
ATOM   3406 O O   . HIS A 1 446 ? -6.979  -49.652 30.066  1.00 33.09  ? 447  HIS A O   1 
ATOM   3407 C CB  . HIS A 1 446 ? -6.313  -48.849 27.181  1.00 31.13  ? 447  HIS A CB  1 
ATOM   3408 C CG  . HIS A 1 446 ? -6.012  -47.416 27.456  1.00 36.78  ? 447  HIS A CG  1 
ATOM   3409 N ND1 . HIS A 1 446 ? -4.918  -46.770 26.922  1.00 37.65  ? 447  HIS A ND1 1 
ATOM   3410 C CD2 . HIS A 1 446 ? -6.686  -46.491 28.178  1.00 29.27  ? 447  HIS A CD2 1 
ATOM   3411 C CE1 . HIS A 1 446 ? -4.943  -45.500 27.287  1.00 34.14  ? 447  HIS A CE1 1 
ATOM   3412 N NE2 . HIS A 1 446 ? -5.997  -45.309 28.062  1.00 45.12  ? 447  HIS A NE2 1 
ATOM   3413 N N   . GLY A 1 447 ? -4.841  -48.986 30.252  1.00 33.86  ? 448  GLY A N   1 
ATOM   3414 C CA  . GLY A 1 447 ? -4.973  -48.577 31.645  1.00 29.66  ? 448  GLY A CA  1 
ATOM   3415 C C   . GLY A 1 447 ? -4.524  -49.607 32.669  1.00 33.59  ? 448  GLY A C   1 
ATOM   3416 O O   . GLY A 1 447 ? -4.357  -49.272 33.843  1.00 33.83  ? 448  GLY A O   1 
ATOM   3417 N N   . TYR A 1 448 ? -4.298  -50.850 32.252  1.00 30.09  ? 449  TYR A N   1 
ATOM   3418 C CA  . TYR A 1 448 ? -4.132  -51.908 33.248  1.00 36.89  ? 449  TYR A CA  1 
ATOM   3419 C C   . TYR A 1 448 ? -2.682  -52.257 33.536  1.00 32.29  ? 449  TYR A C   1 
ATOM   3420 O O   . TYR A 1 448 ? -2.411  -53.241 34.226  1.00 36.29  ? 449  TYR A O   1 
ATOM   3421 C CB  . TYR A 1 448 ? -4.974  -53.154 32.854  1.00 31.43  ? 449  TYR A CB  1 
ATOM   3422 C CG  . TYR A 1 448 ? -6.394  -52.807 33.162  1.00 31.37  ? 449  TYR A CG  1 
ATOM   3423 C CD1 . TYR A 1 448 ? -6.886  -52.905 34.472  1.00 33.70  ? 449  TYR A CD1 1 
ATOM   3424 C CD2 . TYR A 1 448 ? -7.207  -52.240 32.189  1.00 29.84  ? 449  TYR A CD2 1 
ATOM   3425 C CE1 . TYR A 1 448 ? -8.177  -52.501 34.782  1.00 29.72  ? 449  TYR A CE1 1 
ATOM   3426 C CE2 . TYR A 1 448 ? -8.484  -51.832 32.484  1.00 29.41  ? 449  TYR A CE2 1 
ATOM   3427 C CZ  . TYR A 1 448 ? -8.964  -51.951 33.791  1.00 35.08  ? 449  TYR A CZ  1 
ATOM   3428 O OH  . TYR A 1 448 ? -10.241 -51.522 34.067  1.00 36.25  ? 449  TYR A OH  1 
ATOM   3429 N N   . GLU A 1 449 ? -1.753  -51.415 33.086  1.00 33.53  ? 450  GLU A N   1 
ATOM   3430 C CA  . GLU A 1 449 ? -0.387  -51.469 33.637  1.00 32.78  ? 450  GLU A CA  1 
ATOM   3431 C C   . GLU A 1 449 ? -0.233  -50.552 34.868  1.00 28.69  ? 450  GLU A C   1 
ATOM   3432 O O   . GLU A 1 449 ? 0.680   -50.733 35.682  1.00 29.43  ? 450  GLU A O   1 
ATOM   3433 C CB  . GLU A 1 449 ? 0.650   -51.093 32.575  1.00 29.19  ? 450  GLU A CB  1 
ATOM   3434 C CG  . GLU A 1 449 ? 0.996   -49.612 32.456  1.00 29.01  ? 450  GLU A CG  1 
ATOM   3435 C CD  . GLU A 1 449 ? -0.107  -48.741 31.864  1.00 34.21  ? 450  GLU A CD  1 
ATOM   3436 O OE1 . GLU A 1 449 ? -1.272  -49.193 31.690  1.00 32.71  ? 450  GLU A OE1 1 
ATOM   3437 O OE2 . GLU A 1 449 ? 0.199   -47.564 31.579  1.00 33.78  ? 450  GLU A OE2 1 
ATOM   3438 N N   . ILE A 1 450 ? -1.127  -49.576 35.005  1.00 26.77  ? 451  ILE A N   1 
ATOM   3439 C CA  . ILE A 1 450 ? -0.987  -48.575 36.062  1.00 30.37  ? 451  ILE A CA  1 
ATOM   3440 C C   . ILE A 1 450 ? -0.944  -49.189 37.453  1.00 32.51  ? 451  ILE A C   1 
ATOM   3441 O O   . ILE A 1 450 ? -0.079  -48.842 38.246  1.00 32.51  ? 451  ILE A O   1 
ATOM   3442 C CB  . ILE A 1 450 ? -2.127  -47.535 36.030  1.00 30.47  ? 451  ILE A CB  1 
ATOM   3443 C CG1 . ILE A 1 450 ? -2.197  -46.876 34.644  1.00 27.14  ? 451  ILE A CG1 1 
ATOM   3444 C CG2 . ILE A 1 450 ? -1.884  -46.494 37.101  1.00 25.06  ? 451  ILE A CG2 1 
ATOM   3445 C CD1 . ILE A 1 450 ? -3.308  -45.844 34.495  1.00 19.77  ? 451  ILE A CD1 1 
ATOM   3446 N N   . GLU A 1 451 ? -1.848  -50.122 37.741  1.00 32.85  ? 452  GLU A N   1 
ATOM   3447 C CA  . GLU A 1 451 ? -1.874  -50.751 39.060  1.00 32.48  ? 452  GLU A CA  1 
ATOM   3448 C C   . GLU A 1 451 ? -0.547  -51.441 39.379  1.00 31.97  ? 452  GLU A C   1 
ATOM   3449 O O   . GLU A 1 451 ? -0.098  -51.442 40.533  1.00 31.98  ? 452  GLU A O   1 
ATOM   3450 C CB  . GLU A 1 451 ? -3.043  -51.749 39.165  1.00 33.05  ? 452  GLU A CB  1 
ATOM   3451 C CG  . GLU A 1 451 ? -2.992  -52.929 38.179  1.00 34.13  ? 452  GLU A CG  1 
ATOM   3452 C CD  . GLU A 1 451 ? -4.387  -53.513 37.908  1.00 41.11  ? 452  GLU A CD  1 
ATOM   3453 O OE1 . GLU A 1 451 ? -4.566  -54.739 38.027  1.00 39.41  ? 452  GLU A OE1 1 
ATOM   3454 O OE2 . GLU A 1 451 ? -5.313  -52.741 37.587  1.00 35.85  ? 452  GLU A OE2 1 
ATOM   3455 N N   . PHE A 1 452 ? 0.112   -51.991 38.363  1.00 28.92  ? 453  PHE A N   1 
ATOM   3456 C CA  . PHE A 1 452 ? 1.429   -52.585 38.594  1.00 35.09  ? 453  PHE A CA  1 
ATOM   3457 C C   . PHE A 1 452 ? 2.533   -51.550 38.819  1.00 34.16  ? 453  PHE A C   1 
ATOM   3458 O O   . PHE A 1 452 ? 3.402   -51.773 39.650  1.00 33.26  ? 453  PHE A O   1 
ATOM   3459 C CB  . PHE A 1 452 ? 1.803   -53.528 37.445  1.00 34.48  ? 453  PHE A CB  1 
ATOM   3460 C CG  . PHE A 1 452 ? 1.055   -54.818 37.514  1.00 34.56  ? 453  PHE A CG  1 
ATOM   3461 C CD1 . PHE A 1 452 ? -0.206  -54.928 36.944  1.00 33.47  ? 453  PHE A CD1 1 
ATOM   3462 C CD2 . PHE A 1 452 ? 1.553   -55.882 38.249  1.00 35.06  ? 453  PHE A CD2 1 
ATOM   3463 C CE1 . PHE A 1 452 ? -0.938  -56.098 37.069  1.00 33.44  ? 453  PHE A CE1 1 
ATOM   3464 C CE2 . PHE A 1 452 ? 0.828   -57.053 38.369  1.00 35.68  ? 453  PHE A CE2 1 
ATOM   3465 C CZ  . PHE A 1 452 ? -0.419  -57.157 37.780  1.00 31.68  ? 453  PHE A CZ  1 
ATOM   3466 N N   . ILE A 1 453 ? 2.493   -50.429 38.100  1.00 29.51  ? 454  ILE A N   1 
ATOM   3467 C CA  . ILE A 1 453 ? 3.504   -49.392 38.259  1.00 28.49  ? 454  ILE A CA  1 
ATOM   3468 C C   . ILE A 1 453 ? 3.428   -48.806 39.673  1.00 28.22  ? 454  ILE A C   1 
ATOM   3469 O O   . ILE A 1 453 ? 4.454   -48.499 40.274  1.00 31.92  ? 454  ILE A O   1 
ATOM   3470 C CB  . ILE A 1 453 ? 3.332   -48.239 37.230  1.00 32.11  ? 454  ILE A CB  1 
ATOM   3471 C CG1 . ILE A 1 453 ? 3.425   -48.743 35.765  1.00 31.75  ? 454  ILE A CG1 1 
ATOM   3472 C CG2 . ILE A 1 453 ? 4.331   -47.103 37.499  1.00 25.85  ? 454  ILE A CG2 1 
ATOM   3473 C CD1 . ILE A 1 453 ? 4.604   -49.606 35.498  1.00 31.36  ? 454  ILE A CD1 1 
ATOM   3474 N N   . PHE A 1 454 ? 2.205   -48.660 40.195  1.00 28.67  ? 455  PHE A N   1 
ATOM   3475 C CA  . PHE A 1 454 ? 1.977   -48.063 41.517  1.00 28.40  ? 455  PHE A CA  1 
ATOM   3476 C C   . PHE A 1 454 ? 2.050   -49.100 42.650  1.00 27.79  ? 455  PHE A C   1 
ATOM   3477 O O   . PHE A 1 454 ? 1.871   -48.761 43.819  1.00 29.28  ? 455  PHE A O   1 
ATOM   3478 C CB  . PHE A 1 454 ? 0.629   -47.339 41.561  1.00 24.98  ? 455  PHE A CB  1 
ATOM   3479 C CG  . PHE A 1 454 ? 0.667   -45.935 41.011  1.00 30.37  ? 455  PHE A CG  1 
ATOM   3480 C CD1 . PHE A 1 454 ? 0.554   -45.697 39.638  1.00 25.49  ? 455  PHE A CD1 1 
ATOM   3481 C CD2 . PHE A 1 454 ? 0.827   -44.841 41.867  1.00 25.91  ? 455  PHE A CD2 1 
ATOM   3482 C CE1 . PHE A 1 454 ? 0.587   -44.389 39.124  1.00 25.90  ? 455  PHE A CE1 1 
ATOM   3483 C CE2 . PHE A 1 454 ? 0.867   -43.521 41.362  1.00 29.27  ? 455  PHE A CE2 1 
ATOM   3484 C CZ  . PHE A 1 454 ? 0.733   -43.295 39.991  1.00 30.79  ? 455  PHE A CZ  1 
ATOM   3485 N N   . GLY A 1 455 ? 2.351   -50.352 42.303  1.00 32.38  ? 456  GLY A N   1 
ATOM   3486 C CA  . GLY A 1 455 ? 2.572   -51.397 43.294  1.00 30.32  ? 456  GLY A CA  1 
ATOM   3487 C C   . GLY A 1 455 ? 1.313   -51.811 44.041  1.00 33.29  ? 456  GLY A C   1 
ATOM   3488 O O   . GLY A 1 455 ? 1.388   -52.342 45.150  1.00 29.41  ? 456  GLY A O   1 
ATOM   3489 N N   . ILE A 1 456 ? 0.152   -51.548 43.446  1.00 33.07  ? 457  ILE A N   1 
ATOM   3490 C CA  . ILE A 1 456 ? -1.122  -51.941 44.049  1.00 27.14  ? 457  ILE A CA  1 
ATOM   3491 C C   . ILE A 1 456 ? -1.195  -53.446 44.398  1.00 33.83  ? 457  ILE A C   1 
ATOM   3492 O O   . ILE A 1 456 ? -1.815  -53.820 45.394  1.00 40.86  ? 457  ILE A O   1 
ATOM   3493 C CB  . ILE A 1 456 ? -2.296  -51.582 43.121  1.00 39.13  ? 457  ILE A CB  1 
ATOM   3494 C CG1 . ILE A 1 456 ? -2.269  -50.090 42.758  1.00 29.11  ? 457  ILE A CG1 1 
ATOM   3495 C CG2 . ILE A 1 456 ? -3.611  -51.975 43.754  1.00 39.71  ? 457  ILE A CG2 1 
ATOM   3496 C CD1 . ILE A 1 456 ? -2.275  -49.132 43.948  1.00 32.02  ? 457  ILE A CD1 1 
ATOM   3497 N N   . PRO A 1 457 ? -0.541  -54.323 43.607  1.00 33.55  ? 458  PRO A N   1 
ATOM   3498 C CA  . PRO A 1 457 ? -0.566  -55.728 44.045  1.00 36.67  ? 458  PRO A CA  1 
ATOM   3499 C C   . PRO A 1 457 ? 0.049   -56.039 45.419  1.00 41.47  ? 458  PRO A C   1 
ATOM   3500 O O   . PRO A 1 457 ? -0.196  -57.142 45.907  1.00 43.32  ? 458  PRO A O   1 
ATOM   3501 C CB  . PRO A 1 457 ? 0.228   -56.435 42.952  1.00 35.32  ? 458  PRO A CB  1 
ATOM   3502 C CG  . PRO A 1 457 ? -0.146  -55.635 41.700  1.00 33.55  ? 458  PRO A CG  1 
ATOM   3503 C CD  . PRO A 1 457 ? -0.096  -54.206 42.202  1.00 30.86  ? 458  PRO A CD  1 
ATOM   3504 N N   . LEU A 1 458 ? 0.808   -55.121 46.019  1.00 37.22  ? 459  LEU A N   1 
ATOM   3505 C CA  . LEU A 1 458 ? 1.360   -55.349 47.361  1.00 36.39  ? 459  LEU A CA  1 
ATOM   3506 C C   . LEU A 1 458 ? 0.296   -55.245 48.457  1.00 37.78  ? 459  LEU A C   1 
ATOM   3507 O O   . LEU A 1 458 ? 0.512   -55.715 49.567  1.00 46.55  ? 459  LEU A O   1 
ATOM   3508 C CB  . LEU A 1 458 ? 2.493   -54.361 47.674  1.00 31.81  ? 459  LEU A CB  1 
ATOM   3509 C CG  . LEU A 1 458 ? 3.700   -54.473 46.737  1.00 45.98  ? 459  LEU A CG  1 
ATOM   3510 C CD1 . LEU A 1 458 ? 4.834   -53.576 47.207  1.00 44.56  ? 459  LEU A CD1 1 
ATOM   3511 C CD2 . LEU A 1 458 ? 4.148   -55.925 46.642  1.00 43.80  ? 459  LEU A CD2 1 
ATOM   3512 N N   . ASP A 1 459 ? -0.823  -54.605 48.137  1.00 37.71  ? 460  ASP A N   1 
ATOM   3513 C CA  . ASP A 1 459 ? -1.921  -54.407 49.070  1.00 34.29  ? 460  ASP A CA  1 
ATOM   3514 C C   . ASP A 1 459 ? -2.503  -55.766 49.409  1.00 52.63  ? 460  ASP A C   1 
ATOM   3515 O O   . ASP A 1 459 ? -3.062  -56.445 48.535  1.00 43.57  ? 460  ASP A O   1 
ATOM   3516 C CB  . ASP A 1 459 ? -2.968  -53.487 48.458  1.00 35.72  ? 460  ASP A CB  1 
ATOM   3517 C CG  . ASP A 1 459 ? -4.118  -53.173 49.397  1.00 49.11  ? 460  ASP A CG  1 
ATOM   3518 O OD1 . ASP A 1 459 ? -4.291  -53.856 50.433  1.00 48.99  ? 460  ASP A OD1 1 
ATOM   3519 O OD2 . ASP A 1 459 ? -4.879  -52.238 49.071  1.00 47.16  ? 460  ASP A OD2 1 
ATOM   3520 N N   . PRO A 1 460 ? -2.367  -56.173 50.684  1.00 54.46  ? 461  PRO A N   1 
ATOM   3521 C CA  . PRO A 1 460 ? -2.698  -57.537 51.112  1.00 59.46  ? 461  PRO A CA  1 
ATOM   3522 C C   . PRO A 1 460 ? -4.180  -57.825 50.922  1.00 52.80  ? 461  PRO A C   1 
ATOM   3523 O O   . PRO A 1 460 ? -4.540  -58.952 50.585  1.00 66.58  ? 461  PRO A O   1 
ATOM   3524 C CB  . PRO A 1 460 ? -2.303  -57.550 52.602  1.00 54.22  ? 461  PRO A CB  1 
ATOM   3525 C CG  . PRO A 1 460 ? -1.350  -56.383 52.751  1.00 61.88  ? 461  PRO A CG  1 
ATOM   3526 C CD  . PRO A 1 460 ? -1.880  -55.348 51.799  1.00 49.83  ? 461  PRO A CD  1 
ATOM   3527 N N   . SER A 1 461 ? -5.011  -56.798 51.082  1.00 50.15  ? 462  SER A N   1 
ATOM   3528 C CA  . SER A 1 461 ? -6.455  -56.933 50.930  1.00 46.87  ? 462  SER A CA  1 
ATOM   3529 C C   . SER A 1 461 ? -6.897  -57.253 49.508  1.00 55.37  ? 462  SER A C   1 
ATOM   3530 O O   . SER A 1 461 ? -8.052  -57.611 49.280  1.00 60.27  ? 462  SER A O   1 
ATOM   3531 C CB  . SER A 1 461 ? -7.146  -55.654 51.378  1.00 48.12  ? 462  SER A CB  1 
ATOM   3532 O OG  . SER A 1 461 ? -6.806  -54.604 50.503  1.00 54.74  ? 462  SER A OG  1 
ATOM   3533 N N   . ARG A 1 462 ? -6.000  -57.089 48.546  1.00 53.19  ? 463  ARG A N   1 
ATOM   3534 C CA  . ARG A 1 462 ? -6.328  -57.452 47.178  1.00 51.56  ? 463  ARG A CA  1 
ATOM   3535 C C   . ARG A 1 462 ? -5.745  -58.825 46.919  1.00 50.02  ? 463  ARG A C   1 
ATOM   3536 O O   . ARG A 1 462 ? -5.063  -59.384 47.786  1.00 55.06  ? 463  ARG A O   1 
ATOM   3537 C CB  . ARG A 1 462 ? -5.811  -56.409 46.186  1.00 51.95  ? 463  ARG A CB  1 
ATOM   3538 C CG  . ARG A 1 462 ? -6.542  -55.094 46.311  1.00 49.57  ? 463  ARG A CG  1 
ATOM   3539 C CD  . ARG A 1 462 ? -5.925  -54.028 45.442  1.00 54.12  ? 463  ARG A CD  1 
ATOM   3540 N NE  . ARG A 1 462 ? -6.368  -52.704 45.862  1.00 55.07  ? 463  ARG A NE  1 
ATOM   3541 C CZ  . ARG A 1 462 ? -7.461  -52.105 45.408  1.00 57.96  ? 463  ARG A CZ  1 
ATOM   3542 N NH1 . ARG A 1 462 ? -8.213  -52.703 44.490  1.00 65.48  ? 463  ARG A NH1 1 
ATOM   3543 N NH2 . ARG A 1 462 ? -7.791  -50.901 45.862  1.00 60.74  ? 463  ARG A NH2 1 
ATOM   3544 N N   . ASN A 1 463 ? -5.996  -59.365 45.734  1.00 49.41  ? 464  ASN A N   1 
ATOM   3545 C CA  . ASN A 1 463 ? -5.835  -60.803 45.543  1.00 52.46  ? 464  ASN A CA  1 
ATOM   3546 C C   . ASN A 1 463 ? -4.832  -61.202 44.490  1.00 47.51  ? 464  ASN A C   1 
ATOM   3547 O O   . ASN A 1 463 ? -4.958  -62.264 43.888  1.00 48.01  ? 464  ASN A O   1 
ATOM   3548 C CB  . ASN A 1 463 ? -7.197  -61.427 45.215  1.00 52.02  ? 464  ASN A CB  1 
ATOM   3549 C CG  . ASN A 1 463 ? -8.087  -61.529 46.442  1.00 64.83  ? 464  ASN A CG  1 
ATOM   3550 O OD1 . ASN A 1 463 ? -7.734  -62.208 47.412  1.00 73.87  ? 464  ASN A OD1 1 
ATOM   3551 N ND2 . ASN A 1 463 ? -9.231  -60.846 46.418  1.00 64.97  ? 464  ASN A ND2 1 
ATOM   3552 N N   . TYR A 1 464 ? -3.827  -60.366 44.276  1.00 37.29  ? 465  TYR A N   1 
ATOM   3553 C CA  . TYR A 1 464 ? -2.798  -60.687 43.302  1.00 40.50  ? 465  TYR A CA  1 
ATOM   3554 C C   . TYR A 1 464 ? -1.968  -61.872 43.779  1.00 40.27  ? 465  TYR A C   1 
ATOM   3555 O O   . TYR A 1 464 ? -1.893  -62.136 44.973  1.00 39.17  ? 465  TYR A O   1 
ATOM   3556 C CB  . TYR A 1 464 ? -1.914  -59.463 43.051  1.00 39.23  ? 465  TYR A CB  1 
ATOM   3557 C CG  . TYR A 1 464 ? -2.639  -58.319 42.378  1.00 35.55  ? 465  TYR A CG  1 
ATOM   3558 C CD1 . TYR A 1 464 ? -3.407  -57.430 43.114  1.00 32.31  ? 465  TYR A CD1 1 
ATOM   3559 C CD2 . TYR A 1 464 ? -2.552  -58.135 41.001  1.00 35.54  ? 465  TYR A CD2 1 
ATOM   3560 C CE1 . TYR A 1 464 ? -4.073  -56.390 42.512  1.00 34.90  ? 465  TYR A CE1 1 
ATOM   3561 C CE2 . TYR A 1 464 ? -3.211  -57.093 40.380  1.00 37.04  ? 465  TYR A CE2 1 
ATOM   3562 C CZ  . TYR A 1 464 ? -3.959  -56.212 41.137  1.00 37.23  ? 465  TYR A CZ  1 
ATOM   3563 O OH  . TYR A 1 464 ? -4.615  -55.170 40.522  1.00 38.19  ? 465  TYR A OH  1 
ATOM   3564 N N   . THR A 1 465 ? -1.352  -62.584 42.847  1.00 45.13  ? 466  THR A N   1 
ATOM   3565 C CA  . THR A 1 465 ? -0.454  -63.693 43.187  1.00 41.50  ? 466  THR A CA  1 
ATOM   3566 C C   . THR A 1 465 ? 0.909   -63.227 43.677  1.00 45.36  ? 466  THR A C   1 
ATOM   3567 O O   . THR A 1 465 ? 1.311   -62.090 43.422  1.00 43.80  ? 466  THR A O   1 
ATOM   3568 C CB  . THR A 1 465 ? -0.191  -64.587 41.982  1.00 42.10  ? 466  THR A CB  1 
ATOM   3569 O OG1 . THR A 1 465 ? 0.740   -63.921 41.113  1.00 45.36  ? 466  THR A OG1 1 
ATOM   3570 C CG2 . THR A 1 465 ? -1.491  -64.885 41.239  1.00 37.19  ? 466  THR A CG2 1 
ATOM   3571 N N   . ALA A 1 466 ? 1.648   -64.126 44.323  1.00 45.28  ? 467  ALA A N   1 
ATOM   3572 C CA  . ALA A 1 466 ? 3.005   -63.816 44.749  1.00 49.97  ? 467  ALA A CA  1 
ATOM   3573 C C   . ALA A 1 466 ? 3.883   -63.433 43.552  1.00 46.56  ? 467  ALA A C   1 
ATOM   3574 O O   . ALA A 1 466 ? 4.749   -62.565 43.666  1.00 47.44  ? 467  ALA A O   1 
ATOM   3575 C CB  . ALA A 1 466 ? 3.625   -65.007 45.524  1.00 39.46  ? 467  ALA A CB  1 
ATOM   3576 N N   . GLU A 1 467 ? 3.679   -64.087 42.411  1.00 46.32  ? 468  GLU A N   1 
ATOM   3577 C CA  . GLU A 1 467 ? 4.402   -63.724 41.188  1.00 47.12  ? 468  GLU A CA  1 
ATOM   3578 C C   . GLU A 1 467 ? 4.067   -62.295 40.743  1.00 42.97  ? 468  GLU A C   1 
ATOM   3579 O O   . GLU A 1 467 ? 4.927   -61.547 40.281  1.00 37.95  ? 468  GLU A O   1 
ATOM   3580 C CB  . GLU A 1 467 ? 4.069   -64.688 40.041  1.00 46.67  ? 468  GLU A CB  1 
ATOM   3581 C CG  . GLU A 1 467 ? 4.984   -65.895 39.877  1.00 58.76  ? 468  GLU A CG  1 
ATOM   3582 C CD  . GLU A 1 467 ? 4.593   -66.749 38.641  1.00 79.04  ? 468  GLU A CD  1 
ATOM   3583 O OE1 . GLU A 1 467 ? 3.395   -66.748 38.252  1.00 71.33  ? 468  GLU A OE1 1 
ATOM   3584 O OE2 . GLU A 1 467 ? 5.481   -67.409 38.046  1.00 77.02  ? 468  GLU A OE2 1 
ATOM   3585 N N   . GLU A 1 468 ? 2.797   -61.934 40.861  1.00 38.25  ? 469  GLU A N   1 
ATOM   3586 C CA  . GLU A 1 468 ? 2.360   -60.607 40.486  1.00 37.40  ? 469  GLU A CA  1 
ATOM   3587 C C   . GLU A 1 468 ? 2.989   -59.515 41.376  1.00 44.65  ? 469  GLU A C   1 
ATOM   3588 O O   . GLU A 1 468 ? 3.294   -58.400 40.895  1.00 39.43  ? 469  GLU A O   1 
ATOM   3589 C CB  . GLU A 1 468 ? 0.831   -60.571 40.487  1.00 35.38  ? 469  GLU A CB  1 
ATOM   3590 C CG  . GLU A 1 468 ? 0.294   -61.066 39.094  1.00 34.84  ? 469  GLU A CG  1 
ATOM   3591 C CD  . GLU A 1 468 ? -1.224  -61.168 39.017  1.00 42.04  ? 469  GLU A CD  1 
ATOM   3592 O OE1 . GLU A 1 468 ? -1.869  -61.468 40.048  1.00 37.21  ? 469  GLU A OE1 1 
ATOM   3593 O OE2 . GLU A 1 468 ? -1.773  -60.951 37.914  1.00 41.63  ? 469  GLU A OE2 1 
ATOM   3594 N N   . LYS A 1 469 ? 3.269   -59.856 42.634  1.00 35.16  ? 470  LYS A N   1 
ATOM   3595 C CA  . LYS A 1 469 ? 3.838   -58.890 43.570  1.00 35.51  ? 470  LYS A CA  1 
ATOM   3596 C C   . LYS A 1 469 ? 5.286   -58.636 43.225  1.00 34.35  ? 470  LYS A C   1 
ATOM   3597 O O   . LYS A 1 469 ? 5.746   -57.502 43.222  1.00 35.45  ? 470  LYS A O   1 
ATOM   3598 C CB  . LYS A 1 469 ? 3.708   -59.377 45.024  1.00 32.84  ? 470  LYS A CB  1 
ATOM   3599 C CG  . LYS A 1 469 ? 2.245   -59.464 45.485  1.00 41.57  ? 470  LYS A CG  1 
ATOM   3600 C CD  . LYS A 1 469 ? 2.136   -60.093 46.886  1.00 46.90  ? 470  LYS A CD  1 
ATOM   3601 C CE  . LYS A 1 469 ? 0.694   -60.101 47.385  1.00 39.55  ? 470  LYS A CE  1 
ATOM   3602 N NZ  . LYS A 1 469 ? 0.651   -60.380 48.852  1.00 61.38  ? 470  LYS A NZ  1 
ATOM   3603 N N   . ILE A 1 470 ? 6.006   -59.701 42.917  1.00 35.78  ? 471  ILE A N   1 
ATOM   3604 C CA  . ILE A 1 470 ? 7.385   -59.573 42.498  1.00 38.11  ? 471  ILE A CA  1 
ATOM   3605 C C   . ILE A 1 470 ? 7.456   -58.772 41.185  1.00 38.96  ? 471  ILE A C   1 
ATOM   3606 O O   . ILE A 1 470 ? 8.366   -57.979 40.987  1.00 42.29  ? 471  ILE A O   1 
ATOM   3607 C CB  . ILE A 1 470 ? 8.033   -60.970 42.336  1.00 47.58  ? 471  ILE A CB  1 
ATOM   3608 C CG1 . ILE A 1 470 ? 8.305   -61.581 43.711  1.00 40.25  ? 471  ILE A CG1 1 
ATOM   3609 C CG2 . ILE A 1 470 ? 9.325   -60.917 41.520  1.00 36.19  ? 471  ILE A CG2 1 
ATOM   3610 C CD1 . ILE A 1 470 ? 8.271   -63.107 43.688  1.00 48.50  ? 471  ILE A CD1 1 
ATOM   3611 N N   . PHE A 1 471 ? 6.486   -58.971 40.301  1.00 38.53  ? 472  PHE A N   1 
ATOM   3612 C CA  . PHE A 1 471 ? 6.444   -58.247 39.032  1.00 41.18  ? 472  PHE A CA  1 
ATOM   3613 C C   . PHE A 1 471 ? 6.261   -56.738 39.292  1.00 36.79  ? 472  PHE A C   1 
ATOM   3614 O O   . PHE A 1 471 ? 6.980   -55.898 38.732  1.00 33.59  ? 472  PHE A O   1 
ATOM   3615 C CB  . PHE A 1 471 ? 5.319   -58.815 38.158  1.00 30.90  ? 472  PHE A CB  1 
ATOM   3616 C CG  . PHE A 1 471 ? 5.148   -58.129 36.836  1.00 34.46  ? 472  PHE A CG  1 
ATOM   3617 C CD1 . PHE A 1 471 ? 6.239   -57.855 36.020  1.00 32.35  ? 472  PHE A CD1 1 
ATOM   3618 C CD2 . PHE A 1 471 ? 3.882   -57.787 36.392  1.00 34.02  ? 472  PHE A CD2 1 
ATOM   3619 C CE1 . PHE A 1 471 ? 6.062   -57.242 34.770  1.00 36.18  ? 472  PHE A CE1 1 
ATOM   3620 C CE2 . PHE A 1 471 ? 3.699   -57.169 35.158  1.00 36.95  ? 472  PHE A CE2 1 
ATOM   3621 C CZ  . PHE A 1 471 ? 4.793   -56.894 34.342  1.00 34.09  ? 472  PHE A CZ  1 
ATOM   3622 N N   . ALA A 1 472 ? 5.307   -56.412 40.158  1.00 34.99  ? 473  ALA A N   1 
ATOM   3623 C CA  . ALA A 1 472 ? 5.054   -55.025 40.549  1.00 36.89  ? 473  ALA A CA  1 
ATOM   3624 C C   . ALA A 1 472 ? 6.329   -54.389 41.092  1.00 38.12  ? 473  ALA A C   1 
ATOM   3625 O O   . ALA A 1 472 ? 6.648   -53.246 40.758  1.00 35.45  ? 473  ALA A O   1 
ATOM   3626 C CB  . ALA A 1 472 ? 3.934   -54.952 41.579  1.00 28.88  ? 473  ALA A CB  1 
ATOM   3627 N N   . GLN A 1 473 ? 7.083   -55.150 41.882  1.00 36.04  ? 474  GLN A N   1 
ATOM   3628 C CA  . GLN A 1 473 ? 8.281   -54.620 42.510  1.00 37.12  ? 474  GLN A CA  1 
ATOM   3629 C C   . GLN A 1 473 ? 9.337   -54.338 41.462  1.00 33.82  ? 474  GLN A C   1 
ATOM   3630 O O   . GLN A 1 473 ? 10.054  -53.334 41.545  1.00 35.39  ? 474  GLN A O   1 
ATOM   3631 C CB  . GLN A 1 473 ? 8.802   -55.580 43.588  1.00 33.25  ? 474  GLN A CB  1 
ATOM   3632 C CG  . GLN A 1 473 ? 7.878   -55.606 44.794  1.00 39.89  ? 474  GLN A CG  1 
ATOM   3633 C CD  . GLN A 1 473 ? 8.280   -56.618 45.831  1.00 46.98  ? 474  GLN A CD  1 
ATOM   3634 O OE1 . GLN A 1 473 ? 8.490   -57.793 45.527  1.00 45.15  ? 474  GLN A OE1 1 
ATOM   3635 N NE2 . GLN A 1 473 ? 8.392   -56.166 47.077  1.00 40.39  ? 474  GLN A NE2 1 
ATOM   3636 N N   . ARG A 1 474 ? 9.423   -55.225 40.476  1.00 37.01  ? 475  ARG A N   1 
ATOM   3637 C CA  . ARG A 1 474 ? 10.267  -55.006 39.300  1.00 40.47  ? 475  ARG A CA  1 
ATOM   3638 C C   . ARG A 1 474 ? 9.921   -53.704 38.556  1.00 33.57  ? 475  ARG A C   1 
ATOM   3639 O O   . ARG A 1 474 ? 10.815  -52.915 38.206  1.00 28.86  ? 475  ARG A O   1 
ATOM   3640 C CB  . ARG A 1 474 ? 10.153  -56.190 38.321  1.00 41.28  ? 475  ARG A CB  1 
ATOM   3641 C CG  . ARG A 1 474 ? 10.932  -57.433 38.718  1.00 45.39  ? 475  ARG A CG  1 
ATOM   3642 C CD  . ARG A 1 474 ? 10.902  -58.517 37.620  1.00 45.50  ? 475  ARG A CD  1 
ATOM   3643 N NE  . ARG A 1 474 ? 11.323  -57.995 36.321  1.00 40.93  ? 475  ARG A NE  1 
ATOM   3644 C CZ  . ARG A 1 474 ? 10.700  -58.261 35.173  1.00 43.38  ? 475  ARG A CZ  1 
ATOM   3645 N NH1 . ARG A 1 474 ? 9.638   -59.047 35.186  1.00 38.89  ? 475  ARG A NH1 1 
ATOM   3646 N NH2 . ARG A 1 474 ? 11.124  -57.727 34.020  1.00 34.49  ? 475  ARG A NH2 1 
ATOM   3647 N N   . LEU A 1 475 ? 8.634   -53.514 38.270  1.00 30.34  ? 476  LEU A N   1 
ATOM   3648 C CA  . LEU A 1 475 ? 8.187   -52.337 37.537  1.00 29.75  ? 476  LEU A CA  1 
ATOM   3649 C C   . LEU A 1 475 ? 8.460   -51.048 38.333  1.00 32.48  ? 476  LEU A C   1 
ATOM   3650 O O   . LEU A 1 475 ? 8.945   -50.054 37.777  1.00 27.56  ? 476  LEU A O   1 
ATOM   3651 C CB  . LEU A 1 475 ? 6.699   -52.450 37.204  1.00 34.79  ? 476  LEU A CB  1 
ATOM   3652 C CG  . LEU A 1 475 ? 6.339   -53.547 36.195  1.00 38.43  ? 476  LEU A CG  1 
ATOM   3653 C CD1 . LEU A 1 475 ? 5.008   -53.284 35.561  1.00 42.80  ? 476  LEU A CD1 1 
ATOM   3654 C CD2 . LEU A 1 475 ? 7.370   -53.626 35.124  1.00 32.39  ? 476  LEU A CD2 1 
ATOM   3655 N N   . MET A 1 476 ? 8.156   -51.074 39.632  1.00 29.76  ? 477  MET A N   1 
ATOM   3656 C CA  . MET A 1 476 ? 8.422   -49.932 40.502  1.00 32.33  ? 477  MET A CA  1 
ATOM   3657 C C   . MET A 1 476 ? 9.912   -49.579 40.490  1.00 30.06  ? 477  MET A C   1 
ATOM   3658 O O   . MET A 1 476 ? 10.271  -48.398 40.407  1.00 29.24  ? 477  MET A O   1 
ATOM   3659 C CB  . MET A 1 476 ? 7.951   -50.212 41.931  1.00 32.60  ? 477  MET A CB  1 
ATOM   3660 C CG  . MET A 1 476 ? 6.425   -50.228 42.114  1.00 29.33  ? 477  MET A CG  1 
ATOM   3661 S SD  . MET A 1 476 ? 6.000   -50.071 43.868  1.00 34.66  ? 477  MET A SD  1 
ATOM   3662 C CE  . MET A 1 476 ? 6.545   -51.690 44.430  1.00 34.13  ? 477  MET A CE  1 
ATOM   3663 N N   . ARG A 1 477 ? 10.770  -50.601 40.541  1.00 30.18  ? 478  ARG A N   1 
ATOM   3664 C CA  . ARG A 1 477 ? 12.233  -50.407 40.428  1.00 32.10  ? 478  ARG A CA  1 
ATOM   3665 C C   . ARG A 1 477 ? 12.641  -49.808 39.069  1.00 34.18  ? 478  ARG A C   1 
ATOM   3666 O O   . ARG A 1 477 ? 13.466  -48.865 39.026  1.00 31.36  ? 478  ARG A O   1 
ATOM   3667 C CB  . ARG A 1 477 ? 12.967  -51.744 40.647  1.00 31.39  ? 478  ARG A CB  1 
ATOM   3668 C CG  . ARG A 1 477 ? 14.504  -51.715 40.585  1.00 33.13  ? 478  ARG A CG  1 
ATOM   3669 C CD  . ARG A 1 477 ? 15.145  -50.780 41.624  1.00 35.75  ? 478  ARG A CD  1 
ATOM   3670 N NE  . ARG A 1 477 ? 14.730  -51.144 42.975  1.00 36.10  ? 478  ARG A NE  1 
ATOM   3671 C CZ  . ARG A 1 477 ? 15.329  -52.086 43.703  1.00 46.66  ? 478  ARG A CZ  1 
ATOM   3672 N NH1 . ARG A 1 477 ? 16.377  -52.746 43.215  1.00 37.57  ? 478  ARG A NH1 1 
ATOM   3673 N NH2 . ARG A 1 477 ? 14.880  -52.373 44.919  1.00 38.04  ? 478  ARG A NH2 1 
ATOM   3674 N N   . TYR A 1 478 ? 12.095  -50.343 37.964  1.00 30.18  ? 479  TYR A N   1 
ATOM   3675 C CA  . TYR A 1 478 ? 12.414  -49.786 36.637  1.00 30.62  ? 479  TYR A CA  1 
ATOM   3676 C C   . TYR A 1 478 ? 12.090  -48.298 36.616  1.00 30.27  ? 479  TYR A C   1 
ATOM   3677 O O   . TYR A 1 478 ? 12.934  -47.470 36.226  1.00 33.30  ? 479  TYR A O   1 
ATOM   3678 C CB  . TYR A 1 478 ? 11.643  -50.485 35.500  1.00 31.72  ? 479  TYR A CB  1 
ATOM   3679 C CG  . TYR A 1 478 ? 12.119  -51.882 35.170  1.00 33.31  ? 479  TYR A CG  1 
ATOM   3680 C CD1 . TYR A 1 478 ? 13.471  -52.188 35.131  1.00 31.53  ? 479  TYR A CD1 1 
ATOM   3681 C CD2 . TYR A 1 478 ? 11.209  -52.894 34.902  1.00 35.20  ? 479  TYR A CD2 1 
ATOM   3682 C CE1 . TYR A 1 478 ? 13.901  -53.463 34.828  1.00 30.78  ? 479  TYR A CE1 1 
ATOM   3683 C CE2 . TYR A 1 478 ? 11.625  -54.167 34.615  1.00 34.34  ? 479  TYR A CE2 1 
ATOM   3684 C CZ  . TYR A 1 478 ? 12.967  -54.453 34.579  1.00 40.45  ? 479  TYR A CZ  1 
ATOM   3685 O OH  . TYR A 1 478 ? 13.357  -55.741 34.283  1.00 44.03  ? 479  TYR A OH  1 
ATOM   3686 N N   . TRP A 1 479 ? 10.883  -47.963 37.077  1.00 28.08  ? 480  TRP A N   1 
ATOM   3687 C CA  . TRP A 1 479 ? 10.375  -46.599 36.991  1.00 29.22  ? 480  TRP A CA  1 
ATOM   3688 C C   . TRP A 1 479 ? 11.195  -45.657 37.878  1.00 30.42  ? 480  TRP A C   1 
ATOM   3689 O O   . TRP A 1 479 ? 11.557  -44.551 37.467  1.00 28.57  ? 480  TRP A O   1 
ATOM   3690 C CB  . TRP A 1 479 ? 8.872   -46.557 37.372  1.00 21.60  ? 480  TRP A CB  1 
ATOM   3691 C CG  . TRP A 1 479 ? 7.922   -46.421 36.159  1.00 23.56  ? 480  TRP A CG  1 
ATOM   3692 C CD1 . TRP A 1 479 ? 7.068   -45.387 35.901  1.00 22.59  ? 480  TRP A CD1 1 
ATOM   3693 C CD2 . TRP A 1 479 ? 7.715   -47.376 35.100  1.00 24.34  ? 480  TRP A CD2 1 
ATOM   3694 N NE1 . TRP A 1 479 ? 6.386   -45.612 34.735  1.00 29.27  ? 480  TRP A NE1 1 
ATOM   3695 C CE2 . TRP A 1 479 ? 6.747   -46.832 34.229  1.00 27.61  ? 480  TRP A CE2 1 
ATOM   3696 C CE3 . TRP A 1 479 ? 8.261   -48.629 34.801  1.00 29.08  ? 480  TRP A CE3 1 
ATOM   3697 C CZ2 . TRP A 1 479 ? 6.318   -47.490 33.070  1.00 28.34  ? 480  TRP A CZ2 1 
ATOM   3698 C CZ3 . TRP A 1 479 ? 7.833   -49.283 33.650  1.00 30.18  ? 480  TRP A CZ3 1 
ATOM   3699 C CH2 . TRP A 1 479 ? 6.870   -48.712 32.802  1.00 30.04  ? 480  TRP A CH2 1 
ATOM   3700 N N   . ALA A 1 480 ? 11.511  -46.103 39.090  1.00 31.03  ? 481  ALA A N   1 
ATOM   3701 C CA  . ALA A 1 480 ? 12.254  -45.267 40.016  1.00 29.32  ? 481  ALA A CA  1 
ATOM   3702 C C   . ALA A 1 480 ? 13.732  -45.165 39.608  1.00 28.02  ? 481  ALA A C   1 
ATOM   3703 O O   . ALA A 1 480 ? 14.342  -44.099 39.776  1.00 29.08  ? 481  ALA A O   1 
ATOM   3704 C CB  . ALA A 1 480 ? 12.117  -45.804 41.443  1.00 26.87  ? 481  ALA A CB  1 
ATOM   3705 N N   . ASN A 1 481 ? 14.301  -46.246 39.068  1.00 30.05  ? 482  ASN A N   1 
ATOM   3706 C CA  . ASN A 1 481 ? 15.646  -46.165 38.499  1.00 31.36  ? 482  ASN A CA  1 
ATOM   3707 C C   . ASN A 1 481 ? 15.677  -45.079 37.430  1.00 34.34  ? 482  ASN A C   1 
ATOM   3708 O O   . ASN A 1 481 ? 16.636  -44.290 37.353  1.00 31.24  ? 482  ASN A O   1 
ATOM   3709 C CB  . ASN A 1 481 ? 16.106  -47.491 37.875  1.00 27.56  ? 482  ASN A CB  1 
ATOM   3710 C CG  . ASN A 1 481 ? 16.619  -48.492 38.898  1.00 34.78  ? 482  ASN A CG  1 
ATOM   3711 O OD1 . ASN A 1 481 ? 16.676  -48.215 40.114  1.00 32.88  ? 482  ASN A OD1 1 
ATOM   3712 N ND2 . ASN A 1 481 ? 16.975  -49.685 38.412  1.00 35.46  ? 482  ASN A ND2 1 
ATOM   3713 N N   . PHE A 1 482 ? 14.632  -45.049 36.598  1.00 29.18  ? 483  PHE A N   1 
ATOM   3714 C CA  . PHE A 1 482 ? 14.579  -44.092 35.506  1.00 31.47  ? 483  PHE A CA  1 
ATOM   3715 C C   . PHE A 1 482 ? 14.484  -42.689 36.087  1.00 34.97  ? 483  PHE A C   1 
ATOM   3716 O O   . PHE A 1 482 ? 15.109  -41.755 35.581  1.00 30.23  ? 483  PHE A O   1 
ATOM   3717 C CB  . PHE A 1 482 ? 13.393  -44.357 34.555  1.00 27.79  ? 483  PHE A CB  1 
ATOM   3718 C CG  . PHE A 1 482 ? 13.219  -43.288 33.503  1.00 28.93  ? 483  PHE A CG  1 
ATOM   3719 C CD1 . PHE A 1 482 ? 14.040  -43.259 32.383  1.00 29.66  ? 483  PHE A CD1 1 
ATOM   3720 C CD2 . PHE A 1 482 ? 12.265  -42.290 33.663  1.00 26.79  ? 483  PHE A CD2 1 
ATOM   3721 C CE1 . PHE A 1 482 ? 13.903  -42.261 31.418  1.00 31.76  ? 483  PHE A CE1 1 
ATOM   3722 C CE2 . PHE A 1 482 ? 12.120  -41.289 32.721  1.00 27.57  ? 483  PHE A CE2 1 
ATOM   3723 C CZ  . PHE A 1 482 ? 12.951  -41.269 31.586  1.00 28.40  ? 483  PHE A CZ  1 
ATOM   3724 N N   . ALA A 1 483 ? 13.686  -42.527 37.137  1.00 27.70  ? 484  ALA A N   1 
ATOM   3725 C CA  . ALA A 1 483 ? 13.523  -41.202 37.727  1.00 33.23  ? 484  ALA A CA  1 
ATOM   3726 C C   . ALA A 1 483 ? 14.828  -40.704 38.393  1.00 36.58  ? 484  ALA A C   1 
ATOM   3727 O O   . ALA A 1 483 ? 15.126  -39.516 38.405  1.00 33.88  ? 484  ALA A O   1 
ATOM   3728 C CB  . ALA A 1 483 ? 12.392  -41.211 38.735  1.00 25.87  ? 484  ALA A CB  1 
ATOM   3729 N N   . ARG A 1 484 ? 15.587  -41.621 38.973  1.00 31.40  ? 485  ARG A N   1 
ATOM   3730 C CA  . ARG A 1 484 ? 16.826  -41.262 39.641  1.00 34.23  ? 485  ARG A CA  1 
ATOM   3731 C C   . ARG A 1 484 ? 17.964  -40.982 38.659  1.00 42.93  ? 485  ARG A C   1 
ATOM   3732 O O   . ARG A 1 484 ? 18.770  -40.108 38.918  1.00 37.24  ? 485  ARG A O   1 
ATOM   3733 C CB  . ARG A 1 484 ? 17.266  -42.379 40.589  1.00 35.77  ? 485  ARG A CB  1 
ATOM   3734 C CG  . ARG A 1 484 ? 16.456  -42.504 41.847  1.00 32.82  ? 485  ARG A CG  1 
ATOM   3735 C CD  . ARG A 1 484 ? 17.059  -43.566 42.746  1.00 32.31  ? 485  ARG A CD  1 
ATOM   3736 N NE  . ARG A 1 484 ? 16.757  -44.920 42.288  1.00 33.59  ? 485  ARG A NE  1 
ATOM   3737 C CZ  . ARG A 1 484 ? 15.757  -45.668 42.743  1.00 33.69  ? 485  ARG A CZ  1 
ATOM   3738 N NH1 . ARG A 1 484 ? 14.941  -45.206 43.691  1.00 30.51  ? 485  ARG A NH1 1 
ATOM   3739 N NH2 . ARG A 1 484 ? 15.581  -46.882 42.247  1.00 36.90  ? 485  ARG A NH2 1 
ATOM   3740 N N   . THR A 1 485 ? 18.034  -41.728 37.549  1.00 34.06  ? 486  THR A N   1 
ATOM   3741 C CA  . THR A 1 485 ? 19.219  -41.698 36.682  1.00 36.44  ? 486  THR A CA  1 
ATOM   3742 C C   . THR A 1 485 ? 18.970  -41.507 35.193  1.00 37.08  ? 486  THR A C   1 
ATOM   3743 O O   . THR A 1 485 ? 19.926  -41.385 34.443  1.00 36.91  ? 486  THR A O   1 
ATOM   3744 C CB  . THR A 1 485 ? 20.042  -43.017 36.760  1.00 34.61  ? 486  THR A CB  1 
ATOM   3745 O OG1 . THR A 1 485 ? 19.301  -44.074 36.137  1.00 33.61  ? 486  THR A OG1 1 
ATOM   3746 C CG2 . THR A 1 485 ? 20.391  -43.397 38.201  1.00 30.96  ? 486  THR A CG2 1 
ATOM   3747 N N   . GLY A 1 486 ? 17.717  -41.535 34.746  1.00 36.23  ? 487  GLY A N   1 
ATOM   3748 C CA  . GLY A 1 486 ? 17.439  -41.498 33.315  1.00 33.52  ? 487  GLY A CA  1 
ATOM   3749 C C   . GLY A 1 486 ? 17.596  -42.862 32.643  1.00 31.90  ? 487  GLY A C   1 
ATOM   3750 O O   . GLY A 1 486 ? 17.539  -42.986 31.429  1.00 32.61  ? 487  GLY A O   1 
ATOM   3751 N N   . ASP A 1 487 ? 17.757  -43.906 33.444  1.00 38.81  ? 488  ASP A N   1 
ATOM   3752 C CA  . ASP A 1 487 ? 18.032  -45.235 32.900  1.00 38.07  ? 488  ASP A CA  1 
ATOM   3753 C C   . ASP A 1 487 ? 17.325  -46.269 33.794  1.00 33.37  ? 488  ASP A C   1 
ATOM   3754 O O   . ASP A 1 487 ? 17.650  -46.347 34.971  1.00 37.03  ? 488  ASP A O   1 
ATOM   3755 C CB  . ASP A 1 487 ? 19.558  -45.445 32.859  1.00 37.33  ? 488  ASP A CB  1 
ATOM   3756 C CG  . ASP A 1 487 ? 19.979  -46.773 32.252  1.00 33.97  ? 488  ASP A CG  1 
ATOM   3757 O OD1 . ASP A 1 487 ? 19.157  -47.696 32.145  1.00 40.17  ? 488  ASP A OD1 1 
ATOM   3758 O OD2 . ASP A 1 487 ? 21.165  -46.887 31.880  1.00 46.80  ? 488  ASP A OD2 1 
ATOM   3759 N N   . PRO A 1 488 ? 16.358  -47.051 33.252  1.00 30.57  ? 489  PRO A N   1 
ATOM   3760 C CA  . PRO A 1 488 ? 15.618  -47.982 34.133  1.00 31.69  ? 489  PRO A CA  1 
ATOM   3761 C C   . PRO A 1 488 ? 16.431  -49.218 34.545  1.00 35.89  ? 489  PRO A C   1 
ATOM   3762 O O   . PRO A 1 488 ? 16.049  -49.956 35.459  1.00 32.80  ? 489  PRO A O   1 
ATOM   3763 C CB  . PRO A 1 488 ? 14.415  -48.401 33.287  1.00 32.26  ? 489  PRO A CB  1 
ATOM   3764 C CG  . PRO A 1 488 ? 14.922  -48.292 31.828  1.00 30.65  ? 489  PRO A CG  1 
ATOM   3765 C CD  . PRO A 1 488 ? 15.868  -47.086 31.857  1.00 31.45  ? 489  PRO A CD  1 
ATOM   3766 N N   . ASN A 1 489 ? 17.554  -49.438 33.876  1.00 35.19  ? 490  ASN A N   1 
ATOM   3767 C CA  . ASN A 1 489 ? 18.330  -50.642 34.122  1.00 37.58  ? 490  ASN A CA  1 
ATOM   3768 C C   . ASN A 1 489 ? 18.900  -50.695 35.522  1.00 47.41  ? 490  ASN A C   1 
ATOM   3769 O O   . ASN A 1 489 ? 19.315  -49.671 36.071  1.00 42.08  ? 490  ASN A O   1 
ATOM   3770 C CB  . ASN A 1 489 ? 19.440  -50.760 33.091  1.00 35.60  ? 490  ASN A CB  1 
ATOM   3771 C CG  . ASN A 1 489 ? 18.904  -51.183 31.741  1.00 37.58  ? 490  ASN A CG  1 
ATOM   3772 O OD1 . ASN A 1 489 ? 18.536  -52.345 31.558  1.00 39.74  ? 490  ASN A OD1 1 
ATOM   3773 N ND2 . ASN A 1 489 ? 18.818  -50.241 30.807  1.00 28.04  ? 490  ASN A ND2 1 
ATOM   3774 N N   . GLU A 1 490 ? 18.890  -51.889 36.104  1.00 53.81  ? 491  GLU A N   1 
ATOM   3775 C CA  . GLU A 1 490 ? 19.376  -52.052 37.465  1.00 70.38  ? 491  GLU A CA  1 
ATOM   3776 C C   . GLU A 1 490 ? 20.858  -51.679 37.473  1.00 82.30  ? 491  GLU A C   1 
ATOM   3777 O O   . GLU A 1 490 ? 21.696  -52.454 36.970  1.00 68.96  ? 491  GLU A O   1 
ATOM   3778 C CB  . GLU A 1 490 ? 19.119  -53.465 37.967  1.00 72.22  ? 491  GLU A CB  1 
ATOM   3779 C CG  . GLU A 1 490 ? 17.756  -53.612 38.632  1.00 63.50  ? 491  GLU A CG  1 
ATOM   3780 C CD  . GLU A 1 490 ? 17.775  -53.152 40.080  1.00 59.37  ? 491  GLU A CD  1 
ATOM   3781 O OE1 . GLU A 1 490 ? 18.037  -51.955 40.351  1.00 54.14  ? 491  GLU A OE1 1 
ATOM   3782 O OE2 . GLU A 1 490 ? 17.544  -54.008 40.957  1.00 80.10  ? 491  GLU A OE2 1 
ATOM   3783 N N   . PRO A 1 491 ? 21.157  -50.475 38.041  1.00 76.43  ? 492  PRO A N   1 
ATOM   3784 C CA  . PRO A 1 491 ? 22.274  -49.579 37.706  1.00 76.86  ? 492  PRO A CA  1 
ATOM   3785 C C   . PRO A 1 491 ? 23.524  -50.367 37.407  1.00 81.80  ? 492  PRO A C   1 
ATOM   3786 O O   . PRO A 1 491 ? 24.034  -50.338 36.288  1.00 68.79  ? 492  PRO A O   1 
ATOM   3787 C CB  . PRO A 1 491 ? 22.418  -48.720 38.966  1.00 77.08  ? 492  PRO A CB  1 
ATOM   3788 C CG  . PRO A 1 491 ? 21.013  -48.607 39.464  1.00 70.85  ? 492  PRO A CG  1 
ATOM   3789 C CD  . PRO A 1 491 ? 20.444  -49.995 39.243  1.00 75.92  ? 492  PRO A CD  1 
ATOM   3790 N N   . ARG A 1 492 ? 23.995  -51.072 38.428  1.00 97.42  ? 493  ARG A N   1 
ATOM   3791 C CA  . ARG A 1 492 ? 24.863  -52.213 38.235  1.00 88.72  ? 493  ARG A CA  1 
ATOM   3792 C C   . ARG A 1 492 ? 24.063  -53.453 38.611  1.00 89.23  ? 493  ARG A C   1 
ATOM   3793 O O   . ARG A 1 492 ? 23.765  -53.697 39.780  1.00 89.19  ? 493  ARG A O   1 
ATOM   3794 C CB  . ARG A 1 492 ? 26.149  -52.105 39.064  1.00 91.88  ? 493  ARG A CB  1 
ATOM   3795 C CG  . ARG A 1 492 ? 25.979  -51.450 40.425  1.00 79.50  ? 493  ARG A CG  1 
ATOM   3796 C CD  . ARG A 1 492 ? 26.117  -52.430 41.562  1.00 88.31  ? 493  ARG A CD  1 
ATOM   3797 N NE  . ARG A 1 492 ? 26.631  -51.774 42.764  1.00 108.78 ? 493  ARG A NE  1 
ATOM   3798 C CZ  . ARG A 1 492 ? 25.936  -50.924 43.520  1.00 101.18 ? 493  ARG A CZ  1 
ATOM   3799 N NH1 . ARG A 1 492 ? 24.683  -50.614 43.200  1.00 81.81  ? 493  ARG A NH1 1 
ATOM   3800 N NH2 . ARG A 1 492 ? 26.500  -50.381 44.597  1.00 86.36  ? 493  ARG A NH2 1 
ATOM   3801 N N   . ASP A 1 493 ? 23.650  -54.184 37.586  1.00 90.70  ? 494  ASP A N   1 
ATOM   3802 C CA  . ASP A 1 493 ? 23.266  -55.571 37.740  1.00 92.01  ? 494  ASP A CA  1 
ATOM   3803 C C   . ASP A 1 493 ? 23.782  -56.268 36.507  1.00 90.32  ? 494  ASP A C   1 
ATOM   3804 O O   . ASP A 1 493 ? 23.107  -56.290 35.478  1.00 86.28  ? 494  ASP A O   1 
ATOM   3805 C CB  . ASP A 1 493 ? 21.760  -55.749 37.882  1.00 95.35  ? 494  ASP A CB  1 
ATOM   3806 C CG  . ASP A 1 493 ? 21.385  -57.126 38.404  1.00 92.10  ? 494  ASP A CG  1 
ATOM   3807 O OD1 . ASP A 1 493 ? 22.235  -58.050 38.344  1.00 96.32  ? 494  ASP A OD1 1 
ATOM   3808 O OD2 . ASP A 1 493 ? 20.234  -57.279 38.870  1.00 85.67  ? 494  ASP A OD2 1 
ATOM   3809 N N   . PRO A 1 494 ? 25.012  -56.792 36.598  1.00 89.85  ? 495  PRO A N   1 
ATOM   3810 C CA  . PRO A 1 494 ? 25.668  -57.473 35.484  1.00 99.15  ? 495  PRO A CA  1 
ATOM   3811 C C   . PRO A 1 494 ? 24.757  -58.463 34.756  1.00 97.08  ? 495  PRO A C   1 
ATOM   3812 O O   . PRO A 1 494 ? 24.480  -58.247 33.568  1.00 94.54  ? 495  PRO A O   1 
ATOM   3813 C CB  . PRO A 1 494 ? 26.839  -58.190 36.170  1.00 89.81  ? 495  PRO A CB  1 
ATOM   3814 C CG  . PRO A 1 494 ? 27.224  -57.244 37.274  1.00 83.11  ? 495  PRO A CG  1 
ATOM   3815 C CD  . PRO A 1 494 ? 25.915  -56.646 37.759  1.00 85.82  ? 495  PRO A CD  1 
ATOM   3816 N N   . LYS A 1 495 ? 24.275  -59.495 35.448  1.00 88.46  ? 496  LYS A N   1 
ATOM   3817 C CA  . LYS A 1 495 ? 23.713  -60.643 34.742  1.00 86.24  ? 496  LYS A CA  1 
ATOM   3818 C C   . LYS A 1 495 ? 22.207  -60.552 34.504  1.00 89.33  ? 496  LYS A C   1 
ATOM   3819 O O   . LYS A 1 495 ? 21.611  -61.490 33.969  1.00 94.92  ? 496  LYS A O   1 
ATOM   3820 C CB  . LYS A 1 495 ? 24.042  -61.947 35.481  1.00 88.42  ? 496  LYS A CB  1 
ATOM   3821 C CG  . LYS A 1 495 ? 24.150  -63.145 34.534  1.00 93.51  ? 496  LYS A CG  1 
ATOM   3822 C CD  . LYS A 1 495 ? 24.412  -64.457 35.254  1.00 93.17  ? 496  LYS A CD  1 
ATOM   3823 C CE  . LYS A 1 495 ? 24.506  -65.611 34.252  1.00 95.92  ? 496  LYS A CE  1 
ATOM   3824 N NZ  . LYS A 1 495 ? 24.935  -66.898 34.887  1.00 93.74  ? 496  LYS A NZ  1 
ATOM   3825 N N   . ALA A 1 496 ? 21.590  -59.433 34.885  1.00 88.63  ? 497  ALA A N   1 
ATOM   3826 C CA  . ALA A 1 496 ? 20.215  -59.147 34.451  1.00 86.58  ? 497  ALA A CA  1 
ATOM   3827 C C   . ALA A 1 496 ? 20.216  -58.754 32.969  1.00 76.11  ? 497  ALA A C   1 
ATOM   3828 O O   . ALA A 1 496 ? 21.114  -58.022 32.520  1.00 69.34  ? 497  ALA A O   1 
ATOM   3829 C CB  . ALA A 1 496 ? 19.586  -58.040 35.303  1.00 73.55  ? 497  ALA A CB  1 
ATOM   3830 N N   . PRO A 1 497 ? 19.227  -59.249 32.198  1.00 71.26  ? 498  PRO A N   1 
ATOM   3831 C CA  . PRO A 1 497 ? 19.150  -58.909 30.763  1.00 71.20  ? 498  PRO A CA  1 
ATOM   3832 C C   . PRO A 1 497 ? 18.773  -57.427 30.566  1.00 58.09  ? 498  PRO A C   1 
ATOM   3833 O O   . PRO A 1 497 ? 17.823  -56.936 31.172  1.00 63.69  ? 498  PRO A O   1 
ATOM   3834 C CB  . PRO A 1 497 ? 18.073  -59.857 30.224  1.00 63.98  ? 498  PRO A CB  1 
ATOM   3835 C CG  . PRO A 1 497 ? 17.240  -60.210 31.421  1.00 60.15  ? 498  PRO A CG  1 
ATOM   3836 C CD  . PRO A 1 497 ? 18.135  -60.140 32.634  1.00 70.73  ? 498  PRO A CD  1 
ATOM   3837 N N   . GLN A 1 498 ? 19.537  -56.717 29.749  1.00 48.05  ? 499  GLN A N   1 
ATOM   3838 C CA  . GLN A 1 498 ? 19.467  -55.269 29.763  1.00 44.55  ? 499  GLN A CA  1 
ATOM   3839 C C   . GLN A 1 498 ? 18.382  -54.694 28.843  1.00 53.47  ? 499  GLN A C   1 
ATOM   3840 O O   . GLN A 1 498 ? 18.059  -55.247 27.788  1.00 43.31  ? 499  GLN A O   1 
ATOM   3841 C CB  . GLN A 1 498 ? 20.830  -54.685 29.394  1.00 42.51  ? 499  GLN A CB  1 
ATOM   3842 C CG  . GLN A 1 498 ? 21.929  -54.989 30.414  1.00 49.66  ? 499  GLN A CG  1 
ATOM   3843 C CD  . GLN A 1 498 ? 21.751  -54.237 31.731  1.00 60.47  ? 499  GLN A CD  1 
ATOM   3844 O OE1 . GLN A 1 498 ? 21.751  -52.994 31.766  1.00 52.72  ? 499  GLN A OE1 1 
ATOM   3845 N NE2 . GLN A 1 498 ? 21.605  -54.989 32.823  1.00 56.76  ? 499  GLN A NE2 1 
ATOM   3846 N N   . TRP A 1 499 ? 17.837  -53.566 29.274  1.00 41.43  ? 500  TRP A N   1 
ATOM   3847 C CA  . TRP A 1 499 ? 16.857  -52.803 28.530  1.00 33.15  ? 500  TRP A CA  1 
ATOM   3848 C C   . TRP A 1 499 ? 17.611  -51.788 27.645  1.00 33.48  ? 500  TRP A C   1 
ATOM   3849 O O   . TRP A 1 499 ? 18.102  -50.775 28.128  1.00 38.42  ? 500  TRP A O   1 
ATOM   3850 C CB  . TRP A 1 499 ? 15.901  -52.134 29.530  1.00 31.19  ? 500  TRP A CB  1 
ATOM   3851 C CG  . TRP A 1 499 ? 14.693  -51.451 28.977  1.00 35.54  ? 500  TRP A CG  1 
ATOM   3852 C CD1 . TRP A 1 499 ? 14.485  -51.033 27.684  1.00 28.92  ? 500  TRP A CD1 1 
ATOM   3853 C CD2 . TRP A 1 499 ? 13.519  -51.088 29.709  1.00 32.93  ? 500  TRP A CD2 1 
ATOM   3854 N NE1 . TRP A 1 499 ? 13.259  -50.443 27.576  1.00 30.82  ? 500  TRP A NE1 1 
ATOM   3855 C CE2 . TRP A 1 499 ? 12.641  -50.457 28.799  1.00 32.40  ? 500  TRP A CE2 1 
ATOM   3856 C CE3 . TRP A 1 499 ? 13.119  -51.245 31.044  1.00 30.60  ? 500  TRP A CE3 1 
ATOM   3857 C CZ2 . TRP A 1 499 ? 11.382  -49.979 29.181  1.00 33.89  ? 500  TRP A CZ2 1 
ATOM   3858 C CZ3 . TRP A 1 499 ? 11.869  -50.761 31.430  1.00 32.72  ? 500  TRP A CZ3 1 
ATOM   3859 C CH2 . TRP A 1 499 ? 11.016  -50.138 30.500  1.00 31.02  ? 500  TRP A CH2 1 
ATOM   3860 N N   . PRO A 1 500 ? 17.738  -52.068 26.340  1.00 32.79  ? 501  PRO A N   1 
ATOM   3861 C CA  . PRO A 1 500 ? 18.488  -51.134 25.495  1.00 34.37  ? 501  PRO A CA  1 
ATOM   3862 C C   . PRO A 1 500 ? 17.634  -49.926 25.119  1.00 36.31  ? 501  PRO A C   1 
ATOM   3863 O O   . PRO A 1 500 ? 16.411  -50.015 25.127  1.00 36.34  ? 501  PRO A O   1 
ATOM   3864 C CB  . PRO A 1 500 ? 18.808  -51.976 24.247  1.00 36.02  ? 501  PRO A CB  1 
ATOM   3865 C CG  . PRO A 1 500 ? 17.619  -52.856 24.130  1.00 35.77  ? 501  PRO A CG  1 
ATOM   3866 C CD  . PRO A 1 500 ? 17.181  -53.182 25.555  1.00 32.70  ? 501  PRO A CD  1 
ATOM   3867 N N   . PRO A 1 501 ? 18.273  -48.804 24.789  1.00 39.52  ? 502  PRO A N   1 
ATOM   3868 C CA  . PRO A 1 501 ? 17.508  -47.648 24.310  1.00 32.06  ? 502  PRO A CA  1 
ATOM   3869 C C   . PRO A 1 501 ? 16.758  -47.917 22.984  1.00 41.28  ? 502  PRO A C   1 
ATOM   3870 O O   . PRO A 1 501 ? 17.192  -48.702 22.142  1.00 36.65  ? 502  PRO A O   1 
ATOM   3871 C CB  . PRO A 1 501 ? 18.592  -46.570 24.119  1.00 36.61  ? 502  PRO A CB  1 
ATOM   3872 C CG  . PRO A 1 501 ? 19.674  -46.961 25.125  1.00 36.36  ? 502  PRO A CG  1 
ATOM   3873 C CD  . PRO A 1 501 ? 19.673  -48.472 25.129  1.00 33.17  ? 502  PRO A CD  1 
ATOM   3874 N N   . TYR A 1 502 ? 15.619  -47.256 22.816  1.00 36.83  ? 503  TYR A N   1 
ATOM   3875 C CA  . TYR A 1 502 ? 14.880  -47.302 21.562  1.00 35.64  ? 503  TYR A CA  1 
ATOM   3876 C C   . TYR A 1 502 ? 15.493  -46.330 20.558  1.00 35.81  ? 503  TYR A C   1 
ATOM   3877 O O   . TYR A 1 502 ? 15.774  -45.190 20.903  1.00 34.54  ? 503  TYR A O   1 
ATOM   3878 C CB  . TYR A 1 502 ? 13.415  -46.939 21.802  1.00 36.08  ? 503  TYR A CB  1 
ATOM   3879 C CG  . TYR A 1 502 ? 12.526  -46.966 20.562  1.00 36.14  ? 503  TYR A CG  1 
ATOM   3880 C CD1 . TYR A 1 502 ? 12.407  -45.848 19.739  1.00 36.67  ? 503  TYR A CD1 1 
ATOM   3881 C CD2 . TYR A 1 502 ? 11.794  -48.105 20.238  1.00 28.56  ? 503  TYR A CD2 1 
ATOM   3882 C CE1 . TYR A 1 502 ? 11.593  -45.860 18.602  1.00 28.81  ? 503  TYR A CE1 1 
ATOM   3883 C CE2 . TYR A 1 502 ? 10.967  -48.129 19.105  1.00 32.98  ? 503  TYR A CE2 1 
ATOM   3884 C CZ  . TYR A 1 502 ? 10.874  -47.000 18.301  1.00 34.87  ? 503  TYR A CZ  1 
ATOM   3885 O OH  . TYR A 1 502 ? 10.061  -47.006 17.188  1.00 36.50  ? 503  TYR A OH  1 
ATOM   3886 N N   . THR A 1 503 ? 15.672  -46.762 19.314  1.00 32.70  ? 504  THR A N   1 
ATOM   3887 C CA  . THR A 1 503 ? 16.234  -45.884 18.280  1.00 38.46  ? 504  THR A CA  1 
ATOM   3888 C C   . THR A 1 503 ? 15.395  -45.981 17.005  1.00 40.84  ? 504  THR A C   1 
ATOM   3889 O O   . THR A 1 503 ? 14.726  -47.001 16.769  1.00 37.15  ? 504  THR A O   1 
ATOM   3890 C CB  . THR A 1 503 ? 17.707  -46.235 17.972  1.00 41.64  ? 504  THR A CB  1 
ATOM   3891 O OG1 . THR A 1 503 ? 17.791  -47.615 17.621  1.00 43.95  ? 504  THR A OG1 1 
ATOM   3892 C CG2 . THR A 1 503 ? 18.591  -46.004 19.214  1.00 35.76  ? 504  THR A CG2 1 
ATOM   3893 N N   . ALA A 1 504 ? 15.395  -44.915 16.201  1.00 38.48  ? 505  ALA A N   1 
ATOM   3894 C CA  . ALA A 1 504 ? 14.570  -44.889 14.979  1.00 44.76  ? 505  ALA A CA  1 
ATOM   3895 C C   . ALA A 1 504 ? 14.918  -46.044 14.051  1.00 40.24  ? 505  ALA A C   1 
ATOM   3896 O O   . ALA A 1 504 ? 14.051  -46.558 13.340  1.00 40.69  ? 505  ALA A O   1 
ATOM   3897 C CB  . ALA A 1 504 ? 14.727  -43.572 14.241  1.00 43.95  ? 505  ALA A CB  1 
ATOM   3898 N N   . GLY A 1 505 ? 16.182  -46.470 14.077  1.00 43.36  ? 506  GLY A N   1 
ATOM   3899 C CA  . GLY A 1 505 ? 16.617  -47.599 13.262  1.00 37.47  ? 506  GLY A CA  1 
ATOM   3900 C C   . GLY A 1 505 ? 16.274  -48.959 13.832  1.00 40.33  ? 506  GLY A C   1 
ATOM   3901 O O   . GLY A 1 505 ? 15.430  -49.672 13.300  1.00 40.42  ? 506  GLY A O   1 
ATOM   3902 N N   . ALA A 1 506 ? 16.920  -49.330 14.933  1.00 39.14  ? 507  ALA A N   1 
ATOM   3903 C CA  . ALA A 1 506 ? 16.758  -50.675 15.446  1.00 36.41  ? 507  ALA A CA  1 
ATOM   3904 C C   . ALA A 1 506 ? 15.402  -50.850 16.128  1.00 39.42  ? 507  ALA A C   1 
ATOM   3905 O O   . ALA A 1 506 ? 14.911  -51.973 16.220  1.00 39.22  ? 507  ALA A O   1 
ATOM   3906 C CB  . ALA A 1 506 ? 17.902  -51.024 16.401  1.00 35.00  ? 507  ALA A CB  1 
ATOM   3907 N N   . GLN A 1 507 ? 14.802  -49.749 16.601  1.00 37.97  ? 508  GLN A N   1 
ATOM   3908 C CA  . GLN A 1 507 ? 13.449  -49.777 17.198  1.00 33.76  ? 508  GLN A CA  1 
ATOM   3909 C C   . GLN A 1 507 ? 13.254  -50.820 18.308  1.00 39.76  ? 508  GLN A C   1 
ATOM   3910 O O   . GLN A 1 507 ? 12.208  -51.479 18.394  1.00 35.83  ? 508  GLN A O   1 
ATOM   3911 C CB  . GLN A 1 507 ? 12.403  -50.013 16.098  1.00 33.73  ? 508  GLN A CB  1 
ATOM   3912 C CG  . GLN A 1 507 ? 12.400  -48.921 15.021  1.00 39.49  ? 508  GLN A CG  1 
ATOM   3913 C CD  . GLN A 1 507 ? 11.671  -49.337 13.743  1.00 45.33  ? 508  GLN A CD  1 
ATOM   3914 O OE1 . GLN A 1 507 ? 10.462  -49.575 13.745  1.00 35.14  ? 508  GLN A OE1 1 
ATOM   3915 N NE2 . GLN A 1 507 ? 12.416  -49.438 12.646  1.00 39.80  ? 508  GLN A NE2 1 
ATOM   3916 N N   . GLN A 1 508 ? 14.256  -50.984 19.160  1.00 32.99  ? 509  GLN A N   1 
ATOM   3917 C CA  . GLN A 1 508 ? 14.152  -51.996 20.203  1.00 36.79  ? 509  GLN A CA  1 
ATOM   3918 C C   . GLN A 1 508 ? 13.307  -51.554 21.394  1.00 32.14  ? 509  GLN A C   1 
ATOM   3919 O O   . GLN A 1 508 ? 13.351  -50.400 21.818  1.00 32.93  ? 509  GLN A O   1 
ATOM   3920 C CB  . GLN A 1 508 ? 15.545  -52.390 20.676  1.00 33.45  ? 509  GLN A CB  1 
ATOM   3921 C CG  . GLN A 1 508 ? 16.359  -53.037 19.569  1.00 38.65  ? 509  GLN A CG  1 
ATOM   3922 C CD  . GLN A 1 508 ? 17.781  -53.326 19.996  1.00 43.42  ? 509  GLN A CD  1 
ATOM   3923 O OE1 . GLN A 1 508 ? 18.576  -52.408 20.190  1.00 40.82  ? 509  GLN A OE1 1 
ATOM   3924 N NE2 . GLN A 1 508 ? 18.105  -54.604 20.153  1.00 42.31  ? 509  GLN A NE2 1 
ATOM   3925 N N   . TYR A 1 509 ? 12.539  -52.487 21.932  1.00 32.46  ? 510  TYR A N   1 
ATOM   3926 C CA  . TYR A 1 509 ? 11.766  -52.241 23.142  1.00 34.82  ? 510  TYR A CA  1 
ATOM   3927 C C   . TYR A 1 509 ? 11.788  -53.527 23.941  1.00 34.86  ? 510  TYR A C   1 
ATOM   3928 O O   . TYR A 1 509 ? 12.235  -54.541 23.416  1.00 34.07  ? 510  TYR A O   1 
ATOM   3929 C CB  . TYR A 1 509 ? 10.346  -51.831 22.813  1.00 33.43  ? 510  TYR A CB  1 
ATOM   3930 C CG  . TYR A 1 509 ? 9.560   -52.913 22.107  1.00 37.32  ? 510  TYR A CG  1 
ATOM   3931 C CD1 . TYR A 1 509 ? 9.604   -53.049 20.708  1.00 33.43  ? 510  TYR A CD1 1 
ATOM   3932 C CD2 . TYR A 1 509 ? 8.776   -53.799 22.827  1.00 36.69  ? 510  TYR A CD2 1 
ATOM   3933 C CE1 . TYR A 1 509 ? 8.865   -54.045 20.064  1.00 33.47  ? 510  TYR A CE1 1 
ATOM   3934 C CE2 . TYR A 1 509 ? 8.057   -54.793 22.195  1.00 42.00  ? 510  TYR A CE2 1 
ATOM   3935 C CZ  . TYR A 1 509 ? 8.092   -54.903 20.819  1.00 40.55  ? 510  TYR A CZ  1 
ATOM   3936 O OH  . TYR A 1 509 ? 7.361   -55.900 20.230  1.00 40.61  ? 510  TYR A OH  1 
ATOM   3937 N N   . VAL A 1 510 ? 11.324  -53.503 25.196  1.00 31.88  ? 511  VAL A N   1 
ATOM   3938 C CA  . VAL A 1 510 ? 11.217  -54.736 25.962  1.00 27.61  ? 511  VAL A CA  1 
ATOM   3939 C C   . VAL A 1 510 ? 9.779   -55.107 26.292  1.00 32.30  ? 511  VAL A C   1 
ATOM   3940 O O   . VAL A 1 510 ? 8.902   -54.252 26.397  1.00 33.65  ? 511  VAL A O   1 
ATOM   3941 C CB  . VAL A 1 510 ? 11.994  -54.663 27.286  1.00 35.32  ? 511  VAL A CB  1 
ATOM   3942 C CG1 . VAL A 1 510 ? 13.445  -54.440 27.007  1.00 34.47  ? 511  VAL A CG1 1 
ATOM   3943 C CG2 . VAL A 1 510 ? 11.401  -53.569 28.224  1.00 31.97  ? 511  VAL A CG2 1 
ATOM   3944 N N   . SER A 1 511 ? 9.541   -56.393 26.494  1.00 33.50  ? 512  SER A N   1 
ATOM   3945 C CA  . SER A 1 511 ? 8.227   -56.811 26.919  1.00 32.24  ? 512  SER A CA  1 
ATOM   3946 C C   . SER A 1 511 ? 8.247   -56.845 28.437  1.00 34.70  ? 512  SER A C   1 
ATOM   3947 O O   . SER A 1 511 ? 9.179   -57.367 29.038  1.00 33.57  ? 512  SER A O   1 
ATOM   3948 C CB  . SER A 1 511 ? 7.857   -58.183 26.347  1.00 35.73  ? 512  SER A CB  1 
ATOM   3949 O OG  . SER A 1 511 ? 8.802   -59.155 26.753  1.00 40.78  ? 512  SER A OG  1 
ATOM   3950 N N   . LEU A 1 512 ? 7.227   -56.270 29.051  1.00 30.97  ? 513  LEU A N   1 
ATOM   3951 C CA  . LEU A 1 512 ? 7.096   -56.310 30.493  1.00 34.66  ? 513  LEU A CA  1 
ATOM   3952 C C   . LEU A 1 512 ? 6.050   -57.364 30.845  1.00 30.42  ? 513  LEU A C   1 
ATOM   3953 O O   . LEU A 1 512 ? 4.878   -57.171 30.580  1.00 33.92  ? 513  LEU A O   1 
ATOM   3954 C CB  . LEU A 1 512 ? 6.721   -54.924 31.026  1.00 29.15  ? 513  LEU A CB  1 
ATOM   3955 C CG  . LEU A 1 512 ? 7.775   -53.826 30.776  1.00 36.34  ? 513  LEU A CG  1 
ATOM   3956 C CD1 . LEU A 1 512 ? 7.342   -52.441 31.353  1.00 28.37  ? 513  LEU A CD1 1 
ATOM   3957 C CD2 . LEU A 1 512 ? 9.132   -54.242 31.353  1.00 31.04  ? 513  LEU A CD2 1 
ATOM   3958 N N   . ASP A 1 513 ? 6.477   -58.501 31.383  1.00 32.36  ? 514  ASP A N   1 
ATOM   3959 C CA  . ASP A 1 513 ? 5.527   -59.499 31.886  1.00 39.69  ? 514  ASP A CA  1 
ATOM   3960 C C   . ASP A 1 513 ? 6.204   -60.284 32.999  1.00 40.63  ? 514  ASP A C   1 
ATOM   3961 O O   . ASP A 1 513 ? 7.246   -59.858 33.508  1.00 36.22  ? 514  ASP A O   1 
ATOM   3962 C CB  . ASP A 1 513 ? 5.005   -60.444 30.766  1.00 35.86  ? 514  ASP A CB  1 
ATOM   3963 C CG  . ASP A 1 513 ? 6.122   -61.152 30.005  1.00 44.17  ? 514  ASP A CG  1 
ATOM   3964 O OD1 . ASP A 1 513 ? 7.258   -61.281 30.523  1.00 46.88  ? 514  ASP A OD1 1 
ATOM   3965 O OD2 . ASP A 1 513 ? 5.858   -61.593 28.869  1.00 59.29  ? 514  ASP A OD2 1 
ATOM   3966 N N   . LEU A 1 514 ? 5.631   -61.426 33.365  1.00 36.21  ? 515  LEU A N   1 
ATOM   3967 C CA  . LEU A 1 514 ? 6.184   -62.226 34.463  1.00 43.61  ? 515  LEU A CA  1 
ATOM   3968 C C   . LEU A 1 514 ? 7.515   -62.861 34.138  1.00 46.61  ? 515  LEU A C   1 
ATOM   3969 O O   . LEU A 1 514 ? 8.227   -63.289 35.051  1.00 51.44  ? 515  LEU A O   1 
ATOM   3970 C CB  . LEU A 1 514 ? 5.219   -63.326 34.881  1.00 36.61  ? 515  LEU A CB  1 
ATOM   3971 C CG  . LEU A 1 514 ? 3.869   -62.832 35.355  1.00 37.86  ? 515  LEU A CG  1 
ATOM   3972 C CD1 . LEU A 1 514 ? 3.015   -64.019 35.839  1.00 39.15  ? 515  LEU A CD1 1 
ATOM   3973 C CD2 . LEU A 1 514 ? 4.089   -61.801 36.457  1.00 34.66  ? 515  LEU A CD2 1 
ATOM   3974 N N   . ARG A 1 515 ? 7.852   -62.913 32.851  1.00 43.42  ? 516  ARG A N   1 
ATOM   3975 C CA  . ARG A 1 515 ? 9.130   -63.467 32.381  1.00 44.01  ? 516  ARG A CA  1 
ATOM   3976 C C   . ARG A 1 515 ? 10.205  -62.394 32.430  1.00 44.87  ? 516  ARG A C   1 
ATOM   3977 O O   . ARG A 1 515 ? 9.878   -61.214 32.458  1.00 45.83  ? 516  ARG A O   1 
ATOM   3978 C CB  . ARG A 1 515 ? 9.006   -64.000 30.933  1.00 47.64  ? 516  ARG A CB  1 
ATOM   3979 C CG  . ARG A 1 515 ? 7.914   -65.052 30.687  1.00 54.62  ? 516  ARG A CG  1 
ATOM   3980 C CD  . ARG A 1 515 ? 7.793   -65.349 29.187  1.00 58.48  ? 516  ARG A CD  1 
ATOM   3981 N NE  . ARG A 1 515 ? 7.686   -64.098 28.426  1.00 59.38  ? 516  ARG A NE  1 
ATOM   3982 C CZ  . ARG A 1 515 ? 8.437   -63.762 27.376  1.00 64.64  ? 516  ARG A CZ  1 
ATOM   3983 N NH1 . ARG A 1 515 ? 9.363   -64.598 26.910  1.00 72.25  ? 516  ARG A NH1 1 
ATOM   3984 N NH2 . ARG A 1 515 ? 8.252   -62.586 26.778  1.00 56.78  ? 516  ARG A NH2 1 
ATOM   3985 N N   . PRO A 1 516 ? 11.495  -62.790 32.420  1.00 47.28  ? 517  PRO A N   1 
ATOM   3986 C CA  . PRO A 1 516 ? 12.539  -61.762 32.314  1.00 42.45  ? 517  PRO A CA  1 
ATOM   3987 C C   . PRO A 1 516 ? 12.390  -60.945 31.036  1.00 43.80  ? 517  PRO A C   1 
ATOM   3988 O O   . PRO A 1 516 ? 11.800  -61.459 30.084  1.00 43.74  ? 517  PRO A O   1 
ATOM   3989 C CB  . PRO A 1 516 ? 13.839  -62.570 32.281  1.00 47.90  ? 517  PRO A CB  1 
ATOM   3990 C CG  . PRO A 1 516 ? 13.482  -63.885 32.936  1.00 48.89  ? 517  PRO A CG  1 
ATOM   3991 C CD  . PRO A 1 516 ? 12.062  -64.148 32.545  1.00 43.18  ? 517  PRO A CD  1 
ATOM   3992 N N   . LEU A 1 517 ? 12.899  -59.710 31.035  1.00 36.54  ? 518  LEU A N   1 
ATOM   3993 C CA  . LEU A 1 517 ? 12.821  -58.827 29.880  1.00 39.52  ? 518  LEU A CA  1 
ATOM   3994 C C   . LEU A 1 517 ? 13.187  -59.576 28.618  1.00 41.35  ? 518  LEU A C   1 
ATOM   3995 O O   . LEU A 1 517 ? 14.154  -60.338 28.594  1.00 42.99  ? 518  LEU A O   1 
ATOM   3996 C CB  . LEU A 1 517 ? 13.760  -57.633 30.021  1.00 39.04  ? 518  LEU A CB  1 
ATOM   3997 C CG  . LEU A 1 517 ? 13.567  -56.638 31.156  1.00 47.63  ? 518  LEU A CG  1 
ATOM   3998 C CD1 . LEU A 1 517 ? 14.633  -55.561 31.046  1.00 33.11  ? 518  LEU A CD1 1 
ATOM   3999 C CD2 . LEU A 1 517 ? 12.170  -56.050 31.078  1.00 38.31  ? 518  LEU A CD2 1 
ATOM   4000 N N   . GLU A 1 518 ? 12.414  -59.351 27.570  1.00 48.10  ? 519  GLU A N   1 
ATOM   4001 C CA  . GLU A 1 518 ? 12.751  -59.867 26.262  1.00 43.58  ? 519  GLU A CA  1 
ATOM   4002 C C   . GLU A 1 518 ? 12.831  -58.675 25.323  1.00 42.86  ? 519  GLU A C   1 
ATOM   4003 O O   . GLU A 1 518 ? 11.881  -57.902 25.229  1.00 37.89  ? 519  GLU A O   1 
ATOM   4004 C CB  . GLU A 1 518 ? 11.711  -60.886 25.799  1.00 43.26  ? 519  GLU A CB  1 
ATOM   4005 C CG  . GLU A 1 518 ? 11.928  -61.399 24.364  1.00 54.15  ? 519  GLU A CG  1 
ATOM   4006 C CD  . GLU A 1 518 ? 10.869  -62.414 23.940  1.00 66.23  ? 519  GLU A CD  1 
ATOM   4007 O OE1 . GLU A 1 518 ? 9.753   -61.991 23.565  1.00 66.47  ? 519  GLU A OE1 1 
ATOM   4008 O OE2 . GLU A 1 518 ? 11.145  -63.634 23.992  1.00 83.06  ? 519  GLU A OE2 1 
ATOM   4009 N N   . VAL A 1 519 ? 13.969  -58.511 24.652  1.00 38.01  ? 520  VAL A N   1 
ATOM   4010 C CA  . VAL A 1 519 ? 14.141  -57.436 23.684  1.00 37.28  ? 520  VAL A CA  1 
ATOM   4011 C C   . VAL A 1 519 ? 13.527  -57.786 22.311  1.00 43.86  ? 520  VAL A C   1 
ATOM   4012 O O   . VAL A 1 519 ? 13.760  -58.866 21.784  1.00 42.08  ? 520  VAL A O   1 
ATOM   4013 C CB  . VAL A 1 519 ? 15.626  -57.109 23.516  1.00 38.65  ? 520  VAL A CB  1 
ATOM   4014 C CG1 . VAL A 1 519 ? 15.810  -55.939 22.565  1.00 37.40  ? 520  VAL A CG1 1 
ATOM   4015 C CG2 . VAL A 1 519 ? 16.237  -56.807 24.879  1.00 36.66  ? 520  VAL A CG2 1 
ATOM   4016 N N   . ARG A 1 520 ? 12.714  -56.885 21.760  1.00 41.22  ? 521  ARG A N   1 
ATOM   4017 C CA  . ARG A 1 520 ? 12.132  -57.072 20.431  1.00 38.15  ? 521  ARG A CA  1 
ATOM   4018 C C   . ARG A 1 520 ? 12.319  -55.826 19.605  1.00 40.70  ? 521  ARG A C   1 
ATOM   4019 O O   . ARG A 1 520 ? 12.792  -54.817 20.125  1.00 36.92  ? 521  ARG A O   1 
ATOM   4020 C CB  . ARG A 1 520 ? 10.653  -57.410 20.512  1.00 36.83  ? 521  ARG A CB  1 
ATOM   4021 C CG  . ARG A 1 520 ? 10.352  -58.474 21.516  1.00 40.43  ? 521  ARG A CG  1 
ATOM   4022 C CD  . ARG A 1 520 ? 8.954   -58.968 21.321  1.00 47.45  ? 521  ARG A CD  1 
ATOM   4023 N NE  . ARG A 1 520 ? 8.629   -59.942 22.340  1.00 43.72  ? 521  ARG A NE  1 
ATOM   4024 C CZ  . ARG A 1 520 ? 7.500   -59.939 23.033  1.00 49.87  ? 521  ARG A CZ  1 
ATOM   4025 N NH1 . ARG A 1 520 ? 6.585   -59.005 22.790  1.00 46.13  ? 521  ARG A NH1 1 
ATOM   4026 N NH2 . ARG A 1 520 ? 7.296   -60.865 23.961  1.00 38.99  ? 521  ARG A NH2 1 
ATOM   4027 N N   . ARG A 1 521 ? 11.972  -55.908 18.317  1.00 37.71  ? 522  ARG A N   1 
ATOM   4028 C CA  . ARG A 1 521 ? 12.089  -54.775 17.395  1.00 40.38  ? 522  ARG A CA  1 
ATOM   4029 C C   . ARG A 1 521 ? 10.735  -54.326 16.840  1.00 41.24  ? 522  ARG A C   1 
ATOM   4030 O O   . ARG A 1 521 ? 9.941   -55.143 16.367  1.00 41.22  ? 522  ARG A O   1 
ATOM   4031 C CB  . ARG A 1 521 ? 13.010  -55.109 16.206  1.00 40.88  ? 522  ARG A CB  1 
ATOM   4032 C CG  . ARG A 1 521 ? 14.474  -55.401 16.534  1.00 50.42  ? 522  ARG A CG  1 
ATOM   4033 C CD  . ARG A 1 521 ? 15.330  -55.430 15.253  1.00 38.50  ? 522  ARG A CD  1 
ATOM   4034 N NE  . ARG A 1 521 ? 15.355  -54.114 14.600  1.00 46.93  ? 522  ARG A NE  1 
ATOM   4035 C CZ  . ARG A 1 521 ? 15.200  -53.913 13.293  1.00 49.04  ? 522  ARG A CZ  1 
ATOM   4036 N NH1 . ARG A 1 521 ? 15.035  -54.949 12.490  1.00 50.72  ? 522  ARG A NH1 1 
ATOM   4037 N NH2 . ARG A 1 521 ? 15.213  -52.675 12.794  1.00 42.43  ? 522  ARG A NH2 1 
ATOM   4038 N N   . GLY A 1 522 ? 10.497  -53.018 16.874  1.00 38.23  ? 523  GLY A N   1 
ATOM   4039 C CA  . GLY A 1 522 ? 9.372   -52.405 16.185  1.00 40.33  ? 523  GLY A CA  1 
ATOM   4040 C C   . GLY A 1 522 ? 8.072   -52.299 16.954  1.00 37.69  ? 523  GLY A C   1 
ATOM   4041 O O   . GLY A 1 522 ? 7.503   -53.308 17.346  1.00 38.99  ? 523  GLY A O   1 
ATOM   4042 N N   . LEU A 1 523 ? 7.588   -51.076 17.156  1.00 36.63  ? 524  LEU A N   1 
ATOM   4043 C CA  . LEU A 1 523 ? 6.283   -50.886 17.786  1.00 39.62  ? 524  LEU A CA  1 
ATOM   4044 C C   . LEU A 1 523 ? 5.214   -50.911 16.702  1.00 36.41  ? 524  LEU A C   1 
ATOM   4045 O O   . LEU A 1 523 ? 4.842   -49.853 16.163  1.00 36.83  ? 524  LEU A O   1 
ATOM   4046 C CB  . LEU A 1 523 ? 6.235   -49.566 18.575  1.00 30.56  ? 524  LEU A CB  1 
ATOM   4047 C CG  . LEU A 1 523 ? 7.154   -49.489 19.784  1.00 33.67  ? 524  LEU A CG  1 
ATOM   4048 C CD1 . LEU A 1 523 ? 7.289   -48.048 20.309  1.00 34.53  ? 524  LEU A CD1 1 
ATOM   4049 C CD2 . LEU A 1 523 ? 6.637   -50.426 20.844  1.00 37.65  ? 524  LEU A CD2 1 
ATOM   4050 N N   . ARG A 1 524 ? 4.736   -52.106 16.366  1.00 36.80  ? 525  ARG A N   1 
ATOM   4051 C CA  . ARG A 1 524 ? 3.840   -52.266 15.216  1.00 42.42  ? 525  ARG A CA  1 
ATOM   4052 C C   . ARG A 1 524 ? 4.351   -51.473 14.002  1.00 36.89  ? 525  ARG A C   1 
ATOM   4053 O O   . ARG A 1 524 ? 3.636   -50.615 13.452  1.00 31.97  ? 525  ARG A O   1 
ATOM   4054 C CB  . ARG A 1 524 ? 2.425   -51.812 15.593  1.00 36.10  ? 525  ARG A CB  1 
ATOM   4055 C CG  . ARG A 1 524 ? 1.918   -52.401 16.899  1.00 42.60  ? 525  ARG A CG  1 
ATOM   4056 C CD  . ARG A 1 524 ? 0.904   -53.504 16.704  1.00 46.48  ? 525  ARG A CD  1 
ATOM   4057 N NE  . ARG A 1 524 ? -0.134  -53.165 15.723  1.00 62.22  ? 525  ARG A NE  1 
ATOM   4058 C CZ  . ARG A 1 524 ? -0.695  -54.049 14.889  1.00 54.04  ? 525  ARG A CZ  1 
ATOM   4059 N NH1 . ARG A 1 524 ? -0.327  -55.328 14.922  1.00 50.72  ? 525  ARG A NH1 1 
ATOM   4060 N NH2 . ARG A 1 524 ? -1.628  -53.657 14.025  1.00 37.17  ? 525  ARG A NH2 1 
ATOM   4061 N N   . ALA A 1 525 ? 5.602   -51.709 13.615  1.00 34.77  ? 526  ALA A N   1 
ATOM   4062 C CA  . ALA A 1 525 ? 6.241   -50.890 12.576  1.00 38.72  ? 526  ALA A CA  1 
ATOM   4063 C C   . ALA A 1 525 ? 5.496   -50.877 11.230  1.00 37.31  ? 526  ALA A C   1 
ATOM   4064 O O   . ALA A 1 525 ? 5.326   -49.808 10.625  1.00 34.87  ? 526  ALA A O   1 
ATOM   4065 C CB  . ALA A 1 525 ? 7.687   -51.335 12.358  1.00 42.04  ? 526  ALA A CB  1 
ATOM   4066 N N   . GLN A 1 526 ? 5.060   -52.042 10.758  1.00 38.17  ? 527  GLN A N   1 
ATOM   4067 C CA  . GLN A 1 526 ? 4.325   -52.102 9.493   1.00 37.66  ? 527  GLN A CA  1 
ATOM   4068 C C   . GLN A 1 526 ? 3.036   -51.300 9.578   1.00 33.14  ? 527  GLN A C   1 
ATOM   4069 O O   . GLN A 1 526 ? 2.737   -50.493 8.705   1.00 37.76  ? 527  GLN A O   1 
ATOM   4070 C CB  . GLN A 1 526 ? 4.003   -53.548 9.102   1.00 40.76  ? 527  GLN A CB  1 
ATOM   4071 C CG  . GLN A 1 526 ? 5.175   -54.316 8.546   1.00 42.55  ? 527  GLN A CG  1 
ATOM   4072 C CD  . GLN A 1 526 ? 5.877   -53.580 7.406   1.00 46.54  ? 527  GLN A CD  1 
ATOM   4073 O OE1 . GLN A 1 526 ? 6.991   -53.100 7.578   1.00 45.66  ? 527  GLN A OE1 1 
ATOM   4074 N NE2 . GLN A 1 526 ? 5.229   -53.494 6.237   1.00 50.32  ? 527  GLN A NE2 1 
ATOM   4075 N N   . ALA A 1 527 ? 2.279   -51.500 10.650  1.00 36.82  ? 528  ALA A N   1 
ATOM   4076 C CA  . ALA A 1 527 ? 1.012   -50.786 10.785  1.00 35.10  ? 528  ALA A CA  1 
ATOM   4077 C C   . ALA A 1 527 ? 1.247   -49.289 10.961  1.00 31.91  ? 528  ALA A C   1 
ATOM   4078 O O   . ALA A 1 527 ? 0.557   -48.484 10.363  1.00 36.05  ? 528  ALA A O   1 
ATOM   4079 C CB  . ALA A 1 527 ? 0.195   -51.353 11.960  1.00 35.51  ? 528  ALA A CB  1 
ATOM   4080 N N   . CYS A 1 528 ? 2.222   -48.908 11.782  1.00 34.90  ? 529  CYS A N   1 
ATOM   4081 C CA  . CYS A 1 528 ? 2.459   -47.481 12.048  1.00 30.86  ? 529  CYS A CA  1 
ATOM   4082 C C   . CYS A 1 528 ? 3.073   -46.709 10.862  1.00 37.15  ? 529  CYS A C   1 
ATOM   4083 O O   . CYS A 1 528 ? 2.900   -45.472 10.739  1.00 31.79  ? 529  CYS A O   1 
ATOM   4084 C CB  . CYS A 1 528 ? 3.325   -47.339 13.311  1.00 32.58  ? 529  CYS A CB  1 
ATOM   4085 S SG  . CYS A 1 528 ? 2.392   -47.896 14.808  1.00 33.81  ? 529  CYS A SG  1 
ATOM   4086 N N   . ALA A 1 529 ? 3.749   -47.416 9.955   1.00 34.82  ? 530  ALA A N   1 
ATOM   4087 C CA  . ALA A 1 529 ? 4.147   -46.759 8.699   1.00 32.52  ? 530  ALA A CA  1 
ATOM   4088 C C   . ALA A 1 529 ? 2.902   -46.241 8.000   1.00 31.56  ? 530  ALA A C   1 
ATOM   4089 O O   . ALA A 1 529 ? 2.888   -45.123 7.473   1.00 36.27  ? 530  ALA A O   1 
ATOM   4090 C CB  . ALA A 1 529 ? 4.913   -47.704 7.806   1.00 31.83  ? 530  ALA A CB  1 
ATOM   4091 N N   . PHE A 1 530 ? 1.832   -47.030 8.042   1.00 34.42  ? 531  PHE A N   1 
ATOM   4092 C CA  . PHE A 1 530 ? 0.577   -46.602 7.430   1.00 32.72  ? 531  PHE A CA  1 
ATOM   4093 C C   . PHE A 1 530 ? 0.090   -45.295 8.067   1.00 34.74  ? 531  PHE A C   1 
ATOM   4094 O O   . PHE A 1 530 ? -0.086  -44.301 7.383   1.00 33.10  ? 531  PHE A O   1 
ATOM   4095 C CB  . PHE A 1 530 ? -0.516  -47.700 7.557   1.00 32.52  ? 531  PHE A CB  1 
ATOM   4096 C CG  . PHE A 1 530 ? -1.889  -47.199 7.210   1.00 41.10  ? 531  PHE A CG  1 
ATOM   4097 C CD1 . PHE A 1 530 ? -2.237  -46.962 5.886   1.00 42.77  ? 531  PHE A CD1 1 
ATOM   4098 C CD2 . PHE A 1 530 ? -2.809  -46.900 8.202   1.00 37.47  ? 531  PHE A CD2 1 
ATOM   4099 C CE1 . PHE A 1 530 ? -3.488  -46.469 5.550   1.00 40.93  ? 531  PHE A CE1 1 
ATOM   4100 C CE2 . PHE A 1 530 ? -4.063  -46.394 7.875   1.00 44.82  ? 531  PHE A CE2 1 
ATOM   4101 C CZ  . PHE A 1 530 ? -4.404  -46.185 6.542   1.00 46.46  ? 531  PHE A CZ  1 
ATOM   4102 N N   . TRP A 1 531 ? -0.120  -45.299 9.387   1.00 30.00  ? 532  TRP A N   1 
ATOM   4103 C CA  . TRP A 1 531 ? -0.653  -44.118 10.066  1.00 31.14  ? 532  TRP A CA  1 
ATOM   4104 C C   . TRP A 1 531 ? 0.307   -42.940 10.074  1.00 32.90  ? 532  TRP A C   1 
ATOM   4105 O O   . TRP A 1 531 ? -0.111  -41.785 9.987   1.00 35.87  ? 532  TRP A O   1 
ATOM   4106 C CB  . TRP A 1 531 ? -1.015  -44.462 11.509  1.00 30.77  ? 532  TRP A CB  1 
ATOM   4107 C CG  . TRP A 1 531 ? -2.049  -45.513 11.586  1.00 29.35  ? 532  TRP A CG  1 
ATOM   4108 C CD1 . TRP A 1 531 ? -1.867  -46.845 11.851  1.00 27.24  ? 532  TRP A CD1 1 
ATOM   4109 C CD2 . TRP A 1 531 ? -3.442  -45.326 11.380  1.00 27.54  ? 532  TRP A CD2 1 
ATOM   4110 N NE1 . TRP A 1 531 ? -3.080  -47.496 11.843  1.00 27.39  ? 532  TRP A NE1 1 
ATOM   4111 C CE2 . TRP A 1 531 ? -4.063  -46.584 11.553  1.00 28.42  ? 532  TRP A CE2 1 
ATOM   4112 C CE3 . TRP A 1 531 ? -4.232  -44.212 11.054  1.00 29.34  ? 532  TRP A CE3 1 
ATOM   4113 C CZ2 . TRP A 1 531 ? -5.443  -46.757 11.424  1.00 31.90  ? 532  TRP A CZ2 1 
ATOM   4114 C CZ3 . TRP A 1 531 ? -5.598  -44.384 10.915  1.00 27.63  ? 532  TRP A CZ3 1 
ATOM   4115 C CH2 . TRP A 1 531 ? -6.192  -45.645 11.106  1.00 28.44  ? 532  TRP A CH2 1 
ATOM   4116 N N   . ASN A 1 532 ? 1.598   -43.223 10.188  1.00 30.91  ? 533  ASN A N   1 
ATOM   4117 C CA  . ASN A 1 532 ? 2.555   -42.144 10.384  1.00 34.51  ? 533  ASN A CA  1 
ATOM   4118 C C   . ASN A 1 532 ? 3.171   -41.623 9.089   1.00 44.49  ? 533  ASN A C   1 
ATOM   4119 O O   . ASN A 1 532 ? 3.525   -40.452 9.012   1.00 43.24  ? 533  ASN A O   1 
ATOM   4120 C CB  . ASN A 1 532 ? 3.655   -42.598 11.357  1.00 33.61  ? 533  ASN A CB  1 
ATOM   4121 C CG  . ASN A 1 532 ? 3.127   -42.758 12.784  1.00 35.36  ? 533  ASN A CG  1 
ATOM   4122 O OD1 . ASN A 1 532 ? 2.130   -42.138 13.135  1.00 36.89  ? 533  ASN A OD1 1 
ATOM   4123 N ND2 . ASN A 1 532 ? 3.774   -43.607 13.594  1.00 27.24  ? 533  ASN A ND2 1 
ATOM   4124 N N   . ARG A 1 533 ? 3.276   -42.471 8.065   1.00 36.15  ? 534  ARG A N   1 
ATOM   4125 C CA  . ARG A 1 533 ? 3.914   -42.052 6.812   1.00 48.19  ? 534  ARG A CA  1 
ATOM   4126 C C   . ARG A 1 533 ? 2.940   -41.843 5.649   1.00 46.15  ? 534  ARG A C   1 
ATOM   4127 O O   . ARG A 1 533 ? 2.978   -40.807 4.996   1.00 51.95  ? 534  ARG A O   1 
ATOM   4128 C CB  . ARG A 1 533 ? 4.992   -43.060 6.408   1.00 41.98  ? 534  ARG A CB  1 
ATOM   4129 C CG  . ARG A 1 533 ? 6.163   -43.083 7.395   1.00 40.22  ? 534  ARG A CG  1 
ATOM   4130 C CD  . ARG A 1 533 ? 7.126   -44.252 7.163   1.00 45.95  ? 534  ARG A CD  1 
ATOM   4131 N NE  . ARG A 1 533 ? 8.003   -44.431 8.320   1.00 53.30  ? 534  ARG A NE  1 
ATOM   4132 C CZ  . ARG A 1 533 ? 9.154   -43.784 8.506   1.00 52.83  ? 534  ARG A CZ  1 
ATOM   4133 N NH1 . ARG A 1 533 ? 9.596   -42.916 7.597   1.00 45.36  ? 534  ARG A NH1 1 
ATOM   4134 N NH2 . ARG A 1 533 ? 9.864   -44.012 9.607   1.00 57.45  ? 534  ARG A NH2 1 
ATOM   4135 N N   . PHE A 1 534 ? 2.053   -42.797 5.393   1.00 52.03  ? 535  PHE A N   1 
ATOM   4136 C CA  . PHE A 1 534 ? 1.186   -42.661 4.230   1.00 48.01  ? 535  PHE A CA  1 
ATOM   4137 C C   . PHE A 1 534 ? -0.045  -41.774 4.436   1.00 53.54  ? 535  PHE A C   1 
ATOM   4138 O O   . PHE A 1 534 ? -0.271  -40.828 3.688   1.00 48.00  ? 535  PHE A O   1 
ATOM   4139 C CB  . PHE A 1 534 ? 0.710   -44.016 3.733   1.00 44.16  ? 535  PHE A CB  1 
ATOM   4140 C CG  . PHE A 1 534 ? -0.203  -43.898 2.549   1.00 46.84  ? 535  PHE A CG  1 
ATOM   4141 C CD1 . PHE A 1 534 ? 0.285   -43.416 1.338   1.00 44.83  ? 535  PHE A CD1 1 
ATOM   4142 C CD2 . PHE A 1 534 ? -1.551  -44.210 2.650   1.00 50.06  ? 535  PHE A CD2 1 
ATOM   4143 C CE1 . PHE A 1 534 ? -0.547  -43.265 0.238   1.00 39.21  ? 535  PHE A CE1 1 
ATOM   4144 C CE2 . PHE A 1 534 ? -2.397  -44.066 1.551   1.00 51.69  ? 535  PHE A CE2 1 
ATOM   4145 C CZ  . PHE A 1 534 ? -1.894  -43.585 0.345   1.00 45.21  ? 535  PHE A CZ  1 
ATOM   4146 N N   . LEU A 1 535 ? -0.852  -42.092 5.434   1.00 50.36  ? 536  LEU A N   1 
ATOM   4147 C CA  . LEU A 1 535 ? -2.113  -41.382 5.632   1.00 51.07  ? 536  LEU A CA  1 
ATOM   4148 C C   . LEU A 1 535 ? -2.009  -39.849 5.648   1.00 59.20  ? 536  LEU A C   1 
ATOM   4149 O O   . LEU A 1 535 ? -2.882  -39.189 5.087   1.00 60.94  ? 536  LEU A O   1 
ATOM   4150 C CB  . LEU A 1 535 ? -2.779  -41.855 6.921   1.00 46.15  ? 536  LEU A CB  1 
ATOM   4151 C CG  . LEU A 1 535 ? -4.302  -41.853 6.828   1.00 56.79  ? 536  LEU A CG  1 
ATOM   4152 C CD1 . LEU A 1 535 ? -4.725  -42.723 5.653   1.00 64.50  ? 536  LEU A CD1 1 
ATOM   4153 C CD2 . LEU A 1 535 ? -4.876  -42.400 8.102   1.00 54.24  ? 536  LEU A CD2 1 
ATOM   4154 N N   . PRO A 1 536 ? -0.959  -39.273 6.285   1.00 59.81  ? 537  PRO A N   1 
ATOM   4155 C CA  . PRO A 1 536 ? -0.821  -37.809 6.190   1.00 56.91  ? 537  PRO A CA  1 
ATOM   4156 C C   . PRO A 1 536 ? -0.738  -37.278 4.742   1.00 60.68  ? 537  PRO A C   1 
ATOM   4157 O O   . PRO A 1 536 ? -1.346  -36.246 4.438   1.00 59.84  ? 537  PRO A O   1 
ATOM   4158 C CB  . PRO A 1 536 ? 0.492   -37.533 6.943   1.00 55.29  ? 537  PRO A CB  1 
ATOM   4159 C CG  . PRO A 1 536 ? 0.611   -38.654 7.928   1.00 48.09  ? 537  PRO A CG  1 
ATOM   4160 C CD  . PRO A 1 536 ? 0.032   -39.854 7.219   1.00 51.94  ? 537  PRO A CD  1 
ATOM   4161 N N   . LYS A 1 537 ? 0.004   -37.974 3.877   1.00 57.71  ? 538  LYS A N   1 
ATOM   4162 C CA  . LYS A 1 537 ? 0.128   -37.609 2.459   1.00 55.25  ? 538  LYS A CA  1 
ATOM   4163 C C   . LYS A 1 537 ? -1.222  -37.617 1.745   1.00 63.44  ? 538  LYS A C   1 
ATOM   4164 O O   . LYS A 1 537 ? -1.504  -36.775 0.889   1.00 65.42  ? 538  LYS A O   1 
ATOM   4165 C CB  . LYS A 1 537 ? 1.090   -38.565 1.749   1.00 57.76  ? 538  LYS A CB  1 
ATOM   4166 C CG  . LYS A 1 537 ? 2.509   -38.515 2.275   1.00 47.29  ? 538  LYS A CG  1 
ATOM   4167 C CD  . LYS A 1 537 ? 3.444   -39.370 1.434   1.00 56.76  ? 538  LYS A CD  1 
ATOM   4168 C CE  . LYS A 1 537 ? 4.903   -38.973 1.687   1.00 64.94  ? 538  LYS A CE  1 
ATOM   4169 N NZ  . LYS A 1 537 ? 5.215   -38.907 3.145   1.00 63.77  ? 538  LYS A NZ  1 
ATOM   4170 N N   . LEU A 1 538 ? -2.044  -38.593 2.107   1.00 66.95  ? 539  LEU A N   1 
ATOM   4171 C CA  . LEU A 1 538 ? -3.373  -38.755 1.553   1.00 60.64  ? 539  LEU A CA  1 
ATOM   4172 C C   . LEU A 1 538 ? -4.269  -37.575 1.920   1.00 71.86  ? 539  LEU A C   1 
ATOM   4173 O O   . LEU A 1 538 ? -4.822  -36.906 1.039   1.00 77.81  ? 539  LEU A O   1 
ATOM   4174 C CB  . LEU A 1 538 ? -3.968  -40.064 2.054   1.00 64.44  ? 539  LEU A CB  1 
ATOM   4175 C CG  . LEU A 1 538 ? -5.361  -40.516 1.648   1.00 60.81  ? 539  LEU A CG  1 
ATOM   4176 C CD1 . LEU A 1 538 ? -5.397  -42.021 1.759   1.00 61.40  ? 539  LEU A CD1 1 
ATOM   4177 C CD2 . LEU A 1 538 ? -6.405  -39.905 2.558   1.00 69.10  ? 539  LEU A CD2 1 
ATOM   4178 N N   . LEU A 1 539 ? -4.412  -37.321 3.221   1.00 74.22  ? 540  LEU A N   1 
ATOM   4179 C CA  . LEU A 1 539 ? -5.251  -36.222 3.709   1.00 76.56  ? 540  LEU A CA  1 
ATOM   4180 C C   . LEU A 1 539 ? -4.791  -34.856 3.156   1.00 78.34  ? 540  LEU A C   1 
ATOM   4181 O O   . LEU A 1 539 ? -5.562  -33.894 3.164   1.00 87.09  ? 540  LEU A O   1 
ATOM   4182 C CB  . LEU A 1 539 ? -5.288  -36.215 5.252   1.00 68.97  ? 540  LEU A CB  1 
ATOM   4183 C CG  . LEU A 1 539 ? -5.933  -37.465 5.899   1.00 74.78  ? 540  LEU A CG  1 
ATOM   4184 C CD1 . LEU A 1 539 ? -5.784  -37.500 7.418   1.00 69.86  ? 540  LEU A CD1 1 
ATOM   4185 C CD2 . LEU A 1 539 ? -7.410  -37.648 5.520   1.00 64.13  ? 540  LEU A CD2 1 
ATOM   4186 N N   . SER A 1 540 ? -3.553  -34.779 2.659   1.00 75.18  ? 541  SER A N   1 
ATOM   4187 C CA  . SER A 1 540 ? -3.090  -33.609 1.906   1.00 81.25  ? 541  SER A CA  1 
ATOM   4188 C C   . SER A 1 540 ? -3.740  -33.542 0.528   1.00 93.98  ? 541  SER A C   1 
ATOM   4189 O O   . SER A 1 540 ? -4.714  -32.808 0.315   1.00 99.27  ? 541  SER A O   1 
ATOM   4190 C CB  . SER A 1 540 ? -1.568  -33.626 1.733   1.00 73.77  ? 541  SER A CB  1 
ATOM   4191 O OG  . SER A 1 540 ? -0.908  -33.401 2.961   1.00 87.08  ? 541  SER A OG  1 
ATOM   4192 N N   . ALA A 1 541 ? -3.185  -34.316 -0.403  1.00 90.75  ? 542  ALA A N   1 
ATOM   4193 C CA  . ALA A 1 541 ? -3.634  -34.325 -1.790  1.00 86.30  ? 542  ALA A CA  1 
ATOM   4194 C C   . ALA A 1 541 ? -4.826  -35.260 -1.978  1.00 87.06  ? 542  ALA A C   1 
ATOM   4195 O O   . ALA A 1 541 ? -5.898  -35.040 -1.407  1.00 89.59  ? 542  ALA A O   1 
ATOM   4196 C CB  . ALA A 1 541 ? -2.486  -34.725 -2.711  1.00 85.85  ? 542  ALA A CB  1 
ATOM   4197 N N   . ARG B 1 2   ? 5.852   -90.667 -56.161 1.00 77.56  ? 3    ARG B N   1 
ATOM   4198 C CA  . ARG B 1 2   ? 5.559   -89.294 -56.570 1.00 90.01  ? 3    ARG B CA  1 
ATOM   4199 C C   . ARG B 1 2   ? 5.211   -88.373 -55.379 1.00 83.65  ? 3    ARG B C   1 
ATOM   4200 O O   . ARG B 1 2   ? 6.009   -87.500 -55.019 1.00 82.17  ? 3    ARG B O   1 
ATOM   4201 C CB  . ARG B 1 2   ? 4.419   -89.278 -57.602 1.00 79.20  ? 3    ARG B CB  1 
ATOM   4202 C CG  . ARG B 1 2   ? 4.269   -87.937 -58.314 1.00 84.29  ? 3    ARG B CG  1 
ATOM   4203 C CD  . ARG B 1 2   ? 2.882   -87.756 -58.902 1.00 88.83  ? 3    ARG B CD  1 
ATOM   4204 N NE  . ARG B 1 2   ? 2.803   -88.158 -60.304 1.00 91.87  ? 3    ARG B NE  1 
ATOM   4205 C CZ  . ARG B 1 2   ? 1.906   -89.017 -60.791 1.00 95.46  ? 3    ARG B CZ  1 
ATOM   4206 N NH1 . ARG B 1 2   ? 1.006   -89.577 -59.980 1.00 80.03  ? 3    ARG B NH1 1 
ATOM   4207 N NH2 . ARG B 1 2   ? 1.903   -89.314 -62.094 1.00 81.64  ? 3    ARG B NH2 1 
ATOM   4208 N N   . GLU B 1 3   ? 4.039   -88.578 -54.766 1.00 80.79  ? 4    GLU B N   1 
ATOM   4209 C CA  . GLU B 1 3   ? 3.510   -87.668 -53.732 1.00 76.84  ? 4    GLU B CA  1 
ATOM   4210 C C   . GLU B 1 3   ? 2.930   -88.421 -52.498 1.00 75.95  ? 4    GLU B C   1 
ATOM   4211 O O   . GLU B 1 3   ? 2.468   -89.559 -52.623 1.00 71.70  ? 4    GLU B O   1 
ATOM   4212 C CB  . GLU B 1 3   ? 2.444   -86.751 -54.368 1.00 70.20  ? 4    GLU B CB  1 
ATOM   4213 C CG  . GLU B 1 3   ? 2.084   -85.496 -53.564 1.00 83.26  ? 4    GLU B CG  1 
ATOM   4214 C CD  . GLU B 1 3   ? 2.685   -84.179 -54.109 1.00 76.76  ? 4    GLU B CD  1 
ATOM   4215 O OE1 . GLU B 1 3   ? 3.672   -83.694 -53.505 1.00 61.05  ? 4    GLU B OE1 1 
ATOM   4216 O OE2 . GLU B 1 3   ? 2.152   -83.610 -55.099 1.00 60.89  ? 4    GLU B OE2 1 
ATOM   4217 N N   . ASP B 1 4   ? 2.970   -87.796 -51.313 1.00 75.61  ? 5    ASP B N   1 
ATOM   4218 C CA  . ASP B 1 4   ? 2.446   -88.406 -50.068 1.00 61.95  ? 5    ASP B CA  1 
ATOM   4219 C C   . ASP B 1 4   ? 1.123   -87.765 -49.634 1.00 60.46  ? 5    ASP B C   1 
ATOM   4220 O O   . ASP B 1 4   ? 1.085   -86.610 -49.208 1.00 51.06  ? 5    ASP B O   1 
ATOM   4221 C CB  . ASP B 1 4   ? 3.477   -88.302 -48.942 1.00 50.59  ? 5    ASP B CB  1 
ATOM   4222 C CG  . ASP B 1 4   ? 3.000   -88.924 -47.614 1.00 63.22  ? 5    ASP B CG  1 
ATOM   4223 O OD1 . ASP B 1 4   ? 1.825   -89.335 -47.493 1.00 62.38  ? 5    ASP B OD1 1 
ATOM   4224 O OD2 . ASP B 1 4   ? 3.822   -88.988 -46.667 1.00 48.24  ? 5    ASP B OD2 1 
ATOM   4225 N N   . ALA B 1 5   ? 0.050   -88.548 -49.705 1.00 57.53  ? 6    ALA B N   1 
ATOM   4226 C CA  . ALA B 1 5   ? -1.310  -88.055 -49.497 1.00 57.57  ? 6    ALA B CA  1 
ATOM   4227 C C   . ALA B 1 5   ? -1.539  -87.425 -48.128 1.00 56.74  ? 6    ALA B C   1 
ATOM   4228 O O   . ALA B 1 5   ? -2.420  -86.564 -47.979 1.00 50.94  ? 6    ALA B O   1 
ATOM   4229 C CB  . ALA B 1 5   ? -2.306  -89.182 -49.700 1.00 55.72  ? 6    ALA B CB  1 
ATOM   4230 N N   . GLU B 1 6   ? -0.778  -87.866 -47.128 1.00 49.17  ? 7    GLU B N   1 
ATOM   4231 C CA  . GLU B 1 6   ? -0.953  -87.336 -45.779 1.00 58.31  ? 7    GLU B CA  1 
ATOM   4232 C C   . GLU B 1 6   ? -0.540  -85.873 -45.751 1.00 56.03  ? 7    GLU B C   1 
ATOM   4233 O O   . GLU B 1 6   ? -1.096  -85.085 -44.981 1.00 44.19  ? 7    GLU B O   1 
ATOM   4234 C CB  . GLU B 1 6   ? -0.155  -88.137 -44.750 1.00 57.18  ? 7    GLU B CB  1 
ATOM   4235 C CG  . GLU B 1 6   ? -0.836  -89.450 -44.327 1.00 74.23  ? 7    GLU B CG  1 
ATOM   4236 C CD  . GLU B 1 6   ? -2.262  -89.246 -43.793 1.00 76.72  ? 7    GLU B CD  1 
ATOM   4237 O OE1 . GLU B 1 6   ? -2.480  -88.284 -43.022 1.00 73.75  ? 7    GLU B OE1 1 
ATOM   4238 O OE2 . GLU B 1 6   ? -3.164  -90.044 -44.142 1.00 78.50  ? 7    GLU B OE2 1 
ATOM   4239 N N   . LEU B 1 7   ? 0.405   -85.520 -46.629 1.00 47.01  ? 8    LEU B N   1 
ATOM   4240 C CA  . LEU B 1 7   ? 0.977   -84.181 -46.663 1.00 42.86  ? 8    LEU B CA  1 
ATOM   4241 C C   . LEU B 1 7   ? 0.257   -83.245 -47.602 1.00 39.76  ? 8    LEU B C   1 
ATOM   4242 O O   . LEU B 1 7   ? 0.764   -82.160 -47.891 1.00 39.64  ? 8    LEU B O   1 
ATOM   4243 C CB  . LEU B 1 7   ? 2.446   -84.229 -47.056 1.00 36.53  ? 8    LEU B CB  1 
ATOM   4244 C CG  . LEU B 1 7   ? 3.288   -85.119 -46.156 1.00 42.88  ? 8    LEU B CG  1 
ATOM   4245 C CD1 . LEU B 1 7   ? 4.721   -85.029 -46.595 1.00 35.38  ? 8    LEU B CD1 1 
ATOM   4246 C CD2 . LEU B 1 7   ? 3.132   -84.703 -44.664 1.00 40.32  ? 8    LEU B CD2 1 
ATOM   4247 N N   . LEU B 1 8   ? -0.916  -83.661 -48.073 1.00 38.79  ? 9    LEU B N   1 
ATOM   4248 C CA  . LEU B 1 8   ? -1.706  -82.850 -48.991 1.00 41.29  ? 9    LEU B CA  1 
ATOM   4249 C C   . LEU B 1 8   ? -3.073  -82.558 -48.414 1.00 41.38  ? 9    LEU B C   1 
ATOM   4250 O O   . LEU B 1 8   ? -3.774  -83.462 -47.968 1.00 42.54  ? 9    LEU B O   1 
ATOM   4251 C CB  . LEU B 1 8   ? -1.876  -83.546 -50.348 1.00 40.92  ? 9    LEU B CB  1 
ATOM   4252 C CG  . LEU B 1 8   ? -0.622  -83.724 -51.186 1.00 46.55  ? 9    LEU B CG  1 
ATOM   4253 C CD1 . LEU B 1 8   ? -0.996  -84.532 -52.414 1.00 52.53  ? 9    LEU B CD1 1 
ATOM   4254 C CD2 . LEU B 1 8   ? -0.060  -82.365 -51.595 1.00 44.73  ? 9    LEU B CD2 1 
ATOM   4255 N N   . VAL B 1 9   ? -3.466  -81.294 -48.453 1.00 34.29  ? 10   VAL B N   1 
ATOM   4256 C CA  . VAL B 1 9   ? -4.731  -80.891 -47.879 1.00 39.18  ? 10   VAL B CA  1 
ATOM   4257 C C   . VAL B 1 9   ? -5.314  -79.803 -48.731 1.00 32.00  ? 10   VAL B C   1 
ATOM   4258 O O   . VAL B 1 9   ? -4.584  -78.949 -49.229 1.00 40.23  ? 10   VAL B O   1 
ATOM   4259 C CB  . VAL B 1 9   ? -4.567  -80.362 -46.417 1.00 38.14  ? 10   VAL B CB  1 
ATOM   4260 C CG1 . VAL B 1 9   ? -5.897  -79.795 -45.889 1.00 36.89  ? 10   VAL B CG1 1 
ATOM   4261 C CG2 . VAL B 1 9   ? -4.082  -81.464 -45.500 1.00 38.47  ? 10   VAL B CG2 1 
ATOM   4262 N N   . THR B 1 10  ? -6.627  -79.805 -48.877 1.00 35.64  ? 11   THR B N   1 
ATOM   4263 C CA  . THR B 1 10  ? -7.288  -78.729 -49.578 1.00 39.88  ? 11   THR B CA  1 
ATOM   4264 C C   . THR B 1 10  ? -8.058  -77.914 -48.565 1.00 38.58  ? 11   THR B C   1 
ATOM   4265 O O   . THR B 1 10  ? -8.817  -78.464 -47.763 1.00 39.25  ? 11   THR B O   1 
ATOM   4266 C CB  . THR B 1 10  ? -8.231  -79.265 -50.686 1.00 42.27  ? 11   THR B CB  1 
ATOM   4267 O OG1 . THR B 1 10  ? -7.463  -80.026 -51.630 1.00 44.28  ? 11   THR B OG1 1 
ATOM   4268 C CG2 . THR B 1 10  ? -8.917  -78.126 -51.407 1.00 34.28  ? 11   THR B CG2 1 
ATOM   4269 N N   . VAL B 1 11  ? -7.846  -76.604 -48.593 1.00 39.58  ? 12   VAL B N   1 
ATOM   4270 C CA  . VAL B 1 11  ? -8.575  -75.683 -47.718 1.00 36.87  ? 12   VAL B CA  1 
ATOM   4271 C C   . VAL B 1 11  ? -9.389  -74.791 -48.615 1.00 37.44  ? 12   VAL B C   1 
ATOM   4272 O O   . VAL B 1 11  ? -9.250  -74.882 -49.826 1.00 43.26  ? 12   VAL B O   1 
ATOM   4273 C CB  . VAL B 1 11  ? -7.629  -74.866 -46.838 1.00 39.71  ? 12   VAL B CB  1 
ATOM   4274 C CG1 . VAL B 1 11  ? -6.986  -75.780 -45.784 1.00 26.64  ? 12   VAL B CG1 1 
ATOM   4275 C CG2 . VAL B 1 11  ? -6.563  -74.171 -47.704 1.00 31.38  ? 12   VAL B CG2 1 
ATOM   4276 N N   . ARG B 1 12  ? -10.243 -73.943 -48.060 1.00 41.62  ? 13   ARG B N   1 
ATOM   4277 C CA  . ARG B 1 12  ? -11.140 -73.171 -48.911 1.00 43.02  ? 13   ARG B CA  1 
ATOM   4278 C C   . ARG B 1 12  ? -10.437 -72.377 -50.016 1.00 47.43  ? 13   ARG B C   1 
ATOM   4279 O O   . ARG B 1 12  ? -11.009 -72.162 -51.077 1.00 43.47  ? 13   ARG B O   1 
ATOM   4280 C CB  . ARG B 1 12  ? -11.989 -72.229 -48.069 1.00 38.55  ? 13   ARG B CB  1 
ATOM   4281 C CG  . ARG B 1 12  ? -13.070 -72.999 -47.329 1.00 62.79  ? 13   ARG B CG  1 
ATOM   4282 C CD  . ARG B 1 12  ? -14.138 -72.124 -46.686 1.00 64.40  ? 13   ARG B CD  1 
ATOM   4283 N NE  . ARG B 1 12  ? -14.949 -72.941 -45.781 1.00 72.04  ? 13   ARG B NE  1 
ATOM   4284 C CZ  . ARG B 1 12  ? -16.005 -72.502 -45.101 1.00 79.04  ? 13   ARG B CZ  1 
ATOM   4285 N NH1 . ARG B 1 12  ? -16.403 -71.239 -45.221 1.00 77.40  ? 13   ARG B NH1 1 
ATOM   4286 N NH2 . ARG B 1 12  ? -16.671 -73.333 -44.302 1.00 78.59  ? 13   ARG B NH2 1 
ATOM   4287 N N   . GLY B 1 13  ? -9.201  -71.956 -49.778 1.00 43.20  ? 14   GLY B N   1 
ATOM   4288 C CA  . GLY B 1 13  ? -8.511  -71.108 -50.734 1.00 41.02  ? 14   GLY B CA  1 
ATOM   4289 C C   . GLY B 1 13  ? -7.794  -71.869 -51.839 1.00 46.44  ? 14   GLY B C   1 
ATOM   4290 O O   . GLY B 1 13  ? -7.403  -71.296 -52.863 1.00 41.61  ? 14   GLY B O   1 
ATOM   4291 N N   . GLY B 1 14  ? -7.613  -73.167 -51.633 1.00 38.61  ? 15   GLY B N   1 
ATOM   4292 C CA  . GLY B 1 14  ? -6.790  -73.934 -52.540 1.00 35.22  ? 15   GLY B CA  1 
ATOM   4293 C C   . GLY B 1 14  ? -6.037  -75.057 -51.863 1.00 38.51  ? 15   GLY B C   1 
ATOM   4294 O O   . GLY B 1 14  ? -6.289  -75.390 -50.705 1.00 40.32  ? 15   GLY B O   1 
ATOM   4295 N N   . ARG B 1 15  ? -5.079  -75.616 -52.588 1.00 37.69  ? 16   ARG B N   1 
ATOM   4296 C CA  . ARG B 1 15  ? -4.358  -76.785 -52.127 1.00 41.37  ? 16   ARG B CA  1 
ATOM   4297 C C   . ARG B 1 15  ? -3.022  -76.458 -51.474 1.00 37.91  ? 16   ARG B C   1 
ATOM   4298 O O   . ARG B 1 15  ? -2.335  -75.533 -51.895 1.00 36.60  ? 16   ARG B O   1 
ATOM   4299 C CB  . ARG B 1 15  ? -4.132  -77.732 -53.300 1.00 36.38  ? 16   ARG B CB  1 
ATOM   4300 C CG  . ARG B 1 15  ? -5.397  -78.461 -53.771 1.00 48.76  ? 16   ARG B CG  1 
ATOM   4301 C CD  . ARG B 1 15  ? -5.054  -79.414 -54.934 1.00 49.13  ? 16   ARG B CD  1 
ATOM   4302 N NE  . ARG B 1 15  ? -4.780  -78.664 -56.151 1.00 58.21  ? 16   ARG B NE  1 
ATOM   4303 C CZ  . ARG B 1 15  ? -3.958  -79.058 -57.123 1.00 58.26  ? 16   ARG B CZ  1 
ATOM   4304 N NH1 . ARG B 1 15  ? -3.288  -80.208 -57.030 1.00 53.45  ? 16   ARG B NH1 1 
ATOM   4305 N NH2 . ARG B 1 15  ? -3.799  -78.277 -58.185 1.00 53.51  ? 16   ARG B NH2 1 
ATOM   4306 N N   . LEU B 1 16  ? -2.661  -77.269 -50.484 1.00 30.55  ? 17   LEU B N   1 
ATOM   4307 C CA  . LEU B 1 16  ? -1.455  -77.123 -49.682 1.00 40.52  ? 17   LEU B CA  1 
ATOM   4308 C C   . LEU B 1 16  ? -0.628  -78.389 -49.709 1.00 33.25  ? 17   LEU B C   1 
ATOM   4309 O O   . LEU B 1 16  ? -1.171  -79.491 -49.700 1.00 36.48  ? 17   LEU B O   1 
ATOM   4310 C CB  . LEU B 1 16  ? -1.807  -76.807 -48.201 1.00 30.61  ? 17   LEU B CB  1 
ATOM   4311 C CG  . LEU B 1 16  ? -2.651  -75.549 -47.988 1.00 33.59  ? 17   LEU B CG  1 
ATOM   4312 C CD1 . LEU B 1 16  ? -3.159  -75.465 -46.549 1.00 35.09  ? 17   LEU B CD1 1 
ATOM   4313 C CD2 . LEU B 1 16  ? -1.803  -74.327 -48.341 1.00 33.21  ? 17   LEU B CD2 1 
ATOM   4314 N N   . ARG B 1 17  ? 0.685   -78.223 -49.669 1.00 31.94  ? 18   ARG B N   1 
ATOM   4315 C CA  . ARG B 1 17  ? 1.603   -79.327 -49.416 1.00 33.80  ? 18   ARG B CA  1 
ATOM   4316 C C   . ARG B 1 17  ? 2.369   -79.048 -48.119 1.00 33.74  ? 18   ARG B C   1 
ATOM   4317 O O   . ARG B 1 17  ? 2.891   -77.935 -47.931 1.00 33.23  ? 18   ARG B O   1 
ATOM   4318 C CB  . ARG B 1 17  ? 2.582   -79.482 -50.596 1.00 32.80  ? 18   ARG B CB  1 
ATOM   4319 C CG  . ARG B 1 17  ? 3.534   -80.669 -50.518 1.00 36.15  ? 18   ARG B CG  1 
ATOM   4320 C CD  . ARG B 1 17  ? 4.455   -80.704 -51.762 1.00 39.51  ? 18   ARG B CD  1 
ATOM   4321 N NE  . ARG B 1 17  ? 3.662   -80.914 -52.967 1.00 38.21  ? 18   ARG B NE  1 
ATOM   4322 C CZ  . ARG B 1 17  ? 3.454   -80.004 -53.922 1.00 44.84  ? 18   ARG B CZ  1 
ATOM   4323 N NH1 . ARG B 1 17  ? 4.022   -78.789 -53.869 1.00 37.19  ? 18   ARG B NH1 1 
ATOM   4324 N NH2 . ARG B 1 17  ? 2.689   -80.320 -54.959 1.00 45.14  ? 18   ARG B NH2 1 
ATOM   4325 N N   . GLY B 1 18  ? 2.463   -80.043 -47.237 1.00 36.72  ? 19   GLY B N   1 
ATOM   4326 C CA  . GLY B 1 18  ? 3.165   -79.864 -45.976 1.00 32.55  ? 19   GLY B CA  1 
ATOM   4327 C C   . GLY B 1 18  ? 4.392   -80.747 -45.904 1.00 36.21  ? 19   GLY B C   1 
ATOM   4328 O O   . GLY B 1 18  ? 4.899   -81.228 -46.901 1.00 40.03  ? 19   GLY B O   1 
ATOM   4329 N N   . ILE B 1 19  ? 4.845   -80.993 -44.696 1.00 31.27  ? 20   ILE B N   1 
ATOM   4330 C CA  . ILE B 1 19  ? 6.086   -81.691 -44.480 1.00 33.50  ? 20   ILE B CA  1 
ATOM   4331 C C   . ILE B 1 19  ? 5.887   -82.693 -43.313 1.00 44.56  ? 20   ILE B C   1 
ATOM   4332 O O   . ILE B 1 19  ? 5.063   -82.480 -42.409 1.00 36.61  ? 20   ILE B O   1 
ATOM   4333 C CB  . ILE B 1 19  ? 7.235   -80.650 -44.227 1.00 42.84  ? 20   ILE B CB  1 
ATOM   4334 C CG1 . ILE B 1 19  ? 8.604   -81.298 -44.368 1.00 51.50  ? 20   ILE B CG1 1 
ATOM   4335 C CG2 . ILE B 1 19  ? 7.112   -79.928 -42.838 1.00 43.00  ? 20   ILE B CG2 1 
ATOM   4336 C CD1 . ILE B 1 19  ? 9.749   -80.349 -44.038 1.00 50.99  ? 20   ILE B CD1 1 
ATOM   4337 N N   . ARG B 1 20  ? 6.581   -83.822 -43.375 1.00 44.07  ? 21   ARG B N   1 
ATOM   4338 C CA  . ARG B 1 20  ? 6.525   -84.822 -42.308 1.00 44.29  ? 21   ARG B CA  1 
ATOM   4339 C C   . ARG B 1 20  ? 7.652   -84.557 -41.327 1.00 47.72  ? 21   ARG B C   1 
ATOM   4340 O O   . ARG B 1 20  ? 8.820   -84.582 -41.704 1.00 43.93  ? 21   ARG B O   1 
ATOM   4341 C CB  . ARG B 1 20  ? 6.638   -86.234 -42.889 1.00 49.32  ? 21   ARG B CB  1 
ATOM   4342 C CG  . ARG B 1 20  ? 6.655   -87.406 -41.894 1.00 51.24  ? 21   ARG B CG  1 
ATOM   4343 C CD  . ARG B 1 20  ? 7.067   -88.696 -42.661 1.00 63.75  ? 21   ARG B CD  1 
ATOM   4344 N NE  . ARG B 1 20  ? 6.769   -89.964 -41.979 1.00 59.02  ? 21   ARG B NE  1 
ATOM   4345 C CZ  . ARG B 1 20  ? 7.656   -90.660 -41.265 1.00 68.02  ? 21   ARG B CZ  1 
ATOM   4346 N NH1 . ARG B 1 20  ? 8.899   -90.210 -41.128 1.00 68.40  ? 21   ARG B NH1 1 
ATOM   4347 N NH2 . ARG B 1 20  ? 7.306   -91.805 -40.677 1.00 64.43  ? 21   ARG B NH2 1 
ATOM   4348 N N   . LEU B 1 21  ? 7.304   -84.275 -40.074 1.00 43.63  ? 22   LEU B N   1 
ATOM   4349 C CA  . LEU B 1 21  ? 8.313   -83.965 -39.070 1.00 40.36  ? 22   LEU B CA  1 
ATOM   4350 C C   . LEU B 1 21  ? 8.616   -85.153 -38.207 1.00 43.76  ? 22   LEU B C   1 
ATOM   4351 O O   . LEU B 1 21  ? 7.697   -85.826 -37.711 1.00 41.33  ? 22   LEU B O   1 
ATOM   4352 C CB  . LEU B 1 21  ? 7.871   -82.826 -38.153 1.00 39.42  ? 22   LEU B CB  1 
ATOM   4353 C CG  . LEU B 1 21  ? 7.712   -81.426 -38.708 1.00 49.83  ? 22   LEU B CG  1 
ATOM   4354 C CD1 . LEU B 1 21  ? 7.284   -80.557 -37.541 1.00 40.30  ? 22   LEU B CD1 1 
ATOM   4355 C CD2 . LEU B 1 21  ? 9.022   -80.945 -39.332 1.00 35.40  ? 22   LEU B CD2 1 
ATOM   4356 N N   . LYS B 1 22  ? 9.907   -85.382 -38.005 1.00 43.07  ? 23   LYS B N   1 
ATOM   4357 C CA  . LYS B 1 22  ? 10.369  -86.347 -37.032 1.00 49.16  ? 23   LYS B CA  1 
ATOM   4358 C C   . LYS B 1 22  ? 10.227  -85.749 -35.632 1.00 50.96  ? 23   LYS B C   1 
ATOM   4359 O O   . LYS B 1 22  ? 10.553  -84.589 -35.412 1.00 50.99  ? 23   LYS B O   1 
ATOM   4360 C CB  . LYS B 1 22  ? 11.821  -86.740 -37.317 1.00 44.86  ? 23   LYS B CB  1 
ATOM   4361 C CG  . LYS B 1 22  ? 12.007  -87.437 -38.654 1.00 58.16  ? 23   LYS B CG  1 
ATOM   4362 C CD  . LYS B 1 22  ? 13.420  -87.992 -38.841 1.00 62.49  ? 23   LYS B CD  1 
ATOM   4363 C CE  . LYS B 1 22  ? 13.566  -88.658 -40.205 1.00 66.28  ? 23   LYS B CE  1 
ATOM   4364 N NZ  . LYS B 1 22  ? 14.937  -88.459 -40.769 1.00 74.95  ? 23   LYS B NZ  1 
ATOM   4365 N N   . THR B 1 23  ? 9.682   -86.530 -34.709 1.00 46.29  ? 24   THR B N   1 
ATOM   4366 C CA  . THR B 1 23  ? 9.725   -86.211 -33.285 1.00 54.48  ? 24   THR B CA  1 
ATOM   4367 C C   . THR B 1 23  ? 10.210  -87.458 -32.550 1.00 55.71  ? 24   THR B C   1 
ATOM   4368 O O   . THR B 1 23  ? 10.056  -88.562 -33.059 1.00 55.49  ? 24   THR B O   1 
ATOM   4369 C CB  . THR B 1 23  ? 8.346   -85.798 -32.709 1.00 46.64  ? 24   THR B CB  1 
ATOM   4370 O OG1 . THR B 1 23  ? 7.608   -86.976 -32.373 1.00 40.85  ? 24   THR B OG1 1 
ATOM   4371 C CG2 . THR B 1 23  ? 7.539   -84.939 -33.703 1.00 47.39  ? 24   THR B CG2 1 
ATOM   4372 N N   . PRO B 1 24  ? 10.786  -87.288 -31.345 1.00 60.22  ? 25   PRO B N   1 
ATOM   4373 C CA  . PRO B 1 24  ? 11.169  -88.412 -30.479 1.00 56.25  ? 25   PRO B CA  1 
ATOM   4374 C C   . PRO B 1 24  ? 10.085  -89.477 -30.339 1.00 57.79  ? 25   PRO B C   1 
ATOM   4375 O O   . PRO B 1 24  ? 10.417  -90.655 -30.255 1.00 65.51  ? 25   PRO B O   1 
ATOM   4376 C CB  . PRO B 1 24  ? 11.430  -87.738 -29.141 1.00 57.08  ? 25   PRO B CB  1 
ATOM   4377 C CG  . PRO B 1 24  ? 11.966  -86.406 -29.531 1.00 58.57  ? 25   PRO B CG  1 
ATOM   4378 C CD  . PRO B 1 24  ? 11.192  -85.997 -30.764 1.00 54.97  ? 25   PRO B CD  1 
ATOM   4379 N N   . GLY B 1 25  ? 8.819   -89.081 -30.353 1.00 51.85  ? 26   GLY B N   1 
ATOM   4380 C CA  . GLY B 1 25  ? 7.747   -90.044 -30.186 1.00 47.57  ? 26   GLY B CA  1 
ATOM   4381 C C   . GLY B 1 25  ? 7.136   -90.544 -31.484 1.00 55.09  ? 26   GLY B C   1 
ATOM   4382 O O   . GLY B 1 25  ? 6.200   -91.339 -31.457 1.00 67.06  ? 26   GLY B O   1 
ATOM   4383 N N   . GLY B 1 26  ? 7.643   -90.089 -32.625 1.00 42.00  ? 27   GLY B N   1 
ATOM   4384 C CA  . GLY B 1 26  ? 7.045   -90.479 -33.896 1.00 51.87  ? 27   GLY B CA  1 
ATOM   4385 C C   . GLY B 1 26  ? 6.690   -89.302 -34.798 1.00 53.24  ? 27   GLY B C   1 
ATOM   4386 O O   . GLY B 1 26  ? 6.862   -88.150 -34.417 1.00 50.61  ? 27   GLY B O   1 
ATOM   4387 N N   . PRO B 1 27  ? 6.175   -89.584 -36.001 1.00 51.46  ? 28   PRO B N   1 
ATOM   4388 C CA  . PRO B 1 27  ? 5.983   -88.531 -37.005 1.00 42.23  ? 28   PRO B CA  1 
ATOM   4389 C C   . PRO B 1 27  ? 4.771   -87.629 -36.763 1.00 43.67  ? 28   PRO B C   1 
ATOM   4390 O O   . PRO B 1 27  ? 3.726   -88.031 -36.239 1.00 38.93  ? 28   PRO B O   1 
ATOM   4391 C CB  . PRO B 1 27  ? 5.780   -89.331 -38.295 1.00 44.04  ? 28   PRO B CB  1 
ATOM   4392 C CG  . PRO B 1 27  ? 5.030   -90.545 -37.812 1.00 46.59  ? 28   PRO B CG  1 
ATOM   4393 C CD  . PRO B 1 27  ? 5.670   -90.889 -36.479 1.00 46.80  ? 28   PRO B CD  1 
ATOM   4394 N N   . VAL B 1 28  ? 4.907   -86.397 -37.217 1.00 40.57  ? 29   VAL B N   1 
ATOM   4395 C CA  . VAL B 1 28  ? 3.836   -85.427 -37.150 1.00 34.48  ? 29   VAL B CA  1 
ATOM   4396 C C   . VAL B 1 28  ? 3.764   -84.766 -38.529 1.00 33.77  ? 29   VAL B C   1 
ATOM   4397 O O   . VAL B 1 28  ? 4.775   -84.638 -39.194 1.00 36.66  ? 29   VAL B O   1 
ATOM   4398 C CB  . VAL B 1 28  ? 4.114   -84.398 -36.011 1.00 41.60  ? 29   VAL B CB  1 
ATOM   4399 C CG1 . VAL B 1 28  ? 3.286   -83.169 -36.164 1.00 41.61  ? 29   VAL B CG1 1 
ATOM   4400 C CG2 . VAL B 1 28  ? 3.904   -85.055 -34.612 1.00 36.97  ? 29   VAL B CG2 1 
ATOM   4401 N N   . SER B 1 29  ? 2.578   -84.372 -38.972 1.00 34.70  ? 30   SER B N   1 
ATOM   4402 C CA  . SER B 1 29  ? 2.446   -83.571 -40.189 1.00 35.71  ? 30   SER B CA  1 
ATOM   4403 C C   . SER B 1 29  ? 2.432   -82.080 -39.847 1.00 38.37  ? 30   SER B C   1 
ATOM   4404 O O   . SER B 1 29  ? 1.743   -81.666 -38.927 1.00 38.00  ? 30   SER B O   1 
ATOM   4405 C CB  . SER B 1 29  ? 1.172   -83.941 -40.946 1.00 36.36  ? 30   SER B CB  1 
ATOM   4406 O OG  . SER B 1 29  ? 1.190   -85.310 -41.323 1.00 44.05  ? 30   SER B OG  1 
ATOM   4407 N N   . ALA B 1 30  ? 3.200   -81.288 -40.586 1.00 37.95  ? 31   ALA B N   1 
ATOM   4408 C CA  . ALA B 1 30  ? 3.277   -79.858 -40.356 1.00 36.06  ? 31   ALA B CA  1 
ATOM   4409 C C   . ALA B 1 30  ? 3.015   -79.109 -41.637 1.00 39.31  ? 31   ALA B C   1 
ATOM   4410 O O   . ALA B 1 30  ? 3.557   -79.440 -42.690 1.00 36.97  ? 31   ALA B O   1 
ATOM   4411 C CB  . ALA B 1 30  ? 4.629   -79.475 -39.800 1.00 29.40  ? 31   ALA B CB  1 
ATOM   4412 N N   . PHE B 1 31  ? 2.171   -78.098 -41.529 1.00 32.59  ? 32   PHE B N   1 
ATOM   4413 C CA  . PHE B 1 31  ? 1.873   -77.201 -42.622 1.00 28.05  ? 32   PHE B CA  1 
ATOM   4414 C C   . PHE B 1 31  ? 2.248   -75.826 -42.112 1.00 32.85  ? 32   PHE B C   1 
ATOM   4415 O O   . PHE B 1 31  ? 1.485   -75.196 -41.372 1.00 31.37  ? 32   PHE B O   1 
ATOM   4416 C CB  . PHE B 1 31  ? 0.397   -77.304 -43.015 1.00 31.43  ? 32   PHE B CB  1 
ATOM   4417 C CG  . PHE B 1 31  ? -0.001  -78.683 -43.480 1.00 38.29  ? 32   PHE B CG  1 
ATOM   4418 C CD1 . PHE B 1 31  ? -0.277  -79.699 -42.564 1.00 37.51  ? 32   PHE B CD1 1 
ATOM   4419 C CD2 . PHE B 1 31  ? -0.061  -78.981 -44.839 1.00 33.77  ? 32   PHE B CD2 1 
ATOM   4420 C CE1 . PHE B 1 31  ? -0.630  -80.986 -43.003 1.00 38.62  ? 32   PHE B CE1 1 
ATOM   4421 C CE2 . PHE B 1 31  ? -0.411  -80.264 -45.288 1.00 32.44  ? 32   PHE B CE2 1 
ATOM   4422 C CZ  . PHE B 1 31  ? -0.694  -81.262 -44.375 1.00 36.12  ? 32   PHE B CZ  1 
ATOM   4423 N N   . LEU B 1 32  ? 3.461   -75.402 -42.448 1.00 30.59  ? 33   LEU B N   1 
ATOM   4424 C CA  . LEU B 1 32  ? 4.047   -74.204 -41.891 1.00 27.85  ? 33   LEU B CA  1 
ATOM   4425 C C   . LEU B 1 32  ? 4.000   -73.102 -42.913 1.00 32.13  ? 33   LEU B C   1 
ATOM   4426 O O   . LEU B 1 32  ? 4.285   -73.321 -44.065 1.00 33.48  ? 33   LEU B O   1 
ATOM   4427 C CB  . LEU B 1 32  ? 5.482   -74.480 -41.466 1.00 28.87  ? 33   LEU B CB  1 
ATOM   4428 C CG  . LEU B 1 32  ? 5.679   -75.684 -40.536 1.00 32.02  ? 33   LEU B CG  1 
ATOM   4429 C CD1 . LEU B 1 32  ? 7.153   -75.856 -40.236 1.00 26.25  ? 33   LEU B CD1 1 
ATOM   4430 C CD2 . LEU B 1 32  ? 4.916   -75.528 -39.234 1.00 27.24  ? 33   LEU B CD2 1 
ATOM   4431 N N   . GLY B 1 33  ? 3.634   -71.905 -42.510 1.00 30.21  ? 34   GLY B N   1 
ATOM   4432 C CA  . GLY B 1 33  ? 3.577   -70.822 -43.469 1.00 27.65  ? 34   GLY B CA  1 
ATOM   4433 C C   . GLY B 1 33  ? 2.395   -70.831 -44.428 1.00 32.43  ? 34   GLY B C   1 
ATOM   4434 O O   . GLY B 1 33  ? 2.544   -70.545 -45.621 1.00 32.22  ? 34   GLY B O   1 
ATOM   4435 N N   . ILE B 1 34  ? 1.209   -71.133 -43.910 1.00 30.63  ? 35   ILE B N   1 
ATOM   4436 C CA  . ILE B 1 34  ? -0.014  -70.979 -44.690 1.00 29.74  ? 35   ILE B CA  1 
ATOM   4437 C C   . ILE B 1 34  ? -0.513  -69.525 -44.713 1.00 28.98  ? 35   ILE B C   1 
ATOM   4438 O O   . ILE B 1 34  ? -0.734  -68.925 -43.657 1.00 29.97  ? 35   ILE B O   1 
ATOM   4439 C CB  . ILE B 1 34  ? -1.129  -71.871 -44.128 1.00 27.45  ? 35   ILE B CB  1 
ATOM   4440 C CG1 . ILE B 1 34  ? -0.625  -73.309 -43.954 1.00 26.15  ? 35   ILE B CG1 1 
ATOM   4441 C CG2 . ILE B 1 34  ? -2.359  -71.787 -45.006 1.00 30.42  ? 35   ILE B CG2 1 
ATOM   4442 C CD1 . ILE B 1 34  ? -1.621  -74.200 -43.198 1.00 29.77  ? 35   ILE B CD1 1 
ATOM   4443 N N   . PRO B 1 35  ? -0.705  -68.953 -45.911 1.00 32.77  ? 36   PRO B N   1 
ATOM   4444 C CA  . PRO B 1 35  ? -1.155  -67.554 -46.000 1.00 28.02  ? 36   PRO B CA  1 
ATOM   4445 C C   . PRO B 1 35  ? -2.606  -67.454 -45.576 1.00 34.58  ? 36   PRO B C   1 
ATOM   4446 O O   . PRO B 1 35  ? -3.403  -68.243 -46.064 1.00 32.50  ? 36   PRO B O   1 
ATOM   4447 C CB  . PRO B 1 35  ? -0.978  -67.216 -47.492 1.00 31.41  ? 36   PRO B CB  1 
ATOM   4448 C CG  . PRO B 1 35  ? -1.155  -68.565 -48.188 1.00 33.12  ? 36   PRO B CG  1 
ATOM   4449 C CD  . PRO B 1 35  ? -0.524  -69.576 -47.240 1.00 32.99  ? 36   PRO B CD  1 
ATOM   4450 N N   . PHE B 1 36  ? -2.961  -66.559 -44.657 1.00 31.65  ? 37   PHE B N   1 
ATOM   4451 C CA  . PHE B 1 36  ? -4.373  -66.509 -44.275 1.00 30.17  ? 37   PHE B CA  1 
ATOM   4452 C C   . PHE B 1 36  ? -4.951  -65.142 -44.570 1.00 34.85  ? 37   PHE B C   1 
ATOM   4453 O O   . PHE B 1 36  ? -6.158  -64.935 -44.490 1.00 36.76  ? 37   PHE B O   1 
ATOM   4454 C CB  . PHE B 1 36  ? -4.577  -66.901 -42.802 1.00 29.92  ? 37   PHE B CB  1 
ATOM   4455 C CG  . PHE B 1 36  ? -4.003  -65.928 -41.798 1.00 29.10  ? 37   PHE B CG  1 
ATOM   4456 C CD1 . PHE B 1 36  ? -4.752  -64.822 -41.360 1.00 27.38  ? 37   PHE B CD1 1 
ATOM   4457 C CD2 . PHE B 1 36  ? -2.747  -66.152 -41.237 1.00 28.01  ? 37   PHE B CD2 1 
ATOM   4458 C CE1 . PHE B 1 36  ? -4.239  -63.933 -40.382 1.00 31.02  ? 37   PHE B CE1 1 
ATOM   4459 C CE2 . PHE B 1 36  ? -2.212  -65.272 -40.244 1.00 27.72  ? 37   PHE B CE2 1 
ATOM   4460 C CZ  . PHE B 1 36  ? -2.965  -64.168 -39.807 1.00 26.80  ? 37   PHE B CZ  1 
ATOM   4461 N N   . ALA B 1 37  ? -4.071  -64.220 -44.932 1.00 27.51  ? 38   ALA B N   1 
ATOM   4462 C CA  . ALA B 1 37  ? -4.473  -62.893 -45.372 1.00 34.84  ? 38   ALA B CA  1 
ATOM   4463 C C   . ALA B 1 37  ? -3.666  -62.445 -46.597 1.00 33.57  ? 38   ALA B C   1 
ATOM   4464 O O   . ALA B 1 37  ? -2.568  -62.954 -46.857 1.00 30.75  ? 38   ALA B O   1 
ATOM   4465 C CB  . ALA B 1 37  ? -4.299  -61.893 -44.247 1.00 25.10  ? 38   ALA B CB  1 
ATOM   4466 N N   . GLU B 1 38  ? -4.220  -61.502 -47.347 1.00 35.60  ? 39   GLU B N   1 
ATOM   4467 C CA  . GLU B 1 38  ? -3.458  -60.783 -48.357 1.00 35.13  ? 39   GLU B CA  1 
ATOM   4468 C C   . GLU B 1 38  ? -2.339  -60.060 -47.641 1.00 34.04  ? 39   GLU B C   1 
ATOM   4469 O O   . GLU B 1 38  ? -2.555  -59.548 -46.551 1.00 34.05  ? 39   GLU B O   1 
ATOM   4470 C CB  . GLU B 1 38  ? -4.342  -59.783 -49.116 1.00 35.52  ? 39   GLU B CB  1 
ATOM   4471 C CG  . GLU B 1 38  ? -5.370  -60.450 -49.999 1.00 40.11  ? 39   GLU B CG  1 
ATOM   4472 C CD  . GLU B 1 38  ? -4.705  -61.228 -51.120 1.00 41.45  ? 39   GLU B CD  1 
ATOM   4473 O OE1 . GLU B 1 38  ? -3.791  -60.652 -51.758 1.00 43.87  ? 39   GLU B OE1 1 
ATOM   4474 O OE2 . GLU B 1 38  ? -5.072  -62.409 -51.337 1.00 36.90  ? 39   GLU B OE2 1 
ATOM   4475 N N   . PRO B 1 39  ? -1.140  -60.020 -48.237 1.00 34.45  ? 40   PRO B N   1 
ATOM   4476 C CA  . PRO B 1 39  ? -0.022  -59.309 -47.601 1.00 30.76  ? 40   PRO B CA  1 
ATOM   4477 C C   . PRO B 1 39  ? -0.382  -57.856 -47.256 1.00 36.48  ? 40   PRO B C   1 
ATOM   4478 O O   . PRO B 1 39  ? -0.785  -57.096 -48.119 1.00 35.15  ? 40   PRO B O   1 
ATOM   4479 C CB  . PRO B 1 39  ? 1.091   -59.387 -48.669 1.00 31.90  ? 40   PRO B CB  1 
ATOM   4480 C CG  . PRO B 1 39  ? 0.822   -60.681 -49.372 1.00 33.49  ? 40   PRO B CG  1 
ATOM   4481 C CD  . PRO B 1 39  ? -0.710  -60.793 -49.422 1.00 33.47  ? 40   PRO B CD  1 
ATOM   4482 N N   . PRO B 1 40  ? -0.264  -57.459 -45.983 1.00 40.39  ? 41   PRO B N   1 
ATOM   4483 C CA  . PRO B 1 40  ? -0.669  -56.077 -45.673 1.00 32.29  ? 41   PRO B CA  1 
ATOM   4484 C C   . PRO B 1 40  ? 0.415   -55.052 -46.049 1.00 37.96  ? 41   PRO B C   1 
ATOM   4485 O O   . PRO B 1 40  ? 0.952   -54.362 -45.171 1.00 38.62  ? 41   PRO B O   1 
ATOM   4486 C CB  . PRO B 1 40  ? -0.906  -56.132 -44.165 1.00 32.34  ? 41   PRO B CB  1 
ATOM   4487 C CG  . PRO B 1 40  ? 0.094   -57.161 -43.697 1.00 34.02  ? 41   PRO B CG  1 
ATOM   4488 C CD  . PRO B 1 40  ? 0.193   -58.193 -44.792 1.00 30.20  ? 41   PRO B CD  1 
ATOM   4489 N N   . MET B 1 41  ? 0.695   -54.976 -47.355 1.00 41.80  ? 42   MET B N   1 
ATOM   4490 C CA  . MET B 1 41  ? 1.790   -54.217 -47.959 1.00 43.30  ? 42   MET B CA  1 
ATOM   4491 C C   . MET B 1 41  ? 1.310   -52.899 -48.510 1.00 38.40  ? 42   MET B C   1 
ATOM   4492 O O   . MET B 1 41  ? 0.184   -52.815 -48.952 1.00 37.59  ? 42   MET B O   1 
ATOM   4493 C CB  . MET B 1 41  ? 2.398   -54.974 -49.164 1.00 48.96  ? 42   MET B CB  1 
ATOM   4494 C CG  . MET B 1 41  ? 2.829   -56.370 -48.942 1.00 45.54  ? 42   MET B CG  1 
ATOM   4495 S SD  . MET B 1 41  ? 4.232   -56.341 -47.845 1.00 56.20  ? 42   MET B SD  1 
ATOM   4496 C CE  . MET B 1 41  ? 5.399   -55.352 -48.787 1.00 58.33  ? 42   MET B CE  1 
ATOM   4497 N N   . GLY B 1 42  ? 2.187   -51.908 -48.583 1.00 36.54  ? 43   GLY B N   1 
ATOM   4498 C CA  . GLY B 1 42  ? 1.881   -50.703 -49.336 1.00 44.43  ? 43   GLY B CA  1 
ATOM   4499 C C   . GLY B 1 42  ? 0.626   -49.990 -48.866 1.00 44.65  ? 43   GLY B C   1 
ATOM   4500 O O   . GLY B 1 42  ? 0.568   -49.494 -47.738 1.00 40.54  ? 43   GLY B O   1 
ATOM   4501 N N   . PRO B 1 43  ? -0.390  -49.931 -49.733 1.00 43.65  ? 44   PRO B N   1 
ATOM   4502 C CA  . PRO B 1 43  ? -1.669  -49.293 -49.386 1.00 40.59  ? 44   PRO B CA  1 
ATOM   4503 C C   . PRO B 1 43  ? -2.399  -50.040 -48.262 1.00 45.32  ? 44   PRO B C   1 
ATOM   4504 O O   . PRO B 1 43  ? -3.297  -49.493 -47.617 1.00 39.14  ? 44   PRO B O   1 
ATOM   4505 C CB  . PRO B 1 43  ? -2.459  -49.348 -50.710 1.00 35.55  ? 44   PRO B CB  1 
ATOM   4506 C CG  . PRO B 1 43  ? -1.809  -50.476 -51.503 1.00 34.32  ? 44   PRO B CG  1 
ATOM   4507 C CD  . PRO B 1 43  ? -0.361  -50.422 -51.126 1.00 38.52  ? 44   PRO B CD  1 
ATOM   4508 N N   . ARG B 1 44  ? -2.010  -51.289 -48.021 1.00 42.05  ? 45   ARG B N   1 
ATOM   4509 C CA  . ARG B 1 44  ? -2.680  -52.091 -47.008 1.00 37.65  ? 45   ARG B CA  1 
ATOM   4510 C C   . ARG B 1 44  ? -2.023  -52.022 -45.616 1.00 38.03  ? 45   ARG B C   1 
ATOM   4511 O O   . ARG B 1 44  ? -2.522  -52.610 -44.671 1.00 33.95  ? 45   ARG B O   1 
ATOM   4512 C CB  . ARG B 1 44  ? -2.763  -53.532 -47.480 1.00 43.16  ? 45   ARG B CB  1 
ATOM   4513 C CG  . ARG B 1 44  ? -3.717  -53.735 -48.658 1.00 41.51  ? 45   ARG B CG  1 
ATOM   4514 C CD  . ARG B 1 44  ? -3.824  -55.223 -48.914 1.00 39.15  ? 45   ARG B CD  1 
ATOM   4515 N NE  . ARG B 1 44  ? -4.303  -55.578 -50.243 1.00 58.13  ? 45   ARG B NE  1 
ATOM   4516 C CZ  . ARG B 1 44  ? -5.543  -55.988 -50.489 1.00 65.63  ? 45   ARG B CZ  1 
ATOM   4517 N NH1 . ARG B 1 44  ? -6.427  -56.066 -49.491 1.00 53.46  ? 45   ARG B NH1 1 
ATOM   4518 N NH2 . ARG B 1 44  ? -5.903  -56.313 -51.727 1.00 58.83  ? 45   ARG B NH2 1 
ATOM   4519 N N   . ARG B 1 45  ? -0.928  -51.283 -45.493 1.00 35.60  ? 46   ARG B N   1 
ATOM   4520 C CA  . ARG B 1 45  ? -0.321  -51.048 -44.193 1.00 38.02  ? 46   ARG B CA  1 
ATOM   4521 C C   . ARG B 1 45  ? -1.306  -50.277 -43.293 1.00 40.12  ? 46   ARG B C   1 
ATOM   4522 O O   . ARG B 1 45  ? -1.911  -49.306 -43.735 1.00 34.74  ? 46   ARG B O   1 
ATOM   4523 C CB  . ARG B 1 45  ? 1.000   -50.287 -44.358 1.00 29.65  ? 46   ARG B CB  1 
ATOM   4524 C CG  . ARG B 1 45  ? 1.739   -50.039 -43.054 1.00 30.19  ? 46   ARG B CG  1 
ATOM   4525 C CD  . ARG B 1 45  ? 2.897   -49.052 -43.201 1.00 30.22  ? 46   ARG B CD  1 
ATOM   4526 N NE  . ARG B 1 45  ? 4.089   -49.667 -43.794 1.00 32.05  ? 46   ARG B NE  1 
ATOM   4527 C CZ  . ARG B 1 45  ? 5.213   -49.005 -44.063 1.00 37.86  ? 46   ARG B CZ  1 
ATOM   4528 N NH1 . ARG B 1 45  ? 5.306   -47.702 -43.810 1.00 33.49  ? 46   ARG B NH1 1 
ATOM   4529 N NH2 . ARG B 1 45  ? 6.256   -49.640 -44.578 1.00 33.38  ? 46   ARG B NH2 1 
ATOM   4530 N N   . PHE B 1 46  ? -1.460  -50.739 -42.048 1.00 34.46  ? 47   PHE B N   1 
ATOM   4531 C CA  . PHE B 1 46  ? -2.367  -50.178 -41.019 1.00 28.62  ? 47   PHE B CA  1 
ATOM   4532 C C   . PHE B 1 46  ? -3.814  -50.545 -41.227 1.00 32.19  ? 47   PHE B C   1 
ATOM   4533 O O   . PHE B 1 46  ? -4.644  -50.260 -40.364 1.00 36.47  ? 47   PHE B O   1 
ATOM   4534 C CB  . PHE B 1 46  ? -2.295  -48.656 -40.915 1.00 31.30  ? 47   PHE B CB  1 
ATOM   4535 C CG  . PHE B 1 46  ? -0.913  -48.120 -40.737 1.00 33.62  ? 47   PHE B CG  1 
ATOM   4536 C CD1 . PHE B 1 46  ? -0.151  -48.487 -39.651 1.00 31.43  ? 47   PHE B CD1 1 
ATOM   4537 C CD2 . PHE B 1 46  ? -0.384  -47.227 -41.657 1.00 32.77  ? 47   PHE B CD2 1 
ATOM   4538 C CE1 . PHE B 1 46  ? 1.128   -47.976 -39.487 1.00 29.81  ? 47   PHE B CE1 1 
ATOM   4539 C CE2 . PHE B 1 46  ? 0.886   -46.718 -41.499 1.00 30.64  ? 47   PHE B CE2 1 
ATOM   4540 C CZ  . PHE B 1 46  ? 1.641   -47.090 -40.407 1.00 33.41  ? 47   PHE B CZ  1 
ATOM   4541 N N   . LEU B 1 47  ? -4.129  -51.209 -42.330 1.00 31.75  ? 48   LEU B N   1 
ATOM   4542 C CA  . LEU B 1 47  ? -5.522  -51.586 -42.591 1.00 36.19  ? 48   LEU B CA  1 
ATOM   4543 C C   . LEU B 1 47  ? -5.850  -52.943 -41.993 1.00 35.07  ? 48   LEU B C   1 
ATOM   4544 O O   . LEU B 1 47  ? -4.949  -53.764 -41.797 1.00 35.13  ? 48   LEU B O   1 
ATOM   4545 C CB  . LEU B 1 47  ? -5.811  -51.628 -44.106 1.00 30.74  ? 48   LEU B CB  1 
ATOM   4546 C CG  . LEU B 1 47  ? -5.858  -50.317 -44.908 1.00 44.61  ? 48   LEU B CG  1 
ATOM   4547 C CD1 . LEU B 1 47  ? -6.379  -50.557 -46.354 1.00 33.35  ? 48   LEU B CD1 1 
ATOM   4548 C CD2 . LEU B 1 47  ? -6.696  -49.254 -44.194 1.00 43.78  ? 48   LEU B CD2 1 
ATOM   4549 N N   . PRO B 1 48  ? -7.146  -53.211 -41.743 1.00 32.72  ? 49   PRO B N   1 
ATOM   4550 C CA  . PRO B 1 48  ? -7.562  -54.559 -41.347 1.00 32.28  ? 49   PRO B CA  1 
ATOM   4551 C C   . PRO B 1 48  ? -7.112  -55.585 -42.359 1.00 36.77  ? 49   PRO B C   1 
ATOM   4552 O O   . PRO B 1 48  ? -6.963  -55.246 -43.523 1.00 41.17  ? 49   PRO B O   1 
ATOM   4553 C CB  . PRO B 1 48  ? -9.088  -54.461 -41.316 1.00 30.78  ? 49   PRO B CB  1 
ATOM   4554 C CG  . PRO B 1 48  ? -9.331  -53.055 -40.934 1.00 38.13  ? 49   PRO B CG  1 
ATOM   4555 C CD  . PRO B 1 48  ? -8.288  -52.284 -41.739 1.00 31.10  ? 49   PRO B CD  1 
ATOM   4556 N N   . PRO B 1 49  ? -6.908  -56.830 -41.922 1.00 39.28  ? 50   PRO B N   1 
ATOM   4557 C CA  . PRO B 1 49  ? -6.512  -57.857 -42.890 1.00 32.75  ? 50   PRO B CA  1 
ATOM   4558 C C   . PRO B 1 49  ? -7.643  -58.218 -43.863 1.00 35.92  ? 50   PRO B C   1 
ATOM   4559 O O   . PRO B 1 49  ? -8.806  -58.332 -43.470 1.00 37.41  ? 50   PRO B O   1 
ATOM   4560 C CB  . PRO B 1 49  ? -6.154  -59.058 -42.017 1.00 26.18  ? 50   PRO B CB  1 
ATOM   4561 C CG  . PRO B 1 49  ? -7.050  -58.873 -40.754 1.00 28.36  ? 50   PRO B CG  1 
ATOM   4562 C CD  . PRO B 1 49  ? -7.073  -57.357 -40.549 1.00 30.17  ? 50   PRO B CD  1 
ATOM   4563 N N   . GLU B 1 50  ? -7.296  -58.397 -45.133 1.00 39.62  ? 51   GLU B N   1 
ATOM   4564 C CA  . GLU B 1 50  ? -8.242  -58.945 -46.097 1.00 38.10  ? 51   GLU B CA  1 
ATOM   4565 C C   . GLU B 1 50  ? -7.984  -60.452 -46.186 1.00 34.33  ? 51   GLU B C   1 
ATOM   4566 O O   . GLU B 1 50  ? -6.831  -60.885 -46.222 1.00 36.28  ? 51   GLU B O   1 
ATOM   4567 C CB  . GLU B 1 50  ? -8.085  -58.263 -47.462 1.00 43.19  ? 51   GLU B CB  1 
ATOM   4568 C CG  . GLU B 1 50  ? -9.318  -58.406 -48.367 1.00 63.47  ? 51   GLU B CG  1 
ATOM   4569 C CD  . GLU B 1 50  ? -9.003  -58.216 -49.866 1.00 80.10  ? 51   GLU B CD  1 
ATOM   4570 O OE1 . GLU B 1 50  ? -9.269  -59.157 -50.667 1.00 57.73  ? 51   GLU B OE1 1 
ATOM   4571 O OE2 . GLU B 1 50  ? -8.494  -57.126 -50.238 1.00 77.62  ? 51   GLU B OE2 1 
ATOM   4572 N N   . PRO B 1 51  ? -9.043  -61.262 -46.197 1.00 32.84  ? 52   PRO B N   1 
ATOM   4573 C CA  . PRO B 1 51  ? -8.830  -62.705 -46.350 1.00 37.72  ? 52   PRO B CA  1 
ATOM   4574 C C   . PRO B 1 51  ? -7.990  -63.033 -47.587 1.00 35.36  ? 52   PRO B C   1 
ATOM   4575 O O   . PRO B 1 51  ? -8.090  -62.340 -48.601 1.00 41.55  ? 52   PRO B O   1 
ATOM   4576 C CB  . PRO B 1 51  ? -10.252 -63.252 -46.495 1.00 36.62  ? 52   PRO B CB  1 
ATOM   4577 C CG  . PRO B 1 51  ? -11.113 -62.230 -45.728 1.00 41.00  ? 52   PRO B CG  1 
ATOM   4578 C CD  . PRO B 1 51  ? -10.476 -60.914 -46.105 1.00 36.35  ? 52   PRO B CD  1 
ATOM   4579 N N   . LYS B 1 52  ? -7.152  -64.058 -47.477 1.00 40.28  ? 53   LYS B N   1 
ATOM   4580 C CA  . LYS B 1 52  ? -6.325  -64.500 -48.592 1.00 37.87  ? 53   LYS B CA  1 
ATOM   4581 C C   . LYS B 1 52  ? -7.192  -64.907 -49.799 1.00 33.87  ? 53   LYS B C   1 
ATOM   4582 O O   . LYS B 1 52  ? -8.143  -65.665 -49.679 1.00 35.35  ? 53   LYS B O   1 
ATOM   4583 C CB  . LYS B 1 52  ? -5.437  -65.659 -48.142 1.00 36.04  ? 53   LYS B CB  1 
ATOM   4584 C CG  . LYS B 1 52  ? -4.553  -66.296 -49.240 1.00 34.85  ? 53   LYS B CG  1 
ATOM   4585 C CD  . LYS B 1 52  ? -3.537  -65.307 -49.795 1.00 38.69  ? 53   LYS B CD  1 
ATOM   4586 C CE  . LYS B 1 52  ? -2.518  -66.001 -50.706 1.00 36.78  ? 53   LYS B CE  1 
ATOM   4587 N NZ  . LYS B 1 52  ? -1.475  -65.034 -51.204 1.00 36.33  ? 53   LYS B NZ  1 
ATOM   4588 N N   . GLN B 1 53  ? -6.880  -64.392 -50.971 1.00 38.44  ? 54   GLN B N   1 
ATOM   4589 C CA  . GLN B 1 53  ? -7.639  -64.806 -52.153 1.00 47.29  ? 54   GLN B CA  1 
ATOM   4590 C C   . GLN B 1 53  ? -7.274  -66.238 -52.580 1.00 38.03  ? 54   GLN B C   1 
ATOM   4591 O O   . GLN B 1 53  ? -6.123  -66.680 -52.423 1.00 38.85  ? 54   GLN B O   1 
ATOM   4592 C CB  . GLN B 1 53  ? -7.414  -63.809 -53.294 1.00 42.14  ? 54   GLN B CB  1 
ATOM   4593 C CG  . GLN B 1 53  ? -8.271  -62.538 -53.158 1.00 51.16  ? 54   GLN B CG  1 
ATOM   4594 C CD  . GLN B 1 53  ? -9.763  -62.806 -53.437 1.00 76.75  ? 54   GLN B CD  1 
ATOM   4595 O OE1 . GLN B 1 53  ? -10.579 -62.850 -52.511 1.00 76.70  ? 54   GLN B OE1 1 
ATOM   4596 N NE2 . GLN B 1 53  ? -10.115 -62.994 -54.721 1.00 79.50  ? 54   GLN B NE2 1 
ATOM   4597 N N   . PRO B 1 54  ? -8.260  -66.986 -53.092 1.00 41.28  ? 55   PRO B N   1 
ATOM   4598 C CA  . PRO B 1 54  ? -8.001  -68.358 -53.560 1.00 41.58  ? 55   PRO B CA  1 
ATOM   4599 C C   . PRO B 1 54  ? -6.893  -68.414 -54.617 1.00 42.17  ? 55   PRO B C   1 
ATOM   4600 O O   . PRO B 1 54  ? -6.687  -67.452 -55.336 1.00 35.37  ? 55   PRO B O   1 
ATOM   4601 C CB  . PRO B 1 54  ? -9.352  -68.795 -54.151 1.00 44.00  ? 55   PRO B CB  1 
ATOM   4602 C CG  . PRO B 1 54  ? -10.371 -67.924 -53.434 1.00 48.57  ? 55   PRO B CG  1 
ATOM   4603 C CD  . PRO B 1 54  ? -9.676  -66.597 -53.248 1.00 43.73  ? 55   PRO B CD  1 
ATOM   4604 N N   . TRP B 1 55  ? -6.170  -69.525 -54.672 1.00 40.60  ? 56   TRP B N   1 
ATOM   4605 C CA  . TRP B 1 55  ? -5.047  -69.688 -55.578 1.00 34.68  ? 56   TRP B CA  1 
ATOM   4606 C C   . TRP B 1 55  ? -5.225  -71.003 -56.315 1.00 40.80  ? 56   TRP B C   1 
ATOM   4607 O O   . TRP B 1 55  ? -5.881  -71.923 -55.812 1.00 38.86  ? 56   TRP B O   1 
ATOM   4608 C CB  . TRP B 1 55  ? -3.701  -69.701 -54.815 1.00 36.28  ? 56   TRP B CB  1 
ATOM   4609 C CG  . TRP B 1 55  ? -3.633  -70.837 -53.782 1.00 37.88  ? 56   TRP B CG  1 
ATOM   4610 C CD1 . TRP B 1 55  ? -3.201  -72.103 -53.999 1.00 41.07  ? 56   TRP B CD1 1 
ATOM   4611 C CD2 . TRP B 1 55  ? -4.039  -70.785 -52.399 1.00 36.79  ? 56   TRP B CD2 1 
ATOM   4612 N NE1 . TRP B 1 55  ? -3.290  -72.847 -52.844 1.00 35.11  ? 56   TRP B NE1 1 
ATOM   4613 C CE2 . TRP B 1 55  ? -3.799  -72.058 -51.847 1.00 40.46  ? 56   TRP B CE2 1 
ATOM   4614 C CE3 . TRP B 1 55  ? -4.562  -69.778 -51.571 1.00 35.89  ? 56   TRP B CE3 1 
ATOM   4615 C CZ2 . TRP B 1 55  ? -4.085  -72.366 -50.502 1.00 34.14  ? 56   TRP B CZ2 1 
ATOM   4616 C CZ3 . TRP B 1 55  ? -4.833  -70.083 -50.227 1.00 33.31  ? 56   TRP B CZ3 1 
ATOM   4617 C CH2 . TRP B 1 55  ? -4.605  -71.370 -49.719 1.00 33.16  ? 56   TRP B CH2 1 
ATOM   4618 N N   . SER B 1 56  ? -4.640  -71.109 -57.500 1.00 36.33  ? 57   SER B N   1 
ATOM   4619 C CA  . SER B 1 56  ? -4.617  -72.392 -58.193 1.00 44.06  ? 57   SER B CA  1 
ATOM   4620 C C   . SER B 1 56  ? -3.261  -73.037 -57.933 1.00 37.84  ? 57   SER B C   1 
ATOM   4621 O O   . SER B 1 56  ? -2.314  -72.358 -57.528 1.00 44.05  ? 57   SER B O   1 
ATOM   4622 C CB  . SER B 1 56  ? -4.859  -72.211 -59.696 1.00 39.87  ? 57   SER B CB  1 
ATOM   4623 O OG  . SER B 1 56  ? -3.828  -71.417 -60.231 1.00 38.77  ? 57   SER B OG  1 
ATOM   4624 N N   . GLY B 1 57  ? -3.147  -74.334 -58.181 1.00 42.30  ? 58   GLY B N   1 
ATOM   4625 C CA  . GLY B 1 57  ? -1.894  -75.014 -57.910 1.00 41.38  ? 58   GLY B CA  1 
ATOM   4626 C C   . GLY B 1 57  ? -1.736  -75.302 -56.423 1.00 45.68  ? 58   GLY B C   1 
ATOM   4627 O O   . GLY B 1 57  ? -2.673  -75.157 -55.630 1.00 37.55  ? 58   GLY B O   1 
ATOM   4628 N N   . VAL B 1 58  ? -0.544  -75.730 -56.042 1.00 38.39  ? 59   VAL B N   1 
ATOM   4629 C CA  . VAL B 1 58  ? -0.307  -76.150 -54.677 1.00 37.05  ? 59   VAL B CA  1 
ATOM   4630 C C   . VAL B 1 58  ? 0.666   -75.207 -53.982 1.00 40.37  ? 59   VAL B C   1 
ATOM   4631 O O   . VAL B 1 58  ? 1.788   -75.000 -54.469 1.00 35.44  ? 59   VAL B O   1 
ATOM   4632 C CB  . VAL B 1 58  ? 0.264   -77.573 -54.608 1.00 36.26  ? 59   VAL B CB  1 
ATOM   4633 C CG1 . VAL B 1 58  ? 0.220   -78.079 -53.144 1.00 36.40  ? 59   VAL B CG1 1 
ATOM   4634 C CG2 . VAL B 1 58  ? -0.492  -78.516 -55.552 1.00 36.08  ? 59   VAL B CG2 1 
ATOM   4635 N N   . VAL B 1 59  ? 0.235   -74.639 -52.853 1.00 37.31  ? 60   VAL B N   1 
ATOM   4636 C CA  . VAL B 1 59  ? 1.124   -73.830 -52.011 1.00 34.57  ? 60   VAL B CA  1 
ATOM   4637 C C   . VAL B 1 59  ? 1.957   -74.734 -51.120 1.00 30.86  ? 60   VAL B C   1 
ATOM   4638 O O   . VAL B 1 59  ? 1.419   -75.603 -50.431 1.00 34.51  ? 60   VAL B O   1 
ATOM   4639 C CB  . VAL B 1 59  ? 0.338   -72.821 -51.140 1.00 34.02  ? 60   VAL B CB  1 
ATOM   4640 C CG1 . VAL B 1 59  ? 1.255   -72.220 -50.023 1.00 32.27  ? 60   VAL B CG1 1 
ATOM   4641 C CG2 . VAL B 1 59  ? -0.249  -71.737 -52.025 1.00 30.96  ? 60   VAL B CG2 1 
ATOM   4642 N N   . ASP B 1 60  ? 3.270   -74.558 -51.153 1.00 32.45  ? 61   ASP B N   1 
ATOM   4643 C CA  . ASP B 1 60  ? 4.126   -75.294 -50.240 1.00 28.01  ? 61   ASP B CA  1 
ATOM   4644 C C   . ASP B 1 60  ? 4.102   -74.622 -48.863 1.00 33.43  ? 61   ASP B C   1 
ATOM   4645 O O   . ASP B 1 60  ? 4.654   -73.528 -48.672 1.00 31.41  ? 61   ASP B O   1 
ATOM   4646 C CB  . ASP B 1 60  ? 5.556   -75.370 -50.765 1.00 29.81  ? 61   ASP B CB  1 
ATOM   4647 C CG  . ASP B 1 60  ? 5.681   -76.303 -51.959 1.00 35.72  ? 61   ASP B CG  1 
ATOM   4648 O OD1 . ASP B 1 60  ? 5.593   -77.523 -51.763 1.00 39.65  ? 61   ASP B OD1 1 
ATOM   4649 O OD2 . ASP B 1 60  ? 5.868   -75.810 -53.088 1.00 44.72  ? 61   ASP B OD2 1 
ATOM   4650 N N   . ALA B 1 61  ? 3.441   -75.284 -47.923 1.00 30.97  ? 62   ALA B N   1 
ATOM   4651 C CA  . ALA B 1 61  ? 3.445   -74.871 -46.523 1.00 31.05  ? 62   ALA B CA  1 
ATOM   4652 C C   . ALA B 1 61  ? 4.503   -75.669 -45.802 1.00 28.89  ? 62   ALA B C   1 
ATOM   4653 O O   . ALA B 1 61  ? 4.174   -76.526 -44.976 1.00 26.96  ? 62   ALA B O   1 
ATOM   4654 C CB  . ALA B 1 61  ? 2.072   -75.101 -45.893 1.00 27.16  ? 62   ALA B CB  1 
ATOM   4655 N N   . THR B 1 62  ? 5.774   -75.413 -46.109 1.00 29.73  ? 63   THR B N   1 
ATOM   4656 C CA  . THR B 1 62  ? 6.819   -76.324 -45.681 1.00 25.09  ? 63   THR B CA  1 
ATOM   4657 C C   . THR B 1 62  ? 7.904   -75.693 -44.814 1.00 30.00  ? 63   THR B C   1 
ATOM   4658 O O   . THR B 1 62  ? 8.870   -76.364 -44.442 1.00 31.86  ? 63   THR B O   1 
ATOM   4659 C CB  . THR B 1 62  ? 7.505   -76.947 -46.902 1.00 35.89  ? 63   THR B CB  1 
ATOM   4660 O OG1 . THR B 1 62  ? 7.990   -75.883 -47.714 1.00 31.85  ? 63   THR B OG1 1 
ATOM   4661 C CG2 . THR B 1 62  ? 6.521   -77.824 -47.725 1.00 27.77  ? 63   THR B CG2 1 
ATOM   4662 N N   . THR B 1 63  ? 7.784   -74.400 -44.527 1.00 30.71  ? 64   THR B N   1 
ATOM   4663 C CA  . THR B 1 63  ? 8.699   -73.753 -43.583 1.00 28.10  ? 64   THR B CA  1 
ATOM   4664 C C   . THR B 1 63  ? 8.016   -72.510 -43.054 1.00 30.70  ? 64   THR B C   1 
ATOM   4665 O O   . THR B 1 63  ? 7.123   -71.978 -43.719 1.00 26.44  ? 64   THR B O   1 
ATOM   4666 C CB  . THR B 1 63  ? 10.064  -73.365 -44.243 1.00 35.32  ? 64   THR B CB  1 
ATOM   4667 O OG1 . THR B 1 63  ? 11.051  -73.195 -43.231 1.00 36.24  ? 64   THR B OG1 1 
ATOM   4668 C CG2 . THR B 1 63  ? 9.959   -72.069 -45.008 1.00 31.71  ? 64   THR B CG2 1 
ATOM   4669 N N   . PHE B 1 64  ? 8.413   -72.058 -41.861 1.00 27.32  ? 65   PHE B N   1 
ATOM   4670 C CA  . PHE B 1 64  ? 7.910   -70.816 -41.312 1.00 32.23  ? 65   PHE B CA  1 
ATOM   4671 C C   . PHE B 1 64  ? 8.164   -69.653 -42.253 1.00 30.90  ? 65   PHE B C   1 
ATOM   4672 O O   . PHE B 1 64  ? 9.265   -69.503 -42.800 1.00 29.37  ? 65   PHE B O   1 
ATOM   4673 C CB  . PHE B 1 64  ? 8.563   -70.508 -39.954 1.00 30.65  ? 65   PHE B CB  1 
ATOM   4674 C CG  . PHE B 1 64  ? 8.155   -71.453 -38.859 1.00 29.16  ? 65   PHE B CG  1 
ATOM   4675 C CD1 . PHE B 1 64  ? 6.826   -71.521 -38.450 1.00 25.05  ? 65   PHE B CD1 1 
ATOM   4676 C CD2 . PHE B 1 64  ? 9.100   -72.255 -38.229 1.00 32.27  ? 65   PHE B CD2 1 
ATOM   4677 C CE1 . PHE B 1 64  ? 6.438   -72.384 -37.410 1.00 28.72  ? 65   PHE B CE1 1 
ATOM   4678 C CE2 . PHE B 1 64  ? 8.727   -73.136 -37.197 1.00 29.33  ? 65   PHE B CE2 1 
ATOM   4679 C CZ  . PHE B 1 64  ? 7.392   -73.198 -36.797 1.00 31.31  ? 65   PHE B CZ  1 
ATOM   4680 N N   . GLN B 1 65  ? 7.153   -68.811 -42.401 1.00 30.12  ? 66   GLN B N   1 
ATOM   4681 C CA  . GLN B 1 65  ? 7.307   -67.571 -43.141 1.00 29.11  ? 66   GLN B CA  1 
ATOM   4682 C C   . GLN B 1 65  ? 7.926   -66.463 -42.303 1.00 28.14  ? 66   GLN B C   1 
ATOM   4683 O O   . GLN B 1 65  ? 8.243   -66.668 -41.124 1.00 28.31  ? 66   GLN B O   1 
ATOM   4684 C CB  . GLN B 1 65  ? 5.950   -67.122 -43.684 1.00 28.75  ? 66   GLN B CB  1 
ATOM   4685 C CG  . GLN B 1 65  ? 5.775   -67.472 -45.165 1.00 30.61  ? 66   GLN B CG  1 
ATOM   4686 C CD  . GLN B 1 65  ? 6.457   -66.463 -46.039 1.00 36.04  ? 66   GLN B CD  1 
ATOM   4687 O OE1 . GLN B 1 65  ? 7.189   -65.600 -45.548 1.00 37.32  ? 66   GLN B OE1 1 
ATOM   4688 N NE2 . GLN B 1 65  ? 6.212   -66.542 -47.348 1.00 34.03  ? 66   GLN B NE2 1 
ATOM   4689 N N   . SER B 1 66  ? 8.030   -65.274 -42.901 1.00 25.30  ? 67   SER B N   1 
ATOM   4690 C CA  . SER B 1 66  ? 8.733   -64.147 -42.289 1.00 34.77  ? 67   SER B CA  1 
ATOM   4691 C C   . SER B 1 66  ? 8.108   -63.686 -40.972 1.00 30.07  ? 67   SER B C   1 
ATOM   4692 O O   . SER B 1 66  ? 6.911   -63.843 -40.758 1.00 27.54  ? 67   SER B O   1 
ATOM   4693 C CB  . SER B 1 66  ? 8.794   -62.958 -43.269 1.00 29.16  ? 67   SER B CB  1 
ATOM   4694 O OG  . SER B 1 66  ? 9.422   -63.294 -44.497 1.00 32.92  ? 67   SER B OG  1 
ATOM   4695 N N   . VAL B 1 67  ? 8.944   -63.106 -40.115 1.00 29.57  ? 68   VAL B N   1 
ATOM   4696 C CA  . VAL B 1 67  ? 8.526   -62.427 -38.887 1.00 32.62  ? 68   VAL B CA  1 
ATOM   4697 C C   . VAL B 1 67  ? 7.977   -61.021 -39.205 1.00 35.50  ? 68   VAL B C   1 
ATOM   4698 O O   . VAL B 1 67  ? 8.547   -60.308 -40.035 1.00 29.66  ? 68   VAL B O   1 
ATOM   4699 C CB  . VAL B 1 67  ? 9.715   -62.321 -37.915 1.00 32.36  ? 68   VAL B CB  1 
ATOM   4700 C CG1 . VAL B 1 67  ? 9.356   -61.530 -36.687 1.00 35.16  ? 68   VAL B CG1 1 
ATOM   4701 C CG2 . VAL B 1 67  ? 10.188  -63.705 -37.531 1.00 32.23  ? 68   VAL B CG2 1 
ATOM   4702 N N   . CYS B 1 68  ? 6.875   -60.614 -38.578 1.00 29.16  ? 69   CYS B N   1 
ATOM   4703 C CA  . CYS B 1 68  ? 6.358   -59.261 -38.829 1.00 30.19  ? 69   CYS B CA  1 
ATOM   4704 C C   . CYS B 1 68  ? 7.394   -58.271 -38.319 1.00 26.66  ? 69   CYS B C   1 
ATOM   4705 O O   . CYS B 1 68  ? 8.056   -58.549 -37.318 1.00 28.52  ? 69   CYS B O   1 
ATOM   4706 C CB  . CYS B 1 68  ? 4.993   -59.032 -38.147 1.00 24.95  ? 69   CYS B CB  1 
ATOM   4707 S SG  . CYS B 1 68  ? 3.680   -60.187 -38.660 1.00 31.73  ? 69   CYS B SG  1 
ATOM   4708 N N   . TYR B 1 69  ? 7.561   -57.143 -39.008 1.00 32.04  ? 70   TYR B N   1 
ATOM   4709 C CA  . TYR B 1 69  ? 8.550   -56.130 -38.597 1.00 30.22  ? 70   TYR B CA  1 
ATOM   4710 C C   . TYR B 1 69  ? 8.434   -55.766 -37.123 1.00 33.80  ? 70   TYR B C   1 
ATOM   4711 O O   . TYR B 1 69  ? 7.327   -55.553 -36.623 1.00 27.90  ? 70   TYR B O   1 
ATOM   4712 C CB  . TYR B 1 69  ? 8.402   -54.849 -39.435 1.00 32.62  ? 70   TYR B CB  1 
ATOM   4713 C CG  . TYR B 1 69  ? 9.378   -54.770 -40.582 1.00 33.19  ? 70   TYR B CG  1 
ATOM   4714 C CD1 . TYR B 1 69  ? 10.658  -54.245 -40.407 1.00 31.54  ? 70   TYR B CD1 1 
ATOM   4715 C CD2 . TYR B 1 69  ? 9.020   -55.221 -41.837 1.00 35.69  ? 70   TYR B CD2 1 
ATOM   4716 C CE1 . TYR B 1 69  ? 11.552  -54.196 -41.458 1.00 35.16  ? 70   TYR B CE1 1 
ATOM   4717 C CE2 . TYR B 1 69  ? 9.901   -55.167 -42.894 1.00 39.76  ? 70   TYR B CE2 1 
ATOM   4718 C CZ  . TYR B 1 69  ? 11.156  -54.648 -42.706 1.00 37.62  ? 70   TYR B CZ  1 
ATOM   4719 O OH  . TYR B 1 69  ? 12.010  -54.603 -43.784 1.00 51.98  ? 70   TYR B OH  1 
ATOM   4720 N N   . GLN B 1 70  ? 9.578   -55.691 -36.448 1.00 30.65  ? 71   GLN B N   1 
ATOM   4721 C CA  . GLN B 1 70  ? 9.623   -55.421 -35.020 1.00 30.55  ? 71   GLN B CA  1 
ATOM   4722 C C   . GLN B 1 70  ? 11.022  -55.001 -34.589 1.00 36.19  ? 71   GLN B C   1 
ATOM   4723 O O   . GLN B 1 70  ? 12.013  -55.337 -35.243 1.00 34.88  ? 71   GLN B O   1 
ATOM   4724 C CB  . GLN B 1 70  ? 9.197   -56.655 -34.216 1.00 29.72  ? 71   GLN B CB  1 
ATOM   4725 C CG  . GLN B 1 70  ? 10.023  -57.931 -34.507 1.00 31.76  ? 71   GLN B CG  1 
ATOM   4726 C CD  . GLN B 1 70  ? 9.385   -59.170 -33.922 1.00 29.42  ? 71   GLN B CD  1 
ATOM   4727 O OE1 . GLN B 1 70  ? 9.872   -59.730 -32.932 1.00 31.58  ? 71   GLN B OE1 1 
ATOM   4728 N NE2 . GLN B 1 70  ? 8.267   -59.595 -34.513 1.00 25.53  ? 71   GLN B NE2 1 
ATOM   4729 N N   . TYR B 1 71  ? 11.086  -54.264 -33.490 1.00 34.98  ? 72   TYR B N   1 
ATOM   4730 C CA  . TYR B 1 71  ? 12.343  -53.974 -32.821 1.00 38.28  ? 72   TYR B CA  1 
ATOM   4731 C C   . TYR B 1 71  ? 13.055  -55.267 -32.410 1.00 39.99  ? 72   TYR B C   1 
ATOM   4732 O O   . TYR B 1 71  ? 12.420  -56.208 -31.949 1.00 37.05  ? 72   TYR B O   1 
ATOM   4733 C CB  . TYR B 1 71  ? 12.099  -53.091 -31.583 1.00 43.32  ? 72   TYR B CB  1 
ATOM   4734 C CG  . TYR B 1 71  ? 13.321  -52.935 -30.706 1.00 44.57  ? 72   TYR B CG  1 
ATOM   4735 C CD1 . TYR B 1 71  ? 14.346  -52.057 -31.061 1.00 45.21  ? 72   TYR B CD1 1 
ATOM   4736 C CD2 . TYR B 1 71  ? 13.458  -53.665 -29.524 1.00 44.77  ? 72   TYR B CD2 1 
ATOM   4737 C CE1 . TYR B 1 71  ? 15.481  -51.907 -30.266 1.00 46.58  ? 72   TYR B CE1 1 
ATOM   4738 C CE2 . TYR B 1 71  ? 14.590  -53.522 -28.718 1.00 49.43  ? 72   TYR B CE2 1 
ATOM   4739 C CZ  . TYR B 1 71  ? 15.603  -52.640 -29.100 1.00 48.30  ? 72   TYR B CZ  1 
ATOM   4740 O OH  . TYR B 1 71  ? 16.741  -52.501 -28.315 1.00 60.27  ? 72   TYR B OH  1 
ATOM   4741 N N   . VAL B 1 72  ? 14.374  -55.311 -32.562 1.00 39.72  ? 73   VAL B N   1 
ATOM   4742 C CA  . VAL B 1 72  ? 15.124  -56.503 -32.183 1.00 35.99  ? 73   VAL B CA  1 
ATOM   4743 C C   . VAL B 1 72  ? 15.973  -56.196 -30.950 1.00 43.74  ? 73   VAL B C   1 
ATOM   4744 O O   . VAL B 1 72  ? 16.812  -55.302 -30.975 1.00 47.31  ? 73   VAL B O   1 
ATOM   4745 C CB  . VAL B 1 72  ? 16.028  -57.006 -33.340 1.00 42.00  ? 73   VAL B CB  1 
ATOM   4746 C CG1 . VAL B 1 72  ? 16.879  -58.172 -32.876 1.00 43.07  ? 73   VAL B CG1 1 
ATOM   4747 C CG2 . VAL B 1 72  ? 15.179  -57.395 -34.567 1.00 35.87  ? 73   VAL B CG2 1 
ATOM   4748 N N   . ASP B 1 73  ? 15.738  -56.944 -29.879 1.00 42.04  ? 74   ASP B N   1 
ATOM   4749 C CA  . ASP B 1 73  ? 16.420  -56.768 -28.593 1.00 45.45  ? 74   ASP B CA  1 
ATOM   4750 C C   . ASP B 1 73  ? 17.939  -56.974 -28.689 1.00 47.03  ? 74   ASP B C   1 
ATOM   4751 O O   . ASP B 1 73  ? 18.397  -58.004 -29.172 1.00 45.77  ? 74   ASP B O   1 
ATOM   4752 C CB  . ASP B 1 73  ? 15.809  -57.738 -27.582 1.00 41.82  ? 74   ASP B CB  1 
ATOM   4753 C CG  . ASP B 1 73  ? 16.374  -57.585 -26.182 1.00 50.61  ? 74   ASP B CG  1 
ATOM   4754 O OD1 . ASP B 1 73  ? 17.149  -56.650 -25.905 1.00 55.26  ? 74   ASP B OD1 1 
ATOM   4755 O OD2 . ASP B 1 73  ? 16.018  -58.424 -25.332 1.00 63.90  ? 74   ASP B OD2 1 
ATOM   4756 N N   . THR B 1 74  ? 18.711  -55.998 -28.212 1.00 52.13  ? 75   THR B N   1 
ATOM   4757 C CA  . THR B 1 74  ? 20.172  -56.051 -28.292 1.00 49.50  ? 75   THR B CA  1 
ATOM   4758 C C   . THR B 1 74  ? 20.841  -55.850 -26.943 1.00 52.79  ? 75   THR B C   1 
ATOM   4759 O O   . THR B 1 74  ? 22.048  -55.620 -26.880 1.00 59.06  ? 75   THR B O   1 
ATOM   4760 C CB  . THR B 1 74  ? 20.739  -54.975 -29.248 1.00 52.85  ? 75   THR B CB  1 
ATOM   4761 O OG1 . THR B 1 74  ? 20.262  -53.687 -28.844 1.00 54.45  ? 75   THR B OG1 1 
ATOM   4762 C CG2 . THR B 1 74  ? 20.331  -55.240 -30.689 1.00 52.22  ? 75   THR B CG2 1 
ATOM   4763 N N   . LEU B 1 75  ? 20.065  -55.936 -25.869 1.00 50.27  ? 76   LEU B N   1 
ATOM   4764 C CA  . LEU B 1 75  ? 20.585  -55.668 -24.526 1.00 54.83  ? 76   LEU B CA  1 
ATOM   4765 C C   . LEU B 1 75  ? 21.753  -56.582 -24.154 1.00 59.12  ? 76   LEU B C   1 
ATOM   4766 O O   . LEU B 1 75  ? 22.806  -56.104 -23.705 1.00 59.66  ? 76   LEU B O   1 
ATOM   4767 C CB  . LEU B 1 75  ? 19.476  -55.805 -23.481 1.00 59.96  ? 76   LEU B CB  1 
ATOM   4768 C CG  . LEU B 1 75  ? 19.808  -55.242 -22.091 1.00 63.29  ? 76   LEU B CG  1 
ATOM   4769 C CD1 . LEU B 1 75  ? 20.334  -53.804 -22.198 1.00 52.00  ? 76   LEU B CD1 1 
ATOM   4770 C CD2 . LEU B 1 75  ? 18.578  -55.304 -21.193 1.00 61.42  ? 76   LEU B CD2 1 
ATOM   4771 N N   . TYR B 1 76  ? 21.565  -57.889 -24.326 1.00 51.27  ? 77   TYR B N   1 
ATOM   4772 C CA  . TYR B 1 76  ? 22.657  -58.835 -24.085 1.00 53.34  ? 77   TYR B CA  1 
ATOM   4773 C C   . TYR B 1 76  ? 22.950  -59.658 -25.329 1.00 51.74  ? 77   TYR B C   1 
ATOM   4774 O O   . TYR B 1 76  ? 22.489  -60.793 -25.429 1.00 49.07  ? 77   TYR B O   1 
ATOM   4775 C CB  . TYR B 1 76  ? 22.329  -59.769 -22.931 1.00 51.94  ? 77   TYR B CB  1 
ATOM   4776 C CG  . TYR B 1 76  ? 22.108  -59.082 -21.611 1.00 58.51  ? 77   TYR B CG  1 
ATOM   4777 C CD1 . TYR B 1 76  ? 23.181  -58.631 -20.848 1.00 57.61  ? 77   TYR B CD1 1 
ATOM   4778 C CD2 . TYR B 1 76  ? 20.824  -58.905 -21.109 1.00 57.90  ? 77   TYR B CD2 1 
ATOM   4779 C CE1 . TYR B 1 76  ? 22.978  -58.013 -19.627 1.00 60.10  ? 77   TYR B CE1 1 
ATOM   4780 C CE2 . TYR B 1 76  ? 20.609  -58.285 -19.892 1.00 65.48  ? 77   TYR B CE2 1 
ATOM   4781 C CZ  . TYR B 1 76  ? 21.686  -57.841 -19.152 1.00 61.04  ? 77   TYR B CZ  1 
ATOM   4782 O OH  . TYR B 1 76  ? 21.456  -57.223 -17.942 1.00 53.67  ? 77   TYR B OH  1 
ATOM   4783 N N   . PRO B 1 77  ? 23.717  -59.086 -26.281 1.00 54.70  ? 78   PRO B N   1 
ATOM   4784 C CA  . PRO B 1 77  ? 23.976  -59.703 -27.592 1.00 56.22  ? 78   PRO B CA  1 
ATOM   4785 C C   . PRO B 1 77  ? 24.597  -61.091 -27.488 1.00 56.19  ? 78   PRO B C   1 
ATOM   4786 O O   . PRO B 1 77  ? 25.582  -61.272 -26.777 1.00 56.62  ? 78   PRO B O   1 
ATOM   4787 C CB  . PRO B 1 77  ? 24.954  -58.723 -28.265 1.00 55.89  ? 78   PRO B CB  1 
ATOM   4788 C CG  . PRO B 1 77  ? 24.740  -57.426 -27.576 1.00 62.03  ? 78   PRO B CG  1 
ATOM   4789 C CD  . PRO B 1 77  ? 24.390  -57.781 -26.143 1.00 53.22  ? 78   PRO B CD  1 
ATOM   4790 N N   . GLY B 1 78  ? 24.020  -62.059 -28.196 1.00 56.28  ? 79   GLY B N   1 
ATOM   4791 C CA  . GLY B 1 78  ? 24.552  -63.409 -28.202 1.00 52.53  ? 79   GLY B CA  1 
ATOM   4792 C C   . GLY B 1 78  ? 24.066  -64.243 -27.034 1.00 51.99  ? 79   GLY B C   1 
ATOM   4793 O O   . GLY B 1 78  ? 24.206  -65.460 -27.031 1.00 52.99  ? 79   GLY B O   1 
ATOM   4794 N N   . PHE B 1 79  ? 23.479  -63.589 -26.037 1.00 52.78  ? 80   PHE B N   1 
ATOM   4795 C CA  . PHE B 1 79  ? 22.998  -64.291 -24.860 1.00 45.80  ? 80   PHE B CA  1 
ATOM   4796 C C   . PHE B 1 79  ? 21.685  -65.034 -25.148 1.00 45.77  ? 80   PHE B C   1 
ATOM   4797 O O   . PHE B 1 79  ? 20.747  -64.449 -25.691 1.00 49.11  ? 80   PHE B O   1 
ATOM   4798 C CB  . PHE B 1 79  ? 22.824  -63.302 -23.716 1.00 45.83  ? 80   PHE B CB  1 
ATOM   4799 C CG  . PHE B 1 79  ? 22.218  -63.897 -22.490 1.00 40.87  ? 80   PHE B CG  1 
ATOM   4800 C CD1 . PHE B 1 79  ? 22.850  -64.933 -21.824 1.00 45.05  ? 80   PHE B CD1 1 
ATOM   4801 C CD2 . PHE B 1 79  ? 21.027  -63.400 -21.982 1.00 44.03  ? 80   PHE B CD2 1 
ATOM   4802 C CE1 . PHE B 1 79  ? 22.293  -65.484 -20.672 1.00 45.99  ? 80   PHE B CE1 1 
ATOM   4803 C CE2 . PHE B 1 79  ? 20.465  -63.939 -20.831 1.00 40.12  ? 80   PHE B CE2 1 
ATOM   4804 C CZ  . PHE B 1 79  ? 21.098  -64.984 -20.178 1.00 46.35  ? 80   PHE B CZ  1 
ATOM   4805 N N   . GLU B 1 80  ? 21.615  -66.314 -24.791 1.00 42.07  ? 81   GLU B N   1 
ATOM   4806 C CA  . GLU B 1 80  ? 20.438  -67.120 -25.131 1.00 47.77  ? 81   GLU B CA  1 
ATOM   4807 C C   . GLU B 1 80  ? 19.148  -66.568 -24.553 1.00 50.02  ? 81   GLU B C   1 
ATOM   4808 O O   . GLU B 1 80  ? 18.097  -66.609 -25.203 1.00 44.71  ? 81   GLU B O   1 
ATOM   4809 C CB  . GLU B 1 80  ? 20.586  -68.568 -24.663 1.00 53.18  ? 81   GLU B CB  1 
ATOM   4810 C CG  . GLU B 1 80  ? 19.639  -69.506 -25.415 1.00 74.13  ? 81   GLU B CG  1 
ATOM   4811 C CD  . GLU B 1 80  ? 18.972  -70.531 -24.518 1.00 80.22  ? 81   GLU B CD  1 
ATOM   4812 O OE1 . GLU B 1 80  ? 19.566  -70.857 -23.463 1.00 88.82  ? 81   GLU B OE1 1 
ATOM   4813 O OE2 . GLU B 1 80  ? 17.854  -71.004 -24.866 1.00 84.08  ? 81   GLU B OE2 1 
ATOM   4814 N N   . GLY B 1 81  ? 19.229  -66.059 -23.328 1.00 42.42  ? 82   GLY B N   1 
ATOM   4815 C CA  . GLY B 1 81  ? 18.050  -65.614 -22.624 1.00 37.72  ? 82   GLY B CA  1 
ATOM   4816 C C   . GLY B 1 81  ? 17.305  -64.522 -23.341 1.00 45.36  ? 82   GLY B C   1 
ATOM   4817 O O   . GLY B 1 81  ? 16.097  -64.388 -23.169 1.00 45.15  ? 82   GLY B O   1 
ATOM   4818 N N   . THR B 1 82  ? 18.014  -63.747 -24.156 1.00 40.99  ? 83   THR B N   1 
ATOM   4819 C CA  . THR B 1 82  ? 17.365  -62.745 -24.969 1.00 42.09  ? 83   THR B CA  1 
ATOM   4820 C C   . THR B 1 82  ? 17.160  -63.201 -26.429 1.00 47.53  ? 83   THR B C   1 
ATOM   4821 O O   . THR B 1 82  ? 16.104  -62.932 -26.992 1.00 43.54  ? 83   THR B O   1 
ATOM   4822 C CB  . THR B 1 82  ? 18.152  -61.429 -24.948 1.00 45.75  ? 83   THR B CB  1 
ATOM   4823 O OG1 . THR B 1 82  ? 19.494  -61.683 -25.348 1.00 48.03  ? 83   THR B OG1 1 
ATOM   4824 C CG2 . THR B 1 82  ? 18.177  -60.853 -23.558 1.00 50.64  ? 83   THR B CG2 1 
ATOM   4825 N N   . GLU B 1 83  ? 18.140  -63.892 -27.031 1.00 46.03  ? 84   GLU B N   1 
ATOM   4826 C CA  . GLU B 1 83  ? 18.052  -64.272 -28.457 1.00 45.23  ? 84   GLU B CA  1 
ATOM   4827 C C   . GLU B 1 83  ? 16.949  -65.291 -28.730 1.00 36.83  ? 84   GLU B C   1 
ATOM   4828 O O   . GLU B 1 83  ? 16.394  -65.335 -29.832 1.00 36.50  ? 84   GLU B O   1 
ATOM   4829 C CB  . GLU B 1 83  ? 19.376  -64.841 -28.995 1.00 37.94  ? 84   GLU B CB  1 
ATOM   4830 C CG  . GLU B 1 83  ? 20.600  -63.926 -28.876 1.00 56.56  ? 84   GLU B CG  1 
ATOM   4831 C CD  . GLU B 1 83  ? 20.491  -62.624 -29.667 1.00 58.31  ? 84   GLU B CD  1 
ATOM   4832 O OE1 . GLU B 1 83  ? 19.553  -62.473 -30.483 1.00 58.47  ? 84   GLU B OE1 1 
ATOM   4833 O OE2 . GLU B 1 83  ? 21.358  -61.742 -29.470 1.00 60.54  ? 84   GLU B OE2 1 
ATOM   4834 N N   . MET B 1 84  ? 16.620  -66.105 -27.736 1.00 33.78  ? 85   MET B N   1 
ATOM   4835 C CA  . MET B 1 84  ? 15.509  -67.039 -27.900 1.00 28.00  ? 85   MET B CA  1 
ATOM   4836 C C   . MET B 1 84  ? 14.167  -66.327 -28.186 1.00 37.02  ? 85   MET B C   1 
ATOM   4837 O O   . MET B 1 84  ? 13.230  -66.974 -28.653 1.00 35.12  ? 85   MET B O   1 
ATOM   4838 C CB  . MET B 1 84  ? 15.379  -67.922 -26.672 1.00 32.65  ? 85   MET B CB  1 
ATOM   4839 C CG  . MET B 1 84  ? 14.900  -67.170 -25.434 1.00 38.25  ? 85   MET B CG  1 
ATOM   4840 S SD  . MET B 1 84  ? 14.834  -68.257 -24.024 1.00 41.02  ? 85   MET B SD  1 
ATOM   4841 C CE  . MET B 1 84  ? 13.333  -69.185 -24.373 1.00 37.98  ? 85   MET B CE  1 
ATOM   4842 N N   . TRP B 1 85  ? 14.074  -65.011 -27.945 1.00 35.23  ? 86   TRP B N   1 
ATOM   4843 C CA  . TRP B 1 85  ? 12.833  -64.261 -28.214 1.00 27.28  ? 86   TRP B CA  1 
ATOM   4844 C C   . TRP B 1 85  ? 12.901  -63.407 -29.477 1.00 32.59  ? 86   TRP B C   1 
ATOM   4845 O O   . TRP B 1 85  ? 11.907  -62.813 -29.881 1.00 35.35  ? 86   TRP B O   1 
ATOM   4846 C CB  . TRP B 1 85  ? 12.475  -63.371 -27.013 1.00 29.61  ? 86   TRP B CB  1 
ATOM   4847 C CG  . TRP B 1 85  ? 12.435  -64.130 -25.712 1.00 32.33  ? 86   TRP B CG  1 
ATOM   4848 C CD1 . TRP B 1 85  ? 13.313  -64.019 -24.675 1.00 33.82  ? 86   TRP B CD1 1 
ATOM   4849 C CD2 . TRP B 1 85  ? 11.478  -65.128 -25.319 1.00 31.32  ? 86   TRP B CD2 1 
ATOM   4850 N NE1 . TRP B 1 85  ? 12.954  -64.862 -23.649 1.00 33.24  ? 86   TRP B NE1 1 
ATOM   4851 C CE2 . TRP B 1 85  ? 11.836  -65.561 -24.020 1.00 36.18  ? 86   TRP B CE2 1 
ATOM   4852 C CE3 . TRP B 1 85  ? 10.359  -65.697 -25.935 1.00 32.24  ? 86   TRP B CE3 1 
ATOM   4853 C CZ2 . TRP B 1 85  ? 11.117  -66.540 -23.330 1.00 31.85  ? 86   TRP B CZ2 1 
ATOM   4854 C CZ3 . TRP B 1 85  ? 9.641   -66.668 -25.248 1.00 30.27  ? 86   TRP B CZ3 1 
ATOM   4855 C CH2 . TRP B 1 85  ? 10.019  -67.074 -23.954 1.00 31.72  ? 86   TRP B CH2 1 
ATOM   4856 N N   . ASN B 1 86  ? 14.079  -63.331 -30.084 1.00 30.45  ? 87   ASN B N   1 
ATOM   4857 C CA  . ASN B 1 86  ? 14.303  -62.505 -31.257 1.00 34.84  ? 87   ASN B CA  1 
ATOM   4858 C C   . ASN B 1 86  ? 13.896  -63.214 -32.542 1.00 33.35  ? 87   ASN B C   1 
ATOM   4859 O O   . ASN B 1 86  ? 13.857  -64.437 -32.579 1.00 32.73  ? 87   ASN B O   1 
ATOM   4860 C CB  . ASN B 1 86  ? 15.779  -62.097 -31.330 1.00 39.88  ? 87   ASN B CB  1 
ATOM   4861 C CG  . ASN B 1 86  ? 16.111  -60.914 -30.426 1.00 46.71  ? 87   ASN B CG  1 
ATOM   4862 O OD1 . ASN B 1 86  ? 15.232  -60.131 -30.035 1.00 41.39  ? 87   ASN B OD1 1 
ATOM   4863 N ND2 . ASN B 1 86  ? 17.397  -60.763 -30.115 1.00 43.03  ? 87   ASN B ND2 1 
ATOM   4864 N N   . PRO B 1 87  ? 13.596  -62.449 -33.603 1.00 34.12  ? 88   PRO B N   1 
ATOM   4865 C CA  . PRO B 1 87  ? 13.187  -63.059 -34.880 1.00 34.43  ? 88   PRO B CA  1 
ATOM   4866 C C   . PRO B 1 87  ? 14.171  -64.113 -35.381 1.00 39.59  ? 88   PRO B C   1 
ATOM   4867 O O   . PRO B 1 87  ? 15.374  -63.887 -35.352 1.00 35.90  ? 88   PRO B O   1 
ATOM   4868 C CB  . PRO B 1 87  ? 13.159  -61.872 -35.843 1.00 31.47  ? 88   PRO B CB  1 
ATOM   4869 C CG  . PRO B 1 87  ? 12.843  -60.697 -34.963 1.00 32.69  ? 88   PRO B CG  1 
ATOM   4870 C CD  . PRO B 1 87  ? 13.562  -60.972 -33.658 1.00 37.77  ? 88   PRO B CD  1 
ATOM   4871 N N   . ASN B 1 88  ? 13.660  -65.250 -35.828 1.00 37.00  ? 89   ASN B N   1 
ATOM   4872 C CA  . ASN B 1 88  ? 14.508  -66.286 -36.413 1.00 37.47  ? 89   ASN B CA  1 
ATOM   4873 C C   . ASN B 1 88  ? 14.157  -66.537 -37.870 1.00 40.29  ? 89   ASN B C   1 
ATOM   4874 O O   . ASN B 1 88  ? 14.454  -67.601 -38.429 1.00 43.27  ? 89   ASN B O   1 
ATOM   4875 C CB  . ASN B 1 88  ? 14.380  -67.585 -35.619 1.00 37.24  ? 89   ASN B CB  1 
ATOM   4876 C CG  . ASN B 1 88  ? 12.986  -68.153 -35.681 1.00 37.94  ? 89   ASN B CG  1 
ATOM   4877 O OD1 . ASN B 1 88  ? 12.026  -67.448 -36.021 1.00 34.65  ? 89   ASN B OD1 1 
ATOM   4878 N ND2 . ASN B 1 88  ? 12.858  -69.431 -35.362 1.00 37.57  ? 89   ASN B ND2 1 
ATOM   4879 N N   . ARG B 1 89  ? 13.453  -65.574 -38.452 1.00 33.69  ? 90   ARG B N   1 
ATOM   4880 C CA  . ARG B 1 89  ? 13.275  -65.492 -39.895 1.00 34.48  ? 90   ARG B CA  1 
ATOM   4881 C C   . ARG B 1 89  ? 13.489  -64.043 -40.224 1.00 41.13  ? 90   ARG B C   1 
ATOM   4882 O O   . ARG B 1 89  ? 13.545  -63.217 -39.322 1.00 35.28  ? 90   ARG B O   1 
ATOM   4883 C CB  . ARG B 1 89  ? 11.890  -65.938 -40.348 1.00 34.80  ? 90   ARG B CB  1 
ATOM   4884 C CG  . ARG B 1 89  ? 11.640  -67.414 -40.230 1.00 42.59  ? 90   ARG B CG  1 
ATOM   4885 C CD  . ARG B 1 89  ? 12.371  -68.172 -41.339 1.00 40.02  ? 90   ARG B CD  1 
ATOM   4886 N NE  . ARG B 1 89  ? 11.978  -69.575 -41.375 1.00 45.65  ? 90   ARG B NE  1 
ATOM   4887 C CZ  . ARG B 1 89  ? 12.437  -70.496 -40.534 1.00 42.32  ? 90   ARG B CZ  1 
ATOM   4888 N NH1 . ARG B 1 89  ? 13.308  -70.172 -39.594 1.00 40.92  ? 90   ARG B NH1 1 
ATOM   4889 N NH2 . ARG B 1 89  ? 12.022  -71.755 -40.638 1.00 51.92  ? 90   ARG B NH2 1 
ATOM   4890 N N   . GLU B 1 90  ? 13.597  -63.719 -41.503 1.00 39.19  ? 91   GLU B N   1 
ATOM   4891 C CA  . GLU B 1 90  ? 13.787  -62.336 -41.890 1.00 37.31  ? 91   GLU B CA  1 
ATOM   4892 C C   . GLU B 1 90  ? 12.525  -61.529 -41.562 1.00 38.11  ? 91   GLU B C   1 
ATOM   4893 O O   . GLU B 1 90  ? 11.414  -62.080 -41.494 1.00 31.64  ? 91   GLU B O   1 
ATOM   4894 C CB  . GLU B 1 90  ? 14.122  -62.236 -43.384 1.00 32.55  ? 91   GLU B CB  1 
ATOM   4895 C CG  . GLU B 1 90  ? 12.921  -62.460 -44.258 1.00 43.30  ? 91   GLU B CG  1 
ATOM   4896 C CD  . GLU B 1 90  ? 13.161  -62.035 -45.694 1.00 66.02  ? 91   GLU B CD  1 
ATOM   4897 O OE1 . GLU B 1 90  ? 14.339  -62.044 -46.139 1.00 63.52  ? 91   GLU B OE1 1 
ATOM   4898 O OE2 . GLU B 1 90  ? 12.165  -61.676 -46.370 1.00 63.26  ? 91   GLU B OE2 1 
ATOM   4899 N N   . LEU B 1 91  ? 12.707  -60.226 -41.355 1.00 29.41  ? 92   LEU B N   1 
ATOM   4900 C CA  . LEU B 1 91  ? 11.587  -59.324 -41.156 1.00 32.61  ? 92   LEU B CA  1 
ATOM   4901 C C   . LEU B 1 91  ? 10.895  -58.960 -42.482 1.00 37.13  ? 92   LEU B C   1 
ATOM   4902 O O   . LEU B 1 91  ? 11.550  -58.661 -43.481 1.00 37.52  ? 92   LEU B O   1 
ATOM   4903 C CB  . LEU B 1 91  ? 12.045  -58.048 -40.448 1.00 35.13  ? 92   LEU B CB  1 
ATOM   4904 C CG  . LEU B 1 91  ? 12.814  -58.172 -39.139 1.00 38.60  ? 92   LEU B CG  1 
ATOM   4905 C CD1 . LEU B 1 91  ? 13.166  -56.789 -38.602 1.00 33.91  ? 92   LEU B CD1 1 
ATOM   4906 C CD2 . LEU B 1 91  ? 12.006  -58.952 -38.128 1.00 32.84  ? 92   LEU B CD2 1 
ATOM   4907 N N   . SER B 1 92  ? 9.565   -58.966 -42.477 1.00 34.64  ? 93   SER B N   1 
ATOM   4908 C CA  . SER B 1 92  ? 8.819   -58.505 -43.621 1.00 33.02  ? 93   SER B CA  1 
ATOM   4909 C C   . SER B 1 92  ? 7.434   -58.042 -43.190 1.00 36.38  ? 93   SER B C   1 
ATOM   4910 O O   . SER B 1 92  ? 6.883   -58.565 -42.236 1.00 32.97  ? 93   SER B O   1 
ATOM   4911 C CB  . SER B 1 92  ? 8.710   -59.626 -44.648 1.00 28.41  ? 93   SER B CB  1 
ATOM   4912 O OG  . SER B 1 92  ? 7.929   -59.221 -45.742 1.00 33.13  ? 93   SER B OG  1 
ATOM   4913 N N   . GLU B 1 93  ? 6.859   -57.081 -43.904 1.00 30.75  ? 94   GLU B N   1 
ATOM   4914 C CA  . GLU B 1 93  ? 5.460   -56.745 -43.702 1.00 32.11  ? 94   GLU B CA  1 
ATOM   4915 C C   . GLU B 1 93  ? 4.580   -57.859 -44.262 1.00 36.51  ? 94   GLU B C   1 
ATOM   4916 O O   . GLU B 1 93  ? 3.428   -58.013 -43.870 1.00 30.04  ? 94   GLU B O   1 
ATOM   4917 C CB  . GLU B 1 93  ? 5.104   -55.401 -44.358 1.00 34.01  ? 94   GLU B CB  1 
ATOM   4918 C CG  . GLU B 1 93  ? 5.621   -54.180 -43.573 1.00 34.02  ? 94   GLU B CG  1 
ATOM   4919 C CD  . GLU B 1 93  ? 5.088   -52.874 -44.150 1.00 42.67  ? 94   GLU B CD  1 
ATOM   4920 O OE1 . GLU B 1 93  ? 3.975   -52.442 -43.752 1.00 35.00  ? 94   GLU B OE1 1 
ATOM   4921 O OE2 . GLU B 1 93  ? 5.770   -52.300 -45.027 1.00 38.07  ? 94   GLU B OE2 1 
ATOM   4922 N N   . ASP B 1 94  ? 5.141   -58.629 -45.187 1.00 30.59  ? 95   ASP B N   1 
ATOM   4923 C CA  . ASP B 1 94  ? 4.502   -59.827 -45.717 1.00 28.49  ? 95   ASP B CA  1 
ATOM   4924 C C   . ASP B 1 94  ? 4.691   -60.970 -44.701 1.00 32.34  ? 95   ASP B C   1 
ATOM   4925 O O   . ASP B 1 94  ? 5.588   -61.789 -44.848 1.00 28.26  ? 95   ASP B O   1 
ATOM   4926 C CB  . ASP B 1 94  ? 5.105   -60.152 -47.100 1.00 28.72  ? 95   ASP B CB  1 
ATOM   4927 C CG  . ASP B 1 94  ? 4.432   -61.340 -47.791 1.00 29.90  ? 95   ASP B CG  1 
ATOM   4928 O OD1 . ASP B 1 94  ? 3.461   -61.908 -47.255 1.00 32.36  ? 95   ASP B OD1 1 
ATOM   4929 O OD2 . ASP B 1 94  ? 4.874   -61.701 -48.903 1.00 40.38  ? 95   ASP B OD2 1 
ATOM   4930 N N   . CYS B 1 95  ? 3.861   -60.992 -43.653 1.00 32.39  ? 96   CYS B N   1 
ATOM   4931 C CA  . CYS B 1 95  ? 4.031   -61.923 -42.537 1.00 31.38  ? 96   CYS B CA  1 
ATOM   4932 C C   . CYS B 1 95  ? 2.752   -62.585 -42.062 1.00 27.50  ? 96   CYS B C   1 
ATOM   4933 O O   . CYS B 1 95  ? 2.769   -63.276 -41.034 1.00 27.24  ? 96   CYS B O   1 
ATOM   4934 C CB  . CYS B 1 95  ? 4.661   -61.221 -41.325 1.00 28.98  ? 96   CYS B CB  1 
ATOM   4935 S SG  . CYS B 1 95  ? 3.637   -59.814 -40.679 1.00 29.51  ? 96   CYS B SG  1 
ATOM   4936 N N   . LEU B 1 96  ? 1.640   -62.388 -42.759 1.00 25.97  ? 97   LEU B N   1 
ATOM   4937 C CA  . LEU B 1 96  ? 0.392   -62.936 -42.207 1.00 24.84  ? 97   LEU B CA  1 
ATOM   4938 C C   . LEU B 1 96  ? 0.221   -64.398 -42.650 1.00 29.33  ? 97   LEU B C   1 
ATOM   4939 O O   . LEU B 1 96  ? -0.533  -64.707 -43.576 1.00 27.01  ? 97   LEU B O   1 
ATOM   4940 C CB  . LEU B 1 96  ? -0.827  -62.062 -42.594 1.00 23.56  ? 97   LEU B CB  1 
ATOM   4941 C CG  . LEU B 1 96  ? -0.797  -60.674 -41.904 1.00 30.27  ? 97   LEU B CG  1 
ATOM   4942 C CD1 . LEU B 1 96  ? -2.076  -59.854 -42.113 1.00 26.58  ? 97   LEU B CD1 1 
ATOM   4943 C CD2 . LEU B 1 96  ? -0.515  -60.798 -40.386 1.00 25.74  ? 97   LEU B CD2 1 
ATOM   4944 N N   . TYR B 1 97  ? 0.912   -65.293 -41.943 1.00 26.72  ? 98   TYR B N   1 
ATOM   4945 C CA  . TYR B 1 97  ? 0.877   -66.729 -42.211 1.00 22.97  ? 98   TYR B CA  1 
ATOM   4946 C C   . TYR B 1 97  ? 0.598   -67.473 -40.917 1.00 32.95  ? 98   TYR B C   1 
ATOM   4947 O O   . TYR B 1 97  ? 0.984   -67.002 -39.843 1.00 27.66  ? 98   TYR B O   1 
ATOM   4948 C CB  . TYR B 1 97  ? 2.217   -67.202 -42.811 1.00 25.22  ? 98   TYR B CB  1 
ATOM   4949 C CG  . TYR B 1 97  ? 2.535   -66.503 -44.133 1.00 27.11  ? 98   TYR B CG  1 
ATOM   4950 C CD1 . TYR B 1 97  ? 3.147   -65.255 -44.140 1.00 26.94  ? 98   TYR B CD1 1 
ATOM   4951 C CD2 . TYR B 1 97  ? 2.179   -67.077 -45.363 1.00 28.66  ? 98   TYR B CD2 1 
ATOM   4952 C CE1 . TYR B 1 97  ? 3.418   -64.584 -45.313 1.00 26.62  ? 98   TYR B CE1 1 
ATOM   4953 C CE2 . TYR B 1 97  ? 2.467   -66.408 -46.586 1.00 31.22  ? 98   TYR B CE2 1 
ATOM   4954 C CZ  . TYR B 1 97  ? 3.093   -65.159 -46.529 1.00 33.16  ? 98   TYR B CZ  1 
ATOM   4955 O OH  . TYR B 1 97  ? 3.393   -64.445 -47.657 1.00 32.08  ? 98   TYR B OH  1 
ATOM   4956 N N   . LEU B 1 98  ? -0.043  -68.637 -41.019 1.00 27.22  ? 99   LEU B N   1 
ATOM   4957 C CA  . LEU B 1 98  ? -0.264  -69.478 -39.856 1.00 29.30  ? 99   LEU B CA  1 
ATOM   4958 C C   . LEU B 1 98  ? 0.262   -70.894 -40.111 1.00 34.55  ? 99   LEU B C   1 
ATOM   4959 O O   . LEU B 1 98  ? 0.617   -71.270 -41.247 1.00 31.25  ? 99   LEU B O   1 
ATOM   4960 C CB  . LEU B 1 98  ? -1.762  -69.483 -39.466 1.00 29.71  ? 99   LEU B CB  1 
ATOM   4961 C CG  . LEU B 1 98  ? -2.861  -69.905 -40.454 1.00 28.98  ? 99   LEU B CG  1 
ATOM   4962 C CD1 . LEU B 1 98  ? -2.937  -71.421 -40.642 1.00 26.06  ? 99   LEU B CD1 1 
ATOM   4963 C CD2 . LEU B 1 98  ? -4.199  -69.343 -40.041 1.00 26.93  ? 99   LEU B CD2 1 
ATOM   4964 N N   . ASN B 1 99  ? 0.312   -71.664 -39.033 1.00 32.06  ? 100  ASN B N   1 
ATOM   4965 C CA  . ASN B 1 99  ? 0.914   -72.992 -38.997 1.00 30.79  ? 100  ASN B CA  1 
ATOM   4966 C C   . ASN B 1 99  ? -0.045  -73.994 -38.400 1.00 32.10  ? 100  ASN B C   1 
ATOM   4967 O O   . ASN B 1 99  ? -0.674  -73.699 -37.391 1.00 29.51  ? 100  ASN B O   1 
ATOM   4968 C CB  . ASN B 1 99  ? 2.194   -72.966 -38.167 1.00 24.63  ? 100  ASN B CB  1 
ATOM   4969 C CG  . ASN B 1 99  ? 3.058   -71.741 -38.487 1.00 33.22  ? 100  ASN B CG  1 
ATOM   4970 O OD1 . ASN B 1 99  ? 3.555   -71.609 -39.597 1.00 30.23  ? 100  ASN B OD1 1 
ATOM   4971 N ND2 . ASN B 1 99  ? 3.216   -70.835 -37.522 1.00 27.14  ? 100  ASN B ND2 1 
ATOM   4972 N N   . VAL B 1 100 ? -0.155  -75.175 -39.003 1.00 30.85  ? 101  VAL B N   1 
ATOM   4973 C CA  . VAL B 1 100 ? -0.953  -76.266 -38.433 1.00 29.96  ? 101  VAL B CA  1 
ATOM   4974 C C   . VAL B 1 100 ? -0.091  -77.494 -38.241 1.00 33.20  ? 101  VAL B C   1 
ATOM   4975 O O   . VAL B 1 100 ? 0.606   -77.920 -39.163 1.00 33.55  ? 101  VAL B O   1 
ATOM   4976 C CB  . VAL B 1 100 ? -2.157  -76.629 -39.327 1.00 32.24  ? 101  VAL B CB  1 
ATOM   4977 C CG1 . VAL B 1 100 ? -2.974  -77.793 -38.718 1.00 29.24  ? 101  VAL B CG1 1 
ATOM   4978 C CG2 . VAL B 1 100 ? -3.019  -75.401 -39.571 1.00 28.03  ? 101  VAL B CG2 1 
ATOM   4979 N N   . TRP B 1 101 ? -0.105  -78.050 -37.036 1.00 29.92  ? 102  TRP B N   1 
ATOM   4980 C CA  . TRP B 1 101 ? 0.541   -79.325 -36.784 1.00 26.96  ? 102  TRP B CA  1 
ATOM   4981 C C   . TRP B 1 101 ? -0.556  -80.333 -36.506 1.00 37.49  ? 102  TRP B C   1 
ATOM   4982 O O   . TRP B 1 101 ? -1.508  -80.029 -35.782 1.00 31.23  ? 102  TRP B O   1 
ATOM   4983 C CB  . TRP B 1 101 ? 1.480   -79.272 -35.589 1.00 31.56  ? 102  TRP B CB  1 
ATOM   4984 C CG  . TRP B 1 101 ? 2.767   -78.532 -35.739 1.00 29.64  ? 102  TRP B CG  1 
ATOM   4985 C CD1 . TRP B 1 101 ? 3.971   -79.069 -36.060 1.00 26.84  ? 102  TRP B CD1 1 
ATOM   4986 C CD2 . TRP B 1 101 ? 3.000   -77.132 -35.487 1.00 30.77  ? 102  TRP B CD2 1 
ATOM   4987 N NE1 . TRP B 1 101 ? 4.948   -78.100 -36.027 1.00 28.71  ? 102  TRP B NE1 1 
ATOM   4988 C CE2 . TRP B 1 101 ? 4.377   -76.901 -35.675 1.00 29.73  ? 102  TRP B CE2 1 
ATOM   4989 C CE3 . TRP B 1 101 ? 2.183   -76.061 -35.093 1.00 30.16  ? 102  TRP B CE3 1 
ATOM   4990 C CZ2 . TRP B 1 101 ? 4.956   -75.635 -35.505 1.00 27.78  ? 102  TRP B CZ2 1 
ATOM   4991 C CZ3 . TRP B 1 101 ? 2.756   -74.812 -34.921 1.00 31.07  ? 102  TRP B CZ3 1 
ATOM   4992 C CH2 . TRP B 1 101 ? 4.128   -74.606 -35.114 1.00 26.58  ? 102  TRP B CH2 1 
ATOM   4993 N N   . THR B 1 102 ? -0.441  -81.528 -37.073 1.00 35.16  ? 103  THR B N   1 
ATOM   4994 C CA  . THR B 1 102 ? -1.495  -82.517 -36.908 1.00 31.05  ? 103  THR B CA  1 
ATOM   4995 C C   . THR B 1 102 ? -0.825  -83.889 -36.836 1.00 37.21  ? 103  THR B C   1 
ATOM   4996 O O   . THR B 1 102 ? 0.316   -84.041 -37.261 1.00 39.16  ? 103  THR B O   1 
ATOM   4997 C CB  . THR B 1 102 ? -2.563  -82.384 -38.039 1.00 35.98  ? 103  THR B CB  1 
ATOM   4998 O OG1 . THR B 1 102 ? -3.736  -83.142 -37.707 1.00 41.98  ? 103  THR B OG1 1 
ATOM   4999 C CG2 . THR B 1 102 ? -2.025  -82.811 -39.425 1.00 35.92  ? 103  THR B CG2 1 
ATOM   5000 N N   . PRO B 1 103 ? -1.474  -84.866 -36.190 1.00 37.07  ? 104  PRO B N   1 
ATOM   5001 C CA  . PRO B 1 103 ? -0.843  -86.192 -36.116 1.00 41.11  ? 104  PRO B CA  1 
ATOM   5002 C C   . PRO B 1 103 ? -0.670  -86.856 -37.487 1.00 41.64  ? 104  PRO B C   1 
ATOM   5003 O O   . PRO B 1 103 ? -1.427  -86.568 -38.431 1.00 39.22  ? 104  PRO B O   1 
ATOM   5004 C CB  . PRO B 1 103 ? -1.819  -87.002 -35.248 1.00 43.95  ? 104  PRO B CB  1 
ATOM   5005 C CG  . PRO B 1 103 ? -2.530  -85.969 -34.425 1.00 42.08  ? 104  PRO B CG  1 
ATOM   5006 C CD  . PRO B 1 103 ? -2.673  -84.771 -35.335 1.00 37.60  ? 104  PRO B CD  1 
ATOM   5007 N N   . TYR B 1 104 ? 0.341   -87.716 -37.587 1.00 46.20  ? 105  TYR B N   1 
ATOM   5008 C CA  . TYR B 1 104 ? 0.610   -88.501 -38.793 1.00 47.99  ? 105  TYR B CA  1 
ATOM   5009 C C   . TYR B 1 104 ? 0.406   -89.985 -38.485 1.00 50.97  ? 105  TYR B C   1 
ATOM   5010 O O   . TYR B 1 104 ? 1.180   -90.575 -37.745 1.00 49.57  ? 105  TYR B O   1 
ATOM   5011 C CB  . TYR B 1 104 ? 2.035   -88.251 -39.290 1.00 44.34  ? 105  TYR B CB  1 
ATOM   5012 C CG  . TYR B 1 104 ? 2.363   -88.823 -40.662 1.00 56.84  ? 105  TYR B CG  1 
ATOM   5013 C CD1 . TYR B 1 104 ? 2.415   -90.199 -40.877 1.00 57.10  ? 105  TYR B CD1 1 
ATOM   5014 C CD2 . TYR B 1 104 ? 2.662   -87.978 -41.731 1.00 54.81  ? 105  TYR B CD2 1 
ATOM   5015 C CE1 . TYR B 1 104 ? 2.728   -90.719 -42.117 1.00 53.10  ? 105  TYR B CE1 1 
ATOM   5016 C CE2 . TYR B 1 104 ? 2.977   -88.485 -42.982 1.00 60.01  ? 105  TYR B CE2 1 
ATOM   5017 C CZ  . TYR B 1 104 ? 3.010   -89.857 -43.168 1.00 67.91  ? 105  TYR B CZ  1 
ATOM   5018 O OH  . TYR B 1 104 ? 3.323   -90.361 -44.402 1.00 53.04  ? 105  TYR B OH  1 
ATOM   5019 N N   . PRO B 1 105 ? -0.617  -90.606 -39.087 1.00 54.95  ? 106  PRO B N   1 
ATOM   5020 C CA  . PRO B 1 105 ? -1.513  -90.054 -40.109 1.00 52.60  ? 106  PRO B CA  1 
ATOM   5021 C C   . PRO B 1 105 ? -2.610  -89.154 -39.540 1.00 52.40  ? 106  PRO B C   1 
ATOM   5022 O O   . PRO B 1 105 ? -2.917  -89.188 -38.351 1.00 47.63  ? 106  PRO B O   1 
ATOM   5023 C CB  . PRO B 1 105 ? -2.130  -91.304 -40.733 1.00 55.07  ? 106  PRO B CB  1 
ATOM   5024 C CG  . PRO B 1 105 ? -2.185  -92.270 -39.608 1.00 53.36  ? 106  PRO B CG  1 
ATOM   5025 C CD  . PRO B 1 105 ? -0.978  -91.992 -38.735 1.00 60.82  ? 106  PRO B CD  1 
ATOM   5026 N N   . ARG B 1 106 ? -3.194  -88.354 -40.417 1.00 54.01  ? 107  ARG B N   1 
ATOM   5027 C CA  . ARG B 1 106 ? -4.263  -87.450 -40.053 1.00 55.97  ? 107  ARG B CA  1 
ATOM   5028 C C   . ARG B 1 106 ? -5.319  -88.150 -39.194 1.00 57.03  ? 107  ARG B C   1 
ATOM   5029 O O   . ARG B 1 106 ? -5.602  -89.328 -39.387 1.00 63.05  ? 107  ARG B O   1 
ATOM   5030 C CB  . ARG B 1 106 ? -4.867  -86.893 -41.321 1.00 49.72  ? 107  ARG B CB  1 
ATOM   5031 C CG  . ARG B 1 106 ? -5.722  -85.691 -41.168 1.00 56.54  ? 107  ARG B CG  1 
ATOM   5032 C CD  . ARG B 1 106 ? -6.111  -85.235 -42.556 1.00 59.54  ? 107  ARG B CD  1 
ATOM   5033 N NE  . ARG B 1 106 ? -4.918  -85.092 -43.397 1.00 63.72  ? 107  ARG B NE  1 
ATOM   5034 C CZ  . ARG B 1 106 ? -4.952  -84.838 -44.702 1.00 58.89  ? 107  ARG B CZ  1 
ATOM   5035 N NH1 . ARG B 1 106 ? -6.121  -84.698 -45.320 1.00 55.84  ? 107  ARG B NH1 1 
ATOM   5036 N NH2 . ARG B 1 106 ? -3.819  -84.724 -45.386 1.00 53.38  ? 107  ARG B NH2 1 
ATOM   5037 N N   . PRO B 1 107 ? -5.859  -87.442 -38.193 1.00 69.42  ? 108  PRO B N   1 
ATOM   5038 C CA  . PRO B 1 107 ? -6.882  -88.058 -37.340 1.00 64.08  ? 108  PRO B CA  1 
ATOM   5039 C C   . PRO B 1 107 ? -8.093  -88.505 -38.144 1.00 62.63  ? 108  PRO B C   1 
ATOM   5040 O O   . PRO B 1 107 ? -8.410  -87.885 -39.160 1.00 57.66  ? 108  PRO B O   1 
ATOM   5041 C CB  . PRO B 1 107 ? -7.246  -86.933 -36.374 1.00 54.89  ? 108  PRO B CB  1 
ATOM   5042 C CG  . PRO B 1 107 ? -5.985  -86.136 -36.264 1.00 49.91  ? 108  PRO B CG  1 
ATOM   5043 C CD  . PRO B 1 107 ? -5.412  -86.139 -37.661 1.00 53.69  ? 108  PRO B CD  1 
ATOM   5044 N N   . THR B 1 108 ? -8.760  -89.569 -37.712 1.00 64.49  ? 109  THR B N   1 
ATOM   5045 C CA  . THR B 1 108 ? -9.913  -90.038 -38.476 1.00 69.18  ? 109  THR B CA  1 
ATOM   5046 C C   . THR B 1 108 ? -11.223 -89.531 -37.870 1.00 72.29  ? 109  THR B C   1 
ATOM   5047 O O   . THR B 1 108 ? -12.228 -89.390 -38.580 1.00 62.94  ? 109  THR B O   1 
ATOM   5048 C CB  . THR B 1 108 ? -9.919  -91.575 -38.596 1.00 73.98  ? 109  THR B CB  1 
ATOM   5049 O OG1 . THR B 1 108 ? -9.461  -92.171 -37.370 1.00 69.33  ? 109  THR B OG1 1 
ATOM   5050 C CG2 . THR B 1 108 ? -8.989  -91.986 -39.728 1.00 72.54  ? 109  THR B CG2 1 
ATOM   5051 N N   . SER B 1 109 ? -11.198 -89.220 -36.574 1.00 63.35  ? 110  SER B N   1 
ATOM   5052 C CA  . SER B 1 109 ? -12.312 -88.520 -35.931 1.00 55.53  ? 110  SER B CA  1 
ATOM   5053 C C   . SER B 1 109 ? -11.862 -87.129 -35.452 1.00 58.82  ? 110  SER B C   1 
ATOM   5054 O O   . SER B 1 109 ? -10.703 -86.959 -35.067 1.00 57.52  ? 110  SER B O   1 
ATOM   5055 C CB  . SER B 1 109 ? -12.851 -89.354 -34.770 1.00 60.85  ? 110  SER B CB  1 
ATOM   5056 O OG  . SER B 1 109 ? -11.795 -90.010 -34.093 1.00 63.52  ? 110  SER B OG  1 
ATOM   5057 N N   . PRO B 1 110 ? -12.771 -86.132 -35.484 1.00 52.59  ? 111  PRO B N   1 
ATOM   5058 C CA  . PRO B 1 110 ? -12.467 -84.731 -35.136 1.00 50.07  ? 111  PRO B CA  1 
ATOM   5059 C C   . PRO B 1 110 ? -11.709 -84.572 -33.812 1.00 52.27  ? 111  PRO B C   1 
ATOM   5060 O O   . PRO B 1 110 ? -12.092 -85.124 -32.781 1.00 48.47  ? 111  PRO B O   1 
ATOM   5061 C CB  . PRO B 1 110 ? -13.849 -84.083 -35.048 1.00 51.65  ? 111  PRO B CB  1 
ATOM   5062 C CG  . PRO B 1 110 ? -14.692 -84.891 -35.988 1.00 50.09  ? 111  PRO B CG  1 
ATOM   5063 C CD  . PRO B 1 110 ? -14.188 -86.305 -35.856 1.00 54.47  ? 111  PRO B CD  1 
ATOM   5064 N N   . THR B 1 111 ? -10.625 -83.807 -33.866 1.00 53.79  ? 112  THR B N   1 
ATOM   5065 C CA  . THR B 1 111 ? -9.652  -83.734 -32.784 1.00 44.39  ? 112  THR B CA  1 
ATOM   5066 C C   . THR B 1 111 ? -9.602  -82.311 -32.213 1.00 41.24  ? 112  THR B C   1 
ATOM   5067 O O   . THR B 1 111 ? -9.640  -81.341 -32.967 1.00 42.44  ? 112  THR B O   1 
ATOM   5068 C CB  . THR B 1 111 ? -8.260  -84.167 -33.287 1.00 52.53  ? 112  THR B CB  1 
ATOM   5069 O OG1 . THR B 1 111 ? -8.352  -85.479 -33.839 1.00 58.50  ? 112  THR B OG1 1 
ATOM   5070 C CG2 . THR B 1 111 ? -7.254  -84.197 -32.172 1.00 46.76  ? 112  THR B CG2 1 
ATOM   5071 N N   . PRO B 1 112 ? -9.559  -82.185 -30.872 1.00 46.68  ? 113  PRO B N   1 
ATOM   5072 C CA  . PRO B 1 112 ? -9.458  -80.883 -30.208 1.00 42.92  ? 113  PRO B CA  1 
ATOM   5073 C C   . PRO B 1 112 ? -8.300  -80.033 -30.724 1.00 39.21  ? 113  PRO B C   1 
ATOM   5074 O O   . PRO B 1 112 ? -7.172  -80.519 -30.907 1.00 33.00  ? 113  PRO B O   1 
ATOM   5075 C CB  . PRO B 1 112 ? -9.234  -81.263 -28.740 1.00 47.94  ? 113  PRO B CB  1 
ATOM   5076 C CG  . PRO B 1 112 ? -9.975  -82.545 -28.598 1.00 49.44  ? 113  PRO B CG  1 
ATOM   5077 C CD  . PRO B 1 112 ? -9.742  -83.274 -29.894 1.00 48.63  ? 113  PRO B CD  1 
ATOM   5078 N N   . VAL B 1 113 ? -8.590  -78.760 -30.947 1.00 34.45  ? 114  VAL B N   1 
ATOM   5079 C CA  . VAL B 1 113 ? -7.595  -77.848 -31.490 1.00 39.81  ? 114  VAL B CA  1 
ATOM   5080 C C   . VAL B 1 113 ? -7.053  -76.899 -30.420 1.00 36.01  ? 114  VAL B C   1 
ATOM   5081 O O   . VAL B 1 113 ? -7.825  -76.245 -29.728 1.00 32.76  ? 114  VAL B O   1 
ATOM   5082 C CB  . VAL B 1 113 ? -8.173  -77.002 -32.632 1.00 34.73  ? 114  VAL B CB  1 
ATOM   5083 C CG1 . VAL B 1 113 ? -7.075  -76.139 -33.246 1.00 33.07  ? 114  VAL B CG1 1 
ATOM   5084 C CG2 . VAL B 1 113 ? -8.847  -77.890 -33.676 1.00 32.16  ? 114  VAL B CG2 1 
ATOM   5085 N N   . LEU B 1 114 ? -5.730  -76.837 -30.293 1.00 33.06  ? 115  LEU B N   1 
ATOM   5086 C CA  . LEU B 1 114 ? -5.080  -75.786 -29.518 1.00 32.12  ? 115  LEU B CA  1 
ATOM   5087 C C   . LEU B 1 114 ? -4.580  -74.663 -30.436 1.00 35.59  ? 115  LEU B C   1 
ATOM   5088 O O   . LEU B 1 114 ? -3.895  -74.923 -31.420 1.00 32.33  ? 115  LEU B O   1 
ATOM   5089 C CB  . LEU B 1 114 ? -3.920  -76.366 -28.711 1.00 30.77  ? 115  LEU B CB  1 
ATOM   5090 C CG  . LEU B 1 114 ? -4.293  -77.104 -27.425 1.00 33.45  ? 115  LEU B CG  1 
ATOM   5091 C CD1 . LEU B 1 114 ? -3.086  -77.844 -26.896 1.00 34.79  ? 115  LEU B CD1 1 
ATOM   5092 C CD2 . LEU B 1 114 ? -4.707  -76.082 -26.444 1.00 32.34  ? 115  LEU B CD2 1 
ATOM   5093 N N   . VAL B 1 115 ? -4.933  -73.418 -30.131 1.00 28.75  ? 116  VAL B N   1 
ATOM   5094 C CA  . VAL B 1 115 ? -4.469  -72.296 -30.934 1.00 25.17  ? 116  VAL B CA  1 
ATOM   5095 C C   . VAL B 1 115 ? -3.610  -71.353 -30.119 1.00 31.32  ? 116  VAL B C   1 
ATOM   5096 O O   . VAL B 1 115 ? -4.098  -70.743 -29.166 1.00 33.98  ? 116  VAL B O   1 
ATOM   5097 C CB  . VAL B 1 115 ? -5.611  -71.485 -31.533 1.00 27.92  ? 116  VAL B CB  1 
ATOM   5098 C CG1 . VAL B 1 115 ? -5.016  -70.369 -32.423 1.00 31.81  ? 116  VAL B CG1 1 
ATOM   5099 C CG2 . VAL B 1 115 ? -6.544  -72.384 -32.346 1.00 26.31  ? 116  VAL B CG2 1 
ATOM   5100 N N   . TRP B 1 116 ? -2.332  -71.253 -30.495 1.00 22.58  ? 117  TRP B N   1 
ATOM   5101 C CA  . TRP B 1 116 ? -1.337  -70.485 -29.750 1.00 25.80  ? 117  TRP B CA  1 
ATOM   5102 C C   . TRP B 1 116 ? -1.250  -69.058 -30.234 1.00 29.26  ? 117  TRP B C   1 
ATOM   5103 O O   . TRP B 1 116 ? -1.158  -68.831 -31.441 1.00 28.81  ? 117  TRP B O   1 
ATOM   5104 C CB  . TRP B 1 116 ? 0.045   -71.126 -29.875 1.00 22.84  ? 117  TRP B CB  1 
ATOM   5105 C CG  . TRP B 1 116 ? 1.164   -70.325 -29.233 1.00 25.93  ? 117  TRP B CG  1 
ATOM   5106 C CD1 . TRP B 1 116 ? 2.175   -69.655 -29.867 1.00 25.70  ? 117  TRP B CD1 1 
ATOM   5107 C CD2 . TRP B 1 116 ? 1.383   -70.135 -27.824 1.00 25.15  ? 117  TRP B CD2 1 
ATOM   5108 N NE1 . TRP B 1 116 ? 3.005   -69.066 -28.944 1.00 24.14  ? 117  TRP B NE1 1 
ATOM   5109 C CE2 . TRP B 1 116 ? 2.534   -69.333 -27.685 1.00 23.23  ? 117  TRP B CE2 1 
ATOM   5110 C CE3 . TRP B 1 116 ? 0.704   -70.547 -26.671 1.00 25.34  ? 117  TRP B CE3 1 
ATOM   5111 C CZ2 . TRP B 1 116 ? 3.045   -68.964 -26.434 1.00 26.80  ? 117  TRP B CZ2 1 
ATOM   5112 C CZ3 . TRP B 1 116 ? 1.202   -70.178 -25.435 1.00 28.17  ? 117  TRP B CZ3 1 
ATOM   5113 C CH2 . TRP B 1 116 ? 2.366   -69.397 -25.322 1.00 28.14  ? 117  TRP B CH2 1 
ATOM   5114 N N   . ILE B 1 117 ? -1.237  -68.106 -29.300 1.00 27.17  ? 118  ILE B N   1 
ATOM   5115 C CA  . ILE B 1 117 ? -0.979  -66.696 -29.611 1.00 27.35  ? 118  ILE B CA  1 
ATOM   5116 C C   . ILE B 1 117 ? 0.246   -66.203 -28.844 1.00 31.31  ? 118  ILE B C   1 
ATOM   5117 O O   . ILE B 1 117 ? 0.225   -66.141 -27.612 1.00 25.54  ? 118  ILE B O   1 
ATOM   5118 C CB  . ILE B 1 117 ? -2.188  -65.799 -29.266 1.00 28.18  ? 118  ILE B CB  1 
ATOM   5119 C CG1 . ILE B 1 117 ? -3.469  -66.380 -29.874 1.00 28.99  ? 118  ILE B CG1 1 
ATOM   5120 C CG2 . ILE B 1 117 ? -1.955  -64.341 -29.728 1.00 22.50  ? 118  ILE B CG2 1 
ATOM   5121 C CD1 . ILE B 1 117 ? -4.691  -65.525 -29.623 1.00 26.41  ? 118  ILE B CD1 1 
ATOM   5122 N N   . TYR B 1 118 ? 1.317   -65.842 -29.547 1.00 28.08  ? 119  TYR B N   1 
ATOM   5123 C CA  . TYR B 1 118 ? 2.552   -65.474 -28.848 1.00 23.95  ? 119  TYR B CA  1 
ATOM   5124 C C   . TYR B 1 118 ? 2.472   -64.124 -28.149 1.00 29.11  ? 119  TYR B C   1 
ATOM   5125 O O   . TYR B 1 118 ? 1.672   -63.273 -28.531 1.00 26.61  ? 119  TYR B O   1 
ATOM   5126 C CB  . TYR B 1 118 ? 3.750   -65.450 -29.814 1.00 23.66  ? 119  TYR B CB  1 
ATOM   5127 C CG  . TYR B 1 118 ? 3.600   -64.531 -31.022 1.00 25.96  ? 119  TYR B CG  1 
ATOM   5128 C CD1 . TYR B 1 118 ? 3.721   -63.127 -30.913 1.00 25.76  ? 119  TYR B CD1 1 
ATOM   5129 C CD2 . TYR B 1 118 ? 3.407   -65.074 -32.295 1.00 23.73  ? 119  TYR B CD2 1 
ATOM   5130 C CE1 . TYR B 1 118 ? 3.603   -62.303 -32.048 1.00 24.28  ? 119  TYR B CE1 1 
ATOM   5131 C CE2 . TYR B 1 118 ? 3.316   -64.265 -33.432 1.00 25.19  ? 119  TYR B CE2 1 
ATOM   5132 C CZ  . TYR B 1 118 ? 3.406   -62.892 -33.312 1.00 27.55  ? 119  TYR B CZ  1 
ATOM   5133 O OH  . TYR B 1 118 ? 3.271   -62.147 -34.470 1.00 27.92  ? 119  TYR B OH  1 
ATOM   5134 N N   . GLY B 1 119 ? 3.330   -63.942 -27.141 1.00 26.93  ? 120  GLY B N   1 
ATOM   5135 C CA  . GLY B 1 119 ? 3.511   -62.665 -26.470 1.00 27.26  ? 120  GLY B CA  1 
ATOM   5136 C C   . GLY B 1 119 ? 4.681   -61.868 -27.030 1.00 28.92  ? 120  GLY B C   1 
ATOM   5137 O O   . GLY B 1 119 ? 5.201   -62.187 -28.093 1.00 30.64  ? 120  GLY B O   1 
ATOM   5138 N N   . GLY B 1 120 ? 5.089   -60.816 -26.324 1.00 28.34  ? 121  GLY B N   1 
ATOM   5139 C CA  . GLY B 1 120 ? 6.145   -59.947 -26.811 1.00 25.93  ? 121  GLY B CA  1 
ATOM   5140 C C   . GLY B 1 120 ? 5.704   -58.490 -26.765 1.00 32.26  ? 121  GLY B C   1 
ATOM   5141 O O   . GLY B 1 120 ? 6.149   -57.664 -27.576 1.00 27.85  ? 121  GLY B O   1 
ATOM   5142 N N   . GLY B 1 121 ? 4.803   -58.193 -25.827 1.00 30.49  ? 122  GLY B N   1 
ATOM   5143 C CA  . GLY B 1 121 ? 4.369   -56.835 -25.519 1.00 31.74  ? 122  GLY B CA  1 
ATOM   5144 C C   . GLY B 1 121 ? 3.618   -56.084 -26.610 1.00 33.60  ? 122  GLY B C   1 
ATOM   5145 O O   . GLY B 1 121 ? 3.555   -54.868 -26.560 1.00 31.13  ? 122  GLY B O   1 
ATOM   5146 N N   . PHE B 1 122 ? 3.066   -56.813 -27.587 1.00 27.58  ? 123  PHE B N   1 
ATOM   5147 C CA  . PHE B 1 122 ? 2.459   -56.251 -28.790 1.00 28.12  ? 123  PHE B CA  1 
ATOM   5148 C C   . PHE B 1 122 ? 3.482   -55.485 -29.652 1.00 29.83  ? 123  PHE B C   1 
ATOM   5149 O O   . PHE B 1 122 ? 3.106   -54.863 -30.654 1.00 27.53  ? 123  PHE B O   1 
ATOM   5150 C CB  . PHE B 1 122 ? 1.263   -55.339 -28.450 1.00 27.91  ? 123  PHE B CB  1 
ATOM   5151 C CG  . PHE B 1 122 ? 0.102   -56.061 -27.791 1.00 24.91  ? 123  PHE B CG  1 
ATOM   5152 C CD1 . PHE B 1 122 ? -0.699  -56.915 -28.520 1.00 26.52  ? 123  PHE B CD1 1 
ATOM   5153 C CD2 . PHE B 1 122 ? -0.186  -55.857 -26.446 1.00 28.70  ? 123  PHE B CD2 1 
ATOM   5154 C CE1 . PHE B 1 122 ? -1.751  -57.589 -27.929 1.00 23.94  ? 123  PHE B CE1 1 
ATOM   5155 C CE2 . PHE B 1 122 ? -1.253  -56.490 -25.838 1.00 26.21  ? 123  PHE B CE2 1 
ATOM   5156 C CZ  . PHE B 1 122 ? -2.042  -57.354 -26.566 1.00 26.37  ? 123  PHE B CZ  1 
ATOM   5157 N N   . TYR B 1 123 ? 4.770   -55.542 -29.305 1.00 26.56  ? 124  TYR B N   1 
ATOM   5158 C CA  . TYR B 1 123 ? 5.768   -54.932 -30.182 1.00 32.29  ? 124  TYR B CA  1 
ATOM   5159 C C   . TYR B 1 123 ? 6.720   -55.955 -30.837 1.00 34.06  ? 124  TYR B C   1 
ATOM   5160 O O   . TYR B 1 123 ? 7.543   -55.593 -31.669 1.00 31.77  ? 124  TYR B O   1 
ATOM   5161 C CB  . TYR B 1 123 ? 6.593   -53.896 -29.414 1.00 35.80  ? 124  TYR B CB  1 
ATOM   5162 C CG  . TYR B 1 123 ? 7.585   -54.507 -28.446 1.00 37.37  ? 124  TYR B CG  1 
ATOM   5163 C CD1 . TYR B 1 123 ? 8.847   -54.898 -28.873 1.00 39.46  ? 124  TYR B CD1 1 
ATOM   5164 C CD2 . TYR B 1 123 ? 7.276   -54.656 -27.103 1.00 38.11  ? 124  TYR B CD2 1 
ATOM   5165 C CE1 . TYR B 1 123 ? 9.752   -55.454 -28.006 1.00 40.45  ? 124  TYR B CE1 1 
ATOM   5166 C CE2 . TYR B 1 123 ? 8.188   -55.215 -26.226 1.00 44.49  ? 124  TYR B CE2 1 
ATOM   5167 C CZ  . TYR B 1 123 ? 9.425   -55.605 -26.691 1.00 37.89  ? 124  TYR B CZ  1 
ATOM   5168 O OH  . TYR B 1 123 ? 10.343  -56.163 -25.837 1.00 53.03  ? 124  TYR B OH  1 
ATOM   5169 N N   . SER B 1 124 ? 6.633   -57.214 -30.430 1.00 29.07  ? 125  SER B N   1 
ATOM   5170 C CA  . SER B 1 124 ? 7.541   -58.226 -30.928 1.00 32.12  ? 125  SER B CA  1 
ATOM   5171 C C   . SER B 1 124 ? 6.904   -59.609 -30.886 1.00 30.65  ? 125  SER B C   1 
ATOM   5172 O O   . SER B 1 124 ? 5.735   -59.756 -30.476 1.00 29.99  ? 125  SER B O   1 
ATOM   5173 C CB  . SER B 1 124 ? 8.829   -58.214 -30.109 1.00 27.26  ? 125  SER B CB  1 
ATOM   5174 O OG  . SER B 1 124 ? 8.577   -58.560 -28.773 1.00 32.48  ? 125  SER B OG  1 
ATOM   5175 N N   . GLY B 1 125 ? 7.673   -60.619 -31.286 1.00 28.00  ? 126  GLY B N   1 
ATOM   5176 C CA  . GLY B 1 125 ? 7.219   -61.998 -31.231 1.00 26.67  ? 126  GLY B CA  1 
ATOM   5177 C C   . GLY B 1 125 ? 6.998   -62.631 -32.594 1.00 29.14  ? 126  GLY B C   1 
ATOM   5178 O O   . GLY B 1 125 ? 6.943   -61.941 -33.623 1.00 25.50  ? 126  GLY B O   1 
ATOM   5179 N N   . ALA B 1 126 ? 6.869   -63.956 -32.612 1.00 28.23  ? 127  ALA B N   1 
ATOM   5180 C CA  . ALA B 1 126 ? 6.683   -64.680 -33.882 1.00 31.10  ? 127  ALA B CA  1 
ATOM   5181 C C   . ALA B 1 126 ? 6.267   -66.099 -33.591 1.00 27.15  ? 127  ALA B C   1 
ATOM   5182 O O   . ALA B 1 126 ? 6.624   -66.658 -32.534 1.00 26.56  ? 127  ALA B O   1 
ATOM   5183 C CB  . ALA B 1 126 ? 7.963   -64.660 -34.727 1.00 26.94  ? 127  ALA B CB  1 
ATOM   5184 N N   . SER B 1 127 ? 5.498   -66.700 -34.496 1.00 27.24  ? 128  SER B N   1 
ATOM   5185 C CA  . SER B 1 127 ? 5.038   -68.070 -34.240 1.00 29.09  ? 128  SER B CA  1 
ATOM   5186 C C   . SER B 1 127 ? 6.151   -69.058 -34.587 1.00 29.02  ? 128  SER B C   1 
ATOM   5187 O O   . SER B 1 127 ? 6.035   -70.260 -34.318 1.00 28.37  ? 128  SER B O   1 
ATOM   5188 C CB  . SER B 1 127 ? 3.777   -68.390 -35.023 1.00 24.56  ? 128  SER B CB  1 
ATOM   5189 O OG  . SER B 1 127 ? 4.012   -68.195 -36.407 1.00 25.73  ? 128  SER B OG  1 
ATOM   5190 N N   . SER B 1 128 ? 7.245   -68.545 -35.142 1.00 28.72  ? 129  SER B N   1 
ATOM   5191 C CA  . SER B 1 128 ? 8.319   -69.409 -35.621 1.00 32.62  ? 129  SER B CA  1 
ATOM   5192 C C   . SER B 1 128 ? 9.417   -69.655 -34.584 1.00 32.64  ? 129  SER B C   1 
ATOM   5193 O O   . SER B 1 128 ? 10.329  -70.435 -34.831 1.00 35.30  ? 129  SER B O   1 
ATOM   5194 C CB  . SER B 1 128 ? 8.928   -68.827 -36.894 1.00 28.56  ? 129  SER B CB  1 
ATOM   5195 O OG  . SER B 1 128 ? 9.427   -67.533 -36.651 1.00 32.37  ? 129  SER B OG  1 
ATOM   5196 N N   . LEU B 1 129 ? 9.331   -69.013 -33.420 1.00 30.79  ? 130  LEU B N   1 
ATOM   5197 C CA  . LEU B 1 129 ? 10.315  -69.244 -32.366 1.00 32.27  ? 130  LEU B CA  1 
ATOM   5198 C C   . LEU B 1 129 ? 10.435  -70.723 -31.987 1.00 31.06  ? 130  LEU B C   1 
ATOM   5199 O O   . LEU B 1 129 ? 9.418   -71.417 -31.898 1.00 29.70  ? 130  LEU B O   1 
ATOM   5200 C CB  . LEU B 1 129 ? 9.960   -68.419 -31.117 1.00 32.11  ? 130  LEU B CB  1 
ATOM   5201 C CG  . LEU B 1 129 ? 9.973   -66.902 -31.372 1.00 36.63  ? 130  LEU B CG  1 
ATOM   5202 C CD1 . LEU B 1 129 ? 9.994   -66.154 -30.041 1.00 29.49  ? 130  LEU B CD1 1 
ATOM   5203 C CD2 . LEU B 1 129 ? 11.170  -66.490 -32.286 1.00 33.20  ? 130  LEU B CD2 1 
ATOM   5204 N N   . ASP B 1 130 ? 11.659  -71.186 -31.705 1.00 31.34  ? 131  ASP B N   1 
ATOM   5205 C CA  . ASP B 1 130 ? 11.891  -72.612 -31.402 1.00 34.20  ? 131  ASP B CA  1 
ATOM   5206 C C   . ASP B 1 130 ? 11.033  -73.078 -30.247 1.00 31.40  ? 131  ASP B C   1 
ATOM   5207 O O   . ASP B 1 130 ? 10.553  -74.201 -30.216 1.00 31.42  ? 131  ASP B O   1 
ATOM   5208 C CB  . ASP B 1 130 ? 13.376  -72.878 -31.071 1.00 35.44  ? 131  ASP B CB  1 
ATOM   5209 C CG  . ASP B 1 130 ? 14.276  -72.738 -32.291 1.00 47.21  ? 131  ASP B CG  1 
ATOM   5210 O OD1 . ASP B 1 130 ? 13.747  -72.785 -33.423 1.00 40.95  ? 131  ASP B OD1 1 
ATOM   5211 O OD2 . ASP B 1 130 ? 15.501  -72.563 -32.122 1.00 52.52  ? 131  ASP B OD2 1 
ATOM   5212 N N   . VAL B 1 131 ? 10.821  -72.184 -29.296 1.00 28.77  ? 132  VAL B N   1 
ATOM   5213 C CA  . VAL B 1 131 ? 10.180  -72.564 -28.047 1.00 29.57  ? 132  VAL B CA  1 
ATOM   5214 C C   . VAL B 1 131 ? 8.675   -72.737 -28.240 1.00 31.57  ? 132  VAL B C   1 
ATOM   5215 O O   . VAL B 1 131 ? 8.002   -73.225 -27.349 1.00 31.38  ? 132  VAL B O   1 
ATOM   5216 C CB  . VAL B 1 131 ? 10.519  -71.507 -26.940 1.00 40.09  ? 132  VAL B CB  1 
ATOM   5217 C CG1 . VAL B 1 131 ? 9.930   -70.119 -27.282 1.00 33.51  ? 132  VAL B CG1 1 
ATOM   5218 C CG2 . VAL B 1 131 ? 10.085  -71.974 -25.605 1.00 40.49  ? 132  VAL B CG2 1 
ATOM   5219 N N   . TYR B 1 132 ? 8.152   -72.370 -29.419 1.00 27.09  ? 133  TYR B N   1 
ATOM   5220 C CA  . TYR B 1 132 ? 6.710   -72.489 -29.704 1.00 29.89  ? 133  TYR B CA  1 
ATOM   5221 C C   . TYR B 1 132 ? 6.448   -73.642 -30.696 1.00 33.91  ? 133  TYR B C   1 
ATOM   5222 O O   . TYR B 1 132 ? 5.366   -73.748 -31.273 1.00 31.72  ? 133  TYR B O   1 
ATOM   5223 C CB  . TYR B 1 132 ? 6.128   -71.191 -30.302 1.00 27.90  ? 133  TYR B CB  1 
ATOM   5224 C CG  . TYR B 1 132 ? 6.329   -69.890 -29.524 1.00 27.51  ? 133  TYR B CG  1 
ATOM   5225 C CD1 . TYR B 1 132 ? 6.393   -69.881 -28.134 1.00 29.32  ? 133  TYR B CD1 1 
ATOM   5226 C CD2 . TYR B 1 132 ? 6.422   -68.662 -30.195 1.00 28.02  ? 133  TYR B CD2 1 
ATOM   5227 C CE1 . TYR B 1 132 ? 6.557   -68.670 -27.424 1.00 31.95  ? 133  TYR B CE1 1 
ATOM   5228 C CE2 . TYR B 1 132 ? 6.600   -67.461 -29.513 1.00 21.25  ? 133  TYR B CE2 1 
ATOM   5229 C CZ  . TYR B 1 132 ? 6.654   -67.476 -28.112 1.00 29.65  ? 133  TYR B CZ  1 
ATOM   5230 O OH  . TYR B 1 132 ? 6.825   -66.305 -27.403 1.00 27.22  ? 133  TYR B OH  1 
ATOM   5231 N N   . ASP B 1 133 ? 7.464   -74.471 -30.905 1.00 30.71  ? 134  ASP B N   1 
ATOM   5232 C CA  . ASP B 1 133 ? 7.395   -75.618 -31.809 1.00 33.04  ? 134  ASP B CA  1 
ATOM   5233 C C   . ASP B 1 133 ? 6.263   -76.533 -31.383 1.00 35.14  ? 134  ASP B C   1 
ATOM   5234 O O   . ASP B 1 133 ? 6.338   -77.135 -30.321 1.00 34.63  ? 134  ASP B O   1 
ATOM   5235 C CB  . ASP B 1 133 ? 8.736   -76.369 -31.783 1.00 39.16  ? 134  ASP B CB  1 
ATOM   5236 C CG  . ASP B 1 133 ? 8.851   -77.472 -32.853 1.00 47.81  ? 134  ASP B CG  1 
ATOM   5237 O OD1 . ASP B 1 133 ? 7.824   -77.941 -33.415 1.00 32.47  ? 134  ASP B OD1 1 
ATOM   5238 O OD2 . ASP B 1 133 ? 10.013  -77.885 -33.093 1.00 48.48  ? 134  ASP B OD2 1 
ATOM   5239 N N   . GLY B 1 134 ? 5.216   -76.640 -32.196 1.00 31.92  ? 135  GLY B N   1 
ATOM   5240 C CA  . GLY B 1 134 ? 4.066   -77.440 -31.815 1.00 33.99  ? 135  GLY B CA  1 
ATOM   5241 C C   . GLY B 1 134 ? 4.198   -78.961 -31.967 1.00 37.00  ? 135  GLY B C   1 
ATOM   5242 O O   . GLY B 1 134 ? 3.274   -79.694 -31.614 1.00 35.80  ? 135  GLY B O   1 
ATOM   5243 N N   . ARG B 1 135 ? 5.331   -79.456 -32.458 1.00 35.46  ? 136  ARG B N   1 
ATOM   5244 C CA  . ARG B 1 135 ? 5.406   -80.873 -32.840 1.00 36.96  ? 136  ARG B CA  1 
ATOM   5245 C C   . ARG B 1 135 ? 5.342   -81.816 -31.627 1.00 38.44  ? 136  ARG B C   1 
ATOM   5246 O O   . ARG B 1 135 ? 4.721   -82.878 -31.705 1.00 41.30  ? 136  ARG B O   1 
ATOM   5247 C CB  . ARG B 1 135 ? 6.667   -81.148 -33.672 1.00 33.08  ? 136  ARG B CB  1 
ATOM   5248 C CG  . ARG B 1 135 ? 7.952   -81.266 -32.874 1.00 36.32  ? 136  ARG B CG  1 
ATOM   5249 C CD  . ARG B 1 135 ? 9.120   -81.623 -33.747 1.00 41.83  ? 136  ARG B CD  1 
ATOM   5250 N NE  . ARG B 1 135 ? 9.660   -80.465 -34.436 1.00 41.76  ? 136  ARG B NE  1 
ATOM   5251 C CZ  . ARG B 1 135 ? 10.561  -80.523 -35.411 1.00 52.14  ? 136  ARG B CZ  1 
ATOM   5252 N NH1 . ARG B 1 135 ? 11.023  -81.703 -35.816 1.00 46.33  ? 136  ARG B NH1 1 
ATOM   5253 N NH2 . ARG B 1 135 ? 10.991  -79.402 -35.989 1.00 41.47  ? 136  ARG B NH2 1 
ATOM   5254 N N   . PHE B 1 136 ? 5.934   -81.414 -30.504 1.00 34.38  ? 137  PHE B N   1 
ATOM   5255 C CA  . PHE B 1 136 ? 5.926   -82.230 -29.285 1.00 36.36  ? 137  PHE B CA  1 
ATOM   5256 C C   . PHE B 1 136 ? 4.542   -82.366 -28.657 1.00 37.15  ? 137  PHE B C   1 
ATOM   5257 O O   . PHE B 1 136 ? 4.157   -83.468 -28.265 1.00 39.54  ? 137  PHE B O   1 
ATOM   5258 C CB  . PHE B 1 136 ? 6.918   -81.668 -28.287 1.00 29.58  ? 137  PHE B CB  1 
ATOM   5259 C CG  . PHE B 1 136 ? 8.288   -81.489 -28.868 1.00 36.52  ? 137  PHE B CG  1 
ATOM   5260 C CD1 . PHE B 1 136 ? 9.072   -82.591 -29.174 1.00 37.46  ? 137  PHE B CD1 1 
ATOM   5261 C CD2 . PHE B 1 136 ? 8.776   -80.227 -29.146 1.00 37.00  ? 137  PHE B CD2 1 
ATOM   5262 C CE1 . PHE B 1 136 ? 10.331  -82.430 -29.736 1.00 41.99  ? 137  PHE B CE1 1 
ATOM   5263 C CE2 . PHE B 1 136 ? 10.037  -80.048 -29.696 1.00 35.96  ? 137  PHE B CE2 1 
ATOM   5264 C CZ  . PHE B 1 136 ? 10.823  -81.157 -29.996 1.00 41.02  ? 137  PHE B CZ  1 
ATOM   5265 N N   . LEU B 1 137 ? 3.766   -81.286 -28.610 1.00 34.80  ? 138  LEU B N   1 
ATOM   5266 C CA  . LEU B 1 137 ? 2.404   -81.370 -28.062 1.00 38.18  ? 138  LEU B CA  1 
ATOM   5267 C C   . LEU B 1 137 ? 1.531   -82.251 -28.913 1.00 41.32  ? 138  LEU B C   1 
ATOM   5268 O O   . LEU B 1 137 ? 0.698   -83.016 -28.406 1.00 35.04  ? 138  LEU B O   1 
ATOM   5269 C CB  . LEU B 1 137 ? 1.735   -79.992 -27.981 1.00 37.00  ? 138  LEU B CB  1 
ATOM   5270 C CG  . LEU B 1 137 ? 1.705   -79.232 -26.678 1.00 41.36  ? 138  LEU B CG  1 
ATOM   5271 C CD1 . LEU B 1 137 ? 1.308   -77.789 -26.975 1.00 36.77  ? 138  LEU B CD1 1 
ATOM   5272 C CD2 . LEU B 1 137 ? 0.727   -79.889 -25.733 1.00 36.94  ? 138  LEU B CD2 1 
ATOM   5273 N N   . VAL B 1 138 ? 1.673   -82.088 -30.225 1.00 35.62  ? 139  VAL B N   1 
ATOM   5274 C CA  . VAL B 1 138 ? 0.820   -82.821 -31.138 1.00 36.95  ? 139  VAL B CA  1 
ATOM   5275 C C   . VAL B 1 138 ? 1.127   -84.312 -31.065 1.00 37.96  ? 139  VAL B C   1 
ATOM   5276 O O   . VAL B 1 138 ? 0.222   -85.135 -30.975 1.00 39.41  ? 139  VAL B O   1 
ATOM   5277 C CB  . VAL B 1 138 ? 0.970   -82.307 -32.559 1.00 39.47  ? 139  VAL B CB  1 
ATOM   5278 C CG1 . VAL B 1 138 ? 0.340   -83.291 -33.545 1.00 31.85  ? 139  VAL B CG1 1 
ATOM   5279 C CG2 . VAL B 1 138 ? 0.307   -80.917 -32.645 1.00 30.98  ? 139  VAL B CG2 1 
ATOM   5280 N N   . GLN B 1 139 ? 2.404   -84.658 -31.068 1.00 35.44  ? 140  GLN B N   1 
ATOM   5281 C CA  . GLN B 1 139 ? 2.776   -86.055 -30.946 1.00 41.06  ? 140  GLN B CA  1 
ATOM   5282 C C   . GLN B 1 139 ? 2.304   -86.641 -29.611 1.00 44.42  ? 140  GLN B C   1 
ATOM   5283 O O   . GLN B 1 139 ? 1.615   -87.656 -29.587 1.00 40.27  ? 140  GLN B O   1 
ATOM   5284 C CB  . GLN B 1 139 ? 4.289   -86.219 -31.103 1.00 41.05  ? 140  GLN B CB  1 
ATOM   5285 C CG  . GLN B 1 139 ? 4.696   -87.640 -31.489 1.00 49.91  ? 140  GLN B CG  1 
ATOM   5286 C CD  . GLN B 1 139 ? 4.735   -88.567 -30.286 1.00 63.12  ? 140  GLN B CD  1 
ATOM   5287 O OE1 . GLN B 1 139 ? 5.128   -88.153 -29.191 1.00 61.56  ? 140  GLN B OE1 1 
ATOM   5288 N NE2 . GLN B 1 139 ? 4.315   -89.823 -30.477 1.00 53.62  ? 140  GLN B NE2 1 
ATOM   5289 N N   . ALA B 1 140 ? 2.660   -85.988 -28.508 1.00 40.18  ? 141  ALA B N   1 
ATOM   5290 C CA  . ALA B 1 140 ? 2.369   -86.532 -27.177 1.00 41.05  ? 141  ALA B CA  1 
ATOM   5291 C C   . ALA B 1 140 ? 0.883   -86.586 -26.820 1.00 38.96  ? 141  ALA B C   1 
ATOM   5292 O O   . ALA B 1 140 ? 0.454   -87.497 -26.117 1.00 43.58  ? 141  ALA B O   1 
ATOM   5293 C CB  . ALA B 1 140 ? 3.116   -85.737 -26.111 1.00 34.63  ? 141  ALA B CB  1 
ATOM   5294 N N   . GLU B 1 141 ? 0.088   -85.635 -27.296 1.00 38.88  ? 142  GLU B N   1 
ATOM   5295 C CA  . GLU B 1 141 ? -1.282  -85.540 -26.800 1.00 33.23  ? 142  GLU B CA  1 
ATOM   5296 C C   . GLU B 1 141 ? -2.324  -85.676 -27.884 1.00 40.06  ? 142  GLU B C   1 
ATOM   5297 O O   . GLU B 1 141 ? -3.516  -85.648 -27.591 1.00 44.09  ? 142  GLU B O   1 
ATOM   5298 C CB  . GLU B 1 141 ? -1.482  -84.216 -26.051 1.00 34.64  ? 142  GLU B CB  1 
ATOM   5299 C CG  . GLU B 1 141 ? -0.769  -84.166 -24.687 1.00 34.19  ? 142  GLU B CG  1 
ATOM   5300 C CD  . GLU B 1 141 ? -1.235  -85.260 -23.729 1.00 40.99  ? 142  GLU B CD  1 
ATOM   5301 O OE1 . GLU B 1 141 ? -2.449  -85.576 -23.725 1.00 37.19  ? 142  GLU B OE1 1 
ATOM   5302 O OE2 . GLU B 1 141 ? -0.382  -85.799 -22.967 1.00 43.72  ? 142  GLU B OE2 1 
ATOM   5303 N N   . ARG B 1 142 ? -1.869  -85.800 -29.135 1.00 42.29  ? 143  ARG B N   1 
ATOM   5304 C CA  . ARG B 1 142 ? -2.748  -86.016 -30.274 1.00 42.19  ? 143  ARG B CA  1 
ATOM   5305 C C   . ARG B 1 142 ? -3.846  -84.971 -30.354 1.00 43.90  ? 143  ARG B C   1 
ATOM   5306 O O   . ARG B 1 142 ? -5.021  -85.288 -30.418 1.00 54.40  ? 143  ARG B O   1 
ATOM   5307 C CB  . ARG B 1 142 ? -3.358  -87.424 -30.224 1.00 48.02  ? 143  ARG B CB  1 
ATOM   5308 C CG  . ARG B 1 142 ? -2.330  -88.533 -30.452 1.00 56.93  ? 143  ARG B CG  1 
ATOM   5309 C CD  . ARG B 1 142 ? -3.016  -89.878 -30.734 1.00 78.58  ? 143  ARG B CD  1 
ATOM   5310 N NE  . ARG B 1 142 ? -3.903  -89.807 -31.899 1.00 70.60  ? 143  ARG B NE  1 
ATOM   5311 C CZ  . ARG B 1 142 ? -3.501  -89.971 -33.159 1.00 69.05  ? 143  ARG B CZ  1 
ATOM   5312 N NH1 . ARG B 1 142 ? -2.222  -90.228 -33.416 1.00 64.17  ? 143  ARG B NH1 1 
ATOM   5313 N NH2 . ARG B 1 142 ? -4.377  -89.874 -34.159 1.00 54.70  ? 143  ARG B NH2 1 
ATOM   5314 N N   . THR B 1 143 ? -3.439  -83.719 -30.322 1.00 37.49  ? 144  THR B N   1 
ATOM   5315 C CA  . THR B 1 143 ? -4.319  -82.596 -30.574 1.00 38.46  ? 144  THR B CA  1 
ATOM   5316 C C   . THR B 1 143 ? -3.901  -82.006 -31.902 1.00 30.15  ? 144  THR B C   1 
ATOM   5317 O O   . THR B 1 143 ? -2.851  -82.342 -32.417 1.00 34.69  ? 144  THR B O   1 
ATOM   5318 C CB  . THR B 1 143 ? -4.173  -81.532 -29.491 1.00 37.60  ? 144  THR B CB  1 
ATOM   5319 O OG1 . THR B 1 143 ? -2.772  -81.241 -29.363 1.00 44.54  ? 144  THR B OG1 1 
ATOM   5320 C CG2 . THR B 1 143 ? -4.669  -82.073 -28.158 1.00 42.28  ? 144  THR B CG2 1 
ATOM   5321 N N   . VAL B 1 144 ? -4.691  -81.098 -32.440 1.00 37.43  ? 145  VAL B N   1 
ATOM   5322 C CA  . VAL B 1 144 ? -4.204  -80.277 -33.543 1.00 35.31  ? 145  VAL B CA  1 
ATOM   5323 C C   . VAL B 1 144 ? -3.704  -78.959 -32.949 1.00 37.39  ? 145  VAL B C   1 
ATOM   5324 O O   . VAL B 1 144 ? -4.346  -78.381 -32.069 1.00 36.31  ? 145  VAL B O   1 
ATOM   5325 C CB  . VAL B 1 144 ? -5.299  -80.041 -34.604 1.00 32.30  ? 145  VAL B CB  1 
ATOM   5326 C CG1 . VAL B 1 144 ? -4.810  -79.100 -35.695 1.00 29.64  ? 145  VAL B CG1 1 
ATOM   5327 C CG2 . VAL B 1 144 ? -5.731  -81.378 -35.207 1.00 33.38  ? 145  VAL B CG2 1 
ATOM   5328 N N   . LEU B 1 145 ? -2.541  -78.501 -33.390 1.00 36.62  ? 146  LEU B N   1 
ATOM   5329 C CA  . LEU B 1 145 ? -2.022  -77.236 -32.901 1.00 27.89  ? 146  LEU B CA  1 
ATOM   5330 C C   . LEU B 1 145 ? -1.925  -76.214 -34.016 1.00 33.36  ? 146  LEU B C   1 
ATOM   5331 O O   . LEU B 1 145 ? -1.339  -76.495 -35.062 1.00 33.25  ? 146  LEU B O   1 
ATOM   5332 C CB  . LEU B 1 145 ? -0.650  -77.425 -32.272 1.00 26.95  ? 146  LEU B CB  1 
ATOM   5333 C CG  . LEU B 1 145 ? -0.315  -76.206 -31.398 1.00 40.90  ? 146  LEU B CG  1 
ATOM   5334 C CD1 . LEU B 1 145 ? 0.182   -76.672 -30.080 1.00 38.68  ? 146  LEU B CD1 1 
ATOM   5335 C CD2 . LEU B 1 145 ? 0.725   -75.338 -32.047 1.00 42.39  ? 146  LEU B CD2 1 
ATOM   5336 N N   . VAL B 1 146 ? -2.511  -75.040 -33.798 1.00 28.03  ? 147  VAL B N   1 
ATOM   5337 C CA  . VAL B 1 146 ? -2.399  -73.924 -34.735 1.00 27.50  ? 147  VAL B CA  1 
ATOM   5338 C C   . VAL B 1 146 ? -1.699  -72.725 -34.089 1.00 31.71  ? 147  VAL B C   1 
ATOM   5339 O O   . VAL B 1 146 ? -1.954  -72.413 -32.908 1.00 30.03  ? 147  VAL B O   1 
ATOM   5340 C CB  . VAL B 1 146 ? -3.811  -73.492 -35.250 1.00 34.07  ? 147  VAL B CB  1 
ATOM   5341 C CG1 . VAL B 1 146 ? -3.694  -72.443 -36.326 1.00 27.48  ? 147  VAL B CG1 1 
ATOM   5342 C CG2 . VAL B 1 146 ? -4.570  -74.705 -35.769 1.00 28.52  ? 147  VAL B CG2 1 
ATOM   5343 N N   . SER B 1 147 ? -0.802  -72.060 -34.825 1.00 31.42  ? 148  SER B N   1 
ATOM   5344 C CA  . SER B 1 147 ? -0.301  -70.741 -34.385 1.00 30.01  ? 148  SER B CA  1 
ATOM   5345 C C   . SER B 1 147 ? -0.290  -69.769 -35.552 1.00 29.95  ? 148  SER B C   1 
ATOM   5346 O O   . SER B 1 147 ? -0.185  -70.182 -36.697 1.00 31.16  ? 148  SER B O   1 
ATOM   5347 C CB  . SER B 1 147 ? 1.098   -70.834 -33.768 1.00 29.23  ? 148  SER B CB  1 
ATOM   5348 O OG  . SER B 1 147 ? 2.044   -71.310 -34.715 1.00 30.72  ? 148  SER B OG  1 
ATOM   5349 N N   . MET B 1 148 ? -0.428  -68.473 -35.270 1.00 29.28  ? 149  MET B N   1 
ATOM   5350 C CA  . MET B 1 148 ? -0.441  -67.495 -36.344 1.00 25.62  ? 149  MET B CA  1 
ATOM   5351 C C   . MET B 1 148 ? 0.547   -66.383 -36.054 1.00 29.93  ? 149  MET B C   1 
ATOM   5352 O O   . MET B 1 148 ? 0.865   -66.108 -34.894 1.00 26.10  ? 149  MET B O   1 
ATOM   5353 C CB  . MET B 1 148 ? -1.855  -66.908 -36.556 1.00 25.51  ? 149  MET B CB  1 
ATOM   5354 C CG  . MET B 1 148 ? -2.209  -65.726 -35.685 1.00 25.56  ? 149  MET B CG  1 
ATOM   5355 S SD  . MET B 1 148 ? -2.343  -66.157 -33.921 1.00 29.27  ? 149  MET B SD  1 
ATOM   5356 C CE  . MET B 1 148 ? -3.797  -67.181 -33.905 1.00 27.87  ? 149  MET B CE  1 
ATOM   5357 N N   . ASN B 1 149 ? 1.061   -65.763 -37.110 1.00 26.18  ? 150  ASN B N   1 
ATOM   5358 C CA  . ASN B 1 149 ? 1.674   -64.453 -36.950 1.00 29.73  ? 150  ASN B CA  1 
ATOM   5359 C C   . ASN B 1 149 ? 0.575   -63.386 -36.968 1.00 32.31  ? 150  ASN B C   1 
ATOM   5360 O O   . ASN B 1 149 ? -0.462  -63.552 -37.605 1.00 30.49  ? 150  ASN B O   1 
ATOM   5361 C CB  . ASN B 1 149 ? 2.715   -64.186 -38.042 1.00 26.16  ? 150  ASN B CB  1 
ATOM   5362 C CG  . ASN B 1 149 ? 4.053   -64.799 -37.716 1.00 31.61  ? 150  ASN B CG  1 
ATOM   5363 O OD1 . ASN B 1 149 ? 4.193   -65.537 -36.735 1.00 30.07  ? 150  ASN B OD1 1 
ATOM   5364 N ND2 . ASN B 1 149 ? 5.055   -64.489 -38.523 1.00 30.82  ? 150  ASN B ND2 1 
ATOM   5365 N N   . TYR B 1 150 ? 0.791   -62.303 -36.244 1.00 28.87  ? 151  TYR B N   1 
ATOM   5366 C CA  . TYR B 1 150 ? -0.099  -61.157 -36.295 1.00 26.32  ? 151  TYR B CA  1 
ATOM   5367 C C   . TYR B 1 150 ? 0.793   -59.933 -36.210 1.00 25.69  ? 151  TYR B C   1 
ATOM   5368 O O   . TYR B 1 150 ? 1.870   -59.984 -35.596 1.00 27.58  ? 151  TYR B O   1 
ATOM   5369 C CB  . TYR B 1 150 ? -1.140  -61.198 -35.148 1.00 26.28  ? 151  TYR B CB  1 
ATOM   5370 C CG  . TYR B 1 150 ? -0.536  -61.159 -33.755 1.00 20.84  ? 151  TYR B CG  1 
ATOM   5371 C CD1 . TYR B 1 150 ? -0.196  -62.329 -33.072 1.00 23.11  ? 151  TYR B CD1 1 
ATOM   5372 C CD2 . TYR B 1 150 ? -0.289  -59.939 -33.122 1.00 23.39  ? 151  TYR B CD2 1 
ATOM   5373 C CE1 . TYR B 1 150 ? 0.386   -62.285 -31.770 1.00 23.05  ? 151  TYR B CE1 1 
ATOM   5374 C CE2 . TYR B 1 150 ? 0.286   -59.891 -31.817 1.00 20.97  ? 151  TYR B CE2 1 
ATOM   5375 C CZ  . TYR B 1 150 ? 0.609   -61.045 -31.159 1.00 26.88  ? 151  TYR B CZ  1 
ATOM   5376 O OH  . TYR B 1 150 ? 1.167   -60.939 -29.886 1.00 25.64  ? 151  TYR B OH  1 
ATOM   5377 N N   . ARG B 1 151 ? 0.366   -58.836 -36.825 1.00 24.04  ? 152  ARG B N   1 
ATOM   5378 C CA  . ARG B 1 151 ? 1.202   -57.648 -36.881 1.00 24.10  ? 152  ARG B CA  1 
ATOM   5379 C C   . ARG B 1 151 ? 1.410   -57.045 -35.507 1.00 28.90  ? 152  ARG B C   1 
ATOM   5380 O O   . ARG B 1 151 ? 0.482   -56.983 -34.717 1.00 24.40  ? 152  ARG B O   1 
ATOM   5381 C CB  . ARG B 1 151 ? 0.577   -56.614 -37.811 1.00 24.98  ? 152  ARG B CB  1 
ATOM   5382 C CG  . ARG B 1 151 ? 0.756   -56.945 -39.307 1.00 26.33  ? 152  ARG B CG  1 
ATOM   5383 C CD  . ARG B 1 151 ? -0.108  -55.991 -40.129 1.00 28.53  ? 152  ARG B CD  1 
ATOM   5384 N NE  . ARG B 1 151 ? -1.511  -56.386 -40.131 1.00 29.16  ? 152  ARG B NE  1 
ATOM   5385 C CZ  . ARG B 1 151 ? -2.486  -55.691 -40.726 1.00 31.01  ? 152  ARG B CZ  1 
ATOM   5386 N NH1 . ARG B 1 151 ? -2.209  -54.538 -41.345 1.00 26.86  ? 152  ARG B NH1 1 
ATOM   5387 N NH2 . ARG B 1 151 ? -3.739  -56.136 -40.682 1.00 27.36  ? 152  ARG B NH2 1 
ATOM   5388 N N   . VAL B 1 152 ? 2.627   -56.590 -35.239 1.00 24.39  ? 153  VAL B N   1 
ATOM   5389 C CA  . VAL B 1 152 ? 2.941   -56.012 -33.945 1.00 28.88  ? 153  VAL B CA  1 
ATOM   5390 C C   . VAL B 1 152 ? 3.436   -54.578 -34.185 1.00 29.23  ? 153  VAL B C   1 
ATOM   5391 O O   . VAL B 1 152 ? 3.509   -54.127 -35.348 1.00 27.75  ? 153  VAL B O   1 
ATOM   5392 C CB  . VAL B 1 152 ? 3.994   -56.861 -33.178 1.00 25.18  ? 153  VAL B CB  1 
ATOM   5393 C CG1 . VAL B 1 152 ? 3.385   -58.194 -32.750 1.00 23.66  ? 153  VAL B CG1 1 
ATOM   5394 C CG2 . VAL B 1 152 ? 5.246   -57.100 -34.028 1.00 23.05  ? 153  VAL B CG2 1 
ATOM   5395 N N   . GLY B 1 153 ? 3.715   -53.853 -33.106 1.00 25.30  ? 154  GLY B N   1 
ATOM   5396 C CA  . GLY B 1 153 ? 4.202   -52.477 -33.197 1.00 31.25  ? 154  GLY B CA  1 
ATOM   5397 C C   . GLY B 1 153 ? 3.231   -51.555 -33.926 1.00 26.90  ? 154  GLY B C   1 
ATOM   5398 O O   . GLY B 1 153 ? 2.016   -51.771 -33.905 1.00 30.12  ? 154  GLY B O   1 
ATOM   5399 N N   . ALA B 1 154 ? 3.758   -50.531 -34.581 1.00 29.24  ? 155  ALA B N   1 
ATOM   5400 C CA  . ALA B 1 154 ? 2.910   -49.603 -35.315 1.00 35.31  ? 155  ALA B CA  1 
ATOM   5401 C C   . ALA B 1 154 ? 2.085   -50.334 -36.368 1.00 33.49  ? 155  ALA B C   1 
ATOM   5402 O O   . ALA B 1 154 ? 0.910   -50.027 -36.588 1.00 34.55  ? 155  ALA B O   1 
ATOM   5403 C CB  . ALA B 1 154 ? 3.756   -48.504 -35.967 1.00 32.14  ? 155  ALA B CB  1 
ATOM   5404 N N   . PHE B 1 155 ? 2.694   -51.328 -37.007 1.00 32.34  ? 156  PHE B N   1 
ATOM   5405 C CA  . PHE B 1 155 ? 2.043   -52.040 -38.106 1.00 29.53  ? 156  PHE B CA  1 
ATOM   5406 C C   . PHE B 1 155 ? 0.769   -52.737 -37.668 1.00 27.39  ? 156  PHE B C   1 
ATOM   5407 O O   . PHE B 1 155 ? -0.138  -52.947 -38.470 1.00 29.01  ? 156  PHE B O   1 
ATOM   5408 C CB  . PHE B 1 155 ? 3.022   -53.052 -38.712 1.00 29.28  ? 156  PHE B CB  1 
ATOM   5409 C CG  . PHE B 1 155 ? 4.333   -52.444 -39.046 1.00 30.75  ? 156  PHE B CG  1 
ATOM   5410 C CD1 . PHE B 1 155 ? 4.500   -51.776 -40.255 1.00 30.41  ? 156  PHE B CD1 1 
ATOM   5411 C CD2 . PHE B 1 155 ? 5.368   -52.457 -38.133 1.00 26.85  ? 156  PHE B CD2 1 
ATOM   5412 C CE1 . PHE B 1 155 ? 5.691   -51.172 -40.562 1.00 29.41  ? 156  PHE B CE1 1 
ATOM   5413 C CE2 . PHE B 1 155 ? 6.570   -51.857 -38.432 1.00 35.04  ? 156  PHE B CE2 1 
ATOM   5414 C CZ  . PHE B 1 155 ? 6.727   -51.205 -39.661 1.00 32.25  ? 156  PHE B CZ  1 
ATOM   5415 N N   . GLY B 1 156 ? 0.698   -53.123 -36.402 1.00 30.76  ? 157  GLY B N   1 
ATOM   5416 C CA  . GLY B 1 156 ? -0.494  -53.794 -35.929 1.00 28.92  ? 157  GLY B CA  1 
ATOM   5417 C C   . GLY B 1 156 ? -1.378  -52.969 -35.016 1.00 30.49  ? 157  GLY B C   1 
ATOM   5418 O O   . GLY B 1 156 ? -2.556  -53.304 -34.841 1.00 30.13  ? 157  GLY B O   1 
ATOM   5419 N N   . PHE B 1 157 ? -0.827  -51.903 -34.431 1.00 27.36  ? 158  PHE B N   1 
ATOM   5420 C CA  . PHE B 1 157 ? -1.533  -51.228 -33.343 1.00 35.44  ? 158  PHE B CA  1 
ATOM   5421 C C   . PHE B 1 157 ? -1.419  -49.718 -33.343 1.00 33.92  ? 158  PHE B C   1 
ATOM   5422 O O   . PHE B 1 157 ? -1.896  -49.058 -32.403 1.00 31.39  ? 158  PHE B O   1 
ATOM   5423 C CB  . PHE B 1 157 ? -1.047  -51.796 -31.980 1.00 27.69  ? 158  PHE B CB  1 
ATOM   5424 C CG  . PHE B 1 157 ? -1.372  -53.252 -31.825 1.00 30.63  ? 158  PHE B CG  1 
ATOM   5425 C CD1 . PHE B 1 157 ? -2.685  -53.650 -31.600 1.00 25.89  ? 158  PHE B CD1 1 
ATOM   5426 C CD2 . PHE B 1 157 ? -0.392  -54.224 -31.996 1.00 24.51  ? 158  PHE B CD2 1 
ATOM   5427 C CE1 . PHE B 1 157 ? -3.021  -54.997 -31.516 1.00 27.04  ? 158  PHE B CE1 1 
ATOM   5428 C CE2 . PHE B 1 157 ? -0.712  -55.572 -31.919 1.00 28.91  ? 158  PHE B CE2 1 
ATOM   5429 C CZ  . PHE B 1 157 ? -2.030  -55.969 -31.671 1.00 29.14  ? 158  PHE B CZ  1 
ATOM   5430 N N   . LEU B 1 158 ? -0.785  -49.144 -34.360 1.00 31.72  ? 159  LEU B N   1 
ATOM   5431 C CA  . LEU B 1 158 ? -0.859  -47.687 -34.475 1.00 35.11  ? 159  LEU B CA  1 
ATOM   5432 C C   . LEU B 1 158 ? -2.330  -47.365 -34.747 1.00 33.43  ? 159  LEU B C   1 
ATOM   5433 O O   . LEU B 1 158 ? -2.994  -48.022 -35.539 1.00 36.85  ? 159  LEU B O   1 
ATOM   5434 C CB  . LEU B 1 158 ? 0.065   -47.126 -35.555 1.00 32.49  ? 159  LEU B CB  1 
ATOM   5435 C CG  . LEU B 1 158 ? 0.007   -45.596 -35.781 1.00 40.36  ? 159  LEU B CG  1 
ATOM   5436 C CD1 . LEU B 1 158 ? 1.360   -45.034 -36.224 1.00 31.13  ? 159  LEU B CD1 1 
ATOM   5437 C CD2 . LEU B 1 158 ? -1.076  -45.179 -36.789 1.00 33.63  ? 159  LEU B CD2 1 
ATOM   5438 N N   . ALA B 1 159 ? -2.863  -46.391 -34.032 1.00 32.54  ? 160  ALA B N   1 
ATOM   5439 C CA  . ALA B 1 159 ? -4.274  -46.078 -34.167 1.00 35.99  ? 160  ALA B CA  1 
ATOM   5440 C C   . ALA B 1 159 ? -4.495  -44.568 -34.287 1.00 39.63  ? 160  ALA B C   1 
ATOM   5441 O O   . ALA B 1 159 ? -3.955  -43.780 -33.502 1.00 37.60  ? 160  ALA B O   1 
ATOM   5442 C CB  . ALA B 1 159 ? -5.052  -46.642 -32.977 1.00 38.88  ? 160  ALA B CB  1 
ATOM   5443 N N   . LEU B 1 160 ? -5.252  -44.166 -35.298 1.00 38.56  ? 161  LEU B N   1 
ATOM   5444 C CA  . LEU B 1 160 ? -5.829  -42.823 -35.328 1.00 40.01  ? 161  LEU B CA  1 
ATOM   5445 C C   . LEU B 1 160 ? -7.318  -43.049 -35.263 1.00 36.30  ? 161  LEU B C   1 
ATOM   5446 O O   . LEU B 1 160 ? -7.977  -43.144 -36.299 1.00 37.62  ? 161  LEU B O   1 
ATOM   5447 C CB  . LEU B 1 160 ? -5.423  -42.037 -36.574 1.00 34.36  ? 161  LEU B CB  1 
ATOM   5448 C CG  . LEU B 1 160 ? -3.917  -41.785 -36.664 1.00 36.57  ? 161  LEU B CG  1 
ATOM   5449 C CD1 . LEU B 1 160 ? -3.563  -41.458 -38.085 1.00 38.15  ? 161  LEU B CD1 1 
ATOM   5450 C CD2 . LEU B 1 160 ? -3.479  -40.661 -35.750 1.00 26.51  ? 161  LEU B CD2 1 
ATOM   5451 N N   . PRO B 1 161 ? -7.847  -43.161 -34.031 1.00 35.85  ? 162  PRO B N   1 
ATOM   5452 C CA  . PRO B 1 161 ? -9.222  -43.602 -33.784 1.00 35.45  ? 162  PRO B CA  1 
ATOM   5453 C C   . PRO B 1 161 ? -10.218 -42.769 -34.588 1.00 42.37  ? 162  PRO B C   1 
ATOM   5454 O O   . PRO B 1 161 ? -10.013 -41.551 -34.751 1.00 38.22  ? 162  PRO B O   1 
ATOM   5455 C CB  . PRO B 1 161 ? -9.394  -43.402 -32.273 1.00 36.30  ? 162  PRO B CB  1 
ATOM   5456 C CG  . PRO B 1 161 ? -7.993  -43.466 -31.730 1.00 37.21  ? 162  PRO B CG  1 
ATOM   5457 C CD  . PRO B 1 161 ? -7.142  -42.815 -32.787 1.00 32.63  ? 162  PRO B CD  1 
ATOM   5458 N N   . GLY B 1 162 ? -11.257 -43.420 -35.107 1.00 38.96  ? 163  GLY B N   1 
ATOM   5459 C CA  . GLY B 1 162 ? -12.169 -42.770 -36.036 1.00 48.04  ? 163  GLY B CA  1 
ATOM   5460 C C   . GLY B 1 162 ? -11.774 -42.835 -37.515 1.00 49.12  ? 163  GLY B C   1 
ATOM   5461 O O   . GLY B 1 162 ? -12.644 -42.899 -38.375 1.00 52.69  ? 163  GLY B O   1 
ATOM   5462 N N   . SER B 1 163 ? -10.477 -42.822 -37.826 1.00 48.10  ? 164  SER B N   1 
ATOM   5463 C CA  . SER B 1 163 ? -10.039 -42.885 -39.233 1.00 44.61  ? 164  SER B CA  1 
ATOM   5464 C C   . SER B 1 163 ? -10.281 -44.260 -39.845 1.00 47.19  ? 164  SER B C   1 
ATOM   5465 O O   . SER B 1 163 ? -10.328 -45.271 -39.141 1.00 41.23  ? 164  SER B O   1 
ATOM   5466 C CB  . SER B 1 163 ? -8.555  -42.540 -39.367 1.00 45.23  ? 164  SER B CB  1 
ATOM   5467 O OG  . SER B 1 163 ? -7.739  -43.637 -38.970 1.00 46.27  ? 164  SER B OG  1 
ATOM   5468 N N   . ARG B 1 164 ? -10.427 -44.313 -41.161 1.00 49.35  ? 165  ARG B N   1 
ATOM   5469 C CA  . ARG B 1 164 ? -10.586 -45.607 -41.810 1.00 46.07  ? 165  ARG B CA  1 
ATOM   5470 C C   . ARG B 1 164 ? -9.228  -46.133 -42.266 1.00 37.16  ? 165  ARG B C   1 
ATOM   5471 O O   . ARG B 1 164 ? -9.070  -47.329 -42.497 1.00 44.01  ? 165  ARG B O   1 
ATOM   5472 C CB  . ARG B 1 164 ? -11.560 -45.519 -42.990 1.00 62.35  ? 165  ARG B CB  1 
ATOM   5473 C CG  . ARG B 1 164 ? -11.022 -44.787 -44.222 1.00 72.73  ? 165  ARG B CG  1 
ATOM   5474 C CD  . ARG B 1 164 ? -12.130 -44.570 -45.287 1.00 84.94  ? 165  ARG B CD  1 
ATOM   5475 N NE  . ARG B 1 164 ? -13.120 -43.572 -44.863 1.00 89.67  ? 165  ARG B NE  1 
ATOM   5476 C CZ  . ARG B 1 164 ? -14.441 -43.748 -44.894 1.00 92.15  ? 165  ARG B CZ  1 
ATOM   5477 N NH1 . ARG B 1 164 ? -14.951 -44.890 -45.342 1.00 89.21  ? 165  ARG B NH1 1 
ATOM   5478 N NH2 . ARG B 1 164 ? -15.255 -42.777 -44.483 1.00 82.06  ? 165  ARG B NH2 1 
ATOM   5479 N N   . GLU B 1 165 ? -8.251  -45.239 -42.357 1.00 37.41  ? 166  GLU B N   1 
ATOM   5480 C CA  . GLU B 1 165 ? -6.926  -45.573 -42.862 1.00 36.46  ? 166  GLU B CA  1 
ATOM   5481 C C   . GLU B 1 165 ? -5.977  -46.153 -41.795 1.00 43.51  ? 166  GLU B C   1 
ATOM   5482 O O   . GLU B 1 165 ? -5.054  -46.874 -42.128 1.00 40.16  ? 166  GLU B O   1 
ATOM   5483 C CB  . GLU B 1 165 ? -6.278  -44.343 -43.497 1.00 43.38  ? 166  GLU B CB  1 
ATOM   5484 C CG  . GLU B 1 165 ? -7.063  -43.749 -44.673 1.00 57.35  ? 166  GLU B CG  1 
ATOM   5485 C CD  . GLU B 1 165 ? -7.382  -44.770 -45.789 1.00 70.07  ? 166  GLU B CD  1 
ATOM   5486 O OE1 . GLU B 1 165 ? -6.519  -45.637 -46.112 1.00 52.74  ? 166  GLU B OE1 1 
ATOM   5487 O OE2 . GLU B 1 165 ? -8.512  -44.697 -46.341 1.00 76.01  ? 166  GLU B OE2 1 
ATOM   5488 N N   . ALA B 1 166 ? -6.190  -45.835 -40.521 1.00 37.18  ? 167  ALA B N   1 
ATOM   5489 C CA  . ALA B 1 166 ? -5.460  -46.517 -39.444 1.00 36.04  ? 167  ALA B CA  1 
ATOM   5490 C C   . ALA B 1 166 ? -6.322  -46.595 -38.207 1.00 34.29  ? 167  ALA B C   1 
ATOM   5491 O O   . ALA B 1 166 ? -6.087  -45.858 -37.248 1.00 32.12  ? 167  ALA B O   1 
ATOM   5492 C CB  . ALA B 1 166 ? -4.148  -45.798 -39.130 1.00 30.94  ? 167  ALA B CB  1 
ATOM   5493 N N   . PRO B 1 167 ? -7.328  -47.476 -38.238 1.00 32.13  ? 168  PRO B N   1 
ATOM   5494 C CA  . PRO B 1 167 ? -8.357  -47.634 -37.194 1.00 34.40  ? 168  PRO B CA  1 
ATOM   5495 C C   . PRO B 1 167 ? -7.840  -48.229 -35.891 1.00 40.73  ? 168  PRO B C   1 
ATOM   5496 O O   . PRO B 1 167 ? -8.514  -48.150 -34.864 1.00 42.25  ? 168  PRO B O   1 
ATOM   5497 C CB  . PRO B 1 167 ? -9.360  -48.589 -37.828 1.00 32.04  ? 168  PRO B CB  1 
ATOM   5498 C CG  . PRO B 1 167 ? -8.529  -49.411 -38.840 1.00 31.85  ? 168  PRO B CG  1 
ATOM   5499 C CD  . PRO B 1 167 ? -7.515  -48.412 -39.370 1.00 33.60  ? 168  PRO B CD  1 
ATOM   5500 N N   . GLY B 1 168 ? -6.661  -48.832 -35.929 1.00 35.07  ? 169  GLY B N   1 
ATOM   5501 C CA  . GLY B 1 168 ? -6.131  -49.484 -34.745 1.00 33.06  ? 169  GLY B CA  1 
ATOM   5502 C C   . GLY B 1 168 ? -6.594  -50.921 -34.625 1.00 34.47  ? 169  GLY B C   1 
ATOM   5503 O O   . GLY B 1 168 ? -7.522  -51.356 -35.337 1.00 33.23  ? 169  GLY B O   1 
ATOM   5504 N N   . ASN B 1 169 ? -5.929  -51.649 -33.733 1.00 29.94  ? 170  ASN B N   1 
ATOM   5505 C CA  . ASN B 1 169 ? -6.261  -53.026 -33.404 1.00 31.33  ? 170  ASN B CA  1 
ATOM   5506 C C   . ASN B 1 169 ? -6.161  -54.037 -34.560 1.00 30.02  ? 170  ASN B C   1 
ATOM   5507 O O   . ASN B 1 169 ? -6.689  -55.152 -34.455 1.00 29.76  ? 170  ASN B O   1 
ATOM   5508 C CB  . ASN B 1 169 ? -7.672  -53.067 -32.800 1.00 26.11  ? 170  ASN B CB  1 
ATOM   5509 C CG  . ASN B 1 169 ? -7.732  -52.407 -31.410 1.00 39.64  ? 170  ASN B CG  1 
ATOM   5510 O OD1 . ASN B 1 169 ? -6.693  -52.179 -30.781 1.00 31.19  ? 170  ASN B OD1 1 
ATOM   5511 N ND2 . ASN B 1 169 ? -8.946  -52.076 -30.942 1.00 30.80  ? 170  ASN B ND2 1 
ATOM   5512 N N   . VAL B 1 170 ? -5.474  -53.690 -35.646 1.00 29.76  ? 171  VAL B N   1 
ATOM   5513 C CA  . VAL B 1 170 ? -5.505  -54.590 -36.810 1.00 26.82  ? 171  VAL B CA  1 
ATOM   5514 C C   . VAL B 1 170 ? -4.743  -55.912 -36.509 1.00 31.10  ? 171  VAL B C   1 
ATOM   5515 O O   . VAL B 1 170 ? -5.095  -56.983 -37.034 1.00 30.81  ? 171  VAL B O   1 
ATOM   5516 C CB  . VAL B 1 170 ? -4.996  -53.866 -38.087 1.00 32.28  ? 171  VAL B CB  1 
ATOM   5517 C CG1 . VAL B 1 170 ? -5.973  -52.731 -38.438 1.00 30.49  ? 171  VAL B CG1 1 
ATOM   5518 C CG2 . VAL B 1 170 ? -3.561  -53.321 -37.946 1.00 25.96  ? 171  VAL B CG2 1 
ATOM   5519 N N   . GLY B 1 171 ? -3.797  -55.853 -35.570 1.00 28.54  ? 172  GLY B N   1 
ATOM   5520 C CA  . GLY B 1 171 ? -3.104  -57.037 -35.089 1.00 25.74  ? 172  GLY B CA  1 
ATOM   5521 C C   . GLY B 1 171 ? -4.052  -58.031 -34.441 1.00 31.21  ? 172  GLY B C   1 
ATOM   5522 O O   . GLY B 1 171 ? -3.924  -59.249 -34.618 1.00 29.46  ? 172  GLY B O   1 
ATOM   5523 N N   . LEU B 1 172 ? -5.022  -57.513 -33.698 1.00 27.61  ? 173  LEU B N   1 
ATOM   5524 C CA  . LEU B 1 172 ? -6.036  -58.363 -33.081 1.00 30.39  ? 173  LEU B CA  1 
ATOM   5525 C C   . LEU B 1 172 ? -6.962  -58.903 -34.175 1.00 25.45  ? 173  LEU B C   1 
ATOM   5526 O O   . LEU B 1 172 ? -7.419  -60.055 -34.130 1.00 28.66  ? 173  LEU B O   1 
ATOM   5527 C CB  . LEU B 1 172 ? -6.838  -57.584 -32.025 1.00 29.78  ? 173  LEU B CB  1 
ATOM   5528 C CG  . LEU B 1 172 ? -6.213  -57.310 -30.653 1.00 35.51  ? 173  LEU B CG  1 
ATOM   5529 C CD1 . LEU B 1 172 ? -7.070  -56.279 -29.913 1.00 29.34  ? 173  LEU B CD1 1 
ATOM   5530 C CD2 . LEU B 1 172 ? -6.105  -58.615 -29.825 1.00 31.89  ? 173  LEU B CD2 1 
ATOM   5531 N N   . LEU B 1 173 ? -7.234  -58.069 -35.168 1.00 22.34  ? 174  LEU B N   1 
ATOM   5532 C CA  . LEU B 1 173 ? -8.014  -58.543 -36.327 1.00 28.13  ? 174  LEU B CA  1 
ATOM   5533 C C   . LEU B 1 173 ? -7.256  -59.624 -37.103 1.00 27.50  ? 174  LEU B C   1 
ATOM   5534 O O   . LEU B 1 173 ? -7.881  -60.557 -37.640 1.00 32.00  ? 174  LEU B O   1 
ATOM   5535 C CB  . LEU B 1 173 ? -8.385  -57.388 -37.243 1.00 26.02  ? 174  LEU B CB  1 
ATOM   5536 C CG  . LEU B 1 173 ? -9.418  -56.422 -36.635 1.00 34.92  ? 174  LEU B CG  1 
ATOM   5537 C CD1 . LEU B 1 173 ? -9.804  -55.318 -37.641 1.00 31.95  ? 174  LEU B CD1 1 
ATOM   5538 C CD2 . LEU B 1 173 ? -10.670 -57.170 -36.127 1.00 27.33  ? 174  LEU B CD2 1 
ATOM   5539 N N   . ASP B 1 174 ? -5.927  -59.512 -37.152 1.00 23.95  ? 175  ASP B N   1 
ATOM   5540 C CA  . ASP B 1 174 ? -5.092  -60.605 -37.720 1.00 26.06  ? 175  ASP B CA  1 
ATOM   5541 C C   . ASP B 1 174 ? -5.366  -61.901 -36.981 1.00 26.71  ? 175  ASP B C   1 
ATOM   5542 O O   . ASP B 1 174 ? -5.661  -62.925 -37.606 1.00 32.19  ? 175  ASP B O   1 
ATOM   5543 C CB  . ASP B 1 174 ? -3.591  -60.276 -37.649 1.00 22.75  ? 175  ASP B CB  1 
ATOM   5544 C CG  . ASP B 1 174 ? -3.211  -59.067 -38.510 1.00 28.34  ? 175  ASP B CG  1 
ATOM   5545 O OD1 . ASP B 1 174 ? -4.011  -58.718 -39.406 1.00 30.37  ? 175  ASP B OD1 1 
ATOM   5546 O OD2 . ASP B 1 174 ? -2.114  -58.478 -38.302 1.00 27.37  ? 175  ASP B OD2 1 
ATOM   5547 N N   . GLN B 1 175 ? -5.298  -61.847 -35.642 1.00 27.51  ? 176  GLN B N   1 
ATOM   5548 C CA  . GLN B 1 175 ? -5.586  -63.021 -34.824 1.00 27.01  ? 176  GLN B CA  1 
ATOM   5549 C C   . GLN B 1 175 ? -6.992  -63.540 -35.082 1.00 26.58  ? 176  GLN B C   1 
ATOM   5550 O O   . GLN B 1 175 ? -7.191  -64.742 -35.267 1.00 29.70  ? 176  GLN B O   1 
ATOM   5551 C CB  . GLN B 1 175 ? -5.411  -62.707 -33.329 1.00 27.99  ? 176  GLN B CB  1 
ATOM   5552 C CG  . GLN B 1 175 ? -4.018  -62.217 -32.949 1.00 26.21  ? 176  GLN B CG  1 
ATOM   5553 C CD  . GLN B 1 175 ? -4.004  -61.721 -31.519 1.00 27.73  ? 176  GLN B CD  1 
ATOM   5554 O OE1 . GLN B 1 175 ? -4.976  -61.928 -30.792 1.00 29.03  ? 176  GLN B OE1 1 
ATOM   5555 N NE2 . GLN B 1 175 ? -2.916  -61.082 -31.104 1.00 24.14  ? 176  GLN B NE2 1 
ATOM   5556 N N   . ARG B 1 176 ? -7.976  -62.644 -35.083 1.00 28.93  ? 177  ARG B N   1 
ATOM   5557 C CA  . ARG B 1 176 ? -9.355  -63.056 -35.366 1.00 29.23  ? 177  ARG B CA  1 
ATOM   5558 C C   . ARG B 1 176 ? -9.511  -63.705 -36.735 1.00 30.09  ? 177  ARG B C   1 
ATOM   5559 O O   . ARG B 1 176 ? -10.191 -64.737 -36.870 1.00 30.55  ? 177  ARG B O   1 
ATOM   5560 C CB  . ARG B 1 176 ? -10.321 -61.873 -35.286 1.00 32.34  ? 177  ARG B CB  1 
ATOM   5561 C CG  . ARG B 1 176 ? -11.764 -62.274 -35.645 1.00 38.22  ? 177  ARG B CG  1 
ATOM   5562 C CD  . ARG B 1 176 ? -12.729 -61.101 -35.542 1.00 38.22  ? 177  ARG B CD  1 
ATOM   5563 N NE  . ARG B 1 176 ? -12.918 -60.736 -34.142 1.00 42.80  ? 177  ARG B NE  1 
ATOM   5564 C CZ  . ARG B 1 176 ? -13.412 -59.573 -33.733 1.00 41.60  ? 177  ARG B CZ  1 
ATOM   5565 N NH1 . ARG B 1 176 ? -13.760 -58.662 -34.629 1.00 43.70  ? 177  ARG B NH1 1 
ATOM   5566 N NH2 . ARG B 1 176 ? -13.554 -59.335 -32.430 1.00 37.97  ? 177  ARG B NH2 1 
ATOM   5567 N N   . LEU B 1 177 ? -8.888  -63.112 -37.755 1.00 28.25  ? 178  LEU B N   1 
ATOM   5568 C CA  . LEU B 1 177 ? -8.987  -63.701 -39.098 1.00 29.25  ? 178  LEU B CA  1 
ATOM   5569 C C   . LEU B 1 177 ? -8.422  -65.124 -39.058 1.00 32.33  ? 178  LEU B C   1 
ATOM   5570 O O   . LEU B 1 177 ? -9.018  -66.044 -39.612 1.00 33.52  ? 178  LEU B O   1 
ATOM   5571 C CB  . LEU B 1 177 ? -8.279  -62.837 -40.147 1.00 24.89  ? 178  LEU B CB  1 
ATOM   5572 C CG  . LEU B 1 177 ? -8.338  -63.382 -41.584 1.00 35.55  ? 178  LEU B CG  1 
ATOM   5573 C CD1 . LEU B 1 177 ? -9.783  -63.598 -42.028 1.00 30.50  ? 178  LEU B CD1 1 
ATOM   5574 C CD2 . LEU B 1 177 ? -7.626  -62.460 -42.559 1.00 27.49  ? 178  LEU B CD2 1 
ATOM   5575 N N   . ALA B 1 178 ? -7.320  -65.324 -38.334 1.00 28.68  ? 179  ALA B N   1 
ATOM   5576 C CA  . ALA B 1 178 ? -6.750  -66.659 -38.227 1.00 28.36  ? 179  ALA B CA  1 
ATOM   5577 C C   . ALA B 1 178 ? -7.710  -67.621 -37.524 1.00 35.29  ? 179  ALA B C   1 
ATOM   5578 O O   . ALA B 1 178 ? -7.797  -68.809 -37.887 1.00 28.17  ? 179  ALA B O   1 
ATOM   5579 C CB  . ALA B 1 178 ? -5.394  -66.614 -37.487 1.00 23.36  ? 179  ALA B CB  1 
ATOM   5580 N N   . LEU B 1 179 ? -8.418  -67.117 -36.512 1.00 32.04  ? 180  LEU B N   1 
ATOM   5581 C CA  . LEU B 1 179 ? -9.429  -67.924 -35.813 1.00 35.32  ? 180  LEU B CA  1 
ATOM   5582 C C   . LEU B 1 179 ? -10.611 -68.314 -36.729 1.00 32.52  ? 180  LEU B C   1 
ATOM   5583 O O   . LEU B 1 179 ? -11.102 -69.439 -36.656 1.00 32.64  ? 180  LEU B O   1 
ATOM   5584 C CB  . LEU B 1 179 ? -9.960  -67.175 -34.578 1.00 28.52  ? 180  LEU B CB  1 
ATOM   5585 C CG  . LEU B 1 179 ? -8.936  -66.964 -33.466 1.00 30.20  ? 180  LEU B CG  1 
ATOM   5586 C CD1 . LEU B 1 179 ? -9.558  -66.233 -32.263 1.00 30.06  ? 180  LEU B CD1 1 
ATOM   5587 C CD2 . LEU B 1 179 ? -8.316  -68.313 -33.050 1.00 31.73  ? 180  LEU B CD2 1 
ATOM   5588 N N   . GLN B 1 180 ? -11.080 -67.371 -37.551 1.00 33.22  ? 181  GLN B N   1 
ATOM   5589 C CA  . GLN B 1 180 ? -12.049 -67.665 -38.626 1.00 38.80  ? 181  GLN B CA  1 
ATOM   5590 C C   . GLN B 1 180 ? -11.526 -68.724 -39.600 1.00 32.79  ? 181  GLN B C   1 
ATOM   5591 O O   . GLN B 1 180 ? -12.243 -69.658 -39.979 1.00 40.80  ? 181  GLN B O   1 
ATOM   5592 C CB  . GLN B 1 180 ? -12.414 -66.371 -39.381 1.00 36.37  ? 181  GLN B CB  1 
ATOM   5593 C CG  . GLN B 1 180 ? -13.025 -65.351 -38.429 1.00 46.49  ? 181  GLN B CG  1 
ATOM   5594 C CD  . GLN B 1 180 ? -13.253 -63.970 -39.034 1.00 55.38  ? 181  GLN B CD  1 
ATOM   5595 O OE1 . GLN B 1 180 ? -12.497 -63.520 -39.886 1.00 48.97  ? 181  GLN B OE1 1 
ATOM   5596 N NE2 . GLN B 1 180 ? -14.295 -63.283 -38.566 1.00 46.56  ? 181  GLN B NE2 1 
ATOM   5597 N N   . TRP B 1 181 ? -10.264 -68.596 -39.984 1.00 33.98  ? 182  TRP B N   1 
ATOM   5598 C CA  . TRP B 1 181 ? -9.626  -69.601 -40.828 1.00 32.95  ? 182  TRP B CA  1 
ATOM   5599 C C   . TRP B 1 181 ? -9.687  -70.992 -40.188 1.00 35.47  ? 182  TRP B C   1 
ATOM   5600 O O   . TRP B 1 181 ? -9.901  -72.002 -40.870 1.00 33.09  ? 182  TRP B O   1 
ATOM   5601 C CB  . TRP B 1 181 ? -8.184  -69.201 -41.102 1.00 34.34  ? 182  TRP B CB  1 
ATOM   5602 C CG  . TRP B 1 181 ? -7.500  -70.036 -42.128 1.00 35.50  ? 182  TRP B CG  1 
ATOM   5603 C CD1 . TRP B 1 181 ? -7.321  -69.734 -43.459 1.00 36.10  ? 182  TRP B CD1 1 
ATOM   5604 C CD2 . TRP B 1 181 ? -6.870  -71.307 -41.916 1.00 27.62  ? 182  TRP B CD2 1 
ATOM   5605 N NE1 . TRP B 1 181 ? -6.632  -70.757 -44.086 1.00 32.54  ? 182  TRP B NE1 1 
ATOM   5606 C CE2 . TRP B 1 181 ? -6.347  -71.732 -43.162 1.00 33.27  ? 182  TRP B CE2 1 
ATOM   5607 C CE3 . TRP B 1 181 ? -6.702  -72.130 -40.797 1.00 31.68  ? 182  TRP B CE3 1 
ATOM   5608 C CZ2 . TRP B 1 181 ? -5.663  -72.944 -43.314 1.00 29.71  ? 182  TRP B CZ2 1 
ATOM   5609 C CZ3 . TRP B 1 181 ? -6.030  -73.339 -40.955 1.00 35.27  ? 182  TRP B CZ3 1 
ATOM   5610 C CH2 . TRP B 1 181 ? -5.530  -73.739 -42.206 1.00 28.55  ? 182  TRP B CH2 1 
ATOM   5611 N N   . VAL B 1 182 ? -9.490  -71.051 -38.875 1.00 34.03  ? 183  VAL B N   1 
ATOM   5612 C CA  . VAL B 1 182 ? -9.528  -72.335 -38.151 1.00 31.88  ? 183  VAL B CA  1 
ATOM   5613 C C   . VAL B 1 182 ? -10.949 -72.930 -38.192 1.00 34.15  ? 183  VAL B C   1 
ATOM   5614 O O   . VAL B 1 182 ? -11.137 -74.116 -38.453 1.00 35.31  ? 183  VAL B O   1 
ATOM   5615 C CB  . VAL B 1 182 ? -9.059  -72.156 -36.685 1.00 31.49  ? 183  VAL B CB  1 
ATOM   5616 C CG1 . VAL B 1 182 ? -9.393  -73.400 -35.815 1.00 29.86  ? 183  VAL B CG1 1 
ATOM   5617 C CG2 . VAL B 1 182 ? -7.562  -71.854 -36.658 1.00 31.54  ? 183  VAL B CG2 1 
ATOM   5618 N N   . GLN B 1 183 ? -11.947 -72.095 -37.933 1.00 32.83  ? 184  GLN B N   1 
ATOM   5619 C CA  . GLN B 1 183 ? -13.330 -72.531 -38.034 1.00 39.63  ? 184  GLN B CA  1 
ATOM   5620 C C   . GLN B 1 183 ? -13.610 -73.123 -39.428 1.00 39.42  ? 184  GLN B C   1 
ATOM   5621 O O   . GLN B 1 183 ? -14.131 -74.237 -39.546 1.00 41.68  ? 184  GLN B O   1 
ATOM   5622 C CB  . GLN B 1 183 ? -14.285 -71.367 -37.737 1.00 31.56  ? 184  GLN B CB  1 
ATOM   5623 C CG  . GLN B 1 183 ? -14.407 -71.050 -36.237 1.00 40.32  ? 184  GLN B CG  1 
ATOM   5624 C CD  . GLN B 1 183 ? -14.845 -72.258 -35.450 1.00 42.17  ? 184  GLN B CD  1 
ATOM   5625 O OE1 . GLN B 1 183 ? -15.915 -72.805 -35.694 1.00 47.04  ? 184  GLN B OE1 1 
ATOM   5626 N NE2 . GLN B 1 183 ? -14.006 -72.702 -34.524 1.00 39.39  ? 184  GLN B NE2 1 
ATOM   5627 N N   . GLU B 1 184 ? -13.235 -72.396 -40.475 1.00 37.77  ? 185  GLU B N   1 
ATOM   5628 C CA  . GLU B 1 184 ? -13.536 -72.839 -41.845 1.00 41.93  ? 185  GLU B CA  1 
ATOM   5629 C C   . GLU B 1 184 ? -12.706 -74.016 -42.340 1.00 42.57  ? 185  GLU B C   1 
ATOM   5630 O O   . GLU B 1 184 ? -13.148 -74.765 -43.211 1.00 44.71  ? 185  GLU B O   1 
ATOM   5631 C CB  . GLU B 1 184 ? -13.379 -71.667 -42.811 1.00 41.17  ? 185  GLU B CB  1 
ATOM   5632 C CG  . GLU B 1 184 ? -14.416 -70.572 -42.539 1.00 52.56  ? 185  GLU B CG  1 
ATOM   5633 C CD  . GLU B 1 184 ? -14.281 -69.357 -43.449 1.00 73.29  ? 185  GLU B CD  1 
ATOM   5634 O OE1 . GLU B 1 184 ? -13.444 -69.404 -44.383 1.00 76.94  ? 185  GLU B OE1 1 
ATOM   5635 O OE2 . GLU B 1 184 ? -15.018 -68.356 -43.230 1.00 66.05  ? 185  GLU B OE2 1 
ATOM   5636 N N   . ASN B 1 185 ? -11.517 -74.213 -41.787 1.00 38.79  ? 186  ASN B N   1 
ATOM   5637 C CA  . ASN B 1 185 ? -10.567 -75.097 -42.453 1.00 33.78  ? 186  ASN B CA  1 
ATOM   5638 C C   . ASN B 1 185 ? -9.929  -76.186 -41.614 1.00 36.56  ? 186  ASN B C   1 
ATOM   5639 O O   . ASN B 1 185 ? -9.282  -77.061 -42.177 1.00 39.15  ? 186  ASN B O   1 
ATOM   5640 C CB  . ASN B 1 185 ? -9.431  -74.256 -43.071 1.00 33.78  ? 186  ASN B CB  1 
ATOM   5641 C CG  . ASN B 1 185 ? -9.904  -73.374 -44.205 1.00 34.80  ? 186  ASN B CG  1 
ATOM   5642 O OD1 . ASN B 1 185 ? -10.457 -73.853 -45.201 1.00 38.44  ? 186  ASN B OD1 1 
ATOM   5643 N ND2 . ASN B 1 185 ? -9.706  -72.076 -44.057 1.00 36.93  ? 186  ASN B ND2 1 
ATOM   5644 N N   . VAL B 1 186 ? -10.065 -76.141 -40.287 1.00 31.67  ? 187  VAL B N   1 
ATOM   5645 C CA  . VAL B 1 186 ? -9.253  -77.035 -39.458 1.00 33.09  ? 187  VAL B CA  1 
ATOM   5646 C C   . VAL B 1 186 ? -9.735  -78.486 -39.594 1.00 33.46  ? 187  VAL B C   1 
ATOM   5647 O O   . VAL B 1 186 ? -8.975  -79.441 -39.372 1.00 36.87  ? 187  VAL B O   1 
ATOM   5648 C CB  . VAL B 1 186 ? -9.252  -76.595 -37.947 1.00 33.16  ? 187  VAL B CB  1 
ATOM   5649 C CG1 . VAL B 1 186 ? -10.551 -76.984 -37.248 1.00 31.63  ? 187  VAL B CG1 1 
ATOM   5650 C CG2 . VAL B 1 186 ? -8.079  -77.221 -37.207 1.00 28.55  ? 187  VAL B CG2 1 
ATOM   5651 N N   . ALA B 1 187 ? -11.003 -78.657 -39.964 1.00 35.70  ? 188  ALA B N   1 
ATOM   5652 C CA  . ALA B 1 187 ? -11.556 -80.008 -40.138 1.00 37.37  ? 188  ALA B CA  1 
ATOM   5653 C C   . ALA B 1 187 ? -10.809 -80.752 -41.243 1.00 40.32  ? 188  ALA B C   1 
ATOM   5654 O O   . ALA B 1 187 ? -10.678 -81.978 -41.196 1.00 43.86  ? 188  ALA B O   1 
ATOM   5655 C CB  . ALA B 1 187 ? -13.059 -79.946 -40.451 1.00 37.23  ? 188  ALA B CB  1 
ATOM   5656 N N   . ALA B 1 188 ? -10.299 -80.000 -42.221 1.00 34.19  ? 189  ALA B N   1 
ATOM   5657 C CA  . ALA B 1 188 ? -9.537  -80.593 -43.334 1.00 36.55  ? 189  ALA B CA  1 
ATOM   5658 C C   . ALA B 1 188 ? -8.258  -81.253 -42.843 1.00 38.13  ? 189  ALA B C   1 
ATOM   5659 O O   . ALA B 1 188 ? -7.736  -82.154 -43.497 1.00 44.44  ? 189  ALA B O   1 
ATOM   5660 C CB  . ALA B 1 188 ? -9.219  -79.522 -44.401 1.00 32.00  ? 189  ALA B CB  1 
ATOM   5661 N N   . PHE B 1 189 ? -7.754  -80.815 -41.687 1.00 38.67  ? 190  PHE B N   1 
ATOM   5662 C CA  . PHE B 1 189 ? -6.573  -81.431 -41.070 1.00 34.58  ? 190  PHE B CA  1 
ATOM   5663 C C   . PHE B 1 189 ? -6.960  -82.449 -39.998 1.00 40.20  ? 190  PHE B C   1 
ATOM   5664 O O   . PHE B 1 189 ? -6.094  -83.038 -39.354 1.00 38.74  ? 190  PHE B O   1 
ATOM   5665 C CB  . PHE B 1 189 ? -5.650  -80.363 -40.457 1.00 38.69  ? 190  PHE B CB  1 
ATOM   5666 C CG  . PHE B 1 189 ? -5.219  -79.309 -41.436 1.00 36.16  ? 190  PHE B CG  1 
ATOM   5667 C CD1 . PHE B 1 189 ? -6.067  -78.267 -41.766 1.00 29.75  ? 190  PHE B CD1 1 
ATOM   5668 C CD2 . PHE B 1 189 ? -3.969  -79.365 -42.033 1.00 33.22  ? 190  PHE B CD2 1 
ATOM   5669 C CE1 . PHE B 1 189 ? -5.688  -77.301 -42.685 1.00 34.96  ? 190  PHE B CE1 1 
ATOM   5670 C CE2 . PHE B 1 189 ? -3.583  -78.404 -42.955 1.00 31.94  ? 190  PHE B CE2 1 
ATOM   5671 C CZ  . PHE B 1 189 ? -4.442  -77.370 -43.283 1.00 27.62  ? 190  PHE B CZ  1 
ATOM   5672 N N   . GLY B 1 190 ? -8.260  -82.665 -39.820 1.00 38.81  ? 191  GLY B N   1 
ATOM   5673 C CA  . GLY B 1 190 ? -8.727  -83.606 -38.819 1.00 39.69  ? 191  GLY B CA  1 
ATOM   5674 C C   . GLY B 1 190 ? -9.034  -82.965 -37.469 1.00 46.00  ? 191  GLY B C   1 
ATOM   5675 O O   . GLY B 1 190 ? -9.308  -83.655 -36.483 1.00 45.51  ? 191  GLY B O   1 
ATOM   5676 N N   . GLY B 1 191 ? -8.996  -81.637 -37.430 1.00 37.32  ? 192  GLY B N   1 
ATOM   5677 C CA  . GLY B 1 191 ? -9.264  -80.902 -36.211 1.00 38.37  ? 192  GLY B CA  1 
ATOM   5678 C C   . GLY B 1 191 ? -10.746 -80.635 -36.051 1.00 43.09  ? 192  GLY B C   1 
ATOM   5679 O O   . GLY B 1 191 ? -11.500 -80.650 -37.016 1.00 48.23  ? 192  GLY B O   1 
ATOM   5680 N N   . ASP B 1 192 ? -11.160 -80.383 -34.816 1.00 42.81  ? 193  ASP B N   1 
ATOM   5681 C CA  . ASP B 1 192 ? -12.562 -80.189 -34.475 1.00 37.16  ? 193  ASP B CA  1 
ATOM   5682 C C   . ASP B 1 192 ? -12.883 -78.716 -34.259 1.00 37.94  ? 193  ASP B C   1 
ATOM   5683 O O   . ASP B 1 192 ? -12.551 -78.152 -33.218 1.00 42.96  ? 193  ASP B O   1 
ATOM   5684 C CB  . ASP B 1 192 ? -12.885 -80.990 -33.208 1.00 38.90  ? 193  ASP B CB  1 
ATOM   5685 C CG  . ASP B 1 192 ? -14.375 -81.017 -32.877 1.00 40.34  ? 193  ASP B CG  1 
ATOM   5686 O OD1 . ASP B 1 192 ? -15.172 -80.215 -33.428 1.00 41.61  ? 193  ASP B OD1 1 
ATOM   5687 O OD2 . ASP B 1 192 ? -14.747 -81.853 -32.035 1.00 50.68  ? 193  ASP B OD2 1 
ATOM   5688 N N   . PRO B 1 193 ? -13.561 -78.088 -35.222 1.00 44.72  ? 194  PRO B N   1 
ATOM   5689 C CA  . PRO B 1 193 ? -13.902 -76.673 -35.038 1.00 39.05  ? 194  PRO B CA  1 
ATOM   5690 C C   . PRO B 1 193 ? -14.839 -76.415 -33.861 1.00 41.57  ? 194  PRO B C   1 
ATOM   5691 O O   . PRO B 1 193 ? -15.040 -75.248 -33.520 1.00 44.31  ? 194  PRO B O   1 
ATOM   5692 C CB  . PRO B 1 193 ? -14.599 -76.299 -36.363 1.00 40.07  ? 194  PRO B CB  1 
ATOM   5693 C CG  . PRO B 1 193 ? -15.055 -77.597 -36.933 1.00 40.24  ? 194  PRO B CG  1 
ATOM   5694 C CD  . PRO B 1 193 ? -14.038 -78.617 -36.514 1.00 40.06  ? 194  PRO B CD  1 
ATOM   5695 N N   . THR B 1 194 ? -15.426 -77.461 -33.280 1.00 41.14  ? 195  THR B N   1 
ATOM   5696 C CA  . THR B 1 194 ? -16.344 -77.280 -32.150 1.00 47.29  ? 195  THR B CA  1 
ATOM   5697 C C   . THR B 1 194 ? -15.622 -77.425 -30.823 1.00 43.77  ? 195  THR B C   1 
ATOM   5698 O O   . THR B 1 194 ? -16.240 -77.288 -29.769 1.00 50.25  ? 195  THR B O   1 
ATOM   5699 C CB  . THR B 1 194 ? -17.522 -78.283 -32.172 1.00 37.87  ? 195  THR B CB  1 
ATOM   5700 O OG1 . THR B 1 194 ? -17.024 -79.618 -31.992 1.00 40.65  ? 195  THR B OG1 1 
ATOM   5701 C CG2 . THR B 1 194 ? -18.287 -78.184 -33.496 1.00 39.25  ? 195  THR B CG2 1 
ATOM   5702 N N   . SER B 1 195 ? -14.326 -77.719 -30.877 1.00 43.18  ? 196  SER B N   1 
ATOM   5703 C CA  . SER B 1 195 ? -13.489 -77.781 -29.677 1.00 41.63  ? 196  SER B CA  1 
ATOM   5704 C C   . SER B 1 195 ? -12.143 -77.064 -29.917 1.00 41.31  ? 196  SER B C   1 
ATOM   5705 O O   . SER B 1 195 ? -11.105 -77.683 -30.189 1.00 39.16  ? 196  SER B O   1 
ATOM   5706 C CB  . SER B 1 195 ? -13.263 -79.229 -29.241 1.00 36.91  ? 196  SER B CB  1 
ATOM   5707 O OG  . SER B 1 195 ? -12.405 -79.296 -28.110 1.00 46.71  ? 196  SER B OG  1 
ATOM   5708 N N   . VAL B 1 196 ? -12.185 -75.744 -29.810 1.00 36.64  ? 197  VAL B N   1 
ATOM   5709 C CA  . VAL B 1 196 ? -11.014 -74.915 -30.010 1.00 39.50  ? 197  VAL B CA  1 
ATOM   5710 C C   . VAL B 1 196 ? -10.604 -74.181 -28.726 1.00 37.29  ? 197  VAL B C   1 
ATOM   5711 O O   . VAL B 1 196 ? -11.377 -73.384 -28.166 1.00 32.37  ? 197  VAL B O   1 
ATOM   5712 C CB  . VAL B 1 196 ? -11.270 -73.904 -31.119 1.00 35.15  ? 197  VAL B CB  1 
ATOM   5713 C CG1 . VAL B 1 196 ? -10.130 -72.887 -31.174 1.00 31.83  ? 197  VAL B CG1 1 
ATOM   5714 C CG2 . VAL B 1 196 ? -11.472 -74.648 -32.473 1.00 28.82  ? 197  VAL B CG2 1 
ATOM   5715 N N   . THR B 1 197 ? -9.387  -74.456 -28.268 1.00 37.12  ? 198  THR B N   1 
ATOM   5716 C CA  . THR B 1 197 ? -8.858  -73.824 -27.067 1.00 33.59  ? 198  THR B CA  1 
ATOM   5717 C C   . THR B 1 197 ? -7.756  -72.830 -27.418 1.00 34.16  ? 198  THR B C   1 
ATOM   5718 O O   . THR B 1 197 ? -6.733  -73.197 -27.992 1.00 35.50  ? 198  THR B O   1 
ATOM   5719 C CB  . THR B 1 197 ? -8.314  -74.866 -26.091 1.00 32.80  ? 198  THR B CB  1 
ATOM   5720 O OG1 . THR B 1 197 ? -9.383  -75.732 -25.673 1.00 33.78  ? 198  THR B OG1 1 
ATOM   5721 C CG2 . THR B 1 197 ? -7.680  -74.177 -24.861 1.00 30.58  ? 198  THR B CG2 1 
ATOM   5722 N N   . LEU B 1 198 ? -7.974  -71.561 -27.095 1.00 35.93  ? 199  LEU B N   1 
ATOM   5723 C CA  . LEU B 1 198 ? -6.930  -70.567 -27.278 1.00 30.00  ? 199  LEU B CA  1 
ATOM   5724 C C   . LEU B 1 198 ? -5.923  -70.604 -26.134 1.00 33.43  ? 199  LEU B C   1 
ATOM   5725 O O   . LEU B 1 198 ? -6.296  -70.770 -24.968 1.00 33.37  ? 199  LEU B O   1 
ATOM   5726 C CB  . LEU B 1 198 ? -7.518  -69.174 -27.349 1.00 31.55  ? 199  LEU B CB  1 
ATOM   5727 C CG  . LEU B 1 198 ? -8.593  -68.811 -28.338 1.00 37.31  ? 199  LEU B CG  1 
ATOM   5728 C CD1 . LEU B 1 198 ? -8.753  -67.291 -28.277 1.00 32.07  ? 199  LEU B CD1 1 
ATOM   5729 C CD2 . LEU B 1 198 ? -8.158  -69.267 -29.723 1.00 33.73  ? 199  LEU B CD2 1 
ATOM   5730 N N   . PHE B 1 199 ? -4.643  -70.439 -26.438 1.00 30.60  ? 200  PHE B N   1 
ATOM   5731 C CA  . PHE B 1 199 ? -3.728  -70.187 -25.347 1.00 26.15  ? 200  PHE B CA  1 
ATOM   5732 C C   . PHE B 1 199 ? -2.645  -69.230 -25.771 1.00 29.32  ? 200  PHE B C   1 
ATOM   5733 O O   . PHE B 1 199 ? -2.328  -69.088 -26.954 1.00 28.99  ? 200  PHE B O   1 
ATOM   5734 C CB  . PHE B 1 199 ? -3.191  -71.509 -24.725 1.00 24.34  ? 200  PHE B CB  1 
ATOM   5735 C CG  . PHE B 1 199 ? -2.284  -72.360 -25.587 1.00 29.50  ? 200  PHE B CG  1 
ATOM   5736 C CD1 . PHE B 1 199 ? -2.586  -72.674 -26.915 1.00 26.36  ? 200  PHE B CD1 1 
ATOM   5737 C CD2 . PHE B 1 199 ? -1.154  -72.941 -25.004 1.00 27.87  ? 200  PHE B CD2 1 
ATOM   5738 C CE1 . PHE B 1 199 ? -1.757  -73.506 -27.642 1.00 27.97  ? 200  PHE B CE1 1 
ATOM   5739 C CE2 . PHE B 1 199 ? -0.301  -73.758 -25.741 1.00 35.42  ? 200  PHE B CE2 1 
ATOM   5740 C CZ  . PHE B 1 199 ? -0.596  -74.043 -27.058 1.00 29.48  ? 200  PHE B CZ  1 
ATOM   5741 N N   . GLY B 1 200 ? -2.135  -68.499 -24.793 1.00 29.67  ? 201  GLY B N   1 
ATOM   5742 C CA  . GLY B 1 200 ? -1.209  -67.421 -25.065 1.00 24.12  ? 201  GLY B CA  1 
ATOM   5743 C C   . GLY B 1 200 ? -0.480  -67.021 -23.803 1.00 26.64  ? 201  GLY B C   1 
ATOM   5744 O O   . GLY B 1 200 ? -0.946  -67.289 -22.718 1.00 26.96  ? 201  GLY B O   1 
ATOM   5745 N N   . GLU B 1 201 ? 0.659   -66.363 -23.949 1.00 27.15  ? 202  GLU B N   1 
ATOM   5746 C CA  . GLU B 1 201 ? 1.453   -65.992 -22.809 1.00 26.43  ? 202  GLU B CA  1 
ATOM   5747 C C   . GLU B 1 201 ? 1.760   -64.506 -22.923 1.00 32.72  ? 202  GLU B C   1 
ATOM   5748 O O   . GLU B 1 201 ? 1.988   -64.017 -24.031 1.00 27.21  ? 202  GLU B O   1 
ATOM   5749 C CB  . GLU B 1 201 ? 2.713   -66.863 -22.745 1.00 24.82  ? 202  GLU B CB  1 
ATOM   5750 C CG  . GLU B 1 201 ? 3.582   -66.643 -21.523 1.00 23.21  ? 202  GLU B CG  1 
ATOM   5751 C CD  . GLU B 1 201 ? 4.597   -65.541 -21.751 1.00 32.20  ? 202  GLU B CD  1 
ATOM   5752 O OE1 . GLU B 1 201 ? 4.744   -65.112 -22.924 1.00 28.58  ? 202  GLU B OE1 1 
ATOM   5753 O OE2 . GLU B 1 201 ? 5.225   -65.092 -20.761 1.00 32.45  ? 202  GLU B OE2 1 
ATOM   5754 N N   . SER B 1 202 ? 1.712   -63.789 -21.789 1.00 29.67  ? 203  SER B N   1 
ATOM   5755 C CA  . SER B 1 202 ? 1.894   -62.316 -21.740 1.00 28.01  ? 203  SER B CA  1 
ATOM   5756 C C   . SER B 1 202 ? 0.937   -61.516 -22.679 1.00 32.07  ? 203  SER B C   1 
ATOM   5757 O O   . SER B 1 202 ? -0.280  -61.637 -22.557 1.00 28.93  ? 203  SER B O   1 
ATOM   5758 C CB  . SER B 1 202 ? 3.359   -61.979 -22.048 1.00 33.27  ? 203  SER B CB  1 
ATOM   5759 O OG  . SER B 1 202 ? 3.757   -60.756 -21.438 1.00 35.32  ? 203  SER B OG  1 
ATOM   5760 N N   . ALA B 1 203 ? 1.470   -60.721 -23.620 1.00 30.26  ? 204  ALA B N   1 
ATOM   5761 C CA  . ALA B 1 203 ? 0.594   -60.060 -24.607 1.00 27.08  ? 204  ALA B CA  1 
ATOM   5762 C C   . ALA B 1 203 ? -0.321  -61.042 -25.352 1.00 25.78  ? 204  ALA B C   1 
ATOM   5763 O O   . ALA B 1 203 ? -1.434  -60.676 -25.771 1.00 25.70  ? 204  ALA B O   1 
ATOM   5764 C CB  . ALA B 1 203 ? 1.402   -59.275 -25.605 1.00 24.39  ? 204  ALA B CB  1 
ATOM   5765 N N   . GLY B 1 204 ? 0.127   -62.288 -25.498 1.00 29.44  ? 205  GLY B N   1 
ATOM   5766 C CA  . GLY B 1 204 ? -0.698  -63.324 -26.094 1.00 24.93  ? 205  GLY B CA  1 
ATOM   5767 C C   . GLY B 1 204 ? -1.861  -63.714 -25.186 1.00 30.35  ? 205  GLY B C   1 
ATOM   5768 O O   . GLY B 1 204 ? -2.977  -64.011 -25.651 1.00 30.47  ? 205  GLY B O   1 
ATOM   5769 N N   . ALA B 1 205 ? -1.601  -63.714 -23.880 1.00 27.61  ? 206  ALA B N   1 
ATOM   5770 C CA  . ALA B 1 205 ? -2.637  -64.006 -22.895 1.00 30.15  ? 206  ALA B CA  1 
ATOM   5771 C C   . ALA B 1 205 ? -3.635  -62.845 -22.865 1.00 30.12  ? 206  ALA B C   1 
ATOM   5772 O O   . ALA B 1 205 ? -4.842  -63.051 -22.841 1.00 26.96  ? 206  ALA B O   1 
ATOM   5773 C CB  . ALA B 1 205 ? -2.022  -64.230 -21.508 1.00 25.85  ? 206  ALA B CB  1 
ATOM   5774 N N   . ALA B 1 206 ? -3.111  -61.622 -22.868 1.00 28.10  ? 207  ALA B N   1 
ATOM   5775 C CA  . ALA B 1 206 ? -3.948  -60.433 -22.966 1.00 30.07  ? 207  ALA B CA  1 
ATOM   5776 C C   . ALA B 1 206 ? -4.794  -60.463 -24.261 1.00 33.32  ? 207  ALA B C   1 
ATOM   5777 O O   . ALA B 1 206 ? -5.973  -60.088 -24.225 1.00 30.76  ? 207  ALA B O   1 
ATOM   5778 C CB  . ALA B 1 206 ? -3.075  -59.170 -22.903 1.00 27.66  ? 207  ALA B CB  1 
ATOM   5779 N N   . SER B 1 207 ? -4.221  -60.942 -25.383 1.00 25.76  ? 208  SER B N   1 
ATOM   5780 C CA  . SER B 1 207 ? -4.988  -61.064 -26.630 1.00 27.38  ? 208  SER B CA  1 
ATOM   5781 C C   . SER B 1 207 ? -6.092  -62.105 -26.446 1.00 29.65  ? 208  SER B C   1 
ATOM   5782 O O   . SER B 1 207 ? -7.234  -61.883 -26.855 1.00 28.29  ? 208  SER B O   1 
ATOM   5783 C CB  . SER B 1 207 ? -4.104  -61.470 -27.842 1.00 23.80  ? 208  SER B CB  1 
ATOM   5784 O OG  . SER B 1 207 ? -3.059  -60.542 -28.076 1.00 24.62  ? 208  SER B OG  1 
ATOM   5785 N N   . VAL B 1 208 ? -5.743  -63.256 -25.867 1.00 22.47  ? 209  VAL B N   1 
ATOM   5786 C CA  . VAL B 1 208 ? -6.744  -64.292 -25.613 1.00 24.38  ? 209  VAL B CA  1 
ATOM   5787 C C   . VAL B 1 208 ? -7.915  -63.689 -24.831 1.00 34.27  ? 209  VAL B C   1 
ATOM   5788 O O   . VAL B 1 208 ? -9.078  -63.879 -25.187 1.00 32.09  ? 209  VAL B O   1 
ATOM   5789 C CB  . VAL B 1 208 ? -6.169  -65.483 -24.809 1.00 29.00  ? 209  VAL B CB  1 
ATOM   5790 C CG1 . VAL B 1 208 ? -7.299  -66.335 -24.241 1.00 29.97  ? 209  VAL B CG1 1 
ATOM   5791 C CG2 . VAL B 1 208 ? -5.260  -66.334 -25.680 1.00 28.50  ? 209  VAL B CG2 1 
ATOM   5792 N N   . GLY B 1 209 ? -7.599  -62.940 -23.775 1.00 29.69  ? 210  GLY B N   1 
ATOM   5793 C CA  . GLY B 1 209 ? -8.624  -62.301 -22.954 1.00 32.34  ? 210  GLY B CA  1 
ATOM   5794 C C   . GLY B 1 209 ? -9.474  -61.299 -23.734 1.00 32.63  ? 210  GLY B C   1 
ATOM   5795 O O   . GLY B 1 209 ? -10.691 -61.246 -23.586 1.00 33.85  ? 210  GLY B O   1 
ATOM   5796 N N   . MET B 1 210 ? -8.839  -60.504 -24.582 1.00 30.25  ? 211  MET B N   1 
ATOM   5797 C CA  . MET B 1 210 ? -9.587  -59.597 -25.450 1.00 32.64  ? 211  MET B CA  1 
ATOM   5798 C C   . MET B 1 210 ? -10.530 -60.326 -26.415 1.00 32.98  ? 211  MET B C   1 
ATOM   5799 O O   . MET B 1 210 ? -11.631 -59.849 -26.680 1.00 34.67  ? 211  MET B O   1 
ATOM   5800 C CB  . MET B 1 210 ? -8.610  -58.694 -26.211 1.00 32.62  ? 211  MET B CB  1 
ATOM   5801 C CG  . MET B 1 210 ? -7.958  -57.666 -25.279 1.00 33.07  ? 211  MET B CG  1 
ATOM   5802 S SD  . MET B 1 210 ? -6.652  -56.727 -26.071 1.00 34.79  ? 211  MET B SD  1 
ATOM   5803 C CE  . MET B 1 210 ? -5.749  -56.119 -24.650 1.00 32.30  ? 211  MET B CE  1 
ATOM   5804 N N   . HIS B 1 211 ? -10.145 -61.499 -26.900 1.00 29.16  ? 212  HIS B N   1 
ATOM   5805 C CA  . HIS B 1 211 ? -11.061 -62.252 -27.737 1.00 31.24  ? 212  HIS B CA  1 
ATOM   5806 C C   . HIS B 1 211 ? -12.241 -62.732 -26.888 1.00 39.22  ? 212  HIS B C   1 
ATOM   5807 O O   . HIS B 1 211 ? -13.364 -62.757 -27.371 1.00 33.95  ? 212  HIS B O   1 
ATOM   5808 C CB  . HIS B 1 211 ? -10.365 -63.434 -28.430 1.00 29.51  ? 212  HIS B CB  1 
ATOM   5809 C CG  . HIS B 1 211 ? -9.377  -63.009 -29.472 1.00 36.83  ? 212  HIS B CG  1 
ATOM   5810 N ND1 . HIS B 1 211 ? -9.751  -62.368 -30.634 1.00 31.68  ? 212  HIS B ND1 1 
ATOM   5811 C CD2 . HIS B 1 211 ? -8.027  -63.114 -29.520 1.00 30.83  ? 212  HIS B CD2 1 
ATOM   5812 C CE1 . HIS B 1 211 ? -8.673  -62.089 -31.349 1.00 33.49  ? 212  HIS B CE1 1 
ATOM   5813 N NE2 . HIS B 1 211 ? -7.613  -62.532 -30.696 1.00 34.95  ? 212  HIS B NE2 1 
ATOM   5814 N N   . LEU B 1 212 ? -11.995 -63.103 -25.628 1.00 33.48  ? 213  LEU B N   1 
ATOM   5815 C CA  . LEU B 1 212 ? -13.091 -63.451 -24.717 1.00 35.03  ? 213  LEU B CA  1 
ATOM   5816 C C   . LEU B 1 212 ? -14.117 -62.326 -24.613 1.00 33.53  ? 213  LEU B C   1 
ATOM   5817 O O   . LEU B 1 212 ? -15.321 -62.575 -24.524 1.00 40.55  ? 213  LEU B O   1 
ATOM   5818 C CB  . LEU B 1 212 ? -12.563 -63.764 -23.306 1.00 37.09  ? 213  LEU B CB  1 
ATOM   5819 C CG  . LEU B 1 212 ? -11.981 -65.159 -23.097 1.00 46.72  ? 213  LEU B CG  1 
ATOM   5820 C CD1 . LEU B 1 212 ? -11.417 -65.289 -21.673 1.00 37.80  ? 213  LEU B CD1 1 
ATOM   5821 C CD2 . LEU B 1 212 ? -13.046 -66.219 -23.365 1.00 38.93  ? 213  LEU B CD2 1 
ATOM   5822 N N   . LEU B 1 213 ? -13.628 -61.091 -24.630 1.00 34.34  ? 214  LEU B N   1 
ATOM   5823 C CA  . LEU B 1 213 ? -14.454 -59.920 -24.338 1.00 31.90  ? 214  LEU B CA  1 
ATOM   5824 C C   . LEU B 1 213 ? -14.961 -59.195 -25.583 1.00 38.22  ? 214  LEU B C   1 
ATOM   5825 O O   . LEU B 1 213 ? -15.550 -58.122 -25.479 1.00 39.30  ? 214  LEU B O   1 
ATOM   5826 C CB  . LEU B 1 213 ? -13.660 -58.950 -23.473 1.00 30.03  ? 214  LEU B CB  1 
ATOM   5827 C CG  . LEU B 1 213 ? -13.104 -59.581 -22.189 1.00 30.37  ? 214  LEU B CG  1 
ATOM   5828 C CD1 . LEU B 1 213 ? -12.155 -58.602 -21.526 1.00 29.33  ? 214  LEU B CD1 1 
ATOM   5829 C CD2 . LEU B 1 213 ? -14.243 -59.965 -21.243 1.00 33.02  ? 214  LEU B CD2 1 
ATOM   5830 N N   . SER B 1 214 ? -14.699 -59.761 -26.760 1.00 39.04  ? 215  SER B N   1 
ATOM   5831 C CA  . SER B 1 214 ? -15.165 -59.175 -28.020 1.00 35.58  ? 215  SER B CA  1 
ATOM   5832 C C   . SER B 1 214 ? -16.089 -60.194 -28.666 1.00 40.76  ? 215  SER B C   1 
ATOM   5833 O O   . SER B 1 214 ? -15.640 -61.274 -29.089 1.00 39.35  ? 215  SER B O   1 
ATOM   5834 C CB  . SER B 1 214 ? -13.994 -58.819 -28.948 1.00 41.03  ? 215  SER B CB  1 
ATOM   5835 O OG  . SER B 1 214 ? -14.401 -58.071 -30.098 1.00 39.05  ? 215  SER B OG  1 
ATOM   5836 N N   . PRO B 1 215 ? -17.392 -59.877 -28.708 1.00 42.64  ? 216  PRO B N   1 
ATOM   5837 C CA  . PRO B 1 215 ? -18.383 -60.866 -29.159 1.00 40.33  ? 216  PRO B CA  1 
ATOM   5838 C C   . PRO B 1 215 ? -18.089 -61.480 -30.549 1.00 43.08  ? 216  PRO B C   1 
ATOM   5839 O O   . PRO B 1 215 ? -18.303 -62.680 -30.701 1.00 40.59  ? 216  PRO B O   1 
ATOM   5840 C CB  . PRO B 1 215 ? -19.695 -60.068 -29.154 1.00 39.02  ? 216  PRO B CB  1 
ATOM   5841 C CG  . PRO B 1 215 ? -19.483 -59.026 -28.041 1.00 36.67  ? 216  PRO B CG  1 
ATOM   5842 C CD  . PRO B 1 215 ? -18.018 -58.625 -28.243 1.00 39.13  ? 216  PRO B CD  1 
ATOM   5843 N N   . PRO B 1 216 ? -17.558 -60.707 -31.519 1.00 35.06  ? 217  PRO B N   1 
ATOM   5844 C CA  . PRO B 1 216 ? -17.316 -61.429 -32.778 1.00 36.61  ? 217  PRO B CA  1 
ATOM   5845 C C   . PRO B 1 216 ? -16.164 -62.431 -32.712 1.00 42.12  ? 217  PRO B C   1 
ATOM   5846 O O   . PRO B 1 216 ? -16.120 -63.279 -33.586 1.00 47.23  ? 217  PRO B O   1 
ATOM   5847 C CB  . PRO B 1 216 ? -16.993 -60.313 -33.783 1.00 36.36  ? 217  PRO B CB  1 
ATOM   5848 C CG  . PRO B 1 216 ? -17.477 -59.070 -33.178 1.00 34.72  ? 217  PRO B CG  1 
ATOM   5849 C CD  . PRO B 1 216 ? -17.340 -59.261 -31.674 1.00 34.54  ? 217  PRO B CD  1 
ATOM   5850 N N   . SER B 1 217 ? -15.266 -62.351 -31.726 1.00 35.97  ? 218  SER B N   1 
ATOM   5851 C CA  . SER B 1 217 ? -14.234 -63.393 -31.565 1.00 35.11  ? 218  SER B CA  1 
ATOM   5852 C C   . SER B 1 217 ? -14.772 -64.546 -30.752 1.00 38.58  ? 218  SER B C   1 
ATOM   5853 O O   . SER B 1 217 ? -14.465 -65.711 -31.020 1.00 34.29  ? 218  SER B O   1 
ATOM   5854 C CB  . SER B 1 217 ? -12.962 -62.856 -30.882 1.00 35.00  ? 218  SER B CB  1 
ATOM   5855 O OG  . SER B 1 217 ? -12.343 -61.825 -31.642 1.00 38.75  ? 218  SER B OG  1 
ATOM   5856 N N   . ARG B 1 218 ? -15.580 -64.199 -29.749 1.00 47.48  ? 219  ARG B N   1 
ATOM   5857 C CA  . ARG B 1 218 ? -16.010 -65.135 -28.714 1.00 47.15  ? 219  ARG B CA  1 
ATOM   5858 C C   . ARG B 1 218 ? -16.720 -66.343 -29.333 1.00 37.92  ? 219  ARG B C   1 
ATOM   5859 O O   . ARG B 1 218 ? -16.625 -67.469 -28.827 1.00 48.13  ? 219  ARG B O   1 
ATOM   5860 C CB  . ARG B 1 218 ? -16.905 -64.410 -27.681 1.00 45.63  ? 219  ARG B CB  1 
ATOM   5861 C CG  . ARG B 1 218 ? -17.458 -65.301 -26.611 1.00 44.40  ? 219  ARG B CG  1 
ATOM   5862 C CD  . ARG B 1 218 ? -16.341 -65.881 -25.755 1.00 44.95  ? 219  ARG B CD  1 
ATOM   5863 N NE  . ARG B 1 218 ? -16.854 -66.870 -24.814 1.00 49.56  ? 219  ARG B NE  1 
ATOM   5864 C CZ  . ARG B 1 218 ? -16.804 -68.185 -25.020 1.00 60.05  ? 219  ARG B CZ  1 
ATOM   5865 N NH1 . ARG B 1 218 ? -16.242 -68.671 -26.131 1.00 42.23  ? 219  ARG B NH1 1 
ATOM   5866 N NH2 . ARG B 1 218 ? -17.311 -69.015 -24.115 1.00 42.24  ? 219  ARG B NH2 1 
ATOM   5867 N N   . GLY B 1 219 ? -17.376 -66.130 -30.464 1.00 43.55  ? 220  GLY B N   1 
ATOM   5868 C CA  . GLY B 1 219 ? -17.960 -67.243 -31.198 1.00 40.93  ? 220  GLY B CA  1 
ATOM   5869 C C   . GLY B 1 219 ? -16.988 -68.231 -31.849 1.00 46.80  ? 220  GLY B C   1 
ATOM   5870 O O   . GLY B 1 219 ? -17.404 -69.321 -32.257 1.00 45.08  ? 220  GLY B O   1 
ATOM   5871 N N   . LEU B 1 220 ? -15.697 -67.889 -31.932 1.00 38.00  ? 221  LEU B N   1 
ATOM   5872 C CA  . LEU B 1 220 ? -14.755 -68.727 -32.696 1.00 36.54  ? 221  LEU B CA  1 
ATOM   5873 C C   . LEU B 1 220 ? -13.950 -69.715 -31.857 1.00 45.86  ? 221  LEU B C   1 
ATOM   5874 O O   . LEU B 1 220 ? -13.099 -70.421 -32.392 1.00 39.80  ? 221  LEU B O   1 
ATOM   5875 C CB  . LEU B 1 220 ? -13.779 -67.839 -33.481 1.00 35.99  ? 221  LEU B CB  1 
ATOM   5876 C CG  . LEU B 1 220 ? -14.449 -66.688 -34.229 1.00 39.30  ? 221  LEU B CG  1 
ATOM   5877 C CD1 . LEU B 1 220 ? -13.452 -65.656 -34.743 1.00 35.80  ? 221  LEU B CD1 1 
ATOM   5878 C CD2 . LEU B 1 220 ? -15.270 -67.236 -35.371 1.00 35.17  ? 221  LEU B CD2 1 
ATOM   5879 N N   . PHE B 1 221 ? -14.206 -69.766 -30.549 1.00 37.23  ? 222  PHE B N   1 
ATOM   5880 C CA  . PHE B 1 221 ? -13.527 -70.723 -29.680 1.00 38.97  ? 222  PHE B CA  1 
ATOM   5881 C C   . PHE B 1 221 ? -14.365 -71.001 -28.428 1.00 40.60  ? 222  PHE B C   1 
ATOM   5882 O O   . PHE B 1 221 ? -15.400 -70.372 -28.222 1.00 37.27  ? 222  PHE B O   1 
ATOM   5883 C CB  . PHE B 1 221 ? -12.139 -70.206 -29.274 1.00 35.27  ? 222  PHE B CB  1 
ATOM   5884 C CG  . PHE B 1 221 ? -12.179 -68.954 -28.445 1.00 34.55  ? 222  PHE B CG  1 
ATOM   5885 C CD1 . PHE B 1 221 ? -12.435 -67.728 -29.040 1.00 31.88  ? 222  PHE B CD1 1 
ATOM   5886 C CD2 . PHE B 1 221 ? -11.969 -69.004 -27.078 1.00 37.18  ? 222  PHE B CD2 1 
ATOM   5887 C CE1 . PHE B 1 221 ? -12.477 -66.577 -28.295 1.00 33.86  ? 222  PHE B CE1 1 
ATOM   5888 C CE2 . PHE B 1 221 ? -12.001 -67.842 -26.322 1.00 38.31  ? 222  PHE B CE2 1 
ATOM   5889 C CZ  . PHE B 1 221 ? -12.261 -66.631 -26.936 1.00 39.44  ? 222  PHE B CZ  1 
ATOM   5890 N N   . HIS B 1 222 ? -13.889 -71.918 -27.591 1.00 32.25  ? 223  HIS B N   1 
ATOM   5891 C CA  . HIS B 1 222 ? -14.708 -72.523 -26.540 1.00 38.10  ? 223  HIS B CA  1 
ATOM   5892 C C   . HIS B 1 222 ? -14.081 -72.437 -25.160 1.00 37.79  ? 223  HIS B C   1 
ATOM   5893 O O   . HIS B 1 222 ? -14.794 -72.360 -24.167 1.00 49.07  ? 223  HIS B O   1 
ATOM   5894 C CB  . HIS B 1 222 ? -14.994 -73.992 -26.905 1.00 36.93  ? 223  HIS B CB  1 
ATOM   5895 C CG  . HIS B 1 222 ? -15.516 -74.137 -28.299 1.00 48.40  ? 223  HIS B CG  1 
ATOM   5896 N ND1 . HIS B 1 222 ? -14.697 -74.373 -29.382 1.00 43.42  ? 223  HIS B ND1 1 
ATOM   5897 C CD2 . HIS B 1 222 ? -16.762 -73.973 -28.801 1.00 46.15  ? 223  HIS B CD2 1 
ATOM   5898 C CE1 . HIS B 1 222 ? -15.420 -74.380 -30.484 1.00 46.95  ? 223  HIS B CE1 1 
ATOM   5899 N NE2 . HIS B 1 222 ? -16.678 -74.144 -30.159 1.00 49.57  ? 223  HIS B NE2 1 
ATOM   5900 N N   . ARG B 1 223 ? -12.751 -72.455 -25.112 1.00 38.08  ? 224  ARG B N   1 
ATOM   5901 C CA  . ARG B 1 223 ? -11.980 -72.419 -23.866 1.00 36.46  ? 224  ARG B CA  1 
ATOM   5902 C C   . ARG B 1 223 ? -10.757 -71.553 -24.026 1.00 37.76  ? 224  ARG B C   1 
ATOM   5903 O O   . ARG B 1 223 ? -10.301 -71.295 -25.148 1.00 36.87  ? 224  ARG B O   1 
ATOM   5904 C CB  . ARG B 1 223 ? -11.507 -73.806 -23.456 1.00 37.54  ? 224  ARG B CB  1 
ATOM   5905 C CG  . ARG B 1 223 ? -12.585 -74.731 -23.138 1.00 43.55  ? 224  ARG B CG  1 
ATOM   5906 C CD  . ARG B 1 223 ? -12.099 -76.132 -23.211 1.00 42.70  ? 224  ARG B CD  1 
ATOM   5907 N NE  . ARG B 1 223 ? -13.272 -76.971 -23.343 1.00 51.47  ? 224  ARG B NE  1 
ATOM   5908 C CZ  . ARG B 1 223 ? -13.726 -77.439 -24.494 1.00 51.07  ? 224  ARG B CZ  1 
ATOM   5909 N NH1 . ARG B 1 223 ? -13.080 -77.193 -25.629 1.00 59.31  ? 224  ARG B NH1 1 
ATOM   5910 N NH2 . ARG B 1 223 ? -14.822 -78.180 -24.504 1.00 74.86  ? 224  ARG B NH2 1 
ATOM   5911 N N   . ALA B 1 224 ? -10.185 -71.156 -22.899 1.00 34.98  ? 225  ALA B N   1 
ATOM   5912 C CA  . ALA B 1 224 ? -9.096  -70.221 -22.941 1.00 33.73  ? 225  ALA B CA  1 
ATOM   5913 C C   . ALA B 1 224 ? -8.073  -70.490 -21.860 1.00 33.89  ? 225  ALA B C   1 
ATOM   5914 O O   . ALA B 1 224 ? -8.411  -70.936 -20.756 1.00 31.52  ? 225  ALA B O   1 
ATOM   5915 C CB  . ALA B 1 224 ? -9.643  -68.804 -22.841 1.00 33.92  ? 225  ALA B CB  1 
ATOM   5916 N N   . VAL B 1 225 ? -6.812  -70.232 -22.199 1.00 27.15  ? 226  VAL B N   1 
ATOM   5917 C CA  . VAL B 1 225 ? -5.684  -70.382 -21.275 1.00 25.86  ? 226  VAL B CA  1 
ATOM   5918 C C   . VAL B 1 225 ? -4.905  -69.084 -21.329 1.00 34.10  ? 226  VAL B C   1 
ATOM   5919 O O   . VAL B 1 225 ? -4.512  -68.654 -22.408 1.00 29.29  ? 226  VAL B O   1 
ATOM   5920 C CB  . VAL B 1 225 ? -4.745  -71.549 -21.656 1.00 29.86  ? 226  VAL B CB  1 
ATOM   5921 C CG1 . VAL B 1 225 ? -3.601  -71.701 -20.644 1.00 33.35  ? 226  VAL B CG1 1 
ATOM   5922 C CG2 . VAL B 1 225 ? -5.526  -72.848 -21.837 1.00 28.24  ? 226  VAL B CG2 1 
ATOM   5923 N N   . LEU B 1 226 ? -4.726  -68.438 -20.181 1.00 29.26  ? 227  LEU B N   1 
ATOM   5924 C CA  . LEU B 1 226 ? -4.007  -67.169 -20.097 1.00 28.06  ? 227  LEU B CA  1 
ATOM   5925 C C   . LEU B 1 226 ? -2.787  -67.369 -19.228 1.00 29.14  ? 227  LEU B C   1 
ATOM   5926 O O   . LEU B 1 226 ? -2.912  -67.547 -18.015 1.00 32.75  ? 227  LEU B O   1 
ATOM   5927 C CB  . LEU B 1 226 ? -4.895  -66.056 -19.519 1.00 27.57  ? 227  LEU B CB  1 
ATOM   5928 C CG  . LEU B 1 226 ? -6.058  -65.638 -20.431 1.00 33.35  ? 227  LEU B CG  1 
ATOM   5929 C CD1 . LEU B 1 226 ? -7.246  -66.561 -20.300 1.00 27.02  ? 227  LEU B CD1 1 
ATOM   5930 C CD2 . LEU B 1 226 ? -6.460  -64.224 -20.141 1.00 28.64  ? 227  LEU B CD2 1 
ATOM   5931 N N   . GLN B 1 227 ? -1.610  -67.382 -19.841 1.00 32.51  ? 228  GLN B N   1 
ATOM   5932 C CA  . GLN B 1 227 ? -0.360  -67.595 -19.110 1.00 32.17  ? 228  GLN B CA  1 
ATOM   5933 C C   . GLN B 1 227 ? 0.342   -66.273 -18.882 1.00 29.06  ? 228  GLN B C   1 
ATOM   5934 O O   . GLN B 1 227 ? 0.727   -65.607 -19.850 1.00 31.79  ? 228  GLN B O   1 
ATOM   5935 C CB  . GLN B 1 227 ? 0.552   -68.568 -19.880 1.00 31.77  ? 228  GLN B CB  1 
ATOM   5936 C CG  . GLN B 1 227 ? -0.150  -69.905 -20.213 1.00 31.92  ? 228  GLN B CG  1 
ATOM   5937 C CD  . GLN B 1 227 ? 0.619   -70.807 -21.190 1.00 34.84  ? 228  GLN B CD  1 
ATOM   5938 O OE1 . GLN B 1 227 ? 0.023   -71.671 -21.837 1.00 32.99  ? 228  GLN B OE1 1 
ATOM   5939 N NE2 . GLN B 1 227 ? 1.937   -70.616 -21.290 1.00 27.98  ? 228  GLN B NE2 1 
ATOM   5940 N N   . SER B 1 228 ? 0.496   -65.885 -17.615 1.00 30.43  ? 229  SER B N   1 
ATOM   5941 C CA  . SER B 1 228 ? 1.215   -64.657 -17.250 1.00 25.34  ? 229  SER B CA  1 
ATOM   5942 C C   . SER B 1 228 ? 0.756   -63.399 -18.018 1.00 27.23  ? 229  SER B C   1 
ATOM   5943 O O   . SER B 1 228 ? 1.581   -62.635 -18.504 1.00 27.86  ? 229  SER B O   1 
ATOM   5944 C CB  . SER B 1 228 ? 2.720   -64.846 -17.478 1.00 29.00  ? 229  SER B CB  1 
ATOM   5945 O OG  . SER B 1 228 ? 3.184   -66.040 -16.884 1.00 30.55  ? 229  SER B OG  1 
ATOM   5946 N N   . GLY B 1 229 ? -0.544  -63.192 -18.170 1.00 27.59  ? 230  GLY B N   1 
ATOM   5947 C CA  . GLY B 1 229 ? -0.995  -61.976 -18.827 1.00 23.02  ? 230  GLY B CA  1 
ATOM   5948 C C   . GLY B 1 229 ? -2.510  -61.919 -18.786 1.00 28.50  ? 230  GLY B C   1 
ATOM   5949 O O   . GLY B 1 229 ? -3.176  -62.936 -18.636 1.00 25.95  ? 230  GLY B O   1 
ATOM   5950 N N   . ALA B 1 230 ? -3.052  -60.721 -18.937 1.00 27.33  ? 231  ALA B N   1 
ATOM   5951 C CA  . ALA B 1 230 ? -4.483  -60.511 -18.821 1.00 27.28  ? 231  ALA B CA  1 
ATOM   5952 C C   . ALA B 1 230 ? -4.829  -59.283 -19.624 1.00 27.14  ? 231  ALA B C   1 
ATOM   5953 O O   . ALA B 1 230 ? -3.993  -58.401 -19.779 1.00 27.68  ? 231  ALA B O   1 
ATOM   5954 C CB  . ALA B 1 230 ? -4.893  -60.344 -17.336 1.00 26.29  ? 231  ALA B CB  1 
ATOM   5955 N N   . PRO B 1 231 ? -6.058  -59.217 -20.153 1.00 28.14  ? 232  PRO B N   1 
ATOM   5956 C CA  . PRO B 1 231 ? -6.414  -58.066 -20.985 1.00 27.66  ? 232  PRO B CA  1 
ATOM   5957 C C   . PRO B 1 231 ? -6.540  -56.795 -20.134 1.00 36.78  ? 232  PRO B C   1 
ATOM   5958 O O   . PRO B 1 231 ? -6.391  -55.694 -20.666 1.00 29.47  ? 232  PRO B O   1 
ATOM   5959 C CB  . PRO B 1 231 ? -7.764  -58.479 -21.597 1.00 26.10  ? 232  PRO B CB  1 
ATOM   5960 C CG  . PRO B 1 231 ? -8.333  -59.463 -20.559 1.00 26.02  ? 232  PRO B CG  1 
ATOM   5961 C CD  . PRO B 1 231 ? -7.135  -60.224 -20.103 1.00 27.53  ? 232  PRO B CD  1 
ATOM   5962 N N   . ASN B 1 232 ? -6.799  -56.953 -18.833 1.00 30.25  ? 233  ASN B N   1 
ATOM   5963 C CA  . ASN B 1 232 ? -6.866  -55.818 -17.916 1.00 31.90  ? 233  ASN B CA  1 
ATOM   5964 C C   . ASN B 1 232 ? -5.494  -55.379 -17.380 1.00 35.84  ? 233  ASN B C   1 
ATOM   5965 O O   . ASN B 1 232 ? -5.408  -54.453 -16.568 1.00 39.04  ? 233  ASN B O   1 
ATOM   5966 C CB  . ASN B 1 232 ? -7.814  -56.147 -16.744 1.00 34.61  ? 233  ASN B CB  1 
ATOM   5967 C CG  . ASN B 1 232 ? -7.566  -57.532 -16.161 1.00 32.61  ? 233  ASN B CG  1 
ATOM   5968 O OD1 . ASN B 1 232 ? -7.443  -58.509 -16.898 1.00 34.06  ? 233  ASN B OD1 1 
ATOM   5969 N ND2 . ASN B 1 232 ? -7.483  -57.620 -14.840 1.00 28.29  ? 233  ASN B ND2 1 
ATOM   5970 N N   . GLY B 1 233 ? -4.415  -56.029 -17.818 1.00 37.45  ? 234  GLY B N   1 
ATOM   5971 C CA  . GLY B 1 233 ? -3.072  -55.528 -17.529 1.00 34.40  ? 234  GLY B CA  1 
ATOM   5972 C C   . GLY B 1 233 ? -2.891  -54.051 -17.902 1.00 39.24  ? 234  GLY B C   1 
ATOM   5973 O O   . GLY B 1 233 ? -3.378  -53.617 -18.951 1.00 37.41  ? 234  GLY B O   1 
ATOM   5974 N N   . PRO B 1 234 ? -2.189  -53.268 -17.053 1.00 32.84  ? 235  PRO B N   1 
ATOM   5975 C CA  . PRO B 1 234 ? -2.037  -51.821 -17.297 1.00 32.68  ? 235  PRO B CA  1 
ATOM   5976 C C   . PRO B 1 234 ? -1.229  -51.466 -18.575 1.00 34.65  ? 235  PRO B C   1 
ATOM   5977 O O   . PRO B 1 234 ? -1.288  -50.336 -19.028 1.00 35.19  ? 235  PRO B O   1 
ATOM   5978 C CB  . PRO B 1 234 ? -1.297  -51.329 -16.047 1.00 28.84  ? 235  PRO B CB  1 
ATOM   5979 C CG  . PRO B 1 234 ? -0.540  -52.536 -15.555 1.00 33.75  ? 235  PRO B CG  1 
ATOM   5980 C CD  . PRO B 1 234 ? -1.408  -53.731 -15.888 1.00 28.30  ? 235  PRO B CD  1 
ATOM   5981 N N   . TRP B 1 235 ? -0.472  -52.421 -19.103 1.00 36.69  ? 236  TRP B N   1 
ATOM   5982 C CA  . TRP B 1 235 ? 0.369   -52.235 -20.287 1.00 31.08  ? 236  TRP B CA  1 
ATOM   5983 C C   . TRP B 1 235 ? -0.371  -52.658 -21.545 1.00 33.62  ? 236  TRP B C   1 
ATOM   5984 O O   . TRP B 1 235 ? 0.118   -52.472 -22.643 1.00 31.02  ? 236  TRP B O   1 
ATOM   5985 C CB  . TRP B 1 235 ? 1.651   -53.064 -20.158 1.00 26.15  ? 236  TRP B CB  1 
ATOM   5986 C CG  . TRP B 1 235 ? 1.326   -54.457 -19.687 1.00 32.07  ? 236  TRP B CG  1 
ATOM   5987 C CD1 . TRP B 1 235 ? 1.286   -54.897 -18.389 1.00 36.23  ? 236  TRP B CD1 1 
ATOM   5988 C CD2 . TRP B 1 235 ? 0.947   -55.572 -20.502 1.00 29.43  ? 236  TRP B CD2 1 
ATOM   5989 N NE1 . TRP B 1 235 ? 0.919   -56.221 -18.351 1.00 34.56  ? 236  TRP B NE1 1 
ATOM   5990 C CE2 . TRP B 1 235 ? 0.703   -56.654 -19.637 1.00 30.34  ? 236  TRP B CE2 1 
ATOM   5991 C CE3 . TRP B 1 235 ? 0.812   -55.768 -21.889 1.00 32.39  ? 236  TRP B CE3 1 
ATOM   5992 C CZ2 . TRP B 1 235 ? 0.325   -57.911 -20.108 1.00 33.56  ? 236  TRP B CZ2 1 
ATOM   5993 C CZ3 . TRP B 1 235 ? 0.429   -57.014 -22.355 1.00 30.34  ? 236  TRP B CZ3 1 
ATOM   5994 C CH2 . TRP B 1 235 ? 0.196   -58.071 -21.465 1.00 34.27  ? 236  TRP B CH2 1 
ATOM   5995 N N   . ALA B 1 236 ? -1.553  -53.241 -21.375 1.00 32.86  ? 237  ALA B N   1 
ATOM   5996 C CA  . ALA B 1 236 ? -2.168  -54.014 -22.439 1.00 28.76  ? 237  ALA B CA  1 
ATOM   5997 C C   . ALA B 1 236 ? -3.158  -53.245 -23.332 1.00 37.30  ? 237  ALA B C   1 
ATOM   5998 O O   . ALA B 1 236 ? -3.463  -53.683 -24.452 1.00 31.06  ? 237  ALA B O   1 
ATOM   5999 C CB  . ALA B 1 236 ? -2.849  -55.218 -21.840 1.00 25.20  ? 237  ALA B CB  1 
ATOM   6000 N N   . THR B 1 237 ? -3.668  -52.119 -22.847 1.00 31.13  ? 238  THR B N   1 
ATOM   6001 C CA  . THR B 1 237 ? -4.566  -51.286 -23.654 1.00 33.69  ? 238  THR B CA  1 
ATOM   6002 C C   . THR B 1 237 ? -4.228  -49.838 -23.456 1.00 34.69  ? 238  THR B C   1 
ATOM   6003 O O   . THR B 1 237 ? -3.556  -49.476 -22.508 1.00 27.17  ? 238  THR B O   1 
ATOM   6004 C CB  . THR B 1 237 ? -6.024  -51.432 -23.275 1.00 31.60  ? 238  THR B CB  1 
ATOM   6005 O OG1 . THR B 1 237 ? -6.147  -51.115 -21.885 1.00 37.23  ? 238  THR B OG1 1 
ATOM   6006 C CG2 . THR B 1 237 ? -6.533  -52.856 -23.533 1.00 30.57  ? 238  THR B CG2 1 
ATOM   6007 N N   . VAL B 1 238 ? -4.726  -49.010 -24.355 1.00 33.48  ? 239  VAL B N   1 
ATOM   6008 C CA  . VAL B 1 238 ? -4.489  -47.583 -24.299 1.00 33.10  ? 239  VAL B CA  1 
ATOM   6009 C C   . VAL B 1 238 ? -5.813  -46.909 -24.690 1.00 34.87  ? 239  VAL B C   1 
ATOM   6010 O O   . VAL B 1 238 ? -6.643  -47.538 -25.359 1.00 35.44  ? 239  VAL B O   1 
ATOM   6011 C CB  . VAL B 1 238 ? -3.323  -47.215 -25.215 1.00 34.88  ? 239  VAL B CB  1 
ATOM   6012 C CG1 . VAL B 1 238 ? -3.761  -47.185 -26.735 1.00 27.73  ? 239  VAL B CG1 1 
ATOM   6013 C CG2 . VAL B 1 238 ? -2.673  -45.964 -24.773 1.00 38.27  ? 239  VAL B CG2 1 
ATOM   6014 N N   . GLY B 1 239 ? -6.057  -45.680 -24.220 1.00 40.24  ? 240  GLY B N   1 
ATOM   6015 C CA  . GLY B 1 239 ? -7.284  -44.972 -24.576 1.00 34.69  ? 240  GLY B CA  1 
ATOM   6016 C C   . GLY B 1 239 ? -7.154  -44.286 -25.949 1.00 36.55  ? 240  GLY B C   1 
ATOM   6017 O O   . GLY B 1 239 ? -6.051  -44.166 -26.499 1.00 34.79  ? 240  GLY B O   1 
ATOM   6018 N N   . MET B 1 240 ? -8.268  -43.813 -26.504 1.00 37.11  ? 241  MET B N   1 
ATOM   6019 C CA  . MET B 1 240 ? -8.248  -43.258 -27.866 1.00 42.08  ? 241  MET B CA  1 
ATOM   6020 C C   . MET B 1 240 ? -7.314  -42.073 -27.988 1.00 37.37  ? 241  MET B C   1 
ATOM   6021 O O   . MET B 1 240 ? -6.539  -41.977 -28.936 1.00 36.41  ? 241  MET B O   1 
ATOM   6022 C CB  . MET B 1 240 ? -9.650  -42.854 -28.310 1.00 36.20  ? 241  MET B CB  1 
ATOM   6023 C CG  . MET B 1 240 ? -10.543 -44.041 -28.473 1.00 41.80  ? 241  MET B CG  1 
ATOM   6024 S SD  . MET B 1 240 ? -12.212 -43.640 -28.982 1.00 55.21  ? 241  MET B SD  1 
ATOM   6025 C CE  . MET B 1 240 ? -12.935 -43.372 -27.384 1.00 56.91  ? 241  MET B CE  1 
ATOM   6026 N N   . GLY B 1 241 ? -7.365  -41.179 -27.017 1.00 35.56  ? 242  GLY B N   1 
ATOM   6027 C CA  . GLY B 1 241 ? -6.598  -39.967 -27.114 1.00 35.04  ? 242  GLY B CA  1 
ATOM   6028 C C   . GLY B 1 241 ? -5.111  -40.219 -27.003 1.00 39.23  ? 242  GLY B C   1 
ATOM   6029 O O   . GLY B 1 241 ? -4.309  -39.627 -27.742 1.00 37.84  ? 242  GLY B O   1 
ATOM   6030 N N   . GLU B 1 242 ? -4.728  -41.088 -26.075 1.00 38.89  ? 243  GLU B N   1 
ATOM   6031 C CA  . GLU B 1 242 ? -3.313  -41.387 -25.911 1.00 40.77  ? 243  GLU B CA  1 
ATOM   6032 C C   . GLU B 1 242 ? -2.809  -42.144 -27.156 1.00 38.84  ? 243  GLU B C   1 
ATOM   6033 O O   . GLU B 1 242 ? -1.679  -41.935 -27.584 1.00 34.71  ? 243  GLU B O   1 
ATOM   6034 C CB  . GLU B 1 242 ? -3.069  -42.176 -24.619 1.00 39.34  ? 243  GLU B CB  1 
ATOM   6035 C CG  . GLU B 1 242 ? -1.613  -42.682 -24.375 1.00 35.58  ? 243  GLU B CG  1 
ATOM   6036 C CD  . GLU B 1 242 ? -0.579  -41.583 -24.303 1.00 39.27  ? 243  GLU B CD  1 
ATOM   6037 O OE1 . GLU B 1 242 ? -0.952  -40.392 -24.220 1.00 46.31  ? 243  GLU B OE1 1 
ATOM   6038 O OE2 . GLU B 1 242 ? 0.629   -41.908 -24.346 1.00 41.37  ? 243  GLU B OE2 1 
ATOM   6039 N N   . ALA B 1 243 ? -3.654  -42.985 -27.753 1.00 32.97  ? 244  ALA B N   1 
ATOM   6040 C CA  . ALA B 1 243 ? -3.238  -43.709 -28.966 1.00 40.48  ? 244  ALA B CA  1 
ATOM   6041 C C   . ALA B 1 243 ? -2.987  -42.729 -30.097 1.00 40.32  ? 244  ALA B C   1 
ATOM   6042 O O   . ALA B 1 243 ? -1.969  -42.818 -30.804 1.00 35.70  ? 244  ALA B O   1 
ATOM   6043 C CB  . ALA B 1 243 ? -4.262  -44.724 -29.385 1.00 31.39  ? 244  ALA B CB  1 
ATOM   6044 N N   . ARG B 1 244 ? -3.898  -41.773 -30.245 1.00 38.43  ? 245  ARG B N   1 
ATOM   6045 C CA  . ARG B 1 244 ? -3.748  -40.769 -31.291 1.00 37.72  ? 245  ARG B CA  1 
ATOM   6046 C C   . ARG B 1 244 ? -2.491  -39.942 -31.029 1.00 32.87  ? 245  ARG B C   1 
ATOM   6047 O O   . ARG B 1 244 ? -1.765  -39.598 -31.957 1.00 42.09  ? 245  ARG B O   1 
ATOM   6048 C CB  . ARG B 1 244 ? -5.006  -39.877 -31.385 1.00 35.18  ? 245  ARG B CB  1 
ATOM   6049 C CG  . ARG B 1 244 ? -4.782  -38.560 -32.118 1.00 31.78  ? 245  ARG B CG  1 
ATOM   6050 C CD  . ARG B 1 244 ? -6.099  -37.907 -32.584 1.00 39.71  ? 245  ARG B CD  1 
ATOM   6051 N NE  . ARG B 1 244 ? -7.010  -38.793 -33.326 1.00 38.32  ? 245  ARG B NE  1 
ATOM   6052 C CZ  . ARG B 1 244 ? -7.028  -38.919 -34.659 1.00 35.57  ? 245  ARG B CZ  1 
ATOM   6053 N NH1 . ARG B 1 244 ? -6.182  -38.229 -35.408 1.00 33.26  ? 245  ARG B NH1 1 
ATOM   6054 N NH2 . ARG B 1 244 ? -7.902  -39.731 -35.239 1.00 32.23  ? 245  ARG B NH2 1 
ATOM   6055 N N   . ARG B 1 245 ? -2.222  -39.635 -29.767 1.00 32.91  ? 246  ARG B N   1 
ATOM   6056 C CA  . ARG B 1 245 ? -1.044  -38.832 -29.435 1.00 34.98  ? 246  ARG B CA  1 
ATOM   6057 C C   . ARG B 1 245 ? 0.249   -39.543 -29.833 1.00 42.52  ? 246  ARG B C   1 
ATOM   6058 O O   . ARG B 1 245 ? 1.191   -38.916 -30.329 1.00 37.20  ? 246  ARG B O   1 
ATOM   6059 C CB  . ARG B 1 245 ? -1.004  -38.526 -27.934 1.00 38.36  ? 246  ARG B CB  1 
ATOM   6060 C CG  . ARG B 1 245 ? 0.125   -37.572 -27.533 1.00 36.90  ? 246  ARG B CG  1 
ATOM   6061 C CD  . ARG B 1 245 ? 0.335   -37.525 -26.014 1.00 41.39  ? 246  ARG B CD  1 
ATOM   6062 N NE  . ARG B 1 245 ? 0.909   -38.775 -25.522 1.00 46.81  ? 246  ARG B NE  1 
ATOM   6063 C CZ  . ARG B 1 245 ? 2.160   -39.177 -25.757 1.00 53.35  ? 246  ARG B CZ  1 
ATOM   6064 N NH1 . ARG B 1 245 ? 2.990   -38.432 -26.484 1.00 49.41  ? 246  ARG B NH1 1 
ATOM   6065 N NH2 . ARG B 1 245 ? 2.583   -40.334 -25.260 1.00 46.07  ? 246  ARG B NH2 1 
ATOM   6066 N N   . ARG B 1 246 ? 0.288   -40.856 -29.588 1.00 35.51  ? 247  ARG B N   1 
ATOM   6067 C CA  . ARG B 1 246 ? 1.444   -41.678 -29.933 1.00 39.77  ? 247  ARG B CA  1 
ATOM   6068 C C   . ARG B 1 246 ? 1.630   -41.794 -31.457 1.00 38.26  ? 247  ARG B C   1 
ATOM   6069 O O   . ARG B 1 246 ? 2.731   -41.614 -31.972 1.00 36.65  ? 247  ARG B O   1 
ATOM   6070 C CB  . ARG B 1 246 ? 1.298   -43.061 -29.293 1.00 33.40  ? 247  ARG B CB  1 
ATOM   6071 C CG  . ARG B 1 246 ? 1.425   -43.016 -27.753 1.00 33.40  ? 247  ARG B CG  1 
ATOM   6072 C CD  . ARG B 1 246 ? 1.277   -44.396 -27.126 1.00 35.68  ? 247  ARG B CD  1 
ATOM   6073 N NE  . ARG B 1 246 ? 1.239   -44.327 -25.666 1.00 42.77  ? 247  ARG B NE  1 
ATOM   6074 C CZ  . ARG B 1 246 ? 1.265   -45.379 -24.856 1.00 42.59  ? 247  ARG B CZ  1 
ATOM   6075 N NH1 . ARG B 1 246 ? 1.362   -46.603 -25.361 1.00 35.14  ? 247  ARG B NH1 1 
ATOM   6076 N NH2 . ARG B 1 246 ? 1.220   -45.199 -23.534 1.00 35.81  ? 247  ARG B NH2 1 
ATOM   6077 N N   . ALA B 1 247 ? 0.540   -42.091 -32.153 1.00 34.94  ? 248  ALA B N   1 
ATOM   6078 C CA  . ALA B 1 247 ? 0.517   -42.164 -33.605 1.00 34.79  ? 248  ALA B CA  1 
ATOM   6079 C C   . ALA B 1 247 ? 1.029   -40.874 -34.195 1.00 42.10  ? 248  ALA B C   1 
ATOM   6080 O O   . ALA B 1 247 ? 1.871   -40.871 -35.097 1.00 40.38  ? 248  ALA B O   1 
ATOM   6081 C CB  . ALA B 1 247 ? -0.902  -42.454 -34.088 1.00 30.14  ? 248  ALA B CB  1 
ATOM   6082 N N   . THR B 1 248 ? 0.532   -39.767 -33.655 1.00 43.06  ? 249  THR B N   1 
ATOM   6083 C CA  . THR B 1 248 ? 0.874   -38.452 -34.171 1.00 42.75  ? 249  THR B CA  1 
ATOM   6084 C C   . THR B 1 248 ? 2.336   -38.136 -33.923 1.00 42.55  ? 249  THR B C   1 
ATOM   6085 O O   . THR B 1 248 ? 3.001   -37.561 -34.782 1.00 43.85  ? 249  THR B O   1 
ATOM   6086 C CB  . THR B 1 248 ? -0.033  -37.361 -33.556 1.00 43.25  ? 249  THR B CB  1 
ATOM   6087 O OG1 . THR B 1 248 ? -1.383  -37.610 -33.960 1.00 40.91  ? 249  THR B OG1 1 
ATOM   6088 C CG2 . THR B 1 248 ? 0.375   -35.959 -34.037 1.00 40.59  ? 249  THR B CG2 1 
ATOM   6089 N N   A GLN B 1 249 ? 2.851   -38.520 -32.760 0.52 38.94  ? 250  GLN B N   1 
ATOM   6090 N N   B GLN B 1 249 ? 2.853   -38.517 -32.759 0.48 38.79  ? 250  GLN B N   1 
ATOM   6091 C CA  A GLN B 1 249 ? 4.255   -38.248 -32.472 0.52 43.48  ? 250  GLN B CA  1 
ATOM   6092 C CA  B GLN B 1 249 ? 4.258   -38.245 -32.460 0.48 43.50  ? 250  GLN B CA  1 
ATOM   6093 C C   A GLN B 1 249 ? 5.170   -39.087 -33.365 0.52 44.52  ? 250  GLN B C   1 
ATOM   6094 C C   B GLN B 1 249 ? 5.183   -39.098 -33.338 0.48 44.53  ? 250  GLN B C   1 
ATOM   6095 O O   A GLN B 1 249 ? 6.244   -38.635 -33.761 0.52 43.70  ? 250  GLN B O   1 
ATOM   6096 O O   B GLN B 1 249 ? 6.271   -38.659 -33.707 0.48 43.70  ? 250  GLN B O   1 
ATOM   6097 C CB  A GLN B 1 249 ? 4.591   -38.508 -31.000 0.52 43.87  ? 250  GLN B CB  1 
ATOM   6098 C CB  B GLN B 1 249 ? 4.559   -38.478 -30.972 0.48 43.88  ? 250  GLN B CB  1 
ATOM   6099 C CG  A GLN B 1 249 ? 5.949   -37.925 -30.608 0.52 48.14  ? 250  GLN B CG  1 
ATOM   6100 C CG  B GLN B 1 249 ? 6.017   -38.201 -30.543 0.48 48.04  ? 250  GLN B CG  1 
ATOM   6101 C CD  A GLN B 1 249 ? 6.418   -38.353 -29.237 0.52 47.55  ? 250  GLN B CD  1 
ATOM   6102 C CD  B GLN B 1 249 ? 6.449   -36.739 -30.703 0.48 48.74  ? 250  GLN B CD  1 
ATOM   6103 O OE1 A GLN B 1 249 ? 5.697   -39.028 -28.502 0.52 52.40  ? 250  GLN B OE1 1 
ATOM   6104 O OE1 B GLN B 1 249 ? 5.635   -35.861 -31.001 0.48 53.25  ? 250  GLN B OE1 1 
ATOM   6105 N NE2 A GLN B 1 249 ? 7.641   -37.967 -28.886 0.52 50.93  ? 250  GLN B NE2 1 
ATOM   6106 N NE2 B GLN B 1 249 ? 7.742   -36.480 -30.504 0.48 42.18  ? 250  GLN B NE2 1 
ATOM   6107 N N   . LEU B 1 250 ? 4.749   -40.311 -33.671 1.00 40.58  ? 251  LEU B N   1 
ATOM   6108 C CA  . LEU B 1 250 ? 5.550   -41.181 -34.517 1.00 43.77  ? 251  LEU B CA  1 
ATOM   6109 C C   . LEU B 1 250 ? 5.640   -40.531 -35.893 1.00 41.50  ? 251  LEU B C   1 
ATOM   6110 O O   . LEU B 1 250 ? 6.721   -40.400 -36.450 1.00 42.02  ? 251  LEU B O   1 
ATOM   6111 C CB  . LEU B 1 250 ? 4.962   -42.592 -34.632 1.00 37.61  ? 251  LEU B CB  1 
ATOM   6112 C CG  . LEU B 1 250 ? 5.716   -43.492 -35.637 1.00 40.39  ? 251  LEU B CG  1 
ATOM   6113 C CD1 . LEU B 1 250 ? 7.132   -43.815 -35.138 1.00 36.35  ? 251  LEU B CD1 1 
ATOM   6114 C CD2 . LEU B 1 250 ? 4.955   -44.763 -35.932 1.00 37.14  ? 251  LEU B CD2 1 
ATOM   6115 N N   . ALA B 1 251 ? 4.487   -40.120 -36.410 1.00 38.30  ? 252  ALA B N   1 
ATOM   6116 C CA  . ALA B 1 251 ? 4.385   -39.422 -37.678 1.00 42.07  ? 252  ALA B CA  1 
ATOM   6117 C C   . ALA B 1 251 ? 5.342   -38.234 -37.702 1.00 47.42  ? 252  ALA B C   1 
ATOM   6118 O O   . ALA B 1 251 ? 6.201   -38.126 -38.582 1.00 46.94  ? 252  ALA B O   1 
ATOM   6119 C CB  . ALA B 1 251 ? 2.951   -38.979 -37.919 1.00 42.48  ? 252  ALA B CB  1 
ATOM   6120 N N   . HIS B 1 252 ? 5.215   -37.381 -36.694 1.00 46.56  ? 253  HIS B N   1 
ATOM   6121 C CA  . HIS B 1 252 ? 6.083   -36.233 -36.534 1.00 48.58  ? 253  HIS B CA  1 
ATOM   6122 C C   . HIS B 1 252 ? 7.560   -36.594 -36.611 1.00 50.79  ? 253  HIS B C   1 
ATOM   6123 O O   . HIS B 1 252 ? 8.311   -35.986 -37.377 1.00 57.52  ? 253  HIS B O   1 
ATOM   6124 C CB  . HIS B 1 252 ? 5.799   -35.531 -35.197 1.00 53.47  ? 253  HIS B CB  1 
ATOM   6125 C CG  . HIS B 1 252 ? 6.618   -34.292 -34.991 1.00 60.58  ? 253  HIS B CG  1 
ATOM   6126 N ND1 . HIS B 1 252 ? 6.413   -33.136 -35.717 1.00 58.23  ? 253  HIS B ND1 1 
ATOM   6127 C CD2 . HIS B 1 252 ? 7.669   -34.040 -34.171 1.00 60.25  ? 253  HIS B CD2 1 
ATOM   6128 C CE1 . HIS B 1 252 ? 7.289   -32.220 -35.341 1.00 63.91  ? 253  HIS B CE1 1 
ATOM   6129 N NE2 . HIS B 1 252 ? 8.065   -32.743 -34.407 1.00 73.92  ? 253  HIS B NE2 1 
ATOM   6130 N N   . LEU B 1 253 ? 7.973   -37.577 -35.816 1.00 46.27  ? 254  LEU B N   1 
ATOM   6131 C CA  . LEU B 1 253 ? 9.380   -37.974 -35.756 1.00 46.17  ? 254  LEU B CA  1 
ATOM   6132 C C   . LEU B 1 253 ? 9.942   -38.536 -37.068 1.00 46.32  ? 254  LEU B C   1 
ATOM   6133 O O   . LEU B 1 253 ? 11.159  -38.523 -37.267 1.00 45.45  ? 254  LEU B O   1 
ATOM   6134 C CB  . LEU B 1 253 ? 9.594   -39.010 -34.654 1.00 44.86  ? 254  LEU B CB  1 
ATOM   6135 C CG  . LEU B 1 253 ? 9.574   -38.536 -33.197 1.00 56.32  ? 254  LEU B CG  1 
ATOM   6136 C CD1 . LEU B 1 253 ? 9.050   -39.651 -32.317 1.00 48.63  ? 254  LEU B CD1 1 
ATOM   6137 C CD2 . LEU B 1 253 ? 10.963  -38.143 -32.736 1.00 52.15  ? 254  LEU B CD2 1 
ATOM   6138 N N   . VAL B 1 254 ? 9.085   -39.042 -37.951 1.00 48.95  ? 255  VAL B N   1 
ATOM   6139 C CA  . VAL B 1 254 ? 9.576   -39.567 -39.228 1.00 45.87  ? 255  VAL B CA  1 
ATOM   6140 C C   . VAL B 1 254 ? 9.229   -38.611 -40.357 1.00 49.88  ? 255  VAL B C   1 
ATOM   6141 O O   . VAL B 1 254 ? 9.228   -38.986 -41.528 1.00 54.21  ? 255  VAL B O   1 
ATOM   6142 C CB  . VAL B 1 254 ? 9.011   -40.982 -39.527 1.00 44.23  ? 255  VAL B CB  1 
ATOM   6143 C CG1 . VAL B 1 254 ? 9.416   -41.952 -38.414 1.00 41.39  ? 255  VAL B CG1 1 
ATOM   6144 C CG2 . VAL B 1 254 ? 7.506   -40.952 -39.689 1.00 38.79  ? 255  VAL B CG2 1 
ATOM   6145 N N   . GLY B 1 255 ? 8.923   -37.369 -39.993 1.00 52.67  ? 256  GLY B N   1 
ATOM   6146 C CA  . GLY B 1 255 ? 8.664   -36.327 -40.974 1.00 45.91  ? 256  GLY B CA  1 
ATOM   6147 C C   . GLY B 1 255 ? 7.262   -36.249 -41.557 1.00 51.76  ? 256  GLY B C   1 
ATOM   6148 O O   . GLY B 1 255 ? 7.083   -35.722 -42.641 1.00 62.23  ? 256  GLY B O   1 
ATOM   6149 N N   . CYS B 1 256 ? 6.261   -36.757 -40.850 1.00 48.68  ? 257  CYS B N   1 
ATOM   6150 C CA  . CYS B 1 256 ? 4.890   -36.669 -41.345 1.00 51.97  ? 257  CYS B CA  1 
ATOM   6151 C C   . CYS B 1 256 ? 3.995   -35.839 -40.421 1.00 58.83  ? 257  CYS B C   1 
ATOM   6152 O O   . CYS B 1 256 ? 4.065   -35.961 -39.210 1.00 62.34  ? 257  CYS B O   1 
ATOM   6153 C CB  . CYS B 1 256 ? 4.295   -38.064 -41.522 1.00 43.72  ? 257  CYS B CB  1 
ATOM   6154 S SG  . CYS B 1 256 ? 5.206   -39.070 -42.700 1.00 51.06  ? 257  CYS B SG  1 
ATOM   6155 N N   . PRO B 1 257 ? 3.177   -34.950 -40.997 1.00 77.77  ? 258  PRO B N   1 
ATOM   6156 C CA  . PRO B 1 257 ? 3.269   -34.616 -42.420 1.00 75.20  ? 258  PRO B CA  1 
ATOM   6157 C C   . PRO B 1 257 ? 4.363   -33.559 -42.566 1.00 70.97  ? 258  PRO B C   1 
ATOM   6158 O O   . PRO B 1 257 ? 4.866   -33.092 -41.533 1.00 69.64  ? 258  PRO B O   1 
ATOM   6159 C CB  . PRO B 1 257 ? 1.878   -34.069 -42.733 1.00 71.08  ? 258  PRO B CB  1 
ATOM   6160 C CG  . PRO B 1 257 ? 1.498   -33.363 -41.437 1.00 73.59  ? 258  PRO B CG  1 
ATOM   6161 C CD  . PRO B 1 257 ? 2.164   -34.130 -40.302 1.00 68.22  ? 258  PRO B CD  1 
ATOM   6162 N N   . PRO B 1 258 ? 4.755   -33.206 -43.803 1.00 80.46  ? 259  PRO B N   1 
ATOM   6163 C CA  . PRO B 1 258 ? 5.811   -32.189 -43.913 1.00 78.77  ? 259  PRO B CA  1 
ATOM   6164 C C   . PRO B 1 258 ? 5.254   -30.771 -43.756 1.00 73.34  ? 259  PRO B C   1 
ATOM   6165 O O   . PRO B 1 258 ? 5.723   -30.033 -42.888 1.00 71.42  ? 259  PRO B O   1 
ATOM   6166 C CB  . PRO B 1 258 ? 6.373   -32.410 -45.329 1.00 75.55  ? 259  PRO B CB  1 
ATOM   6167 C CG  . PRO B 1 258 ? 5.720   -33.693 -45.845 1.00 76.89  ? 259  PRO B CG  1 
ATOM   6168 C CD  . PRO B 1 258 ? 4.417   -33.786 -45.113 1.00 78.45  ? 259  PRO B CD  1 
ATOM   6169 N N   . THR B 1 261 ? 2.519   -31.422 -37.608 1.00 70.70  ? 262  THR B N   1 
ATOM   6170 C CA  . THR B 1 261 ? 1.905   -32.439 -36.746 1.00 79.74  ? 262  THR B CA  1 
ATOM   6171 C C   . THR B 1 261 ? 0.397   -32.540 -36.977 1.00 68.36  ? 262  THR B C   1 
ATOM   6172 O O   . THR B 1 261 ? -0.312  -31.529 -37.018 1.00 66.23  ? 262  THR B O   1 
ATOM   6173 C CB  . THR B 1 261 ? 2.148   -32.161 -35.216 1.00 79.95  ? 262  THR B CB  1 
ATOM   6174 O OG1 . THR B 1 261 ? 1.586   -30.895 -34.846 1.00 89.17  ? 262  THR B OG1 1 
ATOM   6175 C CG2 . THR B 1 261 ? 3.629   -32.160 -34.873 1.00 68.75  ? 262  THR B CG2 1 
ATOM   6176 N N   . GLY B 1 262 ? -0.093  -33.764 -37.126 1.00 60.02  ? 263  GLY B N   1 
ATOM   6177 C CA  . GLY B 1 262 ? -1.523  -33.994 -37.213 1.00 62.19  ? 263  GLY B CA  1 
ATOM   6178 C C   . GLY B 1 262 ? -2.098  -33.587 -38.552 1.00 67.20  ? 263  GLY B C   1 
ATOM   6179 O O   . GLY B 1 262 ? -1.489  -33.846 -39.590 1.00 69.39  ? 263  GLY B O   1 
ATOM   6180 N N   . GLY B 1 263 ? -3.263  -32.936 -38.525 1.00 64.53  ? 264  GLY B N   1 
ATOM   6181 C CA  . GLY B 1 263 ? -3.979  -32.566 -39.737 1.00 65.16  ? 264  GLY B CA  1 
ATOM   6182 C C   . GLY B 1 263 ? -4.925  -33.670 -40.195 1.00 62.20  ? 264  GLY B C   1 
ATOM   6183 O O   . GLY B 1 263 ? -5.352  -34.489 -39.389 1.00 57.27  ? 264  GLY B O   1 
ATOM   6184 N N   . ASN B 1 264 ? -5.252  -33.680 -41.489 1.00 60.21  ? 265  ASN B N   1 
ATOM   6185 C CA  . ASN B 1 264 ? -6.068  -34.736 -42.101 1.00 53.61  ? 265  ASN B CA  1 
ATOM   6186 C C   . ASN B 1 264 ? -5.463  -36.117 -41.809 1.00 42.60  ? 265  ASN B C   1 
ATOM   6187 O O   . ASN B 1 264 ? -4.248  -36.331 -42.014 1.00 43.88  ? 265  ASN B O   1 
ATOM   6188 C CB  . ASN B 1 264 ? -6.175  -34.462 -43.622 1.00 55.86  ? 265  ASN B CB  1 
ATOM   6189 C CG  . ASN B 1 264 ? -7.072  -35.452 -44.381 1.00 55.88  ? 265  ASN B CG  1 
ATOM   6190 O OD1 . ASN B 1 264 ? -7.162  -36.634 -44.055 1.00 55.23  ? 265  ASN B OD1 1 
ATOM   6191 N ND2 . ASN B 1 264 ? -7.735  -34.945 -45.429 1.00 77.55  ? 265  ASN B ND2 1 
ATOM   6192 N N   . ASP B 1 265 ? -6.285  -37.048 -41.332 1.00 38.64  ? 266  ASP B N   1 
ATOM   6193 C CA  . ASP B 1 265 ? -5.779  -38.390 -41.034 1.00 41.63  ? 266  ASP B CA  1 
ATOM   6194 C C   . ASP B 1 265 ? -5.355  -39.131 -42.318 1.00 45.59  ? 266  ASP B C   1 
ATOM   6195 O O   . ASP B 1 265 ? -4.301  -39.772 -42.363 1.00 45.23  ? 266  ASP B O   1 
ATOM   6196 C CB  . ASP B 1 265 ? -6.818  -39.209 -40.267 1.00 33.85  ? 266  ASP B CB  1 
ATOM   6197 C CG  . ASP B 1 265 ? -6.744  -38.984 -38.749 1.00 41.95  ? 266  ASP B CG  1 
ATOM   6198 O OD1 . ASP B 1 265 ? -5.713  -38.463 -38.264 1.00 36.19  ? 266  ASP B OD1 1 
ATOM   6199 O OD2 . ASP B 1 265 ? -7.725  -39.325 -38.048 1.00 37.94  ? 266  ASP B OD2 1 
ATOM   6200 N N   . THR B 1 266 ? -6.185  -39.046 -43.352 1.00 44.97  ? 267  THR B N   1 
ATOM   6201 C CA  . THR B 1 266 ? -5.859  -39.629 -44.651 1.00 40.74  ? 267  THR B CA  1 
ATOM   6202 C C   . THR B 1 266 ? -4.484  -39.187 -45.146 1.00 41.88  ? 267  THR B C   1 
ATOM   6203 O O   . THR B 1 266 ? -3.657  -40.020 -45.534 1.00 47.31  ? 267  THR B O   1 
ATOM   6204 C CB  . THR B 1 266 ? -6.918  -39.270 -45.683 1.00 46.23  ? 267  THR B CB  1 
ATOM   6205 O OG1 . THR B 1 266 ? -8.159  -39.864 -45.290 1.00 41.31  ? 267  THR B OG1 1 
ATOM   6206 C CG2 . THR B 1 266 ? -6.523  -39.792 -47.068 1.00 40.55  ? 267  THR B CG2 1 
ATOM   6207 N N   . GLU B 1 267 ? -4.213  -37.890 -45.106 1.00 38.61  ? 268  GLU B N   1 
ATOM   6208 C CA  . GLU B 1 267 ? -2.916  -37.416 -45.550 1.00 45.07  ? 268  GLU B CA  1 
ATOM   6209 C C   . GLU B 1 267 ? -1.800  -37.940 -44.672 1.00 49.18  ? 268  GLU B C   1 
ATOM   6210 O O   . GLU B 1 267 ? -0.727  -38.274 -45.168 1.00 41.99  ? 268  GLU B O   1 
ATOM   6211 C CB  . GLU B 1 267 ? -2.856  -35.891 -45.564 1.00 49.59  ? 268  GLU B CB  1 
ATOM   6212 C CG  . GLU B 1 267 ? -3.399  -35.249 -46.837 1.00 72.74  ? 268  GLU B CG  1 
ATOM   6213 C CD  . GLU B 1 267 ? -3.576  -33.735 -46.706 1.00 86.40  ? 268  GLU B CD  1 
ATOM   6214 O OE1 . GLU B 1 267 ? -3.134  -33.161 -45.679 1.00 88.77  ? 268  GLU B OE1 1 
ATOM   6215 O OE2 . GLU B 1 267 ? -4.165  -33.123 -47.627 1.00 102.02 ? 268  GLU B OE2 1 
ATOM   6216 N N   . LEU B 1 268 ? -2.042  -37.974 -43.361 1.00 46.56  ? 269  LEU B N   1 
ATOM   6217 C CA  . LEU B 1 268 ? -1.002  -38.353 -42.420 1.00 42.07  ? 269  LEU B CA  1 
ATOM   6218 C C   . LEU B 1 268 ? -0.631  -39.821 -42.613 1.00 36.95  ? 269  LEU B C   1 
ATOM   6219 O O   . LEU B 1 268 ? 0.541   -40.175 -42.598 1.00 39.34  ? 269  LEU B O   1 
ATOM   6220 C CB  . LEU B 1 268 ? -1.448  -38.084 -40.968 1.00 42.45  ? 269  LEU B CB  1 
ATOM   6221 C CG  . LEU B 1 268 ? -0.392  -38.195 -39.875 1.00 46.51  ? 269  LEU B CG  1 
ATOM   6222 C CD1 . LEU B 1 268 ? -0.791  -37.383 -38.682 1.00 60.60  ? 269  LEU B CD1 1 
ATOM   6223 C CD2 . LEU B 1 268 ? -0.269  -39.644 -39.452 1.00 55.99  ? 269  LEU B CD2 1 
ATOM   6224 N N   . VAL B 1 269 ? -1.631  -40.671 -42.775 1.00 34.61  ? 270  VAL B N   1 
ATOM   6225 C CA  . VAL B 1 269 ? -1.363  -42.088 -42.910 1.00 43.17  ? 270  VAL B CA  1 
ATOM   6226 C C   . VAL B 1 269 ? -0.695  -42.337 -44.271 1.00 47.37  ? 270  VAL B C   1 
ATOM   6227 O O   . VAL B 1 269 ? 0.241   -43.125 -44.368 1.00 42.83  ? 270  VAL B O   1 
ATOM   6228 C CB  . VAL B 1 269 ? -2.647  -42.930 -42.759 1.00 42.75  ? 270  VAL B CB  1 
ATOM   6229 C CG1 . VAL B 1 269 ? -2.365  -44.389 -43.035 1.00 42.48  ? 270  VAL B CG1 1 
ATOM   6230 C CG2 . VAL B 1 269 ? -3.209  -42.778 -41.339 1.00 42.27  ? 270  VAL B CG2 1 
ATOM   6231 N N   . ALA B 1 270 ? -1.145  -41.630 -45.307 1.00 48.10  ? 271  ALA B N   1 
ATOM   6232 C CA  . ALA B 1 270 ? -0.539  -41.760 -46.631 1.00 44.22  ? 271  ALA B CA  1 
ATOM   6233 C C   . ALA B 1 270 ? 0.941   -41.466 -46.550 1.00 39.20  ? 271  ALA B C   1 
ATOM   6234 O O   . ALA B 1 270 ? 1.734   -42.179 -47.144 1.00 47.44  ? 271  ALA B O   1 
ATOM   6235 C CB  . ALA B 1 270 ? -1.206  -40.842 -47.638 1.00 44.79  ? 271  ALA B CB  1 
ATOM   6236 N N   . CYS B 1 271 ? 1.314   -40.446 -45.787 1.00 40.16  ? 272  CYS B N   1 
ATOM   6237 C CA  . CYS B 1 271 ? 2.724   -40.144 -45.580 1.00 38.24  ? 272  CYS B CA  1 
ATOM   6238 C C   . CYS B 1 271 ? 3.426   -41.218 -44.720 1.00 50.23  ? 272  CYS B C   1 
ATOM   6239 O O   . CYS B 1 271 ? 4.603   -41.515 -44.942 1.00 41.13  ? 272  CYS B O   1 
ATOM   6240 C CB  . CYS B 1 271 ? 2.880   -38.759 -44.938 1.00 37.52  ? 272  CYS B CB  1 
ATOM   6241 S SG  . CYS B 1 271 ? 4.589   -38.261 -44.496 1.00 52.71  ? 272  CYS B SG  1 
ATOM   6242 N N   . LEU B 1 272 ? 2.730   -41.791 -43.732 1.00 43.18  ? 273  LEU B N   1 
ATOM   6243 C CA  . LEU B 1 272 ? 3.346   -42.867 -42.952 1.00 42.89  ? 273  LEU B CA  1 
ATOM   6244 C C   . LEU B 1 272 ? 3.585   -44.088 -43.850 1.00 43.11  ? 273  LEU B C   1 
ATOM   6245 O O   . LEU B 1 272 ? 4.564   -44.797 -43.661 1.00 35.97  ? 273  LEU B O   1 
ATOM   6246 C CB  . LEU B 1 272 ? 2.494   -43.271 -41.732 1.00 37.03  ? 273  LEU B CB  1 
ATOM   6247 C CG  . LEU B 1 272 ? 2.641   -42.410 -40.467 1.00 42.73  ? 273  LEU B CG  1 
ATOM   6248 C CD1 . LEU B 1 272 ? 1.642   -42.826 -39.424 1.00 38.14  ? 273  LEU B CD1 1 
ATOM   6249 C CD2 . LEU B 1 272 ? 4.045   -42.450 -39.884 1.00 39.00  ? 273  LEU B CD2 1 
ATOM   6250 N N   . ARG B 1 273 ? 2.706   -44.316 -44.827 1.00 35.21  ? 274  ARG B N   1 
ATOM   6251 C CA  . ARG B 1 273 ? 2.805   -45.495 -45.690 1.00 45.32  ? 274  ARG B CA  1 
ATOM   6252 C C   . ARG B 1 273 ? 3.961   -45.423 -46.679 1.00 41.68  ? 274  ARG B C   1 
ATOM   6253 O O   . ARG B 1 273 ? 4.271   -46.431 -47.305 1.00 44.18  ? 274  ARG B O   1 
ATOM   6254 C CB  . ARG B 1 273 ? 1.488   -45.752 -46.452 1.00 39.01  ? 274  ARG B CB  1 
ATOM   6255 C CG  . ARG B 1 273 ? 0.378   -46.198 -45.509 1.00 43.78  ? 274  ARG B CG  1 
ATOM   6256 C CD  . ARG B 1 273 ? -0.752  -46.975 -46.159 1.00 38.52  ? 274  ARG B CD  1 
ATOM   6257 N NE  . ARG B 1 273 ? -1.909  -46.141 -46.418 1.00 57.24  ? 274  ARG B NE  1 
ATOM   6258 C CZ  . ARG B 1 273 ? -3.118  -46.316 -45.893 1.00 53.40  ? 274  ARG B CZ  1 
ATOM   6259 N NH1 . ARG B 1 273 ? -3.376  -47.323 -45.061 1.00 41.16  ? 274  ARG B NH1 1 
ATOM   6260 N NH2 . ARG B 1 273 ? -4.090  -45.477 -46.226 1.00 55.66  ? 274  ARG B NH2 1 
ATOM   6261 N N   . THR B 1 274 ? 4.610   -44.263 -46.801 1.00 43.58  ? 275  THR B N   1 
ATOM   6262 C CA  . THR B 1 274 ? 5.749   -44.107 -47.721 1.00 43.25  ? 275  THR B CA  1 
ATOM   6263 C C   . THR B 1 274 ? 7.050   -44.320 -46.983 1.00 47.64  ? 275  THR B C   1 
ATOM   6264 O O   . THR B 1 274 ? 8.125   -44.351 -47.582 1.00 42.58  ? 275  THR B O   1 
ATOM   6265 C CB  . THR B 1 274 ? 5.820   -42.704 -48.394 1.00 44.22  ? 275  THR B CB  1 
ATOM   6266 O OG1 . THR B 1 274 ? 6.260   -41.725 -47.436 1.00 42.93  ? 275  THR B OG1 1 
ATOM   6267 C CG2 . THR B 1 274 ? 4.459   -42.304 -49.018 1.00 40.62  ? 275  THR B CG2 1 
ATOM   6268 N N   . ARG B 1 275 ? 6.974   -44.425 -45.664 1.00 42.22  ? 276  ARG B N   1 
ATOM   6269 C CA  . ARG B 1 275 ? 8.200   -44.649 -44.909 1.00 42.64  ? 276  ARG B CA  1 
ATOM   6270 C C   . ARG B 1 275 ? 8.568   -46.132 -44.964 1.00 39.53  ? 276  ARG B C   1 
ATOM   6271 O O   . ARG B 1 275 ? 7.690   -47.000 -44.879 1.00 43.47  ? 276  ARG B O   1 
ATOM   6272 C CB  . ARG B 1 275 ? 8.051   -44.169 -43.462 1.00 43.90  ? 276  ARG B CB  1 
ATOM   6273 C CG  . ARG B 1 275 ? 7.801   -42.659 -43.361 1.00 51.88  ? 276  ARG B CG  1 
ATOM   6274 C CD  . ARG B 1 275 ? 8.946   -41.895 -43.983 1.00 46.94  ? 276  ARG B CD  1 
ATOM   6275 N NE  . ARG B 1 275 ? 8.844   -40.451 -43.796 1.00 53.44  ? 276  ARG B NE  1 
ATOM   6276 C CZ  . ARG B 1 275 ? 8.391   -39.595 -44.716 1.00 57.04  ? 276  ARG B CZ  1 
ATOM   6277 N NH1 . ARG B 1 275 ? 7.972   -40.028 -45.903 1.00 54.10  ? 276  ARG B NH1 1 
ATOM   6278 N NH2 . ARG B 1 275 ? 8.352   -38.296 -44.445 1.00 51.54  ? 276  ARG B NH2 1 
ATOM   6279 N N   . PRO B 1 276 ? 9.865   -46.424 -45.133 1.00 44.16  ? 277  PRO B N   1 
ATOM   6280 C CA  . PRO B 1 276 ? 10.325  -47.810 -45.004 1.00 42.08  ? 277  PRO B CA  1 
ATOM   6281 C C   . PRO B 1 276 ? 9.959   -48.363 -43.623 1.00 37.75  ? 277  PRO B C   1 
ATOM   6282 O O   . PRO B 1 276 ? 10.099  -47.640 -42.639 1.00 35.86  ? 277  PRO B O   1 
ATOM   6283 C CB  . PRO B 1 276 ? 11.850  -47.694 -45.177 1.00 45.87  ? 277  PRO B CB  1 
ATOM   6284 C CG  . PRO B 1 276 ? 12.047  -46.428 -45.982 1.00 43.19  ? 277  PRO B CG  1 
ATOM   6285 C CD  . PRO B 1 276 ? 10.963  -45.497 -45.473 1.00 40.85  ? 277  PRO B CD  1 
ATOM   6286 N N   . ALA B 1 277 ? 9.486   -49.608 -43.575 1.00 34.46  ? 278  ALA B N   1 
ATOM   6287 C CA  . ALA B 1 277 ? 9.165   -50.286 -42.326 1.00 36.03  ? 278  ALA B CA  1 
ATOM   6288 C C   . ALA B 1 277 ? 10.228  -50.076 -41.277 1.00 38.83  ? 278  ALA B C   1 
ATOM   6289 O O   . ALA B 1 277 ? 9.919   -49.700 -40.140 1.00 36.32  ? 278  ALA B O   1 
ATOM   6290 C CB  . ALA B 1 277 ? 8.957   -51.771 -42.565 1.00 33.71  ? 278  ALA B CB  1 
ATOM   6291 N N   . GLN B 1 278 ? 11.486  -50.286 -41.647 1.00 39.65  ? 279  GLN B N   1 
ATOM   6292 C CA  . GLN B 1 278 ? 12.559  -50.202 -40.658 1.00 32.34  ? 279  GLN B CA  1 
ATOM   6293 C C   . GLN B 1 278 ? 12.635  -48.818 -40.008 1.00 32.66  ? 279  GLN B C   1 
ATOM   6294 O O   . GLN B 1 278 ? 13.031  -48.695 -38.855 1.00 33.82  ? 279  GLN B O   1 
ATOM   6295 C CB  . GLN B 1 278 ? 13.909  -50.549 -41.287 1.00 30.80  ? 279  GLN B CB  1 
ATOM   6296 C CG  . GLN B 1 278 ? 15.005  -50.788 -40.246 1.00 39.51  ? 279  GLN B CG  1 
ATOM   6297 C CD  . GLN B 1 278 ? 14.684  -51.973 -39.318 1.00 50.63  ? 279  GLN B CD  1 
ATOM   6298 O OE1 . GLN B 1 278 ? 14.323  -53.063 -39.779 1.00 49.08  ? 279  GLN B OE1 1 
ATOM   6299 N NE2 . GLN B 1 278 ? 14.809  -51.754 -38.010 1.00 36.39  ? 279  GLN B NE2 1 
ATOM   6300 N N   . VAL B 1 279 ? 12.277  -47.777 -40.759 1.00 39.35  ? 280  VAL B N   1 
ATOM   6301 C CA  . VAL B 1 279 ? 12.304  -46.415 -40.230 1.00 38.77  ? 280  VAL B CA  1 
ATOM   6302 C C   . VAL B 1 279 ? 11.245  -46.234 -39.125 1.00 33.46  ? 280  VAL B C   1 
ATOM   6303 O O   . VAL B 1 279 ? 11.523  -45.606 -38.100 1.00 39.78  ? 280  VAL B O   1 
ATOM   6304 C CB  . VAL B 1 279 ? 12.097  -45.369 -41.356 1.00 39.50  ? 280  VAL B CB  1 
ATOM   6305 C CG1 . VAL B 1 279 ? 11.837  -43.985 -40.777 1.00 39.81  ? 280  VAL B CG1 1 
ATOM   6306 C CG2 . VAL B 1 279 ? 13.318  -45.332 -42.294 1.00 33.69  ? 280  VAL B CG2 1 
ATOM   6307 N N   . LEU B 1 280 ? 10.043  -46.777 -39.324 1.00 35.21  ? 281  LEU B N   1 
ATOM   6308 C CA  . LEU B 1 280 ? 9.030   -46.731 -38.275 1.00 33.89  ? 281  LEU B CA  1 
ATOM   6309 C C   . LEU B 1 280 ? 9.539   -47.468 -37.031 1.00 39.67  ? 281  LEU B C   1 
ATOM   6310 O O   . LEU B 1 280 ? 9.517   -46.917 -35.911 1.00 39.72  ? 281  LEU B O   1 
ATOM   6311 C CB  . LEU B 1 280 ? 7.714   -47.324 -38.760 1.00 36.96  ? 281  LEU B CB  1 
ATOM   6312 C CG  . LEU B 1 280 ? 7.140   -46.665 -40.012 1.00 37.86  ? 281  LEU B CG  1 
ATOM   6313 C CD1 . LEU B 1 280 ? 5.776   -47.250 -40.343 1.00 36.45  ? 281  LEU B CD1 1 
ATOM   6314 C CD2 . LEU B 1 280 ? 7.048   -45.153 -39.825 1.00 37.77  ? 281  LEU B CD2 1 
ATOM   6315 N N   . VAL B 1 281 ? 10.042  -48.688 -37.224 1.00 39.13  ? 282  VAL B N   1 
ATOM   6316 C CA  . VAL B 1 281 ? 10.585  -49.470 -36.106 1.00 36.84  ? 282  VAL B CA  1 
ATOM   6317 C C   . VAL B 1 281 ? 11.628  -48.691 -35.322 1.00 40.58  ? 282  VAL B C   1 
ATOM   6318 O O   . VAL B 1 281 ? 11.618  -48.691 -34.082 1.00 39.71  ? 282  VAL B O   1 
ATOM   6319 C CB  . VAL B 1 281 ? 11.238  -50.797 -36.567 1.00 39.30  ? 282  VAL B CB  1 
ATOM   6320 C CG1 . VAL B 1 281 ? 12.014  -51.424 -35.403 1.00 34.20  ? 282  VAL B CG1 1 
ATOM   6321 C CG2 . VAL B 1 281 ? 10.195  -51.760 -37.095 1.00 29.80  ? 282  VAL B CG2 1 
ATOM   6322 N N   . ASN B 1 282 ? 12.535  -48.031 -36.040 1.00 41.45  ? 283  ASN B N   1 
ATOM   6323 C CA  . ASN B 1 282 ? 13.649  -47.353 -35.387 1.00 40.68  ? 283  ASN B CA  1 
ATOM   6324 C C   . ASN B 1 282 ? 13.191  -46.191 -34.518 1.00 42.97  ? 283  ASN B C   1 
ATOM   6325 O O   . ASN B 1 282 ? 13.882  -45.808 -33.580 1.00 43.24  ? 283  ASN B O   1 
ATOM   6326 C CB  . ASN B 1 282 ? 14.664  -46.861 -36.418 1.00 44.16  ? 283  ASN B CB  1 
ATOM   6327 C CG  . ASN B 1 282 ? 15.484  -47.997 -37.020 1.00 48.44  ? 283  ASN B CG  1 
ATOM   6328 O OD1 . ASN B 1 282 ? 15.514  -49.111 -36.494 1.00 49.28  ? 283  ASN B OD1 1 
ATOM   6329 N ND2 . ASN B 1 282 ? 16.163  -47.711 -38.125 1.00 45.47  ? 283  ASN B ND2 1 
ATOM   6330 N N   . HIS B 1 283 ? 12.009  -45.650 -34.801 1.00 42.55  ? 284  HIS B N   1 
ATOM   6331 C CA  . HIS B 1 283 ? 11.540  -44.491 -34.053 1.00 41.30  ? 284  HIS B CA  1 
ATOM   6332 C C   . HIS B 1 283 ? 10.471  -44.801 -32.998 1.00 47.43  ? 284  HIS B C   1 
ATOM   6333 O O   . HIS B 1 283 ? 10.134  -43.930 -32.188 1.00 46.40  ? 284  HIS B O   1 
ATOM   6334 C CB  . HIS B 1 283 ? 11.005  -43.439 -35.018 1.00 39.12  ? 284  HIS B CB  1 
ATOM   6335 C CG  . HIS B 1 283 ? 12.073  -42.724 -35.788 1.00 46.63  ? 284  HIS B CG  1 
ATOM   6336 N ND1 . HIS B 1 283 ? 12.441  -43.087 -37.065 1.00 50.41  ? 284  HIS B ND1 1 
ATOM   6337 C CD2 . HIS B 1 283 ? 12.845  -41.661 -35.463 1.00 44.28  ? 284  HIS B CD2 1 
ATOM   6338 C CE1 . HIS B 1 283 ? 13.392  -42.278 -37.495 1.00 52.38  ? 284  HIS B CE1 1 
ATOM   6339 N NE2 . HIS B 1 283 ? 13.654  -41.402 -36.543 1.00 48.95  ? 284  HIS B NE2 1 
ATOM   6340 N N   . GLU B 1 284 ? 9.954   -46.028 -32.979 1.00 41.30  ? 285  GLU B N   1 
ATOM   6341 C CA  . GLU B 1 284 ? 8.797   -46.313 -32.134 1.00 47.60  ? 285  GLU B CA  1 
ATOM   6342 C C   . GLU B 1 284 ? 9.095   -46.157 -30.631 1.00 52.13  ? 285  GLU B C   1 
ATOM   6343 O O   . GLU B 1 284 ? 8.198   -45.806 -29.877 1.00 42.85  ? 285  GLU B O   1 
ATOM   6344 C CB  . GLU B 1 284 ? 8.234   -47.711 -32.411 1.00 45.28  ? 285  GLU B CB  1 
ATOM   6345 C CG  . GLU B 1 284 ? 8.897   -48.834 -31.626 1.00 54.60  ? 285  GLU B CG  1 
ATOM   6346 C CD  . GLU B 1 284 ? 8.112   -50.148 -31.674 1.00 56.26  ? 285  GLU B CD  1 
ATOM   6347 O OE1 . GLU B 1 284 ? 7.092   -50.222 -32.398 1.00 58.83  ? 285  GLU B OE1 1 
ATOM   6348 O OE2 . GLU B 1 284 ? 8.515   -51.102 -30.976 1.00 57.83  ? 285  GLU B OE2 1 
ATOM   6349 N N   . TRP B 1 285 ? 10.338  -46.376 -30.203 1.00 51.12  ? 286  TRP B N   1 
ATOM   6350 C CA  . TRP B 1 285 ? 10.679  -46.200 -28.787 1.00 55.89  ? 286  TRP B CA  1 
ATOM   6351 C C   . TRP B 1 285 ? 10.468  -44.756 -28.296 1.00 64.23  ? 286  TRP B C   1 
ATOM   6352 O O   . TRP B 1 285 ? 10.181  -44.554 -27.119 1.00 60.38  ? 286  TRP B O   1 
ATOM   6353 C CB  . TRP B 1 285 ? 12.126  -46.624 -28.516 1.00 67.20  ? 286  TRP B CB  1 
ATOM   6354 C CG  . TRP B 1 285 ? 13.171  -45.633 -29.011 1.00 83.15  ? 286  TRP B CG  1 
ATOM   6355 C CD1 . TRP B 1 285 ? 13.693  -45.539 -30.283 1.00 72.43  ? 286  TRP B CD1 1 
ATOM   6356 C CD2 . TRP B 1 285 ? 13.824  -44.610 -28.235 1.00 88.19  ? 286  TRP B CD2 1 
ATOM   6357 N NE1 . TRP B 1 285 ? 14.621  -44.517 -30.338 1.00 75.89  ? 286  TRP B NE1 1 
ATOM   6358 C CE2 . TRP B 1 285 ? 14.720  -43.934 -29.099 1.00 85.76  ? 286  TRP B CE2 1 
ATOM   6359 C CE3 . TRP B 1 285 ? 13.737  -44.202 -26.896 1.00 86.40  ? 286  TRP B CE3 1 
ATOM   6360 C CZ2 . TRP B 1 285 ? 15.524  -42.873 -28.662 1.00 86.38  ? 286  TRP B CZ2 1 
ATOM   6361 C CZ3 . TRP B 1 285 ? 14.533  -43.141 -26.466 1.00 89.46  ? 286  TRP B CZ3 1 
ATOM   6362 C CH2 . TRP B 1 285 ? 15.414  -42.491 -27.349 1.00 93.28  ? 286  TRP B CH2 1 
ATOM   6363 N N   . HIS B 1 286 ? 10.593  -43.771 -29.195 1.00 60.72  ? 287  HIS B N   1 
ATOM   6364 C CA  . HIS B 1 286 ? 10.415  -42.351 -28.857 1.00 51.91  ? 287  HIS B CA  1 
ATOM   6365 C C   . HIS B 1 286 ? 9.016   -41.937 -28.391 1.00 58.02  ? 287  HIS B C   1 
ATOM   6366 O O   . HIS B 1 286 ? 8.862   -40.924 -27.706 1.00 61.28  ? 287  HIS B O   1 
ATOM   6367 C CB  . HIS B 1 286 ? 10.734  -41.470 -30.057 1.00 68.21  ? 287  HIS B CB  1 
ATOM   6368 C CG  . HIS B 1 286 ? 12.192  -41.252 -30.316 1.00 83.49  ? 287  HIS B CG  1 
ATOM   6369 N ND1 . HIS B 1 286 ? 12.953  -42.120 -31.071 1.00 81.26  ? 287  HIS B ND1 1 
ATOM   6370 C CD2 . HIS B 1 286 ? 13.013  -40.226 -29.983 1.00 89.12  ? 287  HIS B CD2 1 
ATOM   6371 C CE1 . HIS B 1 286 ? 14.184  -41.649 -31.174 1.00 87.57  ? 287  HIS B CE1 1 
ATOM   6372 N NE2 . HIS B 1 286 ? 14.251  -40.508 -30.511 1.00 97.76  ? 287  HIS B NE2 1 
ATOM   6373 N N   . VAL B 1 287 ? 7.982   -42.669 -28.781 1.00 51.16  ? 288  VAL B N   1 
ATOM   6374 C CA  . VAL B 1 287 ? 6.639   -42.144 -28.546 1.00 58.52  ? 288  VAL B CA  1 
ATOM   6375 C C   . VAL B 1 287 ? 6.092   -42.413 -27.136 1.00 57.83  ? 288  VAL B C   1 
ATOM   6376 O O   . VAL B 1 287 ? 4.999   -41.949 -26.807 1.00 60.06  ? 288  VAL B O   1 
ATOM   6377 C CB  . VAL B 1 287 ? 5.615   -42.682 -29.609 1.00 50.72  ? 288  VAL B CB  1 
ATOM   6378 C CG1 . VAL B 1 287 ? 6.263   -42.752 -30.995 1.00 50.79  ? 288  VAL B CG1 1 
ATOM   6379 C CG2 . VAL B 1 287 ? 5.035   -44.025 -29.222 1.00 43.40  ? 288  VAL B CG2 1 
ATOM   6380 N N   . LEU B 1 288 ? 6.825   -43.137 -26.293 1.00 54.84  ? 289  LEU B N   1 
ATOM   6381 C CA  . LEU B 1 288 ? 6.302   -43.411 -24.953 1.00 59.54  ? 289  LEU B CA  1 
ATOM   6382 C C   . LEU B 1 288 ? 6.353   -42.144 -24.098 1.00 68.49  ? 289  LEU B C   1 
ATOM   6383 O O   . LEU B 1 288 ? 7.349   -41.411 -24.138 1.00 65.32  ? 289  LEU B O   1 
ATOM   6384 C CB  . LEU B 1 288 ? 7.072   -44.538 -24.267 1.00 50.50  ? 289  LEU B CB  1 
ATOM   6385 C CG  . LEU B 1 288 ? 6.478   -45.941 -24.444 1.00 66.74  ? 289  LEU B CG  1 
ATOM   6386 C CD1 . LEU B 1 288 ? 7.092   -46.965 -23.482 1.00 66.06  ? 289  LEU B CD1 1 
ATOM   6387 C CD2 . LEU B 1 288 ? 4.980   -45.902 -24.285 1.00 53.71  ? 289  LEU B CD2 1 
ATOM   6388 N N   . PRO B 1 289 ? 5.279   -41.888 -23.317 1.00 75.10  ? 290  PRO B N   1 
ATOM   6389 C CA  . PRO B 1 289 ? 5.167   -40.689 -22.468 1.00 70.30  ? 290  PRO B CA  1 
ATOM   6390 C C   . PRO B 1 289 ? 6.103   -40.713 -21.255 1.00 70.38  ? 290  PRO B C   1 
ATOM   6391 O O   . PRO B 1 289 ? 6.576   -39.652 -20.848 1.00 70.59  ? 290  PRO B O   1 
ATOM   6392 C CB  . PRO B 1 289 ? 3.694   -40.707 -22.027 1.00 67.76  ? 290  PRO B CB  1 
ATOM   6393 C CG  . PRO B 1 289 ? 3.317   -42.146 -22.030 1.00 62.80  ? 290  PRO B CG  1 
ATOM   6394 C CD  . PRO B 1 289 ? 4.085   -42.750 -23.202 1.00 65.37  ? 290  PRO B CD  1 
ATOM   6395 N N   . GLN B 1 290 ? 6.369   -41.894 -20.700 1.00 65.01  ? 291  GLN B N   1 
ATOM   6396 C CA  . GLN B 1 290 ? 7.320   -42.024 -19.597 1.00 76.94  ? 291  GLN B CA  1 
ATOM   6397 C C   . GLN B 1 290 ? 8.378   -43.097 -19.876 1.00 75.83  ? 291  GLN B C   1 
ATOM   6398 O O   . GLN B 1 290 ? 8.094   -44.093 -20.548 1.00 62.53  ? 291  GLN B O   1 
ATOM   6399 C CB  . GLN B 1 290 ? 6.593   -42.357 -18.289 1.00 68.44  ? 291  GLN B CB  1 
ATOM   6400 C CG  . GLN B 1 290 ? 7.437   -42.064 -17.056 1.00 84.00  ? 291  GLN B CG  1 
ATOM   6401 C CD  . GLN B 1 290 ? 7.120   -42.967 -15.863 1.00 88.06  ? 291  GLN B CD  1 
ATOM   6402 O OE1 . GLN B 1 290 ? 5.974   -43.032 -15.390 1.00 85.41  ? 291  GLN B OE1 1 
ATOM   6403 N NE2 . GLN B 1 290 ? 8.147   -43.661 -15.361 1.00 71.52  ? 291  GLN B NE2 1 
ATOM   6404 N N   . GLU B 1 291 ? 9.593   -42.893 -19.363 1.00 71.84  ? 292  GLU B N   1 
ATOM   6405 C CA  . GLU B 1 291 ? 10.594  -43.960 -19.374 1.00 78.79  ? 292  GLU B CA  1 
ATOM   6406 C C   . GLU B 1 291 ? 10.072  -45.120 -18.517 1.00 78.23  ? 292  GLU B C   1 
ATOM   6407 O O   . GLU B 1 291 ? 9.540   -44.922 -17.420 1.00 68.27  ? 292  GLU B O   1 
ATOM   6408 C CB  . GLU B 1 291 ? 11.961  -43.470 -18.876 1.00 82.17  ? 292  GLU B CB  1 
ATOM   6409 C CG  . GLU B 1 291 ? 11.908  -42.474 -17.716 1.00 92.22  ? 292  GLU B CG  1 
ATOM   6410 C CD  . GLU B 1 291 ? 13.274  -42.238 -17.068 1.00 95.50  ? 292  GLU B CD  1 
ATOM   6411 O OE1 . GLU B 1 291 ? 14.087  -43.190 -17.007 1.00 92.46  ? 292  GLU B OE1 1 
ATOM   6412 O OE2 . GLU B 1 291 ? 13.529  -41.099 -16.614 1.00 96.43  ? 292  GLU B OE2 1 
ATOM   6413 N N   . SER B 1 292 ? 10.215  -46.331 -19.038 1.00 78.33  ? 293  SER B N   1 
ATOM   6414 C CA  . SER B 1 292 ? 9.525   -47.488 -18.489 1.00 66.93  ? 293  SER B CA  1 
ATOM   6415 C C   . SER B 1 292 ? 10.311  -48.768 -18.785 1.00 70.53  ? 293  SER B C   1 
ATOM   6416 O O   . SER B 1 292 ? 11.119  -48.792 -19.722 1.00 71.46  ? 293  SER B O   1 
ATOM   6417 C CB  . SER B 1 292 ? 8.111   -47.566 -19.078 1.00 67.08  ? 293  SER B CB  1 
ATOM   6418 O OG  . SER B 1 292 ? 7.580   -48.872 -18.978 1.00 64.06  ? 293  SER B OG  1 
ATOM   6419 N N   . VAL B 1 293 ? 10.090  -49.825 -18.000 1.00 60.35  ? 294  VAL B N   1 
ATOM   6420 C CA  . VAL B 1 293 ? 10.646  -51.132 -18.369 1.00 67.56  ? 294  VAL B CA  1 
ATOM   6421 C C   . VAL B 1 293 ? 9.714   -51.919 -19.314 1.00 64.65  ? 294  VAL B C   1 
ATOM   6422 O O   . VAL B 1 293 ? 10.118  -52.939 -19.877 1.00 65.13  ? 294  VAL B O   1 
ATOM   6423 C CB  . VAL B 1 293 ? 10.958  -52.003 -17.137 1.00 55.61  ? 294  VAL B CB  1 
ATOM   6424 C CG1 . VAL B 1 293 ? 12.105  -51.410 -16.352 1.00 67.50  ? 294  VAL B CG1 1 
ATOM   6425 C CG2 . VAL B 1 293 ? 9.738   -52.161 -16.268 1.00 58.15  ? 294  VAL B CG2 1 
ATOM   6426 N N   . PHE B 1 294 ? 8.476   -51.442 -19.468 1.00 62.95  ? 295  PHE B N   1 
ATOM   6427 C CA  . PHE B 1 294 ? 7.528   -51.968 -20.454 1.00 49.71  ? 295  PHE B CA  1 
ATOM   6428 C C   . PHE B 1 294 ? 7.449   -50.994 -21.618 1.00 66.35  ? 295  PHE B C   1 
ATOM   6429 O O   . PHE B 1 294 ? 6.514   -50.184 -21.734 1.00 65.69  ? 295  PHE B O   1 
ATOM   6430 C CB  . PHE B 1 294 ? 6.160   -52.213 -19.822 1.00 51.89  ? 295  PHE B CB  1 
ATOM   6431 C CG  . PHE B 1 294 ? 6.225   -53.150 -18.652 1.00 62.23  ? 295  PHE B CG  1 
ATOM   6432 C CD1 . PHE B 1 294 ? 6.155   -54.531 -18.839 1.00 60.22  ? 295  PHE B CD1 1 
ATOM   6433 C CD2 . PHE B 1 294 ? 6.432   -52.664 -17.375 1.00 58.26  ? 295  PHE B CD2 1 
ATOM   6434 C CE1 . PHE B 1 294 ? 6.250   -55.413 -17.763 1.00 47.38  ? 295  PHE B CE1 1 
ATOM   6435 C CE2 . PHE B 1 294 ? 6.532   -53.533 -16.299 1.00 58.96  ? 295  PHE B CE2 1 
ATOM   6436 C CZ  . PHE B 1 294 ? 6.445   -54.916 -16.499 1.00 49.11  ? 295  PHE B CZ  1 
ATOM   6437 N N   . ARG B 1 295 ? 8.484   -51.075 -22.453 1.00 62.12  ? 296  ARG B N   1 
ATOM   6438 C CA  . ARG B 1 295 ? 8.600   -50.329 -23.702 1.00 70.27  ? 296  ARG B CA  1 
ATOM   6439 C C   . ARG B 1 295 ? 7.515   -50.765 -24.726 1.00 66.71  ? 296  ARG B C   1 
ATOM   6440 O O   . ARG B 1 295 ? 7.809   -51.427 -25.729 1.00 56.30  ? 296  ARG B O   1 
ATOM   6441 C CB  . ARG B 1 295 ? 10.040  -50.524 -24.233 1.00 72.45  ? 296  ARG B CB  1 
ATOM   6442 C CG  . ARG B 1 295 ? 10.329  -50.175 -25.703 1.00 84.29  ? 296  ARG B CG  1 
ATOM   6443 C CD  . ARG B 1 295 ? 10.737  -51.441 -26.500 1.00 64.16  ? 296  ARG B CD  1 
ATOM   6444 N NE  . ARG B 1 295 ? 10.576  -51.224 -27.932 1.00 64.56  ? 296  ARG B NE  1 
ATOM   6445 C CZ  . ARG B 1 295 ? 11.434  -50.534 -28.680 1.00 71.24  ? 296  ARG B CZ  1 
ATOM   6446 N NH1 . ARG B 1 295 ? 12.525  -50.006 -28.131 1.00 72.40  ? 296  ARG B NH1 1 
ATOM   6447 N NH2 . ARG B 1 295 ? 11.202  -50.375 -29.979 1.00 59.47  ? 296  ARG B NH2 1 
ATOM   6448 N N   . PHE B 1 296 ? 6.248   -50.429 -24.451 1.00 58.27  ? 297  PHE B N   1 
ATOM   6449 C CA  . PHE B 1 296 ? 5.157   -50.887 -25.310 1.00 43.71  ? 297  PHE B CA  1 
ATOM   6450 C C   . PHE B 1 296 ? 4.449   -49.716 -25.995 1.00 51.76  ? 297  PHE B C   1 
ATOM   6451 O O   . PHE B 1 296 ? 3.361   -49.298 -25.585 1.00 45.89  ? 297  PHE B O   1 
ATOM   6452 C CB  . PHE B 1 296 ? 4.108   -51.693 -24.536 1.00 48.14  ? 297  PHE B CB  1 
ATOM   6453 C CG  . PHE B 1 296 ? 4.640   -52.900 -23.805 1.00 43.61  ? 297  PHE B CG  1 
ATOM   6454 C CD1 . PHE B 1 296 ? 5.963   -53.309 -23.917 1.00 52.24  ? 297  PHE B CD1 1 
ATOM   6455 C CD2 . PHE B 1 296 ? 3.795   -53.636 -23.010 1.00 41.90  ? 297  PHE B CD2 1 
ATOM   6456 C CE1 . PHE B 1 296 ? 6.435   -54.412 -23.225 1.00 53.20  ? 297  PHE B CE1 1 
ATOM   6457 C CE2 . PHE B 1 296 ? 4.252   -54.743 -22.311 1.00 44.04  ? 297  PHE B CE2 1 
ATOM   6458 C CZ  . PHE B 1 296 ? 5.577   -55.130 -22.423 1.00 50.01  ? 297  PHE B CZ  1 
ATOM   6459 N N   . SER B 1 297 ? 5.032   -49.212 -27.068 1.00 45.23  ? 298  SER B N   1 
ATOM   6460 C CA  . SER B 1 297 ? 4.498   -48.002 -27.677 1.00 48.21  ? 298  SER B CA  1 
ATOM   6461 C C   . SER B 1 297 ? 3.091   -48.165 -28.258 1.00 41.66  ? 298  SER B C   1 
ATOM   6462 O O   . SER B 1 297 ? 2.222   -47.357 -27.976 1.00 35.41  ? 298  SER B O   1 
ATOM   6463 C CB  . SER B 1 297 ? 5.456   -47.509 -28.758 1.00 48.57  ? 298  SER B CB  1 
ATOM   6464 O OG  . SER B 1 297 ? 6.650   -47.038 -28.154 1.00 53.36  ? 298  SER B OG  1 
ATOM   6465 N N   . PHE B 1 298 ? 2.868   -49.199 -29.065 1.00 33.27  ? 299  PHE B N   1 
ATOM   6466 C CA  . PHE B 1 298 ? 1.578   -49.378 -29.700 1.00 27.98  ? 299  PHE B CA  1 
ATOM   6467 C C   . PHE B 1 298 ? 0.915   -50.668 -29.255 1.00 34.00  ? 299  PHE B C   1 
ATOM   6468 O O   . PHE B 1 298 ? 1.454   -51.765 -29.452 1.00 29.76  ? 299  PHE B O   1 
ATOM   6469 C CB  . PHE B 1 298 ? 1.732   -49.355 -31.230 1.00 35.74  ? 299  PHE B CB  1 
ATOM   6470 C CG  . PHE B 1 298 ? 2.279   -48.067 -31.742 1.00 35.68  ? 299  PHE B CG  1 
ATOM   6471 C CD1 . PHE B 1 298 ? 1.450   -46.957 -31.883 1.00 29.25  ? 299  PHE B CD1 1 
ATOM   6472 C CD2 . PHE B 1 298 ? 3.631   -47.939 -32.030 1.00 33.73  ? 299  PHE B CD2 1 
ATOM   6473 C CE1 . PHE B 1 298 ? 1.950   -45.754 -32.343 1.00 33.67  ? 299  PHE B CE1 1 
ATOM   6474 C CE2 . PHE B 1 298 ? 4.145   -46.728 -32.484 1.00 35.08  ? 299  PHE B CE2 1 
ATOM   6475 C CZ  . PHE B 1 298 ? 3.296   -45.635 -32.642 1.00 37.90  ? 299  PHE B CZ  1 
ATOM   6476 N N   . VAL B 1 299 ? -0.274  -50.531 -28.682 1.00 33.35  ? 300  VAL B N   1 
ATOM   6477 C CA  . VAL B 1 299 ? -0.965  -51.645 -28.045 1.00 25.80  ? 300  VAL B CA  1 
ATOM   6478 C C   . VAL B 1 299 ? -2.446  -51.520 -28.395 1.00 27.15  ? 300  VAL B C   1 
ATOM   6479 O O   . VAL B 1 299 ? -2.855  -50.496 -28.977 1.00 26.15  ? 300  VAL B O   1 
ATOM   6480 C CB  . VAL B 1 299 ? -0.749  -51.643 -26.501 1.00 27.78  ? 300  VAL B CB  1 
ATOM   6481 C CG1 . VAL B 1 299 ? 0.754   -51.787 -26.149 1.00 25.62  ? 300  VAL B CG1 1 
ATOM   6482 C CG2 . VAL B 1 299 ? -1.366  -50.376 -25.863 1.00 26.74  ? 300  VAL B CG2 1 
ATOM   6483 N N   . PRO B 1 300 ? -3.253  -52.555 -28.083 1.00 24.86  ? 301  PRO B N   1 
ATOM   6484 C CA  . PRO B 1 300 ? -4.679  -52.432 -28.391 1.00 30.34  ? 301  PRO B CA  1 
ATOM   6485 C C   . PRO B 1 300 ? -5.301  -51.169 -27.785 1.00 35.65  ? 301  PRO B C   1 
ATOM   6486 O O   . PRO B 1 300 ? -4.904  -50.710 -26.693 1.00 28.71  ? 301  PRO B O   1 
ATOM   6487 C CB  . PRO B 1 300 ? -5.265  -53.701 -27.774 1.00 27.49  ? 301  PRO B CB  1 
ATOM   6488 C CG  . PRO B 1 300 ? -4.149  -54.699 -27.934 1.00 29.02  ? 301  PRO B CG  1 
ATOM   6489 C CD  . PRO B 1 300 ? -2.928  -53.917 -27.605 1.00 26.95  ? 301  PRO B CD  1 
ATOM   6490 N N   . VAL B 1 301 ? -6.242  -50.597 -28.529 1.00 33.13  ? 302  VAL B N   1 
ATOM   6491 C CA  . VAL B 1 301 ? -6.889  -49.346 -28.168 1.00 31.91  ? 302  VAL B CA  1 
ATOM   6492 C C   . VAL B 1 301 ? -8.340  -49.626 -27.819 1.00 32.19  ? 302  VAL B C   1 
ATOM   6493 O O   . VAL B 1 301 ? -9.021  -50.409 -28.485 1.00 28.83  ? 302  VAL B O   1 
ATOM   6494 C CB  . VAL B 1 301 ? -6.783  -48.278 -29.310 1.00 32.85  ? 302  VAL B CB  1 
ATOM   6495 C CG1 . VAL B 1 301 ? -7.321  -48.802 -30.644 1.00 28.73  ? 302  VAL B CG1 1 
ATOM   6496 C CG2 . VAL B 1 301 ? -7.499  -46.988 -28.914 1.00 34.18  ? 302  VAL B CG2 1 
ATOM   6497 N N   . VAL B 1 302 ? -8.792  -49.032 -26.716 1.00 32.44  ? 303  VAL B N   1 
ATOM   6498 C CA  . VAL B 1 302 ? -10.187 -49.113 -26.325 1.00 33.13  ? 303  VAL B CA  1 
ATOM   6499 C C   . VAL B 1 302 ? -10.950 -48.018 -27.055 1.00 38.69  ? 303  VAL B C   1 
ATOM   6500 O O   . VAL B 1 302 ? -10.772 -46.835 -26.757 1.00 36.42  ? 303  VAL B O   1 
ATOM   6501 C CB  . VAL B 1 302 ? -10.368 -48.935 -24.797 1.00 38.44  ? 303  VAL B CB  1 
ATOM   6502 C CG1 . VAL B 1 302 ? -11.855 -48.938 -24.451 1.00 33.18  ? 303  VAL B CG1 1 
ATOM   6503 C CG2 . VAL B 1 302 ? -9.621  -50.029 -24.054 1.00 35.63  ? 303  VAL B CG2 1 
ATOM   6504 N N   . ASP B 1 303 ? -11.792 -48.401 -28.005 1.00 41.35  ? 304  ASP B N   1 
ATOM   6505 C CA  . ASP B 1 303 ? -12.361 -47.414 -28.914 1.00 45.32  ? 304  ASP B CA  1 
ATOM   6506 C C   . ASP B 1 303 ? -13.821 -47.700 -29.277 1.00 45.68  ? 304  ASP B C   1 
ATOM   6507 O O   . ASP B 1 303 ? -14.397 -47.039 -30.134 1.00 46.66  ? 304  ASP B O   1 
ATOM   6508 C CB  . ASP B 1 303 ? -11.500 -47.329 -30.177 1.00 40.41  ? 304  ASP B CB  1 
ATOM   6509 C CG  . ASP B 1 303 ? -11.780 -48.457 -31.165 1.00 43.67  ? 304  ASP B CG  1 
ATOM   6510 O OD1 . ASP B 1 303 ? -12.132 -49.599 -30.753 1.00 45.17  ? 304  ASP B OD1 1 
ATOM   6511 O OD2 . ASP B 1 303 ? -11.646 -48.189 -32.373 1.00 49.86  ? 304  ASP B OD2 1 
ATOM   6512 N N   . GLY B 1 304 ? -14.418 -48.679 -28.614 1.00 38.81  ? 305  GLY B N   1 
ATOM   6513 C CA  . GLY B 1 304 ? -15.825 -48.943 -28.812 1.00 43.74  ? 305  GLY B CA  1 
ATOM   6514 C C   . GLY B 1 304 ? -16.075 -50.027 -29.830 1.00 49.82  ? 305  GLY B C   1 
ATOM   6515 O O   . GLY B 1 304 ? -17.171 -50.592 -29.898 1.00 53.25  ? 305  GLY B O   1 
ATOM   6516 N N   . ASP B 1 305 ? -15.054 -50.331 -30.623 1.00 42.22  ? 306  ASP B N   1 
ATOM   6517 C CA  . ASP B 1 305 ? -15.216 -51.296 -31.697 1.00 38.64  ? 306  ASP B CA  1 
ATOM   6518 C C   . ASP B 1 305 ? -14.804 -52.693 -31.222 1.00 41.23  ? 306  ASP B C   1 
ATOM   6519 O O   . ASP B 1 305 ? -15.646 -53.434 -30.703 1.00 39.51  ? 306  ASP B O   1 
ATOM   6520 C CB  . ASP B 1 305 ? -14.409 -50.862 -32.916 1.00 47.61  ? 306  ASP B CB  1 
ATOM   6521 C CG  . ASP B 1 305 ? -14.793 -51.616 -34.177 1.00 41.98  ? 306  ASP B CG  1 
ATOM   6522 O OD1 . ASP B 1 305 ? -15.634 -52.537 -34.111 1.00 46.32  ? 306  ASP B OD1 1 
ATOM   6523 O OD2 . ASP B 1 305 ? -14.237 -51.284 -35.235 1.00 51.23  ? 306  ASP B OD2 1 
ATOM   6524 N N   . PHE B 1 306 ? -13.533 -53.072 -31.384 1.00 39.60  ? 307  PHE B N   1 
ATOM   6525 C CA  . PHE B 1 306 ? -13.127 -54.414 -30.924 1.00 41.77  ? 307  PHE B CA  1 
ATOM   6526 C C   . PHE B 1 306 ? -13.458 -54.606 -29.431 1.00 36.71  ? 307  PHE B C   1 
ATOM   6527 O O   . PHE B 1 306 ? -14.001 -55.644 -29.026 1.00 36.67  ? 307  PHE B O   1 
ATOM   6528 C CB  . PHE B 1 306 ? -11.634 -54.645 -31.165 1.00 37.14  ? 307  PHE B CB  1 
ATOM   6529 C CG  . PHE B 1 306 ? -11.214 -56.094 -31.077 1.00 38.30  ? 307  PHE B CG  1 
ATOM   6530 C CD1 . PHE B 1 306 ? -11.042 -56.718 -29.838 1.00 31.41  ? 307  PHE B CD1 1 
ATOM   6531 C CD2 . PHE B 1 306 ? -10.956 -56.817 -32.221 1.00 35.35  ? 307  PHE B CD2 1 
ATOM   6532 C CE1 . PHE B 1 306 ? -10.657 -58.042 -29.750 1.00 32.78  ? 307  PHE B CE1 1 
ATOM   6533 C CE2 . PHE B 1 306 ? -10.547 -58.145 -32.145 1.00 36.19  ? 307  PHE B CE2 1 
ATOM   6534 C CZ  . PHE B 1 306 ? -10.401 -58.761 -30.920 1.00 35.85  ? 307  PHE B CZ  1 
ATOM   6535 N N   . LEU B 1 307 ? -13.101 -53.603 -28.631 1.00 29.35  ? 308  LEU B N   1 
ATOM   6536 C CA  . LEU B 1 307 ? -13.445 -53.535 -27.214 1.00 37.76  ? 308  LEU B CA  1 
ATOM   6537 C C   . LEU B 1 307 ? -14.471 -52.429 -26.973 1.00 40.34  ? 308  LEU B C   1 
ATOM   6538 O O   . LEU B 1 307 ? -14.138 -51.247 -27.064 1.00 38.18  ? 308  LEU B O   1 
ATOM   6539 C CB  . LEU B 1 307 ? -12.190 -53.265 -26.369 1.00 34.85  ? 308  LEU B CB  1 
ATOM   6540 C CG  . LEU B 1 307 ? -11.151 -54.368 -26.484 1.00 36.63  ? 308  LEU B CG  1 
ATOM   6541 C CD1 . LEU B 1 307 ? -9.826  -53.937 -25.871 1.00 32.88  ? 308  LEU B CD1 1 
ATOM   6542 C CD2 . LEU B 1 307 ? -11.704 -55.661 -25.857 1.00 32.72  ? 308  LEU B CD2 1 
ATOM   6543 N N   . SER B 1 308 ? -15.713 -52.797 -26.676 1.00 40.05  ? 309  SER B N   1 
ATOM   6544 C CA  . SER B 1 308 ? -16.752 -51.776 -26.459 1.00 48.79  ? 309  SER B CA  1 
ATOM   6545 C C   . SER B 1 308 ? -16.533 -50.974 -25.166 1.00 44.74  ? 309  SER B C   1 
ATOM   6546 O O   . SER B 1 308 ? -17.076 -49.888 -25.001 1.00 54.87  ? 309  SER B O   1 
ATOM   6547 C CB  . SER B 1 308 ? -18.149 -52.418 -26.456 1.00 45.48  ? 309  SER B CB  1 
ATOM   6548 O OG  . SER B 1 308 ? -18.304 -53.341 -25.391 1.00 56.04  ? 309  SER B OG  1 
ATOM   6549 N N   . ASP B 1 309 ? -15.713 -51.494 -24.263 1.00 43.43  ? 310  ASP B N   1 
ATOM   6550 C CA  . ASP B 1 309 ? -15.391 -50.782 -23.023 1.00 47.58  ? 310  ASP B CA  1 
ATOM   6551 C C   . ASP B 1 309 ? -14.026 -51.280 -22.559 1.00 45.15  ? 310  ASP B C   1 
ATOM   6552 O O   . ASP B 1 309 ? -13.450 -52.164 -23.198 1.00 46.77  ? 310  ASP B O   1 
ATOM   6553 C CB  . ASP B 1 309 ? -16.470 -51.028 -21.954 1.00 50.66  ? 310  ASP B CB  1 
ATOM   6554 C CG  . ASP B 1 309 ? -16.537 -49.925 -20.897 1.00 51.78  ? 310  ASP B CG  1 
ATOM   6555 O OD1 . ASP B 1 309 ? -15.510 -49.278 -20.591 1.00 47.67  ? 310  ASP B OD1 1 
ATOM   6556 O OD2 . ASP B 1 309 ? -17.645 -49.716 -20.363 1.00 62.04  ? 310  ASP B OD2 1 
ATOM   6557 N N   . THR B 1 310 ? -13.498 -50.729 -21.471 1.00 41.91  ? 311  THR B N   1 
ATOM   6558 C CA  . THR B 1 310 ? -12.221 -51.215 -20.958 1.00 38.10  ? 311  THR B CA  1 
ATOM   6559 C C   . THR B 1 310 ? -12.392 -52.691 -20.630 1.00 44.15  ? 311  THR B C   1 
ATOM   6560 O O   . THR B 1 310 ? -13.509 -53.150 -20.326 1.00 43.09  ? 311  THR B O   1 
ATOM   6561 C CB  . THR B 1 310 ? -11.742 -50.448 -19.689 1.00 40.48  ? 311  THR B CB  1 
ATOM   6562 O OG1 . THR B 1 310 ? -12.620 -50.745 -18.604 1.00 42.21  ? 311  THR B OG1 1 
ATOM   6563 C CG2 . THR B 1 310 ? -11.693 -48.923 -19.917 1.00 36.78  ? 311  THR B CG2 1 
ATOM   6564 N N   . PRO B 1 311 ? -11.300 -53.455 -20.713 1.00 41.32  ? 312  PRO B N   1 
ATOM   6565 C CA  . PRO B 1 311 ? -11.444 -54.869 -20.373 1.00 46.64  ? 312  PRO B CA  1 
ATOM   6566 C C   . PRO B 1 311 ? -11.876 -55.032 -18.909 1.00 45.87  ? 312  PRO B C   1 
ATOM   6567 O O   . PRO B 1 311 ? -12.643 -55.946 -18.585 1.00 42.72  ? 312  PRO B O   1 
ATOM   6568 C CB  . PRO B 1 311 ? -10.044 -55.431 -20.618 1.00 36.10  ? 312  PRO B CB  1 
ATOM   6569 C CG  . PRO B 1 311 ? -9.430  -54.480 -21.594 1.00 41.00  ? 312  PRO B CG  1 
ATOM   6570 C CD  . PRO B 1 311 ? -9.966  -53.141 -21.250 1.00 34.61  ? 312  PRO B CD  1 
ATOM   6571 N N   . GLU B 1 312 ? -11.401 -54.144 -18.044 1.00 45.40  ? 313  GLU B N   1 
ATOM   6572 C CA  . GLU B 1 312 ? -11.804 -54.175 -16.644 1.00 47.64  ? 313  GLU B CA  1 
ATOM   6573 C C   . GLU B 1 312 ? -13.331 -54.110 -16.521 1.00 51.69  ? 313  GLU B C   1 
ATOM   6574 O O   . GLU B 1 312 ? -13.953 -54.937 -15.852 1.00 50.60  ? 313  GLU B O   1 
ATOM   6575 C CB  . GLU B 1 312 ? -11.156 -53.031 -15.873 1.00 52.13  ? 313  GLU B CB  1 
ATOM   6576 C CG  . GLU B 1 312 ? -11.403 -53.107 -14.368 1.00 70.03  ? 313  GLU B CG  1 
ATOM   6577 C CD  . GLU B 1 312 ? -10.987 -51.841 -13.624 1.00 88.78  ? 313  GLU B CD  1 
ATOM   6578 O OE1 . GLU B 1 312 ? -10.508 -50.886 -14.283 1.00 93.03  ? 313  GLU B OE1 1 
ATOM   6579 O OE2 . GLU B 1 312 ? -11.138 -51.806 -12.376 1.00 95.88  ? 313  GLU B OE2 1 
ATOM   6580 N N   . ALA B 1 313 ? -13.930 -53.146 -17.206 1.00 46.00  ? 314  ALA B N   1 
ATOM   6581 C CA  . ALA B 1 313 ? -15.375 -52.996 -17.208 1.00 38.11  ? 314  ALA B CA  1 
ATOM   6582 C C   . ALA B 1 313 ? -16.090 -54.169 -17.874 1.00 49.20  ? 314  ALA B C   1 
ATOM   6583 O O   . ALA B 1 313 ? -17.136 -54.614 -17.399 1.00 50.83  ? 314  ALA B O   1 
ATOM   6584 C CB  . ALA B 1 313 ? -15.749 -51.696 -17.902 1.00 44.24  ? 314  ALA B CB  1 
ATOM   6585 N N   . LEU B 1 314 ? -15.542 -54.663 -18.984 1.00 43.90  ? 315  LEU B N   1 
ATOM   6586 C CA  . LEU B 1 314 ? -16.171 -55.782 -19.689 1.00 43.97  ? 315  LEU B CA  1 
ATOM   6587 C C   . LEU B 1 314 ? -16.137 -57.041 -18.835 1.00 42.93  ? 315  LEU B C   1 
ATOM   6588 O O   . LEU B 1 314 ? -17.086 -57.822 -18.819 1.00 46.69  ? 315  LEU B O   1 
ATOM   6589 C CB  . LEU B 1 314 ? -15.485 -56.042 -21.040 1.00 38.02  ? 315  LEU B CB  1 
ATOM   6590 C CG  . LEU B 1 314 ? -15.759 -54.993 -22.106 1.00 43.46  ? 315  LEU B CG  1 
ATOM   6591 C CD1 . LEU B 1 314 ? -14.820 -55.164 -23.301 1.00 42.06  ? 315  LEU B CD1 1 
ATOM   6592 C CD2 . LEU B 1 314 ? -17.215 -55.083 -22.554 1.00 41.03  ? 315  LEU B CD2 1 
ATOM   6593 N N   . ILE B 1 315 ? -15.023 -57.237 -18.143 1.00 40.59  ? 316  ILE B N   1 
ATOM   6594 C CA  . ILE B 1 315 ? -14.891 -58.346 -17.229 1.00 46.00  ? 316  ILE B CA  1 
ATOM   6595 C C   . ILE B 1 315 ? -15.983 -58.259 -16.143 1.00 53.39  ? 316  ILE B C   1 
ATOM   6596 O O   . ILE B 1 315 ? -16.746 -59.211 -15.944 1.00 48.19  ? 316  ILE B O   1 
ATOM   6597 C CB  . ILE B 1 315 ? -13.477 -58.371 -16.606 1.00 42.37  ? 316  ILE B CB  1 
ATOM   6598 C CG1 . ILE B 1 315 ? -12.472 -58.938 -17.617 1.00 46.51  ? 316  ILE B CG1 1 
ATOM   6599 C CG2 . ILE B 1 315 ? -13.445 -59.244 -15.364 1.00 47.40  ? 316  ILE B CG2 1 
ATOM   6600 C CD1 . ILE B 1 315 ? -11.019 -58.569 -17.350 1.00 39.41  ? 316  ILE B CD1 1 
ATOM   6601 N N   . ASN B 1 316 ? -16.087 -57.106 -15.482 1.00 52.43  ? 317  ASN B N   1 
ATOM   6602 C CA  . ASN B 1 316 ? -17.037 -56.935 -14.373 1.00 59.12  ? 317  ASN B CA  1 
ATOM   6603 C C   . ASN B 1 316 ? -18.492 -57.150 -14.799 1.00 57.51  ? 317  ASN B C   1 
ATOM   6604 O O   . ASN B 1 316 ? -19.290 -57.714 -14.055 1.00 56.96  ? 317  ASN B O   1 
ATOM   6605 C CB  . ASN B 1 316 ? -16.871 -55.550 -13.742 1.00 41.39  ? 317  ASN B CB  1 
ATOM   6606 C CG  . ASN B 1 316 ? -15.517 -55.378 -13.084 1.00 45.12  ? 317  ASN B CG  1 
ATOM   6607 O OD1 . ASN B 1 316 ? -14.845 -56.360 -12.775 1.00 62.17  ? 317  ASN B OD1 1 
ATOM   6608 N ND2 . ASN B 1 316 ? -15.101 -54.135 -12.875 1.00 52.14  ? 317  ASN B ND2 1 
ATOM   6609 N N   . ALA B 1 317 ? -18.820 -56.749 -16.021 1.00 57.72  ? 318  ALA B N   1 
ATOM   6610 C CA  . ALA B 1 317 ? -20.205 -56.774 -16.471 1.00 51.05  ? 318  ALA B CA  1 
ATOM   6611 C C   . ALA B 1 317 ? -20.596 -58.046 -17.215 1.00 57.44  ? 318  ALA B C   1 
ATOM   6612 O O   . ALA B 1 317 ? -21.722 -58.168 -17.691 1.00 61.26  ? 318  ALA B O   1 
ATOM   6613 C CB  . ALA B 1 317 ? -20.470 -55.573 -17.351 1.00 57.74  ? 318  ALA B CB  1 
ATOM   6614 N N   . GLY B 1 318 ? -19.680 -58.998 -17.324 1.00 58.94  ? 319  GLY B N   1 
ATOM   6615 C CA  . GLY B 1 318 ? -19.907 -60.112 -18.227 1.00 49.66  ? 319  GLY B CA  1 
ATOM   6616 C C   . GLY B 1 318 ? -20.511 -61.347 -17.598 1.00 46.75  ? 319  GLY B C   1 
ATOM   6617 O O   . GLY B 1 318 ? -20.262 -61.650 -16.431 1.00 48.53  ? 319  GLY B O   1 
ATOM   6618 N N   . ASP B 1 319 ? -21.303 -62.063 -18.389 1.00 55.43  ? 320  ASP B N   1 
ATOM   6619 C CA  . ASP B 1 319 ? -21.809 -63.377 -18.015 1.00 55.30  ? 320  ASP B CA  1 
ATOM   6620 C C   . ASP B 1 319 ? -20.895 -64.430 -18.613 1.00 52.56  ? 320  ASP B C   1 
ATOM   6621 O O   . ASP B 1 319 ? -20.782 -64.527 -19.825 1.00 46.55  ? 320  ASP B O   1 
ATOM   6622 C CB  . ASP B 1 319 ? -23.243 -63.579 -18.518 1.00 47.39  ? 320  ASP B CB  1 
ATOM   6623 C CG  . ASP B 1 319 ? -23.893 -64.841 -17.968 1.00 60.71  ? 320  ASP B CG  1 
ATOM   6624 O OD1 . ASP B 1 319 ? -23.181 -65.788 -17.561 1.00 58.03  ? 320  ASP B OD1 1 
ATOM   6625 O OD2 . ASP B 1 319 ? -25.143 -64.880 -17.934 1.00 73.66  ? 320  ASP B OD2 1 
ATOM   6626 N N   . PHE B 1 320 ? -20.269 -65.247 -17.775 1.00 51.12  ? 321  PHE B N   1 
ATOM   6627 C CA  . PHE B 1 320 ? -19.284 -66.190 -18.288 1.00 43.44  ? 321  PHE B CA  1 
ATOM   6628 C C   . PHE B 1 320 ? -19.665 -67.637 -18.064 1.00 48.84  ? 321  PHE B C   1 
ATOM   6629 O O   . PHE B 1 320 ? -18.799 -68.511 -18.008 1.00 50.91  ? 321  PHE B O   1 
ATOM   6630 C CB  . PHE B 1 320 ? -17.921 -65.893 -17.657 1.00 44.16  ? 321  PHE B CB  1 
ATOM   6631 C CG  . PHE B 1 320 ? -17.388 -64.541 -18.022 1.00 48.42  ? 321  PHE B CG  1 
ATOM   6632 C CD1 . PHE B 1 320 ? -16.880 -64.308 -19.297 1.00 39.14  ? 321  PHE B CD1 1 
ATOM   6633 C CD2 . PHE B 1 320 ? -17.434 -63.486 -17.112 1.00 40.78  ? 321  PHE B CD2 1 
ATOM   6634 C CE1 . PHE B 1 320 ? -16.376 -63.052 -19.640 1.00 39.74  ? 321  PHE B CE1 1 
ATOM   6635 C CE2 . PHE B 1 320 ? -16.943 -62.226 -17.459 1.00 40.25  ? 321  PHE B CE2 1 
ATOM   6636 C CZ  . PHE B 1 320 ? -16.415 -62.012 -18.723 1.00 38.37  ? 321  PHE B CZ  1 
ATOM   6637 N N   . HIS B 1 321 ? -20.965 -67.886 -17.940 1.00 51.26  ? 322  HIS B N   1 
ATOM   6638 C CA  . HIS B 1 321 ? -21.466 -69.244 -17.805 1.00 50.14  ? 322  HIS B CA  1 
ATOM   6639 C C   . HIS B 1 321 ? -21.165 -70.049 -19.069 1.00 50.82  ? 322  HIS B C   1 
ATOM   6640 O O   . HIS B 1 321 ? -21.288 -69.548 -20.193 1.00 45.29  ? 322  HIS B O   1 
ATOM   6641 C CB  . HIS B 1 321 ? -22.970 -69.231 -17.495 1.00 49.14  ? 322  HIS B CB  1 
ATOM   6642 C CG  . HIS B 1 321 ? -23.278 -68.936 -16.056 1.00 50.65  ? 322  HIS B CG  1 
ATOM   6643 N ND1 . HIS B 1 321 ? -23.615 -67.675 -15.610 1.00 54.54  ? 322  HIS B ND1 1 
ATOM   6644 C CD2 . HIS B 1 321 ? -23.255 -69.729 -14.958 1.00 53.77  ? 322  HIS B CD2 1 
ATOM   6645 C CE1 . HIS B 1 321 ? -23.801 -67.707 -14.301 1.00 53.93  ? 322  HIS B CE1 1 
ATOM   6646 N NE2 . HIS B 1 321 ? -23.596 -68.944 -13.881 1.00 54.18  ? 322  HIS B NE2 1 
ATOM   6647 N N   . GLY B 1 322 ? -20.733 -71.292 -18.884 1.00 48.77  ? 323  GLY B N   1 
ATOM   6648 C CA  . GLY B 1 322 ? -20.374 -72.121 -20.024 1.00 55.85  ? 323  GLY B CA  1 
ATOM   6649 C C   . GLY B 1 322 ? -18.929 -71.978 -20.487 1.00 54.19  ? 323  GLY B C   1 
ATOM   6650 O O   . GLY B 1 322 ? -18.503 -72.659 -21.419 1.00 49.89  ? 323  GLY B O   1 
ATOM   6651 N N   . LEU B 1 323 ? -18.173 -71.094 -19.839 1.00 50.80  ? 324  LEU B N   1 
ATOM   6652 C CA  . LEU B 1 323 ? -16.761 -70.928 -20.142 1.00 45.48  ? 324  LEU B CA  1 
ATOM   6653 C C   . LEU B 1 323 ? -15.872 -71.686 -19.152 1.00 45.29  ? 324  LEU B C   1 
ATOM   6654 O O   . LEU B 1 323 ? -16.147 -71.719 -17.945 1.00 48.41  ? 324  LEU B O   1 
ATOM   6655 C CB  . LEU B 1 323 ? -16.389 -69.448 -20.141 1.00 46.54  ? 324  LEU B CB  1 
ATOM   6656 C CG  . LEU B 1 323 ? -14.931 -69.096 -20.429 1.00 45.42  ? 324  LEU B CG  1 
ATOM   6657 C CD1 . LEU B 1 323 ? -14.589 -69.454 -21.862 1.00 42.40  ? 324  LEU B CD1 1 
ATOM   6658 C CD2 . LEU B 1 323 ? -14.681 -67.615 -20.158 1.00 38.71  ? 324  LEU B CD2 1 
ATOM   6659 N N   . GLN B 1 324 ? -14.810 -72.298 -19.669 1.00 39.39  ? 325  GLN B N   1 
ATOM   6660 C CA  . GLN B 1 324 ? -13.755 -72.803 -18.813 1.00 36.97  ? 325  GLN B CA  1 
ATOM   6661 C C   . GLN B 1 324 ? -12.462 -72.087 -19.191 1.00 40.88  ? 325  GLN B C   1 
ATOM   6662 O O   . GLN B 1 324 ? -12.197 -71.811 -20.374 1.00 34.69  ? 325  GLN B O   1 
ATOM   6663 C CB  . GLN B 1 324 ? -13.605 -74.321 -18.926 1.00 38.18  ? 325  GLN B CB  1 
ATOM   6664 C CG  . GLN B 1 324 ? -14.888 -75.111 -18.731 1.00 41.84  ? 325  GLN B CG  1 
ATOM   6665 C CD  . GLN B 1 324 ? -15.650 -75.270 -20.022 1.00 51.57  ? 325  GLN B CD  1 
ATOM   6666 O OE1 . GLN B 1 324 ? -15.070 -75.592 -21.060 1.00 52.05  ? 325  GLN B OE1 1 
ATOM   6667 N NE2 . GLN B 1 324 ? -16.957 -75.014 -19.978 1.00 56.17  ? 325  GLN B NE2 1 
ATOM   6668 N N   . VAL B 1 325 ? -11.663 -71.775 -18.178 1.00 35.41  ? 326  VAL B N   1 
ATOM   6669 C CA  . VAL B 1 325 ? -10.463 -70.975 -18.339 1.00 31.74  ? 326  VAL B CA  1 
ATOM   6670 C C   . VAL B 1 325 ? -9.386  -71.509 -17.420 1.00 39.88  ? 326  VAL B C   1 
ATOM   6671 O O   . VAL B 1 325 ? -9.669  -71.976 -16.310 1.00 37.44  ? 326  VAL B O   1 
ATOM   6672 C CB  . VAL B 1 325 ? -10.723 -69.478 -18.030 1.00 38.29  ? 326  VAL B CB  1 
ATOM   6673 C CG1 . VAL B 1 325 ? -9.463  -68.710 -18.051 1.00 44.95  ? 326  VAL B CG1 1 
ATOM   6674 C CG2 . VAL B 1 325 ? -11.613 -68.884 -19.043 1.00 39.94  ? 326  VAL B CG2 1 
ATOM   6675 N N   . LEU B 1 326 ? -8.154  -71.470 -17.906 1.00 32.82  ? 327  LEU B N   1 
ATOM   6676 C CA  . LEU B 1 326 ? -6.986  -71.878 -17.138 1.00 31.32  ? 327  LEU B CA  1 
ATOM   6677 C C   . LEU B 1 326 ? -6.029  -70.695 -17.150 1.00 35.38  ? 327  LEU B C   1 
ATOM   6678 O O   . LEU B 1 326 ? -5.764  -70.111 -18.209 1.00 31.58  ? 327  LEU B O   1 
ATOM   6679 C CB  . LEU B 1 326 ? -6.355  -73.129 -17.744 1.00 33.86  ? 327  LEU B CB  1 
ATOM   6680 C CG  . LEU B 1 326 ? -4.935  -73.546 -17.319 1.00 38.27  ? 327  LEU B CG  1 
ATOM   6681 C CD1 . LEU B 1 326 ? -4.884  -73.984 -15.908 1.00 34.83  ? 327  LEU B CD1 1 
ATOM   6682 C CD2 . LEU B 1 326 ? -4.418  -74.666 -18.219 1.00 34.87  ? 327  LEU B CD2 1 
ATOM   6683 N N   . VAL B 1 327 ? -5.561  -70.295 -15.971 1.00 30.20  ? 328  VAL B N   1 
ATOM   6684 C CA  . VAL B 1 327 ? -4.763  -69.079 -15.820 1.00 27.97  ? 328  VAL B CA  1 
ATOM   6685 C C   . VAL B 1 327 ? -3.625  -69.321 -14.866 1.00 33.28  ? 328  VAL B C   1 
ATOM   6686 O O   . VAL B 1 327 ? -3.724  -70.155 -13.967 1.00 34.20  ? 328  VAL B O   1 
ATOM   6687 C CB  . VAL B 1 327 ? -5.597  -67.887 -15.300 1.00 26.59  ? 328  VAL B CB  1 
ATOM   6688 C CG1 . VAL B 1 327 ? -6.760  -67.635 -16.218 1.00 28.99  ? 328  VAL B CG1 1 
ATOM   6689 C CG2 . VAL B 1 327 ? -6.115  -68.164 -13.845 1.00 29.74  ? 328  VAL B CG2 1 
ATOM   6690 N N   . GLY B 1 328 ? -2.533  -68.593 -15.046 1.00 31.08  ? 329  GLY B N   1 
ATOM   6691 C CA  . GLY B 1 328 ? -1.458  -68.739 -14.096 1.00 30.04  ? 329  GLY B CA  1 
ATOM   6692 C C   . GLY B 1 328 ? -0.325  -67.791 -14.357 1.00 31.28  ? 329  GLY B C   1 
ATOM   6693 O O   . GLY B 1 328 ? -0.369  -66.976 -15.273 1.00 31.83  ? 329  GLY B O   1 
ATOM   6694 N N   . VAL B 1 329 ? 0.704   -67.927 -13.537 1.00 29.05  ? 330  VAL B N   1 
ATOM   6695 C CA  . VAL B 1 329 ? 1.820   -67.010 -13.522 1.00 29.48  ? 330  VAL B CA  1 
ATOM   6696 C C   . VAL B 1 329 ? 3.037   -67.851 -13.211 1.00 31.54  ? 330  VAL B C   1 
ATOM   6697 O O   . VAL B 1 329 ? 2.889   -68.979 -12.738 1.00 27.85  ? 330  VAL B O   1 
ATOM   6698 C CB  . VAL B 1 329 ? 1.630   -65.898 -12.446 1.00 35.73  ? 330  VAL B CB  1 
ATOM   6699 C CG1 . VAL B 1 329 ? 0.389   -65.070 -12.759 1.00 26.78  ? 330  VAL B CG1 1 
ATOM   6700 C CG2 . VAL B 1 329 ? 1.515   -66.514 -11.021 1.00 23.81  ? 330  VAL B CG2 1 
ATOM   6701 N N   . VAL B 1 330 ? 4.225   -67.331 -13.496 1.00 26.15  ? 331  VAL B N   1 
ATOM   6702 C CA  . VAL B 1 330 ? 5.430   -67.951 -12.995 1.00 29.73  ? 331  VAL B CA  1 
ATOM   6703 C C   . VAL B 1 330 ? 5.742   -67.362 -11.614 1.00 39.17  ? 331  VAL B C   1 
ATOM   6704 O O   . VAL B 1 330 ? 5.168   -66.359 -11.197 1.00 28.09  ? 331  VAL B O   1 
ATOM   6705 C CB  . VAL B 1 330 ? 6.626   -67.744 -13.939 1.00 27.99  ? 331  VAL B CB  1 
ATOM   6706 C CG1 . VAL B 1 330 ? 6.323   -68.359 -15.321 1.00 31.80  ? 331  VAL B CG1 1 
ATOM   6707 C CG2 . VAL B 1 330 ? 6.970   -66.273 -14.065 1.00 29.84  ? 331  VAL B CG2 1 
ATOM   6708 N N   . LYS B 1 331 ? 6.674   -67.985 -10.917 1.00 34.98  ? 332  LYS B N   1 
ATOM   6709 C CA  . LYS B 1 331 ? 6.983   -67.607 -9.562  1.00 33.93  ? 332  LYS B CA  1 
ATOM   6710 C C   . LYS B 1 331 ? 7.580   -66.198 -9.436  1.00 36.99  ? 332  LYS B C   1 
ATOM   6711 O O   . LYS B 1 331 ? 7.262   -65.482 -8.505  1.00 33.90  ? 332  LYS B O   1 
ATOM   6712 C CB  . LYS B 1 331 ? 7.931   -68.637 -8.958  1.00 32.66  ? 332  LYS B CB  1 
ATOM   6713 C CG  . LYS B 1 331 ? 8.066   -68.502 -7.432  1.00 39.01  ? 332  LYS B CG  1 
ATOM   6714 C CD  . LYS B 1 331 ? 8.544   -69.830 -6.831  1.00 49.04  ? 332  LYS B CD  1 
ATOM   6715 C CE  . LYS B 1 331 ? 9.914   -69.700 -6.213  1.00 61.58  ? 332  LYS B CE  1 
ATOM   6716 N NZ  . LYS B 1 331 ? 9.954   -68.640 -5.150  1.00 62.37  ? 332  LYS B NZ  1 
ATOM   6717 N N   . ASP B 1 332 ? 8.421   -65.786 -10.375 1.00 36.44  ? 333  ASP B N   1 
ATOM   6718 C CA  . ASP B 1 332 ? 9.043   -64.463 -10.299 1.00 34.82  ? 333  ASP B CA  1 
ATOM   6719 C C   . ASP B 1 332 ? 8.791   -63.616 -11.548 1.00 33.08  ? 333  ASP B C   1 
ATOM   6720 O O   . ASP B 1 332 ? 9.679   -63.416 -12.369 1.00 37.09  ? 333  ASP B O   1 
ATOM   6721 C CB  . ASP B 1 332 ? 10.539  -64.636 -10.050 1.00 37.52  ? 333  ASP B CB  1 
ATOM   6722 C CG  . ASP B 1 332 ? 10.812  -65.458 -8.790  1.00 46.44  ? 333  ASP B CG  1 
ATOM   6723 O OD1 . ASP B 1 332 ? 10.871  -64.850 -7.697  1.00 42.85  ? 333  ASP B OD1 1 
ATOM   6724 O OD2 . ASP B 1 332 ? 10.922  -66.709 -8.880  1.00 42.31  ? 333  ASP B OD2 1 
ATOM   6725 N N   . GLU B 1 333 ? 7.569   -63.112 -11.671 1.00 28.68  ? 334  GLU B N   1 
ATOM   6726 C CA  . GLU B 1 333 ? 7.142   -62.402 -12.859 1.00 30.69  ? 334  GLU B CA  1 
ATOM   6727 C C   . GLU B 1 333 ? 7.912   -61.112 -13.081 1.00 36.83  ? 334  GLU B C   1 
ATOM   6728 O O   . GLU B 1 333 ? 8.096   -60.692 -14.222 1.00 34.56  ? 334  GLU B O   1 
ATOM   6729 C CB  . GLU B 1 333 ? 5.645   -62.098 -12.776 1.00 26.79  ? 334  GLU B CB  1 
ATOM   6730 C CG  . GLU B 1 333 ? 4.751   -63.333 -12.900 1.00 30.57  ? 334  GLU B CG  1 
ATOM   6731 C CD  . GLU B 1 333 ? 4.614   -63.770 -14.360 1.00 34.16  ? 334  GLU B CD  1 
ATOM   6732 O OE1 . GLU B 1 333 ? 5.227   -63.110 -15.237 1.00 32.60  ? 334  GLU B OE1 1 
ATOM   6733 O OE2 . GLU B 1 333 ? 3.884   -64.749 -14.625 1.00 31.64  ? 334  GLU B OE2 1 
ATOM   6734 N N   . GLY B 1 334 ? 8.371   -60.485 -12.001 1.00 30.31  ? 335  GLY B N   1 
ATOM   6735 C CA  . GLY B 1 334 ? 8.937   -59.152 -12.131 1.00 29.81  ? 335  GLY B CA  1 
ATOM   6736 C C   . GLY B 1 334 ? 10.409  -59.073 -12.499 1.00 31.83  ? 335  GLY B C   1 
ATOM   6737 O O   . GLY B 1 334 ? 10.831  -58.105 -13.126 1.00 32.75  ? 335  GLY B O   1 
ATOM   6738 N N   . SER B 1 335 ? 11.181  -60.095 -12.128 1.00 30.73  ? 336  SER B N   1 
ATOM   6739 C CA  . SER B 1 335 ? 12.649  -60.065 -12.211 1.00 32.93  ? 336  SER B CA  1 
ATOM   6740 C C   . SER B 1 335 ? 13.201  -59.819 -13.628 1.00 37.65  ? 336  SER B C   1 
ATOM   6741 O O   . SER B 1 335 ? 14.097  -58.980 -13.836 1.00 37.46  ? 336  SER B O   1 
ATOM   6742 C CB  . SER B 1 335 ? 13.210  -61.382 -11.665 1.00 39.62  ? 336  SER B CB  1 
ATOM   6743 O OG  . SER B 1 335 ? 12.829  -62.479 -12.490 1.00 44.74  ? 336  SER B OG  1 
ATOM   6744 N N   . TYR B 1 336 ? 12.648  -60.539 -14.596 1.00 33.60  ? 337  TYR B N   1 
ATOM   6745 C CA  . TYR B 1 336 ? 13.065  -60.423 -15.991 1.00 41.18  ? 337  TYR B CA  1 
ATOM   6746 C C   . TYR B 1 336 ? 12.985  -58.975 -16.477 1.00 43.05  ? 337  TYR B C   1 
ATOM   6747 O O   . TYR B 1 336 ? 13.910  -58.485 -17.103 1.00 42.45  ? 337  TYR B O   1 
ATOM   6748 C CB  . TYR B 1 336 ? 12.209  -61.353 -16.878 1.00 38.34  ? 337  TYR B CB  1 
ATOM   6749 C CG  . TYR B 1 336 ? 12.369  -61.160 -18.384 1.00 41.23  ? 337  TYR B CG  1 
ATOM   6750 C CD1 . TYR B 1 336 ? 13.401  -61.776 -19.078 1.00 49.90  ? 337  TYR B CD1 1 
ATOM   6751 C CD2 . TYR B 1 336 ? 11.479  -60.370 -19.099 1.00 44.31  ? 337  TYR B CD2 1 
ATOM   6752 C CE1 . TYR B 1 336 ? 13.553  -61.601 -20.454 1.00 54.68  ? 337  TYR B CE1 1 
ATOM   6753 C CE2 . TYR B 1 336 ? 11.619  -60.185 -20.466 1.00 56.60  ? 337  TYR B CE2 1 
ATOM   6754 C CZ  . TYR B 1 336 ? 12.659  -60.800 -21.142 1.00 61.05  ? 337  TYR B CZ  1 
ATOM   6755 O OH  . TYR B 1 336 ? 12.787  -60.615 -22.508 1.00 70.59  ? 337  TYR B OH  1 
ATOM   6756 N N   . PHE B 1 337 ? 11.899  -58.278 -16.170 1.00 39.80  ? 338  PHE B N   1 
ATOM   6757 C CA  . PHE B 1 337 ? 11.740  -56.911 -16.664 1.00 38.91  ? 338  PHE B CA  1 
ATOM   6758 C C   . PHE B 1 337 ? 12.725  -55.903 -16.068 1.00 41.93  ? 338  PHE B C   1 
ATOM   6759 O O   . PHE B 1 337 ? 13.024  -54.897 -16.711 1.00 40.55  ? 338  PHE B O   1 
ATOM   6760 C CB  . PHE B 1 337 ? 10.306  -56.448 -16.417 1.00 42.05  ? 338  PHE B CB  1 
ATOM   6761 C CG  . PHE B 1 337 ? 9.308   -57.336 -17.051 1.00 43.13  ? 338  PHE B CG  1 
ATOM   6762 C CD1 . PHE B 1 337 ? 9.084   -57.270 -18.420 1.00 52.26  ? 338  PHE B CD1 1 
ATOM   6763 C CD2 . PHE B 1 337 ? 8.662   -58.309 -16.309 1.00 35.98  ? 338  PHE B CD2 1 
ATOM   6764 C CE1 . PHE B 1 337 ? 8.194   -58.120 -19.036 1.00 44.85  ? 338  PHE B CE1 1 
ATOM   6765 C CE2 . PHE B 1 337 ? 7.764   -59.173 -16.922 1.00 37.62  ? 338  PHE B CE2 1 
ATOM   6766 C CZ  . PHE B 1 337 ? 7.530   -59.068 -18.284 1.00 41.20  ? 338  PHE B CZ  1 
ATOM   6767 N N   . LEU B 1 338 ? 13.229  -56.173 -14.861 1.00 35.40  ? 339  LEU B N   1 
ATOM   6768 C CA  . LEU B 1 338 ? 14.041  -55.196 -14.143 1.00 42.53  ? 339  LEU B CA  1 
ATOM   6769 C C   . LEU B 1 338 ? 15.400  -54.960 -14.794 1.00 45.69  ? 339  LEU B C   1 
ATOM   6770 O O   . LEU B 1 338 ? 15.900  -53.838 -14.778 1.00 40.98  ? 339  LEU B O   1 
ATOM   6771 C CB  . LEU B 1 338 ? 14.230  -55.619 -12.678 1.00 37.58  ? 339  LEU B CB  1 
ATOM   6772 C CG  . LEU B 1 338 ? 12.921  -55.464 -11.905 1.00 42.11  ? 339  LEU B CG  1 
ATOM   6773 C CD1 . LEU B 1 338 ? 13.054  -55.897 -10.447 1.00 39.77  ? 339  LEU B CD1 1 
ATOM   6774 C CD2 . LEU B 1 338 ? 12.403  -54.021 -12.013 1.00 36.27  ? 339  LEU B CD2 1 
ATOM   6775 N N   . VAL B 1 339 ? 15.989  -55.997 -15.388 1.00 45.24  ? 340  VAL B N   1 
ATOM   6776 C CA  . VAL B 1 339 ? 17.283  -55.823 -16.061 1.00 55.65  ? 340  VAL B CA  1 
ATOM   6777 C C   . VAL B 1 339 ? 17.177  -55.017 -17.352 1.00 57.22  ? 340  VAL B C   1 
ATOM   6778 O O   . VAL B 1 339 ? 18.183  -54.636 -17.937 1.00 66.39  ? 340  VAL B O   1 
ATOM   6779 C CB  . VAL B 1 339 ? 17.935  -57.158 -16.372 1.00 58.52  ? 340  VAL B CB  1 
ATOM   6780 C CG1 . VAL B 1 339 ? 18.033  -57.967 -15.096 1.00 53.31  ? 340  VAL B CG1 1 
ATOM   6781 C CG2 . VAL B 1 339 ? 17.138  -57.901 -17.431 1.00 55.28  ? 340  VAL B CG2 1 
ATOM   6782 N N   . TYR B 1 340 ? 15.958  -54.732 -17.780 1.00 54.82  ? 341  TYR B N   1 
ATOM   6783 C CA  . TYR B 1 340 ? 15.753  -53.883 -18.942 1.00 53.05  ? 341  TYR B CA  1 
ATOM   6784 C C   . TYR B 1 340 ? 15.557  -52.433 -18.578 1.00 57.97  ? 341  TYR B C   1 
ATOM   6785 O O   . TYR B 1 340 ? 14.727  -51.760 -19.181 1.00 65.37  ? 341  TYR B O   1 
ATOM   6786 C CB  . TYR B 1 340 ? 14.550  -54.363 -19.748 1.00 54.33  ? 341  TYR B CB  1 
ATOM   6787 C CG  . TYR B 1 340 ? 14.895  -55.567 -20.553 1.00 57.44  ? 341  TYR B CG  1 
ATOM   6788 C CD1 . TYR B 1 340 ? 15.038  -56.806 -19.943 1.00 49.17  ? 341  TYR B CD1 1 
ATOM   6789 C CD2 . TYR B 1 340 ? 15.113  -55.470 -21.927 1.00 64.39  ? 341  TYR B CD2 1 
ATOM   6790 C CE1 . TYR B 1 340 ? 15.390  -57.928 -20.680 1.00 59.78  ? 341  TYR B CE1 1 
ATOM   6791 C CE2 . TYR B 1 340 ? 15.453  -56.584 -22.674 1.00 58.06  ? 341  TYR B CE2 1 
ATOM   6792 C CZ  . TYR B 1 340 ? 15.595  -57.805 -22.045 1.00 59.13  ? 341  TYR B CZ  1 
ATOM   6793 O OH  . TYR B 1 340 ? 15.931  -58.914 -22.779 1.00 61.74  ? 341  TYR B OH  1 
ATOM   6794 N N   . GLY B 1 341 ? 16.294  -51.940 -17.589 1.00 57.74  ? 342  GLY B N   1 
ATOM   6795 C CA  . GLY B 1 341 ? 16.272  -50.512 -17.350 1.00 51.98  ? 342  GLY B CA  1 
ATOM   6796 C C   . GLY B 1 341 ? 16.145  -50.012 -15.935 1.00 59.37  ? 342  GLY B C   1 
ATOM   6797 O O   . GLY B 1 341 ? 16.435  -48.841 -15.684 1.00 61.99  ? 342  GLY B O   1 
ATOM   6798 N N   . ALA B 1 342 ? 15.705  -50.862 -15.007 1.00 61.56  ? 343  ALA B N   1 
ATOM   6799 C CA  . ALA B 1 342 ? 15.625  -50.431 -13.612 1.00 59.50  ? 343  ALA B CA  1 
ATOM   6800 C C   . ALA B 1 342 ? 17.042  -50.145 -13.125 1.00 53.46  ? 343  ALA B C   1 
ATOM   6801 O O   . ALA B 1 342 ? 17.957  -50.943 -13.375 1.00 48.48  ? 343  ALA B O   1 
ATOM   6802 C CB  . ALA B 1 342 ? 14.939  -51.471 -12.736 1.00 48.83  ? 343  ALA B CB  1 
ATOM   6803 N N   . PRO B 1 343 ? 17.237  -48.981 -12.481 1.00 56.28  ? 344  PRO B N   1 
ATOM   6804 C CA  . PRO B 1 343 ? 18.572  -48.579 -12.018 1.00 57.92  ? 344  PRO B CA  1 
ATOM   6805 C C   . PRO B 1 343 ? 19.152  -49.571 -11.013 1.00 57.77  ? 344  PRO B C   1 
ATOM   6806 O O   . PRO B 1 343 ? 18.483  -49.945 -10.050 1.00 55.92  ? 344  PRO B O   1 
ATOM   6807 C CB  . PRO B 1 343 ? 18.330  -47.206 -11.369 1.00 55.84  ? 344  PRO B CB  1 
ATOM   6808 C CG  . PRO B 1 343 ? 16.861  -47.119 -11.138 1.00 57.76  ? 344  PRO B CG  1 
ATOM   6809 C CD  . PRO B 1 343 ? 16.229  -47.936 -12.227 1.00 53.43  ? 344  PRO B CD  1 
ATOM   6810 N N   . GLY B 1 344 ? 20.379  -50.015 -11.263 1.00 55.08  ? 345  GLY B N   1 
ATOM   6811 C CA  . GLY B 1 344 ? 21.047  -50.930 -10.364 1.00 51.76  ? 345  GLY B CA  1 
ATOM   6812 C C   . GLY B 1 344 ? 20.980  -52.384 -10.785 1.00 52.66  ? 345  GLY B C   1 
ATOM   6813 O O   . GLY B 1 344 ? 21.617  -53.236 -10.170 1.00 50.61  ? 345  GLY B O   1 
ATOM   6814 N N   . PHE B 1 345 ? 20.218  -52.678 -11.832 1.00 49.73  ? 346  PHE B N   1 
ATOM   6815 C CA  . PHE B 1 345 ? 19.979  -54.072 -12.214 1.00 53.38  ? 346  PHE B CA  1 
ATOM   6816 C C   . PHE B 1 345 ? 20.858  -54.560 -13.365 1.00 53.35  ? 346  PHE B C   1 
ATOM   6817 O O   . PHE B 1 345 ? 21.173  -53.812 -14.291 1.00 47.68  ? 346  PHE B O   1 
ATOM   6818 C CB  . PHE B 1 345 ? 18.497  -54.269 -12.568 1.00 45.73  ? 346  PHE B CB  1 
ATOM   6819 C CG  . PHE B 1 345 ? 17.622  -54.454 -11.365 1.00 47.33  ? 346  PHE B CG  1 
ATOM   6820 C CD1 . PHE B 1 345 ? 17.104  -53.359 -10.693 1.00 42.16  ? 346  PHE B CD1 1 
ATOM   6821 C CD2 . PHE B 1 345 ? 17.354  -55.724 -10.878 1.00 41.18  ? 346  PHE B CD2 1 
ATOM   6822 C CE1 . PHE B 1 345 ? 16.311  -53.531 -9.573  1.00 46.10  ? 346  PHE B CE1 1 
ATOM   6823 C CE2 . PHE B 1 345 ? 16.560  -55.900 -9.762  1.00 45.89  ? 346  PHE B CE2 1 
ATOM   6824 C CZ  . PHE B 1 345 ? 16.040  -54.804 -9.106  1.00 39.54  ? 346  PHE B CZ  1 
ATOM   6825 N N   . SER B 1 346 ? 21.254  -55.828 -13.283 1.00 51.16  ? 347  SER B N   1 
ATOM   6826 C CA  . SER B 1 346 ? 21.972  -56.492 -14.363 1.00 51.66  ? 347  SER B CA  1 
ATOM   6827 C C   . SER B 1 346 ? 21.849  -57.996 -14.189 1.00 53.09  ? 347  SER B C   1 
ATOM   6828 O O   . SER B 1 346 ? 21.823  -58.498 -13.063 1.00 45.84  ? 347  SER B O   1 
ATOM   6829 C CB  . SER B 1 346 ? 23.448  -56.079 -14.389 1.00 53.30  ? 347  SER B CB  1 
ATOM   6830 O OG  . SER B 1 346 ? 24.196  -56.882 -15.295 1.00 57.69  ? 347  SER B OG  1 
ATOM   6831 N N   . LYS B 1 347 ? 21.766  -58.721 -15.299 1.00 47.77  ? 348  LYS B N   1 
ATOM   6832 C CA  . LYS B 1 347 ? 21.795  -60.174 -15.214 1.00 50.85  ? 348  LYS B CA  1 
ATOM   6833 C C   . LYS B 1 347 ? 23.183  -60.617 -14.745 1.00 45.17  ? 348  LYS B C   1 
ATOM   6834 O O   . LYS B 1 347 ? 23.341  -61.708 -14.218 1.00 44.73  ? 348  LYS B O   1 
ATOM   6835 C CB  . LYS B 1 347 ? 21.449  -60.825 -16.560 1.00 51.58  ? 348  LYS B CB  1 
ATOM   6836 C CG  . LYS B 1 347 ? 22.607  -60.869 -17.539 1.00 41.50  ? 348  LYS B CG  1 
ATOM   6837 C CD  . LYS B 1 347 ? 22.218  -61.608 -18.812 1.00 54.47  ? 348  LYS B CD  1 
ATOM   6838 C CE  . LYS B 1 347 ? 23.434  -61.906 -19.693 1.00 50.10  ? 348  LYS B CE  1 
ATOM   6839 N NZ  . LYS B 1 347 ? 24.399  -62.815 -19.001 1.00 47.08  ? 348  LYS B NZ  1 
ATOM   6840 N N   . ASP B 1 348 ? 24.179  -59.748 -14.908 1.00 42.51  ? 349  ASP B N   1 
ATOM   6841 C CA  . ASP B 1 348 ? 25.566  -60.134 -14.653 1.00 56.69  ? 349  ASP B CA  1 
ATOM   6842 C C   . ASP B 1 348 ? 26.098  -59.838 -13.239 1.00 61.21  ? 349  ASP B C   1 
ATOM   6843 O O   . ASP B 1 348 ? 27.236  -60.186 -12.929 1.00 62.93  ? 349  ASP B O   1 
ATOM   6844 C CB  . ASP B 1 348 ? 26.470  -59.476 -15.697 1.00 54.51  ? 349  ASP B CB  1 
ATOM   6845 C CG  . ASP B 1 348 ? 26.246  -60.052 -17.088 1.00 53.58  ? 349  ASP B CG  1 
ATOM   6846 O OD1 . ASP B 1 348 ? 26.093  -61.296 -17.183 1.00 46.55  ? 349  ASP B OD1 1 
ATOM   6847 O OD2 . ASP B 1 348 ? 26.197  -59.267 -18.067 1.00 52.34  ? 349  ASP B OD2 1 
ATOM   6848 N N   . ASN B 1 349 ? 25.293  -59.208 -12.384 1.00 54.01  ? 350  ASN B N   1 
ATOM   6849 C CA  . ASN B 1 349 ? 25.631  -59.143 -10.958 1.00 49.56  ? 350  ASN B CA  1 
ATOM   6850 C C   . ASN B 1 349 ? 24.399  -59.457 -10.110 1.00 51.64  ? 350  ASN B C   1 
ATOM   6851 O O   . ASN B 1 349 ? 23.379  -59.924 -10.626 1.00 54.00  ? 350  ASN B O   1 
ATOM   6852 C CB  . ASN B 1 349 ? 26.256  -57.782 -10.569 1.00 45.34  ? 350  ASN B CB  1 
ATOM   6853 C CG  . ASN B 1 349 ? 25.346  -56.578 -10.837 1.00 55.28  ? 350  ASN B CG  1 
ATOM   6854 O OD1 . ASN B 1 349 ? 24.119  -56.673 -10.803 1.00 57.54  ? 350  ASN B OD1 1 
ATOM   6855 N ND2 . ASN B 1 349 ? 25.973  -55.427 -11.099 1.00 51.45  ? 350  ASN B ND2 1 
ATOM   6856 N N   . GLU B 1 350 ? 24.492  -59.214 -8.812  1.00 50.08  ? 351  GLU B N   1 
ATOM   6857 C CA  . GLU B 1 350 ? 23.444  -59.650 -7.907  1.00 50.95  ? 351  GLU B CA  1 
ATOM   6858 C C   . GLU B 1 350 ? 22.313  -58.628 -7.829  1.00 45.11  ? 351  GLU B C   1 
ATOM   6859 O O   . GLU B 1 350 ? 21.268  -58.909 -7.237  1.00 47.23  ? 351  GLU B O   1 
ATOM   6860 C CB  . GLU B 1 350 ? 24.019  -59.935 -6.517  1.00 46.19  ? 351  GLU B CB  1 
ATOM   6861 C CG  . GLU B 1 350 ? 24.834  -61.229 -6.444  1.00 48.99  ? 351  GLU B CG  1 
ATOM   6862 C CD  . GLU B 1 350 ? 24.081  -62.426 -7.026  1.00 68.49  ? 351  GLU B CD  1 
ATOM   6863 O OE1 . GLU B 1 350 ? 24.426  -62.864 -8.145  1.00 75.51  ? 351  GLU B OE1 1 
ATOM   6864 O OE2 . GLU B 1 350 ? 23.142  -62.930 -6.368  1.00 75.17  ? 351  GLU B OE2 1 
ATOM   6865 N N   . SER B 1 351 ? 22.526  -57.460 -8.430  1.00 37.95  ? 352  SER B N   1 
ATOM   6866 C CA  . SER B 1 351 ? 21.503  -56.412 -8.480  1.00 47.75  ? 352  SER B CA  1 
ATOM   6867 C C   . SER B 1 351 ? 21.026  -56.007 -7.077  1.00 46.49  ? 352  SER B C   1 
ATOM   6868 O O   . SER B 1 351 ? 19.845  -55.727 -6.868  1.00 43.98  ? 352  SER B O   1 
ATOM   6869 C CB  . SER B 1 351 ? 20.302  -56.862 -9.333  1.00 45.10  ? 352  SER B CB  1 
ATOM   6870 O OG  . SER B 1 351 ? 20.636  -56.921 -10.708 1.00 47.63  ? 352  SER B OG  1 
ATOM   6871 N N   . LEU B 1 352 ? 21.954  -55.993 -6.124  1.00 42.75  ? 353  LEU B N   1 
ATOM   6872 C CA  . LEU B 1 352 ? 21.688  -55.543 -4.763  1.00 46.44  ? 353  LEU B CA  1 
ATOM   6873 C C   . LEU B 1 352 ? 21.557  -54.020 -4.728  1.00 47.35  ? 353  LEU B C   1 
ATOM   6874 O O   . LEU B 1 352 ? 22.545  -53.313 -4.563  1.00 62.54  ? 353  LEU B O   1 
ATOM   6875 C CB  . LEU B 1 352 ? 22.801  -56.021 -3.834  1.00 39.42  ? 353  LEU B CB  1 
ATOM   6876 C CG  . LEU B 1 352 ? 22.892  -57.545 -3.774  1.00 43.48  ? 353  LEU B CG  1 
ATOM   6877 C CD1 . LEU B 1 352 ? 24.152  -58.022 -3.031  1.00 48.20  ? 353  LEU B CD1 1 
ATOM   6878 C CD2 . LEU B 1 352 ? 21.633  -58.138 -3.155  1.00 44.29  ? 353  LEU B CD2 1 
ATOM   6879 N N   . ILE B 1 353 ? 20.333  -53.524 -4.888  1.00 43.43  ? 354  ILE B N   1 
ATOM   6880 C CA  . ILE B 1 353 ? 20.089  -52.093 -5.064  1.00 41.04  ? 354  ILE B CA  1 
ATOM   6881 C C   . ILE B 1 353 ? 19.940  -51.316 -3.762  1.00 42.97  ? 354  ILE B C   1 
ATOM   6882 O O   . ILE B 1 353 ? 19.629  -51.877 -2.712  1.00 40.70  ? 354  ILE B O   1 
ATOM   6883 C CB  . ILE B 1 353 ? 18.807  -51.830 -5.892  1.00 41.44  ? 354  ILE B CB  1 
ATOM   6884 C CG1 . ILE B 1 353 ? 17.592  -52.504 -5.230  1.00 39.04  ? 354  ILE B CG1 1 
ATOM   6885 C CG2 . ILE B 1 353 ? 18.992  -52.307 -7.340  1.00 43.06  ? 354  ILE B CG2 1 
ATOM   6886 C CD1 . ILE B 1 353 ? 16.233  -52.027 -5.752  1.00 35.18  ? 354  ILE B CD1 1 
ATOM   6887 N N   . SER B 1 354 ? 20.126  -50.007 -3.867  1.00 48.47  ? 355  SER B N   1 
ATOM   6888 C CA  . SER B 1 354 ? 19.925  -49.094 -2.755  1.00 48.82  ? 355  SER B CA  1 
ATOM   6889 C C   . SER B 1 354 ? 18.458  -48.696 -2.633  1.00 51.59  ? 355  SER B C   1 
ATOM   6890 O O   . SER B 1 354 ? 17.635  -48.987 -3.517  1.00 48.15  ? 355  SER B O   1 
ATOM   6891 C CB  . SER B 1 354 ? 20.776  -47.834 -2.940  1.00 42.00  ? 355  SER B CB  1 
ATOM   6892 O OG  . SER B 1 354 ? 20.263  -47.033 -4.002  1.00 51.41  ? 355  SER B OG  1 
ATOM   6893 N N   . ARG B 1 355 ? 18.145  -47.990 -1.554  1.00 49.38  ? 356  ARG B N   1 
ATOM   6894 C CA  . ARG B 1 355 ? 16.795  -47.524 -1.332  1.00 47.21  ? 356  ARG B CA  1 
ATOM   6895 C C   . ARG B 1 355 ? 16.431  -46.480 -2.358  1.00 48.96  ? 356  ARG B C   1 
ATOM   6896 O O   . ARG B 1 355 ? 15.298  -46.440 -2.838  1.00 46.36  ? 356  ARG B O   1 
ATOM   6897 C CB  . ARG B 1 355 ? 16.634  -46.957 0.070   1.00 52.20  ? 356  ARG B CB  1 
ATOM   6898 C CG  . ARG B 1 355 ? 15.262  -46.369 0.299   1.00 50.68  ? 356  ARG B CG  1 
ATOM   6899 C CD  . ARG B 1 355 ? 14.586  -47.032 1.465   1.00 55.53  ? 356  ARG B CD  1 
ATOM   6900 N NE  . ARG B 1 355 ? 13.213  -46.566 1.597   1.00 57.20  ? 356  ARG B NE  1 
ATOM   6901 C CZ  . ARG B 1 355 ? 12.168  -47.376 1.633   1.00 41.11  ? 356  ARG B CZ  1 
ATOM   6902 N NH1 . ARG B 1 355 ? 12.357  -48.682 1.557   1.00 40.66  ? 356  ARG B NH1 1 
ATOM   6903 N NH2 . ARG B 1 355 ? 10.947  -46.881 1.751   1.00 39.26  ? 356  ARG B NH2 1 
ATOM   6904 N N   . ALA B 1 356 ? 17.387  -45.628 -2.705  1.00 51.37  ? 357  ALA B N   1 
ATOM   6905 C CA  . ALA B 1 356 ? 17.107  -44.614 -3.709  1.00 48.54  ? 357  ALA B CA  1 
ATOM   6906 C C   . ALA B 1 356 ? 16.878  -45.279 -5.076  1.00 45.60  ? 357  ALA B C   1 
ATOM   6907 O O   . ALA B 1 356 ? 16.069  -44.812 -5.883  1.00 44.84  ? 357  ALA B O   1 
ATOM   6908 C CB  . ALA B 1 356 ? 18.237  -43.596 -3.765  1.00 45.80  ? 357  ALA B CB  1 
ATOM   6909 N N   . GLU B 1 357 ? 17.574  -46.385 -5.327  1.00 46.86  ? 358  GLU B N   1 
ATOM   6910 C CA  . GLU B 1 357 ? 17.374  -47.125 -6.567  1.00 47.88  ? 358  GLU B CA  1 
ATOM   6911 C C   . GLU B 1 357 ? 16.007  -47.834 -6.570  1.00 47.60  ? 358  GLU B C   1 
ATOM   6912 O O   . GLU B 1 357 ? 15.341  -47.915 -7.602  1.00 45.84  ? 358  GLU B O   1 
ATOM   6913 C CB  . GLU B 1 357 ? 18.519  -48.126 -6.779  1.00 53.23  ? 358  GLU B CB  1 
ATOM   6914 C CG  . GLU B 1 357 ? 19.853  -47.449 -7.119  1.00 55.78  ? 358  GLU B CG  1 
ATOM   6915 C CD  . GLU B 1 357 ? 20.991  -48.428 -7.392  1.00 51.44  ? 358  GLU B CD  1 
ATOM   6916 O OE1 . GLU B 1 357 ? 21.142  -49.409 -6.634  1.00 55.95  ? 358  GLU B OE1 1 
ATOM   6917 O OE2 . GLU B 1 357 ? 21.741  -48.209 -8.373  1.00 65.87  ? 358  GLU B OE2 1 
ATOM   6918 N N   . PHE B 1 358 ? 15.594  -48.329 -5.407  1.00 44.80  ? 359  PHE B N   1 
ATOM   6919 C CA  . PHE B 1 358 ? 14.274  -48.925 -5.226  1.00 40.00  ? 359  PHE B CA  1 
ATOM   6920 C C   . PHE B 1 358 ? 13.199  -47.902 -5.529  1.00 46.03  ? 359  PHE B C   1 
ATOM   6921 O O   . PHE B 1 358 ? 12.317  -48.166 -6.345  1.00 38.56  ? 359  PHE B O   1 
ATOM   6922 C CB  . PHE B 1 358 ? 14.132  -49.476 -3.799  1.00 43.98  ? 359  PHE B CB  1 
ATOM   6923 C CG  . PHE B 1 358 ? 12.730  -49.925 -3.425  1.00 39.78  ? 359  PHE B CG  1 
ATOM   6924 C CD1 . PHE B 1 358 ? 12.242  -51.157 -3.836  1.00 41.44  ? 359  PHE B CD1 1 
ATOM   6925 C CD2 . PHE B 1 358 ? 11.930  -49.137 -2.614  1.00 41.00  ? 359  PHE B CD2 1 
ATOM   6926 C CE1 . PHE B 1 358 ? 10.970  -51.575 -3.480  1.00 41.23  ? 359  PHE B CE1 1 
ATOM   6927 C CE2 . PHE B 1 358 ? 10.657  -49.551 -2.239  1.00 39.42  ? 359  PHE B CE2 1 
ATOM   6928 C CZ  . PHE B 1 358 ? 10.181  -50.766 -2.668  1.00 40.51  ? 359  PHE B CZ  1 
ATOM   6929 N N   . LEU B 1 359 ? 13.292  -46.729 -4.895  1.00 42.30  ? 360  LEU B N   1 
ATOM   6930 C CA  . LEU B 1 359 ? 12.336  -45.640 -5.127  1.00 44.55  ? 360  LEU B CA  1 
ATOM   6931 C C   . LEU B 1 359 ? 12.250  -45.281 -6.602  1.00 46.38  ? 360  LEU B C   1 
ATOM   6932 O O   . LEU B 1 359 ? 11.164  -45.046 -7.129  1.00 51.66  ? 360  LEU B O   1 
ATOM   6933 C CB  . LEU B 1 359 ? 12.706  -44.386 -4.319  1.00 41.88  ? 360  LEU B CB  1 
ATOM   6934 C CG  . LEU B 1 359 ? 12.754  -44.538 -2.783  1.00 55.12  ? 360  LEU B CG  1 
ATOM   6935 C CD1 . LEU B 1 359 ? 13.122  -43.232 -2.075  1.00 53.77  ? 360  LEU B CD1 1 
ATOM   6936 C CD2 . LEU B 1 359 ? 11.454  -45.092 -2.222  1.00 48.74  ? 360  LEU B CD2 1 
ATOM   6937 N N   . ALA B 1 360 ? 13.398  -45.250 -7.272  1.00 45.83  ? 361  ALA B N   1 
ATOM   6938 C CA  . ALA B 1 360 ? 13.434  -44.894 -8.685  1.00 38.36  ? 361  ALA B CA  1 
ATOM   6939 C C   . ALA B 1 360 ? 12.870  -46.035 -9.540  1.00 48.27  ? 361  ALA B C   1 
ATOM   6940 O O   . ALA B 1 360 ? 12.182  -45.820 -10.540 1.00 49.56  ? 361  ALA B O   1 
ATOM   6941 C CB  . ALA B 1 360 ? 14.860  -44.561 -9.101  1.00 44.73  ? 361  ALA B CB  1 
ATOM   6942 N N   . GLY B 1 361 ? 13.177  -47.262 -9.141  1.00 44.60  ? 362  GLY B N   1 
ATOM   6943 C CA  . GLY B 1 361 ? 12.615  -48.423 -9.798  1.00 47.57  ? 362  GLY B CA  1 
ATOM   6944 C C   . GLY B 1 361 ? 11.095  -48.459 -9.768  1.00 46.06  ? 362  GLY B C   1 
ATOM   6945 O O   . GLY B 1 361 ? 10.475  -48.927 -10.711 1.00 44.52  ? 362  GLY B O   1 
ATOM   6946 N N   . VAL B 1 362 ? 10.493  -47.967 -8.690  1.00 44.11  ? 363  VAL B N   1 
ATOM   6947 C CA  . VAL B 1 362 ? 9.046   -48.033 -8.564  1.00 49.52  ? 363  VAL B CA  1 
ATOM   6948 C C   . VAL B 1 362 ? 8.389   -47.212 -9.675  1.00 45.07  ? 363  VAL B C   1 
ATOM   6949 O O   . VAL B 1 362 ? 7.372   -47.635 -10.252 1.00 40.89  ? 363  VAL B O   1 
ATOM   6950 C CB  . VAL B 1 362 ? 8.571   -47.538 -7.169  1.00 48.32  ? 363  VAL B CB  1 
ATOM   6951 C CG1 . VAL B 1 362 ? 7.071   -47.306 -7.157  1.00 34.52  ? 363  VAL B CG1 1 
ATOM   6952 C CG2 . VAL B 1 362 ? 8.955   -48.535 -6.077  1.00 38.98  ? 363  VAL B CG2 1 
ATOM   6953 N N   . ARG B 1 363 ? 8.990   -46.058 -9.980  1.00 43.88  ? 364  ARG B N   1 
ATOM   6954 C CA  . ARG B 1 363 ? 8.473   -45.133 -10.997 1.00 50.23  ? 364  ARG B CA  1 
ATOM   6955 C C   . ARG B 1 363 ? 8.568   -45.716 -12.398 1.00 51.79  ? 364  ARG B C   1 
ATOM   6956 O O   . ARG B 1 363 ? 7.690   -45.512 -13.240 1.00 49.29  ? 364  ARG B O   1 
ATOM   6957 C CB  . ARG B 1 363 ? 9.222   -43.790 -10.972 1.00 48.46  ? 364  ARG B CB  1 
ATOM   6958 C CG  . ARG B 1 363 ? 9.054   -42.949 -9.702  1.00 53.95  ? 364  ARG B CG  1 
ATOM   6959 C CD  . ARG B 1 363 ? 7.669   -43.092 -9.043  1.00 62.72  ? 364  ARG B CD  1 
ATOM   6960 N NE  . ARG B 1 363 ? 6.604   -42.302 -9.676  1.00 74.50  ? 364  ARG B NE  1 
ATOM   6961 C CZ  . ARG B 1 363 ? 6.205   -41.094 -9.271  1.00 73.26  ? 364  ARG B CZ  1 
ATOM   6962 N NH1 . ARG B 1 363 ? 6.793   -40.505 -8.232  1.00 64.15  ? 364  ARG B NH1 1 
ATOM   6963 N NH2 . ARG B 1 363 ? 5.210   -40.475 -9.902  1.00 62.95  ? 364  ARG B NH2 1 
ATOM   6964 N N   . VAL B 1 364 ? 9.641   -46.447 -12.654 1.00 47.74  ? 365  VAL B N   1 
ATOM   6965 C CA  . VAL B 1 364 ? 9.842   -46.989 -13.988 1.00 55.57  ? 365  VAL B CA  1 
ATOM   6966 C C   . VAL B 1 364 ? 9.081   -48.322 -14.135 1.00 53.81  ? 365  VAL B C   1 
ATOM   6967 O O   . VAL B 1 364 ? 8.662   -48.684 -15.239 1.00 51.73  ? 365  VAL B O   1 
ATOM   6968 C CB  . VAL B 1 364 ? 11.372  -47.133 -14.307 1.00 52.89  ? 365  VAL B CB  1 
ATOM   6969 C CG1 . VAL B 1 364 ? 12.064  -48.081 -13.352 1.00 51.54  ? 365  VAL B CG1 1 
ATOM   6970 C CG2 . VAL B 1 364 ? 11.592  -47.579 -15.706 1.00 62.46  ? 365  VAL B CG2 1 
ATOM   6971 N N   . GLY B 1 365 ? 8.854   -49.025 -13.024 1.00 47.90  ? 366  GLY B N   1 
ATOM   6972 C CA  . GLY B 1 365 ? 8.123   -50.290 -13.063 1.00 40.65  ? 366  GLY B CA  1 
ATOM   6973 C C   . GLY B 1 365 ? 6.613   -50.139 -12.900 1.00 49.94  ? 366  GLY B C   1 
ATOM   6974 O O   . GLY B 1 365 ? 5.837   -51.060 -13.182 1.00 51.22  ? 366  GLY B O   1 
ATOM   6975 N N   . VAL B 1 366 ? 6.203   -48.970 -12.418 1.00 42.42  ? 367  VAL B N   1 
ATOM   6976 C CA  . VAL B 1 366 ? 4.799   -48.605 -12.290 1.00 40.55  ? 367  VAL B CA  1 
ATOM   6977 C C   . VAL B 1 366 ? 4.640   -47.231 -12.917 1.00 49.68  ? 367  VAL B C   1 
ATOM   6978 O O   . VAL B 1 366 ? 4.414   -46.236 -12.211 1.00 40.91  ? 367  VAL B O   1 
ATOM   6979 C CB  . VAL B 1 366 ? 4.321   -48.558 -10.801 1.00 41.48  ? 367  VAL B CB  1 
ATOM   6980 C CG1 . VAL B 1 366 ? 2.779   -48.370 -10.723 1.00 36.52  ? 367  VAL B CG1 1 
ATOM   6981 C CG2 . VAL B 1 366 ? 4.726   -49.810 -10.087 1.00 33.49  ? 367  VAL B CG2 1 
ATOM   6982 N N   . PRO B 1 367 ? 4.777   -47.162 -14.252 1.00 44.08  ? 368  PRO B N   1 
ATOM   6983 C CA  . PRO B 1 367 ? 4.717   -45.855 -14.896 1.00 47.98  ? 368  PRO B CA  1 
ATOM   6984 C C   . PRO B 1 367 ? 3.303   -45.291 -14.927 1.00 46.96  ? 368  PRO B C   1 
ATOM   6985 O O   . PRO B 1 367 ? 2.308   -46.030 -14.817 1.00 44.40  ? 368  PRO B O   1 
ATOM   6986 C CB  . PRO B 1 367 ? 5.225   -46.146 -16.310 1.00 55.28  ? 368  PRO B CB  1 
ATOM   6987 C CG  . PRO B 1 367 ? 4.756   -47.535 -16.569 1.00 47.01  ? 368  PRO B CG  1 
ATOM   6988 C CD  . PRO B 1 367 ? 4.878   -48.254 -15.238 1.00 50.28  ? 368  PRO B CD  1 
ATOM   6989 N N   . GLN B 1 368 ? 3.233   -43.974 -15.044 1.00 50.17  ? 369  GLN B N   1 
ATOM   6990 C CA  . GLN B 1 368 ? 1.967   -43.266 -15.210 1.00 67.56  ? 369  GLN B CA  1 
ATOM   6991 C C   . GLN B 1 368 ? 1.015   -43.308 -13.998 1.00 63.25  ? 369  GLN B C   1 
ATOM   6992 O O   . GLN B 1 368 ? -0.198  -43.167 -14.171 1.00 62.09  ? 369  GLN B O   1 
ATOM   6993 C CB  . GLN B 1 368 ? 1.237   -43.802 -16.455 1.00 72.17  ? 369  GLN B CB  1 
ATOM   6994 C CG  . GLN B 1 368 ? 2.004   -43.597 -17.767 1.00 74.95  ? 369  GLN B CG  1 
ATOM   6995 C CD  . GLN B 1 368 ? 2.124   -42.121 -18.165 1.00 87.94  ? 369  GLN B CD  1 
ATOM   6996 O OE1 . GLN B 1 368 ? 3.063   -41.423 -17.753 1.00 80.81  ? 369  GLN B OE1 1 
ATOM   6997 N NE2 . GLN B 1 368 ? 1.172   -41.645 -18.977 1.00 84.66  ? 369  GLN B NE2 1 
ATOM   6998 N N   . VAL B 1 369 ? 1.542   -43.486 -12.784 1.00 62.91  ? 370  VAL B N   1 
ATOM   6999 C CA  . VAL B 1 369 ? 0.727   -43.244 -11.587 1.00 49.08  ? 370  VAL B CA  1 
ATOM   7000 C C   . VAL B 1 369 ? 1.210   -41.982 -10.875 1.00 52.81  ? 370  VAL B C   1 
ATOM   7001 O O   . VAL B 1 369 ? 2.372   -41.596 -10.992 1.00 58.26  ? 370  VAL B O   1 
ATOM   7002 C CB  . VAL B 1 369 ? 0.734   -44.438 -10.605 1.00 55.84  ? 370  VAL B CB  1 
ATOM   7003 C CG1 . VAL B 1 369 ? 0.163   -45.691 -11.277 1.00 50.68  ? 370  VAL B CG1 1 
ATOM   7004 C CG2 . VAL B 1 369 ? 2.130   -44.693 -10.035 1.00 49.25  ? 370  VAL B CG2 1 
ATOM   7005 N N   . SER B 1 370 ? 0.304   -41.331 -10.151 1.00 57.99  ? 371  SER B N   1 
ATOM   7006 C CA  . SER B 1 370 ? 0.622   -40.102 -9.416  1.00 61.83  ? 371  SER B CA  1 
ATOM   7007 C C   . SER B 1 370 ? 1.607   -40.326 -8.269  1.00 59.10  ? 371  SER B C   1 
ATOM   7008 O O   . SER B 1 370 ? 1.853   -41.464 -7.865  1.00 58.07  ? 371  SER B O   1 
ATOM   7009 C CB  . SER B 1 370 ? -0.658  -39.486 -8.858  1.00 62.84  ? 371  SER B CB  1 
ATOM   7010 O OG  . SER B 1 370 ? -1.219  -40.307 -7.843  1.00 62.16  ? 371  SER B OG  1 
ATOM   7011 N N   . ASP B 1 371 ? 2.148   -39.236 -7.731  1.00 60.66  ? 372  ASP B N   1 
ATOM   7012 C CA  . ASP B 1 371 ? 3.125   -39.315 -6.644  1.00 59.34  ? 372  ASP B CA  1 
ATOM   7013 C C   . ASP B 1 371 ? 2.517   -39.971 -5.421  1.00 57.79  ? 372  ASP B C   1 
ATOM   7014 O O   . ASP B 1 371 ? 3.160   -40.766 -4.724  1.00 54.64  ? 372  ASP B O   1 
ATOM   7015 C CB  . ASP B 1 371 ? 3.643   -37.924 -6.285  1.00 62.35  ? 372  ASP B CB  1 
ATOM   7016 C CG  . ASP B 1 371 ? 4.385   -37.273 -7.430  1.00 74.17  ? 372  ASP B CG  1 
ATOM   7017 O OD1 . ASP B 1 371 ? 4.889   -38.013 -8.309  1.00 71.75  ? 372  ASP B OD1 1 
ATOM   7018 O OD2 . ASP B 1 371 ? 4.462   -36.024 -7.453  1.00 84.57  ? 372  ASP B OD2 1 
ATOM   7019 N N   . LEU B 1 372 ? 1.265   -39.627 -5.164  1.00 55.78  ? 373  LEU B N   1 
ATOM   7020 C CA  . LEU B 1 372 ? 0.546   -40.219 -4.057  1.00 54.87  ? 373  LEU B CA  1 
ATOM   7021 C C   . LEU B 1 372 ? 0.492   -41.742 -4.228  1.00 57.47  ? 373  LEU B C   1 
ATOM   7022 O O   . LEU B 1 372 ? 0.739   -42.497 -3.275  1.00 46.56  ? 373  LEU B O   1 
ATOM   7023 C CB  . LEU B 1 372 ? -0.857  -39.626 -3.949  1.00 43.70  ? 373  LEU B CB  1 
ATOM   7024 C CG  . LEU B 1 372 ? -1.674  -40.176 -2.784  1.00 52.32  ? 373  LEU B CG  1 
ATOM   7025 C CD1 . LEU B 1 372 ? -1.039  -39.794 -1.443  1.00 51.51  ? 373  LEU B CD1 1 
ATOM   7026 C CD2 . LEU B 1 372 ? -3.117  -39.700 -2.895  1.00 56.94  ? 373  LEU B CD2 1 
ATOM   7027 N N   . ALA B 1 373 ? 0.204   -42.189 -5.450  1.00 53.42  ? 374  ALA B N   1 
ATOM   7028 C CA  . ALA B 1 373 ? 0.108   -43.618 -5.736  1.00 48.36  ? 374  ALA B CA  1 
ATOM   7029 C C   . ALA B 1 373 ? 1.462   -44.293 -5.543  1.00 40.51  ? 374  ALA B C   1 
ATOM   7030 O O   . ALA B 1 373 ? 1.549   -45.368 -4.955  1.00 47.76  ? 374  ALA B O   1 
ATOM   7031 C CB  . ALA B 1 373 ? -0.420  -43.851 -7.156  1.00 42.86  ? 374  ALA B CB  1 
ATOM   7032 N N   . ALA B 1 374 ? 2.516   -43.656 -6.032  1.00 42.26  ? 375  ALA B N   1 
ATOM   7033 C CA  . ALA B 1 374 ? 3.858   -44.190 -5.866  1.00 43.64  ? 375  ALA B CA  1 
ATOM   7034 C C   . ALA B 1 374 ? 4.208   -44.297 -4.378  1.00 54.57  ? 375  ALA B C   1 
ATOM   7035 O O   . ALA B 1 374 ? 4.809   -45.290 -3.952  1.00 51.35  ? 375  ALA B O   1 
ATOM   7036 C CB  . ALA B 1 374 ? 4.863   -43.326 -6.590  1.00 44.72  ? 375  ALA B CB  1 
ATOM   7037 N N   . GLU B 1 375 ? 3.813   -43.285 -3.594  1.00 49.76  ? 376  GLU B N   1 
ATOM   7038 C CA  . GLU B 1 375 ? 3.995   -43.309 -2.142  1.00 51.25  ? 376  GLU B CA  1 
ATOM   7039 C C   . GLU B 1 375 ? 3.329   -44.519 -1.541  1.00 48.08  ? 376  GLU B C   1 
ATOM   7040 O O   . GLU B 1 375 ? 3.927   -45.229 -0.725  1.00 47.08  ? 376  GLU B O   1 
ATOM   7041 C CB  . GLU B 1 375 ? 3.427   -42.046 -1.471  1.00 59.45  ? 376  GLU B CB  1 
ATOM   7042 C CG  . GLU B 1 375 ? 4.254   -40.800 -1.689  1.00 62.38  ? 376  GLU B CG  1 
ATOM   7043 C CD  . GLU B 1 375 ? 5.733   -41.054 -1.497  1.00 77.11  ? 376  GLU B CD  1 
ATOM   7044 O OE1 . GLU B 1 375 ? 6.156   -41.244 -0.331  1.00 71.44  ? 376  GLU B OE1 1 
ATOM   7045 O OE2 . GLU B 1 375 ? 6.467   -41.081 -2.522  1.00 85.57  ? 376  GLU B OE2 1 
ATOM   7046 N N   . ALA B 1 376 ? 2.082   -44.746 -1.934  1.00 38.71  ? 377  ALA B N   1 
ATOM   7047 C CA  . ALA B 1 376 ? 1.366   -45.917 -1.453  1.00 41.96  ? 377  ALA B CA  1 
ATOM   7048 C C   . ALA B 1 376 ? 2.123   -47.199 -1.808  1.00 45.89  ? 377  ALA B C   1 
ATOM   7049 O O   . ALA B 1 376 ? 2.154   -48.138 -1.002  1.00 40.34  ? 377  ALA B O   1 
ATOM   7050 C CB  . ALA B 1 376 ? -0.048  -45.952 -2.013  1.00 35.79  ? 377  ALA B CB  1 
ATOM   7051 N N   . VAL B 1 377 ? 2.745   -47.244 -2.993  1.00 43.29  ? 378  VAL B N   1 
ATOM   7052 C CA  . VAL B 1 377 ? 3.456   -48.452 -3.395  1.00 38.81  ? 378  VAL B CA  1 
ATOM   7053 C C   . VAL B 1 377 ? 4.691   -48.684 -2.521  1.00 36.33  ? 378  VAL B C   1 
ATOM   7054 O O   . VAL B 1 377 ? 4.912   -49.782 -2.010  1.00 33.68  ? 378  VAL B O   1 
ATOM   7055 C CB  . VAL B 1 377 ? 3.872   -48.408 -4.894  1.00 31.64  ? 378  VAL B CB  1 
ATOM   7056 C CG1 . VAL B 1 377 ? 4.700   -49.639 -5.221  1.00 25.94  ? 378  VAL B CG1 1 
ATOM   7057 C CG2 . VAL B 1 377 ? 2.637   -48.370 -5.741  1.00 29.75  ? 378  VAL B CG2 1 
ATOM   7058 N N   . VAL B 1 378 ? 5.498   -47.643 -2.355  1.00 45.56  ? 379  VAL B N   1 
ATOM   7059 C CA  . VAL B 1 378 ? 6.630   -47.687 -1.431  1.00 44.71  ? 379  VAL B CA  1 
ATOM   7060 C C   . VAL B 1 378 ? 6.234   -48.099 -0.001  1.00 45.41  ? 379  VAL B C   1 
ATOM   7061 O O   . VAL B 1 378 ? 6.923   -48.903 0.623   1.00 49.74  ? 379  VAL B O   1 
ATOM   7062 C CB  . VAL B 1 378 ? 7.329   -46.338 -1.396  1.00 53.53  ? 379  VAL B CB  1 
ATOM   7063 C CG1 . VAL B 1 378 ? 8.342   -46.293 -0.264  1.00 56.29  ? 379  VAL B CG1 1 
ATOM   7064 C CG2 . VAL B 1 378 ? 8.004   -46.094 -2.733  1.00 47.19  ? 379  VAL B CG2 1 
ATOM   7065 N N   . LEU B 1 379 ? 5.117   -47.576 0.497   1.00 46.50  ? 380  LEU B N   1 
ATOM   7066 C CA  . LEU B 1 379 ? 4.609   -47.936 1.829   1.00 48.07  ? 380  LEU B CA  1 
ATOM   7067 C C   . LEU B 1 379 ? 4.356   -49.415 1.948   1.00 45.71  ? 380  LEU B C   1 
ATOM   7068 O O   . LEU B 1 379 ? 4.828   -50.070 2.879   1.00 48.89  ? 380  LEU B O   1 
ATOM   7069 C CB  . LEU B 1 379 ? 3.271   -47.218 2.170   1.00 42.88  ? 380  LEU B CB  1 
ATOM   7070 C CG  . LEU B 1 379 ? 2.376   -47.924 3.245   1.00 59.37  ? 380  LEU B CG  1 
ATOM   7071 C CD1 . LEU B 1 379 ? 2.919   -47.808 4.706   1.00 38.84  ? 380  LEU B CD1 1 
ATOM   7072 C CD2 . LEU B 1 379 ? 0.875   -47.541 3.187   1.00 50.33  ? 380  LEU B CD2 1 
ATOM   7073 N N   A HIS B 1 380 ? 3.574   -49.949 1.019   0.49 45.14  ? 381  HIS B N   1 
ATOM   7074 N N   B HIS B 1 380 ? 3.571   -49.926 1.006   0.51 45.06  ? 381  HIS B N   1 
ATOM   7075 C CA  A HIS B 1 380 ? 3.142   -51.333 1.120   0.49 43.80  ? 381  HIS B CA  1 
ATOM   7076 C CA  B HIS B 1 380 ? 3.120   -51.305 1.046   0.51 43.76  ? 381  HIS B CA  1 
ATOM   7077 C C   A HIS B 1 380 ? 4.287   -52.318 0.853   0.49 42.53  ? 381  HIS B C   1 
ATOM   7078 C C   B HIS B 1 380 ? 4.303   -52.272 0.894   0.51 42.46  ? 381  HIS B C   1 
ATOM   7079 O O   A HIS B 1 380 ? 4.273   -53.434 1.370   0.49 42.39  ? 381  HIS B O   1 
ATOM   7080 O O   B HIS B 1 380 ? 4.340   -53.317 1.543   0.51 42.23  ? 381  HIS B O   1 
ATOM   7081 C CB  A HIS B 1 380 ? 1.973   -51.595 0.163   0.49 43.37  ? 381  HIS B CB  1 
ATOM   7082 C CB  B HIS B 1 380 ? 2.063   -51.547 -0.047  0.51 43.23  ? 381  HIS B CB  1 
ATOM   7083 C CG  A HIS B 1 380 ? 0.629   -51.364 0.780   0.49 46.24  ? 381  HIS B CG  1 
ATOM   7084 C CG  B HIS B 1 380 ? 1.397   -52.883 0.052   0.51 44.98  ? 381  HIS B CG  1 
ATOM   7085 N ND1 A HIS B 1 380 ? 0.006   -50.134 0.775   0.49 47.90  ? 381  HIS B ND1 1 
ATOM   7086 N ND1 B HIS B 1 380 ? 0.109   -53.048 0.520   0.51 44.91  ? 381  HIS B ND1 1 
ATOM   7087 C CD2 A HIS B 1 380 ? -0.210  -52.208 1.427   0.49 42.89  ? 381  HIS B CD2 1 
ATOM   7088 C CD2 B HIS B 1 380 ? 1.858   -54.125 -0.226  0.51 43.82  ? 381  HIS B CD2 1 
ATOM   7089 C CE1 A HIS B 1 380 ? -1.160  -50.231 1.390   0.49 47.49  ? 381  HIS B CE1 1 
ATOM   7090 C CE1 B HIS B 1 380 ? -0.197  -54.334 0.515   0.51 42.44  ? 381  HIS B CE1 1 
ATOM   7091 N NE2 A HIS B 1 380 ? -1.316  -51.480 1.793   0.49 45.04  ? 381  HIS B NE2 1 
ATOM   7092 N NE2 B HIS B 1 380 ? 0.849   -55.010 0.070   0.51 47.21  ? 381  HIS B NE2 1 
ATOM   7093 N N   . TYR B 1 381 ? 5.282   -51.910 0.064   1.00 36.07  ? 382  TYR B N   1 
ATOM   7094 C CA  . TYR B 1 381 ? 6.374   -52.827 -0.258  1.00 36.72  ? 382  TYR B CA  1 
ATOM   7095 C C   . TYR B 1 381 ? 7.675   -52.659 0.546   1.00 37.21  ? 382  TYR B C   1 
ATOM   7096 O O   . TYR B 1 381 ? 8.606   -53.453 0.415   1.00 35.62  ? 382  TYR B O   1 
ATOM   7097 C CB  . TYR B 1 381 ? 6.664   -52.741 -1.762  1.00 35.82  ? 382  TYR B CB  1 
ATOM   7098 C CG  . TYR B 1 381 ? 5.621   -53.484 -2.552  1.00 35.46  ? 382  TYR B CG  1 
ATOM   7099 C CD1 . TYR B 1 381 ? 4.432   -52.865 -2.920  1.00 33.08  ? 382  TYR B CD1 1 
ATOM   7100 C CD2 . TYR B 1 381 ? 5.801   -54.821 -2.894  1.00 31.16  ? 382  TYR B CD2 1 
ATOM   7101 C CE1 . TYR B 1 381 ? 3.462   -53.550 -3.647  1.00 34.73  ? 382  TYR B CE1 1 
ATOM   7102 C CE2 . TYR B 1 381 ? 4.840   -55.516 -3.619  1.00 32.16  ? 382  TYR B CE2 1 
ATOM   7103 C CZ  . TYR B 1 381 ? 3.675   -54.872 -3.997  1.00 31.64  ? 382  TYR B CZ  1 
ATOM   7104 O OH  . TYR B 1 381 ? 2.717   -55.546 -4.712  1.00 32.97  ? 382  TYR B OH  1 
ATOM   7105 N N   . THR B 1 382 ? 7.735   -51.658 1.406   1.00 41.81  ? 383  THR B N   1 
ATOM   7106 C CA  . THR B 1 382 ? 8.861   -51.544 2.326   1.00 35.70  ? 383  THR B CA  1 
ATOM   7107 C C   . THR B 1 382 ? 8.666   -52.407 3.554   1.00 41.51  ? 383  THR B C   1 
ATOM   7108 O O   . THR B 1 382 ? 7.586   -52.424 4.152   1.00 35.50  ? 383  THR B O   1 
ATOM   7109 C CB  . THR B 1 382 ? 9.058   -50.109 2.769   1.00 39.50  ? 383  THR B CB  1 
ATOM   7110 O OG1 . THR B 1 382 ? 9.374   -49.326 1.619   1.00 35.22  ? 383  THR B OG1 1 
ATOM   7111 C CG2 . THR B 1 382 ? 10.184  -50.000 3.837   1.00 35.24  ? 383  THR B CG2 1 
ATOM   7112 N N   . ASP B 1 383 ? 9.697   -53.152 3.922   1.00 36.34  ? 384  ASP B N   1 
ATOM   7113 C CA  . ASP B 1 383 ? 9.691   -53.799 5.222   1.00 40.21  ? 384  ASP B CA  1 
ATOM   7114 C C   . ASP B 1 383 ? 10.236  -52.767 6.204   1.00 42.73  ? 384  ASP B C   1 
ATOM   7115 O O   . ASP B 1 383 ? 11.422  -52.434 6.152   1.00 39.27  ? 384  ASP B O   1 
ATOM   7116 C CB  . ASP B 1 383 ? 10.537  -55.072 5.209   1.00 39.65  ? 384  ASP B CB  1 
ATOM   7117 C CG  . ASP B 1 383 ? 10.596  -55.756 6.576   1.00 46.22  ? 384  ASP B CG  1 
ATOM   7118 O OD1 . ASP B 1 383 ? 10.367  -55.099 7.626   1.00 48.61  ? 384  ASP B OD1 1 
ATOM   7119 O OD2 . ASP B 1 383 ? 10.872  -56.973 6.597   1.00 43.82  ? 384  ASP B OD2 1 
ATOM   7120 N N   . TRP B 1 384 ? 9.397   -52.245 7.092   1.00 37.01  ? 385  TRP B N   1 
ATOM   7121 C CA  . TRP B 1 384 ? 9.844   -51.096 7.872   1.00 43.68  ? 385  TRP B CA  1 
ATOM   7122 C C   . TRP B 1 384 ? 10.748  -51.470 9.041   1.00 42.15  ? 385  TRP B C   1 
ATOM   7123 O O   . TRP B 1 384 ? 11.255  -50.590 9.737   1.00 41.59  ? 385  TRP B O   1 
ATOM   7124 C CB  . TRP B 1 384 ? 8.647   -50.286 8.339   1.00 43.06  ? 385  TRP B CB  1 
ATOM   7125 C CG  . TRP B 1 384 ? 7.995   -49.657 7.160   1.00 39.31  ? 385  TRP B CG  1 
ATOM   7126 C CD1 . TRP B 1 384 ? 6.901   -50.111 6.489   1.00 35.58  ? 385  TRP B CD1 1 
ATOM   7127 C CD2 . TRP B 1 384 ? 8.435   -48.491 6.466   1.00 38.20  ? 385  TRP B CD2 1 
ATOM   7128 N NE1 . TRP B 1 384 ? 6.602   -49.274 5.443   1.00 34.64  ? 385  TRP B NE1 1 
ATOM   7129 C CE2 . TRP B 1 384 ? 7.536   -48.276 5.399   1.00 37.82  ? 385  TRP B CE2 1 
ATOM   7130 C CE3 . TRP B 1 384 ? 9.495   -47.597 6.647   1.00 37.87  ? 385  TRP B CE3 1 
ATOM   7131 C CZ2 . TRP B 1 384 ? 7.667   -47.207 4.515   1.00 38.54  ? 385  TRP B CZ2 1 
ATOM   7132 C CZ3 . TRP B 1 384 ? 9.623   -46.537 5.772   1.00 38.39  ? 385  TRP B CZ3 1 
ATOM   7133 C CH2 . TRP B 1 384 ? 8.718   -46.352 4.718   1.00 40.18  ? 385  TRP B CH2 1 
ATOM   7134 N N   . LEU B 1 385 ? 10.993  -52.764 9.224   1.00 40.75  ? 386  LEU B N   1 
ATOM   7135 C CA  . LEU B 1 385 ? 12.053  -53.203 10.131  1.00 37.29  ? 386  LEU B CA  1 
ATOM   7136 C C   . LEU B 1 385 ? 13.377  -53.349 9.398   1.00 48.48  ? 386  LEU B C   1 
ATOM   7137 O O   . LEU B 1 385 ? 14.422  -53.447 10.032  1.00 46.86  ? 386  LEU B O   1 
ATOM   7138 C CB  . LEU B 1 385 ? 11.678  -54.524 10.807  1.00 45.02  ? 386  LEU B CB  1 
ATOM   7139 C CG  . LEU B 1 385 ? 10.659  -54.358 11.939  1.00 51.74  ? 386  LEU B CG  1 
ATOM   7140 C CD1 . LEU B 1 385 ? 10.281  -55.697 12.556  1.00 47.72  ? 386  LEU B CD1 1 
ATOM   7141 C CD2 . LEU B 1 385 ? 11.225  -53.407 12.992  1.00 45.04  ? 386  LEU B CD2 1 
ATOM   7142 N N   . HIS B 1 386 ? 13.334  -53.370 8.063   1.00 42.44  ? 387  HIS B N   1 
ATOM   7143 C CA  . HIS B 1 386 ? 14.552  -53.444 7.267   1.00 34.20  ? 387  HIS B CA  1 
ATOM   7144 C C   . HIS B 1 386 ? 14.446  -52.569 6.037   1.00 43.90  ? 387  HIS B C   1 
ATOM   7145 O O   . HIS B 1 386 ? 14.462  -53.069 4.915   1.00 41.56  ? 387  HIS B O   1 
ATOM   7146 C CB  . HIS B 1 386 ? 14.833  -54.881 6.845   1.00 40.35  ? 387  HIS B CB  1 
ATOM   7147 C CG  . HIS B 1 386 ? 14.809  -55.865 7.975   1.00 41.61  ? 387  HIS B CG  1 
ATOM   7148 N ND1 . HIS B 1 386 ? 15.921  -56.138 8.743   1.00 47.08  ? 387  HIS B ND1 1 
ATOM   7149 C CD2 . HIS B 1 386 ? 13.813  -56.643 8.463   1.00 43.92  ? 387  HIS B CD2 1 
ATOM   7150 C CE1 . HIS B 1 386 ? 15.608  -57.037 9.661   1.00 44.36  ? 387  HIS B CE1 1 
ATOM   7151 N NE2 . HIS B 1 386 ? 14.337  -57.364 9.510   1.00 43.10  ? 387  HIS B NE2 1 
ATOM   7152 N N   . PRO B 1 387 ? 14.322  -51.255 6.237   1.00 47.59  ? 388  PRO B N   1 
ATOM   7153 C CA  . PRO B 1 387 ? 13.947  -50.445 5.070   1.00 38.57  ? 388  PRO B CA  1 
ATOM   7154 C C   . PRO B 1 387 ? 15.021  -50.315 3.978   1.00 44.98  ? 388  PRO B C   1 
ATOM   7155 O O   . PRO B 1 387 ? 14.702  -49.856 2.874   1.00 43.14  ? 388  PRO B O   1 
ATOM   7156 C CB  . PRO B 1 387 ? 13.642  -49.070 5.678   1.00 39.79  ? 388  PRO B CB  1 
ATOM   7157 C CG  . PRO B 1 387 ? 14.291  -49.093 7.064   1.00 43.28  ? 388  PRO B CG  1 
ATOM   7158 C CD  . PRO B 1 387 ? 14.255  -50.506 7.506   1.00 35.53  ? 388  PRO B CD  1 
ATOM   7159 N N   . GLU B 1 388 ? 16.255  -50.714 4.262   1.00 43.36  ? 389  GLU B N   1 
ATOM   7160 C CA  . GLU B 1 388 ? 17.346  -50.459 3.324   1.00 46.85  ? 389  GLU B CA  1 
ATOM   7161 C C   . GLU B 1 388 ? 18.184  -51.688 2.992   1.00 42.73  ? 389  GLU B C   1 
ATOM   7162 O O   . GLU B 1 388 ? 19.255  -51.564 2.404   1.00 43.71  ? 389  GLU B O   1 
ATOM   7163 C CB  . GLU B 1 388 ? 18.250  -49.364 3.877   1.00 55.02  ? 389  GLU B CB  1 
ATOM   7164 C CG  . GLU B 1 388 ? 17.492  -48.101 4.239   1.00 53.61  ? 389  GLU B CG  1 
ATOM   7165 C CD  . GLU B 1 388 ? 18.409  -46.948 4.532   1.00 72.14  ? 389  GLU B CD  1 
ATOM   7166 O OE1 . GLU B 1 388 ? 18.721  -46.192 3.586   1.00 72.54  ? 389  GLU B OE1 1 
ATOM   7167 O OE2 . GLU B 1 388 ? 18.824  -46.806 5.706   1.00 88.66  ? 389  GLU B OE2 1 
ATOM   7168 N N   . ASP B 1 389 ? 17.708  -52.869 3.372   1.00 37.95  ? 390  ASP B N   1 
ATOM   7169 C CA  . ASP B 1 389 ? 18.417  -54.087 3.030   1.00 42.98  ? 390  ASP B CA  1 
ATOM   7170 C C   . ASP B 1 389 ? 18.365  -54.335 1.508   1.00 44.63  ? 390  ASP B C   1 
ATOM   7171 O O   . ASP B 1 389 ? 17.300  -54.633 0.975   1.00 46.92  ? 390  ASP B O   1 
ATOM   7172 C CB  . ASP B 1 389 ? 17.820  -55.266 3.784   1.00 36.69  ? 390  ASP B CB  1 
ATOM   7173 C CG  . ASP B 1 389 ? 18.517  -56.558 3.461   1.00 46.65  ? 390  ASP B CG  1 
ATOM   7174 O OD1 . ASP B 1 389 ? 19.679  -56.495 3.017   1.00 63.43  ? 390  ASP B OD1 1 
ATOM   7175 O OD2 . ASP B 1 389 ? 17.926  -57.639 3.651   1.00 56.10  ? 390  ASP B OD2 1 
ATOM   7176 N N   . PRO B 1 390 ? 19.519  -54.231 0.818   1.00 43.39  ? 391  PRO B N   1 
ATOM   7177 C CA  . PRO B 1 390 ? 19.580  -54.345 -0.650  1.00 42.01  ? 391  PRO B CA  1 
ATOM   7178 C C   . PRO B 1 390 ? 18.885  -55.598 -1.210  1.00 42.65  ? 391  PRO B C   1 
ATOM   7179 O O   . PRO B 1 390 ? 18.081  -55.463 -2.129  1.00 45.51  ? 391  PRO B O   1 
ATOM   7180 C CB  . PRO B 1 390 ? 21.086  -54.375 -0.940  1.00 44.31  ? 391  PRO B CB  1 
ATOM   7181 C CG  . PRO B 1 390 ? 21.708  -53.661 0.251   1.00 41.27  ? 391  PRO B CG  1 
ATOM   7182 C CD  . PRO B 1 390 ? 20.860  -54.075 1.415   1.00 42.69  ? 391  PRO B CD  1 
ATOM   7183 N N   . ALA B 1 391 ? 19.153  -56.773 -0.650  1.00 41.01  ? 392  ALA B N   1 
ATOM   7184 C CA  . ALA B 1 391 ? 18.517  -58.006 -1.114  1.00 43.92  ? 392  ALA B CA  1 
ATOM   7185 C C   . ALA B 1 391 ? 16.993  -57.949 -1.026  1.00 46.95  ? 392  ALA B C   1 
ATOM   7186 O O   . ALA B 1 391 ? 16.287  -58.374 -1.939  1.00 42.72  ? 392  ALA B O   1 
ATOM   7187 C CB  . ALA B 1 391 ? 19.041  -59.202 -0.314  1.00 41.33  ? 392  ALA B CB  1 
ATOM   7188 N N   . ARG B 1 392 ? 16.489  -57.441 0.090   1.00 39.34  ? 393  ARG B N   1 
ATOM   7189 C CA  . ARG B 1 392 ? 15.050  -57.327 0.293   1.00 38.37  ? 393  ARG B CA  1 
ATOM   7190 C C   . ARG B 1 392 ? 14.435  -56.301 -0.650  1.00 38.20  ? 393  ARG B C   1 
ATOM   7191 O O   . ARG B 1 392 ? 13.300  -56.468 -1.097  1.00 37.77  ? 393  ARG B O   1 
ATOM   7192 C CB  . ARG B 1 392 ? 14.730  -56.938 1.743   1.00 43.91  ? 393  ARG B CB  1 
ATOM   7193 C CG  . ARG B 1 392 ? 14.888  -58.071 2.766   1.00 41.61  ? 393  ARG B CG  1 
ATOM   7194 C CD  . ARG B 1 392 ? 14.626  -57.508 4.145   1.00 45.61  ? 393  ARG B CD  1 
ATOM   7195 N NE  . ARG B 1 392 ? 14.363  -58.522 5.157   1.00 48.77  ? 393  ARG B NE  1 
ATOM   7196 C CZ  . ARG B 1 392 ? 15.249  -58.909 6.069   1.00 55.07  ? 393  ARG B CZ  1 
ATOM   7197 N NH1 . ARG B 1 392 ? 16.466  -58.377 6.078   1.00 53.16  ? 393  ARG B NH1 1 
ATOM   7198 N NH2 . ARG B 1 392 ? 14.910  -59.816 6.979   1.00 53.56  ? 393  ARG B NH2 1 
ATOM   7199 N N   . LEU B 1 393 ? 15.179  -55.236 -0.927  1.00 33.36  ? 394  LEU B N   1 
ATOM   7200 C CA  . LEU B 1 393 ? 14.713  -54.187 -1.810  1.00 36.84  ? 394  LEU B CA  1 
ATOM   7201 C C   . LEU B 1 393 ? 14.640  -54.702 -3.250  1.00 41.36  ? 394  LEU B C   1 
ATOM   7202 O O   . LEU B 1 393 ? 13.714  -54.362 -4.015  1.00 34.87  ? 394  LEU B O   1 
ATOM   7203 C CB  . LEU B 1 393 ? 15.633  -52.977 -1.722  1.00 33.63  ? 394  LEU B CB  1 
ATOM   7204 C CG  . LEU B 1 393 ? 15.613  -52.150 -0.434  1.00 41.05  ? 394  LEU B CG  1 
ATOM   7205 C CD1 . LEU B 1 393 ? 16.815  -51.210 -0.425  1.00 38.94  ? 394  LEU B CD1 1 
ATOM   7206 C CD2 . LEU B 1 393 ? 14.324  -51.355 -0.341  1.00 35.14  ? 394  LEU B CD2 1 
ATOM   7207 N N   . ARG B 1 394 ? 15.618  -55.529 -3.616  1.00 39.99  ? 395  ARG B N   1 
ATOM   7208 C CA  . ARG B 1 394 ? 15.631  -56.164 -4.941  1.00 43.55  ? 395  ARG B CA  1 
ATOM   7209 C C   . ARG B 1 394 ? 14.391  -57.040 -5.102  1.00 39.67  ? 395  ARG B C   1 
ATOM   7210 O O   . ARG B 1 394 ? 13.639  -56.909 -6.083  1.00 35.90  ? 395  ARG B O   1 
ATOM   7211 C CB  . ARG B 1 394 ? 16.899  -57.001 -5.140  1.00 41.11  ? 395  ARG B CB  1 
ATOM   7212 C CG  . ARG B 1 394 ? 17.117  -57.491 -6.576  1.00 40.72  ? 395  ARG B CG  1 
ATOM   7213 C CD  . ARG B 1 394 ? 18.153  -58.623 -6.641  1.00 41.87  ? 395  ARG B CD  1 
ATOM   7214 N NE  . ARG B 1 394 ? 17.844  -59.745 -5.747  1.00 40.72  ? 395  ARG B NE  1 
ATOM   7215 C CZ  . ARG B 1 394 ? 18.765  -60.456 -5.091  1.00 49.94  ? 395  ARG B CZ  1 
ATOM   7216 N NH1 . ARG B 1 394 ? 20.058  -60.170 -5.216  1.00 45.23  ? 395  ARG B NH1 1 
ATOM   7217 N NH2 . ARG B 1 394 ? 18.403  -61.462 -4.310  1.00 40.02  ? 395  ARG B NH2 1 
ATOM   7218 N N   . GLU B 1 395 ? 14.175  -57.914 -4.119  1.00 37.99  ? 396  GLU B N   1 
ATOM   7219 C CA  . GLU B 1 395 ? 13.008  -58.790 -4.095  1.00 39.64  ? 396  GLU B CA  1 
ATOM   7220 C C   . GLU B 1 395 ? 11.693  -57.989 -4.140  1.00 42.09  ? 396  GLU B C   1 
ATOM   7221 O O   . GLU B 1 395 ? 10.759  -58.355 -4.853  1.00 38.58  ? 396  GLU B O   1 
ATOM   7222 C CB  . GLU B 1 395 ? 13.045  -59.684 -2.848  1.00 42.96  ? 396  GLU B CB  1 
ATOM   7223 C CG  . GLU B 1 395 ? 13.129  -61.183 -3.108  1.00 57.93  ? 396  GLU B CG  1 
ATOM   7224 C CD  . GLU B 1 395 ? 14.476  -61.610 -3.705  1.00 74.75  ? 396  GLU B CD  1 
ATOM   7225 O OE1 . GLU B 1 395 ? 14.693  -61.412 -4.935  1.00 73.93  ? 396  GLU B OE1 1 
ATOM   7226 O OE2 . GLU B 1 395 ? 15.316  -62.143 -2.940  1.00 67.61  ? 396  GLU B OE2 1 
ATOM   7227 N N   . ALA B 1 396 ? 11.630  -56.889 -3.393  1.00 38.86  ? 397  ALA B N   1 
ATOM   7228 C CA  . ALA B 1 396 ? 10.395  -56.122 -3.285  1.00 35.07  ? 397  ALA B CA  1 
ATOM   7229 C C   . ALA B 1 396 ? 10.074  -55.423 -4.594  1.00 36.41  ? 397  ALA B C   1 
ATOM   7230 O O   . ALA B 1 396 ? 8.921   -55.389 -5.011  1.00 39.89  ? 397  ALA B O   1 
ATOM   7231 C CB  . ALA B 1 396 ? 10.482  -55.098 -2.145  1.00 33.18  ? 397  ALA B CB  1 
ATOM   7232 N N   . LEU B 1 397 ? 11.088  -54.855 -5.232  1.00 33.54  ? 398  LEU B N   1 
ATOM   7233 C CA  . LEU B 1 397 ? 10.890  -54.223 -6.522  1.00 35.27  ? 398  LEU B CA  1 
ATOM   7234 C C   . LEU B 1 397 ? 10.435  -55.252 -7.556  1.00 37.52  ? 398  LEU B C   1 
ATOM   7235 O O   . LEU B 1 397 ? 9.583   -54.967 -8.393  1.00 36.13  ? 398  LEU B O   1 
ATOM   7236 C CB  . LEU B 1 397 ? 12.166  -53.537 -7.001  1.00 36.39  ? 398  LEU B CB  1 
ATOM   7237 C CG  . LEU B 1 397 ? 11.937  -52.697 -8.252  1.00 37.80  ? 398  LEU B CG  1 
ATOM   7238 C CD1 . LEU B 1 397 ? 10.793  -51.708 -7.984  1.00 41.65  ? 398  LEU B CD1 1 
ATOM   7239 C CD2 . LEU B 1 397 ? 13.208  -51.972 -8.664  1.00 39.51  ? 398  LEU B CD2 1 
ATOM   7240 N N   . SER B 1 398 ? 11.001  -56.453 -7.494  1.00 38.79  ? 399  SER B N   1 
ATOM   7241 C CA  . SER B 1 398 ? 10.566  -57.522 -8.385  1.00 35.34  ? 399  SER B CA  1 
ATOM   7242 C C   . SER B 1 398 ? 9.090   -57.861 -8.141  1.00 38.98  ? 399  SER B C   1 
ATOM   7243 O O   . SER B 1 398 ? 8.330   -58.105 -9.084  1.00 33.71  ? 399  SER B O   1 
ATOM   7244 C CB  . SER B 1 398 ? 11.442  -58.767 -8.204  1.00 35.77  ? 399  SER B CB  1 
ATOM   7245 O OG  . SER B 1 398 ? 11.021  -59.810 -9.080  1.00 44.87  ? 399  SER B OG  1 
ATOM   7246 N N   . ASP B 1 399 ? 8.683   -57.867 -6.875  1.00 35.80  ? 400  ASP B N   1 
ATOM   7247 C CA  . ASP B 1 399 ? 7.285   -58.116 -6.532  1.00 33.10  ? 400  ASP B CA  1 
ATOM   7248 C C   . ASP B 1 399 ? 6.389   -56.993 -7.022  1.00 31.81  ? 400  ASP B C   1 
ATOM   7249 O O   . ASP B 1 399 ? 5.304   -57.256 -7.528  1.00 34.65  ? 400  ASP B O   1 
ATOM   7250 C CB  . ASP B 1 399 ? 7.115   -58.293 -5.011  1.00 36.70  ? 400  ASP B CB  1 
ATOM   7251 C CG  . ASP B 1 399 ? 7.598   -59.642 -4.529  1.00 45.17  ? 400  ASP B CG  1 
ATOM   7252 O OD1 . ASP B 1 399 ? 7.527   -60.596 -5.334  1.00 47.99  ? 400  ASP B OD1 1 
ATOM   7253 O OD2 . ASP B 1 399 ? 8.032   -59.747 -3.351  1.00 48.98  ? 400  ASP B OD2 1 
ATOM   7254 N N   . VAL B 1 400 ? 6.840   -55.745 -6.862  1.00 31.20  ? 401  VAL B N   1 
ATOM   7255 C CA  . VAL B 1 400 ? 6.096   -54.584 -7.340  1.00 33.00  ? 401  VAL B CA  1 
ATOM   7256 C C   . VAL B 1 400 ? 5.772   -54.698 -8.845  1.00 37.70  ? 401  VAL B C   1 
ATOM   7257 O O   . VAL B 1 400 ? 4.611   -54.576 -9.274  1.00 34.64  ? 401  VAL B O   1 
ATOM   7258 C CB  . VAL B 1 400 ? 6.881   -53.262 -7.114  1.00 32.92  ? 401  VAL B CB  1 
ATOM   7259 C CG1 . VAL B 1 400 ? 6.251   -52.128 -7.910  1.00 27.88  ? 401  VAL B CG1 1 
ATOM   7260 C CG2 . VAL B 1 400 ? 6.955   -52.893 -5.630  1.00 30.74  ? 401  VAL B CG2 1 
ATOM   7261 N N   . VAL B 1 401 ? 6.814   -54.928 -9.640  1.00 33.80  ? 402  VAL B N   1 
ATOM   7262 C CA  . VAL B 1 401 ? 6.666   -54.982 -11.088 1.00 33.33  ? 402  VAL B CA  1 
ATOM   7263 C C   . VAL B 1 401 ? 5.805   -56.170 -11.486 1.00 31.49  ? 402  VAL B C   1 
ATOM   7264 O O   . VAL B 1 401 ? 4.840   -56.011 -12.247 1.00 29.09  ? 402  VAL B O   1 
ATOM   7265 C CB  . VAL B 1 401 ? 8.033   -55.033 -11.765 1.00 35.63  ? 402  VAL B CB  1 
ATOM   7266 C CG1 . VAL B 1 401 ? 7.886   -55.204 -13.266 1.00 33.83  ? 402  VAL B CG1 1 
ATOM   7267 C CG2 . VAL B 1 401 ? 8.773   -53.744 -11.456 1.00 30.07  ? 402  VAL B CG2 1 
ATOM   7268 N N   . GLY B 1 402 ? 6.104   -57.338 -10.921 1.00 29.88  ? 403  GLY B N   1 
ATOM   7269 C CA  . GLY B 1 402 ? 5.325   -58.529 -11.208 1.00 29.64  ? 403  GLY B CA  1 
ATOM   7270 C C   . GLY B 1 402 ? 3.869   -58.443 -10.796 1.00 36.08  ? 403  GLY B C   1 
ATOM   7271 O O   . GLY B 1 402 ? 2.977   -58.865 -11.556 1.00 32.13  ? 403  GLY B O   1 
ATOM   7272 N N   . ASP B 1 403 ? 3.613   -57.911 -9.596  1.00 29.10  ? 404  ASP B N   1 
ATOM   7273 C CA  . ASP B 1 403 ? 2.246   -57.835 -9.073  1.00 31.66  ? 404  ASP B CA  1 
ATOM   7274 C C   . ASP B 1 403 ? 1.389   -56.895 -9.902  1.00 28.20  ? 404  ASP B C   1 
ATOM   7275 O O   . ASP B 1 403 ? 0.269   -57.237 -10.287 1.00 33.10  ? 404  ASP B O   1 
ATOM   7276 C CB  . ASP B 1 403 ? 2.217   -57.358 -7.600  1.00 31.67  ? 404  ASP B CB  1 
ATOM   7277 C CG  . ASP B 1 403 ? 2.798   -58.372 -6.639  1.00 33.57  ? 404  ASP B CG  1 
ATOM   7278 O OD1 . ASP B 1 403 ? 2.946   -59.556 -7.017  1.00 41.57  ? 404  ASP B OD1 1 
ATOM   7279 O OD2 . ASP B 1 403 ? 3.124   -57.983 -5.497  1.00 36.32  ? 404  ASP B OD2 1 
ATOM   7280 N N   . HIS B 1 404 ? 1.920   -55.699 -10.137 1.00 27.92  ? 405  HIS B N   1 
ATOM   7281 C CA  . HIS B 1 404 ? 1.226   -54.650 -10.876 1.00 26.06  ? 405  HIS B CA  1 
ATOM   7282 C C   . HIS B 1 404 ? 0.941   -55.034 -12.333 1.00 32.10  ? 405  HIS B C   1 
ATOM   7283 O O   . HIS B 1 404 ? -0.143  -54.753 -12.864 1.00 29.04  ? 405  HIS B O   1 
ATOM   7284 C CB  . HIS B 1 404 ? 2.051   -53.359 -10.830 1.00 28.58  ? 405  HIS B CB  1 
ATOM   7285 C CG  . HIS B 1 404 ? 1.510   -52.249 -11.686 1.00 32.50  ? 405  HIS B CG  1 
ATOM   7286 N ND1 . HIS B 1 404 ? 0.213   -51.785 -11.586 1.00 32.40  ? 405  HIS B ND1 1 
ATOM   7287 C CD2 . HIS B 1 404 ? 2.101   -51.501 -12.655 1.00 34.43  ? 405  HIS B CD2 1 
ATOM   7288 C CE1 . HIS B 1 404 ? 0.031   -50.798 -12.449 1.00 27.13  ? 405  HIS B CE1 1 
ATOM   7289 N NE2 . HIS B 1 404 ? 1.161   -50.606 -13.109 1.00 35.08  ? 405  HIS B NE2 1 
ATOM   7290 N N   . ASN B 1 405 ? 1.904   -55.679 -12.978 1.00 27.56  ? 406  ASN B N   1 
ATOM   7291 C CA  . ASN B 1 405 ? 1.782   -55.926 -14.426 1.00 31.44  ? 406  ASN B CA  1 
ATOM   7292 C C   . ASN B 1 405 ? 1.226   -57.297 -14.799 1.00 27.13  ? 406  ASN B C   1 
ATOM   7293 O O   . ASN B 1 405 ? 0.622   -57.447 -15.850 1.00 30.79  ? 406  ASN B O   1 
ATOM   7294 C CB  . ASN B 1 405 ? 3.137   -55.703 -15.088 1.00 30.85  ? 406  ASN B CB  1 
ATOM   7295 C CG  . ASN B 1 405 ? 3.568   -54.252 -14.998 1.00 33.81  ? 406  ASN B CG  1 
ATOM   7296 O OD1 . ASN B 1 405 ? 3.127   -53.421 -15.782 1.00 35.13  ? 406  ASN B OD1 1 
ATOM   7297 N ND2 . ASN B 1 405 ? 4.420   -53.938 -14.026 1.00 38.84  ? 406  ASN B ND2 1 
ATOM   7298 N N   . VAL B 1 406 ? 1.365   -58.286 -13.922 1.00 30.50  ? 407  VAL B N   1 
ATOM   7299 C CA  . VAL B 1 406 ? 0.951   -59.635 -14.281 1.00 29.28  ? 407  VAL B CA  1 
ATOM   7300 C C   . VAL B 1 406 ? 0.077   -60.329 -13.234 1.00 27.37  ? 407  VAL B C   1 
ATOM   7301 O O   . VAL B 1 406 ? -1.054  -60.702 -13.533 1.00 30.64  ? 407  VAL B O   1 
ATOM   7302 C CB  . VAL B 1 406 ? 2.187   -60.545 -14.565 1.00 30.48  ? 407  VAL B CB  1 
ATOM   7303 C CG1 . VAL B 1 406 ? 1.738   -61.943 -14.961 1.00 30.15  ? 407  VAL B CG1 1 
ATOM   7304 C CG2 . VAL B 1 406 ? 3.040   -59.967 -15.655 1.00 31.12  ? 407  VAL B CG2 1 
ATOM   7305 N N   . VAL B 1 407 ? 0.581   -60.521 -12.014 1.00 34.33  ? 408  VAL B N   1 
ATOM   7306 C CA  . VAL B 1 407 ? -0.143  -61.378 -11.058 1.00 31.85  ? 408  VAL B CA  1 
ATOM   7307 C C   . VAL B 1 407 ? -1.500  -60.784 -10.707 1.00 27.33  ? 408  VAL B C   1 
ATOM   7308 O O   . VAL B 1 407 ? -2.516  -61.472 -10.812 1.00 30.05  ? 408  VAL B O   1 
ATOM   7309 C CB  . VAL B 1 407 ? 0.675   -61.641 -9.766  1.00 33.46  ? 408  VAL B CB  1 
ATOM   7310 C CG1 . VAL B 1 407 ? -0.064  -62.639 -8.839  1.00 27.95  ? 408  VAL B CG1 1 
ATOM   7311 C CG2 . VAL B 1 407 ? 2.045   -62.185 -10.135 1.00 27.13  ? 408  VAL B CG2 1 
ATOM   7312 N N   . CYS B 1 408 ? -1.548  -59.504 -10.350 1.00 28.31  ? 409  CYS B N   1 
ATOM   7313 C CA  . CYS B 1 408 ? -2.817  -58.944 -9.865  1.00 25.55  ? 409  CYS B CA  1 
ATOM   7314 C C   . CYS B 1 408 ? -3.847  -58.769 -10.979 1.00 27.71  ? 409  CYS B C   1 
ATOM   7315 O O   . CYS B 1 408 ? -5.029  -59.040 -10.755 1.00 30.82  ? 409  CYS B O   1 
ATOM   7316 C CB  . CYS B 1 408 ? -2.562  -57.619 -9.099  1.00 30.23  ? 409  CYS B CB  1 
ATOM   7317 S SG  . CYS B 1 408 ? -1.484  -57.917 -7.627  1.00 32.19  ? 409  CYS B SG  1 
ATOM   7318 N N   . PRO B 1 409 ? -3.421  -58.367 -12.199 1.00 33.89  ? 410  PRO B N   1 
ATOM   7319 C CA  . PRO B 1 409 ? -4.422  -58.453 -13.279 1.00 29.90  ? 410  PRO B CA  1 
ATOM   7320 C C   . PRO B 1 409 ? -4.950  -59.859 -13.530 1.00 28.61  ? 410  PRO B C   1 
ATOM   7321 O O   . PRO B 1 409 ? -6.151  -59.989 -13.775 1.00 27.38  ? 410  PRO B O   1 
ATOM   7322 C CB  . PRO B 1 409 ? -3.663  -57.937 -14.516 1.00 29.33  ? 410  PRO B CB  1 
ATOM   7323 C CG  . PRO B 1 409 ? -2.622  -57.038 -13.960 1.00 29.74  ? 410  PRO B CG  1 
ATOM   7324 C CD  . PRO B 1 409 ? -2.198  -57.672 -12.646 1.00 28.63  ? 410  PRO B CD  1 
ATOM   7325 N N   . VAL B 1 410 ? -4.098  -60.883 -13.476 1.00 28.22  ? 411  VAL B N   1 
ATOM   7326 C CA  . VAL B 1 410 ? -4.574  -62.264 -13.635 1.00 24.60  ? 411  VAL B CA  1 
ATOM   7327 C C   . VAL B 1 410 ? -5.499  -62.649 -12.474 1.00 32.60  ? 411  VAL B C   1 
ATOM   7328 O O   . VAL B 1 410 ? -6.581  -63.210 -12.695 1.00 35.43  ? 411  VAL B O   1 
ATOM   7329 C CB  . VAL B 1 410 ? -3.396  -63.273 -13.726 1.00 31.36  ? 411  VAL B CB  1 
ATOM   7330 C CG1 . VAL B 1 410 ? -3.903  -64.735 -13.649 1.00 24.94  ? 411  VAL B CG1 1 
ATOM   7331 C CG2 . VAL B 1 410 ? -2.617  -63.048 -15.038 1.00 27.30  ? 411  VAL B CG2 1 
ATOM   7332 N N   . ALA B 1 411 ? -5.100  -62.323 -11.238 1.00 29.77  ? 412  ALA B N   1 
ATOM   7333 C CA  . ALA B 1 411 ? -5.925  -62.679 -10.064 1.00 29.94  ? 412  ALA B CA  1 
ATOM   7334 C C   . ALA B 1 411 ? -7.300  -62.039 -10.184 1.00 32.55  ? 412  ALA B C   1 
ATOM   7335 O O   . ALA B 1 411 ? -8.331  -62.677 -9.931  1.00 32.01  ? 412  ALA B O   1 
ATOM   7336 C CB  . ALA B 1 411 ? -5.238  -62.241 -8.728  1.00 27.06  ? 412  ALA B CB  1 
ATOM   7337 N N   . GLN B 1 412 ? -7.318  -60.777 -10.595 1.00 27.13  ? 413  GLN B N   1 
ATOM   7338 C CA  . GLN B 1 412 ? -8.584  -60.094 -10.745 1.00 28.91  ? 413  GLN B CA  1 
ATOM   7339 C C   . GLN B 1 412 ? -9.461  -60.717 -11.841 1.00 41.07  ? 413  GLN B C   1 
ATOM   7340 O O   . GLN B 1 412 ? -10.661 -60.928 -11.631 1.00 34.80  ? 413  GLN B O   1 
ATOM   7341 C CB  . GLN B 1 412 ? -8.348  -58.619 -11.038 1.00 30.93  ? 413  GLN B CB  1 
ATOM   7342 C CG  . GLN B 1 412 ? -9.571  -57.940 -11.593 1.00 36.78  ? 413  GLN B CG  1 
ATOM   7343 C CD  . GLN B 1 412 ? -9.910  -56.692 -10.840 1.00 61.46  ? 413  GLN B CD  1 
ATOM   7344 O OE1 . GLN B 1 412 ? -9.613  -55.584 -11.299 1.00 62.93  ? 413  GLN B OE1 1 
ATOM   7345 N NE2 . GLN B 1 412 ? -10.529 -56.854 -9.658  1.00 55.75  ? 413  GLN B NE2 1 
ATOM   7346 N N   . LEU B 1 413 ? -8.865  -61.005 -13.002 1.00 36.05  ? 414  LEU B N   1 
ATOM   7347 C CA  . LEU B 1 413 ? -9.566  -61.719 -14.076 1.00 32.76  ? 414  LEU B CA  1 
ATOM   7348 C C   . LEU B 1 413 ? -10.123 -63.032 -13.564 1.00 27.73  ? 414  LEU B C   1 
ATOM   7349 O O   . LEU B 1 413 ? -11.279 -63.350 -13.773 1.00 33.33  ? 414  LEU B O   1 
ATOM   7350 C CB  . LEU B 1 413 ? -8.626  -62.001 -15.262 1.00 29.99  ? 414  LEU B CB  1 
ATOM   7351 C CG  . LEU B 1 413 ? -9.287  -62.814 -16.383 1.00 33.64  ? 414  LEU B CG  1 
ATOM   7352 C CD1 . LEU B 1 413 ? -10.503 -62.053 -16.852 1.00 46.89  ? 414  LEU B CD1 1 
ATOM   7353 C CD2 . LEU B 1 413 ? -8.351  -62.942 -17.533 1.00 35.03  ? 414  LEU B CD2 1 
ATOM   7354 N N   . ALA B 1 414 ? -9.287  -63.777 -12.856 1.00 31.09  ? 415  ALA B N   1 
ATOM   7355 C CA  . ALA B 1 414 ? -9.665  -65.088 -12.350 1.00 30.31  ? 415  ALA B CA  1 
ATOM   7356 C C   . ALA B 1 414 ? -10.838 -65.033 -11.368 1.00 36.39  ? 415  ALA B C   1 
ATOM   7357 O O   . ALA B 1 414 ? -11.781 -65.830 -11.457 1.00 35.93  ? 415  ALA B O   1 
ATOM   7358 C CB  . ALA B 1 414 ? -8.464  -65.743 -11.687 1.00 27.28  ? 415  ALA B CB  1 
ATOM   7359 N N   . GLY B 1 415 ? -10.782 -64.094 -10.431 1.00 36.76  ? 416  GLY B N   1 
ATOM   7360 C CA  . GLY B 1 415 ? -11.820 -63.987 -9.416  1.00 36.10  ? 416  GLY B CA  1 
ATOM   7361 C C   . GLY B 1 415 ? -13.148 -63.567 -9.999  1.00 36.22  ? 416  GLY B C   1 
ATOM   7362 O O   . GLY B 1 415 ? -14.187 -64.149 -9.691  1.00 40.63  ? 416  GLY B O   1 
ATOM   7363 N N   . ARG B 1 416 ? -13.122 -62.574 -10.877 1.00 35.45  ? 417  ARG B N   1 
ATOM   7364 C CA  . ARG B 1 416 ? -14.351 -62.113 -11.510 1.00 34.85  ? 417  ARG B CA  1 
ATOM   7365 C C   . ARG B 1 416 ? -14.976 -63.166 -12.433 1.00 43.63  ? 417  ARG B C   1 
ATOM   7366 O O   . ARG B 1 416 ? -16.192 -63.331 -12.441 1.00 46.44  ? 417  ARG B O   1 
ATOM   7367 C CB  . ARG B 1 416 ? -14.092 -60.831 -12.291 1.00 35.87  ? 417  ARG B CB  1 
ATOM   7368 C CG  . ARG B 1 416 ? -13.900 -59.642 -11.416 1.00 47.60  ? 417  ARG B CG  1 
ATOM   7369 C CD  . ARG B 1 416 ? -15.135 -59.479 -10.550 1.00 48.93  ? 417  ARG B CD  1 
ATOM   7370 N NE  . ARG B 1 416 ? -15.224 -58.152 -9.969  1.00 58.95  ? 417  ARG B NE  1 
ATOM   7371 C CZ  . ARG B 1 416 ? -16.270 -57.343 -10.097 1.00 56.02  ? 417  ARG B CZ  1 
ATOM   7372 N NH1 . ARG B 1 416 ? -17.345 -57.722 -10.788 1.00 53.18  ? 417  ARG B NH1 1 
ATOM   7373 N NH2 . ARG B 1 416 ? -16.241 -56.155 -9.517  1.00 59.27  ? 417  ARG B NH2 1 
ATOM   7374 N N   . LEU B 1 417 ? -14.160 -63.881 -13.206 1.00 42.61  ? 418  LEU B N   1 
ATOM   7375 C CA  . LEU B 1 417 ? -14.711 -64.900 -14.103 1.00 44.95  ? 418  LEU B CA  1 
ATOM   7376 C C   . LEU B 1 417 ? -15.372 -66.001 -13.281 1.00 41.74  ? 418  LEU B C   1 
ATOM   7377 O O   . LEU B 1 417 ? -16.491 -66.408 -13.556 1.00 44.55  ? 418  LEU B O   1 
ATOM   7378 C CB  . LEU B 1 417 ? -13.632 -65.512 -15.008 1.00 38.21  ? 418  LEU B CB  1 
ATOM   7379 C CG  . LEU B 1 417 ? -12.997 -64.702 -16.143 1.00 46.05  ? 418  LEU B CG  1 
ATOM   7380 C CD1 . LEU B 1 417 ? -12.204 -65.618 -17.012 1.00 39.24  ? 418  LEU B CD1 1 
ATOM   7381 C CD2 . LEU B 1 417 ? -14.007 -63.985 -16.974 1.00 43.46  ? 418  LEU B CD2 1 
ATOM   7382 N N   . ALA B 1 418 ? -14.644 -66.503 -12.295 1.00 36.75  ? 419  ALA B N   1 
ATOM   7383 C CA  . ALA B 1 418 ? -15.175 -67.504 -11.386 1.00 44.84  ? 419  ALA B CA  1 
ATOM   7384 C C   . ALA B 1 418 ? -16.509 -67.056 -10.775 1.00 46.33  ? 419  ALA B C   1 
ATOM   7385 O O   . ALA B 1 418 ? -17.480 -67.809 -10.778 1.00 46.45  ? 419  ALA B O   1 
ATOM   7386 C CB  . ALA B 1 418 ? -14.159 -67.808 -10.285 1.00 36.99  ? 419  ALA B CB  1 
ATOM   7387 N N   . ALA B 1 419 ? -16.560 -65.824 -10.279 1.00 41.51  ? 420  ALA B N   1 
ATOM   7388 C CA  . ALA B 1 419 ? -17.744 -65.341 -9.563  1.00 45.10  ? 420  ALA B CA  1 
ATOM   7389 C C   . ALA B 1 419 ? -18.893 -65.126 -10.512 1.00 49.67  ? 420  ALA B C   1 
ATOM   7390 O O   . ALA B 1 419 ? -20.054 -65.127 -10.114 1.00 53.65  ? 420  ALA B O   1 
ATOM   7391 C CB  . ALA B 1 419 ? -17.444 -64.053 -8.818  1.00 41.07  ? 420  ALA B CB  1 
ATOM   7392 N N   . GLN B 1 420 ? -18.575 -64.945 -11.785 1.00 53.43  ? 421  GLN B N   1 
ATOM   7393 C CA  . GLN B 1 420 ? -19.615 -64.648 -12.745 1.00 39.54  ? 421  GLN B CA  1 
ATOM   7394 C C   . GLN B 1 420 ? -19.873 -65.767 -13.727 1.00 42.73  ? 421  GLN B C   1 
ATOM   7395 O O   . GLN B 1 420 ? -20.354 -65.532 -14.838 1.00 43.35  ? 421  GLN B O   1 
ATOM   7396 C CB  . GLN B 1 420 ? -19.279 -63.358 -13.459 1.00 45.52  ? 421  GLN B CB  1 
ATOM   7397 C CG  . GLN B 1 420 ? -19.422 -62.202 -12.500 1.00 50.96  ? 421  GLN B CG  1 
ATOM   7398 C CD  . GLN B 1 420 ? -18.491 -61.065 -12.819 1.00 54.65  ? 421  GLN B CD  1 
ATOM   7399 O OE1 . GLN B 1 420 ? -17.854 -60.501 -11.928 1.00 55.05  ? 421  GLN B OE1 1 
ATOM   7400 N NE2 . GLN B 1 420 ? -18.404 -60.718 -14.095 1.00 45.85  ? 421  GLN B NE2 1 
ATOM   7401 N N   . GLY B 1 421 ? -19.583 -66.994 -13.308 1.00 44.13  ? 422  GLY B N   1 
ATOM   7402 C CA  . GLY B 1 421 ? -20.103 -68.146 -14.021 1.00 43.42  ? 422  GLY B CA  1 
ATOM   7403 C C   . GLY B 1 421 ? -19.116 -69.102 -14.647 1.00 48.94  ? 422  GLY B C   1 
ATOM   7404 O O   . GLY B 1 421 ? -19.491 -70.208 -15.020 1.00 51.13  ? 422  GLY B O   1 
ATOM   7405 N N   . ALA B 1 422 ? -17.858 -68.696 -14.775 1.00 41.56  ? 423  ALA B N   1 
ATOM   7406 C CA  . ALA B 1 422 ? -16.877 -69.543 -15.453 1.00 45.17  ? 423  ALA B CA  1 
ATOM   7407 C C   . ALA B 1 422 ? -16.285 -70.589 -14.513 1.00 38.79  ? 423  ALA B C   1 
ATOM   7408 O O   . ALA B 1 422 ? -16.176 -70.345 -13.309 1.00 46.16  ? 423  ALA B O   1 
ATOM   7409 C CB  . ALA B 1 422 ? -15.763 -68.680 -16.053 1.00 42.39  ? 423  ALA B CB  1 
ATOM   7410 N N   . ARG B 1 423 ? -15.905 -71.748 -15.051 1.00 40.92  ? 424  ARG B N   1 
ATOM   7411 C CA  . ARG B 1 423 ? -15.024 -72.658 -14.315 1.00 42.30  ? 424  ARG B CA  1 
ATOM   7412 C C   . ARG B 1 423 ? -13.561 -72.258 -14.565 1.00 46.69  ? 424  ARG B C   1 
ATOM   7413 O O   . ARG B 1 423 ? -13.098 -72.195 -15.710 1.00 35.46  ? 424  ARG B O   1 
ATOM   7414 C CB  . ARG B 1 423 ? -15.247 -74.125 -14.713 1.00 43.66  ? 424  ARG B CB  1 
ATOM   7415 C CG  . ARG B 1 423 ? -14.589 -75.136 -13.727 1.00 53.85  ? 424  ARG B CG  1 
ATOM   7416 C CD  . ARG B 1 423 ? -15.211 -76.558 -13.777 1.00 72.98  ? 424  ARG B CD  1 
ATOM   7417 N NE  . ARG B 1 423 ? -14.862 -77.309 -14.997 1.00 72.79  ? 424  ARG B NE  1 
ATOM   7418 C CZ  . ARG B 1 423 ? -15.745 -77.936 -15.781 1.00 77.55  ? 424  ARG B CZ  1 
ATOM   7419 N NH1 . ARG B 1 423 ? -17.042 -77.908 -15.478 1.00 80.43  ? 424  ARG B NH1 1 
ATOM   7420 N NH2 . ARG B 1 423 ? -15.341 -78.596 -16.870 1.00 65.79  ? 424  ARG B NH2 1 
ATOM   7421 N N   . VAL B 1 424 ? -12.834 -71.994 -13.484 1.00 40.05  ? 425  VAL B N   1 
ATOM   7422 C CA  . VAL B 1 424 ? -11.495 -71.441 -13.591 1.00 32.74  ? 425  VAL B CA  1 
ATOM   7423 C C   . VAL B 1 424 ? -10.491 -72.342 -12.892 1.00 39.04  ? 425  VAL B C   1 
ATOM   7424 O O   . VAL B 1 424 ? -10.759 -72.852 -11.821 1.00 39.46  ? 425  VAL B O   1 
ATOM   7425 C CB  . VAL B 1 424 ? -11.435 -70.006 -12.978 1.00 40.28  ? 425  VAL B CB  1 
ATOM   7426 C CG1 . VAL B 1 424 ? -10.054 -69.412 -13.128 1.00 27.92  ? 425  VAL B CG1 1 
ATOM   7427 C CG2 . VAL B 1 424 ? -12.485 -69.105 -13.622 1.00 30.70  ? 425  VAL B CG2 1 
ATOM   7428 N N   . TYR B 1 425 ? -9.333  -72.543 -13.505 1.00 31.88  ? 426  TYR B N   1 
ATOM   7429 C CA  . TYR B 1 425 ? -8.254  -73.277 -12.868 1.00 34.79  ? 426  TYR B CA  1 
ATOM   7430 C C   . TYR B 1 425 ? -7.041  -72.367 -12.825 1.00 33.82  ? 426  TYR B C   1 
ATOM   7431 O O   . TYR B 1 425 ? -6.778  -71.652 -13.791 1.00 33.53  ? 426  TYR B O   1 
ATOM   7432 C CB  . TYR B 1 425 ? -7.958  -74.577 -13.625 1.00 29.79  ? 426  TYR B CB  1 
ATOM   7433 C CG  . TYR B 1 425 ? -9.089  -75.579 -13.532 1.00 41.05  ? 426  TYR B CG  1 
ATOM   7434 C CD1 . TYR B 1 425 ? -9.138  -76.503 -12.483 1.00 35.70  ? 426  TYR B CD1 1 
ATOM   7435 C CD2 . TYR B 1 425 ? -10.108 -75.604 -14.486 1.00 40.68  ? 426  TYR B CD2 1 
ATOM   7436 C CE1 . TYR B 1 425 ? -10.168 -77.425 -12.388 1.00 38.80  ? 426  TYR B CE1 1 
ATOM   7437 C CE2 . TYR B 1 425 ? -11.142 -76.521 -14.402 1.00 43.39  ? 426  TYR B CE2 1 
ATOM   7438 C CZ  . TYR B 1 425 ? -11.170 -77.428 -13.344 1.00 43.65  ? 426  TYR B CZ  1 
ATOM   7439 O OH  . TYR B 1 425 ? -12.201 -78.333 -13.250 1.00 45.45  ? 426  TYR B OH  1 
ATOM   7440 N N   . ALA B 1 426 ? -6.302  -72.361 -11.717 1.00 32.03  ? 427  ALA B N   1 
ATOM   7441 C CA  . ALA B 1 426 ? -5.184  -71.448 -11.612 1.00 30.75  ? 427  ALA B CA  1 
ATOM   7442 C C   . ALA B 1 426 ? -3.926  -72.160 -11.167 1.00 33.17  ? 427  ALA B C   1 
ATOM   7443 O O   . ALA B 1 426 ? -4.006  -73.094 -10.383 1.00 34.39  ? 427  ALA B O   1 
ATOM   7444 C CB  . ALA B 1 426 ? -5.537  -70.316 -10.657 1.00 31.84  ? 427  ALA B CB  1 
ATOM   7445 N N   . TYR B 1 427 ? -2.766  -71.712 -11.642 1.00 29.63  ? 428  TYR B N   1 
ATOM   7446 C CA  . TYR B 1 427 ? -1.499  -72.352 -11.276 1.00 31.20  ? 428  TYR B CA  1 
ATOM   7447 C C   . TYR B 1 427 ? -0.454  -71.297 -10.977 1.00 32.92  ? 428  TYR B C   1 
ATOM   7448 O O   . TYR B 1 427 ? -0.609  -70.157 -11.382 1.00 29.11  ? 428  TYR B O   1 
ATOM   7449 C CB  . TYR B 1 427 ? -0.968  -73.275 -12.404 1.00 33.23  ? 428  TYR B CB  1 
ATOM   7450 C CG  . TYR B 1 427 ? -0.583  -72.498 -13.662 1.00 33.76  ? 428  TYR B CG  1 
ATOM   7451 C CD1 . TYR B 1 427 ? 0.656   -71.882 -13.766 1.00 29.50  ? 428  TYR B CD1 1 
ATOM   7452 C CD2 . TYR B 1 427 ? -1.472  -72.361 -14.726 1.00 27.28  ? 428  TYR B CD2 1 
ATOM   7453 C CE1 . TYR B 1 427 ? 1.011   -71.155 -14.890 1.00 30.03  ? 428  TYR B CE1 1 
ATOM   7454 C CE2 . TYR B 1 427 ? -1.115  -71.619 -15.884 1.00 26.40  ? 428  TYR B CE2 1 
ATOM   7455 C CZ  . TYR B 1 427 ? 0.135   -71.017 -15.935 1.00 31.04  ? 428  TYR B CZ  1 
ATOM   7456 O OH  . TYR B 1 427 ? 0.538   -70.261 -17.019 1.00 31.57  ? 428  TYR B OH  1 
ATOM   7457 N N   . VAL B 1 428 ? 0.620   -71.704 -10.300 1.00 28.32  ? 429  VAL B N   1 
ATOM   7458 C CA  . VAL B 1 428 ? 1.848   -70.932 -10.250 1.00 32.19  ? 429  VAL B CA  1 
ATOM   7459 C C   . VAL B 1 428 ? 2.952   -71.878 -10.691 1.00 35.56  ? 429  VAL B C   1 
ATOM   7460 O O   . VAL B 1 428 ? 3.064   -72.988 -10.169 1.00 31.77  ? 429  VAL B O   1 
ATOM   7461 C CB  . VAL B 1 428 ? 2.136   -70.357 -8.831  1.00 32.04  ? 429  VAL B CB  1 
ATOM   7462 C CG1 . VAL B 1 428 ? 3.485   -69.645 -8.801  1.00 28.91  ? 429  VAL B CG1 1 
ATOM   7463 C CG2 . VAL B 1 428 ? 1.039   -69.376 -8.441  1.00 34.61  ? 429  VAL B CG2 1 
ATOM   7464 N N   . PHE B 1 429 ? 3.741   -71.450 -11.671 1.00 35.26  ? 430  PHE B N   1 
ATOM   7465 C CA  . PHE B 1 429 ? 4.813   -72.260 -12.218 1.00 30.84  ? 430  PHE B CA  1 
ATOM   7466 C C   . PHE B 1 429 ? 6.082   -72.016 -11.442 1.00 32.80  ? 430  PHE B C   1 
ATOM   7467 O O   . PHE B 1 429 ? 6.634   -70.907 -11.480 1.00 33.23  ? 430  PHE B O   1 
ATOM   7468 C CB  . PHE B 1 429 ? 5.028   -71.933 -13.699 1.00 31.60  ? 430  PHE B CB  1 
ATOM   7469 C CG  . PHE B 1 429 ? 6.030   -72.808 -14.360 1.00 32.25  ? 430  PHE B CG  1 
ATOM   7470 C CD1 . PHE B 1 429 ? 5.659   -74.048 -14.870 1.00 26.89  ? 430  PHE B CD1 1 
ATOM   7471 C CD2 . PHE B 1 429 ? 7.356   -72.412 -14.463 1.00 30.46  ? 430  PHE B CD2 1 
ATOM   7472 C CE1 . PHE B 1 429 ? 6.599   -74.870 -15.492 1.00 31.46  ? 430  PHE B CE1 1 
ATOM   7473 C CE2 . PHE B 1 429 ? 8.297   -73.228 -15.084 1.00 34.07  ? 430  PHE B CE2 1 
ATOM   7474 C CZ  . PHE B 1 429 ? 7.924   -74.457 -15.589 1.00 27.60  ? 430  PHE B CZ  1 
ATOM   7475 N N   . GLU B 1 430 ? 6.583   -73.049 -10.775 1.00 29.53  ? 431  GLU B N   1 
ATOM   7476 C CA  . GLU B 1 430 ? 7.659   -72.831 -9.815  1.00 36.07  ? 431  GLU B CA  1 
ATOM   7477 C C   . GLU B 1 430 ? 8.948   -73.559 -10.102 1.00 41.30  ? 431  GLU B C   1 
ATOM   7478 O O   . GLU B 1 430 ? 9.801   -73.629 -9.228  1.00 36.47  ? 431  GLU B O   1 
ATOM   7479 C CB  . GLU B 1 430 ? 7.184   -73.214 -8.403  1.00 31.93  ? 431  GLU B CB  1 
ATOM   7480 C CG  . GLU B 1 430 ? 6.021   -72.375 -7.967  1.00 36.43  ? 431  GLU B CG  1 
ATOM   7481 C CD  . GLU B 1 430 ? 5.682   -72.495 -6.479  1.00 45.05  ? 431  GLU B CD  1 
ATOM   7482 O OE1 . GLU B 1 430 ? 5.978   -73.528 -5.838  1.00 51.03  ? 431  GLU B OE1 1 
ATOM   7483 O OE2 . GLU B 1 430 ? 5.106   -71.528 -5.953  1.00 55.52  ? 431  GLU B OE2 1 
ATOM   7484 N N   . HIS B 1 431 ? 9.119   -74.086 -11.311 1.00 41.84  ? 432  HIS B N   1 
ATOM   7485 C CA  . HIS B 1 431 ? 10.342  -74.830 -11.597 1.00 39.76  ? 432  HIS B CA  1 
ATOM   7486 C C   . HIS B 1 431 ? 11.359  -73.996 -12.336 1.00 40.97  ? 432  HIS B C   1 
ATOM   7487 O O   . HIS B 1 431 ? 11.066  -73.410 -13.375 1.00 45.47  ? 432  HIS B O   1 
ATOM   7488 C CB  . HIS B 1 431 ? 10.049  -76.103 -12.411 1.00 37.78  ? 432  HIS B CB  1 
ATOM   7489 C CG  . HIS B 1 431 ? 11.289  -76.837 -12.826 1.00 46.69  ? 432  HIS B CG  1 
ATOM   7490 N ND1 . HIS B 1 431 ? 12.022  -77.615 -11.954 1.00 44.58  ? 432  HIS B ND1 1 
ATOM   7491 C CD2 . HIS B 1 431 ? 11.941  -76.887 -14.014 1.00 42.30  ? 432  HIS B CD2 1 
ATOM   7492 C CE1 . HIS B 1 431 ? 13.064  -78.122 -12.589 1.00 45.59  ? 432  HIS B CE1 1 
ATOM   7493 N NE2 . HIS B 1 431 ? 13.035  -77.701 -13.841 1.00 41.95  ? 432  HIS B NE2 1 
ATOM   7494 N N   . ARG B 1 432 ? 12.572  -73.957 -11.812 1.00 39.92  ? 433  ARG B N   1 
ATOM   7495 C CA  . ARG B 1 432 ? 13.646  -73.285 -12.523 1.00 41.09  ? 433  ARG B CA  1 
ATOM   7496 C C   . ARG B 1 432 ? 14.376  -74.291 -13.402 1.00 48.59  ? 433  ARG B C   1 
ATOM   7497 O O   . ARG B 1 432 ? 14.975  -75.241 -12.896 1.00 48.44  ? 433  ARG B O   1 
ATOM   7498 C CB  . ARG B 1 432 ? 14.617  -72.614 -11.548 1.00 44.31  ? 433  ARG B CB  1 
ATOM   7499 C CG  . ARG B 1 432 ? 15.713  -71.833 -12.234 1.00 44.30  ? 433  ARG B CG  1 
ATOM   7500 C CD  . ARG B 1 432 ? 16.618  -71.136 -11.233 1.00 42.54  ? 433  ARG B CD  1 
ATOM   7501 N NE  . ARG B 1 432 ? 17.849  -70.721 -11.899 1.00 50.97  ? 433  ARG B NE  1 
ATOM   7502 C CZ  . ARG B 1 432 ? 18.072  -69.499 -12.368 1.00 54.17  ? 433  ARG B CZ  1 
ATOM   7503 N NH1 . ARG B 1 432 ? 17.146  -68.553 -12.229 1.00 50.51  ? 433  ARG B NH1 1 
ATOM   7504 N NH2 . ARG B 1 432 ? 19.229  -69.219 -12.966 1.00 47.53  ? 433  ARG B NH2 1 
ATOM   7505 N N   . ALA B 1 433 ? 14.304  -74.085 -14.717 1.00 47.96  ? 434  ALA B N   1 
ATOM   7506 C CA  . ALA B 1 433 ? 14.938  -74.971 -15.686 1.00 45.78  ? 434  ALA B CA  1 
ATOM   7507 C C   . ALA B 1 433 ? 16.421  -75.188 -15.375 1.00 50.39  ? 434  ALA B C   1 
ATOM   7508 O O   . ALA B 1 433 ? 17.143  -74.236 -15.089 1.00 46.41  ? 434  ALA B O   1 
ATOM   7509 C CB  . ALA B 1 433 ? 14.767  -74.410 -17.100 1.00 39.52  ? 434  ALA B CB  1 
ATOM   7510 N N   . SER B 1 434 ? 16.861  -76.446 -15.417 1.00 48.05  ? 435  SER B N   1 
ATOM   7511 C CA  . SER B 1 434 ? 18.277  -76.793 -15.264 1.00 43.50  ? 435  SER B CA  1 
ATOM   7512 C C   . SER B 1 434 ? 19.114  -76.109 -16.339 1.00 45.19  ? 435  SER B C   1 
ATOM   7513 O O   . SER B 1 434 ? 20.308  -75.880 -16.163 1.00 44.94  ? 435  SER B O   1 
ATOM   7514 C CB  . SER B 1 434 ? 18.477  -78.310 -15.344 1.00 49.14  ? 435  SER B CB  1 
ATOM   7515 O OG  . SER B 1 434 ? 18.259  -78.784 -16.670 1.00 47.83  ? 435  SER B OG  1 
ATOM   7516 N N   . THR B 1 435 ? 18.460  -75.756 -17.439 1.00 38.79  ? 436  THR B N   1 
ATOM   7517 C CA  . THR B 1 435 ? 19.109  -75.128 -18.583 1.00 45.40  ? 436  THR B CA  1 
ATOM   7518 C C   . THR B 1 435 ? 19.061  -73.601 -18.571 1.00 48.92  ? 436  THR B C   1 
ATOM   7519 O O   . THR B 1 435 ? 19.609  -72.952 -19.467 1.00 42.70  ? 436  THR B O   1 
ATOM   7520 C CB  . THR B 1 435 ? 18.449  -75.590 -19.870 1.00 50.17  ? 436  THR B CB  1 
ATOM   7521 O OG1 . THR B 1 435 ? 17.043  -75.366 -19.739 1.00 46.24  ? 436  THR B OG1 1 
ATOM   7522 C CG2 . THR B 1 435 ? 18.688  -77.089 -20.092 1.00 48.04  ? 436  THR B CG2 1 
ATOM   7523 N N   . LEU B 1 436 ? 18.392  -73.026 -17.575 1.00 43.27  ? 437  LEU B N   1 
ATOM   7524 C CA  . LEU B 1 436 ? 18.176  -71.575 -17.535 1.00 48.51  ? 437  LEU B CA  1 
ATOM   7525 C C   . LEU B 1 436 ? 19.488  -70.793 -17.517 1.00 50.49  ? 437  LEU B C   1 
ATOM   7526 O O   . LEU B 1 436 ? 20.358  -71.053 -16.685 1.00 52.16  ? 437  LEU B O   1 
ATOM   7527 C CB  . LEU B 1 436 ? 17.333  -71.185 -16.311 1.00 53.71  ? 437  LEU B CB  1 
ATOM   7528 C CG  . LEU B 1 436 ? 16.599  -69.850 -16.431 1.00 55.59  ? 437  LEU B CG  1 
ATOM   7529 C CD1 . LEU B 1 436 ? 15.642  -69.897 -17.605 1.00 43.89  ? 437  LEU B CD1 1 
ATOM   7530 C CD2 . LEU B 1 436 ? 15.844  -69.554 -15.158 1.00 55.16  ? 437  LEU B CD2 1 
ATOM   7531 N N   . SER B 1 437 ? 19.605  -69.825 -18.428 1.00 53.07  ? 438  SER B N   1 
ATOM   7532 C CA  . SER B 1 437 ? 20.817  -69.023 -18.573 1.00 54.12  ? 438  SER B CA  1 
ATOM   7533 C C   . SER B 1 437 ? 20.795  -67.678 -17.807 1.00 58.03  ? 438  SER B C   1 
ATOM   7534 O O   . SER B 1 437 ? 21.829  -67.003 -17.726 1.00 57.16  ? 438  SER B O   1 
ATOM   7535 C CB  . SER B 1 437 ? 21.082  -68.758 -20.065 1.00 56.10  ? 438  SER B CB  1 
ATOM   7536 O OG  . SER B 1 437 ? 20.019  -68.016 -20.660 1.00 62.96  ? 438  SER B OG  1 
ATOM   7537 N N   . TRP B 1 438 ? 19.635  -67.277 -17.272 1.00 56.07  ? 439  TRP B N   1 
ATOM   7538 C CA  . TRP B 1 438 ? 19.556  -66.092 -16.393 1.00 55.74  ? 439  TRP B CA  1 
ATOM   7539 C C   . TRP B 1 438 ? 20.117  -66.448 -15.028 1.00 49.34  ? 439  TRP B C   1 
ATOM   7540 O O   . TRP B 1 438 ? 20.117  -67.620 -14.647 1.00 53.03  ? 439  TRP B O   1 
ATOM   7541 C CB  . TRP B 1 438 ? 18.118  -65.572 -16.245 1.00 46.09  ? 439  TRP B CB  1 
ATOM   7542 C CG  . TRP B 1 438 ? 17.515  -65.135 -17.525 1.00 49.39  ? 439  TRP B CG  1 
ATOM   7543 C CD1 . TRP B 1 438 ? 16.687  -65.867 -18.321 1.00 47.81  ? 439  TRP B CD1 1 
ATOM   7544 C CD2 . TRP B 1 438 ? 17.682  -63.863 -18.179 1.00 45.97  ? 439  TRP B CD2 1 
ATOM   7545 N NE1 . TRP B 1 438 ? 16.334  -65.142 -19.435 1.00 50.81  ? 439  TRP B NE1 1 
ATOM   7546 C CE2 . TRP B 1 438 ? 16.928  -63.909 -19.374 1.00 44.08  ? 439  TRP B CE2 1 
ATOM   7547 C CE3 . TRP B 1 438 ? 18.398  -62.698 -17.876 1.00 39.87  ? 439  TRP B CE3 1 
ATOM   7548 C CZ2 . TRP B 1 438 ? 16.869  -62.833 -20.272 1.00 44.31  ? 439  TRP B CZ2 1 
ATOM   7549 C CZ3 . TRP B 1 438 ? 18.342  -61.630 -18.759 1.00 38.86  ? 439  TRP B CZ3 1 
ATOM   7550 C CH2 . TRP B 1 438 ? 17.577  -61.702 -19.946 1.00 51.84  ? 439  TRP B CH2 1 
ATOM   7551 N N   . PRO B 1 439 ? 20.609  -65.443 -14.285 1.00 50.38  ? 440  PRO B N   1 
ATOM   7552 C CA  . PRO B 1 439 ? 21.187  -65.717 -12.963 1.00 47.74  ? 440  PRO B CA  1 
ATOM   7553 C C   . PRO B 1 439 ? 20.165  -66.228 -11.957 1.00 53.25  ? 440  PRO B C   1 
ATOM   7554 O O   . PRO B 1 439 ? 18.949  -66.145 -12.154 1.00 53.35  ? 440  PRO B O   1 
ATOM   7555 C CB  . PRO B 1 439 ? 21.738  -64.353 -12.528 1.00 47.42  ? 440  PRO B CB  1 
ATOM   7556 C CG  . PRO B 1 439 ? 20.966  -63.371 -13.315 1.00 53.54  ? 440  PRO B CG  1 
ATOM   7557 C CD  . PRO B 1 439 ? 20.746  -64.023 -14.650 1.00 49.62  ? 440  PRO B CD  1 
ATOM   7558 N N   . LEU B 1 440 ? 20.682  -66.740 -10.856 1.00 44.90  ? 441  LEU B N   1 
ATOM   7559 C CA  . LEU B 1 440 ? 19.872  -67.463 -9.897  1.00 50.73  ? 441  LEU B CA  1 
ATOM   7560 C C   . LEU B 1 440 ? 18.923  -66.539 -9.127  1.00 52.53  ? 441  LEU B C   1 
ATOM   7561 O O   . LEU B 1 440 ? 17.869  -66.980 -8.666  1.00 54.85  ? 441  LEU B O   1 
ATOM   7562 C CB  . LEU B 1 440 ? 20.796  -68.234 -8.938  1.00 50.54  ? 441  LEU B CB  1 
ATOM   7563 C CG  . LEU B 1 440 ? 20.237  -69.208 -7.894  1.00 64.79  ? 441  LEU B CG  1 
ATOM   7564 C CD1 . LEU B 1 440 ? 19.353  -70.272 -8.525  1.00 61.26  ? 441  LEU B CD1 1 
ATOM   7565 C CD2 . LEU B 1 440 ? 21.387  -69.864 -7.143  1.00 65.04  ? 441  LEU B CD2 1 
ATOM   7566 N N   . TRP B 1 441 ? 19.278  -65.263 -8.992  1.00 50.14  ? 442  TRP B N   1 
ATOM   7567 C CA  . TRP B 1 441 ? 18.445  -64.365 -8.186  1.00 51.28  ? 442  TRP B CA  1 
ATOM   7568 C C   . TRP B 1 441 ? 17.121  -64.081 -8.903  1.00 48.96  ? 442  TRP B C   1 
ATOM   7569 O O   . TRP B 1 441 ? 16.123  -63.773 -8.243  1.00 44.93  ? 442  TRP B O   1 
ATOM   7570 C CB  . TRP B 1 441 ? 19.177  -63.045 -7.837  1.00 45.72  ? 442  TRP B CB  1 
ATOM   7571 C CG  . TRP B 1 441 ? 19.500  -62.137 -8.999  1.00 47.12  ? 442  TRP B CG  1 
ATOM   7572 C CD1 . TRP B 1 441 ? 20.690  -62.044 -9.653  1.00 46.72  ? 442  TRP B CD1 1 
ATOM   7573 C CD2 . TRP B 1 441 ? 18.621  -61.189 -9.628  1.00 47.23  ? 442  TRP B CD2 1 
ATOM   7574 N NE1 . TRP B 1 441 ? 20.610  -61.110 -10.660 1.00 51.51  ? 442  TRP B NE1 1 
ATOM   7575 C CE2 . TRP B 1 441 ? 19.350  -60.572 -10.669 1.00 47.38  ? 442  TRP B CE2 1 
ATOM   7576 C CE3 . TRP B 1 441 ? 17.285  -60.810 -9.419  1.00 50.68  ? 442  TRP B CE3 1 
ATOM   7577 C CZ2 . TRP B 1 441 ? 18.793  -59.596 -11.499 1.00 48.09  ? 442  TRP B CZ2 1 
ATOM   7578 C CZ3 . TRP B 1 441 ? 16.730  -59.838 -10.249 1.00 42.79  ? 442  TRP B CZ3 1 
ATOM   7579 C CH2 . TRP B 1 441 ? 17.484  -59.247 -11.277 1.00 50.05  ? 442  TRP B CH2 1 
ATOM   7580 N N   . MET B 1 442 ? 17.102  -64.201 -10.236 1.00 42.79  ? 443  MET B N   1 
ATOM   7581 C CA  . MET B 1 442 ? 15.863  -63.978 -10.987 1.00 41.55  ? 443  MET B CA  1 
ATOM   7582 C C   . MET B 1 442 ? 14.812  -65.062 -10.731 1.00 41.88  ? 443  MET B C   1 
ATOM   7583 O O   . MET B 1 442 ? 13.643  -64.869 -11.044 1.00 45.01  ? 443  MET B O   1 
ATOM   7584 C CB  . MET B 1 442 ? 16.137  -63.876 -12.480 1.00 43.95  ? 443  MET B CB  1 
ATOM   7585 C CG  . MET B 1 442 ? 16.922  -62.639 -12.846 1.00 42.62  ? 443  MET B CG  1 
ATOM   7586 S SD  . MET B 1 442 ? 16.935  -62.356 -14.623 1.00 49.23  ? 443  MET B SD  1 
ATOM   7587 C CE  . MET B 1 442 ? 18.375  -61.334 -14.710 1.00 62.95  ? 443  MET B CE  1 
ATOM   7588 N N   . GLY B 1 443 ? 15.211  -66.180 -10.130 1.00 41.33  ? 444  GLY B N   1 
ATOM   7589 C CA  . GLY B 1 443 ? 14.260  -67.233 -9.796  1.00 39.69  ? 444  GLY B CA  1 
ATOM   7590 C C   . GLY B 1 443 ? 13.669  -67.870 -11.049 1.00 39.65  ? 444  GLY B C   1 
ATOM   7591 O O   . GLY B 1 443 ? 14.398  -68.232 -11.977 1.00 41.00  ? 444  GLY B O   1 
ATOM   7592 N N   . VAL B 1 444 ? 12.349  -68.022 -11.073 1.00 36.60  ? 445  VAL B N   1 
ATOM   7593 C CA  . VAL B 1 444 ? 11.666  -68.516 -12.269 1.00 34.93  ? 445  VAL B CA  1 
ATOM   7594 C C   . VAL B 1 444 ? 11.070  -67.327 -13.033 1.00 35.90  ? 445  VAL B C   1 
ATOM   7595 O O   . VAL B 1 444 ? 10.031  -66.818 -12.651 1.00 34.10  ? 445  VAL B O   1 
ATOM   7596 C CB  . VAL B 1 444 ? 10.546  -69.528 -11.914 1.00 38.70  ? 445  VAL B CB  1 
ATOM   7597 C CG1 . VAL B 1 444 ? 9.923   -70.120 -13.197 1.00 38.14  ? 445  VAL B CG1 1 
ATOM   7598 C CG2 . VAL B 1 444 ? 11.080  -70.628 -10.998 1.00 35.13  ? 445  VAL B CG2 1 
ATOM   7599 N N   . PRO B 1 445 ? 11.740  -66.868 -14.102 1.00 33.90  ? 446  PRO B N   1 
ATOM   7600 C CA  . PRO B 1 445 ? 11.332  -65.603 -14.717 1.00 35.42  ? 446  PRO B CA  1 
ATOM   7601 C C   . PRO B 1 445 ? 10.172  -65.735 -15.675 1.00 34.54  ? 446  PRO B C   1 
ATOM   7602 O O   . PRO B 1 445 ? 9.823   -66.825 -16.136 1.00 33.79  ? 446  PRO B O   1 
ATOM   7603 C CB  . PRO B 1 445 ? 12.594  -65.154 -15.489 1.00 34.02  ? 446  PRO B CB  1 
ATOM   7604 C CG  . PRO B 1 445 ? 13.704  -66.062 -14.972 1.00 37.12  ? 446  PRO B CG  1 
ATOM   7605 C CD  . PRO B 1 445 ? 13.005  -67.349 -14.678 1.00 34.34  ? 446  PRO B CD  1 
ATOM   7606 N N   . HIS B 1 446 ? 9.593   -64.585 -15.978 1.00 30.80  ? 447  HIS B N   1 
ATOM   7607 C CA  . HIS B 1 446 ? 8.541   -64.468 -16.965 1.00 33.59  ? 447  HIS B CA  1 
ATOM   7608 C C   . HIS B 1 446 ? 8.918   -65.184 -18.268 1.00 32.76  ? 447  HIS B C   1 
ATOM   7609 O O   . HIS B 1 446 ? 10.021  -64.997 -18.767 1.00 31.89  ? 447  HIS B O   1 
ATOM   7610 C CB  . HIS B 1 446 ? 8.275   -62.987 -17.214 1.00 29.73  ? 447  HIS B CB  1 
ATOM   7611 C CG  . HIS B 1 446 ? 7.233   -62.725 -18.244 1.00 31.55  ? 447  HIS B CG  1 
ATOM   7612 N ND1 . HIS B 1 446 ? 5.884   -62.737 -17.956 1.00 34.95  ? 447  HIS B ND1 1 
ATOM   7613 C CD2 . HIS B 1 446 ? 7.341   -62.428 -19.562 1.00 30.44  ? 447  HIS B CD2 1 
ATOM   7614 C CE1 . HIS B 1 446 ? 5.201   -62.467 -19.056 1.00 35.40  ? 447  HIS B CE1 1 
ATOM   7615 N NE2 . HIS B 1 446 ? 6.062   -62.282 -20.044 1.00 30.03  ? 447  HIS B NE2 1 
ATOM   7616 N N   . GLY B 1 447 ? 8.012   -66.011 -18.792 1.00 29.61  ? 448  GLY B N   1 
ATOM   7617 C CA  . GLY B 1 447 ? 8.202   -66.651 -20.089 1.00 27.82  ? 448  GLY B CA  1 
ATOM   7618 C C   . GLY B 1 447 ? 8.802   -68.064 -20.019 1.00 36.24  ? 448  GLY B C   1 
ATOM   7619 O O   . GLY B 1 447 ? 8.857   -68.765 -21.020 1.00 32.54  ? 448  GLY B O   1 
ATOM   7620 N N   . TYR B 1 448 ? 9.243   -68.516 -18.847 1.00 31.63  ? 449  TYR B N   1 
ATOM   7621 C CA  . TYR B 1 448 ? 10.065  -69.729 -18.827 1.00 29.16  ? 449  TYR B CA  1 
ATOM   7622 C C   . TYR B 1 448 ? 9.282   -70.964 -18.430 1.00 29.39  ? 449  TYR B C   1 
ATOM   7623 O O   . TYR B 1 448 ? 9.844   -72.042 -18.268 1.00 34.80  ? 449  TYR B O   1 
ATOM   7624 C CB  . TYR B 1 448 ? 11.312  -69.498 -17.947 1.00 30.43  ? 449  TYR B CB  1 
ATOM   7625 C CG  . TYR B 1 448 ? 12.249  -68.662 -18.769 1.00 37.05  ? 449  TYR B CG  1 
ATOM   7626 C CD1 . TYR B 1 448 ? 13.047  -69.258 -19.760 1.00 38.53  ? 449  TYR B CD1 1 
ATOM   7627 C CD2 . TYR B 1 448 ? 12.236  -67.263 -18.684 1.00 33.46  ? 449  TYR B CD2 1 
ATOM   7628 C CE1 . TYR B 1 448 ? 13.859  -68.503 -20.585 1.00 31.34  ? 449  TYR B CE1 1 
ATOM   7629 C CE2 . TYR B 1 448 ? 13.053  -66.487 -19.527 1.00 33.86  ? 449  TYR B CE2 1 
ATOM   7630 C CZ  . TYR B 1 448 ? 13.856  -67.131 -20.483 1.00 39.60  ? 449  TYR B CZ  1 
ATOM   7631 O OH  . TYR B 1 448 ? 14.674  -66.418 -21.331 1.00 42.37  ? 449  TYR B OH  1 
ATOM   7632 N N   . GLU B 1 449 ? 7.966   -70.825 -18.351 1.00 28.59  ? 450  GLU B N   1 
ATOM   7633 C CA  . GLU B 1 449 ? 7.115   -72.003 -18.316 1.00 29.52  ? 450  GLU B CA  1 
ATOM   7634 C C   . GLU B 1 449 ? 6.816   -72.513 -19.745 1.00 31.00  ? 450  GLU B C   1 
ATOM   7635 O O   . GLU B 1 449 ? 6.418   -73.673 -19.929 1.00 30.41  ? 450  GLU B O   1 
ATOM   7636 C CB  . GLU B 1 449 ? 5.808   -71.697 -17.582 1.00 29.61  ? 450  GLU B CB  1 
ATOM   7637 C CG  . GLU B 1 449 ? 4.684   -71.198 -18.468 1.00 32.62  ? 450  GLU B CG  1 
ATOM   7638 C CD  . GLU B 1 449 ? 4.805   -69.728 -18.859 1.00 36.07  ? 450  GLU B CD  1 
ATOM   7639 O OE1 . GLU B 1 449 ? 5.916   -69.156 -18.774 1.00 31.26  ? 450  GLU B OE1 1 
ATOM   7640 O OE2 . GLU B 1 449 ? 3.764   -69.143 -19.258 1.00 35.75  ? 450  GLU B OE2 1 
ATOM   7641 N N   . ILE B 1 450 ? 6.998   -71.656 -20.754 1.00 27.89  ? 451  ILE B N   1 
ATOM   7642 C CA  . ILE B 1 450 ? 6.463   -71.951 -22.097 1.00 30.83  ? 451  ILE B CA  1 
ATOM   7643 C C   . ILE B 1 450 ? 7.120   -73.205 -22.679 1.00 33.67  ? 451  ILE B C   1 
ATOM   7644 O O   . ILE B 1 450 ? 6.433   -74.121 -23.116 1.00 29.32  ? 451  ILE B O   1 
ATOM   7645 C CB  . ILE B 1 450 ? 6.658   -70.778 -23.068 1.00 34.23  ? 451  ILE B CB  1 
ATOM   7646 C CG1 . ILE B 1 450 ? 5.818   -69.560 -22.623 1.00 27.39  ? 451  ILE B CG1 1 
ATOM   7647 C CG2 . ILE B 1 450 ? 6.281   -71.204 -24.491 1.00 27.76  ? 451  ILE B CG2 1 
ATOM   7648 C CD1 . ILE B 1 450 ? 6.140   -68.279 -23.331 1.00 23.79  ? 451  ILE B CD1 1 
ATOM   7649 N N   . GLU B 1 451 ? 8.448   -73.243 -22.641 1.00 28.79  ? 452  GLU B N   1 
ATOM   7650 C CA  . GLU B 1 451 ? 9.214   -74.390 -23.095 1.00 35.01  ? 452  GLU B CA  1 
ATOM   7651 C C   . GLU B 1 451 ? 8.737   -75.733 -22.508 1.00 37.39  ? 452  GLU B C   1 
ATOM   7652 O O   . GLU B 1 451 ? 8.799   -76.760 -23.187 1.00 31.49  ? 452  GLU B O   1 
ATOM   7653 C CB  . GLU B 1 451 ? 10.711  -74.172 -22.795 1.00 33.46  ? 452  GLU B CB  1 
ATOM   7654 C CG  . GLU B 1 451 ? 11.083  -73.986 -21.296 1.00 35.82  ? 452  GLU B CG  1 
ATOM   7655 C CD  . GLU B 1 451 ? 12.426  -73.274 -21.147 1.00 40.75  ? 452  GLU B CD  1 
ATOM   7656 O OE1 . GLU B 1 451 ? 13.369  -73.860 -20.572 1.00 43.38  ? 452  GLU B OE1 1 
ATOM   7657 O OE2 . GLU B 1 451 ? 12.553  -72.121 -21.630 1.00 42.22  ? 452  GLU B OE2 1 
ATOM   7658 N N   . PHE B 1 452 ? 8.220   -75.732 -21.281 1.00 31.33  ? 453  PHE B N   1 
ATOM   7659 C CA  . PHE B 1 452 ? 7.696   -76.971 -20.712 1.00 25.60  ? 453  PHE B CA  1 
ATOM   7660 C C   . PHE B 1 452 ? 6.328   -77.324 -21.234 1.00 32.95  ? 453  PHE B C   1 
ATOM   7661 O O   . PHE B 1 452 ? 6.022   -78.508 -21.436 1.00 35.78  ? 453  PHE B O   1 
ATOM   7662 C CB  . PHE B 1 452 ? 7.675   -76.893 -19.160 1.00 30.88  ? 453  PHE B CB  1 
ATOM   7663 C CG  . PHE B 1 452 ? 9.044   -77.017 -18.569 1.00 32.77  ? 453  PHE B CG  1 
ATOM   7664 C CD1 . PHE B 1 452 ? 9.839   -75.892 -18.391 1.00 31.16  ? 453  PHE B CD1 1 
ATOM   7665 C CD2 . PHE B 1 452 ? 9.579   -78.264 -18.283 1.00 32.86  ? 453  PHE B CD2 1 
ATOM   7666 C CE1 . PHE B 1 452 ? 11.127  -76.002 -17.886 1.00 37.40  ? 453  PHE B CE1 1 
ATOM   7667 C CE2 . PHE B 1 452 ? 10.879  -78.384 -17.784 1.00 33.67  ? 453  PHE B CE2 1 
ATOM   7668 C CZ  . PHE B 1 452 ? 11.651  -77.249 -17.588 1.00 32.68  ? 453  PHE B CZ  1 
ATOM   7669 N N   . ILE B 1 453 ? 5.496   -76.307 -21.436 1.00 28.53  ? 454  ILE B N   1 
ATOM   7670 C CA  . ILE B 1 453 ? 4.158   -76.513 -21.954 1.00 26.48  ? 454  ILE B CA  1 
ATOM   7671 C C   . ILE B 1 453 ? 4.225   -77.076 -23.391 1.00 30.39  ? 454  ILE B C   1 
ATOM   7672 O O   . ILE B 1 453 ? 3.421   -77.915 -23.786 1.00 33.60  ? 454  ILE B O   1 
ATOM   7673 C CB  . ILE B 1 453 ? 3.345   -75.178 -21.953 1.00 31.06  ? 454  ILE B CB  1 
ATOM   7674 C CG1 . ILE B 1 453 ? 3.228   -74.571 -20.537 1.00 32.33  ? 454  ILE B CG1 1 
ATOM   7675 C CG2 . ILE B 1 453 ? 1.994   -75.366 -22.622 1.00 26.68  ? 454  ILE B CG2 1 
ATOM   7676 C CD1 . ILE B 1 453 ? 2.672   -75.480 -19.550 1.00 35.78  ? 454  ILE B CD1 1 
ATOM   7677 N N   . PHE B 1 454 ? 5.195   -76.605 -24.171 1.00 30.52  ? 455  PHE B N   1 
ATOM   7678 C CA  . PHE B 1 454 ? 5.333   -77.089 -25.535 1.00 30.42  ? 455  PHE B CA  1 
ATOM   7679 C C   . PHE B 1 454 ? 6.150   -78.377 -25.617 1.00 36.51  ? 455  PHE B C   1 
ATOM   7680 O O   . PHE B 1 454 ? 6.312   -78.915 -26.698 1.00 33.98  ? 455  PHE B O   1 
ATOM   7681 C CB  . PHE B 1 454 ? 5.960   -76.011 -26.422 1.00 28.76  ? 455  PHE B CB  1 
ATOM   7682 C CG  . PHE B 1 454 ? 4.958   -75.033 -26.963 1.00 32.12  ? 455  PHE B CG  1 
ATOM   7683 C CD1 . PHE B 1 454 ? 4.543   -73.949 -26.199 1.00 28.32  ? 455  PHE B CD1 1 
ATOM   7684 C CD2 . PHE B 1 454 ? 4.421   -75.201 -28.231 1.00 27.83  ? 455  PHE B CD2 1 
ATOM   7685 C CE1 . PHE B 1 454 ? 3.621   -73.044 -26.695 1.00 30.96  ? 455  PHE B CE1 1 
ATOM   7686 C CE2 . PHE B 1 454 ? 3.492   -74.304 -28.725 1.00 28.12  ? 455  PHE B CE2 1 
ATOM   7687 C CZ  . PHE B 1 454 ? 3.090   -73.224 -27.967 1.00 27.74  ? 455  PHE B CZ  1 
ATOM   7688 N N   . GLY B 1 455 ? 6.661   -78.869 -24.482 1.00 33.25  ? 456  GLY B N   1 
ATOM   7689 C CA  . GLY B 1 455 ? 7.347   -80.151 -24.465 1.00 31.92  ? 456  GLY B CA  1 
ATOM   7690 C C   . GLY B 1 455 ? 8.757   -80.088 -25.024 1.00 35.34  ? 456  GLY B C   1 
ATOM   7691 O O   . GLY B 1 455 ? 9.346   -81.108 -25.398 1.00 36.19  ? 456  GLY B O   1 
ATOM   7692 N N   . ILE B 1 456 ? 9.315   -78.882 -25.070 1.00 36.47  ? 457  ILE B N   1 
ATOM   7693 C CA  . ILE B 1 456 ? 10.648  -78.672 -25.621 1.00 32.98  ? 457  ILE B CA  1 
ATOM   7694 C C   . ILE B 1 456 ? 11.754  -79.538 -24.973 1.00 40.18  ? 457  ILE B C   1 
ATOM   7695 O O   . ILE B 1 456 ? 12.723  -79.896 -25.653 1.00 40.52  ? 457  ILE B O   1 
ATOM   7696 C CB  . ILE B 1 456 ? 11.020  -77.184 -25.516 1.00 37.41  ? 457  ILE B CB  1 
ATOM   7697 C CG1 . ILE B 1 456 ? 9.918   -76.332 -26.144 1.00 35.09  ? 457  ILE B CG1 1 
ATOM   7698 C CG2 . ILE B 1 456 ? 12.386  -76.881 -26.121 1.00 33.82  ? 457  ILE B CG2 1 
ATOM   7699 C CD1 . ILE B 1 456 ? 9.648   -76.673 -27.604 1.00 30.10  ? 457  ILE B CD1 1 
ATOM   7700 N N   . PRO B 1 457 ? 11.639  -79.871 -23.665 1.00 37.53  ? 458  PRO B N   1 
ATOM   7701 C CA  . PRO B 1 457 ? 12.673  -80.770 -23.129 1.00 40.84  ? 458  PRO B CA  1 
ATOM   7702 C C   . PRO B 1 457 ? 12.789  -82.142 -23.821 1.00 37.29  ? 458  PRO B C   1 
ATOM   7703 O O   . PRO B 1 457 ? 13.832  -82.783 -23.681 1.00 39.44  ? 458  PRO B O   1 
ATOM   7704 C CB  . PRO B 1 457 ? 12.242  -80.953 -21.663 1.00 35.31  ? 458  PRO B CB  1 
ATOM   7705 C CG  . PRO B 1 457 ? 11.569  -79.661 -21.334 1.00 38.93  ? 458  PRO B CG  1 
ATOM   7706 C CD  . PRO B 1 457 ? 10.789  -79.336 -22.577 1.00 32.76  ? 458  PRO B CD  1 
ATOM   7707 N N   . LEU B 1 458 ? 11.761  -82.572 -24.545 1.00 37.96  ? 459  LEU B N   1 
ATOM   7708 C CA  . LEU B 1 458 ? 11.814  -83.846 -25.263 1.00 35.91  ? 459  LEU B CA  1 
ATOM   7709 C C   . LEU B 1 458 ? 12.687  -83.781 -26.529 1.00 44.41  ? 459  LEU B C   1 
ATOM   7710 O O   . LEU B 1 458 ? 13.000  -84.802 -27.126 1.00 48.44  ? 459  LEU B O   1 
ATOM   7711 C CB  . LEU B 1 458 ? 10.408  -84.301 -25.634 1.00 33.68  ? 459  LEU B CB  1 
ATOM   7712 C CG  . LEU B 1 458 ? 9.451   -84.436 -24.457 1.00 38.58  ? 459  LEU B CG  1 
ATOM   7713 C CD1 . LEU B 1 458 ? 8.088   -84.901 -24.940 1.00 38.94  ? 459  LEU B CD1 1 
ATOM   7714 C CD2 . LEU B 1 458 ? 10.030  -85.394 -23.423 1.00 39.60  ? 459  LEU B CD2 1 
ATOM   7715 N N   . ASP B 1 459 ? 13.075  -82.581 -26.935 1.00 43.35  ? 460  ASP B N   1 
ATOM   7716 C CA  . ASP B 1 459 ? 13.999  -82.405 -28.058 1.00 43.60  ? 460  ASP B CA  1 
ATOM   7717 C C   . ASP B 1 459 ? 15.366  -83.014 -27.725 1.00 51.39  ? 460  ASP B C   1 
ATOM   7718 O O   . ASP B 1 459 ? 16.070  -82.533 -26.830 1.00 46.70  ? 460  ASP B O   1 
ATOM   7719 C CB  . ASP B 1 459 ? 14.134  -80.915 -28.392 1.00 47.16  ? 460  ASP B CB  1 
ATOM   7720 C CG  . ASP B 1 459 ? 15.009  -80.638 -29.616 1.00 55.00  ? 460  ASP B CG  1 
ATOM   7721 O OD1 . ASP B 1 459 ? 15.854  -81.475 -30.002 1.00 54.54  ? 460  ASP B OD1 1 
ATOM   7722 O OD2 . ASP B 1 459 ? 14.867  -79.533 -30.176 1.00 56.50  ? 460  ASP B OD2 1 
ATOM   7723 N N   . PRO B 1 460 ? 15.767  -84.052 -28.475 1.00 58.00  ? 461  PRO B N   1 
ATOM   7724 C CA  . PRO B 1 460 ? 17.000  -84.777 -28.149 1.00 54.46  ? 461  PRO B CA  1 
ATOM   7725 C C   . PRO B 1 460 ? 18.243  -83.887 -28.211 1.00 56.13  ? 461  PRO B C   1 
ATOM   7726 O O   . PRO B 1 460 ? 19.199  -84.150 -27.486 1.00 64.54  ? 461  PRO B O   1 
ATOM   7727 C CB  . PRO B 1 460 ? 17.050  -85.878 -29.206 1.00 60.24  ? 461  PRO B CB  1 
ATOM   7728 C CG  . PRO B 1 460 ? 16.246  -85.352 -30.351 1.00 65.63  ? 461  PRO B CG  1 
ATOM   7729 C CD  . PRO B 1 460 ? 15.140  -84.546 -29.713 1.00 60.03  ? 461  PRO B CD  1 
ATOM   7730 N N   . SER B 1 461 ? 18.212  -82.831 -29.018 1.00 54.36  ? 462  SER B N   1 
ATOM   7731 C CA  . SER B 1 461 ? 19.375  -81.949 -29.134 1.00 51.20  ? 462  SER B CA  1 
ATOM   7732 C C   . SER B 1 461 ? 19.538  -81.068 -27.905 1.00 53.90  ? 462  SER B C   1 
ATOM   7733 O O   . SER B 1 461 ? 20.555  -80.408 -27.734 1.00 56.39  ? 462  SER B O   1 
ATOM   7734 C CB  . SER B 1 461 ? 19.269  -81.074 -30.381 1.00 53.75  ? 462  SER B CB  1 
ATOM   7735 O OG  . SER B 1 461 ? 18.414  -79.969 -30.156 1.00 60.71  ? 462  SER B OG  1 
ATOM   7736 N N   . ARG B 1 462 ? 18.531  -81.042 -27.045 1.00 54.63  ? 463  ARG B N   1 
ATOM   7737 C CA  . ARG B 1 462 ? 18.638  -80.216 -25.854 1.00 56.31  ? 463  ARG B CA  1 
ATOM   7738 C C   . ARG B 1 462 ? 19.050  -81.073 -24.658 1.00 58.89  ? 463  ARG B C   1 
ATOM   7739 O O   . ARG B 1 462 ? 19.006  -82.309 -24.723 1.00 54.42  ? 463  ARG B O   1 
ATOM   7740 C CB  . ARG B 1 462 ? 17.323  -79.482 -25.589 1.00 51.98  ? 463  ARG B CB  1 
ATOM   7741 C CG  . ARG B 1 462 ? 17.259  -78.166 -26.325 1.00 51.18  ? 463  ARG B CG  1 
ATOM   7742 C CD  . ARG B 1 462 ? 15.842  -77.748 -26.619 1.00 48.37  ? 463  ARG B CD  1 
ATOM   7743 N NE  . ARG B 1 462 ? 15.793  -76.916 -27.811 1.00 58.20  ? 463  ARG B NE  1 
ATOM   7744 C CZ  . ARG B 1 462 ? 15.985  -75.601 -27.820 1.00 62.54  ? 463  ARG B CZ  1 
ATOM   7745 N NH1 . ARG B 1 462 ? 16.236  -74.962 -26.680 1.00 66.51  ? 463  ARG B NH1 1 
ATOM   7746 N NH2 . ARG B 1 462 ? 15.921  -74.927 -28.970 1.00 57.14  ? 463  ARG B NH2 1 
ATOM   7747 N N   . ASN B 1 463 ? 19.452  -80.416 -23.575 1.00 48.35  ? 464  ASN B N   1 
ATOM   7748 C CA  . ASN B 1 463 ? 20.064  -81.122 -22.461 1.00 43.85  ? 464  ASN B CA  1 
ATOM   7749 C C   . ASN B 1 463 ? 19.306  -80.992 -21.152 1.00 40.70  ? 464  ASN B C   1 
ATOM   7750 O O   . ASN B 1 463 ? 19.902  -80.762 -20.115 1.00 46.37  ? 464  ASN B O   1 
ATOM   7751 C CB  . ASN B 1 463 ? 21.506  -80.636 -22.314 1.00 48.50  ? 464  ASN B CB  1 
ATOM   7752 C CG  . ASN B 1 463 ? 22.315  -80.875 -23.579 1.00 62.51  ? 464  ASN B CG  1 
ATOM   7753 O OD1 . ASN B 1 463 ? 22.356  -82.004 -24.090 1.00 61.41  ? 464  ASN B OD1 1 
ATOM   7754 N ND2 . ASN B 1 463 ? 22.917  -79.815 -24.123 1.00 67.47  ? 464  ASN B ND2 1 
ATOM   7755 N N   . TYR B 1 464 ? 17.985  -81.161 -21.196 1.00 39.65  ? 465  TYR B N   1 
ATOM   7756 C CA  . TYR B 1 464 ? 17.199  -81.199 -19.962 1.00 41.64  ? 465  TYR B CA  1 
ATOM   7757 C C   . TYR B 1 464 ? 17.403  -82.527 -19.234 1.00 43.75  ? 465  TYR B C   1 
ATOM   7758 O O   . TYR B 1 464 ? 17.831  -83.517 -19.834 1.00 42.67  ? 465  TYR B O   1 
ATOM   7759 C CB  . TYR B 1 464 ? 15.702  -80.997 -20.242 1.00 38.51  ? 465  TYR B CB  1 
ATOM   7760 C CG  . TYR B 1 464 ? 15.334  -79.612 -20.738 1.00 47.63  ? 465  TYR B CG  1 
ATOM   7761 C CD1 . TYR B 1 464 ? 15.482  -79.275 -22.086 1.00 38.98  ? 465  TYR B CD1 1 
ATOM   7762 C CD2 . TYR B 1 464 ? 14.825  -78.642 -19.862 1.00 38.88  ? 465  TYR B CD2 1 
ATOM   7763 C CE1 . TYR B 1 464 ? 15.151  -78.010 -22.557 1.00 38.67  ? 465  TYR B CE1 1 
ATOM   7764 C CE2 . TYR B 1 464 ? 14.484  -77.372 -20.324 1.00 39.56  ? 465  TYR B CE2 1 
ATOM   7765 C CZ  . TYR B 1 464 ? 14.644  -77.067 -21.673 1.00 48.39  ? 465  TYR B CZ  1 
ATOM   7766 O OH  . TYR B 1 464 ? 14.309  -75.821 -22.144 1.00 45.62  ? 465  TYR B OH  1 
ATOM   7767 N N   . THR B 1 465 ? 17.083  -82.554 -17.944 1.00 40.40  ? 466  THR B N   1 
ATOM   7768 C CA  . THR B 1 465 ? 17.158  -83.788 -17.184 1.00 43.52  ? 466  THR B CA  1 
ATOM   7769 C C   . THR B 1 465 ? 15.966  -84.664 -17.505 1.00 41.26  ? 466  THR B C   1 
ATOM   7770 O O   . THR B 1 465 ? 14.942  -84.181 -17.988 1.00 38.57  ? 466  THR B O   1 
ATOM   7771 C CB  . THR B 1 465 ? 17.167  -83.545 -15.659 1.00 41.98  ? 466  THR B CB  1 
ATOM   7772 O OG1 . THR B 1 465 ? 15.855  -83.148 -15.236 1.00 41.51  ? 466  THR B OG1 1 
ATOM   7773 C CG2 . THR B 1 465 ? 18.181  -82.482 -15.285 1.00 37.57  ? 466  THR B CG2 1 
ATOM   7774 N N   . ALA B 1 466 ? 16.095  -85.951 -17.203 1.00 38.84  ? 467  ALA B N   1 
ATOM   7775 C CA  . ALA B 1 466 ? 15.004  -86.903 -17.351 1.00 41.28  ? 467  ALA B CA  1 
ATOM   7776 C C   . ALA B 1 466 ? 13.756  -86.488 -16.563 1.00 40.49  ? 467  ALA B C   1 
ATOM   7777 O O   . ALA B 1 466 ? 12.627  -86.646 -17.046 1.00 41.96  ? 467  ALA B O   1 
ATOM   7778 C CB  . ALA B 1 466 ? 15.468  -88.298 -16.918 1.00 40.78  ? 467  ALA B CB  1 
ATOM   7779 N N   . GLU B 1 467 ? 13.957  -85.958 -15.355 1.00 38.61  ? 468  GLU B N   1 
ATOM   7780 C CA  . GLU B 1 467 ? 12.842  -85.526 -14.518 1.00 42.79  ? 468  GLU B CA  1 
ATOM   7781 C C   . GLU B 1 467 ? 12.089  -84.368 -15.154 1.00 34.01  ? 468  GLU B C   1 
ATOM   7782 O O   . GLU B 1 467 ? 10.855  -84.285 -15.097 1.00 38.18  ? 468  GLU B O   1 
ATOM   7783 C CB  . GLU B 1 467 ? 13.346  -85.110 -13.133 1.00 46.34  ? 468  GLU B CB  1 
ATOM   7784 C CG  . GLU B 1 467 ? 13.688  -86.255 -12.223 1.00 60.02  ? 468  GLU B CG  1 
ATOM   7785 C CD  . GLU B 1 467 ? 14.100  -85.761 -10.852 1.00 76.21  ? 468  GLU B CD  1 
ATOM   7786 O OE1 . GLU B 1 467 ? 14.037  -84.530 -10.631 1.00 65.12  ? 468  GLU B OE1 1 
ATOM   7787 O OE2 . GLU B 1 467 ? 14.489  -86.598 -10.002 1.00 95.93  ? 468  GLU B OE2 1 
ATOM   7788 N N   . GLU B 1 468 ? 12.845  -83.466 -15.760 1.00 30.72  ? 469  GLU B N   1 
ATOM   7789 C CA  . GLU B 1 468 ? 12.249  -82.371 -16.509 1.00 38.65  ? 469  GLU B CA  1 
ATOM   7790 C C   . GLU B 1 468 ? 11.455  -82.853 -17.729 1.00 35.55  ? 469  GLU B C   1 
ATOM   7791 O O   . GLU B 1 468 ? 10.416  -82.255 -18.072 1.00 32.54  ? 469  GLU B O   1 
ATOM   7792 C CB  . GLU B 1 468 ? 13.333  -81.386 -16.930 1.00 35.70  ? 469  GLU B CB  1 
ATOM   7793 C CG  . GLU B 1 468 ? 13.802  -80.528 -15.771 1.00 34.47  ? 469  GLU B CG  1 
ATOM   7794 C CD  . GLU B 1 468 ? 14.973  -79.636 -16.140 1.00 42.90  ? 469  GLU B CD  1 
ATOM   7795 O OE1 . GLU B 1 468 ? 15.848  -80.073 -16.932 1.00 41.92  ? 469  GLU B OE1 1 
ATOM   7796 O OE2 . GLU B 1 468 ? 15.014  -78.488 -15.635 1.00 47.82  ? 469  GLU B OE2 1 
ATOM   7797 N N   . LYS B 1 469 ? 11.911  -83.934 -18.368 1.00 35.97  ? 470  LYS B N   1 
ATOM   7798 C CA  . LYS B 1 469 ? 11.156  -84.519 -19.491 1.00 34.68  ? 470  LYS B CA  1 
ATOM   7799 C C   . LYS B 1 469 ? 9.820   -85.056 -18.984 1.00 33.52  ? 470  LYS B C   1 
ATOM   7800 O O   . LYS B 1 469 ? 8.785   -84.874 -19.607 1.00 33.94  ? 470  LYS B O   1 
ATOM   7801 C CB  . LYS B 1 469 ? 11.982  -85.614 -20.187 1.00 38.20  ? 470  LYS B CB  1 
ATOM   7802 C CG  . LYS B 1 469 ? 13.159  -85.026 -20.951 1.00 37.79  ? 470  LYS B CG  1 
ATOM   7803 C CD  . LYS B 1 469 ? 14.165  -86.032 -21.456 1.00 37.11  ? 470  LYS B CD  1 
ATOM   7804 C CE  . LYS B 1 469 ? 15.430  -85.298 -21.831 1.00 40.89  ? 470  LYS B CE  1 
ATOM   7805 N NZ  . LYS B 1 469 ? 16.478  -86.167 -22.389 1.00 38.02  ? 470  LYS B NZ  1 
ATOM   7806 N N   . ILE B 1 470 ? 9.842   -85.680 -17.815 1.00 37.61  ? 471  ILE B N   1 
ATOM   7807 C CA  . ILE B 1 470 ? 8.624   -86.217 -17.198 1.00 36.84  ? 471  ILE B CA  1 
ATOM   7808 C C   . ILE B 1 470 ? 7.680   -85.065 -16.819 1.00 36.34  ? 471  ILE B C   1 
ATOM   7809 O O   . ILE B 1 470 ? 6.465   -85.121 -17.047 1.00 41.40  ? 471  ILE B O   1 
ATOM   7810 C CB  . ILE B 1 470 ? 8.974   -87.071 -15.921 1.00 43.83  ? 471  ILE B CB  1 
ATOM   7811 C CG1 . ILE B 1 470 ? 9.745   -88.334 -16.310 1.00 44.76  ? 471  ILE B CG1 1 
ATOM   7812 C CG2 . ILE B 1 470 ? 7.726   -87.405 -15.083 1.00 33.33  ? 471  ILE B CG2 1 
ATOM   7813 C CD1 . ILE B 1 470 ? 9.038   -89.198 -17.364 1.00 54.68  ? 471  ILE B CD1 1 
ATOM   7814 N N   . PHE B 1 471 ? 8.260   -84.021 -16.232 1.00 37.74  ? 472  PHE B N   1 
ATOM   7815 C CA  . PHE B 1 471 ? 7.526   -82.817 -15.849 1.00 36.89  ? 472  PHE B CA  1 
ATOM   7816 C C   . PHE B 1 471 ? 6.870   -82.185 -17.077 1.00 32.13  ? 472  PHE B C   1 
ATOM   7817 O O   . PHE B 1 471 ? 5.654   -81.931 -17.094 1.00 34.36  ? 472  PHE B O   1 
ATOM   7818 C CB  . PHE B 1 471 ? 8.482   -81.837 -15.159 1.00 37.68  ? 472  PHE B CB  1 
ATOM   7819 C CG  . PHE B 1 471 ? 7.829   -80.558 -14.697 1.00 39.46  ? 472  PHE B CG  1 
ATOM   7820 C CD1 . PHE B 1 471 ? 6.611   -80.586 -14.012 1.00 32.91  ? 472  PHE B CD1 1 
ATOM   7821 C CD2 . PHE B 1 471 ? 8.454   -79.331 -14.916 1.00 34.18  ? 472  PHE B CD2 1 
ATOM   7822 C CE1 . PHE B 1 471 ? 6.015   -79.408 -13.571 1.00 34.47  ? 472  PHE B CE1 1 
ATOM   7823 C CE2 . PHE B 1 471 ? 7.856   -78.139 -14.479 1.00 36.50  ? 472  PHE B CE2 1 
ATOM   7824 C CZ  . PHE B 1 471 ? 6.640   -78.188 -13.795 1.00 34.76  ? 472  PHE B CZ  1 
ATOM   7825 N N   . ALA B 1 472 ? 7.671   -81.970 -18.118 1.00 29.47  ? 473  ALA B N   1 
ATOM   7826 C CA  . ALA B 1 472 ? 7.122   -81.516 -19.419 1.00 31.00  ? 473  ALA B CA  1 
ATOM   7827 C C   . ALA B 1 472 ? 5.915   -82.338 -19.864 1.00 33.92  ? 473  ALA B C   1 
ATOM   7828 O O   . ALA B 1 472 ? 4.878   -81.785 -20.263 1.00 32.50  ? 473  ALA B O   1 
ATOM   7829 C CB  . ALA B 1 472 ? 8.213   -81.545 -20.498 1.00 29.43  ? 473  ALA B CB  1 
ATOM   7830 N N   . GLN B 1 473 ? 6.019   -83.661 -19.757 1.00 37.31  ? 474  GLN B N   1 
ATOM   7831 C CA  . GLN B 1 473 ? 4.902   -84.518 -20.168 1.00 36.59  ? 474  GLN B CA  1 
ATOM   7832 C C   . GLN B 1 473 ? 3.660   -84.324 -19.290 1.00 32.86  ? 474  GLN B C   1 
ATOM   7833 O O   . GLN B 1 473 ? 2.526   -84.361 -19.795 1.00 35.03  ? 474  GLN B O   1 
ATOM   7834 C CB  . GLN B 1 473 ? 5.349   -85.996 -20.183 1.00 40.25  ? 474  GLN B CB  1 
ATOM   7835 C CG  . GLN B 1 473 ? 6.215   -86.334 -21.425 1.00 41.03  ? 474  GLN B CG  1 
ATOM   7836 C CD  . GLN B 1 473 ? 6.916   -87.691 -21.347 1.00 47.72  ? 474  GLN B CD  1 
ATOM   7837 O OE1 . GLN B 1 473 ? 7.139   -88.241 -20.273 1.00 55.59  ? 474  GLN B OE1 1 
ATOM   7838 N NE2 . GLN B 1 473 ? 7.273   -88.221 -22.491 1.00 44.94  ? 474  GLN B NE2 1 
ATOM   7839 N N   . ARG B 1 474 ? 3.863   -84.108 -17.986 1.00 34.49  ? 475  ARG B N   1 
ATOM   7840 C CA  . ARG B 1 474 ? 2.744   -83.784 -17.090 1.00 36.59  ? 475  ARG B CA  1 
ATOM   7841 C C   . ARG B 1 474 ? 2.013   -82.520 -17.534 1.00 30.23  ? 475  ARG B C   1 
ATOM   7842 O O   . ARG B 1 474 ? 0.777   -82.500 -17.636 1.00 33.83  ? 475  ARG B O   1 
ATOM   7843 C CB  . ARG B 1 474 ? 3.216   -83.609 -15.631 1.00 37.97  ? 475  ARG B CB  1 
ATOM   7844 C CG  . ARG B 1 474 ? 3.472   -84.901 -14.904 1.00 44.40  ? 475  ARG B CG  1 
ATOM   7845 C CD  . ARG B 1 474 ? 3.947   -84.652 -13.460 1.00 48.74  ? 475  ARG B CD  1 
ATOM   7846 N NE  . ARG B 1 474 ? 3.021   -83.778 -12.762 1.00 37.36  ? 475  ARG B NE  1 
ATOM   7847 C CZ  . ARG B 1 474 ? 3.396   -82.784 -11.958 1.00 45.14  ? 475  ARG B CZ  1 
ATOM   7848 N NH1 . ARG B 1 474 ? 4.691   -82.555 -11.731 1.00 38.37  ? 475  ARG B NH1 1 
ATOM   7849 N NH2 . ARG B 1 474 ? 2.478   -82.021 -11.377 1.00 38.64  ? 475  ARG B NH2 1 
ATOM   7850 N N   . LEU B 1 475 ? 2.769   -81.461 -17.794 1.00 31.00  ? 476  LEU B N   1 
ATOM   7851 C CA  . LEU B 1 475 ? 2.139   -80.199 -18.185 1.00 31.62  ? 476  LEU B CA  1 
ATOM   7852 C C   . LEU B 1 475 ? 1.388   -80.304 -19.507 1.00 35.28  ? 476  LEU B C   1 
ATOM   7853 O O   . LEU B 1 475 ? 0.234   -79.857 -19.613 1.00 35.19  ? 476  LEU B O   1 
ATOM   7854 C CB  . LEU B 1 475 ? 3.188   -79.084 -18.250 1.00 34.52  ? 476  LEU B CB  1 
ATOM   7855 C CG  . LEU B 1 475 ? 3.878   -78.807 -16.902 1.00 33.61  ? 476  LEU B CG  1 
ATOM   7856 C CD1 . LEU B 1 475 ? 4.684   -77.522 -16.925 1.00 35.58  ? 476  LEU B CD1 1 
ATOM   7857 C CD2 . LEU B 1 475 ? 2.874   -78.765 -15.759 1.00 36.15  ? 476  LEU B CD2 1 
ATOM   7858 N N   . MET B 1 476 ? 2.028   -80.891 -20.516 1.00 31.46  ? 477  MET B N   1 
ATOM   7859 C CA  . MET B 1 476 ? 1.340   -81.119 -21.786 1.00 33.36  ? 477  MET B CA  1 
ATOM   7860 C C   . MET B 1 476 ? 0.025   -81.868 -21.548 1.00 31.91  ? 477  MET B C   1 
ATOM   7861 O O   . MET B 1 476 ? -1.004  -81.548 -22.153 1.00 34.43  ? 477  MET B O   1 
ATOM   7862 C CB  . MET B 1 476 ? 2.234   -81.892 -22.752 1.00 29.27  ? 477  MET B CB  1 
ATOM   7863 C CG  . MET B 1 476 ? 3.411   -81.076 -23.307 1.00 40.06  ? 477  MET B CG  1 
ATOM   7864 S SD  . MET B 1 476 ? 4.204   -81.896 -24.742 1.00 39.71  ? 477  MET B SD  1 
ATOM   7865 C CE  . MET B 1 476 ? 5.185   -83.120 -23.872 1.00 38.04  ? 477  MET B CE  1 
ATOM   7866 N N   . ARG B 1 477 ? 0.047   -82.839 -20.634 1.00 35.96  ? 478  ARG B N   1 
ATOM   7867 C CA  . ARG B 1 477 ? -1.170  -83.594 -20.310 1.00 34.43  ? 478  ARG B CA  1 
ATOM   7868 C C   . ARG B 1 477 ? -2.270  -82.711 -19.687 1.00 36.09  ? 478  ARG B C   1 
ATOM   7869 O O   . ARG B 1 477 ? -3.446  -82.808 -20.086 1.00 35.75  ? 478  ARG B O   1 
ATOM   7870 C CB  . ARG B 1 477 ? -0.830  -84.764 -19.375 1.00 40.78  ? 478  ARG B CB  1 
ATOM   7871 C CG  . ARG B 1 477 ? -2.059  -85.561 -18.888 1.00 43.90  ? 478  ARG B CG  1 
ATOM   7872 C CD  . ARG B 1 477 ? -2.851  -86.166 -20.055 1.00 49.07  ? 478  ARG B CD  1 
ATOM   7873 N NE  . ARG B 1 477 ? -2.005  -87.058 -20.848 1.00 53.54  ? 478  ARG B NE  1 
ATOM   7874 C CZ  . ARG B 1 477 ? -1.852  -88.358 -20.609 1.00 59.99  ? 478  ARG B CZ  1 
ATOM   7875 N NH1 . ARG B 1 477 ? -2.504  -88.930 -19.605 1.00 65.79  ? 478  ARG B NH1 1 
ATOM   7876 N NH2 . ARG B 1 477 ? -1.051  -89.087 -21.376 1.00 55.11  ? 478  ARG B NH2 1 
ATOM   7877 N N   . TYR B 1 478 ? -1.901  -81.850 -18.727 1.00 35.94  ? 479  TYR B N   1 
ATOM   7878 C CA  . TYR B 1 478 ? -2.869  -80.923 -18.099 1.00 34.14  ? 479  TYR B CA  1 
ATOM   7879 C C   . TYR B 1 478 ? -3.491  -79.993 -19.125 1.00 34.87  ? 479  TYR B C   1 
ATOM   7880 O O   . TYR B 1 478 ? -4.717  -79.820 -19.172 1.00 33.79  ? 479  TYR B O   1 
ATOM   7881 C CB  . TYR B 1 478 ? -2.213  -80.047 -17.023 1.00 36.13  ? 479  TYR B CB  1 
ATOM   7882 C CG  . TYR B 1 478 ? -1.733  -80.736 -15.772 1.00 37.38  ? 479  TYR B CG  1 
ATOM   7883 C CD1 . TYR B 1 478 ? -2.465  -81.751 -15.161 1.00 39.39  ? 479  TYR B CD1 1 
ATOM   7884 C CD2 . TYR B 1 478 ? -0.543  -80.348 -15.187 1.00 35.87  ? 479  TYR B CD2 1 
ATOM   7885 C CE1 . TYR B 1 478 ? -1.999  -82.364 -13.993 1.00 41.87  ? 479  TYR B CE1 1 
ATOM   7886 C CE2 . TYR B 1 478 ? -0.075  -80.943 -14.029 1.00 39.06  ? 479  TYR B CE2 1 
ATOM   7887 C CZ  . TYR B 1 478 ? -0.801  -81.953 -13.435 1.00 41.77  ? 479  TYR B CZ  1 
ATOM   7888 O OH  . TYR B 1 478 ? -0.291  -82.534 -12.289 1.00 40.54  ? 479  TYR B OH  1 
ATOM   7889 N N   . TRP B 1 479 ? -2.631  -79.364 -19.929 1.00 33.20  ? 480  TRP B N   1 
ATOM   7890 C CA  . TRP B 1 479 ? -3.101  -78.457 -20.981 1.00 36.05  ? 480  TRP B CA  1 
ATOM   7891 C C   . TRP B 1 479 ? -4.026  -79.162 -21.979 1.00 33.10  ? 480  TRP B C   1 
ATOM   7892 O O   . TRP B 1 479 ? -5.081  -78.626 -22.359 1.00 32.71  ? 480  TRP B O   1 
ATOM   7893 C CB  . TRP B 1 479 ? -1.913  -77.833 -21.718 1.00 31.14  ? 480  TRP B CB  1 
ATOM   7894 C CG  . TRP B 1 479 ? -1.532  -76.442 -21.221 1.00 33.57  ? 480  TRP B CG  1 
ATOM   7895 C CD1 . TRP B 1 479 ? -1.531  -75.276 -21.952 1.00 30.97  ? 480  TRP B CD1 1 
ATOM   7896 C CD2 . TRP B 1 479 ? -1.106  -76.077 -19.895 1.00 28.32  ? 480  TRP B CD2 1 
ATOM   7897 N NE1 . TRP B 1 479 ? -1.123  -74.217 -21.165 1.00 32.78  ? 480  TRP B NE1 1 
ATOM   7898 C CE2 . TRP B 1 479 ? -0.851  -74.677 -19.904 1.00 33.08  ? 480  TRP B CE2 1 
ATOM   7899 C CE3 . TRP B 1 479 ? -0.914  -76.793 -18.700 1.00 33.45  ? 480  TRP B CE3 1 
ATOM   7900 C CZ2 . TRP B 1 479 ? -0.422  -73.981 -18.761 1.00 32.70  ? 480  TRP B CZ2 1 
ATOM   7901 C CZ3 . TRP B 1 479 ? -0.464  -76.105 -17.565 1.00 35.00  ? 480  TRP B CZ3 1 
ATOM   7902 C CH2 . TRP B 1 479 ? -0.235  -74.709 -17.602 1.00 33.46  ? 480  TRP B CH2 1 
ATOM   7903 N N   . ALA B 1 480 ? -3.656  -80.365 -22.406 1.00 31.55  ? 481  ALA B N   1 
ATOM   7904 C CA  . ALA B 1 480 ? -4.481  -81.039 -23.417 1.00 35.80  ? 481  ALA B CA  1 
ATOM   7905 C C   . ALA B 1 480 ? -5.731  -81.644 -22.761 1.00 34.08  ? 481  ALA B C   1 
ATOM   7906 O O   . ALA B 1 480 ? -6.802  -81.669 -23.377 1.00 40.22  ? 481  ALA B O   1 
ATOM   7907 C CB  . ALA B 1 480 ? -3.674  -82.103 -24.163 1.00 29.80  ? 481  ALA B CB  1 
ATOM   7908 N N   . ASN B 1 481 ? -5.618  -82.094 -21.506 1.00 36.22  ? 482  ASN B N   1 
ATOM   7909 C CA  . ASN B 1 481 ? -6.830  -82.477 -20.765 1.00 34.97  ? 482  ASN B CA  1 
ATOM   7910 C C   . ASN B 1 481 ? -7.801  -81.297 -20.726 1.00 38.16  ? 482  ASN B C   1 
ATOM   7911 O O   . ASN B 1 481 ? -8.993  -81.436 -21.031 1.00 40.64  ? 482  ASN B O   1 
ATOM   7912 C CB  . ASN B 1 481 ? -6.516  -82.932 -19.336 1.00 41.26  ? 482  ASN B CB  1 
ATOM   7913 C CG  . ASN B 1 481 ? -5.980  -84.350 -19.267 1.00 42.19  ? 482  ASN B CG  1 
ATOM   7914 O OD1 . ASN B 1 481 ? -6.025  -85.103 -20.245 1.00 39.40  ? 482  ASN B OD1 1 
ATOM   7915 N ND2 . ASN B 1 481 ? -5.471  -84.722 -18.103 1.00 39.55  ? 482  ASN B ND2 1 
ATOM   7916 N N   . PHE B 1 482 ? -7.279  -80.127 -20.367 1.00 33.20  ? 483  PHE B N   1 
ATOM   7917 C CA  . PHE B 1 482 ? -8.102  -78.926 -20.334 1.00 31.76  ? 483  PHE B CA  1 
ATOM   7918 C C   . PHE B 1 482 ? -8.723  -78.629 -21.698 1.00 35.91  ? 483  PHE B C   1 
ATOM   7919 O O   . PHE B 1 482 ? -9.923  -78.384 -21.795 1.00 35.13  ? 483  PHE B O   1 
ATOM   7920 C CB  . PHE B 1 482 ? -7.285  -77.714 -19.857 1.00 31.10  ? 483  PHE B CB  1 
ATOM   7921 C CG  . PHE B 1 482 ? -8.087  -76.451 -19.839 1.00 36.88  ? 483  PHE B CG  1 
ATOM   7922 C CD1 . PHE B 1 482 ? -9.022  -76.231 -18.840 1.00 33.72  ? 483  PHE B CD1 1 
ATOM   7923 C CD2 . PHE B 1 482 ? -7.958  -75.513 -20.862 1.00 31.31  ? 483  PHE B CD2 1 
ATOM   7924 C CE1 . PHE B 1 482 ? -9.798  -75.074 -18.840 1.00 34.53  ? 483  PHE B CE1 1 
ATOM   7925 C CE2 . PHE B 1 482 ? -8.731  -74.369 -20.872 1.00 34.11  ? 483  PHE B CE2 1 
ATOM   7926 C CZ  . PHE B 1 482 ? -9.649  -74.145 -19.868 1.00 32.47  ? 483  PHE B CZ  1 
ATOM   7927 N N   . ALA B 1 483 ? -7.905  -78.639 -22.754 1.00 35.06  ? 484  ALA B N   1 
ATOM   7928 C CA  . ALA B 1 483 ? -8.409  -78.442 -24.120 1.00 34.03  ? 484  ALA B CA  1 
ATOM   7929 C C   . ALA B 1 483 ? -9.531  -79.437 -24.480 1.00 34.43  ? 484  ALA B C   1 
ATOM   7930 O O   . ALA B 1 483 ? -10.573 -79.070 -25.034 1.00 34.00  ? 484  ALA B O   1 
ATOM   7931 C CB  . ALA B 1 483 ? -7.256  -78.566 -25.128 1.00 32.64  ? 484  ALA B CB  1 
ATOM   7932 N N   . ARG B 1 484 ? -9.320  -80.704 -24.150 1.00 35.99  ? 485  ARG B N   1 
ATOM   7933 C CA  . ARG B 1 484 ? -10.315 -81.732 -24.447 1.00 44.09  ? 485  ARG B CA  1 
ATOM   7934 C C   . ARG B 1 484 ? -11.582 -81.600 -23.609 1.00 41.19  ? 485  ARG B C   1 
ATOM   7935 O O   . ARG B 1 484 ? -12.688 -81.684 -24.143 1.00 43.20  ? 485  ARG B O   1 
ATOM   7936 C CB  . ARG B 1 484 ? -9.707  -83.126 -24.256 1.00 39.35  ? 485  ARG B CB  1 
ATOM   7937 C CG  . ARG B 1 484 ? -8.705  -83.460 -25.343 1.00 37.24  ? 485  ARG B CG  1 
ATOM   7938 C CD  . ARG B 1 484 ? -8.200  -84.872 -25.203 1.00 43.10  ? 485  ARG B CD  1 
ATOM   7939 N NE  . ARG B 1 484 ? -7.342  -84.996 -24.037 1.00 43.51  ? 485  ARG B NE  1 
ATOM   7940 C CZ  . ARG B 1 484 ? -6.023  -85.030 -24.109 1.00 42.84  ? 485  ARG B CZ  1 
ATOM   7941 N NH1 . ARG B 1 484 ? -5.430  -84.978 -25.297 1.00 38.74  ? 485  ARG B NH1 1 
ATOM   7942 N NH2 . ARG B 1 484 ? -5.303  -85.128 -23.006 1.00 37.76  ? 485  ARG B NH2 1 
ATOM   7943 N N   . THR B 1 485 ? -11.433 -81.362 -22.306 1.00 40.94  ? 486  THR B N   1 
ATOM   7944 C CA  . THR B 1 485 ? -12.581 -81.512 -21.411 1.00 43.60  ? 486  THR B CA  1 
ATOM   7945 C C   . THR B 1 485 ? -12.957 -80.275 -20.603 1.00 50.40  ? 486  THR B C   1 
ATOM   7946 O O   . THR B 1 485 ? -13.992 -80.276 -19.943 1.00 47.14  ? 486  THR B O   1 
ATOM   7947 C CB  . THR B 1 485 ? -12.349 -82.662 -20.403 1.00 46.15  ? 486  THR B CB  1 
ATOM   7948 O OG1 . THR B 1 485 ? -11.349 -82.284 -19.443 1.00 38.64  ? 486  THR B OG1 1 
ATOM   7949 C CG2 . THR B 1 485 ? -11.907 -83.932 -21.124 1.00 40.41  ? 486  THR B CG2 1 
ATOM   7950 N N   . GLY B 1 486 ? -12.132 -79.227 -20.645 1.00 45.90  ? 487  GLY B N   1 
ATOM   7951 C CA  . GLY B 1 486 ? -12.379 -78.034 -19.845 1.00 41.58  ? 487  GLY B CA  1 
ATOM   7952 C C   . GLY B 1 486 ? -11.933 -78.243 -18.407 1.00 46.21  ? 487  GLY B C   1 
ATOM   7953 O O   . GLY B 1 486 ? -12.207 -77.434 -17.517 1.00 43.02  ? 487  GLY B O   1 
ATOM   7954 N N   . ASP B 1 487 ? -11.214 -79.334 -18.184 1.00 39.68  ? 488  ASP B N   1 
ATOM   7955 C CA  . ASP B 1 487 ? -10.773 -79.703 -16.848 1.00 41.76  ? 488  ASP B CA  1 
ATOM   7956 C C   . ASP B 1 487 ? -9.423  -80.374 -17.021 1.00 39.66  ? 488  ASP B C   1 
ATOM   7957 O O   . ASP B 1 487 ? -9.318  -81.350 -17.750 1.00 43.64  ? 488  ASP B O   1 
ATOM   7958 C CB  . ASP B 1 487 ? -11.819 -80.624 -16.195 1.00 48.67  ? 488  ASP B CB  1 
ATOM   7959 C CG  . ASP B 1 487 ? -11.413 -81.158 -14.806 1.00 42.17  ? 488  ASP B CG  1 
ATOM   7960 O OD1 . ASP B 1 487 ? -10.226 -81.121 -14.406 1.00 47.13  ? 488  ASP B OD1 1 
ATOM   7961 O OD2 . ASP B 1 487 ? -12.327 -81.669 -14.121 1.00 48.30  ? 488  ASP B OD2 1 
ATOM   7962 N N   . PRO B 1 488 ? -8.380  -79.834 -16.376 1.00 39.34  ? 489  PRO B N   1 
ATOM   7963 C CA  . PRO B 1 488 ? -7.010  -80.356 -16.527 1.00 38.95  ? 489  PRO B CA  1 
ATOM   7964 C C   . PRO B 1 488 ? -6.768  -81.677 -15.810 1.00 43.96  ? 489  PRO B C   1 
ATOM   7965 O O   . PRO B 1 488 ? -5.723  -82.301 -16.034 1.00 37.04  ? 489  PRO B O   1 
ATOM   7966 C CB  . PRO B 1 488 ? -6.137  -79.259 -15.888 1.00 37.27  ? 489  PRO B CB  1 
ATOM   7967 C CG  . PRO B 1 488 ? -7.061  -78.637 -14.832 1.00 36.65  ? 489  PRO B CG  1 
ATOM   7968 C CD  . PRO B 1 488 ? -8.443  -78.660 -15.477 1.00 38.64  ? 489  PRO B CD  1 
ATOM   7969 N N   . ASN B 1 489 ? -7.691  -82.082 -14.940 1.00 39.87  ? 490  ASN B N   1 
ATOM   7970 C CA  . ASN B 1 489 ? -7.494  -83.304 -14.166 1.00 47.30  ? 490  ASN B CA  1 
ATOM   7971 C C   . ASN B 1 489 ? -7.657  -84.557 -14.991 1.00 49.80  ? 490  ASN B C   1 
ATOM   7972 O O   . ASN B 1 489 ? -8.510  -84.624 -15.873 1.00 50.78  ? 490  ASN B O   1 
ATOM   7973 C CB  . ASN B 1 489 ? -8.456  -83.357 -12.983 1.00 47.97  ? 490  ASN B CB  1 
ATOM   7974 C CG  . ASN B 1 489 ? -8.092  -82.362 -11.931 1.00 41.54  ? 490  ASN B CG  1 
ATOM   7975 O OD1 . ASN B 1 489 ? -7.109  -82.543 -11.224 1.00 45.59  ? 490  ASN B OD1 1 
ATOM   7976 N ND2 . ASN B 1 489 ? -8.843  -81.277 -11.852 1.00 36.09  ? 490  ASN B ND2 1 
ATOM   7977 N N   . GLU B 1 490 ? -6.823  -85.542 -14.684 1.00 61.32  ? 491  GLU B N   1 
ATOM   7978 C CA  . GLU B 1 490 ? -6.831  -86.824 -15.369 1.00 73.11  ? 491  GLU B CA  1 
ATOM   7979 C C   . GLU B 1 490 ? -8.207  -87.479 -15.262 1.00 82.80  ? 491  GLU B C   1 
ATOM   7980 O O   . GLU B 1 490 ? -8.606  -87.918 -14.172 1.00 85.25  ? 491  GLU B O   1 
ATOM   7981 C CB  . GLU B 1 490 ? -5.749  -87.739 -14.787 1.00 77.57  ? 491  GLU B CB  1 
ATOM   7982 C CG  . GLU B 1 490 ? -4.308  -87.256 -14.985 1.00 74.12  ? 491  GLU B CG  1 
ATOM   7983 C CD  . GLU B 1 490 ? -3.670  -87.820 -16.248 1.00 81.95  ? 491  GLU B CD  1 
ATOM   7984 O OE1 . GLU B 1 490 ? -4.352  -87.846 -17.310 1.00 66.85  ? 491  GLU B OE1 1 
ATOM   7985 O OE2 . GLU B 1 490 ? -2.490  -88.250 -16.170 1.00 78.75  ? 491  GLU B OE2 1 
ATOM   7986 N N   . PRO B 1 491 ? -8.944  -87.532 -16.391 1.00 83.29  ? 492  PRO B N   1 
ATOM   7987 C CA  . PRO B 1 491 ? -10.274 -88.137 -16.321 1.00 88.56  ? 492  PRO B CA  1 
ATOM   7988 C C   . PRO B 1 491 ? -10.104 -89.604 -15.959 1.00 101.87 ? 492  PRO B C   1 
ATOM   7989 O O   . PRO B 1 491 ? -9.358  -90.286 -16.673 1.00 105.39 ? 492  PRO B O   1 
ATOM   7990 C CB  . PRO B 1 491 ? -10.837 -87.961 -17.742 1.00 80.84  ? 492  PRO B CB  1 
ATOM   7991 C CG  . PRO B 1 491 ? -9.831  -87.090 -18.491 1.00 71.58  ? 492  PRO B CG  1 
ATOM   7992 C CD  . PRO B 1 491 ? -8.531  -87.265 -17.783 1.00 76.90  ? 492  PRO B CD  1 
ATOM   7993 N N   . ARG B 1 492 ? -10.728 -90.039 -14.858 1.00 95.28  ? 493  ARG B N   1 
ATOM   7994 C CA  . ARG B 1 492 ? -10.695 -91.425 -14.354 1.00 101.88 ? 493  ARG B CA  1 
ATOM   7995 C C   . ARG B 1 492 ? -9.426  -91.805 -13.554 1.00 101.36 ? 493  ARG B C   1 
ATOM   7996 O O   . ARG B 1 492 ? -9.292  -92.961 -13.140 1.00 103.45 ? 493  ARG B O   1 
ATOM   7997 C CB  . ARG B 1 492 ? -10.882 -92.437 -15.503 1.00 103.32 ? 493  ARG B CB  1 
ATOM   7998 C CG  . ARG B 1 492 ? -12.188 -92.305 -16.285 1.00 105.83 ? 493  ARG B CG  1 
ATOM   7999 C CD  . ARG B 1 492 ? -12.178 -93.175 -17.545 1.00 111.55 ? 493  ARG B CD  1 
ATOM   8000 N NE  . ARG B 1 492 ? -12.050 -94.601 -17.240 1.00 117.23 ? 493  ARG B NE  1 
ATOM   8001 C CZ  . ARG B 1 492 ? -11.943 -95.563 -18.156 1.00 119.80 ? 493  ARG B CZ  1 
ATOM   8002 N NH1 . ARG B 1 492 ? -11.944 -95.261 -19.452 1.00 115.10 ? 493  ARG B NH1 1 
ATOM   8003 N NH2 . ARG B 1 492 ? -11.831 -96.832 -17.777 1.00 113.73 ? 493  ARG B NH2 1 
ATOM   8004 N N   . ASP B 1 493 ? -8.507  -90.864 -13.324 1.00 86.42  ? 494  ASP B N   1 
ATOM   8005 C CA  . ASP B 1 493 ? -7.367  -91.135 -12.436 1.00 94.41  ? 494  ASP B CA  1 
ATOM   8006 C C   . ASP B 1 493 ? -7.628  -90.553 -11.041 1.00 101.08 ? 494  ASP B C   1 
ATOM   8007 O O   . ASP B 1 493 ? -7.816  -89.340 -10.893 1.00 100.69 ? 494  ASP B O   1 
ATOM   8008 C CB  . ASP B 1 493 ? -6.065  -90.571 -13.019 1.00 92.20  ? 494  ASP B CB  1 
ATOM   8009 C CG  . ASP B 1 493 ? -4.813  -90.991 -12.231 1.00 99.77  ? 494  ASP B CG  1 
ATOM   8010 O OD1 . ASP B 1 493 ? -4.916  -91.437 -11.060 1.00 98.35  ? 494  ASP B OD1 1 
ATOM   8011 O OD2 . ASP B 1 493 ? -3.703  -90.857 -12.794 1.00 96.49  ? 494  ASP B OD2 1 
ATOM   8012 N N   . PRO B 1 494 ? -7.640  -91.423 -10.013 1.00 98.73  ? 495  PRO B N   1 
ATOM   8013 C CA  . PRO B 1 494 ? -8.000  -91.006 -8.650  1.00 99.98  ? 495  PRO B CA  1 
ATOM   8014 C C   . PRO B 1 494 ? -6.829  -90.856 -7.653  1.00 96.87  ? 495  PRO B C   1 
ATOM   8015 O O   . PRO B 1 494 ? -6.901  -89.965 -6.801  1.00 92.84  ? 495  PRO B O   1 
ATOM   8016 C CB  . PRO B 1 494 ? -8.945  -92.124 -8.207  1.00 93.94  ? 495  PRO B CB  1 
ATOM   8017 C CG  . PRO B 1 494 ? -8.406  -93.355 -8.921  1.00 97.59  ? 495  PRO B CG  1 
ATOM   8018 C CD  . PRO B 1 494 ? -7.657  -92.890 -10.158 1.00 90.14  ? 495  PRO B CD  1 
ATOM   8019 N N   . LYS B 1 495 ? -5.792  -91.691 -7.742  1.00 93.97  ? 496  LYS B N   1 
ATOM   8020 C CA  . LYS B 1 495 ? -4.676  -91.609 -6.795  1.00 89.63  ? 496  LYS B CA  1 
ATOM   8021 C C   . LYS B 1 495 ? -3.749  -90.439 -7.120  1.00 94.45  ? 496  LYS B C   1 
ATOM   8022 O O   . LYS B 1 495 ? -2.840  -90.125 -6.344  1.00 95.91  ? 496  LYS B O   1 
ATOM   8023 C CB  . LYS B 1 495 ? -3.877  -92.917 -6.764  1.00 96.02  ? 496  LYS B CB  1 
ATOM   8024 C CG  . LYS B 1 495 ? -4.398  -93.957 -5.758  1.00 93.40  ? 496  LYS B CG  1 
ATOM   8025 C CD  . LYS B 1 495 ? -3.244  -94.621 -4.985  1.00 95.31  ? 496  LYS B CD  1 
ATOM   8026 C CE  . LYS B 1 495 ? -3.663  -95.948 -4.326  1.00 96.01  ? 496  LYS B CE  1 
ATOM   8027 N NZ  . LYS B 1 495 ? -2.550  -96.619 -3.560  1.00 65.45  ? 496  LYS B NZ  1 
ATOM   8028 N N   . ALA B 1 496 ? -3.984  -89.805 -8.270  1.00 101.92 ? 497  ALA B N   1 
ATOM   8029 C CA  . ALA B 1 496 ? -3.303  -88.561 -8.634  1.00 89.05  ? 497  ALA B CA  1 
ATOM   8030 C C   . ALA B 1 496 ? -3.888  -87.383 -7.848  1.00 84.05  ? 497  ALA B C   1 
ATOM   8031 O O   . ALA B 1 496 ? -5.118  -87.276 -7.702  1.00 75.43  ? 497  ALA B O   1 
ATOM   8032 C CB  . ALA B 1 496 ? -3.412  -88.306 -10.132 1.00 79.32  ? 497  ALA B CB  1 
ATOM   8033 N N   . PRO B 1 497 ? -3.008  -86.502 -7.333  1.00 72.61  ? 498  PRO B N   1 
ATOM   8034 C CA  . PRO B 1 497 ? -3.457  -85.291 -6.631  1.00 75.99  ? 498  PRO B CA  1 
ATOM   8035 C C   . PRO B 1 497 ? -4.333  -84.460 -7.560  1.00 62.24  ? 498  PRO B C   1 
ATOM   8036 O O   . PRO B 1 497 ? -4.020  -84.338 -8.750  1.00 67.68  ? 498  PRO B O   1 
ATOM   8037 C CB  . PRO B 1 497 ? -2.151  -84.561 -6.285  1.00 72.74  ? 498  PRO B CB  1 
ATOM   8038 C CG  . PRO B 1 497 ? -1.064  -85.617 -6.406  1.00 73.88  ? 498  PRO B CG  1 
ATOM   8039 C CD  . PRO B 1 497 ? -1.541  -86.568 -7.460  1.00 68.12  ? 498  PRO B CD  1 
ATOM   8040 N N   . GLN B 1 498 ? -5.429  -83.929 -7.035  1.00 51.38  ? 499  GLN B N   1 
ATOM   8041 C CA  . GLN B 1 498 ? -6.394  -83.240 -7.873  1.00 55.91  ? 499  GLN B CA  1 
ATOM   8042 C C   . GLN B 1 498 ? -6.199  -81.732 -7.878  1.00 57.29  ? 499  GLN B C   1 
ATOM   8043 O O   . GLN B 1 498 ? -5.805  -81.129 -6.886  1.00 45.12  ? 499  GLN B O   1 
ATOM   8044 C CB  . GLN B 1 498 ? -7.812  -83.579 -7.430  1.00 53.20  ? 499  GLN B CB  1 
ATOM   8045 C CG  . GLN B 1 498 ? -8.175  -85.034 -7.690  1.00 67.55  ? 499  GLN B CG  1 
ATOM   8046 C CD  . GLN B 1 498 ? -8.160  -85.386 -9.174  1.00 69.00  ? 499  GLN B CD  1 
ATOM   8047 O OE1 . GLN B 1 498 ? -9.042  -84.964 -9.935  1.00 63.71  ? 499  GLN B OE1 1 
ATOM   8048 N NE2 . GLN B 1 498 ? -7.158  -86.163 -9.592  1.00 66.80  ? 499  GLN B NE2 1 
ATOM   8049 N N   . TRP B 1 499 ? -6.485  -81.136 -9.026  1.00 47.56  ? 500  TRP B N   1 
ATOM   8050 C CA  . TRP B 1 499 ? -6.427  -79.700 -9.213  1.00 42.41  ? 500  TRP B CA  1 
ATOM   8051 C C   . TRP B 1 499 ? -7.838  -79.125 -9.040  1.00 39.89  ? 500  TRP B C   1 
ATOM   8052 O O   . TRP B 1 499 ? -8.711  -79.334 -9.877  1.00 43.63  ? 500  TRP B O   1 
ATOM   8053 C CB  . TRP B 1 499 ? -5.846  -79.419 -10.592 1.00 40.22  ? 500  TRP B CB  1 
ATOM   8054 C CG  . TRP B 1 499 ? -5.515  -78.011 -10.964 1.00 44.26  ? 500  TRP B CG  1 
ATOM   8055 C CD1 . TRP B 1 499 ? -5.968  -76.849 -10.384 1.00 40.60  ? 500  TRP B CD1 1 
ATOM   8056 C CD2 . TRP B 1 499 ? -4.671  -77.618 -12.051 1.00 44.17  ? 500  TRP B CD2 1 
ATOM   8057 N NE1 . TRP B 1 499 ? -5.437  -75.760 -11.043 1.00 41.64  ? 500  TRP B NE1 1 
ATOM   8058 C CE2 . TRP B 1 499 ? -4.646  -76.205 -12.075 1.00 42.19  ? 500  TRP B CE2 1 
ATOM   8059 C CE3 . TRP B 1 499 ? -3.933  -78.328 -13.012 1.00 39.09  ? 500  TRP B CE3 1 
ATOM   8060 C CZ2 . TRP B 1 499 ? -3.900  -75.490 -13.013 1.00 35.89  ? 500  TRP B CZ2 1 
ATOM   8061 C CZ3 . TRP B 1 499 ? -3.188  -77.613 -13.949 1.00 38.71  ? 500  TRP B CZ3 1 
ATOM   8062 C CH2 . TRP B 1 499 ? -3.180  -76.213 -13.944 1.00 36.18  ? 500  TRP B CH2 1 
ATOM   8063 N N   . PRO B 1 500 ? -8.079  -78.427 -7.924  1.00 40.33  ? 501  PRO B N   1 
ATOM   8064 C CA  . PRO B 1 500 ? -9.413  -77.884 -7.652  1.00 40.08  ? 501  PRO B CA  1 
ATOM   8065 C C   . PRO B 1 500 ? -9.619  -76.597 -8.422  1.00 38.12  ? 501  PRO B C   1 
ATOM   8066 O O   . PRO B 1 500 ? -8.630  -75.917 -8.700  1.00 36.04  ? 501  PRO B O   1 
ATOM   8067 C CB  . PRO B 1 500 ? -9.385  -77.613 -6.134  1.00 38.38  ? 501  PRO B CB  1 
ATOM   8068 C CG  . PRO B 1 500 ? -7.969  -77.297 -5.856  1.00 40.17  ? 501  PRO B CG  1 
ATOM   8069 C CD  . PRO B 1 500 ? -7.139  -78.156 -6.823  1.00 38.56  ? 501  PRO B CD  1 
ATOM   8070 N N   . PRO B 1 501 ? -10.872 -76.269 -8.767  1.00 32.80  ? 502  PRO B N   1 
ATOM   8071 C CA  . PRO B 1 501 ? -11.156 -74.976 -9.394  1.00 36.27  ? 502  PRO B CA  1 
ATOM   8072 C C   . PRO B 1 501 ? -10.802 -73.792 -8.497  1.00 44.96  ? 502  PRO B C   1 
ATOM   8073 O O   . PRO B 1 501 ? -10.853 -73.870 -7.262  1.00 40.98  ? 502  PRO B O   1 
ATOM   8074 C CB  . PRO B 1 501 ? -12.678 -75.023 -9.662  1.00 32.81  ? 502  PRO B CB  1 
ATOM   8075 C CG  . PRO B 1 501 ? -13.004 -76.487 -9.730  1.00 38.73  ? 502  PRO B CG  1 
ATOM   8076 C CD  . PRO B 1 501 ? -12.044 -77.168 -8.762  1.00 35.76  ? 502  PRO B CD  1 
ATOM   8077 N N   . TYR B 1 502 ? -10.449 -72.690 -9.145  1.00 40.33  ? 503  TYR B N   1 
ATOM   8078 C CA  . TYR B 1 502 ? -10.227 -71.418 -8.478  1.00 42.51  ? 503  TYR B CA  1 
ATOM   8079 C C   . TYR B 1 502 ? -11.562 -70.710 -8.286  1.00 40.94  ? 503  TYR B C   1 
ATOM   8080 O O   . TYR B 1 502 ? -12.364 -70.627 -9.211  1.00 42.93  ? 503  TYR B O   1 
ATOM   8081 C CB  . TYR B 1 502 ? -9.264  -70.554 -9.298  1.00 34.17  ? 503  TYR B CB  1 
ATOM   8082 C CG  . TYR B 1 502 ? -8.931  -69.211 -8.689  1.00 36.45  ? 503  TYR B CG  1 
ATOM   8083 C CD1 . TYR B 1 502 ? -9.741  -68.103 -8.915  1.00 37.18  ? 503  TYR B CD1 1 
ATOM   8084 C CD2 . TYR B 1 502 ? -7.794  -69.048 -7.911  1.00 29.65  ? 503  TYR B CD2 1 
ATOM   8085 C CE1 . TYR B 1 502 ? -9.442  -66.878 -8.373  1.00 30.77  ? 503  TYR B CE1 1 
ATOM   8086 C CE2 . TYR B 1 502 ? -7.477  -67.825 -7.369  1.00 35.05  ? 503  TYR B CE2 1 
ATOM   8087 C CZ  . TYR B 1 502 ? -8.310  -66.734 -7.609  1.00 37.64  ? 503  TYR B CZ  1 
ATOM   8088 O OH  . TYR B 1 502 ? -8.013  -65.496 -7.072  1.00 36.51  ? 503  TYR B OH  1 
ATOM   8089 N N   . THR B 1 503 ? -11.803 -70.203 -7.080  1.00 37.67  ? 504  THR B N   1 
ATOM   8090 C CA  . THR B 1 503 ? -13.024 -69.454 -6.788  1.00 43.97  ? 504  THR B CA  1 
ATOM   8091 C C   . THR B 1 503 ? -12.647 -68.159 -6.075  1.00 40.16  ? 504  THR B C   1 
ATOM   8092 O O   . THR B 1 503 ? -11.545 -68.063 -5.523  1.00 39.47  ? 504  THR B O   1 
ATOM   8093 C CB  . THR B 1 503 ? -13.972 -70.268 -5.911  1.00 47.52  ? 504  THR B CB  1 
ATOM   8094 O OG1 . THR B 1 503 ? -13.221 -70.770 -4.796  1.00 43.31  ? 504  THR B OG1 1 
ATOM   8095 C CG2 . THR B 1 503 ? -14.523 -71.443 -6.692  1.00 46.53  ? 504  THR B CG2 1 
ATOM   8096 N N   . ALA B 1 504 ? -13.545 -67.174 -6.080  1.00 38.93  ? 505  ALA B N   1 
ATOM   8097 C CA  . ALA B 1 504 ? -13.234 -65.864 -5.504  1.00 43.42  ? 505  ALA B CA  1 
ATOM   8098 C C   . ALA B 1 504 ? -12.986 -65.936 -3.983  1.00 39.68  ? 505  ALA B C   1 
ATOM   8099 O O   . ALA B 1 504 ? -12.135 -65.207 -3.449  1.00 44.64  ? 505  ALA B O   1 
ATOM   8100 C CB  . ALA B 1 504 ? -14.346 -64.875 -5.821  1.00 40.38  ? 505  ALA B CB  1 
ATOM   8101 N N   . GLY B 1 505 ? -13.694 -66.830 -3.293  1.00 40.05  ? 506  GLY B N   1 
ATOM   8102 C CA  . GLY B 1 505 ? -13.462 -67.040 -1.863  1.00 38.75  ? 506  GLY B CA  1 
ATOM   8103 C C   . GLY B 1 505 ? -12.249 -67.889 -1.498  1.00 39.40  ? 506  GLY B C   1 
ATOM   8104 O O   . GLY B 1 505 ? -11.278 -67.387 -0.924  1.00 42.06  ? 506  GLY B O   1 
ATOM   8105 N N   . ALA B 1 506 ? -12.273 -69.179 -1.817  1.00 35.34  ? 507  ALA B N   1 
ATOM   8106 C CA  . ALA B 1 506 ? -11.153 -70.038 -1.426  1.00 36.60  ? 507  ALA B CA  1 
ATOM   8107 C C   . ALA B 1 506 ? -9.860  -69.731 -2.214  1.00 37.11  ? 507  ALA B C   1 
ATOM   8108 O O   . ALA B 1 506 ? -8.763  -70.021 -1.729  1.00 38.51  ? 507  ALA B O   1 
ATOM   8109 C CB  . ALA B 1 506 ? -11.533 -71.531 -1.584  1.00 30.86  ? 507  ALA B CB  1 
ATOM   8110 N N   . GLN B 1 507 ? -9.991  -69.172 -3.422  1.00 39.11  ? 508  GLN B N   1 
ATOM   8111 C CA  . GLN B 1 507 ? -8.823  -68.758 -4.203  1.00 36.77  ? 508  GLN B CA  1 
ATOM   8112 C C   . GLN B 1 507 ? -7.747  -69.849 -4.321  1.00 33.09  ? 508  GLN B C   1 
ATOM   8113 O O   . GLN B 1 507 ? -6.561  -69.573 -4.186  1.00 35.67  ? 508  GLN B O   1 
ATOM   8114 C CB  . GLN B 1 507 ? -8.200  -67.499 -3.574  1.00 38.27  ? 508  GLN B CB  1 
ATOM   8115 C CG  . GLN B 1 507 ? -9.124  -66.261 -3.571  1.00 37.58  ? 508  GLN B CG  1 
ATOM   8116 C CD  . GLN B 1 507 ? -8.694  -65.198 -2.536  1.00 44.10  ? 508  GLN B CD  1 
ATOM   8117 O OE1 . GLN B 1 507 ? -7.729  -64.464 -2.732  1.00 40.74  ? 508  GLN B OE1 1 
ATOM   8118 N NE2 . GLN B 1 507 ? -9.415  -65.130 -1.428  1.00 41.53  ? 508  GLN B NE2 1 
ATOM   8119 N N   . GLN B 1 508 ? -8.153  -71.091 -4.523  1.00 30.40  ? 509  GLN B N   1 
ATOM   8120 C CA  . GLN B 1 508 ? -7.182  -72.183 -4.578  1.00 38.36  ? 509  GLN B CA  1 
ATOM   8121 C C   . GLN B 1 508 ? -6.464  -72.265 -5.929  1.00 37.15  ? 509  GLN B C   1 
ATOM   8122 O O   . GLN B 1 508 ? -7.074  -72.057 -6.966  1.00 31.32  ? 509  GLN B O   1 
ATOM   8123 C CB  . GLN B 1 508 ? -7.873  -73.512 -4.301  1.00 39.28  ? 509  GLN B CB  1 
ATOM   8124 C CG  . GLN B 1 508 ? -8.464  -73.640 -2.896  1.00 45.90  ? 509  GLN B CG  1 
ATOM   8125 C CD  . GLN B 1 508 ? -9.354  -74.860 -2.782  1.00 35.38  ? 509  GLN B CD  1 
ATOM   8126 O OE1 . GLN B 1 508 ? -10.490 -74.864 -3.269  1.00 47.37  ? 509  GLN B OE1 1 
ATOM   8127 N NE2 . GLN B 1 508 ? -8.830  -75.913 -2.180  1.00 43.36  ? 509  GLN B NE2 1 
ATOM   8128 N N   . TYR B 1 509 ? -5.177  -72.585 -5.905  1.00 34.47  ? 510  TYR B N   1 
ATOM   8129 C CA  . TYR B 1 509 ? -4.410  -72.804 -7.124  1.00 39.40  ? 510  TYR B CA  1 
ATOM   8130 C C   . TYR B 1 509 ? -3.398  -73.883 -6.811  1.00 43.43  ? 510  TYR B C   1 
ATOM   8131 O O   . TYR B 1 509 ? -3.190  -74.206 -5.635  1.00 34.32  ? 510  TYR B O   1 
ATOM   8132 C CB  . TYR B 1 509 ? -3.701  -71.533 -7.572  1.00 37.12  ? 510  TYR B CB  1 
ATOM   8133 C CG  . TYR B 1 509 ? -2.620  -71.092 -6.615  1.00 39.50  ? 510  TYR B CG  1 
ATOM   8134 C CD1 . TYR B 1 509 ? -2.905  -70.215 -5.556  1.00 43.41  ? 510  TYR B CD1 1 
ATOM   8135 C CD2 . TYR B 1 509 ? -1.313  -71.555 -6.753  1.00 35.85  ? 510  TYR B CD2 1 
ATOM   8136 C CE1 . TYR B 1 509 ? -1.903  -69.807 -4.672  1.00 35.00  ? 510  TYR B CE1 1 
ATOM   8137 C CE2 . TYR B 1 509 ? -0.324  -71.158 -5.886  1.00 38.48  ? 510  TYR B CE2 1 
ATOM   8138 C CZ  . TYR B 1 509 ? -0.626  -70.286 -4.848  1.00 39.92  ? 510  TYR B CZ  1 
ATOM   8139 O OH  . TYR B 1 509 ? 0.371   -69.896 -4.000  1.00 40.17  ? 510  TYR B OH  1 
ATOM   8140 N N   . VAL B 1 510 ? -2.745  -74.418 -7.841  1.00 31.98  ? 511  VAL B N   1 
ATOM   8141 C CA  . VAL B 1 510 ? -1.691  -75.409 -7.617  1.00 29.17  ? 511  VAL B CA  1 
ATOM   8142 C C   . VAL B 1 510 ? -0.319  -74.920 -8.045  1.00 33.77  ? 511  VAL B C   1 
ATOM   8143 O O   . VAL B 1 510 ? -0.188  -74.052 -8.914  1.00 35.79  ? 511  VAL B O   1 
ATOM   8144 C CB  . VAL B 1 510 ? -2.004  -76.733 -8.357  1.00 34.59  ? 511  VAL B CB  1 
ATOM   8145 C CG1 . VAL B 1 510 ? -3.344  -77.272 -7.892  1.00 31.76  ? 511  VAL B CG1 1 
ATOM   8146 C CG2 . VAL B 1 510 ? -1.970  -76.537 -9.912  1.00 29.16  ? 511  VAL B CG2 1 
ATOM   8147 N N   . SER B 1 511 ? 0.711   -75.470 -7.417  1.00 33.91  ? 512  SER B N   1 
ATOM   8148 C CA  . SER B 1 511 ? 2.084   -75.200 -7.820  1.00 32.00  ? 512  SER B CA  1 
ATOM   8149 C C   . SER B 1 511 ? 2.512   -76.254 -8.841  1.00 40.51  ? 512  SER B C   1 
ATOM   8150 O O   . SER B 1 511 ? 2.305   -77.452 -8.638  1.00 35.11  ? 512  SER B O   1 
ATOM   8151 C CB  . SER B 1 511 ? 3.026   -75.208 -6.607  1.00 39.79  ? 512  SER B CB  1 
ATOM   8152 O OG  . SER B 1 511 ? 3.008   -76.468 -5.959  1.00 46.51  ? 512  SER B OG  1 
ATOM   8153 N N   . LEU B 1 512 ? 3.058   -75.798 -9.962  1.00 36.89  ? 513  LEU B N   1 
ATOM   8154 C CA  . LEU B 1 512 ? 3.578   -76.695 -10.992 1.00 33.75  ? 513  LEU B CA  1 
ATOM   8155 C C   . LEU B 1 512 ? 5.083   -76.746 -10.836 1.00 37.79  ? 513  LEU B C   1 
ATOM   8156 O O   . LEU B 1 512 ? 5.761   -75.736 -11.059 1.00 35.32  ? 513  LEU B O   1 
ATOM   8157 C CB  . LEU B 1 512 ? 3.205   -76.200 -12.392 1.00 32.89  ? 513  LEU B CB  1 
ATOM   8158 C CG  . LEU B 1 512 ? 1.712   -76.028 -12.634 1.00 32.35  ? 513  LEU B CG  1 
ATOM   8159 C CD1 . LEU B 1 512 ? 1.429   -75.497 -14.068 1.00 27.21  ? 513  LEU B CD1 1 
ATOM   8160 C CD2 . LEU B 1 512 ? 1.020   -77.357 -12.366 1.00 30.99  ? 513  LEU B CD2 1 
ATOM   8161 N N   . ASP B 1 513 ? 5.605   -77.893 -10.408 1.00 34.36  ? 514  ASP B N   1 
ATOM   8162 C CA  . ASP B 1 513 ? 7.053   -78.088 -10.326 1.00 37.55  ? 514  ASP B CA  1 
ATOM   8163 C C   . ASP B 1 513 ? 7.326   -79.598 -10.376 1.00 34.42  ? 514  ASP B C   1 
ATOM   8164 O O   . ASP B 1 513 ? 6.435   -80.362 -10.748 1.00 38.05  ? 514  ASP B O   1 
ATOM   8165 C CB  . ASP B 1 513 ? 7.659   -77.408 -9.064  1.00 40.88  ? 514  ASP B CB  1 
ATOM   8166 C CG  . ASP B 1 513 ? 7.089   -77.948 -7.736  1.00 44.01  ? 514  ASP B CG  1 
ATOM   8167 O OD1 . ASP B 1 513 ? 6.399   -78.990 -7.718  1.00 44.87  ? 514  ASP B OD1 1 
ATOM   8168 O OD2 . ASP B 1 513 ? 7.348   -77.320 -6.687  1.00 57.13  ? 514  ASP B OD2 1 
ATOM   8169 N N   . LEU B 1 514 ? 8.531   -80.030 -10.015 1.00 34.57  ? 515  LEU B N   1 
ATOM   8170 C CA  . LEU B 1 514 ? 8.895   -81.451 -10.114 1.00 41.31  ? 515  LEU B CA  1 
ATOM   8171 C C   . LEU B 1 514 ? 8.114   -82.347 -9.142  1.00 47.92  ? 515  LEU B C   1 
ATOM   8172 O O   . LEU B 1 514 ? 7.901   -83.528 -9.424  1.00 56.93  ? 515  LEU B O   1 
ATOM   8173 C CB  . LEU B 1 514 ? 10.398  -81.634 -9.885  1.00 35.23  ? 515  LEU B CB  1 
ATOM   8174 C CG  . LEU B 1 514 ? 11.269  -80.880 -10.883 1.00 45.96  ? 515  LEU B CG  1 
ATOM   8175 C CD1 . LEU B 1 514 ? 12.718  -81.275 -10.734 1.00 39.09  ? 515  LEU B CD1 1 
ATOM   8176 C CD2 . LEU B 1 514 ? 10.766  -81.132 -12.324 1.00 40.01  ? 515  LEU B CD2 1 
ATOM   8177 N N   . ARG B 1 515 ? 7.674   -81.769 -8.024  1.00 39.65  ? 516  ARG B N   1 
ATOM   8178 C CA  . ARG B 1 515 ? 6.897   -82.459 -6.997  1.00 43.17  ? 516  ARG B CA  1 
ATOM   8179 C C   . ARG B 1 515 ? 5.460   -82.598 -7.458  1.00 44.36  ? 516  ARG B C   1 
ATOM   8180 O O   . ARG B 1 515 ? 5.059   -81.926 -8.400  1.00 43.08  ? 516  ARG B O   1 
ATOM   8181 C CB  . ARG B 1 515 ? 6.954   -81.677 -5.670  1.00 46.25  ? 516  ARG B CB  1 
ATOM   8182 C CG  . ARG B 1 515 ? 8.372   -81.272 -5.229  1.00 48.24  ? 516  ARG B CG  1 
ATOM   8183 C CD  . ARG B 1 515 ? 8.335   -80.246 -4.068  1.00 62.90  ? 516  ARG B CD  1 
ATOM   8184 N NE  . ARG B 1 515 ? 7.467   -79.104 -4.387  1.00 66.94  ? 516  ARG B NE  1 
ATOM   8185 C CZ  . ARG B 1 515 ? 6.419   -78.721 -3.655  1.00 71.04  ? 516  ARG B CZ  1 
ATOM   8186 N NH1 . ARG B 1 515 ? 6.122   -79.373 -2.531  1.00 69.86  ? 516  ARG B NH1 1 
ATOM   8187 N NH2 . ARG B 1 515 ? 5.675   -77.678 -4.036  1.00 53.40  ? 516  ARG B NH2 1 
ATOM   8188 N N   . PRO B 1 516 ? 4.671   -83.460 -6.793  1.00 43.26  ? 517  PRO B N   1 
ATOM   8189 C CA  . PRO B 1 516 ? 3.242   -83.543 -7.132  1.00 48.11  ? 517  PRO B CA  1 
ATOM   8190 C C   . PRO B 1 516 ? 2.513   -82.237 -6.861  1.00 46.87  ? 517  PRO B C   1 
ATOM   8191 O O   . PRO B 1 516 ? 3.028   -81.417 -6.104  1.00 44.46  ? 517  PRO B O   1 
ATOM   8192 C CB  . PRO B 1 516 ? 2.714   -84.652 -6.202  1.00 47.98  ? 517  PRO B CB  1 
ATOM   8193 C CG  . PRO B 1 516 ? 3.929   -85.443 -5.826  1.00 43.42  ? 517  PRO B CG  1 
ATOM   8194 C CD  . PRO B 1 516 ? 5.044   -84.441 -5.754  1.00 44.49  ? 517  PRO B CD  1 
ATOM   8195 N N   . LEU B 1 517 ? 1.334   -82.056 -7.456  1.00 45.06  ? 518  LEU B N   1 
ATOM   8196 C CA  . LEU B 1 517 ? 0.533   -80.851 -7.221  1.00 40.93  ? 518  LEU B CA  1 
ATOM   8197 C C   . LEU B 1 517 ? 0.358   -80.575 -5.734  1.00 45.87  ? 518  LEU B C   1 
ATOM   8198 O O   . LEU B 1 517 ? -0.056  -81.444 -4.973  1.00 44.12  ? 518  LEU B O   1 
ATOM   8199 C CB  . LEU B 1 517 ? -0.854  -80.959 -7.855  1.00 39.44  ? 518  LEU B CB  1 
ATOM   8200 C CG  . LEU B 1 517 ? -0.957  -81.102 -9.372  1.00 43.20  ? 518  LEU B CG  1 
ATOM   8201 C CD1 . LEU B 1 517 ? -2.414  -81.100 -9.780  1.00 41.27  ? 518  LEU B CD1 1 
ATOM   8202 C CD2 . LEU B 1 517 ? -0.214  -79.985 -10.072 1.00 38.64  ? 518  LEU B CD2 1 
ATOM   8203 N N   . GLU B 1 518 ? 0.667   -79.352 -5.337  1.00 48.10  ? 519  GLU B N   1 
ATOM   8204 C CA  . GLU B 1 518 ? 0.349   -78.892 -4.001  1.00 45.17  ? 519  GLU B CA  1 
ATOM   8205 C C   . GLU B 1 518 ? -0.713  -77.795 -4.130  1.00 47.38  ? 519  GLU B C   1 
ATOM   8206 O O   . GLU B 1 518 ? -0.560  -76.871 -4.931  1.00 41.24  ? 519  GLU B O   1 
ATOM   8207 C CB  . GLU B 1 518 ? 1.603   -78.388 -3.292  1.00 41.82  ? 519  GLU B CB  1 
ATOM   8208 C CG  . GLU B 1 518 ? 1.359   -77.934 -1.864  1.00 56.84  ? 519  GLU B CG  1 
ATOM   8209 C CD  . GLU B 1 518 ? 2.422   -76.961 -1.376  1.00 66.00  ? 519  GLU B CD  1 
ATOM   8210 O OE1 . GLU B 1 518 ? 3.474   -76.851 -2.046  1.00 70.94  ? 519  GLU B OE1 1 
ATOM   8211 O OE2 . GLU B 1 518 ? 2.195   -76.294 -0.336  1.00 73.50  ? 519  GLU B OE2 1 
ATOM   8212 N N   . VAL B 1 519 ? -1.806  -77.919 -3.377  1.00 41.79  ? 520  VAL B N   1 
ATOM   8213 C CA  . VAL B 1 519 ? -2.870  -76.923 -3.417  1.00 36.49  ? 520  VAL B CA  1 
ATOM   8214 C C   . VAL B 1 519 ? -2.568  -75.805 -2.416  1.00 41.88  ? 520  VAL B C   1 
ATOM   8215 O O   . VAL B 1 519 ? -2.213  -76.071 -1.272  1.00 46.90  ? 520  VAL B O   1 
ATOM   8216 C CB  . VAL B 1 519 ? -4.230  -77.551 -3.122  1.00 39.97  ? 520  VAL B CB  1 
ATOM   8217 C CG1 . VAL B 1 519 ? -5.324  -76.495 -3.122  1.00 33.95  ? 520  VAL B CG1 1 
ATOM   8218 C CG2 . VAL B 1 519 ? -4.533  -78.653 -4.147  1.00 33.34  ? 520  VAL B CG2 1 
ATOM   8219 N N   . ARG B 1 520 ? -2.669  -74.556 -2.866  1.00 36.08  ? 521  ARG B N   1 
ATOM   8220 C CA  . ARG B 1 520 ? -2.427  -73.398 -2.008  1.00 39.31  ? 521  ARG B CA  1 
ATOM   8221 C C   . ARG B 1 520 ? -3.516  -72.373 -2.197  1.00 36.20  ? 521  ARG B C   1 
ATOM   8222 O O   . ARG B 1 520 ? -4.331  -72.501 -3.101  1.00 42.01  ? 521  ARG B O   1 
ATOM   8223 C CB  . ARG B 1 520 ? -1.083  -72.758 -2.300  1.00 38.98  ? 521  ARG B CB  1 
ATOM   8224 C CG  . ARG B 1 520 ? 0.063   -73.726 -2.321  1.00 45.12  ? 521  ARG B CG  1 
ATOM   8225 C CD  . ARG B 1 520 ? 1.348   -72.977 -2.171  1.00 44.55  ? 521  ARG B CD  1 
ATOM   8226 N NE  . ARG B 1 520 ? 2.492   -73.845 -2.391  1.00 53.68  ? 521  ARG B NE  1 
ATOM   8227 C CZ  . ARG B 1 520 ? 3.474   -73.563 -3.235  1.00 47.37  ? 521  ARG B CZ  1 
ATOM   8228 N NH1 . ARG B 1 520 ? 3.432   -72.438 -3.927  1.00 49.05  ? 521  ARG B NH1 1 
ATOM   8229 N NH2 . ARG B 1 520 ? 4.490   -74.398 -3.384  1.00 55.81  ? 521  ARG B NH2 1 
ATOM   8230 N N   . ARG B 1 521 ? -3.515  -71.343 -1.358  1.00 40.33  ? 522  ARG B N   1 
ATOM   8231 C CA  . ARG B 1 521 ? -4.579  -70.340 -1.369  1.00 38.43  ? 522  ARG B CA  1 
ATOM   8232 C C   . ARG B 1 521 ? -4.033  -68.960 -1.632  1.00 43.17  ? 522  ARG B C   1 
ATOM   8233 O O   . ARG B 1 521 ? -3.042  -68.532 -1.005  1.00 39.10  ? 522  ARG B O   1 
ATOM   8234 C CB  . ARG B 1 521 ? -5.335  -70.317 -0.029  1.00 45.21  ? 522  ARG B CB  1 
ATOM   8235 C CG  . ARG B 1 521 ? -6.337  -71.416 0.149   1.00 47.09  ? 522  ARG B CG  1 
ATOM   8236 C CD  . ARG B 1 521 ? -7.284  -71.095 1.301   1.00 41.37  ? 522  ARG B CD  1 
ATOM   8237 N NE  . ARG B 1 521 ? -8.194  -70.020 0.925   1.00 39.79  ? 522  ARG B NE  1 
ATOM   8238 C CZ  . ARG B 1 521 ? -8.573  -69.041 1.738   1.00 47.85  ? 522  ARG B CZ  1 
ATOM   8239 N NH1 . ARG B 1 521 ? -8.130  -68.998 2.994   1.00 47.92  ? 522  ARG B NH1 1 
ATOM   8240 N NH2 . ARG B 1 521 ? -9.403  -68.111 1.295   1.00 35.15  ? 522  ARG B NH2 1 
ATOM   8241 N N   . GLY B 1 522 ? -4.706  -68.266 -2.546  1.00 35.69  ? 523  GLY B N   1 
ATOM   8242 C CA  . GLY B 1 522 ? -4.476  -66.861 -2.798  1.00 35.63  ? 523  GLY B CA  1 
ATOM   8243 C C   . GLY B 1 522 ? -3.330  -66.564 -3.727  1.00 41.16  ? 523  GLY B C   1 
ATOM   8244 O O   . GLY B 1 522 ? -2.196  -66.956 -3.451  1.00 42.20  ? 523  GLY B O   1 
ATOM   8245 N N   . LEU B 1 523 ? -3.636  -65.875 -4.831  1.00 37.24  ? 524  LEU B N   1 
ATOM   8246 C CA  . LEU B 1 523 ? -2.611  -65.402 -5.759  1.00 39.45  ? 524  LEU B CA  1 
ATOM   8247 C C   . LEU B 1 523 ? -2.085  -64.043 -5.319  1.00 35.88  ? 524  LEU B C   1 
ATOM   8248 O O   . LEU B 1 523 ? -2.630  -63.014 -5.749  1.00 37.66  ? 524  LEU B O   1 
ATOM   8249 C CB  . LEU B 1 523 ? -3.176  -65.300 -7.185  1.00 34.24  ? 524  LEU B CB  1 
ATOM   8250 C CG  . LEU B 1 523 ? -3.503  -66.614 -7.909  1.00 38.26  ? 524  LEU B CG  1 
ATOM   8251 C CD1 . LEU B 1 523 ? -4.348  -66.367 -9.166  1.00 33.98  ? 524  LEU B CD1 1 
ATOM   8252 C CD2 . LEU B 1 523 ? -2.218  -67.395 -8.236  1.00 35.66  ? 524  LEU B CD2 1 
ATOM   8253 N N   . ARG B 1 524 ? -1.049  -64.024 -4.475  1.00 41.20  ? 525  ARG B N   1 
ATOM   8254 C CA  . ARG B 1 524 ? -0.575  -62.768 -3.860  1.00 40.57  ? 525  ARG B CA  1 
ATOM   8255 C C   . ARG B 1 524 ? -1.772  -61.918 -3.355  1.00 38.53  ? 525  ARG B C   1 
ATOM   8256 O O   . ARG B 1 524 ? -1.910  -60.716 -3.673  1.00 36.20  ? 525  ARG B O   1 
ATOM   8257 C CB  . ARG B 1 524 ? 0.274   -61.967 -4.858  1.00 43.17  ? 525  ARG B CB  1 
ATOM   8258 C CG  . ARG B 1 524 ? 1.437   -62.741 -5.505  1.00 44.50  ? 525  ARG B CG  1 
ATOM   8259 C CD  . ARG B 1 524 ? 2.724   -62.619 -4.727  1.00 49.21  ? 525  ARG B CD  1 
ATOM   8260 N NE  . ARG B 1 524 ? 3.139   -61.225 -4.570  1.00 54.19  ? 525  ARG B NE  1 
ATOM   8261 C CZ  . ARG B 1 524 ? 3.775   -60.754 -3.497  1.00 51.73  ? 525  ARG B CZ  1 
ATOM   8262 N NH1 . ARG B 1 524 ? 4.084   -61.573 -2.498  1.00 50.51  ? 525  ARG B NH1 1 
ATOM   8263 N NH2 . ARG B 1 524 ? 4.113   -59.470 -3.427  1.00 36.35  ? 525  ARG B NH2 1 
ATOM   8264 N N   . ALA B 1 525 ? -2.658  -62.566 -2.603  1.00 37.99  ? 526  ALA B N   1 
ATOM   8265 C CA  . ALA B 1 525 ? -3.930  -61.965 -2.204  1.00 38.72  ? 526  ALA B CA  1 
ATOM   8266 C C   . ALA B 1 525 ? -3.780  -60.652 -1.435  1.00 37.21  ? 526  ALA B C   1 
ATOM   8267 O O   . ALA B 1 525 ? -4.501  -59.686 -1.755  1.00 36.33  ? 526  ALA B O   1 
ATOM   8268 C CB  . ALA B 1 525 ? -4.759  -62.967 -1.376  1.00 37.47  ? 526  ALA B CB  1 
ATOM   8269 N N   . GLN B 1 526 ? -2.869  -60.582 -0.452  1.00 36.71  ? 527  GLN B N   1 
ATOM   8270 C CA  . GLN B 1 526 ? -2.660  -59.305 0.264   1.00 36.79  ? 527  GLN B CA  1 
ATOM   8271 C C   . GLN B 1 526 ? -2.127  -58.258 -0.680  1.00 35.26  ? 527  GLN B C   1 
ATOM   8272 O O   . GLN B 1 526 ? -2.590  -57.116 -0.676  1.00 38.98  ? 527  GLN B O   1 
ATOM   8273 C CB  . GLN B 1 526 ? -1.676  -59.415 1.444   1.00 34.51  ? 527  GLN B CB  1 
ATOM   8274 C CG  . GLN B 1 526 ? -2.194  -60.083 2.686   1.00 40.29  ? 527  GLN B CG  1 
ATOM   8275 C CD  . GLN B 1 526 ? -3.541  -59.572 3.158   1.00 41.57  ? 527  GLN B CD  1 
ATOM   8276 O OE1 . GLN B 1 526 ? -4.514  -60.321 3.162   1.00 42.34  ? 527  GLN B OE1 1 
ATOM   8277 N NE2 . GLN B 1 526 ? -3.598  -58.316 3.610   1.00 47.80  ? 527  GLN B NE2 1 
ATOM   8278 N N   . ALA B 1 527 ? -1.121  -58.621 -1.472  1.00 35.95  ? 528  ALA B N   1 
ATOM   8279 C CA  . ALA B 1 527 ? -0.558  -57.642 -2.407  1.00 37.27  ? 528  ALA B CA  1 
ATOM   8280 C C   . ALA B 1 527 ? -1.613  -57.183 -3.394  1.00 35.26  ? 528  ALA B C   1 
ATOM   8281 O O   . ALA B 1 527 ? -1.772  -55.994 -3.622  1.00 41.87  ? 528  ALA B O   1 
ATOM   8282 C CB  . ALA B 1 527 ? 0.653   -58.222 -3.161  1.00 42.29  ? 528  ALA B CB  1 
ATOM   8283 N N   . CYS B 1 528 ? -2.352  -58.121 -3.980  1.00 36.57  ? 529  CYS B N   1 
ATOM   8284 C CA  . CYS B 1 528 ? -3.275  -57.747 -5.053  1.00 30.10  ? 529  CYS B CA  1 
ATOM   8285 C C   . CYS B 1 528 ? -4.512  -57.005 -4.557  1.00 35.97  ? 529  CYS B C   1 
ATOM   8286 O O   . CYS B 1 528 ? -5.176  -56.318 -5.348  1.00 32.90  ? 529  CYS B O   1 
ATOM   8287 C CB  . CYS B 1 528 ? -3.657  -58.997 -5.858  1.00 35.56  ? 529  CYS B CB  1 
ATOM   8288 S SG  . CYS B 1 528 ? -2.198  -59.606 -6.768  1.00 33.22  ? 529  CYS B SG  1 
ATOM   8289 N N   . ALA B 1 529 ? -4.825  -57.121 -3.257  1.00 34.32  ? 530  ALA B N   1 
ATOM   8290 C CA  . ALA B 1 529 ? -5.878  -56.277 -2.686  1.00 34.77  ? 530  ALA B CA  1 
ATOM   8291 C C   . ALA B 1 529 ? -5.464  -54.828 -2.821  1.00 30.75  ? 530  ALA B C   1 
ATOM   8292 O O   . ALA B 1 529 ? -6.276  -53.960 -3.100  1.00 33.08  ? 530  ALA B O   1 
ATOM   8293 C CB  . ALA B 1 529 ? -6.143  -56.619 -1.220  1.00 33.48  ? 530  ALA B CB  1 
ATOM   8294 N N   . PHE B 1 530 ? -4.181  -54.561 -2.642  1.00 32.43  ? 531  PHE B N   1 
ATOM   8295 C CA  . PHE B 1 530 ? -3.705  -53.206 -2.851  1.00 33.38  ? 531  PHE B CA  1 
ATOM   8296 C C   . PHE B 1 530 ? -3.915  -52.760 -4.310  1.00 42.11  ? 531  PHE B C   1 
ATOM   8297 O O   . PHE B 1 530 ? -4.490  -51.685 -4.584  1.00 37.75  ? 531  PHE B O   1 
ATOM   8298 C CB  . PHE B 1 530 ? -2.224  -53.096 -2.444  1.00 37.73  ? 531  PHE B CB  1 
ATOM   8299 C CG  . PHE B 1 530 ? -1.582  -51.828 -2.899  1.00 42.68  ? 531  PHE B CG  1 
ATOM   8300 C CD1 . PHE B 1 530 ? -1.740  -50.663 -2.167  1.00 43.34  ? 531  PHE B CD1 1 
ATOM   8301 C CD2 . PHE B 1 530 ? -0.858  -51.784 -4.087  1.00 40.07  ? 531  PHE B CD2 1 
ATOM   8302 C CE1 . PHE B 1 530 ? -1.176  -49.465 -2.595  1.00 46.62  ? 531  PHE B CE1 1 
ATOM   8303 C CE2 . PHE B 1 530 ? -0.298  -50.592 -4.521  1.00 47.22  ? 531  PHE B CE2 1 
ATOM   8304 C CZ  . PHE B 1 530 ? -0.455  -49.432 -3.769  1.00 46.44  ? 531  PHE B CZ  1 
ATOM   8305 N N   . TRP B 1 531 ? -3.481  -53.584 -5.260  1.00 31.14  ? 532  TRP B N   1 
ATOM   8306 C CA  . TRP B 1 531 ? -3.565  -53.166 -6.658  1.00 33.00  ? 532  TRP B CA  1 
ATOM   8307 C C   . TRP B 1 531 ? -4.997  -53.171 -7.178  1.00 33.26  ? 532  TRP B C   1 
ATOM   8308 O O   . TRP B 1 531 ? -5.380  -52.296 -7.969  1.00 38.59  ? 532  TRP B O   1 
ATOM   8309 C CB  . TRP B 1 531 ? -2.664  -54.055 -7.549  1.00 29.45  ? 532  TRP B CB  1 
ATOM   8310 C CG  . TRP B 1 531 ? -1.219  -53.900 -7.209  1.00 32.02  ? 532  TRP B CG  1 
ATOM   8311 C CD1 . TRP B 1 531 ? -0.469  -54.739 -6.448  1.00 28.61  ? 532  TRP B CD1 1 
ATOM   8312 C CD2 . TRP B 1 531 ? -0.367  -52.803 -7.562  1.00 29.65  ? 532  TRP B CD2 1 
ATOM   8313 N NE1 . TRP B 1 531 ? 0.810   -54.249 -6.329  1.00 31.28  ? 532  TRP B NE1 1 
ATOM   8314 C CE2 . TRP B 1 531 ? 0.899   -53.066 -7.007  1.00 25.32  ? 532  TRP B CE2 1 
ATOM   8315 C CE3 . TRP B 1 531 ? -0.546  -51.634 -8.314  1.00 29.54  ? 532  TRP B CE3 1 
ATOM   8316 C CZ2 . TRP B 1 531 ? 1.981   -52.206 -7.173  1.00 27.71  ? 532  TRP B CZ2 1 
ATOM   8317 C CZ3 . TRP B 1 531 ? 0.535   -50.782 -8.479  1.00 28.83  ? 532  TRP B CZ3 1 
ATOM   8318 C CH2 . TRP B 1 531 ? 1.778   -51.069 -7.916  1.00 24.54  ? 532  TRP B CH2 1 
ATOM   8319 N N   . ASN B 1 532 ? -5.798  -54.131 -6.733  1.00 36.26  ? 533  ASN B N   1 
ATOM   8320 C CA  . ASN B 1 532 ? -7.124  -54.308 -7.340  1.00 40.19  ? 533  ASN B CA  1 
ATOM   8321 C C   . ASN B 1 532 ? -8.267  -53.596 -6.614  1.00 46.27  ? 533  ASN B C   1 
ATOM   8322 O O   . ASN B 1 532 ? -9.233  -53.157 -7.241  1.00 45.76  ? 533  ASN B O   1 
ATOM   8323 C CB  . ASN B 1 532 ? -7.420  -55.811 -7.472  1.00 35.51  ? 533  ASN B CB  1 
ATOM   8324 C CG  . ASN B 1 532 ? -6.494  -56.482 -8.488  1.00 37.15  ? 533  ASN B CG  1 
ATOM   8325 O OD1 . ASN B 1 532 ? -6.028  -55.827 -9.418  1.00 38.12  ? 533  ASN B OD1 1 
ATOM   8326 N ND2 . ASN B 1 532 ? -6.215  -57.779 -8.310  1.00 32.10  ? 533  ASN B ND2 1 
ATOM   8327 N N   . ARG B 1 533 ? -8.144  -53.438 -5.300  1.00 42.07  ? 534  ARG B N   1 
ATOM   8328 C CA  . ARG B 1 533 ? -9.218  -52.829 -4.526  1.00 48.61  ? 534  ARG B CA  1 
ATOM   8329 C C   . ARG B 1 533 ? -8.964  -51.367 -4.127  1.00 52.98  ? 534  ARG B C   1 
ATOM   8330 O O   . ARG B 1 533 ? -9.806  -50.507 -4.368  1.00 54.73  ? 534  ARG B O   1 
ATOM   8331 C CB  . ARG B 1 533 ? -9.484  -53.679 -3.288  1.00 41.68  ? 534  ARG B CB  1 
ATOM   8332 C CG  . ARG B 1 533 ? -9.887  -55.075 -3.672  1.00 41.77  ? 534  ARG B CG  1 
ATOM   8333 C CD  . ARG B 1 533 ? -9.982  -55.982 -2.488  1.00 44.01  ? 534  ARG B CD  1 
ATOM   8334 N NE  . ARG B 1 533 ? -10.214 -57.357 -2.904  1.00 46.39  ? 534  ARG B NE  1 
ATOM   8335 C CZ  . ARG B 1 533 ? -11.423 -57.883 -3.076  1.00 53.55  ? 534  ARG B CZ  1 
ATOM   8336 N NH1 . ARG B 1 533 ? -12.501 -57.132 -2.872  1.00 45.87  ? 534  ARG B NH1 1 
ATOM   8337 N NH2 . ARG B 1 533 ? -11.553 -59.148 -3.465  1.00 53.77  ? 534  ARG B NH2 1 
ATOM   8338 N N   . PHE B 1 534 ? -7.819  -51.078 -3.517  1.00 52.15  ? 535  PHE B N   1 
ATOM   8339 C CA  . PHE B 1 534 ? -7.545  -49.706 -3.078  1.00 51.84  ? 535  PHE B CA  1 
ATOM   8340 C C   . PHE B 1 534 ? -7.098  -48.722 -4.167  1.00 55.87  ? 535  PHE B C   1 
ATOM   8341 O O   . PHE B 1 534 ? -7.730  -47.687 -4.380  1.00 53.56  ? 535  PHE B O   1 
ATOM   8342 C CB  . PHE B 1 534 ? -6.484  -49.685 -1.998  1.00 37.97  ? 535  PHE B CB  1 
ATOM   8343 C CG  . PHE B 1 534 ? -6.115  -48.293 -1.569  1.00 51.01  ? 535  PHE B CG  1 
ATOM   8344 C CD1 . PHE B 1 534 ? -7.029  -47.505 -0.869  1.00 48.37  ? 535  PHE B CD1 1 
ATOM   8345 C CD2 . PHE B 1 534 ? -4.867  -47.759 -1.872  1.00 50.93  ? 535  PHE B CD2 1 
ATOM   8346 C CE1 . PHE B 1 534 ? -6.705  -46.210 -0.471  1.00 46.69  ? 535  PHE B CE1 1 
ATOM   8347 C CE2 . PHE B 1 534 ? -4.528  -46.466 -1.474  1.00 55.06  ? 535  PHE B CE2 1 
ATOM   8348 C CZ  . PHE B 1 534 ? -5.445  -45.688 -0.768  1.00 49.66  ? 535  PHE B CZ  1 
ATOM   8349 N N   . LEU B 1 535 ? -5.989  -49.036 -4.826  1.00 50.77  ? 536  LEU B N   1 
ATOM   8350 C CA  . LEU B 1 535 ? -5.359  -48.094 -5.736  1.00 63.62  ? 536  LEU B CA  1 
ATOM   8351 C C   . LEU B 1 535 ? -6.305  -47.446 -6.764  1.00 65.33  ? 536  LEU B C   1 
ATOM   8352 O O   . LEU B 1 535 ? -6.113  -46.274 -7.115  1.00 65.22  ? 536  LEU B O   1 
ATOM   8353 C CB  . LEU B 1 535 ? -4.207  -48.771 -6.478  1.00 66.35  ? 536  LEU B CB  1 
ATOM   8354 C CG  . LEU B 1 535 ? -3.282  -47.766 -7.169  1.00 66.64  ? 536  LEU B CG  1 
ATOM   8355 C CD1 . LEU B 1 535 ? -2.074  -47.503 -6.285  1.00 69.64  ? 536  LEU B CD1 1 
ATOM   8356 C CD2 . LEU B 1 535 ? -2.877  -48.226 -8.554  1.00 61.31  ? 536  LEU B CD2 1 
ATOM   8357 N N   . PRO B 1 536 ? -7.323  -48.185 -7.256  1.00 62.43  ? 537  PRO B N   1 
ATOM   8358 C CA  . PRO B 1 536 ? -8.167  -47.454 -8.220  1.00 68.02  ? 537  PRO B CA  1 
ATOM   8359 C C   . PRO B 1 536 ? -9.037  -46.378 -7.555  1.00 69.07  ? 537  PRO B C   1 
ATOM   8360 O O   . PRO B 1 536 ? -9.404  -45.403 -8.223  1.00 64.87  ? 537  PRO B O   1 
ATOM   8361 C CB  . PRO B 1 536 ? -9.041  -48.554 -8.845  1.00 61.85  ? 537  PRO B CB  1 
ATOM   8362 C CG  . PRO B 1 536 ? -8.312  -49.857 -8.538  1.00 62.49  ? 537  PRO B CG  1 
ATOM   8363 C CD  . PRO B 1 536 ? -7.653  -49.625 -7.210  1.00 49.33  ? 537  PRO B CD  1 
ATOM   8364 N N   . LYS B 1 537 ? -9.347  -46.550 -6.267  1.00 59.61  ? 538  LYS B N   1 
ATOM   8365 C CA  . LYS B 1 537 ? -10.141 -45.572 -5.528  1.00 58.19  ? 538  LYS B CA  1 
ATOM   8366 C C   . LYS B 1 537 ? -9.345  -44.285 -5.340  1.00 63.94  ? 538  LYS B C   1 
ATOM   8367 O O   . LYS B 1 537 ? -9.897  -43.182 -5.322  1.00 65.91  ? 538  LYS B O   1 
ATOM   8368 C CB  . LYS B 1 537 ? -10.582 -46.155 -4.181  1.00 59.79  ? 538  LYS B CB  1 
ATOM   8369 C CG  . LYS B 1 537 ? -11.614 -47.259 -4.334  1.00 61.33  ? 538  LYS B CG  1 
ATOM   8370 C CD  . LYS B 1 537 ? -12.079 -47.818 -2.997  1.00 71.09  ? 538  LYS B CD  1 
ATOM   8371 C CE  . LYS B 1 537 ? -13.213 -48.825 -3.200  1.00 75.08  ? 538  LYS B CE  1 
ATOM   8372 N NZ  . LYS B 1 537 ? -12.803 -49.992 -4.041  1.00 71.67  ? 538  LYS B NZ  1 
ATOM   8373 N N   . LEU B 1 538 ? -8.033  -44.447 -5.225  1.00 64.28  ? 539  LEU B N   1 
ATOM   8374 C CA  . LEU B 1 538 ? -7.117  -43.328 -5.105  1.00 67.22  ? 539  LEU B CA  1 
ATOM   8375 C C   . LEU B 1 538 ? -7.004  -42.562 -6.420  1.00 73.23  ? 539  LEU B C   1 
ATOM   8376 O O   . LEU B 1 538 ? -6.665  -41.380 -6.412  1.00 78.96  ? 539  LEU B O   1 
ATOM   8377 C CB  . LEU B 1 538 ? -5.745  -43.827 -4.650  1.00 69.20  ? 539  LEU B CB  1 
ATOM   8378 C CG  . LEU B 1 538 ? -4.549  -42.880 -4.557  1.00 59.34  ? 539  LEU B CG  1 
ATOM   8379 C CD1 . LEU B 1 538 ? -3.630  -43.360 -3.457  1.00 63.49  ? 539  LEU B CD1 1 
ATOM   8380 C CD2 . LEU B 1 538 ? -3.794  -42.833 -5.878  1.00 71.39  ? 539  LEU B CD2 1 
ATOM   8381 N N   . LEU B 1 539 ? -7.274  -43.229 -7.544  1.00 77.29  ? 540  LEU B N   1 
ATOM   8382 C CA  . LEU B 1 539 ? -7.310  -42.551 -8.848  1.00 80.67  ? 540  LEU B CA  1 
ATOM   8383 C C   . LEU B 1 539 ? -8.477  -41.563 -8.941  1.00 79.16  ? 540  LEU B C   1 
ATOM   8384 O O   . LEU B 1 539 ? -8.318  -40.449 -9.444  1.00 84.88  ? 540  LEU B O   1 
ATOM   8385 C CB  . LEU B 1 539 ? -7.423  -43.554 -10.000 1.00 83.86  ? 540  LEU B CB  1 
ATOM   8386 C CG  . LEU B 1 539 ? -6.350  -44.615 -10.240 1.00 84.55  ? 540  LEU B CG  1 
ATOM   8387 C CD1 . LEU B 1 539 ? -6.710  -45.410 -11.507 1.00 82.24  ? 540  LEU B CD1 1 
ATOM   8388 C CD2 . LEU B 1 539 ? -4.946  -44.005 -10.327 1.00 73.77  ? 540  LEU B CD2 1 
ATOM   8389 N N   . SER B 1 540 ? -9.645  -41.989 -8.462  1.00 75.19  ? 541  SER B N   1 
ATOM   8390 C CA  . SER B 1 540 ? -10.855 -41.163 -8.467  1.00 86.02  ? 541  SER B CA  1 
ATOM   8391 C C   . SER B 1 540 ? -10.779 -39.898 -7.577  1.00 93.75  ? 541  SER B C   1 
ATOM   8392 O O   . SER B 1 540 ? -11.356 -38.860 -7.920  1.00 95.73  ? 541  SER B O   1 
ATOM   8393 C CB  . SER B 1 540 ? -12.057 -42.011 -8.037  1.00 83.67  ? 541  SER B CB  1 
ATOM   8394 O OG  . SER B 1 540 ? -12.141 -43.198 -8.806  1.00 85.18  ? 541  SER B OG  1 
ATOM   8395 N N   . ALA B 1 541 ? -10.080 -39.986 -6.444  1.00 88.76  ? 542  ALA B N   1 
ATOM   8396 C CA  . ALA B 1 541 ? -9.987  -38.865 -5.506  1.00 84.99  ? 542  ALA B CA  1 
ATOM   8397 C C   . ALA B 1 541 ? -8.685  -38.076 -5.663  1.00 82.96  ? 542  ALA B C   1 
ATOM   8398 O O   . ALA B 1 541 ? -7.914  -38.299 -6.600  1.00 82.97  ? 542  ALA B O   1 
ATOM   8399 C CB  . ALA B 1 541 ? -10.129 -39.369 -4.074  1.00 73.06  ? 542  ALA B CB  1 
HETATM 8400 C C1  . NAG C 2 .   ? -22.884 -59.160 21.983  1.00 58.98  ? 1    NAG C C1  1 
HETATM 8401 C C2  . NAG C 2 .   ? -23.785 -59.698 20.868  1.00 65.49  ? 1    NAG C C2  1 
HETATM 8402 C C3  . NAG C 2 .   ? -24.182 -58.575 19.917  1.00 62.70  ? 1    NAG C C3  1 
HETATM 8403 C C4  . NAG C 2 .   ? -24.758 -57.399 20.692  1.00 65.97  ? 1    NAG C C4  1 
HETATM 8404 C C5  . NAG C 2 .   ? -23.803 -56.985 21.810  1.00 60.81  ? 1    NAG C C5  1 
HETATM 8405 C C6  . NAG C 2 .   ? -24.351 -55.889 22.700  1.00 69.64  ? 1    NAG C C6  1 
HETATM 8406 C C7  . NAG C 2 .   ? -23.745 -61.951 19.884  1.00 77.04  ? 1    NAG C C7  1 
HETATM 8407 C C8  . NAG C 2 .   ? -25.151 -62.100 20.391  1.00 76.04  ? 1    NAG C C8  1 
HETATM 8408 N N2  . NAG C 2 .   ? -23.143 -60.782 20.141  1.00 67.55  ? 1    NAG C N2  1 
HETATM 8409 O O3  . NAG C 2 .   ? -25.159 -59.064 19.006  1.00 71.84  ? 1    NAG C O3  1 
HETATM 8410 O O4  . NAG C 2 .   ? -24.970 -56.314 19.797  1.00 80.68  ? 1    NAG C O4  1 
HETATM 8411 O O5  . NAG C 2 .   ? -23.543 -58.114 22.658  1.00 54.18  ? 1    NAG C O5  1 
HETATM 8412 O O6  . NAG C 2 .   ? -25.735 -56.076 22.969  1.00 79.46  ? 1    NAG C O6  1 
HETATM 8413 O O7  . NAG C 2 .   ? -23.180 -62.849 19.267  1.00 84.39  ? 1    NAG C O7  1 
HETATM 8414 C C1  . NAG C 2 .   ? -26.364 -55.940 19.842  1.00 82.63  ? 2    NAG C C1  1 
HETATM 8415 C C2  . NAG C 2 .   ? -26.478 -54.473 19.442  1.00 85.55  ? 2    NAG C C2  1 
HETATM 8416 C C3  . NAG C 2 .   ? -27.938 -54.029 19.505  1.00 94.85  ? 2    NAG C C3  1 
HETATM 8417 C C4  . NAG C 2 .   ? -28.819 -54.959 18.673  1.00 97.95  ? 2    NAG C C4  1 
HETATM 8418 C C5  . NAG C 2 .   ? -28.567 -56.431 19.029  1.00 99.81  ? 2    NAG C C5  1 
HETATM 8419 C C6  . NAG C 2 .   ? -29.267 -57.395 18.095  1.00 99.56  ? 2    NAG C C6  1 
HETATM 8420 C C7  . NAG C 2 .   ? -24.577 -52.965 19.818  1.00 79.56  ? 2    NAG C C7  1 
HETATM 8421 C C8  . NAG C 2 .   ? -23.833 -52.133 20.820  1.00 65.15  ? 2    NAG C C8  1 
HETATM 8422 N N2  . NAG C 2 .   ? -25.644 -53.627 20.282  1.00 81.40  ? 2    NAG C N2  1 
HETATM 8423 O O3  . NAG C 2 .   ? -28.044 -52.686 19.041  1.00 83.49  ? 2    NAG C O3  1 
HETATM 8424 O O4  . NAG C 2 .   ? -30.194 -54.650 18.886  1.00 86.75  ? 2    NAG C O4  1 
HETATM 8425 O O5  . NAG C 2 .   ? -27.165 -56.740 18.956  1.00 96.52  ? 2    NAG C O5  1 
HETATM 8426 O O6  . NAG C 2 .   ? -30.636 -57.055 17.922  1.00 101.30 ? 2    NAG C O6  1 
HETATM 8427 O O7  . NAG C 2 .   ? -24.229 -53.034 18.638  1.00 74.43  ? 2    NAG C O7  1 
HETATM 8428 C C1  . FUC C 2 .   ? -26.043 -55.968 24.384  1.00 71.92  ? 3    FUC C C1  1 
HETATM 8429 C C2  . FUC C 2 .   ? -27.578 -56.230 24.556  1.00 73.08  ? 3    FUC C C2  1 
HETATM 8430 C C3  . FUC C 2 .   ? -27.923 -57.736 24.471  1.00 82.88  ? 3    FUC C C3  1 
HETATM 8431 C C4  . FUC C 2 .   ? -27.071 -58.552 25.444  1.00 80.60  ? 3    FUC C C4  1 
HETATM 8432 C C5  . FUC C 2 .   ? -25.582 -58.291 25.136  1.00 74.03  ? 3    FUC C C5  1 
HETATM 8433 C C6  . FUC C 2 .   ? -24.607 -59.043 26.052  1.00 59.21  ? 3    FUC C C6  1 
HETATM 8434 O O2  . FUC C 2 .   ? -28.338 -55.514 23.592  1.00 79.40  ? 3    FUC C O2  1 
HETATM 8435 O O3  . FUC C 2 .   ? -29.285 -57.967 24.806  1.00 89.20  ? 3    FUC C O3  1 
HETATM 8436 O O4  . FUC C 2 .   ? -27.394 -58.185 26.779  1.00 83.42  ? 3    FUC C O4  1 
HETATM 8437 O O5  . FUC C 2 .   ? -25.254 -56.858 25.193  1.00 68.07  ? 3    FUC C O5  1 
HETATM 8438 C C1  . NAG D 2 .   ? 25.357  -54.142 -11.377 1.00 60.62  ? 1    NAG D C1  1 
HETATM 8439 C C2  . NAG D 2 .   ? 26.138  -53.030 -10.684 1.00 66.36  ? 1    NAG D C2  1 
HETATM 8440 C C3  . NAG D 2 .   ? 25.491  -51.688 -10.968 1.00 62.84  ? 1    NAG D C3  1 
HETATM 8441 C C4  . NAG D 2 .   ? 25.455  -51.449 -12.471 1.00 71.12  ? 1    NAG D C4  1 
HETATM 8442 C C5  . NAG D 2 .   ? 24.736  -52.614 -13.170 1.00 65.89  ? 1    NAG D C5  1 
HETATM 8443 C C6  . NAG D 2 .   ? 24.815  -52.559 -14.684 1.00 77.30  ? 1    NAG D C6  1 
HETATM 8444 C C7  . NAG D 2 .   ? 27.425  -53.554 -8.669  1.00 80.54  ? 1    NAG D C7  1 
HETATM 8445 C C8  . NAG D 2 .   ? 28.620  -53.640 -9.584  1.00 75.09  ? 1    NAG D C8  1 
HETATM 8446 N N2  . NAG D 2 .   ? 26.257  -53.258 -9.253  1.00 69.17  ? 1    NAG D N2  1 
HETATM 8447 O O3  . NAG D 2 .   ? 26.216  -50.653 -10.313 1.00 75.57  ? 1    NAG D O3  1 
HETATM 8448 O O4  . NAG D 2 .   ? 24.797  -50.211 -12.726 1.00 77.80  ? 1    NAG D O4  1 
HETATM 8449 O O5  . NAG D 2 .   ? 25.305  -53.880 -12.786 1.00 56.30  ? 1    NAG D O5  1 
HETATM 8450 O O6  . NAG D 2 .   ? 26.074  -52.072 -15.136 1.00 84.24  ? 1    NAG D O6  1 
HETATM 8451 O O7  . NAG D 2 .   ? 27.516  -53.752 -7.459  1.00 83.07  ? 1    NAG D O7  1 
HETATM 8452 C C1  . NAG D 2 .   ? 25.607  -49.309 -13.538 1.00 84.15  ? 2    NAG D C1  1 
HETATM 8453 C C2  . NAG D 2 .   ? 24.685  -48.215 -14.100 1.00 81.86  ? 2    NAG D C2  1 
HETATM 8454 C C3  . NAG D 2 .   ? 25.484  -47.250 -14.983 1.00 91.54  ? 2    NAG D C3  1 
HETATM 8455 C C4  . NAG D 2 .   ? 26.697  -46.711 -14.230 1.00 93.10  ? 2    NAG D C4  1 
HETATM 8456 C C5  . NAG D 2 .   ? 27.532  -47.862 -13.666 1.00 91.89  ? 2    NAG D C5  1 
HETATM 8457 C C6  . NAG D 2 .   ? 28.710  -47.397 -12.838 1.00 83.01  ? 2    NAG D C6  1 
HETATM 8458 C C7  . NAG D 2 .   ? 22.353  -48.933 -14.343 1.00 73.20  ? 2    NAG D C7  1 
HETATM 8459 C C8  . NAG D 2 .   ? 21.338  -49.570 -15.245 1.00 64.17  ? 2    NAG D C8  1 
HETATM 8460 N N2  . NAG D 2 .   ? 23.584  -48.803 -14.847 1.00 78.37  ? 2    NAG D N2  1 
HETATM 8461 O O3  . NAG D 2 .   ? 24.644  -46.178 -15.406 1.00 82.43  ? 2    NAG D O3  1 
HETATM 8462 O O4  . NAG D 2 .   ? 27.510  -45.920 -15.092 1.00 82.29  ? 2    NAG D O4  1 
HETATM 8463 O O5  . NAG D 2 .   ? 26.716  -48.690 -12.819 1.00 93.58  ? 2    NAG D O5  1 
HETATM 8464 O O6  . NAG D 2 .   ? 28.419  -47.417 -11.446 1.00 87.88  ? 2    NAG D O6  1 
HETATM 8465 O O7  . NAG D 2 .   ? 22.071  -48.552 -13.208 1.00 66.03  ? 2    NAG D O7  1 
HETATM 8466 C C1  . FUC D 2 .   ? 26.720  -52.910 -16.129 1.00 79.09  ? 3    FUC D C1  1 
HETATM 8467 C C2  . FUC D 2 .   ? 28.159  -52.313 -16.356 1.00 83.11  ? 3    FUC D C2  1 
HETATM 8468 C C3  . FUC D 2 .   ? 29.143  -52.692 -15.217 1.00 86.21  ? 3    FUC D C3  1 
HETATM 8469 C C4  . FUC D 2 .   ? 29.134  -54.203 -14.959 1.00 88.61  ? 3    FUC D C4  1 
HETATM 8470 C C5  . FUC D 2 .   ? 27.692  -54.662 -14.679 1.00 75.29  ? 3    FUC D C5  1 
HETATM 8471 C C6  . FUC D 2 .   ? 27.553  -56.168 -14.438 1.00 66.57  ? 3    FUC D C6  1 
HETATM 8472 O O2  . FUC D 2 .   ? 28.124  -50.893 -16.528 1.00 77.47  ? 3    FUC D O2  1 
HETATM 8473 O O3  . FUC D 2 .   ? 30.485  -52.330 -15.560 1.00 89.98  ? 3    FUC D O3  1 
HETATM 8474 O O4  . FUC D 2 .   ? 29.685  -54.893 -16.087 1.00 88.89  ? 3    FUC D O4  1 
HETATM 8475 O O5  . FUC D 2 .   ? 26.771  -54.296 -15.759 1.00 75.18  ? 3    FUC D O5  1 
HETATM 8476 C C1  . DEP E 3 .   ? -7.523  -41.856 24.797  1.00 42.23  ? 604  DEP A C1  1 
HETATM 8477 C C2  . DEP E 3 .   ? -6.469  -42.881 24.473  1.00 38.14  ? 604  DEP A C2  1 
HETATM 8478 C C3  . DEP E 3 .   ? -8.953  -42.903 28.443  1.00 43.77  ? 604  DEP A C3  1 
HETATM 8479 C C4  . DEP E 3 .   ? -10.009 -42.002 27.829  1.00 41.76  ? 604  DEP A C4  1 
HETATM 8480 O O1  . DEP E 3 .   ? -7.134  -41.068 25.936  1.00 46.44  ? 604  DEP A O1  1 
HETATM 8481 O O2  . DEP E 3 .   ? -7.877  -42.875 27.539  1.00 42.70  ? 604  DEP A O2  1 
HETATM 8482 O O3  . DEP E 3 .   ? -7.090  -40.632 28.507  1.00 34.52  ? 604  DEP A O3  1 
HETATM 8483 P P   . DEP E 3 .   ? -6.887  -41.654 27.445  1.00 39.88  ? 604  DEP A P   1 
HETATM 8484 C C1  . EDO F 4 .   ? -9.577  -59.030 9.566   0.98 41.21  ? 605  EDO A C1  1 
HETATM 8485 O O1  . EDO F 4 .   ? -8.233  -58.615 9.369   0.98 34.69  ? 605  EDO A O1  1 
HETATM 8486 C C2  . EDO F 4 .   ? -9.777  -60.350 8.833   0.98 48.74  ? 605  EDO A C2  1 
HETATM 8487 O O2  . EDO F 4 .   ? -9.919  -60.089 7.432   0.98 36.82  ? 605  EDO A O2  1 
HETATM 8488 C C1  . EDO G 4 .   ? 8.758   -47.377 11.769  0.97 43.44  ? 606  EDO A C1  1 
HETATM 8489 O O1  . EDO G 4 .   ? 9.781   -46.514 11.235  0.97 45.93  ? 606  EDO A O1  1 
HETATM 8490 C C2  . EDO G 4 .   ? 7.516   -47.395 10.865  0.97 38.97  ? 606  EDO A C2  1 
HETATM 8491 O O2  . EDO G 4 .   ? 6.991   -46.070 10.632  0.97 37.25  ? 606  EDO A O2  1 
HETATM 8492 C C1  . NAG H 5 .   ? -8.579  -35.724 -46.317 1.00 82.26  ? 604  NAG B C1  1 
HETATM 8493 C C2  . NAG H 5 .   ? -10.103 -35.415 -46.225 1.00 81.42  ? 604  NAG B C2  1 
HETATM 8494 C C3  . NAG H 5 .   ? -10.822 -35.316 -47.609 1.00 83.29  ? 604  NAG B C3  1 
HETATM 8495 C C4  . NAG H 5 .   ? -10.110 -35.951 -48.812 1.00 85.54  ? 604  NAG B C4  1 
HETATM 8496 C C5  . NAG H 5 .   ? -8.684  -36.391 -48.522 1.00 91.48  ? 604  NAG B C5  1 
HETATM 8497 C C6  . NAG H 5 .   ? -7.782  -36.409 -49.741 1.00 82.44  ? 604  NAG B C6  1 
HETATM 8498 C C7  . NAG H 5 .   ? -11.696 -35.940 -44.427 1.00 91.29  ? 604  NAG B C7  1 
HETATM 8499 C C8  . NAG H 5 .   ? -12.332 -37.022 -43.601 1.00 78.70  ? 604  NAG B C8  1 
HETATM 8500 N N2  . NAG H 5 .   ? -10.799 -36.342 -45.342 1.00 85.87  ? 604  NAG B N2  1 
HETATM 8501 O O3  . NAG H 5 .   ? -11.150 -33.957 -47.883 1.00 93.80  ? 604  NAG B O3  1 
HETATM 8502 O O4  . NAG H 5 .   ? -10.874 -37.032 -49.338 1.00 84.20  ? 604  NAG B O4  1 
HETATM 8503 O O5  . NAG H 5 .   ? -8.119  -35.466 -47.597 1.00 89.83  ? 604  NAG B O5  1 
HETATM 8504 O O6  . NAG H 5 .   ? -8.243  -35.561 -50.785 1.00 91.81  ? 604  NAG B O6  1 
HETATM 8505 O O7  . NAG H 5 .   ? -11.981 -34.754 -44.271 1.00 86.98  ? 604  NAG B O7  1 
HETATM 8506 O O1  . PE8 I 6 .   ? -19.072 -44.769 -33.227 0.93 77.79  ? 605  PE8 B O1  1 
HETATM 8507 C C2  . PE8 I 6 .   ? -19.159 -44.070 -31.962 0.93 75.26  ? 605  PE8 B C2  1 
HETATM 8508 C C3  . PE8 I 6 .   ? -18.227 -42.853 -31.963 0.93 67.01  ? 605  PE8 B C3  1 
HETATM 8509 O O4  . PE8 I 6 .   ? -16.960 -43.211 -31.379 0.93 65.87  ? 605  PE8 B O4  1 
HETATM 8510 C C5  . PE8 I 6 .   ? -15.861 -42.747 -32.161 0.93 64.81  ? 605  PE8 B C5  1 
HETATM 8511 C C6  . PE8 I 6 .   ? -14.668 -43.697 -31.998 0.93 61.20  ? 605  PE8 B C6  1 
HETATM 8512 O O7  . PE8 I 6 .   ? -14.397 -44.346 -33.284 0.93 56.00  ? 605  PE8 B O7  1 
HETATM 8513 C C8  . PE8 I 6 .   ? -13.904 -45.677 -33.178 0.93 47.11  ? 605  PE8 B C8  1 
HETATM 8514 C C9  . PE8 I 6 .   ? -14.342 -46.537 -34.420 0.93 49.99  ? 605  PE8 B C9  1 
HETATM 8515 O O10 . PE8 I 6 .   ? -15.547 -47.199 -34.100 0.93 64.52  ? 605  PE8 B O10 1 
HETATM 8516 C C11 . PE8 I 6 .   ? -15.957 -48.187 -35.068 0.93 62.23  ? 605  PE8 B C11 1 
HETATM 8517 C C12 . PE8 I 6 .   ? -17.400 -48.666 -34.831 0.93 61.61  ? 605  PE8 B C12 1 
HETATM 8518 O O13 . PE8 I 6 .   ? -17.881 -48.229 -33.555 0.93 72.28  ? 605  PE8 B O13 1 
HETATM 8519 C C14 . PE8 I 6 .   ? -18.689 -49.170 -32.863 0.93 65.22  ? 605  PE8 B C14 1 
HETATM 8520 C C15 . PE8 I 6 .   ? -19.742 -48.439 -31.989 0.93 75.61  ? 605  PE8 B C15 1 
HETATM 8521 O O16 . PE8 I 6 .   ? -19.127 -47.617 -31.006 0.93 67.01  ? 605  PE8 B O16 1 
HETATM 8522 C C17 . PE8 I 6 .   ? -19.758 -47.689 -29.711 0.93 62.50  ? 605  PE8 B C17 1 
HETATM 8523 C C18 . PE8 I 6 .   ? -18.843 -46.962 -28.645 0.93 69.03  ? 605  PE8 B C18 1 
HETATM 8524 O O19 . PE8 I 6 .   ? -18.121 -45.885 -29.282 0.93 64.87  ? 605  PE8 B O19 1 
HETATM 8525 C C20 . PE8 I 6 .   ? -17.049 -45.225 -28.488 0.93 53.85  ? 605  PE8 B C20 1 
HETATM 8526 C C21 . PE8 I 6 .   ? -17.038 -45.699 -27.006 0.93 61.86  ? 605  PE8 B C21 1 
HETATM 8527 O O22 . PE8 I 6 .   ? -15.669 -45.849 -26.575 0.93 61.39  ? 605  PE8 B O22 1 
HETATM 8528 C C23 . PE8 I 6 .   ? -15.440 -45.607 -25.193 0.93 60.54  ? 605  PE8 B C23 1 
HETATM 8529 C C24 . PE8 I 6 .   ? -15.790 -46.903 -24.424 0.93 51.23  ? 605  PE8 B C24 1 
HETATM 8530 O O25 . PE8 I 6 .   ? -16.115 -46.587 -23.079 0.93 70.34  ? 605  PE8 B O25 1 
HETATM 8531 C C1  . DEP J 3 .   ? 4.481   -57.675 -20.378 1.00 39.13  ? 606  DEP B C1  1 
HETATM 8532 C C2  . DEP J 3 .   ? 3.821   -58.396 -19.209 1.00 36.25  ? 606  DEP B C2  1 
HETATM 8533 C C3  . DEP J 3 .   ? 7.150   -59.891 -22.716 1.00 44.27  ? 606  DEP B C3  1 
HETATM 8534 C C4  . DEP J 3 .   ? 7.378   -58.545 -23.411 1.00 45.25  ? 606  DEP B C4  1 
HETATM 8535 O O1  . DEP J 3 .   ? 4.002   -58.263 -21.592 1.00 40.31  ? 606  DEP B O1  1 
HETATM 8536 O O2  . DEP J 3 .   ? 6.087   -59.674 -21.816 1.00 44.62  ? 606  DEP B O2  1 
HETATM 8537 O O3  . DEP J 3 .   ? 4.329   -59.756 -23.700 1.00 31.83  ? 606  DEP B O3  1 
HETATM 8538 P P   . DEP J 3 .   ? 4.575   -59.667 -22.235 1.00 37.08  ? 606  DEP B P   1 
HETATM 8539 C C1  . EDO K 4 .   ? 12.846  -53.640 2.088   0.91 40.68  ? 607  EDO B C1  1 
HETATM 8540 O O1  . EDO K 4 .   ? 12.233  -52.854 3.133   0.91 37.80  ? 607  EDO B O1  1 
HETATM 8541 C C2  . EDO K 4 .   ? 11.860  -53.946 0.954   0.91 33.83  ? 607  EDO B C2  1 
HETATM 8542 O O2  . EDO K 4 .   ? 10.712  -54.639 1.466   0.91 35.93  ? 607  EDO B O2  1 
HETATM 8543 C C1  . EDO L 4 .   ? -7.687  -61.219 -3.138  0.90 36.07  ? 608  EDO B C1  1 
HETATM 8544 O O1  . EDO L 4 .   ? -9.080  -61.407 -2.870  0.90 40.38  ? 608  EDO B O1  1 
HETATM 8545 C C2  . EDO L 4 .   ? -7.303  -59.738 -3.036  0.90 37.10  ? 608  EDO B C2  1 
HETATM 8546 O O2  . EDO L 4 .   ? -8.186  -58.902 -3.806  0.90 37.12  ? 608  EDO B O2  1 
HETATM 8547 N N   . NO3 M 7 .   ? -9.069  -39.716 -30.753 0.65 41.65  ? 609  NO3 B N   1 
HETATM 8548 O O1  . NO3 M 7 .   ? -10.194 -40.179 -30.374 0.65 45.84  ? 609  NO3 B O1  1 
HETATM 8549 O O2  . NO3 M 7 .   ? -8.416  -38.938 -30.001 0.65 38.65  ? 609  NO3 B O2  1 
HETATM 8550 O O3  . NO3 M 7 .   ? -8.599  -40.008 -31.896 0.65 39.14  ? 609  NO3 B O3  1 
HETATM 8551 O O   . HOH N 8 .   ? 1.338   -66.500 38.730  1.00 59.49  ? 701  HOH A O   1 
HETATM 8552 O O   . HOH N 8 .   ? -11.397 -37.510 51.295  0.63 33.28  ? 702  HOH A O   1 
HETATM 8553 O O   . HOH N 8 .   ? -21.444 -46.562 37.046  0.93 48.61  ? 703  HOH A O   1 
HETATM 8554 O O   . HOH N 8 .   ? 0.902   -45.244 62.327  1.00 49.32  ? 704  HOH A O   1 
HETATM 8555 O O   . HOH N 8 .   ? -17.500 -30.801 30.249  1.00 46.60  ? 705  HOH A O   1 
HETATM 8556 O O   . HOH N 8 .   ? -1.640  -23.320 22.507  1.00 34.60  ? 706  HOH A O   1 
HETATM 8557 O O   . HOH N 8 .   ? -4.806  -50.861 47.197  0.97 57.79  ? 707  HOH A O   1 
HETATM 8558 O O   . HOH N 8 .   ? -9.188  -58.378 20.909  0.99 54.10  ? 708  HOH A O   1 
HETATM 8559 O O   . HOH N 8 .   ? -20.944 -51.666 7.691   1.00 53.24  ? 709  HOH A O   1 
HETATM 8560 O O   . HOH N 8 .   ? -23.712 -24.154 17.524  0.92 49.08  ? 710  HOH A O   1 
HETATM 8561 O O   . HOH N 8 .   ? 9.119   -60.761 29.125  0.87 39.87  ? 711  HOH A O   1 
HETATM 8562 O O   . HOH N 8 .   ? -8.016  -27.818 56.527  0.89 45.58  ? 712  HOH A O   1 
HETATM 8563 O O   . HOH N 8 .   ? -12.813 -12.814 22.041  0.92 51.79  ? 713  HOH A O   1 
HETATM 8564 O O   . HOH N 8 .   ? -13.524 -65.433 20.897  0.95 59.13  ? 714  HOH A O   1 
HETATM 8565 O O   . HOH N 8 .   ? 11.072  -46.269 52.633  1.00 33.98  ? 715  HOH A O   1 
HETATM 8566 O O   . HOH N 8 .   ? -10.298 -61.951 -0.491  0.91 45.93  ? 716  HOH A O   1 
HETATM 8567 O O   . HOH N 8 .   ? 13.448  -41.264 55.901  0.93 41.35  ? 717  HOH A O   1 
HETATM 8568 O O   . HOH N 8 .   ? -7.849  -41.009 35.791  1.00 24.43  ? 718  HOH A O   1 
HETATM 8569 O O   . HOH N 8 .   ? -21.099 -44.071 30.023  1.00 56.14  ? 719  HOH A O   1 
HETATM 8570 O O   . HOH N 8 .   ? -10.700 -49.792 44.415  1.00 65.65  ? 720  HOH A O   1 
HETATM 8571 O O   . HOH N 8 .   ? -22.069 -14.473 34.305  0.95 49.81  ? 721  HOH A O   1 
HETATM 8572 O O   . HOH N 8 .   ? -7.637  -58.310 44.214  0.90 52.02  ? 722  HOH A O   1 
HETATM 8573 O O   . HOH N 8 .   ? 15.699  -56.551 34.107  0.97 48.85  ? 723  HOH A O   1 
HETATM 8574 O O   . HOH N 8 .   ? -3.513  -18.049 25.900  1.00 52.79  ? 724  HOH A O   1 
HETATM 8575 O O   . HOH N 8 .   ? -2.507  -47.898 29.536  0.99 30.80  ? 725  HOH A O   1 
HETATM 8576 O O   . HOH N 8 .   ? -13.611 -43.806 28.615  1.00 67.52  ? 726  HOH A O   1 
HETATM 8577 O O   . HOH N 8 .   ? -8.324  -43.715 46.920  0.87 33.21  ? 727  HOH A O   1 
HETATM 8578 O O   . HOH N 8 .   ? -5.705  -63.560 41.863  0.99 41.71  ? 728  HOH A O   1 
HETATM 8579 O O   . HOH N 8 .   ? 2.254   -46.536 44.965  1.00 26.62  ? 729  HOH A O   1 
HETATM 8580 O O   . HOH N 8 .   ? 15.544  -31.113 48.685  0.83 41.58  ? 730  HOH A O   1 
HETATM 8581 O O   . HOH N 8 .   ? 11.126  -33.222 55.493  1.00 49.85  ? 731  HOH A O   1 
HETATM 8582 O O   . HOH N 8 .   ? 4.389   -31.145 10.720  1.00 57.26  ? 732  HOH A O   1 
HETATM 8583 O O   . HOH N 8 .   ? -16.553 -34.659 31.632  0.95 35.59  ? 733  HOH A O   1 
HETATM 8584 O O   . HOH N 8 .   ? 22.563  -51.289 30.019  1.00 52.07  ? 734  HOH A O   1 
HETATM 8585 O O   . HOH N 8 .   ? 11.715  -22.600 47.738  1.00 60.93  ? 735  HOH A O   1 
HETATM 8586 O O   . HOH N 8 .   ? -11.997 -41.864 33.024  1.00 35.29  ? 736  HOH A O   1 
HETATM 8587 O O   . HOH N 8 .   ? -7.658  -24.871 45.745  1.00 26.18  ? 737  HOH A O   1 
HETATM 8588 O O   . HOH N 8 .   ? 8.955   -48.925 15.851  0.98 35.88  ? 738  HOH A O   1 
HETATM 8589 O O   . HOH N 8 .   ? -0.776  -21.108 58.145  0.94 38.09  ? 739  HOH A O   1 
HETATM 8590 O O   . HOH N 8 .   ? 8.110   -54.875 9.100   0.95 49.20  ? 740  HOH A O   1 
HETATM 8591 O O   . HOH N 8 .   ? -14.363 -54.410 2.314   1.00 48.59  ? 741  HOH A O   1 
HETATM 8592 O O   . HOH N 8 .   ? -7.612  -51.585 25.525  0.93 32.46  ? 742  HOH A O   1 
HETATM 8593 O O   . HOH N 8 .   ? -13.903 -17.098 42.437  0.93 42.10  ? 743  HOH A O   1 
HETATM 8594 O O   . HOH N 8 .   ? 10.248  -27.848 19.163  1.00 52.19  ? 744  HOH A O   1 
HETATM 8595 O O   . HOH N 8 .   ? -20.720 -62.374 19.959  1.00 58.48  ? 745  HOH A O   1 
HETATM 8596 O O   . HOH N 8 .   ? 10.478  -52.060 43.936  1.00 30.86  ? 746  HOH A O   1 
HETATM 8597 O O   . HOH N 8 .   ? -11.970 -18.188 44.019  1.00 50.07  ? 747  HOH A O   1 
HETATM 8598 O O   . HOH N 8 .   ? -7.147  -55.971 37.895  1.00 47.27  ? 748  HOH A O   1 
HETATM 8599 O O   . HOH N 8 .   ? -22.344 -16.334 20.412  1.00 57.13  ? 749  HOH A O   1 
HETATM 8600 O O   . HOH N 8 .   ? -1.158  -54.151 9.621   1.00 61.81  ? 750  HOH A O   1 
HETATM 8601 O O   . HOH N 8 .   ? -4.897  -48.226 47.793  1.00 62.67  ? 751  HOH A O   1 
HETATM 8602 O O   . HOH N 8 .   ? -13.187 -44.815 41.517  0.93 28.90  ? 752  HOH A O   1 
HETATM 8603 O O   . HOH N 8 .   ? -28.858 -30.655 32.719  0.97 44.56  ? 753  HOH A O   1 
HETATM 8604 O O   . HOH N 8 .   ? 18.953  -30.931 37.980  0.94 52.97  ? 754  HOH A O   1 
HETATM 8605 O O   . HOH N 8 .   ? -7.870  -32.600 52.749  0.89 37.94  ? 755  HOH A O   1 
HETATM 8606 O O   . HOH N 8 .   ? -10.891 -27.230 23.355  1.00 31.56  ? 756  HOH A O   1 
HETATM 8607 O O   . HOH N 8 .   ? -6.617  -34.321 46.949  1.00 30.95  ? 757  HOH A O   1 
HETATM 8608 O O   . HOH N 8 .   ? -6.848  -16.143 36.729  1.00 46.45  ? 758  HOH A O   1 
HETATM 8609 O O   . HOH N 8 .   ? -5.241  -62.688 9.803   1.00 43.81  ? 759  HOH A O   1 
HETATM 8610 O O   . HOH N 8 .   ? -3.198  -56.450 33.159  0.78 41.11  ? 760  HOH A O   1 
HETATM 8611 O O   . HOH N 8 .   ? -20.079 -43.195 12.272  1.00 63.63  ? 761  HOH A O   1 
HETATM 8612 O O   . HOH N 8 .   ? -4.447  -20.210 28.364  0.95 44.98  ? 762  HOH A O   1 
HETATM 8613 O O   . HOH N 8 .   ? 18.873  -41.416 20.788  1.00 46.37  ? 763  HOH A O   1 
HETATM 8614 O O   . HOH N 8 .   ? 0.236   -41.292 14.772  1.00 40.35  ? 764  HOH A O   1 
HETATM 8615 O O   . HOH N 8 .   ? 9.938   -44.968 15.508  0.96 41.77  ? 765  HOH A O   1 
HETATM 8616 O O   . HOH N 8 .   ? 14.506  -28.846 32.918  0.88 43.13  ? 766  HOH A O   1 
HETATM 8617 O O   . HOH N 8 .   ? 19.799  -37.131 25.475  0.97 45.74  ? 767  HOH A O   1 
HETATM 8618 O O   . HOH N 8 .   ? -7.332  -15.021 30.528  1.00 45.58  ? 768  HOH A O   1 
HETATM 8619 O O   . HOH N 8 .   ? -2.526  -39.832 42.930  1.00 28.64  ? 769  HOH A O   1 
HETATM 8620 O O   . HOH N 8 .   ? -0.538  -62.255 31.042  1.00 47.01  ? 770  HOH A O   1 
HETATM 8621 O O   . HOH N 8 .   ? 17.349  -43.570 22.316  1.00 34.54  ? 771  HOH A O   1 
HETATM 8622 O O   . HOH N 8 .   ? -11.589 -23.818 49.180  0.97 41.11  ? 772  HOH A O   1 
HETATM 8623 O O   . HOH N 8 .   ? -2.395  -33.825 18.788  0.91 28.10  ? 773  HOH A O   1 
HETATM 8624 O O   . HOH N 8 .   ? -0.951  -42.092 65.856  1.00 60.09  ? 774  HOH A O   1 
HETATM 8625 O O   . HOH N 8 .   ? 2.970   -57.380 21.655  1.00 56.78  ? 775  HOH A O   1 
HETATM 8626 O O   . HOH N 8 .   ? 10.000  -21.726 50.056  1.00 54.08  ? 776  HOH A O   1 
HETATM 8627 O O   . HOH N 8 .   ? -30.499 -28.211 24.897  0.90 40.35  ? 777  HOH A O   1 
HETATM 8628 O O   . HOH N 8 .   ? -14.092 -24.210 37.296  1.00 29.39  ? 778  HOH A O   1 
HETATM 8629 O O   . HOH N 8 .   ? -10.285 -67.168 14.037  1.00 55.31  ? 779  HOH A O   1 
HETATM 8630 O O   . HOH N 8 .   ? -7.761  -29.555 52.118  0.88 40.76  ? 780  HOH A O   1 
HETATM 8631 O O   . HOH N 8 .   ? -15.239 -21.851 14.342  0.90 49.64  ? 781  HOH A O   1 
HETATM 8632 O O   . HOH N 8 .   ? 18.073  -37.927 40.567  0.78 36.31  ? 782  HOH A O   1 
HETATM 8633 O O   . HOH N 8 .   ? 1.496   -48.007 29.106  1.00 28.49  ? 783  HOH A O   1 
HETATM 8634 O O   . HOH N 8 .   ? -18.787 -38.224 43.267  0.88 43.01  ? 784  HOH A O   1 
HETATM 8635 O O   . HOH N 8 .   ? 8.493   -29.282 39.506  0.98 30.24  ? 785  HOH A O   1 
HETATM 8636 O O   . HOH N 8 .   ? -8.552  -18.757 49.105  1.00 57.55  ? 786  HOH A O   1 
HETATM 8637 O O   . HOH N 8 .   ? 5.978   -22.638 60.431  1.00 55.74  ? 787  HOH A O   1 
HETATM 8638 O O   . HOH N 8 .   ? 0.562   -18.158 55.955  0.93 37.93  ? 788  HOH A O   1 
HETATM 8639 O O   . HOH N 8 .   ? 2.251   -20.114 32.414  0.98 45.30  ? 789  HOH A O   1 
HETATM 8640 O O   . HOH N 8 .   ? -30.979 -23.992 23.255  0.87 40.67  ? 790  HOH A O   1 
HETATM 8641 O O   . HOH N 8 .   ? -1.878  -18.939 61.981  1.00 63.29  ? 791  HOH A O   1 
HETATM 8642 O O   . HOH N 8 .   ? 4.302   -21.702 46.327  0.91 44.15  ? 792  HOH A O   1 
HETATM 8643 O O   . HOH N 8 .   ? -13.806 -63.366 26.438  0.94 49.59  ? 793  HOH A O   1 
HETATM 8644 O O   . HOH N 8 .   ? -21.547 -26.529 14.871  1.00 52.33  ? 794  HOH A O   1 
HETATM 8645 O O   . HOH N 8 .   ? -4.389  -42.290 34.014  0.94 29.79  ? 795  HOH A O   1 
HETATM 8646 O O   . HOH N 8 .   ? 12.594  -30.192 25.835  1.00 55.09  ? 796  HOH A O   1 
HETATM 8647 O O   . HOH N 8 .   ? 9.415   -58.696 31.576  1.00 33.80  ? 797  HOH A O   1 
HETATM 8648 O O   . HOH N 8 .   ? 7.048   -62.521 38.904  0.87 45.68  ? 798  HOH A O   1 
HETATM 8649 O O   . HOH N 8 .   ? -9.353  -47.006 41.135  1.00 34.38  ? 799  HOH A O   1 
HETATM 8650 O O   . HOH N 8 .   ? -3.702  -15.299 44.105  1.00 49.02  ? 800  HOH A O   1 
HETATM 8651 O O   . HOH N 8 .   ? -12.825 -23.429 34.850  1.00 31.13  ? 801  HOH A O   1 
HETATM 8652 O O   . HOH N 8 .   ? 8.735   -44.760 54.471  1.00 33.94  ? 802  HOH A O   1 
HETATM 8653 O O   . HOH N 8 .   ? -13.636 -25.005 23.104  1.00 33.84  ? 803  HOH A O   1 
HETATM 8654 O O   . HOH N 8 .   ? -6.708  -18.392 22.928  1.00 52.21  ? 804  HOH A O   1 
HETATM 8655 O O   . HOH N 8 .   ? -10.380 -21.255 28.954  1.00 35.43  ? 805  HOH A O   1 
HETATM 8656 O O   . HOH N 8 .   ? 15.243  -42.946 45.632  1.00 43.91  ? 806  HOH A O   1 
HETATM 8657 O O   . HOH N 8 .   ? -18.608 -21.470 39.075  0.95 36.14  ? 807  HOH A O   1 
HETATM 8658 O O   . HOH N 8 .   ? -2.387  -42.276 14.279  0.96 33.15  ? 808  HOH A O   1 
HETATM 8659 O O   . HOH N 8 .   ? -10.403 -54.989 36.995  1.00 47.85  ? 809  HOH A O   1 
HETATM 8660 O O   . HOH N 8 .   ? -5.938  -18.592 51.821  1.00 50.14  ? 810  HOH A O   1 
HETATM 8661 O O   . HOH N 8 .   ? 11.257  -26.993 46.851  1.00 31.83  ? 811  HOH A O   1 
HETATM 8662 O O   . HOH N 8 .   ? -4.760  -42.079 44.857  0.81 29.08  ? 812  HOH A O   1 
HETATM 8663 O O   . HOH N 8 .   ? 20.968  -63.824 32.706  1.00 76.33  ? 813  HOH A O   1 
HETATM 8664 O O   . HOH N 8 .   ? 16.833  -49.544 19.569  1.00 35.17  ? 814  HOH A O   1 
HETATM 8665 O O   . HOH N 8 .   ? -24.473 -13.124 28.912  0.79 47.15  ? 815  HOH A O   1 
HETATM 8666 O O   . HOH N 8 .   ? -3.207  -60.172 24.359  1.00 50.56  ? 816  HOH A O   1 
HETATM 8667 O O   . HOH N 8 .   ? 18.848  -45.753 40.734  1.00 40.49  ? 817  HOH A O   1 
HETATM 8668 O O   . HOH N 8 .   ? 7.786   -30.714 61.913  0.76 43.54  ? 818  HOH A O   1 
HETATM 8669 O O   . HOH N 8 .   ? 8.234   -53.559 47.913  0.99 44.14  ? 819  HOH A O   1 
HETATM 8670 O O   . HOH N 8 .   ? 8.720   -42.258 5.082   1.00 54.59  ? 820  HOH A O   1 
HETATM 8671 O O   . HOH N 8 .   ? -7.161  -56.842 21.303  1.00 55.29  ? 821  HOH A O   1 
HETATM 8672 O O   . HOH N 8 .   ? -17.783 -52.688 15.315  1.00 46.24  ? 822  HOH A O   1 
HETATM 8673 O O   . HOH N 8 .   ? -4.190  -68.244 6.180   1.00 52.74  ? 823  HOH A O   1 
HETATM 8674 O O   . HOH N 8 .   ? -13.522 -30.188 35.381  1.00 26.83  ? 824  HOH A O   1 
HETATM 8675 O O   . HOH N 8 .   ? -9.492  -40.316 17.428  1.00 50.29  ? 825  HOH A O   1 
HETATM 8676 O O   . HOH N 8 .   ? -9.792  -25.273 44.227  1.00 31.75  ? 826  HOH A O   1 
HETATM 8677 O O   . HOH N 8 .   ? -12.115 -34.104 26.551  0.98 34.99  ? 827  HOH A O   1 
HETATM 8678 O O   . HOH N 8 .   ? -8.753  -39.671 51.616  0.84 34.56  ? 828  HOH A O   1 
HETATM 8679 O O   . HOH N 8 .   ? 12.703  -51.709 46.867  0.90 43.84  ? 829  HOH A O   1 
HETATM 8680 O O   . HOH N 8 .   ? -24.151 -36.189 32.499  1.00 54.64  ? 830  HOH A O   1 
HETATM 8681 O O   . HOH N 8 .   ? -6.632  -60.527 10.557  1.00 43.62  ? 831  HOH A O   1 
HETATM 8682 O O   . HOH N 8 .   ? -10.195 -34.406 39.089  1.00 27.61  ? 832  HOH A O   1 
HETATM 8683 O O   . HOH N 8 .   ? 2.621   -62.642 32.272  1.00 48.97  ? 833  HOH A O   1 
HETATM 8684 O O   . HOH N 8 .   ? 12.205  -36.384 59.214  0.97 46.11  ? 834  HOH A O   1 
HETATM 8685 O O   . HOH N 8 .   ? -16.560 -58.782 32.295  1.00 43.66  ? 835  HOH A O   1 
HETATM 8686 O O   . HOH N 8 .   ? -20.954 -59.568 18.226  0.91 55.26  ? 836  HOH A O   1 
HETATM 8687 O O   . HOH N 8 .   ? 4.358   -19.685 22.464  0.97 46.11  ? 837  HOH A O   1 
HETATM 8688 O O   . HOH N 8 .   ? 15.926  -27.644 37.993  1.00 47.29  ? 838  HOH A O   1 
HETATM 8689 O O   . HOH N 8 .   ? -2.637  -58.344 46.430  1.00 41.37  ? 839  HOH A O   1 
HETATM 8690 O O   . HOH N 8 .   ? 12.943  -37.793 39.587  0.93 32.28  ? 840  HOH A O   1 
HETATM 8691 O O   . HOH N 8 .   ? -19.884 -25.079 41.077  0.85 32.56  ? 841  HOH A O   1 
HETATM 8692 O O   . HOH N 8 .   ? -7.686  -19.892 40.285  1.00 33.57  ? 842  HOH A O   1 
HETATM 8693 O O   . HOH N 8 .   ? -16.036 -9.978  22.240  1.00 71.18  ? 843  HOH A O   1 
HETATM 8694 O O   . HOH N 8 .   ? 1.121   -39.097 15.316  0.80 45.94  ? 844  HOH A O   1 
HETATM 8695 O O   . HOH N 8 .   ? 7.096   -56.036 17.008  1.00 49.02  ? 845  HOH A O   1 
HETATM 8696 O O   . HOH N 8 .   ? -9.058  -62.214 34.846  1.00 59.53  ? 846  HOH A O   1 
HETATM 8697 O O   . HOH N 8 .   ? -20.859 -6.856  24.193  1.00 78.80  ? 847  HOH A O   1 
HETATM 8698 O O   . HOH N 8 .   ? -12.031 -45.403 45.849  1.00 55.27  ? 848  HOH A O   1 
HETATM 8699 O O   . HOH N 8 .   ? 5.188   -24.511 22.386  0.88 36.99  ? 849  HOH A O   1 
HETATM 8700 O O   . HOH N 8 .   ? -8.527  -23.822 48.243  0.90 38.33  ? 850  HOH A O   1 
HETATM 8701 O O   . HOH N 8 .   ? -10.011 -35.936 43.996  0.97 32.05  ? 851  HOH A O   1 
HETATM 8702 O O   . HOH N 8 .   ? -15.444 -39.969 35.340  1.00 36.34  ? 852  HOH A O   1 
HETATM 8703 O O   . HOH N 8 .   ? 6.793   -54.139 14.299  1.00 44.06  ? 853  HOH A O   1 
HETATM 8704 O O   . HOH N 8 .   ? 8.309   -28.858 12.211  1.00 49.95  ? 854  HOH A O   1 
HETATM 8705 O O   . HOH N 8 .   ? -20.445 -50.912 21.652  1.00 51.89  ? 855  HOH A O   1 
HETATM 8706 O O   . HOH N 8 .   ? 6.881   -21.300 34.322  0.90 42.97  ? 856  HOH A O   1 
HETATM 8707 O O   . HOH N 8 .   ? -15.227 -45.312 33.793  1.00 38.80  ? 857  HOH A O   1 
HETATM 8708 O O   . HOH N 8 .   ? -4.422  -50.302 36.451  1.00 26.89  ? 858  HOH A O   1 
HETATM 8709 O O   . HOH N 8 .   ? 2.090   -22.961 49.527  1.00 35.51  ? 859  HOH A O   1 
HETATM 8710 O O   . HOH N 8 .   ? 2.561   -21.293 27.942  0.88 36.94  ? 860  HOH A O   1 
HETATM 8711 O O   . HOH N 8 .   ? -6.942  -60.151 13.092  0.90 43.05  ? 861  HOH A O   1 
HETATM 8712 O O   . HOH N 8 .   ? -13.634 -28.927 47.694  1.00 33.99  ? 862  HOH A O   1 
HETATM 8713 O O   . HOH N 8 .   ? 5.460   -62.137 46.351  1.00 49.72  ? 863  HOH A O   1 
HETATM 8714 O O   . HOH N 8 .   ? 1.741   -16.465 27.522  1.00 63.13  ? 864  HOH A O   1 
HETATM 8715 O O   . HOH N 8 .   ? -18.596 -41.762 40.542  1.00 41.95  ? 865  HOH A O   1 
HETATM 8716 O O   . HOH N 8 .   ? 2.901   -18.131 54.856  0.74 45.59  ? 866  HOH A O   1 
HETATM 8717 O O   . HOH N 8 .   ? 11.408  -45.391 13.243  0.98 44.08  ? 867  HOH A O   1 
HETATM 8718 O O   . HOH N 8 .   ? -16.253 -36.340 48.898  0.87 40.95  ? 868  HOH A O   1 
HETATM 8719 O O   . HOH N 8 .   ? 0.471   -21.900 44.354  0.94 36.90  ? 869  HOH A O   1 
HETATM 8720 O O   . HOH N 8 .   ? -12.491 -39.946 38.011  0.98 31.44  ? 870  HOH A O   1 
HETATM 8721 O O   . HOH N 8 .   ? 10.316  -23.247 33.139  0.92 46.25  ? 871  HOH A O   1 
HETATM 8722 O O   . HOH N 8 .   ? -25.158 -19.989 20.530  1.00 65.56  ? 872  HOH A O   1 
HETATM 8723 O O   . HOH N 8 .   ? -13.289 -12.846 32.332  1.00 55.00  ? 873  HOH A O   1 
HETATM 8724 O O   . HOH N 8 .   ? -18.395 -13.368 33.415  1.00 53.61  ? 874  HOH A O   1 
HETATM 8725 O O   . HOH N 8 .   ? 10.019  -26.965 25.188  0.85 41.67  ? 875  HOH A O   1 
HETATM 8726 O O   . HOH N 8 .   ? 13.668  -49.549 24.492  0.96 30.92  ? 876  HOH A O   1 
HETATM 8727 O O   . HOH N 8 .   ? 15.967  -60.508 24.643  1.00 41.72  ? 877  HOH A O   1 
HETATM 8728 O O   . HOH N 8 .   ? -9.138  -19.662 37.632  0.84 37.04  ? 878  HOH A O   1 
HETATM 8729 O O   . HOH N 8 .   ? 17.771  -54.171 33.576  1.00 50.10  ? 879  HOH A O   1 
HETATM 8730 O O   . HOH N 8 .   ? 15.680  -48.596 45.331  1.00 40.00  ? 880  HOH A O   1 
HETATM 8731 O O   . HOH N 8 .   ? -21.428 -35.974 36.433  1.00 30.67  ? 881  HOH A O   1 
HETATM 8732 O O   . HOH N 8 .   ? -2.685  -36.497 38.606  1.00 23.91  ? 882  HOH A O   1 
HETATM 8733 O O   . HOH N 8 .   ? -13.996 -13.126 34.977  1.00 57.12  ? 883  HOH A O   1 
HETATM 8734 O O   . HOH N 8 .   ? -2.886  -61.309 47.493  1.00 56.32  ? 884  HOH A O   1 
HETATM 8735 O O   . HOH N 8 .   ? 9.932   -28.732 56.274  1.00 48.55  ? 885  HOH A O   1 
HETATM 8736 O O   . HOH N 8 .   ? -3.468  -65.477 6.664   1.00 46.26  ? 886  HOH A O   1 
HETATM 8737 O O   . HOH N 8 .   ? 19.929  -49.154 21.551  1.00 45.25  ? 887  HOH A O   1 
HETATM 8738 O O   . HOH N 8 .   ? -13.782 -63.949 29.482  1.00 55.14  ? 888  HOH A O   1 
HETATM 8739 O O   . HOH N 8 .   ? -8.917  -29.538 14.981  1.00 45.88  ? 889  HOH A O   1 
HETATM 8740 O O   . HOH N 8 .   ? -19.103 -19.888 36.914  0.92 37.58  ? 890  HOH A O   1 
HETATM 8741 O O   . HOH N 8 .   ? -8.017  -36.483 31.587  1.00 25.67  ? 891  HOH A O   1 
HETATM 8742 O O   . HOH N 8 .   ? -0.098  -23.847 48.480  0.90 33.59  ? 892  HOH A O   1 
HETATM 8743 O O   . HOH N 8 .   ? 4.756   -27.002 60.163  0.95 41.86  ? 893  HOH A O   1 
HETATM 8744 O O   . HOH N 8 .   ? -2.948  -42.786 49.998  1.00 45.22  ? 894  HOH A O   1 
HETATM 8745 O O   . HOH N 8 .   ? -17.624 -12.589 30.562  0.96 57.37  ? 895  HOH A O   1 
HETATM 8746 O O   . HOH N 8 .   ? -20.154 -47.901 34.685  0.87 51.37  ? 896  HOH A O   1 
HETATM 8747 O O   . HOH N 8 .   ? 17.576  -36.411 44.728  0.95 50.74  ? 897  HOH A O   1 
HETATM 8748 O O   . HOH N 8 .   ? -8.274  -25.780 25.462  0.99 31.78  ? 898  HOH A O   1 
HETATM 8749 O O   . HOH N 8 .   ? 8.116   -27.624 57.688  1.00 48.12  ? 899  HOH A O   1 
HETATM 8750 O O   . HOH N 8 .   ? -2.643  -21.555 25.302  1.00 44.55  ? 900  HOH A O   1 
HETATM 8751 O O   . HOH N 8 .   ? -4.967  -24.098 15.286  1.00 48.41  ? 901  HOH A O   1 
HETATM 8752 O O   . HOH N 8 .   ? 0.579   -52.554 21.588  0.76 37.09  ? 902  HOH A O   1 
HETATM 8753 O O   . HOH N 8 .   ? 13.458  -24.527 44.399  1.00 57.10  ? 903  HOH A O   1 
HETATM 8754 O O   . HOH N 8 .   ? 4.985   -38.468 5.987   1.00 64.61  ? 904  HOH A O   1 
HETATM 8755 O O   . HOH N 8 .   ? 14.385  -59.143 33.442  0.99 48.54  ? 905  HOH A O   1 
HETATM 8756 O O   . HOH N 8 .   ? 3.536   -18.168 18.942  0.88 55.21  ? 906  HOH A O   1 
HETATM 8757 O O   . HOH N 8 .   ? -3.044  -46.396 56.817  1.00 45.14  ? 907  HOH A O   1 
HETATM 8758 O O   . HOH N 8 .   ? -8.159  -23.085 13.159  1.00 53.25  ? 908  HOH A O   1 
HETATM 8759 O O   . HOH N 8 .   ? -19.968 -46.096 11.682  1.00 67.54  ? 909  HOH A O   1 
HETATM 8760 O O   . HOH N 8 .   ? -9.376  -39.595 14.452  1.00 57.61  ? 910  HOH A O   1 
HETATM 8761 O O   . HOH N 8 .   ? 9.459   -52.650 50.266  1.00 38.11  ? 911  HOH A O   1 
HETATM 8762 O O   . HOH N 8 .   ? 12.425  -49.393 51.100  1.00 43.23  ? 912  HOH A O   1 
HETATM 8763 O O   . HOH N 8 .   ? -10.644 -25.843 51.029  0.97 47.12  ? 913  HOH A O   1 
HETATM 8764 O O   . HOH N 8 .   ? -13.586 -65.256 5.791   1.00 44.52  ? 914  HOH A O   1 
HETATM 8765 O O   . HOH N 8 .   ? -6.472  -63.151 25.639  1.00 56.67  ? 915  HOH A O   1 
HETATM 8766 O O   . HOH N 8 .   ? -10.398 -41.807 35.420  0.92 27.56  ? 916  HOH A O   1 
HETATM 8767 O O   . HOH N 8 .   ? -1.798  -52.520 21.256  0.96 34.61  ? 917  HOH A O   1 
HETATM 8768 O O   . HOH N 8 .   ? -14.459 -38.441 1.913   1.00 63.62  ? 918  HOH A O   1 
HETATM 8769 O O   . HOH N 8 .   ? 6.137   -45.504 13.389  0.96 41.36  ? 919  HOH A O   1 
HETATM 8770 O O   . HOH N 8 .   ? -6.981  -43.728 31.512  1.00 61.13  ? 920  HOH A O   1 
HETATM 8771 O O   . HOH N 8 .   ? 7.831   -23.325 21.270  0.83 38.92  ? 921  HOH A O   1 
HETATM 8772 O O   . HOH N 8 .   ? -5.866  -24.230 62.513  1.00 58.78  ? 922  HOH A O   1 
HETATM 8773 O O   . HOH N 8 .   ? 16.936  -57.080 19.066  1.00 54.75  ? 923  HOH A O   1 
HETATM 8774 O O   . HOH N 8 .   ? -27.970 -33.885 36.040  0.96 45.44  ? 924  HOH A O   1 
HETATM 8775 O O   . HOH N 8 .   ? 18.490  -29.826 23.680  1.00 55.30  ? 925  HOH A O   1 
HETATM 8776 O O   . HOH N 8 .   ? -14.791 -33.005 27.114  1.00 47.83  ? 926  HOH A O   1 
HETATM 8777 O O   . HOH N 8 .   ? -14.083 -26.255 12.627  1.00 44.87  ? 927  HOH A O   1 
HETATM 8778 O O   . HOH N 8 .   ? 4.853   -26.197 11.105  1.00 49.44  ? 928  HOH A O   1 
HETATM 8779 O O   . HOH N 8 .   ? 3.559   -55.079 57.517  1.00 50.54  ? 929  HOH A O   1 
HETATM 8780 O O   . HOH N 8 .   ? 0.144   -21.142 46.552  0.89 38.14  ? 930  HOH A O   1 
HETATM 8781 O O   . HOH N 8 .   ? -20.693 -35.469 43.513  0.99 35.57  ? 931  HOH A O   1 
HETATM 8782 O O   . HOH N 8 .   ? -14.432 -28.662 37.775  1.00 28.92  ? 932  HOH A O   1 
HETATM 8783 O O   . HOH N 8 .   ? -5.554  -57.477 18.390  0.92 42.81  ? 933  HOH A O   1 
HETATM 8784 O O   . HOH N 8 .   ? -22.342 -25.552 39.949  1.00 42.15  ? 934  HOH A O   1 
HETATM 8785 O O   . HOH N 8 .   ? 6.573   -47.987 14.657  0.95 37.21  ? 935  HOH A O   1 
HETATM 8786 O O   . HOH N 8 .   ? 9.120   -26.727 22.163  1.00 47.79  ? 936  HOH A O   1 
HETATM 8787 O O   . HOH N 8 .   ? 9.996   -57.787 15.031  0.87 46.73  ? 937  HOH A O   1 
HETATM 8788 O O   . HOH N 8 .   ? -6.917  -62.802 33.853  1.00 49.22  ? 938  HOH A O   1 
HETATM 8789 O O   . HOH N 8 .   ? -29.715 -17.634 30.285  1.00 42.53  ? 939  HOH A O   1 
HETATM 8790 O O   . HOH N 8 .   ? -9.600  -26.011 13.676  1.00 49.16  ? 940  HOH A O   1 
HETATM 8791 O O   . HOH N 8 .   ? -13.186 -26.615 38.341  1.00 29.00  ? 941  HOH A O   1 
HETATM 8792 O O   . HOH N 8 .   ? 8.820   -61.037 37.249  0.98 53.44  ? 942  HOH A O   1 
HETATM 8793 O O   . HOH N 8 .   ? 6.921   -22.994 16.630  0.99 49.58  ? 943  HOH A O   1 
HETATM 8794 O O   . HOH N 8 .   ? -18.732 -26.623 42.643  1.00 37.54  ? 944  HOH A O   1 
HETATM 8795 O O   . HOH N 8 .   ? -24.973 -61.871 23.540  1.00 63.51  ? 945  HOH A O   1 
HETATM 8796 O O   . HOH N 8 .   ? 12.938  -31.106 54.550  1.00 50.50  ? 946  HOH A O   1 
HETATM 8797 O O   . HOH N 8 .   ? 3.056   -49.823 58.045  0.88 30.09  ? 947  HOH A O   1 
HETATM 8798 O O   . HOH N 8 .   ? 22.124  -43.218 33.500  1.00 49.87  ? 948  HOH A O   1 
HETATM 8799 O O   . HOH N 8 .   ? -1.275  -16.466 19.832  1.00 56.43  ? 949  HOH A O   1 
HETATM 8800 O O   . HOH N 8 .   ? 18.583  -49.544 42.085  0.90 49.63  ? 950  HOH A O   1 
HETATM 8801 O O   . HOH N 8 .   ? -14.798 -42.348 34.131  1.00 32.03  ? 951  HOH A O   1 
HETATM 8802 O O   . HOH N 8 .   ? -3.140  -37.279 61.172  0.99 53.97  ? 952  HOH A O   1 
HETATM 8803 O O   . HOH N 8 .   ? 6.152   -51.137 48.702  0.76 36.87  ? 953  HOH A O   1 
HETATM 8804 O O   . HOH N 8 .   ? 8.432   -23.254 53.631  0.98 44.04  ? 954  HOH A O   1 
HETATM 8805 O O   . HOH N 8 .   ? 17.003  -31.025 16.085  1.00 49.60  ? 955  HOH A O   1 
HETATM 8806 O O   . HOH N 8 .   ? -5.281  -43.402 50.322  1.00 43.74  ? 956  HOH A O   1 
HETATM 8807 O O   . HOH N 8 .   ? -16.393 -31.993 32.583  0.95 38.05  ? 957  HOH A O   1 
HETATM 8808 O O   . HOH N 8 .   ? 8.460   -24.236 51.012  1.00 41.41  ? 958  HOH A O   1 
HETATM 8809 O O   . HOH N 8 .   ? -6.821  -16.251 24.122  0.93 58.14  ? 959  HOH A O   1 
HETATM 8810 O O   . HOH N 8 .   ? -21.183 -24.105 16.671  1.00 51.77  ? 960  HOH A O   1 
HETATM 8811 O O   . HOH N 8 .   ? -22.563 -37.506 34.528  1.00 41.36  ? 961  HOH A O   1 
HETATM 8812 O O   . HOH N 8 .   ? -11.047 -45.491 42.978  1.00 38.99  ? 962  HOH A O   1 
HETATM 8813 O O   . HOH N 8 .   ? -1.852  -40.047 61.220  1.00 45.82  ? 963  HOH A O   1 
HETATM 8814 O O   . HOH N 8 .   ? 8.492   -29.267 59.652  0.87 49.37  ? 964  HOH A O   1 
HETATM 8815 O O   . HOH N 8 .   ? -5.897  -45.702 53.937  1.00 47.71  ? 965  HOH A O   1 
HETATM 8816 O O   . HOH N 8 .   ? -9.372  -43.403 49.319  1.00 46.37  ? 966  HOH A O   1 
HETATM 8817 O O   . HOH N 8 .   ? 10.424  -25.726 50.151  1.00 41.73  ? 967  HOH A O   1 
HETATM 8818 O O   . HOH N 8 .   ? -3.830  -44.422 58.010  0.82 46.18  ? 968  HOH A O   1 
HETATM 8819 O O   . HOH N 8 .   ? -11.596 -10.816 25.122  1.00 64.83  ? 969  HOH A O   1 
HETATM 8820 O O   . HOH N 8 .   ? -5.159  -53.296 20.195  1.00 43.58  ? 970  HOH A O   1 
HETATM 8821 O O   . HOH N 8 .   ? 4.957   -51.944 50.795  0.74 34.76  ? 971  HOH A O   1 
HETATM 8822 O O   . HOH N 8 .   ? -20.503 -64.533 21.986  1.00 63.25  ? 972  HOH A O   1 
HETATM 8823 O O   . HOH N 8 .   ? 5.022   -35.356 11.044  1.00 56.23  ? 973  HOH A O   1 
HETATM 8824 O O   . HOH N 8 .   ? 19.140  -45.782 14.772  1.00 45.33  ? 974  HOH A O   1 
HETATM 8825 O O   . HOH N 8 .   ? 12.206  -58.834 17.253  1.00 47.91  ? 975  HOH A O   1 
HETATM 8826 O O   . HOH N 8 .   ? -8.244  -53.760 38.003  1.00 46.76  ? 976  HOH A O   1 
HETATM 8827 O O   . HOH N 8 .   ? -23.484 -28.053 39.595  1.00 46.17  ? 977  HOH A O   1 
HETATM 8828 O O   . HOH N 8 .   ? -0.007  -21.712 35.488  1.00 39.16  ? 978  HOH A O   1 
HETATM 8829 O O   . HOH N 8 .   ? -11.022 -34.515 20.155  1.00 46.13  ? 979  HOH A O   1 
HETATM 8830 O O   . HOH N 8 .   ? 17.737  -42.837 16.703  1.00 40.88  ? 980  HOH A O   1 
HETATM 8831 O O   . HOH N 8 .   ? -19.293 -15.534 20.057  1.00 62.54  ? 981  HOH A O   1 
HETATM 8832 O O   . HOH N 8 .   ? -8.282  -52.143 40.481  1.00 54.16  ? 982  HOH A O   1 
HETATM 8833 O O   . HOH N 8 .   ? 14.110  -47.267 10.241  0.99 48.00  ? 983  HOH A O   1 
HETATM 8834 O O   . HOH N 8 .   ? 17.206  -54.910 45.400  1.00 62.34  ? 984  HOH A O   1 
HETATM 8835 O O   . HOH N 8 .   ? -10.229 -33.411 18.438  1.00 56.89  ? 985  HOH A O   1 
HETATM 8836 O O   . HOH N 8 .   ? -0.011  -32.989 16.201  0.96 43.67  ? 986  HOH A O   1 
HETATM 8837 O O   . HOH N 8 .   ? 13.936  -27.711 21.339  1.00 63.64  ? 987  HOH A O   1 
HETATM 8838 O O   . HOH N 8 .   ? 2.243   -27.370 60.330  0.92 40.20  ? 988  HOH A O   1 
HETATM 8839 O O   . HOH N 8 .   ? 11.400  -58.100 42.023  0.84 41.29  ? 989  HOH A O   1 
HETATM 8840 O O   . HOH N 8 .   ? 14.990  -55.268 46.304  1.00 49.83  ? 990  HOH A O   1 
HETATM 8841 O O   . HOH N 8 .   ? 5.240   -54.797 12.404  1.00 50.93  ? 991  HOH A O   1 
HETATM 8842 O O   . HOH N 8 .   ? 0.157   -20.110 28.310  1.00 48.73  ? 992  HOH A O   1 
HETATM 8843 O O   . HOH N 8 .   ? 2.895   -67.168 41.883  1.00 57.64  ? 993  HOH A O   1 
HETATM 8844 O O   . HOH N 8 .   ? -15.764 -48.128 6.431   1.00 47.04  ? 994  HOH A O   1 
HETATM 8845 O O   . HOH N 8 .   ? -0.002  -64.720 38.072  1.00 56.08  ? 995  HOH A O   1 
HETATM 8846 O O   . HOH N 8 .   ? 6.926   -41.742 12.669  1.00 52.44  ? 996  HOH A O   1 
HETATM 8847 O O   . HOH N 8 .   ? 18.218  -29.395 45.758  1.00 52.81  ? 997  HOH A O   1 
HETATM 8848 O O   . HOH N 8 .   ? 1.280   -55.280 21.120  0.87 46.63  ? 998  HOH A O   1 
HETATM 8849 O O   . HOH N 8 .   ? -1.808  -50.979 52.786  1.00 54.08  ? 999  HOH A O   1 
HETATM 8850 O O   . HOH N 8 .   ? -10.178 -50.701 -0.461  1.00 46.68  ? 1000 HOH A O   1 
HETATM 8851 O O   . HOH N 8 .   ? -11.095 -18.924 16.232  1.00 49.56  ? 1001 HOH A O   1 
HETATM 8852 O O   . HOH N 8 .   ? 7.333   -39.923 10.497  1.00 64.21  ? 1002 HOH A O   1 
HETATM 8853 O O   . HOH N 8 .   ? -7.628  -22.289 52.846  1.00 50.68  ? 1003 HOH A O   1 
HETATM 8854 O O   . HOH N 8 .   ? -12.976 -27.764 22.037  0.61 32.34  ? 1004 HOH A O   1 
HETATM 8855 O O   . HOH N 8 .   ? 15.510  -31.886 13.326  1.00 68.50  ? 1005 HOH A O   1 
HETATM 8856 O O   . HOH N 8 .   ? 2.573   -54.247 12.508  1.00 42.66  ? 1006 HOH A O   1 
HETATM 8857 O O   . HOH N 8 .   ? 1.759   -26.933 63.126  1.00 54.30  ? 1007 HOH A O   1 
HETATM 8858 O O   . HOH N 8 .   ? -10.795 -20.500 49.319  1.00 60.32  ? 1008 HOH A O   1 
HETATM 8859 O O   . HOH N 8 .   ? 3.549   -20.186 42.335  1.00 57.52  ? 1009 HOH A O   1 
HETATM 8860 O O   . HOH N 8 .   ? 1.690   -46.121 60.235  0.75 42.28  ? 1010 HOH A O   1 
HETATM 8861 O O   . HOH N 8 .   ? -10.463 -12.036 31.933  1.00 57.60  ? 1011 HOH A O   1 
HETATM 8862 O O   . HOH N 8 .   ? -3.473  -49.539 50.790  1.00 58.25  ? 1012 HOH A O   1 
HETATM 8863 O O   . HOH N 8 .   ? -14.515 -34.094 49.224  1.00 52.23  ? 1013 HOH A O   1 
HETATM 8864 O O   . HOH N 8 .   ? 16.944  -36.091 12.723  1.00 62.13  ? 1014 HOH A O   1 
HETATM 8865 O O   . HOH N 8 .   ? 5.832   -54.309 50.658  0.87 38.57  ? 1015 HOH A O   1 
HETATM 8866 O O   . HOH N 8 .   ? 5.130   -19.436 33.275  1.00 52.16  ? 1016 HOH A O   1 
HETATM 8867 O O   . HOH N 8 .   ? -2.024  -21.006 27.915  0.87 43.37  ? 1017 HOH A O   1 
HETATM 8868 O O   . HOH N 8 .   ? -7.639  -62.159 21.959  1.00 63.48  ? 1018 HOH A O   1 
HETATM 8869 O O   . HOH N 8 .   ? 10.673  -53.502 46.236  1.00 38.83  ? 1019 HOH A O   1 
HETATM 8870 O O   . HOH N 8 .   ? 7.049   -27.764 60.867  0.97 61.31  ? 1020 HOH A O   1 
HETATM 8871 O O   . HOH N 8 .   ? -4.437  -57.843 9.734   1.00 58.37  ? 1021 HOH A O   1 
HETATM 8872 O O   . HOH N 8 .   ? 17.570  -49.392 44.417  0.79 43.44  ? 1022 HOH A O   1 
HETATM 8873 O O   . HOH N 8 .   ? 2.742   -21.074 47.856  1.00 48.18  ? 1023 HOH A O   1 
HETATM 8874 O O   . HOH N 8 .   ? -7.997  -24.549 51.717  0.90 54.11  ? 1024 HOH A O   1 
HETATM 8875 O O   . HOH N 8 .   ? -16.647 -45.185 42.530  1.00 51.33  ? 1025 HOH A O   1 
HETATM 8876 O O   . HOH N 8 .   ? -1.510  -19.766 34.954  0.97 45.62  ? 1026 HOH A O   1 
HETATM 8877 O O   . HOH N 8 .   ? -25.489 -13.917 31.325  1.00 53.40  ? 1027 HOH A O   1 
HETATM 8878 O O   . HOH N 8 .   ? 15.110  -31.271 25.620  1.00 50.60  ? 1028 HOH A O   1 
HETATM 8879 O O   . HOH N 8 .   ? -22.556 -21.421 39.016  1.00 51.49  ? 1029 HOH A O   1 
HETATM 8880 O O   . HOH N 8 .   ? -0.853  -52.688 55.594  1.00 53.81  ? 1030 HOH A O   1 
HETATM 8881 O O   . HOH N 8 .   ? 3.161   -22.126 43.548  1.00 43.47  ? 1031 HOH A O   1 
HETATM 8882 O O   . HOH N 8 .   ? -3.809  -58.761 7.872   1.00 53.68  ? 1032 HOH A O   1 
HETATM 8883 O O   . HOH N 8 .   ? -10.608 -52.205 0.831   1.00 53.33  ? 1033 HOH A O   1 
HETATM 8884 O O   . HOH N 8 .   ? 15.464  -31.963 52.394  1.00 65.83  ? 1034 HOH A O   1 
HETATM 8885 O O   . HOH N 8 .   ? -4.400  -28.197 15.046  1.00 49.73  ? 1035 HOH A O   1 
HETATM 8886 O O   . HOH N 8 .   ? 2.377   -18.605 48.556  0.81 46.07  ? 1036 HOH A O   1 
HETATM 8887 O O   . HOH N 8 .   ? -5.776  -15.749 18.735  1.00 53.94  ? 1037 HOH A O   1 
HETATM 8888 O O   . HOH N 8 .   ? 8.720   -20.942 36.519  0.99 57.44  ? 1038 HOH A O   1 
HETATM 8889 O O   . HOH N 8 .   ? -9.159  -49.748 41.816  1.00 47.65  ? 1039 HOH A O   1 
HETATM 8890 O O   . HOH N 8 .   ? 12.875  -55.712 42.660  1.00 52.13  ? 1040 HOH A O   1 
HETATM 8891 O O   . HOH N 8 .   ? -16.448 -41.856 31.187  1.00 59.19  ? 1041 HOH A O   1 
HETATM 8892 O O   . HOH N 8 .   ? 7.868   -43.532 13.402  1.00 42.86  ? 1042 HOH A O   1 
HETATM 8893 O O   . HOH N 8 .   ? -1.244  -20.174 15.770  1.00 50.17  ? 1043 HOH A O   1 
HETATM 8894 O O   . HOH N 8 .   ? -11.270 -43.523 31.316  1.00 53.38  ? 1044 HOH A O   1 
HETATM 8895 O O   . HOH N 8 .   ? -30.586 -30.588 24.531  1.00 51.30  ? 1045 HOH A O   1 
HETATM 8896 O O   . HOH N 8 .   ? -0.387  -22.126 14.954  1.00 52.31  ? 1046 HOH A O   1 
HETATM 8897 O O   . HOH N 8 .   ? 11.172  -22.356 35.194  0.93 51.61  ? 1047 HOH A O   1 
HETATM 8898 O O   . HOH N 8 .   ? -8.272  -26.923 52.185  0.82 38.50  ? 1048 HOH A O   1 
HETATM 8899 O O   . HOH N 8 .   ? -13.231 -48.977 42.627  1.00 54.36  ? 1049 HOH A O   1 
HETATM 8900 O O   . HOH N 8 .   ? 1.405   -16.792 18.067  1.00 63.14  ? 1050 HOH A O   1 
HETATM 8901 O O   . HOH N 8 .   ? -15.231 -48.530 3.845   1.00 59.85  ? 1051 HOH A O   1 
HETATM 8902 O O   . HOH N 8 .   ? 3.596   -63.135 48.243  0.95 53.44  ? 1052 HOH A O   1 
HETATM 8903 O O   . HOH N 8 .   ? -6.023  -61.461 23.417  1.00 61.40  ? 1053 HOH A O   1 
HETATM 8904 O O   . HOH N 8 .   ? -3.744  -17.933 29.279  0.90 45.96  ? 1054 HOH A O   1 
HETATM 8905 O O   . HOH N 8 .   ? 14.006  -25.585 47.219  0.88 50.76  ? 1055 HOH A O   1 
HETATM 8906 O O   . HOH N 8 .   ? -3.610  -26.038 14.592  0.75 40.28  ? 1056 HOH A O   1 
HETATM 8907 O O   . HOH N 8 .   ? -8.993  -45.193 31.620  1.00 49.48  ? 1057 HOH A O   1 
HETATM 8908 O O   . HOH N 8 .   ? -2.848  -15.949 22.315  1.00 66.35  ? 1058 HOH A O   1 
HETATM 8909 O O   . HOH N 8 .   ? 21.013  -44.475 41.627  1.00 48.82  ? 1059 HOH A O   1 
HETATM 8910 O O   . HOH N 8 .   ? -4.537  -62.116 27.470  1.00 55.36  ? 1060 HOH A O   1 
HETATM 8911 O O   . HOH N 8 .   ? 16.565  -28.972 47.989  0.91 51.17  ? 1061 HOH A O   1 
HETATM 8912 O O   . HOH N 8 .   ? -20.637 -22.692 42.471  1.00 55.30  ? 1062 HOH A O   1 
HETATM 8913 O O   . HOH N 8 .   ? -20.055 -4.847  25.286  1.00 71.25  ? 1063 HOH A O   1 
HETATM 8914 O O   . HOH N 8 .   ? -20.157 -64.806 10.408  0.98 64.63  ? 1064 HOH A O   1 
HETATM 8915 O O   . HOH N 8 .   ? 8.455   -64.698 40.235  1.00 57.81  ? 1065 HOH A O   1 
HETATM 8916 O O   . HOH N 8 .   ? -6.204  -62.138 14.733  1.00 60.15  ? 1066 HOH A O   1 
HETATM 8917 O O   . HOH N 8 .   ? 2.426   -53.396 20.220  1.00 46.66  ? 1067 HOH A O   1 
HETATM 8918 O O   . HOH N 8 .   ? 12.458  -66.639 29.912  1.00 64.71  ? 1068 HOH A O   1 
HETATM 8919 O O   . HOH N 8 .   ? 12.418  -25.777 25.912  1.00 56.72  ? 1069 HOH A O   1 
HETATM 8920 O O   . HOH N 8 .   ? 20.457  -43.850 22.573  1.00 50.54  ? 1070 HOH A O   1 
HETATM 8921 O O   . HOH N 8 .   ? 17.805  -41.450 45.810  1.00 46.69  ? 1071 HOH A O   1 
HETATM 8922 O O   . HOH N 8 .   ? -5.032  -15.561 29.475  0.97 47.97  ? 1072 HOH A O   1 
HETATM 8923 O O   . HOH N 8 .   ? -19.133 -66.965 10.539  1.00 63.89  ? 1073 HOH A O   1 
HETATM 8924 O O   . HOH N 8 .   ? 21.478  -46.095 21.745  0.98 52.88  ? 1074 HOH A O   1 
HETATM 8925 O O   . HOH N 8 .   ? 10.751  -67.804 31.419  1.00 64.05  ? 1075 HOH A O   1 
HETATM 8926 O O   . HOH N 8 .   ? 0.733   -19.956 12.974  1.00 66.67  ? 1076 HOH A O   1 
HETATM 8927 O O   . HOH N 8 .   ? -2.029  -17.719 31.334  1.00 57.13  ? 1077 HOH A O   1 
HETATM 8928 O O   . HOH N 8 .   ? 15.864  -26.721 47.827  0.98 56.82  ? 1078 HOH A O   1 
HETATM 8929 O O   . HOH O 8 .   ? 14.479  -60.976 -23.693 0.88 53.34  ? 701  HOH B O   1 
HETATM 8930 O O   . HOH O 8 .   ? 3.874   -35.014 -31.971 0.89 48.91  ? 702  HOH B O   1 
HETATM 8931 O O   . HOH O 8 .   ? -10.138 -84.253 -17.289 0.97 56.76  ? 703  HOH B O   1 
HETATM 8932 O O   . HOH O 8 .   ? 2.557   -70.215 -4.158  0.76 41.49  ? 704  HOH B O   1 
HETATM 8933 O O   . HOH O 8 .   ? 6.210   -33.546 -39.807 1.00 62.70  ? 705  HOH B O   1 
HETATM 8934 O O   . HOH O 8 .   ? 6.576   -50.299 -34.616 1.00 35.29  ? 706  HOH B O   1 
HETATM 8935 O O   . HOH O 8 .   ? -11.566 -51.220 -29.216 1.00 38.95  ? 707  HOH B O   1 
HETATM 8936 O O   . HOH O 8 .   ? 18.737  -59.808 3.470   0.90 52.78  ? 708  HOH B O   1 
HETATM 8937 O O   . HOH O 8 .   ? 2.377   -68.804 -16.927 1.00 27.58  ? 709  HOH B O   1 
HETATM 8938 O O   . HOH O 8 .   ? -12.366 -49.855 -35.428 1.00 59.76  ? 710  HOH B O   1 
HETATM 8939 O O   . HOH O 8 .   ? 15.408  -53.988 -41.713 0.92 48.28  ? 711  HOH B O   1 
HETATM 8940 O O   . HOH O 8 .   ? 2.478   -56.769 -0.138  1.00 47.94  ? 712  HOH B O   1 
HETATM 8941 O O   . HOH O 8 .   ? -13.191 -83.199 -30.785 0.93 50.92  ? 713  HOH B O   1 
HETATM 8942 O O   . HOH O 8 .   ? 1.936   -85.616 -22.310 1.00 32.53  ? 714  HOH B O   1 
HETATM 8943 O O   . HOH O 8 .   ? 27.168  -43.516 -14.870 1.00 68.94  ? 715  HOH B O   1 
HETATM 8944 O O   . HOH O 8 .   ? -2.657  -38.677 -23.820 0.73 42.27  ? 716  HOH B O   1 
HETATM 8945 O O   . HOH O 8 .   ? -2.727  -84.511 -42.432 1.00 48.17  ? 717  HOH B O   1 
HETATM 8946 O O   . HOH O 8 .   ? -12.438 -55.805 -12.854 1.00 59.33  ? 718  HOH B O   1 
HETATM 8947 O O   . HOH O 8 .   ? -8.668  -36.386 -41.324 1.00 49.00  ? 719  HOH B O   1 
HETATM 8948 O O   . HOH O 8 .   ? 16.463  -54.299 -25.548 1.00 62.89  ? 720  HOH B O   1 
HETATM 8949 O O   . HOH O 8 .   ? -12.332 -83.081 -12.083 0.94 55.70  ? 721  HOH B O   1 
HETATM 8950 O O   . HOH O 8 .   ? 6.294   -88.813 -46.413 1.00 60.55  ? 722  HOH B O   1 
HETATM 8951 O O   . HOH O 8 .   ? -4.598  -55.539 -11.481 1.00 38.78  ? 723  HOH B O   1 
HETATM 8952 O O   . HOH O 8 .   ? 4.279   -79.078 -6.326  0.92 42.70  ? 724  HOH B O   1 
HETATM 8953 O O   . HOH O 8 .   ? 7.088   -64.236 -28.854 1.00 29.60  ? 725  HOH B O   1 
HETATM 8954 O O   . HOH O 8 .   ? 16.287  -82.162 -23.437 1.00 38.25  ? 726  HOH B O   1 
HETATM 8955 O O   . HOH O 8 .   ? 9.848   -53.552 -22.332 1.00 49.12  ? 727  HOH B O   1 
HETATM 8956 O O   . HOH O 8 .   ? -3.750  -62.751 3.419   0.91 53.22  ? 728  HOH B O   1 
HETATM 8957 O O   . HOH O 8 .   ? 11.666  -62.426 -7.916  0.62 38.14  ? 729  HOH B O   1 
HETATM 8958 O O   . HOH O 8 .   ? 7.654   -78.883 -51.085 1.00 33.55  ? 730  HOH B O   1 
HETATM 8959 O O   . HOH O 8 .   ? 15.083  -66.551 -31.814 0.82 34.16  ? 731  HOH B O   1 
HETATM 8960 O O   . HOH O 8 .   ? -4.127  -66.091 -53.919 0.87 43.62  ? 732  HOH B O   1 
HETATM 8961 O O   . HOH O 8 .   ? 2.182   -53.907 -42.644 1.00 30.10  ? 733  HOH B O   1 
HETATM 8962 O O   . HOH O 8 .   ? 11.072  -58.397 4.464   0.90 45.18  ? 734  HOH B O   1 
HETATM 8963 O O   . HOH O 8 .   ? 12.498  -60.431 7.633   1.00 58.49  ? 735  HOH B O   1 
HETATM 8964 O O   . HOH O 8 .   ? 11.649  -72.847 -34.918 0.85 42.86  ? 736  HOH B O   1 
HETATM 8965 O O   . HOH O 8 .   ? 22.011  -45.371 -4.929  1.00 57.18  ? 737  HOH B O   1 
HETATM 8966 O O   . HOH O 8 .   ? -5.188  -74.628 -55.340 1.00 34.84  ? 738  HOH B O   1 
HETATM 8967 O O   . HOH O 8 .   ? 17.908  -53.794 -32.771 1.00 53.17  ? 739  HOH B O   1 
HETATM 8968 O O   . HOH O 8 .   ? 4.922   -78.880 -28.883 1.00 34.76  ? 740  HOH B O   1 
HETATM 8969 O O   . HOH O 8 .   ? -6.344  -84.678 -4.727  1.00 68.84  ? 741  HOH B O   1 
HETATM 8970 O O   . HOH O 8 .   ? -5.271  -75.488 -59.125 1.00 54.92  ? 742  HOH B O   1 
HETATM 8971 O O   . HOH O 8 .   ? 4.788   -48.918 -20.259 1.00 50.96  ? 743  HOH B O   1 
HETATM 8972 O O   . HOH O 8 .   ? -14.101 -58.647 -37.207 1.00 45.87  ? 744  HOH B O   1 
HETATM 8973 O O   . HOH O 8 .   ? -19.644 -72.305 -16.746 0.98 52.30  ? 745  HOH B O   1 
HETATM 8974 O O   . HOH O 8 .   ? -4.229  -36.304 -37.896 0.95 52.63  ? 746  HOH B O   1 
HETATM 8975 O O   . HOH O 8 .   ? 16.823  -61.850 -34.616 0.94 40.33  ? 747  HOH B O   1 
HETATM 8976 O O   . HOH O 8 .   ? -1.588  -84.401 -11.009 1.00 52.15  ? 748  HOH B O   1 
HETATM 8977 O O   . HOH O 8 .   ? -16.003 -55.776 -26.528 1.00 40.62  ? 749  HOH B O   1 
HETATM 8978 O O   . HOH O 8 .   ? -10.936 -69.686 -45.048 1.00 55.25  ? 750  HOH B O   1 
HETATM 8979 O O   . HOH O 8 .   ? -18.876 -70.609 -44.660 1.00 64.48  ? 751  HOH B O   1 
HETATM 8980 O O   . HOH O 8 .   ? -1.929  -34.656 -42.036 1.00 52.11  ? 752  HOH B O   1 
HETATM 8981 O O   . HOH O 8 .   ? 5.483   -66.550 -18.409 1.00 31.71  ? 753  HOH B O   1 
HETATM 8982 O O   . HOH O 8 .   ? 18.598  -84.638 -22.424 0.86 46.31  ? 754  HOH B O   1 
HETATM 8983 O O   . HOH O 8 .   ? 20.636  -79.698 -17.839 0.75 44.44  ? 755  HOH B O   1 
HETATM 8984 O O   . HOH O 8 .   ? -0.105  -63.663 -46.324 0.96 26.41  ? 756  HOH B O   1 
HETATM 8985 O O   . HOH O 8 .   ? 20.713  -59.285 -30.108 0.83 48.99  ? 757  HOH B O   1 
HETATM 8986 O O   . HOH O 8 .   ? 9.224   -40.449 -7.257  0.87 62.80  ? 758  HOH B O   1 
HETATM 8987 O O   . HOH O 8 .   ? 2.878   -51.018 -16.807 1.00 42.01  ? 759  HOH B O   1 
HETATM 8988 O O   . HOH O 8 .   ? 11.522  -47.986 9.538   0.87 40.52  ? 760  HOH B O   1 
HETATM 8989 O O   . HOH O 8 .   ? -12.441 -80.035 -11.263 1.00 46.69  ? 761  HOH B O   1 
HETATM 8990 O O   . HOH O 8 .   ? 4.349   -51.228 -46.963 1.00 35.18  ? 762  HOH B O   1 
HETATM 8991 O O   . HOH O 8 .   ? 4.167   -71.726 -33.171 1.00 29.05  ? 763  HOH B O   1 
HETATM 8992 O O   . HOH O 8 .   ? 1.595   -48.563 -15.036 0.89 50.03  ? 764  HOH B O   1 
HETATM 8993 O O   . HOH O 8 .   ? -9.429  -63.257 -7.183  0.97 40.39  ? 765  HOH B O   1 
HETATM 8994 O O   . HOH O 8 .   ? 10.933  -57.164 2.266   0.92 40.74  ? 766  HOH B O   1 
HETATM 8995 O O   . HOH O 8 .   ? 1.306   -43.425 -49.456 0.70 36.65  ? 767  HOH B O   1 
HETATM 8996 O O   . HOH O 8 .   ? -11.472 -71.194 -34.360 0.97 34.66  ? 768  HOH B O   1 
HETATM 8997 O O   . HOH O 8 .   ? 8.402   -42.684 -0.405  1.00 61.91  ? 769  HOH B O   1 
HETATM 8998 O O   . HOH O 8 .   ? -0.039  -52.833 -41.135 0.92 27.12  ? 770  HOH B O   1 
HETATM 8999 O O   . HOH O 8 .   ? -17.755 -74.576 -34.917 0.95 55.70  ? 771  HOH B O   1 
HETATM 9000 O O   . HOH O 8 .   ? -5.821  -53.091 -20.120 0.92 32.20  ? 772  HOH B O   1 
HETATM 9001 O O   . HOH O 8 .   ? 15.365  -42.258 -6.216  0.91 50.23  ? 773  HOH B O   1 
HETATM 9002 O O   . HOH O 8 .   ? -2.100  -48.112 -29.913 1.00 29.21  ? 774  HOH B O   1 
HETATM 9003 O O   . HOH O 8 .   ? 10.330  -62.200 -14.658 1.00 34.33  ? 775  HOH B O   1 
HETATM 9004 O O   . HOH O 8 .   ? 7.443   -62.946 -46.399 0.91 32.60  ? 776  HOH B O   1 
HETATM 9005 O O   . HOH O 8 .   ? -4.285  -42.438 -46.507 0.73 42.04  ? 777  HOH B O   1 
HETATM 9006 O O   . HOH O 8 .   ? 3.110   -48.808 -46.853 0.93 40.51  ? 778  HOH B O   1 
HETATM 9007 O O   . HOH O 8 .   ? -11.489 -51.740 -32.504 1.00 40.26  ? 779  HOH B O   1 
HETATM 9008 O O   . HOH O 8 .   ? -1.682  -47.933 -21.361 0.88 52.72  ? 780  HOH B O   1 
HETATM 9009 O O   . HOH O 8 .   ? -3.200  -63.438 -52.970 1.00 50.29  ? 781  HOH B O   1 
HETATM 9010 O O   . HOH O 8 .   ? 23.055  -64.681 -17.143 1.00 48.19  ? 782  HOH B O   1 
HETATM 9011 O O   . HOH O 8 .   ? 12.201  -72.357 -15.578 0.84 43.10  ? 783  HOH B O   1 
HETATM 9012 O O   . HOH O 8 .   ? 6.939   -70.822 -46.150 1.00 30.77  ? 784  HOH B O   1 
HETATM 9013 O O   . HOH O 8 .   ? 8.655   -53.337 -32.648 1.00 32.06  ? 785  HOH B O   1 
HETATM 9014 O O   . HOH O 8 .   ? 12.169  -58.861 -31.518 0.98 38.31  ? 786  HOH B O   1 
HETATM 9015 O O   . HOH O 8 .   ? 4.726   -55.797 -37.311 1.00 25.95  ? 787  HOH B O   1 
HETATM 9016 O O   . HOH O 8 .   ? 10.137  -71.042 -22.202 0.87 30.96  ? 788  HOH B O   1 
HETATM 9017 O O   . HOH O 8 .   ? -1.589  -45.306 -31.814 1.00 34.28  ? 789  HOH B O   1 
HETATM 9018 O O   . HOH O 8 .   ? -10.476 -49.643 -42.291 0.96 44.50  ? 790  HOH B O   1 
HETATM 9019 O O   . HOH O 8 .   ? 7.791   -72.670 -33.675 0.73 26.75  ? 791  HOH B O   1 
HETATM 9020 O O   . HOH O 8 .   ? -0.412  -68.077 -1.510  1.00 42.32  ? 792  HOH B O   1 
HETATM 9021 O O   . HOH O 8 .   ? -8.478  -66.312 -44.808 0.74 37.22  ? 793  HOH B O   1 
HETATM 9022 O O   . HOH O 8 .   ? -13.314 -81.548 -26.892 1.00 44.51  ? 794  HOH B O   1 
HETATM 9023 O O   . HOH O 8 .   ? -13.202 -76.748 -40.022 0.99 36.63  ? 795  HOH B O   1 
HETATM 9024 O O   . HOH O 8 .   ? -5.282  -81.632 -51.373 0.94 39.35  ? 796  HOH B O   1 
HETATM 9025 O O   . HOH O 8 .   ? -10.242 -39.323 -39.081 1.00 52.98  ? 797  HOH B O   1 
HETATM 9026 O O   . HOH O 8 .   ? 10.172  -60.343 -27.469 1.00 36.24  ? 798  HOH B O   1 
HETATM 9027 O O   . HOH O 8 .   ? 23.347  -53.088 -8.068  1.00 52.32  ? 799  HOH B O   1 
HETATM 9028 O O   . HOH O 8 .   ? -16.827 -46.322 -31.698 1.00 50.79  ? 800  HOH B O   1 
HETATM 9029 O O   . HOH O 8 .   ? 4.774   -65.773 -25.681 1.00 26.86  ? 801  HOH B O   1 
HETATM 9030 O O   . HOH O 8 .   ? 7.683   -50.518 -28.437 1.00 49.20  ? 802  HOH B O   1 
HETATM 9031 O O   . HOH O 8 .   ? 19.512  -85.008 -24.908 1.00 39.58  ? 803  HOH B O   1 
HETATM 9032 O O   . HOH O 8 .   ? -4.704  -49.426 -37.745 0.94 33.16  ? 804  HOH B O   1 
HETATM 9033 O O   . HOH O 8 .   ? 15.832  -81.950 -12.774 1.00 52.76  ? 805  HOH B O   1 
HETATM 9034 O O   . HOH O 8 .   ? -7.120  -73.738 -9.387  0.97 32.82  ? 806  HOH B O   1 
HETATM 9035 O O   . HOH O 8 .   ? -6.311  -64.658 -5.093  1.00 35.32  ? 807  HOH B O   1 
HETATM 9036 O O   . HOH O 8 .   ? 19.021  -73.257 -13.347 0.99 52.75  ? 808  HOH B O   1 
HETATM 9037 O O   . HOH O 8 .   ? 11.744  -58.490 -0.086  1.00 44.92  ? 809  HOH B O   1 
HETATM 9038 O O   . HOH O 8 .   ? 4.649   -68.920 -5.229  1.00 52.78  ? 810  HOH B O   1 
HETATM 9039 O O   . HOH O 8 .   ? 10.522  -58.353 8.946   1.00 51.67  ? 811  HOH B O   1 
HETATM 9040 O O   . HOH O 8 .   ? 12.264  -68.033 -6.877  1.00 53.91  ? 812  HOH B O   1 
HETATM 9041 O O   . HOH O 8 .   ? 5.572   -63.478 -9.343  1.00 34.25  ? 813  HOH B O   1 
HETATM 9042 O O   . HOH O 8 .   ? -8.112  -82.055 -48.319 1.00 46.57  ? 814  HOH B O   1 
HETATM 9043 O O   . HOH O 8 .   ? -14.095 -71.869 -10.955 1.00 37.08  ? 815  HOH B O   1 
HETATM 9044 O O   . HOH O 8 .   ? -16.285 -63.234 -36.334 0.98 51.18  ? 816  HOH B O   1 
HETATM 9045 O O   . HOH O 8 .   ? 1.333   -61.678 -45.516 1.00 28.02  ? 817  HOH B O   1 
HETATM 9046 O O   . HOH O 8 .   ? 4.594   -70.958 -47.419 1.00 28.10  ? 818  HOH B O   1 
HETATM 9047 O O   . HOH O 8 .   ? 7.631   -66.307 -38.458 1.00 28.58  ? 819  HOH B O   1 
HETATM 9048 O O   . HOH O 8 .   ? 5.868   -68.064 -38.446 0.72 34.91  ? 820  HOH B O   1 
HETATM 9049 O O   . HOH O 8 .   ? -4.087  -36.509 -34.878 0.96 45.81  ? 821  HOH B O   1 
HETATM 9050 O O   . HOH O 8 .   ? 3.703   -79.830 -9.584  0.99 40.45  ? 822  HOH B O   1 
HETATM 9051 O O   . HOH O 8 .   ? 22.510  -77.947 -26.118 1.00 58.50  ? 823  HOH B O   1 
HETATM 9052 O O   . HOH O 8 .   ? 3.244   -59.400 -28.900 1.00 26.05  ? 824  HOH B O   1 
HETATM 9053 O O   . HOH O 8 .   ? 10.722  -63.466 -20.965 0.81 43.82  ? 825  HOH B O   1 
HETATM 9054 O O   . HOH O 8 .   ? 7.140   -82.379 -48.050 1.00 53.57  ? 826  HOH B O   1 
HETATM 9055 O O   . HOH O 8 .   ? -10.845 -87.351 -31.700 1.00 62.97  ? 827  HOH B O   1 
HETATM 9056 O O   . HOH O 8 .   ? 9.549   -85.095 -12.790 0.94 47.11  ? 828  HOH B O   1 
HETATM 9057 O O   . HOH O 8 .   ? 15.550  -61.338 -38.886 1.00 44.93  ? 829  HOH B O   1 
HETATM 9058 O O   . HOH O 8 .   ? 17.781  -69.561 -21.269 1.00 53.96  ? 830  HOH B O   1 
HETATM 9059 O O   . HOH O 8 .   ? 7.984   -53.234 -46.440 0.99 36.19  ? 831  HOH B O   1 
HETATM 9060 O O   . HOH O 8 .   ? -2.317  -53.882 -11.349 0.95 36.63  ? 832  HOH B O   1 
HETATM 9061 O O   . HOH O 8 .   ? 4.733   -69.340 -40.715 1.00 28.56  ? 833  HOH B O   1 
HETATM 9062 O O   . HOH O 8 .   ? 15.727  -50.090 -9.637  0.96 44.00  ? 834  HOH B O   1 
HETATM 9063 O O   . HOH O 8 .   ? 13.064  -69.706 -29.207 1.00 36.07  ? 835  HOH B O   1 
HETATM 9064 O O   . HOH O 8 .   ? 11.774  -58.602 -46.264 0.67 40.93  ? 836  HOH B O   1 
HETATM 9065 O O   . HOH O 8 .   ? 1.261   -88.201 -34.935 1.00 54.10  ? 837  HOH B O   1 
HETATM 9066 O O   . HOH O 8 .   ? 15.289  -50.461 -34.058 0.85 39.19  ? 838  HOH B O   1 
HETATM 9067 O O   . HOH O 8 .   ? 18.712  -52.217 -15.746 1.00 51.11  ? 839  HOH B O   1 
HETATM 9068 O O   . HOH O 8 .   ? -11.611 -78.347 -47.694 0.94 51.14  ? 840  HOH B O   1 
HETATM 9069 O O   . HOH O 8 .   ? 0.627   -37.223 -47.383 1.00 47.53  ? 841  HOH B O   1 
HETATM 9070 O O   . HOH O 8 .   ? -10.236 -32.640 -44.852 1.00 65.79  ? 842  HOH B O   1 
HETATM 9071 O O   . HOH O 8 .   ? -16.088 -68.153 -3.903  0.99 51.87  ? 843  HOH B O   1 
HETATM 9072 O O   . HOH O 8 .   ? -4.609  -57.787 -45.819 0.93 35.99  ? 844  HOH B O   1 
HETATM 9073 O O   . HOH O 8 .   ? 22.390  -67.101 -28.398 1.00 59.78  ? 845  HOH B O   1 
HETATM 9074 O O   . HOH O 8 .   ? -0.138  -90.649 -31.588 1.00 54.84  ? 846  HOH B O   1 
HETATM 9075 O O   . HOH O 8 .   ? -6.457  -41.288 -23.869 1.00 40.40  ? 847  HOH B O   1 
HETATM 9076 O O   . HOH O 8 .   ? 15.225  -71.504 -22.243 1.00 50.80  ? 848  HOH B O   1 
HETATM 9077 O O   . HOH O 8 .   ? -16.073 -78.187 -27.111 1.00 45.82  ? 849  HOH B O   1 
HETATM 9078 O O   . HOH O 8 .   ? 15.986  -72.825 -20.320 0.95 44.80  ? 850  HOH B O   1 
HETATM 9079 O O   . HOH O 8 .   ? 10.477  -62.442 -32.482 0.90 29.97  ? 851  HOH B O   1 
HETATM 9080 O O   . HOH O 8 .   ? -4.392  -50.226 -31.829 1.00 33.27  ? 852  HOH B O   1 
HETATM 9081 O O   . HOH O 8 .   ? -8.742  -83.406 -45.809 1.00 45.31  ? 853  HOH B O   1 
HETATM 9082 O O   . HOH O 8 .   ? 6.033   -85.876 -27.799 0.82 41.83  ? 854  HOH B O   1 
HETATM 9083 O O   . HOH O 8 .   ? 7.729   -77.604 -36.212 1.00 39.58  ? 855  HOH B O   1 
HETATM 9084 O O   . HOH O 8 .   ? -20.083 -52.191 -23.531 1.00 59.68  ? 856  HOH B O   1 
HETATM 9085 O O   . HOH O 8 .   ? -12.020 -46.151 -37.065 0.86 50.76  ? 857  HOH B O   1 
HETATM 9086 O O   . HOH O 8 .   ? -9.826  -77.688 -27.655 0.96 36.74  ? 858  HOH B O   1 
HETATM 9087 O O   . HOH O 8 .   ? -17.697 -61.352 -25.430 1.00 51.35  ? 859  HOH B O   1 
HETATM 9088 O O   . HOH O 8 .   ? -1.944  -29.823 -38.564 1.00 50.21  ? 860  HOH B O   1 
HETATM 9089 O O   . HOH O 8 .   ? -18.672 -58.447 -21.068 1.00 53.26  ? 861  HOH B O   1 
HETATM 9090 O O   . HOH O 8 .   ? 15.319  -86.842 -24.874 0.98 44.86  ? 862  HOH B O   1 
HETATM 9091 O O   . HOH O 8 .   ? 5.722   -61.991 -36.171 1.00 28.71  ? 863  HOH B O   1 
HETATM 9092 O O   . HOH O 8 .   ? -10.926 -46.207 -34.762 0.94 44.19  ? 864  HOH B O   1 
HETATM 9093 O O   . HOH O 8 .   ? 9.378   -62.672 -28.623 1.00 28.17  ? 865  HOH B O   1 
HETATM 9094 O O   . HOH O 8 .   ? -10.709 -72.225 -4.947  1.00 41.49  ? 866  HOH B O   1 
HETATM 9095 O O   . HOH O 8 .   ? 3.864   -52.561 -28.201 0.94 35.56  ? 867  HOH B O   1 
HETATM 9096 O O   . HOH O 8 .   ? -19.965 -69.071 -22.651 1.00 56.07  ? 868  HOH B O   1 
HETATM 9097 O O   . HOH O 8 .   ? -18.925 -76.686 -29.089 0.80 43.35  ? 869  HOH B O   1 
HETATM 9098 O O   . HOH O 8 .   ? 14.429  -54.240 -36.242 0.98 34.61  ? 870  HOH B O   1 
HETATM 9099 O O   . HOH O 8 .   ? 26.218  -63.669 -21.002 1.00 60.09  ? 871  HOH B O   1 
HETATM 9100 O O   . HOH O 8 .   ? 10.012  -58.874 -47.637 0.87 48.55  ? 872  HOH B O   1 
HETATM 9101 O O   . HOH O 8 .   ? 9.230   -43.386 -5.882  1.00 50.55  ? 873  HOH B O   1 
HETATM 9102 O O   . HOH O 8 .   ? 1.042   -67.258 -32.302 1.00 25.03  ? 874  HOH B O   1 
HETATM 9103 O O   . HOH O 8 .   ? 14.579  -60.520 -26.598 1.00 44.47  ? 875  HOH B O   1 
HETATM 9104 O O   . HOH O 8 .   ? 17.521  -51.723 6.596   1.00 47.67  ? 876  HOH B O   1 
HETATM 9105 O O   . HOH O 8 .   ? -10.567 -44.526 -24.995 1.00 45.30  ? 877  HOH B O   1 
HETATM 9106 O O   . HOH O 8 .   ? -18.291 -60.702 -9.126  1.00 57.66  ? 878  HOH B O   1 
HETATM 9107 O O   . HOH O 8 .   ? 4.866   -43.455 -11.815 1.00 58.73  ? 879  HOH B O   1 
HETATM 9108 O O   . HOH O 8 .   ? -8.738  -53.904 -45.296 0.74 39.98  ? 880  HOH B O   1 
HETATM 9109 O O   . HOH O 8 .   ? -8.615  -72.472 -55.234 0.97 42.50  ? 881  HOH B O   1 
HETATM 9110 O O   . HOH O 8 .   ? -4.118  -54.970 -44.530 0.91 31.53  ? 882  HOH B O   1 
HETATM 9111 O O   . HOH O 8 .   ? 8.074   -84.308 -45.760 1.00 46.64  ? 883  HOH B O   1 
HETATM 9112 O O   . HOH O 8 .   ? 8.258   -55.964 -46.132 0.92 34.22  ? 884  HOH B O   1 
HETATM 9113 O O   . HOH O 8 .   ? 15.380  -59.208 -41.435 1.00 43.04  ? 885  HOH B O   1 
HETATM 9114 O O   . HOH O 8 .   ? 8.430   -61.056 -9.195  1.00 43.92  ? 886  HOH B O   1 
HETATM 9115 O O   . HOH O 8 .   ? 0.186   -64.258 -48.998 1.00 34.11  ? 887  HOH B O   1 
HETATM 9116 O O   . HOH O 8 .   ? 6.948   -84.281 -12.166 1.00 49.79  ? 888  HOH B O   1 
HETATM 9117 O O   . HOH O 8 .   ? -5.730  -69.815 -46.682 0.97 38.44  ? 889  HOH B O   1 
HETATM 9118 O O   . HOH O 8 .   ? -3.313  -88.300 -24.050 1.00 51.20  ? 890  HOH B O   1 
HETATM 9119 O O   . HOH O 8 .   ? -13.001 -75.173 -5.861  0.95 47.14  ? 891  HOH B O   1 
HETATM 9120 O O   . HOH O 8 .   ? 13.163  -75.137 -9.255  1.00 44.13  ? 892  HOH B O   1 
HETATM 9121 O O   . HOH O 8 .   ? -0.507  -84.473 -15.981 1.00 48.78  ? 893  HOH B O   1 
HETATM 9122 O O   . HOH O 8 .   ? 2.916   -56.198 -41.694 0.93 29.76  ? 894  HOH B O   1 
HETATM 9123 O O   . HOH O 8 .   ? 1.539   -75.122 -57.936 0.91 40.06  ? 895  HOH B O   1 
HETATM 9124 O O   . HOH O 8 .   ? 15.651  -53.203 -34.070 1.00 39.82  ? 896  HOH B O   1 
HETATM 9125 O O   . HOH O 8 .   ? -5.119  -85.977 -48.841 1.00 58.68  ? 897  HOH B O   1 
HETATM 9126 O O   . HOH O 8 .   ? 12.807  -87.406 -25.879 1.00 46.07  ? 898  HOH B O   1 
HETATM 9127 O O   . HOH O 8 .   ? 0.794   -84.298 -9.209  1.00 54.35  ? 899  HOH B O   1 
HETATM 9128 O O   . HOH O 8 .   ? 13.776  -61.843 -7.649  1.00 50.66  ? 900  HOH B O   1 
HETATM 9129 O O   . HOH O 8 .   ? 29.804  -44.431 -14.133 1.00 72.14  ? 901  HOH B O   1 
HETATM 9130 O O   . HOH O 8 .   ? 4.868   -68.653 -48.821 1.00 35.70  ? 902  HOH B O   1 
HETATM 9131 O O   . HOH O 8 .   ? -12.839 -60.736 -39.133 1.00 53.40  ? 903  HOH B O   1 
HETATM 9132 O O   . HOH O 8 .   ? -18.669 -53.064 -30.187 1.00 47.87  ? 904  HOH B O   1 
HETATM 9133 O O   . HOH O 8 .   ? -8.963  -52.571 -18.213 1.00 42.77  ? 905  HOH B O   1 
HETATM 9134 O O   . HOH O 8 .   ? 18.101  -49.570 -39.238 0.77 43.45  ? 906  HOH B O   1 
HETATM 9135 O O   . HOH O 8 .   ? 11.340  -65.484 -44.343 0.89 35.24  ? 907  HOH B O   1 
HETATM 9136 O O   . HOH O 8 .   ? -8.138  -71.149 -47.185 1.00 44.33  ? 908  HOH B O   1 
HETATM 9137 O O   . HOH O 8 .   ? -16.229 -67.654 -7.115  1.00 49.59  ? 909  HOH B O   1 
HETATM 9138 O O   . HOH O 8 .   ? -6.972  -60.031 -6.211  1.00 36.91  ? 910  HOH B O   1 
HETATM 9139 O O   . HOH O 8 .   ? -2.243  -80.314 -1.757  1.00 45.27  ? 911  HOH B O   1 
HETATM 9140 O O   . HOH O 8 .   ? 10.579  -43.973 1.654   1.00 53.22  ? 912  HOH B O   1 
HETATM 9141 O O   . HOH O 8 .   ? -1.708  -65.368 -1.032  1.00 52.29  ? 913  HOH B O   1 
HETATM 9142 O O   . HOH O 8 .   ? -2.779  -81.600 -54.496 1.00 43.97  ? 914  HOH B O   1 
HETATM 9143 O O   . HOH O 8 .   ? -9.022  -85.458 -21.671 0.98 48.07  ? 915  HOH B O   1 
HETATM 9144 O O   . HOH O 8 .   ? 11.124  -56.075 -46.169 0.98 49.79  ? 916  HOH B O   1 
HETATM 9145 O O   . HOH O 8 .   ? 5.160   -55.869 -40.127 0.86 30.78  ? 917  HOH B O   1 
HETATM 9146 O O   . HOH O 8 .   ? 8.299   -62.654 -2.965  1.00 62.54  ? 918  HOH B O   1 
HETATM 9147 O O   . HOH O 8 .   ? -4.466  -44.513 -22.034 1.00 41.46  ? 919  HOH B O   1 
HETATM 9148 O O   . HOH O 8 .   ? 10.192  -74.058 -40.449 0.69 37.13  ? 920  HOH B O   1 
HETATM 9149 O O   . HOH O 8 .   ? -13.884 -71.788 -51.613 1.00 61.93  ? 921  HOH B O   1 
HETATM 9150 O O   . HOH O 8 .   ? 16.375  -86.617 -13.801 1.00 49.17  ? 922  HOH B O   1 
HETATM 9151 O O   . HOH O 8 .   ? -5.454  -62.248 -5.341  0.97 32.82  ? 923  HOH B O   1 
HETATM 9152 O O   . HOH O 8 .   ? 5.014   -50.903 -30.172 0.95 41.37  ? 924  HOH B O   1 
HETATM 9153 O O   . HOH O 8 .   ? 10.527  -67.900 -44.939 0.86 39.71  ? 925  HOH B O   1 
HETATM 9154 O O   . HOH O 8 .   ? -18.318 -70.491 -28.687 1.00 54.59  ? 926  HOH B O   1 
HETATM 9155 O O   . HOH O 8 .   ? 16.755  -75.005 -23.599 1.00 62.06  ? 927  HOH B O   1 
HETATM 9156 O O   . HOH O 8 .   ? -12.676 -77.672 -43.541 0.72 45.80  ? 928  HOH B O   1 
HETATM 9157 O O   . HOH O 8 .   ? -18.399 -74.353 -17.468 1.00 57.25  ? 929  HOH B O   1 
HETATM 9158 O O   . HOH O 8 .   ? -2.366  -69.279 -58.060 1.00 49.18  ? 930  HOH B O   1 
HETATM 9159 O O   . HOH O 8 .   ? 1.864   -36.045 -30.717 1.00 48.21  ? 931  HOH B O   1 
HETATM 9160 O O   . HOH O 8 .   ? 12.660  -79.282 -38.450 1.00 53.94  ? 932  HOH B O   1 
HETATM 9161 O O   . HOH O 8 .   ? 11.102  -76.444 -42.466 1.00 49.88  ? 933  HOH B O   1 
HETATM 9162 O O   . HOH O 8 .   ? 13.969  -65.835 -43.572 1.00 45.75  ? 934  HOH B O   1 
HETATM 9163 O O   . HOH O 8 .   ? 2.326   -79.026 -57.626 1.00 54.04  ? 935  HOH B O   1 
HETATM 9164 O O   . HOH O 8 .   ? -6.644  -85.772 -27.951 1.00 49.15  ? 936  HOH B O   1 
HETATM 9165 O O   . HOH O 8 .   ? 19.682  -45.379 -0.796  1.00 59.88  ? 937  HOH B O   1 
HETATM 9166 O O   . HOH O 8 .   ? 12.218  -51.647 -44.253 0.94 46.03  ? 938  HOH B O   1 
HETATM 9167 O O   . HOH O 8 .   ? 15.649  -70.724 -34.524 1.00 58.11  ? 939  HOH B O   1 
HETATM 9168 O O   . HOH O 8 .   ? 6.871   -71.386 -3.509  1.00 58.90  ? 940  HOH B O   1 
HETATM 9169 O O   . HOH O 8 .   ? -8.028  -32.924 -40.557 1.00 48.91  ? 941  HOH B O   1 
HETATM 9170 O O   . HOH O 8 .   ? -2.890  -80.488 -52.001 0.81 38.69  ? 942  HOH B O   1 
HETATM 9171 O O   . HOH O 8 .   ? 11.068  -78.036 -9.092  1.00 51.57  ? 943  HOH B O   1 
HETATM 9172 O O   . HOH O 8 .   ? 9.733   -51.393 -46.031 1.00 42.44  ? 944  HOH B O   1 
HETATM 9173 O O   . HOH O 8 .   ? 0.086   -43.519 -21.127 1.00 56.35  ? 945  HOH B O   1 
HETATM 9174 O O   . HOH O 8 .   ? -13.715 -54.682 -35.129 1.00 54.05  ? 946  HOH B O   1 
HETATM 9175 O O   . HOH O 8 .   ? 4.335   -58.121 -0.691  1.00 63.23  ? 947  HOH B O   1 
HETATM 9176 O O   . HOH O 8 .   ? -14.916 -56.096 -33.425 1.00 47.24  ? 948  HOH B O   1 
HETATM 9177 O O   . HOH O 8 .   ? -18.660 -73.623 -32.446 1.00 58.30  ? 949  HOH B O   1 
HETATM 9178 O O   . HOH O 8 .   ? -6.848  -54.263 -47.033 1.00 56.57  ? 950  HOH B O   1 
HETATM 9179 O O   . HOH O 8 .   ? 1.690   -49.644 -23.021 1.00 42.99  ? 951  HOH B O   1 
HETATM 9180 O O   . HOH O 8 .   ? 7.226   -52.904 -35.047 0.96 30.52  ? 952  HOH B O   1 
HETATM 9181 O O   . HOH O 8 .   ? -16.928 -81.154 -35.790 1.00 54.39  ? 953  HOH B O   1 
HETATM 9182 O O   . HOH O 8 .   ? 12.558  -59.727 -28.531 1.00 33.41  ? 954  HOH B O   1 
HETATM 9183 O O   . HOH O 8 .   ? 14.029  -69.192 -31.645 1.00 37.35  ? 955  HOH B O   1 
HETATM 9184 O O   . HOH O 8 .   ? -11.928 -76.563 -45.592 0.90 48.09  ? 956  HOH B O   1 
HETATM 9185 O O   . HOH O 8 .   ? 9.675   -76.706 -36.806 1.00 52.76  ? 957  HOH B O   1 
HETATM 9186 O O   . HOH O 8 .   ? 15.108  -72.676 -24.864 1.00 64.55  ? 958  HOH B O   1 
HETATM 9187 O O   . HOH O 8 .   ? 17.265  -68.743 -39.203 1.00 66.28  ? 959  HOH B O   1 
HETATM 9188 O O   . HOH O 8 .   ? 3.535   -36.511 -10.701 1.00 72.99  ? 960  HOH B O   1 
HETATM 9189 O O   . HOH O 8 .   ? -2.093  -69.312 1.877   0.98 55.41  ? 961  HOH B O   1 
HETATM 9190 O O   . HOH O 8 .   ? -1.570  -71.573 1.092   1.00 44.49  ? 962  HOH B O   1 
HETATM 9191 O O   . HOH O 8 .   ? 20.138  -48.677 0.775   1.00 60.24  ? 963  HOH B O   1 
HETATM 9192 O O   . HOH O 8 .   ? -17.924 -59.149 -23.677 1.00 52.83  ? 964  HOH B O   1 
HETATM 9193 O O   . HOH O 8 .   ? 0.667   -66.274 -2.296  1.00 52.61  ? 965  HOH B O   1 
HETATM 9194 O O   . HOH O 8 .   ? -10.669 -59.789 -38.927 0.75 37.57  ? 966  HOH B O   1 
HETATM 9195 O O   . HOH O 8 .   ? 12.720  -73.121 -37.869 1.00 54.49  ? 967  HOH B O   1 
HETATM 9196 O O   . HOH O 8 .   ? 6.580   -64.286 -49.586 1.00 46.64  ? 968  HOH B O   1 
HETATM 9197 O O   . HOH O 8 .   ? -1.843  -73.616 -61.369 0.92 42.61  ? 969  HOH B O   1 
HETATM 9198 O O   . HOH O 8 .   ? 5.290   -60.880 -8.703  0.94 41.92  ? 970  HOH B O   1 
HETATM 9199 O O   . HOH O 8 .   ? -12.517 -63.771 -0.636  1.00 50.43  ? 971  HOH B O   1 
HETATM 9200 O O   . HOH O 8 .   ? 5.678   -85.811 -9.099  1.00 59.08  ? 972  HOH B O   1 
HETATM 9201 O O   . HOH O 8 .   ? -6.610  -71.299 4.653   1.00 54.29  ? 973  HOH B O   1 
HETATM 9202 O O   . HOH O 8 .   ? -6.982  -76.340 -56.553 0.85 48.19  ? 974  HOH B O   1 
HETATM 9203 O O   . HOH O 8 .   ? 19.083  -86.558 -16.141 1.00 52.71  ? 975  HOH B O   1 
HETATM 9204 O O   . HOH O 8 .   ? 0.370   -61.458 -1.016  1.00 35.64  ? 976  HOH B O   1 
HETATM 9205 O O   . HOH O 8 .   ? 2.734   -35.461 -27.825 1.00 55.67  ? 977  HOH B O   1 
HETATM 9206 O O   . HOH O 8 .   ? -9.730  -88.434 -7.407  1.00 75.79  ? 978  HOH B O   1 
HETATM 9207 O O   . HOH O 8 .   ? 12.427  -39.747 -41.557 0.99 58.04  ? 979  HOH B O   1 
HETATM 9208 O O   . HOH O 8 .   ? 0.500   -48.229 -22.474 1.00 46.64  ? 980  HOH B O   1 
HETATM 9209 O O   . HOH O 8 .   ? 4.407   -87.718 -17.193 1.00 48.60  ? 981  HOH B O   1 
HETATM 9210 O O   . HOH O 8 .   ? -10.926 -83.747 -7.481  1.00 67.74  ? 982  HOH B O   1 
HETATM 9211 O O   . HOH O 8 .   ? 13.391  -38.989 -39.690 1.00 64.28  ? 983  HOH B O   1 
HETATM 9212 O O   . HOH O 8 .   ? -16.061 -81.062 -23.368 1.00 59.78  ? 984  HOH B O   1 
HETATM 9213 O O   . HOH O 8 .   ? 19.213  -87.746 -23.475 1.00 57.56  ? 985  HOH B O   1 
HETATM 9214 O O   . HOH O 8 .   ? 15.789  -44.549 -39.260 1.00 45.97  ? 986  HOH B O   1 
HETATM 9215 O O   . HOH O 8 .   ? -16.921 -79.078 -22.007 1.00 52.29  ? 987  HOH B O   1 
HETATM 9216 O O   . HOH O 8 .   ? 9.491   -90.066 -36.472 1.00 60.30  ? 988  HOH B O   1 
HETATM 9217 O O   . HOH O 8 .   ? 0.578   -71.525 -55.975 1.00 46.10  ? 989  HOH B O   1 
HETATM 9218 O O   . HOH O 8 .   ? -11.710 -86.070 -39.068 1.00 56.17  ? 990  HOH B O   1 
HETATM 9219 O O   . HOH O 8 .   ? -1.316  -63.707 0.310   1.00 52.50  ? 991  HOH B O   1 
HETATM 9220 O O   . HOH O 8 .   ? -20.020 -68.221 -27.975 1.00 60.34  ? 992  HOH B O   1 
HETATM 9221 O O   . HOH O 8 .   ? -10.596 -57.819 -40.397 1.00 51.88  ? 993  HOH B O   1 
HETATM 9222 O O   . HOH O 8 .   ? 7.507   -48.371 -48.197 1.00 49.49  ? 994  HOH B O   1 
HETATM 9223 O O   . HOH O 8 .   ? 10.110  -74.576 -34.519 0.98 41.99  ? 995  HOH B O   1 
HETATM 9224 O O   . HOH O 8 .   ? 8.747   -69.113 -47.214 0.97 33.06  ? 996  HOH B O   1 
HETATM 9225 O O   . HOH O 8 .   ? -10.635 -67.286 -43.457 1.00 52.69  ? 997  HOH B O   1 
HETATM 9226 O O   . HOH O 8 .   ? -12.348 -65.903 -44.078 1.00 62.69  ? 998  HOH B O   1 
HETATM 9227 O O   . HOH O 8 .   ? 14.551  -66.385 -6.090  1.00 49.86  ? 999  HOH B O   1 
HETATM 9228 O O   . HOH O 8 .   ? -7.901  -87.069 -4.647  1.00 69.05  ? 1000 HOH B O   1 
HETATM 9229 O O   . HOH O 8 .   ? 9.887   -60.567 -24.893 1.00 53.11  ? 1001 HOH B O   1 
HETATM 9230 O O   . HOH O 8 .   ? -9.201  -60.243 -7.174  1.00 46.04  ? 1002 HOH B O   1 
HETATM 9231 O O   . HOH O 8 .   ? -7.916  -68.350 -47.012 1.00 50.31  ? 1003 HOH B O   1 
HETATM 9232 O O   . HOH O 8 .   ? -7.993  -47.789 -21.445 1.00 49.19  ? 1004 HOH B O   1 
HETATM 9233 O O   . HOH O 8 .   ? 5.800   -44.092 2.429   1.00 49.29  ? 1005 HOH B O   1 
HETATM 9234 O O   . HOH O 8 .   ? 16.110  -55.740 -37.668 1.00 46.93  ? 1006 HOH B O   1 
HETATM 9235 O O   . HOH O 8 .   ? 7.083   -56.189 3.438   1.00 51.75  ? 1007 HOH B O   1 
HETATM 9236 O O   . HOH O 8 .   ? 3.477   -87.815 -23.162 1.00 49.45  ? 1008 HOH B O   1 
HETATM 9237 O O   . HOH O 8 .   ? 7.170   -57.096 5.440   1.00 61.81  ? 1009 HOH B O   1 
HETATM 9238 O O   . HOH O 8 .   ? -2.453  -60.374 6.697   1.00 60.80  ? 1010 HOH B O   1 
HETATM 9239 O O   . HOH O 8 .   ? -13.394 -48.675 -38.020 1.00 47.96  ? 1011 HOH B O   1 
HETATM 9240 O O   . HOH O 8 .   ? 14.722  -71.380 -27.812 1.00 46.38  ? 1012 HOH B O   1 
HETATM 9241 O O   . HOH O 8 .   ? -15.550 -77.833 -40.666 1.00 58.26  ? 1013 HOH B O   1 
HETATM 9242 O O   . HOH O 8 .   ? 1.732   -87.614 -17.452 1.00 58.14  ? 1014 HOH B O   1 
HETATM 9243 O O   . HOH O 8 .   ? 2.798   -86.510 -9.720  1.00 56.51  ? 1015 HOH B O   1 
HETATM 9244 O O   . HOH O 8 .   ? -11.530 -52.181 -38.299 1.00 46.20  ? 1016 HOH B O   1 
HETATM 9245 O O   . HOH O 8 .   ? 9.193   -62.668 -23.202 1.00 53.73  ? 1017 HOH B O   1 
HETATM 9246 O O   . HOH O 8 .   ? 15.721  -89.318 -12.963 1.00 61.67  ? 1018 HOH B O   1 
HETATM 9247 O O   . HOH O 8 .   ? -2.316  -45.427 -21.064 1.00 52.34  ? 1019 HOH B O   1 
HETATM 9248 O O   . HOH O 8 .   ? 7.787   -94.610 -44.049 1.00 55.10  ? 1020 HOH B O   1 
HETATM 9249 O O   . HOH O 8 .   ? -12.049 -50.010 -40.313 1.00 50.59  ? 1021 HOH B O   1 
HETATM 9250 O O   . HOH O 8 .   ? -10.326 -51.390 -44.611 0.98 45.76  ? 1022 HOH B O   1 
HETATM 9251 O O   . HOH O 8 .   ? 1.090   -37.034 -11.794 1.00 67.55  ? 1023 HOH B O   1 
HETATM 9252 O O   . HOH O 8 .   ? -22.288 -49.498 -34.518 1.00 69.31  ? 1024 HOH B O   1 
HETATM 9253 O O   . HOH O 8 .   ? -22.873 -50.310 -31.859 1.00 72.25  ? 1025 HOH B O   1 
HETATM 9254 O O   . HOH O 8 .   ? -1.304  -63.850 3.418   1.00 56.96  ? 1026 HOH B O   1 
HETATM 9255 O O   . HOH O 8 .   ? 19.937  -85.299 -13.426 1.00 63.71  ? 1027 HOH B O   1 
HETATM 9256 O O   . HOH O 8 .   ? -12.741 -54.354 -39.238 1.00 60.75  ? 1028 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   2   ?   ?   ?   A . n 
A 1 2   ARG 2   3   ?   ?   ?   A . n 
A 1 3   GLU 3   4   4   GLU GLU A . n 
A 1 4   ASP 4   5   5   ASP ASP A . n 
A 1 5   ALA 5   6   6   ALA ALA A . n 
A 1 6   GLU 6   7   7   GLU GLU A . n 
A 1 7   LEU 7   8   8   LEU LEU A . n 
A 1 8   LEU 8   9   9   LEU LEU A . n 
A 1 9   VAL 9   10  10  VAL VAL A . n 
A 1 10  THR 10  11  11  THR THR A . n 
A 1 11  VAL 11  12  12  VAL VAL A . n 
A 1 12  ARG 12  13  13  ARG ARG A . n 
A 1 13  GLY 13  14  14  GLY GLY A . n 
A 1 14  GLY 14  15  15  GLY GLY A . n 
A 1 15  ARG 15  16  16  ARG ARG A . n 
A 1 16  LEU 16  17  17  LEU LEU A . n 
A 1 17  ARG 17  18  18  ARG ARG A . n 
A 1 18  GLY 18  19  19  GLY GLY A . n 
A 1 19  ILE 19  20  20  ILE ILE A . n 
A 1 20  ARG 20  21  21  ARG ARG A . n 
A 1 21  LEU 21  22  22  LEU LEU A . n 
A 1 22  LYS 22  23  23  LYS LYS A . n 
A 1 23  THR 23  24  24  THR THR A . n 
A 1 24  PRO 24  25  25  PRO PRO A . n 
A 1 25  GLY 25  26  26  GLY GLY A . n 
A 1 26  GLY 26  27  27  GLY GLY A . n 
A 1 27  PRO 27  28  28  PRO PRO A . n 
A 1 28  VAL 28  29  29  VAL VAL A . n 
A 1 29  SER 29  30  30  SER SER A . n 
A 1 30  ALA 30  31  31  ALA ALA A . n 
A 1 31  PHE 31  32  32  PHE PHE A . n 
A 1 32  LEU 32  33  33  LEU LEU A . n 
A 1 33  GLY 33  34  34  GLY GLY A . n 
A 1 34  ILE 34  35  35  ILE ILE A . n 
A 1 35  PRO 35  36  36  PRO PRO A . n 
A 1 36  PHE 36  37  37  PHE PHE A . n 
A 1 37  ALA 37  38  38  ALA ALA A . n 
A 1 38  GLU 38  39  39  GLU GLU A . n 
A 1 39  PRO 39  40  40  PRO PRO A . n 
A 1 40  PRO 40  41  41  PRO PRO A . n 
A 1 41  MET 41  42  42  MET MET A . n 
A 1 42  GLY 42  43  43  GLY GLY A . n 
A 1 43  PRO 43  44  44  PRO PRO A . n 
A 1 44  ARG 44  45  45  ARG ARG A . n 
A 1 45  ARG 45  46  46  ARG ARG A . n 
A 1 46  PHE 46  47  47  PHE PHE A . n 
A 1 47  LEU 47  48  48  LEU LEU A . n 
A 1 48  PRO 48  49  49  PRO PRO A . n 
A 1 49  PRO 49  50  50  PRO PRO A . n 
A 1 50  GLU 50  51  51  GLU GLU A . n 
A 1 51  PRO 51  52  52  PRO PRO A . n 
A 1 52  LYS 52  53  53  LYS LYS A . n 
A 1 53  GLN 53  54  54  GLN GLN A . n 
A 1 54  PRO 54  55  55  PRO PRO A . n 
A 1 55  TRP 55  56  56  TRP TRP A . n 
A 1 56  SER 56  57  57  SER SER A . n 
A 1 57  GLY 57  58  58  GLY GLY A . n 
A 1 58  VAL 58  59  59  VAL VAL A . n 
A 1 59  VAL 59  60  60  VAL VAL A . n 
A 1 60  ASP 60  61  61  ASP ASP A . n 
A 1 61  ALA 61  62  62  ALA ALA A . n 
A 1 62  THR 62  63  63  THR THR A . n 
A 1 63  THR 63  64  64  THR THR A . n 
A 1 64  PHE 64  65  65  PHE PHE A . n 
A 1 65  GLN 65  66  66  GLN GLN A . n 
A 1 66  SER 66  67  67  SER SER A . n 
A 1 67  VAL 67  68  68  VAL VAL A . n 
A 1 68  CYS 68  69  69  CYS CYS A . n 
A 1 69  TYR 69  70  70  TYR TYR A . n 
A 1 70  GLN 70  71  71  GLN GLN A . n 
A 1 71  TYR 71  72  72  TYR TYR A . n 
A 1 72  VAL 72  73  73  VAL VAL A . n 
A 1 73  ASP 73  74  74  ASP ASP A . n 
A 1 74  THR 74  75  75  THR THR A . n 
A 1 75  LEU 75  76  76  LEU LEU A . n 
A 1 76  TYR 76  77  77  TYR TYR A . n 
A 1 77  PRO 77  78  78  PRO PRO A . n 
A 1 78  GLY 78  79  79  GLY GLY A . n 
A 1 79  PHE 79  80  80  PHE PHE A . n 
A 1 80  GLU 80  81  81  GLU GLU A . n 
A 1 81  GLY 81  82  82  GLY GLY A . n 
A 1 82  THR 82  83  83  THR THR A . n 
A 1 83  GLU 83  84  84  GLU GLU A . n 
A 1 84  MET 84  85  85  MET MET A . n 
A 1 85  TRP 85  86  86  TRP TRP A . n 
A 1 86  ASN 86  87  87  ASN ASN A . n 
A 1 87  PRO 87  88  88  PRO PRO A . n 
A 1 88  ASN 88  89  89  ASN ASN A . n 
A 1 89  ARG 89  90  90  ARG ARG A . n 
A 1 90  GLU 90  91  91  GLU GLU A . n 
A 1 91  LEU 91  92  92  LEU LEU A . n 
A 1 92  SER 92  93  93  SER SER A . n 
A 1 93  GLU 93  94  94  GLU GLU A . n 
A 1 94  ASP 94  95  95  ASP ASP A . n 
A 1 95  CYS 95  96  96  CYS CYS A . n 
A 1 96  LEU 96  97  97  LEU LEU A . n 
A 1 97  TYR 97  98  98  TYR TYR A . n 
A 1 98  LEU 98  99  99  LEU LEU A . n 
A 1 99  ASN 99  100 100 ASN ASN A . n 
A 1 100 VAL 100 101 101 VAL VAL A . n 
A 1 101 TRP 101 102 102 TRP TRP A . n 
A 1 102 THR 102 103 103 THR THR A . n 
A 1 103 PRO 103 104 104 PRO PRO A . n 
A 1 104 TYR 104 105 105 TYR TYR A . n 
A 1 105 PRO 105 106 106 PRO PRO A . n 
A 1 106 ARG 106 107 107 ARG ARG A . n 
A 1 107 PRO 107 108 108 PRO PRO A . n 
A 1 108 THR 108 109 109 THR THR A . n 
A 1 109 SER 109 110 110 SER SER A . n 
A 1 110 PRO 110 111 111 PRO PRO A . n 
A 1 111 THR 111 112 112 THR THR A . n 
A 1 112 PRO 112 113 113 PRO PRO A . n 
A 1 113 VAL 113 114 114 VAL VAL A . n 
A 1 114 LEU 114 115 115 LEU LEU A . n 
A 1 115 VAL 115 116 116 VAL VAL A . n 
A 1 116 TRP 116 117 117 TRP TRP A . n 
A 1 117 ILE 117 118 118 ILE ILE A . n 
A 1 118 TYR 118 119 119 TYR TYR A . n 
A 1 119 GLY 119 120 120 GLY GLY A . n 
A 1 120 GLY 120 121 121 GLY GLY A . n 
A 1 121 GLY 121 122 122 GLY GLY A . n 
A 1 122 PHE 122 123 123 PHE PHE A . n 
A 1 123 TYR 123 124 124 TYR TYR A . n 
A 1 124 SER 124 125 125 SER SER A . n 
A 1 125 GLY 125 126 126 GLY GLY A . n 
A 1 126 ALA 126 127 127 ALA ALA A . n 
A 1 127 SER 127 128 128 SER SER A . n 
A 1 128 SER 128 129 129 SER SER A . n 
A 1 129 LEU 129 130 130 LEU LEU A . n 
A 1 130 ASP 130 131 131 ASP ASP A . n 
A 1 131 VAL 131 132 132 VAL VAL A . n 
A 1 132 TYR 132 133 133 TYR TYR A . n 
A 1 133 ASP 133 134 134 ASP ASP A . n 
A 1 134 GLY 134 135 135 GLY GLY A . n 
A 1 135 ARG 135 136 136 ARG ARG A . n 
A 1 136 PHE 136 137 137 PHE PHE A . n 
A 1 137 LEU 137 138 138 LEU LEU A . n 
A 1 138 VAL 138 139 139 VAL VAL A . n 
A 1 139 GLN 139 140 140 GLN GLN A . n 
A 1 140 ALA 140 141 141 ALA ALA A . n 
A 1 141 GLU 141 142 142 GLU GLU A . n 
A 1 142 ARG 142 143 143 ARG ARG A . n 
A 1 143 THR 143 144 144 THR THR A . n 
A 1 144 VAL 144 145 145 VAL VAL A . n 
A 1 145 LEU 145 146 146 LEU LEU A . n 
A 1 146 VAL 146 147 147 VAL VAL A . n 
A 1 147 SER 147 148 148 SER SER A . n 
A 1 148 MET 148 149 149 MET MET A . n 
A 1 149 ASN 149 150 150 ASN ASN A . n 
A 1 150 TYR 150 151 151 TYR TYR A . n 
A 1 151 ARG 151 152 152 ARG ARG A . n 
A 1 152 VAL 152 153 153 VAL VAL A . n 
A 1 153 GLY 153 154 154 GLY GLY A . n 
A 1 154 ALA 154 155 155 ALA ALA A . n 
A 1 155 PHE 155 156 156 PHE PHE A . n 
A 1 156 GLY 156 157 157 GLY GLY A . n 
A 1 157 PHE 157 158 158 PHE PHE A . n 
A 1 158 LEU 158 159 159 LEU LEU A . n 
A 1 159 ALA 159 160 160 ALA ALA A . n 
A 1 160 LEU 160 161 161 LEU LEU A . n 
A 1 161 PRO 161 162 162 PRO PRO A . n 
A 1 162 GLY 162 163 163 GLY GLY A . n 
A 1 163 SER 163 164 164 SER SER A . n 
A 1 164 ARG 164 165 165 ARG ARG A . n 
A 1 165 GLU 165 166 166 GLU GLU A . n 
A 1 166 ALA 166 167 167 ALA ALA A . n 
A 1 167 PRO 167 168 168 PRO PRO A . n 
A 1 168 GLY 168 169 169 GLY GLY A . n 
A 1 169 ASN 169 170 170 ASN ASN A . n 
A 1 170 VAL 170 171 171 VAL VAL A . n 
A 1 171 GLY 171 172 172 GLY GLY A . n 
A 1 172 LEU 172 173 173 LEU LEU A . n 
A 1 173 LEU 173 174 174 LEU LEU A . n 
A 1 174 ASP 174 175 175 ASP ASP A . n 
A 1 175 GLN 175 176 176 GLN GLN A . n 
A 1 176 ARG 176 177 177 ARG ARG A . n 
A 1 177 LEU 177 178 178 LEU LEU A . n 
A 1 178 ALA 178 179 179 ALA ALA A . n 
A 1 179 LEU 179 180 180 LEU LEU A . n 
A 1 180 GLN 180 181 181 GLN GLN A . n 
A 1 181 TRP 181 182 182 TRP TRP A . n 
A 1 182 VAL 182 183 183 VAL VAL A . n 
A 1 183 GLN 183 184 184 GLN GLN A . n 
A 1 184 GLU 184 185 185 GLU GLU A . n 
A 1 185 ASN 185 186 186 ASN ASN A . n 
A 1 186 VAL 186 187 187 VAL VAL A . n 
A 1 187 ALA 187 188 188 ALA ALA A . n 
A 1 188 ALA 188 189 189 ALA ALA A . n 
A 1 189 PHE 189 190 190 PHE PHE A . n 
A 1 190 GLY 190 191 191 GLY GLY A . n 
A 1 191 GLY 191 192 192 GLY GLY A . n 
A 1 192 ASP 192 193 193 ASP ASP A . n 
A 1 193 PRO 193 194 194 PRO PRO A . n 
A 1 194 THR 194 195 195 THR THR A . n 
A 1 195 SER 195 196 196 SER SER A . n 
A 1 196 VAL 196 197 197 VAL VAL A . n 
A 1 197 THR 197 198 198 THR THR A . n 
A 1 198 LEU 198 199 199 LEU LEU A . n 
A 1 199 PHE 199 200 200 PHE PHE A . n 
A 1 200 GLY 200 201 201 GLY GLY A . n 
A 1 201 GLU 201 202 202 GLU GLU A . n 
A 1 202 SER 202 203 203 SER SER A . n 
A 1 203 ALA 203 204 204 ALA ALA A . n 
A 1 204 GLY 204 205 205 GLY GLY A . n 
A 1 205 ALA 205 206 206 ALA ALA A . n 
A 1 206 ALA 206 207 207 ALA ALA A . n 
A 1 207 SER 207 208 208 SER SER A . n 
A 1 208 VAL 208 209 209 VAL VAL A . n 
A 1 209 GLY 209 210 210 GLY GLY A . n 
A 1 210 MET 210 211 211 MET MET A . n 
A 1 211 HIS 211 212 212 HIS HIS A . n 
A 1 212 LEU 212 213 213 LEU LEU A . n 
A 1 213 LEU 213 214 214 LEU LEU A . n 
A 1 214 SER 214 215 215 SER SER A . n 
A 1 215 PRO 215 216 216 PRO PRO A . n 
A 1 216 PRO 216 217 217 PRO PRO A . n 
A 1 217 SER 217 218 218 SER SER A . n 
A 1 218 ARG 218 219 219 ARG ARG A . n 
A 1 219 GLY 219 220 220 GLY GLY A . n 
A 1 220 LEU 220 221 221 LEU LEU A . n 
A 1 221 PHE 221 222 222 PHE PHE A . n 
A 1 222 HIS 222 223 223 HIS HIS A . n 
A 1 223 ARG 223 224 224 ARG ARG A . n 
A 1 224 ALA 224 225 225 ALA ALA A . n 
A 1 225 VAL 225 226 226 VAL VAL A . n 
A 1 226 LEU 226 227 227 LEU LEU A . n 
A 1 227 GLN 227 228 228 GLN GLN A . n 
A 1 228 SER 228 229 229 SER SER A . n 
A 1 229 GLY 229 230 230 GLY GLY A . n 
A 1 230 ALA 230 231 231 ALA ALA A . n 
A 1 231 PRO 231 232 232 PRO PRO A . n 
A 1 232 ASN 232 233 233 ASN ASN A . n 
A 1 233 GLY 233 234 234 GLY GLY A . n 
A 1 234 PRO 234 235 235 PRO PRO A . n 
A 1 235 TRP 235 236 236 TRP TRP A . n 
A 1 236 ALA 236 237 237 ALA ALA A . n 
A 1 237 THR 237 238 238 THR THR A . n 
A 1 238 VAL 238 239 239 VAL VAL A . n 
A 1 239 GLY 239 240 240 GLY GLY A . n 
A 1 240 MET 240 241 241 MET MET A . n 
A 1 241 GLY 241 242 242 GLY GLY A . n 
A 1 242 GLU 242 243 243 GLU GLU A . n 
A 1 243 ALA 243 244 244 ALA ALA A . n 
A 1 244 ARG 244 245 245 ARG ARG A . n 
A 1 245 ARG 245 246 246 ARG ARG A . n 
A 1 246 ARG 246 247 247 ARG ARG A . n 
A 1 247 ALA 247 248 248 ALA ALA A . n 
A 1 248 THR 248 249 249 THR THR A . n 
A 1 249 GLN 249 250 250 GLN GLN A . n 
A 1 250 LEU 250 251 251 LEU LEU A . n 
A 1 251 ALA 251 252 252 ALA ALA A . n 
A 1 252 HIS 252 253 253 HIS HIS A . n 
A 1 253 LEU 253 254 254 LEU LEU A . n 
A 1 254 VAL 254 255 255 VAL VAL A . n 
A 1 255 GLY 255 256 256 GLY GLY A . n 
A 1 256 CYS 256 257 257 CYS CYS A . n 
A 1 257 PRO 257 258 258 PRO PRO A . n 
A 1 258 PRO 258 259 ?   ?   ?   A . n 
A 1 259 GLY 259 260 ?   ?   ?   A . n 
A 1 260 GLY 260 261 ?   ?   ?   A . n 
A 1 261 THR 261 262 ?   ?   ?   A . n 
A 1 262 GLY 262 263 ?   ?   ?   A . n 
A 1 263 GLY 263 264 ?   ?   ?   A . n 
A 1 264 ASN 264 265 265 ASN ASN A . n 
A 1 265 ASP 265 266 266 ASP ASP A . n 
A 1 266 THR 266 267 267 THR THR A . n 
A 1 267 GLU 267 268 268 GLU GLU A . n 
A 1 268 LEU 268 269 269 LEU LEU A . n 
A 1 269 VAL 269 270 270 VAL VAL A . n 
A 1 270 ALA 270 271 271 ALA ALA A . n 
A 1 271 CYS 271 272 272 CYS CYS A . n 
A 1 272 LEU 272 273 273 LEU LEU A . n 
A 1 273 ARG 273 274 274 ARG ARG A . n 
A 1 274 THR 274 275 275 THR THR A . n 
A 1 275 ARG 275 276 276 ARG ARG A . n 
A 1 276 PRO 276 277 277 PRO PRO A . n 
A 1 277 ALA 277 278 278 ALA ALA A . n 
A 1 278 GLN 278 279 279 GLN GLN A . n 
A 1 279 VAL 279 280 280 VAL VAL A . n 
A 1 280 LEU 280 281 281 LEU LEU A . n 
A 1 281 VAL 281 282 282 VAL VAL A . n 
A 1 282 ASN 282 283 283 ASN ASN A . n 
A 1 283 HIS 283 284 284 HIS HIS A . n 
A 1 284 GLU 284 285 285 GLU GLU A . n 
A 1 285 TRP 285 286 286 TRP TRP A . n 
A 1 286 HIS 286 287 287 HIS HIS A . n 
A 1 287 VAL 287 288 288 VAL VAL A . n 
A 1 288 LEU 288 289 289 LEU LEU A . n 
A 1 289 PRO 289 290 290 PRO PRO A . n 
A 1 290 GLN 290 291 291 GLN GLN A . n 
A 1 291 GLU 291 292 292 GLU GLU A . n 
A 1 292 SER 292 293 293 SER SER A . n 
A 1 293 VAL 293 294 294 VAL VAL A . n 
A 1 294 PHE 294 295 295 PHE PHE A . n 
A 1 295 ARG 295 296 296 ARG ARG A . n 
A 1 296 PHE 296 297 297 PHE PHE A . n 
A 1 297 SER 297 298 298 SER SER A . n 
A 1 298 PHE 298 299 299 PHE PHE A . n 
A 1 299 VAL 299 300 300 VAL VAL A . n 
A 1 300 PRO 300 301 301 PRO PRO A . n 
A 1 301 VAL 301 302 302 VAL VAL A . n 
A 1 302 VAL 302 303 303 VAL VAL A . n 
A 1 303 ASP 303 304 304 ASP ASP A . n 
A 1 304 GLY 304 305 305 GLY GLY A . n 
A 1 305 ASP 305 306 306 ASP ASP A . n 
A 1 306 PHE 306 307 307 PHE PHE A . n 
A 1 307 LEU 307 308 308 LEU LEU A . n 
A 1 308 SER 308 309 309 SER SER A . n 
A 1 309 ASP 309 310 310 ASP ASP A . n 
A 1 310 THR 310 311 311 THR THR A . n 
A 1 311 PRO 311 312 312 PRO PRO A . n 
A 1 312 GLU 312 313 313 GLU GLU A . n 
A 1 313 ALA 313 314 314 ALA ALA A . n 
A 1 314 LEU 314 315 315 LEU LEU A . n 
A 1 315 ILE 315 316 316 ILE ILE A . n 
A 1 316 ASN 316 317 317 ASN ASN A . n 
A 1 317 ALA 317 318 318 ALA ALA A . n 
A 1 318 GLY 318 319 319 GLY GLY A . n 
A 1 319 ASP 319 320 320 ASP ASP A . n 
A 1 320 PHE 320 321 321 PHE PHE A . n 
A 1 321 HIS 321 322 322 HIS HIS A . n 
A 1 322 GLY 322 323 323 GLY GLY A . n 
A 1 323 LEU 323 324 324 LEU LEU A . n 
A 1 324 GLN 324 325 325 GLN GLN A . n 
A 1 325 VAL 325 326 326 VAL VAL A . n 
A 1 326 LEU 326 327 327 LEU LEU A . n 
A 1 327 VAL 327 328 328 VAL VAL A . n 
A 1 328 GLY 328 329 329 GLY GLY A . n 
A 1 329 VAL 329 330 330 VAL VAL A . n 
A 1 330 VAL 330 331 331 VAL VAL A . n 
A 1 331 LYS 331 332 332 LYS LYS A . n 
A 1 332 ASP 332 333 333 ASP ASP A . n 
A 1 333 GLU 333 334 334 GLU GLU A . n 
A 1 334 GLY 334 335 335 GLY GLY A . n 
A 1 335 SER 335 336 336 SER SER A . n 
A 1 336 TYR 336 337 337 TYR TYR A . n 
A 1 337 PHE 337 338 338 PHE PHE A . n 
A 1 338 LEU 338 339 339 LEU LEU A . n 
A 1 339 VAL 339 340 340 VAL VAL A . n 
A 1 340 TYR 340 341 341 TYR TYR A . n 
A 1 341 GLY 341 342 342 GLY GLY A . n 
A 1 342 ALA 342 343 343 ALA ALA A . n 
A 1 343 PRO 343 344 344 PRO PRO A . n 
A 1 344 GLY 344 345 345 GLY GLY A . n 
A 1 345 PHE 345 346 346 PHE PHE A . n 
A 1 346 SER 346 347 347 SER SER A . n 
A 1 347 LYS 347 348 348 LYS LYS A . n 
A 1 348 ASP 348 349 349 ASP ASP A . n 
A 1 349 ASN 349 350 350 ASN ASN A . n 
A 1 350 GLU 350 351 351 GLU GLU A . n 
A 1 351 SER 351 352 352 SER SER A . n 
A 1 352 LEU 352 353 353 LEU LEU A . n 
A 1 353 ILE 353 354 354 ILE ILE A . n 
A 1 354 SER 354 355 355 SER SER A . n 
A 1 355 ARG 355 356 356 ARG ARG A . n 
A 1 356 ALA 356 357 357 ALA ALA A . n 
A 1 357 GLU 357 358 358 GLU GLU A . n 
A 1 358 PHE 358 359 359 PHE PHE A . n 
A 1 359 LEU 359 360 360 LEU LEU A . n 
A 1 360 ALA 360 361 361 ALA ALA A . n 
A 1 361 GLY 361 362 362 GLY GLY A . n 
A 1 362 VAL 362 363 363 VAL VAL A . n 
A 1 363 ARG 363 364 364 ARG ARG A . n 
A 1 364 VAL 364 365 365 VAL VAL A . n 
A 1 365 GLY 365 366 366 GLY GLY A . n 
A 1 366 VAL 366 367 367 VAL VAL A . n 
A 1 367 PRO 367 368 368 PRO PRO A . n 
A 1 368 GLN 368 369 369 GLN GLN A . n 
A 1 369 VAL 369 370 370 VAL VAL A . n 
A 1 370 SER 370 371 371 SER SER A . n 
A 1 371 ASP 371 372 372 ASP ASP A . n 
A 1 372 LEU 372 373 373 LEU LEU A . n 
A 1 373 ALA 373 374 374 ALA ALA A . n 
A 1 374 ALA 374 375 375 ALA ALA A . n 
A 1 375 GLU 375 376 376 GLU GLU A . n 
A 1 376 ALA 376 377 377 ALA ALA A . n 
A 1 377 VAL 377 378 378 VAL VAL A . n 
A 1 378 VAL 378 379 379 VAL VAL A . n 
A 1 379 LEU 379 380 380 LEU LEU A . n 
A 1 380 HIS 380 381 381 HIS HIS A . n 
A 1 381 TYR 381 382 382 TYR TYR A . n 
A 1 382 THR 382 383 383 THR THR A . n 
A 1 383 ASP 383 384 384 ASP ASP A . n 
A 1 384 TRP 384 385 385 TRP TRP A . n 
A 1 385 LEU 385 386 386 LEU LEU A . n 
A 1 386 HIS 386 387 387 HIS HIS A . n 
A 1 387 PRO 387 388 388 PRO PRO A . n 
A 1 388 GLU 388 389 389 GLU GLU A . n 
A 1 389 ASP 389 390 390 ASP ASP A . n 
A 1 390 PRO 390 391 391 PRO PRO A . n 
A 1 391 ALA 391 392 392 ALA ALA A . n 
A 1 392 ARG 392 393 393 ARG ARG A . n 
A 1 393 LEU 393 394 394 LEU LEU A . n 
A 1 394 ARG 394 395 395 ARG ARG A . n 
A 1 395 GLU 395 396 396 GLU GLU A . n 
A 1 396 ALA 396 397 397 ALA ALA A . n 
A 1 397 LEU 397 398 398 LEU LEU A . n 
A 1 398 SER 398 399 399 SER SER A . n 
A 1 399 ASP 399 400 400 ASP ASP A . n 
A 1 400 VAL 400 401 401 VAL VAL A . n 
A 1 401 VAL 401 402 402 VAL VAL A . n 
A 1 402 GLY 402 403 403 GLY GLY A . n 
A 1 403 ASP 403 404 404 ASP ASP A . n 
A 1 404 HIS 404 405 405 HIS HIS A . n 
A 1 405 ASN 405 406 406 ASN ASN A . n 
A 1 406 VAL 406 407 407 VAL VAL A . n 
A 1 407 VAL 407 408 408 VAL VAL A . n 
A 1 408 CYS 408 409 409 CYS CYS A . n 
A 1 409 PRO 409 410 410 PRO PRO A . n 
A 1 410 VAL 410 411 411 VAL VAL A . n 
A 1 411 ALA 411 412 412 ALA ALA A . n 
A 1 412 GLN 412 413 413 GLN GLN A . n 
A 1 413 LEU 413 414 414 LEU LEU A . n 
A 1 414 ALA 414 415 415 ALA ALA A . n 
A 1 415 GLY 415 416 416 GLY GLY A . n 
A 1 416 ARG 416 417 417 ARG ARG A . n 
A 1 417 LEU 417 418 418 LEU LEU A . n 
A 1 418 ALA 418 419 419 ALA ALA A . n 
A 1 419 ALA 419 420 420 ALA ALA A . n 
A 1 420 GLN 420 421 421 GLN GLN A . n 
A 1 421 GLY 421 422 422 GLY GLY A . n 
A 1 422 ALA 422 423 423 ALA ALA A . n 
A 1 423 ARG 423 424 424 ARG ARG A . n 
A 1 424 VAL 424 425 425 VAL VAL A . n 
A 1 425 TYR 425 426 426 TYR TYR A . n 
A 1 426 ALA 426 427 427 ALA ALA A . n 
A 1 427 TYR 427 428 428 TYR TYR A . n 
A 1 428 VAL 428 429 429 VAL VAL A . n 
A 1 429 PHE 429 430 430 PHE PHE A . n 
A 1 430 GLU 430 431 431 GLU GLU A . n 
A 1 431 HIS 431 432 432 HIS HIS A . n 
A 1 432 ARG 432 433 433 ARG ARG A . n 
A 1 433 ALA 433 434 434 ALA ALA A . n 
A 1 434 SER 434 435 435 SER SER A . n 
A 1 435 THR 435 436 436 THR THR A . n 
A 1 436 LEU 436 437 437 LEU LEU A . n 
A 1 437 SER 437 438 438 SER SER A . n 
A 1 438 TRP 438 439 439 TRP TRP A . n 
A 1 439 PRO 439 440 440 PRO PRO A . n 
A 1 440 LEU 440 441 441 LEU LEU A . n 
A 1 441 TRP 441 442 442 TRP TRP A . n 
A 1 442 MET 442 443 443 MET MET A . n 
A 1 443 GLY 443 444 444 GLY GLY A . n 
A 1 444 VAL 444 445 445 VAL VAL A . n 
A 1 445 PRO 445 446 446 PRO PRO A . n 
A 1 446 HIS 446 447 447 HIS HIS A . n 
A 1 447 GLY 447 448 448 GLY GLY A . n 
A 1 448 TYR 448 449 449 TYR TYR A . n 
A 1 449 GLU 449 450 450 GLU GLU A . n 
A 1 450 ILE 450 451 451 ILE ILE A . n 
A 1 451 GLU 451 452 452 GLU GLU A . n 
A 1 452 PHE 452 453 453 PHE PHE A . n 
A 1 453 ILE 453 454 454 ILE ILE A . n 
A 1 454 PHE 454 455 455 PHE PHE A . n 
A 1 455 GLY 455 456 456 GLY GLY A . n 
A 1 456 ILE 456 457 457 ILE ILE A . n 
A 1 457 PRO 457 458 458 PRO PRO A . n 
A 1 458 LEU 458 459 459 LEU LEU A . n 
A 1 459 ASP 459 460 460 ASP ASP A . n 
A 1 460 PRO 460 461 461 PRO PRO A . n 
A 1 461 SER 461 462 462 SER SER A . n 
A 1 462 ARG 462 463 463 ARG ARG A . n 
A 1 463 ASN 463 464 464 ASN ASN A . n 
A 1 464 TYR 464 465 465 TYR TYR A . n 
A 1 465 THR 465 466 466 THR THR A . n 
A 1 466 ALA 466 467 467 ALA ALA A . n 
A 1 467 GLU 467 468 468 GLU GLU A . n 
A 1 468 GLU 468 469 469 GLU GLU A . n 
A 1 469 LYS 469 470 470 LYS LYS A . n 
A 1 470 ILE 470 471 471 ILE ILE A . n 
A 1 471 PHE 471 472 472 PHE PHE A . n 
A 1 472 ALA 472 473 473 ALA ALA A . n 
A 1 473 GLN 473 474 474 GLN GLN A . n 
A 1 474 ARG 474 475 475 ARG ARG A . n 
A 1 475 LEU 475 476 476 LEU LEU A . n 
A 1 476 MET 476 477 477 MET MET A . n 
A 1 477 ARG 477 478 478 ARG ARG A . n 
A 1 478 TYR 478 479 479 TYR TYR A . n 
A 1 479 TRP 479 480 480 TRP TRP A . n 
A 1 480 ALA 480 481 481 ALA ALA A . n 
A 1 481 ASN 481 482 482 ASN ASN A . n 
A 1 482 PHE 482 483 483 PHE PHE A . n 
A 1 483 ALA 483 484 484 ALA ALA A . n 
A 1 484 ARG 484 485 485 ARG ARG A . n 
A 1 485 THR 485 486 486 THR THR A . n 
A 1 486 GLY 486 487 487 GLY GLY A . n 
A 1 487 ASP 487 488 488 ASP ASP A . n 
A 1 488 PRO 488 489 489 PRO PRO A . n 
A 1 489 ASN 489 490 490 ASN ASN A . n 
A 1 490 GLU 490 491 491 GLU GLU A . n 
A 1 491 PRO 491 492 492 PRO PRO A . n 
A 1 492 ARG 492 493 493 ARG ARG A . n 
A 1 493 ASP 493 494 494 ASP ASP A . n 
A 1 494 PRO 494 495 495 PRO PRO A . n 
A 1 495 LYS 495 496 496 LYS LYS A . n 
A 1 496 ALA 496 497 497 ALA ALA A . n 
A 1 497 PRO 497 498 498 PRO PRO A . n 
A 1 498 GLN 498 499 499 GLN GLN A . n 
A 1 499 TRP 499 500 500 TRP TRP A . n 
A 1 500 PRO 500 501 501 PRO PRO A . n 
A 1 501 PRO 501 502 502 PRO PRO A . n 
A 1 502 TYR 502 503 503 TYR TYR A . n 
A 1 503 THR 503 504 504 THR THR A . n 
A 1 504 ALA 504 505 505 ALA ALA A . n 
A 1 505 GLY 505 506 506 GLY GLY A . n 
A 1 506 ALA 506 507 507 ALA ALA A . n 
A 1 507 GLN 507 508 508 GLN GLN A . n 
A 1 508 GLN 508 509 509 GLN GLN A . n 
A 1 509 TYR 509 510 510 TYR TYR A . n 
A 1 510 VAL 510 511 511 VAL VAL A . n 
A 1 511 SER 511 512 512 SER SER A . n 
A 1 512 LEU 512 513 513 LEU LEU A . n 
A 1 513 ASP 513 514 514 ASP ASP A . n 
A 1 514 LEU 514 515 515 LEU LEU A . n 
A 1 515 ARG 515 516 516 ARG ARG A . n 
A 1 516 PRO 516 517 517 PRO PRO A . n 
A 1 517 LEU 517 518 518 LEU LEU A . n 
A 1 518 GLU 518 519 519 GLU GLU A . n 
A 1 519 VAL 519 520 520 VAL VAL A . n 
A 1 520 ARG 520 521 521 ARG ARG A . n 
A 1 521 ARG 521 522 522 ARG ARG A . n 
A 1 522 GLY 522 523 523 GLY GLY A . n 
A 1 523 LEU 523 524 524 LEU LEU A . n 
A 1 524 ARG 524 525 525 ARG ARG A . n 
A 1 525 ALA 525 526 526 ALA ALA A . n 
A 1 526 GLN 526 527 527 GLN GLN A . n 
A 1 527 ALA 527 528 528 ALA ALA A . n 
A 1 528 CYS 528 529 529 CYS CYS A . n 
A 1 529 ALA 529 530 530 ALA ALA A . n 
A 1 530 PHE 530 531 531 PHE PHE A . n 
A 1 531 TRP 531 532 532 TRP TRP A . n 
A 1 532 ASN 532 533 533 ASN ASN A . n 
A 1 533 ARG 533 534 534 ARG ARG A . n 
A 1 534 PHE 534 535 535 PHE PHE A . n 
A 1 535 LEU 535 536 536 LEU LEU A . n 
A 1 536 PRO 536 537 537 PRO PRO A . n 
A 1 537 LYS 537 538 538 LYS LYS A . n 
A 1 538 LEU 538 539 539 LEU LEU A . n 
A 1 539 LEU 539 540 540 LEU LEU A . n 
A 1 540 SER 540 541 541 SER SER A . n 
A 1 541 ALA 541 542 542 ALA ALA A . n 
A 1 542 THR 542 543 ?   ?   ?   A . n 
B 1 1   GLY 1   2   ?   ?   ?   B . n 
B 1 2   ARG 2   3   3   ARG ARG B . n 
B 1 3   GLU 3   4   4   GLU GLU B . n 
B 1 4   ASP 4   5   5   ASP ASP B . n 
B 1 5   ALA 5   6   6   ALA ALA B . n 
B 1 6   GLU 6   7   7   GLU GLU B . n 
B 1 7   LEU 7   8   8   LEU LEU B . n 
B 1 8   LEU 8   9   9   LEU LEU B . n 
B 1 9   VAL 9   10  10  VAL VAL B . n 
B 1 10  THR 10  11  11  THR THR B . n 
B 1 11  VAL 11  12  12  VAL VAL B . n 
B 1 12  ARG 12  13  13  ARG ARG B . n 
B 1 13  GLY 13  14  14  GLY GLY B . n 
B 1 14  GLY 14  15  15  GLY GLY B . n 
B 1 15  ARG 15  16  16  ARG ARG B . n 
B 1 16  LEU 16  17  17  LEU LEU B . n 
B 1 17  ARG 17  18  18  ARG ARG B . n 
B 1 18  GLY 18  19  19  GLY GLY B . n 
B 1 19  ILE 19  20  20  ILE ILE B . n 
B 1 20  ARG 20  21  21  ARG ARG B . n 
B 1 21  LEU 21  22  22  LEU LEU B . n 
B 1 22  LYS 22  23  23  LYS LYS B . n 
B 1 23  THR 23  24  24  THR THR B . n 
B 1 24  PRO 24  25  25  PRO PRO B . n 
B 1 25  GLY 25  26  26  GLY GLY B . n 
B 1 26  GLY 26  27  27  GLY GLY B . n 
B 1 27  PRO 27  28  28  PRO PRO B . n 
B 1 28  VAL 28  29  29  VAL VAL B . n 
B 1 29  SER 29  30  30  SER SER B . n 
B 1 30  ALA 30  31  31  ALA ALA B . n 
B 1 31  PHE 31  32  32  PHE PHE B . n 
B 1 32  LEU 32  33  33  LEU LEU B . n 
B 1 33  GLY 33  34  34  GLY GLY B . n 
B 1 34  ILE 34  35  35  ILE ILE B . n 
B 1 35  PRO 35  36  36  PRO PRO B . n 
B 1 36  PHE 36  37  37  PHE PHE B . n 
B 1 37  ALA 37  38  38  ALA ALA B . n 
B 1 38  GLU 38  39  39  GLU GLU B . n 
B 1 39  PRO 39  40  40  PRO PRO B . n 
B 1 40  PRO 40  41  41  PRO PRO B . n 
B 1 41  MET 41  42  42  MET MET B . n 
B 1 42  GLY 42  43  43  GLY GLY B . n 
B 1 43  PRO 43  44  44  PRO PRO B . n 
B 1 44  ARG 44  45  45  ARG ARG B . n 
B 1 45  ARG 45  46  46  ARG ARG B . n 
B 1 46  PHE 46  47  47  PHE PHE B . n 
B 1 47  LEU 47  48  48  LEU LEU B . n 
B 1 48  PRO 48  49  49  PRO PRO B . n 
B 1 49  PRO 49  50  50  PRO PRO B . n 
B 1 50  GLU 50  51  51  GLU GLU B . n 
B 1 51  PRO 51  52  52  PRO PRO B . n 
B 1 52  LYS 52  53  53  LYS LYS B . n 
B 1 53  GLN 53  54  54  GLN GLN B . n 
B 1 54  PRO 54  55  55  PRO PRO B . n 
B 1 55  TRP 55  56  56  TRP TRP B . n 
B 1 56  SER 56  57  57  SER SER B . n 
B 1 57  GLY 57  58  58  GLY GLY B . n 
B 1 58  VAL 58  59  59  VAL VAL B . n 
B 1 59  VAL 59  60  60  VAL VAL B . n 
B 1 60  ASP 60  61  61  ASP ASP B . n 
B 1 61  ALA 61  62  62  ALA ALA B . n 
B 1 62  THR 62  63  63  THR THR B . n 
B 1 63  THR 63  64  64  THR THR B . n 
B 1 64  PHE 64  65  65  PHE PHE B . n 
B 1 65  GLN 65  66  66  GLN GLN B . n 
B 1 66  SER 66  67  67  SER SER B . n 
B 1 67  VAL 67  68  68  VAL VAL B . n 
B 1 68  CYS 68  69  69  CYS CYS B . n 
B 1 69  TYR 69  70  70  TYR TYR B . n 
B 1 70  GLN 70  71  71  GLN GLN B . n 
B 1 71  TYR 71  72  72  TYR TYR B . n 
B 1 72  VAL 72  73  73  VAL VAL B . n 
B 1 73  ASP 73  74  74  ASP ASP B . n 
B 1 74  THR 74  75  75  THR THR B . n 
B 1 75  LEU 75  76  76  LEU LEU B . n 
B 1 76  TYR 76  77  77  TYR TYR B . n 
B 1 77  PRO 77  78  78  PRO PRO B . n 
B 1 78  GLY 78  79  79  GLY GLY B . n 
B 1 79  PHE 79  80  80  PHE PHE B . n 
B 1 80  GLU 80  81  81  GLU GLU B . n 
B 1 81  GLY 81  82  82  GLY GLY B . n 
B 1 82  THR 82  83  83  THR THR B . n 
B 1 83  GLU 83  84  84  GLU GLU B . n 
B 1 84  MET 84  85  85  MET MET B . n 
B 1 85  TRP 85  86  86  TRP TRP B . n 
B 1 86  ASN 86  87  87  ASN ASN B . n 
B 1 87  PRO 87  88  88  PRO PRO B . n 
B 1 88  ASN 88  89  89  ASN ASN B . n 
B 1 89  ARG 89  90  90  ARG ARG B . n 
B 1 90  GLU 90  91  91  GLU GLU B . n 
B 1 91  LEU 91  92  92  LEU LEU B . n 
B 1 92  SER 92  93  93  SER SER B . n 
B 1 93  GLU 93  94  94  GLU GLU B . n 
B 1 94  ASP 94  95  95  ASP ASP B . n 
B 1 95  CYS 95  96  96  CYS CYS B . n 
B 1 96  LEU 96  97  97  LEU LEU B . n 
B 1 97  TYR 97  98  98  TYR TYR B . n 
B 1 98  LEU 98  99  99  LEU LEU B . n 
B 1 99  ASN 99  100 100 ASN ASN B . n 
B 1 100 VAL 100 101 101 VAL VAL B . n 
B 1 101 TRP 101 102 102 TRP TRP B . n 
B 1 102 THR 102 103 103 THR THR B . n 
B 1 103 PRO 103 104 104 PRO PRO B . n 
B 1 104 TYR 104 105 105 TYR TYR B . n 
B 1 105 PRO 105 106 106 PRO PRO B . n 
B 1 106 ARG 106 107 107 ARG ARG B . n 
B 1 107 PRO 107 108 108 PRO PRO B . n 
B 1 108 THR 108 109 109 THR THR B . n 
B 1 109 SER 109 110 110 SER SER B . n 
B 1 110 PRO 110 111 111 PRO PRO B . n 
B 1 111 THR 111 112 112 THR THR B . n 
B 1 112 PRO 112 113 113 PRO PRO B . n 
B 1 113 VAL 113 114 114 VAL VAL B . n 
B 1 114 LEU 114 115 115 LEU LEU B . n 
B 1 115 VAL 115 116 116 VAL VAL B . n 
B 1 116 TRP 116 117 117 TRP TRP B . n 
B 1 117 ILE 117 118 118 ILE ILE B . n 
B 1 118 TYR 118 119 119 TYR TYR B . n 
B 1 119 GLY 119 120 120 GLY GLY B . n 
B 1 120 GLY 120 121 121 GLY GLY B . n 
B 1 121 GLY 121 122 122 GLY GLY B . n 
B 1 122 PHE 122 123 123 PHE PHE B . n 
B 1 123 TYR 123 124 124 TYR TYR B . n 
B 1 124 SER 124 125 125 SER SER B . n 
B 1 125 GLY 125 126 126 GLY GLY B . n 
B 1 126 ALA 126 127 127 ALA ALA B . n 
B 1 127 SER 127 128 128 SER SER B . n 
B 1 128 SER 128 129 129 SER SER B . n 
B 1 129 LEU 129 130 130 LEU LEU B . n 
B 1 130 ASP 130 131 131 ASP ASP B . n 
B 1 131 VAL 131 132 132 VAL VAL B . n 
B 1 132 TYR 132 133 133 TYR TYR B . n 
B 1 133 ASP 133 134 134 ASP ASP B . n 
B 1 134 GLY 134 135 135 GLY GLY B . n 
B 1 135 ARG 135 136 136 ARG ARG B . n 
B 1 136 PHE 136 137 137 PHE PHE B . n 
B 1 137 LEU 137 138 138 LEU LEU B . n 
B 1 138 VAL 138 139 139 VAL VAL B . n 
B 1 139 GLN 139 140 140 GLN GLN B . n 
B 1 140 ALA 140 141 141 ALA ALA B . n 
B 1 141 GLU 141 142 142 GLU GLU B . n 
B 1 142 ARG 142 143 143 ARG ARG B . n 
B 1 143 THR 143 144 144 THR THR B . n 
B 1 144 VAL 144 145 145 VAL VAL B . n 
B 1 145 LEU 145 146 146 LEU LEU B . n 
B 1 146 VAL 146 147 147 VAL VAL B . n 
B 1 147 SER 147 148 148 SER SER B . n 
B 1 148 MET 148 149 149 MET MET B . n 
B 1 149 ASN 149 150 150 ASN ASN B . n 
B 1 150 TYR 150 151 151 TYR TYR B . n 
B 1 151 ARG 151 152 152 ARG ARG B . n 
B 1 152 VAL 152 153 153 VAL VAL B . n 
B 1 153 GLY 153 154 154 GLY GLY B . n 
B 1 154 ALA 154 155 155 ALA ALA B . n 
B 1 155 PHE 155 156 156 PHE PHE B . n 
B 1 156 GLY 156 157 157 GLY GLY B . n 
B 1 157 PHE 157 158 158 PHE PHE B . n 
B 1 158 LEU 158 159 159 LEU LEU B . n 
B 1 159 ALA 159 160 160 ALA ALA B . n 
B 1 160 LEU 160 161 161 LEU LEU B . n 
B 1 161 PRO 161 162 162 PRO PRO B . n 
B 1 162 GLY 162 163 163 GLY GLY B . n 
B 1 163 SER 163 164 164 SER SER B . n 
B 1 164 ARG 164 165 165 ARG ARG B . n 
B 1 165 GLU 165 166 166 GLU GLU B . n 
B 1 166 ALA 166 167 167 ALA ALA B . n 
B 1 167 PRO 167 168 168 PRO PRO B . n 
B 1 168 GLY 168 169 169 GLY GLY B . n 
B 1 169 ASN 169 170 170 ASN ASN B . n 
B 1 170 VAL 170 171 171 VAL VAL B . n 
B 1 171 GLY 171 172 172 GLY GLY B . n 
B 1 172 LEU 172 173 173 LEU LEU B . n 
B 1 173 LEU 173 174 174 LEU LEU B . n 
B 1 174 ASP 174 175 175 ASP ASP B . n 
B 1 175 GLN 175 176 176 GLN GLN B . n 
B 1 176 ARG 176 177 177 ARG ARG B . n 
B 1 177 LEU 177 178 178 LEU LEU B . n 
B 1 178 ALA 178 179 179 ALA ALA B . n 
B 1 179 LEU 179 180 180 LEU LEU B . n 
B 1 180 GLN 180 181 181 GLN GLN B . n 
B 1 181 TRP 181 182 182 TRP TRP B . n 
B 1 182 VAL 182 183 183 VAL VAL B . n 
B 1 183 GLN 183 184 184 GLN GLN B . n 
B 1 184 GLU 184 185 185 GLU GLU B . n 
B 1 185 ASN 185 186 186 ASN ASN B . n 
B 1 186 VAL 186 187 187 VAL VAL B . n 
B 1 187 ALA 187 188 188 ALA ALA B . n 
B 1 188 ALA 188 189 189 ALA ALA B . n 
B 1 189 PHE 189 190 190 PHE PHE B . n 
B 1 190 GLY 190 191 191 GLY GLY B . n 
B 1 191 GLY 191 192 192 GLY GLY B . n 
B 1 192 ASP 192 193 193 ASP ASP B . n 
B 1 193 PRO 193 194 194 PRO PRO B . n 
B 1 194 THR 194 195 195 THR THR B . n 
B 1 195 SER 195 196 196 SER SER B . n 
B 1 196 VAL 196 197 197 VAL VAL B . n 
B 1 197 THR 197 198 198 THR THR B . n 
B 1 198 LEU 198 199 199 LEU LEU B . n 
B 1 199 PHE 199 200 200 PHE PHE B . n 
B 1 200 GLY 200 201 201 GLY GLY B . n 
B 1 201 GLU 201 202 202 GLU GLU B . n 
B 1 202 SER 202 203 203 SER SER B . n 
B 1 203 ALA 203 204 204 ALA ALA B . n 
B 1 204 GLY 204 205 205 GLY GLY B . n 
B 1 205 ALA 205 206 206 ALA ALA B . n 
B 1 206 ALA 206 207 207 ALA ALA B . n 
B 1 207 SER 207 208 208 SER SER B . n 
B 1 208 VAL 208 209 209 VAL VAL B . n 
B 1 209 GLY 209 210 210 GLY GLY B . n 
B 1 210 MET 210 211 211 MET MET B . n 
B 1 211 HIS 211 212 212 HIS HIS B . n 
B 1 212 LEU 212 213 213 LEU LEU B . n 
B 1 213 LEU 213 214 214 LEU LEU B . n 
B 1 214 SER 214 215 215 SER SER B . n 
B 1 215 PRO 215 216 216 PRO PRO B . n 
B 1 216 PRO 216 217 217 PRO PRO B . n 
B 1 217 SER 217 218 218 SER SER B . n 
B 1 218 ARG 218 219 219 ARG ARG B . n 
B 1 219 GLY 219 220 220 GLY GLY B . n 
B 1 220 LEU 220 221 221 LEU LEU B . n 
B 1 221 PHE 221 222 222 PHE PHE B . n 
B 1 222 HIS 222 223 223 HIS HIS B . n 
B 1 223 ARG 223 224 224 ARG ARG B . n 
B 1 224 ALA 224 225 225 ALA ALA B . n 
B 1 225 VAL 225 226 226 VAL VAL B . n 
B 1 226 LEU 226 227 227 LEU LEU B . n 
B 1 227 GLN 227 228 228 GLN GLN B . n 
B 1 228 SER 228 229 229 SER SER B . n 
B 1 229 GLY 229 230 230 GLY GLY B . n 
B 1 230 ALA 230 231 231 ALA ALA B . n 
B 1 231 PRO 231 232 232 PRO PRO B . n 
B 1 232 ASN 232 233 233 ASN ASN B . n 
B 1 233 GLY 233 234 234 GLY GLY B . n 
B 1 234 PRO 234 235 235 PRO PRO B . n 
B 1 235 TRP 235 236 236 TRP TRP B . n 
B 1 236 ALA 236 237 237 ALA ALA B . n 
B 1 237 THR 237 238 238 THR THR B . n 
B 1 238 VAL 238 239 239 VAL VAL B . n 
B 1 239 GLY 239 240 240 GLY GLY B . n 
B 1 240 MET 240 241 241 MET MET B . n 
B 1 241 GLY 241 242 242 GLY GLY B . n 
B 1 242 GLU 242 243 243 GLU GLU B . n 
B 1 243 ALA 243 244 244 ALA ALA B . n 
B 1 244 ARG 244 245 245 ARG ARG B . n 
B 1 245 ARG 245 246 246 ARG ARG B . n 
B 1 246 ARG 246 247 247 ARG ARG B . n 
B 1 247 ALA 247 248 248 ALA ALA B . n 
B 1 248 THR 248 249 249 THR THR B . n 
B 1 249 GLN 249 250 250 GLN GLN B . n 
B 1 250 LEU 250 251 251 LEU LEU B . n 
B 1 251 ALA 251 252 252 ALA ALA B . n 
B 1 252 HIS 252 253 253 HIS HIS B . n 
B 1 253 LEU 253 254 254 LEU LEU B . n 
B 1 254 VAL 254 255 255 VAL VAL B . n 
B 1 255 GLY 255 256 256 GLY GLY B . n 
B 1 256 CYS 256 257 257 CYS CYS B . n 
B 1 257 PRO 257 258 258 PRO PRO B . n 
B 1 258 PRO 258 259 259 PRO PRO B . n 
B 1 259 GLY 259 260 ?   ?   ?   B . n 
B 1 260 GLY 260 261 ?   ?   ?   B . n 
B 1 261 THR 261 262 262 THR THR B . n 
B 1 262 GLY 262 263 263 GLY GLY B . n 
B 1 263 GLY 263 264 264 GLY GLY B . n 
B 1 264 ASN 264 265 265 ASN ASN B . n 
B 1 265 ASP 265 266 266 ASP ASP B . n 
B 1 266 THR 266 267 267 THR THR B . n 
B 1 267 GLU 267 268 268 GLU GLU B . n 
B 1 268 LEU 268 269 269 LEU LEU B . n 
B 1 269 VAL 269 270 270 VAL VAL B . n 
B 1 270 ALA 270 271 271 ALA ALA B . n 
B 1 271 CYS 271 272 272 CYS CYS B . n 
B 1 272 LEU 272 273 273 LEU LEU B . n 
B 1 273 ARG 273 274 274 ARG ARG B . n 
B 1 274 THR 274 275 275 THR THR B . n 
B 1 275 ARG 275 276 276 ARG ARG B . n 
B 1 276 PRO 276 277 277 PRO PRO B . n 
B 1 277 ALA 277 278 278 ALA ALA B . n 
B 1 278 GLN 278 279 279 GLN GLN B . n 
B 1 279 VAL 279 280 280 VAL VAL B . n 
B 1 280 LEU 280 281 281 LEU LEU B . n 
B 1 281 VAL 281 282 282 VAL VAL B . n 
B 1 282 ASN 282 283 283 ASN ASN B . n 
B 1 283 HIS 283 284 284 HIS HIS B . n 
B 1 284 GLU 284 285 285 GLU GLU B . n 
B 1 285 TRP 285 286 286 TRP TRP B . n 
B 1 286 HIS 286 287 287 HIS HIS B . n 
B 1 287 VAL 287 288 288 VAL VAL B . n 
B 1 288 LEU 288 289 289 LEU LEU B . n 
B 1 289 PRO 289 290 290 PRO PRO B . n 
B 1 290 GLN 290 291 291 GLN GLN B . n 
B 1 291 GLU 291 292 292 GLU GLU B . n 
B 1 292 SER 292 293 293 SER SER B . n 
B 1 293 VAL 293 294 294 VAL VAL B . n 
B 1 294 PHE 294 295 295 PHE PHE B . n 
B 1 295 ARG 295 296 296 ARG ARG B . n 
B 1 296 PHE 296 297 297 PHE PHE B . n 
B 1 297 SER 297 298 298 SER SER B . n 
B 1 298 PHE 298 299 299 PHE PHE B . n 
B 1 299 VAL 299 300 300 VAL VAL B . n 
B 1 300 PRO 300 301 301 PRO PRO B . n 
B 1 301 VAL 301 302 302 VAL VAL B . n 
B 1 302 VAL 302 303 303 VAL VAL B . n 
B 1 303 ASP 303 304 304 ASP ASP B . n 
B 1 304 GLY 304 305 305 GLY GLY B . n 
B 1 305 ASP 305 306 306 ASP ASP B . n 
B 1 306 PHE 306 307 307 PHE PHE B . n 
B 1 307 LEU 307 308 308 LEU LEU B . n 
B 1 308 SER 308 309 309 SER SER B . n 
B 1 309 ASP 309 310 310 ASP ASP B . n 
B 1 310 THR 310 311 311 THR THR B . n 
B 1 311 PRO 311 312 312 PRO PRO B . n 
B 1 312 GLU 312 313 313 GLU GLU B . n 
B 1 313 ALA 313 314 314 ALA ALA B . n 
B 1 314 LEU 314 315 315 LEU LEU B . n 
B 1 315 ILE 315 316 316 ILE ILE B . n 
B 1 316 ASN 316 317 317 ASN ASN B . n 
B 1 317 ALA 317 318 318 ALA ALA B . n 
B 1 318 GLY 318 319 319 GLY GLY B . n 
B 1 319 ASP 319 320 320 ASP ASP B . n 
B 1 320 PHE 320 321 321 PHE PHE B . n 
B 1 321 HIS 321 322 322 HIS HIS B . n 
B 1 322 GLY 322 323 323 GLY GLY B . n 
B 1 323 LEU 323 324 324 LEU LEU B . n 
B 1 324 GLN 324 325 325 GLN GLN B . n 
B 1 325 VAL 325 326 326 VAL VAL B . n 
B 1 326 LEU 326 327 327 LEU LEU B . n 
B 1 327 VAL 327 328 328 VAL VAL B . n 
B 1 328 GLY 328 329 329 GLY GLY B . n 
B 1 329 VAL 329 330 330 VAL VAL B . n 
B 1 330 VAL 330 331 331 VAL VAL B . n 
B 1 331 LYS 331 332 332 LYS LYS B . n 
B 1 332 ASP 332 333 333 ASP ASP B . n 
B 1 333 GLU 333 334 334 GLU GLU B . n 
B 1 334 GLY 334 335 335 GLY GLY B . n 
B 1 335 SER 335 336 336 SER SER B . n 
B 1 336 TYR 336 337 337 TYR TYR B . n 
B 1 337 PHE 337 338 338 PHE PHE B . n 
B 1 338 LEU 338 339 339 LEU LEU B . n 
B 1 339 VAL 339 340 340 VAL VAL B . n 
B 1 340 TYR 340 341 341 TYR TYR B . n 
B 1 341 GLY 341 342 342 GLY GLY B . n 
B 1 342 ALA 342 343 343 ALA ALA B . n 
B 1 343 PRO 343 344 344 PRO PRO B . n 
B 1 344 GLY 344 345 345 GLY GLY B . n 
B 1 345 PHE 345 346 346 PHE PHE B . n 
B 1 346 SER 346 347 347 SER SER B . n 
B 1 347 LYS 347 348 348 LYS LYS B . n 
B 1 348 ASP 348 349 349 ASP ASP B . n 
B 1 349 ASN 349 350 350 ASN ASN B . n 
B 1 350 GLU 350 351 351 GLU GLU B . n 
B 1 351 SER 351 352 352 SER SER B . n 
B 1 352 LEU 352 353 353 LEU LEU B . n 
B 1 353 ILE 353 354 354 ILE ILE B . n 
B 1 354 SER 354 355 355 SER SER B . n 
B 1 355 ARG 355 356 356 ARG ARG B . n 
B 1 356 ALA 356 357 357 ALA ALA B . n 
B 1 357 GLU 357 358 358 GLU GLU B . n 
B 1 358 PHE 358 359 359 PHE PHE B . n 
B 1 359 LEU 359 360 360 LEU LEU B . n 
B 1 360 ALA 360 361 361 ALA ALA B . n 
B 1 361 GLY 361 362 362 GLY GLY B . n 
B 1 362 VAL 362 363 363 VAL VAL B . n 
B 1 363 ARG 363 364 364 ARG ARG B . n 
B 1 364 VAL 364 365 365 VAL VAL B . n 
B 1 365 GLY 365 366 366 GLY GLY B . n 
B 1 366 VAL 366 367 367 VAL VAL B . n 
B 1 367 PRO 367 368 368 PRO PRO B . n 
B 1 368 GLN 368 369 369 GLN GLN B . n 
B 1 369 VAL 369 370 370 VAL VAL B . n 
B 1 370 SER 370 371 371 SER SER B . n 
B 1 371 ASP 371 372 372 ASP ASP B . n 
B 1 372 LEU 372 373 373 LEU LEU B . n 
B 1 373 ALA 373 374 374 ALA ALA B . n 
B 1 374 ALA 374 375 375 ALA ALA B . n 
B 1 375 GLU 375 376 376 GLU GLU B . n 
B 1 376 ALA 376 377 377 ALA ALA B . n 
B 1 377 VAL 377 378 378 VAL VAL B . n 
B 1 378 VAL 378 379 379 VAL VAL B . n 
B 1 379 LEU 379 380 380 LEU LEU B . n 
B 1 380 HIS 380 381 381 HIS HIS B . n 
B 1 381 TYR 381 382 382 TYR TYR B . n 
B 1 382 THR 382 383 383 THR THR B . n 
B 1 383 ASP 383 384 384 ASP ASP B . n 
B 1 384 TRP 384 385 385 TRP TRP B . n 
B 1 385 LEU 385 386 386 LEU LEU B . n 
B 1 386 HIS 386 387 387 HIS HIS B . n 
B 1 387 PRO 387 388 388 PRO PRO B . n 
B 1 388 GLU 388 389 389 GLU GLU B . n 
B 1 389 ASP 389 390 390 ASP ASP B . n 
B 1 390 PRO 390 391 391 PRO PRO B . n 
B 1 391 ALA 391 392 392 ALA ALA B . n 
B 1 392 ARG 392 393 393 ARG ARG B . n 
B 1 393 LEU 393 394 394 LEU LEU B . n 
B 1 394 ARG 394 395 395 ARG ARG B . n 
B 1 395 GLU 395 396 396 GLU GLU B . n 
B 1 396 ALA 396 397 397 ALA ALA B . n 
B 1 397 LEU 397 398 398 LEU LEU B . n 
B 1 398 SER 398 399 399 SER SER B . n 
B 1 399 ASP 399 400 400 ASP ASP B . n 
B 1 400 VAL 400 401 401 VAL VAL B . n 
B 1 401 VAL 401 402 402 VAL VAL B . n 
B 1 402 GLY 402 403 403 GLY GLY B . n 
B 1 403 ASP 403 404 404 ASP ASP B . n 
B 1 404 HIS 404 405 405 HIS HIS B . n 
B 1 405 ASN 405 406 406 ASN ASN B . n 
B 1 406 VAL 406 407 407 VAL VAL B . n 
B 1 407 VAL 407 408 408 VAL VAL B . n 
B 1 408 CYS 408 409 409 CYS CYS B . n 
B 1 409 PRO 409 410 410 PRO PRO B . n 
B 1 410 VAL 410 411 411 VAL VAL B . n 
B 1 411 ALA 411 412 412 ALA ALA B . n 
B 1 412 GLN 412 413 413 GLN GLN B . n 
B 1 413 LEU 413 414 414 LEU LEU B . n 
B 1 414 ALA 414 415 415 ALA ALA B . n 
B 1 415 GLY 415 416 416 GLY GLY B . n 
B 1 416 ARG 416 417 417 ARG ARG B . n 
B 1 417 LEU 417 418 418 LEU LEU B . n 
B 1 418 ALA 418 419 419 ALA ALA B . n 
B 1 419 ALA 419 420 420 ALA ALA B . n 
B 1 420 GLN 420 421 421 GLN GLN B . n 
B 1 421 GLY 421 422 422 GLY GLY B . n 
B 1 422 ALA 422 423 423 ALA ALA B . n 
B 1 423 ARG 423 424 424 ARG ARG B . n 
B 1 424 VAL 424 425 425 VAL VAL B . n 
B 1 425 TYR 425 426 426 TYR TYR B . n 
B 1 426 ALA 426 427 427 ALA ALA B . n 
B 1 427 TYR 427 428 428 TYR TYR B . n 
B 1 428 VAL 428 429 429 VAL VAL B . n 
B 1 429 PHE 429 430 430 PHE PHE B . n 
B 1 430 GLU 430 431 431 GLU GLU B . n 
B 1 431 HIS 431 432 432 HIS HIS B . n 
B 1 432 ARG 432 433 433 ARG ARG B . n 
B 1 433 ALA 433 434 434 ALA ALA B . n 
B 1 434 SER 434 435 435 SER SER B . n 
B 1 435 THR 435 436 436 THR THR B . n 
B 1 436 LEU 436 437 437 LEU LEU B . n 
B 1 437 SER 437 438 438 SER SER B . n 
B 1 438 TRP 438 439 439 TRP TRP B . n 
B 1 439 PRO 439 440 440 PRO PRO B . n 
B 1 440 LEU 440 441 441 LEU LEU B . n 
B 1 441 TRP 441 442 442 TRP TRP B . n 
B 1 442 MET 442 443 443 MET MET B . n 
B 1 443 GLY 443 444 444 GLY GLY B . n 
B 1 444 VAL 444 445 445 VAL VAL B . n 
B 1 445 PRO 445 446 446 PRO PRO B . n 
B 1 446 HIS 446 447 447 HIS HIS B . n 
B 1 447 GLY 447 448 448 GLY GLY B . n 
B 1 448 TYR 448 449 449 TYR TYR B . n 
B 1 449 GLU 449 450 450 GLU GLU B . n 
B 1 450 ILE 450 451 451 ILE ILE B . n 
B 1 451 GLU 451 452 452 GLU GLU B . n 
B 1 452 PHE 452 453 453 PHE PHE B . n 
B 1 453 ILE 453 454 454 ILE ILE B . n 
B 1 454 PHE 454 455 455 PHE PHE B . n 
B 1 455 GLY 455 456 456 GLY GLY B . n 
B 1 456 ILE 456 457 457 ILE ILE B . n 
B 1 457 PRO 457 458 458 PRO PRO B . n 
B 1 458 LEU 458 459 459 LEU LEU B . n 
B 1 459 ASP 459 460 460 ASP ASP B . n 
B 1 460 PRO 460 461 461 PRO PRO B . n 
B 1 461 SER 461 462 462 SER SER B . n 
B 1 462 ARG 462 463 463 ARG ARG B . n 
B 1 463 ASN 463 464 464 ASN ASN B . n 
B 1 464 TYR 464 465 465 TYR TYR B . n 
B 1 465 THR 465 466 466 THR THR B . n 
B 1 466 ALA 466 467 467 ALA ALA B . n 
B 1 467 GLU 467 468 468 GLU GLU B . n 
B 1 468 GLU 468 469 469 GLU GLU B . n 
B 1 469 LYS 469 470 470 LYS LYS B . n 
B 1 470 ILE 470 471 471 ILE ILE B . n 
B 1 471 PHE 471 472 472 PHE PHE B . n 
B 1 472 ALA 472 473 473 ALA ALA B . n 
B 1 473 GLN 473 474 474 GLN GLN B . n 
B 1 474 ARG 474 475 475 ARG ARG B . n 
B 1 475 LEU 475 476 476 LEU LEU B . n 
B 1 476 MET 476 477 477 MET MET B . n 
B 1 477 ARG 477 478 478 ARG ARG B . n 
B 1 478 TYR 478 479 479 TYR TYR B . n 
B 1 479 TRP 479 480 480 TRP TRP B . n 
B 1 480 ALA 480 481 481 ALA ALA B . n 
B 1 481 ASN 481 482 482 ASN ASN B . n 
B 1 482 PHE 482 483 483 PHE PHE B . n 
B 1 483 ALA 483 484 484 ALA ALA B . n 
B 1 484 ARG 484 485 485 ARG ARG B . n 
B 1 485 THR 485 486 486 THR THR B . n 
B 1 486 GLY 486 487 487 GLY GLY B . n 
B 1 487 ASP 487 488 488 ASP ASP B . n 
B 1 488 PRO 488 489 489 PRO PRO B . n 
B 1 489 ASN 489 490 490 ASN ASN B . n 
B 1 490 GLU 490 491 491 GLU GLU B . n 
B 1 491 PRO 491 492 492 PRO PRO B . n 
B 1 492 ARG 492 493 493 ARG ARG B . n 
B 1 493 ASP 493 494 494 ASP ASP B . n 
B 1 494 PRO 494 495 495 PRO PRO B . n 
B 1 495 LYS 495 496 496 LYS LYS B . n 
B 1 496 ALA 496 497 497 ALA ALA B . n 
B 1 497 PRO 497 498 498 PRO PRO B . n 
B 1 498 GLN 498 499 499 GLN GLN B . n 
B 1 499 TRP 499 500 500 TRP TRP B . n 
B 1 500 PRO 500 501 501 PRO PRO B . n 
B 1 501 PRO 501 502 502 PRO PRO B . n 
B 1 502 TYR 502 503 503 TYR TYR B . n 
B 1 503 THR 503 504 504 THR THR B . n 
B 1 504 ALA 504 505 505 ALA ALA B . n 
B 1 505 GLY 505 506 506 GLY GLY B . n 
B 1 506 ALA 506 507 507 ALA ALA B . n 
B 1 507 GLN 507 508 508 GLN GLN B . n 
B 1 508 GLN 508 509 509 GLN GLN B . n 
B 1 509 TYR 509 510 510 TYR TYR B . n 
B 1 510 VAL 510 511 511 VAL VAL B . n 
B 1 511 SER 511 512 512 SER SER B . n 
B 1 512 LEU 512 513 513 LEU LEU B . n 
B 1 513 ASP 513 514 514 ASP ASP B . n 
B 1 514 LEU 514 515 515 LEU LEU B . n 
B 1 515 ARG 515 516 516 ARG ARG B . n 
B 1 516 PRO 516 517 517 PRO PRO B . n 
B 1 517 LEU 517 518 518 LEU LEU B . n 
B 1 518 GLU 518 519 519 GLU GLU B . n 
B 1 519 VAL 519 520 520 VAL VAL B . n 
B 1 520 ARG 520 521 521 ARG ARG B . n 
B 1 521 ARG 521 522 522 ARG ARG B . n 
B 1 522 GLY 522 523 523 GLY GLY B . n 
B 1 523 LEU 523 524 524 LEU LEU B . n 
B 1 524 ARG 524 525 525 ARG ARG B . n 
B 1 525 ALA 525 526 526 ALA ALA B . n 
B 1 526 GLN 526 527 527 GLN GLN B . n 
B 1 527 ALA 527 528 528 ALA ALA B . n 
B 1 528 CYS 528 529 529 CYS CYS B . n 
B 1 529 ALA 529 530 530 ALA ALA B . n 
B 1 530 PHE 530 531 531 PHE PHE B . n 
B 1 531 TRP 531 532 532 TRP TRP B . n 
B 1 532 ASN 532 533 533 ASN ASN B . n 
B 1 533 ARG 533 534 534 ARG ARG B . n 
B 1 534 PHE 534 535 535 PHE PHE B . n 
B 1 535 LEU 535 536 536 LEU LEU B . n 
B 1 536 PRO 536 537 537 PRO PRO B . n 
B 1 537 LYS 537 538 538 LYS LYS B . n 
B 1 538 LEU 538 539 539 LEU LEU B . n 
B 1 539 LEU 539 540 540 LEU LEU B . n 
B 1 540 SER 540 541 541 SER SER B . n 
B 1 541 ALA 541 542 542 ALA ALA B . n 
B 1 542 THR 542 543 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 DEP 1   604  1001 DEP DEP A . 
F 4 EDO 1   605  1    EDO EDO A . 
G 4 EDO 1   606  2    EDO EDO A . 
H 5 NAG 1   604  604  NAG NAG B . 
I 6 PE8 1   605  608  PE8 PE8 B . 
J 3 DEP 1   606  1001 DEP DEP B . 
K 4 EDO 1   607  3    EDO EDO B . 
L 4 EDO 1   608  4    EDO EDO B . 
M 7 NO3 1   609  5    NO3 NO3 B . 
N 8 HOH 1   701  680  HOH HOH A . 
N 8 HOH 2   702  401  HOH HOH A . 
N 8 HOH 3   703  339  HOH HOH A . 
N 8 HOH 4   704  545  HOH HOH A . 
N 8 HOH 5   705  431  HOH HOH A . 
N 8 HOH 6   706  66   HOH HOH A . 
N 8 HOH 7   707  286  HOH HOH A . 
N 8 HOH 8   708  386  HOH HOH A . 
N 8 HOH 9   709  392  HOH HOH A . 
N 8 HOH 10  710  465  HOH HOH A . 
N 8 HOH 11  711  259  HOH HOH A . 
N 8 HOH 12  712  585  HOH HOH A . 
N 8 HOH 13  713  413  HOH HOH A . 
N 8 HOH 14  714  362  HOH HOH A . 
N 8 HOH 15  715  74   HOH HOH A . 
N 8 HOH 16  716  312  HOH HOH A . 
N 8 HOH 17  717  410  HOH HOH A . 
N 8 HOH 18  718  8    HOH HOH A . 
N 8 HOH 19  719  669  HOH HOH A . 
N 8 HOH 20  720  426  HOH HOH A . 
N 8 HOH 21  721  331  HOH HOH A . 
N 8 HOH 22  722  593  HOH HOH A . 
N 8 HOH 23  723  377  HOH HOH A . 
N 8 HOH 24  724  578  HOH HOH A . 
N 8 HOH 25  725  30   HOH HOH A . 
N 8 HOH 26  726  687  HOH HOH A . 
N 8 HOH 27  727  187  HOH HOH A . 
N 8 HOH 28  728  275  HOH HOH A . 
N 8 HOH 29  729  26   HOH HOH A . 
N 8 HOH 30  730  363  HOH HOH A . 
N 8 HOH 31  731  353  HOH HOH A . 
N 8 HOH 32  732  497  HOH HOH A . 
N 8 HOH 33  733  134  HOH HOH A . 
N 8 HOH 34  734  510  HOH HOH A . 
N 8 HOH 35  735  559  HOH HOH A . 
N 8 HOH 36  736  637  HOH HOH A . 
N 8 HOH 37  737  98   HOH HOH A . 
N 8 HOH 38  738  58   HOH HOH A . 
N 8 HOH 39  739  273  HOH HOH A . 
N 8 HOH 40  740  242  HOH HOH A . 
N 8 HOH 41  741  274  HOH HOH A . 
N 8 HOH 42  742  18   HOH HOH A . 
N 8 HOH 43  743  116  HOH HOH A . 
N 8 HOH 44  744  567  HOH HOH A . 
N 8 HOH 45  745  464  HOH HOH A . 
N 8 HOH 46  746  59   HOH HOH A . 
N 8 HOH 47  747  156  HOH HOH A . 
N 8 HOH 48  748  154  HOH HOH A . 
N 8 HOH 49  749  458  HOH HOH A . 
N 8 HOH 50  750  694  HOH HOH A . 
N 8 HOH 51  751  652  HOH HOH A . 
N 8 HOH 52  752  113  HOH HOH A . 
N 8 HOH 53  753  361  HOH HOH A . 
N 8 HOH 54  754  415  HOH HOH A . 
N 8 HOH 55  755  291  HOH HOH A . 
N 8 HOH 56  756  53   HOH HOH A . 
N 8 HOH 57  757  25   HOH HOH A . 
N 8 HOH 58  758  333  HOH HOH A . 
N 8 HOH 59  759  209  HOH HOH A . 
N 8 HOH 60  760  250  HOH HOH A . 
N 8 HOH 61  761  515  HOH HOH A . 
N 8 HOH 62  762  238  HOH HOH A . 
N 8 HOH 63  763  114  HOH HOH A . 
N 8 HOH 64  764  36   HOH HOH A . 
N 8 HOH 65  765  179  HOH HOH A . 
N 8 HOH 66  766  679  HOH HOH A . 
N 8 HOH 67  767  336  HOH HOH A . 
N 8 HOH 68  768  128  HOH HOH A . 
N 8 HOH 69  769  1    HOH HOH A . 
N 8 HOH 70  770  144  HOH HOH A . 
N 8 HOH 71  771  148  HOH HOH A . 
N 8 HOH 72  772  172  HOH HOH A . 
N 8 HOH 73  773  193  HOH HOH A . 
N 8 HOH 74  774  500  HOH HOH A . 
N 8 HOH 75  775  328  HOH HOH A . 
N 8 HOH 76  776  419  HOH HOH A . 
N 8 HOH 77  777  205  HOH HOH A . 
N 8 HOH 78  778  127  HOH HOH A . 
N 8 HOH 79  779  469  HOH HOH A . 
N 8 HOH 80  780  276  HOH HOH A . 
N 8 HOH 81  781  324  HOH HOH A . 
N 8 HOH 82  782  307  HOH HOH A . 
N 8 HOH 83  783  17   HOH HOH A . 
N 8 HOH 84  784  383  HOH HOH A . 
N 8 HOH 85  785  45   HOH HOH A . 
N 8 HOH 86  786  229  HOH HOH A . 
N 8 HOH 87  787  393  HOH HOH A . 
N 8 HOH 88  788  341  HOH HOH A . 
N 8 HOH 89  789  421  HOH HOH A . 
N 8 HOH 90  790  422  HOH HOH A . 
N 8 HOH 91  791  597  HOH HOH A . 
N 8 HOH 92  792  429  HOH HOH A . 
N 8 HOH 93  793  159  HOH HOH A . 
N 8 HOH 94  794  407  HOH HOH A . 
N 8 HOH 95  795  119  HOH HOH A . 
N 8 HOH 96  796  129  HOH HOH A . 
N 8 HOH 97  797  94   HOH HOH A . 
N 8 HOH 98  798  347  HOH HOH A . 
N 8 HOH 99  799  63   HOH HOH A . 
N 8 HOH 100 800  345  HOH HOH A . 
N 8 HOH 101 801  21   HOH HOH A . 
N 8 HOH 102 802  38   HOH HOH A . 
N 8 HOH 103 803  4    HOH HOH A . 
N 8 HOH 104 804  557  HOH HOH A . 
N 8 HOH 105 805  56   HOH HOH A . 
N 8 HOH 106 806  60   HOH HOH A . 
N 8 HOH 107 807  225  HOH HOH A . 
N 8 HOH 108 808  168  HOH HOH A . 
N 8 HOH 109 809  157  HOH HOH A . 
N 8 HOH 110 810  264  HOH HOH A . 
N 8 HOH 111 811  24   HOH HOH A . 
N 8 HOH 112 812  51   HOH HOH A . 
N 8 HOH 113 813  624  HOH HOH A . 
N 8 HOH 114 814  3    HOH HOH A . 
N 8 HOH 115 815  519  HOH HOH A . 
N 8 HOH 116 816  188  HOH HOH A . 
N 8 HOH 117 817  151  HOH HOH A . 
N 8 HOH 118 818  508  HOH HOH A . 
N 8 HOH 119 819  201  HOH HOH A . 
N 8 HOH 120 820  278  HOH HOH A . 
N 8 HOH 121 821  243  HOH HOH A . 
N 8 HOH 122 822  102  HOH HOH A . 
N 8 HOH 123 823  360  HOH HOH A . 
N 8 HOH 124 824  10   HOH HOH A . 
N 8 HOH 125 825  572  HOH HOH A . 
N 8 HOH 126 826  16   HOH HOH A . 
N 8 HOH 127 827  433  HOH HOH A . 
N 8 HOH 128 828  199  HOH HOH A . 
N 8 HOH 129 829  449  HOH HOH A . 
N 8 HOH 130 830  616  HOH HOH A . 
N 8 HOH 131 831  68   HOH HOH A . 
N 8 HOH 132 832  84   HOH HOH A . 
N 8 HOH 133 833  166  HOH HOH A . 
N 8 HOH 134 834  319  HOH HOH A . 
N 8 HOH 135 835  161  HOH HOH A . 
N 8 HOH 136 836  337  HOH HOH A . 
N 8 HOH 137 837  301  HOH HOH A . 
N 8 HOH 138 838  309  HOH HOH A . 
N 8 HOH 139 839  69   HOH HOH A . 
N 8 HOH 140 840  37   HOH HOH A . 
N 8 HOH 141 841  256  HOH HOH A . 
N 8 HOH 142 842  46   HOH HOH A . 
N 8 HOH 143 843  603  HOH HOH A . 
N 8 HOH 144 844  420  HOH HOH A . 
N 8 HOH 145 845  232  HOH HOH A . 
N 8 HOH 146 846  460  HOH HOH A . 
N 8 HOH 147 847  504  HOH HOH A . 
N 8 HOH 148 848  643  HOH HOH A . 
N 8 HOH 149 849  228  HOH HOH A . 
N 8 HOH 150 850  204  HOH HOH A . 
N 8 HOH 151 851  79   HOH HOH A . 
N 8 HOH 152 852  61   HOH HOH A . 
N 8 HOH 153 853  165  HOH HOH A . 
N 8 HOH 154 854  277  HOH HOH A . 
N 8 HOH 155 855  581  HOH HOH A . 
N 8 HOH 156 856  399  HOH HOH A . 
N 8 HOH 157 857  41   HOH HOH A . 
N 8 HOH 158 858  42   HOH HOH A . 
N 8 HOH 159 859  101  HOH HOH A . 
N 8 HOH 160 860  257  HOH HOH A . 
N 8 HOH 161 861  317  HOH HOH A . 
N 8 HOH 162 862  28   HOH HOH A . 
N 8 HOH 163 863  310  HOH HOH A . 
N 8 HOH 164 864  611  HOH HOH A . 
N 8 HOH 165 865  173  HOH HOH A . 
N 8 HOH 166 866  483  HOH HOH A . 
N 8 HOH 167 867  236  HOH HOH A . 
N 8 HOH 168 868  221  HOH HOH A . 
N 8 HOH 169 869  239  HOH HOH A . 
N 8 HOH 170 870  89   HOH HOH A . 
N 8 HOH 171 871  211  HOH HOH A . 
N 8 HOH 172 872  627  HOH HOH A . 
N 8 HOH 173 873  267  HOH HOH A . 
N 8 HOH 174 874  206  HOH HOH A . 
N 8 HOH 175 875  297  HOH HOH A . 
N 8 HOH 176 876  43   HOH HOH A . 
N 8 HOH 177 877  195  HOH HOH A . 
N 8 HOH 178 878  200  HOH HOH A . 
N 8 HOH 179 879  499  HOH HOH A . 
N 8 HOH 180 880  182  HOH HOH A . 
N 8 HOH 181 881  47   HOH HOH A . 
N 8 HOH 182 882  5    HOH HOH A . 
N 8 HOH 183 883  409  HOH HOH A . 
N 8 HOH 184 884  494  HOH HOH A . 
N 8 HOH 185 885  406  HOH HOH A . 
N 8 HOH 186 886  335  HOH HOH A . 
N 8 HOH 187 887  251  HOH HOH A . 
N 8 HOH 188 888  398  HOH HOH A . 
N 8 HOH 189 889  573  HOH HOH A . 
N 8 HOH 190 890  44   HOH HOH A . 
N 8 HOH 191 891  13   HOH HOH A . 
N 8 HOH 192 892  196  HOH HOH A . 
N 8 HOH 193 893  252  HOH HOH A . 
N 8 HOH 194 894  90   HOH HOH A . 
N 8 HOH 195 895  505  HOH HOH A . 
N 8 HOH 196 896  265  HOH HOH A . 
N 8 HOH 197 897  478  HOH HOH A . 
N 8 HOH 198 898  6    HOH HOH A . 
N 8 HOH 199 899  246  HOH HOH A . 
N 8 HOH 200 900  19   HOH HOH A . 
N 8 HOH 201 901  564  HOH HOH A . 
N 8 HOH 202 902  346  HOH HOH A . 
N 8 HOH 203 903  466  HOH HOH A . 
N 8 HOH 204 904  526  HOH HOH A . 
N 8 HOH 205 905  287  HOH HOH A . 
N 8 HOH 206 906  530  HOH HOH A . 
N 8 HOH 207 907  304  HOH HOH A . 
N 8 HOH 208 908  374  HOH HOH A . 
N 8 HOH 209 909  492  HOH HOH A . 
N 8 HOH 210 910  270  HOH HOH A . 
N 8 HOH 211 911  639  HOH HOH A . 
N 8 HOH 212 912  280  HOH HOH A . 
N 8 HOH 213 913  288  HOH HOH A . 
N 8 HOH 214 914  81   HOH HOH A . 
N 8 HOH 215 915  263  HOH HOH A . 
N 8 HOH 216 916  57   HOH HOH A . 
N 8 HOH 217 917  99   HOH HOH A . 
N 8 HOH 218 918  623  HOH HOH A . 
N 8 HOH 219 919  208  HOH HOH A . 
N 8 HOH 220 920  685  HOH HOH A . 
N 8 HOH 221 921  507  HOH HOH A . 
N 8 HOH 222 922  606  HOH HOH A . 
N 8 HOH 223 923  391  HOH HOH A . 
N 8 HOH 224 924  370  HOH HOH A . 
N 8 HOH 225 925  306  HOH HOH A . 
N 8 HOH 226 926  432  HOH HOH A . 
N 8 HOH 227 927  303  HOH HOH A . 
N 8 HOH 228 928  305  HOH HOH A . 
N 8 HOH 229 929  613  HOH HOH A . 
N 8 HOH 230 930  445  HOH HOH A . 
N 8 HOH 231 931  130  HOH HOH A . 
N 8 HOH 232 932  92   HOH HOH A . 
N 8 HOH 233 933  561  HOH HOH A . 
N 8 HOH 234 934  177  HOH HOH A . 
N 8 HOH 235 935  95   HOH HOH A . 
N 8 HOH 236 936  371  HOH HOH A . 
N 8 HOH 237 937  487  HOH HOH A . 
N 8 HOH 238 938  548  HOH HOH A . 
N 8 HOH 239 939  191  HOH HOH A . 
N 8 HOH 240 940  230  HOH HOH A . 
N 8 HOH 241 941  77   HOH HOH A . 
N 8 HOH 242 942  591  HOH HOH A . 
N 8 HOH 243 943  402  HOH HOH A . 
N 8 HOH 244 944  167  HOH HOH A . 
N 8 HOH 245 945  609  HOH HOH A . 
N 8 HOH 246 946  403  HOH HOH A . 
N 8 HOH 247 947  96   HOH HOH A . 
N 8 HOH 248 948  703  HOH HOH A . 
N 8 HOH 249 949  329  HOH HOH A . 
N 8 HOH 250 950  491  HOH HOH A . 
N 8 HOH 251 951  91   HOH HOH A . 
N 8 HOH 252 952  529  HOH HOH A . 
N 8 HOH 253 953  153  HOH HOH A . 
N 8 HOH 254 954  389  HOH HOH A . 
N 8 HOH 255 955  654  HOH HOH A . 
N 8 HOH 256 956  231  HOH HOH A . 
N 8 HOH 257 957  76   HOH HOH A . 
N 8 HOH 258 958  169  HOH HOH A . 
N 8 HOH 259 959  446  HOH HOH A . 
N 8 HOH 260 960  671  HOH HOH A . 
N 8 HOH 261 961  185  HOH HOH A . 
N 8 HOH 262 962  160  HOH HOH A . 
N 8 HOH 263 963  574  HOH HOH A . 
N 8 HOH 264 964  462  HOH HOH A . 
N 8 HOH 265 965  367  HOH HOH A . 
N 8 HOH 266 966  281  HOH HOH A . 
N 8 HOH 267 967  141  HOH HOH A . 
N 8 HOH 268 968  598  HOH HOH A . 
N 8 HOH 269 969  254  HOH HOH A . 
N 8 HOH 270 970  67   HOH HOH A . 
N 8 HOH 271 971  459  HOH HOH A . 
N 8 HOH 272 972  502  HOH HOH A . 
N 8 HOH 273 973  676  HOH HOH A . 
N 8 HOH 274 974  647  HOH HOH A . 
N 8 HOH 275 975  408  HOH HOH A . 
N 8 HOH 276 976  136  HOH HOH A . 
N 8 HOH 277 977  233  HOH HOH A . 
N 8 HOH 278 978  111  HOH HOH A . 
N 8 HOH 279 979  448  HOH HOH A . 
N 8 HOH 280 980  634  HOH HOH A . 
N 8 HOH 281 981  354  HOH HOH A . 
N 8 HOH 282 982  645  HOH HOH A . 
N 8 HOH 283 983  475  HOH HOH A . 
N 8 HOH 284 984  594  HOH HOH A . 
N 8 HOH 285 985  533  HOH HOH A . 
N 8 HOH 286 986  537  HOH HOH A . 
N 8 HOH 287 987  704  HOH HOH A . 
N 8 HOH 288 988  83   HOH HOH A . 
N 8 HOH 289 989  384  HOH HOH A . 
N 8 HOH 290 990  667  HOH HOH A . 
N 8 HOH 291 991  552  HOH HOH A . 
N 8 HOH 292 992  387  HOH HOH A . 
N 8 HOH 293 993  662  HOH HOH A . 
N 8 HOH 294 994  245  HOH HOH A . 
N 8 HOH 295 995  241  HOH HOH A . 
N 8 HOH 296 996  176  HOH HOH A . 
N 8 HOH 297 997  674  HOH HOH A . 
N 8 HOH 298 998  562  HOH HOH A . 
N 8 HOH 299 999  650  HOH HOH A . 
N 8 HOH 300 1000 348  HOH HOH A . 
N 8 HOH 301 1001 642  HOH HOH A . 
N 8 HOH 302 1002 473  HOH HOH A . 
N 8 HOH 303 1003 657  HOH HOH A . 
N 8 HOH 304 1004 323  HOH HOH A . 
N 8 HOH 305 1005 655  HOH HOH A . 
N 8 HOH 306 1006 536  HOH HOH A . 
N 8 HOH 307 1007 484  HOH HOH A . 
N 8 HOH 308 1008 442  HOH HOH A . 
N 8 HOH 309 1009 486  HOH HOH A . 
N 8 HOH 310 1010 586  HOH HOH A . 
N 8 HOH 311 1011 665  HOH HOH A . 
N 8 HOH 312 1012 651  HOH HOH A . 
N 8 HOH 313 1013 563  HOH HOH A . 
N 8 HOH 314 1014 656  HOH HOH A . 
N 8 HOH 315 1015 441  HOH HOH A . 
N 8 HOH 316 1016 477  HOH HOH A . 
N 8 HOH 317 1017 321  HOH HOH A . 
N 8 HOH 318 1018 622  HOH HOH A . 
N 8 HOH 319 1019 181  HOH HOH A . 
N 8 HOH 320 1020 485  HOH HOH A . 
N 8 HOH 321 1021 629  HOH HOH A . 
N 8 HOH 322 1022 565  HOH HOH A . 
N 8 HOH 323 1023 447  HOH HOH A . 
N 8 HOH 324 1024 690  HOH HOH A . 
N 8 HOH 325 1025 583  HOH HOH A . 
N 8 HOH 326 1026 463  HOH HOH A . 
N 8 HOH 327 1027 488  HOH HOH A . 
N 8 HOH 328 1028 558  HOH HOH A . 
N 8 HOH 329 1029 683  HOH HOH A . 
N 8 HOH 330 1030 649  HOH HOH A . 
N 8 HOH 331 1031 247  HOH HOH A . 
N 8 HOH 332 1032 577  HOH HOH A . 
N 8 HOH 333 1033 418  HOH HOH A . 
N 8 HOH 334 1034 675  HOH HOH A . 
N 8 HOH 335 1035 587  HOH HOH A . 
N 8 HOH 336 1036 531  HOH HOH A . 
N 8 HOH 337 1037 653  HOH HOH A . 
N 8 HOH 338 1038 619  HOH HOH A . 
N 8 HOH 339 1039 302  HOH HOH A . 
N 8 HOH 340 1040 376  HOH HOH A . 
N 8 HOH 341 1041 659  HOH HOH A . 
N 8 HOH 342 1042 216  HOH HOH A . 
N 8 HOH 343 1043 692  HOH HOH A . 
N 8 HOH 344 1044 686  HOH HOH A . 
N 8 HOH 345 1045 417  HOH HOH A . 
N 8 HOH 346 1046 691  HOH HOH A . 
N 8 HOH 347 1047 496  HOH HOH A . 
N 8 HOH 348 1048 359  HOH HOH A . 
N 8 HOH 349 1049 705  HOH HOH A . 
N 8 HOH 350 1050 522  HOH HOH A . 
N 8 HOH 351 1051 534  HOH HOH A . 
N 8 HOH 352 1052 427  HOH HOH A . 
N 8 HOH 353 1053 599  HOH HOH A . 
N 8 HOH 354 1054 290  HOH HOH A . 
N 8 HOH 355 1055 380  HOH HOH A . 
N 8 HOH 356 1056 628  HOH HOH A . 
N 8 HOH 357 1057 658  HOH HOH A . 
N 8 HOH 358 1058 411  HOH HOH A . 
N 8 HOH 359 1059 396  HOH HOH A . 
N 8 HOH 360 1060 513  HOH HOH A . 
N 8 HOH 361 1061 388  HOH HOH A . 
N 8 HOH 362 1062 495  HOH HOH A . 
N 8 HOH 363 1063 535  HOH HOH A . 
N 8 HOH 364 1064 595  HOH HOH A . 
N 8 HOH 365 1065 471  HOH HOH A . 
N 8 HOH 366 1066 368  HOH HOH A . 
N 8 HOH 367 1067 349  HOH HOH A . 
N 8 HOH 368 1068 546  HOH HOH A . 
N 8 HOH 369 1069 570  HOH HOH A . 
N 8 HOH 370 1070 227  HOH HOH A . 
N 8 HOH 371 1071 344  HOH HOH A . 
N 8 HOH 372 1072 455  HOH HOH A . 
N 8 HOH 373 1073 547  HOH HOH A . 
N 8 HOH 374 1074 506  HOH HOH A . 
N 8 HOH 375 1075 612  HOH HOH A . 
N 8 HOH 376 1076 693  HOH HOH A . 
N 8 HOH 377 1077 467  HOH HOH A . 
N 8 HOH 378 1078 450  HOH HOH A . 
O 8 HOH 1   701  684  HOH HOH B . 
O 8 HOH 2   702  688  HOH HOH B . 
O 8 HOH 3   703  553  HOH HOH B . 
O 8 HOH 4   704  579  HOH HOH B . 
O 8 HOH 5   705  681  HOH HOH B . 
O 8 HOH 6   706  434  HOH HOH B . 
O 8 HOH 7   707  146  HOH HOH B . 
O 8 HOH 8   708  589  HOH HOH B . 
O 8 HOH 9   709  35   HOH HOH B . 
O 8 HOH 10  710  566  HOH HOH B . 
O 8 HOH 11  711  356  HOH HOH B . 
O 8 HOH 12  712  85   HOH HOH B . 
O 8 HOH 13  713  311  HOH HOH B . 
O 8 HOH 14  714  162  HOH HOH B . 
O 8 HOH 15  715  501  HOH HOH B . 
O 8 HOH 16  716  596  HOH HOH B . 
O 8 HOH 17  717  49   HOH HOH B . 
O 8 HOH 18  718  147  HOH HOH B . 
O 8 HOH 19  719  443  HOH HOH B . 
O 8 HOH 20  720  350  HOH HOH B . 
O 8 HOH 21  721  511  HOH HOH B . 
O 8 HOH 22  722  412  HOH HOH B . 
O 8 HOH 23  723  117  HOH HOH B . 
O 8 HOH 24  724  62   HOH HOH B . 
O 8 HOH 25  725  31   HOH HOH B . 
O 8 HOH 26  726  118  HOH HOH B . 
O 8 HOH 27  727  439  HOH HOH B . 
O 8 HOH 28  728  298  HOH HOH B . 
O 8 HOH 29  729  428  HOH HOH B . 
O 8 HOH 30  730  39   HOH HOH B . 
O 8 HOH 31  731  207  HOH HOH B . 
O 8 HOH 32  732  320  HOH HOH B . 
O 8 HOH 33  733  112  HOH HOH B . 
O 8 HOH 34  734  556  HOH HOH B . 
O 8 HOH 35  735  414  HOH HOH B . 
O 8 HOH 36  736  296  HOH HOH B . 
O 8 HOH 37  737  382  HOH HOH B . 
O 8 HOH 38  738  155  HOH HOH B . 
O 8 HOH 39  739  340  HOH HOH B . 
O 8 HOH 40  740  11   HOH HOH B . 
O 8 HOH 41  741  518  HOH HOH B . 
O 8 HOH 42  742  592  HOH HOH B . 
O 8 HOH 43  743  438  HOH HOH B . 
O 8 HOH 44  744  137  HOH HOH B . 
O 8 HOH 45  745  452  HOH HOH B . 
O 8 HOH 46  746  554  HOH HOH B . 
O 8 HOH 47  747  258  HOH HOH B . 
O 8 HOH 48  748  289  HOH HOH B . 
O 8 HOH 49  749  164  HOH HOH B . 
O 8 HOH 50  750  476  HOH HOH B . 
O 8 HOH 51  751  523  HOH HOH B . 
O 8 HOH 52  752  314  HOH HOH B . 
O 8 HOH 53  753  12   HOH HOH B . 
O 8 HOH 54  754  489  HOH HOH B . 
O 8 HOH 55  755  351  HOH HOH B . 
O 8 HOH 56  756  100  HOH HOH B . 
O 8 HOH 57  757  390  HOH HOH B . 
O 8 HOH 58  758  600  HOH HOH B . 
O 8 HOH 59  759  135  HOH HOH B . 
O 8 HOH 60  760  192  HOH HOH B . 
O 8 HOH 61  761  300  HOH HOH B . 
O 8 HOH 62  762  78   HOH HOH B . 
O 8 HOH 63  763  9    HOH HOH B . 
O 8 HOH 64  764  672  HOH HOH B . 
O 8 HOH 65  765  184  HOH HOH B . 
O 8 HOH 66  766  234  HOH HOH B . 
O 8 HOH 67  767  322  HOH HOH B . 
O 8 HOH 68  768  50   HOH HOH B . 
O 8 HOH 69  769  366  HOH HOH B . 
O 8 HOH 70  770  72   HOH HOH B . 
O 8 HOH 71  771  468  HOH HOH B . 
O 8 HOH 72  772  194  HOH HOH B . 
O 8 HOH 73  773  295  HOH HOH B . 
O 8 HOH 74  774  70   HOH HOH B . 
O 8 HOH 75  775  15   HOH HOH B . 
O 8 HOH 76  776  65   HOH HOH B . 
O 8 HOH 77  777  490  HOH HOH B . 
O 8 HOH 78  778  132  HOH HOH B . 
O 8 HOH 79  779  7    HOH HOH B . 
O 8 HOH 80  780  695  HOH HOH B . 
O 8 HOH 81  781  202  HOH HOH B . 
O 8 HOH 82  782  175  HOH HOH B . 
O 8 HOH 83  783  226  HOH HOH B . 
O 8 HOH 84  784  34   HOH HOH B . 
O 8 HOH 85  785  97   HOH HOH B . 
O 8 HOH 86  786  218  HOH HOH B . 
O 8 HOH 87  787  14   HOH HOH B . 
O 8 HOH 88  788  125  HOH HOH B . 
O 8 HOH 89  789  538  HOH HOH B . 
O 8 HOH 90  790  260  HOH HOH B . 
O 8 HOH 91  791  104  HOH HOH B . 
O 8 HOH 92  792  82   HOH HOH B . 
O 8 HOH 93  793  582  HOH HOH B . 
O 8 HOH 94  794  190  HOH HOH B . 
O 8 HOH 95  795  48   HOH HOH B . 
O 8 HOH 96  796  163  HOH HOH B . 
O 8 HOH 97  797  555  HOH HOH B . 
O 8 HOH 98  798  198  HOH HOH B . 
O 8 HOH 99  799  272  HOH HOH B . 
O 8 HOH 100 800  122  HOH HOH B . 
O 8 HOH 101 801  88   HOH HOH B . 
O 8 HOH 102 802  435  HOH HOH B . 
O 8 HOH 103 803  64   HOH HOH B . 
O 8 HOH 104 804  107  HOH HOH B . 
O 8 HOH 105 805  332  HOH HOH B . 
O 8 HOH 106 806  93   HOH HOH B . 
O 8 HOH 107 807  73   HOH HOH B . 
O 8 HOH 108 808  395  HOH HOH B . 
O 8 HOH 109 809  283  HOH HOH B . 
O 8 HOH 110 810  604  HOH HOH B . 
O 8 HOH 111 811  294  HOH HOH B . 
O 8 HOH 112 812  143  HOH HOH B . 
O 8 HOH 113 813  22   HOH HOH B . 
O 8 HOH 114 814  178  HOH HOH B . 
O 8 HOH 115 815  80   HOH HOH B . 
O 8 HOH 116 816  481  HOH HOH B . 
O 8 HOH 117 817  27   HOH HOH B . 
O 8 HOH 118 818  55   HOH HOH B . 
O 8 HOH 119 819  86   HOH HOH B . 
O 8 HOH 120 820  701  HOH HOH B . 
O 8 HOH 121 821  285  HOH HOH B . 
O 8 HOH 122 822  142  HOH HOH B . 
O 8 HOH 123 823  299  HOH HOH B . 
O 8 HOH 124 824  23   HOH HOH B . 
O 8 HOH 125 825  700  HOH HOH B . 
O 8 HOH 126 826  590  HOH HOH B . 
O 8 HOH 127 827  621  HOH HOH B . 
O 8 HOH 128 828  338  HOH HOH B . 
O 8 HOH 129 829  235  HOH HOH B . 
O 8 HOH 130 830  666  HOH HOH B . 
O 8 HOH 131 831  217  HOH HOH B . 
O 8 HOH 132 832  152  HOH HOH B . 
O 8 HOH 133 833  20   HOH HOH B . 
O 8 HOH 134 834  126  HOH HOH B . 
O 8 HOH 135 835  123  HOH HOH B . 
O 8 HOH 136 836  550  HOH HOH B . 
O 8 HOH 137 837  174  HOH HOH B . 
O 8 HOH 138 838  378  HOH HOH B . 
O 8 HOH 139 839  210  HOH HOH B . 
O 8 HOH 140 840  509  HOH HOH B . 
O 8 HOH 141 841  327  HOH HOH B . 
O 8 HOH 142 842  474  HOH HOH B . 
O 8 HOH 143 843  326  HOH HOH B . 
O 8 HOH 144 844  121  HOH HOH B . 
O 8 HOH 145 845  601  HOH HOH B . 
O 8 HOH 146 846  646  HOH HOH B . 
O 8 HOH 147 847  124  HOH HOH B . 
O 8 HOH 148 848  543  HOH HOH B . 
O 8 HOH 149 849  214  HOH HOH B . 
O 8 HOH 150 850  237  HOH HOH B . 
O 8 HOH 151 851  150  HOH HOH B . 
O 8 HOH 152 852  32   HOH HOH B . 
O 8 HOH 153 853  313  HOH HOH B . 
O 8 HOH 154 854  292  HOH HOH B . 
O 8 HOH 155 855  541  HOH HOH B . 
O 8 HOH 156 856  503  HOH HOH B . 
O 8 HOH 157 857  379  HOH HOH B . 
O 8 HOH 158 858  140  HOH HOH B . 
O 8 HOH 159 859  372  HOH HOH B . 
O 8 HOH 160 860  660  HOH HOH B . 
O 8 HOH 161 861  282  HOH HOH B . 
O 8 HOH 162 862  255  HOH HOH B . 
O 8 HOH 163 863  33   HOH HOH B . 
O 8 HOH 164 864  365  HOH HOH B . 
O 8 HOH 165 865  29   HOH HOH B . 
O 8 HOH 166 866  75   HOH HOH B . 
O 8 HOH 167 867  437  HOH HOH B . 
O 8 HOH 168 868  608  HOH HOH B . 
O 8 HOH 169 869  625  HOH HOH B . 
O 8 HOH 170 870  170  HOH HOH B . 
O 8 HOH 171 871  375  HOH HOH B . 
O 8 HOH 172 872  528  HOH HOH B . 
O 8 HOH 173 873  189  HOH HOH B . 
O 8 HOH 174 874  2    HOH HOH B . 
O 8 HOH 175 875  105  HOH HOH B . 
O 8 HOH 176 876  171  HOH HOH B . 
O 8 HOH 177 877  223  HOH HOH B . 
O 8 HOH 178 878  430  HOH HOH B . 
O 8 HOH 179 879  261  HOH HOH B . 
O 8 HOH 180 880  493  HOH HOH B . 
O 8 HOH 181 881  249  HOH HOH B . 
O 8 HOH 182 882  110  HOH HOH B . 
O 8 HOH 183 883  580  HOH HOH B . 
O 8 HOH 184 884  145  HOH HOH B . 
O 8 HOH 185 885  108  HOH HOH B . 
O 8 HOH 186 886  197  HOH HOH B . 
O 8 HOH 187 887  109  HOH HOH B . 
O 8 HOH 188 888  224  HOH HOH B . 
O 8 HOH 189 889  139  HOH HOH B . 
O 8 HOH 190 890  385  HOH HOH B . 
O 8 HOH 191 891  394  HOH HOH B . 
O 8 HOH 192 892  183  HOH HOH B . 
O 8 HOH 193 893  400  HOH HOH B . 
O 8 HOH 194 894  87   HOH HOH B . 
O 8 HOH 195 895  640  HOH HOH B . 
O 8 HOH 196 896  103  HOH HOH B . 
O 8 HOH 197 897  424  HOH HOH B . 
O 8 HOH 198 898  551  HOH HOH B . 
O 8 HOH 199 899  240  HOH HOH B . 
O 8 HOH 200 900  308  HOH HOH B . 
O 8 HOH 201 901  532  HOH HOH B . 
O 8 HOH 202 902  180  HOH HOH B . 
O 8 HOH 203 903  330  HOH HOH B . 
O 8 HOH 204 904  325  HOH HOH B . 
O 8 HOH 205 905  115  HOH HOH B . 
O 8 HOH 206 906  521  HOH HOH B . 
O 8 HOH 207 907  158  HOH HOH B . 
O 8 HOH 208 908  138  HOH HOH B . 
O 8 HOH 209 909  663  HOH HOH B . 
O 8 HOH 210 910  215  HOH HOH B . 
O 8 HOH 211 911  271  HOH HOH B . 
O 8 HOH 212 912  212  HOH HOH B . 
O 8 HOH 213 913  682  HOH HOH B . 
O 8 HOH 214 914  186  HOH HOH B . 
O 8 HOH 215 915  318  HOH HOH B . 
O 8 HOH 216 916  279  HOH HOH B . 
O 8 HOH 217 917  133  HOH HOH B . 
O 8 HOH 218 918  512  HOH HOH B . 
O 8 HOH 219 919  120  HOH HOH B . 
O 8 HOH 220 920  369  HOH HOH B . 
O 8 HOH 221 921  525  HOH HOH B . 
O 8 HOH 222 922  106  HOH HOH B . 
O 8 HOH 223 923  40   HOH HOH B . 
O 8 HOH 224 924  436  HOH HOH B . 
O 8 HOH 225 925  342  HOH HOH B . 
O 8 HOH 226 926  423  HOH HOH B . 
O 8 HOH 227 927  472  HOH HOH B . 
O 8 HOH 228 928  520  HOH HOH B . 
O 8 HOH 229 929  575  HOH HOH B . 
O 8 HOH 230 930  293  HOH HOH B . 
O 8 HOH 231 931  266  HOH HOH B . 
O 8 HOH 232 932  542  HOH HOH B . 
O 8 HOH 233 933  576  HOH HOH B . 
O 8 HOH 234 934  222  HOH HOH B . 
O 8 HOH 235 935  539  HOH HOH B . 
O 8 HOH 236 936  454  HOH HOH B . 
O 8 HOH 237 937  244  HOH HOH B . 
O 8 HOH 238 938  213  HOH HOH B . 
O 8 HOH 239 939  707  HOH HOH B . 
O 8 HOH 240 940  253  HOH HOH B . 
O 8 HOH 241 941  444  HOH HOH B . 
O 8 HOH 242 942  316  HOH HOH B . 
O 8 HOH 243 943  248  HOH HOH B . 
O 8 HOH 244 944  131  HOH HOH B . 
O 8 HOH 245 945  673  HOH HOH B . 
O 8 HOH 246 946  373  HOH HOH B . 
O 8 HOH 247 947  568  HOH HOH B . 
O 8 HOH 248 948  352  HOH HOH B . 
O 8 HOH 249 949  284  HOH HOH B . 
O 8 HOH 250 950  527  HOH HOH B . 
O 8 HOH 251 951  697  HOH HOH B . 
O 8 HOH 252 952  52   HOH HOH B . 
O 8 HOH 253 953  358  HOH HOH B . 
O 8 HOH 254 954  54   HOH HOH B . 
O 8 HOH 255 955  71   HOH HOH B . 
O 8 HOH 256 956  524  HOH HOH B . 
O 8 HOH 257 957  549  HOH HOH B . 
O 8 HOH 258 958  457  HOH HOH B . 
O 8 HOH 259 959  618  HOH HOH B . 
O 8 HOH 260 960  614  HOH HOH B . 
O 8 HOH 261 961  470  HOH HOH B . 
O 8 HOH 262 962  357  HOH HOH B . 
O 8 HOH 263 963  355  HOH HOH B . 
O 8 HOH 264 964  416  HOH HOH B . 
O 8 HOH 265 965  451  HOH HOH B . 
O 8 HOH 266 966  404  HOH HOH B . 
O 8 HOH 267 967  610  HOH HOH B . 
O 8 HOH 268 968  648  HOH HOH B . 
O 8 HOH 269 969  668  HOH HOH B . 
O 8 HOH 270 970  220  HOH HOH B . 
O 8 HOH 271 971  678  HOH HOH B . 
O 8 HOH 272 972  630  HOH HOH B . 
O 8 HOH 273 973  584  HOH HOH B . 
O 8 HOH 274 974  479  HOH HOH B . 
O 8 HOH 275 975  498  HOH HOH B . 
O 8 HOH 276 976  635  HOH HOH B . 
O 8 HOH 277 977  689  HOH HOH B . 
O 8 HOH 278 978  615  HOH HOH B . 
O 8 HOH 279 979  602  HOH HOH B . 
O 8 HOH 280 980  696  HOH HOH B . 
O 8 HOH 281 981  560  HOH HOH B . 
O 8 HOH 282 982  544  HOH HOH B . 
O 8 HOH 283 983  631  HOH HOH B . 
O 8 HOH 284 984  315  HOH HOH B . 
O 8 HOH 285 985  677  HOH HOH B . 
O 8 HOH 286 986  661  HOH HOH B . 
O 8 HOH 287 987  482  HOH HOH B . 
O 8 HOH 288 988  670  HOH HOH B . 
O 8 HOH 289 989  641  HOH HOH B . 
O 8 HOH 290 990  702  HOH HOH B . 
O 8 HOH 291 991  636  HOH HOH B . 
O 8 HOH 292 992  617  HOH HOH B . 
O 8 HOH 293 993  364  HOH HOH B . 
O 8 HOH 294 994  644  HOH HOH B . 
O 8 HOH 295 995  269  HOH HOH B . 
O 8 HOH 296 996  149  HOH HOH B . 
O 8 HOH 297 997  440  HOH HOH B . 
O 8 HOH 298 998  456  HOH HOH B . 
O 8 HOH 299 999  571  HOH HOH B . 
O 8 HOH 300 1000 620  HOH HOH B . 
O 8 HOH 301 1001 699  HOH HOH B . 
O 8 HOH 302 1002 203  HOH HOH B . 
O 8 HOH 303 1003 219  HOH HOH B . 
O 8 HOH 304 1004 706  HOH HOH B . 
O 8 HOH 305 1005 664  HOH HOH B . 
O 8 HOH 306 1006 343  HOH HOH B . 
O 8 HOH 307 1007 453  HOH HOH B . 
O 8 HOH 308 1008 588  HOH HOH B . 
O 8 HOH 309 1009 514  HOH HOH B . 
O 8 HOH 310 1010 607  HOH HOH B . 
O 8 HOH 311 1011 461  HOH HOH B . 
O 8 HOH 312 1012 262  HOH HOH B . 
O 8 HOH 313 1013 268  HOH HOH B . 
O 8 HOH 314 1014 540  HOH HOH B . 
O 8 HOH 315 1015 517  HOH HOH B . 
O 8 HOH 316 1016 397  HOH HOH B . 
O 8 HOH 317 1017 638  HOH HOH B . 
O 8 HOH 318 1018 405  HOH HOH B . 
O 8 HOH 319 1019 698  HOH HOH B . 
O 8 HOH 320 1020 425  HOH HOH B . 
O 8 HOH 321 1021 381  HOH HOH B . 
O 8 HOH 322 1022 334  HOH HOH B . 
O 8 HOH 323 1023 632  HOH HOH B . 
O 8 HOH 324 1024 605  HOH HOH B . 
O 8 HOH 325 1025 626  HOH HOH B . 
O 8 HOH 326 1026 516  HOH HOH B . 
O 8 HOH 327 1027 480  HOH HOH B . 
O 8 HOH 328 1028 569  HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6190  ? 
1 MORE         45    ? 
1 'SSA (A^2)'  38900 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-07-27 
2 'Structure model' 1 1 2016-08-24 
3 'Structure model' 1 2 2017-11-22 
4 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Database references'    
3 3 'Structure model' 'Derived calculations'   
4 3 'Structure model' 'Refinement description' 
5 4 'Structure model' 'Atomic model'           
6 4 'Structure model' 'Data collection'        
7 4 'Structure model' 'Derived calculations'   
8 4 'Structure model' 'Structure summary'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  3 'Structure model' citation                      
2  3 'Structure model' pdbx_struct_oper_list         
3  3 'Structure model' software                      
4  4 'Structure model' atom_site                     
5  4 'Structure model' chem_comp                     
6  4 'Structure model' entity                        
7  4 'Structure model' pdbx_branch_scheme            
8  4 'Structure model' pdbx_chem_comp_identifier     
9  4 'Structure model' pdbx_entity_branch            
10 4 'Structure model' pdbx_entity_branch_descriptor 
11 4 'Structure model' pdbx_entity_branch_link       
12 4 'Structure model' pdbx_entity_branch_list       
13 4 'Structure model' pdbx_entity_nonpoly           
14 4 'Structure model' pdbx_nonpoly_scheme           
15 4 'Structure model' pdbx_struct_assembly_gen      
16 4 'Structure model' struct_asym                   
17 4 'Structure model' struct_conn                   
18 4 'Structure model' struct_site                   
19 4 'Structure model' struct_site_gen               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  3 'Structure model' '_citation.journal_id_CSD'                  
2  3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
3  3 'Structure model' '_software.classification'                  
4  4 'Structure model' '_atom_site.B_iso_or_equiv'                 
5  4 'Structure model' '_atom_site.Cartn_x'                        
6  4 'Structure model' '_atom_site.Cartn_y'                        
7  4 'Structure model' '_atom_site.Cartn_z'                        
8  4 'Structure model' '_atom_site.auth_asym_id'                   
9  4 'Structure model' '_atom_site.auth_atom_id'                   
10 4 'Structure model' '_atom_site.auth_comp_id'                   
11 4 'Structure model' '_atom_site.auth_seq_id'                    
12 4 'Structure model' '_atom_site.label_asym_id'                  
13 4 'Structure model' '_atom_site.label_atom_id'                  
14 4 'Structure model' '_atom_site.label_comp_id'                  
15 4 'Structure model' '_atom_site.label_entity_id'                
16 4 'Structure model' '_atom_site.occupancy'                      
17 4 'Structure model' '_atom_site.type_symbol'                    
18 4 'Structure model' '_chem_comp.name'                           
19 4 'Structure model' '_chem_comp.type'                           
20 4 'Structure model' '_entity.formula_weight'                    
21 4 'Structure model' '_entity.pdbx_description'                  
22 4 'Structure model' '_entity.pdbx_number_of_molecules'          
23 4 'Structure model' '_entity.src_method'                        
24 4 'Structure model' '_entity.type'                              
25 4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list'    
26 4 'Structure model' '_struct_conn.pdbx_role'                    
27 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id'           
28 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'            
29 4 'Structure model' '_struct_conn.ptnr1_label_asym_id'          
30 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id'           
31 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'            
32 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'          
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data collection' ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .    1 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? SCALEPACK   ? ? ? .    2 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? .    3 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? .    5 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .    6 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   B HOH 951  ? ? O B HOH 980  ? ? 1.93 
2 1 O   A HOH 1000 ? ? O A HOH 1033 ? ? 2.03 
3 1 OE1 A GLU 468  ? ? O A HOH 701  ? ? 2.13 
4 1 O   A HOH 996  ? ? O A HOH 1042 ? ? 2.15 
5 1 O   A HOH 1021 ? ? O A HOH 1032 ? ? 2.17 
6 1 O   B HOH 913  ? ? O B HOH 991  ? ? 2.17 
7 1 O   A HOH 979  ? ? O A HOH 985  ? ? 2.19 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 47  ? ? 76.51   -6.08   
2  1 ALA A 62  ? ? -117.58 56.48   
3  1 SER A 203 ? ? 58.45   -118.95 
4  1 HIS A 287 ? ? -94.61  39.35   
5  1 ARG A 296 ? ? -105.51 55.46   
6  1 PHE A 297 ? ? -110.67 69.27   
7  1 ASP A 306 ? ? -95.35  -86.54  
8  1 TYR A 341 ? ? -98.16  31.39   
9  1 VAL A 407 ? ? -129.37 -60.82  
10 1 SER A 541 ? ? -71.61  -81.16  
11 1 PHE B 47  ? ? 76.92   -5.51   
12 1 SER B 203 ? ? 54.44   -121.25 
13 1 PHE B 295 ? ? -103.90 77.58   
14 1 ARG B 296 ? ? -65.40  69.63   
15 1 ASP B 306 ? ? -93.86  -90.47  
16 1 TYR B 341 ? ? -93.61  38.79   
17 1 VAL B 407 ? ? -131.51 -60.35  
18 1 GLU B 491 ? ? -57.61  109.15  
19 1 ARG B 493 ? ? 80.47   3.21    
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 2   ? A GLY 1   
2  1 Y 1 A ARG 3   ? A ARG 2   
3  1 Y 1 A PRO 259 ? A PRO 258 
4  1 Y 1 A GLY 260 ? A GLY 259 
5  1 Y 1 A GLY 261 ? A GLY 260 
6  1 Y 1 A THR 262 ? A THR 261 
7  1 Y 1 A GLY 263 ? A GLY 262 
8  1 Y 1 A GLY 264 ? A GLY 263 
9  1 Y 1 A THR 543 ? A THR 542 
10 1 Y 1 B GLY 2   ? B GLY 1   
11 1 Y 1 B GLY 260 ? B GLY 259 
12 1 Y 1 B GLY 261 ? B GLY 260 
13 1 Y 1 B THR 543 ? B THR 542 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
C 2 NAG 1 C NAG 1 A NAG 601 n 
C 2 NAG 2 C NAG 2 A NAG 603 n 
C 2 FUC 3 C FUC 3 A FUC 602 n 
D 2 NAG 1 D NAG 1 B NAG 601 n 
D 2 NAG 2 D NAG 2 B NAG 603 n 
D 2 FUC 3 D FUC 3 B FUC 602 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
FUC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 LFucpa                         
FUC 'COMMON NAME'                         GMML     1.0 a-L-fucopyranose               
FUC 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-L-Fucp                       
FUC 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Fuc                            
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
_pdbx_entity_branch.entity_id   2 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 'DGlcpNAcb1-4[LFucpa1-6]DGlcpNAcb1-'                                         'Glycam Condensed Sequence' GMML       1.0   
2 2 'WURCS=2.0/2,3,2/[a2122h-1b_1-5_2*NCC/3=O][a1221m-1a_1-5]/1-1-2/a4-b1_a6-c1' WURCS                       PDB2Glycan 1.1.0 
3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}[(6+1)][a-L-Fucp]{}}}'        LINUCS                      PDB-CARE   ?     
# 
loop_
_pdbx_entity_branch_link.link_id 
_pdbx_entity_branch_link.entity_id 
_pdbx_entity_branch_link.entity_branch_list_num_1 
_pdbx_entity_branch_link.comp_id_1 
_pdbx_entity_branch_link.atom_id_1 
_pdbx_entity_branch_link.leaving_atom_id_1 
_pdbx_entity_branch_link.entity_branch_list_num_2 
_pdbx_entity_branch_link.comp_id_2 
_pdbx_entity_branch_link.atom_id_2 
_pdbx_entity_branch_link.leaving_atom_id_2 
_pdbx_entity_branch_link.value_order 
_pdbx_entity_branch_link.details 
1 2 2 NAG C1 O1 1 NAG O4 HO4 sing ? 
2 2 3 FUC C1 O1 1 NAG O6 HO6 sing ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 NAG 1 n 
2 NAG 2 n 
2 FUC 3 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'DIETHYL PHOSPHONATE'                         DEP 
4 1,2-ETHANEDIOL                                EDO 
5 2-acetamido-2-deoxy-beta-D-glucopyranose      NAG 
6 3,6,9,12,15,18,21-HEPTAOXATRICOSANE-1,23-DIOL PE8 
7 'NITRATE ION'                                 NO3 
8 water                                         HOH 
#