data_5HF6
# 
_entry.id   5HF6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5HF6         
WWPDB D_1000216488 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 5HF5 PDB . 
unspecified 5HF8 PDB . 
unspecified 5HF9 PDB . 
unspecified 5HFA PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5HF6 
_pdbx_database_status.recvd_initial_deposition_date   2016-01-06 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Franklin, M.F.' 1 
'Rudolph, M.J.'  2 
'Ginter, C.'     3 
'Cassidy, M.S.'  4 
'Cheung, J.'     5 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Proteins 
_citation.journal_id_ASTM           PSFGEY 
_citation.journal_id_CSD            0867 
_citation.journal_id_ISSN           1097-0134 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            84 
_citation.language                  ? 
_citation.page_first                1246 
_citation.page_last                 1256 
_citation.title                     
'Structures of paraoxon-inhibited human acetylcholinesterase reveal perturbations of the acyl loop and the dimer interface.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1002/prot.25073 
_citation.pdbx_database_id_PubMed   27191504 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Franklin, M.C.' 1 ? 
primary 'Rudolph, M.J.'  2 ? 
primary 'Ginter, C.'     3 ? 
primary 'Cassidy, M.S.'  4 ? 
primary 'Cheung, J.'     5 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5HF6 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     105.899 
_cell.length_a_esd                 ? 
_cell.length_b                     105.899 
_cell.length_b_esd                 ? 
_cell.length_c                     323.078 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        12 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5HF6 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Acetylcholinesterase 59447.105 2   3.1.1.7 none 'catalytic domain, UNP residues 33 to 574' ? 
2 branched    man 
'2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose' 570.542   2 
?       ?    ?                                          ? 
3 non-polymer syn 'ETHYL DIHYDROGEN PHOSPHATE' 126.048   2   ?       ?    ?                                          ? 
4 non-polymer syn 1,2-ETHANEDIOL 62.068    4   ?       ?    ?                                          ? 
5 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   1   ?       ?    ?                                          ? 
6 water       nat water 18.015    538 ?       ?    ?                                          ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        AChE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFE
GTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLAL
PGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGM
GEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDF
HGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDV
VGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWA
NFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFE
GTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLAL
PGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGM
GEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDF
HGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDV
VGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWA
NFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ARG n 
1 3   GLU n 
1 4   ASP n 
1 5   ALA n 
1 6   GLU n 
1 7   LEU n 
1 8   LEU n 
1 9   VAL n 
1 10  THR n 
1 11  VAL n 
1 12  ARG n 
1 13  GLY n 
1 14  GLY n 
1 15  ARG n 
1 16  LEU n 
1 17  ARG n 
1 18  GLY n 
1 19  ILE n 
1 20  ARG n 
1 21  LEU n 
1 22  LYS n 
1 23  THR n 
1 24  PRO n 
1 25  GLY n 
1 26  GLY n 
1 27  PRO n 
1 28  VAL n 
1 29  SER n 
1 30  ALA n 
1 31  PHE n 
1 32  LEU n 
1 33  GLY n 
1 34  ILE n 
1 35  PRO n 
1 36  PHE n 
1 37  ALA n 
1 38  GLU n 
1 39  PRO n 
1 40  PRO n 
1 41  MET n 
1 42  GLY n 
1 43  PRO n 
1 44  ARG n 
1 45  ARG n 
1 46  PHE n 
1 47  LEU n 
1 48  PRO n 
1 49  PRO n 
1 50  GLU n 
1 51  PRO n 
1 52  LYS n 
1 53  GLN n 
1 54  PRO n 
1 55  TRP n 
1 56  SER n 
1 57  GLY n 
1 58  VAL n 
1 59  VAL n 
1 60  ASP n 
1 61  ALA n 
1 62  THR n 
1 63  THR n 
1 64  PHE n 
1 65  GLN n 
1 66  SER n 
1 67  VAL n 
1 68  CYS n 
1 69  TYR n 
1 70  GLN n 
1 71  TYR n 
1 72  VAL n 
1 73  ASP n 
1 74  THR n 
1 75  LEU n 
1 76  TYR n 
1 77  PRO n 
1 78  GLY n 
1 79  PHE n 
1 80  GLU n 
1 81  GLY n 
1 82  THR n 
1 83  GLU n 
1 84  MET n 
1 85  TRP n 
1 86  ASN n 
1 87  PRO n 
1 88  ASN n 
1 89  ARG n 
1 90  GLU n 
1 91  LEU n 
1 92  SER n 
1 93  GLU n 
1 94  ASP n 
1 95  CYS n 
1 96  LEU n 
1 97  TYR n 
1 98  LEU n 
1 99  ASN n 
1 100 VAL n 
1 101 TRP n 
1 102 THR n 
1 103 PRO n 
1 104 TYR n 
1 105 PRO n 
1 106 ARG n 
1 107 PRO n 
1 108 THR n 
1 109 SER n 
1 110 PRO n 
1 111 THR n 
1 112 PRO n 
1 113 VAL n 
1 114 LEU n 
1 115 VAL n 
1 116 TRP n 
1 117 ILE n 
1 118 TYR n 
1 119 GLY n 
1 120 GLY n 
1 121 GLY n 
1 122 PHE n 
1 123 TYR n 
1 124 SER n 
1 125 GLY n 
1 126 ALA n 
1 127 SER n 
1 128 SER n 
1 129 LEU n 
1 130 ASP n 
1 131 VAL n 
1 132 TYR n 
1 133 ASP n 
1 134 GLY n 
1 135 ARG n 
1 136 PHE n 
1 137 LEU n 
1 138 VAL n 
1 139 GLN n 
1 140 ALA n 
1 141 GLU n 
1 142 ARG n 
1 143 THR n 
1 144 VAL n 
1 145 LEU n 
1 146 VAL n 
1 147 SER n 
1 148 MET n 
1 149 ASN n 
1 150 TYR n 
1 151 ARG n 
1 152 VAL n 
1 153 GLY n 
1 154 ALA n 
1 155 PHE n 
1 156 GLY n 
1 157 PHE n 
1 158 LEU n 
1 159 ALA n 
1 160 LEU n 
1 161 PRO n 
1 162 GLY n 
1 163 SER n 
1 164 ARG n 
1 165 GLU n 
1 166 ALA n 
1 167 PRO n 
1 168 GLY n 
1 169 ASN n 
1 170 VAL n 
1 171 GLY n 
1 172 LEU n 
1 173 LEU n 
1 174 ASP n 
1 175 GLN n 
1 176 ARG n 
1 177 LEU n 
1 178 ALA n 
1 179 LEU n 
1 180 GLN n 
1 181 TRP n 
1 182 VAL n 
1 183 GLN n 
1 184 GLU n 
1 185 ASN n 
1 186 VAL n 
1 187 ALA n 
1 188 ALA n 
1 189 PHE n 
1 190 GLY n 
1 191 GLY n 
1 192 ASP n 
1 193 PRO n 
1 194 THR n 
1 195 SER n 
1 196 VAL n 
1 197 THR n 
1 198 LEU n 
1 199 PHE n 
1 200 GLY n 
1 201 GLU n 
1 202 SER n 
1 203 ALA n 
1 204 GLY n 
1 205 ALA n 
1 206 ALA n 
1 207 SER n 
1 208 VAL n 
1 209 GLY n 
1 210 MET n 
1 211 HIS n 
1 212 LEU n 
1 213 LEU n 
1 214 SER n 
1 215 PRO n 
1 216 PRO n 
1 217 SER n 
1 218 ARG n 
1 219 GLY n 
1 220 LEU n 
1 221 PHE n 
1 222 HIS n 
1 223 ARG n 
1 224 ALA n 
1 225 VAL n 
1 226 LEU n 
1 227 GLN n 
1 228 SER n 
1 229 GLY n 
1 230 ALA n 
1 231 PRO n 
1 232 ASN n 
1 233 GLY n 
1 234 PRO n 
1 235 TRP n 
1 236 ALA n 
1 237 THR n 
1 238 VAL n 
1 239 GLY n 
1 240 MET n 
1 241 GLY n 
1 242 GLU n 
1 243 ALA n 
1 244 ARG n 
1 245 ARG n 
1 246 ARG n 
1 247 ALA n 
1 248 THR n 
1 249 GLN n 
1 250 LEU n 
1 251 ALA n 
1 252 HIS n 
1 253 LEU n 
1 254 VAL n 
1 255 GLY n 
1 256 CYS n 
1 257 PRO n 
1 258 PRO n 
1 259 GLY n 
1 260 GLY n 
1 261 THR n 
1 262 GLY n 
1 263 GLY n 
1 264 ASN n 
1 265 ASP n 
1 266 THR n 
1 267 GLU n 
1 268 LEU n 
1 269 VAL n 
1 270 ALA n 
1 271 CYS n 
1 272 LEU n 
1 273 ARG n 
1 274 THR n 
1 275 ARG n 
1 276 PRO n 
1 277 ALA n 
1 278 GLN n 
1 279 VAL n 
1 280 LEU n 
1 281 VAL n 
1 282 ASN n 
1 283 HIS n 
1 284 GLU n 
1 285 TRP n 
1 286 HIS n 
1 287 VAL n 
1 288 LEU n 
1 289 PRO n 
1 290 GLN n 
1 291 GLU n 
1 292 SER n 
1 293 VAL n 
1 294 PHE n 
1 295 ARG n 
1 296 PHE n 
1 297 SER n 
1 298 PHE n 
1 299 VAL n 
1 300 PRO n 
1 301 VAL n 
1 302 VAL n 
1 303 ASP n 
1 304 GLY n 
1 305 ASP n 
1 306 PHE n 
1 307 LEU n 
1 308 SER n 
1 309 ASP n 
1 310 THR n 
1 311 PRO n 
1 312 GLU n 
1 313 ALA n 
1 314 LEU n 
1 315 ILE n 
1 316 ASN n 
1 317 ALA n 
1 318 GLY n 
1 319 ASP n 
1 320 PHE n 
1 321 HIS n 
1 322 GLY n 
1 323 LEU n 
1 324 GLN n 
1 325 VAL n 
1 326 LEU n 
1 327 VAL n 
1 328 GLY n 
1 329 VAL n 
1 330 VAL n 
1 331 LYS n 
1 332 ASP n 
1 333 GLU n 
1 334 GLY n 
1 335 SER n 
1 336 TYR n 
1 337 PHE n 
1 338 LEU n 
1 339 VAL n 
1 340 TYR n 
1 341 GLY n 
1 342 ALA n 
1 343 PRO n 
1 344 GLY n 
1 345 PHE n 
1 346 SER n 
1 347 LYS n 
1 348 ASP n 
1 349 ASN n 
1 350 GLU n 
1 351 SER n 
1 352 LEU n 
1 353 ILE n 
1 354 SER n 
1 355 ARG n 
1 356 ALA n 
1 357 GLU n 
1 358 PHE n 
1 359 LEU n 
1 360 ALA n 
1 361 GLY n 
1 362 VAL n 
1 363 ARG n 
1 364 VAL n 
1 365 GLY n 
1 366 VAL n 
1 367 PRO n 
1 368 GLN n 
1 369 VAL n 
1 370 SER n 
1 371 ASP n 
1 372 LEU n 
1 373 ALA n 
1 374 ALA n 
1 375 GLU n 
1 376 ALA n 
1 377 VAL n 
1 378 VAL n 
1 379 LEU n 
1 380 HIS n 
1 381 TYR n 
1 382 THR n 
1 383 ASP n 
1 384 TRP n 
1 385 LEU n 
1 386 HIS n 
1 387 PRO n 
1 388 GLU n 
1 389 ASP n 
1 390 PRO n 
1 391 ALA n 
1 392 ARG n 
1 393 LEU n 
1 394 ARG n 
1 395 GLU n 
1 396 ALA n 
1 397 LEU n 
1 398 SER n 
1 399 ASP n 
1 400 VAL n 
1 401 VAL n 
1 402 GLY n 
1 403 ASP n 
1 404 HIS n 
1 405 ASN n 
1 406 VAL n 
1 407 VAL n 
1 408 CYS n 
1 409 PRO n 
1 410 VAL n 
1 411 ALA n 
1 412 GLN n 
1 413 LEU n 
1 414 ALA n 
1 415 GLY n 
1 416 ARG n 
1 417 LEU n 
1 418 ALA n 
1 419 ALA n 
1 420 GLN n 
1 421 GLY n 
1 422 ALA n 
1 423 ARG n 
1 424 VAL n 
1 425 TYR n 
1 426 ALA n 
1 427 TYR n 
1 428 VAL n 
1 429 PHE n 
1 430 GLU n 
1 431 HIS n 
1 432 ARG n 
1 433 ALA n 
1 434 SER n 
1 435 THR n 
1 436 LEU n 
1 437 SER n 
1 438 TRP n 
1 439 PRO n 
1 440 LEU n 
1 441 TRP n 
1 442 MET n 
1 443 GLY n 
1 444 VAL n 
1 445 PRO n 
1 446 HIS n 
1 447 GLY n 
1 448 TYR n 
1 449 GLU n 
1 450 ILE n 
1 451 GLU n 
1 452 PHE n 
1 453 ILE n 
1 454 PHE n 
1 455 GLY n 
1 456 ILE n 
1 457 PRO n 
1 458 LEU n 
1 459 ASP n 
1 460 PRO n 
1 461 SER n 
1 462 ARG n 
1 463 ASN n 
1 464 TYR n 
1 465 THR n 
1 466 ALA n 
1 467 GLU n 
1 468 GLU n 
1 469 LYS n 
1 470 ILE n 
1 471 PHE n 
1 472 ALA n 
1 473 GLN n 
1 474 ARG n 
1 475 LEU n 
1 476 MET n 
1 477 ARG n 
1 478 TYR n 
1 479 TRP n 
1 480 ALA n 
1 481 ASN n 
1 482 PHE n 
1 483 ALA n 
1 484 ARG n 
1 485 THR n 
1 486 GLY n 
1 487 ASP n 
1 488 PRO n 
1 489 ASN n 
1 490 GLU n 
1 491 PRO n 
1 492 ARG n 
1 493 ASP n 
1 494 PRO n 
1 495 LYS n 
1 496 ALA n 
1 497 PRO n 
1 498 GLN n 
1 499 TRP n 
1 500 PRO n 
1 501 PRO n 
1 502 TYR n 
1 503 THR n 
1 504 ALA n 
1 505 GLY n 
1 506 ALA n 
1 507 GLN n 
1 508 GLN n 
1 509 TYR n 
1 510 VAL n 
1 511 SER n 
1 512 LEU n 
1 513 ASP n 
1 514 LEU n 
1 515 ARG n 
1 516 PRO n 
1 517 LEU n 
1 518 GLU n 
1 519 VAL n 
1 520 ARG n 
1 521 ARG n 
1 522 GLY n 
1 523 LEU n 
1 524 ARG n 
1 525 ALA n 
1 526 GLN n 
1 527 ALA n 
1 528 CYS n 
1 529 ALA n 
1 530 PHE n 
1 531 TRP n 
1 532 ASN n 
1 533 ARG n 
1 534 PHE n 
1 535 LEU n 
1 536 PRO n 
1 537 LYS n 
1 538 LEU n 
1 539 LEU n 
1 540 SER n 
1 541 ALA n 
1 542 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   542 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ACHE 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            HEK293 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_HUMAN 
_struct_ref.pdbx_db_accession          P22303 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFE
GTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLAL
PGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGM
GEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDF
HGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDV
VGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWA
NFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT
;
_struct_ref.pdbx_align_begin           33 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5HF6 A 1 ? 542 ? P22303 33 ? 574 ? 2 543 
2 1 5HF6 B 1 ? 542 ? P22303 33 ? 574 ? 2 543 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                  ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE                                 ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                               ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                          ?                 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'           y CYSTEINE                                 ?                 'C3 H7 N O2 S'   121.158 
EDO non-polymer                   . 1,2-ETHANEDIOL                           'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
EFS non-polymer                   . 'ETHYL DIHYDROGEN PHOSPHATE'             ?                 'C2 H7 O4 P'     126.048 
FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose                     ?                 'C6 H12 O5'      164.156 
GLN 'L-peptide linking'           y GLUTAMINE                                ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                          ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                                  ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE                                ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                                    ?                 'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                               ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE                                  ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                                   ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'           y METHIONINE                               ?                 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose ?                 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'           y PHENYLALANINE                            ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE                                  ?                 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                                   ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE                                ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                               ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                                 ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                                   ?                 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5HF6 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            4.41 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         72.11 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '15 - 18% PEG3350, 0.2M potassium nitrate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-05-29 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.075 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'NSLS BEAMLINE X29A' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.075 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X29A 
_diffrn_source.pdbx_synchrotron_site       NSLS 
# 
_reflns.B_iso_Wilson_estimate            46.970 
_reflns.entry_id                         5HF6 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.300 
_reflns.d_resolution_low                 100.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       94357 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.900 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  10.100 
_reflns.pdbx_Rmerge_I_obs                0.105 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         20.286 
_reflns.pdbx_netI_over_sigmaI            5.700 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 0.992 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.110 
_reflns.pdbx_Rpim_I_all                  0.041 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         952487 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
2.300 2.340   ? ? ? ? ? 4498 ? 98.000  ? ? ? ? ?     ? ? ? ? ? ? ? ? 6.200  ? 0.703 ? ? ?     0.596 0 1  1 0.626 ? 
2.340 2.380   ? ? ? ? ? 4651 ? 99.900  ? ? ? ? ?     ? ? ? ? ? ? ? ? 7.900  ? 0.703 ? ? ?     0.552 0 2  1 0.702 ? 
2.380 2.430   ? ? ? ? ? 4667 ? 100.000 ? ? ? ? ?     ? ? ? ? ? ? ? ? 9.800  ? 0.714 ? ? ?     0.477 0 3  1 0.813 ? 
2.430 2.480   ? ? ? ? ? 4701 ? 100.000 ? ? ? ? ?     ? ? ? ? ? ? ? ? 10.400 ? 0.736 ? ? ?     0.413 0 4  1 0.858 ? 
2.480 2.530   ? ? ? ? ? 4631 ? 100.000 ? ? ? ? ?     ? ? ? ? ? ? ? ? 10.600 ? 0.760 ? ? ?     0.363 0 5  1 0.862 ? 
2.530 2.590   ? ? ? ? ? 4690 ? 100.000 ? ? ? ? 0.896 ? ? ? ? ? ? ? ? 10.600 ? 0.783 ? ? 0.942 0.289 0 6  1 0.899 ? 
2.590 2.660   ? ? ? ? ? 4641 ? 100.000 ? ? ? ? 0.758 ? ? ? ? ? ? ? ? 10.600 ? 0.814 ? ? 0.796 0.244 0 7  1 0.922 ? 
2.660 2.730   ? ? ? ? ? 4677 ? 100.000 ? ? ? ? 0.624 ? ? ? ? ? ? ? ? 10.500 ? 0.842 ? ? 0.656 0.202 0 8  1 0.952 ? 
2.730 2.810   ? ? ? ? ? 4680 ? 100.000 ? ? ? ? 0.525 ? ? ? ? ? ? ? ? 10.500 ? 0.865 ? ? 0.552 0.170 0 9  1 0.957 ? 
2.810 2.900   ? ? ? ? ? 4683 ? 100.000 ? ? ? ? 0.402 ? ? ? ? ? ? ? ? 10.400 ? 0.872 ? ? 0.423 0.130 0 10 1 0.972 ? 
2.900 3.000   ? ? ? ? ? 4702 ? 100.000 ? ? ? ? 0.309 ? ? ? ? ? ? ? ? 10.400 ? 0.876 ? ? 0.325 0.100 0 11 1 0.986 ? 
3.000 3.120   ? ? ? ? ? 4707 ? 100.000 ? ? ? ? 0.226 ? ? ? ? ? ? ? ? 10.500 ? 0.891 ? ? 0.238 0.073 0 12 1 0.992 ? 
3.120 3.260   ? ? ? ? ? 4707 ? 100.000 ? ? ? ? 0.188 ? ? ? ? ? ? ? ? 10.500 ? 0.930 ? ? 0.197 0.061 0 13 1 0.992 ? 
3.260 3.440   ? ? ? ? ? 4710 ? 100.000 ? ? ? ? 0.135 ? ? ? ? ? ? ? ? 10.500 ? 0.994 ? ? 0.142 0.044 0 14 1 0.996 ? 
3.440 3.650   ? ? ? ? ? 4754 ? 100.000 ? ? ? ? 0.102 ? ? ? ? ? ? ? ? 10.500 ? 1.075 ? ? 0.107 0.033 0 15 1 0.997 ? 
3.650 3.930   ? ? ? ? ? 4734 ? 100.000 ? ? ? ? 0.080 ? ? ? ? ? ? ? ? 10.500 ? 1.152 ? ? 0.084 0.026 0 16 1 0.998 ? 
3.930 4.330   ? ? ? ? ? 4755 ? 100.000 ? ? ? ? 0.067 ? ? ? ? ? ? ? ? 10.500 ? 1.332 ? ? 0.071 0.022 0 17 1 0.998 ? 
4.330 4.960   ? ? ? ? ? 4811 ? 100.000 ? ? ? ? 0.064 ? ? ? ? ? ? ? ? 10.400 ? 1.647 ? ? 0.067 0.021 0 18 1 0.998 ? 
4.960 6.240   ? ? ? ? ? 4867 ? 100.000 ? ? ? ? 0.059 ? ? ? ? ? ? ? ? 10.300 ? 1.423 ? ? 0.062 0.019 0 19 1 0.998 ? 
6.240 100.000 ? ? ? ? ? 5091 ? 99.600  ? ? ? ? 0.042 ? ? ? ? ? ? ? ? 10.100 ? 1.455 ? ? 0.044 0.014 0 20 1 0.999 ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                134.190 
_refine.B_iso_mean                               54.7337 
_refine.B_iso_min                                26.010 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5HF6 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.3000 
_refine.ls_d_res_low                             47.5170 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     94201 
_refine.ls_number_reflns_R_free                  4734 
_refine.ls_number_reflns_R_work                  89467 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.8200 
_refine.ls_percent_reflns_R_free                 5.0300 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1760 
_refine.ls_R_factor_R_free                       0.2064 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1744 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.350 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4EY4 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 23.2900 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.2600 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.3000 
_refine_hist.d_res_low                        47.5170 
_refine_hist.pdbx_number_atoms_ligand         118 
_refine_hist.number_atoms_solvent             538 
_refine_hist.number_atoms_total               8953 
_refine_hist.pdbx_number_residues_total       1066 
_refine_hist.pdbx_B_iso_mean_ligand           87.35 
_refine_hist.pdbx_B_iso_mean_solvent          57.15 
_refine_hist.pdbx_number_atoms_protein        8297 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.009  ? 8757  ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.197  ? 11977 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.049  ? 1288  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.007  ? 1579  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 13.883 ? 3154  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.2997 2.3258  2960 . 162 2798 97.0000  . . . 0.3862 . 0.3243 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.3258 2.3531  3127 . 161 2966 99.0000  . . . 0.3550 . 0.3077 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.3531 2.3818  3039 . 167 2872 100.0000 . . . 0.2885 . 0.2790 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.3818 2.4120  3150 . 146 3004 100.0000 . . . 0.3313 . 0.2672 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.4120 2.4437  3081 . 164 2917 100.0000 . . . 0.3182 . 0.2556 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.4437 2.4772  3115 . 151 2964 100.0000 . . . 0.2836 . 0.2499 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.4772 2.5126  3110 . 180 2930 100.0000 . . . 0.2742 . 0.2352 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.5126 2.5501  3070 . 151 2919 100.0000 . . . 0.2724 . 0.2286 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.5501 2.5899  3135 . 142 2993 100.0000 . . . 0.2666 . 0.2258 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.5899 2.6324  3089 . 174 2915 100.0000 . . . 0.2766 . 0.2293 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.6324 2.6778  3103 . 161 2942 100.0000 . . . 0.2825 . 0.2204 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.6778 2.7265  3120 . 153 2967 100.0000 . . . 0.2565 . 0.2155 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.7265 2.7789  3171 . 151 3020 100.0000 . . . 0.2987 . 0.2136 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.7789 2.8356  3060 . 170 2890 100.0000 . . . 0.2692 . 0.2130 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.8356 2.8973  3110 . 149 2961 100.0000 . . . 0.2338 . 0.2017 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.8973 2.9647  3144 . 136 3008 100.0000 . . . 0.2642 . 0.1954 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.9647 3.0388  3137 . 161 2976 100.0000 . . . 0.2222 . 0.1845 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.0388 3.1209  3128 . 153 2975 100.0000 . . . 0.2526 . 0.1796 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.1209 3.2127  3146 . 160 2986 100.0000 . . . 0.2213 . 0.1830 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.2127 3.3164  3135 . 142 2993 100.0000 . . . 0.2195 . 0.1834 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.3164 3.4349  3120 . 169 2951 100.0000 . . . 0.2141 . 0.1772 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.4349 3.5724  3155 . 162 2993 100.0000 . . . 0.2007 . 0.1758 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.5724 3.7349  3170 . 148 3022 100.0000 . . . 0.2037 . 0.1626 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.7349 3.9318  3154 . 169 2985 100.0000 . . . 0.1810 . 0.1462 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.9318 4.1780  3160 . 141 3019 100.0000 . . . 0.1853 . 0.1399 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 4.1780 4.5003  3175 . 176 2999 100.0000 . . . 0.1393 . 0.1261 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 4.5003 4.9528  3217 . 147 3070 100.0000 . . . 0.1246 . 0.1208 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 4.9528 5.6684  3215 . 162 3053 100.0000 . . . 0.1622 . 0.1442 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 5.6684 7.1377  3284 . 173 3111 100.0000 . . . 0.1732 . 0.1642 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 7.1377 47.5268 3421 . 153 3268 100.0000 . . . 0.1899 . 0.1744 . . . . . . 30 . . . 
# 
_struct.entry_id                     5HF6 
_struct.title                        'Crystal structure of human acetylcholinesterase in complex with paraoxon in the aged state' 
_struct.pdbx_descriptor              'Acetylcholinesterase (E.C.3.1.1.7)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5HF6 
_struct_keywords.text            'acetylcholinesterase, hydrolase' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
H N N 5 ? 
I N N 3 ? 
J N N 4 ? 
K N N 4 ? 
L N N 6 ? 
M N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 4   ? GLU A 6   ? ASP A 5   GLU A 7   5 ? 3  
HELX_P HELX_P2  AA2 MET A 41  ? ARG A 45  ? MET A 42  ARG A 46  5 ? 5  
HELX_P HELX_P3  AA3 PHE A 79  ? MET A 84  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P4  AA4 LEU A 129 ? ASP A 133 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P5  AA5 GLY A 134 ? ARG A 142 ? GLY A 135 ARG A 143 1 ? 9  
HELX_P HELX_P6  AA6 VAL A 152 ? LEU A 158 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P7  AA7 ASN A 169 ? VAL A 186 ? ASN A 170 VAL A 187 1 ? 18 
HELX_P HELX_P8  AA8 ALA A 187 ? PHE A 189 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P9  AA9 SER A 202 ? LEU A 213 ? SER A 203 LEU A 214 1 ? 12 
HELX_P HELX_P10 AB1 SER A 214 ? GLY A 219 ? SER A 215 GLY A 220 1 ? 6  
HELX_P HELX_P11 AB2 MET A 240 ? VAL A 254 ? MET A 241 VAL A 255 1 ? 15 
HELX_P HELX_P12 AB3 ASP A 265 ? ARG A 273 ? ASP A 266 ARG A 274 1 ? 9  
HELX_P HELX_P13 AB4 PRO A 276 ? GLU A 284 ? PRO A 277 GLU A 285 1 ? 9  
HELX_P HELX_P14 AB5 TRP A 285 ? LEU A 288 ? TRP A 286 LEU A 289 5 ? 4  
HELX_P HELX_P15 AB6 THR A 310 ? ALA A 317 ? THR A 311 ALA A 318 1 ? 8  
HELX_P HELX_P16 AB7 GLY A 334 ? VAL A 339 ? GLY A 335 VAL A 340 1 ? 6  
HELX_P HELX_P17 AB8 SER A 354 ? VAL A 366 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P18 AB9 SER A 370 ? THR A 382 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P19 AC1 ASP A 389 ? VAL A 406 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P20 AC2 VAL A 406 ? ALA A 419 ? VAL A 407 ALA A 420 1 ? 14 
HELX_P HELX_P21 AC3 PRO A 439 ? GLY A 443 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P22 AC4 GLU A 449 ? PHE A 454 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P23 AC5 GLY A 455 ? ASP A 459 ? GLY A 456 ASP A 460 5 ? 5  
HELX_P HELX_P24 AC6 THR A 465 ? GLY A 486 ? THR A 466 GLY A 487 1 ? 22 
HELX_P HELX_P25 AC7 ARG A 524 ? ARG A 533 ? ARG A 525 ARG A 534 1 ? 10 
HELX_P HELX_P26 AC8 ARG A 533 ? SER A 540 ? ARG A 534 SER A 541 1 ? 8  
HELX_P HELX_P27 AC9 ASP B 4   ? GLU B 6   ? ASP B 5   GLU B 7   5 ? 3  
HELX_P HELX_P28 AD1 MET B 41  ? ARG B 45  ? MET B 42  ARG B 46  5 ? 5  
HELX_P HELX_P29 AD2 PHE B 79  ? MET B 84  ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P30 AD3 LEU B 129 ? ASP B 133 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P31 AD4 GLY B 134 ? ARG B 142 ? GLY B 135 ARG B 143 1 ? 9  
HELX_P HELX_P32 AD5 VAL B 152 ? LEU B 158 ? VAL B 153 LEU B 159 1 ? 7  
HELX_P HELX_P33 AD6 ASN B 169 ? VAL B 186 ? ASN B 170 VAL B 187 1 ? 18 
HELX_P HELX_P34 AD7 ALA B 187 ? PHE B 189 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P35 AD8 SER B 202 ? SER B 214 ? SER B 203 SER B 215 1 ? 13 
HELX_P HELX_P36 AD9 SER B 214 ? GLY B 219 ? SER B 215 GLY B 220 1 ? 6  
HELX_P HELX_P37 AE1 MET B 240 ? VAL B 254 ? MET B 241 VAL B 255 1 ? 15 
HELX_P HELX_P38 AE2 ASN B 264 ? THR B 274 ? ASN B 265 THR B 275 1 ? 11 
HELX_P HELX_P39 AE3 PRO B 276 ? GLU B 284 ? PRO B 277 GLU B 285 1 ? 9  
HELX_P HELX_P40 AE4 TRP B 285 ? LEU B 288 ? TRP B 286 LEU B 289 5 ? 4  
HELX_P HELX_P41 AE5 THR B 310 ? GLY B 318 ? THR B 311 GLY B 319 1 ? 9  
HELX_P HELX_P42 AE6 GLY B 334 ? VAL B 339 ? GLY B 335 VAL B 340 1 ? 6  
HELX_P HELX_P43 AE7 SER B 354 ? VAL B 366 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P44 AE8 SER B 370 ? THR B 382 ? SER B 371 THR B 383 1 ? 13 
HELX_P HELX_P45 AE9 ASP B 389 ? VAL B 406 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P46 AF1 VAL B 406 ? GLN B 420 ? VAL B 407 GLN B 421 1 ? 15 
HELX_P HELX_P47 AF2 PRO B 439 ? GLY B 443 ? PRO B 440 GLY B 444 5 ? 5  
HELX_P HELX_P48 AF3 GLU B 449 ? PHE B 454 ? GLU B 450 PHE B 455 1 ? 6  
HELX_P HELX_P49 AF4 GLY B 455 ? ASP B 459 ? GLY B 456 ASP B 460 5 ? 5  
HELX_P HELX_P50 AF5 THR B 465 ? GLY B 486 ? THR B 466 GLY B 487 1 ? 22 
HELX_P HELX_P51 AF6 ARG B 524 ? ARG B 533 ? ARG B 525 ARG B 534 1 ? 10 
HELX_P HELX_P52 AF7 PHE B 534 ? ALA B 541 ? PHE B 535 ALA B 542 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 68  SG  ? ? ? 1_555 A CYS 95  SG ? ? A CYS 69  A CYS 96  1_555 ? ? ? ? ? ? ? 2.062 ? ?               
disulf2 disulf ?    ? A CYS 256 SG  ? ? ? 1_555 A CYS 271 SG ? ? A CYS 257 A CYS 272 1_555 ? ? ? ? ? ? ? 2.054 ? ?               
disulf3 disulf ?    ? A CYS 408 SG  ? ? ? 1_555 A CYS 528 SG ? ? A CYS 409 A CYS 529 1_555 ? ? ? ? ? ? ? 2.047 ? ?               
disulf4 disulf ?    ? B CYS 68  SG  ? ? ? 1_555 B CYS 95  SG ? ? B CYS 69  B CYS 96  1_555 ? ? ? ? ? ? ? 2.068 ? ?               
disulf5 disulf ?    ? B CYS 256 SG  ? ? ? 1_555 B CYS 271 SG ? ? B CYS 257 B CYS 272 1_555 ? ? ? ? ? ? ? 2.059 ? ?               
disulf6 disulf ?    ? B CYS 408 SG  ? ? ? 1_555 B CYS 528 SG ? ? B CYS 409 B CYS 529 1_555 ? ? ? ? ? ? ? 2.046 ? ?               
covale1 covale none ? A SER 202 OG  ? ? ? 1_555 E EFS .   P  ? ? A SER 203 A EFS 604 1_555 ? ? ? ? ? ? ? 1.564 ? ?               
covale2 covale one  ? A ASN 349 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 350 C NAG 1   1_555 ? ? ? ? ? ? ? 1.447 ? N-Glycosylation 
covale3 covale none ? B SER 202 OG  ? ? ? 1_555 I EFS .   P  ? ? B SER 203 B EFS 605 1_555 ? ? ? ? ? ? ? 1.557 ? ?               
covale4 covale one  ? B ASN 264 ND2 ? ? ? 1_555 H NAG .   C1 ? ? B ASN 265 B NAG 604 1_555 ? ? ? ? ? ? ? 1.441 ? N-Glycosylation 
covale5 covale one  ? B ASN 349 ND2 ? ? ? 1_555 D NAG .   C1 ? ? B ASN 350 D NAG 1   1_555 ? ? ? ? ? ? ? 1.449 ? N-Glycosylation 
covale6 covale both ? C NAG .   O4  ? ? ? 1_555 C NAG .   C1 ? ? C NAG 1   C NAG 2   1_555 ? ? ? ? ? ? ? 1.441 ? ?               
covale7 covale one  ? C NAG .   O6  ? ? ? 1_555 C FUC .   C1 ? ? C NAG 1   C FUC 3   1_555 ? ? ? ? ? ? ? 1.452 ? ?               
covale8 covale both ? D NAG .   O4  ? ? ? 1_555 D NAG .   C1 ? ? D NAG 1   D NAG 2   1_555 ? ? ? ? ? ? ? 1.451 ? ?               
covale9 covale one  ? D NAG .   O6  ? ? ? 1_555 D FUC .   C1 ? ? D NAG 1   D FUC 3   1_555 ? ? ? ? ? ? ? 1.453 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 104 A . ? TYR 105 A PRO 105 A ? PRO 106 A 1 -3.45 
2 TYR 104 B . ? TYR 105 B PRO 105 B ? PRO 106 B 1 6.94  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3  ? 
AA2 ? 11 ? 
AA3 ? 2  ? 
AA4 ? 3  ? 
AA5 ? 11 ? 
AA6 ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? parallel      
AA2 1  2  ? anti-parallel 
AA2 2  3  ? anti-parallel 
AA2 3  4  ? anti-parallel 
AA2 4  5  ? parallel      
AA2 5  6  ? parallel      
AA2 6  7  ? parallel      
AA2 7  8  ? parallel      
AA2 8  9  ? parallel      
AA2 9  10 ? parallel      
AA2 10 11 ? anti-parallel 
AA3 1  2  ? parallel      
AA4 1  2  ? anti-parallel 
AA4 2  3  ? parallel      
AA5 1  2  ? anti-parallel 
AA5 2  3  ? anti-parallel 
AA5 3  4  ? anti-parallel 
AA5 4  5  ? parallel      
AA5 5  6  ? parallel      
AA5 6  7  ? parallel      
AA5 7  8  ? parallel      
AA5 8  9  ? parallel      
AA5 9  10 ? parallel      
AA5 10 11 ? anti-parallel 
AA6 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  LEU A 8   ? VAL A 11  ? LEU A 9   VAL A 12  
AA1 2  GLY A 14  ? ARG A 17  ? GLY A 15  ARG A 18  
AA1 3  VAL A 58  ? ASP A 60  ? VAL A 59  ASP A 61  
AA2 1  ILE A 19  ? LEU A 21  ? ILE A 20  LEU A 22  
AA2 2  VAL A 28  ? PRO A 35  ? VAL A 29  PRO A 36  
AA2 3  TYR A 97  ? PRO A 103 ? TYR A 98  PRO A 104 
AA2 4  VAL A 144 ? MET A 148 ? VAL A 145 MET A 149 
AA2 5  THR A 111 ? ILE A 117 ? THR A 112 ILE A 118 
AA2 6  GLY A 191 ? GLU A 201 ? GLY A 192 GLU A 202 
AA2 7  ARG A 223 ? GLN A 227 ? ARG A 224 GLN A 228 
AA2 8  GLN A 324 ? VAL A 330 ? GLN A 325 VAL A 331 
AA2 9  ARG A 423 ? PHE A 429 ? ARG A 424 PHE A 430 
AA2 10 GLN A 508 ? LEU A 512 ? GLN A 509 LEU A 513 
AA2 11 GLU A 518 ? ARG A 521 ? GLU A 519 ARG A 522 
AA3 1  VAL A 238 ? GLY A 239 ? VAL A 239 GLY A 240 
AA3 2  VAL A 301 ? VAL A 302 ? VAL A 302 VAL A 303 
AA4 1  LEU B 8   ? VAL B 11  ? LEU B 9   VAL B 12  
AA4 2  GLY B 14  ? ARG B 17  ? GLY B 15  ARG B 18  
AA4 3  VAL B 58  ? ASP B 60  ? VAL B 59  ASP B 61  
AA5 1  ILE B 19  ? THR B 23  ? ILE B 20  THR B 24  
AA5 2  GLY B 26  ? PRO B 35  ? GLY B 27  PRO B 36  
AA5 3  TYR B 97  ? PRO B 103 ? TYR B 98  PRO B 104 
AA5 4  VAL B 144 ? MET B 148 ? VAL B 145 MET B 149 
AA5 5  THR B 111 ? ILE B 117 ? THR B 112 ILE B 118 
AA5 6  GLY B 191 ? GLU B 201 ? GLY B 192 GLU B 202 
AA5 7  ARG B 223 ? GLN B 227 ? ARG B 224 GLN B 228 
AA5 8  GLN B 324 ? VAL B 330 ? GLN B 325 VAL B 331 
AA5 9  ARG B 423 ? PHE B 429 ? ARG B 424 PHE B 430 
AA5 10 GLN B 508 ? LEU B 512 ? GLN B 509 LEU B 513 
AA5 11 GLU B 518 ? ARG B 521 ? GLU B 519 ARG B 522 
AA6 1  VAL B 238 ? GLY B 239 ? VAL B 239 GLY B 240 
AA6 2  VAL B 301 ? VAL B 302 ? VAL B 302 VAL B 303 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  N VAL A 11  ? N VAL A 12  O GLY A 14  ? O GLY A 15  
AA1 2  3  N ARG A 15  ? N ARG A 16  O VAL A 59  ? O VAL A 60  
AA2 1  2  N ILE A 19  ? N ILE A 20  O ALA A 30  ? O ALA A 31  
AA2 2  3  N SER A 29  ? N SER A 30  O THR A 102 ? O THR A 103 
AA2 3  4  N TRP A 101 ? N TRP A 102 O LEU A 145 ? O LEU A 146 
AA2 4  5  O VAL A 144 ? O VAL A 145 N LEU A 114 ? N LEU A 115 
AA2 5  6  N VAL A 115 ? N VAL A 116 O THR A 197 ? O THR A 198 
AA2 6  7  N LEU A 198 ? N LEU A 199 O VAL A 225 ? O VAL A 226 
AA2 7  8  N LEU A 226 ? N LEU A 227 O LEU A 326 ? O LEU A 327 
AA2 8  9  N VAL A 329 ? N VAL A 330 O PHE A 429 ? O PHE A 430 
AA2 9  10 N VAL A 428 ? N VAL A 429 O LEU A 512 ? O LEU A 513 
AA2 10 11 N TYR A 509 ? N TYR A 510 O ARG A 520 ? O ARG A 521 
AA3 1  2  N VAL A 238 ? N VAL A 239 O VAL A 302 ? O VAL A 303 
AA4 1  2  N VAL B 9   ? N VAL B 10  O LEU B 16  ? O LEU B 17  
AA4 2  3  N ARG B 15  ? N ARG B 16  O VAL B 59  ? O VAL B 60  
AA5 1  2  N LEU B 21  ? N LEU B 22  O VAL B 28  ? O VAL B 29  
AA5 2  3  N PHE B 31  ? N PHE B 32  O VAL B 100 ? O VAL B 101 
AA5 3  4  N ASN B 99  ? N ASN B 100 O SER B 147 ? O SER B 148 
AA5 4  5  O VAL B 146 ? O VAL B 147 N LEU B 114 ? N LEU B 115 
AA5 5  6  N THR B 111 ? N THR B 112 O ASP B 192 ? O ASP B 193 
AA5 6  7  N GLY B 200 ? N GLY B 201 O GLN B 227 ? O GLN B 228 
AA5 7  8  N LEU B 226 ? N LEU B 227 O LEU B 326 ? O LEU B 327 
AA5 8  9  N VAL B 327 ? N VAL B 328 O TYR B 425 ? O TYR B 426 
AA5 9  10 N VAL B 428 ? N VAL B 429 O LEU B 512 ? O LEU B 513 
AA5 10 11 N TYR B 509 ? N TYR B 510 O ARG B 520 ? O ARG B 521 
AA6 1  2  N VAL B 238 ? N VAL B 239 O VAL B 302 ? O VAL B 303 
# 
_atom_sites.entry_id                    5HF6 
_atom_sites.fract_transf_matrix[1][1]   0.009443 
_atom_sites.fract_transf_matrix[1][2]   0.005452 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010904 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003095 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 4   ? 2.919   -35.872 66.560  1.00 62.26  ? 5   ASP A N   1 
ATOM   2    C CA  . ASP A 1 4   ? 3.867   -36.452 65.605  1.00 71.24  ? 5   ASP A CA  1 
ATOM   3    C C   . ASP A 1 4   ? 4.400   -35.403 64.618  1.00 65.74  ? 5   ASP A C   1 
ATOM   4    O O   . ASP A 1 4   ? 3.703   -35.020 63.686  1.00 61.65  ? 5   ASP A O   1 
ATOM   5    C CB  . ASP A 1 4   ? 3.215   -37.605 64.838  1.00 58.15  ? 5   ASP A CB  1 
ATOM   6    C CG  . ASP A 1 4   ? 4.230   -38.467 64.092  1.00 69.14  ? 5   ASP A CG  1 
ATOM   7    O OD1 . ASP A 1 4   ? 5.385   -38.012 63.900  1.00 67.60  ? 5   ASP A OD1 1 
ATOM   8    O OD2 . ASP A 1 4   ? 3.868   -39.604 63.690  1.00 62.54  ? 5   ASP A OD2 1 
ATOM   9    N N   . ALA A 1 5   ? 5.643   -34.966 64.820  1.00 64.69  ? 6   ALA A N   1 
ATOM   10   C CA  . ALA A 1 5   ? 6.227   -33.884 64.030  1.00 65.20  ? 6   ALA A CA  1 
ATOM   11   C C   . ALA A 1 5   ? 6.399   -34.256 62.563  1.00 63.91  ? 6   ALA A C   1 
ATOM   12   O O   . ALA A 1 5   ? 6.422   -33.373 61.706  1.00 71.74  ? 6   ALA A O   1 
ATOM   13   C CB  . ALA A 1 5   ? 7.572   -33.465 64.604  1.00 45.77  ? 6   ALA A CB  1 
ATOM   14   N N   . GLU A 1 6   ? 6.533   -35.549 62.277  1.00 65.20  ? 7   GLU A N   1 
ATOM   15   C CA  . GLU A 1 6   ? 6.730   -35.999 60.901  1.00 62.40  ? 7   GLU A CA  1 
ATOM   16   C C   . GLU A 1 6   ? 5.536   -35.619 60.028  1.00 60.72  ? 7   GLU A C   1 
ATOM   17   O O   . GLU A 1 6   ? 5.654   -35.419 58.814  1.00 60.06  ? 7   GLU A O   1 
ATOM   18   C CB  . GLU A 1 6   ? 6.961   -37.504 60.865  1.00 58.44  ? 7   GLU A CB  1 
ATOM   19   C CG  . GLU A 1 6   ? 8.263   -37.931 61.534  1.00 64.47  ? 7   GLU A CG  1 
ATOM   20   C CD  . GLU A 1 6   ? 9.508   -37.351 60.858  1.00 84.06  ? 7   GLU A CD  1 
ATOM   21   O OE1 . GLU A 1 6   ? 9.494   -37.107 59.627  1.00 74.01  ? 7   GLU A OE1 1 
ATOM   22   O OE2 . GLU A 1 6   ? 10.515  -37.138 61.571  1.00 94.84  ? 7   GLU A OE2 1 
ATOM   23   N N   . LEU A 1 7   ? 4.390   -35.487 60.675  1.00 52.25  ? 8   LEU A N   1 
ATOM   24   C CA  . LEU A 1 7   ? 3.142   -35.184 60.002  1.00 52.76  ? 8   LEU A CA  1 
ATOM   25   C C   . LEU A 1 7   ? 2.810   -33.697 59.973  1.00 53.07  ? 8   LEU A C   1 
ATOM   26   O O   . LEU A 1 7   ? 1.708   -33.307 59.582  1.00 54.56  ? 8   LEU A O   1 
ATOM   27   C CB  . LEU A 1 7   ? 2.011   -35.964 60.676  1.00 45.83  ? 8   LEU A CB  1 
ATOM   28   C CG  . LEU A 1 7   ? 2.280   -37.474 60.639  1.00 54.15  ? 8   LEU A CG  1 
ATOM   29   C CD1 . LEU A 1 7   ? 1.080   -38.240 61.176  1.00 45.53  ? 8   LEU A CD1 1 
ATOM   30   C CD2 . LEU A 1 7   ? 2.671   -37.954 59.195  1.00 50.32  ? 8   LEU A CD2 1 
ATOM   31   N N   . LEU A 1 8   ? 3.757   -32.862 60.384  1.00 54.02  ? 9   LEU A N   1 
ATOM   32   C CA  . LEU A 1 8   ? 3.532   -31.424 60.364  1.00 47.86  ? 9   LEU A CA  1 
ATOM   33   C C   . LEU A 1 8   ? 4.509   -30.819 59.401  1.00 49.88  ? 9   LEU A C   1 
ATOM   34   O O   . LEU A 1 8   ? 5.708   -31.084 59.469  1.00 50.24  ? 9   LEU A O   1 
ATOM   35   C CB  . LEU A 1 8   ? 3.691   -30.812 61.759  1.00 48.29  ? 9   LEU A CB  1 
ATOM   36   C CG  . LEU A 1 8   ? 2.653   -31.246 62.792  1.00 58.54  ? 9   LEU A CG  1 
ATOM   37   C CD1 . LEU A 1 8   ? 2.877   -30.539 64.159  1.00 54.72  ? 9   LEU A CD1 1 
ATOM   38   C CD2 . LEU A 1 8   ? 1.231   -31.018 62.285  1.00 43.51  ? 9   LEU A CD2 1 
ATOM   39   N N   . VAL A 1 9   ? 3.991   -30.038 58.464  1.00 50.88  ? 10  VAL A N   1 
ATOM   40   C CA  . VAL A 1 9   ? 4.818   -29.473 57.408  1.00 45.68  ? 10  VAL A CA  1 
ATOM   41   C C   . VAL A 1 9   ? 4.344   -28.065 57.151  1.00 45.61  ? 10  VAL A C   1 
ATOM   42   O O   . VAL A 1 9   ? 3.141   -27.782 57.200  1.00 45.80  ? 10  VAL A O   1 
ATOM   43   C CB  . VAL A 1 9   ? 4.743   -30.306 56.081  1.00 48.61  ? 10  VAL A CB  1 
ATOM   44   C CG1 . VAL A 1 9   ? 5.574   -29.678 54.997  1.00 46.06  ? 10  VAL A CG1 1 
ATOM   45   C CG2 . VAL A 1 9   ? 5.211   -31.717 56.314  1.00 53.08  ? 10  VAL A CG2 1 
ATOM   46   N N   . THR A 1 10  ? 5.280   -27.176 56.870  1.00 47.18  ? 11  THR A N   1 
ATOM   47   C CA  . THR A 1 10  ? 4.918   -25.824 56.500  1.00 48.35  ? 11  THR A CA  1 
ATOM   48   C C   . THR A 1 10  ? 5.343   -25.582 55.049  1.00 45.58  ? 11  THR A C   1 
ATOM   49   O O   . THR A 1 10  ? 6.500   -25.804 54.684  1.00 42.83  ? 11  THR A O   1 
ATOM   50   C CB  . THR A 1 10  ? 5.570   -24.798 57.474  1.00 55.06  ? 11  THR A CB  1 
ATOM   51   O OG1 . THR A 1 10  ? 5.084   -25.036 58.812  1.00 49.85  ? 11  THR A OG1 1 
ATOM   52   C CG2 . THR A 1 10  ? 5.247   -23.379 57.059  1.00 47.34  ? 11  THR A CG2 1 
ATOM   53   N N   . VAL A 1 11  ? 4.392   -25.182 54.213  1.00 42.01  ? 12  VAL A N   1 
ATOM   54   C CA  . VAL A 1 11  ? 4.699   -24.830 52.826  1.00 48.52  ? 12  VAL A CA  1 
ATOM   55   C C   . VAL A 1 11  ? 4.499   -23.334 52.706  1.00 56.01  ? 12  VAL A C   1 
ATOM   56   O O   . VAL A 1 11  ? 3.982   -22.720 53.637  1.00 58.91  ? 12  VAL A O   1 
ATOM   57   C CB  . VAL A 1 11  ? 3.818   -25.594 51.826  1.00 44.19  ? 12  VAL A CB  1 
ATOM   58   C CG1 . VAL A 1 11  ? 4.161   -27.074 51.865  1.00 45.22  ? 12  VAL A CG1 1 
ATOM   59   C CG2 . VAL A 1 11  ? 2.339   -25.394 52.135  1.00 36.92  ? 12  VAL A CG2 1 
ATOM   60   N N   . ARG A 1 12  ? 4.909   -22.736 51.595  1.00 47.18  ? 13  ARG A N   1 
ATOM   61   C CA  . ARG A 1 12  ? 4.796   -21.281 51.457  1.00 45.54  ? 13  ARG A CA  1 
ATOM   62   C C   . ARG A 1 12  ? 3.422   -20.724 51.846  1.00 53.03  ? 13  ARG A C   1 
ATOM   63   O O   . ARG A 1 12  ? 3.324   -19.648 52.428  1.00 61.51  ? 13  ARG A O   1 
ATOM   64   C CB  . ARG A 1 12  ? 5.120   -20.864 50.036  1.00 43.12  ? 13  ARG A CB  1 
ATOM   65   C CG  . ARG A 1 12  ? 6.554   -21.172 49.668  1.00 65.82  ? 13  ARG A CG  1 
ATOM   66   C CD  . ARG A 1 12  ? 6.982   -20.407 48.424  1.00 75.73  ? 13  ARG A CD  1 
ATOM   67   N NE  . ARG A 1 12  ? 8.327   -20.790 48.001  1.00 83.75  ? 13  ARG A NE  1 
ATOM   68   C CZ  . ARG A 1 12  ? 9.003   -20.187 47.027  1.00 87.73  ? 13  ARG A CZ  1 
ATOM   69   N NH1 . ARG A 1 12  ? 8.457   -19.162 46.379  1.00 77.74  ? 13  ARG A NH1 1 
ATOM   70   N NH2 . ARG A 1 12  ? 10.225  -20.605 46.705  1.00 93.94  ? 13  ARG A NH2 1 
ATOM   71   N N   . GLY A 1 13  ? 2.370   -21.473 51.551  1.00 45.74  ? 14  GLY A N   1 
ATOM   72   C CA  . GLY A 1 13  ? 1.023   -21.037 51.832  1.00 40.58  ? 14  GLY A CA  1 
ATOM   73   C C   . GLY A 1 13  ? 0.613   -21.137 53.280  1.00 45.83  ? 14  GLY A C   1 
ATOM   74   O O   . GLY A 1 13  ? -0.390  -20.541 53.690  1.00 51.54  ? 14  GLY A O   1 
ATOM   75   N N   . GLY A 1 14  ? 1.365   -21.903 54.062  1.00 43.36  ? 15  GLY A N   1 
ATOM   76   C CA  . GLY A 1 14  ? 0.945   -22.195 55.418  1.00 47.35  ? 15  GLY A CA  1 
ATOM   77   C C   . GLY A 1 14  ? 1.292   -23.580 55.929  1.00 46.61  ? 15  GLY A C   1 
ATOM   78   O O   . GLY A 1 14  ? 2.148   -24.268 55.381  1.00 51.07  ? 15  GLY A O   1 
ATOM   79   N N   . ARG A 1 15  ? 0.589   -23.979 56.981  1.00 48.95  ? 16  ARG A N   1 
ATOM   80   C CA  . ARG A 1 15  ? 0.862   -25.206 57.711  1.00 44.07  ? 16  ARG A CA  1 
ATOM   81   C C   . ARG A 1 15  ? -0.086  -26.336 57.311  1.00 44.06  ? 16  ARG A C   1 
ATOM   82   O O   . ARG A 1 15  ? -1.259  -26.096 57.029  1.00 45.02  ? 16  ARG A O   1 
ATOM   83   C CB  . ARG A 1 15  ? 0.766   -24.941 59.228  1.00 49.11  ? 16  ARG A CB  1 
ATOM   84   C CG  . ARG A 1 15  ? 1.999   -24.246 59.836  1.00 66.73  ? 16  ARG A CG  1 
ATOM   85   C CD  . ARG A 1 15  ? 1.861   -24.022 61.358  1.00 59.83  ? 16  ARG A CD  1 
ATOM   86   N NE  . ARG A 1 15  ? 0.756   -23.116 61.657  1.00 70.78  ? 16  ARG A NE  1 
ATOM   87   C CZ  . ARG A 1 15  ? -0.046  -23.240 62.711  1.00 70.99  ? 16  ARG A CZ  1 
ATOM   88   N NH1 . ARG A 1 15  ? 0.141   -24.236 63.565  1.00 71.48  ? 16  ARG A NH1 1 
ATOM   89   N NH2 . ARG A 1 15  ? -1.039  -22.377 62.909  1.00 74.35  ? 16  ARG A NH2 1 
ATOM   90   N N   . LEU A 1 16  ? 0.433   -27.564 57.322  1.00 43.88  ? 17  LEU A N   1 
ATOM   91   C CA  . LEU A 1 16  ? -0.320  -28.746 56.918  1.00 56.09  ? 17  LEU A CA  1 
ATOM   92   C C   . LEU A 1 16  ? -0.199  -29.841 57.950  1.00 43.03  ? 17  LEU A C   1 
ATOM   93   O O   . LEU A 1 16  ? 0.855   -29.994 58.568  1.00 50.68  ? 17  LEU A O   1 
ATOM   94   C CB  . LEU A 1 16  ? 0.186   -29.305 55.574  1.00 45.01  ? 17  LEU A CB  1 
ATOM   95   C CG  . LEU A 1 16  ? 0.290   -28.359 54.397  1.00 51.36  ? 17  LEU A CG  1 
ATOM   96   C CD1 . LEU A 1 16  ? 0.982   -29.086 53.252  1.00 49.18  ? 17  LEU A CD1 1 
ATOM   97   C CD2 . LEU A 1 16  ? -1.117  -27.909 54.019  1.00 49.91  ? 17  LEU A CD2 1 
ATOM   98   N N   A ARG A 1 17  ? -1.274  -30.611 58.110  0.49 47.94  ? 18  ARG A N   1 
ATOM   99   N N   B ARG A 1 17  ? -1.263  -30.621 58.117  0.51 48.54  ? 18  ARG A N   1 
ATOM   100  C CA  A ARG A 1 17  ? -1.269  -31.816 58.937  0.49 56.62  ? 18  ARG A CA  1 
ATOM   101  C CA  B ARG A 1 17  ? -1.199  -31.819 58.947  0.51 53.58  ? 18  ARG A CA  1 
ATOM   102  C C   A ARG A 1 17  ? -1.528  -33.028 58.055  0.49 46.75  ? 18  ARG A C   1 
ATOM   103  C C   B ARG A 1 17  ? -1.525  -33.032 58.093  0.51 47.23  ? 18  ARG A C   1 
ATOM   104  O O   A ARG A 1 17  ? -2.580  -33.127 57.415  0.49 48.34  ? 18  ARG A O   1 
ATOM   105  O O   B ARG A 1 17  ? -2.611  -33.132 57.509  0.51 48.26  ? 18  ARG A O   1 
ATOM   106  C CB  A ARG A 1 17  ? -2.320  -31.731 60.056  0.49 46.71  ? 18  ARG A CB  1 
ATOM   107  C CB  B ARG A 1 17  ? -2.150  -31.727 60.149  0.51 46.68  ? 18  ARG A CB  1 
ATOM   108  C CG  A ARG A 1 17  ? -2.788  -33.094 60.583  0.49 55.74  ? 18  ARG A CG  1 
ATOM   109  C CG  B ARG A 1 17  ? -2.039  -32.907 61.121  0.51 52.27  ? 18  ARG A CG  1 
ATOM   110  C CD  A ARG A 1 17  ? -3.758  -32.971 61.763  0.49 54.74  ? 18  ARG A CD  1 
ATOM   111  C CD  B ARG A 1 17  ? -2.921  -32.716 62.368  0.51 51.51  ? 18  ARG A CD  1 
ATOM   112  N NE  A ARG A 1 17  ? -4.481  -31.702 61.740  0.49 58.69  ? 18  ARG A NE  1 
ATOM   113  N NE  B ARG A 1 17  ? -2.424  -31.638 63.224  0.51 56.07  ? 18  ARG A NE  1 
ATOM   114  C CZ  A ARG A 1 17  ? -5.712  -31.546 61.268  0.49 58.09  ? 18  ARG A CZ  1 
ATOM   115  C CZ  B ARG A 1 17  ? -3.025  -30.462 63.401  0.51 54.63  ? 18  ARG A CZ  1 
ATOM   116  N NH1 A ARG A 1 17  ? -6.375  -32.585 60.788  0.49 62.66  ? 18  ARG A NH1 1 
ATOM   117  N NH1 B ARG A 1 17  ? -4.178  -30.187 62.802  0.51 48.54  ? 18  ARG A NH1 1 
ATOM   118  N NH2 A ARG A 1 17  ? -6.281  -30.351 61.285  0.49 51.23  ? 18  ARG A NH2 1 
ATOM   119  N NH2 B ARG A 1 17  ? -2.471  -29.559 64.196  0.51 48.68  ? 18  ARG A NH2 1 
ATOM   120  N N   . GLY A 1 18  ? -0.565  -33.942 58.010  1.00 44.25  ? 19  GLY A N   1 
ATOM   121  C CA  . GLY A 1 18  ? -0.698  -35.141 57.202  1.00 48.63  ? 19  GLY A CA  1 
ATOM   122  C C   . GLY A 1 18  ? -1.138  -36.351 58.002  1.00 55.96  ? 19  GLY A C   1 
ATOM   123  O O   . GLY A 1 18  ? -1.617  -36.224 59.127  1.00 53.42  ? 19  GLY A O   1 
ATOM   124  N N   . ILE A 1 19  ? -0.972  -37.530 57.414  1.00 50.92  ? 20  ILE A N   1 
ATOM   125  C CA  . ILE A 1 19  ? -1.426  -38.768 58.024  1.00 43.20  ? 20  ILE A CA  1 
ATOM   126  C C   . ILE A 1 19  ? -0.382  -39.849 57.777  1.00 46.10  ? 20  ILE A C   1 
ATOM   127  O O   . ILE A 1 19  ? 0.303   -39.829 56.755  1.00 50.37  ? 20  ILE A O   1 
ATOM   128  C CB  . ILE A 1 19  ? -2.809  -39.196 57.471  1.00 58.56  ? 20  ILE A CB  1 
ATOM   129  C CG1 . ILE A 1 19  ? -3.373  -40.360 58.286  1.00 51.92  ? 20  ILE A CG1 1 
ATOM   130  C CG2 . ILE A 1 19  ? -2.749  -39.539 55.943  1.00 49.27  ? 20  ILE A CG2 1 
ATOM   131  C CD1 . ILE A 1 19  ? -4.807  -40.742 57.907  1.00 43.70  ? 20  ILE A CD1 1 
ATOM   132  N N   . ARG A 1 20  ? -0.238  -40.764 58.733  1.00 53.98  ? 21  ARG A N   1 
ATOM   133  C CA  . ARG A 1 20  ? 0.663   -41.911 58.610  1.00 48.71  ? 21  ARG A CA  1 
ATOM   134  C C   . ARG A 1 20  ? -0.100  -43.080 58.003  1.00 47.76  ? 21  ARG A C   1 
ATOM   135  O O   . ARG A 1 20  ? -1.189  -43.406 58.462  1.00 52.61  ? 21  ARG A O   1 
ATOM   136  C CB  . ARG A 1 20  ? 1.232   -42.299 59.979  1.00 55.57  ? 21  ARG A CB  1 
ATOM   137  C CG  . ARG A 1 20  ? 2.529   -43.090 59.923  1.00 54.27  ? 21  ARG A CG  1 
ATOM   138  C CD  . ARG A 1 20  ? 3.124   -43.294 61.340  1.00 73.80  ? 21  ARG A CD  1 
ATOM   139  N NE  . ARG A 1 20  ? 2.130   -43.843 62.264  1.00 69.26  ? 21  ARG A NE  1 
ATOM   140  C CZ  . ARG A 1 20  ? 1.714   -43.247 63.379  1.00 69.30  ? 21  ARG A CZ  1 
ATOM   141  N NH1 . ARG A 1 20  ? 2.214   -42.066 63.767  1.00 58.94  ? 21  ARG A NH1 1 
ATOM   142  N NH2 . ARG A 1 20  ? 0.779   -43.848 64.104  1.00 70.38  ? 21  ARG A NH2 1 
ATOM   143  N N   . LEU A 1 21  ? 0.443   -43.679 56.949  1.00 45.39  ? 22  LEU A N   1 
ATOM   144  C CA  . LEU A 1 21  ? -0.214  -44.780 56.268  1.00 46.22  ? 22  LEU A CA  1 
ATOM   145  C C   . LEU A 1 21  ? 0.582   -46.034 56.516  1.00 48.04  ? 22  LEU A C   1 
ATOM   146  O O   . LEU A 1 21  ? 1.791   -45.961 56.685  1.00 51.16  ? 22  LEU A O   1 
ATOM   147  C CB  . LEU A 1 21  ? -0.321  -44.530 54.746  1.00 41.73  ? 22  LEU A CB  1 
ATOM   148  C CG  . LEU A 1 21  ? -1.106  -43.299 54.290  1.00 54.91  ? 22  LEU A CG  1 
ATOM   149  C CD1 . LEU A 1 21  ? -1.120  -43.216 52.776  1.00 56.95  ? 22  LEU A CD1 1 
ATOM   150  C CD2 . LEU A 1 21  ? -2.532  -43.287 54.852  1.00 43.06  ? 22  LEU A CD2 1 
ATOM   151  N N   . LYS A 1 22  ? -0.083  -47.184 56.512  1.00 53.56  ? 23  LYS A N   1 
ATOM   152  C CA  . LYS A 1 22  ? 0.614   -48.456 56.634  1.00 52.94  ? 23  LYS A CA  1 
ATOM   153  C C   . LYS A 1 22  ? 0.824   -49.126 55.273  1.00 41.64  ? 23  LYS A C   1 
ATOM   154  O O   . LYS A 1 22  ? 0.004   -49.010 54.377  1.00 50.85  ? 23  LYS A O   1 
ATOM   155  C CB  . LYS A 1 22  ? -0.162  -49.420 57.539  1.00 46.64  ? 23  LYS A CB  1 
ATOM   156  C CG  . LYS A 1 22  ? -0.668  -48.835 58.841  1.00 62.55  ? 23  LYS A CG  1 
ATOM   157  C CD  . LYS A 1 22  ? -1.296  -49.922 59.740  1.00 56.56  ? 23  LYS A CD  1 
ATOM   158  C CE  . LYS A 1 22  ? -2.544  -50.536 59.085  1.00 72.65  ? 23  LYS A CE  1 
ATOM   159  N NZ  . LYS A 1 22  ? -3.002  -51.815 59.740  1.00 73.28  ? 23  LYS A NZ  1 
ATOM   160  N N   . THR A 1 23  ? 1.924   -49.850 55.147  1.00 38.98  ? 24  THR A N   1 
ATOM   161  C CA  . THR A 1 23  ? 2.126   -50.768 54.048  1.00 43.46  ? 24  THR A CA  1 
ATOM   162  C C   . THR A 1 23  ? 2.750   -52.026 54.619  1.00 41.53  ? 24  THR A C   1 
ATOM   163  O O   . THR A 1 23  ? 3.309   -51.994 55.721  1.00 48.73  ? 24  THR A O   1 
ATOM   164  C CB  . THR A 1 23  ? 3.077   -50.192 52.939  1.00 46.91  ? 24  THR A CB  1 
ATOM   165  O OG1 . THR A 1 23  ? 4.444   -50.468 53.297  1.00 47.74  ? 24  THR A OG1 1 
ATOM   166  C CG2 . THR A 1 23  ? 2.873   -48.699 52.744  1.00 38.30  ? 24  THR A CG2 1 
ATOM   167  N N   . PRO A 1 24  ? 2.722   -53.126 53.855  1.00 51.17  ? 25  PRO A N   1 
ATOM   168  C CA  . PRO A 1 24  ? 3.428   -54.348 54.254  1.00 48.88  ? 25  PRO A CA  1 
ATOM   169  C C   . PRO A 1 24  ? 4.931   -54.159 54.439  1.00 52.58  ? 25  PRO A C   1 
ATOM   170  O O   . PRO A 1 24  ? 5.580   -55.044 54.976  1.00 61.83  ? 25  PRO A O   1 
ATOM   171  C CB  . PRO A 1 24  ? 3.177   -55.295 53.082  1.00 47.68  ? 25  PRO A CB  1 
ATOM   172  C CG  . PRO A 1 24  ? 1.987   -54.747 52.396  1.00 48.84  ? 25  PRO A CG  1 
ATOM   173  C CD  . PRO A 1 24  ? 2.011   -53.293 52.573  1.00 43.70  ? 25  PRO A CD  1 
ATOM   174  N N   . GLY A 1 25  ? 5.491   -53.051 53.969  1.00 48.71  ? 26  GLY A N   1 
ATOM   175  C CA  . GLY A 1 25  ? 6.920   -52.830 54.108  1.00 36.14  ? 26  GLY A CA  1 
ATOM   176  C C   . GLY A 1 25  ? 7.254   -51.768 55.143  1.00 47.91  ? 26  GLY A C   1 
ATOM   177  O O   . GLY A 1 25  ? 8.415   -51.415 55.328  1.00 44.95  ? 26  GLY A O   1 
ATOM   178  N N   . GLY A 1 26  ? 6.241   -51.255 55.831  1.00 40.98  ? 27  GLY A N   1 
ATOM   179  C CA  . GLY A 1 26  ? 6.463   -50.174 56.765  1.00 41.57  ? 27  GLY A CA  1 
ATOM   180  C C   . GLY A 1 26  ? 5.653   -48.938 56.428  1.00 43.95  ? 27  GLY A C   1 
ATOM   181  O O   . GLY A 1 26  ? 5.006   -48.873 55.386  1.00 54.01  ? 27  GLY A O   1 
ATOM   182  N N   . PRO A 1 27  ? 5.690   -47.949 57.322  1.00 45.78  ? 28  PRO A N   1 
ATOM   183  C CA  . PRO A 1 27  ? 4.918   -46.714 57.162  1.00 43.71  ? 28  PRO A CA  1 
ATOM   184  C C   . PRO A 1 27  ? 5.462   -45.734 56.120  1.00 48.50  ? 28  PRO A C   1 
ATOM   185  O O   . PRO A 1 27  ? 6.609   -45.756 55.691  1.00 46.00  ? 28  PRO A O   1 
ATOM   186  C CB  . PRO A 1 27  ? 4.985   -46.077 58.556  1.00 36.56  ? 28  PRO A CB  1 
ATOM   187  C CG  . PRO A 1 27  ? 6.271   -46.575 59.124  1.00 38.18  ? 28  PRO A CG  1 
ATOM   188  C CD  . PRO A 1 27  ? 6.443   -47.985 58.595  1.00 39.55  ? 28  PRO A CD  1 
ATOM   189  N N   . VAL A 1 28  ? 4.582   -44.815 55.777  1.00 41.52  ? 29  VAL A N   1 
ATOM   190  C CA  . VAL A 1 28  ? 4.774   -43.844 54.738  1.00 38.72  ? 29  VAL A CA  1 
ATOM   191  C C   . VAL A 1 28  ? 4.070   -42.596 55.240  1.00 39.65  ? 29  VAL A C   1 
ATOM   192  O O   . VAL A 1 28  ? 3.063   -42.722 55.941  1.00 39.01  ? 29  VAL A O   1 
ATOM   193  C CB  . VAL A 1 28  ? 4.143   -44.369 53.422  1.00 45.63  ? 29  VAL A CB  1 
ATOM   194  C CG1 . VAL A 1 28  ? 3.506   -43.252 52.646  1.00 38.71  ? 29  VAL A CG1 1 
ATOM   195  C CG2 . VAL A 1 28  ? 5.141   -45.181 52.629  1.00 32.68  ? 29  VAL A CG2 1 
ATOM   196  N N   . SER A 1 29  ? 4.573   -41.402 54.927  1.00 40.69  ? 30  SER A N   1 
ATOM   197  C CA  . SER A 1 29  ? 3.843   -40.178 55.301  1.00 44.51  ? 30  SER A CA  1 
ATOM   198  C C   . SER A 1 29  ? 3.045   -39.665 54.097  1.00 43.31  ? 30  SER A C   1 
ATOM   199  O O   . SER A 1 29  ? 3.545   -39.677 52.996  1.00 42.56  ? 30  SER A O   1 
ATOM   200  C CB  . SER A 1 29  ? 4.789   -39.084 55.792  1.00 42.72  ? 30  SER A CB  1 
ATOM   201  O OG  . SER A 1 29  ? 5.905   -39.604 56.495  1.00 60.26  ? 30  SER A OG  1 
ATOM   202  N N   . ALA A 1 30  ? 1.828   -39.185 54.324  1.00 45.31  ? 31  ALA A N   1 
ATOM   203  C CA  . ALA A 1 30  ? 0.974   -38.752 53.239  1.00 40.07  ? 31  ALA A CA  1 
ATOM   204  C C   . ALA A 1 30  ? 0.299   -37.450 53.583  1.00 47.51  ? 31  ALA A C   1 
ATOM   205  O O   . ALA A 1 30  ? -0.200  -37.269 54.688  1.00 46.93  ? 31  ALA A O   1 
ATOM   206  C CB  . ALA A 1 30  ? -0.057  -39.799 52.922  1.00 38.59  ? 31  ALA A CB  1 
ATOM   207  N N   . PHE A 1 31  ? 0.291   -36.545 52.615  1.00 42.84  ? 32  PHE A N   1 
ATOM   208  C CA  . PHE A 1 31  ? -0.360  -35.266 52.762  1.00 40.05  ? 32  PHE A CA  1 
ATOM   209  C C   . PHE A 1 31  ? -1.313  -35.139 51.599  1.00 43.77  ? 32  PHE A C   1 
ATOM   210  O O   . PHE A 1 31  ? -0.900  -34.886 50.462  1.00 42.68  ? 32  PHE A O   1 
ATOM   211  C CB  . PHE A 1 31  ? 0.667   -34.139 52.789  1.00 35.31  ? 32  PHE A CB  1 
ATOM   212  C CG  . PHE A 1 31  ? 1.669   -34.295 53.874  1.00 43.94  ? 32  PHE A CG  1 
ATOM   213  C CD1 . PHE A 1 31  ? 2.769   -35.112 53.701  1.00 37.58  ? 32  PHE A CD1 1 
ATOM   214  C CD2 . PHE A 1 31  ? 1.496   -33.652 55.091  1.00 40.71  ? 32  PHE A CD2 1 
ATOM   215  C CE1 . PHE A 1 31  ? 3.685   -35.267 54.708  1.00 41.37  ? 32  PHE A CE1 1 
ATOM   216  C CE2 . PHE A 1 31  ? 2.411   -33.813 56.103  1.00 49.92  ? 32  PHE A CE2 1 
ATOM   217  C CZ  . PHE A 1 31  ? 3.500   -34.624 55.908  1.00 42.42  ? 32  PHE A CZ  1 
ATOM   218  N N   . LEU A 1 32  ? -2.585  -35.362 51.891  1.00 38.73  ? 33  LEU A N   1 
ATOM   219  C CA  . LEU A 1 32  ? -3.595  -35.562 50.878  1.00 42.15  ? 33  LEU A CA  1 
ATOM   220  C C   . LEU A 1 32  ? -4.511  -34.383 50.894  1.00 45.92  ? 33  LEU A C   1 
ATOM   221  O O   . LEU A 1 32  ? -4.880  -33.923 51.959  1.00 44.00  ? 33  LEU A O   1 
ATOM   222  C CB  . LEU A 1 32  ? -4.376  -36.837 51.153  1.00 40.11  ? 33  LEU A CB  1 
ATOM   223  C CG  . LEU A 1 32  ? -3.530  -38.082 51.326  1.00 40.42  ? 33  LEU A CG  1 
ATOM   224  C CD1 . LEU A 1 32  ? -4.425  -39.237 51.700  1.00 41.94  ? 33  LEU A CD1 1 
ATOM   225  C CD2 . LEU A 1 32  ? -2.730  -38.400 50.048  1.00 41.60  ? 33  LEU A CD2 1 
ATOM   226  N N   . GLY A 1 33  ? -4.886  -33.886 49.724  1.00 34.14  ? 34  GLY A N   1 
ATOM   227  C CA  . GLY A 1 33  ? -5.808  -32.766 49.675  1.00 34.05  ? 34  GLY A CA  1 
ATOM   228  C C   . GLY A 1 33  ? -5.207  -31.402 49.980  1.00 40.65  ? 34  GLY A C   1 
ATOM   229  O O   . GLY A 1 33  ? -5.875  -30.554 50.576  1.00 48.96  ? 34  GLY A O   1 
ATOM   230  N N   . ILE A 1 34  ? -3.955  -31.182 49.583  1.00 40.81  ? 35  ILE A N   1 
ATOM   231  C CA  . ILE A 1 34  ? -3.348  -29.857 49.712  1.00 41.87  ? 35  ILE A CA  1 
ATOM   232  C C   . ILE A 1 34  ? -3.860  -28.910 48.630  1.00 44.46  ? 35  ILE A C   1 
ATOM   233  O O   . ILE A 1 34  ? -3.781  -29.230 47.451  1.00 45.94  ? 35  ILE A O   1 
ATOM   234  C CB  . ILE A 1 34  ? -1.839  -29.908 49.584  1.00 39.09  ? 35  ILE A CB  1 
ATOM   235  C CG1 . ILE A 1 34  ? -1.255  -30.974 50.495  1.00 36.82  ? 35  ILE A CG1 1 
ATOM   236  C CG2 . ILE A 1 34  ? -1.251  -28.543 49.856  1.00 40.88  ? 35  ILE A CG2 1 
ATOM   237  C CD1 . ILE A 1 34  ? 0.199   -31.264 50.213  1.00 34.96  ? 35  ILE A CD1 1 
ATOM   238  N N   . PRO A 1 35  ? -4.383  -27.741 49.017  1.00 47.21  ? 36  PRO A N   1 
ATOM   239  C CA  . PRO A 1 35  ? -4.848  -26.823 47.970  1.00 36.39  ? 36  PRO A CA  1 
ATOM   240  C C   . PRO A 1 35  ? -3.688  -26.168 47.222  1.00 45.88  ? 36  PRO A C   1 
ATOM   241  O O   . PRO A 1 35  ? -2.796  -25.660 47.879  1.00 42.90  ? 36  PRO A O   1 
ATOM   242  C CB  . PRO A 1 35  ? -5.657  -25.778 48.744  1.00 44.86  ? 36  PRO A CB  1 
ATOM   243  C CG  . PRO A 1 35  ? -5.102  -25.820 50.155  1.00 42.64  ? 36  PRO A CG  1 
ATOM   244  C CD  . PRO A 1 35  ? -4.658  -27.249 50.378  1.00 42.32  ? 36  PRO A CD  1 
ATOM   245  N N   . PHE A 1 36  ? -3.681  -26.173 45.886  1.00 42.42  ? 37  PHE A N   1 
ATOM   246  C CA  . PHE A 1 36  ? -2.594  -25.495 45.190  1.00 37.27  ? 37  PHE A CA  1 
ATOM   247  C C   . PHE A 1 36  ? -3.118  -24.364 44.332  1.00 44.88  ? 37  PHE A C   1 
ATOM   248  O O   . PHE A 1 36  ? -2.337  -23.594 43.793  1.00 45.93  ? 37  PHE A O   1 
ATOM   249  C CB  . PHE A 1 36  ? -1.757  -26.476 44.364  1.00 40.86  ? 37  PHE A CB  1 
ATOM   250  C CG  . PHE A 1 36  ? -2.464  -27.063 43.147  1.00 41.07  ? 37  PHE A CG  1 
ATOM   251  C CD1 . PHE A 1 36  ? -2.317  -26.489 41.890  1.00 44.58  ? 37  PHE A CD1 1 
ATOM   252  C CD2 . PHE A 1 36  ? -3.207  -28.222 43.255  1.00 37.18  ? 37  PHE A CD2 1 
ATOM   253  C CE1 . PHE A 1 36  ? -2.926  -27.048 40.765  1.00 45.24  ? 37  PHE A CE1 1 
ATOM   254  C CE2 . PHE A 1 36  ? -3.838  -28.790 42.136  1.00 39.02  ? 37  PHE A CE2 1 
ATOM   255  C CZ  . PHE A 1 36  ? -3.681  -28.202 40.887  1.00 38.18  ? 37  PHE A CZ  1 
ATOM   256  N N   . ALA A 1 37  ? -4.439  -24.225 44.253  1.00 36.39  ? 38  ALA A N   1 
ATOM   257  C CA  . ALA A 1 37  ? -5.042  -23.116 43.514  1.00 37.78  ? 38  ALA A CA  1 
ATOM   258  C C   . ALA A 1 37  ? -6.246  -22.543 44.258  1.00 44.45  ? 38  ALA A C   1 
ATOM   259  O O   . ALA A 1 37  ? -6.865  -23.221 45.079  1.00 39.84  ? 38  ALA A O   1 
ATOM   260  C CB  . ALA A 1 37  ? -5.467  -23.570 42.115  1.00 30.62  ? 38  ALA A CB  1 
ATOM   261  N N   . GLU A 1 38  ? -6.590  -21.299 43.954  1.00 44.21  ? 39  GLU A N   1 
ATOM   262  C CA  . GLU A 1 38  ? -7.885  -20.772 44.352  1.00 48.07  ? 39  GLU A CA  1 
ATOM   263  C C   . GLU A 1 38  ? -8.970  -21.567 43.629  1.00 51.16  ? 39  GLU A C   1 
ATOM   264  O O   . GLU A 1 38  ? -8.809  -21.912 42.467  1.00 47.07  ? 39  GLU A O   1 
ATOM   265  C CB  . GLU A 1 38  ? -7.983  -19.283 44.027  1.00 49.27  ? 39  GLU A CB  1 
ATOM   266  C CG  . GLU A 1 38  ? -7.152  -18.425 44.962  1.00 59.31  ? 39  GLU A CG  1 
ATOM   267  C CD  . GLU A 1 38  ? -7.654  -18.495 46.391  1.00 53.35  ? 39  GLU A CD  1 
ATOM   268  O OE1 . GLU A 1 38  ? -8.865  -18.264 46.591  1.00 65.36  ? 39  GLU A OE1 1 
ATOM   269  O OE2 . GLU A 1 38  ? -6.852  -18.802 47.305  1.00 54.36  ? 39  GLU A OE2 1 
ATOM   270  N N   . PRO A 1 39  ? -10.058 -21.900 44.333  1.00 52.81  ? 40  PRO A N   1 
ATOM   271  C CA  . PRO A 1 39  ? -11.127 -22.704 43.730  1.00 41.40  ? 40  PRO A CA  1 
ATOM   272  C C   . PRO A 1 39  ? -11.675 -22.054 42.468  1.00 47.18  ? 40  PRO A C   1 
ATOM   273  O O   . PRO A 1 39  ? -12.106 -20.910 42.510  1.00 53.81  ? 40  PRO A O   1 
ATOM   274  C CB  . PRO A 1 39  ? -12.189 -22.751 44.828  1.00 47.10  ? 40  PRO A CB  1 
ATOM   275  C CG  . PRO A 1 39  ? -11.404 -22.581 46.120  1.00 39.61  ? 40  PRO A CG  1 
ATOM   276  C CD  . PRO A 1 39  ? -10.285 -21.638 45.769  1.00 40.85  ? 40  PRO A CD  1 
ATOM   277  N N   . PRO A 1 40  ? -11.647 -22.776 41.344  1.00 49.65  ? 41  PRO A N   1 
ATOM   278  C CA  . PRO A 1 40  ? -12.021 -22.172 40.061  1.00 48.58  ? 41  PRO A CA  1 
ATOM   279  C C   . PRO A 1 40  ? -13.528 -22.156 39.834  1.00 58.01  ? 41  PRO A C   1 
ATOM   280  O O   . PRO A 1 40  ? -14.019 -22.861 38.958  1.00 55.13  ? 41  PRO A O   1 
ATOM   281  C CB  . PRO A 1 40  ? -11.325 -23.071 39.044  1.00 45.89  ? 41  PRO A CB  1 
ATOM   282  C CG  . PRO A 1 40  ? -11.243 -24.396 39.708  1.00 45.44  ? 41  PRO A CG  1 
ATOM   283  C CD  . PRO A 1 40  ? -11.228 -24.179 41.202  1.00 42.18  ? 41  PRO A CD  1 
ATOM   284  N N   . MET A 1 41  ? -14.241 -21.340 40.607  1.00 60.64  ? 42  MET A N   1 
ATOM   285  C CA  . MET A 1 41  ? -15.702 -21.349 40.613  1.00 56.06  ? 42  MET A CA  1 
ATOM   286  C C   . MET A 1 41  ? -16.319 -19.989 40.337  1.00 54.25  ? 42  MET A C   1 
ATOM   287  O O   . MET A 1 41  ? -15.651 -18.956 40.451  1.00 57.62  ? 42  MET A O   1 
ATOM   288  C CB  . MET A 1 41  ? -16.212 -21.850 41.953  1.00 64.96  ? 42  MET A CB  1 
ATOM   289  C CG  . MET A 1 41  ? -15.704 -23.208 42.298  1.00 66.64  ? 42  MET A CG  1 
ATOM   290  S SD  . MET A 1 41  ? -16.478 -23.754 43.803  1.00 76.66  ? 42  MET A SD  1 
ATOM   291  C CE  . MET A 1 41  ? -18.183 -23.301 43.472  1.00 82.32  ? 42  MET A CE  1 
ATOM   292  N N   . GLY A 1 42  ? -17.609 -20.000 40.006  1.00 49.45  ? 43  GLY A N   1 
ATOM   293  C CA  . GLY A 1 42  ? -18.320 -18.789 39.638  1.00 49.75  ? 43  GLY A CA  1 
ATOM   294  C C   . GLY A 1 42  ? -17.585 -18.088 38.525  1.00 55.28  ? 43  GLY A C   1 
ATOM   295  O O   . GLY A 1 42  ? -17.380 -18.668 37.453  1.00 52.84  ? 43  GLY A O   1 
ATOM   296  N N   . PRO A 1 43  ? -17.146 -16.849 38.782  1.00 52.96  ? 44  PRO A N   1 
ATOM   297  C CA  . PRO A 1 43  ? -16.433 -16.071 37.756  1.00 53.52  ? 44  PRO A CA  1 
ATOM   298  C C   . PRO A 1 43  ? -15.126 -16.728 37.293  1.00 55.58  ? 44  PRO A C   1 
ATOM   299  O O   . PRO A 1 43  ? -14.626 -16.400 36.212  1.00 47.94  ? 44  PRO A O   1 
ATOM   300  C CB  . PRO A 1 43  ? -16.162 -14.726 38.449  1.00 49.21  ? 44  PRO A CB  1 
ATOM   301  C CG  . PRO A 1 43  ? -16.313 -14.993 39.920  1.00 44.90  ? 44  PRO A CG  1 
ATOM   302  C CD  . PRO A 1 43  ? -17.313 -16.110 40.048  1.00 47.31  ? 44  PRO A CD  1 
ATOM   303  N N   . ARG A 1 44  ? -14.594 -17.654 38.091  1.00 55.75  ? 45  ARG A N   1 
ATOM   304  C CA  . ARG A 1 44  ? -13.337 -18.316 37.759  1.00 54.73  ? 45  ARG A CA  1 
ATOM   305  C C   . ARG A 1 44  ? -13.500 -19.581 36.904  1.00 55.36  ? 45  ARG A C   1 
ATOM   306  O O   . ARG A 1 44  ? -12.510 -20.154 36.454  1.00 47.84  ? 45  ARG A O   1 
ATOM   307  C CB  . ARG A 1 44  ? -12.570 -18.671 39.030  1.00 53.18  ? 45  ARG A CB  1 
ATOM   308  C CG  . ARG A 1 44  ? -11.953 -17.490 39.762  1.00 55.33  ? 45  ARG A CG  1 
ATOM   309  C CD  . ARG A 1 44  ? -11.096 -18.006 40.937  1.00 72.92  ? 45  ARG A CD  1 
ATOM   310  N NE  . ARG A 1 44  ? -10.929 -17.039 42.030  1.00 84.87  ? 45  ARG A NE  1 
ATOM   311  C CZ  . ARG A 1 44  ? -10.156 -15.955 41.961  1.00 91.63  ? 45  ARG A CZ  1 
ATOM   312  N NH1 . ARG A 1 44  ? -9.489  -15.682 40.841  1.00 89.42  ? 45  ARG A NH1 1 
ATOM   313  N NH2 . ARG A 1 44  ? -10.057 -15.139 43.004  1.00 77.66  ? 45  ARG A NH2 1 
ATOM   314  N N   . ARG A 1 45  ? -14.729 -20.026 36.675  1.00 50.59  ? 46  ARG A N   1 
ATOM   315  C CA  . ARG A 1 45  ? -14.942 -21.132 35.741  1.00 48.82  ? 46  ARG A CA  1 
ATOM   316  C C   . ARG A 1 45  ? -14.422 -20.773 34.344  1.00 44.57  ? 46  ARG A C   1 
ATOM   317  O O   . ARG A 1 45  ? -14.682 -19.678 33.862  1.00 46.35  ? 46  ARG A O   1 
ATOM   318  C CB  . ARG A 1 45  ? -16.420 -21.503 35.679  1.00 43.10  ? 46  ARG A CB  1 
ATOM   319  C CG  . ARG A 1 45  ? -16.739 -22.626 34.727  1.00 50.30  ? 46  ARG A CG  1 
ATOM   320  C CD  . ARG A 1 45  ? -18.232 -22.814 34.589  1.00 48.85  ? 46  ARG A CD  1 
ATOM   321  N NE  . ARG A 1 45  ? -18.798 -23.604 35.685  1.00 48.02  ? 46  ARG A NE  1 
ATOM   322  C CZ  . ARG A 1 45  ? -20.099 -23.839 35.830  1.00 45.55  ? 46  ARG A CZ  1 
ATOM   323  N NH1 . ARG A 1 45  ? -20.956 -23.327 34.956  1.00 55.16  ? 46  ARG A NH1 1 
ATOM   324  N NH2 . ARG A 1 45  ? -20.552 -24.576 36.835  1.00 41.75  ? 46  ARG A NH2 1 
ATOM   325  N N   . PHE A 1 46  ? -13.673 -21.704 33.742  1.00 43.04  ? 47  PHE A N   1 
ATOM   326  C CA  . PHE A 1 46  ? -13.023 -21.587 32.429  1.00 48.81  ? 47  PHE A CA  1 
ATOM   327  C C   . PHE A 1 46  ? -11.738 -20.747 32.431  1.00 49.72  ? 47  PHE A C   1 
ATOM   328  O O   . PHE A 1 46  ? -11.051 -20.669 31.410  1.00 57.14  ? 47  PHE A O   1 
ATOM   329  C CB  . PHE A 1 46  ? -13.985 -21.017 31.370  1.00 47.39  ? 47  PHE A CB  1 
ATOM   330  C CG  . PHE A 1 46  ? -15.288 -21.748 31.266  1.00 42.03  ? 47  PHE A CG  1 
ATOM   331  C CD1 . PHE A 1 46  ? -15.323 -23.122 31.116  1.00 42.35  ? 47  PHE A CD1 1 
ATOM   332  C CD2 . PHE A 1 46  ? -16.489 -21.052 31.321  1.00 48.29  ? 47  PHE A CD2 1 
ATOM   333  C CE1 . PHE A 1 46  ? -16.521 -23.785 31.011  1.00 42.11  ? 47  PHE A CE1 1 
ATOM   334  C CE2 . PHE A 1 46  ? -17.700 -21.712 31.224  1.00 35.57  ? 47  PHE A CE2 1 
ATOM   335  C CZ  . PHE A 1 46  ? -17.719 -23.074 31.071  1.00 45.44  ? 47  PHE A CZ  1 
ATOM   336  N N   . LEU A 1 47  ? -11.400 -20.130 33.556  1.00 40.76  ? 48  LEU A N   1 
ATOM   337  C CA  . LEU A 1 47  ? -10.192 -19.293 33.625  1.00 47.43  ? 48  LEU A CA  1 
ATOM   338  C C   . LEU A 1 47  ? -8.953  -20.044 34.096  1.00 51.31  ? 48  LEU A C   1 
ATOM   339  O O   . LEU A 1 47  ? -9.061  -21.056 34.789  1.00 45.81  ? 48  LEU A O   1 
ATOM   340  C CB  . LEU A 1 47  ? -10.412 -18.112 34.558  1.00 46.74  ? 48  LEU A CB  1 
ATOM   341  C CG  . LEU A 1 47  ? -11.471 -17.102 34.139  1.00 54.85  ? 48  LEU A CG  1 
ATOM   342  C CD1 . LEU A 1 47  ? -11.510 -15.944 35.140  1.00 49.38  ? 48  LEU A CD1 1 
ATOM   343  C CD2 . LEU A 1 47  ? -11.177 -16.622 32.742  1.00 40.92  ? 48  LEU A CD2 1 
ATOM   344  N N   . PRO A 1 48  ? -7.766  -19.542 33.721  1.00 53.14  ? 49  PRO A N   1 
ATOM   345  C CA  . PRO A 1 48  ? -6.515  -20.041 34.292  1.00 46.35  ? 49  PRO A CA  1 
ATOM   346  C C   . PRO A 1 48  ? -6.571  -20.088 35.785  1.00 46.28  ? 49  PRO A C   1 
ATOM   347  O O   . PRO A 1 48  ? -7.203  -19.232 36.403  1.00 49.11  ? 49  PRO A O   1 
ATOM   348  C CB  . PRO A 1 48  ? -5.485  -19.011 33.832  1.00 41.13  ? 49  PRO A CB  1 
ATOM   349  C CG  . PRO A 1 48  ? -6.003  -18.601 32.484  1.00 50.31  ? 49  PRO A CG  1 
ATOM   350  C CD  . PRO A 1 48  ? -7.516  -18.571 32.642  1.00 44.89  ? 49  PRO A CD  1 
ATOM   351  N N   . PRO A 1 49  ? -5.914  -21.082 36.368  1.00 47.14  ? 50  PRO A N   1 
ATOM   352  C CA  . PRO A 1 49  ? -5.867  -21.215 37.820  1.00 40.93  ? 50  PRO A CA  1 
ATOM   353  C C   . PRO A 1 49  ? -5.089  -20.075 38.465  1.00 51.33  ? 50  PRO A C   1 
ATOM   354  O O   . PRO A 1 49  ? -4.039  -19.697 37.958  1.00 56.14  ? 50  PRO A O   1 
ATOM   355  C CB  . PRO A 1 49  ? -5.136  -22.545 38.020  1.00 40.80  ? 50  PRO A CB  1 
ATOM   356  C CG  . PRO A 1 49  ? -4.251  -22.655 36.793  1.00 47.57  ? 50  PRO A CG  1 
ATOM   357  C CD  . PRO A 1 49  ? -5.095  -22.096 35.679  1.00 45.67  ? 50  PRO A CD  1 
ATOM   358  N N   . GLU A 1 50  ? -5.600  -19.532 39.563  1.00 46.01  ? 51  GLU A N   1 
ATOM   359  C CA  . GLU A 1 50  ? -4.817  -18.619 40.386  1.00 54.19  ? 51  GLU A CA  1 
ATOM   360  C C   . GLU A 1 50  ? -4.164  -19.353 41.547  1.00 43.06  ? 51  GLU A C   1 
ATOM   361  O O   . GLU A 1 50  ? -4.784  -20.221 42.158  1.00 49.72  ? 51  GLU A O   1 
ATOM   362  C CB  . GLU A 1 50  ? -5.693  -17.498 40.919  1.00 68.71  ? 51  GLU A CB  1 
ATOM   363  C CG  . GLU A 1 50  ? -6.146  -16.498 39.870  1.00 69.39  ? 51  GLU A CG  1 
ATOM   364  C CD  . GLU A 1 50  ? -6.534  -15.170 40.506  1.00 109.04 ? 51  GLU A CD  1 
ATOM   365  O OE1 . GLU A 1 50  ? -6.765  -15.148 41.744  1.00 104.10 ? 51  GLU A OE1 1 
ATOM   366  O OE2 . GLU A 1 50  ? -6.595  -14.152 39.779  1.00 122.22 ? 51  GLU A OE2 1 
ATOM   367  N N   . PRO A 1 51  ? -2.913  -19.012 41.862  1.00 50.13  ? 52  PRO A N   1 
ATOM   368  C CA  . PRO A 1 51  ? -2.230  -19.641 43.005  1.00 50.70  ? 52  PRO A CA  1 
ATOM   369  C C   . PRO A 1 51  ? -3.016  -19.517 44.309  1.00 49.93  ? 52  PRO A C   1 
ATOM   370  O O   . PRO A 1 51  ? -3.703  -18.524 44.544  1.00 51.57  ? 52  PRO A O   1 
ATOM   371  C CB  . PRO A 1 51  ? -0.912  -18.878 43.093  1.00 48.05  ? 52  PRO A CB  1 
ATOM   372  C CG  . PRO A 1 51  ? -0.672  -18.393 41.684  1.00 47.42  ? 52  PRO A CG  1 
ATOM   373  C CD  . PRO A 1 51  ? -2.035  -18.093 41.120  1.00 46.86  ? 52  PRO A CD  1 
ATOM   374  N N   . LYS A 1 52  ? -2.944  -20.550 45.136  1.00 45.79  ? 53  LYS A N   1 
ATOM   375  C CA  . LYS A 1 52  ? -3.712  -20.563 46.366  1.00 55.57  ? 53  LYS A CA  1 
ATOM   376  C C   . LYS A 1 52  ? -3.193  -19.470 47.292  1.00 51.65  ? 53  LYS A C   1 
ATOM   377  O O   . LYS A 1 52  ? -1.999  -19.398 47.569  1.00 52.45  ? 53  LYS A O   1 
ATOM   378  C CB  . LYS A 1 52  ? -3.631  -21.936 47.043  1.00 48.45  ? 53  LYS A CB  1 
ATOM   379  C CG  . LYS A 1 52  ? -4.271  -21.995 48.432  1.00 46.41  ? 53  LYS A CG  1 
ATOM   380  C CD  . LYS A 1 52  ? -5.776  -21.852 48.347  1.00 50.42  ? 53  LYS A CD  1 
ATOM   381  C CE  . LYS A 1 52  ? -6.425  -21.967 49.724  1.00 52.35  ? 53  LYS A CE  1 
ATOM   382  N NZ  . LYS A 1 52  ? -7.933  -21.919 49.644  1.00 48.11  ? 53  LYS A NZ  1 
ATOM   383  N N   A GLN A 1 53  ? -4.106  -18.632 47.770  0.48 52.24  ? 54  GLN A N   1 
ATOM   384  N N   B GLN A 1 53  ? -4.083  -18.603 47.756  0.52 52.29  ? 54  GLN A N   1 
ATOM   385  C CA  A GLN A 1 53  ? -3.771  -17.602 48.751  0.48 56.80  ? 54  GLN A CA  1 
ATOM   386  C CA  B GLN A 1 53  ? -3.673  -17.563 48.695  0.52 56.87  ? 54  GLN A CA  1 
ATOM   387  C C   A GLN A 1 53  ? -3.365  -18.243 50.080  0.48 51.39  ? 54  GLN A C   1 
ATOM   388  C C   B GLN A 1 53  ? -3.393  -18.173 50.067  0.52 50.91  ? 54  GLN A C   1 
ATOM   389  O O   A GLN A 1 53  ? -3.950  -19.248 50.489  0.48 51.38  ? 54  GLN A O   1 
ATOM   390  O O   B GLN A 1 53  ? -4.099  -19.086 50.498  0.52 51.71  ? 54  GLN A O   1 
ATOM   391  C CB  A GLN A 1 53  ? -4.958  -16.647 48.951  0.48 55.25  ? 54  GLN A CB  1 
ATOM   392  C CB  B GLN A 1 53  ? -4.735  -16.463 48.791  0.52 56.28  ? 54  GLN A CB  1 
ATOM   393  C CG  A GLN A 1 53  ? -5.398  -15.905 47.676  0.48 56.68  ? 54  GLN A CG  1 
ATOM   394  C CG  B GLN A 1 53  ? -4.786  -15.544 47.564  0.52 54.10  ? 54  GLN A CG  1 
ATOM   395  C CD  A GLN A 1 53  ? -6.721  -15.166 47.846  0.48 56.88  ? 54  GLN A CD  1 
ATOM   396  C CD  B GLN A 1 53  ? -3.531  -14.706 47.405  0.52 55.55  ? 54  GLN A CD  1 
ATOM   397  O OE1 A GLN A 1 53  ? -7.155  -14.900 48.970  0.48 57.28  ? 54  GLN A OE1 1 
ATOM   398  O OE1 B GLN A 1 53  ? -3.189  -13.908 48.278  0.52 59.91  ? 54  GLN A OE1 1 
ATOM   399  N NE2 A GLN A 1 53  ? -7.371  -14.838 46.725  0.48 48.40  ? 54  GLN A NE2 1 
ATOM   400  N NE2 B GLN A 1 53  ? -2.832  -14.889 46.288  0.52 54.37  ? 54  GLN A NE2 1 
ATOM   401  N N   . PRO A 1 54  ? -2.351  -17.674 50.752  1.00 55.50  ? 55  PRO A N   1 
ATOM   402  C CA  . PRO A 1 54  ? -1.923  -18.185 52.060  1.00 55.34  ? 55  PRO A CA  1 
ATOM   403  C C   . PRO A 1 54  ? -3.069  -18.273 53.051  1.00 53.36  ? 55  PRO A C   1 
ATOM   404  O O   . PRO A 1 54  ? -4.047  -17.539 52.942  1.00 56.29  ? 55  PRO A O   1 
ATOM   405  C CB  . PRO A 1 54  ? -0.885  -17.162 52.521  1.00 49.65  ? 55  PRO A CB  1 
ATOM   406  C CG  . PRO A 1 54  ? -0.331  -16.610 51.277  1.00 52.32  ? 55  PRO A CG  1 
ATOM   407  C CD  . PRO A 1 54  ? -1.483  -16.575 50.292  1.00 59.05  ? 55  PRO A CD  1 
ATOM   408  N N   . TRP A 1 55  ? -2.954  -19.201 53.989  1.00 56.54  ? 56  TRP A N   1 
ATOM   409  C CA  . TRP A 1 55  ? -4.009  -19.447 54.956  1.00 49.24  ? 56  TRP A CA  1 
ATOM   410  C C   . TRP A 1 55  ? -3.425  -19.385 56.357  1.00 55.16  ? 56  TRP A C   1 
ATOM   411  O O   . TRP A 1 55  ? -2.213  -19.506 56.540  1.00 54.66  ? 56  TRP A O   1 
ATOM   412  C CB  . TRP A 1 55  ? -4.664  -20.805 54.708  1.00 54.59  ? 56  TRP A CB  1 
ATOM   413  C CG  . TRP A 1 55  ? -3.697  -21.963 54.771  1.00 54.72  ? 56  TRP A CG  1 
ATOM   414  C CD1 . TRP A 1 55  ? -3.324  -22.651 55.877  1.00 47.21  ? 56  TRP A CD1 1 
ATOM   415  C CD2 . TRP A 1 55  ? -2.989  -22.558 53.673  1.00 54.62  ? 56  TRP A CD2 1 
ATOM   416  N NE1 . TRP A 1 55  ? -2.422  -23.635 55.551  1.00 53.46  ? 56  TRP A NE1 1 
ATOM   417  C CE2 . TRP A 1 55  ? -2.205  -23.601 54.200  1.00 46.23  ? 56  TRP A CE2 1 
ATOM   418  C CE3 . TRP A 1 55  ? -2.952  -22.315 52.295  1.00 46.42  ? 56  TRP A CE3 1 
ATOM   419  C CZ2 . TRP A 1 55  ? -1.390  -24.396 53.404  1.00 47.79  ? 56  TRP A CZ2 1 
ATOM   420  C CZ3 . TRP A 1 55  ? -2.136  -23.103 51.504  1.00 45.42  ? 56  TRP A CZ3 1 
ATOM   421  C CH2 . TRP A 1 55  ? -1.367  -24.134 52.058  1.00 47.91  ? 56  TRP A CH2 1 
ATOM   422  N N   . SER A 1 56  ? -4.275  -19.169 57.348  1.00 58.48  ? 57  SER A N   1 
ATOM   423  C CA  . SER A 1 56  ? -3.800  -19.229 58.721  1.00 69.04  ? 57  SER A CA  1 
ATOM   424  C C   . SER A 1 56  ? -4.282  -20.533 59.312  1.00 61.32  ? 57  SER A C   1 
ATOM   425  O O   . SER A 1 56  ? -5.204  -21.162 58.787  1.00 69.52  ? 57  SER A O   1 
ATOM   426  C CB  . SER A 1 56  ? -4.283  -18.031 59.542  1.00 61.58  ? 57  SER A CB  1 
ATOM   427  O OG  . SER A 1 56  ? -5.678  -17.836 59.387  1.00 66.72  ? 57  SER A OG  1 
ATOM   428  N N   . GLY A 1 57  ? -3.649  -20.956 60.392  1.00 65.19  ? 58  GLY A N   1 
ATOM   429  C CA  . GLY A 1 57  ? -4.014  -22.221 60.985  1.00 59.53  ? 58  GLY A CA  1 
ATOM   430  C C   . GLY A 1 57  ? -3.462  -23.381 60.187  1.00 68.23  ? 58  GLY A C   1 
ATOM   431  O O   . GLY A 1 57  ? -2.509  -23.239 59.410  1.00 58.92  ? 58  GLY A O   1 
ATOM   432  N N   . VAL A 1 58  ? -4.064  -24.544 60.379  1.00 60.14  ? 59  VAL A N   1 
ATOM   433  C CA  . VAL A 1 58  ? -3.517  -25.756 59.805  1.00 56.71  ? 59  VAL A CA  1 
ATOM   434  C C   . VAL A 1 58  ? -4.533  -26.395 58.880  1.00 62.29  ? 59  VAL A C   1 
ATOM   435  O O   . VAL A 1 58  ? -5.662  -26.670 59.285  1.00 56.78  ? 59  VAL A O   1 
ATOM   436  C CB  . VAL A 1 58  ? -3.103  -26.752 60.895  1.00 52.55  ? 59  VAL A CB  1 
ATOM   437  C CG1 . VAL A 1 58  ? -2.388  -27.954 60.271  1.00 52.79  ? 59  VAL A CG1 1 
ATOM   438  C CG2 . VAL A 1 58  ? -2.216  -26.062 61.935  1.00 43.13  ? 59  VAL A CG2 1 
ATOM   439  N N   . VAL A 1 59  ? -4.132  -26.593 57.626  1.00 56.03  ? 60  VAL A N   1 
ATOM   440  C CA  . VAL A 1 59  ? -4.948  -27.322 56.668  1.00 46.85  ? 60  VAL A CA  1 
ATOM   441  C C   . VAL A 1 59  ? -4.974  -28.801 57.051  1.00 53.22  ? 60  VAL A C   1 
ATOM   442  O O   . VAL A 1 59  ? -3.937  -29.409 57.364  1.00 44.47  ? 60  VAL A O   1 
ATOM   443  C CB  . VAL A 1 59  ? -4.429  -27.145 55.225  1.00 53.87  ? 60  VAL A CB  1 
ATOM   444  C CG1 . VAL A 1 59  ? -4.906  -28.282 54.322  1.00 49.65  ? 60  VAL A CG1 1 
ATOM   445  C CG2 . VAL A 1 59  ? -4.891  -25.813 54.670  1.00 50.59  ? 60  VAL A CG2 1 
ATOM   446  N N   . ASP A 1 60  ? -6.171  -29.371 57.077  1.00 47.37  ? 61  ASP A N   1 
ATOM   447  C CA  . ASP A 1 60  ? -6.274  -30.799 57.313  1.00 57.77  ? 61  ASP A CA  1 
ATOM   448  C C   . ASP A 1 60  ? -5.952  -31.530 56.014  1.00 53.67  ? 61  ASP A C   1 
ATOM   449  O O   . ASP A 1 60  ? -6.702  -31.425 55.055  1.00 53.55  ? 61  ASP A O   1 
ATOM   450  C CB  . ASP A 1 60  ? -7.666  -31.159 57.822  1.00 64.13  ? 61  ASP A CB  1 
ATOM   451  C CG  . ASP A 1 60  ? -7.960  -32.644 57.727  1.00 75.40  ? 61  ASP A CG  1 
ATOM   452  O OD1 . ASP A 1 60  ? -7.008  -33.458 57.804  1.00 74.07  ? 61  ASP A OD1 1 
ATOM   453  O OD2 . ASP A 1 60  ? -9.153  -32.996 57.579  1.00 87.91  ? 61  ASP A OD2 1 
ATOM   454  N N   . ALA A 1 61  ? -4.836  -32.255 55.985  1.00 54.56  ? 62  ALA A N   1 
ATOM   455  C CA  . ALA A 1 61  ? -4.426  -32.968 54.780  1.00 45.38  ? 62  ALA A CA  1 
ATOM   456  C C   . ALA A 1 61  ? -4.338  -34.475 55.000  1.00 46.36  ? 62  ALA A C   1 
ATOM   457  O O   . ALA A 1 61  ? -3.304  -35.084 54.736  1.00 38.55  ? 62  ALA A O   1 
ATOM   458  C CB  . ALA A 1 61  ? -3.082  -32.434 54.280  1.00 43.00  ? 62  ALA A CB  1 
ATOM   459  N N   . THR A 1 62  ? -5.424  -35.078 55.477  1.00 49.20  ? 63  THR A N   1 
ATOM   460  C CA  . THR A 1 62  ? -5.398  -36.489 55.883  1.00 49.35  ? 63  THR A CA  1 
ATOM   461  C C   . THR A 1 62  ? -6.310  -37.332 55.011  1.00 45.42  ? 63  THR A C   1 
ATOM   462  O O   . THR A 1 62  ? -6.391  -38.551 55.182  1.00 50.38  ? 63  THR A O   1 
ATOM   463  C CB  . THR A 1 62  ? -5.860  -36.681 57.347  1.00 53.87  ? 63  THR A CB  1 
ATOM   464  O OG1 . THR A 1 62  ? -7.184  -36.146 57.466  1.00 49.89  ? 63  THR A OG1 1 
ATOM   465  C CG2 . THR A 1 62  ? -4.916  -35.986 58.337  1.00 42.04  ? 63  THR A CG2 1 
ATOM   466  N N   . THR A 1 63  ? -7.012  -36.665 54.101  1.00 44.54  ? 64  THR A N   1 
ATOM   467  C CA  . THR A 1 63  ? -7.959  -37.331 53.227  1.00 49.66  ? 64  THR A CA  1 
ATOM   468  C C   . THR A 1 63  ? -7.975  -36.711 51.809  1.00 45.02  ? 64  THR A C   1 
ATOM   469  O O   . THR A 1 63  ? -7.721  -35.522 51.636  1.00 47.76  ? 64  THR A O   1 
ATOM   470  C CB  . THR A 1 63  ? -9.393  -37.300 53.857  1.00 50.56  ? 64  THR A CB  1 
ATOM   471  O OG1 . THR A 1 63  ? -10.310 -38.033 53.027  1.00 82.50  ? 64  THR A OG1 1 
ATOM   472  C CG2 . THR A 1 63  ? -9.889  -35.866 54.035  1.00 37.68  ? 64  THR A CG2 1 
ATOM   473  N N   . PHE A 1 64  ? -8.269  -37.531 50.804  1.00 45.38  ? 65  PHE A N   1 
ATOM   474  C CA  . PHE A 1 64  ? -8.426  -37.049 49.454  1.00 44.37  ? 65  PHE A CA  1 
ATOM   475  C C   . PHE A 1 64  ? -9.524  -36.002 49.394  1.00 46.06  ? 65  PHE A C   1 
ATOM   476  O O   . PHE A 1 64  ? -10.494 -36.077 50.141  1.00 46.15  ? 65  PHE A O   1 
ATOM   477  C CB  . PHE A 1 64  ? -8.730  -38.213 48.501  1.00 39.95  ? 65  PHE A CB  1 
ATOM   478  C CG  . PHE A 1 64  ? -7.539  -39.077 48.216  1.00 40.02  ? 65  PHE A CG  1 
ATOM   479  C CD1 . PHE A 1 64  ? -6.420  -38.541 47.607  1.00 33.53  ? 65  PHE A CD1 1 
ATOM   480  C CD2 . PHE A 1 64  ? -7.541  -40.426 48.541  1.00 41.17  ? 65  PHE A CD2 1 
ATOM   481  C CE1 . PHE A 1 64  ? -5.321  -39.327 47.335  1.00 39.02  ? 65  PHE A CE1 1 
ATOM   482  C CE2 . PHE A 1 64  ? -6.439  -41.218 48.281  1.00 38.86  ? 65  PHE A CE2 1 
ATOM   483  C CZ  . PHE A 1 64  ? -5.324  -40.664 47.676  1.00 40.39  ? 65  PHE A CZ  1 
ATOM   484  N N   . GLN A 1 65  ? -9.360  -35.025 48.509  1.00 39.33  ? 66  GLN A N   1 
ATOM   485  C CA  . GLN A 1 65  ? -10.376 -34.012 48.297  1.00 44.28  ? 66  GLN A CA  1 
ATOM   486  C C   . GLN A 1 65  ? -11.299 -34.357 47.131  1.00 43.14  ? 66  GLN A C   1 
ATOM   487  O O   . GLN A 1 65  ? -11.162 -35.398 46.506  1.00 39.75  ? 66  GLN A O   1 
ATOM   488  C CB  . GLN A 1 65  ? -9.716  -32.663 48.060  1.00 40.99  ? 66  GLN A CB  1 
ATOM   489  C CG  . GLN A 1 65  ? -9.413  -31.904 49.338  1.00 44.12  ? 66  GLN A CG  1 
ATOM   490  C CD  . GLN A 1 65  ? -10.623 -31.143 49.810  1.00 57.69  ? 66  GLN A CD  1 
ATOM   491  O OE1 . GLN A 1 65  ? -11.664 -31.134 49.147  1.00 62.82  ? 66  GLN A OE1 1 
ATOM   492  N NE2 . GLN A 1 65  ? -10.495 -30.483 50.949  1.00 51.38  ? 66  GLN A NE2 1 
ATOM   493  N N   . SER A 1 66  ? -12.230 -33.462 46.845  1.00 34.60  ? 67  SER A N   1 
ATOM   494  C CA  . SER A 1 66  ? -13.216 -33.679 45.798  1.00 41.88  ? 67  SER A CA  1 
ATOM   495  C C   . SER A 1 66  ? -12.631 -33.974 44.414  1.00 44.36  ? 67  SER A C   1 
ATOM   496  O O   . SER A 1 66  ? -11.531 -33.534 44.081  1.00 42.72  ? 67  SER A O   1 
ATOM   497  C CB  . SER A 1 66  ? -14.124 -32.459 45.715  1.00 45.22  ? 67  SER A CB  1 
ATOM   498  O OG  . SER A 1 66  ? -14.745 -32.224 46.967  1.00 56.39  ? 67  SER A OG  1 
ATOM   499  N N   . VAL A 1 67  ? -13.384 -34.738 43.628  1.00 46.98  ? 68  VAL A N   1 
ATOM   500  C CA  . VAL A 1 67  ? -13.095 -35.017 42.220  1.00 42.07  ? 68  VAL A CA  1 
ATOM   501  C C   . VAL A 1 67  ? -13.660 -33.912 41.339  1.00 42.05  ? 68  VAL A C   1 
ATOM   502  O O   . VAL A 1 67  ? -14.759 -33.418 41.567  1.00 41.64  ? 68  VAL A O   1 
ATOM   503  C CB  . VAL A 1 67  ? -13.681 -36.368 41.803  1.00 40.93  ? 68  VAL A CB  1 
ATOM   504  C CG1 . VAL A 1 67  ? -13.494 -36.619 40.316  1.00 39.48  ? 68  VAL A CG1 1 
ATOM   505  C CG2 . VAL A 1 67  ? -13.035 -37.482 42.620  1.00 38.27  ? 68  VAL A CG2 1 
ATOM   506  N N   . CYS A 1 68  ? -12.899 -33.488 40.344  1.00 38.12  ? 69  CYS A N   1 
ATOM   507  C CA  . CYS A 1 68  ? -13.389 -32.461 39.436  1.00 43.10  ? 69  CYS A CA  1 
ATOM   508  C C   . CYS A 1 68  ? -14.588 -32.999 38.693  1.00 43.88  ? 69  CYS A C   1 
ATOM   509  O O   . CYS A 1 68  ? -14.616 -34.180 38.350  1.00 40.02  ? 69  CYS A O   1 
ATOM   510  C CB  . CYS A 1 68  ? -12.299 -32.034 38.452  1.00 45.19  ? 69  CYS A CB  1 
ATOM   511  S SG  . CYS A 1 68  ? -10.864 -31.316 39.239  1.00 47.59  ? 69  CYS A SG  1 
ATOM   512  N N   . TYR A 1 69  ? -15.564 -32.133 38.423  1.00 44.06  ? 70  TYR A N   1 
ATOM   513  C CA  . TYR A 1 69  ? -16.782 -32.549 37.728  1.00 46.56  ? 70  TYR A CA  1 
ATOM   514  C C   . TYR A 1 69  ? -16.519 -33.305 36.425  1.00 42.76  ? 70  TYR A C   1 
ATOM   515  O O   . TYR A 1 69  ? -15.739 -32.872 35.581  1.00 45.20  ? 70  TYR A O   1 
ATOM   516  C CB  . TYR A 1 69  ? -17.658 -31.341 37.439  1.00 49.95  ? 70  TYR A CB  1 
ATOM   517  C CG  . TYR A 1 69  ? -18.795 -31.218 38.415  1.00 51.33  ? 70  TYR A CG  1 
ATOM   518  C CD1 . TYR A 1 69  ? -19.980 -31.943 38.234  1.00 56.32  ? 70  TYR A CD1 1 
ATOM   519  C CD2 . TYR A 1 69  ? -18.687 -30.397 39.528  1.00 49.24  ? 70  TYR A CD2 1 
ATOM   520  C CE1 . TYR A 1 69  ? -21.037 -31.846 39.150  1.00 56.06  ? 70  TYR A CE1 1 
ATOM   521  C CE2 . TYR A 1 69  ? -19.740 -30.289 40.449  1.00 49.61  ? 70  TYR A CE2 1 
ATOM   522  C CZ  . TYR A 1 69  ? -20.907 -31.020 40.254  1.00 49.79  ? 70  TYR A CZ  1 
ATOM   523  O OH  . TYR A 1 69  ? -21.938 -30.904 41.160  1.00 68.39  ? 70  TYR A OH  1 
ATOM   524  N N   . GLN A 1 70  ? -17.186 -34.438 36.260  1.00 47.26  ? 71  GLN A N   1 
ATOM   525  C CA  . GLN A 1 70  ? -16.967 -35.258 35.080  1.00 45.69  ? 71  GLN A CA  1 
ATOM   526  C C   . GLN A 1 70  ? -18.127 -36.213 34.907  1.00 47.02  ? 71  GLN A C   1 
ATOM   527  O O   . GLN A 1 70  ? -18.840 -36.505 35.867  1.00 50.60  ? 71  GLN A O   1 
ATOM   528  C CB  . GLN A 1 70  ? -15.659 -36.035 35.203  1.00 44.84  ? 71  GLN A CB  1 
ATOM   529  C CG  . GLN A 1 70  ? -15.620 -36.910 36.449  1.00 39.50  ? 71  GLN A CG  1 
ATOM   530  C CD  . GLN A 1 70  ? -14.242 -37.440 36.733  1.00 38.12  ? 71  GLN A CD  1 
ATOM   531  O OE1 . GLN A 1 70  ? -13.943 -38.613 36.508  1.00 39.90  ? 71  GLN A OE1 1 
ATOM   532  N NE2 . GLN A 1 70  ? -13.385 -36.575 37.232  1.00 39.86  ? 71  GLN A NE2 1 
ATOM   533  N N   . TYR A 1 71  ? -18.317 -36.676 33.677  1.00 46.58  ? 72  TYR A N   1 
ATOM   534  C CA  . TYR A 1 71  ? -19.239 -37.752 33.364  1.00 44.83  ? 72  TYR A CA  1 
ATOM   535  C C   . TYR A 1 71  ? -18.897 -38.979 34.190  1.00 49.92  ? 72  TYR A C   1 
ATOM   536  O O   . TYR A 1 71  ? -17.719 -39.289 34.370  1.00 51.73  ? 72  TYR A O   1 
ATOM   537  C CB  . TYR A 1 71  ? -19.189 -38.080 31.856  1.00 52.50  ? 72  TYR A CB  1 
ATOM   538  C CG  . TYR A 1 71  ? -20.003 -39.296 31.468  1.00 56.08  ? 72  TYR A CG  1 
ATOM   539  C CD1 . TYR A 1 71  ? -21.396 -39.218 31.334  1.00 56.15  ? 72  TYR A CD1 1 
ATOM   540  C CD2 . TYR A 1 71  ? -19.391 -40.529 31.254  1.00 58.26  ? 72  TYR A CD2 1 
ATOM   541  C CE1 . TYR A 1 71  ? -22.161 -40.347 30.990  1.00 63.81  ? 72  TYR A CE1 1 
ATOM   542  C CE2 . TYR A 1 71  ? -20.148 -41.666 30.912  1.00 63.74  ? 72  TYR A CE2 1 
ATOM   543  C CZ  . TYR A 1 71  ? -21.531 -41.566 30.781  1.00 73.45  ? 72  TYR A CZ  1 
ATOM   544  O OH  . TYR A 1 71  ? -22.272 -42.681 30.448  1.00 72.59  ? 72  TYR A OH  1 
ATOM   545  N N   . VAL A 1 72  ? -19.914 -39.665 34.715  1.00 54.29  ? 73  VAL A N   1 
ATOM   546  C CA  . VAL A 1 72  ? -19.694 -40.940 35.401  1.00 47.42  ? 73  VAL A CA  1 
ATOM   547  C C   . VAL A 1 72  ? -20.147 -42.120 34.537  1.00 55.16  ? 73  VAL A C   1 
ATOM   548  O O   . VAL A 1 72  ? -21.298 -42.178 34.083  1.00 55.41  ? 73  VAL A O   1 
ATOM   549  C CB  . VAL A 1 72  ? -20.423 -41.000 36.745  1.00 50.68  ? 73  VAL A CB  1 
ATOM   550  C CG1 . VAL A 1 72  ? -20.232 -42.387 37.399  1.00 46.73  ? 73  VAL A CG1 1 
ATOM   551  C CG2 . VAL A 1 72  ? -19.922 -39.907 37.653  1.00 47.59  ? 73  VAL A CG2 1 
ATOM   552  N N   . ASP A 1 73  ? -19.238 -43.064 34.320  1.00 59.37  ? 74  ASP A N   1 
ATOM   553  C CA  . ASP A 1 73  ? -19.499 -44.183 33.416  1.00 59.95  ? 74  ASP A CA  1 
ATOM   554  C C   . ASP A 1 73  ? -20.539 -45.142 33.967  1.00 58.72  ? 74  ASP A C   1 
ATOM   555  O O   . ASP A 1 73  ? -20.324 -45.745 35.021  1.00 57.70  ? 74  ASP A O   1 
ATOM   556  C CB  . ASP A 1 73  ? -18.210 -44.952 33.134  1.00 57.57  ? 74  ASP A CB  1 
ATOM   557  C CG  . ASP A 1 73  ? -18.387 -46.026 32.065  1.00 67.90  ? 74  ASP A CG  1 
ATOM   558  O OD1 . ASP A 1 73  ? -19.368 -45.963 31.290  1.00 80.16  ? 74  ASP A OD1 1 
ATOM   559  O OD2 . ASP A 1 73  ? -17.530 -46.927 31.993  1.00 71.02  ? 74  ASP A OD2 1 
ATOM   560  N N   . THR A 1 74  ? -21.645 -45.312 33.240  1.00 59.87  ? 75  THR A N   1 
ATOM   561  C CA  . THR A 1 74  ? -22.702 -46.233 33.672  1.00 70.90  ? 75  THR A CA  1 
ATOM   562  C C   . THR A 1 74  ? -22.933 -47.408 32.715  1.00 68.19  ? 75  THR A C   1 
ATOM   563  O O   . THR A 1 74  ? -24.015 -47.996 32.700  1.00 58.49  ? 75  THR A O   1 
ATOM   564  C CB  . THR A 1 74  ? -24.051 -45.503 33.855  1.00 59.09  ? 75  THR A CB  1 
ATOM   565  O OG1 . THR A 1 74  ? -24.375 -44.788 32.654  1.00 62.57  ? 75  THR A OG1 1 
ATOM   566  C CG2 . THR A 1 74  ? -23.982 -44.534 35.017  1.00 51.45  ? 75  THR A CG2 1 
ATOM   567  N N   . LEU A 1 75  ? -21.925 -47.762 31.928  1.00 67.05  ? 76  LEU A N   1 
ATOM   568  C CA  . LEU A 1 75  ? -22.093 -48.838 30.950  1.00 66.53  ? 76  LEU A CA  1 
ATOM   569  C C   . LEU A 1 75  ? -22.367 -50.187 31.619  1.00 69.67  ? 76  LEU A C   1 
ATOM   570  O O   . LEU A 1 75  ? -23.213 -50.951 31.155  1.00 71.81  ? 76  LEU A O   1 
ATOM   571  C CB  . LEU A 1 75  ? -20.859 -48.949 30.046  1.00 58.52  ? 76  LEU A CB  1 
ATOM   572  C CG  . LEU A 1 75  ? -20.912 -50.025 28.962  1.00 68.85  ? 76  LEU A CG  1 
ATOM   573  C CD1 . LEU A 1 75  ? -21.982 -49.670 27.954  1.00 51.09  ? 76  LEU A CD1 1 
ATOM   574  C CD2 . LEU A 1 75  ? -19.562 -50.193 28.284  1.00 69.74  ? 76  LEU A CD2 1 
ATOM   575  N N   . TYR A 1 76  ? -21.650 -50.481 32.699  1.00 59.35  ? 77  TYR A N   1 
ATOM   576  C CA  . TYR A 1 76  ? -21.837 -51.743 33.410  1.00 56.36  ? 77  TYR A CA  1 
ATOM   577  C C   . TYR A 1 76  ? -21.931 -51.497 34.914  1.00 58.31  ? 77  TYR A C   1 
ATOM   578  O O   . TYR A 1 76  ? -20.958 -51.714 35.642  1.00 54.50  ? 77  TYR A O   1 
ATOM   579  C CB  . TYR A 1 76  ? -20.689 -52.717 33.132  1.00 55.96  ? 77  TYR A CB  1 
ATOM   580  C CG  . TYR A 1 76  ? -20.497 -53.134 31.687  1.00 72.75  ? 77  TYR A CG  1 
ATOM   581  C CD1 . TYR A 1 76  ? -21.462 -53.876 31.018  1.00 71.76  ? 77  TYR A CD1 1 
ATOM   582  C CD2 . TYR A 1 76  ? -19.324 -52.819 31.003  1.00 71.63  ? 77  TYR A CD2 1 
ATOM   583  C CE1 . TYR A 1 76  ? -21.280 -54.268 29.692  1.00 64.23  ? 77  TYR A CE1 1 
ATOM   584  C CE2 . TYR A 1 76  ? -19.132 -53.206 29.681  1.00 71.82  ? 77  TYR A CE2 1 
ATOM   585  C CZ  . TYR A 1 76  ? -20.115 -53.929 29.032  1.00 74.00  ? 77  TYR A CZ  1 
ATOM   586  O OH  . TYR A 1 76  ? -19.933 -54.320 27.723  1.00 78.45  ? 77  TYR A OH  1 
ATOM   587  N N   . PRO A 1 77  ? -23.094 -51.031 35.386  1.00 63.73  ? 78  PRO A N   1 
ATOM   588  C CA  . PRO A 1 77  ? -23.197 -50.627 36.800  1.00 55.80  ? 78  PRO A CA  1 
ATOM   589  C C   . PRO A 1 77  ? -22.736 -51.718 37.765  1.00 57.29  ? 78  PRO A C   1 
ATOM   590  O O   . PRO A 1 77  ? -23.100 -52.885 37.604  1.00 65.51  ? 78  PRO A O   1 
ATOM   591  C CB  . PRO A 1 77  ? -24.685 -50.327 36.987  1.00 48.20  ? 78  PRO A CB  1 
ATOM   592  C CG  . PRO A 1 77  ? -25.340 -50.516 35.624  1.00 61.69  ? 78  PRO A CG  1 
ATOM   593  C CD  . PRO A 1 77  ? -24.263 -50.617 34.594  1.00 55.82  ? 78  PRO A CD  1 
ATOM   594  N N   . GLY A 1 78  ? -21.904 -51.337 38.733  1.00 56.49  ? 79  GLY A N   1 
ATOM   595  C CA  . GLY A 1 78  ? -21.359 -52.271 39.704  1.00 52.69  ? 79  GLY A CA  1 
ATOM   596  C C   . GLY A 1 78  ? -20.157 -53.085 39.240  1.00 58.03  ? 79  GLY A C   1 
ATOM   597  O O   . GLY A 1 78  ? -19.494 -53.719 40.048  1.00 55.74  ? 79  GLY A O   1 
ATOM   598  N N   . PHE A 1 79  ? -19.875 -53.086 37.940  1.00 60.92  ? 80  PHE A N   1 
ATOM   599  C CA  . PHE A 1 79  ? -18.745 -53.846 37.401  1.00 54.88  ? 80  PHE A CA  1 
ATOM   600  C C   . PHE A 1 79  ? -17.421 -53.252 37.875  1.00 50.78  ? 80  PHE A C   1 
ATOM   601  O O   . PHE A 1 79  ? -17.190 -52.048 37.761  1.00 58.28  ? 80  PHE A O   1 
ATOM   602  C CB  . PHE A 1 79  ? -18.803 -53.867 35.859  1.00 53.51  ? 80  PHE A CB  1 
ATOM   603  C CG  . PHE A 1 79  ? -17.697 -54.646 35.201  1.00 49.60  ? 80  PHE A CG  1 
ATOM   604  C CD1 . PHE A 1 79  ? -17.455 -55.967 35.548  1.00 48.67  ? 80  PHE A CD1 1 
ATOM   605  C CD2 . PHE A 1 79  ? -16.922 -54.063 34.207  1.00 47.76  ? 80  PHE A CD2 1 
ATOM   606  C CE1 . PHE A 1 79  ? -16.437 -56.696 34.927  1.00 50.13  ? 80  PHE A CE1 1 
ATOM   607  C CE2 . PHE A 1 79  ? -15.903 -54.782 33.574  1.00 43.74  ? 80  PHE A CE2 1 
ATOM   608  C CZ  . PHE A 1 79  ? -15.660 -56.099 33.934  1.00 50.71  ? 80  PHE A CZ  1 
ATOM   609  N N   . GLU A 1 80  ? -16.540 -54.098 38.383  1.00 45.46  ? 81  GLU A N   1 
ATOM   610  C CA  . GLU A 1 80  ? -15.255 -53.635 38.879  1.00 51.38  ? 81  GLU A CA  1 
ATOM   611  C C   . GLU A 1 80  ? -14.424 -52.967 37.775  1.00 58.99  ? 81  GLU A C   1 
ATOM   612  O O   . GLU A 1 80  ? -13.850 -51.893 37.974  1.00 50.15  ? 81  GLU A O   1 
ATOM   613  C CB  . GLU A 1 80  ? -14.491 -54.808 39.495  1.00 55.54  ? 81  GLU A CB  1 
ATOM   614  C CG  . GLU A 1 80  ? -13.703 -54.446 40.744  1.00 86.69  ? 81  GLU A CG  1 
ATOM   615  C CD  . GLU A 1 80  ? -12.338 -53.869 40.429  1.00 81.80  ? 81  GLU A CD  1 
ATOM   616  O OE1 . GLU A 1 80  ? -11.781 -54.223 39.362  1.00 87.24  ? 81  GLU A OE1 1 
ATOM   617  O OE2 . GLU A 1 80  ? -11.827 -53.066 41.249  1.00 90.13  ? 81  GLU A OE2 1 
ATOM   618  N N   . GLY A 1 81  ? -14.385 -53.599 36.605  1.00 57.24  ? 82  GLY A N   1 
ATOM   619  C CA  . GLY A 1 81  ? -13.552 -53.131 35.515  1.00 41.34  ? 82  GLY A CA  1 
ATOM   620  C C   . GLY A 1 81  ? -13.828 -51.702 35.103  1.00 44.30  ? 82  GLY A C   1 
ATOM   621  O O   . GLY A 1 81  ? -12.937 -51.040 34.581  1.00 60.46  ? 82  GLY A O   1 
ATOM   622  N N   . THR A 1 82  ? -15.050 -51.219 35.320  1.00 45.62  ? 83  THR A N   1 
ATOM   623  C CA  . THR A 1 82  ? -15.355 -49.829 34.992  1.00 50.24  ? 83  THR A CA  1 
ATOM   624  C C   . THR A 1 82  ? -15.423 -48.926 36.234  1.00 53.27  ? 83  THR A C   1 
ATOM   625  O O   . THR A 1 82  ? -15.097 -47.741 36.164  1.00 50.82  ? 83  THR A O   1 
ATOM   626  C CB  . THR A 1 82  ? -16.692 -49.688 34.231  1.00 50.14  ? 83  THR A CB  1 
ATOM   627  O OG1 . THR A 1 82  ? -17.719 -50.371 34.954  1.00 59.21  ? 83  THR A OG1 1 
ATOM   628  C CG2 . THR A 1 82  ? -16.597 -50.250 32.804  1.00 61.33  ? 83  THR A CG2 1 
ATOM   629  N N   . GLU A 1 83  ? -15.874 -49.465 37.359  1.00 51.37  ? 84  GLU A N   1 
ATOM   630  C CA  . GLU A 1 83  ? -16.063 -48.629 38.543  1.00 51.24  ? 84  GLU A CA  1 
ATOM   631  C C   . GLU A 1 83  ? -14.729 -48.188 39.121  1.00 47.99  ? 84  GLU A C   1 
ATOM   632  O O   . GLU A 1 83  ? -14.646 -47.142 39.761  1.00 48.61  ? 84  GLU A O   1 
ATOM   633  C CB  . GLU A 1 83  ? -16.879 -49.354 39.625  1.00 52.99  ? 84  GLU A CB  1 
ATOM   634  C CG  . GLU A 1 83  ? -18.323 -49.673 39.241  1.00 54.34  ? 84  GLU A CG  1 
ATOM   635  C CD  . GLU A 1 83  ? -19.226 -48.459 39.101  1.00 68.17  ? 84  GLU A CD  1 
ATOM   636  O OE1 . GLU A 1 83  ? -20.374 -48.650 38.634  1.00 69.84  ? 84  GLU A OE1 1 
ATOM   637  O OE2 . GLU A 1 83  ? -18.813 -47.327 39.462  1.00 68.83  ? 84  GLU A OE2 1 
ATOM   638  N N   . MET A 1 84  ? -13.680 -48.969 38.890  1.00 50.15  ? 85  MET A N   1 
ATOM   639  C CA  . MET A 1 84  ? -12.356 -48.598 39.382  1.00 40.07  ? 85  MET A CA  1 
ATOM   640  C C   . MET A 1 84  ? -11.851 -47.288 38.751  1.00 53.15  ? 85  MET A C   1 
ATOM   641  O O   . MET A 1 84  ? -10.855 -46.733 39.213  1.00 40.91  ? 85  MET A O   1 
ATOM   642  C CB  . MET A 1 84  ? -11.354 -49.720 39.114  1.00 39.06  ? 85  MET A CB  1 
ATOM   643  C CG  . MET A 1 84  ? -11.158 -50.005 37.611  1.00 47.90  ? 85  MET A CG  1 
ATOM   644  S SD  . MET A 1 84  ? -9.930  -51.283 37.284  1.00 50.50  ? 85  MET A SD  1 
ATOM   645  C CE  . MET A 1 84  ? -8.436  -50.427 37.795  1.00 47.28  ? 85  MET A CE  1 
ATOM   646  N N   . TRP A 1 85  ? -12.524 -46.786 37.708  1.00 40.45  ? 86  TRP A N   1 
ATOM   647  C CA  . TRP A 1 85  ? -12.098 -45.535 37.079  1.00 37.87  ? 86  TRP A CA  1 
ATOM   648  C C   . TRP A 1 85  ? -13.057 -44.407 37.423  1.00 39.15  ? 86  TRP A C   1 
ATOM   649  O O   . TRP A 1 85  ? -12.785 -43.241 37.142  1.00 43.89  ? 86  TRP A O   1 
ATOM   650  C CB  . TRP A 1 85  ? -11.981 -45.695 35.543  1.00 43.19  ? 86  TRP A CB  1 
ATOM   651  C CG  . TRP A 1 85  ? -11.122 -46.857 35.116  1.00 40.69  ? 86  TRP A CG  1 
ATOM   652  C CD1 . TRP A 1 85  ? -11.546 -48.009 34.522  1.00 44.04  ? 86  TRP A CD1 1 
ATOM   653  C CD2 . TRP A 1 85  ? -9.698  -46.989 35.274  1.00 48.89  ? 86  TRP A CD2 1 
ATOM   654  N NE1 . TRP A 1 85  ? -10.480 -48.855 34.303  1.00 40.13  ? 86  TRP A NE1 1 
ATOM   655  C CE2 . TRP A 1 85  ? -9.333  -48.247 34.741  1.00 40.48  ? 86  TRP A CE2 1 
ATOM   656  C CE3 . TRP A 1 85  ? -8.699  -46.161 35.802  1.00 44.58  ? 86  TRP A CE3 1 
ATOM   657  C CZ2 . TRP A 1 85  ? -8.013  -48.700 34.722  1.00 33.58  ? 86  TRP A CZ2 1 
ATOM   658  C CZ3 . TRP A 1 85  ? -7.376  -46.615 35.786  1.00 39.44  ? 86  TRP A CZ3 1 
ATOM   659  C CH2 . TRP A 1 85  ? -7.049  -47.874 35.243  1.00 39.74  ? 86  TRP A CH2 1 
ATOM   660  N N   . ASN A 1 86  ? -14.194 -44.737 38.019  1.00 40.76  ? 87  ASN A N   1 
ATOM   661  C CA  . ASN A 1 86  ? -15.170 -43.694 38.330  1.00 37.86  ? 87  ASN A CA  1 
ATOM   662  C C   . ASN A 1 86  ? -14.789 -42.923 39.585  1.00 37.64  ? 87  ASN A C   1 
ATOM   663  O O   . ASN A 1 86  ? -14.016 -43.419 40.414  1.00 34.83  ? 87  ASN A O   1 
ATOM   664  C CB  . ASN A 1 86  ? -16.558 -44.301 38.480  1.00 51.47  ? 87  ASN A CB  1 
ATOM   665  C CG  . ASN A 1 86  ? -17.213 -44.615 37.137  1.00 50.32  ? 87  ASN A CG  1 
ATOM   666  O OD1 . ASN A 1 86  ? -17.131 -43.837 36.168  1.00 48.03  ? 87  ASN A OD1 1 
ATOM   667  N ND2 . ASN A 1 86  ? -17.878 -45.757 37.080  1.00 51.64  ? 87  ASN A ND2 1 
ATOM   668  N N   . PRO A 1 87  ? -15.307 -41.694 39.718  1.00 32.20  ? 88  PRO A N   1 
ATOM   669  C CA  . PRO A 1 87  ? -15.051 -40.883 40.918  1.00 38.27  ? 88  PRO A CA  1 
ATOM   670  C C   . PRO A 1 87  ? -15.268 -41.685 42.208  1.00 48.59  ? 88  PRO A C   1 
ATOM   671  O O   . PRO A 1 87  ? -16.257 -42.419 42.316  1.00 51.41  ? 88  PRO A O   1 
ATOM   672  C CB  . PRO A 1 87  ? -16.075 -39.745 40.803  1.00 36.61  ? 88  PRO A CB  1 
ATOM   673  C CG  . PRO A 1 87  ? -16.327 -39.611 39.314  1.00 39.65  ? 88  PRO A CG  1 
ATOM   674  C CD  . PRO A 1 87  ? -16.113 -40.982 38.704  1.00 39.02  ? 88  PRO A CD  1 
ATOM   675  N N   . ASN A 1 88  ? -14.344 -41.582 43.157  1.00 45.19  ? 89  ASN A N   1 
ATOM   676  C CA  . ASN A 1 88  ? -14.532 -42.216 44.459  1.00 41.44  ? 89  ASN A CA  1 
ATOM   677  C C   . ASN A 1 88  ? -14.570 -41.175 45.586  1.00 48.18  ? 89  ASN A C   1 
ATOM   678  O O   . ASN A 1 88  ? -14.319 -41.485 46.761  1.00 46.25  ? 89  ASN A O   1 
ATOM   679  C CB  . ASN A 1 88  ? -13.426 -43.240 44.727  1.00 43.55  ? 89  ASN A CB  1 
ATOM   680  C CG  . ASN A 1 88  ? -12.069 -42.598 44.817  1.00 46.32  ? 89  ASN A CG  1 
ATOM   681  O OD1 . ASN A 1 88  ? -11.862 -41.499 44.299  1.00 54.26  ? 89  ASN A OD1 1 
ATOM   682  N ND2 . ASN A 1 88  ? -11.133 -43.274 45.455  1.00 44.34  ? 89  ASN A ND2 1 
ATOM   683  N N   . ARG A 1 89  ? -14.846 -39.934 45.203  1.00 40.33  ? 90  ARG A N   1 
ATOM   684  C CA  . ARG A 1 89  ? -15.159 -38.861 46.148  1.00 46.93  ? 90  ARG A CA  1 
ATOM   685  C C   . ARG A 1 89  ? -16.237 -38.032 45.472  1.00 46.98  ? 90  ARG A C   1 
ATOM   686  O O   . ARG A 1 89  ? -16.519 -38.228 44.279  1.00 42.02  ? 90  ARG A O   1 
ATOM   687  C CB  . ARG A 1 89  ? -13.929 -37.998 46.494  1.00 43.03  ? 90  ARG A CB  1 
ATOM   688  C CG  . ARG A 1 89  ? -12.793 -38.722 47.213  1.00 45.19  ? 90  ARG A CG  1 
ATOM   689  C CD  . ARG A 1 89  ? -13.185 -39.091 48.663  1.00 47.61  ? 90  ARG A CD  1 
ATOM   690  N NE  . ARG A 1 89  ? -12.059 -39.600 49.438  1.00 45.69  ? 90  ARG A NE  1 
ATOM   691  C CZ  . ARG A 1 89  ? -11.642 -40.867 49.414  1.00 54.35  ? 90  ARG A CZ  1 
ATOM   692  N NH1 . ARG A 1 89  ? -12.270 -41.756 48.655  1.00 53.35  ? 90  ARG A NH1 1 
ATOM   693  N NH2 . ARG A 1 89  ? -10.600 -41.254 50.150  1.00 40.94  ? 90  ARG A NH2 1 
ATOM   694  N N   . GLU A 1 90  ? -16.837 -37.100 46.199  1.00 46.89  ? 91  GLU A N   1 
ATOM   695  C CA  . GLU A 1 90  ? -17.917 -36.332 45.594  1.00 48.26  ? 91  GLU A CA  1 
ATOM   696  C C   . GLU A 1 90  ? -17.364 -35.406 44.513  1.00 49.58  ? 91  GLU A C   1 
ATOM   697  O O   . GLU A 1 90  ? -16.213 -34.972 44.582  1.00 46.86  ? 91  GLU A O   1 
ATOM   698  C CB  . GLU A 1 90  ? -18.691 -35.527 46.653  1.00 49.54  ? 91  GLU A CB  1 
ATOM   699  C CG  . GLU A 1 90  ? -17.861 -34.513 47.409  1.00 82.38  ? 91  GLU A CG  1 
ATOM   700  C CD  . GLU A 1 90  ? -18.716 -33.506 48.190  1.00 108.68 ? 91  GLU A CD  1 
ATOM   701  O OE1 . GLU A 1 90  ? -19.967 -33.648 48.176  1.00 90.87  ? 91  GLU A OE1 1 
ATOM   702  O OE2 . GLU A 1 90  ? -18.133 -32.575 48.809  1.00 95.03  ? 91  GLU A OE2 1 
ATOM   703  N N   . LEU A 1 91  ? -18.189 -35.115 43.518  1.00 44.12  ? 92  LEU A N   1 
ATOM   704  C CA  . LEU A 1 91  ? -17.831 -34.154 42.489  1.00 50.52  ? 92  LEU A CA  1 
ATOM   705  C C   . LEU A 1 91  ? -17.893 -32.741 43.038  1.00 40.24  ? 92  LEU A C   1 
ATOM   706  O O   . LEU A 1 91  ? -18.772 -32.423 43.822  1.00 54.19  ? 92  LEU A O   1 
ATOM   707  C CB  . LEU A 1 91  ? -18.760 -34.279 41.277  1.00 34.68  ? 92  LEU A CB  1 
ATOM   708  C CG  . LEU A 1 91  ? -18.796 -35.669 40.635  1.00 42.52  ? 92  LEU A CG  1 
ATOM   709  C CD1 . LEU A 1 91  ? -19.616 -35.612 39.376  1.00 35.86  ? 92  LEU A CD1 1 
ATOM   710  C CD2 . LEU A 1 91  ? -17.394 -36.199 40.338  1.00 48.35  ? 92  LEU A CD2 1 
ATOM   711  N N   . SER A 1 92  ? -16.961 -31.899 42.607  1.00 48.20  ? 93  SER A N   1 
ATOM   712  C CA  . SER A 1 92  ? -16.991 -30.471 42.914  1.00 45.99  ? 93  SER A CA  1 
ATOM   713  C C   . SER A 1 92  ? -16.106 -29.685 41.942  1.00 47.06  ? 93  SER A C   1 
ATOM   714  O O   . SER A 1 92  ? -15.076 -30.190 41.482  1.00 48.45  ? 93  SER A O   1 
ATOM   715  C CB  . SER A 1 92  ? -16.519 -30.207 44.349  1.00 33.56  ? 93  SER A CB  1 
ATOM   716  O OG  . SER A 1 92  ? -16.450 -28.801 44.571  1.00 43.79  ? 93  SER A OG  1 
ATOM   717  N N   . GLU A 1 93  ? -16.489 -28.450 41.637  1.00 42.20  ? 94  GLU A N   1 
ATOM   718  C CA  . GLU A 1 93  ? -15.603 -27.583 40.874  1.00 42.15  ? 94  GLU A CA  1 
ATOM   719  C C   . GLU A 1 93  ? -14.426 -27.124 41.747  1.00 51.75  ? 94  GLU A C   1 
ATOM   720  O O   . GLU A 1 93  ? -13.379 -26.719 41.249  1.00 56.14  ? 94  GLU A O   1 
ATOM   721  C CB  . GLU A 1 93  ? -16.362 -26.385 40.322  1.00 40.65  ? 94  GLU A CB  1 
ATOM   722  C CG  . GLU A 1 93  ? -17.186 -26.685 39.065  1.00 42.87  ? 94  GLU A CG  1 
ATOM   723  C CD  . GLU A 1 93  ? -17.783 -25.412 38.473  1.00 47.32  ? 94  GLU A CD  1 
ATOM   724  O OE1 . GLU A 1 93  ? -17.189 -24.859 37.528  1.00 49.61  ? 94  GLU A OE1 1 
ATOM   725  O OE2 . GLU A 1 93  ? -18.835 -24.948 38.963  1.00 53.86  ? 94  GLU A OE2 1 
ATOM   726  N N   . ASP A 1 94  ? -14.608 -27.209 43.060  1.00 44.51  ? 95  ASP A N   1 
ATOM   727  C CA  . ASP A 1 94  ? -13.559 -26.920 44.044  1.00 42.99  ? 95  ASP A CA  1 
ATOM   728  C C   . ASP A 1 94  ? -12.721 -28.177 44.154  1.00 41.01  ? 95  ASP A C   1 
ATOM   729  O O   . ASP A 1 94  ? -12.928 -28.996 45.051  1.00 41.15  ? 95  ASP A O   1 
ATOM   730  C CB  . ASP A 1 94  ? -14.200 -26.527 45.388  1.00 39.65  ? 95  ASP A CB  1 
ATOM   731  C CG  . ASP A 1 94  ? -13.193 -26.175 46.481  1.00 53.07  ? 95  ASP A CG  1 
ATOM   732  O OD1 . ASP A 1 94  ? -11.988 -26.520 46.396  1.00 46.79  ? 95  ASP A OD1 1 
ATOM   733  O OD2 . ASP A 1 94  ? -13.639 -25.547 47.466  1.00 53.24  ? 95  ASP A OD2 1 
ATOM   734  N N   . CYS A 1 95  ? -11.783 -28.362 43.230  1.00 43.85  ? 96  CYS A N   1 
ATOM   735  C CA  . CYS A 1 95  ? -11.137 -29.673 43.132  1.00 38.94  ? 96  CYS A CA  1 
ATOM   736  C C   . CYS A 1 95  ? -9.648  -29.601 42.899  1.00 35.04  ? 96  CYS A C   1 
ATOM   737  O O   . CYS A 1 95  ? -9.013  -30.618 42.632  1.00 41.40  ? 96  CYS A O   1 
ATOM   738  C CB  . CYS A 1 95  ? -11.770 -30.484 42.017  1.00 38.56  ? 96  CYS A CB  1 
ATOM   739  S SG  . CYS A 1 95  ? -11.526 -29.732 40.381  1.00 45.26  ? 96  CYS A SG  1 
ATOM   740  N N   . LEU A 1 96  ? -9.081  -28.410 42.982  1.00 37.14  ? 97  LEU A N   1 
ATOM   741  C CA  . LEU A 1 96  ? -7.692  -28.269 42.606  1.00 37.12  ? 97  LEU A CA  1 
ATOM   742  C C   . LEU A 1 96  ? -6.837  -28.517 43.833  1.00 38.87  ? 97  LEU A C   1 
ATOM   743  O O   . LEU A 1 96  ? -6.417  -27.584 44.521  1.00 38.54  ? 97  LEU A O   1 
ATOM   744  C CB  . LEU A 1 96  ? -7.440  -26.897 41.978  1.00 31.67  ? 97  LEU A CB  1 
ATOM   745  C CG  . LEU A 1 96  ? -8.087  -26.761 40.587  1.00 39.55  ? 97  LEU A CG  1 
ATOM   746  C CD1 . LEU A 1 96  ? -7.661  -25.462 39.857  1.00 39.40  ? 97  LEU A CD1 1 
ATOM   747  C CD2 . LEU A 1 96  ? -7.803  -27.965 39.674  1.00 32.61  ? 97  LEU A CD2 1 
ATOM   748  N N   . TYR A 1 97  ? -6.623  -29.799 44.122  1.00 35.10  ? 98  TYR A N   1 
ATOM   749  C CA  . TYR A 1 97  ? -5.813  -30.212 45.261  1.00 32.45  ? 98  TYR A CA  1 
ATOM   750  C C   . TYR A 1 97  ? -4.779  -31.175 44.749  1.00 36.52  ? 98  TYR A C   1 
ATOM   751  O O   . TYR A 1 97  ? -4.967  -31.785 43.683  1.00 39.25  ? 98  TYR A O   1 
ATOM   752  C CB  . TYR A 1 97  ? -6.677  -30.859 46.374  1.00 33.72  ? 98  TYR A CB  1 
ATOM   753  C CG  . TYR A 1 97  ? -7.704  -29.892 46.904  1.00 42.05  ? 98  TYR A CG  1 
ATOM   754  C CD1 . TYR A 1 97  ? -8.887  -29.649 46.201  1.00 38.22  ? 98  TYR A CD1 1 
ATOM   755  C CD2 . TYR A 1 97  ? -7.485  -29.194 48.097  1.00 41.78  ? 98  TYR A CD2 1 
ATOM   756  C CE1 . TYR A 1 97  ? -9.823  -28.749 46.665  1.00 42.73  ? 98  TYR A CE1 1 
ATOM   757  C CE2 . TYR A 1 97  ? -8.427  -28.303 48.584  1.00 36.81  ? 98  TYR A CE2 1 
ATOM   758  C CZ  . TYR A 1 97  ? -9.589  -28.082 47.864  1.00 45.83  ? 98  TYR A CZ  1 
ATOM   759  O OH  . TYR A 1 97  ? -10.520 -27.180 48.328  1.00 44.24  ? 98  TYR A OH  1 
ATOM   760  N N   . LEU A 1 98  ? -3.661  -31.272 45.467  1.00 34.94  ? 99  LEU A N   1 
ATOM   761  C CA  . LEU A 1 98  ? -2.641  -32.252 45.123  1.00 34.79  ? 99  LEU A CA  1 
ATOM   762  C C   . LEU A 1 98  ? -2.234  -33.005 46.393  1.00 37.43  ? 99  LEU A C   1 
ATOM   763  O O   . LEU A 1 98  ? -2.610  -32.625 47.523  1.00 37.70  ? 99  LEU A O   1 
ATOM   764  C CB  . LEU A 1 98  ? -1.433  -31.585 44.428  1.00 38.12  ? 99  LEU A CB  1 
ATOM   765  C CG  . LEU A 1 98  ? -0.700  -30.410 45.097  1.00 42.74  ? 99  LEU A CG  1 
ATOM   766  C CD1 . LEU A 1 98  ? 0.226   -30.899 46.193  1.00 36.95  ? 99  LEU A CD1 1 
ATOM   767  C CD2 . LEU A 1 98  ? 0.086   -29.589 44.093  1.00 38.60  ? 99  LEU A CD2 1 
ATOM   768  N N   . ASN A 1 99  ? -1.484  -34.083 46.184  1.00 36.59  ? 100 ASN A N   1 
ATOM   769  C CA  . ASN A 1 99  ? -1.164  -35.045 47.218  1.00 41.26  ? 100 ASN A CA  1 
ATOM   770  C C   . ASN A 1 99  ? 0.311   -35.322 47.187  1.00 39.23  ? 100 ASN A C   1 
ATOM   771  O O   . ASN A 1 99  ? 0.894   -35.428 46.099  1.00 40.63  ? 100 ASN A O   1 
ATOM   772  C CB  . ASN A 1 99  ? -1.944  -36.354 47.013  1.00 37.91  ? 100 ASN A CB  1 
ATOM   773  C CG  . ASN A 1 99  ? -3.352  -36.108 46.516  1.00 42.54  ? 100 ASN A CG  1 
ATOM   774  O OD1 . ASN A 1 99  ? -4.219  -35.679 47.281  1.00 38.86  ? 100 ASN A OD1 1 
ATOM   775  N ND2 . ASN A 1 99  ? -3.584  -36.342 45.220  1.00 38.92  ? 100 ASN A ND2 1 
ATOM   776  N N   . VAL A 1 100 ? 0.905   -35.451 48.373  1.00 38.15  ? 101 VAL A N   1 
ATOM   777  C CA  . VAL A 1 100 ? 2.315   -35.812 48.507  1.00 39.53  ? 101 VAL A CA  1 
ATOM   778  C C   . VAL A 1 100 ? 2.441   -37.014 49.416  1.00 42.04  ? 101 VAL A C   1 
ATOM   779  O O   . VAL A 1 100 ? 1.983   -36.972 50.554  1.00 43.17  ? 101 VAL A O   1 
ATOM   780  C CB  . VAL A 1 100 ? 3.173   -34.672 49.115  1.00 41.05  ? 101 VAL A CB  1 
ATOM   781  C CG1 . VAL A 1 100 ? 4.643   -35.028 49.089  1.00 31.33  ? 101 VAL A CG1 1 
ATOM   782  C CG2 . VAL A 1 100 ? 2.916   -33.351 48.421  1.00 30.72  ? 101 VAL A CG2 1 
ATOM   783  N N   . TRP A 1 101 ? 3.039   -38.080 48.897  1.00 41.87  ? 102 TRP A N   1 
ATOM   784  C CA  . TRP A 1 101 ? 3.506   -39.202 49.710  1.00 36.87  ? 102 TRP A CA  1 
ATOM   785  C C   . TRP A 1 101 ? 5.009   -39.116 49.869  1.00 44.46  ? 102 TRP A C   1 
ATOM   786  O O   . TRP A 1 101 ? 5.718   -38.769 48.923  1.00 43.25  ? 102 TRP A O   1 
ATOM   787  C CB  . TRP A 1 101 ? 3.184   -40.558 49.076  1.00 38.91  ? 102 TRP A CB  1 
ATOM   788  C CG  . TRP A 1 101 ? 1.747   -40.918 48.968  1.00 39.85  ? 102 TRP A CG  1 
ATOM   789  C CD1 . TRP A 1 101 ? 1.042   -41.716 49.808  1.00 41.74  ? 102 TRP A CD1 1 
ATOM   790  C CD2 . TRP A 1 101 ? 0.843   -40.511 47.947  1.00 36.12  ? 102 TRP A CD2 1 
ATOM   791  N NE1 . TRP A 1 101 ? -0.250  -41.830 49.378  1.00 45.73  ? 102 TRP A NE1 1 
ATOM   792  C CE2 . TRP A 1 101 ? -0.399  -41.104 48.231  1.00 37.93  ? 102 TRP A CE2 1 
ATOM   793  C CE3 . TRP A 1 101 ? 0.964   -39.708 46.820  1.00 36.88  ? 102 TRP A CE3 1 
ATOM   794  C CZ2 . TRP A 1 101 ? -1.519  -40.915 47.429  1.00 43.27  ? 102 TRP A CZ2 1 
ATOM   795  C CZ3 . TRP A 1 101 ? -0.149  -39.521 46.013  1.00 36.22  ? 102 TRP A CZ3 1 
ATOM   796  C CH2 . TRP A 1 101 ? -1.375  -40.117 46.325  1.00 41.97  ? 102 TRP A CH2 1 
ATOM   797  N N   . THR A 1 102 ? 5.503   -39.489 51.043  1.00 44.39  ? 103 THR A N   1 
ATOM   798  C CA  . THR A 1 102 ? 6.927   -39.415 51.320  1.00 40.96  ? 103 THR A CA  1 
ATOM   799  C C   . THR A 1 102 ? 7.281   -40.488 52.346  1.00 38.11  ? 103 THR A C   1 
ATOM   800  O O   . THR A 1 102 ? 6.403   -40.944 53.072  1.00 47.62  ? 103 THR A O   1 
ATOM   801  C CB  . THR A 1 102 ? 7.301   -38.014 51.832  1.00 45.35  ? 103 THR A CB  1 
ATOM   802  O OG1 . THR A 1 102 ? 8.680   -37.774 51.572  1.00 58.51  ? 103 THR A OG1 1 
ATOM   803  C CG2 . THR A 1 102 ? 7.028   -37.894 53.337  1.00 40.70  ? 103 THR A CG2 1 
ATOM   804  N N   . PRO A 1 103 ? 8.541   -40.944 52.372  1.00 38.47  ? 104 PRO A N   1 
ATOM   805  C CA  . PRO A 1 103 ? 8.940   -41.929 53.391  1.00 44.62  ? 104 PRO A CA  1 
ATOM   806  C C   . PRO A 1 103 ? 8.724   -41.463 54.829  1.00 54.46  ? 104 PRO A C   1 
ATOM   807  O O   . PRO A 1 103 ? 8.649   -40.266 55.112  1.00 53.40  ? 104 PRO A O   1 
ATOM   808  C CB  . PRO A 1 103 ? 10.429  -42.123 53.124  1.00 43.82  ? 104 PRO A CB  1 
ATOM   809  C CG  . PRO A 1 103 ? 10.536  -41.895 51.605  1.00 44.46  ? 104 PRO A CG  1 
ATOM   810  C CD  . PRO A 1 103 ? 9.595   -40.740 51.361  1.00 36.02  ? 104 PRO A CD  1 
ATOM   811  N N   . TYR A 1 104 ? 8.592   -42.436 55.725  1.00 51.65  ? 105 TYR A N   1 
ATOM   812  C CA  . TYR A 1 104 ? 8.539   -42.186 57.160  1.00 53.91  ? 105 TYR A CA  1 
ATOM   813  C C   . TYR A 1 104 ? 9.755   -42.818 57.826  1.00 56.54  ? 105 TYR A C   1 
ATOM   814  O O   . TYR A 1 104 ? 10.027  -44.006 57.629  1.00 54.00  ? 105 TYR A O   1 
ATOM   815  C CB  . TYR A 1 104 ? 7.267   -42.747 57.759  1.00 47.92  ? 105 TYR A CB  1 
ATOM   816  C CG  . TYR A 1 104 ? 6.990   -42.319 59.175  1.00 55.26  ? 105 TYR A CG  1 
ATOM   817  C CD1 . TYR A 1 104 ? 7.627   -42.928 60.257  1.00 64.88  ? 105 TYR A CD1 1 
ATOM   818  C CD2 . TYR A 1 104 ? 6.051   -41.334 59.437  1.00 58.45  ? 105 TYR A CD2 1 
ATOM   819  C CE1 . TYR A 1 104 ? 7.343   -42.538 61.569  1.00 60.83  ? 105 TYR A CE1 1 
ATOM   820  C CE2 . TYR A 1 104 ? 5.759   -40.942 60.719  1.00 60.40  ? 105 TYR A CE2 1 
ATOM   821  C CZ  . TYR A 1 104 ? 6.402   -41.540 61.787  1.00 66.88  ? 105 TYR A CZ  1 
ATOM   822  O OH  . TYR A 1 104 ? 6.090   -41.124 63.061  1.00 59.31  ? 105 TYR A OH  1 
ATOM   823  N N   . PRO A 1 105 ? 10.514  -42.017 58.582  1.00 57.69  ? 106 PRO A N   1 
ATOM   824  C CA  . PRO A 1 105 ? 10.296  -40.579 58.749  1.00 61.64  ? 106 PRO A CA  1 
ATOM   825  C C   . PRO A 1 105 ? 10.725  -39.804 57.488  1.00 52.80  ? 106 PRO A C   1 
ATOM   826  O O   . PRO A 1 105 ? 11.467  -40.380 56.697  1.00 47.57  ? 106 PRO A O   1 
ATOM   827  C CB  . PRO A 1 105 ? 11.187  -40.245 59.941  1.00 54.46  ? 106 PRO A CB  1 
ATOM   828  C CG  . PRO A 1 105 ? 12.335  -41.190 59.788  1.00 52.23  ? 106 PRO A CG  1 
ATOM   829  C CD  . PRO A 1 105 ? 11.753  -42.464 59.242  1.00 54.26  ? 106 PRO A CD  1 
ATOM   830  N N   . ARG A 1 106 ? 10.278  -38.556 57.313  1.00 54.22  ? 107 ARG A N   1 
ATOM   831  C CA  . ARG A 1 106 ? 10.604  -37.773 56.111  1.00 58.93  ? 107 ARG A CA  1 
ATOM   832  C C   . ARG A 1 106 ? 12.082  -37.729 55.860  1.00 60.03  ? 107 ARG A C   1 
ATOM   833  O O   . ARG A 1 106 ? 12.871  -37.610 56.790  1.00 66.78  ? 107 ARG A O   1 
ATOM   834  C CB  . ARG A 1 106 ? 10.069  -36.347 56.205  1.00 56.09  ? 107 ARG A CB  1 
ATOM   835  C CG  . ARG A 1 106 ? 8.582   -36.304 56.537  1.00 70.72  ? 107 ARG A CG  1 
ATOM   836  C CD  . ARG A 1 106 ? 7.941   -35.051 55.985  1.00 71.18  ? 107 ARG A CD  1 
ATOM   837  N NE  . ARG A 1 106 ? 8.717   -33.845 56.285  1.00 61.69  ? 107 ARG A NE  1 
ATOM   838  C CZ  . ARG A 1 106 ? 8.444   -33.027 57.295  1.00 60.53  ? 107 ARG A CZ  1 
ATOM   839  N NH1 . ARG A 1 106 ? 7.426   -33.294 58.108  1.00 60.23  ? 107 ARG A NH1 1 
ATOM   840  N NH2 . ARG A 1 106 ? 9.180   -31.942 57.492  1.00 69.08  ? 107 ARG A NH2 1 
ATOM   841  N N   . PRO A 1 107 ? 12.463  -37.848 54.586  1.00 53.75  ? 108 PRO A N   1 
ATOM   842  C CA  . PRO A 1 107 ? 13.880  -37.862 54.216  1.00 62.19  ? 108 PRO A CA  1 
ATOM   843  C C   . PRO A 1 107 ? 14.567  -36.589 54.697  1.00 66.23  ? 108 PRO A C   1 
ATOM   844  O O   . PRO A 1 107 ? 13.918  -35.539 54.780  1.00 60.10  ? 108 PRO A O   1 
ATOM   845  C CB  . PRO A 1 107 ? 13.852  -37.942 52.680  1.00 61.96  ? 108 PRO A CB  1 
ATOM   846  C CG  . PRO A 1 107 ? 12.478  -38.492 52.335  1.00 50.71  ? 108 PRO A CG  1 
ATOM   847  C CD  . PRO A 1 107 ? 11.566  -37.968 53.421  1.00 52.08  ? 108 PRO A CD  1 
ATOM   848  N N   . THR A 1 108 ? 15.851  -36.680 55.028  1.00 65.90  ? 109 THR A N   1 
ATOM   849  C CA  . THR A 1 108 ? 16.573  -35.502 55.498  1.00 70.86  ? 109 THR A CA  1 
ATOM   850  C C   . THR A 1 108 ? 17.585  -35.071 54.467  1.00 73.16  ? 109 THR A C   1 
ATOM   851  O O   . THR A 1 108 ? 18.284  -34.071 54.660  1.00 74.17  ? 109 THR A O   1 
ATOM   852  C CB  . THR A 1 108 ? 17.285  -35.746 56.845  1.00 66.92  ? 109 THR A CB  1 
ATOM   853  O OG1 . THR A 1 108 ? 18.030  -36.975 56.785  1.00 76.69  ? 109 THR A OG1 1 
ATOM   854  C CG2 . THR A 1 108 ? 16.270  -35.804 57.978  1.00 56.25  ? 109 THR A CG2 1 
ATOM   855  N N   . SER A 1 109 ? 17.659  -35.839 53.380  1.00 67.90  ? 110 SER A N   1 
ATOM   856  C CA  . SER A 1 109 ? 18.458  -35.475 52.210  1.00 64.35  ? 110 SER A CA  1 
ATOM   857  C C   . SER A 1 109 ? 17.565  -35.523 50.974  1.00 66.04  ? 110 SER A C   1 
ATOM   858  O O   . SER A 1 109 ? 16.652  -36.344 50.910  1.00 57.21  ? 110 SER A O   1 
ATOM   859  C CB  . SER A 1 109 ? 19.663  -36.410 52.055  1.00 57.39  ? 110 SER A CB  1 
ATOM   860  O OG  . SER A 1 109 ? 19.320  -37.733 52.418  1.00 73.35  ? 110 SER A OG  1 
ATOM   861  N N   . PRO A 1 110 ? 17.819  -34.641 49.992  1.00 60.43  ? 111 PRO A N   1 
ATOM   862  C CA  . PRO A 1 110 ? 16.977  -34.530 48.791  1.00 67.21  ? 111 PRO A CA  1 
ATOM   863  C C   . PRO A 1 110 ? 16.706  -35.879 48.129  1.00 60.05  ? 111 PRO A C   1 
ATOM   864  O O   . PRO A 1 110 ? 17.641  -36.589 47.767  1.00 57.58  ? 111 PRO A O   1 
ATOM   865  C CB  . PRO A 1 110 ? 17.798  -33.627 47.868  1.00 52.30  ? 111 PRO A CB  1 
ATOM   866  C CG  . PRO A 1 110 ? 18.657  -32.824 48.800  1.00 59.61  ? 111 PRO A CG  1 
ATOM   867  C CD  . PRO A 1 110 ? 19.011  -33.782 49.902  1.00 53.66  ? 111 PRO A CD  1 
ATOM   868  N N   . THR A 1 111 ? 15.423  -36.214 48.021  1.00 53.15  ? 112 THR A N   1 
ATOM   869  C CA  . THR A 1 111 ? 14.931  -37.465 47.450  1.00 58.55  ? 112 THR A CA  1 
ATOM   870  C C   . THR A 1 111 ? 14.300  -37.181 46.072  1.00 49.28  ? 112 THR A C   1 
ATOM   871  O O   . THR A 1 111 ? 13.577  -36.199 45.934  1.00 50.01  ? 112 THR A O   1 
ATOM   872  C CB  . THR A 1 111 ? 13.886  -38.092 48.391  1.00 65.58  ? 112 THR A CB  1 
ATOM   873  O OG1 . THR A 1 111 ? 14.448  -38.239 49.696  1.00 67.16  ? 112 THR A OG1 1 
ATOM   874  C CG2 . THR A 1 111 ? 13.423  -39.433 47.899  1.00 54.16  ? 112 THR A CG2 1 
ATOM   875  N N   . PRO A 1 112 ? 14.580  -38.014 45.054  1.00 50.43  ? 113 PRO A N   1 
ATOM   876  C CA  . PRO A 1 112 ? 13.995  -37.780 43.718  1.00 46.59  ? 113 PRO A CA  1 
ATOM   877  C C   . PRO A 1 112 ? 12.469  -37.844 43.726  1.00 44.55  ? 113 PRO A C   1 
ATOM   878  O O   . PRO A 1 112 ? 11.866  -38.620 44.488  1.00 44.51  ? 113 PRO A O   1 
ATOM   879  C CB  . PRO A 1 112 ? 14.577  -38.912 42.879  1.00 45.19  ? 113 PRO A CB  1 
ATOM   880  C CG  . PRO A 1 112 ? 14.844  -39.995 43.866  1.00 61.48  ? 113 PRO A CG  1 
ATOM   881  C CD  . PRO A 1 112 ? 15.321  -39.285 45.102  1.00 52.63  ? 113 PRO A CD  1 
ATOM   882  N N   . VAL A 1 113 ? 11.848  -37.003 42.905  1.00 43.66  ? 114 VAL A N   1 
ATOM   883  C CA  . VAL A 1 113 ? 10.401  -36.828 42.933  1.00 35.34  ? 114 VAL A CA  1 
ATOM   884  C C   . VAL A 1 113 ? 9.719   -37.380 41.680  1.00 40.77  ? 114 VAL A C   1 
ATOM   885  O O   . VAL A 1 113 ? 10.115  -37.073 40.564  1.00 45.07  ? 114 VAL A O   1 
ATOM   886  C CB  . VAL A 1 113 ? 10.046  -35.343 43.080  1.00 35.79  ? 114 VAL A CB  1 
ATOM   887  C CG1 . VAL A 1 113 ? 8.522   -35.142 43.081  1.00 30.66  ? 114 VAL A CG1 1 
ATOM   888  C CG2 . VAL A 1 113 ? 10.692  -34.780 44.374  1.00 34.23  ? 114 VAL A CG2 1 
ATOM   889  N N   . LEU A 1 114 ? 8.708   -38.213 41.880  1.00 48.17  ? 115 LEU A N   1 
ATOM   890  C CA  . LEU A 1 114 ? 7.851   -38.688 40.801  1.00 43.20  ? 115 LEU A CA  1 
ATOM   891  C C   . LEU A 1 114 ? 6.550   -37.905 40.798  1.00 36.80  ? 115 LEU A C   1 
ATOM   892  O O   . LEU A 1 114 ? 5.913   -37.767 41.840  1.00 44.98  ? 115 LEU A O   1 
ATOM   893  C CB  . LEU A 1 114 ? 7.559   -40.179 40.960  1.00 39.99  ? 115 LEU A CB  1 
ATOM   894  C CG  . LEU A 1 114 ? 8.684   -41.069 40.443  1.00 44.62  ? 115 LEU A CG  1 
ATOM   895  C CD1 . LEU A 1 114 ? 8.555   -42.424 41.034  1.00 45.29  ? 115 LEU A CD1 1 
ATOM   896  C CD2 . LEU A 1 114 ? 8.621   -41.133 38.905  1.00 45.71  ? 115 LEU A CD2 1 
ATOM   897  N N   . VAL A 1 115 ? 6.143   -37.378 39.652  1.00 33.94  ? 116 VAL A N   1 
ATOM   898  C CA  . VAL A 1 115 ? 4.861   -36.676 39.603  1.00 31.18  ? 116 VAL A CA  1 
ATOM   899  C C   . VAL A 1 115 ? 3.909   -37.350 38.640  1.00 39.29  ? 116 VAL A C   1 
ATOM   900  O O   . VAL A 1 115 ? 4.207   -37.493 37.457  1.00 40.35  ? 116 VAL A O   1 
ATOM   901  C CB  . VAL A 1 115 ? 5.022   -35.203 39.198  1.00 34.83  ? 116 VAL A CB  1 
ATOM   902  C CG1 . VAL A 1 115 ? 3.640   -34.524 39.130  1.00 27.69  ? 116 VAL A CG1 1 
ATOM   903  C CG2 . VAL A 1 115 ? 5.928   -34.479 40.183  1.00 32.68  ? 116 VAL A CG2 1 
ATOM   904  N N   . TRP A 1 116 ? 2.764   -37.762 39.172  1.00 41.68  ? 117 TRP A N   1 
ATOM   905  C CA  . TRP A 1 116 ? 1.785   -38.523 38.431  1.00 34.45  ? 117 TRP A CA  1 
ATOM   906  C C   . TRP A 1 116 ? 0.692   -37.646 37.829  1.00 41.91  ? 117 TRP A C   1 
ATOM   907  O O   . TRP A 1 116 ? 0.102   -36.825 38.530  1.00 35.48  ? 117 TRP A O   1 
ATOM   908  C CB  . TRP A 1 116 ? 1.156   -39.588 39.347  1.00 33.35  ? 117 TRP A CB  1 
ATOM   909  C CG  . TRP A 1 116 ? 0.040   -40.333 38.674  1.00 38.32  ? 117 TRP A CG  1 
ATOM   910  C CD1 . TRP A 1 116 ? -1.292  -40.208 38.928  1.00 33.73  ? 117 TRP A CD1 1 
ATOM   911  C CD2 . TRP A 1 116 ? 0.155   -41.279 37.592  1.00 34.68  ? 117 TRP A CD2 1 
ATOM   912  N NE1 . TRP A 1 116 ? -2.014  -41.021 38.082  1.00 38.81  ? 117 TRP A NE1 1 
ATOM   913  C CE2 . TRP A 1 116 ? -1.151  -41.697 37.264  1.00 31.75  ? 117 TRP A CE2 1 
ATOM   914  C CE3 . TRP A 1 116 ? 1.239   -41.818 36.878  1.00 37.92  ? 117 TRP A CE3 1 
ATOM   915  C CZ2 . TRP A 1 116 ? -1.407  -42.642 36.263  1.00 37.90  ? 117 TRP A CZ2 1 
ATOM   916  C CZ3 . TRP A 1 116 ? 0.986   -42.761 35.889  1.00 37.50  ? 117 TRP A CZ3 1 
ATOM   917  C CH2 . TRP A 1 116 ? -0.329  -43.149 35.578  1.00 33.55  ? 117 TRP A CH2 1 
ATOM   918  N N   . ILE A 1 117 ? 0.422   -37.820 36.531  1.00 34.91  ? 118 ILE A N   1 
ATOM   919  C CA  . ILE A 1 117 ? -0.727  -37.156 35.910  1.00 34.56  ? 118 ILE A CA  1 
ATOM   920  C C   . ILE A 1 117 ? -1.710  -38.185 35.390  1.00 36.43  ? 118 ILE A C   1 
ATOM   921  O O   . ILE A 1 117 ? -1.378  -38.967 34.484  1.00 39.66  ? 118 ILE A O   1 
ATOM   922  C CB  . ILE A 1 117 ? -0.304  -36.269 34.753  1.00 42.71  ? 118 ILE A CB  1 
ATOM   923  C CG1 . ILE A 1 117 ? 0.777   -35.290 35.198  1.00 33.92  ? 118 ILE A CG1 1 
ATOM   924  C CG2 . ILE A 1 117 ? -1.514  -35.562 34.132  1.00 34.98  ? 118 ILE A CG2 1 
ATOM   925  C CD1 . ILE A 1 117 ? 1.254   -34.404 34.040  1.00 41.06  ? 118 ILE A CD1 1 
ATOM   926  N N   . TYR A 1 118 ? -2.918  -38.207 35.934  1.00 33.69  ? 119 TYR A N   1 
ATOM   927  C CA  . TYR A 1 118 ? -3.836  -39.276 35.541  1.00 36.66  ? 119 TYR A CA  1 
ATOM   928  C C   . TYR A 1 118 ? -4.371  -39.079 34.127  1.00 35.66  ? 119 TYR A C   1 
ATOM   929  O O   . TYR A 1 118 ? -4.405  -37.952 33.638  1.00 35.36  ? 119 TYR A O   1 
ATOM   930  C CB  . TYR A 1 118 ? -5.022  -39.393 36.518  1.00 36.37  ? 119 TYR A CB  1 
ATOM   931  C CG  . TYR A 1 118 ? -5.844  -38.131 36.720  1.00 34.26  ? 119 TYR A CG  1 
ATOM   932  C CD1 . TYR A 1 118 ? -6.714  -37.651 35.732  1.00 36.62  ? 119 TYR A CD1 1 
ATOM   933  C CD2 . TYR A 1 118 ? -5.795  -37.457 37.928  1.00 36.40  ? 119 TYR A CD2 1 
ATOM   934  C CE1 . TYR A 1 118 ? -7.473  -36.491 35.944  1.00 32.33  ? 119 TYR A CE1 1 
ATOM   935  C CE2 . TYR A 1 118 ? -6.541  -36.298 38.151  1.00 32.95  ? 119 TYR A CE2 1 
ATOM   936  C CZ  . TYR A 1 118 ? -7.362  -35.819 37.175  1.00 40.87  ? 119 TYR A CZ  1 
ATOM   937  O OH  . TYR A 1 118 ? -8.078  -34.664 37.441  1.00 39.99  ? 119 TYR A OH  1 
ATOM   938  N N   . GLY A 1 119 ? -4.837  -40.168 33.507  1.00 32.66  ? 120 GLY A N   1 
ATOM   939  C CA  . GLY A 1 119 ? -5.585  -40.086 32.251  1.00 37.12  ? 120 GLY A CA  1 
ATOM   940  C C   . GLY A 1 119 ? -7.099  -40.112 32.430  1.00 40.58  ? 120 GLY A C   1 
ATOM   941  O O   . GLY A 1 119 ? -7.596  -39.924 33.554  1.00 44.63  ? 120 GLY A O   1 
ATOM   942  N N   . GLY A 1 120 ? -7.827  -40.360 31.339  1.00 43.27  ? 121 GLY A N   1 
ATOM   943  C CA  . GLY A 1 120 ? -9.290  -40.306 31.307  1.00 30.21  ? 121 GLY A CA  1 
ATOM   944  C C   . GLY A 1 120 ? -9.825  -39.435 30.171  1.00 36.10  ? 121 GLY A C   1 
ATOM   945  O O   . GLY A 1 120 ? -10.844 -38.757 30.318  1.00 35.91  ? 121 GLY A O   1 
ATOM   946  N N   . GLY A 1 121 ? -9.114  -39.428 29.037  1.00 41.62  ? 122 GLY A N   1 
ATOM   947  C CA  . GLY A 1 121 ? -9.574  -38.788 27.805  1.00 37.42  ? 122 GLY A CA  1 
ATOM   948  C C   . GLY A 1 121 ? -9.752  -37.293 27.938  1.00 39.24  ? 122 GLY A C   1 
ATOM   949  O O   . GLY A 1 121 ? -10.438 -36.677 27.146  1.00 36.37  ? 122 GLY A O   1 
ATOM   950  N N   . PHE A 1 122 ? -9.155  -36.711 28.973  1.00 37.14  ? 123 PHE A N   1 
ATOM   951  C CA  . PHE A 1 122 ? -9.368  -35.294 29.287  1.00 34.67  ? 123 PHE A CA  1 
ATOM   952  C C   . PHE A 1 122 ? -10.819 -34.996 29.657  1.00 39.72  ? 123 PHE A C   1 
ATOM   953  O O   . PHE A 1 122 ? -11.206 -33.826 29.736  1.00 36.17  ? 123 PHE A O   1 
ATOM   954  C CB  . PHE A 1 122 ? -8.952  -34.385 28.108  1.00 36.52  ? 123 PHE A CB  1 
ATOM   955  C CG  . PHE A 1 122 ? -7.475  -34.376 27.825  1.00 37.26  ? 123 PHE A CG  1 
ATOM   956  C CD1 . PHE A 1 122 ? -6.577  -33.832 28.737  1.00 39.87  ? 123 PHE A CD1 1 
ATOM   957  C CD2 . PHE A 1 122 ? -6.983  -34.885 26.628  1.00 41.39  ? 123 PHE A CD2 1 
ATOM   958  C CE1 . PHE A 1 122 ? -5.213  -33.812 28.462  1.00 40.11  ? 123 PHE A CE1 1 
ATOM   959  C CE2 . PHE A 1 122 ? -5.622  -34.864 26.348  1.00 37.30  ? 123 PHE A CE2 1 
ATOM   960  C CZ  . PHE A 1 122 ? -4.738  -34.328 27.267  1.00 38.26  ? 123 PHE A CZ  1 
ATOM   961  N N   . TYR A 1 123 ? -11.634 -36.028 29.885  1.00 35.54  ? 124 TYR A N   1 
ATOM   962  C CA  . TYR A 1 123 ? -13.021 -35.774 30.287  1.00 42.36  ? 124 TYR A CA  1 
ATOM   963  C C   . TYR A 1 123 ? -13.294 -36.382 31.663  1.00 40.16  ? 124 TYR A C   1 
ATOM   964  O O   . TYR A 1 123 ? -14.383 -36.224 32.213  1.00 43.28  ? 124 TYR A O   1 
ATOM   965  C CB  . TYR A 1 123 ? -14.034 -36.313 29.248  1.00 34.13  ? 124 TYR A CB  1 
ATOM   966  C CG  . TYR A 1 123 ? -14.022 -37.813 29.097  1.00 40.06  ? 124 TYR A CG  1 
ATOM   967  C CD1 . TYR A 1 123 ? -14.713 -38.630 29.989  1.00 42.96  ? 124 TYR A CD1 1 
ATOM   968  C CD2 . TYR A 1 123 ? -13.329 -38.423 28.057  1.00 44.21  ? 124 TYR A CD2 1 
ATOM   969  C CE1 . TYR A 1 123 ? -14.680 -40.014 29.871  1.00 41.49  ? 124 TYR A CE1 1 
ATOM   970  C CE2 . TYR A 1 123 ? -13.308 -39.809 27.922  1.00 49.23  ? 124 TYR A CE2 1 
ATOM   971  C CZ  . TYR A 1 123 ? -13.983 -40.596 28.834  1.00 54.17  ? 124 TYR A CZ  1 
ATOM   972  O OH  . TYR A 1 123 ? -13.971 -41.966 28.704  1.00 72.13  ? 124 TYR A OH  1 
ATOM   973  N N   . SER A 1 124 ? -12.303 -37.067 32.220  1.00 37.75  ? 125 SER A N   1 
ATOM   974  C CA  . SER A 1 124 ? -12.499 -37.778 33.474  1.00 39.44  ? 125 SER A CA  1 
ATOM   975  C C   . SER A 1 124 ? -11.188 -38.086 34.194  1.00 39.97  ? 125 SER A C   1 
ATOM   976  O O   . SER A 1 124 ? -10.110 -37.834 33.661  1.00 40.87  ? 125 SER A O   1 
ATOM   977  C CB  . SER A 1 124 ? -13.247 -39.080 33.200  1.00 39.58  ? 125 SER A CB  1 
ATOM   978  O OG  . SER A 1 124 ? -12.402 -39.990 32.540  1.00 37.76  ? 125 SER A OG  1 
ATOM   979  N N   . GLY A 1 125 ? -11.290 -38.682 35.383  1.00 30.49  ? 126 GLY A N   1 
ATOM   980  C CA  . GLY A 1 125 ? -10.123 -39.093 36.148  1.00 35.25  ? 126 GLY A CA  1 
ATOM   981  C C   . GLY A 1 125 ? -10.024 -38.369 37.485  1.00 33.46  ? 126 GLY A C   1 
ATOM   982  O O   . GLY A 1 125 ? -10.680 -37.355 37.702  1.00 33.52  ? 126 GLY A O   1 
ATOM   983  N N   . ALA A 1 126 ? -9.178  -38.876 38.369  1.00 29.74  ? 127 ALA A N   1 
ATOM   984  C CA  . ALA A 1 126 ? -8.960  -38.263 39.690  1.00 42.24  ? 127 ALA A CA  1 
ATOM   985  C C   . ALA A 1 126 ? -7.679  -38.801 40.303  1.00 36.82  ? 127 ALA A C   1 
ATOM   986  O O   . ALA A 1 126 ? -7.323  -39.971 40.085  1.00 39.05  ? 127 ALA A O   1 
ATOM   987  C CB  . ALA A 1 126 ? -10.124 -38.533 40.630  1.00 35.77  ? 127 ALA A CB  1 
ATOM   988  N N   . SER A 1 127 ? -6.978  -37.977 41.076  1.00 36.10  ? 128 SER A N   1 
ATOM   989  C CA  . SER A 1 127 ? -5.771  -38.473 41.747  1.00 40.17  ? 128 SER A CA  1 
ATOM   990  C C   . SER A 1 127 ? -6.087  -39.405 42.942  1.00 42.58  ? 128 SER A C   1 
ATOM   991  O O   . SER A 1 127 ? -5.165  -40.010 43.527  1.00 40.90  ? 128 SER A O   1 
ATOM   992  C CB  . SER A 1 127 ? -4.897  -37.299 42.208  1.00 40.94  ? 128 SER A CB  1 
ATOM   993  O OG  . SER A 1 127 ? -5.603  -36.459 43.116  1.00 43.35  ? 128 SER A OG  1 
ATOM   994  N N   . SER A 1 128 ? -7.373  -39.556 43.282  1.00 38.61  ? 129 SER A N   1 
ATOM   995  C CA  . SER A 1 128 ? -7.758  -40.320 44.487  1.00 43.08  ? 129 SER A CA  1 
ATOM   996  C C   . SER A 1 128 ? -8.151  -41.763 44.243  1.00 48.03  ? 129 SER A C   1 
ATOM   997  O O   . SER A 1 128 ? -8.447  -42.485 45.195  1.00 41.72  ? 129 SER A O   1 
ATOM   998  C CB  . SER A 1 128 ? -8.917  -39.652 45.210  1.00 34.78  ? 129 SER A CB  1 
ATOM   999  O OG  . SER A 1 128 ? -9.959  -39.316 44.310  1.00 41.02  ? 129 SER A OG  1 
ATOM   1000 N N   . LEU A 1 129 ? -8.168  -42.190 42.984  1.00 45.95  ? 130 LEU A N   1 
ATOM   1001 C CA  . LEU A 1 129 ? -8.515  -43.577 42.690  1.00 38.54  ? 130 LEU A CA  1 
ATOM   1002 C C   . LEU A 1 129 ? -7.534  -44.506 43.398  1.00 38.91  ? 130 LEU A C   1 
ATOM   1003 O O   . LEU A 1 129 ? -6.344  -44.207 43.471  1.00 41.40  ? 130 LEU A O   1 
ATOM   1004 C CB  . LEU A 1 129 ? -8.508  -43.837 41.174  1.00 36.11  ? 130 LEU A CB  1 
ATOM   1005 C CG  . LEU A 1 129 ? -9.362  -42.910 40.314  1.00 45.36  ? 130 LEU A CG  1 
ATOM   1006 C CD1 . LEU A 1 129 ? -9.358  -43.373 38.853  1.00 37.87  ? 130 LEU A CD1 1 
ATOM   1007 C CD2 . LEU A 1 129 ? -10.782 -42.781 40.840  1.00 39.06  ? 130 LEU A CD2 1 
ATOM   1008 N N   . ASP A 1 130 ? -8.039  -45.624 43.910  1.00 44.92  ? 131 ASP A N   1 
ATOM   1009 C CA  . ASP A 1 130 ? -7.213  -46.615 44.587  1.00 38.85  ? 131 ASP A CA  1 
ATOM   1010 C C   . ASP A 1 130 ? -6.008  -47.019 43.774  1.00 40.05  ? 131 ASP A C   1 
ATOM   1011 O O   . ASP A 1 130 ? -4.948  -47.299 44.311  1.00 45.73  ? 131 ASP A O   1 
ATOM   1012 C CB  . ASP A 1 130 ? -8.019  -47.887 44.896  1.00 46.58  ? 131 ASP A CB  1 
ATOM   1013 C CG  . ASP A 1 130 ? -9.205  -47.636 45.813  1.00 58.96  ? 131 ASP A CG  1 
ATOM   1014 O OD1 . ASP A 1 130 ? -9.319  -46.532 46.391  1.00 43.61  ? 131 ASP A OD1 1 
ATOM   1015 O OD2 . ASP A 1 130 ? -10.031 -48.565 45.952  1.00 63.18  ? 131 ASP A OD2 1 
ATOM   1016 N N   . VAL A 1 131 ? -6.171  -47.075 42.463  1.00 40.64  ? 132 VAL A N   1 
ATOM   1017 C CA  . VAL A 1 131 ? -5.130  -47.657 41.652  1.00 37.80  ? 132 VAL A CA  1 
ATOM   1018 C C   . VAL A 1 131 ? -3.936  -46.688 41.503  1.00 33.84  ? 132 VAL A C   1 
ATOM   1019 O O   . VAL A 1 131 ? -2.880  -47.085 41.029  1.00 42.13  ? 132 VAL A O   1 
ATOM   1020 C CB  . VAL A 1 131 ? -5.719  -48.097 40.287  1.00 44.64  ? 132 VAL A CB  1 
ATOM   1021 C CG1 . VAL A 1 131 ? -5.820  -46.927 39.337  1.00 35.33  ? 132 VAL A CG1 1 
ATOM   1022 C CG2 . VAL A 1 131 ? -4.931  -49.244 39.701  1.00 41.02  ? 132 VAL A CG2 1 
ATOM   1023 N N   . TYR A 1 132 ? -4.088  -45.445 41.966  1.00 40.78  ? 133 TYR A N   1 
ATOM   1024 C CA  . TYR A 1 132 ? -3.005  -44.461 41.940  1.00 35.76  ? 133 TYR A CA  1 
ATOM   1025 C C   . TYR A 1 132 ? -2.397  -44.208 43.349  1.00 39.37  ? 133 TYR A C   1 
ATOM   1026 O O   . TYR A 1 132 ? -1.731  -43.189 43.582  1.00 39.66  ? 133 TYR A O   1 
ATOM   1027 C CB  . TYR A 1 132 ? -3.497  -43.123 41.371  1.00 32.83  ? 133 TYR A CB  1 
ATOM   1028 C CG  . TYR A 1 132 ? -4.167  -43.164 40.011  1.00 37.38  ? 133 TYR A CG  1 
ATOM   1029 C CD1 . TYR A 1 132 ? -3.793  -44.093 39.038  1.00 34.48  ? 133 TYR A CD1 1 
ATOM   1030 C CD2 . TYR A 1 132 ? -5.185  -42.263 39.702  1.00 34.19  ? 133 TYR A CD2 1 
ATOM   1031 C CE1 . TYR A 1 132 ? -4.413  -44.116 37.798  1.00 32.63  ? 133 TYR A CE1 1 
ATOM   1032 C CE2 . TYR A 1 132 ? -5.810  -42.280 38.474  1.00 34.10  ? 133 TYR A CE2 1 
ATOM   1033 C CZ  . TYR A 1 132 ? -5.423  -43.211 37.532  1.00 40.21  ? 133 TYR A CZ  1 
ATOM   1034 O OH  . TYR A 1 132 ? -6.047  -43.219 36.324  1.00 35.31  ? 133 TYR A OH  1 
ATOM   1035 N N   . ASP A 1 133 ? -2.656  -45.117 44.284  1.00 45.42  ? 134 ASP A N   1 
ATOM   1036 C CA  . ASP A 1 133 ? -2.200  -44.993 45.679  1.00 38.99  ? 134 ASP A CA  1 
ATOM   1037 C C   . ASP A 1 133 ? -0.673  -44.952 45.736  1.00 39.18  ? 134 ASP A C   1 
ATOM   1038 O O   . ASP A 1 133 ? -0.016  -45.938 45.423  1.00 38.39  ? 134 ASP A O   1 
ATOM   1039 C CB  . ASP A 1 133 ? -2.735  -46.177 46.499  1.00 43.21  ? 134 ASP A CB  1 
ATOM   1040 C CG  . ASP A 1 133 ? -2.501  -46.032 48.006  1.00 55.69  ? 134 ASP A CG  1 
ATOM   1041 O OD1 . ASP A 1 133 ? -1.675  -45.201 48.435  1.00 40.36  ? 134 ASP A OD1 1 
ATOM   1042 O OD2 . ASP A 1 133 ? -3.171  -46.776 48.764  1.00 63.29  ? 134 ASP A OD2 1 
ATOM   1043 N N   . GLY A 1 134 ? -0.100  -43.824 46.139  1.00 37.53  ? 135 GLY A N   1 
ATOM   1044 C CA  . GLY A 1 134 ? 1.346   -43.697 46.145  1.00 39.74  ? 135 GLY A CA  1 
ATOM   1045 C C   . GLY A 1 134 ? 2.150   -44.456 47.208  1.00 42.64  ? 135 GLY A C   1 
ATOM   1046 O O   . GLY A 1 134 ? 3.382   -44.513 47.126  1.00 37.89  ? 135 GLY A O   1 
ATOM   1047 N N   . ARG A 1 135 ? 1.481   -45.058 48.189  1.00 37.39  ? 136 ARG A N   1 
ATOM   1048 C CA  . ARG A 1 135 ? 2.187   -45.578 49.369  1.00 39.00  ? 136 ARG A CA  1 
ATOM   1049 C C   . ARG A 1 135 ? 3.196   -46.683 49.042  1.00 44.94  ? 136 ARG A C   1 
ATOM   1050 O O   . ARG A 1 135 ? 4.268   -46.723 49.645  1.00 41.34  ? 136 ARG A O   1 
ATOM   1051 C CB  . ARG A 1 135 ? 1.179   -46.076 50.427  1.00 41.57  ? 136 ARG A CB  1 
ATOM   1052 C CG  . ARG A 1 135 ? 0.522   -47.414 50.114  1.00 43.04  ? 136 ARG A CG  1 
ATOM   1053 C CD  . ARG A 1 135 ? -0.454  -47.819 51.195  1.00 46.21  ? 136 ARG A CD  1 
ATOM   1054 N NE  . ARG A 1 135 ? -1.654  -47.001 51.122  1.00 39.72  ? 136 ARG A NE  1 
ATOM   1055 C CZ  . ARG A 1 135 ? -2.548  -46.882 52.093  1.00 55.92  ? 136 ARG A CZ  1 
ATOM   1056 N NH1 . ARG A 1 135 ? -2.366  -47.501 53.273  1.00 48.24  ? 136 ARG A NH1 1 
ATOM   1057 N NH2 . ARG A 1 135 ? -3.605  -46.107 51.888  1.00 44.32  ? 136 ARG A NH2 1 
ATOM   1058 N N   . PHE A 1 136 ? 2.909   -47.550 48.072  1.00 41.35  ? 137 PHE A N   1 
ATOM   1059 C CA  . PHE A 1 136 ? 3.811   -48.695 47.840  1.00 35.79  ? 137 PHE A CA  1 
ATOM   1060 C C   . PHE A 1 136 ? 5.081   -48.299 47.092  1.00 45.84  ? 137 PHE A C   1 
ATOM   1061 O O   . PHE A 1 136 ? 6.152   -48.844 47.361  1.00 45.45  ? 137 PHE A O   1 
ATOM   1062 C CB  . PHE A 1 136 ? 3.104   -49.821 47.067  1.00 40.91  ? 137 PHE A CB  1 
ATOM   1063 C CG  . PHE A 1 136 ? 1.817   -50.261 47.687  1.00 39.16  ? 137 PHE A CG  1 
ATOM   1064 C CD1 . PHE A 1 136 ? 1.817   -51.099 48.795  1.00 46.17  ? 137 PHE A CD1 1 
ATOM   1065 C CD2 . PHE A 1 136 ? 0.607   -49.830 47.180  1.00 43.97  ? 137 PHE A CD2 1 
ATOM   1066 C CE1 . PHE A 1 136 ? 0.632   -51.489 49.385  1.00 37.89  ? 137 PHE A CE1 1 
ATOM   1067 C CE2 . PHE A 1 136 ? -0.586  -50.212 47.774  1.00 44.95  ? 137 PHE A CE2 1 
ATOM   1068 C CZ  . PHE A 1 136 ? -0.567  -51.045 48.880  1.00 41.48  ? 137 PHE A CZ  1 
ATOM   1069 N N   . LEU A 1 137 ? 4.964   -47.368 46.143  1.00 49.33  ? 138 LEU A N   1 
ATOM   1070 C CA  . LEU A 1 137 ? 6.135   -46.878 45.412  1.00 48.73  ? 138 LEU A CA  1 
ATOM   1071 C C   . LEU A 1 137 ? 7.087   -46.158 46.359  1.00 40.26  ? 138 LEU A C   1 
ATOM   1072 O O   . LEU A 1 137 ? 8.307   -46.346 46.335  1.00 44.65  ? 138 LEU A O   1 
ATOM   1073 C CB  . LEU A 1 137 ? 5.714   -45.917 44.304  1.00 36.14  ? 138 LEU A CB  1 
ATOM   1074 C CG  . LEU A 1 137 ? 5.897   -46.370 42.881  1.00 38.39  ? 138 LEU A CG  1 
ATOM   1075 C CD1 . LEU A 1 137 ? 5.116   -45.402 42.016  1.00 40.56  ? 138 LEU A CD1 1 
ATOM   1076 C CD2 . LEU A 1 137 ? 7.359   -46.327 42.586  1.00 41.46  ? 138 LEU A CD2 1 
ATOM   1077 N N   . VAL A 1 138 ? 6.505   -45.297 47.174  1.00 39.50  ? 139 VAL A N   1 
ATOM   1078 C CA  . VAL A 1 138 ? 7.281   -44.500 48.103  1.00 38.57  ? 139 VAL A CA  1 
ATOM   1079 C C   . VAL A 1 138 ? 8.016   -45.360 49.135  1.00 42.29  ? 139 VAL A C   1 
ATOM   1080 O O   . VAL A 1 138 ? 9.193   -45.129 49.387  1.00 41.45  ? 139 VAL A O   1 
ATOM   1081 C CB  . VAL A 1 138 ? 6.371   -43.484 48.757  1.00 44.11  ? 139 VAL A CB  1 
ATOM   1082 C CG1 . VAL A 1 138 ? 7.023   -42.845 49.956  1.00 36.94  ? 139 VAL A CG1 1 
ATOM   1083 C CG2 . VAL A 1 138 ? 6.013   -42.448 47.698  1.00 33.49  ? 139 VAL A CG2 1 
ATOM   1084 N N   . GLN A 1 139 ? 7.359   -46.378 49.692  1.00 48.59  ? 140 GLN A N   1 
ATOM   1085 C CA  . GLN A 1 139 ? 8.026   -47.225 50.677  1.00 39.34  ? 140 GLN A CA  1 
ATOM   1086 C C   . GLN A 1 139 ? 9.109   -48.059 50.007  1.00 50.00  ? 140 GLN A C   1 
ATOM   1087 O O   . GLN A 1 139 ? 10.237  -48.138 50.496  1.00 54.29  ? 140 GLN A O   1 
ATOM   1088 C CB  . GLN A 1 139 ? 7.027   -48.137 51.402  1.00 46.87  ? 140 GLN A CB  1 
ATOM   1089 C CG  . GLN A 1 139 ? 7.608   -48.847 52.649  1.00 38.72  ? 140 GLN A CG  1 
ATOM   1090 C CD  . GLN A 1 139 ? 8.447   -50.053 52.289  1.00 53.53  ? 140 GLN A CD  1 
ATOM   1091 O OE1 . GLN A 1 139 ? 8.067   -50.847 51.427  1.00 51.11  ? 140 GLN A OE1 1 
ATOM   1092 N NE2 . GLN A 1 139 ? 9.609   -50.188 52.929  1.00 45.32  ? 140 GLN A NE2 1 
ATOM   1093 N N   . ALA A 1 140 ? 8.779   -48.661 48.873  1.00 46.11  ? 141 ALA A N   1 
ATOM   1094 C CA  . ALA A 1 140 ? 9.692   -49.593 48.217  1.00 43.19  ? 141 ALA A CA  1 
ATOM   1095 C C   . ALA A 1 140 ? 10.892  -48.926 47.575  1.00 49.02  ? 141 ALA A C   1 
ATOM   1096 O O   . ALA A 1 140 ? 11.982  -49.490 47.562  1.00 48.24  ? 141 ALA A O   1 
ATOM   1097 C CB  . ALA A 1 140 ? 8.941   -50.410 47.163  1.00 51.38  ? 141 ALA A CB  1 
ATOM   1098 N N   . GLU A 1 141 ? 10.707  -47.740 47.010  1.00 42.02  ? 142 GLU A N   1 
ATOM   1099 C CA  . GLU A 1 141 ? 11.776  -47.177 46.198  1.00 43.79  ? 142 GLU A CA  1 
ATOM   1100 C C   . GLU A 1 141 ? 12.257  -45.826 46.718  1.00 45.61  ? 142 GLU A C   1 
ATOM   1101 O O   . GLU A 1 141 ? 13.154  -45.203 46.141  1.00 51.63  ? 142 GLU A O   1 
ATOM   1102 C CB  . GLU A 1 141 ? 11.315  -47.070 44.736  1.00 41.08  ? 142 GLU A CB  1 
ATOM   1103 C CG  . GLU A 1 141 ? 11.166  -48.430 44.052  1.00 44.17  ? 142 GLU A CG  1 
ATOM   1104 C CD  . GLU A 1 141 ? 12.489  -49.176 43.930  1.00 51.41  ? 142 GLU A CD  1 
ATOM   1105 O OE1 . GLU A 1 141 ? 13.558  -48.516 43.942  1.00 54.08  ? 142 GLU A OE1 1 
ATOM   1106 O OE2 . GLU A 1 141 ? 12.460  -50.425 43.812  1.00 49.34  ? 142 GLU A OE2 1 
ATOM   1107 N N   . ARG A 1 142 ? 11.646  -45.382 47.808  1.00 45.61  ? 143 ARG A N   1 
ATOM   1108 C CA  . ARG A 1 142 ? 12.106  -44.214 48.551  1.00 47.91  ? 143 ARG A CA  1 
ATOM   1109 C C   . ARG A 1 142 ? 12.209  -42.990 47.682  1.00 50.82  ? 143 ARG A C   1 
ATOM   1110 O O   . ARG A 1 142 ? 13.242  -42.358 47.590  1.00 50.23  ? 143 ARG A O   1 
ATOM   1111 C CB  . ARG A 1 142 ? 13.440  -44.529 49.229  1.00 49.76  ? 143 ARG A CB  1 
ATOM   1112 C CG  . ARG A 1 142 ? 13.235  -45.589 50.328  1.00 53.33  ? 143 ARG A CG  1 
ATOM   1113 C CD  . ARG A 1 142 ? 14.404  -45.721 51.264  1.00 59.66  ? 143 ARG A CD  1 
ATOM   1114 N NE  . ARG A 1 142 ? 14.597  -44.542 52.107  1.00 65.64  ? 143 ARG A NE  1 
ATOM   1115 C CZ  . ARG A 1 142 ? 13.916  -44.301 53.225  1.00 68.11  ? 143 ARG A CZ  1 
ATOM   1116 N NH1 . ARG A 1 142 ? 12.968  -45.143 53.617  1.00 49.45  ? 143 ARG A NH1 1 
ATOM   1117 N NH2 . ARG A 1 142 ? 14.163  -43.204 53.936  1.00 66.13  ? 143 ARG A NH2 1 
ATOM   1118 N N   . THR A 1 143 ? 11.102  -42.677 47.034  1.00 48.73  ? 144 THR A N   1 
ATOM   1119 C CA  . THR A 1 143 ? 10.978  -41.471 46.251  1.00 45.60  ? 144 THR A CA  1 
ATOM   1120 C C   . THR A 1 143 ? 9.926   -40.650 46.930  1.00 44.16  ? 144 THR A C   1 
ATOM   1121 O O   . THR A 1 143 ? 9.206   -41.162 47.781  1.00 43.90  ? 144 THR A O   1 
ATOM   1122 C CB  . THR A 1 143 ? 10.535  -41.769 44.822  1.00 48.13  ? 144 THR A CB  1 
ATOM   1123 O OG1 . THR A 1 143 ? 9.467   -42.714 44.893  1.00 57.46  ? 144 THR A OG1 1 
ATOM   1124 C CG2 . THR A 1 143 ? 11.673  -42.372 44.015  1.00 47.34  ? 144 THR A CG2 1 
ATOM   1125 N N   . VAL A 1 144 ? 9.823   -39.385 46.558  1.00 36.61  ? 145 VAL A N   1 
ATOM   1126 C CA  . VAL A 1 144 ? 8.641   -38.615 46.880  1.00 33.21  ? 145 VAL A CA  1 
ATOM   1127 C C   . VAL A 1 144 ? 7.683   -38.709 45.682  1.00 45.71  ? 145 VAL A C   1 
ATOM   1128 O O   . VAL A 1 144 ? 8.108   -38.648 44.520  1.00 50.85  ? 145 VAL A O   1 
ATOM   1129 C CB  . VAL A 1 144 ? 8.999   -37.153 47.221  1.00 41.71  ? 145 VAL A CB  1 
ATOM   1130 C CG1 . VAL A 1 144 ? 7.744   -36.327 47.461  1.00 39.84  ? 145 VAL A CG1 1 
ATOM   1131 C CG2 . VAL A 1 144 ? 9.908   -37.117 48.482  1.00 38.59  ? 145 VAL A CG2 1 
ATOM   1132 N N   . LEU A 1 145 ? 6.406   -38.938 45.962  1.00 38.40  ? 146 LEU A N   1 
ATOM   1133 C CA  . LEU A 1 145 ? 5.419   -39.037 44.915  1.00 36.95  ? 146 LEU A CA  1 
ATOM   1134 C C   . LEU A 1 145 ? 4.359   -37.959 45.095  1.00 39.69  ? 146 LEU A C   1 
ATOM   1135 O O   . LEU A 1 145 ? 3.843   -37.764 46.203  1.00 40.69  ? 146 LEU A O   1 
ATOM   1136 C CB  . LEU A 1 145 ? 4.775   -40.427 44.887  1.00 40.01  ? 146 LEU A CB  1 
ATOM   1137 C CG  . LEU A 1 145 ? 3.965   -40.629 43.599  1.00 48.58  ? 146 LEU A CG  1 
ATOM   1138 C CD1 . LEU A 1 145 ? 4.182   -41.994 43.050  1.00 57.73  ? 146 LEU A CD1 1 
ATOM   1139 C CD2 . LEU A 1 145 ? 2.497   -40.431 43.864  1.00 47.89  ? 146 LEU A CD2 1 
ATOM   1140 N N   . VAL A 1 146 ? 4.055   -37.264 43.998  1.00 31.75  ? 147 VAL A N   1 
ATOM   1141 C CA  . VAL A 1 146 ? 3.051   -36.192 43.965  1.00 36.94  ? 147 VAL A CA  1 
ATOM   1142 C C   . VAL A 1 146 ? 2.049   -36.483 42.861  1.00 36.54  ? 147 VAL A C   1 
ATOM   1143 O O   . VAL A 1 146 ? 2.454   -36.886 41.764  1.00 41.17  ? 147 VAL A O   1 
ATOM   1144 C CB  . VAL A 1 146 ? 3.692   -34.795 43.703  1.00 37.46  ? 147 VAL A CB  1 
ATOM   1145 C CG1 . VAL A 1 146 ? 2.673   -33.682 43.851  1.00 35.59  ? 147 VAL A CG1 1 
ATOM   1146 C CG2 . VAL A 1 146 ? 4.852   -34.555 44.643  1.00 42.35  ? 147 VAL A CG2 1 
ATOM   1147 N N   . SER A 1 147 ? 0.756   -36.306 43.146  1.00 39.45  ? 148 SER A N   1 
ATOM   1148 C CA  . SER A 1 147 ? -0.276  -36.361 42.104  1.00 36.19  ? 148 SER A CA  1 
ATOM   1149 C C   . SER A 1 147 ? -1.215  -35.177 42.284  1.00 47.89  ? 148 SER A C   1 
ATOM   1150 O O   . SER A 1 147 ? -1.483  -34.767 43.416  1.00 39.21  ? 148 SER A O   1 
ATOM   1151 C CB  . SER A 1 147 ? -1.047  -37.690 42.146  1.00 41.67  ? 148 SER A CB  1 
ATOM   1152 O OG  . SER A 1 147 ? -1.681  -37.920 43.407  1.00 40.99  ? 148 SER A OG  1 
ATOM   1153 N N   . MET A 1 148 ? -1.680  -34.591 41.180  1.00 38.24  ? 149 MET A N   1 
ATOM   1154 C CA  . MET A 1 148 ? -2.616  -33.490 41.281  1.00 26.36  ? 149 MET A CA  1 
ATOM   1155 C C   . MET A 1 148 ? -3.932  -33.823 40.597  1.00 44.04  ? 149 MET A C   1 
ATOM   1156 O O   . MET A 1 148 ? -3.993  -34.709 39.725  1.00 35.72  ? 149 MET A O   1 
ATOM   1157 C CB  . MET A 1 148 ? -2.020  -32.198 40.682  1.00 31.95  ? 149 MET A CB  1 
ATOM   1158 C CG  . MET A 1 148 ? -2.225  -31.997 39.147  1.00 35.04  ? 149 MET A CG  1 
ATOM   1159 S SD  . MET A 1 148 ? -1.328  -33.283 38.269  1.00 41.04  ? 149 MET A SD  1 
ATOM   1160 C CE  . MET A 1 148 ? 0.360   -32.726 38.440  1.00 30.79  ? 149 MET A CE  1 
ATOM   1161 N N   . ASN A 1 149 ? -4.993  -33.138 41.024  1.00 36.86  ? 150 ASN A N   1 
ATOM   1162 C CA  . ASN A 1 149 ? -6.219  -33.088 40.245  1.00 35.90  ? 150 ASN A CA  1 
ATOM   1163 C C   . ASN A 1 149 ? -6.134  -31.940 39.255  1.00 38.60  ? 150 ASN A C   1 
ATOM   1164 O O   . ASN A 1 149 ? -5.646  -30.863 39.591  1.00 43.34  ? 150 ASN A O   1 
ATOM   1165 C CB  . ASN A 1 149 ? -7.455  -32.890 41.136  1.00 38.64  ? 150 ASN A CB  1 
ATOM   1166 C CG  . ASN A 1 149 ? -7.983  -34.185 41.731  1.00 40.40  ? 150 ASN A CG  1 
ATOM   1167 O OD1 . ASN A 1 149 ? -7.409  -35.269 41.574  1.00 40.93  ? 150 ASN A OD1 1 
ATOM   1168 N ND2 . ASN A 1 149 ? -9.090  -34.068 42.435  1.00 45.52  ? 150 ASN A ND2 1 
ATOM   1169 N N   . TYR A 1 150 ? -6.631  -32.138 38.040  1.00 35.14  ? 151 TYR A N   1 
ATOM   1170 C CA  . TYR A 1 150 ? -6.771  -31.014 37.130  1.00 35.51  ? 151 TYR A CA  1 
ATOM   1171 C C   . TYR A 1 150 ? -8.145  -31.023 36.492  1.00 35.97  ? 151 TYR A C   1 
ATOM   1172 O O   . TYR A 1 150 ? -8.762  -32.080 36.358  1.00 33.75  ? 151 TYR A O   1 
ATOM   1173 C CB  . TYR A 1 150 ? -5.692  -31.057 36.057  1.00 33.55  ? 151 TYR A CB  1 
ATOM   1174 C CG  . TYR A 1 150 ? -5.727  -32.320 35.221  1.00 38.47  ? 151 TYR A CG  1 
ATOM   1175 C CD1 . TYR A 1 150 ? -5.065  -33.473 35.646  1.00 31.13  ? 151 TYR A CD1 1 
ATOM   1176 C CD2 . TYR A 1 150 ? -6.433  -32.366 34.008  1.00 34.51  ? 151 TYR A CD2 1 
ATOM   1177 C CE1 . TYR A 1 150 ? -5.078  -34.637 34.889  1.00 31.33  ? 151 TYR A CE1 1 
ATOM   1178 C CE2 . TYR A 1 150 ? -6.444  -33.538 33.220  1.00 29.41  ? 151 TYR A CE2 1 
ATOM   1179 C CZ  . TYR A 1 150 ? -5.770  -34.661 33.678  1.00 38.47  ? 151 TYR A CZ  1 
ATOM   1180 O OH  . TYR A 1 150 ? -5.779  -35.820 32.935  1.00 38.09  ? 151 TYR A OH  1 
ATOM   1181 N N   . ARG A 1 151 ? -8.616  -29.855 36.077  1.00 36.19  ? 152 ARG A N   1 
ATOM   1182 C CA  . ARG A 1 151 ? -9.954  -29.770 35.509  1.00 40.77  ? 152 ARG A CA  1 
ATOM   1183 C C   . ARG A 1 151 ? -10.067 -30.506 34.171  1.00 40.83  ? 152 ARG A C   1 
ATOM   1184 O O   . ARG A 1 151 ? -9.185  -30.415 33.326  1.00 37.77  ? 152 ARG A O   1 
ATOM   1185 C CB  . ARG A 1 151 ? -10.364 -28.312 35.329  1.00 39.94  ? 152 ARG A CB  1 
ATOM   1186 C CG  . ARG A 1 151 ? -10.661 -27.589 36.627  1.00 37.26  ? 152 ARG A CG  1 
ATOM   1187 C CD  . ARG A 1 151 ? -10.830 -26.094 36.361  1.00 37.53  ? 152 ARG A CD  1 
ATOM   1188 N NE  . ARG A 1 151 ? -9.544  -25.425 36.200  1.00 42.37  ? 152 ARG A NE  1 
ATOM   1189 C CZ  . ARG A 1 151 ? -9.412  -24.133 35.924  1.00 44.03  ? 152 ARG A CZ  1 
ATOM   1190 N NH1 . ARG A 1 151 ? -10.489 -23.384 35.763  1.00 42.90  ? 152 ARG A NH1 1 
ATOM   1191 N NH2 . ARG A 1 151 ? -8.211  -23.589 35.829  1.00 41.23  ? 152 ARG A NH2 1 
ATOM   1192 N N   . VAL A 1 152 ? -11.170 -31.225 33.996  1.00 46.14  ? 153 VAL A N   1 
ATOM   1193 C CA  . VAL A 1 152 ? -11.400 -32.028 32.809  1.00 37.03  ? 153 VAL A CA  1 
ATOM   1194 C C   . VAL A 1 152 ? -12.725 -31.622 32.168  1.00 41.21  ? 153 VAL A C   1 
ATOM   1195 O O   . VAL A 1 152 ? -13.412 -30.745 32.668  1.00 37.72  ? 153 VAL A O   1 
ATOM   1196 C CB  . VAL A 1 152 ? -11.379 -33.523 33.144  1.00 37.94  ? 153 VAL A CB  1 
ATOM   1197 C CG1 . VAL A 1 152 ? -9.986  -33.933 33.580  1.00 36.20  ? 153 VAL A CG1 1 
ATOM   1198 C CG2 . VAL A 1 152 ? -12.345 -33.833 34.283  1.00 34.83  ? 153 VAL A CG2 1 
ATOM   1199 N N   . GLY A 1 153 ? -13.070 -32.243 31.042  1.00 43.95  ? 154 GLY A N   1 
ATOM   1200 C CA  . GLY A 1 153 ? -14.273 -31.877 30.317  1.00 31.83  ? 154 GLY A CA  1 
ATOM   1201 C C   . GLY A 1 153 ? -14.255 -30.412 29.952  1.00 39.60  ? 154 GLY A C   1 
ATOM   1202 O O   . GLY A 1 153 ? -13.194 -29.816 29.813  1.00 39.59  ? 154 GLY A O   1 
ATOM   1203 N N   . ALA A 1 154 ? -15.430 -29.811 29.846  1.00 40.16  ? 155 ALA A N   1 
ATOM   1204 C CA  . ALA A 1 154 ? -15.504 -28.404 29.516  1.00 38.23  ? 155 ALA A CA  1 
ATOM   1205 C C   . ALA A 1 154 ? -14.815 -27.545 30.549  1.00 46.84  ? 155 ALA A C   1 
ATOM   1206 O O   . ALA A 1 154 ? -14.304 -26.478 30.214  1.00 49.50  ? 155 ALA A O   1 
ATOM   1207 C CB  . ALA A 1 154 ? -16.937 -27.967 29.367  1.00 38.18  ? 155 ALA A CB  1 
ATOM   1208 N N   . PHE A 1 155 ? -14.807 -27.982 31.807  1.00 42.78  ? 156 PHE A N   1 
ATOM   1209 C CA  . PHE A 1 155 ? -14.283 -27.121 32.867  1.00 43.53  ? 156 PHE A CA  1 
ATOM   1210 C C   . PHE A 1 155 ? -12.800 -26.865 32.690  1.00 36.31  ? 156 PHE A C   1 
ATOM   1211 O O   . PHE A 1 155 ? -12.290 -25.829 33.126  1.00 41.27  ? 156 PHE A O   1 
ATOM   1212 C CB  . PHE A 1 155 ? -14.558 -27.733 34.236  1.00 42.60  ? 156 PHE A CB  1 
ATOM   1213 C CG  . PHE A 1 155 ? -15.989 -28.025 34.441  1.00 43.28  ? 156 PHE A CG  1 
ATOM   1214 C CD1 . PHE A 1 155 ? -16.842 -27.030 34.887  1.00 39.84  ? 156 PHE A CD1 1 
ATOM   1215 C CD2 . PHE A 1 155 ? -16.500 -29.274 34.128  1.00 38.58  ? 156 PHE A CD2 1 
ATOM   1216 C CE1 . PHE A 1 155 ? -18.180 -27.281 35.037  1.00 48.05  ? 156 PHE A CE1 1 
ATOM   1217 C CE2 . PHE A 1 155 ? -17.839 -29.530 34.274  1.00 42.14  ? 156 PHE A CE2 1 
ATOM   1218 C CZ  . PHE A 1 155 ? -18.677 -28.538 34.729  1.00 49.22  ? 156 PHE A CZ  1 
ATOM   1219 N N   . GLY A 1 156 ? -12.124 -27.816 32.049  1.00 37.22  ? 157 GLY A N   1 
ATOM   1220 C CA  . GLY A 1 156 ? -10.696 -27.732 31.821  1.00 36.94  ? 157 GLY A CA  1 
ATOM   1221 C C   . GLY A 1 156 ? -10.262 -27.376 30.410  1.00 38.68  ? 157 GLY A C   1 
ATOM   1222 O O   . GLY A 1 156 ? -9.145  -26.881 30.218  1.00 40.17  ? 157 GLY A O   1 
ATOM   1223 N N   . PHE A 1 157 ? -11.131 -27.602 29.420  1.00 42.90  ? 158 PHE A N   1 
ATOM   1224 C CA  . PHE A 1 157 ? -10.723 -27.493 28.006  1.00 39.51  ? 158 PHE A CA  1 
ATOM   1225 C C   . PHE A 1 157 ? -11.748 -26.868 27.063  1.00 43.33  ? 158 PHE A C   1 
ATOM   1226 O O   . PHE A 1 157 ? -11.565 -26.898 25.856  1.00 45.76  ? 158 PHE A O   1 
ATOM   1227 C CB  . PHE A 1 157 ? -10.319 -28.880 27.471  1.00 33.63  ? 158 PHE A CB  1 
ATOM   1228 C CG  . PHE A 1 157 ? -9.217  -29.485 28.244  1.00 38.83  ? 158 PHE A CG  1 
ATOM   1229 C CD1 . PHE A 1 157 ? -7.908  -29.089 28.022  1.00 39.84  ? 158 PHE A CD1 1 
ATOM   1230 C CD2 . PHE A 1 157 ? -9.486  -30.361 29.297  1.00 42.08  ? 158 PHE A CD2 1 
ATOM   1231 C CE1 . PHE A 1 157 ? -6.873  -29.598 28.807  1.00 42.27  ? 158 PHE A CE1 1 
ATOM   1232 C CE2 . PHE A 1 157 ? -8.453  -30.884 30.087  1.00 34.52  ? 158 PHE A CE2 1 
ATOM   1233 C CZ  . PHE A 1 157 ? -7.147  -30.498 29.843  1.00 34.81  ? 158 PHE A CZ  1 
ATOM   1234 N N   . LEU A 1 158 ? -12.816 -26.286 27.592  1.00 44.51  ? 159 LEU A N   1 
ATOM   1235 C CA  . LEU A 1 158 ? -13.704 -25.525 26.727  1.00 43.36  ? 159 LEU A CA  1 
ATOM   1236 C C   . LEU A 1 158 ? -12.953 -24.294 26.264  1.00 47.43  ? 159 LEU A C   1 
ATOM   1237 O O   . LEU A 1 158 ? -12.400 -23.574 27.085  1.00 51.31  ? 159 LEU A O   1 
ATOM   1238 C CB  . LEU A 1 158 ? -14.990 -25.122 27.434  1.00 50.54  ? 159 LEU A CB  1 
ATOM   1239 C CG  . LEU A 1 158 ? -15.886 -24.238 26.564  1.00 52.17  ? 159 LEU A CG  1 
ATOM   1240 C CD1 . LEU A 1 158 ? -17.291 -24.807 26.475  1.00 41.90  ? 159 LEU A CD1 1 
ATOM   1241 C CD2 . LEU A 1 158 ? -15.892 -22.808 27.094  1.00 43.83  ? 159 LEU A CD2 1 
ATOM   1242 N N   . ALA A 1 159 ? -12.930 -24.041 24.956  1.00 46.60  ? 160 ALA A N   1 
ATOM   1243 C CA  . ALA A 1 159 ? -12.174 -22.901 24.452  1.00 53.68  ? 160 ALA A CA  1 
ATOM   1244 C C   . ALA A 1 159 ? -12.953 -22.075 23.452  1.00 51.86  ? 160 ALA A C   1 
ATOM   1245 O O   . ALA A 1 159 ? -13.497 -22.607 22.496  1.00 50.11  ? 160 ALA A O   1 
ATOM   1246 C CB  . ALA A 1 159 ? -10.865 -23.372 23.818  1.00 48.24  ? 160 ALA A CB  1 
ATOM   1247 N N   . LEU A 1 160 ? -13.005 -20.771 23.694  1.00 49.81  ? 161 LEU A N   1 
ATOM   1248 C CA  . LEU A 1 160 ? -13.347 -19.794 22.662  1.00 57.54  ? 161 LEU A CA  1 
ATOM   1249 C C   . LEU A 1 160 ? -12.070 -19.041 22.295  1.00 58.23  ? 161 LEU A C   1 
ATOM   1250 O O   . LEU A 1 160 ? -11.786 -17.982 22.859  1.00 53.12  ? 161 LEU A O   1 
ATOM   1251 C CB  . LEU A 1 160 ? -14.423 -18.827 23.149  1.00 53.10  ? 161 LEU A CB  1 
ATOM   1252 C CG  . LEU A 1 160 ? -15.832 -19.393 23.280  1.00 60.53  ? 161 LEU A CG  1 
ATOM   1253 C CD1 . LEU A 1 160 ? -16.712 -18.411 24.003  1.00 59.81  ? 161 LEU A CD1 1 
ATOM   1254 C CD2 . LEU A 1 160 ? -16.393 -19.694 21.898  1.00 52.70  ? 161 LEU A CD2 1 
ATOM   1255 N N   . PRO A 1 161 ? -11.280 -19.603 21.366  1.00 53.81  ? 162 PRO A N   1 
ATOM   1256 C CA  . PRO A 1 161 ? -9.939  -19.089 21.064  1.00 57.89  ? 162 PRO A CA  1 
ATOM   1257 C C   . PRO A 1 161 ? -9.943  -17.579 20.812  1.00 59.51  ? 162 PRO A C   1 
ATOM   1258 O O   . PRO A 1 161 ? -10.812 -17.042 20.127  1.00 54.87  ? 162 PRO A O   1 
ATOM   1259 C CB  . PRO A 1 161 ? -9.543  -19.872 19.813  1.00 59.60  ? 162 PRO A CB  1 
ATOM   1260 C CG  . PRO A 1 161 ? -10.282 -21.184 19.959  1.00 51.78  ? 162 PRO A CG  1 
ATOM   1261 C CD  . PRO A 1 161 ? -11.629 -20.759 20.520  1.00 50.91  ? 162 PRO A CD  1 
ATOM   1262 N N   . GLY A 1 162 ? -9.001  -16.894 21.440  1.00 56.39  ? 163 GLY A N   1 
ATOM   1263 C CA  . GLY A 1 162 ? -8.935  -15.455 21.334  1.00 62.99  ? 163 GLY A CA  1 
ATOM   1264 C C   . GLY A 1 162 ? -9.505  -14.734 22.537  1.00 68.98  ? 163 GLY A C   1 
ATOM   1265 O O   . GLY A 1 162 ? -9.042  -13.645 22.871  1.00 69.85  ? 163 GLY A O   1 
ATOM   1266 N N   . SER A 1 163 ? -10.509 -15.328 23.183  1.00 57.40  ? 164 SER A N   1 
ATOM   1267 C CA  . SER A 1 163 ? -11.179 -14.680 24.315  1.00 62.83  ? 164 SER A CA  1 
ATOM   1268 C C   . SER A 1 163 ? -10.373 -14.807 25.585  1.00 53.77  ? 164 SER A C   1 
ATOM   1269 O O   . SER A 1 163 ? -9.597  -15.743 25.741  1.00 71.35  ? 164 SER A O   1 
ATOM   1270 C CB  . SER A 1 163 ? -12.562 -15.278 24.542  1.00 66.51  ? 164 SER A CB  1 
ATOM   1271 O OG  . SER A 1 163 ? -12.448 -16.611 25.010  1.00 65.72  ? 164 SER A OG  1 
ATOM   1272 N N   . ARG A 1 164 ? -10.559 -13.867 26.499  1.00 62.17  ? 165 ARG A N   1 
ATOM   1273 C CA  . ARG A 1 164 ? -9.928  -13.979 27.804  1.00 71.23  ? 165 ARG A CA  1 
ATOM   1274 C C   . ARG A 1 164 ? -10.843 -14.773 28.737  1.00 64.63  ? 165 ARG A C   1 
ATOM   1275 O O   . ARG A 1 164 ? -10.389 -15.358 29.721  1.00 66.13  ? 165 ARG A O   1 
ATOM   1276 C CB  . ARG A 1 164 ? -9.611  -12.591 28.387  1.00 82.67  ? 165 ARG A CB  1 
ATOM   1277 C CG  . ARG A 1 164 ? -10.758 -11.566 28.275  1.00 96.82  ? 165 ARG A CG  1 
ATOM   1278 C CD  . ARG A 1 164 ? -10.893 -10.692 29.543  1.00 105.44 ? 165 ARG A CD  1 
ATOM   1279 N NE  . ARG A 1 164 ? -10.415 -9.317  29.358  1.00 123.47 ? 165 ARG A NE  1 
ATOM   1280 C CZ  . ARG A 1 164 ? -9.339  -8.798  29.953  1.00 122.78 ? 165 ARG A CZ  1 
ATOM   1281 N NH1 . ARG A 1 164 ? -8.614  -9.535  30.787  1.00 120.34 ? 165 ARG A NH1 1 
ATOM   1282 N NH2 . ARG A 1 164 ? -8.987  -7.536  29.720  1.00 117.45 ? 165 ARG A NH2 1 
ATOM   1283 N N   . GLU A 1 165 ? -12.132 -14.806 28.412  1.00 64.56  ? 166 GLU A N   1 
ATOM   1284 C CA  . GLU A 1 165 ? -13.121 -15.423 29.295  1.00 65.83  ? 166 GLU A CA  1 
ATOM   1285 C C   . GLU A 1 165 ? -13.004 -16.942 29.282  1.00 65.99  ? 166 GLU A C   1 
ATOM   1286 O O   . GLU A 1 165 ? -13.300 -17.602 30.280  1.00 59.66  ? 166 GLU A O   1 
ATOM   1287 C CB  . GLU A 1 165 ? -14.544 -15.006 28.904  1.00 62.38  ? 166 GLU A CB  1 
ATOM   1288 C CG  . GLU A 1 165 ? -14.870 -13.531 29.134  1.00 74.84  ? 166 GLU A CG  1 
ATOM   1289 C CD  . GLU A 1 165 ? -14.604 -12.643 27.907  1.00 101.10 ? 166 GLU A CD  1 
ATOM   1290 O OE1 . GLU A 1 165 ? -14.126 -13.156 26.858  1.00 90.38  ? 166 GLU A OE1 1 
ATOM   1291 O OE2 . GLU A 1 165 ? -14.882 -11.421 28.001  1.00 93.92  ? 166 GLU A OE2 1 
ATOM   1292 N N   . ALA A 1 166 ? -12.566 -17.492 28.150  1.00 52.51  ? 167 ALA A N   1 
ATOM   1293 C CA  . ALA A 1 166 ? -12.396 -18.941 28.006  1.00 49.99  ? 167 ALA A CA  1 
ATOM   1294 C C   . ALA A 1 166 ? -11.290 -19.304 27.010  1.00 54.32  ? 167 ALA A C   1 
ATOM   1295 O O   . ALA A 1 166 ? -11.569 -19.781 25.909  1.00 56.60  ? 167 ALA A O   1 
ATOM   1296 C CB  . ALA A 1 166 ? -13.697 -19.569 27.586  1.00 45.37  ? 167 ALA A CB  1 
ATOM   1297 N N   . PRO A 1 167 ? -10.029 -19.091 27.403  1.00 57.13  ? 168 PRO A N   1 
ATOM   1298 C CA  . PRO A 1 167 ? -8.876  -19.222 26.502  1.00 48.10  ? 168 PRO A CA  1 
ATOM   1299 C C   . PRO A 1 167 ? -8.484  -20.666 26.130  1.00 61.01  ? 168 PRO A C   1 
ATOM   1300 O O   . PRO A 1 167 ? -7.667  -20.860 25.223  1.00 56.79  ? 168 PRO A O   1 
ATOM   1301 C CB  . PRO A 1 167 ? -7.750  -18.571 27.298  1.00 43.93  ? 168 PRO A CB  1 
ATOM   1302 C CG  . PRO A 1 167 ? -8.152  -18.754 28.733  1.00 53.71  ? 168 PRO A CG  1 
ATOM   1303 C CD  . PRO A 1 167 ? -9.637  -18.682 28.763  1.00 48.01  ? 168 PRO A CD  1 
ATOM   1304 N N   . GLY A 1 168 ? -9.035  -21.656 26.823  1.00 51.32  ? 169 GLY A N   1 
ATOM   1305 C CA  . GLY A 1 168 ? -8.671  -23.038 26.571  1.00 45.71  ? 169 GLY A CA  1 
ATOM   1306 C C   . GLY A 1 168 ? -7.434  -23.489 27.336  1.00 50.31  ? 169 GLY A C   1 
ATOM   1307 O O   . GLY A 1 168 ? -6.673  -22.676 27.859  1.00 43.98  ? 169 GLY A O   1 
ATOM   1308 N N   . ASN A 1 169 ? -7.264  -24.807 27.415  1.00 41.88  ? 170 ASN A N   1 
ATOM   1309 C CA  . ASN A 1 169 ? -6.103  -25.443 28.014  1.00 36.27  ? 170 ASN A CA  1 
ATOM   1310 C C   . ASN A 1 169 ? -5.903  -25.166 29.501  1.00 37.98  ? 170 ASN A C   1 
ATOM   1311 O O   . ASN A 1 169 ? -4.812  -25.431 30.038  1.00 43.61  ? 170 ASN A O   1 
ATOM   1312 C CB  . ASN A 1 169 ? -4.834  -25.043 27.238  1.00 38.31  ? 170 ASN A CB  1 
ATOM   1313 C CG  . ASN A 1 169 ? -4.846  -25.543 25.801  1.00 45.76  ? 170 ASN A CG  1 
ATOM   1314 O OD1 . ASN A 1 169 ? -5.425  -26.591 25.511  1.00 49.65  ? 170 ASN A OD1 1 
ATOM   1315 N ND2 . ASN A 1 169 ? -4.203  -24.802 24.897  1.00 42.62  ? 170 ASN A ND2 1 
ATOM   1316 N N   . VAL A 1 170 ? -6.933  -24.688 30.200  1.00 38.76  ? 171 VAL A N   1 
ATOM   1317 C CA  . VAL A 1 170 ? -6.718  -24.313 31.609  1.00 44.07  ? 171 VAL A CA  1 
ATOM   1318 C C   . VAL A 1 170 ? -6.464  -25.561 32.494  1.00 39.56  ? 171 VAL A C   1 
ATOM   1319 O O   . VAL A 1 170 ? -5.774  -25.497 33.519  1.00 38.90  ? 171 VAL A O   1 
ATOM   1320 C CB  . VAL A 1 170 ? -7.904  -23.443 32.157  1.00 47.87  ? 171 VAL A CB  1 
ATOM   1321 C CG1 . VAL A 1 170 ? -8.072  -22.206 31.294  1.00 42.38  ? 171 VAL A CG1 1 
ATOM   1322 C CG2 . VAL A 1 170 ? -9.221  -24.204 32.209  1.00 40.51  ? 171 VAL A CG2 1 
ATOM   1323 N N   . GLY A 1 171 ? -6.983  -26.706 32.077  1.00 40.15  ? 172 GLY A N   1 
ATOM   1324 C CA  . GLY A 1 171 ? -6.678  -27.945 32.769  1.00 35.64  ? 172 GLY A CA  1 
ATOM   1325 C C   . GLY A 1 171 ? -5.194  -28.276 32.687  1.00 41.39  ? 172 GLY A C   1 
ATOM   1326 O O   . GLY A 1 171 ? -4.602  -28.818 33.636  1.00 40.58  ? 172 GLY A O   1 
ATOM   1327 N N   . LEU A 1 172 ? -4.583  -27.954 31.552  1.00 38.90  ? 173 LEU A N   1 
ATOM   1328 C CA  . LEU A 1 172 ? -3.127  -28.079 31.419  1.00 43.07  ? 173 LEU A CA  1 
ATOM   1329 C C   . LEU A 1 172 ? -2.402  -27.088 32.332  1.00 36.42  ? 173 LEU A C   1 
ATOM   1330 O O   . LEU A 1 172 ? -1.367  -27.403 32.924  1.00 40.18  ? 173 LEU A O   1 
ATOM   1331 C CB  . LEU A 1 172 ? -2.699  -27.858 29.973  1.00 32.80  ? 173 LEU A CB  1 
ATOM   1332 C CG  . LEU A 1 172 ? -2.917  -29.029 29.020  1.00 40.26  ? 173 LEU A CG  1 
ATOM   1333 C CD1 . LEU A 1 172 ? -2.557  -28.612 27.600  1.00 32.62  ? 173 LEU A CD1 1 
ATOM   1334 C CD2 . LEU A 1 172 ? -2.080  -30.223 29.451  1.00 34.14  ? 173 LEU A CD2 1 
ATOM   1335 N N   . LEU A 1 173 ? -2.946  -25.880 32.427  1.00 33.85  ? 174 LEU A N   1 
ATOM   1336 C CA  . LEU A 1 173 ? -2.401  -24.879 33.320  1.00 35.25  ? 174 LEU A CA  1 
ATOM   1337 C C   . LEU A 1 173 ? -2.522  -25.347 34.766  1.00 44.52  ? 174 LEU A C   1 
ATOM   1338 O O   . LEU A 1 173 ? -1.606  -25.086 35.559  1.00 41.68  ? 174 LEU A O   1 
ATOM   1339 C CB  . LEU A 1 173 ? -3.103  -23.548 33.124  1.00 42.57  ? 174 LEU A CB  1 
ATOM   1340 C CG  . LEU A 1 173 ? -2.867  -22.869 31.772  1.00 52.71  ? 174 LEU A CG  1 
ATOM   1341 C CD1 . LEU A 1 173 ? -3.579  -21.528 31.726  1.00 52.53  ? 174 LEU A CD1 1 
ATOM   1342 C CD2 . LEU A 1 173 ? -1.377  -22.710 31.501  1.00 38.11  ? 174 LEU A CD2 1 
ATOM   1343 N N   . ASP A 1 174 ? -3.617  -26.048 35.108  1.00 37.13  ? 175 ASP A N   1 
ATOM   1344 C CA  . ASP A 1 174 ? -3.765  -26.606 36.466  1.00 39.28  ? 175 ASP A CA  1 
ATOM   1345 C C   . ASP A 1 174 ? -2.585  -27.528 36.738  1.00 41.09  ? 175 ASP A C   1 
ATOM   1346 O O   . ASP A 1 174 ? -1.959  -27.462 37.789  1.00 37.53  ? 175 ASP A O   1 
ATOM   1347 C CB  . ASP A 1 174 ? -5.058  -27.401 36.654  1.00 32.33  ? 175 ASP A CB  1 
ATOM   1348 C CG  . ASP A 1 174 ? -6.315  -26.575 36.457  1.00 40.31  ? 175 ASP A CG  1 
ATOM   1349 O OD1 . ASP A 1 174 ? -6.277  -25.354 36.674  1.00 38.98  ? 175 ASP A OD1 1 
ATOM   1350 O OD2 . ASP A 1 174 ? -7.366  -27.172 36.095  1.00 42.02  ? 175 ASP A OD2 1 
ATOM   1351 N N   . GLN A 1 175 ? -2.283  -28.385 35.767  1.00 40.49  ? 176 GLN A N   1 
ATOM   1352 C CA  . GLN A 1 175 ? -1.118  -29.253 35.875  1.00 37.75  ? 176 GLN A CA  1 
ATOM   1353 C C   . GLN A 1 175 ? 0.196   -28.468 36.033  1.00 40.68  ? 176 GLN A C   1 
ATOM   1354 O O   . GLN A 1 175 ? 1.018   -28.814 36.886  1.00 39.47  ? 176 GLN A O   1 
ATOM   1355 C CB  . GLN A 1 175 ? -1.021  -30.164 34.657  1.00 31.18  ? 176 GLN A CB  1 
ATOM   1356 C CG  . GLN A 1 175 ? -2.089  -31.234 34.576  1.00 37.26  ? 176 GLN A CG  1 
ATOM   1357 C CD  . GLN A 1 175 ? -2.113  -31.872 33.197  1.00 40.76  ? 176 GLN A CD  1 
ATOM   1358 O OE1 . GLN A 1 175 ? -1.120  -31.811 32.455  1.00 34.98  ? 176 GLN A OE1 1 
ATOM   1359 N NE2 . GLN A 1 175 ? -3.246  -32.472 32.835  1.00 35.36  ? 176 GLN A NE2 1 
ATOM   1360 N N   . ARG A 1 176 ? 0.392   -27.417 35.229  1.00 39.46  ? 177 ARG A N   1 
ATOM   1361 C CA  . ARG A 1 176 ? 1.618   -26.615 35.326  1.00 39.95  ? 177 ARG A CA  1 
ATOM   1362 C C   . ARG A 1 176 ? 1.751   -25.933 36.676  1.00 36.96  ? 177 ARG A C   1 
ATOM   1363 O O   . ARG A 1 176 ? 2.837   -25.925 37.273  1.00 40.01  ? 177 ARG A O   1 
ATOM   1364 C CB  . ARG A 1 176 ? 1.682   -25.565 34.224  1.00 36.73  ? 177 ARG A CB  1 
ATOM   1365 C CG  . ARG A 1 176 ? 2.902   -24.674 34.314  1.00 45.38  ? 177 ARG A CG  1 
ATOM   1366 C CD  . ARG A 1 176 ? 2.911   -23.634 33.189  1.00 41.33  ? 177 ARG A CD  1 
ATOM   1367 N NE  . ARG A 1 176 ? 3.177   -24.261 31.895  1.00 44.27  ? 177 ARG A NE  1 
ATOM   1368 C CZ  . ARG A 1 176 ? 3.001   -23.643 30.731  1.00 50.35  ? 177 ARG A CZ  1 
ATOM   1369 N NH1 . ARG A 1 176 ? 2.538   -22.393 30.717  1.00 47.44  ? 177 ARG A NH1 1 
ATOM   1370 N NH2 . ARG A 1 176 ? 3.282   -24.264 29.591  1.00 45.25  ? 177 ARG A NH2 1 
ATOM   1371 N N   . LEU A 1 177 ? 0.647   -25.375 37.164  1.00 37.78  ? 178 LEU A N   1 
ATOM   1372 C CA  . LEU A 1 177 ? 0.645   -24.697 38.454  1.00 38.76  ? 178 LEU A CA  1 
ATOM   1373 C C   . LEU A 1 177 ? 1.057   -25.664 39.558  1.00 42.24  ? 178 LEU A C   1 
ATOM   1374 O O   . LEU A 1 177 ? 1.793   -25.301 40.467  1.00 47.68  ? 178 LEU A O   1 
ATOM   1375 C CB  . LEU A 1 177 ? -0.722  -24.100 38.760  1.00 39.63  ? 178 LEU A CB  1 
ATOM   1376 C CG  . LEU A 1 177 ? -0.830  -23.395 40.110  1.00 47.67  ? 178 LEU A CG  1 
ATOM   1377 C CD1 . LEU A 1 177 ? 0.210   -22.287 40.222  1.00 33.28  ? 178 LEU A CD1 1 
ATOM   1378 C CD2 . LEU A 1 177 ? -2.207  -22.839 40.260  1.00 40.04  ? 178 LEU A CD2 1 
ATOM   1379 N N   . ALA A 1 178 ? 0.624   -26.913 39.446  1.00 41.02  ? 179 ALA A N   1 
ATOM   1380 C CA  . ALA A 1 178 ? 0.981   -27.917 40.435  1.00 41.82  ? 179 ALA A CA  1 
ATOM   1381 C C   . ALA A 1 178 ? 2.464   -28.244 40.345  1.00 38.76  ? 179 ALA A C   1 
ATOM   1382 O O   . ALA A 1 178 ? 3.118   -28.473 41.356  1.00 38.22  ? 179 ALA A O   1 
ATOM   1383 C CB  . ALA A 1 178 ? 0.138   -29.177 40.256  1.00 35.23  ? 179 ALA A CB  1 
ATOM   1384 N N   . LEU A 1 179 ? 2.994   -28.282 39.127  1.00 41.83  ? 180 LEU A N   1 
ATOM   1385 C CA  . LEU A 1 179 ? 4.436   -28.445 38.923  1.00 37.92  ? 180 LEU A CA  1 
ATOM   1386 C C   . LEU A 1 179 ? 5.253   -27.275 39.501  1.00 43.82  ? 180 LEU A C   1 
ATOM   1387 O O   . LEU A 1 179 ? 6.329   -27.482 40.062  1.00 40.08  ? 180 LEU A O   1 
ATOM   1388 C CB  . LEU A 1 179 ? 4.750   -28.607 37.427  1.00 43.73  ? 180 LEU A CB  1 
ATOM   1389 C CG  . LEU A 1 179 ? 4.266   -29.920 36.802  1.00 31.50  ? 180 LEU A CG  1 
ATOM   1390 C CD1 . LEU A 1 179 ? 4.663   -29.987 35.325  1.00 36.71  ? 180 LEU A CD1 1 
ATOM   1391 C CD2 . LEU A 1 179 ? 4.838   -31.082 37.599  1.00 31.97  ? 180 LEU A CD2 1 
ATOM   1392 N N   . GLN A 1 180 ? 4.752   -26.051 39.346  1.00 40.93  ? 181 GLN A N   1 
ATOM   1393 C CA  . GLN A 1 180 ? 5.369   -24.895 39.990  1.00 39.81  ? 181 GLN A CA  1 
ATOM   1394 C C   . GLN A 1 180 ? 5.290   -25.072 41.507  1.00 43.18  ? 181 GLN A C   1 
ATOM   1395 O O   . GLN A 1 180 ? 6.274   -24.831 42.227  1.00 46.16  ? 181 GLN A O   1 
ATOM   1396 C CB  . GLN A 1 180 ? 4.696   -23.586 39.538  1.00 35.59  ? 181 GLN A CB  1 
ATOM   1397 C CG  . GLN A 1 180 ? 4.980   -23.273 38.065  1.00 46.99  ? 181 GLN A CG  1 
ATOM   1398 C CD  . GLN A 1 180 ? 4.041   -22.236 37.443  1.00 53.57  ? 181 GLN A CD  1 
ATOM   1399 O OE1 . GLN A 1 180 ? 3.021   -21.853 38.019  1.00 62.49  ? 181 GLN A OE1 1 
ATOM   1400 N NE2 . GLN A 1 180 ? 4.395   -21.778 36.255  1.00 56.60  ? 181 GLN A NE2 1 
ATOM   1401 N N   . TRP A 1 181 ? 4.134   -25.523 41.986  1.00 38.65  ? 182 TRP A N   1 
ATOM   1402 C CA  . TRP A 1 181 ? 3.976   -25.823 43.410  1.00 42.62  ? 182 TRP A CA  1 
ATOM   1403 C C   . TRP A 1 181 ? 5.059   -26.786 43.885  1.00 41.36  ? 182 TRP A C   1 
ATOM   1404 O O   . TRP A 1 181 ? 5.630   -26.600 44.961  1.00 46.77  ? 182 TRP A O   1 
ATOM   1405 C CB  . TRP A 1 181 ? 2.600   -26.416 43.694  1.00 37.09  ? 182 TRP A CB  1 
ATOM   1406 C CG  . TRP A 1 181 ? 2.285   -26.523 45.145  1.00 39.14  ? 182 TRP A CG  1 
ATOM   1407 C CD1 . TRP A 1 181 ? 1.568   -25.640 45.881  1.00 32.39  ? 182 TRP A CD1 1 
ATOM   1408 C CD2 . TRP A 1 181 ? 2.680   -27.575 46.048  1.00 35.27  ? 182 TRP A CD2 1 
ATOM   1409 N NE1 . TRP A 1 181 ? 1.482   -26.068 47.179  1.00 36.04  ? 182 TRP A NE1 1 
ATOM   1410 C CE2 . TRP A 1 181 ? 2.155   -27.251 47.314  1.00 35.56  ? 182 TRP A CE2 1 
ATOM   1411 C CE3 . TRP A 1 181 ? 3.418   -28.758 45.903  1.00 34.87  ? 182 TRP A CE3 1 
ATOM   1412 C CZ2 . TRP A 1 181 ? 2.346   -28.064 48.443  1.00 36.45  ? 182 TRP A CZ2 1 
ATOM   1413 C CZ3 . TRP A 1 181 ? 3.611   -29.560 47.024  1.00 34.33  ? 182 TRP A CZ3 1 
ATOM   1414 C CH2 . TRP A 1 181 ? 3.068   -29.213 48.273  1.00 32.76  ? 182 TRP A CH2 1 
ATOM   1415 N N   . VAL A 1 182 ? 5.354   -27.800 43.069  1.00 43.39  ? 183 VAL A N   1 
ATOM   1416 C CA  . VAL A 1 182 ? 6.343   -28.798 43.456  1.00 42.91  ? 183 VAL A CA  1 
ATOM   1417 C C   . VAL A 1 182 ? 7.731   -28.171 43.520  1.00 51.27  ? 183 VAL A C   1 
ATOM   1418 O O   . VAL A 1 182 ? 8.463   -28.404 44.481  1.00 44.26  ? 183 VAL A O   1 
ATOM   1419 C CB  . VAL A 1 182 ? 6.349   -30.027 42.504  1.00 41.42  ? 183 VAL A CB  1 
ATOM   1420 C CG1 . VAL A 1 182 ? 7.645   -30.807 42.622  1.00 26.01  ? 183 VAL A CG1 1 
ATOM   1421 C CG2 . VAL A 1 182 ? 5.192   -30.915 42.819  1.00 35.00  ? 183 VAL A CG2 1 
ATOM   1422 N N   . GLN A 1 183 ? 8.084   -27.371 42.513  1.00 43.66  ? 184 GLN A N   1 
ATOM   1423 C CA  . GLN A 1 183 ? 9.322   -26.598 42.555  1.00 43.67  ? 184 GLN A CA  1 
ATOM   1424 C C   . GLN A 1 183 ? 9.480   -25.799 43.849  1.00 39.48  ? 184 GLN A C   1 
ATOM   1425 O O   . GLN A 1 183 ? 10.528  -25.844 44.485  1.00 52.56  ? 184 GLN A O   1 
ATOM   1426 C CB  . GLN A 1 183 ? 9.409   -25.649 41.359  1.00 37.84  ? 184 GLN A CB  1 
ATOM   1427 C CG  . GLN A 1 183 ? 9.819   -26.360 40.082  1.00 45.46  ? 184 GLN A CG  1 
ATOM   1428 C CD  . GLN A 1 183 ? 11.121  -27.117 40.249  1.00 49.79  ? 184 GLN A CD  1 
ATOM   1429 O OE1 . GLN A 1 183 ? 12.148  -26.530 40.574  1.00 67.48  ? 184 GLN A OE1 1 
ATOM   1430 N NE2 . GLN A 1 183 ? 11.085  -28.424 40.038  1.00 47.26  ? 184 GLN A NE2 1 
ATOM   1431 N N   . GLU A 1 184 ? 8.447   -25.071 44.241  1.00 43.23  ? 185 GLU A N   1 
ATOM   1432 C CA  . GLU A 1 184 ? 8.531   -24.222 45.418  1.00 44.19  ? 185 GLU A CA  1 
ATOM   1433 C C   . GLU A 1 184 ? 8.434   -24.962 46.740  1.00 49.07  ? 185 GLU A C   1 
ATOM   1434 O O   . GLU A 1 184 ? 9.022   -24.524 47.708  1.00 55.95  ? 185 GLU A O   1 
ATOM   1435 C CB  . GLU A 1 184 ? 7.452   -23.146 45.372  1.00 44.51  ? 185 GLU A CB  1 
ATOM   1436 C CG  . GLU A 1 184 ? 7.699   -22.182 44.226  1.00 64.89  ? 185 GLU A CG  1 
ATOM   1437 C CD  . GLU A 1 184 ? 6.618   -21.134 44.063  1.00 76.01  ? 185 GLU A CD  1 
ATOM   1438 O OE1 . GLU A 1 184 ? 6.450   -20.647 42.918  1.00 71.75  ? 185 GLU A OE1 1 
ATOM   1439 O OE2 . GLU A 1 184 ? 5.955   -20.793 45.071  1.00 78.54  ? 185 GLU A OE2 1 
ATOM   1440 N N   . ASN A 1 185 ? 7.724   -26.084 46.795  1.00 49.53  ? 186 ASN A N   1 
ATOM   1441 C CA  . ASN A 1 185 ? 7.446   -26.675 48.099  1.00 47.47  ? 186 ASN A CA  1 
ATOM   1442 C C   . ASN A 1 185 ? 7.865   -28.095 48.356  1.00 43.81  ? 186 ASN A C   1 
ATOM   1443 O O   . ASN A 1 185 ? 7.730   -28.551 49.484  1.00 43.87  ? 186 ASN A O   1 
ATOM   1444 C CB  . ASN A 1 185 ? 5.960   -26.611 48.400  1.00 39.64  ? 186 ASN A CB  1 
ATOM   1445 C CG  . ASN A 1 185 ? 5.437   -25.211 48.393  1.00 50.02  ? 186 ASN A CG  1 
ATOM   1446 O OD1 . ASN A 1 185 ? 5.662   -24.458 49.335  1.00 48.30  ? 186 ASN A OD1 1 
ATOM   1447 N ND2 . ASN A 1 185 ? 4.723   -24.842 47.326  1.00 47.71  ? 186 ASN A ND2 1 
ATOM   1448 N N   . VAL A 1 186 ? 8.361   -28.815 47.359  1.00 43.47  ? 187 VAL A N   1 
ATOM   1449 C CA  . VAL A 1 186 ? 8.546   -30.238 47.606  1.00 43.99  ? 187 VAL A CA  1 
ATOM   1450 C C   . VAL A 1 186 ? 9.715   -30.466 48.579  1.00 41.27  ? 187 VAL A C   1 
ATOM   1451 O O   . VAL A 1 186 ? 9.706   -31.446 49.330  1.00 49.42  ? 187 VAL A O   1 
ATOM   1452 C CB  . VAL A 1 186 ? 8.728   -31.052 46.289  1.00 39.09  ? 187 VAL A CB  1 
ATOM   1453 C CG1 . VAL A 1 186 ? 10.097  -30.837 45.653  1.00 37.47  ? 187 VAL A CG1 1 
ATOM   1454 C CG2 . VAL A 1 186 ? 8.463   -32.543 46.545  1.00 30.93  ? 187 VAL A CG2 1 
ATOM   1455 N N   . ALA A 1 187 ? 10.675  -29.542 48.611  1.00 46.33  ? 188 ALA A N   1 
ATOM   1456 C CA  . ALA A 1 187 ? 11.822  -29.652 49.528  1.00 50.05  ? 188 ALA A CA  1 
ATOM   1457 C C   . ALA A 1 187 ? 11.377  -29.768 50.982  1.00 47.37  ? 188 ALA A C   1 
ATOM   1458 O O   . ALA A 1 187 ? 12.027  -30.433 51.783  1.00 52.90  ? 188 ALA A O   1 
ATOM   1459 C CB  . ALA A 1 187 ? 12.750  -28.467 49.380  1.00 35.77  ? 188 ALA A CB  1 
ATOM   1460 N N   . ALA A 1 188 ? 10.253  -29.136 51.309  1.00 45.28  ? 189 ALA A N   1 
ATOM   1461 C CA  . ALA A 1 188 ? 9.706   -29.198 52.657  1.00 43.70  ? 189 ALA A CA  1 
ATOM   1462 C C   . ALA A 1 188 ? 9.320   -30.616 53.057  1.00 54.37  ? 189 ALA A C   1 
ATOM   1463 O O   . ALA A 1 188 ? 9.055   -30.878 54.231  1.00 49.54  ? 189 ALA A O   1 
ATOM   1464 C CB  . ALA A 1 188 ? 8.503   -28.291 52.785  1.00 38.67  ? 189 ALA A CB  1 
ATOM   1465 N N   . PHE A 1 189 ? 9.254   -31.525 52.082  1.00 47.85  ? 190 PHE A N   1 
ATOM   1466 C CA  . PHE A 1 189 ? 8.872   -32.912 52.358  1.00 43.28  ? 190 PHE A CA  1 
ATOM   1467 C C   . PHE A 1 189 ? 10.056  -33.840 52.159  1.00 41.37  ? 190 PHE A C   1 
ATOM   1468 O O   . PHE A 1 189 ? 9.929   -35.052 52.270  1.00 45.56  ? 190 PHE A O   1 
ATOM   1469 C CB  . PHE A 1 189 ? 7.712   -33.379 51.466  1.00 39.25  ? 190 PHE A CB  1 
ATOM   1470 C CG  . PHE A 1 189 ? 6.455   -32.515 51.542  1.00 38.40  ? 190 PHE A CG  1 
ATOM   1471 C CD1 . PHE A 1 189 ? 6.340   -31.364 50.775  1.00 41.53  ? 190 PHE A CD1 1 
ATOM   1472 C CD2 . PHE A 1 189 ? 5.371   -32.897 52.315  1.00 42.16  ? 190 PHE A CD2 1 
ATOM   1473 C CE1 . PHE A 1 189 ? 5.195   -30.593 50.808  1.00 40.34  ? 190 PHE A CE1 1 
ATOM   1474 C CE2 . PHE A 1 189 ? 4.202   -32.122 52.353  1.00 38.80  ? 190 PHE A CE2 1 
ATOM   1475 C CZ  . PHE A 1 189 ? 4.120   -30.970 51.607  1.00 42.50  ? 190 PHE A CZ  1 
ATOM   1476 N N   . GLY A 1 190 ? 11.218  -33.283 51.857  1.00 41.02  ? 191 GLY A N   1 
ATOM   1477 C CA  . GLY A 1 190 ? 12.386  -34.111 51.614  1.00 43.03  ? 191 GLY A CA  1 
ATOM   1478 C C   . GLY A 1 190 ? 12.592  -34.390 50.136  1.00 49.91  ? 191 GLY A C   1 
ATOM   1479 O O   . GLY A 1 190 ? 13.430  -35.215 49.751  1.00 48.39  ? 191 GLY A O   1 
ATOM   1480 N N   . GLY A 1 191 ? 11.834  -33.702 49.290  1.00 44.15  ? 192 GLY A N   1 
ATOM   1481 C CA  . GLY A 1 191 ? 11.953  -33.950 47.861  1.00 44.06  ? 192 GLY A CA  1 
ATOM   1482 C C   . GLY A 1 191 ? 12.994  -33.053 47.231  1.00 43.59  ? 192 GLY A C   1 
ATOM   1483 O O   . GLY A 1 191 ? 13.280  -31.961 47.730  1.00 56.92  ? 192 GLY A O   1 
ATOM   1484 N N   . ASP A 1 192 ? 13.559  -33.511 46.126  1.00 45.30  ? 193 ASP A N   1 
ATOM   1485 C CA  . ASP A 1 192 ? 14.576  -32.761 45.427  1.00 36.51  ? 193 ASP A CA  1 
ATOM   1486 C C   . ASP A 1 192 ? 14.001  -32.119 44.174  1.00 44.01  ? 193 ASP A C   1 
ATOM   1487 O O   . ASP A 1 192 ? 13.738  -32.798 43.189  1.00 50.56  ? 193 ASP A O   1 
ATOM   1488 C CB  . ASP A 1 192 ? 15.732  -33.691 45.092  1.00 47.56  ? 193 ASP A CB  1 
ATOM   1489 C CG  . ASP A 1 192 ? 16.809  -33.026 44.261  1.00 43.56  ? 193 ASP A CG  1 
ATOM   1490 O OD1 . ASP A 1 192 ? 16.766  -31.801 44.023  1.00 59.97  ? 193 ASP A OD1 1 
ATOM   1491 O OD2 . ASP A 1 192 ? 17.720  -33.752 43.843  1.00 60.99  ? 193 ASP A OD2 1 
ATOM   1492 N N   . PRO A 1 193 ? 13.830  -30.799 44.195  1.00 48.50  ? 194 PRO A N   1 
ATOM   1493 C CA  . PRO A 1 193 ? 13.192  -30.148 43.046  1.00 44.04  ? 194 PRO A CA  1 
ATOM   1494 C C   . PRO A 1 193 ? 14.042  -30.173 41.780  1.00 53.44  ? 194 PRO A C   1 
ATOM   1495 O O   . PRO A 1 193 ? 13.556  -29.759 40.721  1.00 47.85  ? 194 PRO A O   1 
ATOM   1496 C CB  . PRO A 1 193 ? 12.983  -28.707 43.525  1.00 41.27  ? 194 PRO A CB  1 
ATOM   1497 C CG  . PRO A 1 193 ? 13.947  -28.539 44.668  1.00 37.82  ? 194 PRO A CG  1 
ATOM   1498 C CD  . PRO A 1 193 ? 14.062  -29.874 45.317  1.00 38.95  ? 194 PRO A CD  1 
ATOM   1499 N N   . THR A 1 194 ? 15.279  -30.653 41.886  1.00 56.74  ? 195 THR A N   1 
ATOM   1500 C CA  . THR A 1 194 ? 16.179  -30.740 40.735  1.00 57.84  ? 195 THR A CA  1 
ATOM   1501 C C   . THR A 1 194 ? 16.145  -32.138 40.096  1.00 51.87  ? 195 THR A C   1 
ATOM   1502 O O   . THR A 1 194 ? 16.826  -32.398 39.101  1.00 56.78  ? 195 THR A O   1 
ATOM   1503 C CB  . THR A 1 194 ? 17.643  -30.415 41.116  1.00 56.41  ? 195 THR A CB  1 
ATOM   1504 O OG1 . THR A 1 194 ? 18.170  -31.470 41.929  1.00 56.03  ? 195 THR A OG1 1 
ATOM   1505 C CG2 . THR A 1 194 ? 17.729  -29.093 41.878  1.00 44.49  ? 195 THR A CG2 1 
ATOM   1506 N N   . SER A 1 195 ? 15.360  -33.033 40.685  1.00 48.42  ? 196 SER A N   1 
ATOM   1507 C CA  . SER A 1 195 ? 15.150  -34.365 40.121  1.00 53.80  ? 196 SER A CA  1 
ATOM   1508 C C   . SER A 1 195 ? 13.654  -34.729 40.092  1.00 46.44  ? 196 SER A C   1 
ATOM   1509 O O   . SER A 1 195 ? 13.179  -35.563 40.877  1.00 46.95  ? 196 SER A O   1 
ATOM   1510 C CB  . SER A 1 195 ? 15.939  -35.411 40.911  1.00 54.46  ? 196 SER A CB  1 
ATOM   1511 O OG  . SER A 1 195 ? 15.876  -36.691 40.285  1.00 61.74  ? 196 SER A OG  1 
ATOM   1512 N N   . VAL A 1 196 ? 12.912  -34.077 39.208  1.00 39.91  ? 197 VAL A N   1 
ATOM   1513 C CA  . VAL A 1 196 ? 11.487  -34.352 39.066  1.00 42.66  ? 197 VAL A CA  1 
ATOM   1514 C C   . VAL A 1 196 ? 11.176  -35.148 37.772  1.00 49.68  ? 197 VAL A C   1 
ATOM   1515 O O   . VAL A 1 196 ? 11.433  -34.677 36.650  1.00 41.55  ? 197 VAL A O   1 
ATOM   1516 C CB  . VAL A 1 196 ? 10.695  -33.044 39.084  1.00 45.40  ? 197 VAL A CB  1 
ATOM   1517 C CG1 . VAL A 1 196 ? 9.200   -33.308 38.920  1.00 42.37  ? 197 VAL A CG1 1 
ATOM   1518 C CG2 . VAL A 1 196 ? 10.970  -32.287 40.363  1.00 40.46  ? 197 VAL A CG2 1 
ATOM   1519 N N   . THR A 1 197 ? 10.643  -36.360 37.935  1.00 44.06  ? 198 THR A N   1 
ATOM   1520 C CA  . THR A 1 197 ? 10.183  -37.161 36.795  1.00 43.68  ? 198 THR A CA  1 
ATOM   1521 C C   . THR A 1 197 ? 8.648   -37.144 36.643  1.00 47.10  ? 198 THR A C   1 
ATOM   1522 O O   . THR A 1 197 ? 7.929   -37.479 37.581  1.00 41.59  ? 198 THR A O   1 
ATOM   1523 C CB  . THR A 1 197 ? 10.631  -38.614 36.922  1.00 40.93  ? 198 THR A CB  1 
ATOM   1524 O OG1 . THR A 1 197 ? 12.054  -38.672 37.068  1.00 42.15  ? 198 THR A OG1 1 
ATOM   1525 C CG2 . THR A 1 197 ? 10.238  -39.407 35.681  1.00 38.15  ? 198 THR A CG2 1 
ATOM   1526 N N   . LEU A 1 198 ? 8.158   -36.727 35.475  1.00 41.31  ? 199 LEU A N   1 
ATOM   1527 C CA  . LEU A 1 198 ? 6.732   -36.800 35.155  1.00 33.30  ? 199 LEU A CA  1 
ATOM   1528 C C   . LEU A 1 198 ? 6.366   -38.166 34.586  1.00 34.80  ? 199 LEU A C   1 
ATOM   1529 O O   . LEU A 1 198 ? 7.000   -38.621 33.638  1.00 43.95  ? 199 LEU A O   1 
ATOM   1530 C CB  . LEU A 1 198 ? 6.344   -35.750 34.128  1.00 36.25  ? 199 LEU A CB  1 
ATOM   1531 C CG  . LEU A 1 198 ? 6.425   -34.280 34.443  1.00 38.59  ? 199 LEU A CG  1 
ATOM   1532 C CD1 . LEU A 1 198 ? 5.807   -33.492 33.287  1.00 31.35  ? 199 LEU A CD1 1 
ATOM   1533 C CD2 . LEU A 1 198 ? 5.712   -33.971 35.747  1.00 44.42  ? 199 LEU A CD2 1 
ATOM   1534 N N   . PHE A 1 199 ? 5.371   -38.833 35.154  1.00 37.10  ? 200 PHE A N   1 
ATOM   1535 C CA  . PHE A 1 199 ? 4.795   -39.977 34.469  1.00 33.95  ? 200 PHE A CA  1 
ATOM   1536 C C   . PHE A 1 199 ? 3.262   -39.846 34.446  1.00 39.53  ? 200 PHE A C   1 
ATOM   1537 O O   . PHE A 1 199 ? 2.662   -39.095 35.232  1.00 37.75  ? 200 PHE A O   1 
ATOM   1538 C CB  . PHE A 1 199 ? 5.276   -41.319 35.055  1.00 32.10  ? 200 PHE A CB  1 
ATOM   1539 C CG  . PHE A 1 199 ? 4.844   -41.619 36.482  1.00 41.18  ? 200 PHE A CG  1 
ATOM   1540 C CD1 . PHE A 1 199 ? 4.874   -40.655 37.479  1.00 36.79  ? 200 PHE A CD1 1 
ATOM   1541 C CD2 . PHE A 1 199 ? 4.470   -42.910 36.827  1.00 38.71  ? 200 PHE A CD2 1 
ATOM   1542 C CE1 . PHE A 1 199 ? 4.512   -40.973 38.774  1.00 40.74  ? 200 PHE A CE1 1 
ATOM   1543 C CE2 . PHE A 1 199 ? 4.100   -43.235 38.134  1.00 42.63  ? 200 PHE A CE2 1 
ATOM   1544 C CZ  . PHE A 1 199 ? 4.121   -42.267 39.103  1.00 35.95  ? 200 PHE A CZ  1 
ATOM   1545 N N   . GLY A 1 200 ? 2.650   -40.519 33.479  1.00 37.44  ? 201 GLY A N   1 
ATOM   1546 C CA  . GLY A 1 200 ? 1.239   -40.368 33.189  1.00 33.04  ? 201 GLY A CA  1 
ATOM   1547 C C   . GLY A 1 200 ? 0.827   -41.439 32.202  1.00 35.75  ? 201 GLY A C   1 
ATOM   1548 O O   . GLY A 1 200 ? 1.644   -41.930 31.410  1.00 38.91  ? 201 GLY A O   1 
ATOM   1549 N N   . GLU A 1 201 ? -0.448  -41.808 32.240  1.00 42.96  ? 202 GLU A N   1 
ATOM   1550 C CA  . GLU A 1 201 ? -0.971  -42.844 31.358  1.00 34.94  ? 202 GLU A CA  1 
ATOM   1551 C C   . GLU A 1 201 ? -2.091  -42.234 30.511  1.00 46.29  ? 202 GLU A C   1 
ATOM   1552 O O   . GLU A 1 201 ? -2.847  -41.367 30.988  1.00 38.15  ? 202 GLU A O   1 
ATOM   1553 C CB  . GLU A 1 201 ? -1.443  -44.043 32.189  1.00 42.74  ? 202 GLU A CB  1 
ATOM   1554 C CG  . GLU A 1 201 ? -1.873  -45.278 31.410  1.00 39.70  ? 202 GLU A CG  1 
ATOM   1555 C CD  . GLU A 1 201 ? -3.352  -45.243 31.076  1.00 46.75  ? 202 GLU A CD  1 
ATOM   1556 O OE1 . GLU A 1 201 ? -4.048  -44.298 31.553  1.00 43.92  ? 202 GLU A OE1 1 
ATOM   1557 O OE2 . GLU A 1 201 ? -3.804  -46.137 30.314  1.00 50.29  ? 202 GLU A OE2 1 
ATOM   1558 N N   . SER A 1 202 ? -2.148  -42.636 29.241  1.00 45.61  ? 203 SER A N   1 
ATOM   1559 C CA  . SER A 1 202 ? -3.200  -42.214 28.304  1.00 51.02  ? 203 SER A CA  1 
ATOM   1560 C C   . SER A 1 202 ? -3.255  -40.670 28.108  1.00 38.03  ? 203 SER A C   1 
ATOM   1561 O O   . SER A 1 202 ? -2.294  -40.082 27.614  1.00 43.82  ? 203 SER A O   1 
ATOM   1562 C CB  . SER A 1 202 ? -4.549  -42.785 28.771  1.00 54.72  ? 203 SER A CB  1 
ATOM   1563 O OG  . SER A 1 202 ? -5.506  -42.792 27.731  1.00 61.20  ? 203 SER A OG  1 
ATOM   1564 N N   . ALA A 1 203 ? -4.345  -40.005 28.484  1.00 43.17  ? 204 ALA A N   1 
ATOM   1565 C CA  . ALA A 1 203 ? -4.367  -38.535 28.396  1.00 37.92  ? 204 ALA A CA  1 
ATOM   1566 C C   . ALA A 1 203 ? -3.373  -37.895 29.369  1.00 42.09  ? 204 ALA A C   1 
ATOM   1567 O O   . ALA A 1 203 ? -2.920  -36.751 29.156  1.00 36.27  ? 204 ALA A O   1 
ATOM   1568 C CB  . ALA A 1 203 ? -5.749  -37.995 28.654  1.00 32.91  ? 204 ALA A CB  1 
ATOM   1569 N N   . GLY A 1 204 ? -3.051  -38.619 30.444  1.00 37.50  ? 205 GLY A N   1 
ATOM   1570 C CA  . GLY A 1 204 ? -1.958  -38.224 31.319  1.00 39.53  ? 205 GLY A CA  1 
ATOM   1571 C C   . GLY A 1 204 ? -0.614  -38.247 30.602  1.00 36.40  ? 205 GLY A C   1 
ATOM   1572 O O   . GLY A 1 204 ? 0.221   -37.367 30.787  1.00 37.84  ? 205 GLY A O   1 
ATOM   1573 N N   . ALA A 1 205 ? -0.407  -39.265 29.772  1.00 42.62  ? 206 ALA A N   1 
ATOM   1574 C CA  . ALA A 1 205 ? 0.799   -39.352 28.967  1.00 39.73  ? 206 ALA A CA  1 
ATOM   1575 C C   . ALA A 1 205 ? 0.820   -38.231 27.901  1.00 35.28  ? 206 ALA A C   1 
ATOM   1576 O O   . ALA A 1 205 ? 1.839   -37.590 27.672  1.00 41.60  ? 206 ALA A O   1 
ATOM   1577 C CB  . ALA A 1 205 ? 0.897   -40.722 28.322  1.00 38.34  ? 206 ALA A CB  1 
ATOM   1578 N N   . ALA A 1 206 ? -0.316  -37.982 27.271  1.00 40.36  ? 207 ALA A N   1 
ATOM   1579 C CA  . ALA A 1 206 ? -0.426  -36.899 26.299  1.00 42.36  ? 207 ALA A CA  1 
ATOM   1580 C C   . ALA A 1 206 ? -0.104  -35.563 26.979  1.00 42.97  ? 207 ALA A C   1 
ATOM   1581 O O   . ALA A 1 206 ? 0.543   -34.675 26.402  1.00 43.93  ? 207 ALA A O   1 
ATOM   1582 C CB  . ALA A 1 206 ? -1.833  -36.874 25.679  1.00 34.13  ? 207 ALA A CB  1 
ATOM   1583 N N   . SER A 1 207 ? -0.563  -35.433 28.214  1.00 38.68  ? 208 SER A N   1 
ATOM   1584 C CA  . SER A 1 207 ? -0.277  -34.259 29.029  1.00 36.47  ? 208 SER A CA  1 
ATOM   1585 C C   . SER A 1 207 ? 1.224   -34.086 29.254  1.00 39.35  ? 208 SER A C   1 
ATOM   1586 O O   . SER A 1 207 ? 1.764   -32.996 29.077  1.00 36.29  ? 208 SER A O   1 
ATOM   1587 C CB  . SER A 1 207 ? -0.994  -34.373 30.373  1.00 35.26  ? 208 SER A CB  1 
ATOM   1588 O OG  . SER A 1 207 ? -2.394  -34.249 30.195  1.00 37.72  ? 208 SER A OG  1 
ATOM   1589 N N   . VAL A 1 208 ? 1.879   -35.165 29.680  1.00 35.21  ? 209 VAL A N   1 
ATOM   1590 C CA  . VAL A 1 208 ? 3.319   -35.162 29.888  1.00 36.39  ? 209 VAL A CA  1 
ATOM   1591 C C   . VAL A 1 208 ? 4.036   -34.675 28.619  1.00 41.74  ? 209 VAL A C   1 
ATOM   1592 O O   . VAL A 1 208 ? 4.775   -33.690 28.649  1.00 42.49  ? 209 VAL A O   1 
ATOM   1593 C CB  . VAL A 1 208 ? 3.817   -36.559 30.281  1.00 34.86  ? 209 VAL A CB  1 
ATOM   1594 C CG1 . VAL A 1 208 ? 5.330   -36.638 30.148  1.00 32.66  ? 209 VAL A CG1 1 
ATOM   1595 C CG2 . VAL A 1 208 ? 3.375   -36.899 31.701  1.00 32.12  ? 209 VAL A CG2 1 
ATOM   1596 N N   . GLY A 1 209 ? 3.777   -35.338 27.496  1.00 40.31  ? 210 GLY A N   1 
ATOM   1597 C CA  . GLY A 1 209 ? 4.292   -34.908 26.205  1.00 34.78  ? 210 GLY A CA  1 
ATOM   1598 C C   . GLY A 1 209 ? 4.014   -33.446 25.889  1.00 38.47  ? 210 GLY A C   1 
ATOM   1599 O O   . GLY A 1 209 ? 4.861   -32.748 25.333  1.00 42.58  ? 210 GLY A O   1 
ATOM   1600 N N   . MET A 1 210 ? 2.837   -32.960 26.254  1.00 43.15  ? 211 MET A N   1 
ATOM   1601 C CA  . MET A 1 210 ? 2.542   -31.560 26.004  1.00 35.60  ? 211 MET A CA  1 
ATOM   1602 C C   . MET A 1 210 ? 3.411   -30.657 26.858  1.00 44.32  ? 211 MET A C   1 
ATOM   1603 O O   . MET A 1 210 ? 3.849   -29.615 26.394  1.00 46.30  ? 211 MET A O   1 
ATOM   1604 C CB  . MET A 1 210 ? 1.054   -31.277 26.218  1.00 34.16  ? 211 MET A CB  1 
ATOM   1605 C CG  . MET A 1 210 ? 0.252   -31.667 24.949  1.00 41.31  ? 211 MET A CG  1 
ATOM   1606 S SD  . MET A 1 210 ? -1.517  -31.584 25.188  1.00 56.89  ? 211 MET A SD  1 
ATOM   1607 C CE  . MET A 1 210 ? -2.124  -32.976 24.205  1.00 40.54  ? 211 MET A CE  1 
ATOM   1608 N N   . HIS A 1 211 ? 3.700   -31.063 28.090  1.00 43.48  ? 212 HIS A N   1 
ATOM   1609 C CA  . HIS A 1 211 ? 4.603   -30.274 28.920  1.00 41.91  ? 212 HIS A CA  1 
ATOM   1610 C C   . HIS A 1 211 ? 6.014   -30.277 28.332  1.00 42.40  ? 212 HIS A C   1 
ATOM   1611 O O   . HIS A 1 211 ? 6.724   -29.278 28.405  1.00 43.78  ? 212 HIS A O   1 
ATOM   1612 C CB  . HIS A 1 211 ? 4.601   -30.794 30.370  1.00 36.88  ? 212 HIS A CB  1 
ATOM   1613 C CG  . HIS A 1 211 ? 3.335   -30.486 31.102  1.00 29.61  ? 212 HIS A CG  1 
ATOM   1614 N ND1 . HIS A 1 211 ? 2.950   -29.197 31.402  1.00 40.16  ? 212 HIS A ND1 1 
ATOM   1615 C CD2 . HIS A 1 211 ? 2.339   -31.290 31.548  1.00 40.62  ? 212 HIS A CD2 1 
ATOM   1616 C CE1 . HIS A 1 211 ? 1.783   -29.222 32.023  1.00 31.97  ? 212 HIS A CE1 1 
ATOM   1617 N NE2 . HIS A 1 211 ? 1.392   -30.479 32.127  1.00 37.19  ? 212 HIS A NE2 1 
ATOM   1618 N N   . LEU A 1 212 ? 6.415   -31.409 27.764  1.00 39.98  ? 213 LEU A N   1 
ATOM   1619 C CA  . LEU A 1 212 ? 7.677   -31.498 27.041  1.00 47.86  ? 213 LEU A CA  1 
ATOM   1620 C C   . LEU A 1 212 ? 7.786   -30.461 25.920  1.00 52.60  ? 213 LEU A C   1 
ATOM   1621 O O   . LEU A 1 212 ? 8.875   -29.938 25.647  1.00 55.28  ? 213 LEU A O   1 
ATOM   1622 C CB  . LEU A 1 212 ? 7.852   -32.891 26.442  1.00 40.20  ? 213 LEU A CB  1 
ATOM   1623 C CG  . LEU A 1 212 ? 8.364   -33.967 27.379  1.00 55.32  ? 213 LEU A CG  1 
ATOM   1624 C CD1 . LEU A 1 212 ? 8.491   -35.238 26.583  1.00 42.79  ? 213 LEU A CD1 1 
ATOM   1625 C CD2 . LEU A 1 212 ? 9.704   -33.568 27.982  1.00 51.18  ? 213 LEU A CD2 1 
ATOM   1626 N N   . LEU A 1 213 ? 6.661   -30.185 25.264  1.00 40.95  ? 214 LEU A N   1 
ATOM   1627 C CA  . LEU A 1 213 ? 6.635   -29.356 24.053  1.00 40.69  ? 214 LEU A CA  1 
ATOM   1628 C C   . LEU A 1 213 ? 6.249   -27.912 24.343  1.00 41.79  ? 214 LEU A C   1 
ATOM   1629 O O   . LEU A 1 213 ? 6.096   -27.107 23.431  1.00 48.45  ? 214 LEU A O   1 
ATOM   1630 C CB  . LEU A 1 213 ? 5.666   -29.950 23.038  1.00 36.56  ? 214 LEU A CB  1 
ATOM   1631 C CG  . LEU A 1 213 ? 5.986   -31.401 22.659  1.00 46.58  ? 214 LEU A CG  1 
ATOM   1632 C CD1 . LEU A 1 213 ? 4.866   -32.006 21.844  1.00 39.06  ? 214 LEU A CD1 1 
ATOM   1633 C CD2 . LEU A 1 213 ? 7.292   -31.481 21.877  1.00 52.09  ? 214 LEU A CD2 1 
ATOM   1634 N N   . SER A 1 214 ? 6.085   -27.582 25.618  1.00 44.95  ? 215 SER A N   1 
ATOM   1635 C CA  . SER A 1 214 ? 5.731   -26.212 25.983  1.00 44.55  ? 215 SER A CA  1 
ATOM   1636 C C   . SER A 1 214 ? 6.783   -25.629 26.912  1.00 50.08  ? 215 SER A C   1 
ATOM   1637 O O   . SER A 1 214 ? 6.893   -26.058 28.067  1.00 54.71  ? 215 SER A O   1 
ATOM   1638 C CB  . SER A 1 214 ? 4.350   -26.158 26.635  1.00 41.40  ? 215 SER A CB  1 
ATOM   1639 O OG  . SER A 1 214 ? 4.051   -24.830 27.027  1.00 44.49  ? 215 SER A OG  1 
ATOM   1640 N N   . PRO A 1 215 ? 7.572   -24.664 26.406  1.00 51.83  ? 216 PRO A N   1 
ATOM   1641 C CA  . PRO A 1 215 ? 8.751   -24.158 27.129  1.00 51.33  ? 216 PRO A CA  1 
ATOM   1642 C C   . PRO A 1 215 ? 8.511   -23.727 28.589  1.00 52.29  ? 216 PRO A C   1 
ATOM   1643 O O   . PRO A 1 215 ? 9.353   -24.058 29.426  1.00 46.12  ? 216 PRO A O   1 
ATOM   1644 C CB  . PRO A 1 215 ? 9.198   -22.979 26.256  1.00 48.68  ? 216 PRO A CB  1 
ATOM   1645 C CG  . PRO A 1 215 ? 8.843   -23.463 24.836  1.00 43.74  ? 216 PRO A CG  1 
ATOM   1646 C CD  . PRO A 1 215 ? 7.510   -24.156 25.018  1.00 58.26  ? 216 PRO A CD  1 
ATOM   1647 N N   . PRO A 1 216 ? 7.402   -23.029 28.905  1.00 46.04  ? 217 PRO A N   1 
ATOM   1648 C CA  . PRO A 1 216 ? 7.236   -22.666 30.324  1.00 45.00  ? 217 PRO A CA  1 
ATOM   1649 C C   . PRO A 1 216 ? 7.084   -23.866 31.269  1.00 52.68  ? 217 PRO A C   1 
ATOM   1650 O O   . PRO A 1 216 ? 7.302   -23.720 32.469  1.00 50.43  ? 217 PRO A O   1 
ATOM   1651 C CB  . PRO A 1 216 ? 5.957   -21.828 30.326  1.00 41.56  ? 217 PRO A CB  1 
ATOM   1652 C CG  . PRO A 1 216 ? 5.833   -21.307 28.922  1.00 36.32  ? 217 PRO A CG  1 
ATOM   1653 C CD  . PRO A 1 216 ? 6.395   -22.380 28.047  1.00 38.66  ? 217 PRO A CD  1 
ATOM   1654 N N   . SER A 1 217 ? 6.727   -25.032 30.739  1.00 43.53  ? 218 SER A N   1 
ATOM   1655 C CA  . SER A 1 217 ? 6.617   -26.243 31.553  1.00 49.63  ? 218 SER A CA  1 
ATOM   1656 C C   . SER A 1 217 ? 7.945   -26.996 31.626  1.00 47.93  ? 218 SER A C   1 
ATOM   1657 O O   . SER A 1 217 ? 8.201   -27.733 32.575  1.00 51.75  ? 218 SER A O   1 
ATOM   1658 C CB  . SER A 1 217 ? 5.523   -27.178 31.010  1.00 39.77  ? 218 SER A CB  1 
ATOM   1659 O OG  . SER A 1 217 ? 4.238   -26.577 31.079  1.00 47.15  ? 218 SER A OG  1 
ATOM   1660 N N   . ARG A 1 218 ? 8.799   -26.789 30.634  1.00 50.75  ? 219 ARG A N   1 
ATOM   1661 C CA  . ARG A 1 218 ? 9.932   -27.671 30.438  1.00 45.79  ? 219 ARG A CA  1 
ATOM   1662 C C   . ARG A 1 218 ? 10.962  -27.455 31.538  1.00 49.40  ? 219 ARG A C   1 
ATOM   1663 O O   . ARG A 1 218 ? 11.704  -28.367 31.908  1.00 52.67  ? 219 ARG A O   1 
ATOM   1664 C CB  . ARG A 1 218 ? 10.515  -27.449 29.034  1.00 58.99  ? 219 ARG A CB  1 
ATOM   1665 C CG  . ARG A 1 218 ? 11.622  -28.402 28.631  1.00 60.42  ? 219 ARG A CG  1 
ATOM   1666 C CD  . ARG A 1 218 ? 11.190  -29.850 28.625  1.00 63.37  ? 219 ARG A CD  1 
ATOM   1667 N NE  . ARG A 1 218 ? 12.327  -30.767 28.470  1.00 63.59  ? 219 ARG A NE  1 
ATOM   1668 C CZ  . ARG A 1 218 ? 13.046  -31.262 29.486  1.00 72.46  ? 219 ARG A CZ  1 
ATOM   1669 N NH1 . ARG A 1 218 ? 12.775  -30.936 30.749  1.00 42.48  ? 219 ARG A NH1 1 
ATOM   1670 N NH2 . ARG A 1 218 ? 14.049  -32.094 29.236  1.00 71.08  ? 219 ARG A NH2 1 
ATOM   1671 N N   . GLY A 1 219 ? 10.986  -26.252 32.098  1.00 48.04  ? 220 GLY A N   1 
ATOM   1672 C CA  . GLY A 1 219 ? 11.881  -25.999 33.205  1.00 42.45  ? 220 GLY A CA  1 
ATOM   1673 C C   . GLY A 1 219 ? 11.388  -26.579 34.522  1.00 55.62  ? 220 GLY A C   1 
ATOM   1674 O O   . GLY A 1 219 ? 12.098  -26.514 35.512  1.00 49.18  ? 220 GLY A O   1 
ATOM   1675 N N   . LEU A 1 220 ? 10.187  -27.158 34.549  1.00 50.16  ? 221 LEU A N   1 
ATOM   1676 C CA  . LEU A 1 220 ? 9.634   -27.645 35.817  1.00 46.75  ? 221 LEU A CA  1 
ATOM   1677 C C   . LEU A 1 220 ? 9.861   -29.123 36.094  1.00 47.75  ? 221 LEU A C   1 
ATOM   1678 O O   . LEU A 1 220 ? 9.378   -29.640 37.102  1.00 44.90  ? 221 LEU A O   1 
ATOM   1679 C CB  . LEU A 1 220 ? 8.141   -27.366 35.876  1.00 39.42  ? 221 LEU A CB  1 
ATOM   1680 C CG  . LEU A 1 220 ? 7.795   -25.917 35.581  1.00 49.49  ? 221 LEU A CG  1 
ATOM   1681 C CD1 . LEU A 1 220 ? 6.297   -25.730 35.529  1.00 42.09  ? 221 LEU A CD1 1 
ATOM   1682 C CD2 . LEU A 1 220 ? 8.420   -25.050 36.651  1.00 34.47  ? 221 LEU A CD2 1 
ATOM   1683 N N   . PHE A 1 221 ? 10.585  -29.807 35.214  1.00 44.67  ? 222 PHE A N   1 
ATOM   1684 C CA  . PHE A 1 221 ? 10.889  -31.223 35.432  1.00 41.28  ? 222 PHE A CA  1 
ATOM   1685 C C   . PHE A 1 221 ? 12.073  -31.632 34.570  1.00 43.15  ? 222 PHE A C   1 
ATOM   1686 O O   . PHE A 1 221 ? 12.529  -30.870 33.727  1.00 45.99  ? 222 PHE A O   1 
ATOM   1687 C CB  . PHE A 1 221 ? 9.669   -32.105 35.122  1.00 44.73  ? 222 PHE A CB  1 
ATOM   1688 C CG  . PHE A 1 221 ? 9.241   -32.077 33.670  1.00 42.52  ? 222 PHE A CG  1 
ATOM   1689 C CD1 . PHE A 1 221 ? 8.513   -31.013 33.165  1.00 42.02  ? 222 PHE A CD1 1 
ATOM   1690 C CD2 . PHE A 1 221 ? 9.553   -33.124 32.824  1.00 41.07  ? 222 PHE A CD2 1 
ATOM   1691 C CE1 . PHE A 1 221 ? 8.108   -30.993 31.848  1.00 41.08  ? 222 PHE A CE1 1 
ATOM   1692 C CE2 . PHE A 1 221 ? 9.154   -33.114 31.490  1.00 40.44  ? 222 PHE A CE2 1 
ATOM   1693 C CZ  . PHE A 1 221 ? 8.431   -32.044 31.002  1.00 43.60  ? 222 PHE A CZ  1 
ATOM   1694 N N   . HIS A 1 222 ? 12.558  -32.847 34.762  1.00 40.98  ? 223 HIS A N   1 
ATOM   1695 C CA  . HIS A 1 222 ? 13.801  -33.241 34.142  1.00 47.87  ? 223 HIS A CA  1 
ATOM   1696 C C   . HIS A 1 222 ? 13.693  -34.494 33.275  1.00 41.72  ? 223 HIS A C   1 
ATOM   1697 O O   . HIS A 1 222 ? 14.365  -34.590 32.264  1.00 56.24  ? 223 HIS A O   1 
ATOM   1698 C CB  . HIS A 1 222 ? 14.843  -33.398 35.259  1.00 44.55  ? 223 HIS A CB  1 
ATOM   1699 C CG  . HIS A 1 222 ? 14.891  -32.204 36.159  1.00 62.70  ? 223 HIS A CG  1 
ATOM   1700 N ND1 . HIS A 1 222 ? 14.095  -32.088 37.284  1.00 56.55  ? 223 HIS A ND1 1 
ATOM   1701 C CD2 . HIS A 1 222 ? 15.564  -31.031 36.051  1.00 56.51  ? 223 HIS A CD2 1 
ATOM   1702 C CE1 . HIS A 1 222 ? 14.304  -30.912 37.847  1.00 53.58  ? 223 HIS A CE1 1 
ATOM   1703 N NE2 . HIS A 1 222 ? 15.197  -30.254 37.125  1.00 65.57  ? 223 HIS A NE2 1 
ATOM   1704 N N   . ARG A 1 223 ? 12.847  -35.440 33.667  1.00 49.20  ? 224 ARG A N   1 
ATOM   1705 C CA  . ARG A 1 223 ? 12.654  -36.685 32.932  1.00 39.30  ? 224 ARG A CA  1 
ATOM   1706 C C   . ARG A 1 223 ? 11.162  -36.925 32.718  1.00 39.31  ? 224 ARG A C   1 
ATOM   1707 O O   . ARG A 1 223 ? 10.344  -36.305 33.397  1.00 42.25  ? 224 ARG A O   1 
ATOM   1708 C CB  . ARG A 1 223 ? 13.293  -37.852 33.681  1.00 42.86  ? 224 ARG A CB  1 
ATOM   1709 C CG  . ARG A 1 223 ? 14.767  -38.004 33.425  1.00 51.53  ? 224 ARG A CG  1 
ATOM   1710 C CD  . ARG A 1 223 ? 15.413  -38.926 34.447  1.00 45.99  ? 224 ARG A CD  1 
ATOM   1711 N NE  . ARG A 1 223 ? 15.401  -38.286 35.748  1.00 74.48  ? 224 ARG A NE  1 
ATOM   1712 C CZ  . ARG A 1 223 ? 16.350  -37.468 36.183  1.00 70.26  ? 224 ARG A CZ  1 
ATOM   1713 N NH1 . ARG A 1 223 ? 17.407  -37.225 35.415  1.00 68.51  ? 224 ARG A NH1 1 
ATOM   1714 N NH2 . ARG A 1 223 ? 16.236  -36.902 37.383  1.00 68.15  ? 224 ARG A NH2 1 
ATOM   1715 N N   . ALA A 1 224 ? 10.807  -37.803 31.771  1.00 38.54  ? 225 ALA A N   1 
ATOM   1716 C CA  . ALA A 1 224 ? 9.406   -38.036 31.404  1.00 32.91  ? 225 ALA A CA  1 
ATOM   1717 C C   . ALA A 1 224 ? 9.052   -39.508 31.120  1.00 41.14  ? 225 ALA A C   1 
ATOM   1718 O O   . ALA A 1 224 ? 9.798   -40.232 30.460  1.00 36.56  ? 225 ALA A O   1 
ATOM   1719 C CB  . ALA A 1 224 ? 9.051   -37.196 30.205  1.00 38.29  ? 225 ALA A CB  1 
ATOM   1720 N N   . VAL A 1 225 ? 7.913   -39.954 31.639  1.00 34.89  ? 226 VAL A N   1 
ATOM   1721 C CA  . VAL A 1 225 ? 7.404   -41.279 31.303  1.00 35.04  ? 226 VAL A CA  1 
ATOM   1722 C C   . VAL A 1 225 ? 6.058   -41.151 30.634  1.00 41.06  ? 226 VAL A C   1 
ATOM   1723 O O   . VAL A 1 225 ? 5.152   -40.527 31.182  1.00 41.00  ? 226 VAL A O   1 
ATOM   1724 C CB  . VAL A 1 225 ? 7.221   -42.192 32.512  1.00 40.13  ? 226 VAL A CB  1 
ATOM   1725 C CG1 . VAL A 1 225 ? 6.724   -43.571 32.051  1.00 34.18  ? 226 VAL A CG1 1 
ATOM   1726 C CG2 . VAL A 1 225 ? 8.498   -42.294 33.329  1.00 33.39  ? 226 VAL A CG2 1 
ATOM   1727 N N   . LEU A 1 226 ? 5.926   -41.762 29.466  1.00 34.65  ? 227 LEU A N   1 
ATOM   1728 C CA  . LEU A 1 226 ? 4.675   -41.737 28.712  1.00 40.14  ? 227 LEU A CA  1 
ATOM   1729 C C   . LEU A 1 226 ? 4.149   -43.137 28.538  1.00 40.95  ? 227 LEU A C   1 
ATOM   1730 O O   . LEU A 1 226 ? 4.698   -43.907 27.749  1.00 41.35  ? 227 LEU A O   1 
ATOM   1731 C CB  . LEU A 1 226 ? 4.870   -41.105 27.344  1.00 36.54  ? 227 LEU A CB  1 
ATOM   1732 C CG  . LEU A 1 226 ? 4.979   -39.582 27.320  1.00 37.97  ? 227 LEU A CG  1 
ATOM   1733 C CD1 . LEU A 1 226 ? 6.382   -39.148 27.616  1.00 29.82  ? 227 LEU A CD1 1 
ATOM   1734 C CD2 . LEU A 1 226 ? 4.536   -39.113 25.961  1.00 35.07  ? 227 LEU A CD2 1 
ATOM   1735 N N   . GLN A 1 227 ? 3.076   -43.455 29.255  1.00 33.91  ? 228 GLN A N   1 
ATOM   1736 C CA  . GLN A 1 227 ? 2.492   -44.786 29.234  1.00 33.27  ? 228 GLN A CA  1 
ATOM   1737 C C   . GLN A 1 227 ? 1.207   -44.803 28.400  1.00 38.49  ? 228 GLN A C   1 
ATOM   1738 O O   . GLN A 1 227 ? 0.221   -44.157 28.780  1.00 35.22  ? 228 GLN A O   1 
ATOM   1739 C CB  . GLN A 1 227 ? 2.196   -45.241 30.672  1.00 34.85  ? 228 GLN A CB  1 
ATOM   1740 C CG  . GLN A 1 227 ? 3.416   -45.244 31.593  1.00 32.64  ? 228 GLN A CG  1 
ATOM   1741 C CD  . GLN A 1 227 ? 3.051   -45.438 33.062  1.00 49.15  ? 228 GLN A CD  1 
ATOM   1742 O OE1 . GLN A 1 227 ? 3.779   -45.006 33.964  1.00 46.16  ? 228 GLN A OE1 1 
ATOM   1743 N NE2 . GLN A 1 227 ? 1.911   -46.076 33.309  1.00 42.80  ? 228 GLN A NE2 1 
ATOM   1744 N N   . SER A 1 228 ? 1.214   -45.529 27.273  1.00 39.06  ? 229 SER A N   1 
ATOM   1745 C CA  . SER A 1 228 ? -0.011  -45.740 26.484  1.00 33.56  ? 229 SER A CA  1 
ATOM   1746 C C   . SER A 1 228 ? -0.709  -44.456 26.113  1.00 31.89  ? 229 SER A C   1 
ATOM   1747 O O   . SER A 1 228 ? -1.914  -44.346 26.278  1.00 39.87  ? 229 SER A O   1 
ATOM   1748 C CB  . SER A 1 228 ? -1.026  -46.628 27.236  1.00 32.52  ? 229 SER A CB  1 
ATOM   1749 O OG  . SER A 1 228 ? -0.483  -47.917 27.483  1.00 45.64  ? 229 SER A OG  1 
ATOM   1750 N N   . GLY A 1 229 ? 0.040   -43.477 25.637  1.00 34.94  ? 230 GLY A N   1 
ATOM   1751 C CA  . GLY A 1 229 ? -0.550  -42.219 25.241  1.00 33.16  ? 230 GLY A CA  1 
ATOM   1752 C C   . GLY A 1 229 ? 0.558   -41.306 24.774  1.00 39.78  ? 230 GLY A C   1 
ATOM   1753 O O   . GLY A 1 229 ? 1.714   -41.539 25.097  1.00 41.64  ? 230 GLY A O   1 
ATOM   1754 N N   . ALA A 1 230 ? 0.200   -40.268 24.029  1.00 35.06  ? 231 ALA A N   1 
ATOM   1755 C CA  . ALA A 1 230 ? 1.172   -39.414 23.378  1.00 43.16  ? 231 ALA A CA  1 
ATOM   1756 C C   . ALA A 1 230 ? 0.475   -38.139 22.923  1.00 38.72  ? 231 ALA A C   1 
ATOM   1757 O O   . ALA A 1 230 ? -0.699  -38.169 22.585  1.00 45.18  ? 231 ALA A O   1 
ATOM   1758 C CB  . ALA A 1 230 ? 1.822   -40.142 22.208  1.00 35.07  ? 231 ALA A CB  1 
ATOM   1759 N N   . PRO A 1 231 ? 1.190   -37.005 22.919  1.00 38.45  ? 232 PRO A N   1 
ATOM   1760 C CA  . PRO A 1 231 ? 0.492   -35.748 22.629  1.00 38.64  ? 232 PRO A CA  1 
ATOM   1761 C C   . PRO A 1 231 ? 0.062   -35.628 21.166  1.00 42.47  ? 232 PRO A C   1 
ATOM   1762 O O   . PRO A 1 231 ? -0.819  -34.799 20.858  1.00 37.93  ? 232 PRO A O   1 
ATOM   1763 C CB  . PRO A 1 231 ? 1.528   -34.683 22.994  1.00 38.76  ? 232 PRO A CB  1 
ATOM   1764 C CG  . PRO A 1 231 ? 2.837   -35.342 22.772  1.00 38.66  ? 232 PRO A CG  1 
ATOM   1765 C CD  . PRO A 1 231 ? 2.643   -36.816 23.074  1.00 43.11  ? 232 PRO A CD  1 
ATOM   1766 N N   . ASN A 1 232 ? 0.663   -36.448 20.298  1.00 46.22  ? 233 ASN A N   1 
ATOM   1767 C CA  . ASN A 1 232 ? 0.326   -36.478 18.866  1.00 50.34  ? 233 ASN A CA  1 
ATOM   1768 C C   . ASN A 1 232 ? -0.791  -37.464 18.531  1.00 53.30  ? 233 ASN A C   1 
ATOM   1769 O O   . ASN A 1 232 ? -1.143  -37.634 17.370  1.00 43.93  ? 233 ASN A O   1 
ATOM   1770 C CB  . ASN A 1 232 ? 1.568   -36.809 17.999  1.00 40.30  ? 233 ASN A CB  1 
ATOM   1771 C CG  . ASN A 1 232 ? 2.443   -37.888 18.606  1.00 43.46  ? 233 ASN A CG  1 
ATOM   1772 O OD1 . ASN A 1 232 ? 2.803   -37.804 19.778  1.00 48.31  ? 233 ASN A OD1 1 
ATOM   1773 N ND2 . ASN A 1 232 ? 2.770   -38.920 17.825  1.00 38.49  ? 233 ASN A ND2 1 
ATOM   1774 N N   . GLY A 1 233 ? -1.348  -38.123 19.543  1.00 51.91  ? 234 GLY A N   1 
ATOM   1775 C CA  . GLY A 1 233 ? -2.552  -38.913 19.321  1.00 57.38  ? 234 GLY A CA  1 
ATOM   1776 C C   . GLY A 1 233 ? -3.638  -38.103 18.626  1.00 58.84  ? 234 GLY A C   1 
ATOM   1777 O O   . GLY A 1 233 ? -3.786  -36.913 18.900  1.00 59.59  ? 234 GLY A O   1 
ATOM   1778 N N   . PRO A 1 234 ? -4.403  -38.736 17.717  1.00 52.93  ? 235 PRO A N   1 
ATOM   1779 C CA  . PRO A 1 234 ? -5.461  -38.041 16.969  1.00 44.20  ? 235 PRO A CA  1 
ATOM   1780 C C   . PRO A 1 234 ? -6.629  -37.560 17.858  1.00 45.47  ? 235 PRO A C   1 
ATOM   1781 O O   . PRO A 1 234 ? -7.419  -36.724 17.430  1.00 51.92  ? 235 PRO A O   1 
ATOM   1782 C CB  . PRO A 1 234 ? -5.934  -39.108 15.974  1.00 42.30  ? 235 PRO A CB  1 
ATOM   1783 C CG  . PRO A 1 234 ? -5.725  -40.391 16.694  1.00 42.37  ? 235 PRO A CG  1 
ATOM   1784 C CD  . PRO A 1 234 ? -4.427  -40.188 17.467  1.00 44.91  ? 235 PRO A CD  1 
ATOM   1785 N N   . TRP A 1 235 ? -6.736  -38.080 19.076  1.00 43.78  ? 236 TRP A N   1 
ATOM   1786 C CA  . TRP A 1 235 ? -7.781  -37.651 20.005  1.00 40.13  ? 236 TRP A CA  1 
ATOM   1787 C C   . TRP A 1 235 ? -7.306  -36.545 20.970  1.00 47.47  ? 236 TRP A C   1 
ATOM   1788 O O   . TRP A 1 235 ? -8.107  -35.964 21.690  1.00 56.69  ? 236 TRP A O   1 
ATOM   1789 C CB  . TRP A 1 235 ? -8.268  -38.850 20.817  1.00 39.94  ? 236 TRP A CB  1 
ATOM   1790 C CG  . TRP A 1 235 ? -7.117  -39.625 21.369  1.00 41.98  ? 236 TRP A CG  1 
ATOM   1791 C CD1 . TRP A 1 235 ? -6.508  -40.710 20.803  1.00 52.34  ? 236 TRP A CD1 1 
ATOM   1792 C CD2 . TRP A 1 235 ? -6.409  -39.354 22.580  1.00 44.13  ? 236 TRP A CD2 1 
ATOM   1793 N NE1 . TRP A 1 235 ? -5.466  -41.150 21.599  1.00 41.51  ? 236 TRP A NE1 1 
ATOM   1794 C CE2 . TRP A 1 235 ? -5.379  -40.323 22.692  1.00 40.14  ? 236 TRP A CE2 1 
ATOM   1795 C CE3 . TRP A 1 235 ? -6.545  -38.385 23.586  1.00 43.87  ? 236 TRP A CE3 1 
ATOM   1796 C CZ2 . TRP A 1 235 ? -4.492  -40.354 23.770  1.00 37.03  ? 236 TRP A CZ2 1 
ATOM   1797 C CZ3 . TRP A 1 235 ? -5.666  -38.422 24.661  1.00 44.25  ? 236 TRP A CZ3 1 
ATOM   1798 C CH2 . TRP A 1 235 ? -4.651  -39.403 24.740  1.00 45.33  ? 236 TRP A CH2 1 
ATOM   1799 N N   . ALA A 1 236 ? -6.004  -36.267 20.995  1.00 44.57  ? 237 ALA A N   1 
ATOM   1800 C CA  . ALA A 1 236 ? -5.411  -35.498 22.097  1.00 41.54  ? 237 ALA A CA  1 
ATOM   1801 C C   . ALA A 1 236 ? -5.446  -33.986 21.920  1.00 43.78  ? 237 ALA A C   1 
ATOM   1802 O O   . ALA A 1 236 ? -5.292  -33.259 22.899  1.00 41.18  ? 237 ALA A O   1 
ATOM   1803 C CB  . ALA A 1 236 ? -3.968  -35.946 22.336  1.00 39.32  ? 237 ALA A CB  1 
ATOM   1804 N N   . THR A 1 237 ? -5.644  -33.503 20.691  1.00 38.32  ? 238 THR A N   1 
ATOM   1805 C CA  . THR A 1 237 ? -5.726  -32.061 20.485  1.00 44.79  ? 238 THR A CA  1 
ATOM   1806 C C   . THR A 1 237 ? -6.854  -31.714 19.535  1.00 44.55  ? 238 THR A C   1 
ATOM   1807 O O   . THR A 1 237 ? -7.390  -32.571 18.850  1.00 40.15  ? 238 THR A O   1 
ATOM   1808 C CB  . THR A 1 237 ? -4.396  -31.464 19.928  1.00 44.08  ? 238 THR A CB  1 
ATOM   1809 O OG1 . THR A 1 237 ? -4.014  -32.169 18.741  1.00 41.73  ? 238 THR A OG1 1 
ATOM   1810 C CG2 . THR A 1 237 ? -3.285  -31.573 20.947  1.00 52.46  ? 238 THR A CG2 1 
ATOM   1811 N N   . VAL A 1 238 ? -7.202  -30.438 19.486  1.00 41.29  ? 239 VAL A N   1 
ATOM   1812 C CA  . VAL A 1 238 ? -8.228  -29.986 18.564  1.00 44.94  ? 239 VAL A CA  1 
ATOM   1813 C C   . VAL A 1 238 ? -7.771  -28.640 18.019  1.00 52.56  ? 239 VAL A C   1 
ATOM   1814 O O   . VAL A 1 238 ? -7.019  -27.921 18.697  1.00 48.39  ? 239 VAL A O   1 
ATOM   1815 C CB  . VAL A 1 238 ? -9.612  -29.888 19.263  1.00 48.58  ? 239 VAL A CB  1 
ATOM   1816 C CG1 . VAL A 1 238 ? -9.629  -28.763 20.296  1.00 42.22  ? 239 VAL A CG1 1 
ATOM   1817 C CG2 . VAL A 1 238 ? -10.703 -29.710 18.264  1.00 51.14  ? 239 VAL A CG2 1 
ATOM   1818 N N   . GLY A 1 239 ? -8.164  -28.325 16.782  1.00 52.84  ? 240 GLY A N   1 
ATOM   1819 C CA  . GLY A 1 239 ? -7.805  -27.060 16.168  1.00 40.06  ? 240 GLY A CA  1 
ATOM   1820 C C   . GLY A 1 239 ? -8.692  -25.940 16.666  1.00 50.31  ? 240 GLY A C   1 
ATOM   1821 O O   . GLY A 1 239 ? -9.775  -26.196 17.207  1.00 48.31  ? 240 GLY A O   1 
ATOM   1822 N N   . MET A 1 240 ? -8.235  -24.701 16.503  1.00 53.47  ? 241 MET A N   1 
ATOM   1823 C CA  . MET A 1 240 ? -8.943  -23.554 17.061  1.00 49.02  ? 241 MET A CA  1 
ATOM   1824 C C   . MET A 1 240 ? -10.398 -23.483 16.602  1.00 60.96  ? 241 MET A C   1 
ATOM   1825 O O   . MET A 1 240 ? -11.310 -23.266 17.411  1.00 57.89  ? 241 MET A O   1 
ATOM   1826 C CB  . MET A 1 240 ? -8.224  -22.260 16.697  1.00 46.49  ? 241 MET A CB  1 
ATOM   1827 C CG  . MET A 1 240 ? -7.139  -21.892 17.663  1.00 55.38  ? 241 MET A CG  1 
ATOM   1828 S SD  . MET A 1 240 ? -6.204  -20.437 17.182  1.00 74.62  ? 241 MET A SD  1 
ATOM   1829 C CE  . MET A 1 240 ? -7.538  -19.328 16.711  1.00 90.91  ? 241 MET A CE  1 
ATOM   1830 N N   . GLY A 1 241 ? -10.609 -23.684 15.306  1.00 55.30  ? 242 GLY A N   1 
ATOM   1831 C CA  . GLY A 1 241 ? -11.926 -23.566 14.715  1.00 52.00  ? 242 GLY A CA  1 
ATOM   1832 C C   . GLY A 1 241 ? -12.899 -24.586 15.266  1.00 55.81  ? 242 GLY A C   1 
ATOM   1833 O O   . GLY A 1 241 ? -14.037 -24.252 15.604  1.00 55.91  ? 242 GLY A O   1 
ATOM   1834 N N   . GLU A 1 242 ? -12.445 -25.832 15.344  1.00 46.93  ? 243 GLU A N   1 
ATOM   1835 C CA  . GLU A 1 242 ? -13.267 -26.931 15.830  1.00 53.33  ? 243 GLU A CA  1 
ATOM   1836 C C   . GLU A 1 242 ? -13.528 -26.791 17.350  1.00 57.50  ? 243 GLU A C   1 
ATOM   1837 O O   . GLU A 1 242 ? -14.566 -27.201 17.845  1.00 59.20  ? 243 GLU A O   1 
ATOM   1838 C CB  . GLU A 1 242 ? -12.600 -28.273 15.491  1.00 43.04  ? 243 GLU A CB  1 
ATOM   1839 C CG  . GLU A 1 242 ? -13.300 -29.532 16.032  1.00 55.18  ? 243 GLU A CG  1 
ATOM   1840 C CD  . GLU A 1 242 ? -14.714 -29.739 15.511  1.00 61.51  ? 243 GLU A CD  1 
ATOM   1841 O OE1 . GLU A 1 242 ? -15.121 -29.042 14.551  1.00 75.31  ? 243 GLU A OE1 1 
ATOM   1842 O OE2 . GLU A 1 242 ? -15.424 -30.614 16.070  1.00 65.60  ? 243 GLU A OE2 1 
ATOM   1843 N N   . ALA A 1 243 ? -12.593 -26.194 18.081  1.00 58.95  ? 244 ALA A N   1 
ATOM   1844 C CA  . ALA A 1 243 ? -12.822 -25.921 19.496  1.00 57.04  ? 244 ALA A CA  1 
ATOM   1845 C C   . ALA A 1 243 ? -13.945 -24.903 19.641  1.00 54.82  ? 244 ALA A C   1 
ATOM   1846 O O   . ALA A 1 243 ? -14.844 -25.088 20.464  1.00 51.20  ? 244 ALA A O   1 
ATOM   1847 C CB  . ALA A 1 243 ? -11.550 -25.413 20.174  1.00 42.74  ? 244 ALA A CB  1 
ATOM   1848 N N   . ARG A 1 244 ? -13.890 -23.835 18.837  1.00 55.89  ? 245 ARG A N   1 
ATOM   1849 C CA  . ARG A 1 244 ? -14.944 -22.804 18.837  1.00 57.33  ? 245 ARG A CA  1 
ATOM   1850 C C   . ARG A 1 244 ? -16.303 -23.385 18.515  1.00 53.88  ? 245 ARG A C   1 
ATOM   1851 O O   . ARG A 1 244 ? -17.313 -22.976 19.085  1.00 56.99  ? 245 ARG A O   1 
ATOM   1852 C CB  . ARG A 1 244 ? -14.651 -21.690 17.832  1.00 56.95  ? 245 ARG A CB  1 
ATOM   1853 C CG  . ARG A 1 244 ? -15.701 -20.576 17.823  1.00 53.93  ? 245 ARG A CG  1 
ATOM   1854 C CD  . ARG A 1 244 ? -15.166 -19.292 17.171  1.00 53.24  ? 245 ARG A CD  1 
ATOM   1855 N NE  . ARG A 1 244 ? -14.177 -18.610 18.001  1.00 58.70  ? 245 ARG A NE  1 
ATOM   1856 C CZ  . ARG A 1 244 ? -14.483 -17.753 18.971  1.00 62.84  ? 245 ARG A CZ  1 
ATOM   1857 N NH1 . ARG A 1 244 ? -15.754 -17.471 19.225  1.00 61.08  ? 245 ARG A NH1 1 
ATOM   1858 N NH2 . ARG A 1 244 ? -13.519 -17.182 19.690  1.00 61.51  ? 245 ARG A NH2 1 
ATOM   1859 N N   . ARG A 1 245 ? -16.333 -24.351 17.610  1.00 50.99  ? 246 ARG A N   1 
ATOM   1860 C CA  . ARG A 1 245 ? -17.606 -24.924 17.216  1.00 58.26  ? 246 ARG A CA  1 
ATOM   1861 C C   . ARG A 1 245 ? -18.216 -25.749 18.337  1.00 55.79  ? 246 ARG A C   1 
ATOM   1862 O O   . ARG A 1 245 ? -19.417 -25.666 18.586  1.00 57.53  ? 246 ARG A O   1 
ATOM   1863 C CB  . ARG A 1 245 ? -17.476 -25.793 15.970  1.00 59.76  ? 246 ARG A CB  1 
ATOM   1864 C CG  . ARG A 1 245 ? -18.839 -26.203 15.440  1.00 52.99  ? 246 ARG A CG  1 
ATOM   1865 C CD  . ARG A 1 245 ? -18.796 -27.392 14.506  1.00 62.94  ? 246 ARG A CD  1 
ATOM   1866 N NE  . ARG A 1 245 ? -18.361 -28.640 15.132  1.00 65.41  ? 246 ARG A NE  1 
ATOM   1867 C CZ  . ARG A 1 245 ? -19.130 -29.437 15.877  1.00 83.83  ? 246 ARG A CZ  1 
ATOM   1868 N NH1 . ARG A 1 245 ? -20.391 -29.110 16.142  1.00 86.42  ? 246 ARG A NH1 1 
ATOM   1869 N NH2 . ARG A 1 245 ? -18.628 -30.562 16.379  1.00 69.57  ? 246 ARG A NH2 1 
ATOM   1870 N N   . ARG A 1 246 ? -17.388 -26.554 18.991  1.00 55.40  ? 247 ARG A N   1 
ATOM   1871 C CA  . ARG A 1 246 ? -17.849 -27.425 20.063  1.00 48.96  ? 247 ARG A CA  1 
ATOM   1872 C C   . ARG A 1 246 ? -18.324 -26.631 21.290  1.00 47.67  ? 247 ARG A C   1 
ATOM   1873 O O   . ARG A 1 246 ? -19.356 -26.946 21.874  1.00 53.40  ? 247 ARG A O   1 
ATOM   1874 C CB  . ARG A 1 246 ? -16.740 -28.388 20.460  1.00 51.33  ? 247 ARG A CB  1 
ATOM   1875 C CG  . ARG A 1 246 ? -16.289 -29.322 19.357  1.00 48.47  ? 247 ARG A CG  1 
ATOM   1876 C CD  . ARG A 1 246 ? -15.168 -30.224 19.862  1.00 55.32  ? 247 ARG A CD  1 
ATOM   1877 N NE  . ARG A 1 246 ? -14.634 -31.091 18.825  1.00 53.79  ? 247 ARG A NE  1 
ATOM   1878 C CZ  . ARG A 1 246 ? -13.891 -32.166 19.062  1.00 59.88  ? 247 ARG A CZ  1 
ATOM   1879 N NH1 . ARG A 1 246 ? -13.588 -32.513 20.312  1.00 54.95  ? 247 ARG A NH1 1 
ATOM   1880 N NH2 . ARG A 1 246 ? -13.456 -32.897 18.046  1.00 49.46  ? 247 ARG A NH2 1 
ATOM   1881 N N   . ALA A 1 247 ? -17.571 -25.603 21.669  1.00 49.43  ? 248 ALA A N   1 
ATOM   1882 C CA  . ALA A 1 247 ? -17.969 -24.696 22.745  1.00 45.50  ? 248 ALA A CA  1 
ATOM   1883 C C   . ALA A 1 247 ? -19.334 -24.122 22.448  1.00 60.27  ? 248 ALA A C   1 
ATOM   1884 O O   . ALA A 1 247 ? -20.236 -24.104 23.297  1.00 54.76  ? 248 ALA A O   1 
ATOM   1885 C CB  . ALA A 1 247 ? -16.957 -23.571 22.905  1.00 42.60  ? 248 ALA A CB  1 
ATOM   1886 N N   . THR A 1 248 ? -19.469 -23.662 21.214  1.00 56.04  ? 249 THR A N   1 
ATOM   1887 C CA  . THR A 1 248 ? -20.662 -22.980 20.778  1.00 50.92  ? 249 THR A CA  1 
ATOM   1888 C C   . THR A 1 248 ? -21.844 -23.942 20.822  1.00 50.17  ? 249 THR A C   1 
ATOM   1889 O O   . THR A 1 248 ? -22.927 -23.576 21.271  1.00 56.04  ? 249 THR A O   1 
ATOM   1890 C CB  . THR A 1 248 ? -20.440 -22.378 19.382  1.00 60.89  ? 249 THR A CB  1 
ATOM   1891 O OG1 . THR A 1 248 ? -19.625 -21.207 19.526  1.00 52.70  ? 249 THR A OG1 1 
ATOM   1892 C CG2 . THR A 1 248 ? -21.757 -21.998 18.715  1.00 50.31  ? 249 THR A CG2 1 
ATOM   1893 N N   A GLN A 1 249 ? -21.636 -25.182 20.389  0.41 49.14  ? 250 GLN A N   1 
ATOM   1894 N N   B GLN A 1 249 ? -21.625 -25.176 20.388  0.59 49.27  ? 250 GLN A N   1 
ATOM   1895 C CA  A GLN A 1 249 ? -22.714 -26.165 20.437  0.41 50.43  ? 250 GLN A CA  1 
ATOM   1896 C CA  B GLN A 1 249 ? -22.676 -26.183 20.432  0.59 50.31  ? 250 GLN A CA  1 
ATOM   1897 C C   A GLN A 1 249 ? -23.110 -26.515 21.874  0.41 54.06  ? 250 GLN A C   1 
ATOM   1898 C C   B GLN A 1 249 ? -23.097 -26.529 21.863  0.59 54.08  ? 250 GLN A C   1 
ATOM   1899 O O   A GLN A 1 249 ? -24.282 -26.764 22.148  0.41 54.28  ? 250 GLN A O   1 
ATOM   1900 O O   B GLN A 1 249 ? -24.270 -26.786 22.122  0.59 54.29  ? 250 GLN A O   1 
ATOM   1901 C CB  A GLN A 1 249 ? -22.341 -27.447 19.685  0.41 48.42  ? 250 GLN A CB  1 
ATOM   1902 C CB  B GLN A 1 249 ? -22.227 -27.449 19.702  0.59 46.94  ? 250 GLN A CB  1 
ATOM   1903 C CG  A GLN A 1 249 ? -23.513 -28.429 19.621  0.41 57.37  ? 250 GLN A CG  1 
ATOM   1904 C CG  B GLN A 1 249 ? -23.288 -28.542 19.636  0.59 57.26  ? 250 GLN A CG  1 
ATOM   1905 C CD  A GLN A 1 249 ? -23.231 -29.701 18.846  0.41 63.39  ? 250 GLN A CD  1 
ATOM   1906 C CD  B GLN A 1 249 ? -24.548 -28.117 18.878  0.59 63.96  ? 250 GLN A CD  1 
ATOM   1907 O OE1 A GLN A 1 249 ? -22.121 -29.925 18.359  0.41 73.62  ? 250 GLN A OE1 1 
ATOM   1908 O OE1 B GLN A 1 249 ? -24.596 -27.046 18.251  0.59 57.61  ? 250 GLN A OE1 1 
ATOM   1909 N NE2 A GLN A 1 249 ? -24.250 -30.548 18.728  0.41 61.62  ? 250 GLN A NE2 1 
ATOM   1910 N NE2 B GLN A 1 249 ? -25.577 -28.966 18.931  0.59 56.67  ? 250 GLN A NE2 1 
ATOM   1911 N N   . LEU A 1 250 ? -22.141 -26.549 22.788  1.00 51.69  ? 251 LEU A N   1 
ATOM   1912 C CA  . LEU A 1 250 ? -22.454 -26.844 24.183  1.00 57.54  ? 251 LEU A CA  1 
ATOM   1913 C C   . LEU A 1 250 ? -23.388 -25.757 24.676  1.00 55.14  ? 251 LEU A C   1 
ATOM   1914 O O   . LEU A 1 250 ? -24.418 -26.051 25.269  1.00 53.75  ? 251 LEU A O   1 
ATOM   1915 C CB  . LEU A 1 250 ? -21.197 -26.918 25.069  1.00 55.56  ? 251 LEU A CB  1 
ATOM   1916 C CG  . LEU A 1 250 ? -21.481 -27.242 26.541  1.00 51.20  ? 251 LEU A CG  1 
ATOM   1917 C CD1 . LEU A 1 250 ? -22.088 -28.628 26.638  1.00 48.39  ? 251 LEU A CD1 1 
ATOM   1918 C CD2 . LEU A 1 250 ? -20.228 -27.139 27.409  1.00 48.91  ? 251 LEU A CD2 1 
ATOM   1919 N N   . ALA A 1 251 ? -23.032 -24.507 24.384  1.00 52.63  ? 252 ALA A N   1 
ATOM   1920 C CA  . ALA A 1 251 ? -23.805 -23.354 24.828  1.00 62.54  ? 252 ALA A CA  1 
ATOM   1921 C C   . ALA A 1 251 ? -25.244 -23.477 24.370  1.00 65.46  ? 252 ALA A C   1 
ATOM   1922 O O   . ALA A 1 251 ? -26.185 -23.240 25.141  1.00 59.89  ? 252 ALA A O   1 
ATOM   1923 C CB  . ALA A 1 251 ? -23.189 -22.060 24.308  1.00 49.02  ? 252 ALA A CB  1 
ATOM   1924 N N   . HIS A 1 252 ? -25.408 -23.881 23.116  1.00 55.83  ? 253 HIS A N   1 
ATOM   1925 C CA  . HIS A 1 252 ? -26.730 -23.977 22.525  1.00 63.08  ? 253 HIS A CA  1 
ATOM   1926 C C   . HIS A 1 252 ? -27.536 -25.088 23.197  1.00 61.87  ? 253 HIS A C   1 
ATOM   1927 O O   . HIS A 1 252 ? -28.723 -24.913 23.483  1.00 58.36  ? 253 HIS A O   1 
ATOM   1928 C CB  . HIS A 1 252 ? -26.628 -24.202 21.009  1.00 65.50  ? 253 HIS A CB  1 
ATOM   1929 C CG  . HIS A 1 252 ? -27.955 -24.362 20.331  1.00 90.08  ? 253 HIS A CG  1 
ATOM   1930 N ND1 . HIS A 1 252 ? -28.469 -25.593 19.974  1.00 83.13  ? 253 HIS A ND1 1 
ATOM   1931 C CD2 . HIS A 1 252 ? -28.884 -23.447 19.961  1.00 93.10  ? 253 HIS A CD2 1 
ATOM   1932 C CE1 . HIS A 1 252 ? -29.652 -25.428 19.408  1.00 85.73  ? 253 HIS A CE1 1 
ATOM   1933 N NE2 . HIS A 1 252 ? -29.926 -24.136 19.387  1.00 100.22 ? 253 HIS A NE2 1 
ATOM   1934 N N   . LEU A 1 253 ? -26.884 -26.213 23.469  1.00 48.17  ? 254 LEU A N   1 
ATOM   1935 C CA  . LEU A 1 253 ? -27.550 -27.357 24.084  1.00 49.75  ? 254 LEU A CA  1 
ATOM   1936 C C   . LEU A 1 253 ? -28.042 -27.082 25.503  1.00 56.78  ? 254 LEU A C   1 
ATOM   1937 O O   . LEU A 1 253 ? -28.976 -27.736 25.971  1.00 55.14  ? 254 LEU A O   1 
ATOM   1938 C CB  . LEU A 1 253 ? -26.620 -28.575 24.109  1.00 53.16  ? 254 LEU A CB  1 
ATOM   1939 C CG  . LEU A 1 253 ? -26.273 -29.265 22.784  1.00 64.32  ? 254 LEU A CG  1 
ATOM   1940 C CD1 . LEU A 1 253 ? -25.253 -30.395 22.984  1.00 54.88  ? 254 LEU A CD1 1 
ATOM   1941 C CD2 . LEU A 1 253 ? -27.531 -29.794 22.122  1.00 51.24  ? 254 LEU A CD2 1 
ATOM   1942 N N   . VAL A 1 254 ? -27.405 -26.142 26.194  1.00 56.70  ? 255 VAL A N   1 
ATOM   1943 C CA  . VAL A 1 254 ? -27.798 -25.818 27.568  1.00 59.03  ? 255 VAL A CA  1 
ATOM   1944 C C   . VAL A 1 254 ? -28.550 -24.486 27.639  1.00 59.90  ? 255 VAL A C   1 
ATOM   1945 O O   . VAL A 1 254 ? -28.778 -23.942 28.728  1.00 58.35  ? 255 VAL A O   1 
ATOM   1946 C CB  . VAL A 1 254 ? -26.572 -25.764 28.525  1.00 54.14  ? 255 VAL A CB  1 
ATOM   1947 C CG1 . VAL A 1 254 ? -25.819 -27.091 28.508  1.00 47.18  ? 255 VAL A CG1 1 
ATOM   1948 C CG2 . VAL A 1 254 ? -25.651 -24.603 28.180  1.00 47.41  ? 255 VAL A CG2 1 
ATOM   1949 N N   . GLY A 1 255 ? -28.925 -23.966 26.470  1.00 49.75  ? 256 GLY A N   1 
ATOM   1950 C CA  . GLY A 1 255 ? -29.809 -22.816 26.377  1.00 45.32  ? 256 GLY A CA  1 
ATOM   1951 C C   . GLY A 1 255 ? -29.174 -21.450 26.537  1.00 52.26  ? 256 GLY A C   1 
ATOM   1952 O O   . GLY A 1 255 ? -29.810 -20.532 27.041  1.00 64.45  ? 256 GLY A O   1 
ATOM   1953 N N   . CYS A 1 256 ? -27.927 -21.313 26.098  1.00 62.91  ? 257 CYS A N   1 
ATOM   1954 C CA  . CYS A 1 256 ? -27.221 -20.032 26.096  1.00 57.71  ? 257 CYS A CA  1 
ATOM   1955 C C   . CYS A 1 256 ? -27.117 -19.512 24.669  1.00 67.67  ? 257 CYS A C   1 
ATOM   1956 O O   . CYS A 1 256 ? -27.086 -20.313 23.747  1.00 62.13  ? 257 CYS A O   1 
ATOM   1957 C CB  . CYS A 1 256 ? -25.842 -20.199 26.721  1.00 64.19  ? 257 CYS A CB  1 
ATOM   1958 S SG  . CYS A 1 256 ? -25.962 -20.571 28.477  1.00 72.08  ? 257 CYS A SG  1 
ATOM   1959 N N   . PRO A 1 257 ? -27.053 -18.177 24.483  1.00 81.64  ? 258 PRO A N   1 
ATOM   1960 C CA  . PRO A 1 257 ? -27.234 -17.596 23.150  1.00 77.10  ? 258 PRO A CA  1 
ATOM   1961 C C   . PRO A 1 257 ? -25.935 -17.335 22.383  1.00 91.92  ? 258 PRO A C   1 
ATOM   1962 O O   . PRO A 1 257 ? -25.020 -18.154 22.377  1.00 96.44  ? 258 PRO A O   1 
ATOM   1963 C CB  . PRO A 1 257 ? -27.938 -16.264 23.457  1.00 92.09  ? 258 PRO A CB  1 
ATOM   1964 C CG  . PRO A 1 257 ? -27.700 -15.995 24.967  1.00 80.45  ? 258 PRO A CG  1 
ATOM   1965 C CD  . PRO A 1 257 ? -26.827 -17.115 25.478  1.00 84.52  ? 258 PRO A CD  1 
ATOM   1966 N N   . ASN A 1 264 ? -21.335 -12.968 20.652  1.00 67.35  ? 265 ASN A N   1 
ATOM   1967 C CA  . ASN A 1 264 ? -20.349 -12.332 21.519  1.00 76.50  ? 265 ASN A CA  1 
ATOM   1968 C C   . ASN A 1 264 ? -19.818 -13.346 22.545  1.00 82.28  ? 265 ASN A C   1 
ATOM   1969 O O   . ASN A 1 264 ? -20.591 -13.915 23.316  1.00 76.06  ? 265 ASN A O   1 
ATOM   1970 C CB  . ASN A 1 264 ? -20.976 -11.112 22.209  1.00 85.85  ? 265 ASN A CB  1 
ATOM   1971 C CG  . ASN A 1 264 ? -19.950 -10.195 22.884  1.00 92.30  ? 265 ASN A CG  1 
ATOM   1972 O OD1 . ASN A 1 264 ? -18.886 -10.632 23.324  1.00 93.86  ? 265 ASN A OD1 1 
ATOM   1973 N ND2 . ASN A 1 264 ? -20.288 -8.910  22.981  1.00 95.80  ? 265 ASN A ND2 1 
ATOM   1974 N N   . ASP A 1 265 ? -18.506 -13.577 22.543  1.00 75.21  ? 266 ASP A N   1 
ATOM   1975 C CA  . ASP A 1 265 ? -17.891 -14.540 23.457  1.00 67.81  ? 266 ASP A CA  1 
ATOM   1976 C C   . ASP A 1 265 ? -18.151 -14.208 24.921  1.00 77.57  ? 266 ASP A C   1 
ATOM   1977 O O   . ASP A 1 265 ? -18.471 -15.093 25.713  1.00 67.60  ? 266 ASP A O   1 
ATOM   1978 C CB  . ASP A 1 265 ? -16.385 -14.619 23.227  1.00 61.83  ? 266 ASP A CB  1 
ATOM   1979 C CG  . ASP A 1 265 ? -16.028 -15.355 21.957  1.00 66.57  ? 266 ASP A CG  1 
ATOM   1980 O OD1 . ASP A 1 265 ? -16.900 -16.087 21.428  1.00 67.05  ? 266 ASP A OD1 1 
ATOM   1981 O OD2 . ASP A 1 265 ? -14.872 -15.205 21.493  1.00 63.07  ? 266 ASP A OD2 1 
ATOM   1982 N N   . THR A 1 266 ? -17.998 -12.936 25.274  1.00 70.31  ? 267 THR A N   1 
ATOM   1983 C CA  . THR A 1 266 ? -18.237 -12.482 26.635  1.00 66.93  ? 267 THR A CA  1 
ATOM   1984 C C   . THR A 1 266 ? -19.618 -12.920 27.122  1.00 72.61  ? 267 THR A C   1 
ATOM   1985 O O   . THR A 1 266 ? -19.760 -13.466 28.218  1.00 80.66  ? 267 THR A O   1 
ATOM   1986 C CB  . THR A 1 266 ? -18.114 -10.953 26.730  1.00 67.61  ? 267 THR A CB  1 
ATOM   1987 O OG1 . THR A 1 266 ? -16.833 -10.555 26.238  1.00 74.10  ? 267 THR A OG1 1 
ATOM   1988 C CG2 . THR A 1 266 ? -18.255 -10.475 28.166  1.00 62.89  ? 267 THR A CG2 1 
ATOM   1989 N N   . GLU A 1 267 ? -20.622 -12.702 26.280  1.00 76.93  ? 268 GLU A N   1 
ATOM   1990 C CA  . GLU A 1 267 ? -22.004 -13.006 26.621  1.00 68.68  ? 268 GLU A CA  1 
ATOM   1991 C C   . GLU A 1 267 ? -22.227 -14.509 26.733  1.00 65.75  ? 268 GLU A C   1 
ATOM   1992 O O   . GLU A 1 267 ? -22.948 -14.986 27.616  1.00 71.19  ? 268 GLU A O   1 
ATOM   1993 C CB  . GLU A 1 267 ? -22.950 -12.400 25.579  1.00 69.70  ? 268 GLU A CB  1 
ATOM   1994 C CG  . GLU A 1 267 ? -22.871 -10.873 25.503  1.00 98.80  ? 268 GLU A CG  1 
ATOM   1995 C CD  . GLU A 1 267 ? -23.525 -10.291 24.246  1.00 119.12 ? 268 GLU A CD  1 
ATOM   1996 O OE1 . GLU A 1 267 ? -23.579 -9.041  24.124  1.00 113.56 ? 268 GLU A OE1 1 
ATOM   1997 O OE2 . GLU A 1 267 ? -23.972 -11.082 23.378  1.00 118.26 ? 268 GLU A OE2 1 
ATOM   1998 N N   . LEU A 1 268 ? -21.598 -15.250 25.836  1.00 57.31  ? 269 LEU A N   1 
ATOM   1999 C CA  . LEU A 1 268 ? -21.752 -16.693 25.801  1.00 62.43  ? 269 LEU A CA  1 
ATOM   2000 C C   . LEU A 1 268 ? -21.151 -17.335 27.061  1.00 66.33  ? 269 LEU A C   1 
ATOM   2001 O O   . LEU A 1 268 ? -21.779 -18.164 27.710  1.00 64.87  ? 269 LEU A O   1 
ATOM   2002 C CB  . LEU A 1 268 ? -21.103 -17.252 24.534  1.00 59.02  ? 269 LEU A CB  1 
ATOM   2003 C CG  . LEU A 1 268 ? -21.387 -18.700 24.136  1.00 62.34  ? 269 LEU A CG  1 
ATOM   2004 C CD1 . LEU A 1 268 ? -21.178 -18.906 22.649  1.00 54.15  ? 269 LEU A CD1 1 
ATOM   2005 C CD2 . LEU A 1 268 ? -20.470 -19.623 24.891  1.00 79.00  ? 269 LEU A CD2 1 
ATOM   2006 N N   . VAL A 1 269 ? -19.929 -16.948 27.395  1.00 52.25  ? 270 VAL A N   1 
ATOM   2007 C CA  . VAL A 1 269 ? -19.253 -17.522 28.542  1.00 60.59  ? 270 VAL A CA  1 
ATOM   2008 C C   . VAL A 1 269 ? -19.968 -17.114 29.822  1.00 62.38  ? 270 VAL A C   1 
ATOM   2009 O O   . VAL A 1 269 ? -20.051 -17.902 30.765  1.00 59.58  ? 270 VAL A O   1 
ATOM   2010 C CB  . VAL A 1 269 ? -17.767 -17.106 28.578  1.00 65.72  ? 270 VAL A CB  1 
ATOM   2011 C CG1 . VAL A 1 269 ? -17.080 -17.616 29.829  1.00 53.64  ? 270 VAL A CG1 1 
ATOM   2012 C CG2 . VAL A 1 269 ? -17.057 -17.653 27.358  1.00 66.44  ? 270 VAL A CG2 1 
ATOM   2013 N N   . ALA A 1 270 ? -20.519 -15.904 29.855  1.00 57.26  ? 271 ALA A N   1 
ATOM   2014 C CA  . ALA A 1 270 ? -21.224 -15.455 31.061  1.00 51.11  ? 271 ALA A CA  1 
ATOM   2015 C C   . ALA A 1 270 ? -22.462 -16.308 31.306  1.00 55.70  ? 271 ALA A C   1 
ATOM   2016 O O   . ALA A 1 270 ? -22.792 -16.637 32.439  1.00 58.09  ? 271 ALA A O   1 
ATOM   2017 C CB  . ALA A 1 270 ? -21.598 -14.004 30.949  1.00 52.18  ? 271 ALA A CB  1 
ATOM   2018 N N   . CYS A 1 271 ? -23.131 -16.690 30.228  1.00 59.65  ? 272 CYS A N   1 
ATOM   2019 C CA  . CYS A 1 271 ? -24.297 -17.539 30.350  1.00 55.83  ? 272 CYS A CA  1 
ATOM   2020 C C   . CYS A 1 271 ? -23.918 -18.964 30.768  1.00 51.54  ? 272 CYS A C   1 
ATOM   2021 O O   . CYS A 1 271 ? -24.629 -19.589 31.557  1.00 62.86  ? 272 CYS A O   1 
ATOM   2022 C CB  . CYS A 1 271 ? -25.083 -17.559 29.035  1.00 59.02  ? 272 CYS A CB  1 
ATOM   2023 S SG  . CYS A 1 271 ? -26.501 -18.681 29.073  1.00 71.47  ? 272 CYS A SG  1 
ATOM   2024 N N   . LEU A 1 272 ? -22.813 -19.479 30.230  1.00 57.06  ? 273 LEU A N   1 
ATOM   2025 C CA  . LEU A 1 272 ? -22.331 -20.806 30.600  1.00 53.60  ? 273 LEU A CA  1 
ATOM   2026 C C   . LEU A 1 272 ? -21.988 -20.845 32.094  1.00 53.60  ? 273 LEU A C   1 
ATOM   2027 O O   . LEU A 1 272 ? -22.194 -21.851 32.771  1.00 53.19  ? 273 LEU A O   1 
ATOM   2028 C CB  . LEU A 1 272 ? -21.106 -21.200 29.769  1.00 51.41  ? 273 LEU A CB  1 
ATOM   2029 C CG  . LEU A 1 272 ? -21.267 -21.673 28.321  1.00 57.70  ? 273 LEU A CG  1 
ATOM   2030 C CD1 . LEU A 1 272 ? -19.921 -22.064 27.727  1.00 59.12  ? 273 LEU A CD1 1 
ATOM   2031 C CD2 . LEU A 1 272 ? -22.208 -22.840 28.238  1.00 52.41  ? 273 LEU A CD2 1 
ATOM   2032 N N   . ARG A 1 273 ? -21.485 -19.727 32.601  1.00 50.14  ? 274 ARG A N   1 
ATOM   2033 C CA  . ARG A 1 273 ? -21.064 -19.644 33.985  1.00 55.72  ? 274 ARG A CA  1 
ATOM   2034 C C   . ARG A 1 273 ? -22.256 -19.668 34.942  1.00 55.59  ? 274 ARG A C   1 
ATOM   2035 O O   . ARG A 1 273 ? -22.076 -19.859 36.140  1.00 55.81  ? 274 ARG A O   1 
ATOM   2036 C CB  . ARG A 1 273 ? -20.216 -18.387 34.208  1.00 48.96  ? 274 ARG A CB  1 
ATOM   2037 C CG  . ARG A 1 273 ? -18.817 -18.489 33.622  1.00 54.40  ? 274 ARG A CG  1 
ATOM   2038 C CD  . ARG A 1 273 ? -17.826 -17.615 34.368  1.00 48.06  ? 274 ARG A CD  1 
ATOM   2039 N NE  . ARG A 1 273 ? -17.453 -16.431 33.596  1.00 77.40  ? 274 ARG A NE  1 
ATOM   2040 C CZ  . ARG A 1 273 ? -16.288 -16.271 32.964  1.00 80.81  ? 274 ARG A CZ  1 
ATOM   2041 N NH1 . ARG A 1 273 ? -15.356 -17.222 32.996  1.00 62.27  ? 274 ARG A NH1 1 
ATOM   2042 N NH2 . ARG A 1 273 ? -16.047 -15.150 32.295  1.00 84.27  ? 274 ARG A NH2 1 
ATOM   2043 N N   . THR A 1 274 ? -23.470 -19.495 34.426  1.00 55.06  ? 275 THR A N   1 
ATOM   2044 C CA  . THR A 1 274 ? -24.658 -19.518 35.287  1.00 54.44  ? 275 THR A CA  1 
ATOM   2045 C C   . THR A 1 274 ? -25.228 -20.918 35.396  1.00 51.49  ? 275 THR A C   1 
ATOM   2046 O O   . THR A 1 274 ? -26.106 -21.170 36.208  1.00 58.70  ? 275 THR A O   1 
ATOM   2047 C CB  . THR A 1 274 ? -25.781 -18.610 34.768  1.00 58.13  ? 275 THR A CB  1 
ATOM   2048 O OG1 . THR A 1 274 ? -26.249 -19.119 33.513  1.00 63.56  ? 275 THR A OG1 1 
ATOM   2049 C CG2 . THR A 1 274 ? -25.303 -17.181 34.591  1.00 50.97  ? 275 THR A CG2 1 
ATOM   2050 N N   . ARG A 1 275 ? -24.750 -21.823 34.551  1.00 55.68  ? 276 ARG A N   1 
ATOM   2051 C CA  . ARG A 1 275 ? -25.278 -23.175 34.517  1.00 47.09  ? 276 ARG A CA  1 
ATOM   2052 C C   . ARG A 1 275 ? -24.612 -24.058 35.564  1.00 52.02  ? 276 ARG A C   1 
ATOM   2053 O O   . ARG A 1 275 ? -23.387 -24.047 35.683  1.00 53.34  ? 276 ARG A O   1 
ATOM   2054 C CB  . ARG A 1 275 ? -25.080 -23.785 33.127  1.00 47.62  ? 276 ARG A CB  1 
ATOM   2055 C CG  . ARG A 1 275 ? -25.847 -23.090 32.005  1.00 56.00  ? 276 ARG A CG  1 
ATOM   2056 C CD  . ARG A 1 275 ? -27.317 -23.156 32.273  1.00 59.14  ? 276 ARG A CD  1 
ATOM   2057 N NE  . ARG A 1 275 ? -28.115 -22.788 31.114  1.00 55.92  ? 276 ARG A NE  1 
ATOM   2058 C CZ  . ARG A 1 275 ? -28.728 -21.619 30.975  1.00 65.04  ? 276 ARG A CZ  1 
ATOM   2059 N NH1 . ARG A 1 275 ? -28.615 -20.694 31.919  1.00 54.06  ? 276 ARG A NH1 1 
ATOM   2060 N NH2 . ARG A 1 275 ? -29.445 -21.375 29.884  1.00 58.04  ? 276 ARG A NH2 1 
ATOM   2061 N N   . PRO A 1 276 ? -25.410 -24.821 36.337  1.00 54.74  ? 277 PRO A N   1 
ATOM   2062 C CA  . PRO A 1 276 ? -24.841 -25.823 37.247  1.00 39.90  ? 277 PRO A CA  1 
ATOM   2063 C C   . PRO A 1 276 ? -23.854 -26.739 36.506  1.00 54.56  ? 277 PRO A C   1 
ATOM   2064 O O   . PRO A 1 276 ? -24.095 -27.114 35.351  1.00 45.96  ? 277 PRO A O   1 
ATOM   2065 C CB  . PRO A 1 276 ? -26.069 -26.613 37.717  1.00 45.83  ? 277 PRO A CB  1 
ATOM   2066 C CG  . PRO A 1 276 ? -27.200 -25.665 37.572  1.00 46.74  ? 277 PRO A CG  1 
ATOM   2067 C CD  . PRO A 1 276 ? -26.884 -24.815 36.375  1.00 45.87  ? 277 PRO A CD  1 
ATOM   2068 N N   . ALA A 1 277 ? -22.748 -27.068 37.167  1.00 44.78  ? 278 ALA A N   1 
ATOM   2069 C CA  . ALA A 1 277 ? -21.715 -27.922 36.599  1.00 49.78  ? 278 ALA A CA  1 
ATOM   2070 C C   . ALA A 1 277 ? -22.308 -29.168 35.977  1.00 53.82  ? 278 ALA A C   1 
ATOM   2071 O O   . ALA A 1 277 ? -21.931 -29.566 34.865  1.00 46.61  ? 278 ALA A O   1 
ATOM   2072 C CB  . ALA A 1 277 ? -20.689 -28.319 37.672  1.00 45.36  ? 278 ALA A CB  1 
ATOM   2073 N N   . GLN A 1 278 ? -23.247 -29.779 36.690  1.00 43.81  ? 279 GLN A N   1 
ATOM   2074 C CA  . GLN A 1 278 ? -23.772 -31.063 36.265  1.00 50.01  ? 279 GLN A CA  1 
ATOM   2075 C C   . GLN A 1 278 ? -24.507 -30.957 34.919  1.00 50.98  ? 279 GLN A C   1 
ATOM   2076 O O   . GLN A 1 278 ? -24.557 -31.922 34.162  1.00 47.17  ? 279 GLN A O   1 
ATOM   2077 C CB  . GLN A 1 278 ? -24.680 -31.640 37.352  1.00 46.80  ? 279 GLN A CB  1 
ATOM   2078 C CG  . GLN A 1 278 ? -25.133 -33.060 37.086  1.00 44.21  ? 279 GLN A CG  1 
ATOM   2079 C CD  . GLN A 1 278 ? -23.986 -34.030 36.892  1.00 58.55  ? 279 GLN A CD  1 
ATOM   2080 O OE1 . GLN A 1 278 ? -23.148 -34.204 37.771  1.00 63.11  ? 279 GLN A OE1 1 
ATOM   2081 N NE2 . GLN A 1 278 ? -23.954 -34.679 35.739  1.00 63.13  ? 279 GLN A NE2 1 
ATOM   2082 N N   . VAL A 1 279 ? -25.050 -29.777 34.623  1.00 45.45  ? 280 VAL A N   1 
ATOM   2083 C CA  . VAL A 1 279 ? -25.774 -29.544 33.383  1.00 41.74  ? 280 VAL A CA  1 
ATOM   2084 C C   . VAL A 1 279 ? -24.824 -29.566 32.187  1.00 55.19  ? 280 VAL A C   1 
ATOM   2085 O O   . VAL A 1 279 ? -25.130 -30.150 31.135  1.00 50.29  ? 280 VAL A O   1 
ATOM   2086 C CB  . VAL A 1 279 ? -26.528 -28.192 33.412  1.00 49.88  ? 280 VAL A CB  1 
ATOM   2087 C CG1 . VAL A 1 279 ? -27.165 -27.899 32.053  1.00 49.99  ? 280 VAL A CG1 1 
ATOM   2088 C CG2 . VAL A 1 279 ? -27.567 -28.204 34.470  1.00 38.66  ? 280 VAL A CG2 1 
ATOM   2089 N N   . LEU A 1 280 ? -23.668 -28.929 32.353  1.00 51.28  ? 281 LEU A N   1 
ATOM   2090 C CA  . LEU A 1 280 ? -22.639 -28.987 31.329  1.00 48.91  ? 281 LEU A CA  1 
ATOM   2091 C C   . LEU A 1 280 ? -22.213 -30.436 31.127  1.00 52.53  ? 281 LEU A C   1 
ATOM   2092 O O   . LEU A 1 280 ? -22.093 -30.895 29.998  1.00 55.69  ? 281 LEU A O   1 
ATOM   2093 C CB  . LEU A 1 280 ? -21.446 -28.109 31.697  1.00 48.86  ? 281 LEU A CB  1 
ATOM   2094 C CG  . LEU A 1 280 ? -21.756 -26.621 31.911  1.00 47.01  ? 281 LEU A CG  1 
ATOM   2095 C CD1 . LEU A 1 280 ? -20.476 -25.812 31.923  1.00 46.04  ? 281 LEU A CD1 1 
ATOM   2096 C CD2 . LEU A 1 280 ? -22.701 -26.108 30.838  1.00 47.49  ? 281 LEU A CD2 1 
ATOM   2097 N N   . VAL A 1 281 ? -22.023 -31.173 32.215  1.00 50.30  ? 282 VAL A N   1 
ATOM   2098 C CA  . VAL A 1 281 ? -21.600 -32.562 32.097  1.00 46.08  ? 282 VAL A CA  1 
ATOM   2099 C C   . VAL A 1 281 ? -22.620 -33.402 31.337  1.00 56.09  ? 282 VAL A C   1 
ATOM   2100 O O   . VAL A 1 281 ? -22.246 -34.246 30.522  1.00 55.84  ? 282 VAL A O   1 
ATOM   2101 C CB  . VAL A 1 281 ? -21.350 -33.207 33.475  1.00 45.14  ? 282 VAL A CB  1 
ATOM   2102 C CG1 . VAL A 1 281 ? -21.053 -34.685 33.319  1.00 37.09  ? 282 VAL A CG1 1 
ATOM   2103 C CG2 . VAL A 1 281 ? -20.191 -32.533 34.169  1.00 43.40  ? 282 VAL A CG2 1 
ATOM   2104 N N   . ASN A 1 282 ? -23.906 -33.166 31.592  1.00 53.77  ? 283 ASN A N   1 
ATOM   2105 C CA  . ASN A 1 282 ? -24.959 -33.982 30.993  1.00 48.33  ? 283 ASN A CA  1 
ATOM   2106 C C   . ASN A 1 282 ? -25.064 -33.841 29.478  1.00 54.25  ? 283 ASN A C   1 
ATOM   2107 O O   . ASN A 1 282 ? -25.632 -34.710 28.815  1.00 58.17  ? 283 ASN A O   1 
ATOM   2108 C CB  . ASN A 1 282 ? -26.310 -33.646 31.607  1.00 52.91  ? 283 ASN A CB  1 
ATOM   2109 C CG  . ASN A 1 282 ? -26.410 -34.050 33.070  1.00 62.83  ? 283 ASN A CG  1 
ATOM   2110 O OD1 . ASN A 1 282 ? -25.582 -34.806 33.594  1.00 54.19  ? 283 ASN A OD1 1 
ATOM   2111 N ND2 . ASN A 1 282 ? -27.437 -33.544 33.738  1.00 59.86  ? 283 ASN A ND2 1 
ATOM   2112 N N   . HIS A 1 283 ? -24.519 -32.756 28.934  1.00 48.54  ? 284 HIS A N   1 
ATOM   2113 C CA  . HIS A 1 283 ? -24.622 -32.489 27.505  1.00 56.35  ? 284 HIS A CA  1 
ATOM   2114 C C   . HIS A 1 283 ? -23.304 -32.586 26.752  1.00 61.33  ? 284 HIS A C   1 
ATOM   2115 O O   . HIS A 1 283 ? -23.278 -32.420 25.530  1.00 64.38  ? 284 HIS A O   1 
ATOM   2116 C CB  . HIS A 1 283 ? -25.214 -31.097 27.272  1.00 59.03  ? 284 HIS A CB  1 
ATOM   2117 C CG  . HIS A 1 283 ? -26.650 -30.988 27.665  1.00 72.71  ? 284 HIS A CG  1 
ATOM   2118 N ND1 . HIS A 1 283 ? -27.669 -31.537 26.915  1.00 76.53  ? 284 HIS A ND1 1 
ATOM   2119 C CD2 . HIS A 1 283 ? -27.239 -30.409 28.737  1.00 72.72  ? 284 HIS A CD2 1 
ATOM   2120 C CE1 . HIS A 1 283 ? -28.826 -31.287 27.502  1.00 69.99  ? 284 HIS A CE1 1 
ATOM   2121 N NE2 . HIS A 1 283 ? -28.593 -30.607 28.611  1.00 79.85  ? 284 HIS A NE2 1 
ATOM   2122 N N   . GLU A 1 284 ? -22.214 -32.845 27.466  1.00 61.65  ? 285 GLU A N   1 
ATOM   2123 C CA  . GLU A 1 284 ? -20.894 -32.769 26.859  1.00 64.11  ? 285 GLU A CA  1 
ATOM   2124 C C   . GLU A 1 284 ? -20.732 -33.848 25.792  1.00 70.83  ? 285 GLU A C   1 
ATOM   2125 O O   . GLU A 1 284 ? -19.992 -33.663 24.838  1.00 62.88  ? 285 GLU A O   1 
ATOM   2126 C CB  . GLU A 1 284 ? -19.789 -32.903 27.909  1.00 61.81  ? 285 GLU A CB  1 
ATOM   2127 C CG  . GLU A 1 284 ? -19.389 -34.349 28.181  1.00 73.96  ? 285 GLU A CG  1 
ATOM   2128 C CD  . GLU A 1 284 ? -18.051 -34.487 28.891  1.00 91.74  ? 285 GLU A CD  1 
ATOM   2129 O OE1 . GLU A 1 284 ? -17.186 -33.584 28.741  1.00 80.52  ? 285 GLU A OE1 1 
ATOM   2130 O OE2 . GLU A 1 284 ? -17.874 -35.513 29.599  1.00 84.21  ? 285 GLU A OE2 1 
ATOM   2131 N N   . TRP A 1 285 ? -21.443 -34.959 25.937  1.00 68.23  ? 286 TRP A N   1 
ATOM   2132 C CA  . TRP A 1 285 ? -21.252 -36.062 25.020  1.00 67.62  ? 286 TRP A CA  1 
ATOM   2133 C C   . TRP A 1 285 ? -21.755 -35.715 23.617  1.00 74.58  ? 286 TRP A C   1 
ATOM   2134 O O   . TRP A 1 285 ? -21.066 -36.015 22.642  1.00 83.37  ? 286 TRP A O   1 
ATOM   2135 C CB  . TRP A 1 285 ? -21.929 -37.333 25.538  1.00 75.42  ? 286 TRP A CB  1 
ATOM   2136 C CG  . TRP A 1 285 ? -23.433 -37.317 25.496  1.00 101.10 ? 286 TRP A CG  1 
ATOM   2137 C CD1 . TRP A 1 285 ? -24.286 -36.850 26.465  1.00 84.79  ? 286 TRP A CD1 1 
ATOM   2138 C CD2 . TRP A 1 285 ? -24.264 -37.801 24.428  1.00 114.02 ? 286 TRP A CD2 1 
ATOM   2139 N NE1 . TRP A 1 285 ? -25.596 -37.007 26.056  1.00 85.18  ? 286 TRP A NE1 1 
ATOM   2140 C CE2 . TRP A 1 285 ? -25.609 -37.590 24.814  1.00 100.26 ? 286 TRP A CE2 1 
ATOM   2141 C CE3 . TRP A 1 285 ? -24.000 -38.393 23.182  1.00 104.57 ? 286 TRP A CE3 1 
ATOM   2142 C CZ2 . TRP A 1 285 ? -26.685 -37.943 23.994  1.00 100.48 ? 286 TRP A CZ2 1 
ATOM   2143 C CZ3 . TRP A 1 285 ? -25.069 -38.745 22.371  1.00 101.18 ? 286 TRP A CZ3 1 
ATOM   2144 C CH2 . TRP A 1 285 ? -26.396 -38.519 22.782  1.00 110.68 ? 286 TRP A CH2 1 
ATOM   2145 N N   . HIS A 1 286 ? -22.913 -35.070 23.477  1.00 70.79  ? 287 HIS A N   1 
ATOM   2146 C CA  . HIS A 1 286 ? -23.388 -34.884 22.110  1.00 88.03  ? 287 HIS A CA  1 
ATOM   2147 C C   . HIS A 1 286 ? -23.019 -33.525 21.512  1.00 80.16  ? 287 HIS A C   1 
ATOM   2148 O O   . HIS A 1 286 ? -23.843 -32.867 20.880  1.00 79.06  ? 287 HIS A O   1 
ATOM   2149 C CB  . HIS A 1 286 ? -24.912 -35.161 21.961  1.00 86.64  ? 287 HIS A CB  1 
ATOM   2150 C CG  . HIS A 1 286 ? -25.809 -34.501 22.968  1.00 95.37  ? 287 HIS A CG  1 
ATOM   2151 N ND1 . HIS A 1 286 ? -25.640 -34.626 24.331  1.00 105.31 ? 287 HIS A ND1 1 
ATOM   2152 C CD2 . HIS A 1 286 ? -26.950 -33.786 22.800  1.00 102.54 ? 287 HIS A CD2 1 
ATOM   2153 C CE1 . HIS A 1 286 ? -26.610 -33.978 24.959  1.00 92.65  ? 287 HIS A CE1 1 
ATOM   2154 N NE2 . HIS A 1 286 ? -27.416 -33.456 24.052  1.00 97.32  ? 287 HIS A NE2 1 
ATOM   2155 N N   . VAL A 1 287 ? -21.749 -33.150 21.656  1.00 65.78  ? 288 VAL A N   1 
ATOM   2156 C CA  . VAL A 1 287 ? -21.199 -32.045 20.872  1.00 77.93  ? 288 VAL A CA  1 
ATOM   2157 C C   . VAL A 1 287 ? -20.216 -32.569 19.803  1.00 73.27  ? 288 VAL A C   1 
ATOM   2158 O O   . VAL A 1 287 ? -19.758 -31.817 18.939  1.00 75.39  ? 288 VAL A O   1 
ATOM   2159 C CB  . VAL A 1 287 ? -20.508 -30.990 21.783  1.00 66.93  ? 288 VAL A CB  1 
ATOM   2160 C CG1 . VAL A 1 287 ? -21.172 -30.965 23.150  1.00 69.51  ? 288 VAL A CG1 1 
ATOM   2161 C CG2 . VAL A 1 287 ? -19.029 -31.273 21.942  1.00 55.23  ? 288 VAL A CG2 1 
ATOM   2162 N N   . LEU A 1 288 ? -19.907 -33.863 19.857  1.00 74.29  ? 289 LEU A N   1 
ATOM   2163 C CA  . LEU A 1 288 ? -18.964 -34.463 18.920  1.00 73.61  ? 289 LEU A CA  1 
ATOM   2164 C C   . LEU A 1 288 ? -19.590 -34.532 17.531  1.00 94.53  ? 289 LEU A C   1 
ATOM   2165 O O   . LEU A 1 288 ? -20.799 -34.788 17.412  1.00 80.20  ? 289 LEU A O   1 
ATOM   2166 C CB  . LEU A 1 288 ? -18.543 -35.861 19.383  1.00 77.33  ? 289 LEU A CB  1 
ATOM   2167 C CG  . LEU A 1 288 ? -17.441 -35.969 20.444  1.00 87.08  ? 289 LEU A CG  1 
ATOM   2168 C CD1 . LEU A 1 288 ? -17.168 -37.435 20.849  1.00 67.09  ? 289 LEU A CD1 1 
ATOM   2169 C CD2 . LEU A 1 288 ? -16.165 -35.268 19.970  1.00 62.58  ? 289 LEU A CD2 1 
ATOM   2170 N N   . PRO A 1 289 ? -18.764 -34.302 16.480  1.00 110.46 ? 290 PRO A N   1 
ATOM   2171 C CA  . PRO A 1 289 ? -19.143 -34.284 15.054  1.00 91.95  ? 290 PRO A CA  1 
ATOM   2172 C C   . PRO A 1 289 ? -19.684 -35.617 14.510  1.00 94.43  ? 290 PRO A C   1 
ATOM   2173 O O   . PRO A 1 289 ? -20.363 -35.608 13.482  1.00 101.41 ? 290 PRO A O   1 
ATOM   2174 C CB  . PRO A 1 289 ? -17.828 -33.916 14.346  1.00 81.52  ? 290 PRO A CB  1 
ATOM   2175 C CG  . PRO A 1 289 ? -16.747 -34.319 15.302  1.00 87.99  ? 290 PRO A CG  1 
ATOM   2176 C CD  . PRO A 1 289 ? -17.327 -34.006 16.658  1.00 99.72  ? 290 PRO A CD  1 
ATOM   2177 N N   . GLN A 1 290 ? -19.390 -36.728 15.183  1.00 87.22  ? 291 GLN A N   1 
ATOM   2178 C CA  . GLN A 1 290 ? -19.884 -38.044 14.778  1.00 83.70  ? 291 GLN A CA  1 
ATOM   2179 C C   . GLN A 1 290 ? -19.918 -39.007 15.974  1.00 97.73  ? 291 GLN A C   1 
ATOM   2180 O O   . GLN A 1 290 ? -19.257 -38.774 16.992  1.00 94.07  ? 291 GLN A O   1 
ATOM   2181 C CB  . GLN A 1 290 ? -19.010 -38.601 13.645  1.00 96.65  ? 291 GLN A CB  1 
ATOM   2182 C CG  . GLN A 1 290 ? -19.143 -40.095 13.332  1.00 105.23 ? 291 GLN A CG  1 
ATOM   2183 C CD  . GLN A 1 290 ? -17.936 -40.657 12.586  1.00 115.15 ? 291 GLN A CD  1 
ATOM   2184 O OE1 . GLN A 1 290 ? -17.273 -39.948 11.817  1.00 120.30 ? 291 GLN A OE1 1 
ATOM   2185 N NE2 . GLN A 1 290 ? -17.647 -41.939 12.812  1.00 93.54  ? 291 GLN A NE2 1 
ATOM   2186 N N   . GLU A 1 291 ? -20.709 -40.071 15.865  1.00 91.32  ? 292 GLU A N   1 
ATOM   2187 C CA  . GLU A 1 291 ? -20.657 -41.148 16.840  1.00 96.26  ? 292 GLU A CA  1 
ATOM   2188 C C   . GLU A 1 291 ? -19.265 -41.793 16.871  1.00 90.77  ? 292 GLU A C   1 
ATOM   2189 O O   . GLU A 1 291 ? -18.625 -41.985 15.838  1.00 86.32  ? 292 GLU A O   1 
ATOM   2190 C CB  . GLU A 1 291 ? -21.718 -42.201 16.531  1.00 88.90  ? 292 GLU A CB  1 
ATOM   2191 C CG  . GLU A 1 291 ? -21.478 -42.946 15.230  1.00 102.57 ? 292 GLU A CG  1 
ATOM   2192 C CD  . GLU A 1 291 ? -22.545 -43.988 14.945  1.00 115.85 ? 292 GLU A CD  1 
ATOM   2193 O OE1 . GLU A 1 291 ? -23.270 -44.368 15.890  1.00 128.72 ? 292 GLU A OE1 1 
ATOM   2194 O OE2 . GLU A 1 291 ? -22.664 -44.417 13.775  1.00 112.61 ? 292 GLU A OE2 1 
ATOM   2195 N N   . SER A 1 292 ? -18.802 -42.122 18.070  1.00 96.65  ? 293 SER A N   1 
ATOM   2196 C CA  . SER A 1 292 ? -17.482 -42.710 18.251  1.00 77.90  ? 293 SER A CA  1 
ATOM   2197 C C   . SER A 1 292 ? -17.438 -43.549 19.518  1.00 78.52  ? 293 SER A C   1 
ATOM   2198 O O   . SER A 1 292 ? -18.246 -43.345 20.428  1.00 91.69  ? 293 SER A O   1 
ATOM   2199 C CB  . SER A 1 292 ? -16.417 -41.617 18.316  1.00 75.02  ? 293 SER A CB  1 
ATOM   2200 O OG  . SER A 1 292 ? -15.240 -42.107 18.937  1.00 92.59  ? 293 SER A OG  1 
ATOM   2201 N N   . VAL A 1 293 ? -16.493 -44.483 19.587  1.00 75.27  ? 294 VAL A N   1 
ATOM   2202 C CA  . VAL A 1 293 ? -16.266 -45.218 20.828  1.00 84.55  ? 294 VAL A CA  1 
ATOM   2203 C C   . VAL A 1 293 ? -15.637 -44.291 21.872  1.00 91.95  ? 294 VAL A C   1 
ATOM   2204 O O   . VAL A 1 293 ? -15.590 -44.614 23.064  1.00 84.47  ? 294 VAL A O   1 
ATOM   2205 C CB  . VAL A 1 293 ? -15.361 -46.453 20.623  1.00 69.07  ? 294 VAL A CB  1 
ATOM   2206 C CG1 . VAL A 1 293 ? -16.164 -47.627 20.058  1.00 64.39  ? 294 VAL A CG1 1 
ATOM   2207 C CG2 . VAL A 1 293 ? -14.183 -46.110 19.756  1.00 65.53  ? 294 VAL A CG2 1 
ATOM   2208 N N   . PHE A 1 294 ? -15.163 -43.135 21.403  1.00 90.16  ? 295 PHE A N   1 
ATOM   2209 C CA  . PHE A 1 294 ? -14.544 -42.125 22.260  1.00 94.80  ? 295 PHE A CA  1 
ATOM   2210 C C   . PHE A 1 294 ? -15.520 -40.999 22.632  1.00 93.21  ? 295 PHE A C   1 
ATOM   2211 O O   . PHE A 1 294 ? -16.395 -40.610 21.841  1.00 81.80  ? 295 PHE A O   1 
ATOM   2212 C CB  . PHE A 1 294 ? -13.284 -41.556 21.579  1.00 75.74  ? 295 PHE A CB  1 
ATOM   2213 C CG  . PHE A 1 294 ? -12.257 -42.609 21.254  1.00 84.64  ? 295 PHE A CG  1 
ATOM   2214 C CD1 . PHE A 1 294 ? -12.234 -43.216 20.009  1.00 79.86  ? 295 PHE A CD1 1 
ATOM   2215 C CD2 . PHE A 1 294 ? -11.344 -43.030 22.210  1.00 89.30  ? 295 PHE A CD2 1 
ATOM   2216 C CE1 . PHE A 1 294 ? -11.301 -44.202 19.721  1.00 71.93  ? 295 PHE A CE1 1 
ATOM   2217 C CE2 . PHE A 1 294 ? -10.398 -44.019 21.920  1.00 80.58  ? 295 PHE A CE2 1 
ATOM   2218 C CZ  . PHE A 1 294 ? -10.381 -44.603 20.679  1.00 54.93  ? 295 PHE A CZ  1 
ATOM   2219 N N   . ARG A 1 295 ? -15.355 -40.495 23.855  1.00 102.47 ? 296 ARG A N   1 
ATOM   2220 C CA  . ARG A 1 295 ? -16.188 -39.431 24.426  1.00 87.69  ? 296 ARG A CA  1 
ATOM   2221 C C   . ARG A 1 295 ? -15.397 -38.124 24.633  1.00 92.76  ? 296 ARG A C   1 
ATOM   2222 O O   . ARG A 1 295 ? -15.408 -37.548 25.734  1.00 90.00  ? 296 ARG A O   1 
ATOM   2223 C CB  . ARG A 1 295 ? -16.768 -39.896 25.764  1.00 64.07  ? 296 ARG A CB  1 
ATOM   2224 C CG  . ARG A 1 295 ? -17.962 -39.102 26.212  1.00 82.42  ? 296 ARG A CG  1 
ATOM   2225 C CD  . ARG A 1 295 ? -18.068 -39.066 27.713  1.00 64.69  ? 296 ARG A CD  1 
ATOM   2226 N NE  . ARG A 1 295 ? -19.240 -38.287 28.097  1.00 78.29  ? 296 ARG A NE  1 
ATOM   2227 C CZ  . ARG A 1 295 ? -20.476 -38.779 28.146  1.00 93.07  ? 296 ARG A CZ  1 
ATOM   2228 N NH1 . ARG A 1 295 ? -20.699 -40.057 27.836  1.00 88.96  ? 296 ARG A NH1 1 
ATOM   2229 N NH2 . ARG A 1 295 ? -21.490 -37.993 28.507  1.00 94.25  ? 296 ARG A NH2 1 
ATOM   2230 N N   . PHE A 1 296 ? -14.709 -37.657 23.589  1.00 88.48  ? 297 PHE A N   1 
ATOM   2231 C CA  . PHE A 1 296 ? -13.640 -36.682 23.795  1.00 75.09  ? 297 PHE A CA  1 
ATOM   2232 C C   . PHE A 1 296 ? -13.972 -35.293 23.263  1.00 73.64  ? 297 PHE A C   1 
ATOM   2233 O O   . PHE A 1 296 ? -13.265 -34.751 22.396  1.00 60.10  ? 297 PHE A O   1 
ATOM   2234 C CB  . PHE A 1 296 ? -12.336 -37.161 23.148  1.00 85.14  ? 297 PHE A CB  1 
ATOM   2235 C CG  . PHE A 1 296 ? -11.716 -38.373 23.806  1.00 73.83  ? 297 PHE A CG  1 
ATOM   2236 C CD1 . PHE A 1 296 ? -12.477 -39.289 24.510  1.00 81.54  ? 297 PHE A CD1 1 
ATOM   2237 C CD2 . PHE A 1 296 ? -10.361 -38.597 23.701  1.00 65.16  ? 297 PHE A CD2 1 
ATOM   2238 C CE1 . PHE A 1 296 ? -11.907 -40.413 25.075  1.00 71.78  ? 297 PHE A CE1 1 
ATOM   2239 C CE2 . PHE A 1 296 ? -9.782  -39.716 24.262  1.00 64.18  ? 297 PHE A CE2 1 
ATOM   2240 C CZ  . PHE A 1 296 ? -10.559 -40.625 24.956  1.00 78.40  ? 297 PHE A CZ  1 
ATOM   2241 N N   . SER A 1 297 ? -15.016 -34.690 23.817  1.00 64.21  ? 298 SER A N   1 
ATOM   2242 C CA  . SER A 1 297 ? -15.450 -33.381 23.340  1.00 63.35  ? 298 SER A CA  1 
ATOM   2243 C C   . SER A 1 297 ? -14.458 -32.243 23.594  1.00 55.28  ? 298 SER A C   1 
ATOM   2244 O O   . SER A 1 297 ? -14.127 -31.492 22.683  1.00 48.65  ? 298 SER A O   1 
ATOM   2245 C CB  . SER A 1 297 ? -16.795 -33.042 23.964  1.00 66.12  ? 298 SER A CB  1 
ATOM   2246 O OG  . SER A 1 297 ? -17.810 -33.842 23.375  1.00 79.46  ? 298 SER A OG  1 
ATOM   2247 N N   . PHE A 1 298 ? -13.980 -32.105 24.825  1.00 52.62  ? 299 PHE A N   1 
ATOM   2248 C CA  . PHE A 1 298 ? -13.137 -30.962 25.159  1.00 45.26  ? 299 PHE A CA  1 
ATOM   2249 C C   . PHE A 1 298 ? -11.722 -31.389 25.506  1.00 53.31  ? 299 PHE A C   1 
ATOM   2250 O O   . PHE A 1 298 ? -11.502 -32.088 26.497  1.00 42.29  ? 299 PHE A O   1 
ATOM   2251 C CB  . PHE A 1 298 ? -13.790 -30.171 26.286  1.00 42.59  ? 299 PHE A CB  1 
ATOM   2252 C CG  . PHE A 1 298 ? -15.105 -29.582 25.873  1.00 45.92  ? 299 PHE A CG  1 
ATOM   2253 C CD1 . PHE A 1 298 ? -15.144 -28.563 24.932  1.00 39.99  ? 299 PHE A CD1 1 
ATOM   2254 C CD2 . PHE A 1 298 ? -16.301 -30.095 26.352  1.00 49.31  ? 299 PHE A CD2 1 
ATOM   2255 C CE1 . PHE A 1 298 ? -16.344 -28.034 24.513  1.00 44.49  ? 299 PHE A CE1 1 
ATOM   2256 C CE2 . PHE A 1 298 ? -17.508 -29.570 25.936  1.00 39.81  ? 299 PHE A CE2 1 
ATOM   2257 C CZ  . PHE A 1 298 ? -17.532 -28.539 25.017  1.00 46.08  ? 299 PHE A CZ  1 
ATOM   2258 N N   . VAL A 1 299 ? -10.779 -31.002 24.638  1.00 45.75  ? 300 VAL A N   1 
ATOM   2259 C CA  . VAL A 1 299 ? -9.405  -31.473 24.720  1.00 35.59  ? 300 VAL A CA  1 
ATOM   2260 C C   . VAL A 1 299 ? -8.476  -30.281 24.510  1.00 37.93  ? 300 VAL A C   1 
ATOM   2261 O O   . VAL A 1 299 ? -8.955  -29.186 24.227  1.00 39.33  ? 300 VAL A O   1 
ATOM   2262 C CB  . VAL A 1 299 ? -9.126  -32.611 23.700  1.00 41.46  ? 300 VAL A CB  1 
ATOM   2263 C CG1 . VAL A 1 299 ? -10.017 -33.806 23.987  1.00 36.28  ? 300 VAL A CG1 1 
ATOM   2264 C CG2 . VAL A 1 299 ? -9.246  -32.119 22.222  1.00 37.14  ? 300 VAL A CG2 1 
ATOM   2265 N N   . PRO A 1 300 ? -7.166  -30.456 24.756  1.00 38.98  ? 301 PRO A N   1 
ATOM   2266 C CA  . PRO A 1 300 ? -6.226  -29.362 24.483  1.00 40.19  ? 301 PRO A CA  1 
ATOM   2267 C C   . PRO A 1 300 ? -6.342  -28.791 23.070  1.00 41.66  ? 301 PRO A C   1 
ATOM   2268 O O   . PRO A 1 300 ? -6.512  -29.526 22.096  1.00 41.14  ? 301 PRO A O   1 
ATOM   2269 C CB  . PRO A 1 300 ? -4.870  -30.030 24.680  1.00 42.05  ? 301 PRO A CB  1 
ATOM   2270 C CG  . PRO A 1 300 ? -5.150  -31.012 25.803  1.00 37.28  ? 301 PRO A CG  1 
ATOM   2271 C CD  . PRO A 1 300 ? -6.510  -31.559 25.491  1.00 42.67  ? 301 PRO A CD  1 
ATOM   2272 N N   . VAL A 1 301 ? -6.288  -27.475 22.970  1.00 44.67  ? 302 VAL A N   1 
ATOM   2273 C CA  . VAL A 1 301 ? -6.430  -26.835 21.683  1.00 47.55  ? 302 VAL A CA  1 
ATOM   2274 C C   . VAL A 1 301 ? -5.083  -26.233 21.273  1.00 51.31  ? 302 VAL A C   1 
ATOM   2275 O O   . VAL A 1 301 ? -4.359  -25.659 22.100  1.00 49.19  ? 302 VAL A O   1 
ATOM   2276 C CB  . VAL A 1 301 ? -7.535  -25.756 21.717  1.00 48.62  ? 302 VAL A CB  1 
ATOM   2277 C CG1 . VAL A 1 301 ? -7.271  -24.748 22.822  1.00 36.73  ? 302 VAL A CG1 1 
ATOM   2278 C CG2 . VAL A 1 301 ? -7.669  -25.073 20.354  1.00 53.65  ? 302 VAL A CG2 1 
ATOM   2279 N N   . VAL A 1 302 ? -4.728  -26.409 20.004  1.00 51.77  ? 303 VAL A N   1 
ATOM   2280 C CA  . VAL A 1 302 ? -3.549  -25.746 19.447  1.00 51.21  ? 303 VAL A CA  1 
ATOM   2281 C C   . VAL A 1 302 ? -3.889  -24.319 19.067  1.00 52.07  ? 303 VAL A C   1 
ATOM   2282 O O   . VAL A 1 302 ? -4.504  -24.090 18.026  1.00 54.12  ? 303 VAL A O   1 
ATOM   2283 C CB  . VAL A 1 302 ? -3.020  -26.450 18.187  1.00 54.87  ? 303 VAL A CB  1 
ATOM   2284 C CG1 . VAL A 1 302 ? -1.605  -25.970 17.883  1.00 52.67  ? 303 VAL A CG1 1 
ATOM   2285 C CG2 . VAL A 1 302 ? -3.058  -27.951 18.350  1.00 45.10  ? 303 VAL A CG2 1 
ATOM   2286 N N   . ASP A 1 303 ? -3.483  -23.359 19.885  1.00 56.14  ? 304 ASP A N   1 
ATOM   2287 C CA  . ASP A 1 303 ? -3.845  -21.975 19.631  1.00 50.10  ? 304 ASP A CA  1 
ATOM   2288 C C   . ASP A 1 303 ? -2.635  -21.046 19.630  1.00 60.97  ? 304 ASP A C   1 
ATOM   2289 O O   . ASP A 1 303 ? -2.786  -19.829 19.693  1.00 61.32  ? 304 ASP A O   1 
ATOM   2290 C CB  . ASP A 1 303 ? -4.841  -21.498 20.678  1.00 55.59  ? 304 ASP A CB  1 
ATOM   2291 C CG  . ASP A 1 303 ? -4.230  -21.435 22.077  1.00 72.40  ? 304 ASP A CG  1 
ATOM   2292 O OD1 . ASP A 1 303 ? -3.128  -22.007 22.285  1.00 58.36  ? 304 ASP A OD1 1 
ATOM   2293 O OD2 . ASP A 1 303 ? -4.861  -20.818 22.968  1.00 84.40  ? 304 ASP A OD2 1 
ATOM   2294 N N   . GLY A 1 304 ? -1.437  -21.612 19.592  1.00 55.68  ? 305 GLY A N   1 
ATOM   2295 C CA  . GLY A 1 304 ? -0.238  -20.796 19.529  1.00 48.01  ? 305 GLY A CA  1 
ATOM   2296 C C   . GLY A 1 304 ? 0.291   -20.344 20.876  1.00 65.00  ? 305 GLY A C   1 
ATOM   2297 O O   . GLY A 1 304 ? 1.392   -19.800 20.959  1.00 72.89  ? 305 GLY A O   1 
ATOM   2298 N N   . ASP A 1 305 ? -0.473  -20.577 21.940  1.00 56.03  ? 306 ASP A N   1 
ATOM   2299 C CA  . ASP A 1 305 ? -0.057  -20.156 23.281  1.00 53.19  ? 306 ASP A CA  1 
ATOM   2300 C C   . ASP A 1 305 ? 0.664   -21.303 24.031  1.00 60.90  ? 306 ASP A C   1 
ATOM   2301 O O   . ASP A 1 305 ? 1.893   -21.371 24.030  1.00 63.16  ? 306 ASP A O   1 
ATOM   2302 C CB  . ASP A 1 305 ? -1.273  -19.646 24.061  1.00 51.69  ? 306 ASP A CB  1 
ATOM   2303 C CG  . ASP A 1 305 ? -0.894  -18.894 25.322  1.00 67.59  ? 306 ASP A CG  1 
ATOM   2304 O OD1 . ASP A 1 305 ? 0.319   -18.665 25.548  1.00 65.24  ? 306 ASP A OD1 1 
ATOM   2305 O OD2 . ASP A 1 305 ? -1.819  -18.523 26.083  1.00 74.39  ? 306 ASP A OD2 1 
ATOM   2306 N N   . PHE A 1 306 ? -0.095  -22.203 24.655  1.00 51.16  ? 307 PHE A N   1 
ATOM   2307 C CA  . PHE A 1 306 ? 0.486   -23.377 25.300  1.00 48.54  ? 307 PHE A CA  1 
ATOM   2308 C C   . PHE A 1 306 ? 1.275   -24.200 24.293  1.00 54.14  ? 307 PHE A C   1 
ATOM   2309 O O   . PHE A 1 306 ? 2.425   -24.573 24.529  1.00 55.59  ? 307 PHE A O   1 
ATOM   2310 C CB  . PHE A 1 306 ? -0.596  -24.261 25.942  1.00 44.43  ? 307 PHE A CB  1 
ATOM   2311 C CG  . PHE A 1 306 ? -0.064  -25.183 27.007  1.00 40.29  ? 307 PHE A CG  1 
ATOM   2312 C CD1 . PHE A 1 306 ? 0.550   -26.378 26.669  1.00 40.68  ? 307 PHE A CD1 1 
ATOM   2313 C CD2 . PHE A 1 306 ? -0.162  -24.841 28.341  1.00 38.93  ? 307 PHE A CD2 1 
ATOM   2314 C CE1 . PHE A 1 306 ? 1.056   -27.221 27.644  1.00 38.79  ? 307 PHE A CE1 1 
ATOM   2315 C CE2 . PHE A 1 306 ? 0.325   -25.683 29.332  1.00 41.37  ? 307 PHE A CE2 1 
ATOM   2316 C CZ  . PHE A 1 306 ? 0.945   -26.874 28.982  1.00 44.31  ? 307 PHE A CZ  1 
ATOM   2317 N N   . LEU A 1 307 ? 0.626   -24.509 23.181  1.00 53.47  ? 308 LEU A N   1 
ATOM   2318 C CA  . LEU A 1 307 ? 1.290   -25.171 22.072  1.00 57.70  ? 308 LEU A CA  1 
ATOM   2319 C C   . LEU A 1 307 ? 1.437   -24.195 20.906  1.00 57.64  ? 308 LEU A C   1 
ATOM   2320 O O   . LEU A 1 307 ? 0.441   -23.800 20.304  1.00 56.41  ? 308 LEU A O   1 
ATOM   2321 C CB  . LEU A 1 307 ? 0.503   -26.398 21.644  1.00 55.97  ? 308 LEU A CB  1 
ATOM   2322 C CG  . LEU A 1 307 ? 0.340   -27.457 22.721  1.00 53.35  ? 308 LEU A CG  1 
ATOM   2323 C CD1 . LEU A 1 307 ? -0.498  -28.595 22.166  1.00 49.01  ? 308 LEU A CD1 1 
ATOM   2324 C CD2 . LEU A 1 307 ? 1.719   -27.942 23.181  1.00 51.28  ? 308 LEU A CD2 1 
ATOM   2325 N N   . SER A 1 308 ? 2.668   -23.794 20.600  1.00 55.49  ? 309 SER A N   1 
ATOM   2326 C CA  . SER A 1 308 ? 2.901   -22.813 19.541  1.00 63.68  ? 309 SER A CA  1 
ATOM   2327 C C   . SER A 1 308 ? 2.597   -23.412 18.172  1.00 55.19  ? 309 SER A C   1 
ATOM   2328 O O   . SER A 1 308 ? 2.308   -22.702 17.224  1.00 63.25  ? 309 SER A O   1 
ATOM   2329 C CB  . SER A 1 308 ? 4.335   -22.298 19.592  1.00 53.94  ? 309 SER A CB  1 
ATOM   2330 O OG  . SER A 1 308 ? 5.239   -23.379 19.557  1.00 72.44  ? 309 SER A OG  1 
ATOM   2331 N N   . ASP A 1 309 ? 2.616   -24.731 18.091  1.00 63.06  ? 310 ASP A N   1 
ATOM   2332 C CA  . ASP A 1 309 ? 2.262   -25.425 16.865  1.00 53.69  ? 310 ASP A CA  1 
ATOM   2333 C C   . ASP A 1 309 ? 1.628   -26.753 17.254  1.00 53.61  ? 310 ASP A C   1 
ATOM   2334 O O   . ASP A 1 309 ? 1.485   -27.035 18.434  1.00 61.80  ? 310 ASP A O   1 
ATOM   2335 C CB  . ASP A 1 309 ? 3.506   -25.642 16.004  1.00 68.14  ? 310 ASP A CB  1 
ATOM   2336 C CG  . ASP A 1 309 ? 3.197   -25.739 14.519  1.00 65.05  ? 310 ASP A CG  1 
ATOM   2337 O OD1 . ASP A 1 309 ? 2.213   -26.421 14.139  1.00 61.54  ? 310 ASP A OD1 1 
ATOM   2338 O OD2 . ASP A 1 309 ? 3.958   -25.128 13.736  1.00 73.90  ? 310 ASP A OD2 1 
ATOM   2339 N N   . THR A 1 310 ? 1.260   -27.574 16.280  1.00 54.68  ? 311 THR A N   1 
ATOM   2340 C CA  . THR A 1 310 ? 0.770   -28.911 16.584  1.00 50.15  ? 311 THR A CA  1 
ATOM   2341 C C   . THR A 1 310 ? 1.868   -29.751 17.232  1.00 53.48  ? 311 THR A C   1 
ATOM   2342 O O   . THR A 1 310 ? 3.049   -29.541 16.956  1.00 55.43  ? 311 THR A O   1 
ATOM   2343 C CB  . THR A 1 310 ? 0.282   -29.640 15.332  1.00 51.71  ? 311 THR A CB  1 
ATOM   2344 O OG1 . THR A 1 310 ? 1.418   -30.124 14.608  1.00 58.89  ? 311 THR A OG1 1 
ATOM   2345 C CG2 . THR A 1 310 ? -0.559  -28.705 14.453  1.00 44.89  ? 311 THR A CG2 1 
ATOM   2346 N N   . PRO A 1 311 ? 1.488   -30.704 18.098  1.00 58.59  ? 312 PRO A N   1 
ATOM   2347 C CA  . PRO A 1 311 ? 2.540   -31.514 18.722  1.00 53.71  ? 312 PRO A CA  1 
ATOM   2348 C C   . PRO A 1 311 ? 3.388   -32.234 17.666  1.00 47.58  ? 312 PRO A C   1 
ATOM   2349 O O   . PRO A 1 311 ? 4.579   -32.444 17.886  1.00 53.58  ? 312 PRO A O   1 
ATOM   2350 C CB  . PRO A 1 311 ? 1.751   -32.501 19.611  1.00 46.14  ? 312 PRO A CB  1 
ATOM   2351 C CG  . PRO A 1 311 ? 0.485   -31.748 19.946  1.00 44.13  ? 312 PRO A CG  1 
ATOM   2352 C CD  . PRO A 1 311 ? 0.156   -30.963 18.682  1.00 43.54  ? 312 PRO A CD  1 
ATOM   2353 N N   . GLU A 1 312 ? 2.778   -32.578 16.535  1.00 60.01  ? 313 GLU A N   1 
ATOM   2354 C CA  A GLU A 1 312 ? 3.506   -33.218 15.436  0.56 59.36  ? 313 GLU A CA  1 
ATOM   2355 C CA  B GLU A 1 312 ? 3.492   -33.199 15.427  0.44 59.29  ? 313 GLU A CA  1 
ATOM   2356 C C   . GLU A 1 312 ? 4.621   -32.303 14.931  1.00 54.72  ? 313 GLU A C   1 
ATOM   2357 O O   . GLU A 1 312 ? 5.789   -32.699 14.889  1.00 49.62  ? 313 GLU A O   1 
ATOM   2358 C CB  A GLU A 1 312 ? 2.555   -33.583 14.290  0.56 61.53  ? 313 GLU A CB  1 
ATOM   2359 C CB  B GLU A 1 312 ? 2.515   -33.500 14.296  0.44 61.52  ? 313 GLU A CB  1 
ATOM   2360 C CG  A GLU A 1 312 ? 3.256   -33.953 12.976  0.56 71.37  ? 313 GLU A CG  1 
ATOM   2361 C CG  B GLU A 1 312 ? 1.503   -34.566 14.646  0.44 61.10  ? 313 GLU A CG  1 
ATOM   2362 C CD  A GLU A 1 312 ? 2.284   -34.303 11.851  0.56 70.06  ? 313 GLU A CD  1 
ATOM   2363 C CD  B GLU A 1 312 ? 2.024   -35.944 14.332  0.44 68.14  ? 313 GLU A CD  1 
ATOM   2364 O OE1 A GLU A 1 312 ? 1.218   -34.889 12.140  0.56 65.99  ? 313 GLU A OE1 1 
ATOM   2365 O OE1 B GLU A 1 312 ? 3.202   -36.035 13.922  0.44 67.47  ? 313 GLU A OE1 1 
ATOM   2366 O OE2 A GLU A 1 312 ? 2.590   -33.992 10.678  0.56 65.83  ? 313 GLU A OE2 1 
ATOM   2367 O OE2 B GLU A 1 312 ? 1.259   -36.925 14.481  0.44 67.55  ? 313 GLU A OE2 1 
ATOM   2368 N N   . ALA A 1 313 ? 4.257   -31.081 14.566  1.00 48.86  ? 314 ALA A N   1 
ATOM   2369 C CA  . ALA A 1 313 ? 5.231   -30.088 14.144  1.00 54.97  ? 314 ALA A CA  1 
ATOM   2370 C C   . ALA A 1 313 ? 6.292   -29.879 15.212  1.00 60.04  ? 314 ALA A C   1 
ATOM   2371 O O   . ALA A 1 313 ? 7.486   -29.897 14.911  1.00 59.50  ? 314 ALA A O   1 
ATOM   2372 C CB  . ALA A 1 313 ? 4.546   -28.785 13.833  1.00 47.48  ? 314 ALA A CB  1 
ATOM   2373 N N   . LEU A 1 314 ? 5.852   -29.667 16.457  1.00 59.10  ? 315 LEU A N   1 
ATOM   2374 C CA  . LEU A 1 314 ? 6.766   -29.353 17.557  1.00 48.61  ? 315 LEU A CA  1 
ATOM   2375 C C   . LEU A 1 314 ? 7.762   -30.472 17.774  1.00 42.64  ? 315 LEU A C   1 
ATOM   2376 O O   . LEU A 1 314 ? 8.941   -30.226 18.000  1.00 57.49  ? 315 LEU A O   1 
ATOM   2377 C CB  . LEU A 1 314 ? 5.987   -29.082 18.840  1.00 47.18  ? 315 LEU A CB  1 
ATOM   2378 C CG  . LEU A 1 314 ? 5.257   -27.743 18.808  1.00 54.48  ? 315 LEU A CG  1 
ATOM   2379 C CD1 . LEU A 1 314 ? 4.435   -27.512 20.076  1.00 55.80  ? 315 LEU A CD1 1 
ATOM   2380 C CD2 . LEU A 1 314 ? 6.260   -26.630 18.618  1.00 56.07  ? 315 LEU A CD2 1 
ATOM   2381 N N   . ILE A 1 315 ? 7.282   -31.705 17.687  1.00 47.72  ? 316 ILE A N   1 
ATOM   2382 C CA  . ILE A 1 315 ? 8.141   -32.870 17.865  1.00 54.55  ? 316 ILE A CA  1 
ATOM   2383 C C   . ILE A 1 315 ? 9.186   -32.966 16.749  1.00 61.40  ? 316 ILE A C   1 
ATOM   2384 O O   . ILE A 1 315 ? 10.357  -33.204 17.021  1.00 55.97  ? 316 ILE A O   1 
ATOM   2385 C CB  . ILE A 1 315 ? 7.313   -34.170 17.927  1.00 49.15  ? 316 ILE A CB  1 
ATOM   2386 C CG1 . ILE A 1 315 ? 6.700   -34.336 19.307  1.00 59.63  ? 316 ILE A CG1 1 
ATOM   2387 C CG2 . ILE A 1 315 ? 8.182   -35.395 17.651  1.00 52.13  ? 316 ILE A CG2 1 
ATOM   2388 C CD1 . ILE A 1 315 ? 5.466   -35.210 19.299  1.00 55.00  ? 316 ILE A CD1 1 
ATOM   2389 N N   . ASN A 1 316 ? 8.768   -32.771 15.497  1.00 59.70  ? 317 ASN A N   1 
ATOM   2390 C CA  . ASN A 1 316 ? 9.704   -32.826 14.370  1.00 61.52  ? 317 ASN A CA  1 
ATOM   2391 C C   . ASN A 1 316 ? 10.809  -31.768 14.426  1.00 55.78  ? 317 ASN A C   1 
ATOM   2392 O O   . ASN A 1 316 ? 11.907  -32.000 13.940  1.00 69.64  ? 317 ASN A O   1 
ATOM   2393 C CB  . ASN A 1 316 ? 8.942   -32.702 13.052  1.00 53.47  ? 317 ASN A CB  1 
ATOM   2394 C CG  . ASN A 1 316 ? 8.074   -33.916 12.773  1.00 63.98  ? 317 ASN A CG  1 
ATOM   2395 O OD1 . ASN A 1 316 ? 8.285   -34.989 13.344  1.00 65.67  ? 317 ASN A OD1 1 
ATOM   2396 N ND2 . ASN A 1 316 ? 7.084   -33.751 11.901  1.00 61.97  ? 317 ASN A ND2 1 
ATOM   2397 N N   . ALA A 1 317 ? 10.528  -30.628 15.047  1.00 59.63  ? 318 ALA A N   1 
ATOM   2398 C CA  . ALA A 1 317 ? 11.451  -29.496 15.033  1.00 59.35  ? 318 ALA A CA  1 
ATOM   2399 C C   . ALA A 1 317 ? 12.305  -29.355 16.290  1.00 71.20  ? 318 ALA A C   1 
ATOM   2400 O O   . ALA A 1 317 ? 12.995  -28.349 16.457  1.00 80.57  ? 318 ALA A O   1 
ATOM   2401 C CB  . ALA A 1 317 ? 10.673  -28.215 14.817  1.00 51.67  ? 318 ALA A CB  1 
ATOM   2402 N N   . GLY A 1 318 ? 12.268  -30.344 17.175  1.00 64.38  ? 319 GLY A N   1 
ATOM   2403 C CA  . GLY A 1 318 ? 12.850  -30.161 18.492  1.00 48.75  ? 319 GLY A CA  1 
ATOM   2404 C C   . GLY A 1 318 ? 14.229  -30.759 18.663  1.00 62.24  ? 319 GLY A C   1 
ATOM   2405 O O   . GLY A 1 318 ? 14.574  -31.767 18.024  1.00 59.93  ? 319 GLY A O   1 
ATOM   2406 N N   . ASP A 1 319 ? 15.024  -30.126 19.521  1.00 56.78  ? 320 ASP A N   1 
ATOM   2407 C CA  . ASP A 1 319 ? 16.329  -30.648 19.887  1.00 68.67  ? 320 ASP A CA  1 
ATOM   2408 C C   . ASP A 1 319 ? 16.104  -31.349 21.206  1.00 67.17  ? 320 ASP A C   1 
ATOM   2409 O O   . ASP A 1 319 ? 15.807  -30.687 22.203  1.00 60.32  ? 320 ASP A O   1 
ATOM   2410 C CB  . ASP A 1 319 ? 17.376  -29.521 20.008  1.00 63.83  ? 320 ASP A CB  1 
ATOM   2411 C CG  . ASP A 1 319 ? 18.797  -30.031 20.352  1.00 78.51  ? 320 ASP A CG  1 
ATOM   2412 O OD1 . ASP A 1 319 ? 18.954  -31.187 20.811  1.00 69.36  ? 320 ASP A OD1 1 
ATOM   2413 O OD2 . ASP A 1 319 ? 19.772  -29.254 20.166  1.00 78.03  ? 320 ASP A OD2 1 
ATOM   2414 N N   . PHE A 1 320 ? 16.228  -32.675 21.225  1.00 55.75  ? 321 PHE A N   1 
ATOM   2415 C CA  . PHE A 1 320 ? 15.954  -33.398 22.466  1.00 58.23  ? 321 PHE A CA  1 
ATOM   2416 C C   . PHE A 1 320 ? 17.184  -34.055 23.090  1.00 62.95  ? 321 PHE A C   1 
ATOM   2417 O O   . PHE A 1 320 ? 17.054  -34.968 23.899  1.00 59.32  ? 321 PHE A O   1 
ATOM   2418 C CB  . PHE A 1 320 ? 14.867  -34.449 22.231  1.00 50.84  ? 321 PHE A CB  1 
ATOM   2419 C CG  . PHE A 1 320 ? 13.551  -33.861 21.828  1.00 55.93  ? 321 PHE A CG  1 
ATOM   2420 C CD1 . PHE A 1 320 ? 12.740  -33.246 22.773  1.00 43.28  ? 321 PHE A CD1 1 
ATOM   2421 C CD2 . PHE A 1 320 ? 13.130  -33.902 20.502  1.00 44.90  ? 321 PHE A CD2 1 
ATOM   2422 C CE1 . PHE A 1 320 ? 11.535  -32.681 22.406  1.00 44.70  ? 321 PHE A CE1 1 
ATOM   2423 C CE2 . PHE A 1 320 ? 11.917  -33.341 20.123  1.00 51.36  ? 321 PHE A CE2 1 
ATOM   2424 C CZ  . PHE A 1 320 ? 11.117  -32.730 21.074  1.00 52.46  ? 321 PHE A CZ  1 
ATOM   2425 N N   . HIS A 1 321 ? 18.374  -33.601 22.708  1.00 67.10  ? 322 HIS A N   1 
ATOM   2426 C CA  . HIS A 1 321 ? 19.590  -33.982 23.416  1.00 62.99  ? 322 HIS A CA  1 
ATOM   2427 C C   . HIS A 1 321 ? 19.423  -33.598 24.887  1.00 52.14  ? 322 HIS A C   1 
ATOM   2428 O O   . HIS A 1 321 ? 18.981  -32.492 25.193  1.00 55.03  ? 322 HIS A O   1 
ATOM   2429 C CB  . HIS A 1 321 ? 20.829  -33.304 22.801  1.00 54.61  ? 322 HIS A CB  1 
ATOM   2430 C CG  . HIS A 1 321 ? 21.276  -33.918 21.513  1.00 52.78  ? 322 HIS A CG  1 
ATOM   2431 N ND1 . HIS A 1 321 ? 20.868  -33.447 20.280  1.00 53.99  ? 322 HIS A ND1 1 
ATOM   2432 C CD2 . HIS A 1 321 ? 22.069  -34.989 21.264  1.00 59.51  ? 322 HIS A CD2 1 
ATOM   2433 C CE1 . HIS A 1 321 ? 21.400  -34.197 19.328  1.00 64.09  ? 322 HIS A CE1 1 
ATOM   2434 N NE2 . HIS A 1 321 ? 22.126  -35.144 19.897  1.00 57.31  ? 322 HIS A NE2 1 
ATOM   2435 N N   . GLY A 1 322 ? 19.740  -34.514 25.796  1.00 53.51  ? 323 GLY A N   1 
ATOM   2436 C CA  . GLY A 1 322 ? 19.638  -34.220 27.221  1.00 59.42  ? 323 GLY A CA  1 
ATOM   2437 C C   . GLY A 1 322 ? 18.318  -34.646 27.848  1.00 56.78  ? 323 GLY A C   1 
ATOM   2438 O O   . GLY A 1 322 ? 18.068  -34.438 29.032  1.00 64.54  ? 323 GLY A O   1 
ATOM   2439 N N   . LEU A 1 323 ? 17.461  -35.242 27.036  1.00 57.64  ? 324 LEU A N   1 
ATOM   2440 C CA  . LEU A 1 323 ? 16.202  -35.761 27.519  1.00 50.13  ? 324 LEU A CA  1 
ATOM   2441 C C   . LEU A 1 323 ? 16.266  -37.279 27.577  1.00 49.03  ? 324 LEU A C   1 
ATOM   2442 O O   . LEU A 1 323 ? 16.756  -37.920 26.629  1.00 54.41  ? 324 LEU A O   1 
ATOM   2443 C CB  . LEU A 1 323 ? 15.058  -35.307 26.612  1.00 54.39  ? 324 LEU A CB  1 
ATOM   2444 C CG  . LEU A 1 323 ? 13.659  -35.805 26.972  1.00 53.97  ? 324 LEU A CG  1 
ATOM   2445 C CD1 . LEU A 1 323 ? 13.242  -35.206 28.285  1.00 48.58  ? 324 LEU A CD1 1 
ATOM   2446 C CD2 . LEU A 1 323 ? 12.659  -35.455 25.890  1.00 49.35  ? 324 LEU A CD2 1 
ATOM   2447 N N   . GLN A 1 324 ? 15.785  -37.856 28.679  1.00 45.27  ? 325 GLN A N   1 
ATOM   2448 C CA  . GLN A 1 324 ? 15.552  -39.305 28.716  1.00 50.30  ? 325 GLN A CA  1 
ATOM   2449 C C   . GLN A 1 324 ? 14.073  -39.562 28.922  1.00 52.53  ? 325 GLN A C   1 
ATOM   2450 O O   . GLN A 1 324 ? 13.427  -38.890 29.728  1.00 46.29  ? 325 GLN A O   1 
ATOM   2451 C CB  . GLN A 1 324 ? 16.359  -40.002 29.804  1.00 53.47  ? 325 GLN A CB  1 
ATOM   2452 C CG  . GLN A 1 324 ? 17.850  -39.843 29.661  1.00 57.69  ? 325 GLN A CG  1 
ATOM   2453 C CD  . GLN A 1 324 ? 18.327  -38.627 30.403  1.00 58.68  ? 325 GLN A CD  1 
ATOM   2454 O OE1 . GLN A 1 324 ? 17.928  -38.392 31.543  1.00 55.39  ? 325 GLN A OE1 1 
ATOM   2455 N NE2 . GLN A 1 324 ? 19.162  -37.828 29.755  1.00 62.12  ? 325 GLN A NE2 1 
ATOM   2456 N N   . VAL A 1 325 ? 13.544  -40.521 28.162  1.00 43.42  ? 326 VAL A N   1 
ATOM   2457 C CA  . VAL A 1 325 ? 12.112  -40.778 28.146  1.00 48.23  ? 326 VAL A CA  1 
ATOM   2458 C C   . VAL A 1 325 ? 11.848  -42.261 28.224  1.00 40.82  ? 326 VAL A C   1 
ATOM   2459 O O   . VAL A 1 325 ? 12.507  -43.042 27.550  1.00 48.77  ? 326 VAL A O   1 
ATOM   2460 C CB  . VAL A 1 325 ? 11.434  -40.223 26.877  1.00 47.55  ? 326 VAL A CB  1 
ATOM   2461 C CG1 . VAL A 1 325 ? 9.955   -40.253 27.037  1.00 44.38  ? 326 VAL A CG1 1 
ATOM   2462 C CG2 . VAL A 1 325 ? 11.845  -38.817 26.655  1.00 57.66  ? 326 VAL A CG2 1 
ATOM   2463 N N   . LEU A 1 326 ? 10.895  -42.650 29.061  1.00 43.35  ? 327 LEU A N   1 
ATOM   2464 C CA  . LEU A 1 326 ? 10.428  -44.025 29.096  1.00 39.71  ? 327 LEU A CA  1 
ATOM   2465 C C   . LEU A 1 326 ? 9.034   -44.035 28.467  1.00 49.20  ? 327 LEU A C   1 
ATOM   2466 O O   . LEU A 1 326 ? 8.174   -43.255 28.867  1.00 43.33  ? 327 LEU A O   1 
ATOM   2467 C CB  . LEU A 1 326 ? 10.419  -44.537 30.532  1.00 45.03  ? 327 LEU A CB  1 
ATOM   2468 C CG  . LEU A 1 326 ? 9.906   -45.930 30.894  1.00 42.17  ? 327 LEU A CG  1 
ATOM   2469 C CD1 . LEU A 1 326 ? 10.725  -46.985 30.258  1.00 37.73  ? 327 LEU A CD1 1 
ATOM   2470 C CD2 . LEU A 1 326 ? 9.938   -46.078 32.397  1.00 45.68  ? 327 LEU A CD2 1 
ATOM   2471 N N   . VAL A 1 327 ? 8.824   -44.868 27.447  1.00 38.25  ? 328 VAL A N   1 
ATOM   2472 C CA  . VAL A 1 327 ? 7.510   -44.963 26.794  1.00 43.14  ? 328 VAL A CA  1 
ATOM   2473 C C   . VAL A 1 327 ? 7.124   -46.410 26.581  1.00 37.49  ? 328 VAL A C   1 
ATOM   2474 O O   . VAL A 1 327 ? 7.981   -47.293 26.492  1.00 40.61  ? 328 VAL A O   1 
ATOM   2475 C CB  . VAL A 1 327 ? 7.454   -44.238 25.415  1.00 42.22  ? 328 VAL A CB  1 
ATOM   2476 C CG1 . VAL A 1 327 ? 7.826   -42.783 25.567  1.00 36.02  ? 328 VAL A CG1 1 
ATOM   2477 C CG2 . VAL A 1 327 ? 8.358   -44.922 24.405  1.00 33.61  ? 328 VAL A CG2 1 
ATOM   2478 N N   . GLY A 1 328 ? 5.832   -46.672 26.494  1.00 36.57  ? 329 GLY A N   1 
ATOM   2479 C CA  . GLY A 1 328 ? 5.417   -48.045 26.281  1.00 32.94  ? 329 GLY A CA  1 
ATOM   2480 C C   . GLY A 1 328 ? 3.933   -48.163 26.094  1.00 37.83  ? 329 GLY A C   1 
ATOM   2481 O O   . GLY A 1 328 ? 3.207   -47.169 26.187  1.00 32.80  ? 329 GLY A O   1 
ATOM   2482 N N   . VAL A 1 329 ? 3.484   -49.388 25.839  1.00 41.32  ? 330 VAL A N   1 
ATOM   2483 C CA  . VAL A 1 329 ? 2.072   -49.675 25.607  1.00 36.59  ? 330 VAL A CA  1 
ATOM   2484 C C   . VAL A 1 329 ? 1.726   -51.017 26.233  1.00 39.04  ? 330 VAL A C   1 
ATOM   2485 O O   . VAL A 1 329 ? 2.624   -51.797 26.572  1.00 42.34  ? 330 VAL A O   1 
ATOM   2486 C CB  . VAL A 1 329 ? 1.738   -49.725 24.093  1.00 35.42  ? 330 VAL A CB  1 
ATOM   2487 C CG1 . VAL A 1 329 ? 1.960   -48.365 23.440  1.00 32.94  ? 330 VAL A CG1 1 
ATOM   2488 C CG2 . VAL A 1 329 ? 2.586   -50.793 23.412  1.00 31.54  ? 330 VAL A CG2 1 
ATOM   2489 N N   . VAL A 1 330 ? 0.433   -51.304 26.370  1.00 41.33  ? 331 VAL A N   1 
ATOM   2490 C CA  . VAL A 1 330 ? 0.014   -52.656 26.739  1.00 41.42  ? 331 VAL A CA  1 
ATOM   2491 C C   . VAL A 1 330 ? -0.159  -53.499 25.482  1.00 47.93  ? 331 VAL A C   1 
ATOM   2492 O O   . VAL A 1 330 ? -0.202  -52.964 24.377  1.00 43.77  ? 331 VAL A O   1 
ATOM   2493 C CB  . VAL A 1 330 ? -1.292  -52.669 27.537  1.00 43.26  ? 331 VAL A CB  1 
ATOM   2494 C CG1 . VAL A 1 330 ? -1.103  -51.944 28.864  1.00 34.44  ? 331 VAL A CG1 1 
ATOM   2495 C CG2 . VAL A 1 330 ? -2.444  -52.071 26.711  1.00 36.43  ? 331 VAL A CG2 1 
ATOM   2496 N N   . LYS A 1 331 ? -0.250  -54.815 25.657  1.00 48.09  ? 332 LYS A N   1 
ATOM   2497 C CA  . LYS A 1 331 ? -0.341  -55.732 24.531  1.00 48.07  ? 332 LYS A CA  1 
ATOM   2498 C C   . LYS A 1 331 ? -1.604  -55.498 23.689  1.00 49.62  ? 332 LYS A C   1 
ATOM   2499 O O   . LYS A 1 331 ? -1.558  -55.580 22.474  1.00 47.87  ? 332 LYS A O   1 
ATOM   2500 C CB  . LYS A 1 331 ? -0.292  -57.177 25.027  1.00 51.53  ? 332 LYS A CB  1 
ATOM   2501 C CG  . LYS A 1 331 ? -0.117  -58.227 23.926  1.00 47.85  ? 332 LYS A CG  1 
ATOM   2502 C CD  . LYS A 1 331 ? -0.004  -59.643 24.537  1.00 62.62  ? 332 LYS A CD  1 
ATOM   2503 C CE  . LYS A 1 331 ? 0.293   -60.719 23.474  1.00 75.95  ? 332 LYS A CE  1 
ATOM   2504 N NZ  . LYS A 1 331 ? -0.779  -60.860 22.430  1.00 65.66  ? 332 LYS A NZ  1 
ATOM   2505 N N   . ASP A 1 332 ? -2.723  -55.168 24.322  1.00 46.70  ? 333 ASP A N   1 
ATOM   2506 C CA  . ASP A 1 332 ? -3.964  -55.025 23.570  1.00 42.23  ? 333 ASP A CA  1 
ATOM   2507 C C   . ASP A 1 332 ? -4.647  -53.696 23.812  1.00 44.86  ? 333 ASP A C   1 
ATOM   2508 O O   . ASP A 1 332 ? -5.669  -53.646 24.499  1.00 47.60  ? 333 ASP A O   1 
ATOM   2509 C CB  . ASP A 1 332 ? -4.923  -56.166 23.922  1.00 50.93  ? 333 ASP A CB  1 
ATOM   2510 C CG  . ASP A 1 332 ? -4.298  -57.549 23.710  1.00 61.82  ? 333 ASP A CG  1 
ATOM   2511 O OD1 . ASP A 1 332 ? -4.308  -58.035 22.544  1.00 56.00  ? 333 ASP A OD1 1 
ATOM   2512 O OD2 . ASP A 1 332 ? -3.798  -58.139 24.708  1.00 55.57  ? 333 ASP A OD2 1 
ATOM   2513 N N   . GLU A 1 333 ? -4.100  -52.630 23.231  1.00 37.23  ? 334 GLU A N   1 
ATOM   2514 C CA  . GLU A 1 333 ? -4.572  -51.272 23.500  1.00 43.83  ? 334 GLU A CA  1 
ATOM   2515 C C   . GLU A 1 333 ? -6.013  -50.998 23.108  1.00 45.55  ? 334 GLU A C   1 
ATOM   2516 O O   . GLU A 1 333 ? -6.691  -50.187 23.754  1.00 49.90  ? 334 GLU A O   1 
ATOM   2517 C CB  . GLU A 1 333 ? -3.673  -50.246 22.794  1.00 39.06  ? 334 GLU A CB  1 
ATOM   2518 C CG  . GLU A 1 333 ? -2.293  -50.082 23.435  1.00 52.61  ? 334 GLU A CG  1 
ATOM   2519 C CD  . GLU A 1 333 ? -2.314  -49.367 24.814  1.00 54.08  ? 334 GLU A CD  1 
ATOM   2520 O OE1 . GLU A 1 333 ? -3.369  -48.803 25.197  1.00 45.24  ? 334 GLU A OE1 1 
ATOM   2521 O OE2 . GLU A 1 333 ? -1.263  -49.376 25.511  1.00 48.94  ? 334 GLU A OE2 1 
ATOM   2522 N N   . GLY A 1 334 ? -6.485  -51.653 22.052  1.00 45.39  ? 335 GLY A N   1 
ATOM   2523 C CA  . GLY A 1 334 ? -7.757  -51.287 21.467  1.00 38.80  ? 335 GLY A CA  1 
ATOM   2524 C C   . GLY A 1 334 ? -8.972  -51.979 22.064  1.00 44.05  ? 335 GLY A C   1 
ATOM   2525 O O   . GLY A 1 334 ? -10.084 -51.446 22.001  1.00 43.57  ? 335 GLY A O   1 
ATOM   2526 N N   . SER A 1 335 ? -8.770  -53.163 22.635  1.00 40.39  ? 336 SER A N   1 
ATOM   2527 C CA  . SER A 1 335 ? -9.888  -54.016 23.048  1.00 48.12  ? 336 SER A CA  1 
ATOM   2528 C C   . SER A 1 335 ? -10.892 -53.347 24.011  1.00 46.82  ? 336 SER A C   1 
ATOM   2529 O O   . SER A 1 335 ? -12.087 -53.366 23.759  1.00 56.37  ? 336 SER A O   1 
ATOM   2530 C CB  . SER A 1 335 ? -9.351  -55.298 23.680  1.00 47.04  ? 336 SER A CB  1 
ATOM   2531 O OG  . SER A 1 335 ? -8.836  -55.054 24.974  1.00 56.96  ? 336 SER A OG  1 
ATOM   2532 N N   . TYR A 1 336 ? -10.396 -52.756 25.095  1.00 53.67  ? 337 TYR A N   1 
ATOM   2533 C CA  . TYR A 1 336 ? -11.226 -52.026 26.066  1.00 60.44  ? 337 TYR A CA  1 
ATOM   2534 C C   . TYR A 1 336 ? -12.221 -51.051 25.412  1.00 51.97  ? 337 TYR A C   1 
ATOM   2535 O O   . TYR A 1 336 ? -13.378 -50.997 25.790  1.00 57.19  ? 337 TYR A O   1 
ATOM   2536 C CB  . TYR A 1 336 ? -10.310 -51.269 27.055  1.00 56.72  ? 337 TYR A CB  1 
ATOM   2537 C CG  . TYR A 1 336 ? -10.987 -50.343 28.044  1.00 53.99  ? 337 TYR A CG  1 
ATOM   2538 C CD1 . TYR A 1 336 ? -11.369 -50.807 29.306  1.00 78.87  ? 337 TYR A CD1 1 
ATOM   2539 C CD2 . TYR A 1 336 ? -11.202 -48.999 27.751  1.00 62.11  ? 337 TYR A CD2 1 
ATOM   2540 C CE1 . TYR A 1 336 ? -11.981 -49.967 30.243  1.00 76.57  ? 337 TYR A CE1 1 
ATOM   2541 C CE2 . TYR A 1 336 ? -11.820 -48.142 28.684  1.00 78.21  ? 337 TYR A CE2 1 
ATOM   2542 C CZ  . TYR A 1 336 ? -12.213 -48.636 29.929  1.00 88.44  ? 337 TYR A CZ  1 
ATOM   2543 O OH  . TYR A 1 336 ? -12.826 -47.823 30.877  1.00 86.68  ? 337 TYR A OH  1 
ATOM   2544 N N   . PHE A 1 337 ? -11.771 -50.278 24.434  1.00 52.59  ? 338 PHE A N   1 
ATOM   2545 C CA  . PHE A 1 337 ? -12.631 -49.250 23.841  1.00 53.39  ? 338 PHE A CA  1 
ATOM   2546 C C   . PHE A 1 337 ? -13.768 -49.787 22.979  1.00 58.54  ? 338 PHE A C   1 
ATOM   2547 O O   . PHE A 1 337 ? -14.756 -49.084 22.745  1.00 51.51  ? 338 PHE A O   1 
ATOM   2548 C CB  . PHE A 1 337 ? -11.799 -48.296 22.999  1.00 55.17  ? 338 PHE A CB  1 
ATOM   2549 C CG  . PHE A 1 337 ? -10.688 -47.672 23.750  1.00 59.91  ? 338 PHE A CG  1 
ATOM   2550 C CD1 . PHE A 1 337 ? -10.913 -46.557 24.539  1.00 65.28  ? 338 PHE A CD1 1 
ATOM   2551 C CD2 . PHE A 1 337 ? -9.417  -48.212 23.690  1.00 54.92  ? 338 PHE A CD2 1 
ATOM   2552 C CE1 . PHE A 1 337 ? -9.882  -45.974 25.245  1.00 55.09  ? 338 PHE A CE1 1 
ATOM   2553 C CE2 . PHE A 1 337 ? -8.377  -47.640 24.395  1.00 63.41  ? 338 PHE A CE2 1 
ATOM   2554 C CZ  . PHE A 1 337 ? -8.607  -46.518 25.177  1.00 57.75  ? 338 PHE A CZ  1 
ATOM   2555 N N   . LEU A 1 338 ? -13.639 -51.018 22.499  1.00 46.55  ? 339 LEU A N   1 
ATOM   2556 C CA  . LEU A 1 338 ? -14.636 -51.540 21.571  1.00 58.42  ? 339 LEU A CA  1 
ATOM   2557 C C   . LEU A 1 338 ? -16.021 -51.732 22.211  1.00 65.75  ? 339 LEU A C   1 
ATOM   2558 O O   . LEU A 1 338 ? -17.045 -51.612 21.519  1.00 54.08  ? 339 LEU A O   1 
ATOM   2559 C CB  . LEU A 1 338 ? -14.147 -52.850 20.960  1.00 55.45  ? 339 LEU A CB  1 
ATOM   2560 C CG  . LEU A 1 338 ? -12.876 -52.705 20.123  1.00 49.90  ? 339 LEU A CG  1 
ATOM   2561 C CD1 . LEU A 1 338 ? -12.399 -54.049 19.628  1.00 49.96  ? 339 LEU A CD1 1 
ATOM   2562 C CD2 . LEU A 1 338 ? -13.088 -51.759 18.966  1.00 46.26  ? 339 LEU A CD2 1 
ATOM   2563 N N   . VAL A 1 339 ? -16.079 -51.994 23.521  1.00 56.59  ? 340 VAL A N   1 
ATOM   2564 C CA  . VAL A 1 339 ? -17.386 -52.248 24.147  1.00 55.99  ? 340 VAL A CA  1 
ATOM   2565 C C   . VAL A 1 339 ? -18.192 -50.981 24.400  1.00 55.70  ? 340 VAL A C   1 
ATOM   2566 O O   . VAL A 1 339 ? -19.325 -51.047 24.871  1.00 69.68  ? 340 VAL A O   1 
ATOM   2567 C CB  . VAL A 1 339 ? -17.241 -53.023 25.449  1.00 61.90  ? 340 VAL A CB  1 
ATOM   2568 C CG1 . VAL A 1 339 ? -16.761 -54.438 25.132  1.00 62.64  ? 340 VAL A CG1 1 
ATOM   2569 C CG2 . VAL A 1 339 ? -16.288 -52.320 26.407  1.00 62.95  ? 340 VAL A CG2 1 
ATOM   2570 N N   . TYR A 1 340 ? -17.623 -49.838 24.032  1.00 59.68  ? 341 TYR A N   1 
ATOM   2571 C CA  . TYR A 1 340 ? -18.297 -48.549 24.147  1.00 56.22  ? 341 TYR A CA  1 
ATOM   2572 C C   . TYR A 1 340 ? -18.857 -48.046 22.830  1.00 61.93  ? 341 TYR A C   1 
ATOM   2573 O O   . TYR A 1 340 ? -18.850 -46.841 22.569  1.00 72.19  ? 341 TYR A O   1 
ATOM   2574 C CB  . TYR A 1 340 ? -17.340 -47.501 24.725  1.00 53.78  ? 341 TYR A CB  1 
ATOM   2575 C CG  . TYR A 1 340 ? -17.056 -47.737 26.180  1.00 59.60  ? 341 TYR A CG  1 
ATOM   2576 C CD1 . TYR A 1 340 ? -16.101 -48.664 26.573  1.00 52.34  ? 341 TYR A CD1 1 
ATOM   2577 C CD2 . TYR A 1 340 ? -17.770 -47.062 27.168  1.00 58.91  ? 341 TYR A CD2 1 
ATOM   2578 C CE1 . TYR A 1 340 ? -15.846 -48.901 27.900  1.00 57.87  ? 341 TYR A CE1 1 
ATOM   2579 C CE2 . TYR A 1 340 ? -17.523 -47.292 28.505  1.00 52.79  ? 341 TYR A CE2 1 
ATOM   2580 C CZ  . TYR A 1 340 ? -16.562 -48.214 28.863  1.00 58.57  ? 341 TYR A CZ  1 
ATOM   2581 O OH  . TYR A 1 340 ? -16.302 -48.457 30.186  1.00 68.92  ? 341 TYR A OH  1 
ATOM   2582 N N   . GLY A 1 341 ? -19.336 -48.951 21.986  1.00 64.66  ? 342 GLY A N   1 
ATOM   2583 C CA  . GLY A 1 341 ? -20.083 -48.504 20.827  1.00 66.05  ? 342 GLY A CA  1 
ATOM   2584 C C   . GLY A 1 341 ? -19.722 -49.143 19.510  1.00 72.24  ? 342 GLY A C   1 
ATOM   2585 O O   . GLY A 1 341 ? -20.280 -48.791 18.472  1.00 64.09  ? 342 GLY A O   1 
ATOM   2586 N N   . ALA A 1 342 ? -18.779 -50.071 19.530  1.00 70.81  ? 343 ALA A N   1 
ATOM   2587 C CA  . ALA A 1 342 ? -18.513 -50.825 18.321  1.00 66.90  ? 343 ALA A CA  1 
ATOM   2588 C C   . ALA A 1 342 ? -19.582 -51.910 18.211  1.00 72.35  ? 343 ALA A C   1 
ATOM   2589 O O   . ALA A 1 342 ? -19.747 -52.720 19.135  1.00 67.94  ? 343 ALA A O   1 
ATOM   2590 C CB  . ALA A 1 342 ? -17.111 -51.418 18.335  1.00 61.55  ? 343 ALA A CB  1 
ATOM   2591 N N   . PRO A 1 343 ? -20.335 -51.905 17.094  1.00 71.87  ? 344 PRO A N   1 
ATOM   2592 C CA  . PRO A 1 343 ? -21.415 -52.874 16.880  1.00 53.03  ? 344 PRO A CA  1 
ATOM   2593 C C   . PRO A 1 343 ? -20.961 -54.309 17.070  1.00 54.20  ? 344 PRO A C   1 
ATOM   2594 O O   . PRO A 1 343 ? -19.904 -54.707 16.561  1.00 60.89  ? 344 PRO A O   1 
ATOM   2595 C CB  . PRO A 1 343 ? -21.839 -52.619 15.429  1.00 55.96  ? 344 PRO A CB  1 
ATOM   2596 C CG  . PRO A 1 343 ? -20.801 -51.715 14.846  1.00 66.39  ? 344 PRO A CG  1 
ATOM   2597 C CD  . PRO A 1 343 ? -20.234 -50.946 15.979  1.00 58.49  ? 344 PRO A CD  1 
ATOM   2598 N N   . GLY A 1 344 ? -21.747 -55.066 17.830  1.00 61.68  ? 345 GLY A N   1 
ATOM   2599 C CA  . GLY A 1 344 ? -21.488 -56.479 18.050  1.00 54.41  ? 345 GLY A CA  1 
ATOM   2600 C C   . GLY A 1 344 ? -20.595 -56.770 19.244  1.00 63.40  ? 345 GLY A C   1 
ATOM   2601 O O   . GLY A 1 344 ? -20.290 -57.935 19.530  1.00 58.53  ? 345 GLY A O   1 
ATOM   2602 N N   . PHE A 1 345 ? -20.166 -55.727 19.946  1.00 55.84  ? 346 PHE A N   1 
ATOM   2603 C CA  . PHE A 1 345 ? -19.230 -55.936 21.046  1.00 59.30  ? 346 PHE A CA  1 
ATOM   2604 C C   . PHE A 1 345 ? -19.918 -55.905 22.405  1.00 58.67  ? 346 PHE A C   1 
ATOM   2605 O O   . PHE A 1 345 ? -20.844 -55.119 22.633  1.00 64.47  ? 346 PHE A O   1 
ATOM   2606 C CB  . PHE A 1 345 ? -18.101 -54.902 20.989  1.00 55.68  ? 346 PHE A CB  1 
ATOM   2607 C CG  . PHE A 1 345 ? -17.001 -55.274 20.037  1.00 58.96  ? 346 PHE A CG  1 
ATOM   2608 C CD1 . PHE A 1 345 ? -17.066 -54.897 18.699  1.00 57.16  ? 346 PHE A CD1 1 
ATOM   2609 C CD2 . PHE A 1 345 ? -15.919 -56.033 20.468  1.00 59.31  ? 346 PHE A CD2 1 
ATOM   2610 C CE1 . PHE A 1 345 ? -16.062 -55.254 17.807  1.00 62.91  ? 346 PHE A CE1 1 
ATOM   2611 C CE2 . PHE A 1 345 ? -14.907 -56.400 19.583  1.00 57.43  ? 346 PHE A CE2 1 
ATOM   2612 C CZ  . PHE A 1 345 ? -14.980 -56.006 18.249  1.00 55.01  ? 346 PHE A CZ  1 
ATOM   2613 N N   . SER A 1 346 ? -19.462 -56.789 23.289  1.00 57.53  ? 347 SER A N   1 
ATOM   2614 C CA  . SER A 1 346 ? -19.872 -56.808 24.691  1.00 57.25  ? 347 SER A CA  1 
ATOM   2615 C C   . SER A 1 346 ? -18.839 -57.546 25.541  1.00 64.09  ? 347 SER A C   1 
ATOM   2616 O O   . SER A 1 346 ? -18.200 -58.499 25.079  1.00 57.38  ? 347 SER A O   1 
ATOM   2617 C CB  . SER A 1 346 ? -21.241 -57.475 24.859  1.00 56.45  ? 347 SER A CB  1 
ATOM   2618 O OG  . SER A 1 346 ? -21.522 -57.704 26.231  1.00 73.75  ? 347 SER A OG  1 
ATOM   2619 N N   . LYS A 1 347 ? -18.688 -57.126 26.794  1.00 58.20  ? 348 LYS A N   1 
ATOM   2620 C CA  . LYS A 1 347 ? -17.782 -57.828 27.692  1.00 57.05  ? 348 LYS A CA  1 
ATOM   2621 C C   . LYS A 1 347 ? -18.365 -59.188 28.072  1.00 55.67  ? 348 LYS A C   1 
ATOM   2622 O O   . LYS A 1 347 ? -17.650 -60.079 28.542  1.00 57.90  ? 348 LYS A O   1 
ATOM   2623 C CB  . LYS A 1 347 ? -17.503 -56.998 28.946  1.00 63.44  ? 348 LYS A CB  1 
ATOM   2624 C CG  . LYS A 1 347 ? -18.603 -57.072 30.003  1.00 54.82  ? 348 LYS A CG  1 
ATOM   2625 C CD  . LYS A 1 347 ? -18.224 -56.331 31.280  1.00 56.65  ? 348 LYS A CD  1 
ATOM   2626 C CE  . LYS A 1 347 ? -19.230 -56.608 32.373  1.00 44.36  ? 348 LYS A CE  1 
ATOM   2627 N NZ  . LYS A 1 347 ? -19.025 -57.993 32.868  1.00 52.37  ? 348 LYS A NZ  1 
ATOM   2628 N N   . ASP A 1 348 ? -19.664 -59.358 27.857  1.00 50.62  ? 349 ASP A N   1 
ATOM   2629 C CA  . ASP A 1 348 ? -20.342 -60.565 28.326  1.00 61.28  ? 349 ASP A CA  1 
ATOM   2630 C C   . ASP A 1 348 ? -20.492 -61.693 27.298  1.00 74.52  ? 349 ASP A C   1 
ATOM   2631 O O   . ASP A 1 348 ? -20.985 -62.766 27.649  1.00 69.75  ? 349 ASP A O   1 
ATOM   2632 C CB  . ASP A 1 348 ? -21.711 -60.183 28.876  1.00 57.96  ? 349 ASP A CB  1 
ATOM   2633 C CG  . ASP A 1 348 ? -21.602 -59.391 30.158  1.00 65.06  ? 349 ASP A CG  1 
ATOM   2634 O OD1 . ASP A 1 348 ? -20.814 -59.822 31.049  1.00 51.28  ? 349 ASP A OD1 1 
ATOM   2635 O OD2 . ASP A 1 348 ? -22.266 -58.329 30.250  1.00 56.28  ? 349 ASP A OD2 1 
ATOM   2636 N N   . ASN A 1 349 ? -20.086 -61.456 26.046  1.00 67.51  ? 350 ASN A N   1 
ATOM   2637 C CA  . ASN A 1 349 ? -19.901 -62.557 25.092  1.00 66.45  ? 350 ASN A CA  1 
ATOM   2638 C C   . ASN A 1 349 ? -18.551 -62.466 24.369  1.00 68.81  ? 350 ASN A C   1 
ATOM   2639 O O   . ASN A 1 349 ? -17.701 -61.650 24.735  1.00 71.28  ? 350 ASN A O   1 
ATOM   2640 C CB  . ASN A 1 349 ? -21.069 -62.630 24.097  1.00 55.34  ? 350 ASN A CB  1 
ATOM   2641 C CG  . ASN A 1 349 ? -21.185 -61.411 23.185  1.00 69.49  ? 350 ASN A CG  1 
ATOM   2642 O OD1 . ASN A 1 349 ? -20.191 -60.858 22.713  1.00 68.01  ? 350 ASN A OD1 1 
ATOM   2643 N ND2 . ASN A 1 349 ? -22.433 -61.003 22.920  1.00 70.79  ? 350 ASN A ND2 1 
ATOM   2644 N N   . GLU A 1 350 ? -18.342 -63.303 23.359  1.00 61.79  ? 351 GLU A N   1 
ATOM   2645 C CA  . GLU A 1 350 ? -17.013 -63.424 22.757  1.00 59.05  ? 351 GLU A CA  1 
ATOM   2646 C C   . GLU A 1 350 ? -16.780 -62.352 21.710  1.00 50.91  ? 351 GLU A C   1 
ATOM   2647 O O   . GLU A 1 350 ? -15.694 -62.237 21.166  1.00 55.43  ? 351 GLU A O   1 
ATOM   2648 C CB  . GLU A 1 350 ? -16.805 -64.809 22.142  1.00 56.65  ? 351 GLU A CB  1 
ATOM   2649 C CG  . GLU A 1 350 ? -16.446 -65.882 23.143  1.00 67.94  ? 351 GLU A CG  1 
ATOM   2650 C CD  . GLU A 1 350 ? -15.261 -65.493 24.013  1.00 84.64  ? 351 GLU A CD  1 
ATOM   2651 O OE1 . GLU A 1 350 ? -14.105 -65.698 23.582  1.00 96.13  ? 351 GLU A OE1 1 
ATOM   2652 O OE2 . GLU A 1 350 ? -15.484 -64.976 25.131  1.00 95.96  ? 351 GLU A OE2 1 
ATOM   2653 N N   . SER A 1 351 ? -17.815 -61.575 21.444  1.00 48.65  ? 352 SER A N   1 
ATOM   2654 C CA  . SER A 1 351 ? -17.737 -60.479 20.505  1.00 54.37  ? 352 SER A CA  1 
ATOM   2655 C C   . SER A 1 351 ? -17.219 -60.923 19.124  1.00 66.55  ? 352 SER A C   1 
ATOM   2656 O O   . SER A 1 351 ? -16.461 -60.202 18.467  1.00 56.23  ? 352 SER A O   1 
ATOM   2657 C CB  . SER A 1 351 ? -16.867 -59.373 21.099  1.00 57.19  ? 352 SER A CB  1 
ATOM   2658 O OG  . SER A 1 351 ? -17.513 -58.812 22.223  1.00 57.51  ? 352 SER A OG  1 
ATOM   2659 N N   . LEU A 1 352 ? -17.650 -62.106 18.687  1.00 58.09  ? 353 LEU A N   1 
ATOM   2660 C CA  . LEU A 1 352 ? -17.323 -62.614 17.355  1.00 58.35  ? 353 LEU A CA  1 
ATOM   2661 C C   . LEU A 1 352 ? -18.120 -61.895 16.283  1.00 60.39  ? 353 LEU A C   1 
ATOM   2662 O O   . LEU A 1 352 ? -19.238 -62.293 15.975  1.00 74.77  ? 353 LEU A O   1 
ATOM   2663 C CB  . LEU A 1 352 ? -17.595 -64.110 17.283  1.00 47.56  ? 353 LEU A CB  1 
ATOM   2664 C CG  . LEU A 1 352 ? -16.779 -64.939 18.261  1.00 52.21  ? 353 LEU A CG  1 
ATOM   2665 C CD1 . LEU A 1 352 ? -17.238 -66.378 18.210  1.00 51.79  ? 353 LEU A CD1 1 
ATOM   2666 C CD2 . LEU A 1 352 ? -15.304 -64.828 17.926  1.00 56.95  ? 353 LEU A CD2 1 
ATOM   2667 N N   . ILE A 1 353 ? -17.545 -60.849 15.697  1.00 54.81  ? 354 ILE A N   1 
ATOM   2668 C CA  . ILE A 1 353 ? -18.307 -59.980 14.808  1.00 51.43  ? 354 ILE A CA  1 
ATOM   2669 C C   . ILE A 1 353 ? -18.270 -60.438 13.337  1.00 65.72  ? 354 ILE A C   1 
ATOM   2670 O O   . ILE A 1 353 ? -17.450 -61.274 12.931  1.00 54.68  ? 354 ILE A O   1 
ATOM   2671 C CB  . ILE A 1 353 ? -17.811 -58.522 14.907  1.00 57.91  ? 354 ILE A CB  1 
ATOM   2672 C CG1 . ILE A 1 353 ? -16.314 -58.432 14.573  1.00 57.47  ? 354 ILE A CG1 1 
ATOM   2673 C CG2 . ILE A 1 353 ? -18.060 -57.976 16.298  1.00 59.78  ? 354 ILE A CG2 1 
ATOM   2674 C CD1 . ILE A 1 353 ? -15.860 -57.041 14.160  1.00 47.05  ? 354 ILE A CD1 1 
ATOM   2675 N N   . SER A 1 354 ? -19.179 -59.885 12.543  1.00 55.51  ? 355 SER A N   1 
ATOM   2676 C CA  . SER A 1 354 ? -19.261 -60.212 11.123  1.00 54.37  ? 355 SER A CA  1 
ATOM   2677 C C   . SER A 1 354 ? -18.539 -59.126 10.351  1.00 64.30  ? 355 SER A C   1 
ATOM   2678 O O   . SER A 1 354 ? -18.173 -58.091 10.912  1.00 60.17  ? 355 SER A O   1 
ATOM   2679 C CB  . SER A 1 354 ? -20.715 -60.325 10.665  1.00 49.61  ? 355 SER A CB  1 
ATOM   2680 O OG  . SER A 1 354 ? -21.365 -59.056 10.689  1.00 56.53  ? 355 SER A OG  1 
ATOM   2681 N N   . ARG A 1 355 ? -18.339 -59.348 9.060   1.00 56.96  ? 356 ARG A N   1 
ATOM   2682 C CA  . ARG A 1 355 ? -17.532 -58.426 8.294   1.00 51.45  ? 356 ARG A CA  1 
ATOM   2683 C C   . ARG A 1 355 ? -18.227 -57.078 8.182   1.00 53.15  ? 356 ARG A C   1 
ATOM   2684 O O   . ARG A 1 355 ? -17.578 -56.031 8.216   1.00 58.20  ? 356 ARG A O   1 
ATOM   2685 C CB  . ARG A 1 355 ? -17.216 -58.993 6.916   1.00 60.32  ? 356 ARG A CB  1 
ATOM   2686 C CG  . ARG A 1 355 ? -16.434 -58.016 6.084   1.00 52.56  ? 356 ARG A CG  1 
ATOM   2687 C CD  . ARG A 1 355 ? -15.485 -58.704 5.152   1.00 61.92  ? 356 ARG A CD  1 
ATOM   2688 N NE  . ARG A 1 355 ? -14.687 -57.692 4.488   1.00 59.34  ? 356 ARG A NE  1 
ATOM   2689 C CZ  . ARG A 1 355 ? -13.434 -57.412 4.813   1.00 57.55  ? 356 ARG A CZ  1 
ATOM   2690 N NH1 . ARG A 1 355 ? -12.820 -58.108 5.766   1.00 50.18  ? 356 ARG A NH1 1 
ATOM   2691 N NH2 . ARG A 1 355 ? -12.794 -56.449 4.164   1.00 59.60  ? 356 ARG A NH2 1 
ATOM   2692 N N   . ALA A 1 356 ? -19.549 -57.093 8.085   1.00 55.84  ? 357 ALA A N   1 
ATOM   2693 C CA  . ALA A 1 356 ? -20.284 -55.836 8.017   1.00 59.27  ? 357 ALA A CA  1 
ATOM   2694 C C   . ALA A 1 356 ? -20.100 -55.059 9.327   1.00 63.19  ? 357 ALA A C   1 
ATOM   2695 O O   . ALA A 1 356 ? -19.993 -53.832 9.321   1.00 66.17  ? 357 ALA A O   1 
ATOM   2696 C CB  . ALA A 1 356 ? -21.763 -56.091 7.730   1.00 46.87  ? 357 ALA A CB  1 
ATOM   2697 N N   . GLU A 1 357 ? -20.050 -55.785 10.443  1.00 51.73  ? 358 GLU A N   1 
ATOM   2698 C CA  . GLU A 1 357 ? -19.837 -55.161 11.750  1.00 66.90  ? 358 GLU A CA  1 
ATOM   2699 C C   . GLU A 1 357 ? -18.416 -54.612 11.834  1.00 61.14  ? 358 GLU A C   1 
ATOM   2700 O O   . GLU A 1 357 ? -18.190 -53.524 12.365  1.00 57.10  ? 358 GLU A O   1 
ATOM   2701 C CB  . GLU A 1 357 ? -20.105 -56.154 12.892  1.00 55.83  ? 358 GLU A CB  1 
ATOM   2702 C CG  . GLU A 1 357 ? -21.560 -56.641 12.945  1.00 58.19  ? 358 GLU A CG  1 
ATOM   2703 C CD  . GLU A 1 357 ? -21.884 -57.553 14.135  1.00 57.37  ? 358 GLU A CD  1 
ATOM   2704 O OE1 . GLU A 1 357 ? -21.157 -58.547 14.375  1.00 61.60  ? 358 GLU A OE1 1 
ATOM   2705 O OE2 . GLU A 1 357 ? -22.888 -57.273 14.826  1.00 69.68  ? 358 GLU A OE2 1 
ATOM   2706 N N   . PHE A 1 358 ? -17.466 -55.372 11.294  1.00 62.54  ? 359 PHE A N   1 
ATOM   2707 C CA  . PHE A 1 358 ? -16.078 -54.930 11.214  1.00 53.81  ? 359 PHE A CA  1 
ATOM   2708 C C   . PHE A 1 358 ? -15.983 -53.615 10.438  1.00 51.51  ? 359 PHE A C   1 
ATOM   2709 O O   . PHE A 1 358 ? -15.384 -52.659 10.927  1.00 66.30  ? 359 PHE A O   1 
ATOM   2710 C CB  . PHE A 1 358 ? -15.211 -56.015 10.577  1.00 48.01  ? 359 PHE A CB  1 
ATOM   2711 C CG  . PHE A 1 358 ? -13.780 -55.610 10.356  1.00 58.75  ? 359 PHE A CG  1 
ATOM   2712 C CD1 . PHE A 1 358 ? -12.871 -55.595 11.406  1.00 54.68  ? 359 PHE A CD1 1 
ATOM   2713 C CD2 . PHE A 1 358 ? -13.334 -55.273 9.084   1.00 54.44  ? 359 PHE A CD2 1 
ATOM   2714 C CE1 . PHE A 1 358 ? -11.545 -55.236 11.192  1.00 51.30  ? 359 PHE A CE1 1 
ATOM   2715 C CE2 . PHE A 1 358 ? -12.013 -54.914 8.863   1.00 52.21  ? 359 PHE A CE2 1 
ATOM   2716 C CZ  . PHE A 1 358 ? -11.117 -54.893 9.916   1.00 53.65  ? 359 PHE A CZ  1 
ATOM   2717 N N   . LEU A 1 359 ? -16.603 -53.556 9.262   1.00 56.45  ? 360 LEU A N   1 
ATOM   2718 C CA  . LEU A 1 359 ? -16.612 -52.331 8.450   1.00 59.01  ? 360 LEU A CA  1 
ATOM   2719 C C   . LEU A 1 359 ? -17.241 -51.169 9.222   1.00 63.81  ? 360 LEU A C   1 
ATOM   2720 O O   . LEU A 1 359 ? -16.713 -50.059 9.228   1.00 70.28  ? 360 LEU A O   1 
ATOM   2721 C CB  . LEU A 1 359 ? -17.348 -52.558 7.118   1.00 49.25  ? 360 LEU A CB  1 
ATOM   2722 C CG  . LEU A 1 359 ? -16.815 -53.692 6.206   1.00 63.61  ? 360 LEU A CG  1 
ATOM   2723 C CD1 . LEU A 1 359 ? -17.587 -53.892 4.871   1.00 54.10  ? 360 LEU A CD1 1 
ATOM   2724 C CD2 . LEU A 1 359 ? -15.343 -53.503 5.913   1.00 61.66  ? 360 LEU A CD2 1 
ATOM   2725 N N   . ALA A 1 360 ? -18.357 -51.429 9.894   1.00 68.54  ? 361 ALA A N   1 
ATOM   2726 C CA  . ALA A 1 360 ? -18.989 -50.412 10.734  1.00 63.41  ? 361 ALA A CA  1 
ATOM   2727 C C   . ALA A 1 360 ? -18.082 -49.984 11.886  1.00 61.56  ? 361 ALA A C   1 
ATOM   2728 O O   . ALA A 1 360 ? -17.985 -48.804 12.205  1.00 66.78  ? 361 ALA A O   1 
ATOM   2729 C CB  . ALA A 1 360 ? -20.308 -50.927 11.290  1.00 59.56  ? 361 ALA A CB  1 
ATOM   2730 N N   . GLY A 1 361 ? -17.446 -50.960 12.526  1.00 64.27  ? 362 GLY A N   1 
ATOM   2731 C CA  . GLY A 1 361 ? -16.589 -50.694 13.661  1.00 53.61  ? 362 GLY A CA  1 
ATOM   2732 C C   . GLY A 1 361 ? -15.470 -49.752 13.284  1.00 55.70  ? 362 GLY A C   1 
ATOM   2733 O O   . GLY A 1 361 ? -15.138 -48.836 14.036  1.00 58.75  ? 362 GLY A O   1 
ATOM   2734 N N   . VAL A 1 362 ? -14.900 -49.965 12.102  1.00 56.74  ? 363 VAL A N   1 
ATOM   2735 C CA  . VAL A 1 362 ? -13.801 -49.135 11.639  1.00 52.24  ? 363 VAL A CA  1 
ATOM   2736 C C   . VAL A 1 362 ? -14.184 -47.654 11.559  1.00 54.71  ? 363 VAL A C   1 
ATOM   2737 O O   . VAL A 1 362 ? -13.415 -46.794 11.998  1.00 61.86  ? 363 VAL A O   1 
ATOM   2738 C CB  . VAL A 1 362 ? -13.282 -49.627 10.287  1.00 59.42  ? 363 VAL A CB  1 
ATOM   2739 C CG1 . VAL A 1 362 ? -12.378 -48.590 9.650   1.00 50.96  ? 363 VAL A CG1 1 
ATOM   2740 C CG2 . VAL A 1 362 ? -12.546 -50.958 10.470  1.00 44.68  ? 363 VAL A CG2 1 
ATOM   2741 N N   . ARG A 1 363 ? -15.369 -47.341 11.041  1.00 59.53  ? 364 ARG A N   1 
ATOM   2742 C CA  . ARG A 1 363 ? -15.808 -45.941 11.002  1.00 60.42  ? 364 ARG A CA  1 
ATOM   2743 C C   . ARG A 1 363 ? -15.977 -45.340 12.411  1.00 65.45  ? 364 ARG A C   1 
ATOM   2744 O O   . ARG A 1 363 ? -15.897 -44.127 12.582  1.00 71.30  ? 364 ARG A O   1 
ATOM   2745 C CB  . ARG A 1 363 ? -17.125 -45.786 10.230  1.00 62.13  ? 364 ARG A CB  1 
ATOM   2746 C CG  . ARG A 1 363 ? -17.088 -46.129 8.733   1.00 68.77  ? 364 ARG A CG  1 
ATOM   2747 C CD  . ARG A 1 363 ? -15.818 -45.665 8.006   1.00 82.65  ? 364 ARG A CD  1 
ATOM   2748 N NE  . ARG A 1 363 ? -15.752 -44.236 7.666   1.00 85.57  ? 364 ARG A NE  1 
ATOM   2749 C CZ  . ARG A 1 363 ? -15.973 -43.732 6.448   1.00 96.18  ? 364 ARG A CZ  1 
ATOM   2750 N NH1 . ARG A 1 363 ? -16.309 -44.533 5.439   1.00 89.61  ? 364 ARG A NH1 1 
ATOM   2751 N NH2 . ARG A 1 363 ? -15.862 -42.422 6.233   1.00 76.54  ? 364 ARG A NH2 1 
ATOM   2752 N N   . VAL A 1 364 ? -16.203 -46.183 13.415  1.00 55.43  ? 365 VAL A N   1 
ATOM   2753 C CA  . VAL A 1 364 ? -16.390 -45.710 14.788  1.00 57.33  ? 365 VAL A CA  1 
ATOM   2754 C C   . VAL A 1 364 ? -15.062 -45.616 15.552  1.00 69.84  ? 365 VAL A C   1 
ATOM   2755 O O   . VAL A 1 364 ? -14.878 -44.756 16.424  1.00 73.69  ? 365 VAL A O   1 
ATOM   2756 C CB  . VAL A 1 364 ? -17.383 -46.635 15.564  1.00 63.64  ? 365 VAL A CB  1 
ATOM   2757 C CG1 . VAL A 1 364 ? -17.339 -46.363 17.025  1.00 68.32  ? 365 VAL A CG1 1 
ATOM   2758 C CG2 . VAL A 1 364 ? -18.797 -46.438 15.062  1.00 65.71  ? 365 VAL A CG2 1 
ATOM   2759 N N   . GLY A 1 365 ? -14.131 -46.505 15.227  1.00 60.51  ? 366 GLY A N   1 
ATOM   2760 C CA  . GLY A 1 365 ? -12.836 -46.498 15.885  1.00 59.14  ? 366 GLY A CA  1 
ATOM   2761 C C   . GLY A 1 365 ? -11.911 -45.468 15.265  1.00 61.51  ? 366 GLY A C   1 
ATOM   2762 O O   . GLY A 1 365 ? -10.962 -45.009 15.901  1.00 65.64  ? 366 GLY A O   1 
ATOM   2763 N N   . VAL A 1 366 ? -12.199 -45.098 14.021  1.00 52.80  ? 367 VAL A N   1 
ATOM   2764 C CA  . VAL A 1 366 ? -11.373 -44.142 13.285  1.00 61.18  ? 367 VAL A CA  1 
ATOM   2765 C C   . VAL A 1 366 ? -12.241 -43.003 12.757  1.00 61.71  ? 367 VAL A C   1 
ATOM   2766 O O   . VAL A 1 366 ? -12.472 -42.898 11.551  1.00 65.18  ? 367 VAL A O   1 
ATOM   2767 C CB  . VAL A 1 366 ? -10.631 -44.826 12.110  1.00 53.34  ? 367 VAL A CB  1 
ATOM   2768 C CG1 . VAL A 1 366 ? -9.548  -43.918 11.540  1.00 48.20  ? 367 VAL A CG1 1 
ATOM   2769 C CG2 . VAL A 1 366 ? -10.023 -46.144 12.559  1.00 49.46  ? 367 VAL A CG2 1 
ATOM   2770 N N   . PRO A 1 367 ? -12.743 -42.148 13.661  1.00 69.71  ? 368 PRO A N   1 
ATOM   2771 C CA  . PRO A 1 367 ? -13.718 -41.141 13.233  1.00 63.36  ? 368 PRO A CA  1 
ATOM   2772 C C   . PRO A 1 367 ? -13.115 -40.025 12.383  1.00 71.52  ? 368 PRO A C   1 
ATOM   2773 O O   . PRO A 1 367 ? -11.910 -39.755 12.440  1.00 74.13  ? 368 PRO A O   1 
ATOM   2774 C CB  . PRO A 1 367 ? -14.245 -40.586 14.556  1.00 74.65  ? 368 PRO A CB  1 
ATOM   2775 C CG  . PRO A 1 367 ? -13.150 -40.842 15.538  1.00 60.09  ? 368 PRO A CG  1 
ATOM   2776 C CD  . PRO A 1 367 ? -12.519 -42.125 15.117  1.00 65.17  ? 368 PRO A CD  1 
ATOM   2777 N N   . GLN A 1 368 ? -13.974 -39.389 11.596  1.00 70.47  ? 369 GLN A N   1 
ATOM   2778 C CA  . GLN A 1 368 ? -13.623 -38.198 10.824  1.00 92.75  ? 369 GLN A CA  1 
ATOM   2779 C C   . GLN A 1 368 ? -12.469 -38.400 9.841   1.00 90.84  ? 369 GLN A C   1 
ATOM   2780 O O   . GLN A 1 368 ? -11.577 -37.560 9.749   1.00 88.35  ? 369 GLN A O   1 
ATOM   2781 C CB  . GLN A 1 368 ? -13.285 -37.027 11.766  1.00 102.11 ? 369 GLN A CB  1 
ATOM   2782 C CG  . GLN A 1 368 ? -14.428 -36.597 12.706  1.00 102.69 ? 369 GLN A CG  1 
ATOM   2783 C CD  . GLN A 1 368 ? -15.789 -36.569 12.018  1.00 100.87 ? 369 GLN A CD  1 
ATOM   2784 O OE1 . GLN A 1 368 ? -16.129 -35.616 11.317  1.00 106.38 ? 369 GLN A OE1 1 
ATOM   2785 N NE2 . GLN A 1 368 ? -16.569 -37.621 12.216  1.00 89.76  ? 369 GLN A NE2 1 
ATOM   2786 N N   . VAL A 1 369 ? -12.484 -39.512 9.111   1.00 86.75  ? 370 VAL A N   1 
ATOM   2787 C CA  . VAL A 1 369 ? -11.580 -39.669 7.981   1.00 82.37  ? 370 VAL A CA  1 
ATOM   2788 C C   . VAL A 1 369 ? -12.394 -40.058 6.756   1.00 76.31  ? 370 VAL A C   1 
ATOM   2789 O O   . VAL A 1 369 ? -13.465 -40.645 6.873   1.00 84.43  ? 370 VAL A O   1 
ATOM   2790 C CB  . VAL A 1 369 ? -10.468 -40.714 8.246   1.00 81.17  ? 370 VAL A CB  1 
ATOM   2791 C CG1 . VAL A 1 369 ? -9.539  -40.229 9.344   1.00 67.43  ? 370 VAL A CG1 1 
ATOM   2792 C CG2 . VAL A 1 369 ? -11.058 -42.082 8.581   1.00 70.21  ? 370 VAL A CG2 1 
ATOM   2793 N N   . SER A 1 370 ? -11.889 -39.720 5.578   1.00 84.10  ? 371 SER A N   1 
ATOM   2794 C CA  . SER A 1 370 ? -12.627 -39.968 4.345   1.00 79.20  ? 371 SER A CA  1 
ATOM   2795 C C   . SER A 1 370 ? -12.901 -41.450 4.107   1.00 84.09  ? 371 SER A C   1 
ATOM   2796 O O   . SER A 1 370 ? -12.294 -42.328 4.736   1.00 77.58  ? 371 SER A O   1 
ATOM   2797 C CB  . SER A 1 370 ? -11.869 -39.394 3.146   1.00 75.33  ? 371 SER A CB  1 
ATOM   2798 O OG  . SER A 1 370 ? -10.635 -40.064 2.956   1.00 76.67  ? 371 SER A OG  1 
ATOM   2799 N N   . ASP A 1 371 ? -13.823 -41.715 3.187   1.00 83.87  ? 372 ASP A N   1 
ATOM   2800 C CA  . ASP A 1 371 ? -14.129 -43.074 2.765   1.00 77.66  ? 372 ASP A CA  1 
ATOM   2801 C C   . ASP A 1 371 ? -12.894 -43.739 2.183   1.00 67.31  ? 372 ASP A C   1 
ATOM   2802 O O   . ASP A 1 371 ? -12.604 -44.897 2.484   1.00 59.16  ? 372 ASP A O   1 
ATOM   2803 C CB  . ASP A 1 371 ? -15.261 -43.078 1.738   1.00 87.49  ? 372 ASP A CB  1 
ATOM   2804 C CG  . ASP A 1 371 ? -16.571 -42.582 2.315   1.00 93.87  ? 372 ASP A CG  1 
ATOM   2805 O OD1 . ASP A 1 371 ? -16.691 -42.556 3.564   1.00 96.09  ? 372 ASP A OD1 1 
ATOM   2806 O OD2 . ASP A 1 371 ? -17.477 -42.227 1.522   1.00 93.49  ? 372 ASP A OD2 1 
ATOM   2807 N N   . LEU A 1 372 ? -12.167 -42.995 1.353   1.00 64.61  ? 373 LEU A N   1 
ATOM   2808 C CA  . LEU A 1 372 ? -10.910 -43.487 0.804   1.00 73.39  ? 373 LEU A CA  1 
ATOM   2809 C C   . LEU A 1 372 ? -9.958  -43.902 1.944   1.00 70.92  ? 373 LEU A C   1 
ATOM   2810 O O   . LEU A 1 372 ? -9.348  -44.974 1.898   1.00 71.41  ? 373 LEU A O   1 
ATOM   2811 C CB  . LEU A 1 372 ? -10.262 -42.432 -0.102  1.00 62.54  ? 373 LEU A CB  1 
ATOM   2812 C CG  . LEU A 1 372 ? -8.971  -42.874 -0.805  1.00 74.28  ? 373 LEU A CG  1 
ATOM   2813 C CD1 . LEU A 1 372 ? -9.217  -44.065 -1.747  1.00 77.68  ? 373 LEU A CD1 1 
ATOM   2814 C CD2 . LEU A 1 372 ? -8.309  -41.715 -1.545  1.00 72.98  ? 373 LEU A CD2 1 
ATOM   2815 N N   . ALA A 1 373 ? -9.861  -43.076 2.981   1.00 74.13  ? 374 ALA A N   1 
ATOM   2816 C CA  . ALA A 1 373 ? -9.004  -43.389 4.120   1.00 60.65  ? 374 ALA A CA  1 
ATOM   2817 C C   . ALA A 1 373 ? -9.491  -44.653 4.823   1.00 61.82  ? 374 ALA A C   1 
ATOM   2818 O O   . ALA A 1 373 ? -8.690  -45.535 5.156   1.00 57.92  ? 374 ALA A O   1 
ATOM   2819 C CB  . ALA A 1 373 ? -8.954  -42.212 5.087   1.00 66.30  ? 374 ALA A CB  1 
ATOM   2820 N N   . ALA A 1 374 ? -10.805 -44.744 5.019   1.00 51.69  ? 375 ALA A N   1 
ATOM   2821 C CA  . ALA A 1 374 ? -11.395 -45.905 5.656   1.00 50.43  ? 375 ALA A CA  1 
ATOM   2822 C C   . ALA A 1 374 ? -11.184 -47.182 4.852   1.00 71.36  ? 375 ALA A C   1 
ATOM   2823 O O   . ALA A 1 374 ? -10.913 -48.239 5.442   1.00 66.26  ? 375 ALA A O   1 
ATOM   2824 C CB  . ALA A 1 374 ? -12.857 -45.675 5.899   1.00 53.79  ? 375 ALA A CB  1 
ATOM   2825 N N   . GLU A 1 375 ? -11.316 -47.091 3.521   1.00 59.14  ? 376 GLU A N   1 
ATOM   2826 C CA  . GLU A 1 375 ? -11.074 -48.229 2.639   1.00 55.56  ? 376 GLU A CA  1 
ATOM   2827 C C   . GLU A 1 375 ? -9.669  -48.741 2.816   1.00 49.13  ? 376 GLU A C   1 
ATOM   2828 O O   . GLU A 1 375 ? -9.458  -49.936 2.982   1.00 54.20  ? 376 GLU A O   1 
ATOM   2829 C CB  . GLU A 1 375 ? -11.284 -47.860 1.156   1.00 84.52  ? 376 GLU A CB  1 
ATOM   2830 C CG  . GLU A 1 375 ? -12.718 -47.533 0.732   1.00 87.19  ? 376 GLU A CG  1 
ATOM   2831 C CD  . GLU A 1 375 ? -13.570 -48.762 0.446   1.00 93.38  ? 376 GLU A CD  1 
ATOM   2832 O OE1 . GLU A 1 375 ? -13.462 -49.776 1.171   1.00 95.25  ? 376 GLU A OE1 1 
ATOM   2833 O OE2 . GLU A 1 375 ? -14.363 -48.704 -0.517  1.00 118.82 ? 376 GLU A OE2 1 
ATOM   2834 N N   . ALA A 1 376 ? -8.706  -47.830 2.749   1.00 47.13  ? 377 ALA A N   1 
ATOM   2835 C CA  . ALA A 1 376 ? -7.320  -48.177 3.042   1.00 56.26  ? 377 ALA A CA  1 
ATOM   2836 C C   . ALA A 1 376 ? -7.161  -48.912 4.391   1.00 55.16  ? 377 ALA A C   1 
ATOM   2837 O O   . ALA A 1 376 ? -6.324  -49.824 4.517   1.00 58.32  ? 377 ALA A O   1 
ATOM   2838 C CB  . ALA A 1 376 ? -6.452  -46.932 3.017   1.00 50.29  ? 377 ALA A CB  1 
ATOM   2839 N N   . VAL A 1 377 ? -7.952  -48.532 5.398   1.00 51.68  ? 378 VAL A N   1 
ATOM   2840 C CA  . VAL A 1 377 ? -7.822  -49.193 6.691   1.00 42.92  ? 378 VAL A CA  1 
ATOM   2841 C C   . VAL A 1 377 ? -8.289  -50.626 6.567   1.00 45.73  ? 378 VAL A C   1 
ATOM   2842 O O   . VAL A 1 377 ? -7.606  -51.564 7.003   1.00 45.52  ? 378 VAL A O   1 
ATOM   2843 C CB  . VAL A 1 377 ? -8.622  -48.484 7.810   1.00 45.81  ? 378 VAL A CB  1 
ATOM   2844 C CG1 . VAL A 1 377 ? -8.617  -49.337 9.069   1.00 35.83  ? 378 VAL A CG1 1 
ATOM   2845 C CG2 . VAL A 1 377 ? -8.057  -47.090 8.077   1.00 38.97  ? 378 VAL A CG2 1 
ATOM   2846 N N   . VAL A 1 378 ? -9.458  -50.793 5.962   1.00 46.77  ? 379 VAL A N   1 
ATOM   2847 C CA  . VAL A 1 378 ? -10.005 -52.130 5.746   1.00 54.62  ? 379 VAL A CA  1 
ATOM   2848 C C   . VAL A 1 378 ? -9.093  -53.014 4.887   1.00 59.48  ? 379 VAL A C   1 
ATOM   2849 O O   . VAL A 1 378 ? -8.965  -54.213 5.137   1.00 64.52  ? 379 VAL A O   1 
ATOM   2850 C CB  . VAL A 1 378 ? -11.383 -52.045 5.100   1.00 64.20  ? 379 VAL A CB  1 
ATOM   2851 C CG1 . VAL A 1 378 ? -11.798 -53.392 4.564   1.00 72.76  ? 379 VAL A CG1 1 
ATOM   2852 C CG2 . VAL A 1 378 ? -12.383 -51.563 6.113   1.00 51.97  ? 379 VAL A CG2 1 
ATOM   2853 N N   . LEU A 1 379 ? -8.449  -52.419 3.887   1.00 52.63  ? 380 LEU A N   1 
ATOM   2854 C CA  . LEU A 1 379 ? -7.478  -53.149 3.072   1.00 60.77  ? 380 LEU A CA  1 
ATOM   2855 C C   . LEU A 1 379 ? -6.352  -53.672 3.921   1.00 54.83  ? 380 LEU A C   1 
ATOM   2856 O O   . LEU A 1 379 ? -6.045  -54.863 3.886   1.00 54.35  ? 380 LEU A O   1 
ATOM   2857 C CB  . LEU A 1 379 ? -6.878  -52.267 1.949   1.00 68.11  ? 380 LEU A CB  1 
ATOM   2858 C CG  . LEU A 1 379 ? -5.437  -52.555 1.429   1.00 65.67  ? 380 LEU A CG  1 
ATOM   2859 C CD1 . LEU A 1 379 ? -5.315  -53.845 0.573   1.00 56.66  ? 380 LEU A CD1 1 
ATOM   2860 C CD2 . LEU A 1 379 ? -4.826  -51.348 0.684   1.00 64.86  ? 380 LEU A CD2 1 
ATOM   2861 N N   A HIS A 1 380 ? -5.721  -52.767 4.667   0.53 50.36  ? 381 HIS A N   1 
ATOM   2862 N N   B HIS A 1 380 ? -5.710  -52.788 4.674   0.47 49.78  ? 381 HIS A N   1 
ATOM   2863 C CA  A HIS A 1 380 ? -4.519  -53.093 5.412   0.53 51.23  ? 381 HIS A CA  1 
ATOM   2864 C CA  B HIS A 1 380 ? -4.493  -53.186 5.350   0.47 51.24  ? 381 HIS A CA  1 
ATOM   2865 C C   A HIS A 1 380 ? -4.786  -54.208 6.427   0.53 50.11  ? 381 HIS A C   1 
ATOM   2866 C C   B HIS A 1 380 ? -4.750  -54.166 6.500   0.47 50.17  ? 381 HIS A C   1 
ATOM   2867 O O   A HIS A 1 380 ? -3.944  -55.087 6.635   0.53 55.49  ? 381 HIS A O   1 
ATOM   2868 O O   B HIS A 1 380 ? -3.846  -54.911 6.891   0.47 55.90  ? 381 HIS A O   1 
ATOM   2869 C CB  A HIS A 1 380 ? -3.974  -51.840 6.117   0.53 51.91  ? 381 HIS A CB  1 
ATOM   2870 C CB  B HIS A 1 380 ? -3.743  -51.952 5.854   0.47 52.49  ? 381 HIS A CB  1 
ATOM   2871 C CG  A HIS A 1 380 ? -2.616  -52.024 6.723   0.53 45.22  ? 381 HIS A CG  1 
ATOM   2872 C CG  B HIS A 1 380 ? -2.696  -51.457 4.907   0.47 51.43  ? 381 HIS A CG  1 
ATOM   2873 N ND1 A HIS A 1 380 ? -1.458  -51.624 6.093   0.53 50.28  ? 381 HIS A ND1 1 
ATOM   2874 N ND1 B HIS A 1 380 ? -2.983  -50.626 3.845   0.47 54.51  ? 381 HIS A ND1 1 
ATOM   2875 C CD2 A HIS A 1 380 ? -2.229  -52.573 7.901   0.53 60.56  ? 381 HIS A CD2 1 
ATOM   2876 C CD2 B HIS A 1 380 ? -1.360  -51.678 4.859   0.47 48.65  ? 381 HIS A CD2 1 
ATOM   2877 C CE1 A HIS A 1 380 ? -0.417  -51.916 6.855   0.53 49.20  ? 381 HIS A CE1 1 
ATOM   2878 C CE1 B HIS A 1 380 ? -1.870  -50.353 3.188   0.47 55.76  ? 381 HIS A CE1 1 
ATOM   2879 N NE2 A HIS A 1 380 ? -0.857  -52.497 7.957   0.53 55.59  ? 381 HIS A NE2 1 
ATOM   2880 N NE2 B HIS A 1 380 ? -0.870  -50.978 3.784   0.47 56.34  ? 381 HIS A NE2 1 
ATOM   2881 N N   . TYR A 1 381 ? -5.969  -54.187 7.036   1.00 45.31  ? 382 TYR A N   1 
ATOM   2882 C CA  . TYR A 1 381 ? -6.255  -55.038 8.211   1.00 49.02  ? 382 TYR A CA  1 
ATOM   2883 C C   . TYR A 1 381 ? -7.113  -56.252 7.914   1.00 48.50  ? 382 TYR A C   1 
ATOM   2884 O O   . TYR A 1 381 ? -7.469  -57.010 8.806   1.00 48.00  ? 382 TYR A O   1 
ATOM   2885 C CB  . TYR A 1 381 ? -6.926  -54.225 9.302   1.00 38.07  ? 382 TYR A CB  1 
ATOM   2886 C CG  . TYR A 1 381 ? -5.993  -53.302 10.047  1.00 47.84  ? 382 TYR A CG  1 
ATOM   2887 C CD1 . TYR A 1 381 ? -5.685  -52.040 9.551   1.00 39.10  ? 382 TYR A CD1 1 
ATOM   2888 C CD2 . TYR A 1 381 ? -5.448  -53.684 11.271  1.00 43.80  ? 382 TYR A CD2 1 
ATOM   2889 C CE1 . TYR A 1 381 ? -4.834  -51.193 10.232  1.00 44.11  ? 382 TYR A CE1 1 
ATOM   2890 C CE2 . TYR A 1 381 ? -4.605  -52.844 11.971  1.00 44.84  ? 382 TYR A CE2 1 
ATOM   2891 C CZ  . TYR A 1 381 ? -4.306  -51.605 11.462  1.00 47.53  ? 382 TYR A CZ  1 
ATOM   2892 O OH  . TYR A 1 381 ? -3.460  -50.791 12.179  1.00 38.73  ? 382 TYR A OH  1 
ATOM   2893 N N   . THR A 1 382 ? -7.454  -56.440 6.653   1.00 50.32  ? 383 THR A N   1 
ATOM   2894 C CA  . THR A 1 382 ? -8.112  -57.666 6.259   1.00 40.88  ? 383 THR A CA  1 
ATOM   2895 C C   . THR A 1 382 ? -7.072  -58.733 5.925   1.00 44.77  ? 383 THR A C   1 
ATOM   2896 O O   . THR A 1 382 ? -6.098  -58.452 5.230   1.00 50.35  ? 383 THR A O   1 
ATOM   2897 C CB  . THR A 1 382 ? -9.027  -57.405 5.072   1.00 59.73  ? 383 THR A CB  1 
ATOM   2898 O OG1 . THR A 1 382 ? -10.033 -56.470 5.486   1.00 49.62  ? 383 THR A OG1 1 
ATOM   2899 C CG2 . THR A 1 382 ? -9.669  -58.700 4.569   1.00 50.70  ? 383 THR A CG2 1 
ATOM   2900 N N   . ASP A 1 383 ? -7.250  -59.937 6.462   1.00 41.15  ? 384 ASP A N   1 
ATOM   2901 C CA  . ASP A 1 383 ? -6.542  -61.104 5.948   1.00 51.64  ? 384 ASP A CA  1 
ATOM   2902 C C   . ASP A 1 383 ? -7.342  -61.625 4.742   1.00 51.25  ? 384 ASP A C   1 
ATOM   2903 O O   . ASP A 1 383 ? -8.402  -62.224 4.898   1.00 44.61  ? 384 ASP A O   1 
ATOM   2904 C CB  . ASP A 1 383 ? -6.394  -62.192 7.013   1.00 44.09  ? 384 ASP A CB  1 
ATOM   2905 C CG  . ASP A 1 383 ? -5.650  -63.424 6.499   1.00 61.67  ? 384 ASP A CG  1 
ATOM   2906 O OD1 . ASP A 1 383 ? -5.632  -63.672 5.265   1.00 59.79  ? 384 ASP A OD1 1 
ATOM   2907 O OD2 . ASP A 1 383 ? -5.076  -64.159 7.329   1.00 57.32  ? 384 ASP A OD2 1 
ATOM   2908 N N   . TRP A 1 384 ? -6.838  -61.419 3.538   1.00 49.95  ? 385 TRP A N   1 
ATOM   2909 C CA  . TRP A 1 384 ? -7.653  -61.713 2.366   1.00 47.00  ? 385 TRP A CA  1 
ATOM   2910 C C   . TRP A 1 384 ? -7.761  -63.210 2.045   1.00 50.00  ? 385 TRP A C   1 
ATOM   2911 O O   . TRP A 1 384 ? -8.447  -63.601 1.099   1.00 58.40  ? 385 TRP A O   1 
ATOM   2912 C CB  . TRP A 1 384 ? -7.121  -60.919 1.188   1.00 50.78  ? 385 TRP A CB  1 
ATOM   2913 C CG  . TRP A 1 384 ? -7.362  -59.451 1.410   1.00 43.52  ? 385 TRP A CG  1 
ATOM   2914 C CD1 . TRP A 1 384 ? -6.455  -58.522 1.834   1.00 50.21  ? 385 TRP A CD1 1 
ATOM   2915 C CD2 . TRP A 1 384 ? -8.613  -58.758 1.275   1.00 41.63  ? 385 TRP A CD2 1 
ATOM   2916 N NE1 . TRP A 1 384 ? -7.058  -57.284 1.943   1.00 43.46  ? 385 TRP A NE1 1 
ATOM   2917 C CE2 . TRP A 1 384 ? -8.381  -57.403 1.610   1.00 42.50  ? 385 TRP A CE2 1 
ATOM   2918 C CE3 . TRP A 1 384 ? -9.901  -59.149 0.898   1.00 45.32  ? 385 TRP A CE3 1 
ATOM   2919 C CZ2 . TRP A 1 384 ? -9.385  -56.437 1.569   1.00 45.59  ? 385 TRP A CZ2 1 
ATOM   2920 C CZ3 . TRP A 1 384 ? -10.898 -58.188 0.850   1.00 45.73  ? 385 TRP A CZ3 1 
ATOM   2921 C CH2 . TRP A 1 384 ? -10.634 -56.845 1.191   1.00 55.02  ? 385 TRP A CH2 1 
ATOM   2922 N N   . LEU A 1 385 ? -7.117  -64.039 2.862   1.00 53.00  ? 386 LEU A N   1 
ATOM   2923 C CA  . LEU A 1 385 ? -7.346  -65.482 2.854   1.00 48.77  ? 386 LEU A CA  1 
ATOM   2924 C C   . LEU A 1 385 ? -8.463  -65.899 3.817   1.00 63.95  ? 386 LEU A C   1 
ATOM   2925 O O   . LEU A 1 385 ? -8.997  -67.006 3.715   1.00 59.35  ? 386 LEU A O   1 
ATOM   2926 C CB  . LEU A 1 385 ? -6.068  -66.229 3.215   1.00 56.56  ? 386 LEU A CB  1 
ATOM   2927 C CG  . LEU A 1 385 ? -4.942  -66.178 2.182   1.00 66.45  ? 386 LEU A CG  1 
ATOM   2928 C CD1 . LEU A 1 385 ? -3.757  -66.945 2.713   1.00 61.11  ? 386 LEU A CD1 1 
ATOM   2929 C CD2 . LEU A 1 385 ? -5.400  -66.735 0.845   1.00 51.58  ? 386 LEU A CD2 1 
ATOM   2930 N N   . HIS A 1 386 ? -8.785  -65.016 4.765   1.00 62.37  ? 387 HIS A N   1 
ATOM   2931 C CA  . HIS A 1 386 ? -9.862  -65.236 5.739   1.00 62.19  ? 387 HIS A CA  1 
ATOM   2932 C C   . HIS A 1 386 ? -10.604 -63.939 6.004   1.00 52.21  ? 387 HIS A C   1 
ATOM   2933 O O   . HIS A 1 386 ? -10.577 -63.419 7.110   1.00 61.51  ? 387 HIS A O   1 
ATOM   2934 C CB  . HIS A 1 386 ? -9.321  -65.777 7.059   1.00 46.83  ? 387 HIS A CB  1 
ATOM   2935 C CG  . HIS A 1 386 ? -8.389  -66.929 6.905   1.00 54.74  ? 387 HIS A CG  1 
ATOM   2936 N ND1 . HIS A 1 386 ? -8.828  -68.233 6.839   1.00 63.58  ? 387 HIS A ND1 1 
ATOM   2937 C CD2 . HIS A 1 386 ? -7.039  -66.979 6.812   1.00 57.26  ? 387 HIS A CD2 1 
ATOM   2938 C CE1 . HIS A 1 386 ? -7.787  -69.038 6.702   1.00 58.89  ? 387 HIS A CE1 1 
ATOM   2939 N NE2 . HIS A 1 386 ? -6.690  -68.302 6.685   1.00 64.36  ? 387 HIS A NE2 1 
ATOM   2940 N N   . PRO A 1 387 ? -11.268 -63.404 4.981   1.00 53.85  ? 388 PRO A N   1 
ATOM   2941 C CA  . PRO A 1 387 ? -11.827 -62.050 5.079   1.00 44.67  ? 388 PRO A CA  1 
ATOM   2942 C C   . PRO A 1 387 ? -13.016 -61.958 6.018   1.00 54.16  ? 388 PRO A C   1 
ATOM   2943 O O   . PRO A 1 387 ? -13.433 -60.839 6.358   1.00 55.70  ? 388 PRO A O   1 
ATOM   2944 C CB  . PRO A 1 387 ? -12.259 -61.742 3.642   1.00 48.01  ? 388 PRO A CB  1 
ATOM   2945 C CG  . PRO A 1 387 ? -12.503 -63.084 3.022   1.00 45.92  ? 388 PRO A CG  1 
ATOM   2946 C CD  . PRO A 1 387 ? -11.586 -64.068 3.707   1.00 53.03  ? 388 PRO A CD  1 
ATOM   2947 N N   . GLU A 1 388 ? -13.544 -63.108 6.436   1.00 51.70  ? 389 GLU A N   1 
ATOM   2948 C CA  . GLU A 1 388 ? -14.821 -63.147 7.154   1.00 53.44  ? 389 GLU A CA  1 
ATOM   2949 C C   . GLU A 1 388 ? -14.781 -63.947 8.452   1.00 49.33  ? 389 GLU A C   1 
ATOM   2950 O O   . GLU A 1 388 ? -15.816 -64.195 9.053   1.00 59.16  ? 389 GLU A O   1 
ATOM   2951 C CB  . GLU A 1 388 ? -15.904 -63.716 6.237   1.00 55.89  ? 389 GLU A CB  1 
ATOM   2952 C CG  . GLU A 1 388 ? -16.045 -62.951 4.923   1.00 64.75  ? 389 GLU A CG  1 
ATOM   2953 C CD  . GLU A 1 388 ? -17.479 -62.752 4.510   1.00 74.08  ? 389 GLU A CD  1 
ATOM   2954 O OE1 . GLU A 1 388 ? -18.149 -61.876 5.093   1.00 94.52  ? 389 GLU A OE1 1 
ATOM   2955 O OE2 . GLU A 1 388 ? -17.939 -63.471 3.599   1.00 102.89 ? 389 GLU A OE2 1 
ATOM   2956 N N   . ASP A 1 389 ? -13.596 -64.364 8.872   1.00 45.16  ? 390 ASP A N   1 
ATOM   2957 C CA  . ASP A 1 389 ? -13.471 -65.100 10.116  1.00 63.23  ? 390 ASP A CA  1 
ATOM   2958 C C   . ASP A 1 389 ? -13.744 -64.167 11.307  1.00 64.97  ? 390 ASP A C   1 
ATOM   2959 O O   . ASP A 1 389 ? -13.008 -63.209 11.530  1.00 55.53  ? 390 ASP A O   1 
ATOM   2960 C CB  . ASP A 1 389 ? -12.084 -65.734 10.227  1.00 59.62  ? 390 ASP A CB  1 
ATOM   2961 C CG  . ASP A 1 389 ? -11.916 -66.524 11.500  1.00 64.51  ? 390 ASP A CG  1 
ATOM   2962 O OD1 . ASP A 1 389 ? -12.917 -67.115 11.956  1.00 88.31  ? 390 ASP A OD1 1 
ATOM   2963 O OD2 . ASP A 1 389 ? -10.797 -66.555 12.048  1.00 72.48  ? 390 ASP A OD2 1 
ATOM   2964 N N   . PRO A 1 390 ? -14.820 -64.440 12.061  1.00 73.15  ? 391 PRO A N   1 
ATOM   2965 C CA  . PRO A 1 390 ? -15.280 -63.549 13.139  1.00 65.25  ? 391 PRO A CA  1 
ATOM   2966 C C   . PRO A 1 390 ? -14.208 -63.262 14.181  1.00 51.40  ? 391 PRO A C   1 
ATOM   2967 O O   . PRO A 1 390 ? -14.000 -62.093 14.499  1.00 59.43  ? 391 PRO A O   1 
ATOM   2968 C CB  . PRO A 1 390 ? -16.447 -64.317 13.752  1.00 59.63  ? 391 PRO A CB  1 
ATOM   2969 C CG  . PRO A 1 390 ? -16.958 -65.153 12.587  1.00 75.23  ? 391 PRO A CG  1 
ATOM   2970 C CD  . PRO A 1 390 ? -15.717 -65.596 11.888  1.00 62.47  ? 391 PRO A CD  1 
ATOM   2971 N N   . ALA A 1 391 ? -13.525 -64.291 14.669  1.00 47.03  ? 392 ALA A N   1 
ATOM   2972 C CA  . ALA A 1 391 ? -12.443 -64.098 15.630  1.00 59.11  ? 392 ALA A CA  1 
ATOM   2973 C C   . ALA A 1 391 ? -11.359 -63.169 15.078  1.00 59.54  ? 392 ALA A C   1 
ATOM   2974 O O   . ALA A 1 391 ? -10.951 -62.212 15.751  1.00 56.95  ? 392 ALA A O   1 
ATOM   2975 C CB  . ALA A 1 391 ? -11.836 -65.439 16.041  1.00 47.81  ? 392 ALA A CB  1 
ATOM   2976 N N   . ARG A 1 392 ? -10.899 -63.440 13.858  1.00 50.51  ? 393 ARG A N   1 
ATOM   2977 C CA  . ARG A 1 392 ? -9.868  -62.606 13.245  1.00 48.87  ? 393 ARG A CA  1 
ATOM   2978 C C   . ARG A 1 392 ? -10.356 -61.174 13.067  1.00 50.52  ? 393 ARG A C   1 
ATOM   2979 O O   . ARG A 1 392 ? -9.564  -60.233 13.168  1.00 52.15  ? 393 ARG A O   1 
ATOM   2980 C CB  . ARG A 1 392 ? -9.429  -63.174 11.905  1.00 52.55  ? 393 ARG A CB  1 
ATOM   2981 C CG  . ARG A 1 392 ? -8.384  -64.281 11.973  1.00 54.81  ? 393 ARG A CG  1 
ATOM   2982 C CD  . ARG A 1 392 ? -8.075  -64.754 10.526  1.00 67.76  ? 393 ARG A CD  1 
ATOM   2983 N NE  . ARG A 1 392 ? -6.983  -65.731 10.440  1.00 57.62  ? 393 ARG A NE  1 
ATOM   2984 C CZ  . ARG A 1 392 ? -7.163  -67.047 10.372  1.00 55.78  ? 393 ARG A CZ  1 
ATOM   2985 N NH1 . ARG A 1 392 ? -8.389  -67.566 10.388  1.00 66.27  ? 393 ARG A NH1 1 
ATOM   2986 N NH2 . ARG A 1 392 ? -6.117  -67.846 10.299  1.00 57.42  ? 393 ARG A NH2 1 
ATOM   2987 N N   . LEU A 1 393 ? -11.650 -61.005 12.812  1.00 41.36  ? 394 LEU A N   1 
ATOM   2988 C CA  . LEU A 1 393 ? -12.212 -59.668 12.637  1.00 44.32  ? 394 LEU A CA  1 
ATOM   2989 C C   . LEU A 1 393 ? -12.226 -58.897 13.966  1.00 49.27  ? 394 LEU A C   1 
ATOM   2990 O O   . LEU A 1 393 ? -11.916 -57.705 14.001  1.00 48.83  ? 394 LEU A O   1 
ATOM   2991 C CB  . LEU A 1 393 ? -13.621 -59.745 12.043  1.00 42.73  ? 394 LEU A CB  1 
ATOM   2992 C CG  . LEU A 1 393 ? -13.670 -60.158 10.557  1.00 55.84  ? 394 LEU A CG  1 
ATOM   2993 C CD1 . LEU A 1 393 ? -15.087 -60.459 10.123  1.00 47.98  ? 394 LEU A CD1 1 
ATOM   2994 C CD2 . LEU A 1 393 ? -13.073 -59.086 9.651   1.00 40.22  ? 394 LEU A CD2 1 
ATOM   2995 N N   . ARG A 1 394 ? -12.603 -59.581 15.043  1.00 46.17  ? 395 ARG A N   1 
ATOM   2996 C CA  . ARG A 1 394 ? -12.543 -59.018 16.381  1.00 51.14  ? 395 ARG A CA  1 
ATOM   2997 C C   . ARG A 1 394 ? -11.130 -58.512 16.664  1.00 48.44  ? 395 ARG A C   1 
ATOM   2998 O O   . ARG A 1 394 ? -10.944 -57.342 16.982  1.00 43.26  ? 395 ARG A O   1 
ATOM   2999 C CB  . ARG A 1 394 ? -12.957 -60.059 17.423  1.00 53.67  ? 395 ARG A CB  1 
ATOM   3000 C CG  . ARG A 1 394 ? -13.058 -59.516 18.854  1.00 43.47  ? 395 ARG A CG  1 
ATOM   3001 C CD  . ARG A 1 394 ? -13.289 -60.647 19.829  1.00 41.90  ? 395 ARG A CD  1 
ATOM   3002 N NE  . ARG A 1 394 ? -12.184 -61.599 19.801  1.00 51.12  ? 395 ARG A NE  1 
ATOM   3003 C CZ  . ARG A 1 394 ? -12.282 -62.880 20.143  1.00 57.74  ? 395 ARG A CZ  1 
ATOM   3004 N NH1 . ARG A 1 394 ? -13.446 -63.379 20.545  1.00 66.12  ? 395 ARG A NH1 1 
ATOM   3005 N NH2 . ARG A 1 394 ? -11.215 -63.669 20.087  1.00 55.47  ? 395 ARG A NH2 1 
ATOM   3006 N N   . GLU A 1 395 ? -10.147 -59.394 16.510  1.00 44.59  ? 396 GLU A N   1 
ATOM   3007 C CA  . GLU A 1 395 ? -8.749  -59.055 16.739  1.00 45.19  ? 396 GLU A CA  1 
ATOM   3008 C C   . GLU A 1 395 ? -8.305  -57.881 15.878  1.00 48.17  ? 396 GLU A C   1 
ATOM   3009 O O   . GLU A 1 395 ? -7.616  -56.987 16.365  1.00 54.76  ? 396 GLU A O   1 
ATOM   3010 C CB  . GLU A 1 395 ? -7.844  -60.270 16.489  1.00 43.65  ? 396 GLU A CB  1 
ATOM   3011 C CG  . GLU A 1 395 ? -7.337  -61.006 17.735  1.00 63.48  ? 396 GLU A CG  1 
ATOM   3012 C CD  . GLU A 1 395 ? -8.451  -61.533 18.654  1.00 78.62  ? 396 GLU A CD  1 
ATOM   3013 O OE1 . GLU A 1 395 ? -8.896  -60.777 19.560  1.00 85.04  ? 396 GLU A OE1 1 
ATOM   3014 O OE2 . GLU A 1 395 ? -8.869  -62.707 18.484  1.00 72.27  ? 396 GLU A OE2 1 
ATOM   3015 N N   . ALA A 1 396 ? -8.713  -57.849 14.612  1.00 48.64  ? 397 ALA A N   1 
ATOM   3016 C CA  . ALA A 1 396 ? -8.212  -56.823 13.710  1.00 39.93  ? 397 ALA A CA  1 
ATOM   3017 C C   . ALA A 1 396 ? -8.825  -55.471 14.032  1.00 39.67  ? 397 ALA A C   1 
ATOM   3018 O O   . ALA A 1 396 ? -8.167  -54.446 13.898  1.00 49.05  ? 397 ALA A O   1 
ATOM   3019 C CB  . ALA A 1 396 ? -8.486  -57.205 12.205  1.00 38.58  ? 397 ALA A CB  1 
ATOM   3020 N N   . LEU A 1 397 ? -10.093 -55.448 14.424  1.00 41.36  ? 398 LEU A N   1 
ATOM   3021 C CA  . LEU A 1 397 ? -10.712 -54.178 14.797  1.00 44.34  ? 398 LEU A CA  1 
ATOM   3022 C C   . LEU A 1 397 ? -10.063 -53.641 16.097  1.00 52.96  ? 398 LEU A C   1 
ATOM   3023 O O   . LEU A 1 397 ? -9.885  -52.435 16.284  1.00 41.02  ? 398 LEU A O   1 
ATOM   3024 C CB  . LEU A 1 397 ? -12.215 -54.328 14.979  1.00 46.54  ? 398 LEU A CB  1 
ATOM   3025 C CG  . LEU A 1 397 ? -12.894 -52.978 15.213  1.00 41.06  ? 398 LEU A CG  1 
ATOM   3026 C CD1 . LEU A 1 397 ? -12.645 -52.071 14.016  1.00 47.59  ? 398 LEU A CD1 1 
ATOM   3027 C CD2 . LEU A 1 397 ? -14.366 -53.116 15.470  1.00 41.01  ? 398 LEU A CD2 1 
ATOM   3028 N N   . SER A 1 398 ? -9.693  -54.549 16.986  1.00 41.44  ? 399 SER A N   1 
ATOM   3029 C CA  . SER A 1 398 ? -8.936  -54.180 18.178  1.00 50.31  ? 399 SER A CA  1 
ATOM   3030 C C   . SER A 1 398 ? -7.601  -53.539 17.749  1.00 51.71  ? 399 SER A C   1 
ATOM   3031 O O   . SER A 1 398 ? -7.283  -52.419 18.159  1.00 48.35  ? 399 SER A O   1 
ATOM   3032 C CB  . SER A 1 398 ? -8.722  -55.408 19.047  1.00 35.95  ? 399 SER A CB  1 
ATOM   3033 O OG  . SER A 1 398 ? -7.969  -55.098 20.190  1.00 56.82  ? 399 SER A OG  1 
ATOM   3034 N N   . ASP A 1 399 ? -6.849  -54.247 16.902  1.00 46.13  ? 400 ASP A N   1 
ATOM   3035 C CA  . ASP A 1 399 ? -5.635  -53.717 16.279  1.00 45.32  ? 400 ASP A CA  1 
ATOM   3036 C C   . ASP A 1 399 ? -5.852  -52.347 15.655  1.00 42.60  ? 400 ASP A C   1 
ATOM   3037 O O   . ASP A 1 399 ? -5.072  -51.446 15.887  1.00 44.52  ? 400 ASP A O   1 
ATOM   3038 C CB  . ASP A 1 399 ? -5.112  -54.664 15.191  1.00 54.40  ? 400 ASP A CB  1 
ATOM   3039 C CG  . ASP A 1 399 ? -4.408  -55.879 15.756  1.00 64.22  ? 400 ASP A CG  1 
ATOM   3040 O OD1 . ASP A 1 399 ? -4.017  -55.847 16.946  1.00 60.73  ? 400 ASP A OD1 1 
ATOM   3041 O OD2 . ASP A 1 399 ? -4.246  -56.868 15.003  1.00 73.95  ? 400 ASP A OD2 1 
ATOM   3042 N N   . VAL A 1 400 ? -6.910  -52.182 14.870  1.00 43.44  ? 401 VAL A N   1 
ATOM   3043 C CA  . VAL A 1 400 ? -7.142  -50.898 14.218  1.00 46.24  ? 401 VAL A CA  1 
ATOM   3044 C C   . VAL A 1 400 ? -7.232  -49.751 15.230  1.00 47.91  ? 401 VAL A C   1 
ATOM   3045 O O   . VAL A 1 400 ? -6.517  -48.753 15.129  1.00 44.79  ? 401 VAL A O   1 
ATOM   3046 C CB  . VAL A 1 400 ? -8.424  -50.926 13.353  1.00 40.87  ? 401 VAL A CB  1 
ATOM   3047 C CG1 . VAL A 1 400 ? -8.850  -49.516 12.975  1.00 34.04  ? 401 VAL A CG1 1 
ATOM   3048 C CG2 . VAL A 1 400 ? -8.173  -51.747 12.100  1.00 41.75  ? 401 VAL A CG2 1 
ATOM   3049 N N   . VAL A 1 401 ? -8.102  -49.916 16.215  1.00 48.56  ? 402 VAL A N   1 
ATOM   3050 C CA  . VAL A 1 401 ? -8.362  -48.876 17.189  1.00 47.40  ? 402 VAL A CA  1 
ATOM   3051 C C   . VAL A 1 401 ? -7.125  -48.575 18.054  1.00 40.15  ? 402 VAL A C   1 
ATOM   3052 O O   . VAL A 1 401 ? -6.781  -47.404 18.281  1.00 35.38  ? 402 VAL A O   1 
ATOM   3053 C CB  . VAL A 1 401 ? -9.576  -49.273 18.060  1.00 47.36  ? 402 VAL A CB  1 
ATOM   3054 C CG1 . VAL A 1 401 ? -9.738  -48.302 19.194  1.00 40.36  ? 402 VAL A CG1 1 
ATOM   3055 C CG2 . VAL A 1 401 ? -10.835 -49.285 17.184  1.00 42.70  ? 402 VAL A CG2 1 
ATOM   3056 N N   . GLY A 1 402 ? -6.433  -49.623 18.485  1.00 38.49  ? 403 GLY A N   1 
ATOM   3057 C CA  . GLY A 1 402 ? -5.242  -49.465 19.311  1.00 38.51  ? 403 GLY A CA  1 
ATOM   3058 C C   . GLY A 1 402 ? -4.075  -48.841 18.566  1.00 52.25  ? 403 GLY A C   1 
ATOM   3059 O O   . GLY A 1 402 ? -3.347  -47.998 19.116  1.00 43.62  ? 403 GLY A O   1 
ATOM   3060 N N   . ASP A 1 403 ? -3.902  -49.253 17.307  1.00 43.78  ? 404 ASP A N   1 
ATOM   3061 C CA  . ASP A 1 403 ? -2.816  -48.752 16.470  1.00 37.93  ? 404 ASP A CA  1 
ATOM   3062 C C   . ASP A 1 403 ? -2.996  -47.280 16.224  1.00 40.27  ? 404 ASP A C   1 
ATOM   3063 O O   . ASP A 1 403 ? -2.110  -46.470 16.517  1.00 44.06  ? 404 ASP A O   1 
ATOM   3064 C CB  . ASP A 1 403 ? -2.752  -49.510 15.133  1.00 40.24  ? 404 ASP A CB  1 
ATOM   3065 C CG  . ASP A 1 403 ? -2.250  -50.938 15.295  1.00 39.12  ? 404 ASP A CG  1 
ATOM   3066 O OD1 . ASP A 1 403 ? -1.781  -51.301 16.398  1.00 50.30  ? 404 ASP A OD1 1 
ATOM   3067 O OD2 . ASP A 1 403 ? -2.340  -51.704 14.319  1.00 50.98  ? 404 ASP A OD2 1 
ATOM   3068 N N   . HIS A 1 404 ? -4.168  -46.941 15.707  1.00 40.25  ? 405 HIS A N   1 
ATOM   3069 C CA  . HIS A 1 404 ? -4.506  -45.563 15.375  1.00 45.02  ? 405 HIS A CA  1 
ATOM   3070 C C   . HIS A 1 404 ? -4.430  -44.621 16.575  1.00 44.73  ? 405 HIS A C   1 
ATOM   3071 O O   . HIS A 1 404 ? -3.912  -43.507 16.481  1.00 45.15  ? 405 HIS A O   1 
ATOM   3072 C CB  . HIS A 1 404 ? -5.913  -45.509 14.779  1.00 40.99  ? 405 HIS A CB  1 
ATOM   3073 C CG  . HIS A 1 404 ? -6.396  -44.125 14.471  1.00 37.50  ? 405 HIS A CG  1 
ATOM   3074 N ND1 . HIS A 1 404 ? -5.667  -43.232 13.718  1.00 45.17  ? 405 HIS A ND1 1 
ATOM   3075 C CD2 . HIS A 1 404 ? -7.548  -43.488 14.796  1.00 43.17  ? 405 HIS A CD2 1 
ATOM   3076 C CE1 . HIS A 1 404 ? -6.344  -42.103 13.594  1.00 40.50  ? 405 HIS A CE1 1 
ATOM   3077 N NE2 . HIS A 1 404 ? -7.492  -42.234 14.235  1.00 45.09  ? 405 HIS A NE2 1 
ATOM   3078 N N   . ASN A 1 405 ? -4.963  -45.064 17.704  1.00 43.08  ? 406 ASN A N   1 
ATOM   3079 C CA  . ASN A 1 405 ? -5.133  -44.156 18.821  1.00 39.06  ? 406 ASN A CA  1 
ATOM   3080 C C   . ASN A 1 405 ? -3.968  -44.149 19.814  1.00 42.09  ? 406 ASN A C   1 
ATOM   3081 O O   . ASN A 1 405 ? -3.707  -43.122 20.433  1.00 41.89  ? 406 ASN A O   1 
ATOM   3082 C CB  . ASN A 1 405 ? -6.446  -44.479 19.547  1.00 37.67  ? 406 ASN A CB  1 
ATOM   3083 C CG  . ASN A 1 405 ? -7.648  -44.079 18.741  1.00 41.97  ? 406 ASN A CG  1 
ATOM   3084 O OD1 . ASN A 1 405 ? -7.901  -42.890 18.548  1.00 44.55  ? 406 ASN A OD1 1 
ATOM   3085 N ND2 . ASN A 1 405 ? -8.371  -45.070 18.212  1.00 41.77  ? 406 ASN A ND2 1 
ATOM   3086 N N   . VAL A 1 406 ? -3.270  -45.272 19.964  1.00 37.12  ? 407 VAL A N   1 
ATOM   3087 C CA  . VAL A 1 406 ? -2.205  -45.348 20.978  1.00 39.44  ? 407 VAL A CA  1 
ATOM   3088 C C   . VAL A 1 406 ? -0.834  -45.774 20.459  1.00 36.88  ? 407 VAL A C   1 
ATOM   3089 O O   . VAL A 1 406 ? 0.124   -45.005 20.540  1.00 40.07  ? 407 VAL A O   1 
ATOM   3090 C CB  . VAL A 1 406 ? -2.590  -46.306 22.109  1.00 34.71  ? 407 VAL A CB  1 
ATOM   3091 C CG1 . VAL A 1 406 ? -1.535  -46.263 23.241  1.00 35.65  ? 407 VAL A CG1 1 
ATOM   3092 C CG2 . VAL A 1 406 ? -3.940  -45.924 22.649  1.00 35.44  ? 407 VAL A CG2 1 
ATOM   3093 N N   . VAL A 1 407 ? -0.745  -46.993 19.926  1.00 38.08  ? 408 VAL A N   1 
ATOM   3094 C CA  . VAL A 1 407 ? 0.548   -47.577 19.552  1.00 34.62  ? 408 VAL A CA  1 
ATOM   3095 C C   . VAL A 1 407 ? 1.323   -46.791 18.497  1.00 48.16  ? 408 VAL A C   1 
ATOM   3096 O O   . VAL A 1 407 ? 2.536   -46.624 18.618  1.00 44.70  ? 408 VAL A O   1 
ATOM   3097 C CB  . VAL A 1 407 ? 0.385   -49.023 19.040  1.00 41.65  ? 408 VAL A CB  1 
ATOM   3098 C CG1 . VAL A 1 407 ? 1.737   -49.610 18.693  1.00 39.87  ? 408 VAL A CG1 1 
ATOM   3099 C CG2 . VAL A 1 407 ? -0.279  -49.885 20.093  1.00 34.12  ? 408 VAL A CG2 1 
ATOM   3100 N N   . CYS A 1 408 ? 0.652   -46.282 17.470  1.00 34.15  ? 409 CYS A N   1 
ATOM   3101 C CA  . CYS A 1 408 ? 1.406   -45.608 16.420  1.00 42.72  ? 409 CYS A CA  1 
ATOM   3102 C C   . CYS A 1 408 ? 1.685   -44.164 16.788  1.00 38.45  ? 409 CYS A C   1 
ATOM   3103 O O   . CYS A 1 408 ? 2.730   -43.635 16.416  1.00 39.86  ? 409 CYS A O   1 
ATOM   3104 C CB  . CYS A 1 408 ? 0.685   -45.718 15.062  1.00 41.56  ? 409 CYS A CB  1 
ATOM   3105 S SG  . CYS A 1 408 ? 0.574   -47.437 14.521  1.00 42.65  ? 409 CYS A SG  1 
ATOM   3106 N N   . PRO A 1 409 ? 0.763   -43.502 17.515  1.00 39.34  ? 410 PRO A N   1 
ATOM   3107 C CA  . PRO A 1 409 ? 1.273   -42.210 17.981  1.00 43.31  ? 410 PRO A CA  1 
ATOM   3108 C C   . PRO A 1 409 ? 2.485   -42.369 18.927  1.00 45.63  ? 410 PRO A C   1 
ATOM   3109 O O   . PRO A 1 409 ? 3.414   -41.577 18.807  1.00 41.37  ? 410 PRO A O   1 
ATOM   3110 C CB  . PRO A 1 409 ? 0.068   -41.601 18.700  1.00 43.12  ? 410 PRO A CB  1 
ATOM   3111 C CG  . PRO A 1 409 ? -1.089  -42.162 17.984  1.00 36.87  ? 410 PRO A CG  1 
ATOM   3112 C CD  . PRO A 1 409 ? -0.699  -43.593 17.693  1.00 40.06  ? 410 PRO A CD  1 
ATOM   3113 N N   . VAL A 1 410 ? 2.500   -43.384 19.794  1.00 37.83  ? 411 VAL A N   1 
ATOM   3114 C CA  . VAL A 1 410 ? 3.606   -43.542 20.726  1.00 36.02  ? 411 VAL A CA  1 
ATOM   3115 C C   . VAL A 1 410 ? 4.880   -43.923 19.955  1.00 46.40  ? 411 VAL A C   1 
ATOM   3116 O O   . VAL A 1 410 ? 5.958   -43.408 20.232  1.00 46.35  ? 411 VAL A O   1 
ATOM   3117 C CB  . VAL A 1 410 ? 3.294   -44.597 21.826  1.00 34.21  ? 411 VAL A CB  1 
ATOM   3118 C CG1 . VAL A 1 410 ? 4.566   -45.006 22.560  1.00 29.68  ? 411 VAL A CG1 1 
ATOM   3119 C CG2 . VAL A 1 410 ? 2.269   -44.061 22.820  1.00 31.32  ? 411 VAL A CG2 1 
ATOM   3120 N N   . ALA A 1 411 ? 4.744   -44.807 18.974  1.00 45.37  ? 412 ALA A N   1 
ATOM   3121 C CA  . ALA A 1 411 ? 5.873   -45.194 18.124  1.00 44.92  ? 412 ALA A CA  1 
ATOM   3122 C C   . ALA A 1 411 ? 6.495   -44.007 17.391  1.00 37.35  ? 412 ALA A C   1 
ATOM   3123 O O   . ALA A 1 411 ? 7.708   -43.859 17.336  1.00 45.20  ? 412 ALA A O   1 
ATOM   3124 C CB  . ALA A 1 411 ? 5.432   -46.244 17.113  1.00 42.49  ? 412 ALA A CB  1 
ATOM   3125 N N   . GLN A 1 412 ? 5.658   -43.175 16.798  1.00 42.13  ? 413 GLN A N   1 
ATOM   3126 C CA  . GLN A 1 412 ? 6.146   -41.992 16.132  1.00 39.06  ? 413 GLN A CA  1 
ATOM   3127 C C   . GLN A 1 412 ? 6.893   -41.067 17.076  1.00 44.00  ? 413 GLN A C   1 
ATOM   3128 O O   . GLN A 1 412 ? 7.918   -40.497 16.709  1.00 46.77  ? 413 GLN A O   1 
ATOM   3129 C CB  . GLN A 1 412 ? 4.994   -41.222 15.486  1.00 45.45  ? 413 GLN A CB  1 
ATOM   3130 C CG  . GLN A 1 412 ? 5.459   -40.070 14.611  1.00 45.86  ? 413 GLN A CG  1 
ATOM   3131 C CD  . GLN A 1 412 ? 4.296   -39.353 13.984  1.00 76.20  ? 413 GLN A CD  1 
ATOM   3132 O OE1 . GLN A 1 412 ? 3.590   -38.598 14.657  1.00 85.75  ? 413 GLN A OE1 1 
ATOM   3133 N NE2 . GLN A 1 412 ? 4.058   -39.608 12.704  1.00 73.59  ? 413 GLN A NE2 1 
ATOM   3134 N N   . LEU A 1 413 ? 6.356   -40.884 18.281  1.00 50.80  ? 414 LEU A N   1 
ATOM   3135 C CA  . LEU A 1 413 ? 6.990   -40.002 19.254  1.00 39.78  ? 414 LEU A CA  1 
ATOM   3136 C C   . LEU A 1 413 ? 8.352   -40.558 19.657  1.00 40.36  ? 414 LEU A C   1 
ATOM   3137 O O   . LEU A 1 413 ? 9.337   -39.825 19.716  1.00 49.23  ? 414 LEU A O   1 
ATOM   3138 C CB  . LEU A 1 413 ? 6.115   -39.829 20.494  1.00 45.76  ? 414 LEU A CB  1 
ATOM   3139 C CG  . LEU A 1 413 ? 6.782   -39.086 21.668  1.00 41.73  ? 414 LEU A CG  1 
ATOM   3140 C CD1 . LEU A 1 413 ? 7.039   -37.674 21.285  1.00 48.69  ? 414 LEU A CD1 1 
ATOM   3141 C CD2 . LEU A 1 413 ? 5.850   -39.082 22.786  1.00 41.49  ? 414 LEU A CD2 1 
ATOM   3142 N N   . ALA A 1 414 ? 8.394   -41.856 19.931  1.00 35.06  ? 415 ALA A N   1 
ATOM   3143 C CA  . ALA A 1 414 ? 9.633   -42.523 20.297  1.00 36.48  ? 415 ALA A CA  1 
ATOM   3144 C C   . ALA A 1 414 ? 10.705  -42.371 19.210  1.00 48.54  ? 415 ALA A C   1 
ATOM   3145 O O   . ALA A 1 414 ? 11.840  -41.993 19.501  1.00 50.60  ? 415 ALA A O   1 
ATOM   3146 C CB  . ALA A 1 414 ? 9.374   -43.983 20.579  1.00 36.44  ? 415 ALA A CB  1 
ATOM   3147 N N   . GLY A 1 415 ? 10.338  -42.646 17.960  1.00 50.05  ? 416 GLY A N   1 
ATOM   3148 C CA  . GLY A 1 415 ? 11.273  -42.568 16.849  1.00 39.47  ? 416 GLY A CA  1 
ATOM   3149 C C   . GLY A 1 415 ? 11.852  -41.184 16.646  1.00 36.53  ? 416 GLY A C   1 
ATOM   3150 O O   . GLY A 1 415 ? 13.063  -41.023 16.551  1.00 49.53  ? 416 GLY A O   1 
ATOM   3151 N N   . ARG A 1 416 ? 10.981  -40.184 16.588  1.00 42.68  ? 417 ARG A N   1 
ATOM   3152 C CA  . ARG A 1 416 ? 11.402  -38.808 16.412  1.00 36.32  ? 417 ARG A CA  1 
ATOM   3153 C C   . ARG A 1 416 ? 12.270  -38.314 17.564  1.00 50.91  ? 417 ARG A C   1 
ATOM   3154 O O   . ARG A 1 416 ? 13.286  -37.661 17.328  1.00 50.90  ? 417 ARG A O   1 
ATOM   3155 C CB  . ARG A 1 416 ? 10.185  -37.901 16.239  1.00 41.28  ? 417 ARG A CB  1 
ATOM   3156 C CG  . ARG A 1 416 ? 9.592   -37.913 14.832  1.00 60.16  ? 417 ARG A CG  1 
ATOM   3157 C CD  . ARG A 1 416 ? 10.712  -37.947 13.787  1.00 53.76  ? 417 ARG A CD  1 
ATOM   3158 N NE  . ARG A 1 416 ? 10.300  -37.434 12.492  1.00 78.45  ? 417 ARG A NE  1 
ATOM   3159 C CZ  . ARG A 1 416 ? 10.652  -36.248 11.997  1.00 78.16  ? 417 ARG A CZ  1 
ATOM   3160 N NH1 . ARG A 1 416 ? 11.426  -35.422 12.699  1.00 68.14  ? 417 ARG A NH1 1 
ATOM   3161 N NH2 . ARG A 1 416 ? 10.219  -35.885 10.791  1.00 84.45  ? 417 ARG A NH2 1 
ATOM   3162 N N   . LEU A 1 417 ? 11.880  -38.607 18.810  1.00 44.35  ? 418 LEU A N   1 
ATOM   3163 C CA  . LEU A 1 417 ? 12.660  -38.119 19.949  1.00 50.51  ? 418 LEU A CA  1 
ATOM   3164 C C   . LEU A 1 417 ? 14.049  -38.745 19.912  1.00 43.44  ? 418 LEU A C   1 
ATOM   3165 O O   . LEU A 1 417 ? 15.042  -38.052 20.096  1.00 50.55  ? 418 LEU A O   1 
ATOM   3166 C CB  . LEU A 1 417 ? 11.977  -38.425 21.293  1.00 45.67  ? 418 LEU A CB  1 
ATOM   3167 C CG  . LEU A 1 417 ? 10.693  -37.670 21.661  1.00 49.83  ? 418 LEU A CG  1 
ATOM   3168 C CD1 . LEU A 1 417 ? 10.179  -38.120 23.003  1.00 44.19  ? 418 LEU A CD1 1 
ATOM   3169 C CD2 . LEU A 1 417 ? 10.913  -36.197 21.699  1.00 50.98  ? 418 LEU A CD2 1 
ATOM   3170 N N   . ALA A 1 418 ? 14.110  -40.057 19.690  1.00 45.13  ? 419 ALA A N   1 
ATOM   3171 C CA  . ALA A 1 418 ? 15.393  -40.766 19.640  1.00 46.85  ? 419 ALA A CA  1 
ATOM   3172 C C   . ALA A 1 418 ? 16.277  -40.237 18.520  1.00 53.54  ? 419 ALA A C   1 
ATOM   3173 O O   . ALA A 1 418 ? 17.499  -40.148 18.667  1.00 56.59  ? 419 ALA A O   1 
ATOM   3174 C CB  . ALA A 1 418 ? 15.178  -42.261 19.456  1.00 42.21  ? 419 ALA A CB  1 
ATOM   3175 N N   . ALA A 1 419 ? 15.660  -39.886 17.399  1.00 49.87  ? 420 ALA A N   1 
ATOM   3176 C CA  . ALA A 1 419 ? 16.441  -39.443 16.246  1.00 53.91  ? 420 ALA A CA  1 
ATOM   3177 C C   . ALA A 1 419 ? 16.843  -37.988 16.399  1.00 51.61  ? 420 ALA A C   1 
ATOM   3178 O O   . ALA A 1 419 ? 17.553  -37.451 15.570  1.00 62.76  ? 420 ALA A O   1 
ATOM   3179 C CB  . ALA A 1 419 ? 15.665  -39.644 14.955  1.00 39.68  ? 420 ALA A CB  1 
ATOM   3180 N N   . GLN A 1 420 ? 16.395  -37.344 17.466  1.00 53.92  ? 421 GLN A N   1 
ATOM   3181 C CA  . GLN A 1 420 ? 16.704  -35.933 17.641  1.00 43.82  ? 421 GLN A CA  1 
ATOM   3182 C C   . GLN A 1 420 ? 17.321  -35.655 18.987  1.00 47.01  ? 421 GLN A C   1 
ATOM   3183 O O   . GLN A 1 420 ? 17.160  -34.564 19.574  1.00 48.80  ? 421 GLN A O   1 
ATOM   3184 C CB  . GLN A 1 420 ? 15.457  -35.111 17.418  1.00 52.63  ? 421 GLN A CB  1 
ATOM   3185 C CG  . GLN A 1 420 ? 15.016  -35.263 15.981  1.00 56.57  ? 421 GLN A CG  1 
ATOM   3186 C CD  . GLN A 1 420 ? 13.703  -34.620 15.720  1.00 60.67  ? 421 GLN A CD  1 
ATOM   3187 O OE1 . GLN A 1 420 ? 12.988  -35.010 14.801  1.00 60.66  ? 421 GLN A OE1 1 
ATOM   3188 N NE2 . GLN A 1 420 ? 13.360  -33.626 16.532  1.00 67.29  ? 421 GLN A NE2 1 
ATOM   3189 N N   . GLY A 1 421 ? 18.044  -36.665 19.469  1.00 41.94  ? 422 GLY A N   1 
ATOM   3190 C CA  . GLY A 1 421 ? 18.936  -36.474 20.593  1.00 51.32  ? 422 GLY A CA  1 
ATOM   3191 C C   . GLY A 1 421 ? 18.514  -37.092 21.905  1.00 57.05  ? 422 GLY A C   1 
ATOM   3192 O O   . GLY A 1 421 ? 19.314  -37.157 22.828  1.00 61.95  ? 422 GLY A O   1 
ATOM   3193 N N   . ALA A 1 422 ? 17.269  -37.546 22.000  1.00 57.46  ? 423 ALA A N   1 
ATOM   3194 C CA  . ALA A 1 422 ? 16.775  -38.067 23.263  1.00 50.83  ? 423 ALA A CA  1 
ATOM   3195 C C   . ALA A 1 422 ? 17.221  -39.494 23.426  1.00 45.72  ? 423 ALA A C   1 
ATOM   3196 O O   . ALA A 1 422 ? 17.454  -40.190 22.441  1.00 49.11  ? 423 ALA A O   1 
ATOM   3197 C CB  . ALA A 1 422 ? 15.251  -37.965 23.342  1.00 44.69  ? 423 ALA A CB  1 
ATOM   3198 N N   . ARG A 1 423 ? 17.352  -39.927 24.675  1.00 44.47  ? 424 ARG A N   1 
ATOM   3199 C CA  . ARG A 1 423 ? 17.552  -41.339 24.966  1.00 42.53  ? 424 ARG A CA  1 
ATOM   3200 C C   . ARG A 1 423 ? 16.200  -41.934 25.384  1.00 46.86  ? 424 ARG A C   1 
ATOM   3201 O O   . ARG A 1 423 ? 15.600  -41.527 26.384  1.00 49.36  ? 424 ARG A O   1 
ATOM   3202 C CB  . ARG A 1 423 ? 18.615  -41.545 26.065  1.00 41.94  ? 424 ARG A CB  1 
ATOM   3203 C CG  . ARG A 1 423 ? 19.010  -43.000 26.201  1.00 50.13  ? 424 ARG A CG  1 
ATOM   3204 C CD  . ARG A 1 423 ? 20.344  -43.188 26.879  1.00 62.10  ? 424 ARG A CD  1 
ATOM   3205 N NE  . ARG A 1 423 ? 20.183  -43.207 28.332  1.00 80.14  ? 424 ARG A NE  1 
ATOM   3206 C CZ  . ARG A 1 423 ? 20.697  -42.296 29.151  1.00 67.42  ? 424 ARG A CZ  1 
ATOM   3207 N NH1 . ARG A 1 423 ? 21.424  -41.292 28.658  1.00 62.31  ? 424 ARG A NH1 1 
ATOM   3208 N NH2 . ARG A 1 423 ? 20.484  -42.395 30.456  1.00 61.90  ? 424 ARG A NH2 1 
ATOM   3209 N N   . VAL A 1 424 ? 15.726  -42.892 24.605  1.00 44.62  ? 425 VAL A N   1 
ATOM   3210 C CA  . VAL A 1 424 ? 14.382  -43.413 24.751  1.00 40.93  ? 425 VAL A CA  1 
ATOM   3211 C C   . VAL A 1 424 ? 14.399  -44.866 25.205  1.00 45.24  ? 425 VAL A C   1 
ATOM   3212 O O   . VAL A 1 424 ? 15.183  -45.665 24.686  1.00 40.70  ? 425 VAL A O   1 
ATOM   3213 C CB  . VAL A 1 424 ? 13.623  -43.311 23.410  1.00 48.66  ? 425 VAL A CB  1 
ATOM   3214 C CG1 . VAL A 1 424 ? 12.242  -43.895 23.529  1.00 34.25  ? 425 VAL A CG1 1 
ATOM   3215 C CG2 . VAL A 1 424 ? 13.585  -41.868 22.936  1.00 34.99  ? 425 VAL A CG2 1 
ATOM   3216 N N   . TYR A 1 425 ? 13.545  -45.226 26.161  1.00 40.45  ? 426 TYR A N   1 
ATOM   3217 C CA  . TYR A 1 425 ? 13.358  -46.645 26.487  1.00 41.81  ? 426 TYR A CA  1 
ATOM   3218 C C   . TYR A 1 425 ? 11.922  -47.032 26.207  1.00 41.89  ? 426 TYR A C   1 
ATOM   3219 O O   . TYR A 1 425 ? 10.998  -46.305 26.592  1.00 43.90  ? 426 TYR A O   1 
ATOM   3220 C CB  . TYR A 1 425 ? 13.718  -46.943 27.953  1.00 42.71  ? 426 TYR A CB  1 
ATOM   3221 C CG  . TYR A 1 425 ? 15.172  -46.705 28.249  1.00 43.49  ? 426 TYR A CG  1 
ATOM   3222 C CD1 . TYR A 1 425 ? 15.631  -45.431 28.574  1.00 43.37  ? 426 TYR A CD1 1 
ATOM   3223 C CD2 . TYR A 1 425 ? 16.097  -47.745 28.168  1.00 40.71  ? 426 TYR A CD2 1 
ATOM   3224 C CE1 . TYR A 1 425 ? 16.970  -45.194 28.840  1.00 41.16  ? 426 TYR A CE1 1 
ATOM   3225 C CE2 . TYR A 1 425 ? 17.447  -47.517 28.423  1.00 47.52  ? 426 TYR A CE2 1 
ATOM   3226 C CZ  . TYR A 1 425 ? 17.872  -46.236 28.763  1.00 44.51  ? 426 TYR A CZ  1 
ATOM   3227 O OH  . TYR A 1 425 ? 19.205  -45.992 29.017  1.00 49.80  ? 426 TYR A OH  1 
ATOM   3228 N N   . ALA A 1 426 ? 11.733  -48.170 25.543  1.00 39.59  ? 427 ALA A N   1 
ATOM   3229 C CA  . ALA A 1 426 ? 10.398  -48.608 25.143  1.00 41.59  ? 427 ALA A CA  1 
ATOM   3230 C C   . ALA A 1 426 ? 10.059  -49.970 25.721  1.00 38.13  ? 427 ALA A C   1 
ATOM   3231 O O   . ALA A 1 426 ? 10.923  -50.837 25.841  1.00 38.24  ? 427 ALA A O   1 
ATOM   3232 C CB  . ALA A 1 426 ? 10.270  -48.634 23.595  1.00 40.55  ? 427 ALA A CB  1 
ATOM   3233 N N   . TYR A 1 427 ? 8.792   -50.160 26.069  1.00 36.83  ? 428 TYR A N   1 
ATOM   3234 C CA  . TYR A 1 427 ? 8.319   -51.442 26.569  1.00 38.84  ? 428 TYR A CA  1 
ATOM   3235 C C   . TYR A 1 427 ? 6.961   -51.779 25.963  1.00 41.41  ? 428 TYR A C   1 
ATOM   3236 O O   . TYR A 1 427 ? 6.220   -50.899 25.538  1.00 37.80  ? 428 TYR A O   1 
ATOM   3237 C CB  . TYR A 1 427 ? 8.204   -51.427 28.116  1.00 37.34  ? 428 TYR A CB  1 
ATOM   3238 C CG  . TYR A 1 427 ? 7.104   -50.499 28.606  1.00 38.41  ? 428 TYR A CG  1 
ATOM   3239 C CD1 . TYR A 1 427 ? 5.779   -50.925 28.664  1.00 32.71  ? 428 TYR A CD1 1 
ATOM   3240 C CD2 . TYR A 1 427 ? 7.392   -49.189 28.999  1.00 33.22  ? 428 TYR A CD2 1 
ATOM   3241 C CE1 . TYR A 1 427 ? 4.763   -50.077 29.117  1.00 36.74  ? 428 TYR A CE1 1 
ATOM   3242 C CE2 . TYR A 1 427 ? 6.384   -48.333 29.444  1.00 37.05  ? 428 TYR A CE2 1 
ATOM   3243 C CZ  . TYR A 1 427 ? 5.075   -48.785 29.500  1.00 39.67  ? 428 TYR A CZ  1 
ATOM   3244 O OH  . TYR A 1 427 ? 4.081   -47.939 29.910  1.00 46.55  ? 428 TYR A OH  1 
ATOM   3245 N N   . VAL A 1 428 ? 6.624   -53.058 25.962  1.00 41.61  ? 429 VAL A N   1 
ATOM   3246 C CA  . VAL A 1 428 ? 5.251   -53.475 25.775  1.00 39.00  ? 429 VAL A CA  1 
ATOM   3247 C C   . VAL A 1 428 ? 4.875   -54.275 26.992  1.00 42.97  ? 429 VAL A C   1 
ATOM   3248 O O   . VAL A 1 428 ? 5.628   -55.161 27.412  1.00 44.53  ? 429 VAL A O   1 
ATOM   3249 C CB  . VAL A 1 428 ? 5.078   -54.313 24.491  1.00 42.48  ? 429 VAL A CB  1 
ATOM   3250 C CG1 . VAL A 1 428 ? 3.698   -54.895 24.433  1.00 36.60  ? 429 VAL A CG1 1 
ATOM   3251 C CG2 . VAL A 1 428 ? 5.318   -53.431 23.276  1.00 42.32  ? 429 VAL A CG2 1 
ATOM   3252 N N   . PHE A 1 429 ? 3.728   -53.969 27.587  1.00 43.28  ? 430 PHE A N   1 
ATOM   3253 C CA  . PHE A 1 429 ? 3.360   -54.640 28.828  1.00 46.47  ? 430 PHE A CA  1 
ATOM   3254 C C   . PHE A 1 429 ? 2.429   -55.808 28.506  1.00 44.67  ? 430 PHE A C   1 
ATOM   3255 O O   . PHE A 1 429 ? 1.338   -55.612 27.972  1.00 42.66  ? 430 PHE A O   1 
ATOM   3256 C CB  . PHE A 1 429 ? 2.718   -53.643 29.801  1.00 38.96  ? 430 PHE A CB  1 
ATOM   3257 C CG  . PHE A 1 429 ? 2.257   -54.253 31.091  1.00 38.02  ? 430 PHE A CG  1 
ATOM   3258 C CD1 . PHE A 1 429 ? 3.093   -54.281 32.202  1.00 42.59  ? 430 PHE A CD1 1 
ATOM   3259 C CD2 . PHE A 1 429 ? 0.979   -54.765 31.211  1.00 40.97  ? 430 PHE A CD2 1 
ATOM   3260 C CE1 . PHE A 1 429 ? 2.657   -54.830 33.410  1.00 52.20  ? 430 PHE A CE1 1 
ATOM   3261 C CE2 . PHE A 1 429 ? 0.542   -55.325 32.403  1.00 47.10  ? 430 PHE A CE2 1 
ATOM   3262 C CZ  . PHE A 1 429 ? 1.376   -55.358 33.504  1.00 44.07  ? 430 PHE A CZ  1 
ATOM   3263 N N   . GLU A 1 430 ? 2.859   -57.024 28.836  1.00 47.39  ? 431 GLU A N   1 
ATOM   3264 C CA  . GLU A 1 430 ? 2.182   -58.206 28.310  1.00 49.21  ? 431 GLU A CA  1 
ATOM   3265 C C   . GLU A 1 430 ? 1.638   -59.162 29.343  1.00 48.62  ? 431 GLU A C   1 
ATOM   3266 O O   . GLU A 1 430 ? 1.369   -60.307 29.021  1.00 50.61  ? 431 GLU A O   1 
ATOM   3267 C CB  . GLU A 1 430 ? 3.126   -58.987 27.398  1.00 43.84  ? 431 GLU A CB  1 
ATOM   3268 C CG  . GLU A 1 430 ? 3.554   -58.191 26.188  1.00 59.77  ? 431 GLU A CG  1 
ATOM   3269 C CD  . GLU A 1 430 ? 4.282   -59.037 25.154  1.00 63.99  ? 431 GLU A CD  1 
ATOM   3270 O OE1 . GLU A 1 430 ? 4.234   -58.672 23.962  1.00 79.16  ? 431 GLU A OE1 1 
ATOM   3271 O OE2 . GLU A 1 430 ? 4.903   -60.058 25.526  1.00 65.58  ? 431 GLU A OE2 1 
ATOM   3272 N N   . HIS A 1 431 ? 1.461   -58.700 30.572  1.00 47.76  ? 432 HIS A N   1 
ATOM   3273 C CA  . HIS A 1 431 ? 0.930   -59.557 31.610  1.00 41.21  ? 432 HIS A CA  1 
ATOM   3274 C C   . HIS A 1 431 ? -0.536  -59.298 31.886  1.00 46.02  ? 432 HIS A C   1 
ATOM   3275 O O   . HIS A 1 431 ? -0.931  -58.178 32.186  1.00 49.52  ? 432 HIS A O   1 
ATOM   3276 C CB  . HIS A 1 431 ? 1.700   -59.390 32.911  1.00 52.79  ? 432 HIS A CB  1 
ATOM   3277 C CG  . HIS A 1 431 ? 1.134   -60.206 34.024  1.00 51.80  ? 432 HIS A CG  1 
ATOM   3278 N ND1 . HIS A 1 431 ? 1.102   -61.584 33.984  1.00 66.22  ? 432 HIS A ND1 1 
ATOM   3279 C CD2 . HIS A 1 431 ? 0.520   -59.844 35.176  1.00 47.00  ? 432 HIS A CD2 1 
ATOM   3280 C CE1 . HIS A 1 431 ? 0.532   -62.037 35.088  1.00 57.29  ? 432 HIS A CE1 1 
ATOM   3281 N NE2 . HIS A 1 431 ? 0.163   -61.002 35.821  1.00 50.92  ? 432 HIS A NE2 1 
ATOM   3282 N N   . ARG A 1 432 ? -1.343  -60.349 31.800  1.00 48.65  ? 433 ARG A N   1 
ATOM   3283 C CA  . ARG A 1 432 ? -2.751  -60.242 32.149  1.00 49.68  ? 433 ARG A CA  1 
ATOM   3284 C C   . ARG A 1 432 ? -2.925  -60.564 33.629  1.00 54.36  ? 433 ARG A C   1 
ATOM   3285 O O   . ARG A 1 432 ? -2.583  -61.658 34.077  1.00 48.77  ? 433 ARG A O   1 
ATOM   3286 C CB  . ARG A 1 432 ? -3.595  -61.168 31.282  1.00 52.89  ? 433 ARG A CB  1 
ATOM   3287 C CG  . ARG A 1 432 ? -5.056  -60.832 31.326  1.00 58.56  ? 433 ARG A CG  1 
ATOM   3288 C CD  . ARG A 1 432 ? -5.872  -61.882 30.631  1.00 54.16  ? 433 ARG A CD  1 
ATOM   3289 N NE  . ARG A 1 432 ? -7.179  -62.006 31.266  1.00 57.66  ? 433 ARG A NE  1 
ATOM   3290 C CZ  . ARG A 1 432 ? -8.271  -61.381 30.842  1.00 62.76  ? 433 ARG A CZ  1 
ATOM   3291 N NH1 . ARG A 1 432 ? -8.209  -60.591 29.763  1.00 52.82  ? 433 ARG A NH1 1 
ATOM   3292 N NH2 . ARG A 1 432 ? -9.419  -61.552 31.495  1.00 54.51  ? 433 ARG A NH2 1 
ATOM   3293 N N   . ALA A 1 433 ? -3.439  -59.602 34.388  1.00 53.04  ? 434 ALA A N   1 
ATOM   3294 C CA  . ALA A 1 433 ? -3.540  -59.752 35.837  1.00 53.58  ? 434 ALA A CA  1 
ATOM   3295 C C   . ALA A 1 433 ? -4.473  -60.891 36.204  1.00 59.14  ? 434 ALA A C   1 
ATOM   3296 O O   . ALA A 1 433 ? -5.593  -60.963 35.698  1.00 60.18  ? 434 ALA A O   1 
ATOM   3297 C CB  . ALA A 1 433 ? -4.019  -58.452 36.476  1.00 47.33  ? 434 ALA A CB  1 
ATOM   3298 N N   . SER A 1 434 ? -4.012  -61.772 37.091  1.00 50.62  ? 435 SER A N   1 
ATOM   3299 C CA  . SER A 1 434 ? -4.841  -62.868 37.598  1.00 53.06  ? 435 SER A CA  1 
ATOM   3300 C C   . SER A 1 434 ? -6.180  -62.359 38.122  1.00 50.44  ? 435 SER A C   1 
ATOM   3301 O O   . SER A 1 434 ? -7.176  -63.063 38.074  1.00 62.09  ? 435 SER A O   1 
ATOM   3302 C CB  . SER A 1 434 ? -4.110  -63.634 38.703  1.00 52.52  ? 435 SER A CB  1 
ATOM   3303 O OG  . SER A 1 434 ? -4.007  -62.841 39.878  1.00 57.73  ? 435 SER A OG  1 
ATOM   3304 N N   . THR A 1 435 ? -6.203  -61.121 38.596  1.00 54.62  ? 436 THR A N   1 
ATOM   3305 C CA  . THR A 1 435 ? -7.425  -60.523 39.119  1.00 53.99  ? 436 THR A CA  1 
ATOM   3306 C C   . THR A 1 435 ? -8.277  -59.801 38.076  1.00 59.10  ? 436 THR A C   1 
ATOM   3307 O O   . THR A 1 435 ? -9.315  -59.229 38.415  1.00 54.38  ? 436 THR A O   1 
ATOM   3308 C CB  . THR A 1 435 ? -7.102  -59.503 40.225  1.00 62.90  ? 436 THR A CB  1 
ATOM   3309 O OG1 . THR A 1 435 ? -6.422  -58.377 39.646  1.00 60.66  ? 436 THR A OG1 1 
ATOM   3310 C CG2 . THR A 1 435 ? -6.229  -60.140 41.312  1.00 56.10  ? 436 THR A CG2 1 
ATOM   3311 N N   . LEU A 1 436 ? -7.842  -59.795 36.818  1.00 50.57  ? 437 LEU A N   1 
ATOM   3312 C CA  . LEU A 1 436 ? -8.533  -58.991 35.794  1.00 54.73  ? 437 LEU A CA  1 
ATOM   3313 C C   . LEU A 1 436 ? -9.992  -59.402 35.585  1.00 55.79  ? 437 LEU A C   1 
ATOM   3314 O O   . LEU A 1 436 ? -10.286 -60.577 35.346  1.00 56.63  ? 437 LEU A O   1 
ATOM   3315 C CB  . LEU A 1 436 ? -7.781  -59.068 34.460  1.00 57.47  ? 437 LEU A CB  1 
ATOM   3316 C CG  . LEU A 1 436 ? -8.204  -58.032 33.417  1.00 56.91  ? 437 LEU A CG  1 
ATOM   3317 C CD1 . LEU A 1 436 ? -7.909  -56.655 33.915  1.00 56.93  ? 437 LEU A CD1 1 
ATOM   3318 C CD2 . LEU A 1 436 ? -7.493  -58.275 32.099  1.00 58.66  ? 437 LEU A CD2 1 
ATOM   3319 N N   . SER A 1 437 ? -10.900 -58.430 35.652  1.00 48.23  ? 438 SER A N   1 
ATOM   3320 C CA  . SER A 1 437 ? -12.328 -58.735 35.590  1.00 50.96  ? 438 SER A CA  1 
ATOM   3321 C C   . SER A 1 437 ? -12.959 -58.617 34.191  1.00 56.85  ? 438 SER A C   1 
ATOM   3322 O O   . SER A 1 437 ? -14.137 -58.941 34.009  1.00 55.19  ? 438 SER A O   1 
ATOM   3323 C CB  . SER A 1 437 ? -13.092 -57.837 36.578  1.00 52.79  ? 438 SER A CB  1 
ATOM   3324 O OG  . SER A 1 437 ? -12.917 -56.453 36.284  1.00 66.11  ? 438 SER A OG  1 
ATOM   3325 N N   . TRP A 1 438 ? -12.190 -58.138 33.213  1.00 54.82  ? 439 TRP A N   1 
ATOM   3326 C CA  . TRP A 1 438 ? -12.634 -58.106 31.818  1.00 50.57  ? 439 TRP A CA  1 
ATOM   3327 C C   . TRP A 1 438 ? -12.457 -59.493 31.176  1.00 52.46  ? 439 TRP A C   1 
ATOM   3328 O O   . TRP A 1 438 ? -11.564 -60.259 31.568  1.00 49.33  ? 439 TRP A O   1 
ATOM   3329 C CB  . TRP A 1 438 ? -11.863 -57.044 31.019  1.00 54.43  ? 439 TRP A CB  1 
ATOM   3330 C CG  . TRP A 1 438 ? -12.116 -55.623 31.450  1.00 48.97  ? 439 TRP A CG  1 
ATOM   3331 C CD1 . TRP A 1 438 ? -11.339 -54.874 32.296  1.00 43.66  ? 439 TRP A CD1 1 
ATOM   3332 C CD2 . TRP A 1 438 ? -13.204 -54.775 31.053  1.00 49.03  ? 439 TRP A CD2 1 
ATOM   3333 N NE1 . TRP A 1 438 ? -11.886 -53.620 32.456  1.00 48.44  ? 439 TRP A NE1 1 
ATOM   3334 C CE2 . TRP A 1 438 ? -13.031 -53.532 31.715  1.00 48.40  ? 439 TRP A CE2 1 
ATOM   3335 C CE3 . TRP A 1 438 ? -14.313 -54.944 30.221  1.00 45.80  ? 439 TRP A CE3 1 
ATOM   3336 C CZ2 . TRP A 1 438 ? -13.920 -52.461 31.555  1.00 51.54  ? 439 TRP A CZ2 1 
ATOM   3337 C CZ3 . TRP A 1 438 ? -15.195 -53.875 30.058  1.00 46.12  ? 439 TRP A CZ3 1 
ATOM   3338 C CH2 . TRP A 1 438 ? -14.987 -52.645 30.716  1.00 54.84  ? 439 TRP A CH2 1 
ATOM   3339 N N   . PRO A 1 439 ? -13.293 -59.820 30.172  1.00 49.61  ? 440 PRO A N   1 
ATOM   3340 C CA  . PRO A 1 439 ? -13.201 -61.147 29.560  1.00 41.65  ? 440 PRO A CA  1 
ATOM   3341 C C   . PRO A 1 439 ? -11.824 -61.444 28.983  1.00 58.12  ? 440 PRO A C   1 
ATOM   3342 O O   . PRO A 1 439 ? -11.029 -60.535 28.713  1.00 53.47  ? 440 PRO A O   1 
ATOM   3343 C CB  . PRO A 1 439 ? -14.251 -61.093 28.454  1.00 49.44  ? 440 PRO A CB  1 
ATOM   3344 C CG  . PRO A 1 439 ? -14.406 -59.647 28.140  1.00 50.44  ? 440 PRO A CG  1 
ATOM   3345 C CD  . PRO A 1 439 ? -14.250 -58.955 29.458  1.00 52.91  ? 440 PRO A CD  1 
ATOM   3346 N N   . LEU A 1 440 ? -11.557 -62.730 28.805  1.00 58.88  ? 441 LEU A N   1 
ATOM   3347 C CA  . LEU A 1 440 ? -10.289 -63.204 28.279  1.00 57.58  ? 441 LEU A CA  1 
ATOM   3348 C C   . LEU A 1 440 ? -9.944  -62.694 26.863  1.00 59.07  ? 441 LEU A C   1 
ATOM   3349 O O   . LEU A 1 440 ? -8.764  -62.537 26.532  1.00 60.84  ? 441 LEU A O   1 
ATOM   3350 C CB  . LEU A 1 440 ? -10.283 -64.729 28.285  1.00 67.88  ? 441 LEU A CB  1 
ATOM   3351 C CG  . LEU A 1 440 ? -8.916  -65.347 28.020  1.00 82.34  ? 441 LEU A CG  1 
ATOM   3352 C CD1 . LEU A 1 440 ? -8.002  -65.033 29.186  1.00 64.11  ? 441 LEU A CD1 1 
ATOM   3353 C CD2 . LEU A 1 440 ? -9.016  -66.848 27.778  1.00 75.47  ? 441 LEU A CD2 1 
ATOM   3354 N N   . TRP A 1 441 ? -10.952 -62.425 26.032  1.00 51.45  ? 442 TRP A N   1 
ATOM   3355 C CA  . TRP A 1 441 ? -10.683 -62.042 24.646  1.00 59.56  ? 442 TRP A CA  1 
ATOM   3356 C C   . TRP A 1 441 ? -10.095 -60.643 24.565  1.00 59.73  ? 442 TRP A C   1 
ATOM   3357 O O   . TRP A 1 441 ? -9.570  -60.251 23.533  1.00 59.98  ? 442 TRP A O   1 
ATOM   3358 C CB  . TRP A 1 441 ? -11.944 -62.130 23.763  1.00 51.44  ? 442 TRP A CB  1 
ATOM   3359 C CG  . TRP A 1 441 ? -13.043 -61.139 24.064  1.00 53.47  ? 442 TRP A CG  1 
ATOM   3360 C CD1 . TRP A 1 441 ? -14.169 -61.373 24.804  1.00 55.24  ? 442 TRP A CD1 1 
ATOM   3361 C CD2 . TRP A 1 441 ? -13.137 -59.776 23.614  1.00 51.04  ? 442 TRP A CD2 1 
ATOM   3362 N NE1 . TRP A 1 441 ? -14.956 -60.243 24.846  1.00 54.48  ? 442 TRP A NE1 1 
ATOM   3363 C CE2 . TRP A 1 441 ? -14.341 -59.246 24.134  1.00 47.54  ? 442 TRP A CE2 1 
ATOM   3364 C CE3 . TRP A 1 441 ? -12.325 -58.955 22.822  1.00 51.52  ? 442 TRP A CE3 1 
ATOM   3365 C CZ2 . TRP A 1 441 ? -14.751 -57.932 23.894  1.00 43.87  ? 442 TRP A CZ2 1 
ATOM   3366 C CZ3 . TRP A 1 441 ? -12.736 -57.655 22.576  1.00 44.78  ? 442 TRP A CZ3 1 
ATOM   3367 C CH2 . TRP A 1 441 ? -13.937 -57.152 23.120  1.00 52.62  ? 442 TRP A CH2 1 
ATOM   3368 N N   . MET A 1 442 ? -10.182 -59.891 25.656  1.00 58.48  ? 443 MET A N   1 
ATOM   3369 C CA  . MET A 1 442 ? -9.637  -58.540 25.670  1.00 54.54  ? 443 MET A CA  1 
ATOM   3370 C C   . MET A 1 442 ? -8.128  -58.501 25.903  1.00 52.41  ? 443 MET A C   1 
ATOM   3371 O O   . MET A 1 442 ? -7.510  -57.437 25.781  1.00 48.66  ? 443 MET A O   1 
ATOM   3372 C CB  . MET A 1 442 ? -10.334 -57.697 26.729  1.00 49.68  ? 443 MET A CB  1 
ATOM   3373 C CG  . MET A 1 442 ? -11.727 -57.250 26.342  1.00 48.54  ? 443 MET A CG  1 
ATOM   3374 S SD  . MET A 1 442 ? -12.311 -55.928 27.429  1.00 54.02  ? 443 MET A SD  1 
ATOM   3375 C CE  . MET A 1 442 ? -13.840 -55.453 26.657  1.00 54.23  ? 443 MET A CE  1 
ATOM   3376 N N   . GLY A 1 443 ? -7.542  -59.652 26.228  1.00 44.74  ? 444 GLY A N   1 
ATOM   3377 C CA  . GLY A 1 443 ? -6.105  -59.759 26.445  1.00 45.24  ? 444 GLY A CA  1 
ATOM   3378 C C   . GLY A 1 443 ? -5.633  -58.882 27.601  1.00 63.47  ? 444 GLY A C   1 
ATOM   3379 O O   . GLY A 1 443 ? -6.219  -58.914 28.691  1.00 47.52  ? 444 GLY A O   1 
ATOM   3380 N N   . VAL A 1 444 ? -4.569  -58.112 27.369  1.00 48.49  ? 445 VAL A N   1 
ATOM   3381 C CA  . VAL A 1 444 ? -4.109  -57.107 28.328  1.00 50.29  ? 445 VAL A CA  1 
ATOM   3382 C C   . VAL A 1 444 ? -4.623  -55.725 27.939  1.00 45.80  ? 445 VAL A C   1 
ATOM   3383 O O   . VAL A 1 444 ? -4.047  -55.049 27.088  1.00 39.78  ? 445 VAL A O   1 
ATOM   3384 C CB  . VAL A 1 444 ? -2.580  -57.052 28.410  1.00 44.37  ? 445 VAL A CB  1 
ATOM   3385 C CG1 . VAL A 1 444 ? -2.148  -56.271 29.663  1.00 44.80  ? 445 VAL A CG1 1 
ATOM   3386 C CG2 . VAL A 1 444 ? -2.008  -58.455 28.421  1.00 49.50  ? 445 VAL A CG2 1 
ATOM   3387 N N   . PRO A 1 445 ? -5.708  -55.280 28.568  1.00 42.63  ? 446 PRO A N   1 
ATOM   3388 C CA  . PRO A 1 445 ? -6.328  -54.067 28.043  1.00 40.79  ? 446 PRO A CA  1 
ATOM   3389 C C   . PRO A 1 445 ? -5.686  -52.771 28.546  1.00 49.61  ? 446 PRO A C   1 
ATOM   3390 O O   . PRO A 1 445 ? -4.867  -52.722 29.464  1.00 43.29  ? 446 PRO A O   1 
ATOM   3391 C CB  . PRO A 1 445 ? -7.781  -54.179 28.523  1.00 38.41  ? 446 PRO A CB  1 
ATOM   3392 C CG  . PRO A 1 445 ? -7.855  -55.433 29.368  1.00 42.30  ? 446 PRO A CG  1 
ATOM   3393 C CD  . PRO A 1 445 ? -6.462  -55.839 29.693  1.00 47.55  ? 446 PRO A CD  1 
ATOM   3394 N N   . HIS A 1 446 ? -6.070  -51.702 27.874  1.00 43.74  ? 447 HIS A N   1 
ATOM   3395 C CA  . HIS A 1 446 ? -5.611  -50.358 28.163  1.00 47.48  ? 447 HIS A CA  1 
ATOM   3396 C C   . HIS A 1 446 ? -5.777  -50.007 29.643  1.00 45.63  ? 447 HIS A C   1 
ATOM   3397 O O   . HIS A 1 446 ? -6.854  -50.193 30.203  1.00 47.58  ? 447 HIS A O   1 
ATOM   3398 C CB  . HIS A 1 446 ? -6.404  -49.397 27.285  1.00 35.47  ? 447 HIS A CB  1 
ATOM   3399 C CG  . HIS A 1 446 ? -6.067  -47.965 27.481  1.00 52.44  ? 447 HIS A CG  1 
ATOM   3400 N ND1 . HIS A 1 446 ? -4.943  -47.387 26.929  1.00 49.53  ? 447 HIS A ND1 1 
ATOM   3401 C CD2 . HIS A 1 446 ? -6.725  -46.978 28.133  1.00 39.65  ? 447 HIS A CD2 1 
ATOM   3402 C CE1 . HIS A 1 446 ? -4.920  -46.103 27.242  1.00 50.24  ? 447 HIS A CE1 1 
ATOM   3403 N NE2 . HIS A 1 446 ? -5.983  -45.834 27.982  1.00 56.87  ? 447 HIS A NE2 1 
ATOM   3404 N N   . GLY A 1 447 ? -4.714  -49.505 30.264  1.00 45.69  ? 448 GLY A N   1 
ATOM   3405 C CA  . GLY A 1 447 ? -4.773  -49.065 31.647  1.00 41.77  ? 448 GLY A CA  1 
ATOM   3406 C C   . GLY A 1 447 ? -4.374  -50.102 32.680  1.00 41.05  ? 448 GLY A C   1 
ATOM   3407 O O   . GLY A 1 447 ? -4.250  -49.766 33.843  1.00 46.06  ? 448 GLY A O   1 
ATOM   3408 N N   . TYR A 1 448 ? -4.138  -51.349 32.282  1.00 41.47  ? 449 TYR A N   1 
ATOM   3409 C CA  . TYR A 1 448 ? -3.977  -52.394 33.289  1.00 42.35  ? 449 TYR A CA  1 
ATOM   3410 C C   . TYR A 1 448 ? -2.521  -52.742 33.591  1.00 45.71  ? 449 TYR A C   1 
ATOM   3411 O O   . TYR A 1 448 ? -2.234  -53.737 34.275  1.00 49.26  ? 449 TYR A O   1 
ATOM   3412 C CB  . TYR A 1 448 ? -4.813  -53.626 32.896  1.00 37.96  ? 449 TYR A CB  1 
ATOM   3413 C CG  . TYR A 1 448 ? -6.251  -53.316 33.251  1.00 41.52  ? 449 TYR A CG  1 
ATOM   3414 C CD1 . TYR A 1 448 ? -6.719  -53.494 34.553  1.00 41.54  ? 449 TYR A CD1 1 
ATOM   3415 C CD2 . TYR A 1 448 ? -7.110  -52.730 32.318  1.00 40.04  ? 449 TYR A CD2 1 
ATOM   3416 C CE1 . TYR A 1 448 ? -8.024  -53.140 34.905  1.00 40.38  ? 449 TYR A CE1 1 
ATOM   3417 C CE2 . TYR A 1 448 ? -8.395  -52.379 32.653  1.00 43.13  ? 449 TYR A CE2 1 
ATOM   3418 C CZ  . TYR A 1 448 ? -8.851  -52.584 33.953  1.00 51.10  ? 449 TYR A CZ  1 
ATOM   3419 O OH  . TYR A 1 448 ? -10.140 -52.216 34.274  1.00 49.08  ? 449 TYR A OH  1 
ATOM   3420 N N   . GLU A 1 449 ? -1.613  -51.871 33.151  1.00 41.61  ? 450 GLU A N   1 
ATOM   3421 C CA  . GLU A 1 449 ? -0.242  -51.867 33.665  1.00 42.84  ? 450 GLU A CA  1 
ATOM   3422 C C   . GLU A 1 449 ? -0.122  -50.978 34.919  1.00 40.66  ? 450 GLU A C   1 
ATOM   3423 O O   . GLU A 1 449 ? 0.724   -51.218 35.761  1.00 43.67  ? 450 GLU A O   1 
ATOM   3424 C CB  . GLU A 1 449 ? 0.748   -51.392 32.588  1.00 32.35  ? 450 GLU A CB  1 
ATOM   3425 C CG  . GLU A 1 449 ? 0.972   -49.898 32.524  1.00 40.60  ? 450 GLU A CG  1 
ATOM   3426 C CD  . GLU A 1 449 ? -0.192  -49.123 31.913  1.00 42.12  ? 450 GLU A CD  1 
ATOM   3427 O OE1 . GLU A 1 449 ? -1.311  -49.665 31.841  1.00 50.57  ? 450 GLU A OE1 1 
ATOM   3428 O OE2 . GLU A 1 449 ? 0.019   -47.958 31.495  1.00 45.99  ? 450 GLU A OE2 1 
ATOM   3429 N N   . ILE A 1 450 ? -0.964  -49.952 35.029  1.00 34.90  ? 451 ILE A N   1 
ATOM   3430 C CA  . ILE A 1 450 ? -0.859  -48.978 36.114  1.00 40.38  ? 451 ILE A CA  1 
ATOM   3431 C C   . ILE A 1 450 ? -0.805  -49.626 37.500  1.00 45.22  ? 451 ILE A C   1 
ATOM   3432 O O   . ILE A 1 450 ? 0.051   -49.282 38.305  1.00 45.14  ? 451 ILE A O   1 
ATOM   3433 C CB  . ILE A 1 450 ? -2.024  -47.983 36.083  1.00 41.77  ? 451 ILE A CB  1 
ATOM   3434 C CG1 . ILE A 1 450 ? -2.023  -47.209 34.762  1.00 37.74  ? 451 ILE A CG1 1 
ATOM   3435 C CG2 . ILE A 1 450 ? -1.955  -47.070 37.298  1.00 35.77  ? 451 ILE A CG2 1 
ATOM   3436 C CD1 . ILE A 1 450 ? -3.210  -46.264 34.566  1.00 30.13  ? 451 ILE A CD1 1 
ATOM   3437 N N   . GLU A 1 451 ? -1.688  -50.589 37.762  1.00 44.14  ? 452 GLU A N   1 
ATOM   3438 C CA  . GLU A 1 451 ? -1.755  -51.193 39.092  1.00 44.80  ? 452 GLU A CA  1 
ATOM   3439 C C   . GLU A 1 451 ? -0.449  -51.897 39.460  1.00 46.80  ? 452 GLU A C   1 
ATOM   3440 O O   . GLU A 1 451 ? -0.092  -51.978 40.643  1.00 47.62  ? 452 GLU A O   1 
ATOM   3441 C CB  . GLU A 1 451 ? -2.946  -52.163 39.197  1.00 45.87  ? 452 GLU A CB  1 
ATOM   3442 C CG  . GLU A 1 451 ? -2.901  -53.395 38.265  1.00 52.37  ? 452 GLU A CG  1 
ATOM   3443 C CD  . GLU A 1 451 ? -4.294  -53.986 38.009  1.00 57.78  ? 452 GLU A CD  1 
ATOM   3444 O OE1 . GLU A 1 451 ? -4.462  -55.213 38.163  1.00 67.71  ? 452 GLU A OE1 1 
ATOM   3445 O OE2 . GLU A 1 451 ? -5.226  -53.229 37.654  1.00 54.02  ? 452 GLU A OE2 1 
ATOM   3446 N N   . PHE A 1 452 ? 0.280   -52.370 38.455  1.00 42.91  ? 453 PHE A N   1 
ATOM   3447 C CA  . PHE A 1 452 ? 1.578   -52.978 38.711  1.00 44.42  ? 453 PHE A CA  1 
ATOM   3448 C C   . PHE A 1 452 ? 2.659   -51.937 38.948  1.00 46.09  ? 453 PHE A C   1 
ATOM   3449 O O   . PHE A 1 452 ? 3.529   -52.139 39.790  1.00 46.94  ? 453 PHE A O   1 
ATOM   3450 C CB  . PHE A 1 452 ? 1.972   -53.920 37.562  1.00 46.64  ? 453 PHE A CB  1 
ATOM   3451 C CG  . PHE A 1 452 ? 1.231   -55.213 37.612  1.00 49.64  ? 453 PHE A CG  1 
ATOM   3452 C CD1 . PHE A 1 452 ? 1.729   -56.279 38.342  1.00 44.49  ? 453 PHE A CD1 1 
ATOM   3453 C CD2 . PHE A 1 452 ? -0.006  -55.337 37.011  1.00 43.98  ? 453 PHE A CD2 1 
ATOM   3454 C CE1 . PHE A 1 452 ? 1.017   -57.460 38.440  1.00 42.87  ? 453 PHE A CE1 1 
ATOM   3455 C CE2 . PHE A 1 452 ? -0.725  -56.519 37.110  1.00 48.35  ? 453 PHE A CE2 1 
ATOM   3456 C CZ  . PHE A 1 452 ? -0.213  -57.572 37.827  1.00 46.45  ? 453 PHE A CZ  1 
ATOM   3457 N N   . ILE A 1 453 ? 2.604   -50.828 38.214  1.00 40.57  ? 454 ILE A N   1 
ATOM   3458 C CA  . ILE A 1 453 ? 3.597   -49.782 38.379  1.00 38.44  ? 454 ILE A CA  1 
ATOM   3459 C C   . ILE A 1 453 ? 3.500   -49.187 39.787  1.00 44.37  ? 454 ILE A C   1 
ATOM   3460 O O   . ILE A 1 453 ? 4.517   -48.918 40.414  1.00 41.05  ? 454 ILE A O   1 
ATOM   3461 C CB  . ILE A 1 453 ? 3.443   -48.670 37.343  1.00 44.71  ? 454 ILE A CB  1 
ATOM   3462 C CG1 . ILE A 1 453 ? 3.530   -49.214 35.899  1.00 40.78  ? 454 ILE A CG1 1 
ATOM   3463 C CG2 . ILE A 1 453 ? 4.530   -47.642 37.533  1.00 39.65  ? 454 ILE A CG2 1 
ATOM   3464 C CD1 . ILE A 1 453 ? 4.719   -50.053 35.675  1.00 48.80  ? 454 ILE A CD1 1 
ATOM   3465 N N   . PHE A 1 454 ? 2.280   -49.024 40.296  1.00 39.71  ? 455 PHE A N   1 
ATOM   3466 C CA  . PHE A 1 454 ? 2.089   -48.479 41.640  1.00 44.73  ? 455 PHE A CA  1 
ATOM   3467 C C   . PHE A 1 454 ? 2.218   -49.520 42.750  1.00 40.66  ? 455 PHE A C   1 
ATOM   3468 O O   . PHE A 1 454 ? 2.109   -49.182 43.928  1.00 45.00  ? 455 PHE A O   1 
ATOM   3469 C CB  . PHE A 1 454 ? 0.734   -47.790 41.748  1.00 32.70  ? 455 PHE A CB  1 
ATOM   3470 C CG  . PHE A 1 454 ? 0.723   -46.407 41.178  1.00 39.28  ? 455 PHE A CG  1 
ATOM   3471 C CD1 . PHE A 1 454 ? 0.613   -46.205 39.813  1.00 35.36  ? 455 PHE A CD1 1 
ATOM   3472 C CD2 . PHE A 1 454 ? 0.873   -45.298 42.007  1.00 37.55  ? 455 PHE A CD2 1 
ATOM   3473 C CE1 . PHE A 1 454 ? 0.606   -44.924 39.278  1.00 33.43  ? 455 PHE A CE1 1 
ATOM   3474 C CE2 . PHE A 1 454 ? 0.877   -44.005 41.480  1.00 40.01  ? 455 PHE A CE2 1 
ATOM   3475 C CZ  . PHE A 1 454 ? 0.728   -43.821 40.105  1.00 38.53  ? 455 PHE A CZ  1 
ATOM   3476 N N   . GLY A 1 455 ? 2.467   -50.775 42.382  1.00 42.57  ? 456 GLY A N   1 
ATOM   3477 C CA  . GLY A 1 455 ? 2.703   -51.827 43.359  1.00 42.08  ? 456 GLY A CA  1 
ATOM   3478 C C   . GLY A 1 455 ? 1.477   -52.256 44.157  1.00 44.79  ? 456 GLY A C   1 
ATOM   3479 O O   . GLY A 1 455 ? 1.603   -52.846 45.228  1.00 44.39  ? 456 GLY A O   1 
ATOM   3480 N N   . ILE A 1 456 ? 0.290   -51.954 43.635  1.00 45.35  ? 457 ILE A N   1 
ATOM   3481 C CA  . ILE A 1 456 ? -0.987  -52.405 44.209  1.00 42.07  ? 457 ILE A CA  1 
ATOM   3482 C C   . ILE A 1 456 ? -1.031  -53.912 44.537  1.00 49.78  ? 457 ILE A C   1 
ATOM   3483 O O   . ILE A 1 456 ? -1.637  -54.311 45.529  1.00 54.36  ? 457 ILE A O   1 
ATOM   3484 C CB  . ILE A 1 456 ? -2.163  -52.095 43.264  1.00 48.74  ? 457 ILE A CB  1 
ATOM   3485 C CG1 . ILE A 1 456 ? -2.214  -50.608 42.901  1.00 42.49  ? 457 ILE A CG1 1 
ATOM   3486 C CG2 . ILE A 1 456 ? -3.446  -52.537 43.882  1.00 44.80  ? 457 ILE A CG2 1 
ATOM   3487 C CD1 . ILE A 1 456 ? -2.140  -49.694 44.081  1.00 41.60  ? 457 ILE A CD1 1 
ATOM   3488 N N   . PRO A 1 457 ? -0.385  -54.758 43.717  1.00 50.46  ? 458 PRO A N   1 
ATOM   3489 C CA  . PRO A 1 457 ? -0.322  -56.163 44.127  1.00 52.00  ? 458 PRO A CA  1 
ATOM   3490 C C   . PRO A 1 457 ? 0.294   -56.444 45.505  1.00 49.99  ? 458 PRO A C   1 
ATOM   3491 O O   . PRO A 1 457 ? 0.173   -57.576 45.962  1.00 55.00  ? 458 PRO A O   1 
ATOM   3492 C CB  . PRO A 1 457 ? 0.553   -56.787 43.039  1.00 42.42  ? 458 PRO A CB  1 
ATOM   3493 C CG  . PRO A 1 457 ? 0.200   -56.004 41.826  1.00 50.01  ? 458 PRO A CG  1 
ATOM   3494 C CD  . PRO A 1 457 ? 0.055   -54.594 42.319  1.00 48.97  ? 458 PRO A CD  1 
ATOM   3495 N N   . LEU A 1 458 ? 0.952   -55.479 46.141  1.00 51.41  ? 459 LEU A N   1 
ATOM   3496 C CA  . LEU A 1 458 ? 1.555   -55.741 47.453  1.00 51.28  ? 459 LEU A CA  1 
ATOM   3497 C C   . LEU A 1 458 ? 0.516   -55.599 48.559  1.00 51.73  ? 459 LEU A C   1 
ATOM   3498 O O   . LEU A 1 458 ? 0.765   -55.987 49.706  1.00 60.30  ? 459 LEU A O   1 
ATOM   3499 C CB  . LEU A 1 458 ? 2.738   -54.800 47.738  1.00 38.48  ? 459 LEU A CB  1 
ATOM   3500 C CG  . LEU A 1 458 ? 3.936   -54.751 46.786  1.00 59.22  ? 459 LEU A CG  1 
ATOM   3501 C CD1 . LEU A 1 458 ? 5.032   -53.898 47.430  1.00 43.74  ? 459 LEU A CD1 1 
ATOM   3502 C CD2 . LEU A 1 458 ? 4.448   -56.134 46.436  1.00 56.61  ? 459 LEU A CD2 1 
ATOM   3503 N N   . ASP A 1 459 ? -0.633  -55.022 48.214  1.00 47.77  ? 460 ASP A N   1 
ATOM   3504 C CA  . ASP A 1 459 ? -1.727  -54.838 49.162  1.00 43.88  ? 460 ASP A CA  1 
ATOM   3505 C C   . ASP A 1 459 ? -2.287  -56.199 49.524  1.00 65.74  ? 460 ASP A C   1 
ATOM   3506 O O   . ASP A 1 459 ? -2.884  -56.873 48.681  1.00 57.94  ? 460 ASP A O   1 
ATOM   3507 C CB  . ASP A 1 459 ? -2.811  -53.949 48.564  1.00 55.00  ? 460 ASP A CB  1 
ATOM   3508 C CG  . ASP A 1 459 ? -3.938  -53.655 49.537  1.00 69.64  ? 460 ASP A CG  1 
ATOM   3509 O OD1 . ASP A 1 459 ? -4.025  -54.337 50.586  1.00 60.51  ? 460 ASP A OD1 1 
ATOM   3510 O OD2 . ASP A 1 459 ? -4.750  -52.746 49.234  1.00 67.80  ? 460 ASP A OD2 1 
ATOM   3511 N N   . PRO A 1 460 ? -2.107  -56.609 50.788  1.00 65.95  ? 461 PRO A N   1 
ATOM   3512 C CA  . PRO A 1 460 ? -2.420  -57.998 51.149  1.00 68.58  ? 461 PRO A CA  1 
ATOM   3513 C C   . PRO A 1 460 ? -3.922  -58.286 51.047  1.00 66.19  ? 461 PRO A C   1 
ATOM   3514 O O   . PRO A 1 460 ? -4.320  -59.407 50.705  1.00 79.03  ? 461 PRO A O   1 
ATOM   3515 C CB  . PRO A 1 460 ? -1.903  -58.119 52.590  1.00 62.60  ? 461 PRO A CB  1 
ATOM   3516 C CG  . PRO A 1 460 ? -1.847  -56.713 53.110  1.00 73.21  ? 461 PRO A CG  1 
ATOM   3517 C CD  . PRO A 1 460 ? -1.603  -55.816 51.924  1.00 64.79  ? 461 PRO A CD  1 
ATOM   3518 N N   . SER A 1 461 ? -4.734  -57.259 51.276  1.00 53.52  ? 462 SER A N   1 
ATOM   3519 C CA  . SER A 1 461 ? -6.181  -57.358 51.107  1.00 58.04  ? 462 SER A CA  1 
ATOM   3520 C C   . SER A 1 461 ? -6.634  -57.684 49.674  1.00 65.34  ? 462 SER A C   1 
ATOM   3521 O O   . SER A 1 461 ? -7.805  -57.963 49.443  1.00 73.02  ? 462 SER A O   1 
ATOM   3522 C CB  . SER A 1 461 ? -6.841  -56.058 51.541  1.00 61.89  ? 462 SER A CB  1 
ATOM   3523 O OG  . SER A 1 461 ? -6.755  -55.103 50.503  1.00 63.28  ? 462 SER A OG  1 
ATOM   3524 N N   . ARG A 1 462 ? -5.718  -57.626 48.712  1.00 67.14  ? 463 ARG A N   1 
ATOM   3525 C CA  . ARG A 1 462 ? -6.042  -57.965 47.330  1.00 61.81  ? 463 ARG A CA  1 
ATOM   3526 C C   . ARG A 1 462 ? -5.459  -59.332 46.987  1.00 64.12  ? 463 ARG A C   1 
ATOM   3527 O O   . ARG A 1 462 ? -4.664  -59.886 47.756  1.00 67.54  ? 463 ARG A O   1 
ATOM   3528 C CB  . ARG A 1 462 ? -5.531  -56.889 46.383  1.00 59.39  ? 463 ARG A CB  1 
ATOM   3529 C CG  . ARG A 1 462 ? -6.192  -55.556 46.629  1.00 61.58  ? 463 ARG A CG  1 
ATOM   3530 C CD  . ARG A 1 462 ? -5.667  -54.510 45.680  1.00 57.84  ? 463 ARG A CD  1 
ATOM   3531 N NE  . ARG A 1 462 ? -6.113  -53.181 46.064  1.00 65.65  ? 463 ARG A NE  1 
ATOM   3532 C CZ  . ARG A 1 462 ? -7.231  -52.621 45.621  1.00 71.12  ? 463 ARG A CZ  1 
ATOM   3533 N NH1 . ARG A 1 462 ? -8.006  -53.279 44.758  1.00 59.20  ? 463 ARG A NH1 1 
ATOM   3534 N NH2 . ARG A 1 462 ? -7.570  -51.405 46.043  1.00 71.24  ? 463 ARG A NH2 1 
ATOM   3535 N N   . ASN A 1 463 ? -5.852  -59.879 45.841  1.00 59.85  ? 464 ASN A N   1 
ATOM   3536 C CA  . ASN A 1 463 ? -5.694  -61.317 45.623  1.00 68.90  ? 464 ASN A CA  1 
ATOM   3537 C C   . ASN A 1 463 ? -4.665  -61.700 44.568  1.00 62.22  ? 464 ASN A C   1 
ATOM   3538 O O   . ASN A 1 463 ? -4.812  -62.732 43.915  1.00 70.30  ? 464 ASN A O   1 
ATOM   3539 C CB  . ASN A 1 463 ? -7.055  -61.941 45.256  1.00 75.22  ? 464 ASN A CB  1 
ATOM   3540 C CG  . ASN A 1 463 ? -8.049  -61.920 46.420  1.00 77.27  ? 464 ASN A CG  1 
ATOM   3541 O OD1 . ASN A 1 463 ? -7.672  -62.165 47.567  1.00 81.60  ? 464 ASN A OD1 1 
ATOM   3542 N ND2 . ASN A 1 463 ? -9.318  -61.625 46.126  1.00 78.85  ? 464 ASN A ND2 1 
ATOM   3543 N N   . TYR A 1 464 ? -3.620  -60.891 44.407  1.00 50.24  ? 465 TYR A N   1 
ATOM   3544 C CA  . TYR A 1 464 ? -2.609  -61.173 43.389  1.00 51.18  ? 465 TYR A CA  1 
ATOM   3545 C C   . TYR A 1 464 ? -1.726  -62.333 43.830  1.00 54.91  ? 465 TYR A C   1 
ATOM   3546 O O   . TYR A 1 464 ? -1.603  -62.596 45.012  1.00 56.47  ? 465 TYR A O   1 
ATOM   3547 C CB  . TYR A 1 464 ? -1.750  -59.932 43.103  1.00 59.72  ? 465 TYR A CB  1 
ATOM   3548 C CG  . TYR A 1 464 ? -2.494  -58.784 42.453  1.00 52.89  ? 465 TYR A CG  1 
ATOM   3549 C CD1 . TYR A 1 464 ? -3.232  -57.906 43.220  1.00 40.46  ? 465 TYR A CD1 1 
ATOM   3550 C CD2 . TYR A 1 464 ? -2.442  -58.580 41.060  1.00 51.28  ? 465 TYR A CD2 1 
ATOM   3551 C CE1 . TYR A 1 464 ? -3.910  -56.865 42.657  1.00 47.94  ? 465 TYR A CE1 1 
ATOM   3552 C CE2 . TYR A 1 464 ? -3.134  -57.527 40.469  1.00 40.09  ? 465 TYR A CE2 1 
ATOM   3553 C CZ  . TYR A 1 464 ? -3.856  -56.667 41.275  1.00 47.65  ? 465 TYR A CZ  1 
ATOM   3554 O OH  . TYR A 1 464 ? -4.551  -55.611 40.727  1.00 47.86  ? 465 TYR A OH  1 
ATOM   3555 N N   . THR A 1 465 ? -1.097  -63.015 42.880  1.00 59.21  ? 466 THR A N   1 
ATOM   3556 C CA  . THR A 1 465 ? -0.210  -64.117 43.225  1.00 52.50  ? 466 THR A CA  1 
ATOM   3557 C C   . THR A 1 465 ? 1.142   -63.621 43.725  1.00 60.22  ? 466 THR A C   1 
ATOM   3558 O O   . THR A 1 465 ? 1.475   -62.451 43.568  1.00 61.46  ? 466 THR A O   1 
ATOM   3559 C CB  . THR A 1 465 ? 0.046   -65.039 42.034  1.00 54.72  ? 466 THR A CB  1 
ATOM   3560 O OG1 . THR A 1 465 ? 1.012   -64.429 41.168  1.00 55.96  ? 466 THR A OG1 1 
ATOM   3561 C CG2 . THR A 1 465 ? -1.249  -65.305 41.274  1.00 52.48  ? 466 THR A CG2 1 
ATOM   3562 N N   . ALA A 1 466 ? 1.925   -64.528 44.306  1.00 58.78  ? 467 ALA A N   1 
ATOM   3563 C CA  . ALA A 1 466 ? 3.271   -64.205 44.753  1.00 58.76  ? 467 ALA A CA  1 
ATOM   3564 C C   . ALA A 1 466 ? 4.159   -63.824 43.571  1.00 55.93  ? 467 ALA A C   1 
ATOM   3565 O O   . ALA A 1 466 ? 5.006   -62.942 43.692  1.00 59.16  ? 467 ALA A O   1 
ATOM   3566 C CB  . ALA A 1 466 ? 3.884   -65.377 45.516  1.00 51.26  ? 467 ALA A CB  1 
ATOM   3567 N N   . GLU A 1 467 ? 3.981   -64.500 42.439  1.00 53.34  ? 468 GLU A N   1 
ATOM   3568 C CA  . GLU A 1 467 ? 4.712   -64.141 41.221  1.00 57.16  ? 468 GLU A CA  1 
ATOM   3569 C C   . GLU A 1 467 ? 4.403   -62.710 40.799  1.00 53.00  ? 468 GLU A C   1 
ATOM   3570 O O   . GLU A 1 467 ? 5.288   -61.968 40.378  1.00 53.35  ? 468 GLU A O   1 
ATOM   3571 C CB  . GLU A 1 467 ? 4.365   -65.081 40.076  1.00 59.16  ? 468 GLU A CB  1 
ATOM   3572 C CG  . GLU A 1 467 ? 5.114   -66.398 40.060  1.00 74.33  ? 468 GLU A CG  1 
ATOM   3573 C CD  . GLU A 1 467 ? 4.635   -67.308 38.921  1.00 105.64 ? 468 GLU A CD  1 
ATOM   3574 O OE1 . GLU A 1 467 ? 3.563   -67.028 38.314  1.00 75.78  ? 468 GLU A OE1 1 
ATOM   3575 O OE2 . GLU A 1 467 ? 5.336   -68.306 38.632  1.00 117.26 ? 468 GLU A OE2 1 
ATOM   3576 N N   . GLU A 1 468 ? 3.133   -62.341 40.921  1.00 45.30  ? 469 GLU A N   1 
ATOM   3577 C CA  . GLU A 1 468 ? 2.671   -61.017 40.579  1.00 43.13  ? 469 GLU A CA  1 
ATOM   3578 C C   . GLU A 1 468 ? 3.252   -59.941 41.496  1.00 59.31  ? 469 GLU A C   1 
ATOM   3579 O O   . GLU A 1 468 ? 3.573   -58.843 41.027  1.00 54.05  ? 469 GLU A O   1 
ATOM   3580 C CB  . GLU A 1 468 ? 1.140   -60.997 40.574  1.00 44.61  ? 469 GLU A CB  1 
ATOM   3581 C CG  . GLU A 1 468 ? 0.587   -61.535 39.215  1.00 49.16  ? 469 GLU A CG  1 
ATOM   3582 C CD  . GLU A 1 468 ? -0.927  -61.579 39.155  1.00 57.10  ? 469 GLU A CD  1 
ATOM   3583 O OE1 . GLU A 1 468 ? -1.559  -61.857 40.196  1.00 57.00  ? 469 GLU A OE1 1 
ATOM   3584 O OE2 . GLU A 1 468 ? -1.491  -61.330 38.066  1.00 55.88  ? 469 GLU A OE2 1 
ATOM   3585 N N   . LYS A 1 469 ? 3.440   -60.254 42.780  1.00 48.34  ? 470 LYS A N   1 
ATOM   3586 C CA  . LYS A 1 469 ? 4.051   -59.288 43.688  1.00 43.43  ? 470 LYS A CA  1 
ATOM   3587 C C   . LYS A 1 469 ? 5.515   -59.047 43.315  1.00 45.63  ? 470 LYS A C   1 
ATOM   3588 O O   . LYS A 1 469 ? 5.993   -57.907 43.299  1.00 47.63  ? 470 LYS A O   1 
ATOM   3589 C CB  . LYS A 1 469 ? 3.931   -59.755 45.143  1.00 47.06  ? 470 LYS A CB  1 
ATOM   3590 C CG  . LYS A 1 469 ? 2.483   -59.962 45.578  1.00 55.77  ? 470 LYS A CG  1 
ATOM   3591 C CD  . LYS A 1 469 ? 2.387   -60.440 47.008  1.00 61.80  ? 470 LYS A CD  1 
ATOM   3592 C CE  . LYS A 1 469 ? 0.942   -60.591 47.459  1.00 67.46  ? 470 LYS A CE  1 
ATOM   3593 N NZ  . LYS A 1 469 ? 0.877   -60.851 48.924  1.00 74.71  ? 470 LYS A NZ  1 
ATOM   3594 N N   . ILE A 1 470 ? 6.233   -60.113 43.008  1.00 42.82  ? 471 ILE A N   1 
ATOM   3595 C CA  . ILE A 1 470 ? 7.616   -59.973 42.573  1.00 47.92  ? 471 ILE A CA  1 
ATOM   3596 C C   . ILE A 1 470 ? 7.690   -59.126 41.295  1.00 52.89  ? 471 ILE A C   1 
ATOM   3597 O O   . ILE A 1 470 ? 8.548   -58.256 41.166  1.00 53.71  ? 471 ILE A O   1 
ATOM   3598 C CB  . ILE A 1 470 ? 8.256   -61.359 42.371  1.00 59.74  ? 471 ILE A CB  1 
ATOM   3599 C CG1 . ILE A 1 470 ? 8.435   -62.022 43.741  1.00 51.76  ? 471 ILE A CG1 1 
ATOM   3600 C CG2 . ILE A 1 470 ? 9.588   -61.261 41.632  1.00 41.92  ? 471 ILE A CG2 1 
ATOM   3601 C CD1 . ILE A 1 470 ? 8.759   -63.486 43.683  1.00 51.97  ? 471 ILE A CD1 1 
ATOM   3602 N N   . PHE A 1 471 ? 6.744   -59.347 40.390  1.00 45.19  ? 472 PHE A N   1 
ATOM   3603 C CA  . PHE A 1 471 ? 6.678   -58.611 39.128  1.00 49.92  ? 472 PHE A CA  1 
ATOM   3604 C C   . PHE A 1 471 ? 6.498   -57.119 39.385  1.00 49.60  ? 472 PHE A C   1 
ATOM   3605 O O   . PHE A 1 471 ? 7.218   -56.282 38.818  1.00 46.49  ? 472 PHE A O   1 
ATOM   3606 C CB  . PHE A 1 471 ? 5.539   -59.168 38.264  1.00 45.26  ? 472 PHE A CB  1 
ATOM   3607 C CG  . PHE A 1 471 ? 5.386   -58.496 36.925  1.00 52.99  ? 472 PHE A CG  1 
ATOM   3608 C CD1 . PHE A 1 471 ? 6.492   -58.180 36.151  1.00 42.31  ? 472 PHE A CD1 1 
ATOM   3609 C CD2 . PHE A 1 471 ? 4.120   -58.223 36.424  1.00 46.95  ? 472 PHE A CD2 1 
ATOM   3610 C CE1 . PHE A 1 471 ? 6.337   -57.579 34.914  1.00 48.10  ? 472 PHE A CE1 1 
ATOM   3611 C CE2 . PHE A 1 471 ? 3.956   -57.618 35.185  1.00 44.83  ? 472 PHE A CE2 1 
ATOM   3612 C CZ  . PHE A 1 471 ? 5.063   -57.303 34.424  1.00 43.48  ? 472 PHE A CZ  1 
ATOM   3613 N N   . ALA A 1 472 ? 5.544   -56.787 40.250  1.00 46.70  ? 473 ALA A N   1 
ATOM   3614 C CA  . ALA A 1 472 ? 5.299   -55.391 40.588  1.00 42.93  ? 473 ALA A CA  1 
ATOM   3615 C C   . ALA A 1 472 ? 6.572   -54.747 41.128  1.00 49.26  ? 473 ALA A C   1 
ATOM   3616 O O   . ALA A 1 472 ? 6.914   -53.619 40.756  1.00 46.13  ? 473 ALA A O   1 
ATOM   3617 C CB  . ALA A 1 472 ? 4.169   -55.275 41.586  1.00 41.97  ? 473 ALA A CB  1 
ATOM   3618 N N   . GLN A 1 473 ? 7.295   -55.479 41.970  1.00 44.00  ? 474 GLN A N   1 
ATOM   3619 C CA  . GLN A 1 473 ? 8.508   -54.942 42.572  1.00 44.64  ? 474 GLN A CA  1 
ATOM   3620 C C   . GLN A 1 473 ? 9.542   -54.636 41.505  1.00 43.03  ? 474 GLN A C   1 
ATOM   3621 O O   . GLN A 1 473 ? 10.182  -53.578 41.540  1.00 50.77  ? 474 GLN A O   1 
ATOM   3622 C CB  . GLN A 1 473 ? 9.057   -55.908 43.626  1.00 51.79  ? 474 GLN A CB  1 
ATOM   3623 C CG  . GLN A 1 473 ? 8.150   -55.953 44.844  1.00 43.67  ? 474 GLN A CG  1 
ATOM   3624 C CD  . GLN A 1 473 ? 8.559   -56.975 45.877  1.00 60.25  ? 474 GLN A CD  1 
ATOM   3625 O OE1 . GLN A 1 473 ? 8.784   -58.149 45.578  1.00 60.00  ? 474 GLN A OE1 1 
ATOM   3626 N NE2 . GLN A 1 473 ? 8.640   -56.530 47.120  1.00 47.30  ? 474 GLN A NE2 1 
ATOM   3627 N N   . ARG A 1 474 ? 9.682   -55.549 40.551  1.00 44.12  ? 475 ARG A N   1 
ATOM   3628 C CA  . ARG A 1 474 ? 10.494  -55.309 39.361  1.00 48.35  ? 475 ARG A CA  1 
ATOM   3629 C C   . ARG A 1 474 ? 10.116  -54.014 38.643  1.00 38.26  ? 475 ARG A C   1 
ATOM   3630 O O   . ARG A 1 474 ? 10.977  -53.206 38.298  1.00 44.12  ? 475 ARG A O   1 
ATOM   3631 C CB  . ARG A 1 474 ? 10.362  -56.477 38.374  1.00 52.31  ? 475 ARG A CB  1 
ATOM   3632 C CG  . ARG A 1 474 ? 11.159  -57.716 38.733  1.00 53.51  ? 475 ARG A CG  1 
ATOM   3633 C CD  . ARG A 1 474 ? 11.117  -58.761 37.598  1.00 60.47  ? 475 ARG A CD  1 
ATOM   3634 N NE  . ARG A 1 474 ? 11.458  -58.176 36.308  1.00 60.15  ? 475 ARG A NE  1 
ATOM   3635 C CZ  . ARG A 1 474 ? 10.866  -58.507 35.159  1.00 60.48  ? 475 ARG A CZ  1 
ATOM   3636 N NH1 . ARG A 1 474 ? 9.901   -59.418 35.150  1.00 49.51  ? 475 ARG A NH1 1 
ATOM   3637 N NH2 . ARG A 1 474 ? 11.232  -57.920 34.024  1.00 45.24  ? 475 ARG A NH2 1 
ATOM   3638 N N   . LEU A 1 475 ? 8.827   -53.823 38.404  1.00 37.49  ? 476 LEU A N   1 
ATOM   3639 C CA  . LEU A 1 475 ? 8.377   -52.673 37.623  1.00 39.21  ? 476 LEU A CA  1 
ATOM   3640 C C   . LEU A 1 475 ? 8.592   -51.373 38.403  1.00 44.77  ? 476 LEU A C   1 
ATOM   3641 O O   . LEU A 1 475 ? 9.018   -50.354 37.848  1.00 46.12  ? 476 LEU A O   1 
ATOM   3642 C CB  . LEU A 1 475 ? 6.913   -52.841 37.237  1.00 47.45  ? 476 LEU A CB  1 
ATOM   3643 C CG  . LEU A 1 475 ? 6.614   -53.962 36.244  1.00 47.57  ? 476 LEU A CG  1 
ATOM   3644 C CD1 . LEU A 1 475 ? 5.227   -53.795 35.675  1.00 58.11  ? 476 LEU A CD1 1 
ATOM   3645 C CD2 . LEU A 1 475 ? 7.595   -53.913 35.140  1.00 44.86  ? 476 LEU A CD2 1 
ATOM   3646 N N   . MET A 1 476 ? 8.332   -51.423 39.703  1.00 42.09  ? 477 MET A N   1 
ATOM   3647 C CA  . MET A 1 476 ? 8.599   -50.273 40.558  1.00 43.80  ? 477 MET A CA  1 
ATOM   3648 C C   . MET A 1 476 ? 10.078  -49.881 40.532  1.00 40.27  ? 477 MET A C   1 
ATOM   3649 O O   . MET A 1 476 ? 10.408  -48.686 40.518  1.00 38.21  ? 477 MET A O   1 
ATOM   3650 C CB  . MET A 1 476 ? 8.146   -50.558 41.986  1.00 45.19  ? 477 MET A CB  1 
ATOM   3651 C CG  . MET A 1 476 ? 6.638   -50.482 42.179  1.00 41.34  ? 477 MET A CG  1 
ATOM   3652 S SD  . MET A 1 476 ? 6.201   -50.436 43.932  1.00 49.57  ? 477 MET A SD  1 
ATOM   3653 C CE  . MET A 1 476 ? 6.617   -52.114 44.401  1.00 50.40  ? 477 MET A CE  1 
ATOM   3654 N N   . ARG A 1 477 ? 10.956  -50.884 40.499  1.00 41.44  ? 478 ARG A N   1 
ATOM   3655 C CA  . ARG A 1 477 ? 12.410  -50.661 40.456  1.00 39.46  ? 478 ARG A CA  1 
ATOM   3656 C C   . ARG A 1 477 ? 12.849  -50.076 39.097  1.00 46.37  ? 478 ARG A C   1 
ATOM   3657 O O   . ARG A 1 477 ? 13.625  -49.117 39.055  1.00 44.09  ? 478 ARG A O   1 
ATOM   3658 C CB  . ARG A 1 477 ? 13.154  -51.982 40.758  1.00 36.96  ? 478 ARG A CB  1 
ATOM   3659 C CG  . ARG A 1 477 ? 14.682  -51.934 40.664  1.00 42.23  ? 478 ARG A CG  1 
ATOM   3660 C CD  . ARG A 1 477 ? 15.278  -50.977 41.672  1.00 50.01  ? 478 ARG A CD  1 
ATOM   3661 N NE  . ARG A 1 477 ? 14.891  -51.357 43.026  1.00 50.97  ? 478 ARG A NE  1 
ATOM   3662 C CZ  . ARG A 1 477 ? 15.489  -52.329 43.707  1.00 58.88  ? 478 ARG A CZ  1 
ATOM   3663 N NH1 . ARG A 1 477 ? 16.495  -52.999 43.147  1.00 48.48  ? 478 ARG A NH1 1 
ATOM   3664 N NH2 . ARG A 1 477 ? 15.084  -52.634 44.935  1.00 41.67  ? 478 ARG A NH2 1 
ATOM   3665 N N   . TYR A 1 478 ? 12.352  -50.635 37.989  1.00 38.59  ? 479 TYR A N   1 
ATOM   3666 C CA  . TYR A 1 478 ? 12.657  -50.061 36.665  1.00 39.44  ? 479 TYR A CA  1 
ATOM   3667 C C   . TYR A 1 478 ? 12.270  -48.582 36.648  1.00 41.88  ? 479 TYR A C   1 
ATOM   3668 O O   . TYR A 1 478 ? 13.062  -47.718 36.254  1.00 41.98  ? 479 TYR A O   1 
ATOM   3669 C CB  . TYR A 1 478 ? 11.913  -50.786 35.540  1.00 40.84  ? 479 TYR A CB  1 
ATOM   3670 C CG  . TYR A 1 478 ? 12.366  -52.195 35.217  1.00 44.09  ? 479 TYR A CG  1 
ATOM   3671 C CD1 . TYR A 1 478 ? 13.709  -52.515 35.077  1.00 41.32  ? 479 TYR A CD1 1 
ATOM   3672 C CD2 . TYR A 1 478 ? 11.433  -53.201 35.012  1.00 45.02  ? 479 TYR A CD2 1 
ATOM   3673 C CE1 . TYR A 1 478 ? 14.109  -53.807 34.759  1.00 33.61  ? 479 TYR A CE1 1 
ATOM   3674 C CE2 . TYR A 1 478 ? 11.821  -54.485 34.714  1.00 41.01  ? 479 TYR A CE2 1 
ATOM   3675 C CZ  . TYR A 1 478 ? 13.156  -54.785 34.585  1.00 44.58  ? 479 TYR A CZ  1 
ATOM   3676 O OH  . TYR A 1 478 ? 13.517  -56.081 34.278  1.00 48.05  ? 479 TYR A OH  1 
ATOM   3677 N N   . TRP A 1 479 ? 11.046  -48.302 37.100  1.00 42.43  ? 480 TRP A N   1 
ATOM   3678 C CA  . TRP A 1 479 ? 10.503  -46.949 37.059  1.00 41.41  ? 480 TRP A CA  1 
ATOM   3679 C C   . TRP A 1 479 ? 11.298  -45.995 37.965  1.00 43.28  ? 480 TRP A C   1 
ATOM   3680 O O   . TRP A 1 479 ? 11.592  -44.871 37.584  1.00 43.05  ? 480 TRP A O   1 
ATOM   3681 C CB  . TRP A 1 479 ? 9.015   -46.966 37.447  1.00 30.67  ? 480 TRP A CB  1 
ATOM   3682 C CG  . TRP A 1 479 ? 8.061   -46.821 36.264  1.00 39.27  ? 480 TRP A CG  1 
ATOM   3683 C CD1 . TRP A 1 479 ? 7.185   -45.797 36.039  1.00 32.60  ? 480 TRP A CD1 1 
ATOM   3684 C CD2 . TRP A 1 479 ? 7.891   -47.740 35.163  1.00 37.28  ? 480 TRP A CD2 1 
ATOM   3685 N NE1 . TRP A 1 479 ? 6.493   -46.011 34.865  1.00 38.59  ? 480 TRP A NE1 1 
ATOM   3686 C CE2 . TRP A 1 479 ? 6.899   -47.198 34.313  1.00 40.79  ? 480 TRP A CE2 1 
ATOM   3687 C CE3 . TRP A 1 479 ? 8.473   -48.967 34.822  1.00 39.92  ? 480 TRP A CE3 1 
ATOM   3688 C CZ2 . TRP A 1 479 ? 6.486   -47.835 33.135  1.00 35.66  ? 480 TRP A CZ2 1 
ATOM   3689 C CZ3 . TRP A 1 479 ? 8.053   -49.608 33.641  1.00 37.58  ? 480 TRP A CZ3 1 
ATOM   3690 C CH2 . TRP A 1 479 ? 7.066   -49.035 32.822  1.00 39.22  ? 480 TRP A CH2 1 
ATOM   3691 N N   . ALA A 1 480 ? 11.667  -46.438 39.164  1.00 47.57  ? 481 ALA A N   1 
ATOM   3692 C CA  . ALA A 1 480 ? 12.400  -45.558 40.073  1.00 40.93  ? 481 ALA A CA  1 
ATOM   3693 C C   . ALA A 1 480 ? 13.862  -45.422 39.630  1.00 44.70  ? 481 ALA A C   1 
ATOM   3694 O O   . ALA A 1 480 ? 14.475  -44.353 39.779  1.00 40.71  ? 481 ALA A O   1 
ATOM   3695 C CB  . ALA A 1 480 ? 12.311  -46.074 41.496  1.00 48.67  ? 481 ALA A CB  1 
ATOM   3696 N N   . ASN A 1 481 ? 14.414  -46.506 39.084  1.00 39.15  ? 482 ASN A N   1 
ATOM   3697 C CA  . ASN A 1 481 ? 15.733  -46.446 38.469  1.00 45.16  ? 482 ASN A CA  1 
ATOM   3698 C C   . ASN A 1 481 ? 15.741  -45.344 37.426  1.00 48.45  ? 482 ASN A C   1 
ATOM   3699 O O   . ASN A 1 481 ? 16.672  -44.534 37.373  1.00 45.62  ? 482 ASN A O   1 
ATOM   3700 C CB  . ASN A 1 481 ? 16.121  -47.788 37.828  1.00 43.08  ? 482 ASN A CB  1 
ATOM   3701 C CG  . ASN A 1 481 ? 16.703  -48.769 38.834  1.00 51.28  ? 482 ASN A CG  1 
ATOM   3702 O OD1 . ASN A 1 481 ? 16.798  -48.463 40.027  1.00 49.86  ? 482 ASN A OD1 1 
ATOM   3703 N ND2 . ASN A 1 481 ? 17.090  -49.957 38.361  1.00 44.25  ? 482 ASN A ND2 1 
ATOM   3704 N N   . PHE A 1 482 ? 14.684  -45.291 36.619  1.00 39.66  ? 483 PHE A N   1 
ATOM   3705 C CA  . PHE A 1 482 ? 14.626  -44.312 35.543  1.00 40.88  ? 483 PHE A CA  1 
ATOM   3706 C C   . PHE A 1 482 ? 14.512  -42.905 36.112  1.00 47.86  ? 483 PHE A C   1 
ATOM   3707 O O   . PHE A 1 482 ? 15.163  -41.978 35.625  1.00 45.24  ? 483 PHE A O   1 
ATOM   3708 C CB  . PHE A 1 482 ? 13.458  -44.596 34.586  1.00 40.76  ? 483 PHE A CB  1 
ATOM   3709 C CG  . PHE A 1 482 ? 13.294  -43.555 33.517  1.00 35.62  ? 483 PHE A CG  1 
ATOM   3710 C CD1 . PHE A 1 482 ? 14.108  -43.568 32.391  1.00 37.20  ? 483 PHE A CD1 1 
ATOM   3711 C CD2 . PHE A 1 482 ? 12.348  -42.542 33.650  1.00 35.57  ? 483 PHE A CD2 1 
ATOM   3712 C CE1 . PHE A 1 482 ? 13.966  -42.602 31.400  1.00 38.99  ? 483 PHE A CE1 1 
ATOM   3713 C CE2 . PHE A 1 482 ? 12.207  -41.563 32.682  1.00 36.24  ? 483 PHE A CE2 1 
ATOM   3714 C CZ  . PHE A 1 482 ? 13.024  -41.584 31.556  1.00 41.38  ? 483 PHE A CZ  1 
ATOM   3715 N N   . ALA A 1 483 ? 13.680  -42.742 37.137  1.00 43.11  ? 484 ALA A N   1 
ATOM   3716 C CA  . ALA A 1 483 ? 13.509  -41.439 37.773  1.00 44.56  ? 484 ALA A CA  1 
ATOM   3717 C C   . ALA A 1 483 ? 14.820  -40.908 38.370  1.00 48.45  ? 484 ALA A C   1 
ATOM   3718 O O   . ALA A 1 483 ? 15.085  -39.711 38.337  1.00 47.19  ? 484 ALA A O   1 
ATOM   3719 C CB  . ALA A 1 483 ? 12.428  -41.524 38.852  1.00 39.29  ? 484 ALA A CB  1 
ATOM   3720 N N   . ARG A 1 484 ? 15.620  -41.804 38.936  1.00 42.82  ? 485 ARG A N   1 
ATOM   3721 C CA  . ARG A 1 484 ? 16.869  -41.432 39.594  1.00 41.36  ? 485 ARG A CA  1 
ATOM   3722 C C   . ARG A 1 484 ? 18.004  -41.145 38.613  1.00 51.53  ? 485 ARG A C   1 
ATOM   3723 O O   . ARG A 1 484 ? 18.803  -40.246 38.852  1.00 55.09  ? 485 ARG A O   1 
ATOM   3724 C CB  . ARG A 1 484 ? 17.308  -42.543 40.555  1.00 37.34  ? 485 ARG A CB  1 
ATOM   3725 C CG  . ARG A 1 484 ? 16.536  -42.567 41.855  1.00 42.01  ? 485 ARG A CG  1 
ATOM   3726 C CD  . ARG A 1 484 ? 17.054  -43.640 42.799  1.00 43.08  ? 485 ARG A CD  1 
ATOM   3727 N NE  . ARG A 1 484 ? 16.819  -45.001 42.311  1.00 45.62  ? 485 ARG A NE  1 
ATOM   3728 C CZ  . ARG A 1 484 ? 15.868  -45.807 42.777  1.00 43.80  ? 485 ARG A CZ  1 
ATOM   3729 N NH1 . ARG A 1 484 ? 15.048  -45.402 43.746  1.00 39.63  ? 485 ARG A NH1 1 
ATOM   3730 N NH2 . ARG A 1 484 ? 15.745  -47.021 42.277  1.00 44.25  ? 485 ARG A NH2 1 
ATOM   3731 N N   . THR A 1 485 ? 18.082  -41.912 37.523  1.00 44.72  ? 486 THR A N   1 
ATOM   3732 C CA  . THR A 1 485 ? 19.249  -41.862 36.626  1.00 48.49  ? 486 THR A CA  1 
ATOM   3733 C C   . THR A 1 485 ? 18.976  -41.676 35.137  1.00 42.67  ? 486 THR A C   1 
ATOM   3734 O O   . THR A 1 485 ? 19.914  -41.454 34.375  1.00 56.48  ? 486 THR A O   1 
ATOM   3735 C CB  . THR A 1 485 ? 20.083  -43.147 36.732  1.00 44.12  ? 486 THR A CB  1 
ATOM   3736 O OG1 . THR A 1 485 ? 19.327  -44.242 36.198  1.00 47.70  ? 486 THR A OG1 1 
ATOM   3737 C CG2 . THR A 1 485 ? 20.466  -43.433 38.195  1.00 45.43  ? 486 THR A CG2 1 
ATOM   3738 N N   . GLY A 1 486 ? 17.720  -41.783 34.712  1.00 51.59  ? 487 GLY A N   1 
ATOM   3739 C CA  . GLY A 1 486 ? 17.388  -41.712 33.288  1.00 43.59  ? 487 GLY A CA  1 
ATOM   3740 C C   . GLY A 1 486 ? 17.677  -43.032 32.587  1.00 43.44  ? 487 GLY A C   1 
ATOM   3741 O O   . GLY A 1 486 ? 17.760  -43.103 31.360  1.00 57.05  ? 487 GLY A O   1 
ATOM   3742 N N   . ASP A 1 487 ? 17.834  -44.087 33.380  1.00 49.35  ? 488 ASP A N   1 
ATOM   3743 C CA  . ASP A 1 487 ? 18.122  -45.415 32.856  1.00 50.83  ? 488 ASP A CA  1 
ATOM   3744 C C   . ASP A 1 487 ? 17.447  -46.428 33.773  1.00 44.40  ? 488 ASP A C   1 
ATOM   3745 O O   . ASP A 1 487 ? 17.797  -46.520 34.940  1.00 52.81  ? 488 ASP A O   1 
ATOM   3746 C CB  . ASP A 1 487 ? 19.639  -45.626 32.791  1.00 49.46  ? 488 ASP A CB  1 
ATOM   3747 C CG  . ASP A 1 487 ? 20.053  -46.965 32.199  1.00 45.77  ? 488 ASP A CG  1 
ATOM   3748 O OD1 . ASP A 1 487 ? 19.229  -47.896 32.083  1.00 53.73  ? 488 ASP A OD1 1 
ATOM   3749 O OD2 . ASP A 1 487 ? 21.254  -47.089 31.873  1.00 54.08  ? 488 ASP A OD2 1 
ATOM   3750 N N   . PRO A 1 488 ? 16.488  -47.205 33.244  1.00 45.46  ? 489 PRO A N   1 
ATOM   3751 C CA  . PRO A 1 488 ? 15.736  -48.136 34.092  1.00 42.06  ? 489 PRO A CA  1 
ATOM   3752 C C   . PRO A 1 488 ? 16.542  -49.359 34.502  1.00 42.20  ? 489 PRO A C   1 
ATOM   3753 O O   . PRO A 1 488 ? 16.127  -50.080 35.424  1.00 48.05  ? 489 PRO A O   1 
ATOM   3754 C CB  . PRO A 1 488 ? 14.558  -48.543 33.203  1.00 43.50  ? 489 PRO A CB  1 
ATOM   3755 C CG  . PRO A 1 488 ? 15.154  -48.487 31.782  1.00 41.86  ? 489 PRO A CG  1 
ATOM   3756 C CD  . PRO A 1 488 ? 16.084  -47.286 31.824  1.00 43.59  ? 489 PRO A CD  1 
ATOM   3757 N N   . ASN A 1 489 ? 17.672  -49.608 33.852  1.00 43.84  ? 490 ASN A N   1 
ATOM   3758 C CA  . ASN A 1 489 ? 18.361  -50.879 34.091  1.00 44.25  ? 490 ASN A CA  1 
ATOM   3759 C C   . ASN A 1 489 ? 18.893  -51.093 35.506  1.00 55.75  ? 490 ASN A C   1 
ATOM   3760 O O   . ASN A 1 489 ? 19.378  -50.170 36.167  1.00 52.28  ? 490 ASN A O   1 
ATOM   3761 C CB  . ASN A 1 489 ? 19.509  -51.045 33.116  1.00 48.44  ? 490 ASN A CB  1 
ATOM   3762 C CG  . ASN A 1 489 ? 19.034  -51.393 31.735  1.00 50.23  ? 490 ASN A CG  1 
ATOM   3763 O OD1 . ASN A 1 489 ? 18.758  -52.554 31.438  1.00 59.84  ? 490 ASN A OD1 1 
ATOM   3764 N ND2 . ASN A 1 489 ? 18.923  -50.390 30.880  1.00 39.96  ? 490 ASN A ND2 1 
ATOM   3765 N N   . GLU A 1 490 ? 18.767  -52.335 35.956  1.00 63.99  ? 491 GLU A N   1 
ATOM   3766 C CA  . GLU A 1 490 ? 19.513  -52.845 37.098  1.00 73.39  ? 491 GLU A CA  1 
ATOM   3767 C C   . GLU A 1 490 ? 20.915  -53.319 36.636  1.00 84.83  ? 491 GLU A C   1 
ATOM   3768 O O   . GLU A 1 490 ? 21.134  -53.511 35.429  1.00 80.60  ? 491 GLU A O   1 
ATOM   3769 C CB  . GLU A 1 490 ? 18.728  -53.989 37.751  1.00 74.09  ? 491 GLU A CB  1 
ATOM   3770 C CG  . GLU A 1 490 ? 17.552  -53.547 38.616  1.00 72.02  ? 491 GLU A CG  1 
ATOM   3771 C CD  . GLU A 1 490 ? 17.965  -53.222 40.057  1.00 76.34  ? 491 GLU A CD  1 
ATOM   3772 O OE1 . GLU A 1 490 ? 17.819  -54.109 40.927  1.00 97.46  ? 491 GLU A OE1 1 
ATOM   3773 O OE2 . GLU A 1 490 ? 18.429  -52.091 40.327  1.00 71.95  ? 491 GLU A OE2 1 
ATOM   3774 N N   . PRO A 1 491 ? 21.869  -53.496 37.581  1.00 87.07  ? 492 PRO A N   1 
ATOM   3775 C CA  . PRO A 1 491 ? 23.196  -54.071 37.280  1.00 79.72  ? 492 PRO A CA  1 
ATOM   3776 C C   . PRO A 1 491 ? 23.170  -55.409 36.509  1.00 90.90  ? 492 PRO A C   1 
ATOM   3777 O O   . PRO A 1 491 ? 22.192  -56.157 36.578  1.00 98.57  ? 492 PRO A O   1 
ATOM   3778 C CB  . PRO A 1 491 ? 23.804  -54.281 38.669  1.00 79.63  ? 492 PRO A CB  1 
ATOM   3779 C CG  . PRO A 1 491 ? 23.184  -53.210 39.512  1.00 82.44  ? 492 PRO A CG  1 
ATOM   3780 C CD  . PRO A 1 491 ? 21.786  -53.002 38.974  1.00 84.52  ? 492 PRO A CD  1 
ATOM   3781 N N   . ARG A 1 492 ? 24.254  -55.708 35.796  1.00 92.33  ? 493 ARG A N   1 
ATOM   3782 C CA  . ARG A 1 492 ? 24.334  -56.901 34.946  1.00 88.66  ? 493 ARG A CA  1 
ATOM   3783 C C   . ARG A 1 492 ? 24.386  -58.215 35.731  1.00 85.15  ? 493 ARG A C   1 
ATOM   3784 O O   . ARG A 1 492 ? 24.647  -58.222 36.935  1.00 91.52  ? 493 ARG A O   1 
ATOM   3785 C CB  . ARG A 1 492 ? 25.554  -56.789 34.035  1.00 83.77  ? 493 ARG A CB  1 
ATOM   3786 C CG  . ARG A 1 492 ? 25.720  -55.389 33.469  1.00 85.06  ? 493 ARG A CG  1 
ATOM   3787 C CD  . ARG A 1 492 ? 26.684  -55.344 32.309  1.00 78.04  ? 493 ARG A CD  1 
ATOM   3788 N NE  . ARG A 1 492 ? 26.208  -54.411 31.298  1.00 95.04  ? 493 ARG A NE  1 
ATOM   3789 C CZ  . ARG A 1 492 ? 26.354  -54.590 29.986  1.00 115.10 ? 493 ARG A CZ  1 
ATOM   3790 N NH1 . ARG A 1 492 ? 26.981  -55.673 29.532  1.00 100.67 ? 493 ARG A NH1 1 
ATOM   3791 N NH2 . ARG A 1 492 ? 25.875  -53.686 29.124  1.00 101.91 ? 493 ARG A NH2 1 
ATOM   3792 N N   . ALA A 1 496 ? 21.512  -59.977 34.864  1.00 84.02  ? 497 ALA A N   1 
ATOM   3793 C CA  . ALA A 1 496 ? 20.232  -59.457 34.356  1.00 105.33 ? 497 ALA A CA  1 
ATOM   3794 C C   . ALA A 1 496 ? 20.315  -59.061 32.876  1.00 94.08  ? 497 ALA A C   1 
ATOM   3795 O O   . ALA A 1 496 ? 21.215  -58.304 32.493  1.00 92.08  ? 497 ALA A O   1 
ATOM   3796 C CB  . ALA A 1 496 ? 19.774  -58.252 35.193  1.00 77.84  ? 497 ALA A CB  1 
ATOM   3797 N N   . PRO A 1 497 ? 19.386  -59.573 32.039  1.00 96.37  ? 498 PRO A N   1 
ATOM   3798 C CA  . PRO A 1 497 ? 19.351  -59.151 30.623  1.00 82.91  ? 498 PRO A CA  1 
ATOM   3799 C C   . PRO A 1 497 ? 19.024  -57.659 30.533  1.00 72.59  ? 498 PRO A C   1 
ATOM   3800 O O   . PRO A 1 497 ? 18.121  -57.192 31.237  1.00 72.65  ? 498 PRO A O   1 
ATOM   3801 C CB  . PRO A 1 497 ? 18.237  -60.011 30.006  1.00 74.88  ? 498 PRO A CB  1 
ATOM   3802 C CG  . PRO A 1 497 ? 18.043  -61.146 30.972  1.00 85.80  ? 498 PRO A CG  1 
ATOM   3803 C CD  . PRO A 1 497 ? 18.366  -60.590 32.344  1.00 81.31  ? 498 PRO A CD  1 
ATOM   3804 N N   . GLN A 1 498 ? 19.761  -56.918 29.712  1.00 59.62  ? 499 GLN A N   1 
ATOM   3805 C CA  . GLN A 1 498 ? 19.675  -55.469 29.746  1.00 53.33  ? 499 GLN A CA  1 
ATOM   3806 C C   . GLN A 1 498 ? 18.605  -54.923 28.809  1.00 69.47  ? 499 GLN A C   1 
ATOM   3807 O O   . GLN A 1 498 ? 18.290  -55.507 27.771  1.00 65.07  ? 499 GLN A O   1 
ATOM   3808 C CB  . GLN A 1 498 ? 21.028  -54.844 29.409  1.00 53.42  ? 499 GLN A CB  1 
ATOM   3809 C CG  . GLN A 1 498 ? 22.128  -55.166 30.422  1.00 74.92  ? 499 GLN A CG  1 
ATOM   3810 C CD  . GLN A 1 498 ? 21.940  -54.470 31.770  1.00 73.46  ? 499 GLN A CD  1 
ATOM   3811 O OE1 . GLN A 1 498 ? 22.040  -53.239 31.870  1.00 69.50  ? 499 GLN A OE1 1 
ATOM   3812 N NE2 . GLN A 1 498 ? 21.675  -55.258 32.814  1.00 70.84  ? 499 GLN A NE2 1 
ATOM   3813 N N   . TRP A 1 499 ? 18.067  -53.780 29.206  1.00 60.14  ? 500 TRP A N   1 
ATOM   3814 C CA  . TRP A 1 499 ? 17.048  -53.066 28.471  1.00 49.83  ? 500 TRP A CA  1 
ATOM   3815 C C   . TRP A 1 499 ? 17.723  -52.008 27.605  1.00 45.80  ? 500 TRP A C   1 
ATOM   3816 O O   . TRP A 1 499 ? 18.196  -51.005 28.119  1.00 51.45  ? 500 TRP A O   1 
ATOM   3817 C CB  . TRP A 1 499 ? 16.063  -52.444 29.472  1.00 43.02  ? 500 TRP A CB  1 
ATOM   3818 C CG  . TRP A 1 499 ? 14.876  -51.716 28.921  1.00 49.94  ? 500 TRP A CG  1 
ATOM   3819 C CD1 . TRP A 1 499 ? 14.684  -51.256 27.638  1.00 42.97  ? 500 TRP A CD1 1 
ATOM   3820 C CD2 . TRP A 1 499 ? 13.705  -51.355 29.655  1.00 48.39  ? 500 TRP A CD2 1 
ATOM   3821 N NE1 . TRP A 1 499 ? 13.456  -50.635 27.538  1.00 45.14  ? 500 TRP A NE1 1 
ATOM   3822 C CE2 . TRP A 1 499 ? 12.831  -50.698 28.758  1.00 43.68  ? 500 TRP A CE2 1 
ATOM   3823 C CE3 . TRP A 1 499 ? 13.302  -51.534 30.986  1.00 45.05  ? 500 TRP A CE3 1 
ATOM   3824 C CZ2 . TRP A 1 499 ? 11.583  -50.215 29.154  1.00 42.24  ? 500 TRP A CZ2 1 
ATOM   3825 C CZ3 . TRP A 1 499 ? 12.062  -51.058 31.380  1.00 43.28  ? 500 TRP A CZ3 1 
ATOM   3826 C CH2 . TRP A 1 499 ? 11.221  -50.391 30.467  1.00 46.88  ? 500 TRP A CH2 1 
ATOM   3827 N N   . PRO A 1 500 ? 17.781  -52.231 26.283  1.00 39.98  ? 501 PRO A N   1 
ATOM   3828 C CA  . PRO A 1 500 ? 18.482  -51.284 25.407  1.00 38.87  ? 501 PRO A CA  1 
ATOM   3829 C C   . PRO A 1 500 ? 17.621  -50.089 25.067  1.00 44.79  ? 501 PRO A C   1 
ATOM   3830 O O   . PRO A 1 500 ? 16.395  -50.170 25.116  1.00 46.31  ? 501 PRO A O   1 
ATOM   3831 C CB  . PRO A 1 500 ? 18.760  -52.109 24.136  1.00 43.45  ? 501 PRO A CB  1 
ATOM   3832 C CG  . PRO A 1 500 ? 17.673  -53.100 24.105  1.00 46.30  ? 501 PRO A CG  1 
ATOM   3833 C CD  . PRO A 1 500 ? 17.286  -53.403 25.541  1.00 49.54  ? 501 PRO A CD  1 
ATOM   3834 N N   . PRO A 1 501 ? 18.259  -48.974 24.726  1.00 40.84  ? 502 PRO A N   1 
ATOM   3835 C CA  . PRO A 1 501 ? 17.532  -47.806 24.240  1.00 42.29  ? 502 PRO A CA  1 
ATOM   3836 C C   . PRO A 1 501 ? 16.781  -48.097 22.937  1.00 50.12  ? 502 PRO A C   1 
ATOM   3837 O O   . PRO A 1 501 ? 17.169  -48.973 22.166  1.00 46.25  ? 502 PRO A O   1 
ATOM   3838 C CB  . PRO A 1 501 ? 18.641  -46.773 24.014  1.00 45.25  ? 502 PRO A CB  1 
ATOM   3839 C CG  . PRO A 1 501 ? 19.708  -47.168 24.969  1.00 41.01  ? 502 PRO A CG  1 
ATOM   3840 C CD  . PRO A 1 501 ? 19.667  -48.675 25.029  1.00 40.75  ? 502 PRO A CD  1 
ATOM   3841 N N   . TYR A 1 502 ? 15.699  -47.361 22.711  1.00 52.87  ? 503 TYR A N   1 
ATOM   3842 C CA  . TYR A 1 502 ? 14.933  -47.454 21.478  1.00 44.49  ? 503 TYR A CA  1 
ATOM   3843 C C   . TYR A 1 502 ? 15.503  -46.475 20.450  1.00 51.98  ? 503 TYR A C   1 
ATOM   3844 O O   . TYR A 1 502 ? 15.722  -45.301 20.759  1.00 49.38  ? 503 TYR A O   1 
ATOM   3845 C CB  . TYR A 1 502 ? 13.462  -47.157 21.745  1.00 45.79  ? 503 TYR A CB  1 
ATOM   3846 C CG  . TYR A 1 502 ? 12.574  -47.181 20.514  1.00 51.49  ? 503 TYR A CG  1 
ATOM   3847 C CD1 . TYR A 1 502 ? 12.448  -46.055 19.696  1.00 48.19  ? 503 TYR A CD1 1 
ATOM   3848 C CD2 . TYR A 1 502 ? 11.850  -48.324 20.179  1.00 41.16  ? 503 TYR A CD2 1 
ATOM   3849 C CE1 . TYR A 1 502 ? 11.654  -46.073 18.573  1.00 42.49  ? 503 TYR A CE1 1 
ATOM   3850 C CE2 . TYR A 1 502 ? 11.040  -48.349 19.060  1.00 47.47  ? 503 TYR A CE2 1 
ATOM   3851 C CZ  . TYR A 1 502 ? 10.951  -47.219 18.257  1.00 44.50  ? 503 TYR A CZ  1 
ATOM   3852 O OH  . TYR A 1 502 ? 10.149  -47.228 17.139  1.00 52.69  ? 503 TYR A OH  1 
ATOM   3853 N N   . THR A 1 503 ? 15.746  -46.958 19.231  1.00 51.54  ? 504 THR A N   1 
ATOM   3854 C CA  . THR A 1 503 ? 16.299  -46.130 18.152  1.00 52.53  ? 504 THR A CA  1 
ATOM   3855 C C   . THR A 1 503 ? 15.446  -46.246 16.879  1.00 56.27  ? 504 THR A C   1 
ATOM   3856 O O   . THR A 1 503 ? 14.837  -47.290 16.645  1.00 48.60  ? 504 THR A O   1 
ATOM   3857 C CB  . THR A 1 503 ? 17.747  -46.528 17.850  1.00 49.06  ? 504 THR A CB  1 
ATOM   3858 O OG1 . THR A 1 503 ? 17.814  -47.941 17.591  1.00 56.65  ? 504 THR A OG1 1 
ATOM   3859 C CG2 . THR A 1 503 ? 18.634  -46.211 19.048  1.00 42.82  ? 504 THR A CG2 1 
ATOM   3860 N N   . ALA A 1 504 ? 15.387  -45.183 16.071  1.00 54.89  ? 505 ALA A N   1 
ATOM   3861 C CA  . ALA A 1 504 ? 14.522  -45.193 14.884  1.00 57.44  ? 505 ALA A CA  1 
ATOM   3862 C C   . ALA A 1 504 ? 14.873  -46.335 13.934  1.00 58.59  ? 505 ALA A C   1 
ATOM   3863 O O   . ALA A 1 504 ? 13.993  -46.862 13.243  1.00 49.68  ? 505 ALA A O   1 
ATOM   3864 C CB  . ALA A 1 504 ? 14.589  -43.872 14.147  1.00 48.70  ? 505 ALA A CB  1 
ATOM   3865 N N   . GLY A 1 505 ? 16.142  -46.741 13.930  1.00 53.18  ? 506 GLY A N   1 
ATOM   3866 C CA  . GLY A 1 505 ? 16.562  -47.894 13.150  1.00 46.45  ? 506 GLY A CA  1 
ATOM   3867 C C   . GLY A 1 505 ? 16.251  -49.238 13.776  1.00 51.62  ? 506 GLY A C   1 
ATOM   3868 O O   . GLY A 1 505 ? 15.366  -49.958 13.320  1.00 56.38  ? 506 GLY A O   1 
ATOM   3869 N N   . ALA A 1 506 ? 16.986  -49.593 14.822  1.00 55.18  ? 507 ALA A N   1 
ATOM   3870 C CA  . ALA A 1 506 ? 16.843  -50.918 15.419  1.00 48.03  ? 507 ALA A CA  1 
ATOM   3871 C C   . ALA A 1 506 ? 15.467  -51.123 16.062  1.00 55.63  ? 507 ALA A C   1 
ATOM   3872 O O   . ALA A 1 506 ? 14.962  -52.250 16.108  1.00 52.40  ? 507 ALA A O   1 
ATOM   3873 C CB  . ALA A 1 506 ? 17.952  -51.159 16.444  1.00 40.25  ? 507 ALA A CB  1 
ATOM   3874 N N   . GLN A 1 507 ? 14.872  -50.040 16.563  1.00 44.55  ? 508 GLN A N   1 
ATOM   3875 C CA  . GLN A 1 507 ? 13.535  -50.104 17.159  1.00 52.13  ? 508 GLN A CA  1 
ATOM   3876 C C   . GLN A 1 507 ? 13.378  -51.166 18.263  1.00 51.41  ? 508 GLN A C   1 
ATOM   3877 O O   . GLN A 1 507 ? 12.392  -51.891 18.301  1.00 53.29  ? 508 GLN A O   1 
ATOM   3878 C CB  . GLN A 1 507 ? 12.492  -50.370 16.065  1.00 49.52  ? 508 GLN A CB  1 
ATOM   3879 C CG  . GLN A 1 507 ? 12.325  -49.246 15.052  1.00 51.57  ? 508 GLN A CG  1 
ATOM   3880 C CD  . GLN A 1 507 ? 11.677  -49.731 13.745  1.00 54.55  ? 508 GLN A CD  1 
ATOM   3881 O OE1 . GLN A 1 507 ? 10.468  -49.916 13.666  1.00 50.26  ? 508 GLN A OE1 1 
ATOM   3882 N NE2 . GLN A 1 507 ? 12.493  -49.944 12.727  1.00 50.06  ? 508 GLN A NE2 1 
ATOM   3883 N N   . GLN A 1 508 ? 14.343  -51.283 19.159  1.00 40.62  ? 509 GLN A N   1 
ATOM   3884 C CA  . GLN A 1 508 ? 14.231  -52.307 20.193  1.00 46.39  ? 509 GLN A CA  1 
ATOM   3885 C C   . GLN A 1 508 ? 13.393  -51.853 21.409  1.00 47.93  ? 509 GLN A C   1 
ATOM   3886 O O   . GLN A 1 508 ? 13.382  -50.687 21.783  1.00 42.61  ? 509 GLN A O   1 
ATOM   3887 C CB  . GLN A 1 508 ? 15.621  -52.732 20.635  1.00 53.24  ? 509 GLN A CB  1 
ATOM   3888 C CG  . GLN A 1 508 ? 16.429  -53.358 19.524  1.00 54.92  ? 509 GLN A CG  1 
ATOM   3889 C CD  . GLN A 1 508 ? 17.856  -53.601 19.933  1.00 54.24  ? 509 GLN A CD  1 
ATOM   3890 O OE1 . GLN A 1 508 ? 18.618  -52.655 20.149  1.00 53.08  ? 509 GLN A OE1 1 
ATOM   3891 N NE2 . GLN A 1 508 ? 18.228  -54.870 20.059  1.00 54.01  ? 509 GLN A NE2 1 
ATOM   3892 N N   . TYR A 1 509 ? 12.679  -52.791 22.005  1.00 44.45  ? 510 TYR A N   1 
ATOM   3893 C CA  . TYR A 1 509 ? 11.872  -52.531 23.189  1.00 45.56  ? 510 TYR A CA  1 
ATOM   3894 C C   . TYR A 1 509 ? 11.898  -53.824 23.974  1.00 47.02  ? 510 TYR A C   1 
ATOM   3895 O O   . TYR A 1 509 ? 12.353  -54.845 23.444  1.00 40.83  ? 510 TYR A O   1 
ATOM   3896 C CB  . TYR A 1 509 ? 10.443  -52.139 22.824  1.00 46.02  ? 510 TYR A CB  1 
ATOM   3897 C CG  . TYR A 1 509 ? 9.669   -53.247 22.141  1.00 45.46  ? 510 TYR A CG  1 
ATOM   3898 C CD1 . TYR A 1 509 ? 9.742   -53.431 20.752  1.00 50.79  ? 510 TYR A CD1 1 
ATOM   3899 C CD2 . TYR A 1 509 ? 8.859   -54.108 22.878  1.00 42.53  ? 510 TYR A CD2 1 
ATOM   3900 C CE1 . TYR A 1 509 ? 9.010   -54.456 20.115  1.00 45.88  ? 510 TYR A CE1 1 
ATOM   3901 C CE2 . TYR A 1 509 ? 8.150   -55.129 22.260  1.00 48.86  ? 510 TYR A CE2 1 
ATOM   3902 C CZ  . TYR A 1 509 ? 8.223   -55.298 20.883  1.00 51.93  ? 510 TYR A CZ  1 
ATOM   3903 O OH  . TYR A 1 509 ? 7.509   -56.313 20.302  1.00 55.33  ? 510 TYR A OH  1 
ATOM   3904 N N   . VAL A 1 510 ? 11.428  -53.806 25.218  1.00 40.26  ? 511 VAL A N   1 
ATOM   3905 C CA  . VAL A 1 510 ? 11.384  -55.047 25.985  1.00 41.12  ? 511 VAL A CA  1 
ATOM   3906 C C   . VAL A 1 510 ? 9.952   -55.418 26.306  1.00 41.35  ? 511 VAL A C   1 
ATOM   3907 O O   . VAL A 1 510 ? 9.078   -54.552 26.378  1.00 46.14  ? 511 VAL A O   1 
ATOM   3908 C CB  . VAL A 1 510 ? 12.194  -54.948 27.288  1.00 49.42  ? 511 VAL A CB  1 
ATOM   3909 C CG1 . VAL A 1 510 ? 13.646  -54.660 26.973  1.00 44.96  ? 511 VAL A CG1 1 
ATOM   3910 C CG2 . VAL A 1 510 ? 11.612  -53.858 28.211  1.00 37.16  ? 511 VAL A CG2 1 
ATOM   3911 N N   . SER A 1 511 ? 9.706   -56.709 26.491  1.00 45.09  ? 512 SER A N   1 
ATOM   3912 C CA  . SER A 1 511 ? 8.412   -57.163 26.984  1.00 45.84  ? 512 SER A CA  1 
ATOM   3913 C C   . SER A 1 511 ? 8.435   -57.197 28.508  1.00 48.29  ? 512 SER A C   1 
ATOM   3914 O O   . SER A 1 511 ? 9.354   -57.737 29.107  1.00 47.17  ? 512 SER A O   1 
ATOM   3915 C CB  . SER A 1 511 ? 8.073   -58.544 26.434  1.00 47.52  ? 512 SER A CB  1 
ATOM   3916 O OG  . SER A 1 511 ? 9.094   -59.466 26.768  1.00 62.62  ? 512 SER A OG  1 
ATOM   3917 N N   . LEU A 1 512 ? 7.426   -56.611 29.129  1.00 48.67  ? 513 LEU A N   1 
ATOM   3918 C CA  . LEU A 1 512 ? 7.302   -56.655 30.568  1.00 45.41  ? 513 LEU A CA  1 
ATOM   3919 C C   . LEU A 1 512 ? 6.242   -57.686 30.930  1.00 43.54  ? 513 LEU A C   1 
ATOM   3920 O O   . LEU A 1 512 ? 5.048   -57.477 30.690  1.00 46.80  ? 513 LEU A O   1 
ATOM   3921 C CB  . LEU A 1 512 ? 6.948   -55.270 31.118  1.00 46.20  ? 513 LEU A CB  1 
ATOM   3922 C CG  . LEU A 1 512 ? 7.959   -54.157 30.837  1.00 49.64  ? 513 LEU A CG  1 
ATOM   3923 C CD1 . LEU A 1 512 ? 7.476   -52.805 31.399  1.00 34.86  ? 513 LEU A CD1 1 
ATOM   3924 C CD2 . LEU A 1 512 ? 9.330   -54.529 31.401  1.00 38.13  ? 513 LEU A CD2 1 
ATOM   3925 N N   . ASP A 1 513 ? 6.681   -58.822 31.459  1.00 44.48  ? 514 ASP A N   1 
ATOM   3926 C CA  . ASP A 1 513 ? 5.760   -59.850 31.949  1.00 55.98  ? 514 ASP A CA  1 
ATOM   3927 C C   . ASP A 1 513 ? 6.459   -60.644 33.043  1.00 54.98  ? 514 ASP A C   1 
ATOM   3928 O O   . ASP A 1 513 ? 7.490   -60.207 33.545  1.00 60.36  ? 514 ASP A O   1 
ATOM   3929 C CB  . ASP A 1 513 ? 5.265   -60.773 30.814  1.00 48.22  ? 514 ASP A CB  1 
ATOM   3930 C CG  . ASP A 1 513 ? 6.403   -61.435 30.026  1.00 63.17  ? 514 ASP A CG  1 
ATOM   3931 O OD1 . ASP A 1 513 ? 7.536   -61.573 30.545  1.00 63.04  ? 514 ASP A OD1 1 
ATOM   3932 O OD2 . ASP A 1 513 ? 6.152   -61.831 28.868  1.00 69.34  ? 514 ASP A OD2 1 
ATOM   3933 N N   . LEU A 1 514 ? 5.919   -61.805 33.399  1.00 55.76  ? 515 LEU A N   1 
ATOM   3934 C CA  . LEU A 1 514 ? 6.480   -62.590 34.500  1.00 55.85  ? 515 LEU A CA  1 
ATOM   3935 C C   . LEU A 1 514 ? 7.837   -63.186 34.158  1.00 56.66  ? 515 LEU A C   1 
ATOM   3936 O O   . LEU A 1 514 ? 8.624   -63.493 35.051  1.00 66.34  ? 515 LEU A O   1 
ATOM   3937 C CB  . LEU A 1 514 ? 5.526   -63.702 34.906  1.00 50.25  ? 515 LEU A CB  1 
ATOM   3938 C CG  . LEU A 1 514 ? 4.154   -63.234 35.374  1.00 52.92  ? 515 LEU A CG  1 
ATOM   3939 C CD1 . LEU A 1 514 ? 3.353   -64.398 35.896  1.00 57.47  ? 515 LEU A CD1 1 
ATOM   3940 C CD2 . LEU A 1 514 ? 4.324   -62.194 36.448  1.00 46.16  ? 515 LEU A CD2 1 
ATOM   3941 N N   . ARG A 1 515 ? 8.114   -63.340 32.868  1.00 62.24  ? 516 ARG A N   1 
ATOM   3942 C CA  . ARG A 1 515 ? 9.409   -63.847 32.417  1.00 59.51  ? 516 ARG A CA  1 
ATOM   3943 C C   . ARG A 1 515 ? 10.449  -62.729 32.477  1.00 56.35  ? 516 ARG A C   1 
ATOM   3944 O O   . ARG A 1 515 ? 10.089  -61.558 32.516  1.00 57.70  ? 516 ARG A O   1 
ATOM   3945 C CB  . ARG A 1 515 ? 9.311   -64.396 30.990  1.00 51.88  ? 516 ARG A CB  1 
ATOM   3946 C CG  . ARG A 1 515 ? 8.199   -65.404 30.761  1.00 66.99  ? 516 ARG A CG  1 
ATOM   3947 C CD  . ARG A 1 515 ? 8.063   -65.769 29.269  1.00 75.12  ? 516 ARG A CD  1 
ATOM   3948 N NE  . ARG A 1 515 ? 7.791   -64.600 28.420  1.00 82.90  ? 516 ARG A NE  1 
ATOM   3949 C CZ  . ARG A 1 515 ? 8.671   -64.034 27.584  1.00 87.76  ? 516 ARG A CZ  1 
ATOM   3950 N NH1 . ARG A 1 515 ? 9.903   -64.523 27.457  1.00 84.44  ? 516 ARG A NH1 1 
ATOM   3951 N NH2 . ARG A 1 515 ? 8.320   -62.971 26.864  1.00 76.53  ? 516 ARG A NH2 1 
ATOM   3952 N N   . PRO A 1 516 ? 11.743  -63.077 32.463  1.00 59.26  ? 517 PRO A N   1 
ATOM   3953 C CA  . PRO A 1 516 ? 12.776  -62.044 32.308  1.00 56.99  ? 517 PRO A CA  1 
ATOM   3954 C C   . PRO A 1 516 ? 12.642  -61.227 31.022  1.00 61.80  ? 517 PRO A C   1 
ATOM   3955 O O   . PRO A 1 516 ? 12.044  -61.698 30.047  1.00 57.60  ? 517 PRO A O   1 
ATOM   3956 C CB  . PRO A 1 516 ? 14.078  -62.852 32.282  1.00 59.54  ? 517 PRO A CB  1 
ATOM   3957 C CG  . PRO A 1 516 ? 13.750  -64.096 33.048  1.00 63.85  ? 517 PRO A CG  1 
ATOM   3958 C CD  . PRO A 1 516 ? 12.330  -64.412 32.669  1.00 53.82  ? 517 PRO A CD  1 
ATOM   3959 N N   . LEU A 1 517 ? 13.212  -60.023 31.029  1.00 54.05  ? 518 LEU A N   1 
ATOM   3960 C CA  . LEU A 1 517 ? 13.168  -59.136 29.875  1.00 47.94  ? 518 LEU A CA  1 
ATOM   3961 C C   . LEU A 1 517 ? 13.592  -59.839 28.609  1.00 60.48  ? 518 LEU A C   1 
ATOM   3962 O O   . LEU A 1 517 ? 14.678  -60.418 28.534  1.00 60.55  ? 518 LEU A O   1 
ATOM   3963 C CB  . LEU A 1 517 ? 14.066  -57.918 30.076  1.00 53.66  ? 518 LEU A CB  1 
ATOM   3964 C CG  . LEU A 1 517 ? 13.694  -56.911 31.156  1.00 52.87  ? 518 LEU A CG  1 
ATOM   3965 C CD1 . LEU A 1 517 ? 14.593  -55.699 31.049  1.00 48.61  ? 518 LEU A CD1 1 
ATOM   3966 C CD2 . LEU A 1 517 ? 12.233  -56.521 31.053  1.00 59.14  ? 518 LEU A CD2 1 
ATOM   3967 N N   . GLU A 1 518 ? 12.717  -59.785 27.616  1.00 60.05  ? 519 GLU A N   1 
ATOM   3968 C CA  . GLU A 1 518 ? 13.027  -60.251 26.287  1.00 57.97  ? 519 GLU A CA  1 
ATOM   3969 C C   . GLU A 1 518 ? 13.100  -59.025 25.393  1.00 53.17  ? 519 GLU A C   1 
ATOM   3970 O O   . GLU A 1 518 ? 12.194  -58.202 25.403  1.00 60.99  ? 519 GLU A O   1 
ATOM   3971 C CB  . GLU A 1 518 ? 11.966  -61.245 25.806  1.00 67.35  ? 519 GLU A CB  1 
ATOM   3972 C CG  . GLU A 1 518 ? 12.250  -61.855 24.437  1.00 85.87  ? 519 GLU A CG  1 
ATOM   3973 C CD  . GLU A 1 518 ? 11.153  -62.805 23.968  1.00 93.26  ? 519 GLU A CD  1 
ATOM   3974 O OE1 . GLU A 1 518 ? 9.976   -62.384 23.878  1.00 85.08  ? 519 GLU A OE1 1 
ATOM   3975 O OE2 . GLU A 1 518 ? 11.473  -63.979 23.685  1.00 111.35 ? 519 GLU A OE2 1 
ATOM   3976 N N   . VAL A 1 519 ? 14.193  -58.874 24.653  1.00 52.36  ? 520 VAL A N   1 
ATOM   3977 C CA  . VAL A 1 519 ? 14.351  -57.741 23.740  1.00 43.12  ? 520 VAL A CA  1 
ATOM   3978 C C   . VAL A 1 519 ? 13.754  -58.052 22.362  1.00 54.00  ? 520 VAL A C   1 
ATOM   3979 O O   . VAL A 1 519 ? 14.001  -59.112 21.792  1.00 54.20  ? 520 VAL A O   1 
ATOM   3980 C CB  . VAL A 1 519 ? 15.836  -57.361 23.597  1.00 51.37  ? 520 VAL A CB  1 
ATOM   3981 C CG1 . VAL A 1 519 ? 16.028  -56.277 22.543  1.00 46.40  ? 520 VAL A CG1 1 
ATOM   3982 C CG2 . VAL A 1 519 ? 16.403  -56.912 24.956  1.00 50.05  ? 520 VAL A CG2 1 
ATOM   3983 N N   . ARG A 1 520 ? 12.953  -57.131 21.833  1.00 55.52  ? 521 ARG A N   1 
ATOM   3984 C CA  . ARG A 1 520 ? 12.284  -57.332 20.551  1.00 51.06  ? 521 ARG A CA  1 
ATOM   3985 C C   . ARG A 1 520 ? 12.422  -56.097 19.690  1.00 52.36  ? 521 ARG A C   1 
ATOM   3986 O O   . ARG A 1 520 ? 12.873  -55.055 20.174  1.00 52.19  ? 521 ARG A O   1 
ATOM   3987 C CB  . ARG A 1 520 ? 10.813  -57.658 20.752  1.00 52.94  ? 521 ARG A CB  1 
ATOM   3988 C CG  . ARG A 1 520 ? 10.574  -58.917 21.534  1.00 55.35  ? 521 ARG A CG  1 
ATOM   3989 C CD  . ARG A 1 520 ? 9.097   -59.241 21.571  1.00 50.55  ? 521 ARG A CD  1 
ATOM   3990 N NE  . ARG A 1 520 ? 8.833   -60.319 22.513  1.00 65.61  ? 521 ARG A NE  1 
ATOM   3991 C CZ  . ARG A 1 520 ? 7.716   -60.418 23.218  1.00 65.33  ? 521 ARG A CZ  1 
ATOM   3992 N NH1 . ARG A 1 520 ? 6.768   -59.496 23.076  1.00 63.90  ? 521 ARG A NH1 1 
ATOM   3993 N NH2 . ARG A 1 520 ? 7.549   -61.431 24.052  1.00 63.10  ? 521 ARG A NH2 1 
ATOM   3994 N N   . ARG A 1 521 ? 12.030  -56.216 18.422  1.00 50.07  ? 522 ARG A N   1 
ATOM   3995 C CA  . ARG A 1 521 ? 12.177  -55.125 17.455  1.00 50.66  ? 522 ARG A CA  1 
ATOM   3996 C C   . ARG A 1 521 ? 10.832  -54.673 16.875  1.00 49.71  ? 522 ARG A C   1 
ATOM   3997 O O   . ARG A 1 521 ? 10.017  -55.493 16.459  1.00 60.47  ? 522 ARG A O   1 
ATOM   3998 C CB  . ARG A 1 521 ? 13.095  -55.538 16.298  1.00 52.29  ? 522 ARG A CB  1 
ATOM   3999 C CG  . ARG A 1 521 ? 14.559  -55.663 16.629  1.00 58.54  ? 522 ARG A CG  1 
ATOM   4000 C CD  . ARG A 1 521 ? 15.398  -55.788 15.347  1.00 57.51  ? 522 ARG A CD  1 
ATOM   4001 N NE  . ARG A 1 521 ? 15.466  -54.515 14.629  1.00 62.04  ? 522 ARG A NE  1 
ATOM   4002 C CZ  . ARG A 1 521 ? 15.238  -54.363 13.324  1.00 69.01  ? 522 ARG A CZ  1 
ATOM   4003 N NH1 . ARG A 1 521 ? 14.937  -55.424 12.577  1.00 55.84  ? 522 ARG A NH1 1 
ATOM   4004 N NH2 . ARG A 1 521 ? 15.321  -53.148 12.770  1.00 52.23  ? 522 ARG A NH2 1 
ATOM   4005 N N   . GLY A 1 522 ? 10.617  -53.365 16.838  1.00 51.31  ? 523 GLY A N   1 
ATOM   4006 C CA  . GLY A 1 522 ? 9.469   -52.795 16.158  1.00 51.40  ? 523 GLY A CA  1 
ATOM   4007 C C   . GLY A 1 522 ? 8.158   -52.782 16.916  1.00 44.11  ? 523 GLY A C   1 
ATOM   4008 O O   . GLY A 1 522 ? 7.592   -53.824 17.234  1.00 53.10  ? 523 GLY A O   1 
ATOM   4009 N N   . LEU A 1 523 ? 7.668   -51.582 17.193  1.00 48.81  ? 524 LEU A N   1 
ATOM   4010 C CA  . LEU A 1 523 ? 6.364   -51.395 17.806  1.00 51.58  ? 524 LEU A CA  1 
ATOM   4011 C C   . LEU A 1 523 ? 5.273   -51.392 16.730  1.00 48.56  ? 524 LEU A C   1 
ATOM   4012 O O   . LEU A 1 523 ? 4.861   -50.321 16.257  1.00 50.10  ? 524 LEU A O   1 
ATOM   4013 C CB  . LEU A 1 523 ? 6.328   -50.075 18.594  1.00 42.91  ? 524 LEU A CB  1 
ATOM   4014 C CG  . LEU A 1 523 ? 7.256   -49.950 19.798  1.00 49.08  ? 524 LEU A CG  1 
ATOM   4015 C CD1 . LEU A 1 523 ? 7.301   -48.519 20.310  1.00 39.66  ? 524 LEU A CD1 1 
ATOM   4016 C CD2 . LEU A 1 523 ? 6.793   -50.874 20.883  1.00 38.51  ? 524 LEU A CD2 1 
ATOM   4017 N N   . ARG A 1 524 ? 4.800   -52.577 16.357  1.00 50.94  ? 525 ARG A N   1 
ATOM   4018 C CA  . ARG A 1 524 ? 3.875   -52.716 15.237  1.00 47.79  ? 525 ARG A CA  1 
ATOM   4019 C C   . ARG A 1 524 ? 4.378   -51.907 14.023  1.00 47.46  ? 525 ARG A C   1 
ATOM   4020 O O   . ARG A 1 524 ? 3.650   -51.076 13.459  1.00 43.57  ? 525 ARG A O   1 
ATOM   4021 C CB  . ARG A 1 524 ? 2.469   -52.267 15.652  1.00 42.59  ? 525 ARG A CB  1 
ATOM   4022 C CG  . ARG A 1 524 ? 2.003   -52.869 16.972  1.00 66.44  ? 525 ARG A CG  1 
ATOM   4023 C CD  . ARG A 1 524 ? 0.977   -53.991 16.833  1.00 54.46  ? 525 ARG A CD  1 
ATOM   4024 N NE  . ARG A 1 524 ? -0.110  -53.666 15.916  1.00 79.99  ? 525 ARG A NE  1 
ATOM   4025 C CZ  . ARG A 1 524 ? -0.528  -54.476 14.940  1.00 77.90  ? 525 ARG A CZ  1 
ATOM   4026 N NH1 . ARG A 1 524 ? 0.041   -55.666 14.769  1.00 68.90  ? 525 ARG A NH1 1 
ATOM   4027 N NH2 . ARG A 1 524 ? -1.518  -54.102 14.141  1.00 49.72  ? 525 ARG A NH2 1 
ATOM   4028 N N   . ALA A 1 525 ? 5.636   -52.132 13.653  1.00 45.16  ? 526 ALA A N   1 
ATOM   4029 C CA  . ALA A 1 525 ? 6.287   -51.365 12.578  1.00 52.57  ? 526 ALA A CA  1 
ATOM   4030 C C   . ALA A 1 525 ? 5.521   -51.353 11.246  1.00 51.84  ? 526 ALA A C   1 
ATOM   4031 O O   . ALA A 1 525 ? 5.376   -50.291 10.627  1.00 50.76  ? 526 ALA A O   1 
ATOM   4032 C CB  . ALA A 1 525 ? 7.696   -51.883 12.349  1.00 50.97  ? 526 ALA A CB  1 
ATOM   4033 N N   . GLN A 1 526 ? 5.029   -52.507 10.800  1.00 44.75  ? 527 GLN A N   1 
ATOM   4034 C CA  . GLN A 1 526 ? 4.297   -52.530 9.526   1.00 50.70  ? 527 GLN A CA  1 
ATOM   4035 C C   . GLN A 1 526 ? 3.019   -51.723 9.627   1.00 43.83  ? 527 GLN A C   1 
ATOM   4036 O O   . GLN A 1 526 ? 2.728   -50.885 8.770   1.00 54.09  ? 527 GLN A O   1 
ATOM   4037 C CB  . GLN A 1 526 ? 3.979   -53.964 9.092   1.00 44.69  ? 527 GLN A CB  1 
ATOM   4038 C CG  . GLN A 1 526 ? 5.201   -54.737 8.643   1.00 48.45  ? 527 GLN A CG  1 
ATOM   4039 C CD  . GLN A 1 526 ? 5.904   -54.069 7.466   1.00 51.43  ? 527 GLN A CD  1 
ATOM   4040 O OE1 . GLN A 1 526 ? 7.044   -53.615 7.581   1.00 56.31  ? 527 GLN A OE1 1 
ATOM   4041 N NE2 . GLN A 1 526 ? 5.225   -54.012 6.324   1.00 60.06  ? 527 GLN A NE2 1 
ATOM   4042 N N   . ALA A 1 527 ? 2.260   -51.965 10.687  1.00 51.59  ? 528 ALA A N   1 
ATOM   4043 C CA  . ALA A 1 527 ? 1.000   -51.261 10.877  1.00 44.11  ? 528 ALA A CA  1 
ATOM   4044 C C   . ALA A 1 527 ? 1.232   -49.757 10.993  1.00 43.79  ? 528 ALA A C   1 
ATOM   4045 O O   . ALA A 1 527 ? 0.537   -48.961 10.377  1.00 55.53  ? 528 ALA A O   1 
ATOM   4046 C CB  . ALA A 1 527 ? 0.277   -51.796 12.118  1.00 53.85  ? 528 ALA A CB  1 
ATOM   4047 N N   . CYS A 1 528 ? 2.238   -49.363 11.759  1.00 40.46  ? 529 CYS A N   1 
ATOM   4048 C CA  . CYS A 1 528 ? 2.450   -47.942 12.027  1.00 40.24  ? 529 CYS A CA  1 
ATOM   4049 C C   . CYS A 1 528 ? 3.033   -47.185 10.825  1.00 50.70  ? 529 CYS A C   1 
ATOM   4050 O O   . CYS A 1 528 ? 2.842   -45.965 10.703  1.00 47.67  ? 529 CYS A O   1 
ATOM   4051 C CB  . CYS A 1 528 ? 3.322   -47.786 13.283  1.00 39.72  ? 529 CYS A CB  1 
ATOM   4052 S SG  . CYS A 1 528 ? 2.397   -48.321 14.813  1.00 50.70  ? 529 CYS A SG  1 
ATOM   4053 N N   . ALA A 1 529 ? 3.716   -47.900 9.927   1.00 44.59  ? 530 ALA A N   1 
ATOM   4054 C CA  . ALA A 1 529 ? 4.044   -47.323 8.617   1.00 43.49  ? 530 ALA A CA  1 
ATOM   4055 C C   . ALA A 1 529 ? 2.779   -46.829 7.944   1.00 37.77  ? 530 ALA A C   1 
ATOM   4056 O O   . ALA A 1 529 ? 2.749   -45.731 7.391   1.00 50.87  ? 530 ALA A O   1 
ATOM   4057 C CB  . ALA A 1 529 ? 4.753   -48.328 7.743   1.00 40.79  ? 530 ALA A CB  1 
ATOM   4058 N N   . PHE A 1 530 ? 1.712   -47.616 8.028   1.00 42.20  ? 531 PHE A N   1 
ATOM   4059 C CA  . PHE A 1 530 ? 0.452   -47.199 7.411   1.00 45.55  ? 531 PHE A CA  1 
ATOM   4060 C C   . PHE A 1 530 ? -0.043  -45.900 8.041   1.00 50.41  ? 531 PHE A C   1 
ATOM   4061 O O   . PHE A 1 530 ? -0.282  -44.929 7.338   1.00 48.19  ? 531 PHE A O   1 
ATOM   4062 C CB  . PHE A 1 530 ? -0.620  -48.295 7.520   1.00 41.64  ? 531 PHE A CB  1 
ATOM   4063 C CG  . PHE A 1 530 ? -1.998  -47.823 7.153   1.00 49.13  ? 531 PHE A CG  1 
ATOM   4064 C CD1 . PHE A 1 530 ? -2.362  -47.668 5.824   1.00 50.97  ? 531 PHE A CD1 1 
ATOM   4065 C CD2 . PHE A 1 530 ? -2.922  -47.503 8.132   1.00 45.96  ? 531 PHE A CD2 1 
ATOM   4066 C CE1 . PHE A 1 530 ? -3.620  -47.212 5.477   1.00 49.10  ? 531 PHE A CE1 1 
ATOM   4067 C CE2 . PHE A 1 530 ? -4.179  -47.034 7.795   1.00 52.29  ? 531 PHE A CE2 1 
ATOM   4068 C CZ  . PHE A 1 530 ? -4.532  -46.895 6.466   1.00 59.43  ? 531 PHE A CZ  1 
ATOM   4069 N N   . TRP A 1 531 ? -0.163  -45.866 9.369   1.00 41.79  ? 532 TRP A N   1 
ATOM   4070 C CA  . TRP A 1 531 ? -0.741  -44.704 10.040  1.00 41.15  ? 532 TRP A CA  1 
ATOM   4071 C C   . TRP A 1 531 ? 0.167   -43.500 10.022  1.00 45.77  ? 532 TRP A C   1 
ATOM   4072 O O   . TRP A 1 531 ? -0.304  -42.369 9.894   1.00 49.09  ? 532 TRP A O   1 
ATOM   4073 C CB  . TRP A 1 531 ? -1.102  -45.046 11.493  1.00 35.64  ? 532 TRP A CB  1 
ATOM   4074 C CG  . TRP A 1 531 ? -2.141  -46.113 11.580  1.00 38.39  ? 532 TRP A CG  1 
ATOM   4075 C CD1 . TRP A 1 531 ? -1.943  -47.454 11.810  1.00 41.83  ? 532 TRP A CD1 1 
ATOM   4076 C CD2 . TRP A 1 531 ? -3.542  -45.937 11.403  1.00 34.63  ? 532 TRP A CD2 1 
ATOM   4077 N NE1 . TRP A 1 531 ? -3.149  -48.119 11.794  1.00 33.65  ? 532 TRP A NE1 1 
ATOM   4078 C CE2 . TRP A 1 531 ? -4.147  -47.207 11.553  1.00 38.69  ? 532 TRP A CE2 1 
ATOM   4079 C CE3 . TRP A 1 531 ? -4.353  -44.822 11.127  1.00 42.70  ? 532 TRP A CE3 1 
ATOM   4080 C CZ2 . TRP A 1 531 ? -5.526  -47.390 11.458  1.00 44.63  ? 532 TRP A CZ2 1 
ATOM   4081 C CZ3 . TRP A 1 531 ? -5.729  -45.004 11.027  1.00 32.01  ? 532 TRP A CZ3 1 
ATOM   4082 C CH2 . TRP A 1 531 ? -6.298  -46.278 11.193  1.00 43.05  ? 532 TRP A CH2 1 
ATOM   4083 N N   . ASN A 1 532 ? 1.469   -43.733 10.155  1.00 41.78  ? 533 ASN A N   1 
ATOM   4084 C CA  . ASN A 1 532 ? 2.403   -42.633 10.342  1.00 44.79  ? 533 ASN A CA  1 
ATOM   4085 C C   . ASN A 1 532 ? 3.015   -42.119 9.047   1.00 55.19  ? 533 ASN A C   1 
ATOM   4086 O O   . ASN A 1 532 ? 3.330   -40.935 8.953   1.00 58.75  ? 533 ASN A O   1 
ATOM   4087 C CB  . ASN A 1 532 ? 3.502   -43.056 11.320  1.00 45.84  ? 533 ASN A CB  1 
ATOM   4088 C CG  . ASN A 1 532 ? 2.976   -43.203 12.753  1.00 46.54  ? 533 ASN A CG  1 
ATOM   4089 O OD1 . ASN A 1 532 ? 1.978   -42.587 13.109  1.00 47.49  ? 533 ASN A OD1 1 
ATOM   4090 N ND2 . ASN A 1 532 ? 3.641   -44.022 13.565  1.00 39.43  ? 533 ASN A ND2 1 
ATOM   4091 N N   . ARG A 1 533 ? 3.166   -42.987 8.044   1.00 48.97  ? 534 ARG A N   1 
ATOM   4092 C CA  . ARG A 1 533 ? 3.816   -42.566 6.798   1.00 58.42  ? 534 ARG A CA  1 
ATOM   4093 C C   . ARG A 1 533 ? 2.859   -42.360 5.622   1.00 56.52  ? 534 ARG A C   1 
ATOM   4094 O O   . ARG A 1 533 ? 2.928   -41.348 4.942   1.00 65.66  ? 534 ARG A O   1 
ATOM   4095 C CB  . ARG A 1 533 ? 4.892   -43.571 6.413   1.00 55.40  ? 534 ARG A CB  1 
ATOM   4096 C CG  . ARG A 1 533 ? 6.075   -43.566 7.372   1.00 54.45  ? 534 ARG A CG  1 
ATOM   4097 C CD  . ARG A 1 533 ? 7.035   -44.707 7.074   1.00 63.87  ? 534 ARG A CD  1 
ATOM   4098 N NE  . ARG A 1 533 ? 7.909   -44.968 8.211   1.00 64.66  ? 534 ARG A NE  1 
ATOM   4099 C CZ  . ARG A 1 533 ? 9.085   -44.380 8.397   1.00 67.32  ? 534 ARG A CZ  1 
ATOM   4100 N NH1 . ARG A 1 533 ? 9.535   -43.501 7.506   1.00 56.79  ? 534 ARG A NH1 1 
ATOM   4101 N NH2 . ARG A 1 533 ? 9.808   -44.673 9.480   1.00 66.45  ? 534 ARG A NH2 1 
ATOM   4102 N N   . PHE A 1 534 ? 1.964   -43.310 5.386   1.00 64.05  ? 535 PHE A N   1 
ATOM   4103 C CA  . PHE A 1 534 ? 1.094   -43.218 4.228   1.00 63.31  ? 535 PHE A CA  1 
ATOM   4104 C C   . PHE A 1 534 ? -0.141  -42.343 4.419   1.00 66.41  ? 535 PHE A C   1 
ATOM   4105 O O   . PHE A 1 534 ? -0.341  -41.375 3.699   1.00 69.59  ? 535 PHE A O   1 
ATOM   4106 C CB  . PHE A 1 534 ? 0.624   -44.596 3.775   1.00 57.87  ? 535 PHE A CB  1 
ATOM   4107 C CG  . PHE A 1 534 ? -0.298  -44.524 2.593   1.00 62.22  ? 535 PHE A CG  1 
ATOM   4108 C CD1 . PHE A 1 534 ? 0.141   -43.950 1.400   1.00 67.96  ? 535 PHE A CD1 1 
ATOM   4109 C CD2 . PHE A 1 534 ? -1.607  -44.976 2.675   1.00 66.71  ? 535 PHE A CD2 1 
ATOM   4110 C CE1 . PHE A 1 534 ? -0.704  -43.850 0.288   1.00 59.35  ? 535 PHE A CE1 1 
ATOM   4111 C CE2 . PHE A 1 534 ? -2.465  -44.876 1.573   1.00 73.13  ? 535 PHE A CE2 1 
ATOM   4112 C CZ  . PHE A 1 534 ? -2.008  -44.311 0.377   1.00 60.35  ? 535 PHE A CZ  1 
ATOM   4113 N N   . LEU A 1 535 ? -0.986  -42.703 5.371   1.00 65.88  ? 536 LEU A N   1 
ATOM   4114 C CA  . LEU A 1 535 ? -2.249  -41.998 5.564   1.00 65.57  ? 536 LEU A CA  1 
ATOM   4115 C C   . LEU A 1 535 ? -2.198  -40.457 5.582   1.00 75.41  ? 536 LEU A C   1 
ATOM   4116 O O   . LEU A 1 535 ? -3.134  -39.826 5.089   1.00 77.30  ? 536 LEU A O   1 
ATOM   4117 C CB  . LEU A 1 535 ? -2.898  -42.480 6.850   1.00 64.39  ? 536 LEU A CB  1 
ATOM   4118 C CG  . LEU A 1 535 ? -4.410  -42.605 6.773   1.00 71.71  ? 536 LEU A CG  1 
ATOM   4119 C CD1 . LEU A 1 535 ? -4.796  -43.455 5.575   1.00 66.96  ? 536 LEU A CD1 1 
ATOM   4120 C CD2 . LEU A 1 535 ? -4.887  -43.250 8.035   1.00 63.96  ? 536 LEU A CD2 1 
ATOM   4121 N N   . PRO A 1 536 ? -1.130  -39.844 6.154   1.00 75.47  ? 537 PRO A N   1 
ATOM   4122 C CA  . PRO A 1 536 ? -1.042  -38.377 6.053   1.00 74.20  ? 537 PRO A CA  1 
ATOM   4123 C C   . PRO A 1 536 ? -0.939  -37.843 4.617   1.00 83.32  ? 537 PRO A C   1 
ATOM   4124 O O   . PRO A 1 536 ? -1.521  -36.793 4.325   1.00 71.80  ? 537 PRO A O   1 
ATOM   4125 C CB  . PRO A 1 536 ? 0.241   -38.048 6.827   1.00 75.96  ? 537 PRO A CB  1 
ATOM   4126 C CG  . PRO A 1 536 ? 0.399   -39.162 7.795   1.00 68.06  ? 537 PRO A CG  1 
ATOM   4127 C CD  . PRO A 1 536 ? -0.097  -40.382 7.064   1.00 73.68  ? 537 PRO A CD  1 
ATOM   4128 N N   . LYS A 1 537 ? -0.199  -38.542 3.753   1.00 79.17  ? 538 LYS A N   1 
ATOM   4129 C CA  . LYS A 1 537 ? -0.064  -38.173 2.337   1.00 72.29  ? 538 LYS A CA  1 
ATOM   4130 C C   . LYS A 1 537 ? -1.417  -38.158 1.618   1.00 81.75  ? 538 LYS A C   1 
ATOM   4131 O O   . LYS A 1 537 ? -1.662  -37.343 0.724   1.00 83.85  ? 538 LYS A O   1 
ATOM   4132 C CB  . LYS A 1 537 ? 0.889   -39.137 1.628   1.00 68.84  ? 538 LYS A CB  1 
ATOM   4133 C CG  . LYS A 1 537 ? 2.330   -39.020 2.082   1.00 66.85  ? 538 LYS A CG  1 
ATOM   4134 C CD  . LYS A 1 537 ? 3.250   -39.972 1.319   1.00 69.73  ? 538 LYS A CD  1 
ATOM   4135 C CE  . LYS A 1 537 ? 4.711   -39.580 1.525   1.00 80.68  ? 538 LYS A CE  1 
ATOM   4136 N NZ  . LYS A 1 537 ? 5.057   -39.392 2.976   1.00 75.59  ? 538 LYS A NZ  1 
ATOM   4137 N N   . LEU A 1 538 ? -2.286  -39.073 2.026   1.00 76.12  ? 539 LEU A N   1 
ATOM   4138 C CA  . LEU A 1 538 ? -3.613  -39.220 1.455   1.00 73.44  ? 539 LEU A CA  1 
ATOM   4139 C C   . LEU A 1 538 ? -4.494  -38.013 1.756   1.00 82.58  ? 539 LEU A C   1 
ATOM   4140 O O   . LEU A 1 538 ? -5.100  -37.437 0.851   1.00 100.42 ? 539 LEU A O   1 
ATOM   4141 C CB  . LEU A 1 538 ? -4.247  -40.506 1.988   1.00 69.78  ? 539 LEU A CB  1 
ATOM   4142 C CG  . LEU A 1 538 ? -5.699  -40.882 1.716   1.00 75.46  ? 539 LEU A CG  1 
ATOM   4143 C CD1 . LEU A 1 538 ? -5.824  -42.389 1.770   1.00 69.93  ? 539 LEU A CD1 1 
ATOM   4144 C CD2 . LEU A 1 538 ? -6.633  -40.252 2.741   1.00 88.91  ? 539 LEU A CD2 1 
ATOM   4145 N N   . LEU A 1 539 ? -4.560  -37.635 3.030   1.00 92.56  ? 540 LEU A N   1 
ATOM   4146 C CA  . LEU A 1 539 ? -5.428  -36.545 3.483   1.00 93.01  ? 540 LEU A CA  1 
ATOM   4147 C C   . LEU A 1 539 ? -5.023  -35.186 2.887   1.00 90.01  ? 540 LEU A C   1 
ATOM   4148 O O   . LEU A 1 539 ? -5.811  -34.237 2.907   1.00 108.24 ? 540 LEU A O   1 
ATOM   4149 C CB  . LEU A 1 539 ? -5.438  -36.477 5.018   1.00 86.39  ? 540 LEU A CB  1 
ATOM   4150 C CG  . LEU A 1 539 ? -5.917  -37.740 5.761   1.00 89.74  ? 540 LEU A CG  1 
ATOM   4151 C CD1 . LEU A 1 539 ? -5.706  -37.599 7.257   1.00 89.70  ? 540 LEU A CD1 1 
ATOM   4152 C CD2 . LEU A 1 539 ? -7.383  -38.083 5.471   1.00 86.47  ? 540 LEU A CD2 1 
ATOM   4153 N N   . SER A 1 540 ? -3.807  -35.099 2.350   1.00 89.36  ? 541 SER A N   1 
ATOM   4154 C CA  . SER A 1 540 ? -3.366  -33.908 1.618   1.00 98.50  ? 541 SER A CA  1 
ATOM   4155 C C   . SER A 1 540 ? -4.223  -33.626 0.372   1.00 104.28 ? 541 SER A C   1 
ATOM   4156 O O   . SER A 1 540 ? -4.549  -34.530 -0.410  1.00 92.29  ? 541 SER A O   1 
ATOM   4157 C CB  . SER A 1 540 ? -1.897  -34.048 1.211   1.00 93.29  ? 541 SER A CB  1 
ATOM   4158 O OG  . SER A 1 540 ? -1.071  -34.210 2.350   1.00 90.58  ? 541 SER A OG  1 
ATOM   4159 N N   . ARG B 1 2   ? 6.476   -91.445 -56.167 1.00 79.44  ? 3   ARG B N   1 
ATOM   4160 C CA  . ARG B 1 2   ? 6.062   -90.095 -56.550 1.00 89.72  ? 3   ARG B CA  1 
ATOM   4161 C C   . ARG B 1 2   ? 5.614   -89.228 -55.349 1.00 94.57  ? 3   ARG B C   1 
ATOM   4162 O O   . ARG B 1 2   ? 6.347   -88.328 -54.927 1.00 93.81  ? 3   ARG B O   1 
ATOM   4163 C CB  . ARG B 1 2   ? 4.940   -90.165 -57.594 1.00 91.34  ? 3   ARG B CB  1 
ATOM   4164 C CG  . ARG B 1 2   ? 4.601   -88.820 -58.213 1.00 90.27  ? 3   ARG B CG  1 
ATOM   4165 C CD  . ARG B 1 2   ? 3.174   -88.795 -58.724 1.00 98.09  ? 3   ARG B CD  1 
ATOM   4166 N NE  . ARG B 1 2   ? 3.086   -89.191 -60.127 1.00 106.39 ? 3   ARG B NE  1 
ATOM   4167 C CZ  . ARG B 1 2   ? 2.093   -89.918 -60.640 1.00 115.75 ? 3   ARG B CZ  1 
ATOM   4168 N NH1 . ARG B 1 2   ? 1.103   -90.340 -59.853 1.00 99.26  ? 3   ARG B NH1 1 
ATOM   4169 N NH2 . ARG B 1 2   ? 2.091   -90.229 -61.940 1.00 100.28 ? 3   ARG B NH2 1 
ATOM   4170 N N   . GLU B 1 3   ? 4.425   -89.490 -54.800 1.00 83.51  ? 4   GLU B N   1 
ATOM   4171 C CA  . GLU B 1 3   ? 3.876   -88.657 -53.720 1.00 90.75  ? 4   GLU B CA  1 
ATOM   4172 C C   . GLU B 1 3   ? 3.392   -89.480 -52.492 1.00 94.34  ? 4   GLU B C   1 
ATOM   4173 O O   . GLU B 1 3   ? 3.176   -90.690 -52.596 1.00 87.28  ? 4   GLU B O   1 
ATOM   4174 C CB  . GLU B 1 3   ? 2.734   -87.792 -54.275 1.00 82.57  ? 4   GLU B CB  1 
ATOM   4175 C CG  . GLU B 1 3   ? 2.469   -86.490 -53.491 1.00 102.02 ? 4   GLU B CG  1 
ATOM   4176 C CD  . GLU B 1 3   ? 3.212   -85.255 -54.032 1.00 98.00  ? 4   GLU B CD  1 
ATOM   4177 O OE1 . GLU B 1 3   ? 3.793   -84.506 -53.213 1.00 85.16  ? 4   GLU B OE1 1 
ATOM   4178 O OE2 . GLU B 1 3   ? 3.192   -85.016 -55.263 1.00 77.68  ? 4   GLU B OE2 1 
ATOM   4179 N N   . ASP B 1 4   ? 3.240   -88.828 -51.332 1.00 86.96  ? 5   ASP B N   1 
ATOM   4180 C CA  . ASP B 1 4   ? 2.744   -89.497 -50.112 1.00 79.07  ? 5   ASP B CA  1 
ATOM   4181 C C   . ASP B 1 4   ? 1.440   -88.859 -49.630 1.00 68.57  ? 5   ASP B C   1 
ATOM   4182 O O   . ASP B 1 4   ? 1.407   -87.692 -49.254 1.00 66.13  ? 5   ASP B O   1 
ATOM   4183 C CB  . ASP B 1 4   ? 3.803   -89.470 -49.002 1.00 64.06  ? 5   ASP B CB  1 
ATOM   4184 C CG  . ASP B 1 4   ? 3.277   -89.977 -47.647 1.00 78.87  ? 5   ASP B CG  1 
ATOM   4185 O OD1 . ASP B 1 4   ? 2.105   -90.397 -47.531 1.00 79.85  ? 5   ASP B OD1 1 
ATOM   4186 O OD2 . ASP B 1 4   ? 4.063   -89.973 -46.674 1.00 66.75  ? 5   ASP B OD2 1 
ATOM   4187 N N   . ALA B 1 5   ? 0.379   -89.660 -49.610 1.00 65.99  ? 6   ALA B N   1 
ATOM   4188 C CA  . ALA B 1 5   ? -0.970  -89.159 -49.372 1.00 74.82  ? 6   ALA B CA  1 
ATOM   4189 C C   . ALA B 1 5   ? -1.132  -88.488 -48.012 1.00 71.21  ? 6   ALA B C   1 
ATOM   4190 O O   . ALA B 1 5   ? -1.945  -87.571 -47.871 1.00 75.56  ? 6   ALA B O   1 
ATOM   4191 C CB  . ALA B 1 5   ? -1.976  -90.283 -49.513 1.00 77.55  ? 6   ALA B CB  1 
ATOM   4192 N N   . GLU B 1 6   ? -0.372  -88.943 -47.015 1.00 63.28  ? 7   GLU B N   1 
ATOM   4193 C CA  . GLU B 1 6   ? -0.472  -88.374 -45.667 1.00 73.51  ? 7   GLU B CA  1 
ATOM   4194 C C   . GLU B 1 6   ? -0.124  -86.891 -45.684 1.00 71.61  ? 7   GLU B C   1 
ATOM   4195 O O   . GLU B 1 6   ? -0.763  -86.087 -44.986 1.00 60.63  ? 7   GLU B O   1 
ATOM   4196 C CB  . GLU B 1 6   ? 0.434   -89.118 -44.680 1.00 69.00  ? 7   GLU B CB  1 
ATOM   4197 C CG  . GLU B 1 6   ? -0.150  -90.440 -44.179 1.00 86.61  ? 7   GLU B CG  1 
ATOM   4198 C CD  . GLU B 1 6   ? -1.479  -90.266 -43.439 1.00 91.72  ? 7   GLU B CD  1 
ATOM   4199 O OE1 . GLU B 1 6   ? -1.545  -89.414 -42.528 1.00 87.72  ? 7   GLU B OE1 1 
ATOM   4200 O OE2 . GLU B 1 6   ? -2.459  -90.974 -43.769 1.00 87.24  ? 7   GLU B OE2 1 
ATOM   4201 N N   . LEU B 1 7   ? 0.863   -86.538 -46.512 1.00 59.97  ? 8   LEU B N   1 
ATOM   4202 C CA  . LEU B 1 7   ? 1.373   -85.172 -46.595 1.00 49.49  ? 8   LEU B CA  1 
ATOM   4203 C C   . LEU B 1 7   ? 0.597   -84.273 -47.550 1.00 43.57  ? 8   LEU B C   1 
ATOM   4204 O O   . LEU B 1 7   ? 1.038   -83.165 -47.839 1.00 51.27  ? 8   LEU B O   1 
ATOM   4205 C CB  . LEU B 1 7   ? 2.846   -85.188 -46.999 1.00 42.34  ? 8   LEU B CB  1 
ATOM   4206 C CG  . LEU B 1 7   ? 3.732   -86.054 -46.096 1.00 53.97  ? 8   LEU B CG  1 
ATOM   4207 C CD1 . LEU B 1 7   ? 5.200   -85.913 -46.486 1.00 54.79  ? 8   LEU B CD1 1 
ATOM   4208 C CD2 . LEU B 1 7   ? 3.553   -85.721 -44.619 1.00 54.28  ? 8   LEU B CD2 1 
ATOM   4209 N N   . LEU B 1 8   ? -0.555  -84.737 -48.028 1.00 52.05  ? 9   LEU B N   1 
ATOM   4210 C CA  . LEU B 1 8   ? -1.382  -83.949 -48.941 1.00 53.00  ? 9   LEU B CA  1 
ATOM   4211 C C   . LEU B 1 8   ? -2.739  -83.711 -48.334 1.00 50.74  ? 9   LEU B C   1 
ATOM   4212 O O   . LEU B 1 8   ? -3.347  -84.639 -47.794 1.00 58.31  ? 9   LEU B O   1 
ATOM   4213 C CB  . LEU B 1 8   ? -1.562  -84.645 -50.300 1.00 47.96  ? 9   LEU B CB  1 
ATOM   4214 C CG  . LEU B 1 8   ? -0.336  -84.809 -51.182 1.00 66.18  ? 9   LEU B CG  1 
ATOM   4215 C CD1 . LEU B 1 8   ? -0.752  -85.485 -52.476 1.00 65.78  ? 9   LEU B CD1 1 
ATOM   4216 C CD2 . LEU B 1 8   ? 0.303   -83.466 -51.472 1.00 58.43  ? 9   LEU B CD2 1 
ATOM   4217 N N   . VAL B 1 9   ? -3.233  -82.481 -48.456 1.00 39.21  ? 10  VAL B N   1 
ATOM   4218 C CA  . VAL B 1 9   ? -4.492  -82.098 -47.836 1.00 49.19  ? 10  VAL B CA  1 
ATOM   4219 C C   . VAL B 1 9   ? -5.100  -81.011 -48.671 1.00 39.15  ? 10  VAL B C   1 
ATOM   4220 O O   . VAL B 1 9   ? -4.379  -80.205 -49.244 1.00 49.64  ? 10  VAL B O   1 
ATOM   4221 C CB  . VAL B 1 9   ? -4.294  -81.589 -46.357 1.00 54.33  ? 10  VAL B CB  1 
ATOM   4222 C CG1 . VAL B 1 9   ? -5.563  -81.003 -45.796 1.00 52.40  ? 10  VAL B CG1 1 
ATOM   4223 C CG2 . VAL B 1 9   ? -3.847  -82.703 -45.466 1.00 47.43  ? 10  VAL B CG2 1 
ATOM   4224 N N   . THR B 1 10  ? -6.421  -80.975 -48.736 1.00 44.67  ? 11  THR B N   1 
ATOM   4225 C CA  . THR B 1 10  ? -7.097  -79.921 -49.449 1.00 51.58  ? 11  THR B CA  1 
ATOM   4226 C C   . THR B 1 10  ? -7.918  -79.107 -48.479 1.00 52.13  ? 11  THR B C   1 
ATOM   4227 O O   . THR B 1 10  ? -8.737  -79.654 -47.746 1.00 51.27  ? 11  THR B O   1 
ATOM   4228 C CB  . THR B 1 10  ? -8.002  -80.490 -50.562 1.00 52.68  ? 11  THR B CB  1 
ATOM   4229 O OG1 . THR B 1 10  ? -7.181  -81.161 -51.519 1.00 56.22  ? 11  THR B OG1 1 
ATOM   4230 C CG2 . THR B 1 10  ? -8.773  -79.386 -51.246 1.00 39.58  ? 11  THR B CG2 1 
ATOM   4231 N N   . VAL B 1 11  ? -7.682  -77.802 -48.483 1.00 52.24  ? 12  VAL B N   1 
ATOM   4232 C CA  . VAL B 1 11  ? -8.396  -76.874 -47.617 1.00 56.45  ? 12  VAL B CA  1 
ATOM   4233 C C   . VAL B 1 11  ? -9.198  -76.016 -48.560 1.00 56.28  ? 12  VAL B C   1 
ATOM   4234 O O   . VAL B 1 11  ? -9.029  -76.160 -49.764 1.00 53.98  ? 12  VAL B O   1 
ATOM   4235 C CB  . VAL B 1 11  ? -7.439  -76.037 -46.751 1.00 56.98  ? 12  VAL B CB  1 
ATOM   4236 C CG1 . VAL B 1 11  ? -6.744  -76.940 -45.733 1.00 38.34  ? 12  VAL B CG1 1 
ATOM   4237 C CG2 . VAL B 1 11  ? -6.403  -75.340 -47.633 1.00 51.09  ? 12  VAL B CG2 1 
ATOM   4238 N N   . ARG B 1 12  ? -10.064 -75.142 -48.053 1.00 50.39  ? 13  ARG B N   1 
ATOM   4239 C CA  . ARG B 1 12  ? -10.979 -74.432 -48.954 1.00 55.19  ? 13  ARG B CA  1 
ATOM   4240 C C   . ARG B 1 12  ? -10.272 -73.636 -50.039 1.00 52.27  ? 13  ARG B C   1 
ATOM   4241 O O   . ARG B 1 12  ? -10.842 -73.401 -51.089 1.00 54.98  ? 13  ARG B O   1 
ATOM   4242 C CB  . ARG B 1 12  ? -11.912 -73.500 -48.180 1.00 44.49  ? 13  ARG B CB  1 
ATOM   4243 C CG  . ARG B 1 12  ? -13.030 -74.270 -47.512 1.00 69.77  ? 13  ARG B CG  1 
ATOM   4244 C CD  . ARG B 1 12  ? -14.181 -73.399 -47.040 1.00 82.49  ? 13  ARG B CD  1 
ATOM   4245 N NE  . ARG B 1 12  ? -14.791 -73.985 -45.844 1.00 90.22  ? 13  ARG B NE  1 
ATOM   4246 C CZ  . ARG B 1 12  ? -15.957 -73.608 -45.327 1.00 90.36  ? 13  ARG B CZ  1 
ATOM   4247 N NH1 . ARG B 1 12  ? -16.662 -72.645 -45.910 1.00 92.46  ? 13  ARG B NH1 1 
ATOM   4248 N NH2 . ARG B 1 12  ? -16.421 -74.202 -44.232 1.00 79.74  ? 13  ARG B NH2 1 
ATOM   4249 N N   . GLY B 1 13  ? -9.030  -73.236 -49.792 1.00 50.85  ? 14  GLY B N   1 
ATOM   4250 C CA  . GLY B 1 13  ? -8.350  -72.317 -50.678 1.00 49.30  ? 14  GLY B CA  1 
ATOM   4251 C C   . GLY B 1 13  ? -7.589  -73.016 -51.790 1.00 56.11  ? 14  GLY B C   1 
ATOM   4252 O O   . GLY B 1 13  ? -7.164  -72.394 -52.771 1.00 46.66  ? 14  GLY B O   1 
ATOM   4253 N N   . GLY B 1 14  ? -7.411  -74.321 -51.637 1.00 47.36  ? 15  GLY B N   1 
ATOM   4254 C CA  . GLY B 1 14  ? -6.594  -75.061 -52.569 1.00 44.39  ? 15  GLY B CA  1 
ATOM   4255 C C   . GLY B 1 14  ? -5.847  -76.179 -51.893 1.00 53.39  ? 15  GLY B C   1 
ATOM   4256 O O   . GLY B 1 14  ? -6.126  -76.526 -50.738 1.00 51.68  ? 15  GLY B O   1 
ATOM   4257 N N   . ARG B 1 15  ? -4.888  -76.738 -52.623 1.00 48.72  ? 16  ARG B N   1 
ATOM   4258 C CA  . ARG B 1 15  ? -4.151  -77.906 -52.170 1.00 51.56  ? 16  ARG B CA  1 
ATOM   4259 C C   . ARG B 1 15  ? -2.835  -77.547 -51.480 1.00 45.16  ? 16  ARG B C   1 
ATOM   4260 O O   . ARG B 1 15  ? -2.180  -76.574 -51.867 1.00 46.56  ? 16  ARG B O   1 
ATOM   4261 C CB  . ARG B 1 15  ? -3.873  -78.838 -53.352 1.00 55.61  ? 16  ARG B CB  1 
ATOM   4262 C CG  . ARG B 1 15  ? -5.055  -79.682 -53.787 1.00 64.45  ? 16  ARG B CG  1 
ATOM   4263 C CD  . ARG B 1 15  ? -4.648  -80.606 -54.926 1.00 59.95  ? 16  ARG B CD  1 
ATOM   4264 N NE  . ARG B 1 15  ? -4.441  -79.849 -56.154 1.00 67.26  ? 16  ARG B NE  1 
ATOM   4265 C CZ  . ARG B 1 15  ? -3.592  -80.194 -57.121 1.00 73.90  ? 16  ARG B CZ  1 
ATOM   4266 N NH1 . ARG B 1 15  ? -2.851  -81.295 -57.001 1.00 67.62  ? 16  ARG B NH1 1 
ATOM   4267 N NH2 . ARG B 1 15  ? -3.481  -79.434 -58.207 1.00 61.34  ? 16  ARG B NH2 1 
ATOM   4268 N N   . LEU B 1 16  ? -2.444  -78.380 -50.512 1.00 40.72  ? 17  LEU B N   1 
ATOM   4269 C CA  . LEU B 1 16  ? -1.221  -78.202 -49.723 1.00 47.60  ? 17  LEU B CA  1 
ATOM   4270 C C   . LEU B 1 16  ? -0.412  -79.472 -49.656 1.00 46.47  ? 17  LEU B C   1 
ATOM   4271 O O   . LEU B 1 16  ? -0.955  -80.573 -49.614 1.00 46.67  ? 17  LEU B O   1 
ATOM   4272 C CB  . LEU B 1 16  ? -1.533  -77.772 -48.278 1.00 47.13  ? 17  LEU B CB  1 
ATOM   4273 C CG  . LEU B 1 16  ? -2.410  -76.549 -48.031 1.00 36.54  ? 17  LEU B CG  1 
ATOM   4274 C CD1 . LEU B 1 16  ? -2.991  -76.585 -46.610 1.00 46.42  ? 17  LEU B CD1 1 
ATOM   4275 C CD2 . LEU B 1 16  ? -1.591  -75.298 -48.226 1.00 38.16  ? 17  LEU B CD2 1 
ATOM   4276 N N   . ARG B 1 17  ? 0.893   -79.298 -49.558 1.00 42.86  ? 18  ARG B N   1 
ATOM   4277 C CA  . ARG B 1 17  ? 1.818   -80.397 -49.363 1.00 47.37  ? 18  ARG B CA  1 
ATOM   4278 C C   . ARG B 1 17  ? 2.643   -80.108 -48.106 1.00 42.56  ? 18  ARG B C   1 
ATOM   4279 O O   . ARG B 1 17  ? 3.174   -79.002 -47.954 1.00 41.87  ? 18  ARG B O   1 
ATOM   4280 C CB  . ARG B 1 17  ? 2.718   -80.547 -50.610 1.00 43.41  ? 18  ARG B CB  1 
ATOM   4281 C CG  . ARG B 1 17  ? 3.883   -81.495 -50.476 1.00 44.60  ? 18  ARG B CG  1 
ATOM   4282 C CD  . ARG B 1 17  ? 4.786   -81.444 -51.720 1.00 54.96  ? 18  ARG B CD  1 
ATOM   4283 N NE  . ARG B 1 17  ? 4.054   -81.789 -52.940 1.00 57.96  ? 18  ARG B NE  1 
ATOM   4284 C CZ  . ARG B 1 17  ? 3.789   -80.946 -53.941 1.00 64.61  ? 18  ARG B CZ  1 
ATOM   4285 N NH1 . ARG B 1 17  ? 4.211   -79.680 -53.924 1.00 53.04  ? 18  ARG B NH1 1 
ATOM   4286 N NH2 . ARG B 1 17  ? 3.106   -81.383 -54.989 1.00 62.29  ? 18  ARG B NH2 1 
ATOM   4287 N N   . GLY B 1 18  ? 2.765   -81.085 -47.213 1.00 44.79  ? 19  GLY B N   1 
ATOM   4288 C CA  . GLY B 1 18  ? 3.498   -80.887 -45.972 1.00 40.46  ? 19  GLY B CA  1 
ATOM   4289 C C   . GLY B 1 18  ? 4.745   -81.747 -45.896 1.00 49.30  ? 19  GLY B C   1 
ATOM   4290 O O   . GLY B 1 18  ? 5.171   -82.327 -46.892 1.00 53.44  ? 19  GLY B O   1 
ATOM   4291 N N   . ILE B 1 19  ? 5.335   -81.798 -44.707 1.00 39.99  ? 20  ILE B N   1 
ATOM   4292 C CA  . ILE B 1 19  ? 6.489   -82.624 -44.400 1.00 40.25  ? 20  ILE B CA  1 
ATOM   4293 C C   . ILE B 1 19  ? 6.186   -83.627 -43.274 1.00 53.84  ? 20  ILE B C   1 
ATOM   4294 O O   . ILE B 1 19  ? 5.375   -83.360 -42.378 1.00 49.62  ? 20  ILE B O   1 
ATOM   4295 C CB  . ILE B 1 19  ? 7.698   -81.774 -43.950 1.00 54.97  ? 20  ILE B CB  1 
ATOM   4296 C CG1 . ILE B 1 19  ? 7.289   -80.826 -42.824 1.00 51.48  ? 20  ILE B CG1 1 
ATOM   4297 C CG2 . ILE B 1 19  ? 8.215   -80.923 -45.041 1.00 50.08  ? 20  ILE B CG2 1 
ATOM   4298 C CD1 . ILE B 1 19  ? 8.428   -79.984 -42.359 1.00 57.60  ? 20  ILE B CD1 1 
ATOM   4299 N N   . ARG B 1 20  ? 6.863   -84.768 -43.315 1.00 53.87  ? 21  ARG B N   1 
ATOM   4300 C CA  . ARG B 1 20  ? 6.822   -85.748 -42.244 1.00 53.99  ? 21  ARG B CA  1 
ATOM   4301 C C   . ARG B 1 20  ? 7.953   -85.465 -41.262 1.00 59.68  ? 21  ARG B C   1 
ATOM   4302 O O   . ARG B 1 20  ? 9.119   -85.444 -41.642 1.00 55.30  ? 21  ARG B O   1 
ATOM   4303 C CB  . ARG B 1 20  ? 6.943   -87.161 -42.802 1.00 57.88  ? 21  ARG B CB  1 
ATOM   4304 C CG  . ARG B 1 20  ? 7.175   -88.251 -41.776 1.00 63.84  ? 21  ARG B CG  1 
ATOM   4305 C CD  . ARG B 1 20  ? 7.737   -89.482 -42.480 1.00 69.98  ? 21  ARG B CD  1 
ATOM   4306 N NE  . ARG B 1 20  ? 7.238   -90.746 -41.940 1.00 74.19  ? 21  ARG B NE  1 
ATOM   4307 C CZ  . ARG B 1 20  ? 7.950   -91.561 -41.165 1.00 77.53  ? 21  ARG B CZ  1 
ATOM   4308 N NH1 . ARG B 1 20  ? 9.200   -91.248 -40.839 1.00 77.16  ? 21  ARG B NH1 1 
ATOM   4309 N NH2 . ARG B 1 20  ? 7.416   -92.693 -40.719 1.00 79.87  ? 21  ARG B NH2 1 
ATOM   4310 N N   . LEU B 1 21  ? 7.593   -85.234 -40.003 1.00 57.94  ? 22  LEU B N   1 
ATOM   4311 C CA  . LEU B 1 21  ? 8.542   -84.835 -38.977 1.00 53.91  ? 22  LEU B CA  1 
ATOM   4312 C C   . LEU B 1 21  ? 8.936   -85.995 -38.102 1.00 53.86  ? 22  LEU B C   1 
ATOM   4313 O O   . LEU B 1 21  ? 8.062   -86.722 -37.620 1.00 61.16  ? 22  LEU B O   1 
ATOM   4314 C CB  . LEU B 1 21  ? 7.951   -83.742 -38.088 1.00 53.86  ? 22  LEU B CB  1 
ATOM   4315 C CG  . LEU B 1 21  ? 7.937   -82.321 -38.614 1.00 54.23  ? 22  LEU B CG  1 
ATOM   4316 C CD1 . LEU B 1 21  ? 7.627   -81.364 -37.462 1.00 60.28  ? 22  LEU B CD1 1 
ATOM   4317 C CD2 . LEU B 1 21  ? 9.289   -82.031 -39.216 1.00 48.01  ? 22  LEU B CD2 1 
ATOM   4318 N N   . LYS B 1 22  ? 10.239  -86.150 -37.866 1.00 52.02  ? 23  LYS B N   1 
ATOM   4319 C CA  . LYS B 1 22  ? 10.723  -87.114 -36.874 1.00 60.29  ? 23  LYS B CA  1 
ATOM   4320 C C   . LYS B 1 22  ? 10.661  -86.543 -35.459 1.00 62.26  ? 23  LYS B C   1 
ATOM   4321 O O   . LYS B 1 22  ? 11.177  -85.458 -35.205 1.00 65.35  ? 23  LYS B O   1 
ATOM   4322 C CB  . LYS B 1 22  ? 12.158  -87.547 -37.189 1.00 58.71  ? 23  LYS B CB  1 
ATOM   4323 C CG  . LYS B 1 22  ? 12.314  -88.144 -38.572 1.00 64.85  ? 23  LYS B CG  1 
ATOM   4324 C CD  . LYS B 1 22  ? 13.624  -88.908 -38.759 1.00 71.12  ? 23  LYS B CD  1 
ATOM   4325 C CE  . LYS B 1 22  ? 13.719  -89.425 -40.191 1.00 77.57  ? 23  LYS B CE  1 
ATOM   4326 N NZ  . LYS B 1 22  ? 14.833  -90.389 -40.411 1.00 84.19  ? 23  LYS B NZ  1 
ATOM   4327 N N   . THR B 1 23  ? 10.008  -87.272 -34.554 1.00 63.06  ? 24  THR B N   1 
ATOM   4328 C CA  . THR B 1 23  ? 10.066  -86.997 -33.112 1.00 70.64  ? 24  THR B CA  1 
ATOM   4329 C C   . THR B 1 23  ? 10.497  -88.273 -32.379 1.00 64.69  ? 24  THR B C   1 
ATOM   4330 O O   . THR B 1 23  ? 10.227  -89.377 -32.855 1.00 67.34  ? 24  THR B O   1 
ATOM   4331 C CB  . THR B 1 23  ? 8.702   -86.523 -32.538 1.00 61.12  ? 24  THR B CB  1 
ATOM   4332 O OG1 . THR B 1 23  ? 7.917   -87.665 -32.168 1.00 63.29  ? 24  THR B OG1 1 
ATOM   4333 C CG2 . THR B 1 23  ? 7.929   -85.691 -33.563 1.00 63.66  ? 24  THR B CG2 1 
ATOM   4334 N N   . PRO B 1 24  ? 11.154  -88.130 -31.215 1.00 70.71  ? 25  PRO B N   1 
ATOM   4335 C CA  . PRO B 1 24  ? 11.588  -89.288 -30.417 1.00 71.08  ? 25  PRO B CA  1 
ATOM   4336 C C   . PRO B 1 24  ? 10.506  -90.353 -30.229 1.00 65.90  ? 25  PRO B C   1 
ATOM   4337 O O   . PRO B 1 24  ? 10.831  -91.533 -30.245 1.00 79.63  ? 25  PRO B O   1 
ATOM   4338 C CB  . PRO B 1 24  ? 11.974  -88.657 -29.085 1.00 70.80  ? 25  PRO B CB  1 
ATOM   4339 C CG  . PRO B 1 24  ? 12.499  -87.315 -29.481 1.00 65.34  ? 25  PRO B CG  1 
ATOM   4340 C CD  . PRO B 1 24  ? 11.608  -86.862 -30.615 1.00 66.60  ? 25  PRO B CD  1 
ATOM   4341 N N   . GLY B 1 25  ? 9.245   -89.962 -30.102 1.00 59.31  ? 26  GLY B N   1 
ATOM   4342 C CA  . GLY B 1 25  ? 8.184   -90.946 -30.023 1.00 55.16  ? 26  GLY B CA  1 
ATOM   4343 C C   . GLY B 1 25  ? 7.644   -91.410 -31.370 1.00 75.09  ? 26  GLY B C   1 
ATOM   4344 O O   . GLY B 1 25  ? 6.756   -92.257 -31.411 1.00 79.73  ? 26  GLY B O   1 
ATOM   4345 N N   . GLY B 1 26  ? 8.156   -90.865 -32.476 1.00 61.27  ? 27  GLY B N   1 
ATOM   4346 C CA  . GLY B 1 26  ? 7.647   -91.239 -33.791 1.00 72.21  ? 27  GLY B CA  1 
ATOM   4347 C C   . GLY B 1 26  ? 7.229   -90.089 -34.697 1.00 68.39  ? 27  GLY B C   1 
ATOM   4348 O O   . GLY B 1 26  ? 7.323   -88.926 -34.318 1.00 75.71  ? 27  GLY B O   1 
ATOM   4349 N N   . PRO B 1 27  ? 6.744   -90.413 -35.903 1.00 68.11  ? 28  PRO B N   1 
ATOM   4350 C CA  . PRO B 1 27  ? 6.431   -89.411 -36.932 1.00 69.68  ? 28  PRO B CA  1 
ATOM   4351 C C   . PRO B 1 27  ? 5.194   -88.553 -36.664 1.00 60.26  ? 28  PRO B C   1 
ATOM   4352 O O   . PRO B 1 27  ? 4.191   -89.020 -36.124 1.00 56.98  ? 28  PRO B O   1 
ATOM   4353 C CB  . PRO B 1 27  ? 6.199   -90.267 -38.187 1.00 60.87  ? 28  PRO B CB  1 
ATOM   4354 C CG  . PRO B 1 27  ? 5.655   -91.543 -37.643 1.00 61.70  ? 28  PRO B CG  1 
ATOM   4355 C CD  . PRO B 1 27  ? 6.455   -91.780 -36.374 1.00 59.70  ? 28  PRO B CD  1 
ATOM   4356 N N   . VAL B 1 28  ? 5.278   -87.303 -37.101 1.00 52.81  ? 29  VAL B N   1 
ATOM   4357 C CA  . VAL B 1 28  ? 4.178   -86.358 -37.055 1.00 44.69  ? 29  VAL B CA  1 
ATOM   4358 C C   . VAL B 1 28  ? 4.087   -85.680 -38.426 1.00 50.20  ? 29  VAL B C   1 
ATOM   4359 O O   . VAL B 1 28  ? 5.115   -85.458 -39.073 1.00 46.30  ? 29  VAL B O   1 
ATOM   4360 C CB  . VAL B 1 28  ? 4.404   -85.304 -35.929 1.00 57.41  ? 29  VAL B CB  1 
ATOM   4361 C CG1 . VAL B 1 28  ? 3.574   -84.069 -36.165 1.00 45.68  ? 29  VAL B CG1 1 
ATOM   4362 C CG2 . VAL B 1 28  ? 4.130   -85.913 -34.529 1.00 44.34  ? 29  VAL B CG2 1 
ATOM   4363 N N   . SER B 1 29  ? 2.880   -85.369 -38.890 1.00 42.27  ? 30  SER B N   1 
ATOM   4364 C CA  . SER B 1 29  ? 2.735   -84.557 -40.096 1.00 48.19  ? 30  SER B CA  1 
ATOM   4365 C C   . SER B 1 29  ? 2.686   -83.071 -39.739 1.00 50.90  ? 30  SER B C   1 
ATOM   4366 O O   . SER B 1 29  ? 1.951   -82.664 -38.845 1.00 49.14  ? 30  SER B O   1 
ATOM   4367 C CB  . SER B 1 29  ? 1.474   -84.938 -40.875 1.00 49.00  ? 30  SER B CB  1 
ATOM   4368 O OG  . SER B 1 29  ? 1.489   -86.302 -41.252 1.00 58.48  ? 30  SER B OG  1 
ATOM   4369 N N   . ALA B 1 30  ? 3.472   -82.269 -40.444 1.00 48.70  ? 31  ALA B N   1 
ATOM   4370 C CA  . ALA B 1 30  ? 3.459   -80.830 -40.257 1.00 41.41  ? 31  ALA B CA  1 
ATOM   4371 C C   . ALA B 1 30  ? 3.184   -80.111 -41.569 1.00 48.70  ? 31  ALA B C   1 
ATOM   4372 O O   . ALA B 1 30  ? 3.777   -80.405 -42.606 1.00 50.41  ? 31  ALA B O   1 
ATOM   4373 C CB  . ALA B 1 30  ? 4.778   -80.360 -39.671 1.00 37.98  ? 31  ALA B CB  1 
ATOM   4374 N N   . PHE B 1 31  ? 2.273   -79.161 -41.502 1.00 45.62  ? 32  PHE B N   1 
ATOM   4375 C CA  . PHE B 1 31  ? 2.025   -78.233 -42.575 1.00 39.39  ? 32  PHE B CA  1 
ATOM   4376 C C   . PHE B 1 31  ? 2.370   -76.832 -42.087 1.00 44.02  ? 32  PHE B C   1 
ATOM   4377 O O   . PHE B 1 31  ? 1.566   -76.189 -41.410 1.00 45.59  ? 32  PHE B O   1 
ATOM   4378 C CB  . PHE B 1 31  ? 0.570   -78.330 -43.015 1.00 42.86  ? 32  PHE B CB  1 
ATOM   4379 C CG  . PHE B 1 31  ? 0.183   -79.703 -43.481 1.00 52.20  ? 32  PHE B CG  1 
ATOM   4380 C CD1 . PHE B 1 31  ? -0.140  -80.699 -42.570 1.00 47.64  ? 32  PHE B CD1 1 
ATOM   4381 C CD2 . PHE B 1 31  ? 0.176   -80.012 -44.833 1.00 52.21  ? 32  PHE B CD2 1 
ATOM   4382 C CE1 . PHE B 1 31  ? -0.491  -81.963 -42.996 1.00 51.71  ? 32  PHE B CE1 1 
ATOM   4383 C CE2 . PHE B 1 31  ? -0.171  -81.277 -45.271 1.00 46.42  ? 32  PHE B CE2 1 
ATOM   4384 C CZ  . PHE B 1 31  ? -0.505  -82.253 -44.362 1.00 51.78  ? 32  PHE B CZ  1 
ATOM   4385 N N   . LEU B 1 32  ? 3.578   -76.375 -42.397 1.00 38.75  ? 33  LEU B N   1 
ATOM   4386 C CA  . LEU B 1 32  ? 4.078   -75.129 -41.845 1.00 44.27  ? 33  LEU B CA  1 
ATOM   4387 C C   . LEU B 1 32  ? 4.037   -74.062 -42.901 1.00 43.86  ? 33  LEU B C   1 
ATOM   4388 O O   . LEU B 1 32  ? 4.387   -74.314 -44.027 1.00 45.77  ? 33  LEU B O   1 
ATOM   4389 C CB  . LEU B 1 32  ? 5.502   -75.303 -41.339 1.00 40.95  ? 33  LEU B CB  1 
ATOM   4390 C CG  . LEU B 1 32  ? 5.783   -76.541 -40.504 1.00 38.24  ? 33  LEU B CG  1 
ATOM   4391 C CD1 . LEU B 1 32  ? 7.275   -76.600 -40.270 1.00 39.61  ? 33  LEU B CD1 1 
ATOM   4392 C CD2 . LEU B 1 32  ? 5.000   -76.531 -39.150 1.00 34.21  ? 33  LEU B CD2 1 
ATOM   4393 N N   . GLY B 1 33  ? 3.616   -72.861 -42.548 1.00 43.05  ? 34  GLY B N   1 
ATOM   4394 C CA  . GLY B 1 33  ? 3.615   -71.786 -43.516 1.00 37.80  ? 34  GLY B CA  1 
ATOM   4395 C C   . GLY B 1 33  ? 2.433   -71.785 -44.461 1.00 40.84  ? 34  GLY B C   1 
ATOM   4396 O O   . GLY B 1 33  ? 2.591   -71.526 -45.653 1.00 48.27  ? 34  GLY B O   1 
ATOM   4397 N N   . ILE B 1 34  ? 1.243   -72.061 -43.938 1.00 41.30  ? 35  ILE B N   1 
ATOM   4398 C CA  . ILE B 1 34  ? 0.021   -71.926 -44.730 1.00 36.71  ? 35  ILE B CA  1 
ATOM   4399 C C   . ILE B 1 34  ? -0.502  -70.493 -44.746 1.00 43.24  ? 35  ILE B C   1 
ATOM   4400 O O   . ILE B 1 34  ? -0.724  -69.905 -43.690 1.00 47.11  ? 35  ILE B O   1 
ATOM   4401 C CB  . ILE B 1 34  ? -1.101  -72.820 -44.188 1.00 38.21  ? 35  ILE B CB  1 
ATOM   4402 C CG1 . ILE B 1 34  ? -0.633  -74.262 -44.046 1.00 35.17  ? 35  ILE B CG1 1 
ATOM   4403 C CG2 . ILE B 1 34  ? -2.332  -72.707 -45.056 1.00 40.43  ? 35  ILE B CG2 1 
ATOM   4404 C CD1 . ILE B 1 34  ? -1.522  -75.077 -43.112 1.00 38.19  ? 35  ILE B CD1 1 
ATOM   4405 N N   . PRO B 1 35  ? -0.720  -69.928 -45.943 1.00 49.83  ? 36  PRO B N   1 
ATOM   4406 C CA  . PRO B 1 35  ? -1.235  -68.558 -46.006 1.00 40.76  ? 36  PRO B CA  1 
ATOM   4407 C C   . PRO B 1 35  ? -2.694  -68.509 -45.613 1.00 48.58  ? 36  PRO B C   1 
ATOM   4408 O O   . PRO B 1 35  ? -3.466  -69.343 -46.089 1.00 47.36  ? 36  PRO B O   1 
ATOM   4409 C CB  . PRO B 1 35  ? -1.041  -68.175 -47.481 1.00 45.41  ? 36  PRO B CB  1 
ATOM   4410 C CG  . PRO B 1 35  ? -1.154  -69.482 -48.205 1.00 44.86  ? 36  PRO B CG  1 
ATOM   4411 C CD  . PRO B 1 35  ? -0.507  -70.503 -47.284 1.00 38.21  ? 36  PRO B CD  1 
ATOM   4412 N N   . PHE B 1 36  ? -3.080  -67.577 -44.743 1.00 44.45  ? 37  PHE B N   1 
ATOM   4413 C CA  . PHE B 1 36  ? -4.485  -67.543 -44.353 1.00 43.33  ? 37  PHE B CA  1 
ATOM   4414 C C   . PHE B 1 36  ? -5.097  -66.183 -44.615 1.00 41.48  ? 37  PHE B C   1 
ATOM   4415 O O   . PHE B 1 36  ? -6.312  -66.020 -44.538 1.00 43.66  ? 37  PHE B O   1 
ATOM   4416 C CB  . PHE B 1 36  ? -4.660  -67.963 -42.891 1.00 40.14  ? 37  PHE B CB  1 
ATOM   4417 C CG  . PHE B 1 36  ? -4.119  -66.977 -41.874 1.00 40.81  ? 37  PHE B CG  1 
ATOM   4418 C CD1 . PHE B 1 36  ? -4.905  -65.932 -41.405 1.00 42.07  ? 37  PHE B CD1 1 
ATOM   4419 C CD2 . PHE B 1 36  ? -2.849  -67.144 -41.338 1.00 39.95  ? 37  PHE B CD2 1 
ATOM   4420 C CE1 . PHE B 1 36  ? -4.418  -65.040 -40.433 1.00 48.25  ? 37  PHE B CE1 1 
ATOM   4421 C CE2 . PHE B 1 36  ? -2.349  -66.271 -40.355 1.00 45.16  ? 37  PHE B CE2 1 
ATOM   4422 C CZ  . PHE B 1 36  ? -3.133  -65.215 -39.899 1.00 39.98  ? 37  PHE B CZ  1 
ATOM   4423 N N   . ALA B 1 37  ? -4.246  -65.220 -44.944 1.00 39.67  ? 38  ALA B N   1 
ATOM   4424 C CA  . ALA B 1 37  ? -4.682  -63.896 -45.352 1.00 42.17  ? 38  ALA B CA  1 
ATOM   4425 C C   . ALA B 1 37  ? -3.898  -63.452 -46.574 1.00 52.89  ? 38  ALA B C   1 
ATOM   4426 O O   . ALA B 1 37  ? -2.807  -63.956 -46.831 1.00 39.59  ? 38  ALA B O   1 
ATOM   4427 C CB  . ALA B 1 37  ? -4.495  -62.889 -44.220 1.00 44.05  ? 38  ALA B CB  1 
ATOM   4428 N N   . GLU B 1 38  ? -4.454  -62.515 -47.332 1.00 41.75  ? 39  GLU B N   1 
ATOM   4429 C CA  . GLU B 1 38  ? -3.671  -61.825 -48.344 1.00 45.45  ? 39  GLU B CA  1 
ATOM   4430 C C   . GLU B 1 38  ? -2.581  -61.046 -47.633 1.00 46.62  ? 39  GLU B C   1 
ATOM   4431 O O   . GLU B 1 38  ? -2.818  -60.504 -46.565 1.00 51.73  ? 39  GLU B O   1 
ATOM   4432 C CB  . GLU B 1 38  ? -4.557  -60.894 -49.175 1.00 43.66  ? 39  GLU B CB  1 
ATOM   4433 C CG  . GLU B 1 38  ? -5.574  -61.657 -50.025 1.00 56.50  ? 39  GLU B CG  1 
ATOM   4434 C CD  . GLU B 1 38  ? -4.897  -62.437 -51.143 1.00 58.12  ? 39  GLU B CD  1 
ATOM   4435 O OE1 . GLU B 1 38  ? -3.993  -61.867 -51.802 1.00 63.87  ? 39  GLU B OE1 1 
ATOM   4436 O OE2 . GLU B 1 38  ? -5.244  -63.624 -51.343 1.00 51.14  ? 39  GLU B OE2 1 
ATOM   4437 N N   . PRO B 1 39  ? -1.386  -60.981 -48.220 1.00 46.48  ? 40  PRO B N   1 
ATOM   4438 C CA  . PRO B 1 39  ? -0.314  -60.236 -47.549 1.00 38.80  ? 40  PRO B CA  1 
ATOM   4439 C C   . PRO B 1 39  ? -0.702  -58.768 -47.278 1.00 50.78  ? 40  PRO B C   1 
ATOM   4440 O O   . PRO B 1 39  ? -1.101  -58.043 -48.187 1.00 50.54  ? 40  PRO B O   1 
ATOM   4441 C CB  . PRO B 1 39  ? 0.869   -60.337 -48.543 1.00 39.89  ? 40  PRO B CB  1 
ATOM   4442 C CG  . PRO B 1 39  ? 0.549   -61.533 -49.415 1.00 43.38  ? 40  PRO B CG  1 
ATOM   4443 C CD  . PRO B 1 39  ? -0.958  -61.591 -49.500 1.00 44.43  ? 40  PRO B CD  1 
ATOM   4444 N N   . PRO B 1 40  ? -0.591  -58.326 -46.016 1.00 57.90  ? 41  PRO B N   1 
ATOM   4445 C CA  . PRO B 1 40  ? -0.968  -56.953 -45.671 1.00 38.50  ? 41  PRO B CA  1 
ATOM   4446 C C   . PRO B 1 40  ? 0.120   -55.961 -46.088 1.00 56.89  ? 41  PRO B C   1 
ATOM   4447 O O   . PRO B 1 40  ? 0.717   -55.286 -45.247 1.00 56.21  ? 41  PRO B O   1 
ATOM   4448 C CB  . PRO B 1 40  ? -1.144  -57.006 -44.145 1.00 47.16  ? 41  PRO B CB  1 
ATOM   4449 C CG  . PRO B 1 40  ? -0.230  -58.080 -43.699 1.00 52.76  ? 41  PRO B CG  1 
ATOM   4450 C CD  . PRO B 1 40  ? -0.092  -59.080 -44.856 1.00 38.29  ? 41  PRO B CD  1 
ATOM   4451 N N   . MET B 1 41  ? 0.353   -55.888 -47.401 1.00 58.32  ? 42  MET B N   1 
ATOM   4452 C CA  . MET B 1 41  ? 1.421   -55.086 -47.996 1.00 53.65  ? 42  MET B CA  1 
ATOM   4453 C C   . MET B 1 41  ? 0.907   -53.764 -48.525 1.00 55.87  ? 42  MET B C   1 
ATOM   4454 O O   . MET B 1 41  ? -0.279  -53.641 -48.836 1.00 60.58  ? 42  MET B O   1 
ATOM   4455 C CB  . MET B 1 41  ? 2.077   -55.830 -49.165 1.00 69.05  ? 42  MET B CB  1 
ATOM   4456 C CG  . MET B 1 41  ? 2.636   -57.179 -48.850 1.00 61.13  ? 42  MET B CG  1 
ATOM   4457 S SD  . MET B 1 41  ? 4.188   -57.000 -47.991 1.00 77.73  ? 42  MET B SD  1 
ATOM   4458 C CE  . MET B 1 41  ? 5.125   -55.998 -49.146 1.00 87.63  ? 42  MET B CE  1 
ATOM   4459 N N   . GLY B 1 42  ? 1.812   -52.797 -48.667 1.00 50.09  ? 43  GLY B N   1 
ATOM   4460 C CA  . GLY B 1 42  ? 1.520   -51.569 -49.388 1.00 58.83  ? 43  GLY B CA  1 
ATOM   4461 C C   . GLY B 1 42  ? 0.272   -50.865 -48.912 1.00 59.72  ? 43  GLY B C   1 
ATOM   4462 O O   . GLY B 1 42  ? 0.215   -50.400 -47.780 1.00 58.41  ? 43  GLY B O   1 
ATOM   4463 N N   . PRO B 1 43  ? -0.745  -50.794 -49.777 1.00 57.13  ? 44  PRO B N   1 
ATOM   4464 C CA  . PRO B 1 43  ? -2.024  -50.176 -49.415 1.00 54.92  ? 44  PRO B CA  1 
ATOM   4465 C C   . PRO B 1 43  ? -2.752  -50.923 -48.284 1.00 62.78  ? 44  PRO B C   1 
ATOM   4466 O O   . PRO B 1 43  ? -3.661  -50.355 -47.682 1.00 54.75  ? 44  PRO B O   1 
ATOM   4467 C CB  . PRO B 1 43  ? -2.834  -50.244 -50.732 1.00 48.31  ? 44  PRO B CB  1 
ATOM   4468 C CG  . PRO B 1 43  ? -2.238  -51.381 -51.489 1.00 36.95  ? 44  PRO B CG  1 
ATOM   4469 C CD  . PRO B 1 43  ? -0.766  -51.366 -51.137 1.00 47.60  ? 44  PRO B CD  1 
ATOM   4470 N N   . ARG B 1 44  ? -2.372  -52.173 -48.017 1.00 55.02  ? 45  ARG B N   1 
ATOM   4471 C CA  . ARG B 1 44  ? -3.058  -52.979 -47.008 1.00 50.58  ? 45  ARG B CA  1 
ATOM   4472 C C   . ARG B 1 44  ? -2.401  -52.919 -45.626 1.00 54.12  ? 45  ARG B C   1 
ATOM   4473 O O   . ARG B 1 44  ? -2.891  -53.535 -44.671 1.00 47.16  ? 45  ARG B O   1 
ATOM   4474 C CB  . ARG B 1 44  ? -3.141  -54.429 -47.453 1.00 52.09  ? 45  ARG B CB  1 
ATOM   4475 C CG  . ARG B 1 44  ? -3.993  -54.681 -48.673 1.00 51.25  ? 45  ARG B CG  1 
ATOM   4476 C CD  . ARG B 1 44  ? -3.904  -56.159 -48.990 1.00 57.37  ? 45  ARG B CD  1 
ATOM   4477 N NE  . ARG B 1 44  ? -4.402  -56.515 -50.314 1.00 76.30  ? 45  ARG B NE  1 
ATOM   4478 C CZ  . ARG B 1 44  ? -5.653  -56.901 -50.536 1.00 83.12  ? 45  ARG B CZ  1 
ATOM   4479 N NH1 . ARG B 1 44  ? -6.507  -56.961 -49.521 1.00 69.27  ? 45  ARG B NH1 1 
ATOM   4480 N NH2 . ARG B 1 44  ? -6.051  -57.222 -51.758 1.00 74.17  ? 45  ARG B NH2 1 
ATOM   4481 N N   . ARG B 1 45  ? -1.292  -52.191 -45.523 1.00 44.63  ? 46  ARG B N   1 
ATOM   4482 C CA  . ARG B 1 45  ? -0.690  -51.894 -44.230 1.00 47.15  ? 46  ARG B CA  1 
ATOM   4483 C C   . ARG B 1 45  ? -1.704  -51.176 -43.320 1.00 48.56  ? 46  ARG B C   1 
ATOM   4484 O O   . ARG B 1 45  ? -2.374  -50.250 -43.758 1.00 55.76  ? 46  ARG B O   1 
ATOM   4485 C CB  . ARG B 1 45  ? 0.571   -51.045 -44.412 1.00 41.22  ? 46  ARG B CB  1 
ATOM   4486 C CG  . ARG B 1 45  ? 1.323   -50.790 -43.116 1.00 49.87  ? 46  ARG B CG  1 
ATOM   4487 C CD  . ARG B 1 45  ? 2.487   -49.823 -43.287 1.00 44.79  ? 46  ARG B CD  1 
ATOM   4488 N NE  . ARG B 1 45  ? 3.659   -50.464 -43.875 1.00 48.84  ? 46  ARG B NE  1 
ATOM   4489 C CZ  . ARG B 1 45  ? 4.812   -49.841 -44.096 1.00 49.49  ? 46  ARG B CZ  1 
ATOM   4490 N NH1 . ARG B 1 45  ? 4.947   -48.562 -43.783 1.00 40.29  ? 46  ARG B NH1 1 
ATOM   4491 N NH2 . ARG B 1 45  ? 5.836   -50.499 -44.615 1.00 50.29  ? 46  ARG B NH2 1 
ATOM   4492 N N   . PHE B 1 46  ? -1.814  -51.642 -42.073 1.00 53.60  ? 47  PHE B N   1 
ATOM   4493 C CA  . PHE B 1 46  ? -2.700  -51.093 -41.026 1.00 43.47  ? 47  PHE B CA  1 
ATOM   4494 C C   . PHE B 1 46  ? -4.153  -51.496 -41.192 1.00 48.69  ? 47  PHE B C   1 
ATOM   4495 O O   . PHE B 1 46  ? -4.971  -51.178 -40.337 1.00 46.92  ? 47  PHE B O   1 
ATOM   4496 C CB  . PHE B 1 46  ? -2.662  -49.567 -40.943 1.00 37.02  ? 47  PHE B CB  1 
ATOM   4497 C CG  . PHE B 1 46  ? -1.280  -48.980 -40.839 1.00 45.56  ? 47  PHE B CG  1 
ATOM   4498 C CD1 . PHE B 1 46  ? -0.447  -49.308 -39.789 1.00 42.77  ? 47  PHE B CD1 1 
ATOM   4499 C CD2 . PHE B 1 46  ? -0.833  -48.064 -41.776 1.00 46.09  ? 47  PHE B CD2 1 
ATOM   4500 C CE1 . PHE B 1 46  ? 0.812   -48.743 -39.687 1.00 45.64  ? 47  PHE B CE1 1 
ATOM   4501 C CE2 . PHE B 1 46  ? 0.432   -47.500 -41.674 1.00 41.26  ? 47  PHE B CE2 1 
ATOM   4502 C CZ  . PHE B 1 46  ? 1.244   -47.835 -40.623 1.00 46.64  ? 47  PHE B CZ  1 
ATOM   4503 N N   . LEU B 1 47  ? -4.485  -52.202 -42.266 1.00 44.81  ? 48  LEU B N   1 
ATOM   4504 C CA  . LEU B 1 47  ? -5.877  -52.554 -42.506 1.00 41.36  ? 48  LEU B CA  1 
ATOM   4505 C C   . LEU B 1 47  ? -6.195  -53.919 -41.947 1.00 44.45  ? 48  LEU B C   1 
ATOM   4506 O O   . LEU B 1 47  ? -5.290  -54.724 -41.714 1.00 51.22  ? 48  LEU B O   1 
ATOM   4507 C CB  . LEU B 1 47  ? -6.205  -52.547 -44.008 1.00 42.90  ? 48  LEU B CB  1 
ATOM   4508 C CG  . LEU B 1 47  ? -6.320  -51.240 -44.787 1.00 62.20  ? 48  LEU B CG  1 
ATOM   4509 C CD1 . LEU B 1 47  ? -6.741  -51.515 -46.240 1.00 42.02  ? 48  LEU B CD1 1 
ATOM   4510 C CD2 . LEU B 1 47  ? -7.290  -50.301 -44.113 1.00 51.76  ? 48  LEU B CD2 1 
ATOM   4511 N N   . PRO B 1 48  ? -7.491  -54.203 -41.753 1.00 42.71  ? 49  PRO B N   1 
ATOM   4512 C CA  . PRO B 1 48  ? -7.906  -55.548 -41.379 1.00 49.26  ? 49  PRO B CA  1 
ATOM   4513 C C   . PRO B 1 48  ? -7.421  -56.546 -42.401 1.00 48.20  ? 49  PRO B C   1 
ATOM   4514 O O   . PRO B 1 48  ? -7.229  -56.197 -43.555 1.00 58.14  ? 49  PRO B O   1 
ATOM   4515 C CB  . PRO B 1 48  ? -9.434  -55.451 -41.373 1.00 48.18  ? 49  PRO B CB  1 
ATOM   4516 C CG  . PRO B 1 48  ? -9.689  -54.036 -40.990 1.00 43.02  ? 49  PRO B CG  1 
ATOM   4517 C CD  . PRO B 1 48  ? -8.626  -53.264 -41.732 1.00 46.40  ? 49  PRO B CD  1 
ATOM   4518 N N   . PRO B 1 49  ? -7.201  -57.784 -41.975 1.00 59.70  ? 50  PRO B N   1 
ATOM   4519 C CA  . PRO B 1 49  ? -6.720  -58.797 -42.908 1.00 46.93  ? 50  PRO B CA  1 
ATOM   4520 C C   . PRO B 1 49  ? -7.811  -59.233 -43.886 1.00 48.99  ? 50  PRO B C   1 
ATOM   4521 O O   . PRO B 1 49  ? -8.977  -59.322 -43.508 1.00 50.50  ? 50  PRO B O   1 
ATOM   4522 C CB  . PRO B 1 49  ? -6.311  -59.952 -41.990 1.00 45.99  ? 50  PRO B CB  1 
ATOM   4523 C CG  . PRO B 1 49  ? -7.221  -59.811 -40.795 1.00 43.88  ? 50  PRO B CG  1 
ATOM   4524 C CD  . PRO B 1 49  ? -7.390  -58.312 -40.616 1.00 44.09  ? 50  PRO B CD  1 
ATOM   4525 N N   . GLU B 1 50  ? -7.437  -59.502 -45.134 1.00 47.35  ? 51  GLU B N   1 
ATOM   4526 C CA  . GLU B 1 50  ? -8.373  -60.085 -46.092 1.00 49.83  ? 51  GLU B CA  1 
ATOM   4527 C C   . GLU B 1 50  ? -8.143  -61.587 -46.188 1.00 39.79  ? 51  GLU B C   1 
ATOM   4528 O O   . GLU B 1 50  ? -7.000  -62.039 -46.181 1.00 48.93  ? 51  GLU B O   1 
ATOM   4529 C CB  . GLU B 1 50  ? -8.218  -59.428 -47.459 1.00 51.03  ? 51  GLU B CB  1 
ATOM   4530 C CG  . GLU B 1 50  ? -8.773  -58.015 -47.515 1.00 79.02  ? 51  GLU B CG  1 
ATOM   4531 C CD  . GLU B 1 50  ? -9.399  -57.688 -48.877 1.00 119.37 ? 51  GLU B CD  1 
ATOM   4532 O OE1 . GLU B 1 50  ? -8.831  -58.107 -49.919 1.00 107.03 ? 51  GLU B OE1 1 
ATOM   4533 O OE2 . GLU B 1 50  ? -10.465 -57.025 -48.905 1.00 121.58 ? 51  GLU B OE2 1 
ATOM   4534 N N   . PRO B 1 51  ? -9.220  -62.375 -46.267 1.00 44.67  ? 52  PRO B N   1 
ATOM   4535 C CA  . PRO B 1 51  ? -9.010  -63.826 -46.423 1.00 47.99  ? 52  PRO B CA  1 
ATOM   4536 C C   . PRO B 1 51  ? -8.154  -64.135 -47.650 1.00 49.41  ? 52  PRO B C   1 
ATOM   4537 O O   . PRO B 1 51  ? -8.245  -63.427 -48.650 1.00 57.95  ? 52  PRO B O   1 
ATOM   4538 C CB  . PRO B 1 51  ? -10.429 -64.378 -46.586 1.00 48.04  ? 52  PRO B CB  1 
ATOM   4539 C CG  . PRO B 1 51  ? -11.288 -63.380 -45.849 1.00 51.31  ? 52  PRO B CG  1 
ATOM   4540 C CD  . PRO B 1 51  ? -10.646 -62.027 -46.145 1.00 45.18  ? 52  PRO B CD  1 
ATOM   4541 N N   . LYS B 1 52  ? -7.298  -65.143 -47.542 1.00 48.72  ? 53  LYS B N   1 
ATOM   4542 C CA  . LYS B 1 52  ? -6.449  -65.554 -48.647 1.00 52.92  ? 53  LYS B CA  1 
ATOM   4543 C C   . LYS B 1 52  ? -7.311  -66.016 -49.835 1.00 46.67  ? 53  LYS B C   1 
ATOM   4544 O O   . LYS B 1 52  ? -8.241  -66.807 -49.672 1.00 53.34  ? 53  LYS B O   1 
ATOM   4545 C CB  . LYS B 1 52  ? -5.497  -66.662 -48.186 1.00 43.87  ? 53  LYS B CB  1 
ATOM   4546 C CG  . LYS B 1 52  ? -4.618  -67.277 -49.279 1.00 50.57  ? 53  LYS B CG  1 
ATOM   4547 C CD  . LYS B 1 52  ? -3.569  -66.294 -49.766 1.00 45.56  ? 53  LYS B CD  1 
ATOM   4548 C CE  . LYS B 1 52  ? -2.619  -66.951 -50.741 1.00 45.07  ? 53  LYS B CE  1 
ATOM   4549 N NZ  . LYS B 1 52  ? -1.536  -66.026 -51.245 1.00 50.50  ? 53  LYS B NZ  1 
ATOM   4550 N N   . GLN B 1 53  ? -7.025  -65.507 -51.022 1.00 53.72  ? 54  GLN B N   1 
ATOM   4551 C CA  A GLN B 1 53  ? -7.793  -65.924 -52.194 0.51 57.46  ? 54  GLN B CA  1 
ATOM   4552 C CA  B GLN B 1 53  ? -7.747  -65.893 -52.238 0.49 57.44  ? 54  GLN B CA  1 
ATOM   4553 C C   . GLN B 1 53  ? -7.353  -67.318 -52.655 1.00 50.99  ? 54  GLN B C   1 
ATOM   4554 O O   . GLN B 1 53  ? -6.180  -67.693 -52.545 1.00 45.53  ? 54  GLN B O   1 
ATOM   4555 C CB  A GLN B 1 53  ? -7.667  -64.896 -53.326 0.51 55.67  ? 54  GLN B CB  1 
ATOM   4556 C CB  B GLN B 1 53  ? -7.458  -64.880 -53.363 0.49 55.15  ? 54  GLN B CB  1 
ATOM   4557 C CG  A GLN B 1 53  ? -8.667  -63.725 -53.208 0.51 60.70  ? 54  GLN B CG  1 
ATOM   4558 C CG  B GLN B 1 53  ? -7.896  -63.433 -53.028 0.49 58.78  ? 54  GLN B CG  1 
ATOM   4559 C CD  A GLN B 1 53  ? -10.118 -64.146 -53.446 0.51 62.18  ? 54  GLN B CD  1 
ATOM   4560 C CD  B GLN B 1 53  ? -7.395  -62.387 -54.029 0.49 64.79  ? 54  GLN B CD  1 
ATOM   4561 O OE1 A GLN B 1 53  ? -10.898 -64.274 -52.500 0.51 57.28  ? 54  GLN B OE1 1 
ATOM   4562 O OE1 B GLN B 1 53  ? -6.700  -62.711 -54.996 0.49 56.45  ? 54  GLN B OE1 1 
ATOM   4563 N NE2 A GLN B 1 53  ? -10.482 -64.357 -54.716 0.51 60.59  ? 54  GLN B NE2 1 
ATOM   4564 N NE2 B GLN B 1 53  ? -7.751  -61.121 -53.793 0.49 58.46  ? 54  GLN B NE2 1 
ATOM   4565 N N   . PRO B 1 54  ? -8.319  -68.123 -53.128 1.00 57.99  ? 55  PRO B N   1 
ATOM   4566 C CA  . PRO B 1 54  ? -8.021  -69.515 -53.523 1.00 52.47  ? 55  PRO B CA  1 
ATOM   4567 C C   . PRO B 1 54  ? -6.934  -69.612 -54.593 1.00 52.39  ? 55  PRO B C   1 
ATOM   4568 O O   . PRO B 1 54  ? -6.733  -68.666 -55.350 1.00 44.03  ? 55  PRO B O   1 
ATOM   4569 C CB  . PRO B 1 54  ? -9.362  -70.032 -54.050 1.00 51.73  ? 55  PRO B CB  1 
ATOM   4570 C CG  . PRO B 1 54  ? -10.397 -69.175 -53.365 1.00 55.15  ? 55  PRO B CG  1 
ATOM   4571 C CD  . PRO B 1 54  ? -9.756  -67.810 -53.213 1.00 56.49  ? 55  PRO B CD  1 
ATOM   4572 N N   . TRP B 1 55  ? -6.215  -70.729 -54.630 1.00 48.66  ? 56  TRP B N   1 
ATOM   4573 C CA  . TRP B 1 55  ? -5.075  -70.889 -55.530 1.00 40.33  ? 56  TRP B CA  1 
ATOM   4574 C C   . TRP B 1 55  ? -5.161  -72.236 -56.247 1.00 57.30  ? 56  TRP B C   1 
ATOM   4575 O O   . TRP B 1 55  ? -5.828  -73.174 -55.774 1.00 45.43  ? 56  TRP B O   1 
ATOM   4576 C CB  . TRP B 1 55  ? -3.739  -70.802 -54.766 1.00 39.21  ? 56  TRP B CB  1 
ATOM   4577 C CG  . TRP B 1 55  ? -3.581  -71.911 -53.748 1.00 51.60  ? 56  TRP B CG  1 
ATOM   4578 C CD1 . TRP B 1 55  ? -3.065  -73.150 -53.961 1.00 46.83  ? 56  TRP B CD1 1 
ATOM   4579 C CD2 . TRP B 1 55  ? -3.964  -71.871 -52.366 1.00 43.88  ? 56  TRP B CD2 1 
ATOM   4580 N NE1 . TRP B 1 55  ? -3.102  -73.890 -52.802 1.00 49.34  ? 56  TRP B NE1 1 
ATOM   4581 C CE2 . TRP B 1 55  ? -3.643  -73.123 -51.806 1.00 52.33  ? 56  TRP B CE2 1 
ATOM   4582 C CE3 . TRP B 1 55  ? -4.535  -70.892 -51.547 1.00 52.33  ? 56  TRP B CE3 1 
ATOM   4583 C CZ2 . TRP B 1 55  ? -3.879  -73.426 -50.462 1.00 48.03  ? 56  TRP B CZ2 1 
ATOM   4584 C CZ3 . TRP B 1 55  ? -4.770  -71.201 -50.195 1.00 46.70  ? 56  TRP B CZ3 1 
ATOM   4585 C CH2 . TRP B 1 55  ? -4.444  -72.454 -49.681 1.00 47.67  ? 56  TRP B CH2 1 
ATOM   4586 N N   . SER B 1 56  ? -4.479  -72.335 -57.385 1.00 41.08  ? 57  SER B N   1 
ATOM   4587 C CA  . SER B 1 56  ? -4.435  -73.592 -58.120 1.00 51.16  ? 57  SER B CA  1 
ATOM   4588 C C   . SER B 1 56  ? -3.088  -74.204 -57.886 1.00 44.64  ? 57  SER B C   1 
ATOM   4589 O O   . SER B 1 56  ? -2.159  -73.522 -57.437 1.00 51.35  ? 57  SER B O   1 
ATOM   4590 C CB  . SER B 1 56  ? -4.683  -73.374 -59.614 1.00 50.96  ? 57  SER B CB  1 
ATOM   4591 O OG  . SER B 1 56  ? -3.791  -72.400 -60.125 1.00 55.52  ? 57  SER B OG  1 
ATOM   4592 N N   . GLY B 1 57  ? -2.958  -75.487 -58.192 1.00 48.45  ? 58  GLY B N   1 
ATOM   4593 C CA  . GLY B 1 57  ? -1.706  -76.167 -57.911 1.00 48.21  ? 58  GLY B CA  1 
ATOM   4594 C C   . GLY B 1 57  ? -1.552  -76.426 -56.413 1.00 54.71  ? 58  GLY B C   1 
ATOM   4595 O O   . GLY B 1 57  ? -2.502  -76.287 -55.638 1.00 43.05  ? 58  GLY B O   1 
ATOM   4596 N N   . VAL B 1 58  ? -0.350  -76.812 -56.011 1.00 39.89  ? 59  VAL B N   1 
ATOM   4597 C CA  . VAL B 1 58  ? -0.096  -77.199 -54.643 1.00 47.37  ? 59  VAL B CA  1 
ATOM   4598 C C   . VAL B 1 58  ? 0.829   -76.199 -53.961 1.00 51.69  ? 59  VAL B C   1 
ATOM   4599 O O   . VAL B 1 58  ? 1.943   -75.959 -54.434 1.00 45.39  ? 59  VAL B O   1 
ATOM   4600 C CB  . VAL B 1 58  ? 0.546   -78.589 -54.571 1.00 57.83  ? 59  VAL B CB  1 
ATOM   4601 C CG1 . VAL B 1 58  ? 0.621   -79.062 -53.105 1.00 48.24  ? 59  VAL B CG1 1 
ATOM   4602 C CG2 . VAL B 1 58  ? -0.210  -79.579 -55.447 1.00 41.13  ? 59  VAL B CG2 1 
ATOM   4603 N N   . VAL B 1 59  ? 0.365   -75.614 -52.857 1.00 49.61  ? 60  VAL B N   1 
ATOM   4604 C CA  . VAL B 1 59  ? 1.235   -74.796 -52.009 1.00 43.47  ? 60  VAL B CA  1 
ATOM   4605 C C   . VAL B 1 59  ? 2.063   -75.710 -51.106 1.00 44.38  ? 60  VAL B C   1 
ATOM   4606 O O   . VAL B 1 59  ? 1.533   -76.604 -50.442 1.00 47.45  ? 60  VAL B O   1 
ATOM   4607 C CB  . VAL B 1 59  ? 0.423   -73.784 -51.166 1.00 51.05  ? 60  VAL B CB  1 
ATOM   4608 C CG1 . VAL B 1 59  ? 1.271   -73.195 -50.035 1.00 45.62  ? 60  VAL B CG1 1 
ATOM   4609 C CG2 . VAL B 1 59  ? -0.116  -72.678 -52.055 1.00 42.30  ? 60  VAL B CG2 1 
ATOM   4610 N N   . ASP B 1 60  ? 3.375   -75.523 -51.128 1.00 44.99  ? 61  ASP B N   1 
ATOM   4611 C CA  . ASP B 1 60  ? 4.269   -76.241 -50.229 1.00 39.90  ? 61  ASP B CA  1 
ATOM   4612 C C   . ASP B 1 60  ? 4.254   -75.608 -48.839 1.00 49.81  ? 61  ASP B C   1 
ATOM   4613 O O   . ASP B 1 60  ? 4.809   -74.528 -48.636 1.00 43.03  ? 61  ASP B O   1 
ATOM   4614 C CB  . ASP B 1 60  ? 5.699   -76.244 -50.760 1.00 38.13  ? 61  ASP B CB  1 
ATOM   4615 C CG  . ASP B 1 60  ? 5.894   -77.190 -51.934 1.00 57.42  ? 61  ASP B CG  1 
ATOM   4616 O OD1 . ASP B 1 60  ? 5.931   -78.421 -51.709 1.00 54.74  ? 61  ASP B OD1 1 
ATOM   4617 O OD2 . ASP B 1 60  ? 6.041   -76.699 -53.074 1.00 60.21  ? 61  ASP B OD2 1 
ATOM   4618 N N   . ALA B 1 61  ? 3.613   -76.284 -47.892 1.00 43.41  ? 62  ALA B N   1 
ATOM   4619 C CA  . ALA B 1 61  ? 3.635   -75.883 -46.485 1.00 42.95  ? 62  ALA B CA  1 
ATOM   4620 C C   . ALA B 1 61  ? 4.724   -76.651 -45.778 1.00 41.24  ? 62  ALA B C   1 
ATOM   4621 O O   . ALA B 1 61  ? 4.433   -77.541 -44.978 1.00 39.63  ? 62  ALA B O   1 
ATOM   4622 C CB  . ALA B 1 61  ? 2.290   -76.151 -45.824 1.00 34.57  ? 62  ALA B CB  1 
ATOM   4623 N N   . THR B 1 62  ? 5.980   -76.339 -46.085 1.00 40.69  ? 63  THR B N   1 
ATOM   4624 C CA  . THR B 1 62  ? 7.063   -77.214 -45.664 1.00 38.00  ? 63  THR B CA  1 
ATOM   4625 C C   . THR B 1 62  ? 8.115   -76.535 -44.783 1.00 43.42  ? 63  THR B C   1 
ATOM   4626 O O   . THR B 1 62  ? 9.072   -77.175 -44.331 1.00 49.95  ? 63  THR B O   1 
ATOM   4627 C CB  . THR B 1 62  ? 7.753   -77.820 -46.909 1.00 43.52  ? 63  THR B CB  1 
ATOM   4628 O OG1 . THR B 1 62  ? 8.270   -76.758 -47.700 1.00 39.53  ? 63  THR B OG1 1 
ATOM   4629 C CG2 . THR B 1 62  ? 6.766   -78.622 -47.752 1.00 35.24  ? 63  THR B CG2 1 
ATOM   4630 N N   . THR B 1 63  ? 7.959   -75.237 -44.541 1.00 43.09  ? 64  THR B N   1 
ATOM   4631 C CA  . THR B 1 63  ? 8.834   -74.543 -43.591 1.00 37.12  ? 64  THR B CA  1 
ATOM   4632 C C   . THR B 1 63  ? 8.115   -73.319 -43.046 1.00 44.25  ? 64  THR B C   1 
ATOM   4633 O O   . THR B 1 63  ? 7.179   -72.812 -43.677 1.00 43.62  ? 64  THR B O   1 
ATOM   4634 C CB  . THR B 1 63  ? 10.176  -74.128 -44.238 1.00 37.63  ? 64  THR B CB  1 
ATOM   4635 O OG1 . THR B 1 63  ? 11.169  -73.914 -43.226 1.00 45.98  ? 64  THR B OG1 1 
ATOM   4636 C CG2 . THR B 1 63  ? 10.018  -72.867 -45.080 1.00 38.38  ? 64  THR B CG2 1 
ATOM   4637 N N   . PHE B 1 64  ? 8.530   -72.855 -41.868 1.00 36.50  ? 65  PHE B N   1 
ATOM   4638 C CA  . PHE B 1 64  ? 7.963   -71.634 -41.289 1.00 40.72  ? 65  PHE B CA  1 
ATOM   4639 C C   . PHE B 1 64  ? 8.181   -70.445 -42.204 1.00 47.96  ? 65  PHE B C   1 
ATOM   4640 O O   . PHE B 1 64  ? 9.280   -70.255 -42.755 1.00 40.01  ? 65  PHE B O   1 
ATOM   4641 C CB  . PHE B 1 64  ? 8.576   -71.325 -39.916 1.00 35.56  ? 65  PHE B CB  1 
ATOM   4642 C CG  . PHE B 1 64  ? 8.208   -72.310 -38.830 1.00 35.52  ? 65  PHE B CG  1 
ATOM   4643 C CD1 . PHE B 1 64  ? 6.895   -72.438 -38.407 1.00 35.39  ? 65  PHE B CD1 1 
ATOM   4644 C CD2 . PHE B 1 64  ? 9.199   -73.060 -38.190 1.00 38.32  ? 65  PHE B CD2 1 
ATOM   4645 C CE1 . PHE B 1 64  ? 6.561   -73.327 -37.383 1.00 38.52  ? 65  PHE B CE1 1 
ATOM   4646 C CE2 . PHE B 1 64  ? 8.883   -73.943 -37.181 1.00 32.28  ? 65  PHE B CE2 1 
ATOM   4647 C CZ  . PHE B 1 64  ? 7.555   -74.082 -36.774 1.00 41.12  ? 65  PHE B CZ  1 
ATOM   4648 N N   . GLN B 1 65  ? 7.142   -69.631 -42.361 1.00 42.75  ? 66  GLN B N   1 
ATOM   4649 C CA  . GLN B 1 65  ? 7.274   -68.408 -43.143 1.00 37.57  ? 66  GLN B CA  1 
ATOM   4650 C C   . GLN B 1 65  ? 7.898   -67.286 -42.324 1.00 46.86  ? 66  GLN B C   1 
ATOM   4651 O O   . GLN B 1 65  ? 8.297   -67.485 -41.170 1.00 42.26  ? 66  GLN B O   1 
ATOM   4652 C CB  . GLN B 1 65  ? 5.918   -67.962 -43.678 1.00 42.96  ? 66  GLN B CB  1 
ATOM   4653 C CG  . GLN B 1 65  ? 5.682   -68.350 -45.105 1.00 39.95  ? 66  GLN B CG  1 
ATOM   4654 C CD  . GLN B 1 65  ? 6.347   -67.387 -46.082 1.00 50.84  ? 66  GLN B CD  1 
ATOM   4655 O OE1 . GLN B 1 65  ? 7.130   -66.511 -45.703 1.00 52.10  ? 66  GLN B OE1 1 
ATOM   4656 N NE2 . GLN B 1 65  ? 6.019   -67.539 -47.346 1.00 42.55  ? 66  GLN B NE2 1 
ATOM   4657 N N   . SER B 1 66  ? 7.943   -66.104 -42.927 1.00 36.45  ? 67  SER B N   1 
ATOM   4658 C CA  . SER B 1 66  ? 8.624   -64.954 -42.350 1.00 44.23  ? 67  SER B CA  1 
ATOM   4659 C C   . SER B 1 66  ? 8.013   -64.491 -41.027 1.00 40.79  ? 67  SER B C   1 
ATOM   4660 O O   . SER B 1 66  ? 6.819   -64.673 -40.789 1.00 37.91  ? 67  SER B O   1 
ATOM   4661 C CB  . SER B 1 66  ? 8.625   -63.781 -43.342 1.00 42.86  ? 67  SER B CB  1 
ATOM   4662 O OG  . SER B 1 66  ? 9.308   -64.094 -44.547 1.00 48.27  ? 67  SER B OG  1 
ATOM   4663 N N   . VAL B 1 67  ? 8.845   -63.884 -40.186 1.00 33.81  ? 68  VAL B N   1 
ATOM   4664 C CA  . VAL B 1 67  ? 8.402   -63.202 -38.967 1.00 41.97  ? 68  VAL B CA  1 
ATOM   4665 C C   . VAL B 1 67  ? 7.840   -61.788 -39.256 1.00 46.30  ? 68  VAL B C   1 
ATOM   4666 O O   . VAL B 1 67  ? 8.412   -61.037 -40.049 1.00 41.85  ? 68  VAL B O   1 
ATOM   4667 C CB  . VAL B 1 67  ? 9.569   -63.096 -37.991 1.00 44.49  ? 68  VAL B CB  1 
ATOM   4668 C CG1 . VAL B 1 67  ? 9.134   -62.456 -36.707 1.00 47.44  ? 68  VAL B CG1 1 
ATOM   4669 C CG2 . VAL B 1 67  ? 10.118  -64.478 -37.729 1.00 42.46  ? 68  VAL B CG2 1 
ATOM   4670 N N   . CYS B 1 68  ? 6.724   -61.412 -38.641 1.00 42.74  ? 69  CYS B N   1 
ATOM   4671 C CA  . CYS B 1 68  ? 6.210   -60.049 -38.843 1.00 44.17  ? 69  CYS B CA  1 
ATOM   4672 C C   . CYS B 1 68  ? 7.225   -59.025 -38.353 1.00 39.80  ? 69  CYS B C   1 
ATOM   4673 O O   . CYS B 1 68  ? 7.987   -59.311 -37.416 1.00 41.36  ? 69  CYS B O   1 
ATOM   4674 C CB  . CYS B 1 68  ? 4.875   -59.867 -38.129 1.00 41.54  ? 69  CYS B CB  1 
ATOM   4675 S SG  . CYS B 1 68  ? 3.637   -61.064 -38.683 1.00 46.01  ? 69  CYS B SG  1 
ATOM   4676 N N   . TYR B 1 69  ? 7.273   -57.859 -38.998 1.00 41.57  ? 70  TYR B N   1 
ATOM   4677 C CA  . TYR B 1 69  ? 8.297   -56.854 -38.664 1.00 39.89  ? 70  TYR B CA  1 
ATOM   4678 C C   . TYR B 1 69  ? 8.220   -56.474 -37.189 1.00 40.25  ? 70  TYR B C   1 
ATOM   4679 O O   . TYR B 1 69  ? 7.129   -56.249 -36.643 1.00 37.59  ? 70  TYR B O   1 
ATOM   4680 C CB  . TYR B 1 69  ? 8.149   -55.606 -39.535 1.00 47.50  ? 70  TYR B CB  1 
ATOM   4681 C CG  . TYR B 1 69  ? 9.159   -55.510 -40.661 1.00 47.04  ? 70  TYR B CG  1 
ATOM   4682 C CD1 . TYR B 1 69  ? 10.424  -54.964 -40.452 1.00 42.96  ? 70  TYR B CD1 1 
ATOM   4683 C CD2 . TYR B 1 69  ? 8.835   -55.951 -41.942 1.00 51.49  ? 70  TYR B CD2 1 
ATOM   4684 C CE1 . TYR B 1 69  ? 11.352  -54.883 -41.494 1.00 49.79  ? 70  TYR B CE1 1 
ATOM   4685 C CE2 . TYR B 1 69  ? 9.743   -55.860 -42.995 1.00 48.04  ? 70  TYR B CE2 1 
ATOM   4686 C CZ  . TYR B 1 69  ? 10.997  -55.329 -42.774 1.00 53.97  ? 70  TYR B CZ  1 
ATOM   4687 O OH  . TYR B 1 69  ? 11.885  -55.251 -43.835 1.00 62.99  ? 70  TYR B OH  1 
ATOM   4688 N N   . GLN B 1 70  ? 9.378   -56.428 -36.542 1.00 43.01  ? 71  GLN B N   1 
ATOM   4689 C CA  . GLN B 1 70  ? 9.424   -56.185 -35.115 1.00 43.23  ? 71  GLN B CA  1 
ATOM   4690 C C   . GLN B 1 70  ? 10.822  -55.781 -34.660 1.00 46.61  ? 71  GLN B C   1 
ATOM   4691 O O   . GLN B 1 70  ? 11.819  -56.100 -35.314 1.00 50.43  ? 71  GLN B O   1 
ATOM   4692 C CB  . GLN B 1 70  ? 8.952   -57.430 -34.356 1.00 43.08  ? 71  GLN B CB  1 
ATOM   4693 C CG  . GLN B 1 70  ? 9.785   -58.694 -34.594 1.00 46.11  ? 71  GLN B CG  1 
ATOM   4694 C CD  . GLN B 1 70  ? 9.149   -59.927 -33.981 1.00 43.02  ? 71  GLN B CD  1 
ATOM   4695 O OE1 . GLN B 1 70  ? 9.615   -60.450 -32.967 1.00 42.31  ? 71  GLN B OE1 1 
ATOM   4696 N NE2 . GLN B 1 70  ? 8.069   -60.389 -34.587 1.00 39.43  ? 71  GLN B NE2 1 
ATOM   4697 N N   . TYR B 1 71  ? 10.886  -55.065 -33.546 1.00 45.38  ? 72  TYR B N   1 
ATOM   4698 C CA  . TYR B 1 71  ? 12.154  -54.712 -32.927 1.00 50.31  ? 72  TYR B CA  1 
ATOM   4699 C C   . TYR B 1 71  ? 12.881  -55.976 -32.471 1.00 53.55  ? 72  TYR B C   1 
ATOM   4700 O O   . TYR B 1 71  ? 12.264  -56.917 -31.973 1.00 48.64  ? 72  TYR B O   1 
ATOM   4701 C CB  . TYR B 1 71  ? 11.937  -53.754 -31.737 1.00 62.19  ? 72  TYR B CB  1 
ATOM   4702 C CG  . TYR B 1 71  ? 13.156  -53.604 -30.841 1.00 60.10  ? 72  TYR B CG  1 
ATOM   4703 C CD1 . TYR B 1 71  ? 14.200  -52.743 -31.182 1.00 57.51  ? 72  TYR B CD1 1 
ATOM   4704 C CD2 . TYR B 1 71  ? 13.271  -54.341 -29.662 1.00 54.50  ? 72  TYR B CD2 1 
ATOM   4705 C CE1 . TYR B 1 71  ? 15.331  -52.618 -30.362 1.00 66.87  ? 72  TYR B CE1 1 
ATOM   4706 C CE2 . TYR B 1 71  ? 14.390  -54.228 -28.847 1.00 59.76  ? 72  TYR B CE2 1 
ATOM   4707 C CZ  . TYR B 1 71  ? 15.419  -53.369 -29.196 1.00 65.58  ? 72  TYR B CZ  1 
ATOM   4708 O OH  . TYR B 1 71  ? 16.528  -53.278 -28.370 1.00 71.95  ? 72  TYR B OH  1 
ATOM   4709 N N   . VAL B 1 72  ? 14.198  -55.986 -32.620 1.00 52.52  ? 73  VAL B N   1 
ATOM   4710 C CA  . VAL B 1 72  ? 14.993  -57.140 -32.241 1.00 52.26  ? 73  VAL B CA  1 
ATOM   4711 C C   . VAL B 1 72  ? 15.854  -56.799 -31.034 1.00 54.48  ? 73  VAL B C   1 
ATOM   4712 O O   . VAL B 1 72  ? 16.658  -55.868 -31.072 1.00 61.47  ? 73  VAL B O   1 
ATOM   4713 C CB  . VAL B 1 72  ? 15.871  -57.618 -33.421 1.00 50.82  ? 73  VAL B CB  1 
ATOM   4714 C CG1 . VAL B 1 72  ? 16.667  -58.850 -33.021 1.00 54.42  ? 73  VAL B CG1 1 
ATOM   4715 C CG2 . VAL B 1 72  ? 14.989  -57.922 -34.604 1.00 40.66  ? 73  VAL B CG2 1 
ATOM   4716 N N   . ASP B 1 73  ? 15.648  -57.548 -29.956 1.00 62.70  ? 74  ASP B N   1 
ATOM   4717 C CA  . ASP B 1 73  ? 16.335  -57.357 -28.676 1.00 52.35  ? 74  ASP B CA  1 
ATOM   4718 C C   . ASP B 1 73  ? 17.846  -57.506 -28.794 1.00 56.52  ? 74  ASP B C   1 
ATOM   4719 O O   . ASP B 1 73  ? 18.340  -58.579 -29.145 1.00 67.69  ? 74  ASP B O   1 
ATOM   4720 C CB  . ASP B 1 73  ? 15.800  -58.375 -27.663 1.00 60.38  ? 74  ASP B CB  1 
ATOM   4721 C CG  . ASP B 1 73  ? 16.258  -58.105 -26.243 1.00 60.22  ? 74  ASP B CG  1 
ATOM   4722 O OD1 . ASP B 1 73  ? 17.170  -57.278 -26.016 1.00 57.96  ? 74  ASP B OD1 1 
ATOM   4723 O OD2 . ASP B 1 73  ? 15.692  -58.747 -25.344 1.00 74.59  ? 74  ASP B OD2 1 
ATOM   4724 N N   . THR B 1 74  ? 18.586  -56.452 -28.474 1.00 61.65  ? 75  THR B N   1 
ATOM   4725 C CA  . THR B 1 74  ? 20.048  -56.521 -28.530 1.00 65.00  ? 75  THR B CA  1 
ATOM   4726 C C   . THR B 1 74  ? 20.720  -56.295 -27.176 1.00 64.54  ? 75  THR B C   1 
ATOM   4727 O O   . THR B 1 74  ? 21.891  -55.932 -27.120 1.00 71.03  ? 75  THR B O   1 
ATOM   4728 C CB  . THR B 1 74  ? 20.610  -55.490 -29.516 1.00 64.88  ? 75  THR B CB  1 
ATOM   4729 O OG1 . THR B 1 74  ? 20.167  -54.183 -29.130 1.00 71.78  ? 75  THR B OG1 1 
ATOM   4730 C CG2 . THR B 1 74  ? 20.134  -55.786 -30.944 1.00 57.32  ? 75  THR B CG2 1 
ATOM   4731 N N   . LEU B 1 75  ? 19.979  -56.510 -26.093 1.00 67.14  ? 76  LEU B N   1 
ATOM   4732 C CA  . LEU B 1 75  ? 20.476  -56.237 -24.742 1.00 65.02  ? 76  LEU B CA  1 
ATOM   4733 C C   . LEU B 1 75  ? 21.674  -57.105 -24.369 1.00 70.66  ? 76  LEU B C   1 
ATOM   4734 O O   . LEU B 1 75  ? 22.684  -56.610 -23.858 1.00 77.47  ? 76  LEU B O   1 
ATOM   4735 C CB  . LEU B 1 75  ? 19.363  -56.438 -23.705 1.00 66.38  ? 76  LEU B CB  1 
ATOM   4736 C CG  . LEU B 1 75  ? 19.740  -55.961 -22.292 1.00 79.58  ? 76  LEU B CG  1 
ATOM   4737 C CD1 . LEU B 1 75  ? 20.159  -54.489 -22.323 1.00 67.91  ? 76  LEU B CD1 1 
ATOM   4738 C CD2 . LEU B 1 75  ? 18.605  -56.175 -21.295 1.00 67.93  ? 76  LEU B CD2 1 
ATOM   4739 N N   . TYR B 1 76  ? 21.557  -58.403 -24.618 1.00 66.06  ? 77  TYR B N   1 
ATOM   4740 C CA  . TYR B 1 76  ? 22.665  -59.309 -24.368 1.00 63.90  ? 77  TYR B CA  1 
ATOM   4741 C C   . TYR B 1 76  ? 22.965  -60.149 -25.601 1.00 58.93  ? 77  TYR B C   1 
ATOM   4742 O O   . TYR B 1 76  ? 22.498  -61.280 -25.708 1.00 70.59  ? 77  TYR B O   1 
ATOM   4743 C CB  . TYR B 1 76  ? 22.358  -60.221 -23.192 1.00 60.69  ? 77  TYR B CB  1 
ATOM   4744 C CG  . TYR B 1 76  ? 22.162  -59.524 -21.870 1.00 73.66  ? 77  TYR B CG  1 
ATOM   4745 C CD1 . TYR B 1 76  ? 23.241  -58.982 -21.179 1.00 70.88  ? 77  TYR B CD1 1 
ATOM   4746 C CD2 . TYR B 1 76  ? 20.900  -59.440 -21.290 1.00 71.21  ? 77  TYR B CD2 1 
ATOM   4747 C CE1 . TYR B 1 76  ? 23.067  -58.363 -19.951 1.00 81.96  ? 77  TYR B CE1 1 
ATOM   4748 C CE2 . TYR B 1 76  ? 20.711  -58.821 -20.063 1.00 77.69  ? 77  TYR B CE2 1 
ATOM   4749 C CZ  . TYR B 1 76  ? 21.797  -58.284 -19.391 1.00 84.70  ? 77  TYR B CZ  1 
ATOM   4750 O OH  . TYR B 1 76  ? 21.613  -57.666 -18.162 1.00 72.19  ? 77  TYR B OH  1 
ATOM   4751 N N   . PRO B 1 77  ? 23.749  -59.602 -26.535 1.00 70.18  ? 78  PRO B N   1 
ATOM   4752 C CA  . PRO B 1 77  ? 24.002  -60.264 -27.824 1.00 68.12  ? 78  PRO B CA  1 
ATOM   4753 C C   . PRO B 1 77  ? 24.556  -61.690 -27.689 1.00 63.69  ? 78  PRO B C   1 
ATOM   4754 O O   . PRO B 1 77  ? 25.467  -61.941 -26.896 1.00 64.55  ? 78  PRO B O   1 
ATOM   4755 C CB  . PRO B 1 77  ? 25.030  -59.347 -28.493 1.00 61.22  ? 78  PRO B CB  1 
ATOM   4756 C CG  . PRO B 1 77  ? 24.824  -58.020 -27.866 1.00 69.42  ? 78  PRO B CG  1 
ATOM   4757 C CD  . PRO B 1 77  ? 24.424  -58.300 -26.435 1.00 61.41  ? 78  PRO B CD  1 
ATOM   4758 N N   . GLY B 1 78  ? 23.995  -62.618 -28.460 1.00 70.37  ? 79  GLY B N   1 
ATOM   4759 C CA  . GLY B 1 78  ? 24.463  -63.993 -28.454 1.00 62.15  ? 79  GLY B CA  1 
ATOM   4760 C C   . GLY B 1 78  ? 24.161  -64.735 -27.166 1.00 64.47  ? 79  GLY B C   1 
ATOM   4761 O O   . GLY B 1 78  ? 24.614  -65.856 -26.969 1.00 60.29  ? 79  GLY B O   1 
ATOM   4762 N N   . PHE B 1 79  ? 23.393  -64.111 -26.283 1.00 60.85  ? 80  PHE B N   1 
ATOM   4763 C CA  . PHE B 1 79  ? 22.987  -64.764 -25.058 1.00 48.65  ? 80  PHE B CA  1 
ATOM   4764 C C   . PHE B 1 79  ? 21.699  -65.555 -25.302 1.00 64.02  ? 80  PHE B C   1 
ATOM   4765 O O   . PHE B 1 79  ? 20.716  -65.016 -25.812 1.00 62.20  ? 80  PHE B O   1 
ATOM   4766 C CB  . PHE B 1 79  ? 22.817  -63.726 -23.957 1.00 59.04  ? 80  PHE B CB  1 
ATOM   4767 C CG  . PHE B 1 79  ? 22.210  -64.264 -22.701 1.00 54.34  ? 80  PHE B CG  1 
ATOM   4768 C CD1 . PHE B 1 79  ? 22.821  -65.291 -22.004 1.00 53.54  ? 80  PHE B CD1 1 
ATOM   4769 C CD2 . PHE B 1 79  ? 21.037  -63.720 -22.205 1.00 52.74  ? 80  PHE B CD2 1 
ATOM   4770 C CE1 . PHE B 1 79  ? 22.250  -65.785 -20.844 1.00 54.79  ? 80  PHE B CE1 1 
ATOM   4771 C CE2 . PHE B 1 79  ? 20.472  -64.199 -21.052 1.00 50.91  ? 80  PHE B CE2 1 
ATOM   4772 C CZ  . PHE B 1 79  ? 21.076  -65.231 -20.364 1.00 50.51  ? 80  PHE B CZ  1 
ATOM   4773 N N   . GLU B 1 80  ? 21.706  -66.836 -24.953 1.00 56.34  ? 81  GLU B N   1 
ATOM   4774 C CA  . GLU B 1 80  ? 20.563  -67.690 -25.252 1.00 60.00  ? 81  GLU B CA  1 
ATOM   4775 C C   . GLU B 1 80  ? 19.266  -67.187 -24.633 1.00 62.64  ? 81  GLU B C   1 
ATOM   4776 O O   . GLU B 1 80  ? 18.196  -67.316 -25.237 1.00 62.83  ? 81  GLU B O   1 
ATOM   4777 C CB  . GLU B 1 80  ? 20.809  -69.122 -24.783 1.00 73.80  ? 81  GLU B CB  1 
ATOM   4778 C CG  . GLU B 1 80  ? 19.853  -70.119 -25.440 1.00 88.44  ? 81  GLU B CG  1 
ATOM   4779 C CD  . GLU B 1 80  ? 19.395  -71.211 -24.491 1.00 106.40 ? 81  GLU B CD  1 
ATOM   4780 O OE1 . GLU B 1 80  ? 20.229  -71.692 -23.686 1.00 117.79 ? 81  GLU B OE1 1 
ATOM   4781 O OE2 . GLU B 1 80  ? 18.199  -71.585 -24.550 1.00 107.29 ? 81  GLU B OE2 1 
ATOM   4782 N N   . GLY B 1 81  ? 19.358  -66.616 -23.436 1.00 59.28  ? 82  GLY B N   1 
ATOM   4783 C CA  . GLY B 1 81  ? 18.174  -66.201 -22.701 1.00 50.68  ? 82  GLY B CA  1 
ATOM   4784 C C   . GLY B 1 81  ? 17.376  -65.119 -23.400 1.00 53.53  ? 82  GLY B C   1 
ATOM   4785 O O   . GLY B 1 81  ? 16.162  -65.041 -23.254 1.00 56.96  ? 82  GLY B O   1 
ATOM   4786 N N   . THR B 1 82  ? 18.061  -64.278 -24.164 1.00 56.94  ? 83  THR B N   1 
ATOM   4787 C CA  . THR B 1 82  ? 17.378  -63.277 -24.960 1.00 53.95  ? 83  THR B CA  1 
ATOM   4788 C C   . THR B 1 82  ? 17.140  -63.788 -26.393 1.00 56.85  ? 83  THR B C   1 
ATOM   4789 O O   . THR B 1 82  ? 16.033  -63.654 -26.911 1.00 56.95  ? 83  THR B O   1 
ATOM   4790 C CB  . THR B 1 82  ? 18.161  -61.938 -24.973 1.00 53.15  ? 83  THR B CB  1 
ATOM   4791 O OG1 . THR B 1 82  ? 19.515  -62.170 -25.365 1.00 64.09  ? 83  THR B OG1 1 
ATOM   4792 C CG2 . THR B 1 82  ? 18.162  -61.306 -23.579 1.00 61.59  ? 83  THR B CG2 1 
ATOM   4793 N N   . GLU B 1 83  ? 18.155  -64.403 -27.008 1.00 57.80  ? 84  GLU B N   1 
ATOM   4794 C CA  . GLU B 1 83  ? 18.083  -64.818 -28.422 1.00 62.74  ? 84  GLU B CA  1 
ATOM   4795 C C   . GLU B 1 83  ? 16.990  -65.839 -28.721 1.00 57.27  ? 84  GLU B C   1 
ATOM   4796 O O   . GLU B 1 83  ? 16.492  -65.919 -29.849 1.00 50.80  ? 84  GLU B O   1 
ATOM   4797 C CB  . GLU B 1 83  ? 19.424  -65.398 -28.902 1.00 59.97  ? 84  GLU B CB  1 
ATOM   4798 C CG  . GLU B 1 83  ? 20.626  -64.444 -28.832 1.00 64.71  ? 84  GLU B CG  1 
ATOM   4799 C CD  . GLU B 1 83  ? 20.529  -63.245 -29.770 1.00 77.58  ? 84  GLU B CD  1 
ATOM   4800 O OE1 . GLU B 1 83  ? 19.595  -63.190 -30.612 1.00 76.14  ? 84  GLU B OE1 1 
ATOM   4801 O OE2 . GLU B 1 83  ? 21.409  -62.354 -29.664 1.00 68.69  ? 84  GLU B OE2 1 
ATOM   4802 N N   . MET B 1 84  ? 16.613  -66.627 -27.724 1.00 51.59  ? 85  MET B N   1 
ATOM   4803 C CA  . MET B 1 84  ? 15.577  -67.632 -27.937 1.00 40.43  ? 85  MET B CA  1 
ATOM   4804 C C   . MET B 1 84  ? 14.225  -67.010 -28.264 1.00 53.74  ? 85  MET B C   1 
ATOM   4805 O O   . MET B 1 84  ? 13.328  -67.724 -28.713 1.00 48.61  ? 85  MET B O   1 
ATOM   4806 C CB  . MET B 1 84  ? 15.424  -68.519 -26.710 1.00 48.10  ? 85  MET B CB  1 
ATOM   4807 C CG  . MET B 1 84  ? 14.837  -67.790 -25.523 1.00 47.54  ? 85  MET B CG  1 
ATOM   4808 S SD  . MET B 1 84  ? 14.870  -68.814 -24.045 1.00 56.50  ? 85  MET B SD  1 
ATOM   4809 C CE  . MET B 1 84  ? 13.397  -69.794 -24.287 1.00 45.20  ? 85  MET B CE  1 
ATOM   4810 N N   . TRP B 1 85  ? 14.074  -65.702 -28.014 1.00 41.59  ? 86  TRP B N   1 
ATOM   4811 C CA  . TRP B 1 85  ? 12.818  -64.989 -28.274 1.00 43.00  ? 86  TRP B CA  1 
ATOM   4812 C C   . TRP B 1 85  ? 12.871  -64.130 -29.543 1.00 44.01  ? 86  TRP B C   1 
ATOM   4813 O O   . TRP B 1 85  ? 11.864  -63.575 -29.968 1.00 46.11  ? 86  TRP B O   1 
ATOM   4814 C CB  . TRP B 1 85  ? 12.439  -64.100 -27.072 1.00 39.91  ? 86  TRP B CB  1 
ATOM   4815 C CG  . TRP B 1 85  ? 12.401  -64.846 -25.771 1.00 50.34  ? 86  TRP B CG  1 
ATOM   4816 C CD1 . TRP B 1 85  ? 13.271  -64.719 -24.731 1.00 46.13  ? 86  TRP B CD1 1 
ATOM   4817 C CD2 . TRP B 1 85  ? 11.454  -65.851 -25.379 1.00 43.74  ? 86  TRP B CD2 1 
ATOM   4818 N NE1 . TRP B 1 85  ? 12.919  -65.565 -23.709 1.00 47.07  ? 86  TRP B NE1 1 
ATOM   4819 C CE2 . TRP B 1 85  ? 11.807  -66.273 -24.084 1.00 47.16  ? 86  TRP B CE2 1 
ATOM   4820 C CE3 . TRP B 1 85  ? 10.338  -66.422 -25.990 1.00 43.76  ? 86  TRP B CE3 1 
ATOM   4821 C CZ2 . TRP B 1 85  ? 11.095  -67.248 -23.400 1.00 39.61  ? 86  TRP B CZ2 1 
ATOM   4822 C CZ3 . TRP B 1 85  ? 9.631   -67.390 -25.309 1.00 45.13  ? 86  TRP B CZ3 1 
ATOM   4823 C CH2 . TRP B 1 85  ? 10.003  -67.785 -24.028 1.00 45.80  ? 86  TRP B CH2 1 
ATOM   4824 N N   . ASN B 1 86  ? 14.052  -64.004 -30.126 1.00 42.26  ? 87  ASN B N   1 
ATOM   4825 C CA  . ASN B 1 86  ? 14.237  -63.176 -31.311 1.00 47.93  ? 87  ASN B CA  1 
ATOM   4826 C C   . ASN B 1 86  ? 13.871  -63.911 -32.598 1.00 42.09  ? 87  ASN B C   1 
ATOM   4827 O O   . ASN B 1 86  ? 13.940  -65.137 -32.648 1.00 45.13  ? 87  ASN B O   1 
ATOM   4828 C CB  . ASN B 1 86  ? 15.685  -62.685 -31.370 1.00 50.63  ? 87  ASN B CB  1 
ATOM   4829 C CG  . ASN B 1 86  ? 15.930  -61.484 -30.472 1.00 58.68  ? 87  ASN B CG  1 
ATOM   4830 O OD1 . ASN B 1 86  ? 15.003  -60.732 -30.139 1.00 58.80  ? 87  ASN B OD1 1 
ATOM   4831 N ND2 . ASN B 1 86  ? 17.184  -61.292 -30.083 1.00 64.14  ? 87  ASN B ND2 1 
ATOM   4832 N N   . PRO B 1 87  ? 13.461  -63.166 -33.633 1.00 48.09  ? 88  PRO B N   1 
ATOM   4833 C CA  . PRO B 1 87  ? 13.063  -63.760 -34.920 1.00 47.26  ? 88  PRO B CA  1 
ATOM   4834 C C   . PRO B 1 87  ? 14.067  -64.777 -35.429 1.00 50.38  ? 88  PRO B C   1 
ATOM   4835 O O   . PRO B 1 87  ? 15.268  -64.497 -35.433 1.00 47.91  ? 88  PRO B O   1 
ATOM   4836 C CB  . PRO B 1 87  ? 13.016  -62.557 -35.872 1.00 42.76  ? 88  PRO B CB  1 
ATOM   4837 C CG  . PRO B 1 87  ? 12.722  -61.414 -34.992 1.00 44.33  ? 88  PRO B CG  1 
ATOM   4838 C CD  . PRO B 1 87  ? 13.409  -61.695 -33.672 1.00 39.65  ? 88  PRO B CD  1 
ATOM   4839 N N   . ASN B 1 88  ? 13.578  -65.943 -35.832 1.00 47.45  ? 89  ASN B N   1 
ATOM   4840 C CA  . ASN B 1 88  ? 14.428  -66.951 -36.454 1.00 48.77  ? 89  ASN B CA  1 
ATOM   4841 C C   . ASN B 1 88  ? 14.081  -67.170 -37.926 1.00 49.18  ? 89  ASN B C   1 
ATOM   4842 O O   . ASN B 1 88  ? 14.325  -68.237 -38.486 1.00 51.40  ? 89  ASN B O   1 
ATOM   4843 C CB  . ASN B 1 88  ? 14.320  -68.261 -35.699 1.00 46.23  ? 89  ASN B CB  1 
ATOM   4844 C CG  . ASN B 1 88  ? 12.929  -68.825 -35.736 1.00 47.03  ? 89  ASN B CG  1 
ATOM   4845 O OD1 . ASN B 1 88  ? 11.961  -68.118 -36.044 1.00 48.69  ? 89  ASN B OD1 1 
ATOM   4846 N ND2 . ASN B 1 88  ? 12.805  -70.096 -35.403 1.00 55.00  ? 89  ASN B ND2 1 
ATOM   4847 N N   . ARG B 1 89  ? 13.466  -66.158 -38.527 1.00 42.70  ? 90  ARG B N   1 
ATOM   4848 C CA  . ARG B 1 89  ? 13.255  -66.072 -39.971 1.00 44.36  ? 90  ARG B CA  1 
ATOM   4849 C C   . ARG B 1 89  ? 13.404  -64.608 -40.334 1.00 51.04  ? 90  ARG B C   1 
ATOM   4850 O O   . ARG B 1 89  ? 13.422  -63.745 -39.457 1.00 49.50  ? 90  ARG B O   1 
ATOM   4851 C CB  . ARG B 1 89  ? 11.878  -66.567 -40.390 1.00 45.91  ? 90  ARG B CB  1 
ATOM   4852 C CG  . ARG B 1 89  ? 11.666  -68.054 -40.270 1.00 51.94  ? 90  ARG B CG  1 
ATOM   4853 C CD  . ARG B 1 89  ? 12.361  -68.772 -41.415 1.00 50.59  ? 90  ARG B CD  1 
ATOM   4854 N NE  . ARG B 1 89  ? 11.953  -70.166 -41.500 1.00 49.40  ? 90  ARG B NE  1 
ATOM   4855 C CZ  . ARG B 1 89  ? 12.377  -71.105 -40.664 1.00 50.57  ? 90  ARG B CZ  1 
ATOM   4856 N NH1 . ARG B 1 89  ? 13.209  -70.795 -39.679 1.00 48.66  ? 90  ARG B NH1 1 
ATOM   4857 N NH2 . ARG B 1 89  ? 11.956  -72.353 -40.803 1.00 66.84  ? 90  ARG B NH2 1 
ATOM   4858 N N   . GLU B 1 90  ? 13.499  -64.312 -41.617 1.00 43.28  ? 91  GLU B N   1 
ATOM   4859 C CA  . GLU B 1 90  ? 13.639  -62.930 -42.020 1.00 48.52  ? 91  GLU B CA  1 
ATOM   4860 C C   . GLU B 1 90  ? 12.353  -62.168 -41.676 1.00 45.91  ? 91  GLU B C   1 
ATOM   4861 O O   . GLU B 1 90  ? 11.254  -62.742 -41.653 1.00 41.53  ? 91  GLU B O   1 
ATOM   4862 C CB  . GLU B 1 90  ? 13.957  -62.831 -43.513 1.00 43.66  ? 91  GLU B CB  1 
ATOM   4863 C CG  . GLU B 1 90  ? 12.730  -62.863 -44.362 1.00 53.12  ? 91  GLU B CG  1 
ATOM   4864 C CD  . GLU B 1 90  ? 13.018  -62.613 -45.826 1.00 82.74  ? 91  GLU B CD  1 
ATOM   4865 O OE1 . GLU B 1 90  ? 14.204  -62.700 -46.234 1.00 84.81  ? 91  GLU B OE1 1 
ATOM   4866 O OE2 . GLU B 1 90  ? 12.047  -62.327 -46.562 1.00 82.33  ? 91  GLU B OE2 1 
ATOM   4867 N N   . LEU B 1 91  ? 12.503  -60.878 -41.397 1.00 39.03  ? 92  LEU B N   1 
ATOM   4868 C CA  . LEU B 1 91  ? 11.346  -60.017 -41.204 1.00 42.38  ? 92  LEU B CA  1 
ATOM   4869 C C   . LEU B 1 91  ? 10.678  -59.689 -42.528 1.00 46.30  ? 92  LEU B C   1 
ATOM   4870 O O   . LEU B 1 91  ? 11.335  -59.324 -43.498 1.00 49.39  ? 92  LEU B O   1 
ATOM   4871 C CB  . LEU B 1 91  ? 11.746  -58.722 -40.514 1.00 45.00  ? 92  LEU B CB  1 
ATOM   4872 C CG  . LEU B 1 91  ? 12.539  -58.867 -39.224 1.00 46.81  ? 92  LEU B CG  1 
ATOM   4873 C CD1 . LEU B 1 91  ? 12.798  -57.478 -38.660 1.00 47.81  ? 92  LEU B CD1 1 
ATOM   4874 C CD2 . LEU B 1 91  ? 11.771  -59.742 -38.242 1.00 49.54  ? 92  LEU B CD2 1 
ATOM   4875 N N   . SER B 1 92  ? 9.361   -59.802 -42.562 1.00 50.29  ? 93  SER B N   1 
ATOM   4876 C CA  . SER B 1 92  ? 8.615   -59.332 -43.703 1.00 44.48  ? 93  SER B CA  1 
ATOM   4877 C C   . SER B 1 92  ? 7.246   -58.863 -43.266 1.00 48.93  ? 93  SER B C   1 
ATOM   4878 O O   . SER B 1 92  ? 6.704   -59.380 -42.299 1.00 47.21  ? 93  SER B O   1 
ATOM   4879 C CB  . SER B 1 92  ? 8.478   -60.435 -44.745 1.00 43.11  ? 93  SER B CB  1 
ATOM   4880 O OG  . SER B 1 92  ? 7.540   -60.048 -45.739 1.00 44.92  ? 93  SER B OG  1 
ATOM   4881 N N   . GLU B 1 93  ? 6.679   -57.893 -43.978 1.00 50.27  ? 94  GLU B N   1 
ATOM   4882 C CA  . GLU B 1 93  ? 5.279   -57.542 -43.775 1.00 43.51  ? 94  GLU B CA  1 
ATOM   4883 C C   . GLU B 1 93  ? 4.366   -58.632 -44.317 1.00 48.35  ? 94  GLU B C   1 
ATOM   4884 O O   . GLU B 1 93  ? 3.184   -58.703 -43.972 1.00 48.28  ? 94  GLU B O   1 
ATOM   4885 C CB  . GLU B 1 93  ? 4.937   -56.220 -44.452 1.00 42.85  ? 94  GLU B CB  1 
ATOM   4886 C CG  . GLU B 1 93  ? 5.416   -55.003 -43.692 1.00 46.92  ? 94  GLU B CG  1 
ATOM   4887 C CD  . GLU B 1 93  ? 4.848   -53.728 -44.281 1.00 57.77  ? 94  GLU B CD  1 
ATOM   4888 O OE1 . GLU B 1 93  ? 3.724   -53.340 -43.881 1.00 51.72  ? 94  GLU B OE1 1 
ATOM   4889 O OE2 . GLU B 1 93  ? 5.518   -53.134 -45.158 1.00 59.01  ? 94  GLU B OE2 1 
ATOM   4890 N N   . ASP B 1 94  ? 4.918   -59.452 -45.202 1.00 45.31  ? 95  ASP B N   1 
ATOM   4891 C CA  . ASP B 1 94  ? 4.233   -60.621 -45.727 1.00 45.25  ? 95  ASP B CA  1 
ATOM   4892 C C   . ASP B 1 94  ? 4.446   -61.747 -44.711 1.00 49.60  ? 95  ASP B C   1 
ATOM   4893 O O   . ASP B 1 94  ? 5.387   -62.522 -44.846 1.00 38.71  ? 95  ASP B O   1 
ATOM   4894 C CB  . ASP B 1 94  ? 4.793   -60.942 -47.120 1.00 41.94  ? 95  ASP B CB  1 
ATOM   4895 C CG  . ASP B 1 94  ? 4.155   -62.155 -47.773 1.00 43.74  ? 95  ASP B CG  1 
ATOM   4896 O OD1 . ASP B 1 94  ? 3.151   -62.680 -47.260 1.00 49.95  ? 95  ASP B OD1 1 
ATOM   4897 O OD2 . ASP B 1 94  ? 4.668   -62.582 -48.832 1.00 59.44  ? 95  ASP B OD2 1 
ATOM   4898 N N   . CYS B 1 95  ? 3.597   -61.808 -43.673 1.00 44.85  ? 96  CYS B N   1 
ATOM   4899 C CA  . CYS B 1 95  ? 3.793   -62.757 -42.551 1.00 42.84  ? 96  CYS B CA  1 
ATOM   4900 C C   . CYS B 1 95  ? 2.532   -63.471 -42.081 1.00 43.28  ? 96  CYS B C   1 
ATOM   4901 O O   . CYS B 1 95  ? 2.552   -64.179 -41.068 1.00 38.43  ? 96  CYS B O   1 
ATOM   4902 C CB  . CYS B 1 95  ? 4.407   -62.043 -41.332 1.00 32.01  ? 96  CYS B CB  1 
ATOM   4903 S SG  . CYS B 1 95  ? 3.425   -60.634 -40.695 1.00 43.49  ? 96  CYS B SG  1 
ATOM   4904 N N   . LEU B 1 96  ? 1.425   -63.311 -42.788 1.00 34.73  ? 97  LEU B N   1 
ATOM   4905 C CA  . LEU B 1 96  ? 0.208   -63.897 -42.258 1.00 38.22  ? 97  LEU B CA  1 
ATOM   4906 C C   . LEU B 1 96  ? 0.067   -65.370 -42.687 1.00 41.33  ? 97  LEU B C   1 
ATOM   4907 O O   . LEU B 1 96  ? -0.726  -65.716 -43.567 1.00 45.65  ? 97  LEU B O   1 
ATOM   4908 C CB  . LEU B 1 96  ? -1.004  -63.034 -42.647 1.00 35.77  ? 97  LEU B CB  1 
ATOM   4909 C CG  . LEU B 1 96  ? -0.966  -61.670 -41.922 1.00 41.08  ? 97  LEU B CG  1 
ATOM   4910 C CD1 . LEU B 1 96  ? -2.211  -60.843 -42.170 1.00 38.98  ? 97  LEU B CD1 1 
ATOM   4911 C CD2 . LEU B 1 96  ? -0.742  -61.837 -40.391 1.00 38.59  ? 97  LEU B CD2 1 
ATOM   4912 N N   . TYR B 1 97  ? 0.856   -66.227 -42.032 1.00 39.22  ? 98  TYR B N   1 
ATOM   4913 C CA  . TYR B 1 97  ? 0.825   -67.671 -42.236 1.00 33.68  ? 98  TYR B CA  1 
ATOM   4914 C C   . TYR B 1 97  ? 0.536   -68.402 -40.929 1.00 50.61  ? 98  TYR B C   1 
ATOM   4915 O O   . TYR B 1 97  ? 0.887   -67.904 -39.848 1.00 42.40  ? 98  TYR B O   1 
ATOM   4916 C CB  . TYR B 1 97  ? 2.161   -68.146 -42.836 1.00 31.61  ? 98  TYR B CB  1 
ATOM   4917 C CG  . TYR B 1 97  ? 2.448   -67.444 -44.172 1.00 39.54  ? 98  TYR B CG  1 
ATOM   4918 C CD1 . TYR B 1 97  ? 3.014   -66.165 -44.188 1.00 35.60  ? 98  TYR B CD1 1 
ATOM   4919 C CD2 . TYR B 1 97  ? 2.129   -68.042 -45.406 1.00 45.42  ? 98  TYR B CD2 1 
ATOM   4920 C CE1 . TYR B 1 97  ? 3.268   -65.498 -45.331 1.00 43.78  ? 98  TYR B CE1 1 
ATOM   4921 C CE2 . TYR B 1 97  ? 2.396   -67.357 -46.646 1.00 40.24  ? 98  TYR B CE2 1 
ATOM   4922 C CZ  . TYR B 1 97  ? 2.962   -66.091 -46.569 1.00 48.53  ? 98  TYR B CZ  1 
ATOM   4923 O OH  . TYR B 1 97  ? 3.221   -65.354 -47.675 1.00 43.06  ? 98  TYR B OH  1 
ATOM   4924 N N   . LEU B 1 98  ? -0.104  -69.571 -41.019 1.00 34.36  ? 99  LEU B N   1 
ATOM   4925 C CA  . LEU B 1 98  ? -0.267  -70.413 -39.845 1.00 41.23  ? 99  LEU B CA  1 
ATOM   4926 C C   . LEU B 1 98  ? 0.277   -71.819 -40.074 1.00 43.86  ? 99  LEU B C   1 
ATOM   4927 O O   . LEU B 1 98  ? 0.592   -72.207 -41.200 1.00 46.61  ? 99  LEU B O   1 
ATOM   4928 C CB  . LEU B 1 98  ? -1.743  -70.471 -39.413 1.00 36.50  ? 99  LEU B CB  1 
ATOM   4929 C CG  . LEU B 1 98  ? -2.749  -70.913 -40.467 1.00 39.43  ? 99  LEU B CG  1 
ATOM   4930 C CD1 . LEU B 1 98  ? -2.793  -72.438 -40.620 1.00 37.77  ? 99  LEU B CD1 1 
ATOM   4931 C CD2 . LEU B 1 98  ? -4.117  -70.333 -40.173 1.00 34.06  ? 99  LEU B CD2 1 
ATOM   4932 N N   . ASN B 1 99  ? 0.348   -72.581 -38.988 1.00 43.11  ? 100 ASN B N   1 
ATOM   4933 C CA  . ASN B 1 99  ? 0.994   -73.884 -38.950 1.00 38.29  ? 100 ASN B CA  1 
ATOM   4934 C C   . ASN B 1 99  ? 0.072   -74.926 -38.360 1.00 43.32  ? 100 ASN B C   1 
ATOM   4935 O O   . ASN B 1 99  ? -0.546  -74.667 -37.336 1.00 42.41  ? 100 ASN B O   1 
ATOM   4936 C CB  . ASN B 1 99  ? 2.270   -73.818 -38.107 1.00 35.27  ? 100 ASN B CB  1 
ATOM   4937 C CG  . ASN B 1 99  ? 3.127   -72.625 -38.456 1.00 49.18  ? 100 ASN B CG  1 
ATOM   4938 O OD1 . ASN B 1 99  ? 3.712   -72.570 -39.537 1.00 41.22  ? 100 ASN B OD1 1 
ATOM   4939 N ND2 . ASN B 1 99  ? 3.205   -71.654 -37.543 1.00 44.70  ? 100 ASN B ND2 1 
ATOM   4940 N N   . VAL B 1 100 ? -0.016  -76.104 -38.977 1.00 39.89  ? 101 VAL B N   1 
ATOM   4941 C CA  . VAL B 1 100 ? -0.804  -77.209 -38.426 1.00 38.12  ? 101 VAL B CA  1 
ATOM   4942 C C   . VAL B 1 100 ? 0.088   -78.422 -38.231 1.00 49.68  ? 101 VAL B C   1 
ATOM   4943 O O   . VAL B 1 100 ? 0.768   -78.844 -39.172 1.00 43.74  ? 101 VAL B O   1 
ATOM   4944 C CB  . VAL B 1 100 ? -1.980  -77.622 -39.338 1.00 38.97  ? 101 VAL B CB  1 
ATOM   4945 C CG1 . VAL B 1 100 ? -2.750  -78.800 -38.722 1.00 37.50  ? 101 VAL B CG1 1 
ATOM   4946 C CG2 . VAL B 1 100 ? -2.900  -76.454 -39.621 1.00 34.60  ? 101 VAL B CG2 1 
ATOM   4947 N N   . TRP B 1 101 ? 0.102   -78.968 -37.015 1.00 42.51  ? 102 TRP B N   1 
ATOM   4948 C CA  . TRP B 1 101 ? 0.746   -80.254 -36.750 1.00 40.14  ? 102 TRP B CA  1 
ATOM   4949 C C   . TRP B 1 101 ? -0.333  -81.278 -36.450 1.00 45.83  ? 102 TRP B C   1 
ATOM   4950 O O   . TRP B 1 101 ? -1.282  -80.989 -35.718 1.00 47.30  ? 102 TRP B O   1 
ATOM   4951 C CB  . TRP B 1 101 ? 1.701   -80.200 -35.571 1.00 39.87  ? 102 TRP B CB  1 
ATOM   4952 C CG  . TRP B 1 101 ? 2.966   -79.403 -35.696 1.00 42.54  ? 102 TRP B CG  1 
ATOM   4953 C CD1 . TRP B 1 101 ? 4.217   -79.886 -35.978 1.00 41.55  ? 102 TRP B CD1 1 
ATOM   4954 C CD2 . TRP B 1 101 ? 3.126   -77.997 -35.456 1.00 40.36  ? 102 TRP B CD2 1 
ATOM   4955 N NE1 . TRP B 1 101 ? 5.144   -78.861 -35.931 1.00 45.97  ? 102 TRP B NE1 1 
ATOM   4956 C CE2 . TRP B 1 101 ? 4.498   -77.695 -35.615 1.00 39.33  ? 102 TRP B CE2 1 
ATOM   4957 C CE3 . TRP B 1 101 ? 2.244   -76.965 -35.121 1.00 42.58  ? 102 TRP B CE3 1 
ATOM   4958 C CZ2 . TRP B 1 101 ? 5.004   -76.403 -35.457 1.00 41.16  ? 102 TRP B CZ2 1 
ATOM   4959 C CZ3 . TRP B 1 101 ? 2.751   -75.680 -34.956 1.00 38.78  ? 102 TRP B CZ3 1 
ATOM   4960 C CH2 . TRP B 1 101 ? 4.116   -75.409 -35.127 1.00 39.48  ? 102 TRP B CH2 1 
ATOM   4961 N N   . THR B 1 102 ? -0.184  -82.477 -37.003 1.00 49.14  ? 103 THR B N   1 
ATOM   4962 C CA  . THR B 1 102 ? -1.200  -83.508 -36.860 1.00 36.56  ? 103 THR B CA  1 
ATOM   4963 C C   . THR B 1 102 ? -0.482  -84.855 -36.760 1.00 48.61  ? 103 THR B C   1 
ATOM   4964 O O   . THR B 1 102 ? 0.681   -84.978 -37.173 1.00 47.68  ? 103 THR B O   1 
ATOM   4965 C CB  . THR B 1 102 ? -2.198  -83.451 -38.026 1.00 46.53  ? 103 THR B CB  1 
ATOM   4966 O OG1 . THR B 1 102 ? -3.443  -84.053 -37.646 1.00 57.56  ? 103 THR B OG1 1 
ATOM   4967 C CG2 . THR B 1 102 ? -1.644  -84.139 -39.283 1.00 48.34  ? 103 THR B CG2 1 
ATOM   4968 N N   . PRO B 1 103 ? -1.120  -85.843 -36.124 1.00 48.75  ? 104 PRO B N   1 
ATOM   4969 C CA  . PRO B 1 103 ? -0.456  -87.149 -35.981 1.00 52.64  ? 104 PRO B CA  1 
ATOM   4970 C C   . PRO B 1 103 ? -0.261  -87.872 -37.311 1.00 59.60  ? 104 PRO B C   1 
ATOM   4971 O O   . PRO B 1 103 ? -1.004  -87.602 -38.262 1.00 55.40  ? 104 PRO B O   1 
ATOM   4972 C CB  . PRO B 1 103 ? -1.414  -87.939 -35.084 1.00 56.87  ? 104 PRO B CB  1 
ATOM   4973 C CG  . PRO B 1 103 ? -2.150  -86.899 -34.320 1.00 54.92  ? 104 PRO B CG  1 
ATOM   4974 C CD  . PRO B 1 103 ? -2.302  -85.718 -35.251 1.00 47.94  ? 104 PRO B CD  1 
ATOM   4975 N N   . TYR B 1 104 ? 0.724   -88.772 -37.358 1.00 59.74  ? 105 TYR B N   1 
ATOM   4976 C CA  . TYR B 1 104 ? 1.028   -89.596 -38.540 1.00 70.25  ? 105 TYR B CA  1 
ATOM   4977 C C   . TYR B 1 104 ? 0.835   -91.079 -38.233 1.00 70.08  ? 105 TYR B C   1 
ATOM   4978 O O   . TYR B 1 104 ? 1.630   -91.668 -37.508 1.00 69.04  ? 105 TYR B O   1 
ATOM   4979 C CB  . TYR B 1 104 ? 2.467   -89.361 -39.000 1.00 65.17  ? 105 TYR B CB  1 
ATOM   4980 C CG  . TYR B 1 104 ? 2.810   -89.857 -40.396 1.00 82.58  ? 105 TYR B CG  1 
ATOM   4981 C CD1 . TYR B 1 104 ? 2.906   -91.219 -40.682 1.00 80.07  ? 105 TYR B CD1 1 
ATOM   4982 C CD2 . TYR B 1 104 ? 3.093   -88.952 -41.420 1.00 81.08  ? 105 TYR B CD2 1 
ATOM   4983 C CE1 . TYR B 1 104 ? 3.247   -91.661 -41.950 1.00 72.24  ? 105 TYR B CE1 1 
ATOM   4984 C CE2 . TYR B 1 104 ? 3.432   -89.385 -42.697 1.00 75.75  ? 105 TYR B CE2 1 
ATOM   4985 C CZ  . TYR B 1 104 ? 3.507   -90.738 -42.959 1.00 89.01  ? 105 TYR B CZ  1 
ATOM   4986 O OH  . TYR B 1 104 ? 3.845   -91.157 -44.232 1.00 81.38  ? 105 TYR B OH  1 
ATOM   4987 N N   . PRO B 1 105 ? -0.184  -91.705 -38.832 1.00 73.48  ? 106 PRO B N   1 
ATOM   4988 C CA  . PRO B 1 105 ? -1.039  -91.123 -39.864 1.00 73.16  ? 106 PRO B CA  1 
ATOM   4989 C C   . PRO B 1 105 ? -2.147  -90.246 -39.307 1.00 67.77  ? 106 PRO B C   1 
ATOM   4990 O O   . PRO B 1 105 ? -2.407  -90.235 -38.101 1.00 69.30  ? 106 PRO B O   1 
ATOM   4991 C CB  . PRO B 1 105 ? -1.632  -92.351 -40.549 1.00 61.91  ? 106 PRO B CB  1 
ATOM   4992 C CG  . PRO B 1 105 ? -1.731  -93.349 -39.450 1.00 59.98  ? 106 PRO B CG  1 
ATOM   4993 C CD  . PRO B 1 105 ? -0.540  -93.109 -38.557 1.00 71.89  ? 106 PRO B CD  1 
ATOM   4994 N N   . ARG B 1 106 ? -2.790  -89.525 -40.214 1.00 65.10  ? 107 ARG B N   1 
ATOM   4995 C CA  . ARG B 1 106 ? -3.861  -88.615 -39.877 1.00 69.76  ? 107 ARG B CA  1 
ATOM   4996 C C   . ARG B 1 106 ? -4.919  -89.329 -39.047 1.00 67.94  ? 107 ARG B C   1 
ATOM   4997 O O   . ARG B 1 106 ? -5.291  -90.460 -39.353 1.00 69.60  ? 107 ARG B O   1 
ATOM   4998 C CB  . ARG B 1 106 ? -4.459  -88.042 -41.158 1.00 59.94  ? 107 ARG B CB  1 
ATOM   4999 C CG  . ARG B 1 106 ? -5.264  -86.792 -40.988 1.00 54.86  ? 107 ARG B CG  1 
ATOM   5000 C CD  . ARG B 1 106 ? -5.615  -86.233 -42.352 1.00 68.60  ? 107 ARG B CD  1 
ATOM   5001 N NE  . ARG B 1 106 ? -4.456  -86.221 -43.247 1.00 69.63  ? 107 ARG B NE  1 
ATOM   5002 C CZ  . ARG B 1 106 ? -4.530  -85.949 -44.547 1.00 74.38  ? 107 ARG B CZ  1 
ATOM   5003 N NH1 . ARG B 1 106 ? -5.711  -85.663 -45.093 1.00 57.88  ? 107 ARG B NH1 1 
ATOM   5004 N NH2 . ARG B 1 106 ? -3.431  -85.956 -45.302 1.00 59.55  ? 107 ARG B NH2 1 
ATOM   5005 N N   . PRO B 1 107 ? -5.378  -88.682 -37.968 1.00 83.65  ? 108 PRO B N   1 
ATOM   5006 C CA  . PRO B 1 107 ? -6.453  -89.235 -37.141 1.00 83.81  ? 108 PRO B CA  1 
ATOM   5007 C C   . PRO B 1 107 ? -7.639  -89.660 -37.994 1.00 76.02  ? 108 PRO B C   1 
ATOM   5008 O O   . PRO B 1 107 ? -7.865  -89.077 -39.064 1.00 64.28  ? 108 PRO B O   1 
ATOM   5009 C CB  . PRO B 1 107 ? -6.824  -88.067 -36.228 1.00 73.90  ? 108 PRO B CB  1 
ATOM   5010 C CG  . PRO B 1 107 ? -5.575  -87.276 -36.120 1.00 58.94  ? 108 PRO B CG  1 
ATOM   5011 C CD  . PRO B 1 107 ? -4.912  -87.380 -37.462 1.00 71.39  ? 108 PRO B CD  1 
ATOM   5012 N N   . THR B 1 108 ? -8.376  -90.665 -37.532 1.00 77.50  ? 109 THR B N   1 
ATOM   5013 C CA  . THR B 1 108 ? -9.491  -91.199 -38.306 1.00 87.28  ? 109 THR B CA  1 
ATOM   5014 C C   . THR B 1 108 ? -10.820 -90.796 -37.687 1.00 83.98  ? 109 THR B C   1 
ATOM   5015 O O   . THR B 1 108 ? -11.857 -90.811 -38.348 1.00 89.47  ? 109 THR B O   1 
ATOM   5016 C CB  . THR B 1 108 ? -9.404  -92.723 -38.425 1.00 82.29  ? 109 THR B CB  1 
ATOM   5017 O OG1 . THR B 1 108 ? -9.035  -93.278 -37.155 1.00 87.73  ? 109 THR B OG1 1 
ATOM   5018 C CG2 . THR B 1 108 ? -8.353  -93.101 -39.460 1.00 78.55  ? 109 THR B CG2 1 
ATOM   5019 N N   . SER B 1 109 ? -10.783 -90.428 -36.414 1.00 74.18  ? 110 SER B N   1 
ATOM   5020 C CA  . SER B 1 109 ? -11.928 -89.783 -35.789 1.00 76.59  ? 110 SER B CA  1 
ATOM   5021 C C   . SER B 1 109 ? -11.506 -88.379 -35.369 1.00 71.09  ? 110 SER B C   1 
ATOM   5022 O O   . SER B 1 109 ? -10.339 -88.175 -35.033 1.00 67.07  ? 110 SER B O   1 
ATOM   5023 C CB  . SER B 1 109 ? -12.426 -90.602 -34.601 1.00 80.25  ? 110 SER B CB  1 
ATOM   5024 O OG  . SER B 1 109 ? -11.333 -91.112 -33.861 1.00 80.47  ? 110 SER B OG  1 
ATOM   5025 N N   . PRO B 1 110 ? -12.440 -87.406 -35.417 1.00 71.79  ? 111 PRO B N   1 
ATOM   5026 C CA  . PRO B 1 110 ? -12.173 -86.009 -35.029 1.00 70.64  ? 111 PRO B CA  1 
ATOM   5027 C C   . PRO B 1 110 ? -11.386 -85.871 -33.712 1.00 72.55  ? 111 PRO B C   1 
ATOM   5028 O O   . PRO B 1 110 ? -11.700 -86.512 -32.702 1.00 67.04  ? 111 PRO B O   1 
ATOM   5029 C CB  . PRO B 1 110 ? -13.576 -85.414 -34.889 1.00 66.46  ? 111 PRO B CB  1 
ATOM   5030 C CG  . PRO B 1 110 ? -14.389 -86.177 -35.882 1.00 70.78  ? 111 PRO B CG  1 
ATOM   5031 C CD  . PRO B 1 110 ? -13.829 -87.588 -35.881 1.00 65.01  ? 111 PRO B CD  1 
ATOM   5032 N N   . THR B 1 111 ? -10.355 -85.031 -33.754 1.00 71.34  ? 112 THR B N   1 
ATOM   5033 C CA  . THR B 1 111 ? -9.393  -84.891 -32.667 1.00 62.54  ? 112 THR B CA  1 
ATOM   5034 C C   . THR B 1 111 ? -9.387  -83.450 -32.115 1.00 58.72  ? 112 THR B C   1 
ATOM   5035 O O   . THR B 1 111 ? -9.526  -82.492 -32.876 1.00 60.04  ? 112 THR B O   1 
ATOM   5036 C CB  . THR B 1 111 ? -7.996  -85.300 -33.163 1.00 56.92  ? 112 THR B CB  1 
ATOM   5037 O OG1 . THR B 1 111 ? -8.048  -86.649 -33.631 1.00 69.37  ? 112 THR B OG1 1 
ATOM   5038 C CG2 . THR B 1 111 ? -6.969  -85.217 -32.069 1.00 59.46  ? 112 THR B CG2 1 
ATOM   5039 N N   . PRO B 1 112 ? -9.271  -83.301 -30.782 1.00 63.90  ? 113 PRO B N   1 
ATOM   5040 C CA  . PRO B 1 112 ? -9.184  -81.982 -30.144 1.00 58.53  ? 113 PRO B CA  1 
ATOM   5041 C C   . PRO B 1 112 ? -8.027  -81.131 -30.668 1.00 51.76  ? 113 PRO B C   1 
ATOM   5042 O O   . PRO B 1 112 ? -6.913  -81.622 -30.923 1.00 45.14  ? 113 PRO B O   1 
ATOM   5043 C CB  . PRO B 1 112 ? -8.965  -82.322 -28.666 1.00 58.16  ? 113 PRO B CB  1 
ATOM   5044 C CG  . PRO B 1 112 ? -9.614  -83.632 -28.501 1.00 65.26  ? 113 PRO B CG  1 
ATOM   5045 C CD  . PRO B 1 112 ? -9.353  -84.377 -29.779 1.00 72.82  ? 113 PRO B CD  1 
ATOM   5046 N N   . VAL B 1 113 ? -8.301  -79.840 -30.792 1.00 42.88  ? 114 VAL B N   1 
ATOM   5047 C CA  . VAL B 1 113 ? -7.347  -78.912 -31.370 1.00 48.40  ? 114 VAL B CA  1 
ATOM   5048 C C   . VAL B 1 113 ? -6.837  -77.918 -30.339 1.00 48.02  ? 114 VAL B C   1 
ATOM   5049 O O   . VAL B 1 113 ? -7.620  -77.263 -29.653 1.00 44.55  ? 114 VAL B O   1 
ATOM   5050 C CB  . VAL B 1 113 ? -7.985  -78.124 -32.541 1.00 40.23  ? 114 VAL B CB  1 
ATOM   5051 C CG1 . VAL B 1 113 ? -6.974  -77.198 -33.165 1.00 37.13  ? 114 VAL B CG1 1 
ATOM   5052 C CG2 . VAL B 1 113 ? -8.574  -79.081 -33.564 1.00 42.07  ? 114 VAL B CG2 1 
ATOM   5053 N N   . LEU B 1 114 ? -5.522  -77.803 -30.249 1.00 48.16  ? 115 LEU B N   1 
ATOM   5054 C CA  . LEU B 1 114 ? -4.895  -76.737 -29.496 1.00 43.90  ? 115 LEU B CA  1 
ATOM   5055 C C   . LEU B 1 114 ? -4.399  -75.624 -30.426 1.00 46.00  ? 115 LEU B C   1 
ATOM   5056 O O   . LEU B 1 114 ? -3.608  -75.878 -31.344 1.00 47.11  ? 115 LEU B O   1 
ATOM   5057 C CB  . LEU B 1 114 ? -3.729  -77.289 -28.697 1.00 44.62  ? 115 LEU B CB  1 
ATOM   5058 C CG  . LEU B 1 114 ? -4.088  -78.012 -27.414 1.00 51.95  ? 115 LEU B CG  1 
ATOM   5059 C CD1 . LEU B 1 114 ? -2.865  -78.704 -26.927 1.00 46.06  ? 115 LEU B CD1 1 
ATOM   5060 C CD2 . LEU B 1 114 ? -4.502  -76.954 -26.447 1.00 45.60  ? 115 LEU B CD2 1 
ATOM   5061 N N   . VAL B 1 115 ? -4.849  -74.398 -30.183 1.00 43.42  ? 116 VAL B N   1 
ATOM   5062 C CA  . VAL B 1 115 ? -4.356  -73.249 -30.934 1.00 42.70  ? 116 VAL B CA  1 
ATOM   5063 C C   . VAL B 1 115 ? -3.501  -72.316 -30.086 1.00 44.79  ? 116 VAL B C   1 
ATOM   5064 O O   . VAL B 1 115 ? -3.970  -71.755 -29.105 1.00 45.24  ? 116 VAL B O   1 
ATOM   5065 C CB  . VAL B 1 115 ? -5.495  -72.436 -31.512 1.00 39.77  ? 116 VAL B CB  1 
ATOM   5066 C CG1 . VAL B 1 115 ? -4.937  -71.265 -32.330 1.00 34.61  ? 116 VAL B CG1 1 
ATOM   5067 C CG2 . VAL B 1 115 ? -6.414  -73.325 -32.334 1.00 33.29  ? 116 VAL B CG2 1 
ATOM   5068 N N   . TRP B 1 116 ? -2.254  -72.139 -30.498 1.00 42.69  ? 117 TRP B N   1 
ATOM   5069 C CA  . TRP B 1 116 ? -1.293  -71.376 -29.734 1.00 39.87  ? 117 TRP B CA  1 
ATOM   5070 C C   . TRP B 1 116 ? -1.195  -69.954 -30.219 1.00 41.70  ? 117 TRP B C   1 
ATOM   5071 O O   . TRP B 1 116 ? -1.050  -69.726 -31.414 1.00 44.59  ? 117 TRP B O   1 
ATOM   5072 C CB  . TRP B 1 116 ? 0.075   -72.034 -29.805 1.00 36.14  ? 117 TRP B CB  1 
ATOM   5073 C CG  . TRP B 1 116 ? 1.169   -71.223 -29.190 1.00 36.42  ? 117 TRP B CG  1 
ATOM   5074 C CD1 . TRP B 1 116 ? 2.177   -70.565 -29.839 1.00 38.03  ? 117 TRP B CD1 1 
ATOM   5075 C CD2 . TRP B 1 116 ? 1.379   -70.998 -27.795 1.00 40.32  ? 117 TRP B CD2 1 
ATOM   5076 N NE1 . TRP B 1 116 ? 3.000   -69.942 -28.937 1.00 37.86  ? 117 TRP B NE1 1 
ATOM   5077 C CE2 . TRP B 1 116 ? 2.541   -70.199 -27.671 1.00 33.34  ? 117 TRP B CE2 1 
ATOM   5078 C CE3 . TRP B 1 116 ? 0.710   -71.410 -26.640 1.00 36.60  ? 117 TRP B CE3 1 
ATOM   5079 C CZ2 . TRP B 1 116 ? 3.036   -69.779 -26.436 1.00 40.16  ? 117 TRP B CZ2 1 
ATOM   5080 C CZ3 . TRP B 1 116 ? 1.216   -71.004 -25.403 1.00 35.89  ? 117 TRP B CZ3 1 
ATOM   5081 C CH2 . TRP B 1 116 ? 2.365   -70.195 -25.316 1.00 36.93  ? 117 TRP B CH2 1 
ATOM   5082 N N   . ILE B 1 117 ? -1.282  -69.007 -29.285 1.00 38.63  ? 118 ILE B N   1 
ATOM   5083 C CA  . ILE B 1 117 ? -1.047  -67.605 -29.598 1.00 37.99  ? 118 ILE B CA  1 
ATOM   5084 C C   . ILE B 1 117 ? 0.169   -67.106 -28.840 1.00 43.65  ? 118 ILE B C   1 
ATOM   5085 O O   . ILE B 1 117 ? 0.122   -67.035 -27.609 1.00 37.45  ? 118 ILE B O   1 
ATOM   5086 C CB  . ILE B 1 117 ? -2.242  -66.728 -29.231 1.00 41.64  ? 118 ILE B CB  1 
ATOM   5087 C CG1 . ILE B 1 117 ? -3.523  -67.301 -29.812 1.00 36.68  ? 118 ILE B CG1 1 
ATOM   5088 C CG2 . ILE B 1 117 ? -2.027  -65.306 -29.731 1.00 40.35  ? 118 ILE B CG2 1 
ATOM   5089 C CD1 . ILE B 1 117 ? -4.695  -66.357 -29.665 1.00 34.03  ? 118 ILE B CD1 1 
ATOM   5090 N N   . TYR B 1 118 ? 1.255   -66.777 -29.552 1.00 37.40  ? 119 TYR B N   1 
ATOM   5091 C CA  . TYR B 1 118 ? 2.480   -66.341 -28.861 1.00 33.94  ? 119 TYR B CA  1 
ATOM   5092 C C   . TYR B 1 118 ? 2.344   -64.970 -28.217 1.00 38.84  ? 119 TYR B C   1 
ATOM   5093 O O   . TYR B 1 118 ? 1.498   -64.162 -28.613 1.00 39.09  ? 119 TYR B O   1 
ATOM   5094 C CB  . TYR B 1 118 ? 3.686   -66.312 -29.804 1.00 37.83  ? 119 TYR B CB  1 
ATOM   5095 C CG  . TYR B 1 118 ? 3.538   -65.412 -31.018 1.00 38.81  ? 119 TYR B CG  1 
ATOM   5096 C CD1 . TYR B 1 118 ? 3.604   -64.020 -30.911 1.00 38.69  ? 119 TYR B CD1 1 
ATOM   5097 C CD2 . TYR B 1 118 ? 3.375   -65.963 -32.287 1.00 38.89  ? 119 TYR B CD2 1 
ATOM   5098 C CE1 . TYR B 1 118 ? 3.472   -63.198 -32.044 1.00 41.93  ? 119 TYR B CE1 1 
ATOM   5099 C CE2 . TYR B 1 118 ? 3.258   -65.152 -33.433 1.00 42.75  ? 119 TYR B CE2 1 
ATOM   5100 C CZ  . TYR B 1 118 ? 3.302   -63.776 -33.309 1.00 41.74  ? 119 TYR B CZ  1 
ATOM   5101 O OH  . TYR B 1 118 ? 3.167   -63.003 -34.449 1.00 42.51  ? 119 TYR B OH  1 
ATOM   5102 N N   . GLY B 1 119 ? 3.204   -64.716 -27.233 1.00 37.45  ? 120 GLY B N   1 
ATOM   5103 C CA  . GLY B 1 119 ? 3.320   -63.412 -26.611 1.00 35.65  ? 120 GLY B CA  1 
ATOM   5104 C C   . GLY B 1 119 ? 4.520   -62.644 -27.113 1.00 47.86  ? 120 GLY B C   1 
ATOM   5105 O O   . GLY B 1 119 ? 5.112   -63.005 -28.142 1.00 42.99  ? 120 GLY B O   1 
ATOM   5106 N N   . GLY B 1 120 ? 4.885   -61.584 -26.396 1.00 37.83  ? 121 GLY B N   1 
ATOM   5107 C CA  . GLY B 1 120 ? 5.912   -60.670 -26.864 1.00 38.52  ? 121 GLY B CA  1 
ATOM   5108 C C   . GLY B 1 120 ? 5.448   -59.220 -26.806 1.00 40.28  ? 121 GLY B C   1 
ATOM   5109 O O   . GLY B 1 120 ? 5.870   -58.393 -27.631 1.00 41.93  ? 121 GLY B O   1 
ATOM   5110 N N   . GLY B 1 121 ? 4.578   -58.920 -25.834 1.00 45.34  ? 122 GLY B N   1 
ATOM   5111 C CA  . GLY B 1 121 ? 4.156   -57.558 -25.524 1.00 36.18  ? 122 GLY B CA  1 
ATOM   5112 C C   . GLY B 1 121 ? 3.398   -56.838 -26.628 1.00 47.78  ? 122 GLY B C   1 
ATOM   5113 O O   . GLY B 1 121 ? 3.292   -55.621 -26.601 1.00 38.60  ? 122 GLY B O   1 
ATOM   5114 N N   . PHE B 1 122 ? 2.908   -57.598 -27.611 1.00 42.14  ? 123 PHE B N   1 
ATOM   5115 C CA  . PHE B 1 122 ? 2.264   -57.062 -28.805 1.00 42.06  ? 123 PHE B CA  1 
ATOM   5116 C C   . PHE B 1 122 ? 3.224   -56.302 -29.702 1.00 38.28  ? 123 PHE B C   1 
ATOM   5117 O O   . PHE B 1 122 ? 2.800   -55.675 -30.673 1.00 39.42  ? 123 PHE B O   1 
ATOM   5118 C CB  . PHE B 1 122 ? 1.094   -56.147 -28.448 1.00 37.67  ? 123 PHE B CB  1 
ATOM   5119 C CG  . PHE B 1 122 ? -0.050  -56.855 -27.812 1.00 41.28  ? 123 PHE B CG  1 
ATOM   5120 C CD1 . PHE B 1 122 ? -0.759  -57.800 -28.519 1.00 33.82  ? 123 PHE B CD1 1 
ATOM   5121 C CD2 . PHE B 1 122 ? -0.429  -56.562 -26.496 1.00 38.29  ? 123 PHE B CD2 1 
ATOM   5122 C CE1 . PHE B 1 122 ? -1.826  -58.477 -27.930 1.00 36.45  ? 123 PHE B CE1 1 
ATOM   5123 C CE2 . PHE B 1 122 ? -1.499  -57.211 -25.903 1.00 38.38  ? 123 PHE B CE2 1 
ATOM   5124 C CZ  . PHE B 1 122 ? -2.201  -58.176 -26.622 1.00 34.36  ? 123 PHE B CZ  1 
ATOM   5125 N N   . TYR B 1 123 ? 4.511   -56.339 -29.383 1.00 36.56  ? 124 TYR B N   1 
ATOM   5126 C CA  . TYR B 1 123 ? 5.505   -55.715 -30.251 1.00 40.91  ? 124 TYR B CA  1 
ATOM   5127 C C   . TYR B 1 123 ? 6.488   -56.727 -30.875 1.00 45.02  ? 124 TYR B C   1 
ATOM   5128 O O   . TYR B 1 123 ? 7.376   -56.336 -31.617 1.00 45.29  ? 124 TYR B O   1 
ATOM   5129 C CB  . TYR B 1 123 ? 6.279   -54.642 -29.473 1.00 39.22  ? 124 TYR B CB  1 
ATOM   5130 C CG  . TYR B 1 123 ? 7.244   -55.185 -28.444 1.00 43.46  ? 124 TYR B CG  1 
ATOM   5131 C CD1 . TYR B 1 123 ? 8.536   -55.539 -28.804 1.00 51.04  ? 124 TYR B CD1 1 
ATOM   5132 C CD2 . TYR B 1 123 ? 6.884   -55.308 -27.111 1.00 55.25  ? 124 TYR B CD2 1 
ATOM   5133 C CE1 . TYR B 1 123 ? 9.430   -56.030 -27.885 1.00 49.25  ? 124 TYR B CE1 1 
ATOM   5134 C CE2 . TYR B 1 123 ? 7.789   -55.799 -26.166 1.00 54.76  ? 124 TYR B CE2 1 
ATOM   5135 C CZ  . TYR B 1 123 ? 9.059   -56.164 -26.569 1.00 48.83  ? 124 TYR B CZ  1 
ATOM   5136 O OH  . TYR B 1 123 ? 9.976   -56.654 -25.673 1.00 67.13  ? 124 TYR B OH  1 
ATOM   5137 N N   . SER B 1 124 ? 6.345   -58.015 -30.571 1.00 39.10  ? 125 SER B N   1 
ATOM   5138 C CA  . SER B 1 124 ? 7.298   -59.009 -31.052 1.00 40.44  ? 125 SER B CA  1 
ATOM   5139 C C   . SER B 1 124 ? 6.719   -60.404 -30.949 1.00 42.29  ? 125 SER B C   1 
ATOM   5140 O O   . SER B 1 124 ? 5.585   -60.589 -30.484 1.00 44.58  ? 125 SER B O   1 
ATOM   5141 C CB  . SER B 1 124 ? 8.593   -58.944 -30.247 1.00 39.63  ? 125 SER B CB  1 
ATOM   5142 O OG  . SER B 1 124 ? 8.343   -59.339 -28.902 1.00 46.15  ? 125 SER B OG  1 
ATOM   5143 N N   . GLY B 1 125 ? 7.505   -61.395 -31.350 1.00 33.93  ? 126 GLY B N   1 
ATOM   5144 C CA  . GLY B 1 125 ? 7.074   -62.779 -31.261 1.00 36.61  ? 126 GLY B CA  1 
ATOM   5145 C C   . GLY B 1 125 ? 6.867   -63.410 -32.629 1.00 41.07  ? 126 GLY B C   1 
ATOM   5146 O O   . GLY B 1 125 ? 6.701   -62.707 -33.636 1.00 34.35  ? 126 GLY B O   1 
ATOM   5147 N N   . ALA B 1 126 ? 6.838   -64.738 -32.667 1.00 36.82  ? 127 ALA B N   1 
ATOM   5148 C CA  . ALA B 1 126 ? 6.685   -65.442 -33.937 1.00 41.63  ? 127 ALA B CA  1 
ATOM   5149 C C   . ALA B 1 126 ? 6.267   -66.855 -33.658 1.00 43.76  ? 127 ALA B C   1 
ATOM   5150 O O   . ALA B 1 126 ? 6.676   -67.422 -32.634 1.00 37.51  ? 127 ALA B O   1 
ATOM   5151 C CB  . ALA B 1 126 ? 7.990   -65.423 -34.738 1.00 34.96  ? 127 ALA B CB  1 
ATOM   5152 N N   . SER B 1 127 ? 5.484   -67.450 -34.561 1.00 38.04  ? 128 SER B N   1 
ATOM   5153 C CA  . SER B 1 127 ? 5.044   -68.829 -34.312 1.00 38.89  ? 128 SER B CA  1 
ATOM   5154 C C   . SER B 1 127 ? 6.156   -69.836 -34.619 1.00 40.95  ? 128 SER B C   1 
ATOM   5155 O O   . SER B 1 127 ? 6.013   -71.028 -34.358 1.00 42.06  ? 128 SER B O   1 
ATOM   5156 C CB  . SER B 1 127 ? 3.797   -69.168 -35.121 1.00 37.57  ? 128 SER B CB  1 
ATOM   5157 O OG  . SER B 1 127 ? 4.087   -69.219 -36.503 1.00 41.11  ? 128 SER B OG  1 
ATOM   5158 N N   . SER B 1 128 ? 7.275   -69.346 -35.139 1.00 34.98  ? 129 SER B N   1 
ATOM   5159 C CA  . SER B 1 128 ? 8.332   -70.224 -35.611 1.00 40.23  ? 129 SER B CA  1 
ATOM   5160 C C   . SER B 1 128 ? 9.446   -70.444 -34.602 1.00 43.86  ? 129 SER B C   1 
ATOM   5161 O O   . SER B 1 128 ? 10.396  -71.173 -34.886 1.00 43.07  ? 129 SER B O   1 
ATOM   5162 C CB  . SER B 1 128 ? 8.928   -69.671 -36.905 1.00 34.04  ? 129 SER B CB  1 
ATOM   5163 O OG  . SER B 1 128 ? 9.354   -68.337 -36.725 1.00 38.38  ? 129 SER B OG  1 
ATOM   5164 N N   . LEU B 1 129 ? 9.346   -69.833 -33.426 1.00 38.69  ? 130 LEU B N   1 
ATOM   5165 C CA  . LEU B 1 129 ? 10.389  -70.028 -32.418 1.00 39.67  ? 130 LEU B CA  1 
ATOM   5166 C C   . LEU B 1 129 ? 10.533  -71.492 -32.027 1.00 37.81  ? 130 LEU B C   1 
ATOM   5167 O O   . LEU B 1 129 ? 9.540   -72.219 -31.934 1.00 40.73  ? 130 LEU B O   1 
ATOM   5168 C CB  . LEU B 1 129 ? 10.108  -69.185 -31.173 1.00 36.24  ? 130 LEU B CB  1 
ATOM   5169 C CG  . LEU B 1 129 ? 10.007  -67.684 -31.426 1.00 45.49  ? 130 LEU B CG  1 
ATOM   5170 C CD1 . LEU B 1 129 ? 10.001  -66.912 -30.111 1.00 39.98  ? 130 LEU B CD1 1 
ATOM   5171 C CD2 . LEU B 1 129 ? 11.137  -67.215 -32.358 1.00 41.23  ? 130 LEU B CD2 1 
ATOM   5172 N N   . ASP B 1 130 ? 11.769  -71.917 -31.775 1.00 44.43  ? 131 ASP B N   1 
ATOM   5173 C CA  . ASP B 1 130 ? 12.038  -73.302 -31.380 1.00 45.34  ? 131 ASP B CA  1 
ATOM   5174 C C   . ASP B 1 130 ? 11.159  -73.770 -30.247 1.00 36.36  ? 131 ASP B C   1 
ATOM   5175 O O   . ASP B 1 130 ? 10.637  -74.871 -30.269 1.00 52.81  ? 131 ASP B O   1 
ATOM   5176 C CB  . ASP B 1 130 ? 13.499  -73.462 -30.970 1.00 54.62  ? 131 ASP B CB  1 
ATOM   5177 C CG  . ASP B 1 130 ? 14.436  -73.350 -32.148 1.00 60.95  ? 131 ASP B CG  1 
ATOM   5178 O OD1 . ASP B 1 130 ? 13.951  -73.414 -33.296 1.00 50.46  ? 131 ASP B OD1 1 
ATOM   5179 O OD2 . ASP B 1 130 ? 15.652  -73.195 -31.920 1.00 76.93  ? 131 ASP B OD2 1 
ATOM   5180 N N   . VAL B 1 131 ? 10.969  -72.899 -29.269 1.00 38.50  ? 132 VAL B N   1 
ATOM   5181 C CA  . VAL B 1 131 ? 10.246  -73.255 -28.055 1.00 35.38  ? 132 VAL B CA  1 
ATOM   5182 C C   . VAL B 1 131 ? 8.733   -73.393 -28.284 1.00 45.07  ? 132 VAL B C   1 
ATOM   5183 O O   . VAL B 1 131 ? 8.039   -73.883 -27.405 1.00 43.82  ? 132 VAL B O   1 
ATOM   5184 C CB  . VAL B 1 131 ? 10.580  -72.216 -26.934 1.00 49.64  ? 132 VAL B CB  1 
ATOM   5185 C CG1 . VAL B 1 131 ? 10.073  -70.813 -27.282 1.00 43.27  ? 132 VAL B CG1 1 
ATOM   5186 C CG2 . VAL B 1 131 ? 10.081  -72.667 -25.609 1.00 47.04  ? 132 VAL B CG2 1 
ATOM   5187 N N   . TYR B 1 132 ? 8.224   -73.021 -29.472 1.00 41.33  ? 133 TYR B N   1 
ATOM   5188 C CA  . TYR B 1 132 ? 6.793   -73.194 -29.767 1.00 38.60  ? 133 TYR B CA  1 
ATOM   5189 C C   . TYR B 1 132 ? 6.559   -74.389 -30.703 1.00 50.22  ? 133 TYR B C   1 
ATOM   5190 O O   . TYR B 1 132 ? 5.473   -74.563 -31.271 1.00 44.68  ? 133 TYR B O   1 
ATOM   5191 C CB  . TYR B 1 132 ? 6.181   -71.927 -30.398 1.00 39.48  ? 133 TYR B CB  1 
ATOM   5192 C CG  . TYR B 1 132 ? 6.333   -70.652 -29.584 1.00 44.59  ? 133 TYR B CG  1 
ATOM   5193 C CD1 . TYR B 1 132 ? 6.316   -70.685 -28.192 1.00 45.58  ? 133 TYR B CD1 1 
ATOM   5194 C CD2 . TYR B 1 132 ? 6.501   -69.417 -30.215 1.00 41.79  ? 133 TYR B CD2 1 
ATOM   5195 C CE1 . TYR B 1 132 ? 6.457   -69.529 -27.449 1.00 45.31  ? 133 TYR B CE1 1 
ATOM   5196 C CE2 . TYR B 1 132 ? 6.650   -68.251 -29.482 1.00 36.69  ? 133 TYR B CE2 1 
ATOM   5197 C CZ  . TYR B 1 132 ? 6.625   -68.318 -28.094 1.00 42.52  ? 133 TYR B CZ  1 
ATOM   5198 O OH  . TYR B 1 132 ? 6.770   -67.179 -27.343 1.00 36.72  ? 133 TYR B OH  1 
ATOM   5199 N N   . ASP B 1 133 ? 7.586   -75.214 -30.863 1.00 45.56  ? 134 ASP B N   1 
ATOM   5200 C CA  . ASP B 1 133 ? 7.520   -76.371 -31.749 1.00 40.30  ? 134 ASP B CA  1 
ATOM   5201 C C   . ASP B 1 133 ? 6.454   -77.369 -31.291 1.00 49.35  ? 134 ASP B C   1 
ATOM   5202 O O   . ASP B 1 133 ? 6.569   -77.974 -30.212 1.00 51.38  ? 134 ASP B O   1 
ATOM   5203 C CB  . ASP B 1 133 ? 8.901   -77.027 -31.807 1.00 54.10  ? 134 ASP B CB  1 
ATOM   5204 C CG  . ASP B 1 133 ? 9.009   -78.115 -32.865 1.00 62.17  ? 134 ASP B CG  1 
ATOM   5205 O OD1 . ASP B 1 133 ? 7.983   -78.531 -33.452 1.00 50.12  ? 134 ASP B OD1 1 
ATOM   5206 O OD2 . ASP B 1 133 ? 10.149  -78.575 -33.076 1.00 56.40  ? 134 ASP B OD2 1 
ATOM   5207 N N   . GLY B 1 134 ? 5.429   -77.551 -32.117 1.00 42.75  ? 135 GLY B N   1 
ATOM   5208 C CA  . GLY B 1 134 ? 4.305   -78.392 -31.766 1.00 46.52  ? 135 GLY B CA  1 
ATOM   5209 C C   . GLY B 1 134 ? 4.471   -79.898 -31.967 1.00 49.08  ? 135 GLY B C   1 
ATOM   5210 O O   . GLY B 1 134 ? 3.565   -80.674 -31.640 1.00 48.57  ? 135 GLY B O   1 
ATOM   5211 N N   . ARG B 1 135 ? 5.620   -80.335 -32.469 1.00 47.86  ? 136 ARG B N   1 
ATOM   5212 C CA  . ARG B 1 135 ? 5.757   -81.746 -32.839 1.00 53.42  ? 136 ARG B CA  1 
ATOM   5213 C C   . ARG B 1 135 ? 5.670   -82.677 -31.608 1.00 52.61  ? 136 ARG B C   1 
ATOM   5214 O O   . ARG B 1 135 ? 5.149   -83.793 -31.714 1.00 50.68  ? 136 ARG B O   1 
ATOM   5215 C CB  . ARG B 1 135 ? 7.071   -81.988 -33.608 1.00 37.76  ? 136 ARG B CB  1 
ATOM   5216 C CG  . ARG B 1 135 ? 8.304   -82.105 -32.715 1.00 54.14  ? 136 ARG B CG  1 
ATOM   5217 C CD  . ARG B 1 135 ? 9.573   -82.328 -33.512 1.00 45.24  ? 136 ARG B CD  1 
ATOM   5218 N NE  . ARG B 1 135 ? 9.937   -81.143 -34.274 1.00 55.25  ? 136 ARG B NE  1 
ATOM   5219 C CZ  . ARG B 1 135 ? 10.794  -81.140 -35.291 1.00 54.03  ? 136 ARG B CZ  1 
ATOM   5220 N NH1 . ARG B 1 135 ? 11.367  -82.271 -35.683 1.00 51.73  ? 136 ARG B NH1 1 
ATOM   5221 N NH2 . ARG B 1 135 ? 11.073  -80.007 -35.922 1.00 49.91  ? 136 ARG B NH2 1 
ATOM   5222 N N   . PHE B 1 136 ? 6.140   -82.224 -30.445 1.00 50.77  ? 137 PHE B N   1 
ATOM   5223 C CA  . PHE B 1 136 ? 6.158   -83.105 -29.261 1.00 53.32  ? 137 PHE B CA  1 
ATOM   5224 C C   . PHE B 1 136 ? 4.788   -83.277 -28.615 1.00 46.00  ? 137 PHE B C   1 
ATOM   5225 O O   . PHE B 1 136 ? 4.426   -84.382 -28.224 1.00 56.26  ? 137 PHE B O   1 
ATOM   5226 C CB  . PHE B 1 136 ? 7.151   -82.597 -28.241 1.00 40.59  ? 137 PHE B CB  1 
ATOM   5227 C CG  . PHE B 1 136 ? 8.514   -82.381 -28.814 1.00 47.24  ? 137 PHE B CG  1 
ATOM   5228 C CD1 . PHE B 1 136 ? 9.326   -83.461 -29.124 1.00 47.71  ? 137 PHE B CD1 1 
ATOM   5229 C CD2 . PHE B 1 136 ? 8.977   -81.104 -29.064 1.00 46.95  ? 137 PHE B CD2 1 
ATOM   5230 C CE1 . PHE B 1 136 ? 10.592  -83.271 -29.672 1.00 43.57  ? 137 PHE B CE1 1 
ATOM   5231 C CE2 . PHE B 1 136 ? 10.233  -80.896 -29.616 1.00 52.96  ? 137 PHE B CE2 1 
ATOM   5232 C CZ  . PHE B 1 136 ? 11.046  -81.983 -29.921 1.00 55.30  ? 137 PHE B CZ  1 
ATOM   5233 N N   . LEU B 1 137 ? 4.010   -82.207 -28.542 1.00 50.72  ? 138 LEU B N   1 
ATOM   5234 C CA  . LEU B 1 137 ? 2.651   -82.312 -28.012 1.00 52.08  ? 138 LEU B CA  1 
ATOM   5235 C C   . LEU B 1 137 ? 1.796   -83.210 -28.873 1.00 54.39  ? 138 LEU B C   1 
ATOM   5236 O O   . LEU B 1 137 ? 0.967   -83.976 -28.367 1.00 51.68  ? 138 LEU B O   1 
ATOM   5237 C CB  . LEU B 1 137 ? 1.974   -80.945 -27.933 1.00 53.41  ? 138 LEU B CB  1 
ATOM   5238 C CG  . LEU B 1 137 ? 1.928   -80.179 -26.631 1.00 54.57  ? 138 LEU B CG  1 
ATOM   5239 C CD1 . LEU B 1 137 ? 1.318   -78.824 -26.936 1.00 48.90  ? 138 LEU B CD1 1 
ATOM   5240 C CD2 . LEU B 1 137 ? 1.101   -80.956 -25.621 1.00 46.65  ? 138 LEU B CD2 1 
ATOM   5241 N N   . VAL B 1 138 ? 1.960   -83.068 -30.185 1.00 53.36  ? 139 VAL B N   1 
ATOM   5242 C CA  . VAL B 1 138 ? 1.074   -83.764 -31.101 1.00 51.30  ? 139 VAL B CA  1 
ATOM   5243 C C   . VAL B 1 138 ? 1.352   -85.246 -31.016 1.00 45.52  ? 139 VAL B C   1 
ATOM   5244 O O   . VAL B 1 138 ? 0.433   -86.065 -30.952 1.00 48.38  ? 139 VAL B O   1 
ATOM   5245 C CB  . VAL B 1 138 ? 1.229   -83.255 -32.526 1.00 48.57  ? 139 VAL B CB  1 
ATOM   5246 C CG1 . VAL B 1 138 ? 0.571   -84.224 -33.538 1.00 42.59  ? 139 VAL B CG1 1 
ATOM   5247 C CG2 . VAL B 1 138 ? 0.608   -81.886 -32.608 1.00 39.03  ? 139 VAL B CG2 1 
ATOM   5248 N N   . GLN B 1 139 ? 2.628   -85.581 -30.950 1.00 46.24  ? 140 GLN B N   1 
ATOM   5249 C CA  . GLN B 1 139 ? 3.028   -86.969 -30.848 1.00 52.72  ? 140 GLN B CA  1 
ATOM   5250 C C   . GLN B 1 139 ? 2.610   -87.576 -29.500 1.00 58.30  ? 140 GLN B C   1 
ATOM   5251 O O   . GLN B 1 139 ? 1.943   -88.611 -29.469 1.00 62.39  ? 140 GLN B O   1 
ATOM   5252 C CB  . GLN B 1 139 ? 4.543   -87.088 -31.063 1.00 52.13  ? 140 GLN B CB  1 
ATOM   5253 C CG  . GLN B 1 139 ? 5.002   -88.475 -31.482 1.00 68.83  ? 140 GLN B CG  1 
ATOM   5254 C CD  . GLN B 1 139 ? 5.065   -89.461 -30.317 1.00 74.68  ? 140 GLN B CD  1 
ATOM   5255 O OE1 . GLN B 1 139 ? 5.565   -89.132 -29.238 1.00 71.85  ? 140 GLN B OE1 1 
ATOM   5256 N NE2 . GLN B 1 139 ? 4.554   -90.679 -30.535 1.00 65.11  ? 140 GLN B NE2 1 
ATOM   5257 N N   . ALA B 1 140 ? 2.979   -86.926 -28.397 1.00 55.90  ? 141 ALA B N   1 
ATOM   5258 C CA  . ALA B 1 140 ? 2.670   -87.448 -27.054 1.00 56.77  ? 141 ALA B CA  1 
ATOM   5259 C C   . ALA B 1 140 ? 1.179   -87.547 -26.725 1.00 48.78  ? 141 ALA B C   1 
ATOM   5260 O O   . ALA B 1 140 ? 0.770   -88.437 -25.988 1.00 56.43  ? 141 ALA B O   1 
ATOM   5261 C CB  . ALA B 1 140 ? 3.357   -86.596 -25.982 1.00 52.15  ? 141 ALA B CB  1 
ATOM   5262 N N   . GLU B 1 141 ? 0.361   -86.643 -27.250 1.00 50.58  ? 142 GLU B N   1 
ATOM   5263 C CA  . GLU B 1 141 ? -1.006  -86.539 -26.748 1.00 43.78  ? 142 GLU B CA  1 
ATOM   5264 C C   . GLU B 1 141 ? -2.061  -86.702 -27.822 1.00 54.60  ? 142 GLU B C   1 
ATOM   5265 O O   . GLU B 1 141 ? -3.263  -86.744 -27.517 1.00 54.50  ? 142 GLU B O   1 
ATOM   5266 C CB  . GLU B 1 141 ? -1.193  -85.201 -26.028 1.00 43.77  ? 142 GLU B CB  1 
ATOM   5267 C CG  . GLU B 1 141 ? -0.433  -85.133 -24.689 1.00 45.69  ? 142 GLU B CG  1 
ATOM   5268 C CD  . GLU B 1 141 ? -0.968  -86.140 -23.658 1.00 56.60  ? 142 GLU B CD  1 
ATOM   5269 O OE1 . GLU B 1 141 ? -2.183  -86.488 -23.715 1.00 50.91  ? 142 GLU B OE1 1 
ATOM   5270 O OE2 . GLU B 1 141 ? -0.171  -86.585 -22.791 1.00 46.89  ? 142 GLU B OE2 1 
ATOM   5271 N N   . ARG B 1 142 ? -1.606  -86.798 -29.073 1.00 53.38  ? 143 ARG B N   1 
ATOM   5272 C CA  . ARG B 1 142 ? -2.489  -87.020 -30.206 1.00 49.89  ? 143 ARG B CA  1 
ATOM   5273 C C   . ARG B 1 142 ? -3.563  -85.959 -30.280 1.00 50.74  ? 143 ARG B C   1 
ATOM   5274 O O   . ARG B 1 142 ? -4.744  -86.255 -30.308 1.00 64.39  ? 143 ARG B O   1 
ATOM   5275 C CB  . ARG B 1 142 ? -3.134  -88.409 -30.134 1.00 63.91  ? 143 ARG B CB  1 
ATOM   5276 C CG  . ARG B 1 142 ? -2.158  -89.551 -30.396 1.00 73.14  ? 143 ARG B CG  1 
ATOM   5277 C CD  . ARG B 1 142 ? -2.905  -90.855 -30.677 1.00 91.73  ? 143 ARG B CD  1 
ATOM   5278 N NE  . ARG B 1 142 ? -3.799  -90.731 -31.827 1.00 93.45  ? 143 ARG B NE  1 
ATOM   5279 C CZ  . ARG B 1 142 ? -3.395  -90.811 -33.092 1.00 84.73  ? 143 ARG B CZ  1 
ATOM   5280 N NH1 . ARG B 1 142 ? -2.110  -91.017 -33.353 1.00 74.48  ? 143 ARG B NH1 1 
ATOM   5281 N NH2 . ARG B 1 142 ? -4.268  -90.684 -34.091 1.00 74.99  ? 143 ARG B NH2 1 
ATOM   5282 N N   . THR B 1 143 ? -3.132  -84.715 -30.282 1.00 54.28  ? 144 THR B N   1 
ATOM   5283 C CA  . THR B 1 143 ? -4.010  -83.592 -30.531 1.00 52.39  ? 144 THR B CA  1 
ATOM   5284 C C   . THR B 1 143 ? -3.577  -82.994 -31.856 1.00 47.46  ? 144 THR B C   1 
ATOM   5285 O O   . THR B 1 143 ? -2.489  -83.289 -32.343 1.00 44.04  ? 144 THR B O   1 
ATOM   5286 C CB  . THR B 1 143 ? -3.885  -82.541 -29.442 1.00 58.98  ? 144 THR B CB  1 
ATOM   5287 O OG1 . THR B 1 143 ? -2.491  -82.244 -29.279 1.00 57.69  ? 144 THR B OG1 1 
ATOM   5288 C CG2 . THR B 1 143 ? -4.432  -83.076 -28.111 1.00 54.33  ? 144 THR B CG2 1 
ATOM   5289 N N   . VAL B 1 144 ? -4.396  -82.136 -32.433 1.00 47.78  ? 145 VAL B N   1 
ATOM   5290 C CA  . VAL B 1 144 ? -3.899  -81.300 -33.508 1.00 46.13  ? 145 VAL B CA  1 
ATOM   5291 C C   . VAL B 1 144 ? -3.470  -79.975 -32.901 1.00 46.65  ? 145 VAL B C   1 
ATOM   5292 O O   . VAL B 1 144 ? -4.154  -79.429 -32.026 1.00 52.04  ? 145 VAL B O   1 
ATOM   5293 C CB  . VAL B 1 144 ? -4.953  -81.079 -34.606 1.00 43.86  ? 145 VAL B CB  1 
ATOM   5294 C CG1 . VAL B 1 144 ? -4.416  -80.137 -35.681 1.00 36.47  ? 145 VAL B CG1 1 
ATOM   5295 C CG2 . VAL B 1 144 ? -5.337  -82.410 -35.211 1.00 46.05  ? 145 VAL B CG2 1 
ATOM   5296 N N   . LEU B 1 145 ? -2.321  -79.473 -33.338 1.00 43.42  ? 146 LEU B N   1 
ATOM   5297 C CA  . LEU B 1 145 ? -1.854  -78.185 -32.877 1.00 38.82  ? 146 LEU B CA  1 
ATOM   5298 C C   . LEU B 1 145 ? -1.766  -77.162 -34.009 1.00 46.76  ? 146 LEU B C   1 
ATOM   5299 O O   . LEU B 1 145 ? -1.162  -77.406 -35.054 1.00 46.39  ? 146 LEU B O   1 
ATOM   5300 C CB  . LEU B 1 145 ? -0.501  -78.314 -32.204 1.00 46.35  ? 146 LEU B CB  1 
ATOM   5301 C CG  . LEU B 1 145 ? -0.216  -77.014 -31.451 1.00 54.40  ? 146 LEU B CG  1 
ATOM   5302 C CD1 . LEU B 1 145 ? -0.008  -77.273 -30.002 1.00 39.47  ? 146 LEU B CD1 1 
ATOM   5303 C CD2 . LEU B 1 145 ? 1.001   -76.343 -32.028 1.00 61.35  ? 146 LEU B CD2 1 
ATOM   5304 N N   . VAL B 1 146 ? -2.364  -76.003 -33.784 1.00 40.42  ? 147 VAL B N   1 
ATOM   5305 C CA  . VAL B 1 146 ? -2.295  -74.916 -34.736 1.00 36.53  ? 147 VAL B CA  1 
ATOM   5306 C C   . VAL B 1 146 ? -1.627  -73.709 -34.109 1.00 43.83  ? 147 VAL B C   1 
ATOM   5307 O O   . VAL B 1 146 ? -1.930  -73.382 -32.965 1.00 46.03  ? 147 VAL B O   1 
ATOM   5308 C CB  . VAL B 1 146 ? -3.695  -74.515 -35.214 1.00 42.17  ? 147 VAL B CB  1 
ATOM   5309 C CG1 . VAL B 1 146 ? -3.594  -73.469 -36.287 1.00 36.43  ? 147 VAL B CG1 1 
ATOM   5310 C CG2 . VAL B 1 146 ? -4.442  -75.735 -35.727 1.00 39.62  ? 147 VAL B CG2 1 
ATOM   5311 N N   . SER B 1 147 ? -0.714  -73.047 -34.825 1.00 44.09  ? 148 SER B N   1 
ATOM   5312 C CA  . SER B 1 147 ? -0.257  -71.723 -34.385 1.00 39.55  ? 148 SER B CA  1 
ATOM   5313 C C   . SER B 1 147 ? -0.263  -70.741 -35.541 1.00 45.33  ? 148 SER B C   1 
ATOM   5314 O O   . SER B 1 147 ? -0.047  -71.133 -36.692 1.00 48.70  ? 148 SER B O   1 
ATOM   5315 C CB  . SER B 1 147 ? 1.139   -71.781 -33.749 1.00 45.38  ? 148 SER B CB  1 
ATOM   5316 O OG  . SER B 1 147 ? 2.126   -72.120 -34.692 1.00 44.52  ? 148 SER B OG  1 
ATOM   5317 N N   . MET B 1 148 ? -0.542  -69.469 -35.257 1.00 44.24  ? 149 MET B N   1 
ATOM   5318 C CA  . MET B 1 148 ? -0.550  -68.476 -36.329 1.00 42.28  ? 149 MET B CA  1 
ATOM   5319 C C   . MET B 1 148 ? 0.427   -67.347 -36.064 1.00 40.93  ? 149 MET B C   1 
ATOM   5320 O O   . MET B 1 148 ? 0.833   -67.101 -34.920 1.00 41.65  ? 149 MET B O   1 
ATOM   5321 C CB  . MET B 1 148 ? -1.963  -67.890 -36.546 1.00 38.58  ? 149 MET B CB  1 
ATOM   5322 C CG  . MET B 1 148 ? -2.291  -66.671 -35.691 1.00 44.78  ? 149 MET B CG  1 
ATOM   5323 S SD  . MET B 1 148 ? -2.431  -67.138 -33.938 1.00 42.73  ? 149 MET B SD  1 
ATOM   5324 C CE  . MET B 1 148 ? -3.880  -68.197 -33.980 1.00 30.52  ? 149 MET B CE  1 
ATOM   5325 N N   . ASN B 1 149 ? 0.802   -66.647 -37.127 1.00 39.32  ? 150 ASN B N   1 
ATOM   5326 C CA  . ASN B 1 149 ? 1.485   -65.376 -36.970 1.00 36.21  ? 150 ASN B CA  1 
ATOM   5327 C C   . ASN B 1 149 ? 0.458   -64.267 -36.982 1.00 42.51  ? 150 ASN B C   1 
ATOM   5328 O O   . ASN B 1 149 ? -0.573  -64.392 -37.625 1.00 40.77  ? 150 ASN B O   1 
ATOM   5329 C CB  . ASN B 1 149 ? 2.512   -65.157 -38.073 1.00 38.45  ? 150 ASN B CB  1 
ATOM   5330 C CG  . ASN B 1 149 ? 3.875   -65.643 -37.689 1.00 38.80  ? 150 ASN B CG  1 
ATOM   5331 O OD1 . ASN B 1 149 ? 4.031   -66.359 -36.698 1.00 42.39  ? 150 ASN B OD1 1 
ATOM   5332 N ND2 . ASN B 1 149 ? 4.878   -65.273 -38.469 1.00 41.61  ? 150 ASN B ND2 1 
ATOM   5333 N N   . TYR B 1 150 ? 0.717   -63.193 -36.249 1.00 37.80  ? 151 TYR B N   1 
ATOM   5334 C CA  . TYR B 1 150 ? -0.178  -62.052 -36.295 1.00 36.31  ? 151 TYR B CA  1 
ATOM   5335 C C   . TYR B 1 150 ? 0.683   -60.795 -36.223 1.00 38.64  ? 151 TYR B C   1 
ATOM   5336 O O   . TYR B 1 150 ? 1.782   -60.804 -35.643 1.00 39.30  ? 151 TYR B O   1 
ATOM   5337 C CB  . TYR B 1 150 ? -1.215  -62.130 -35.157 1.00 42.78  ? 151 TYR B CB  1 
ATOM   5338 C CG  . TYR B 1 150 ? -0.625  -62.075 -33.751 1.00 35.15  ? 151 TYR B CG  1 
ATOM   5339 C CD1 . TYR B 1 150 ? -0.380  -60.854 -33.134 1.00 32.47  ? 151 TYR B CD1 1 
ATOM   5340 C CD2 . TYR B 1 150 ? -0.293  -63.242 -33.055 1.00 37.17  ? 151 TYR B CD2 1 
ATOM   5341 C CE1 . TYR B 1 150 ? 0.160   -60.787 -31.832 1.00 38.97  ? 151 TYR B CE1 1 
ATOM   5342 C CE2 . TYR B 1 150 ? 0.256   -63.187 -31.753 1.00 35.10  ? 151 TYR B CE2 1 
ATOM   5343 C CZ  . TYR B 1 150 ? 0.470   -61.946 -31.156 1.00 41.18  ? 151 TYR B CZ  1 
ATOM   5344 O OH  . TYR B 1 150 ? 1.014   -61.848 -29.895 1.00 41.42  ? 151 TYR B OH  1 
ATOM   5345 N N   . ARG B 1 151 ? 0.203   -59.718 -36.830 1.00 35.95  ? 152 ARG B N   1 
ATOM   5346 C CA  . ARG B 1 151 ? 0.987   -58.490 -36.906 1.00 37.96  ? 152 ARG B CA  1 
ATOM   5347 C C   . ARG B 1 151 ? 1.192   -57.864 -35.535 1.00 43.79  ? 152 ARG B C   1 
ATOM   5348 O O   . ARG B 1 151 ? 0.271   -57.849 -34.714 1.00 42.84  ? 152 ARG B O   1 
ATOM   5349 C CB  . ARG B 1 151 ? 0.310   -57.502 -37.845 1.00 37.39  ? 152 ARG B CB  1 
ATOM   5350 C CG  . ARG B 1 151 ? 0.459   -57.852 -39.338 1.00 41.55  ? 152 ARG B CG  1 
ATOM   5351 C CD  . ARG B 1 151 ? -0.412  -56.902 -40.203 1.00 34.48  ? 152 ARG B CD  1 
ATOM   5352 N NE  . ARG B 1 151 ? -1.813  -57.303 -40.189 1.00 42.57  ? 152 ARG B NE  1 
ATOM   5353 C CZ  . ARG B 1 151 ? -2.794  -56.616 -40.763 1.00 40.99  ? 152 ARG B CZ  1 
ATOM   5354 N NH1 . ARG B 1 151 ? -2.527  -55.478 -41.363 1.00 37.46  ? 152 ARG B NH1 1 
ATOM   5355 N NH2 . ARG B 1 151 ? -4.039  -57.057 -40.715 1.00 43.78  ? 152 ARG B NH2 1 
ATOM   5356 N N   . VAL B 1 152 ? 2.392   -57.336 -35.290 1.00 36.90  ? 153 VAL B N   1 
ATOM   5357 C CA  . VAL B 1 152 ? 2.720   -56.749 -33.993 1.00 37.40  ? 153 VAL B CA  1 
ATOM   5358 C C   . VAL B 1 152 ? 3.217   -55.330 -34.198 1.00 46.34  ? 153 VAL B C   1 
ATOM   5359 O O   . VAL B 1 152 ? 3.423   -54.914 -35.341 1.00 42.84  ? 153 VAL B O   1 
ATOM   5360 C CB  . VAL B 1 152 ? 3.793   -57.567 -33.232 1.00 40.40  ? 153 VAL B CB  1 
ATOM   5361 C CG1 . VAL B 1 152 ? 3.235   -58.929 -32.825 1.00 33.95  ? 153 VAL B CG1 1 
ATOM   5362 C CG2 . VAL B 1 152 ? 5.045   -57.742 -34.096 1.00 36.12  ? 153 VAL B CG2 1 
ATOM   5363 N N   . GLY B 1 153 ? 3.394   -54.584 -33.109 1.00 37.66  ? 154 GLY B N   1 
ATOM   5364 C CA  . GLY B 1 153 ? 3.871   -53.214 -33.203 1.00 40.49  ? 154 GLY B CA  1 
ATOM   5365 C C   . GLY B 1 153 ? 2.900   -52.316 -33.935 1.00 39.56  ? 154 GLY B C   1 
ATOM   5366 O O   . GLY B 1 153 ? 1.695   -52.572 -33.943 1.00 44.42  ? 154 GLY B O   1 
ATOM   5367 N N   . ALA B 1 154 ? 3.414   -51.262 -34.560 1.00 38.56  ? 155 ALA B N   1 
ATOM   5368 C CA  . ALA B 1 154 ? 2.560   -50.382 -35.353 1.00 35.75  ? 155 ALA B CA  1 
ATOM   5369 C C   . ALA B 1 154 ? 1.769   -51.158 -36.397 1.00 39.38  ? 155 ALA B C   1 
ATOM   5370 O O   . ALA B 1 154 ? 0.605   -50.864 -36.659 1.00 47.67  ? 155 ALA B O   1 
ATOM   5371 C CB  . ALA B 1 154 ? 3.390   -49.289 -36.032 1.00 43.49  ? 155 ALA B CB  1 
ATOM   5372 N N   . PHE B 1 155 ? 2.393   -52.173 -36.978 1.00 39.64  ? 156 PHE B N   1 
ATOM   5373 C CA  . PHE B 1 155 ? 1.770   -52.917 -38.071 1.00 40.42  ? 156 PHE B CA  1 
ATOM   5374 C C   . PHE B 1 155 ? 0.503   -53.615 -37.631 1.00 41.82  ? 156 PHE B C   1 
ATOM   5375 O O   . PHE B 1 155 ? -0.429  -53.782 -38.419 1.00 42.84  ? 156 PHE B O   1 
ATOM   5376 C CB  . PHE B 1 155 ? 2.776   -53.912 -38.656 1.00 38.68  ? 156 PHE B CB  1 
ATOM   5377 C CG  . PHE B 1 155 ? 4.054   -53.263 -39.073 1.00 37.57  ? 156 PHE B CG  1 
ATOM   5378 C CD1 . PHE B 1 155 ? 4.148   -52.623 -40.305 1.00 39.07  ? 156 PHE B CD1 1 
ATOM   5379 C CD2 . PHE B 1 155 ? 5.148   -53.250 -38.222 1.00 40.79  ? 156 PHE B CD2 1 
ATOM   5380 C CE1 . PHE B 1 155 ? 5.328   -52.008 -40.691 1.00 42.33  ? 156 PHE B CE1 1 
ATOM   5381 C CE2 . PHE B 1 155 ? 6.318   -52.630 -38.594 1.00 38.01  ? 156 PHE B CE2 1 
ATOM   5382 C CZ  . PHE B 1 155 ? 6.407   -52.008 -39.840 1.00 47.14  ? 156 PHE B CZ  1 
ATOM   5383 N N   . GLY B 1 156 ? 0.442   -53.987 -36.356 1.00 42.05  ? 157 GLY B N   1 
ATOM   5384 C CA  . GLY B 1 156 ? -0.731  -54.676 -35.859 1.00 34.60  ? 157 GLY B CA  1 
ATOM   5385 C C   . GLY B 1 156 ? -1.652  -53.839 -35.002 1.00 40.71  ? 157 GLY B C   1 
ATOM   5386 O O   . GLY B 1 156 ? -2.846  -54.142 -34.924 1.00 45.64  ? 157 GLY B O   1 
ATOM   5387 N N   . PHE B 1 157 ? -1.128  -52.782 -34.377 1.00 39.31  ? 158 PHE B N   1 
ATOM   5388 C CA  . PHE B 1 157 ? -1.904  -52.074 -33.360 1.00 42.79  ? 158 PHE B CA  1 
ATOM   5389 C C   . PHE B 1 157 ? -1.835  -50.559 -33.390 1.00 46.40  ? 158 PHE B C   1 
ATOM   5390 O O   . PHE B 1 157 ? -2.401  -49.910 -32.510 1.00 46.53  ? 158 PHE B O   1 
ATOM   5391 C CB  . PHE B 1 157 ? -1.496  -52.584 -31.963 1.00 41.40  ? 158 PHE B CB  1 
ATOM   5392 C CG  . PHE B 1 157 ? -1.742  -54.033 -31.816 1.00 37.47  ? 158 PHE B CG  1 
ATOM   5393 C CD1 . PHE B 1 157 ? -3.038  -54.500 -31.610 1.00 35.24  ? 158 PHE B CD1 1 
ATOM   5394 C CD2 . PHE B 1 157 ? -0.715  -54.948 -32.018 1.00 38.31  ? 158 PHE B CD2 1 
ATOM   5395 C CE1 . PHE B 1 157 ? -3.298  -55.855 -31.542 1.00 37.98  ? 158 PHE B CE1 1 
ATOM   5396 C CE2 . PHE B 1 157 ? -0.965  -56.313 -31.946 1.00 32.76  ? 158 PHE B CE2 1 
ATOM   5397 C CZ  . PHE B 1 157 ? -2.256  -56.766 -31.718 1.00 39.11  ? 158 PHE B CZ  1 
ATOM   5398 N N   . LEU B 1 158 ? -1.167  -49.978 -34.382 1.00 41.79  ? 159 LEU B N   1 
ATOM   5399 C CA  . LEU B 1 158 ? -1.263  -48.532 -34.493 1.00 51.41  ? 159 LEU B CA  1 
ATOM   5400 C C   . LEU B 1 158 ? -2.712  -48.218 -34.835 1.00 44.35  ? 159 LEU B C   1 
ATOM   5401 O O   . LEU B 1 158 ? -3.309  -48.860 -35.695 1.00 45.20  ? 159 LEU B O   1 
ATOM   5402 C CB  . LEU B 1 158 ? -0.298  -47.957 -35.519 1.00 44.20  ? 159 LEU B CB  1 
ATOM   5403 C CG  . LEU B 1 158 ? -0.428  -46.457 -35.819 1.00 50.28  ? 159 LEU B CG  1 
ATOM   5404 C CD1 . LEU B 1 158 ? 0.893   -45.860 -36.238 1.00 44.12  ? 159 LEU B CD1 1 
ATOM   5405 C CD2 . LEU B 1 158 ? -1.431  -46.239 -36.924 1.00 39.18  ? 159 LEU B CD2 1 
ATOM   5406 N N   . ALA B 1 159 ? -3.288  -47.258 -34.119 1.00 48.27  ? 160 ALA B N   1 
ATOM   5407 C CA  . ALA B 1 159 ? -4.706  -46.947 -34.289 1.00 50.54  ? 160 ALA B CA  1 
ATOM   5408 C C   . ALA B 1 159 ? -4.930  -45.454 -34.368 1.00 51.27  ? 160 ALA B C   1 
ATOM   5409 O O   . ALA B 1 159 ? -4.340  -44.684 -33.611 1.00 45.35  ? 160 ALA B O   1 
ATOM   5410 C CB  . ALA B 1 159 ? -5.520  -47.533 -33.160 1.00 47.98  ? 160 ALA B CB  1 
ATOM   5411 N N   . LEU B 1 160 ? -5.754  -45.054 -35.326 1.00 49.96  ? 161 LEU B N   1 
ATOM   5412 C CA  . LEU B 1 160 ? -6.289  -43.704 -35.385 1.00 48.21  ? 161 LEU B CA  1 
ATOM   5413 C C   . LEU B 1 160 ? -7.783  -43.906 -35.303 1.00 48.88  ? 161 LEU B C   1 
ATOM   5414 O O   . LEU B 1 160 ? -8.465  -43.939 -36.334 1.00 47.99  ? 161 LEU B O   1 
ATOM   5415 C CB  . LEU B 1 160 ? -5.873  -42.980 -36.671 1.00 45.46  ? 161 LEU B CB  1 
ATOM   5416 C CG  . LEU B 1 160 ? -4.385  -42.642 -36.785 1.00 54.28  ? 161 LEU B CG  1 
ATOM   5417 C CD1 . LEU B 1 160 ? -4.071  -42.310 -38.208 1.00 57.33  ? 161 LEU B CD1 1 
ATOM   5418 C CD2 . LEU B 1 160 ? -3.984  -41.480 -35.904 1.00 40.02  ? 161 LEU B CD2 1 
ATOM   5419 N N   . PRO B 1 161 ? -8.294  -44.091 -34.072 1.00 53.82  ? 162 PRO B N   1 
ATOM   5420 C CA  . PRO B 1 161 ? -9.662  -44.570 -33.828 1.00 52.91  ? 162 PRO B CA  1 
ATOM   5421 C C   . PRO B 1 161 ? -10.714 -43.747 -34.570 1.00 53.49  ? 162 PRO B C   1 
ATOM   5422 O O   . PRO B 1 161 ? -10.596 -42.517 -34.627 1.00 53.79  ? 162 PRO B O   1 
ATOM   5423 C CB  . PRO B 1 161 ? -9.816  -44.426 -32.306 1.00 56.94  ? 162 PRO B CB  1 
ATOM   5424 C CG  . PRO B 1 161 ? -8.429  -44.493 -31.788 1.00 50.40  ? 162 PRO B CG  1 
ATOM   5425 C CD  . PRO B 1 161 ? -7.585  -43.801 -32.813 1.00 44.65  ? 162 PRO B CD  1 
ATOM   5426 N N   . GLY B 1 162 ? -11.710 -44.418 -35.145 1.00 53.70  ? 163 GLY B N   1 
ATOM   5427 C CA  . GLY B 1 162 ? -12.698 -43.747 -35.973 1.00 46.94  ? 163 GLY B CA  1 
ATOM   5428 C C   . GLY B 1 162 ? -12.396 -43.828 -37.468 1.00 69.50  ? 163 GLY B C   1 
ATOM   5429 O O   . GLY B 1 162 ? -13.317 -43.915 -38.291 1.00 67.59  ? 163 GLY B O   1 
ATOM   5430 N N   . SER B 1 163 ? -11.111 -43.806 -37.825 1.00 53.11  ? 164 SER B N   1 
ATOM   5431 C CA  . SER B 1 163 ? -10.698 -43.854 -39.230 1.00 61.84  ? 164 SER B CA  1 
ATOM   5432 C C   . SER B 1 163 ? -10.855 -45.238 -39.852 1.00 59.14  ? 164 SER B C   1 
ATOM   5433 O O   . SER B 1 163 ? -10.829 -46.245 -39.151 1.00 55.05  ? 164 SER B O   1 
ATOM   5434 C CB  . SER B 1 163 ? -9.249  -43.427 -39.377 1.00 53.45  ? 164 SER B CB  1 
ATOM   5435 O OG  . SER B 1 163 ? -8.424  -44.556 -39.180 1.00 65.29  ? 164 SER B OG  1 
ATOM   5436 N N   . ARG B 1 164 ? -10.986 -45.290 -41.175 1.00 60.04  ? 165 ARG B N   1 
ATOM   5437 C CA  . ARG B 1 164 ? -11.139 -46.573 -41.857 1.00 59.44  ? 165 ARG B CA  1 
ATOM   5438 C C   . ARG B 1 164 ? -9.777  -47.111 -42.288 1.00 53.13  ? 165 ARG B C   1 
ATOM   5439 O O   . ARG B 1 164 ? -9.616  -48.311 -42.505 1.00 57.39  ? 165 ARG B O   1 
ATOM   5440 C CB  . ARG B 1 164 ? -12.071 -46.445 -43.069 1.00 75.49  ? 165 ARG B CB  1 
ATOM   5441 C CG  . ARG B 1 164 ? -11.429 -45.770 -44.294 1.00 88.85  ? 165 ARG B CG  1 
ATOM   5442 C CD  . ARG B 1 164 ? -12.385 -45.684 -45.496 1.00 94.98  ? 165 ARG B CD  1 
ATOM   5443 N NE  . ARG B 1 164 ? -13.275 -44.521 -45.419 1.00 107.94 ? 165 ARG B NE  1 
ATOM   5444 C CZ  . ARG B 1 164 ? -14.488 -44.529 -44.864 1.00 112.39 ? 165 ARG B CZ  1 
ATOM   5445 N NH1 . ARG B 1 164 ? -14.974 -45.645 -44.327 1.00 107.17 ? 165 ARG B NH1 1 
ATOM   5446 N NH2 . ARG B 1 164 ? -15.219 -43.416 -44.846 1.00 99.97  ? 165 ARG B NH2 1 
ATOM   5447 N N   . GLU B 1 165 ? -8.799  -46.216 -42.387 1.00 48.86  ? 166 GLU B N   1 
ATOM   5448 C CA  . GLU B 1 165 ? -7.472  -46.560 -42.866 1.00 49.29  ? 166 GLU B CA  1 
ATOM   5449 C C   . GLU B 1 165 ? -6.505  -47.104 -41.794 1.00 60.25  ? 166 GLU B C   1 
ATOM   5450 O O   . GLU B 1 165 ? -5.473  -47.687 -42.119 1.00 53.97  ? 166 GLU B O   1 
ATOM   5451 C CB  . GLU B 1 165 ? -6.863  -45.330 -43.541 1.00 52.90  ? 166 GLU B CB  1 
ATOM   5452 C CG  . GLU B 1 165 ? -7.762  -44.725 -44.633 1.00 67.18  ? 166 GLU B CG  1 
ATOM   5453 C CD  . GLU B 1 165 ? -7.867  -45.568 -45.936 1.00 89.80  ? 166 GLU B CD  1 
ATOM   5454 O OE1 . GLU B 1 165 ? -7.280  -46.680 -46.044 1.00 69.80  ? 166 GLU B OE1 1 
ATOM   5455 O OE2 . GLU B 1 165 ? -8.550  -45.087 -46.872 1.00 98.64  ? 166 GLU B OE2 1 
ATOM   5456 N N   . ALA B 1 166 ? -6.822  -46.918 -40.517 1.00 53.63  ? 167 ALA B N   1 
ATOM   5457 C CA  . ALA B 1 166 ? -6.010  -47.493 -39.441 1.00 49.75  ? 167 ALA B CA  1 
ATOM   5458 C C   . ALA B 1 166 ? -6.884  -47.624 -38.225 1.00 54.91  ? 167 ALA B C   1 
ATOM   5459 O O   . ALA B 1 166 ? -6.746  -46.857 -37.274 1.00 46.34  ? 167 ALA B O   1 
ATOM   5460 C CB  . ALA B 1 166 ? -4.791  -46.632 -39.144 1.00 48.34  ? 167 ALA B CB  1 
ATOM   5461 N N   . PRO B 1 167 ? -7.814  -48.582 -38.270 1.00 46.71  ? 168 PRO B N   1 
ATOM   5462 C CA  . PRO B 1 167 ? -8.832  -48.696 -37.233 1.00 41.14  ? 168 PRO B CA  1 
ATOM   5463 C C   . PRO B 1 167 ? -8.301  -49.284 -35.927 1.00 54.23  ? 168 PRO B C   1 
ATOM   5464 O O   . PRO B 1 167 ? -9.009  -49.247 -34.921 1.00 63.42  ? 168 PRO B O   1 
ATOM   5465 C CB  . PRO B 1 167 ? -9.870  -49.628 -37.864 1.00 49.27  ? 168 PRO B CB  1 
ATOM   5466 C CG  . PRO B 1 167 ? -9.108  -50.437 -38.880 1.00 38.47  ? 168 PRO B CG  1 
ATOM   5467 C CD  . PRO B 1 167 ? -7.993  -49.565 -39.358 1.00 40.34  ? 168 PRO B CD  1 
ATOM   5468 N N   . GLY B 1 168 ? -7.081  -49.816 -35.945 1.00 58.48  ? 169 GLY B N   1 
ATOM   5469 C CA  . GLY B 1 168 ? -6.498  -50.449 -34.774 1.00 52.00  ? 169 GLY B CA  1 
ATOM   5470 C C   . GLY B 1 168 ? -6.954  -51.881 -34.586 1.00 51.16  ? 169 GLY B C   1 
ATOM   5471 O O   . GLY B 1 168 ? -7.903  -52.336 -35.233 1.00 52.24  ? 169 GLY B O   1 
ATOM   5472 N N   . ASN B 1 169 ? -6.253  -52.595 -33.714 1.00 44.49  ? 170 ASN B N   1 
ATOM   5473 C CA  . ASN B 1 169 ? -6.582  -53.973 -33.375 1.00 41.13  ? 170 ASN B CA  1 
ATOM   5474 C C   . ASN B 1 169 ? -6.463  -54.982 -34.534 1.00 46.15  ? 170 ASN B C   1 
ATOM   5475 O O   . ASN B 1 169 ? -6.994  -56.107 -34.422 1.00 42.97  ? 170 ASN B O   1 
ATOM   5476 C CB  . ASN B 1 169 ? -8.003  -54.040 -32.786 1.00 35.59  ? 170 ASN B CB  1 
ATOM   5477 C CG  . ASN B 1 169 ? -8.082  -53.462 -31.384 1.00 50.92  ? 170 ASN B CG  1 
ATOM   5478 O OD1 . ASN B 1 169 ? -7.071  -53.366 -30.687 1.00 45.21  ? 170 ASN B OD1 1 
ATOM   5479 N ND2 . ASN B 1 169 ? -9.277  -53.070 -30.965 1.00 43.09  ? 170 ASN B ND2 1 
ATOM   5480 N N   . VAL B 1 170 ? -5.774  -54.631 -35.627 1.00 41.57  ? 171 VAL B N   1 
ATOM   5481 C CA  . VAL B 1 170 ? -5.809  -55.541 -36.791 1.00 39.49  ? 171 VAL B CA  1 
ATOM   5482 C C   . VAL B 1 170 ? -4.999  -56.804 -36.489 1.00 44.37  ? 171 VAL B C   1 
ATOM   5483 O O   . VAL B 1 170 ? -5.313  -57.886 -37.000 1.00 39.11  ? 171 VAL B O   1 
ATOM   5484 C CB  . VAL B 1 170 ? -5.320  -54.878 -38.105 1.00 43.98  ? 171 VAL B CB  1 
ATOM   5485 C CG1 . VAL B 1 170 ? -6.232  -53.722 -38.466 1.00 38.97  ? 171 VAL B CG1 1 
ATOM   5486 C CG2 . VAL B 1 170 ? -3.851  -54.430 -38.031 1.00 43.84  ? 171 VAL B CG2 1 
ATOM   5487 N N   . GLY B 1 171 ? -4.007  -56.681 -35.601 1.00 42.84  ? 172 GLY B N   1 
ATOM   5488 C CA  . GLY B 1 171 ? -3.288  -57.851 -35.115 1.00 33.78  ? 172 GLY B CA  1 
ATOM   5489 C C   . GLY B 1 171 ? -4.216  -58.870 -34.455 1.00 41.03  ? 172 GLY B C   1 
ATOM   5490 O O   . GLY B 1 171 ? -4.042  -60.082 -34.613 1.00 41.38  ? 172 GLY B O   1 
ATOM   5491 N N   . LEU B 1 172 ? -5.219  -58.392 -33.722 1.00 40.06  ? 173 LEU B N   1 
ATOM   5492 C CA  . LEU B 1 172 ? -6.204  -59.300 -33.125 1.00 41.23  ? 173 LEU B CA  1 
ATOM   5493 C C   . LEU B 1 172 ? -7.126  -59.858 -34.205 1.00 40.35  ? 173 LEU B C   1 
ATOM   5494 O O   . LEU B 1 172 ? -7.555  -61.020 -34.152 1.00 42.04  ? 173 LEU B O   1 
ATOM   5495 C CB  . LEU B 1 172 ? -7.037  -58.593 -32.060 1.00 37.71  ? 173 LEU B CB  1 
ATOM   5496 C CG  . LEU B 1 172 ? -6.415  -58.286 -30.703 1.00 47.15  ? 173 LEU B CG  1 
ATOM   5497 C CD1 . LEU B 1 172 ? -7.310  -57.324 -29.901 1.00 35.06  ? 173 LEU B CD1 1 
ATOM   5498 C CD2 . LEU B 1 172 ? -6.182  -59.577 -29.935 1.00 35.97  ? 173 LEU B CD2 1 
ATOM   5499 N N   . LEU B 1 173 ? -7.436  -59.022 -35.188 1.00 38.79  ? 174 LEU B N   1 
ATOM   5500 C CA  . LEU B 1 173 ? -8.210  -59.500 -36.332 1.00 44.92  ? 174 LEU B CA  1 
ATOM   5501 C C   . LEU B 1 173 ? -7.457  -60.586 -37.097 1.00 41.55  ? 174 LEU B C   1 
ATOM   5502 O O   . LEU B 1 173 ? -8.089  -61.513 -37.620 1.00 45.99  ? 174 LEU B O   1 
ATOM   5503 C CB  . LEU B 1 173 ? -8.578  -58.350 -37.263 1.00 42.12  ? 174 LEU B CB  1 
ATOM   5504 C CG  . LEU B 1 173 ? -9.622  -57.397 -36.663 1.00 49.64  ? 174 LEU B CG  1 
ATOM   5505 C CD1 . LEU B 1 173 ? -10.019 -56.325 -37.677 1.00 43.35  ? 174 LEU B CD1 1 
ATOM   5506 C CD2 . LEU B 1 173 ? -10.845 -58.171 -36.173 1.00 36.28  ? 174 LEU B CD2 1 
ATOM   5507 N N   . ASP B 1 174 ? -6.123  -60.490 -37.148 1.00 36.12  ? 175 ASP B N   1 
ATOM   5508 C CA  . ASP B 1 174 ? -5.310  -61.564 -37.751 1.00 41.29  ? 175 ASP B CA  1 
ATOM   5509 C C   . ASP B 1 174 ? -5.568  -62.869 -37.003 1.00 41.10  ? 175 ASP B C   1 
ATOM   5510 O O   . ASP B 1 174 ? -5.841  -63.910 -37.609 1.00 42.95  ? 175 ASP B O   1 
ATOM   5511 C CB  . ASP B 1 174 ? -3.806  -61.248 -37.725 1.00 32.75  ? 175 ASP B CB  1 
ATOM   5512 C CG  . ASP B 1 174 ? -3.430  -60.013 -38.544 1.00 43.49  ? 175 ASP B CG  1 
ATOM   5513 O OD1 . ASP B 1 174 ? -4.231  -59.592 -39.421 1.00 45.05  ? 175 ASP B OD1 1 
ATOM   5514 O OD2 . ASP B 1 174 ? -2.314  -59.463 -38.313 1.00 44.52  ? 175 ASP B OD2 1 
ATOM   5515 N N   . GLN B 1 175 ? -5.483  -62.807 -35.671 1.00 46.49  ? 176 GLN B N   1 
ATOM   5516 C CA  . GLN B 1 175 ? -5.736  -63.984 -34.845 1.00 35.77  ? 176 GLN B CA  1 
ATOM   5517 C C   . GLN B 1 175 ? -7.147  -64.528 -35.107 1.00 32.51  ? 176 GLN B C   1 
ATOM   5518 O O   . GLN B 1 175 ? -7.337  -65.742 -35.234 1.00 39.48  ? 176 GLN B O   1 
ATOM   5519 C CB  . GLN B 1 175 ? -5.557  -63.662 -33.354 1.00 39.94  ? 176 GLN B CB  1 
ATOM   5520 C CG  . GLN B 1 175 ? -4.156  -63.231 -32.938 1.00 39.39  ? 176 GLN B CG  1 
ATOM   5521 C CD  . GLN B 1 175 ? -4.156  -62.669 -31.521 1.00 44.22  ? 176 GLN B CD  1 
ATOM   5522 O OE1 . GLN B 1 175 ? -5.157  -62.777 -30.813 1.00 45.75  ? 176 GLN B OE1 1 
ATOM   5523 N NE2 . GLN B 1 175 ? -3.048  -62.030 -31.117 1.00 31.31  ? 176 GLN B NE2 1 
ATOM   5524 N N   . ARG B 1 176 ? -8.141  -63.642 -35.178 1.00 39.16  ? 177 ARG B N   1 
ATOM   5525 C CA  . ARG B 1 176 ? -9.505  -64.091 -35.456 1.00 39.04  ? 177 ARG B CA  1 
ATOM   5526 C C   . ARG B 1 176 ? -9.623  -64.804 -36.819 1.00 41.94  ? 177 ARG B C   1 
ATOM   5527 O O   . ARG B 1 176 ? -10.269 -65.863 -36.924 1.00 37.46  ? 177 ARG B O   1 
ATOM   5528 C CB  . ARG B 1 176 ? -10.494 -62.924 -35.406 1.00 44.10  ? 177 ARG B CB  1 
ATOM   5529 C CG  . ARG B 1 176 ? -11.955 -63.375 -35.590 1.00 48.63  ? 177 ARG B CG  1 
ATOM   5530 C CD  . ARG B 1 176 ? -12.934 -62.215 -35.519 1.00 46.03  ? 177 ARG B CD  1 
ATOM   5531 N NE  . ARG B 1 176 ? -13.111 -61.766 -34.143 1.00 56.87  ? 177 ARG B NE  1 
ATOM   5532 C CZ  . ARG B 1 176 ? -13.663 -60.606 -33.794 1.00 53.92  ? 177 ARG B CZ  1 
ATOM   5533 N NH1 . ARG B 1 176 ? -14.101 -59.761 -34.723 1.00 52.77  ? 177 ARG B NH1 1 
ATOM   5534 N NH2 . ARG B 1 176 ? -13.776 -60.293 -32.510 1.00 55.03  ? 177 ARG B NH2 1 
ATOM   5535 N N   . LEU B 1 177 ? -9.012  -64.223 -37.854 1.00 41.67  ? 178 LEU B N   1 
ATOM   5536 C CA  . LEU B 1 177 ? -9.077  -64.820 -39.187 1.00 40.34  ? 178 LEU B CA  1 
ATOM   5537 C C   . LEU B 1 177 ? -8.504  -66.232 -39.110 1.00 38.46  ? 178 LEU B C   1 
ATOM   5538 O O   . LEU B 1 177 ? -9.127  -67.190 -39.568 1.00 44.65  ? 178 LEU B O   1 
ATOM   5539 C CB  . LEU B 1 177 ? -8.338  -63.962 -40.215 1.00 46.81  ? 178 LEU B CB  1 
ATOM   5540 C CG  . LEU B 1 177 ? -8.487  -64.424 -41.667 1.00 48.88  ? 178 LEU B CG  1 
ATOM   5541 C CD1 . LEU B 1 177 ? -9.954  -64.634 -42.014 1.00 44.67  ? 178 LEU B CD1 1 
ATOM   5542 C CD2 . LEU B 1 177 ? -7.853  -63.416 -42.620 1.00 41.05  ? 178 LEU B CD2 1 
ATOM   5543 N N   . ALA B 1 178 ? -7.367  -66.382 -38.439 1.00 41.37  ? 179 ALA B N   1 
ATOM   5544 C CA  . ALA B 1 178 ? -6.785  -67.712 -38.265 1.00 36.39  ? 179 ALA B CA  1 
ATOM   5545 C C   . ALA B 1 178 ? -7.748  -68.649 -37.559 1.00 46.72  ? 179 ALA B C   1 
ATOM   5546 O O   . ALA B 1 178 ? -7.850  -69.830 -37.909 1.00 45.37  ? 179 ALA B O   1 
ATOM   5547 C CB  . ALA B 1 178 ? -5.485  -67.618 -37.504 1.00 37.14  ? 179 ALA B CB  1 
ATOM   5548 N N   . LEU B 1 179 ? -8.469  -68.120 -36.568 1.00 46.02  ? 180 LEU B N   1 
ATOM   5549 C CA  . LEU B 1 179 ? -9.431  -68.934 -35.833 1.00 48.72  ? 180 LEU B CA  1 
ATOM   5550 C C   . LEU B 1 179 ? -10.590 -69.381 -36.738 1.00 41.45  ? 180 LEU B C   1 
ATOM   5551 O O   . LEU B 1 179 ? -11.000 -70.542 -36.698 1.00 46.34  ? 180 LEU B O   1 
ATOM   5552 C CB  . LEU B 1 179 ? -9.963  -68.168 -34.617 1.00 44.09  ? 180 LEU B CB  1 
ATOM   5553 C CG  . LEU B 1 179 ? -8.980  -67.971 -33.464 1.00 48.45  ? 180 LEU B CG  1 
ATOM   5554 C CD1 . LEU B 1 179 ? -9.673  -67.274 -32.326 1.00 43.32  ? 180 LEU B CD1 1 
ATOM   5555 C CD2 . LEU B 1 179 ? -8.386  -69.306 -33.010 1.00 36.19  ? 180 LEU B CD2 1 
ATOM   5556 N N   . GLN B 1 180 ? -11.125 -68.450 -37.524 1.00 38.85  ? 181 GLN B N   1 
ATOM   5557 C CA  . GLN B 1 180 ? -12.100 -68.767 -38.589 1.00 49.11  ? 181 GLN B CA  1 
ATOM   5558 C C   . GLN B 1 180 ? -11.577 -69.837 -39.547 1.00 45.89  ? 181 GLN B C   1 
ATOM   5559 O O   . GLN B 1 180 ? -12.308 -70.754 -39.928 1.00 56.64  ? 181 GLN B O   1 
ATOM   5560 C CB  . GLN B 1 180 ? -12.476 -67.494 -39.373 1.00 46.18  ? 181 GLN B CB  1 
ATOM   5561 C CG  . GLN B 1 180 ? -13.386 -66.517 -38.577 1.00 50.54  ? 181 GLN B CG  1 
ATOM   5562 C CD  . GLN B 1 180 ? -13.381 -65.086 -39.116 1.00 56.21  ? 181 GLN B CD  1 
ATOM   5563 O OE1 . GLN B 1 180 ? -12.673 -64.774 -40.063 1.00 56.61  ? 181 GLN B OE1 1 
ATOM   5564 N NE2 . GLN B 1 180 ? -14.163 -64.208 -38.492 1.00 56.82  ? 181 GLN B NE2 1 
ATOM   5565 N N   . TRP B 1 181 ? -10.303 -69.729 -39.907 1.00 42.37  ? 182 TRP B N   1 
ATOM   5566 C CA  . TRP B 1 181 ? -9.665  -70.711 -40.784 1.00 48.14  ? 182 TRP B CA  1 
ATOM   5567 C C   . TRP B 1 181 ? -9.684  -72.093 -40.168 1.00 50.08  ? 182 TRP B C   1 
ATOM   5568 O O   . TRP B 1 181 ? -9.892  -73.081 -40.870 1.00 52.19  ? 182 TRP B O   1 
ATOM   5569 C CB  . TRP B 1 181 ? -8.223  -70.302 -41.079 1.00 44.77  ? 182 TRP B CB  1 
ATOM   5570 C CG  . TRP B 1 181 ? -7.552  -71.102 -42.141 1.00 45.12  ? 182 TRP B CG  1 
ATOM   5571 C CD1 . TRP B 1 181 ? -7.427  -70.766 -43.468 1.00 48.16  ? 182 TRP B CD1 1 
ATOM   5572 C CD2 . TRP B 1 181 ? -6.883  -72.362 -41.981 1.00 43.10  ? 182 TRP B CD2 1 
ATOM   5573 N NE1 . TRP B 1 181 ? -6.735  -71.743 -44.131 1.00 45.91  ? 182 TRP B NE1 1 
ATOM   5574 C CE2 . TRP B 1 181 ? -6.391  -72.734 -43.246 1.00 45.77  ? 182 TRP B CE2 1 
ATOM   5575 C CE3 . TRP B 1 181 ? -6.661  -73.214 -40.889 1.00 42.20  ? 182 TRP B CE3 1 
ATOM   5576 C CZ2 . TRP B 1 181 ? -5.686  -73.923 -43.454 1.00 45.68  ? 182 TRP B CZ2 1 
ATOM   5577 C CZ3 . TRP B 1 181 ? -5.968  -74.391 -41.098 1.00 40.77  ? 182 TRP B CZ3 1 
ATOM   5578 C CH2 . TRP B 1 181 ? -5.492  -74.738 -42.368 1.00 46.78  ? 182 TRP B CH2 1 
ATOM   5579 N N   . VAL B 1 182 ? -9.431  -72.159 -38.857 1.00 52.12  ? 183 VAL B N   1 
ATOM   5580 C CA  . VAL B 1 182 ? -9.418  -73.427 -38.127 1.00 41.51  ? 183 VAL B CA  1 
ATOM   5581 C C   . VAL B 1 182 ? -10.813 -74.047 -38.165 1.00 47.58  ? 183 VAL B C   1 
ATOM   5582 O O   . VAL B 1 182 ? -10.967 -75.259 -38.382 1.00 47.41  ? 183 VAL B O   1 
ATOM   5583 C CB  . VAL B 1 182 ? -8.935  -73.255 -36.643 1.00 49.76  ? 183 VAL B CB  1 
ATOM   5584 C CG1 . VAL B 1 182 ? -9.295  -74.467 -35.786 1.00 37.87  ? 183 VAL B CG1 1 
ATOM   5585 C CG2 . VAL B 1 182 ? -7.454  -73.067 -36.604 1.00 43.84  ? 183 VAL B CG2 1 
ATOM   5586 N N   . GLN B 1 183 ? -11.832 -73.215 -37.975 1.00 45.18  ? 184 GLN B N   1 
ATOM   5587 C CA  . GLN B 1 183 ? -13.204 -73.694 -38.078 1.00 53.70  ? 184 GLN B CA  1 
ATOM   5588 C C   . GLN B 1 183 ? -13.466 -74.318 -39.459 1.00 54.45  ? 184 GLN B C   1 
ATOM   5589 O O   . GLN B 1 183 ? -13.949 -75.458 -39.572 1.00 51.73  ? 184 GLN B O   1 
ATOM   5590 C CB  . GLN B 1 183 ? -14.194 -72.558 -37.808 1.00 47.55  ? 184 GLN B CB  1 
ATOM   5591 C CG  . GLN B 1 183 ? -14.376 -72.224 -36.338 1.00 54.15  ? 184 GLN B CG  1 
ATOM   5592 C CD  . GLN B 1 183 ? -14.788 -73.427 -35.522 1.00 54.43  ? 184 GLN B CD  1 
ATOM   5593 O OE1 . GLN B 1 183 ? -15.847 -74.013 -35.743 1.00 64.60  ? 184 GLN B OE1 1 
ATOM   5594 N NE2 . GLN B 1 183 ? -13.935 -73.820 -34.586 1.00 53.10  ? 184 GLN B NE2 1 
ATOM   5595 N N   . GLU B 1 184 ? -13.118 -73.581 -40.504 1.00 52.49  ? 185 GLU B N   1 
ATOM   5596 C CA  . GLU B 1 184 ? -13.459 -74.012 -41.856 1.00 58.90  ? 185 GLU B CA  1 
ATOM   5597 C C   . GLU B 1 184 ? -12.578 -75.154 -42.364 1.00 48.07  ? 185 GLU B C   1 
ATOM   5598 O O   . GLU B 1 184 ? -12.993 -75.900 -43.235 1.00 62.92  ? 185 GLU B O   1 
ATOM   5599 C CB  . GLU B 1 184 ? -13.400 -72.817 -42.808 1.00 55.73  ? 185 GLU B CB  1 
ATOM   5600 C CG  . GLU B 1 184 ? -14.416 -71.732 -42.421 1.00 72.44  ? 185 GLU B CG  1 
ATOM   5601 C CD  . GLU B 1 184 ? -14.461 -70.558 -43.392 1.00 90.07  ? 185 GLU B CD  1 
ATOM   5602 O OE1 . GLU B 1 184 ? -13.472 -70.363 -44.132 1.00 100.83 ? 185 GLU B OE1 1 
ATOM   5603 O OE2 . GLU B 1 184 ? -15.487 -69.832 -43.416 1.00 84.74  ? 185 GLU B OE2 1 
ATOM   5604 N N   . ASN B 1 185 ? -11.393 -75.338 -41.786 1.00 55.32  ? 186 ASN B N   1 
ATOM   5605 C CA  . ASN B 1 185 ? -10.431 -76.251 -42.398 1.00 44.35  ? 186 ASN B CA  1 
ATOM   5606 C C   . ASN B 1 185 ? -9.790  -77.308 -41.538 1.00 54.18  ? 186 ASN B C   1 
ATOM   5607 O O   . ASN B 1 185 ? -9.137  -78.198 -42.084 1.00 51.33  ? 186 ASN B O   1 
ATOM   5608 C CB  . ASN B 1 185 ? -9.280  -75.455 -43.028 1.00 49.45  ? 186 ASN B CB  1 
ATOM   5609 C CG  . ASN B 1 185 ? -9.735  -74.556 -44.147 1.00 54.48  ? 186 ASN B CG  1 
ATOM   5610 O OD1 . ASN B 1 185 ? -10.203 -75.016 -45.196 1.00 59.96  ? 186 ASN B OD1 1 
ATOM   5611 N ND2 . ASN B 1 185 ? -9.588  -73.263 -43.942 1.00 48.25  ? 186 ASN B ND2 1 
ATOM   5612 N N   . VAL B 1 186 ? -9.899  -77.206 -40.214 1.00 45.59  ? 187 VAL B N   1 
ATOM   5613 C CA  . VAL B 1 186 ? -9.106  -78.105 -39.376 1.00 44.67  ? 187 VAL B CA  1 
ATOM   5614 C C   . VAL B 1 186 ? -9.568  -79.555 -39.550 1.00 44.76  ? 187 VAL B C   1 
ATOM   5615 O O   . VAL B 1 186 ? -8.807  -80.490 -39.283 1.00 41.54  ? 187 VAL B O   1 
ATOM   5616 C CB  . VAL B 1 186 ? -9.161  -77.717 -37.848 1.00 48.45  ? 187 VAL B CB  1 
ATOM   5617 C CG1 . VAL B 1 186 ? -10.458 -78.209 -37.191 1.00 38.61  ? 187 VAL B CG1 1 
ATOM   5618 C CG2 . VAL B 1 186 ? -7.953  -78.297 -37.113 1.00 34.78  ? 187 VAL B CG2 1 
ATOM   5619 N N   . ALA B 1 187 ? -10.819 -79.741 -39.971 1.00 40.25  ? 188 ALA B N   1 
ATOM   5620 C CA  . ALA B 1 187 ? -11.349 -81.098 -40.142 1.00 56.15  ? 188 ALA B CA  1 
ATOM   5621 C C   . ALA B 1 187 ? -10.525 -81.870 -41.179 1.00 57.70  ? 188 ALA B C   1 
ATOM   5622 O O   . ALA B 1 187 ? -10.297 -83.072 -41.029 1.00 53.72  ? 188 ALA B O   1 
ATOM   5623 C CB  . ALA B 1 187 ? -12.813 -81.058 -40.533 1.00 38.94  ? 188 ALA B CB  1 
ATOM   5624 N N   . ALA B 1 188 ? -10.026 -81.155 -42.189 1.00 47.96  ? 189 ALA B N   1 
ATOM   5625 C CA  . ALA B 1 188 ? -9.220  -81.769 -43.248 1.00 48.23  ? 189 ALA B CA  1 
ATOM   5626 C C   . ALA B 1 188 ? -7.953  -82.408 -42.699 1.00 54.29  ? 189 ALA B C   1 
ATOM   5627 O O   . ALA B 1 188 ? -7.378  -83.291 -43.336 1.00 55.53  ? 189 ALA B O   1 
ATOM   5628 C CB  . ALA B 1 188 ? -8.871  -80.736 -44.329 1.00 44.14  ? 189 ALA B CB  1 
ATOM   5629 N N   . PHE B 1 189 ? -7.523  -81.990 -41.511 1.00 53.11  ? 190 PHE B N   1 
ATOM   5630 C CA  . PHE B 1 189 ? -6.321  -82.578 -40.920 1.00 47.09  ? 190 PHE B CA  1 
ATOM   5631 C C   . PHE B 1 189 ? -6.696  -83.590 -39.854 1.00 50.59  ? 190 PHE B C   1 
ATOM   5632 O O   . PHE B 1 189 ? -5.829  -84.166 -39.190 1.00 57.47  ? 190 PHE B O   1 
ATOM   5633 C CB  . PHE B 1 189 ? -5.411  -81.501 -40.337 1.00 52.37  ? 190 PHE B CB  1 
ATOM   5634 C CG  . PHE B 1 189 ? -5.015  -80.447 -41.329 1.00 50.46  ? 190 PHE B CG  1 
ATOM   5635 C CD1 . PHE B 1 189 ? -5.892  -79.417 -41.650 1.00 43.71  ? 190 PHE B CD1 1 
ATOM   5636 C CD2 . PHE B 1 189 ? -3.763  -80.479 -41.932 1.00 40.70  ? 190 PHE B CD2 1 
ATOM   5637 C CE1 . PHE B 1 189 ? -5.538  -78.440 -42.568 1.00 41.66  ? 190 PHE B CE1 1 
ATOM   5638 C CE2 . PHE B 1 189 ? -3.395  -79.514 -42.843 1.00 43.27  ? 190 PHE B CE2 1 
ATOM   5639 C CZ  . PHE B 1 189 ? -4.289  -78.489 -43.171 1.00 41.36  ? 190 PHE B CZ  1 
ATOM   5640 N N   . GLY B 1 190 ? -7.996  -83.827 -39.704 1.00 53.88  ? 191 GLY B N   1 
ATOM   5641 C CA  . GLY B 1 190 ? -8.456  -84.776 -38.706 1.00 58.23  ? 191 GLY B CA  1 
ATOM   5642 C C   . GLY B 1 190 ? -8.772  -84.100 -37.389 1.00 62.67  ? 191 GLY B C   1 
ATOM   5643 O O   . GLY B 1 190 ? -8.893  -84.757 -36.351 1.00 62.42  ? 191 GLY B O   1 
ATOM   5644 N N   . GLY B 1 191 ? -8.918  -82.780 -37.435 1.00 57.03  ? 192 GLY B N   1 
ATOM   5645 C CA  . GLY B 1 191 ? -9.168  -82.009 -36.233 1.00 50.09  ? 192 GLY B CA  1 
ATOM   5646 C C   . GLY B 1 191 ? -10.647 -81.771 -36.033 1.00 66.93  ? 192 GLY B C   1 
ATOM   5647 O O   . GLY B 1 191 ? -11.429 -81.790 -36.986 1.00 63.24  ? 192 GLY B O   1 
ATOM   5648 N N   . ASP B 1 192 ? -11.026 -81.541 -34.781 1.00 61.61  ? 193 ASP B N   1 
ATOM   5649 C CA  . ASP B 1 192 ? -12.415 -81.377 -34.415 1.00 54.76  ? 193 ASP B CA  1 
ATOM   5650 C C   . ASP B 1 192 ? -12.773 -79.917 -34.182 1.00 48.30  ? 193 ASP B C   1 
ATOM   5651 O O   . ASP B 1 192 ? -12.524 -79.373 -33.112 1.00 63.45  ? 193 ASP B O   1 
ATOM   5652 C CB  . ASP B 1 192 ? -12.703 -82.199 -33.162 1.00 58.39  ? 193 ASP B CB  1 
ATOM   5653 C CG  . ASP B 1 192 ? -14.174 -82.222 -32.795 1.00 61.10  ? 193 ASP B CG  1 
ATOM   5654 O OD1 . ASP B 1 192 ? -14.966 -81.377 -33.291 1.00 58.52  ? 193 ASP B OD1 1 
ATOM   5655 O OD2 . ASP B 1 192 ? -14.531 -83.105 -31.982 1.00 62.55  ? 193 ASP B OD2 1 
ATOM   5656 N N   . PRO B 1 193 ? -13.414 -79.287 -35.161 1.00 56.46  ? 194 PRO B N   1 
ATOM   5657 C CA  . PRO B 1 193 ? -13.713 -77.860 -35.001 1.00 52.23  ? 194 PRO B CA  1 
ATOM   5658 C C   . PRO B 1 193 ? -14.673 -77.562 -33.845 1.00 59.64  ? 194 PRO B C   1 
ATOM   5659 O O   . PRO B 1 193 ? -14.921 -76.391 -33.566 1.00 58.84  ? 194 PRO B O   1 
ATOM   5660 C CB  . PRO B 1 193 ? -14.346 -77.476 -36.352 1.00 52.76  ? 194 PRO B CB  1 
ATOM   5661 C CG  . PRO B 1 193 ? -14.763 -78.761 -36.978 1.00 45.04  ? 194 PRO B CG  1 
ATOM   5662 C CD  . PRO B 1 193 ? -13.817 -79.808 -36.475 1.00 59.94  ? 194 PRO B CD  1 
ATOM   5663 N N   . THR B 1 194 ? -15.201 -78.598 -33.197 1.00 58.34  ? 195 THR B N   1 
ATOM   5664 C CA  . THR B 1 194 ? -16.133 -78.423 -32.089 1.00 58.68  ? 195 THR B CA  1 
ATOM   5665 C C   . THR B 1 194 ? -15.405 -78.584 -30.750 1.00 58.87  ? 195 THR B C   1 
ATOM   5666 O O   . THR B 1 194 ? -16.005 -78.433 -29.690 1.00 69.56  ? 195 THR B O   1 
ATOM   5667 C CB  . THR B 1 194 ? -17.305 -79.432 -32.144 1.00 51.67  ? 195 THR B CB  1 
ATOM   5668 O OG1 . THR B 1 194 ? -16.817 -80.755 -31.868 1.00 60.24  ? 195 THR B OG1 1 
ATOM   5669 C CG2 . THR B 1 194 ? -17.973 -79.415 -33.507 1.00 59.84  ? 195 THR B CG2 1 
ATOM   5670 N N   . SER B 1 195 ? -14.116 -78.903 -30.811 1.00 59.30  ? 196 SER B N   1 
ATOM   5671 C CA  . SER B 1 195 ? -13.268 -78.939 -29.623 1.00 57.97  ? 196 SER B CA  1 
ATOM   5672 C C   . SER B 1 195 ? -11.949 -78.179 -29.848 1.00 54.78  ? 196 SER B C   1 
ATOM   5673 O O   . SER B 1 195 ? -10.883 -78.770 -30.083 1.00 50.21  ? 196 SER B O   1 
ATOM   5674 C CB  . SER B 1 195 ? -12.982 -80.381 -29.209 1.00 57.19  ? 196 SER B CB  1 
ATOM   5675 O OG  . SER B 1 195 ? -12.247 -80.411 -27.999 1.00 62.06  ? 196 SER B OG  1 
ATOM   5676 N N   . VAL B 1 196 ? -12.038 -76.858 -29.784 1.00 45.72  ? 197 VAL B N   1 
ATOM   5677 C CA  . VAL B 1 196 ? -10.880 -76.008 -29.952 1.00 40.55  ? 197 VAL B CA  1 
ATOM   5678 C C   . VAL B 1 196 ? -10.524 -75.268 -28.652 1.00 50.94  ? 197 VAL B C   1 
ATOM   5679 O O   . VAL B 1 196 ? -11.332 -74.506 -28.092 1.00 41.98  ? 197 VAL B O   1 
ATOM   5680 C CB  . VAL B 1 196 ? -11.118 -74.998 -31.077 1.00 46.69  ? 197 VAL B CB  1 
ATOM   5681 C CG1 . VAL B 1 196 ? -9.972  -74.002 -31.140 1.00 37.00  ? 197 VAL B CG1 1 
ATOM   5682 C CG2 . VAL B 1 196 ? -11.291 -75.737 -32.420 1.00 39.65  ? 197 VAL B CG2 1 
ATOM   5683 N N   . THR B 1 197 ? -9.293  -75.487 -28.204 1.00 43.66  ? 198 THR B N   1 
ATOM   5684 C CA  . THR B 1 197 ? -8.743  -74.831 -27.032 1.00 43.15  ? 198 THR B CA  1 
ATOM   5685 C C   . THR B 1 197 ? -7.654  -73.808 -27.380 1.00 41.58  ? 198 THR B C   1 
ATOM   5686 O O   . THR B 1 197 ? -6.602  -74.175 -27.888 1.00 45.93  ? 198 THR B O   1 
ATOM   5687 C CB  . THR B 1 197 ? -8.161  -75.886 -26.072 1.00 49.04  ? 198 THR B CB  1 
ATOM   5688 O OG1 . THR B 1 197 ? -9.221  -76.723 -25.598 1.00 44.31  ? 198 THR B OG1 1 
ATOM   5689 C CG2 . THR B 1 197 ? -7.453  -75.232 -24.891 1.00 40.65  ? 198 THR B CG2 1 
ATOM   5690 N N   . LEU B 1 198 ? -7.910  -72.531 -27.105 1.00 39.34  ? 199 LEU B N   1 
ATOM   5691 C CA  . LEU B 1 198 ? -6.890  -71.498 -27.233 1.00 41.98  ? 199 LEU B CA  1 
ATOM   5692 C C   . LEU B 1 198 ? -5.908  -71.523 -26.084 1.00 46.20  ? 199 LEU B C   1 
ATOM   5693 O O   . LEU B 1 198 ? -6.292  -71.703 -24.929 1.00 46.49  ? 199 LEU B O   1 
ATOM   5694 C CB  . LEU B 1 198 ? -7.501  -70.106 -27.267 1.00 43.81  ? 199 LEU B CB  1 
ATOM   5695 C CG  . LEU B 1 198 ? -8.481  -69.697 -28.335 1.00 44.75  ? 199 LEU B CG  1 
ATOM   5696 C CD1 . LEU B 1 198 ? -8.618  -68.193 -28.275 1.00 40.96  ? 199 LEU B CD1 1 
ATOM   5697 C CD2 . LEU B 1 198 ? -7.909  -70.134 -29.677 1.00 46.24  ? 199 LEU B CD2 1 
ATOM   5698 N N   . PHE B 1 199 ? -4.637  -71.314 -26.382 1.00 42.14  ? 200 PHE B N   1 
ATOM   5699 C CA  . PHE B 1 199 ? -3.714  -71.049 -25.306 1.00 36.62  ? 200 PHE B CA  1 
ATOM   5700 C C   . PHE B 1 199 ? -2.588  -70.153 -25.768 1.00 41.50  ? 200 PHE B C   1 
ATOM   5701 O O   . PHE B 1 199 ? -2.227  -70.120 -26.944 1.00 40.31  ? 200 PHE B O   1 
ATOM   5702 C CB  . PHE B 1 199 ? -3.194  -72.345 -24.654 1.00 35.81  ? 200 PHE B CB  1 
ATOM   5703 C CG  . PHE B 1 199 ? -2.294  -73.199 -25.498 1.00 46.63  ? 200 PHE B CG  1 
ATOM   5704 C CD1 . PHE B 1 199 ? -2.578  -73.475 -26.824 1.00 42.86  ? 200 PHE B CD1 1 
ATOM   5705 C CD2 . PHE B 1 199 ? -1.163  -73.777 -24.920 1.00 41.94  ? 200 PHE B CD2 1 
ATOM   5706 C CE1 . PHE B 1 199 ? -1.744  -74.304 -27.559 1.00 40.12  ? 200 PHE B CE1 1 
ATOM   5707 C CE2 . PHE B 1 199 ? -0.325  -74.600 -25.651 1.00 43.84  ? 200 PHE B CE2 1 
ATOM   5708 C CZ  . PHE B 1 199 ? -0.617  -74.864 -26.975 1.00 42.48  ? 200 PHE B CZ  1 
ATOM   5709 N N   . GLY B 1 200 ? -2.083  -69.374 -24.822 1.00 38.83  ? 201 GLY B N   1 
ATOM   5710 C CA  . GLY B 1 200 ? -1.086  -68.374 -25.107 1.00 35.56  ? 201 GLY B CA  1 
ATOM   5711 C C   . GLY B 1 200 ? -0.418  -67.912 -23.838 1.00 42.40  ? 201 GLY B C   1 
ATOM   5712 O O   . GLY B 1 200 ? -0.904  -68.150 -22.726 1.00 40.69  ? 201 GLY B O   1 
ATOM   5713 N N   . GLU B 1 201 ? 0.704   -67.232 -23.989 1.00 37.43  ? 202 GLU B N   1 
ATOM   5714 C CA  . GLU B 1 201 ? 1.440   -66.813 -22.822 1.00 36.81  ? 202 GLU B CA  1 
ATOM   5715 C C   . GLU B 1 201 ? 1.652   -65.324 -22.943 1.00 43.47  ? 202 GLU B C   1 
ATOM   5716 O O   . GLU B 1 201 ? 1.803   -64.818 -24.061 1.00 40.55  ? 202 GLU B O   1 
ATOM   5717 C CB  . GLU B 1 201 ? 2.746   -67.603 -22.718 1.00 40.24  ? 202 GLU B CB  1 
ATOM   5718 C CG  . GLU B 1 201 ? 3.604   -67.268 -21.511 1.00 37.40  ? 202 GLU B CG  1 
ATOM   5719 C CD  . GLU B 1 201 ? 4.646   -66.203 -21.822 1.00 54.49  ? 202 GLU B CD  1 
ATOM   5720 O OE1 . GLU B 1 201 ? 4.678   -65.701 -22.974 1.00 51.04  ? 202 GLU B OE1 1 
ATOM   5721 O OE2 . GLU B 1 201 ? 5.440   -65.875 -20.906 1.00 54.37  ? 202 GLU B OE2 1 
ATOM   5722 N N   . SER B 1 202 ? 1.590   -64.616 -21.808 1.00 44.10  ? 203 SER B N   1 
ATOM   5723 C CA  . SER B 1 202 ? 1.815   -63.157 -21.770 1.00 34.93  ? 203 SER B CA  1 
ATOM   5724 C C   . SER B 1 202 ? 0.856   -62.378 -22.718 1.00 45.95  ? 203 SER B C   1 
ATOM   5725 O O   . SER B 1 202 ? -0.364  -62.529 -22.612 1.00 39.31  ? 203 SER B O   1 
ATOM   5726 C CB  . SER B 1 202 ? 3.269   -62.886 -22.102 1.00 47.56  ? 203 SER B CB  1 
ATOM   5727 O OG  . SER B 1 202 ? 3.716   -61.662 -21.598 1.00 46.68  ? 203 SER B OG  1 
ATOM   5728 N N   . ALA B 1 203 ? 1.379   -61.581 -23.662 1.00 40.00  ? 204 ALA B N   1 
ATOM   5729 C CA  . ALA B 1 203 ? 0.498   -60.917 -24.638 1.00 35.00  ? 204 ALA B CA  1 
ATOM   5730 C C   . ALA B 1 203 ? -0.410  -61.920 -25.367 1.00 38.18  ? 204 ALA B C   1 
ATOM   5731 O O   . ALA B 1 203 ? -1.537  -61.581 -25.742 1.00 36.26  ? 204 ALA B O   1 
ATOM   5732 C CB  . ALA B 1 203 ? 1.305   -60.119 -25.645 1.00 39.47  ? 204 ALA B CB  1 
ATOM   5733 N N   . GLY B 1 204 ? 0.064   -63.160 -25.526 1.00 40.51  ? 205 GLY B N   1 
ATOM   5734 C CA  . GLY B 1 204 ? -0.755  -64.223 -26.092 1.00 37.12  ? 205 GLY B CA  1 
ATOM   5735 C C   . GLY B 1 204 ? -1.937  -64.596 -25.204 1.00 43.45  ? 205 GLY B C   1 
ATOM   5736 O O   . GLY B 1 204 ? -3.037  -64.871 -25.693 1.00 39.98  ? 205 GLY B O   1 
ATOM   5737 N N   . ALA B 1 205 ? -1.705  -64.616 -23.893 1.00 36.26  ? 206 ALA B N   1 
ATOM   5738 C CA  . ALA B 1 205 ? -2.747  -64.910 -22.923 1.00 35.19  ? 206 ALA B CA  1 
ATOM   5739 C C   . ALA B 1 205 ? -3.744  -63.774 -22.904 1.00 40.23  ? 206 ALA B C   1 
ATOM   5740 O O   . ALA B 1 205 ? -4.955  -63.995 -22.893 1.00 42.01  ? 206 ALA B O   1 
ATOM   5741 C CB  . ALA B 1 205 ? -2.140  -65.123 -21.517 1.00 35.74  ? 206 ALA B CB  1 
ATOM   5742 N N   . ALA B 1 206 ? -3.223  -62.552 -22.914 1.00 35.75  ? 207 ALA B N   1 
ATOM   5743 C CA  . ALA B 1 206 ? -4.067  -61.367 -23.002 1.00 37.30  ? 207 ALA B CA  1 
ATOM   5744 C C   . ALA B 1 206 ? -4.932  -61.435 -24.262 1.00 46.26  ? 207 ALA B C   1 
ATOM   5745 O O   . ALA B 1 206 ? -6.124  -61.100 -24.206 1.00 44.16  ? 207 ALA B O   1 
ATOM   5746 C CB  . ALA B 1 206 ? -3.207  -60.090 -22.980 1.00 28.96  ? 207 ALA B CB  1 
ATOM   5747 N N   . SER B 1 207 ? -4.349  -61.890 -25.382 1.00 35.25  ? 208 SER B N   1 
ATOM   5748 C CA  . SER B 1 207 ? -5.121  -62.015 -26.623 1.00 41.02  ? 208 SER B CA  1 
ATOM   5749 C C   . SER B 1 207 ? -6.203  -63.058 -26.434 1.00 40.42  ? 208 SER B C   1 
ATOM   5750 O O   . SER B 1 207 ? -7.339  -62.838 -26.856 1.00 40.51  ? 208 SER B O   1 
ATOM   5751 C CB  . SER B 1 207 ? -4.238  -62.386 -27.837 1.00 34.24  ? 208 SER B CB  1 
ATOM   5752 O OG  . SER B 1 207 ? -3.233  -61.404 -28.057 1.00 39.43  ? 208 SER B OG  1 
ATOM   5753 N N   . VAL B 1 208 ? -5.851  -64.188 -25.818 1.00 34.21  ? 209 VAL B N   1 
ATOM   5754 C CA  . VAL B 1 208 ? -6.849  -65.235 -25.575 1.00 36.30  ? 209 VAL B CA  1 
ATOM   5755 C C   . VAL B 1 208 ? -8.033  -64.661 -24.809 1.00 43.69  ? 209 VAL B C   1 
ATOM   5756 O O   . VAL B 1 208 ? -9.191  -64.919 -25.144 1.00 45.27  ? 209 VAL B O   1 
ATOM   5757 C CB  . VAL B 1 208 ? -6.297  -66.420 -24.766 1.00 45.52  ? 209 VAL B CB  1 
ATOM   5758 C CG1 . VAL B 1 208 ? -7.452  -67.356 -24.310 1.00 41.10  ? 209 VAL B CG1 1 
ATOM   5759 C CG2 . VAL B 1 208 ? -5.265  -67.177 -25.541 1.00 40.58  ? 209 VAL B CG2 1 
ATOM   5760 N N   . GLY B 1 209 ? -7.728  -63.866 -23.787 1.00 45.71  ? 210 GLY B N   1 
ATOM   5761 C CA  . GLY B 1 209 ? -8.741  -63.245 -22.956 1.00 43.62  ? 210 GLY B CA  1 
ATOM   5762 C C   . GLY B 1 209 ? -9.606  -62.269 -23.735 1.00 44.01  ? 210 GLY B C   1 
ATOM   5763 O O   . GLY B 1 209 ? -10.821 -62.200 -23.542 1.00 43.99  ? 210 GLY B O   1 
ATOM   5764 N N   . MET B 1 210 ? -8.996  -61.504 -24.628 1.00 46.89  ? 211 MET B N   1 
ATOM   5765 C CA  . MET B 1 210 ? -9.790  -60.604 -25.458 1.00 40.26  ? 211 MET B CA  1 
ATOM   5766 C C   . MET B 1 210 ? -10.714 -61.336 -26.428 1.00 43.52  ? 211 MET B C   1 
ATOM   5767 O O   . MET B 1 210 ? -11.775 -60.824 -26.769 1.00 49.94  ? 211 MET B O   1 
ATOM   5768 C CB  . MET B 1 210 ? -8.883  -59.652 -26.210 1.00 47.58  ? 211 MET B CB  1 
ATOM   5769 C CG  . MET B 1 210 ? -8.366  -58.559 -25.315 1.00 39.64  ? 211 MET B CG  1 
ATOM   5770 S SD  . MET B 1 210 ? -6.988  -57.754 -26.067 1.00 57.97  ? 211 MET B SD  1 
ATOM   5771 C CE  . MET B 1 210 ? -6.189  -57.003 -24.665 1.00 47.86  ? 211 MET B CE  1 
ATOM   5772 N N   . HIS B 1 211 ? -10.340 -62.538 -26.858 1.00 44.57  ? 212 HIS B N   1 
ATOM   5773 C CA  . HIS B 1 211 ? -11.257 -63.296 -27.700 1.00 49.40  ? 212 HIS B CA  1 
ATOM   5774 C C   . HIS B 1 211 ? -12.421 -63.776 -26.844 1.00 51.66  ? 212 HIS B C   1 
ATOM   5775 O O   . HIS B 1 211 ? -13.562 -63.817 -27.307 1.00 52.05  ? 212 HIS B O   1 
ATOM   5776 C CB  . HIS B 1 211 ? -10.560 -64.467 -28.403 1.00 43.54  ? 212 HIS B CB  1 
ATOM   5777 C CG  . HIS B 1 211 ? -9.581  -64.028 -29.442 1.00 48.70  ? 212 HIS B CG  1 
ATOM   5778 N ND1 . HIS B 1 211 ? -9.965  -63.358 -30.588 1.00 49.59  ? 212 HIS B ND1 1 
ATOM   5779 C CD2 . HIS B 1 211 ? -8.231  -64.126 -29.494 1.00 37.75  ? 212 HIS B CD2 1 
ATOM   5780 C CE1 . HIS B 1 211 ? -8.891  -63.066 -31.301 1.00 40.16  ? 212 HIS B CE1 1 
ATOM   5781 N NE2 . HIS B 1 211 ? -7.827  -63.516 -30.655 1.00 43.76  ? 212 HIS B NE2 1 
ATOM   5782 N N   . LEU B 1 212 ? -12.135 -64.114 -25.591 1.00 48.18  ? 213 LEU B N   1 
ATOM   5783 C CA  . LEU B 1 212 ? -13.201 -64.431 -24.642 1.00 53.12  ? 213 LEU B CA  1 
ATOM   5784 C C   . LEU B 1 212 ? -14.241 -63.322 -24.541 1.00 44.77  ? 213 LEU B C   1 
ATOM   5785 O O   . LEU B 1 212 ? -15.427 -63.611 -24.435 1.00 53.33  ? 213 LEU B O   1 
ATOM   5786 C CB  . LEU B 1 212 ? -12.629 -64.708 -23.255 1.00 49.88  ? 213 LEU B CB  1 
ATOM   5787 C CG  . LEU B 1 212 ? -12.070 -66.113 -23.082 1.00 53.75  ? 213 LEU B CG  1 
ATOM   5788 C CD1 . LEU B 1 212 ? -11.556 -66.282 -21.668 1.00 42.47  ? 213 LEU B CD1 1 
ATOM   5789 C CD2 . LEU B 1 212 ? -13.139 -67.163 -23.419 1.00 46.06  ? 213 LEU B CD2 1 
ATOM   5790 N N   . LEU B 1 213 ? -13.798 -62.065 -24.594 1.00 48.21  ? 214 LEU B N   1 
ATOM   5791 C CA  . LEU B 1 213 ? -14.671 -60.915 -24.307 1.00 41.52  ? 214 LEU B CA  1 
ATOM   5792 C C   . LEU B 1 213 ? -15.241 -60.284 -25.580 1.00 50.39  ? 214 LEU B C   1 
ATOM   5793 O O   . LEU B 1 213 ? -16.033 -59.346 -25.529 1.00 52.87  ? 214 LEU B O   1 
ATOM   5794 C CB  . LEU B 1 213 ? -13.904 -59.872 -23.489 1.00 37.22  ? 214 LEU B CB  1 
ATOM   5795 C CG  . LEU B 1 213 ? -13.304 -60.456 -22.193 1.00 39.02  ? 214 LEU B CG  1 
ATOM   5796 C CD1 . LEU B 1 213 ? -12.384 -59.479 -21.491 1.00 39.71  ? 214 LEU B CD1 1 
ATOM   5797 C CD2 . LEU B 1 213 ? -14.407 -60.941 -21.217 1.00 41.89  ? 214 LEU B CD2 1 
ATOM   5798 N N   . SER B 1 214 ? -14.844 -60.814 -26.728 1.00 50.11  ? 215 SER B N   1 
ATOM   5799 C CA  . SER B 1 214 ? -15.330 -60.299 -28.010 1.00 50.37  ? 215 SER B CA  1 
ATOM   5800 C C   . SER B 1 214 ? -16.241 -61.332 -28.647 1.00 53.53  ? 215 SER B C   1 
ATOM   5801 O O   . SER B 1 214 ? -15.779 -62.397 -29.067 1.00 53.53  ? 215 SER B O   1 
ATOM   5802 C CB  . SER B 1 214 ? -14.170 -59.960 -28.945 1.00 55.96  ? 215 SER B CB  1 
ATOM   5803 O OG  . SER B 1 214 ? -14.612 -59.262 -30.099 1.00 59.66  ? 215 SER B OG  1 
ATOM   5804 N N   . PRO B 1 215 ? -17.544 -61.033 -28.698 1.00 62.32  ? 216 PRO B N   1 
ATOM   5805 C CA  . PRO B 1 215 ? -18.539 -61.998 -29.181 1.00 60.43  ? 216 PRO B CA  1 
ATOM   5806 C C   . PRO B 1 215 ? -18.227 -62.636 -30.562 1.00 61.62  ? 216 PRO B C   1 
ATOM   5807 O O   . PRO B 1 215 ? -18.357 -63.855 -30.680 1.00 53.57  ? 216 PRO B O   1 
ATOM   5808 C CB  . PRO B 1 215 ? -19.823 -61.161 -29.215 1.00 53.11  ? 216 PRO B CB  1 
ATOM   5809 C CG  . PRO B 1 215 ? -19.623 -60.166 -28.092 1.00 51.07  ? 216 PRO B CG  1 
ATOM   5810 C CD  . PRO B 1 215 ? -18.166 -59.801 -28.176 1.00 55.95  ? 216 PRO B CD  1 
ATOM   5811 N N   . PRO B 1 216 ? -17.800 -61.857 -31.576 1.00 44.23  ? 217 PRO B N   1 
ATOM   5812 C CA  . PRO B 1 216 ? -17.534 -62.581 -32.839 1.00 54.16  ? 217 PRO B CA  1 
ATOM   5813 C C   . PRO B 1 216 ? -16.370 -63.576 -32.754 1.00 55.06  ? 217 PRO B C   1 
ATOM   5814 O O   . PRO B 1 216 ? -16.360 -64.486 -33.570 1.00 59.25  ? 217 PRO B O   1 
ATOM   5815 C CB  . PRO B 1 216 ? -17.195 -61.470 -33.842 1.00 40.18  ? 217 PRO B CB  1 
ATOM   5816 C CG  . PRO B 1 216 ? -17.645 -60.200 -33.208 1.00 41.46  ? 217 PRO B CG  1 
ATOM   5817 C CD  . PRO B 1 216 ? -17.553 -60.411 -31.710 1.00 48.38  ? 217 PRO B CD  1 
ATOM   5818 N N   . SER B 1 217 ? -15.435 -63.423 -31.810 1.00 51.39  ? 218 SER B N   1 
ATOM   5819 C CA  . SER B 1 217 ? -14.391 -64.442 -31.598 1.00 51.30  ? 218 SER B CA  1 
ATOM   5820 C C   . SER B 1 217 ? -14.897 -65.617 -30.775 1.00 51.66  ? 218 SER B C   1 
ATOM   5821 O O   . SER B 1 217 ? -14.458 -66.759 -30.961 1.00 49.86  ? 218 SER B O   1 
ATOM   5822 C CB  . SER B 1 217 ? -13.149 -63.866 -30.894 1.00 44.85  ? 218 SER B CB  1 
ATOM   5823 O OG  . SER B 1 217 ? -12.576 -62.772 -31.603 1.00 58.76  ? 218 SER B OG  1 
ATOM   5824 N N   . ARG B 1 218 ? -15.820 -65.333 -29.860 1.00 63.26  ? 219 ARG B N   1 
ATOM   5825 C CA  . ARG B 1 218 ? -16.174 -66.289 -28.810 1.00 60.30  ? 219 ARG B CA  1 
ATOM   5826 C C   . ARG B 1 218 ? -16.800 -67.559 -29.397 1.00 53.05  ? 219 ARG B C   1 
ATOM   5827 O O   . ARG B 1 218 ? -16.667 -68.660 -28.838 1.00 59.31  ? 219 ARG B O   1 
ATOM   5828 C CB  . ARG B 1 218 ? -17.106 -65.622 -27.782 1.00 60.18  ? 219 ARG B CB  1 
ATOM   5829 C CG  . ARG B 1 218 ? -17.515 -66.509 -26.637 1.00 53.23  ? 219 ARG B CG  1 
ATOM   5830 C CD  . ARG B 1 218 ? -16.335 -66.975 -25.812 1.00 55.51  ? 219 ARG B CD  1 
ATOM   5831 N NE  . ARG B 1 218 ? -16.768 -67.936 -24.799 1.00 74.54  ? 219 ARG B NE  1 
ATOM   5832 C CZ  . ARG B 1 218 ? -16.711 -69.261 -24.940 1.00 68.07  ? 219 ARG B CZ  1 
ATOM   5833 N NH1 . ARG B 1 218 ? -16.229 -69.794 -26.053 1.00 57.55  ? 219 ARG B NH1 1 
ATOM   5834 N NH2 . ARG B 1 218 ? -17.141 -70.056 -23.966 1.00 63.24  ? 219 ARG B NH2 1 
ATOM   5835 N N   . GLY B 1 219 ? -17.438 -67.418 -30.551 1.00 57.18  ? 220 GLY B N   1 
ATOM   5836 C CA  . GLY B 1 219 ? -17.979 -68.574 -31.255 1.00 50.77  ? 220 GLY B CA  1 
ATOM   5837 C C   . GLY B 1 219 ? -16.957 -69.533 -31.869 1.00 58.71  ? 220 GLY B C   1 
ATOM   5838 O O   . GLY B 1 219 ? -17.308 -70.655 -32.234 1.00 55.60  ? 220 GLY B O   1 
ATOM   5839 N N   . LEU B 1 220 ? -15.693 -69.126 -31.966 1.00 49.26  ? 221 LEU B N   1 
ATOM   5840 C CA  . LEU B 1 220 ? -14.709 -69.931 -32.696 1.00 53.14  ? 221 LEU B CA  1 
ATOM   5841 C C   . LEU B 1 220 ? -13.885 -70.887 -31.832 1.00 57.43  ? 221 LEU B C   1 
ATOM   5842 O O   . LEU B 1 220 ? -12.991 -71.565 -32.332 1.00 52.26  ? 221 LEU B O   1 
ATOM   5843 C CB  . LEU B 1 220 ? -13.756 -69.010 -33.464 1.00 40.17  ? 221 LEU B CB  1 
ATOM   5844 C CG  . LEU B 1 220 ? -14.458 -67.862 -34.181 1.00 48.72  ? 221 LEU B CG  1 
ATOM   5845 C CD1 . LEU B 1 220 ? -13.501 -66.769 -34.602 1.00 47.99  ? 221 LEU B CD1 1 
ATOM   5846 C CD2 . LEU B 1 220 ? -15.157 -68.423 -35.369 1.00 43.54  ? 221 LEU B CD2 1 
ATOM   5847 N N   . PHE B 1 221 ? -14.157 -70.933 -30.533 1.00 52.22  ? 222 PHE B N   1 
ATOM   5848 C CA  . PHE B 1 221 ? -13.416 -71.839 -29.659 1.00 45.95  ? 222 PHE B CA  1 
ATOM   5849 C C   . PHE B 1 221 ? -14.244 -72.145 -28.412 1.00 59.05  ? 222 PHE B C   1 
ATOM   5850 O O   . PHE B 1 221 ? -15.279 -71.514 -28.181 1.00 55.39  ? 222 PHE B O   1 
ATOM   5851 C CB  . PHE B 1 221 ? -12.047 -71.246 -29.285 1.00 50.00  ? 222 PHE B CB  1 
ATOM   5852 C CG  . PHE B 1 221 ? -12.132 -69.990 -28.457 1.00 49.40  ? 222 PHE B CG  1 
ATOM   5853 C CD1 . PHE B 1 221 ? -12.433 -68.771 -29.048 1.00 45.15  ? 222 PHE B CD1 1 
ATOM   5854 C CD2 . PHE B 1 221 ? -11.927 -70.033 -27.090 1.00 49.53  ? 222 PHE B CD2 1 
ATOM   5855 C CE1 . PHE B 1 221 ? -12.520 -67.608 -28.289 1.00 50.33  ? 222 PHE B CE1 1 
ATOM   5856 C CE2 . PHE B 1 221 ? -12.000 -68.874 -26.326 1.00 49.65  ? 222 PHE B CE2 1 
ATOM   5857 C CZ  . PHE B 1 221 ? -12.300 -67.663 -26.928 1.00 49.78  ? 222 PHE B CZ  1 
ATOM   5858 N N   . HIS B 1 222 ? -13.777 -73.101 -27.613 1.00 44.23  ? 223 HIS B N   1 
ATOM   5859 C CA  . HIS B 1 222 ? -14.590 -73.665 -26.546 1.00 58.48  ? 223 HIS B CA  1 
ATOM   5860 C C   . HIS B 1 222 ? -13.958 -73.523 -25.178 1.00 52.73  ? 223 HIS B C   1 
ATOM   5861 O O   . HIS B 1 222 ? -14.650 -73.281 -24.206 1.00 65.36  ? 223 HIS B O   1 
ATOM   5862 C CB  . HIS B 1 222 ? -14.876 -75.134 -26.864 1.00 45.59  ? 223 HIS B CB  1 
ATOM   5863 C CG  . HIS B 1 222 ? -15.475 -75.305 -28.217 1.00 69.89  ? 223 HIS B CG  1 
ATOM   5864 N ND1 . HIS B 1 222 ? -14.710 -75.483 -29.352 1.00 64.14  ? 223 HIS B ND1 1 
ATOM   5865 C CD2 . HIS B 1 222 ? -16.758 -75.200 -28.638 1.00 67.55  ? 223 HIS B CD2 1 
ATOM   5866 C CE1 . HIS B 1 222 ? -15.503 -75.524 -30.406 1.00 65.60  ? 223 HIS B CE1 1 
ATOM   5867 N NE2 . HIS B 1 222 ? -16.750 -75.370 -29.999 1.00 63.12  ? 223 HIS B NE2 1 
ATOM   5868 N N   . ARG B 1 223 ? -12.642 -73.663 -25.124 1.00 53.83  ? 224 ARG B N   1 
ATOM   5869 C CA  . ARG B 1 223 ? -11.896 -73.589 -23.882 1.00 49.11  ? 224 ARG B CA  1 
ATOM   5870 C C   . ARG B 1 223 ? -10.688 -72.694 -24.075 1.00 50.89  ? 224 ARG B C   1 
ATOM   5871 O O   . ARG B 1 223 ? -10.259 -72.429 -25.212 1.00 54.14  ? 224 ARG B O   1 
ATOM   5872 C CB  . ARG B 1 223 ? -11.456 -74.984 -23.418 1.00 44.86  ? 224 ARG B CB  1 
ATOM   5873 C CG  . ARG B 1 223 ? -12.598 -75.882 -23.054 1.00 47.39  ? 224 ARG B CG  1 
ATOM   5874 C CD  . ARG B 1 223 ? -12.123 -77.278 -22.712 1.00 54.20  ? 224 ARG B CD  1 
ATOM   5875 N NE  . ARG B 1 223 ? -12.173 -78.086 -23.909 1.00 75.11  ? 224 ARG B NE  1 
ATOM   5876 C CZ  . ARG B 1 223 ? -13.300 -78.535 -24.443 1.00 67.38  ? 224 ARG B CZ  1 
ATOM   5877 N NH1 . ARG B 1 223 ? -14.460 -78.274 -23.854 1.00 66.61  ? 224 ARG B NH1 1 
ATOM   5878 N NH2 . ARG B 1 223 ? -13.261 -79.247 -25.561 1.00 72.54  ? 224 ARG B NH2 1 
ATOM   5879 N N   . ALA B 1 224 ? -10.122 -72.258 -22.960 1.00 40.58  ? 225 ALA B N   1 
ATOM   5880 C CA  . ALA B 1 224 ? -9.096  -71.229 -22.957 1.00 40.74  ? 225 ALA B CA  1 
ATOM   5881 C C   . ALA B 1 224 ? -8.047  -71.486 -21.884 1.00 40.93  ? 225 ALA B C   1 
ATOM   5882 O O   . ALA B 1 224 ? -8.372  -71.929 -20.783 1.00 47.51  ? 225 ALA B O   1 
ATOM   5883 C CB  . ALA B 1 224 ? -9.738  -69.867 -22.760 1.00 39.23  ? 225 ALA B CB  1 
ATOM   5884 N N   . VAL B 1 225 ? -6.790  -71.219 -22.221 1.00 38.00  ? 226 VAL B N   1 
ATOM   5885 C CA  . VAL B 1 225 ? -5.674  -71.330 -21.281 1.00 34.55  ? 226 VAL B CA  1 
ATOM   5886 C C   . VAL B 1 225 ? -4.927  -70.016 -21.317 1.00 40.25  ? 226 VAL B C   1 
ATOM   5887 O O   . VAL B 1 225 ? -4.513  -69.576 -22.385 1.00 47.09  ? 226 VAL B O   1 
ATOM   5888 C CB  . VAL B 1 225 ? -4.694  -72.482 -21.634 1.00 43.10  ? 226 VAL B CB  1 
ATOM   5889 C CG1 . VAL B 1 225 ? -3.536  -72.560 -20.641 1.00 44.07  ? 226 VAL B CG1 1 
ATOM   5890 C CG2 . VAL B 1 225 ? -5.410  -73.798 -21.733 1.00 39.49  ? 226 VAL B CG2 1 
ATOM   5891 N N   . LEU B 1 226 ? -4.761  -69.383 -20.160 1.00 45.34  ? 227 LEU B N   1 
ATOM   5892 C CA  . LEU B 1 226 ? -4.060  -68.104 -20.077 1.00 38.19  ? 227 LEU B CA  1 
ATOM   5893 C C   . LEU B 1 226 ? -2.847  -68.228 -19.189 1.00 39.37  ? 227 LEU B C   1 
ATOM   5894 O O   . LEU B 1 226 ? -2.973  -68.269 -17.963 1.00 46.19  ? 227 LEU B O   1 
ATOM   5895 C CB  . LEU B 1 226 ? -4.971  -66.998 -19.548 1.00 38.66  ? 227 LEU B CB  1 
ATOM   5896 C CG  . LEU B 1 226 ? -6.160  -66.568 -20.398 1.00 39.04  ? 227 LEU B CG  1 
ATOM   5897 C CD1 . LEU B 1 226 ? -7.347  -67.455 -20.190 1.00 43.57  ? 227 LEU B CD1 1 
ATOM   5898 C CD2 . LEU B 1 226 ? -6.529  -65.148 -20.102 1.00 33.78  ? 227 LEU B CD2 1 
ATOM   5899 N N   . GLN B 1 227 ? -1.676  -68.289 -19.811 1.00 42.44  ? 228 GLN B N   1 
ATOM   5900 C CA  . GLN B 1 227 ? -0.411  -68.412 -19.097 1.00 36.15  ? 228 GLN B CA  1 
ATOM   5901 C C   . GLN B 1 227 ? 0.267   -67.065 -18.867 1.00 44.56  ? 228 GLN B C   1 
ATOM   5902 O O   . GLN B 1 227 ? 0.614   -66.373 -19.824 1.00 43.46  ? 228 GLN B O   1 
ATOM   5903 C CB  . GLN B 1 227 ? 0.518   -69.342 -19.877 1.00 38.52  ? 228 GLN B CB  1 
ATOM   5904 C CG  . GLN B 1 227 ? -0.132  -70.688 -20.188 1.00 35.50  ? 228 GLN B CG  1 
ATOM   5905 C CD  . GLN B 1 227 ? 0.693   -71.557 -21.147 1.00 51.46  ? 228 GLN B CD  1 
ATOM   5906 O OE1 . GLN B 1 227 ? 0.159   -72.463 -21.779 1.00 42.00  ? 228 GLN B OE1 1 
ATOM   5907 N NE2 . GLN B 1 227 ? 1.995   -71.295 -21.236 1.00 47.43  ? 228 GLN B NE2 1 
ATOM   5908 N N   . SER B 1 228 ? 0.442   -66.681 -17.601 1.00 40.01  ? 229 SER B N   1 
ATOM   5909 C CA  . SER B 1 228 ? 1.177   -65.450 -17.261 1.00 34.98  ? 229 SER B CA  1 
ATOM   5910 C C   . SER B 1 228 ? 0.703   -64.215 -18.024 1.00 40.86  ? 229 SER B C   1 
ATOM   5911 O O   . SER B 1 228 ? 1.511   -63.396 -18.470 1.00 43.22  ? 229 SER B O   1 
ATOM   5912 C CB  . SER B 1 228 ? 2.683   -65.639 -17.506 1.00 35.93  ? 229 SER B CB  1 
ATOM   5913 O OG  . SER B 1 228 ? 3.152   -66.778 -16.798 1.00 49.95  ? 229 SER B OG  1 
ATOM   5914 N N   . GLY B 1 229 ? -0.600  -64.073 -18.211 1.00 30.26  ? 230 GLY B N   1 
ATOM   5915 C CA  . GLY B 1 229 ? -1.089  -62.845 -18.810 1.00 30.96  ? 230 GLY B CA  1 
ATOM   5916 C C   . GLY B 1 229 ? -2.596  -62.809 -18.737 1.00 36.73  ? 230 GLY B C   1 
ATOM   5917 O O   . GLY B 1 229 ? -3.229  -63.834 -18.532 1.00 34.88  ? 230 GLY B O   1 
ATOM   5918 N N   . ALA B 1 230 ? -3.153  -61.620 -18.916 1.00 37.43  ? 231 ALA B N   1 
ATOM   5919 C CA  . ALA B 1 230 ? -4.574  -61.391 -18.800 1.00 35.31  ? 231 ALA B CA  1 
ATOM   5920 C C   . ALA B 1 230 ? -4.912  -60.154 -19.617 1.00 41.93  ? 231 ALA B C   1 
ATOM   5921 O O   . ALA B 1 230 ? -4.083  -59.252 -19.752 1.00 40.35  ? 231 ALA B O   1 
ATOM   5922 C CB  . ALA B 1 230 ? -4.977  -61.202 -17.319 1.00 38.91  ? 231 ALA B CB  1 
ATOM   5923 N N   . PRO B 1 231 ? -6.131  -60.093 -20.160 1.00 40.37  ? 232 PRO B N   1 
ATOM   5924 C CA  . PRO B 1 231 ? -6.523  -58.920 -20.945 1.00 41.31  ? 232 PRO B CA  1 
ATOM   5925 C C   . PRO B 1 231 ? -6.714  -57.672 -20.089 1.00 52.54  ? 232 PRO B C   1 
ATOM   5926 O O   . PRO B 1 231 ? -6.612  -56.562 -20.621 1.00 45.00  ? 232 PRO B O   1 
ATOM   5927 C CB  . PRO B 1 231 ? -7.843  -59.358 -21.590 1.00 37.93  ? 232 PRO B CB  1 
ATOM   5928 C CG  . PRO B 1 231 ? -8.384  -60.375 -20.655 1.00 40.80  ? 232 PRO B CG  1 
ATOM   5929 C CD  . PRO B 1 231 ? -7.182  -61.121 -20.140 1.00 41.19  ? 232 PRO B CD  1 
ATOM   5930 N N   . ASN B 1 232 ? -6.961  -57.837 -18.786 1.00 48.23  ? 233 ASN B N   1 
ATOM   5931 C CA  . ASN B 1 232 ? -7.054  -56.683 -17.882 1.00 45.50  ? 233 ASN B CA  1 
ATOM   5932 C C   . ASN B 1 232 ? -5.695  -56.176 -17.355 1.00 47.52  ? 233 ASN B C   1 
ATOM   5933 O O   . ASN B 1 232 ? -5.642  -55.193 -16.630 1.00 48.91  ? 233 ASN B O   1 
ATOM   5934 C CB  . ASN B 1 232 ? -7.966  -57.016 -16.705 1.00 51.52  ? 233 ASN B CB  1 
ATOM   5935 C CG  . ASN B 1 232 ? -7.691  -58.390 -16.136 1.00 46.43  ? 233 ASN B CG  1 
ATOM   5936 O OD1 . ASN B 1 232 ? -7.633  -59.371 -16.874 1.00 46.16  ? 233 ASN B OD1 1 
ATOM   5937 N ND2 . ASN B 1 232 ? -7.496  -58.469 -14.827 1.00 42.62  ? 233 ASN B ND2 1 
ATOM   5938 N N   . GLY B 1 233 ? -4.594  -56.822 -17.726 1.00 50.28  ? 234 GLY B N   1 
ATOM   5939 C CA  . GLY B 1 233 ? -3.275  -56.259 -17.438 1.00 54.24  ? 234 GLY B CA  1 
ATOM   5940 C C   . GLY B 1 233 ? -3.097  -54.794 -17.859 1.00 57.84  ? 234 GLY B C   1 
ATOM   5941 O O   . GLY B 1 233 ? -3.521  -54.422 -18.949 1.00 61.24  ? 234 GLY B O   1 
ATOM   5942 N N   . PRO B 1 234 ? -2.446  -53.959 -17.012 1.00 52.47  ? 235 PRO B N   1 
ATOM   5943 C CA  . PRO B 1 234 ? -2.268  -52.520 -17.267 1.00 45.44  ? 235 PRO B CA  1 
ATOM   5944 C C   . PRO B 1 234 ? -1.492  -52.174 -18.559 1.00 45.65  ? 235 PRO B C   1 
ATOM   5945 O O   . PRO B 1 234 ? -1.539  -51.033 -18.995 1.00 46.18  ? 235 PRO B O   1 
ATOM   5946 C CB  . PRO B 1 234 ? -1.483  -52.042 -16.039 1.00 42.95  ? 235 PRO B CB  1 
ATOM   5947 C CG  . PRO B 1 234 ? -0.745  -53.234 -15.589 1.00 44.30  ? 235 PRO B CG  1 
ATOM   5948 C CD  . PRO B 1 234 ? -1.657  -54.399 -15.845 1.00 41.55  ? 235 PRO B CD  1 
ATOM   5949 N N   . TRP B 1 235 ? -0.800  -53.140 -19.151 1.00 43.23  ? 236 TRP B N   1 
ATOM   5950 C CA  . TRP B 1 235 ? 0.015   -52.907 -20.341 1.00 46.43  ? 236 TRP B CA  1 
ATOM   5951 C C   . TRP B 1 235 ? -0.704  -53.358 -21.603 1.00 44.37  ? 236 TRP B C   1 
ATOM   5952 O O   . TRP B 1 235 ? -0.232  -53.122 -22.715 1.00 50.67  ? 236 TRP B O   1 
ATOM   5953 C CB  . TRP B 1 235 ? 1.339   -53.664 -20.216 1.00 38.83  ? 236 TRP B CB  1 
ATOM   5954 C CG  . TRP B 1 235 ? 1.083   -55.038 -19.765 1.00 46.24  ? 236 TRP B CG  1 
ATOM   5955 C CD1 . TRP B 1 235 ? 1.043   -55.473 -18.476 1.00 49.44  ? 236 TRP B CD1 1 
ATOM   5956 C CD2 . TRP B 1 235 ? 0.762   -56.169 -20.583 1.00 39.55  ? 236 TRP B CD2 1 
ATOM   5957 N NE1 . TRP B 1 235 ? 0.741   -56.810 -18.439 1.00 43.49  ? 236 TRP B NE1 1 
ATOM   5958 C CE2 . TRP B 1 235 ? 0.558   -57.259 -19.721 1.00 42.66  ? 236 TRP B CE2 1 
ATOM   5959 C CE3 . TRP B 1 235 ? 0.635   -56.368 -21.959 1.00 46.49  ? 236 TRP B CE3 1 
ATOM   5960 C CZ2 . TRP B 1 235 ? 0.239   -58.532 -20.187 1.00 42.08  ? 236 TRP B CZ2 1 
ATOM   5961 C CZ3 . TRP B 1 235 ? 0.316   -57.639 -22.420 1.00 39.38  ? 236 TRP B CZ3 1 
ATOM   5962 C CH2 . TRP B 1 235 ? 0.121   -58.701 -21.532 1.00 47.37  ? 236 TRP B CH2 1 
ATOM   5963 N N   . ALA B 1 236 ? -1.847  -54.007 -21.421 1.00 42.24  ? 237 ALA B N   1 
ATOM   5964 C CA  . ALA B 1 236 ? -2.445  -54.820 -22.461 1.00 38.24  ? 237 ALA B CA  1 
ATOM   5965 C C   . ALA B 1 236 ? -3.433  -54.059 -23.350 1.00 52.93  ? 237 ALA B C   1 
ATOM   5966 O O   . ALA B 1 236 ? -3.687  -54.462 -24.493 1.00 50.21  ? 237 ALA B O   1 
ATOM   5967 C CB  . ALA B 1 236 ? -3.120  -56.014 -21.845 1.00 34.54  ? 237 ALA B CB  1 
ATOM   5968 N N   . THR B 1 237 ? -4.006  -52.974 -22.833 1.00 47.61  ? 238 THR B N   1 
ATOM   5969 C CA  . THR B 1 237 ? -4.885  -52.133 -23.640 1.00 42.33  ? 238 THR B CA  1 
ATOM   5970 C C   . THR B 1 237 ? -4.579  -50.676 -23.440 1.00 43.93  ? 238 THR B C   1 
ATOM   5971 O O   . THR B 1 237 ? -3.865  -50.289 -22.517 1.00 46.50  ? 238 THR B O   1 
ATOM   5972 C CB  . THR B 1 237 ? -6.363  -52.333 -23.320 1.00 45.78  ? 238 THR B CB  1 
ATOM   5973 O OG1 . THR B 1 237 ? -6.596  -52.002 -21.950 1.00 59.23  ? 238 THR B OG1 1 
ATOM   5974 C CG2 . THR B 1 237 ? -6.788  -53.749 -23.569 1.00 39.87  ? 238 THR B CG2 1 
ATOM   5975 N N   . VAL B 1 238 ? -5.146  -49.864 -24.318 1.00 49.35  ? 239 VAL B N   1 
ATOM   5976 C CA  . VAL B 1 238 ? -4.921  -48.434 -24.285 1.00 40.99  ? 239 VAL B CA  1 
ATOM   5977 C C   . VAL B 1 238 ? -6.222  -47.757 -24.731 1.00 49.93  ? 239 VAL B C   1 
ATOM   5978 O O   . VAL B 1 238 ? -7.036  -48.381 -25.430 1.00 52.38  ? 239 VAL B O   1 
ATOM   5979 C CB  . VAL B 1 238 ? -3.728  -48.064 -25.168 1.00 52.22  ? 239 VAL B CB  1 
ATOM   5980 C CG1 . VAL B 1 238 ? -4.141  -47.997 -26.647 1.00 40.81  ? 239 VAL B CG1 1 
ATOM   5981 C CG2 . VAL B 1 238 ? -3.111  -46.793 -24.720 1.00 54.83  ? 239 VAL B CG2 1 
ATOM   5982 N N   . GLY B 1 239 ? -6.449  -46.520 -24.277 1.00 42.60  ? 240 GLY B N   1 
ATOM   5983 C CA  . GLY B 1 239 ? -7.653  -45.785 -24.639 1.00 43.79  ? 240 GLY B CA  1 
ATOM   5984 C C   . GLY B 1 239 ? -7.566  -45.155 -26.032 1.00 50.23  ? 240 GLY B C   1 
ATOM   5985 O O   . GLY B 1 239 ? -6.463  -44.987 -26.580 1.00 42.87  ? 240 GLY B O   1 
ATOM   5986 N N   . MET B 1 240 ? -8.720  -44.791 -26.600 1.00 52.42  ? 241 MET B N   1 
ATOM   5987 C CA  . MET B 1 240 ? -8.776  -44.203 -27.948 1.00 49.60  ? 241 MET B CA  1 
ATOM   5988 C C   . MET B 1 240 ? -7.885  -42.995 -28.066 1.00 57.58  ? 241 MET B C   1 
ATOM   5989 O O   . MET B 1 240 ? -7.147  -42.850 -29.048 1.00 48.82  ? 241 MET B O   1 
ATOM   5990 C CB  . MET B 1 240 ? -10.205 -43.825 -28.314 1.00 48.01  ? 241 MET B CB  1 
ATOM   5991 C CG  . MET B 1 240 ? -11.025 -45.028 -28.703 1.00 55.16  ? 241 MET B CG  1 
ATOM   5992 S SD  . MET B 1 240 ? -12.689 -44.631 -29.243 1.00 67.79  ? 241 MET B SD  1 
ATOM   5993 C CE  . MET B 1 240 ? -13.471 -44.404 -27.652 1.00 59.72  ? 241 MET B CE  1 
ATOM   5994 N N   . GLY B 1 241 ? -7.921  -42.151 -27.039 1.00 43.98  ? 242 GLY B N   1 
ATOM   5995 C CA  . GLY B 1 241 ? -7.151  -40.924 -27.052 1.00 40.74  ? 242 GLY B CA  1 
ATOM   5996 C C   . GLY B 1 241 ? -5.667  -41.167 -27.026 1.00 49.17  ? 242 GLY B C   1 
ATOM   5997 O O   . GLY B 1 241 ? -4.919  -40.595 -27.836 1.00 53.22  ? 242 GLY B O   1 
ATOM   5998 N N   . GLU B 1 242 ? -5.236  -42.024 -26.104 1.00 44.13  ? 243 GLU B N   1 
ATOM   5999 C CA  . GLU B 1 242 ? -3.810  -42.308 -25.957 1.00 53.88  ? 243 GLU B CA  1 
ATOM   6000 C C   . GLU B 1 242 ? -3.277  -43.004 -27.220 1.00 51.96  ? 243 GLU B C   1 
ATOM   6001 O O   . GLU B 1 242 ? -2.164  -42.712 -27.674 1.00 51.73  ? 243 GLU B O   1 
ATOM   6002 C CB  . GLU B 1 242 ? -3.547  -43.141 -24.688 1.00 53.26  ? 243 GLU B CB  1 
ATOM   6003 C CG  . GLU B 1 242 ? -2.069  -43.510 -24.397 1.00 43.98  ? 243 GLU B CG  1 
ATOM   6004 C CD  . GLU B 1 242 ? -1.104  -42.324 -24.344 1.00 54.39  ? 243 GLU B CD  1 
ATOM   6005 O OE1 . GLU B 1 242 ? -1.564  -41.162 -24.272 1.00 65.15  ? 243 GLU B OE1 1 
ATOM   6006 O OE2 . GLU B 1 242 ? 0.134   -42.561 -24.379 1.00 49.12  ? 243 GLU B OE2 1 
ATOM   6007 N N   . ALA B 1 243 ? -4.084  -43.901 -27.785 1.00 44.78  ? 244 ALA B N   1 
ATOM   6008 C CA  . ALA B 1 243 ? -3.762  -44.574 -29.055 1.00 50.91  ? 244 ALA B CA  1 
ATOM   6009 C C   . ALA B 1 243 ? -3.488  -43.571 -30.166 1.00 52.20  ? 244 ALA B C   1 
ATOM   6010 O O   . ALA B 1 243 ? -2.517  -43.699 -30.914 1.00 51.97  ? 244 ALA B O   1 
ATOM   6011 C CB  . ALA B 1 243 ? -4.888  -45.500 -29.471 1.00 40.37  ? 244 ALA B CB  1 
ATOM   6012 N N   . ARG B 1 244 ? -4.351  -42.565 -30.255 1.00 54.14  ? 245 ARG B N   1 
ATOM   6013 C CA  . ARG B 1 244 ? -4.214  -41.544 -31.283 1.00 55.31  ? 245 ARG B CA  1 
ATOM   6014 C C   . ARG B 1 244 ? -2.972  -40.712 -31.057 1.00 52.59  ? 245 ARG B C   1 
ATOM   6015 O O   . ARG B 1 244 ? -2.290  -40.326 -32.004 1.00 55.19  ? 245 ARG B O   1 
ATOM   6016 C CB  . ARG B 1 244 ? -5.449  -40.641 -31.326 1.00 43.75  ? 245 ARG B CB  1 
ATOM   6017 C CG  . ARG B 1 244 ? -5.313  -39.479 -32.277 1.00 50.50  ? 245 ARG B CG  1 
ATOM   6018 C CD  . ARG B 1 244 ? -6.665  -38.839 -32.537 1.00 48.37  ? 245 ARG B CD  1 
ATOM   6019 N NE  . ARG B 1 244 ? -7.541  -39.686 -33.338 1.00 51.42  ? 245 ARG B NE  1 
ATOM   6020 C CZ  . ARG B 1 244 ? -7.505  -39.758 -34.673 1.00 54.77  ? 245 ARG B CZ  1 
ATOM   6021 N NH1 . ARG B 1 244 ? -6.625  -39.034 -35.371 1.00 40.50  ? 245 ARG B NH1 1 
ATOM   6022 N NH2 . ARG B 1 244 ? -8.364  -40.552 -35.311 1.00 45.96  ? 245 ARG B NH2 1 
ATOM   6023 N N   . ARG B 1 245 ? -2.673  -40.436 -29.796 1.00 52.71  ? 246 ARG B N   1 
ATOM   6024 C CA  . ARG B 1 245 ? -1.516  -39.617 -29.484 1.00 50.48  ? 246 ARG B CA  1 
ATOM   6025 C C   . ARG B 1 245 ? -0.253  -40.331 -29.907 1.00 50.75  ? 246 ARG B C   1 
ATOM   6026 O O   . ARG B 1 245 ? 0.705   -39.708 -30.366 1.00 52.54  ? 246 ARG B O   1 
ATOM   6027 C CB  . ARG B 1 245 ? -1.449  -39.294 -27.988 1.00 55.06  ? 246 ARG B CB  1 
ATOM   6028 C CG  . ARG B 1 245 ? -0.292  -38.372 -27.647 1.00 56.68  ? 246 ARG B CG  1 
ATOM   6029 C CD  . ARG B 1 245 ? -0.056  -38.288 -26.147 1.00 63.39  ? 246 ARG B CD  1 
ATOM   6030 N NE  . ARG B 1 245 ? 0.536   -39.509 -25.621 1.00 60.09  ? 246 ARG B NE  1 
ATOM   6031 C CZ  . ARG B 1 245 ? 1.797   -39.878 -25.829 1.00 75.62  ? 246 ARG B CZ  1 
ATOM   6032 N NH1 . ARG B 1 245 ? 2.612   -39.118 -26.565 1.00 70.74  ? 246 ARG B NH1 1 
ATOM   6033 N NH2 . ARG B 1 245 ? 2.242   -41.014 -25.298 1.00 71.14  ? 246 ARG B NH2 1 
ATOM   6034 N N   . ARG B 1 246 ? -0.266  -41.650 -29.727 1.00 54.25  ? 247 ARG B N   1 
ATOM   6035 C CA  . ARG B 1 246 ? 0.867   -42.505 -30.052 1.00 45.44  ? 247 ARG B CA  1 
ATOM   6036 C C   . ARG B 1 246 ? 1.024   -42.668 -31.560 1.00 52.66  ? 247 ARG B C   1 
ATOM   6037 O O   . ARG B 1 246 ? 2.126   -42.486 -32.095 1.00 49.29  ? 247 ARG B O   1 
ATOM   6038 C CB  . ARG B 1 246 ? 0.706   -43.861 -29.376 1.00 51.52  ? 247 ARG B CB  1 
ATOM   6039 C CG  . ARG B 1 246 ? 0.990   -43.814 -27.878 1.00 50.45  ? 247 ARG B CG  1 
ATOM   6040 C CD  . ARG B 1 246 ? 0.740   -45.156 -27.225 1.00 53.31  ? 247 ARG B CD  1 
ATOM   6041 N NE  . ARG B 1 246 ? 0.775   -45.055 -25.767 1.00 60.59  ? 247 ARG B NE  1 
ATOM   6042 C CZ  . ARG B 1 246 ? 0.799   -46.100 -24.948 1.00 60.33  ? 247 ARG B CZ  1 
ATOM   6043 N NH1 . ARG B 1 246 ? 0.794   -47.327 -25.446 1.00 49.26  ? 247 ARG B NH1 1 
ATOM   6044 N NH2 . ARG B 1 246 ? 0.834   -45.919 -23.636 1.00 55.88  ? 247 ARG B NH2 1 
ATOM   6045 N N   . ALA B 1 247 ? -0.075  -42.998 -32.239 1.00 48.09  ? 248 ALA B N   1 
ATOM   6046 C CA  . ALA B 1 247 ? -0.090  -43.074 -33.704 1.00 47.55  ? 248 ALA B CA  1 
ATOM   6047 C C   . ALA B 1 247 ? 0.444   -41.766 -34.271 1.00 51.26  ? 248 ALA B C   1 
ATOM   6048 O O   . ALA B 1 247 ? 1.365   -41.747 -35.082 1.00 50.27  ? 248 ALA B O   1 
ATOM   6049 C CB  . ALA B 1 247 ? -1.488  -43.358 -34.215 1.00 38.34  ? 248 ALA B CB  1 
ATOM   6050 N N   . THR B 1 248 ? -0.090  -40.667 -33.763 1.00 58.33  ? 249 THR B N   1 
ATOM   6051 C CA  . THR B 1 248 ? 0.292   -39.365 -34.264 1.00 60.31  ? 249 THR B CA  1 
ATOM   6052 C C   . THR B 1 248 ? 1.757   -39.044 -33.993 1.00 59.77  ? 249 THR B C   1 
ATOM   6053 O O   . THR B 1 248 ? 2.440   -38.520 -34.876 1.00 62.86  ? 249 THR B O   1 
ATOM   6054 C CB  . THR B 1 248 ? -0.611  -38.265 -33.680 1.00 62.16  ? 249 THR B CB  1 
ATOM   6055 O OG1 . THR B 1 248 ? -1.945  -38.472 -34.158 1.00 58.58  ? 249 THR B OG1 1 
ATOM   6056 C CG2 . THR B 1 248 ? -0.141  -36.883 -34.130 1.00 64.47  ? 249 THR B CG2 1 
ATOM   6057 N N   A GLN B 1 249 ? 2.253   -39.364 -32.802 0.42 52.13  ? 250 GLN B N   1 
ATOM   6058 N N   B GLN B 1 249 ? 2.247   -39.362 -32.800 0.58 52.11  ? 250 GLN B N   1 
ATOM   6059 C CA  A GLN B 1 249 ? 3.650   -39.063 -32.505 0.42 57.60  ? 250 GLN B CA  1 
ATOM   6060 C CA  B GLN B 1 249 ? 3.643   -39.069 -32.486 0.58 57.59  ? 250 GLN B CA  1 
ATOM   6061 C C   A GLN B 1 249 ? 4.588   -39.882 -33.393 0.42 60.95  ? 250 GLN B C   1 
ATOM   6062 C C   B GLN B 1 249 ? 4.591   -39.886 -33.375 0.58 61.02  ? 250 GLN B C   1 
ATOM   6063 O O   A GLN B 1 249 ? 5.620   -39.382 -33.841 0.42 59.98  ? 250 GLN B O   1 
ATOM   6064 O O   B GLN B 1 249 ? 5.623   -39.384 -33.818 0.58 60.04  ? 250 GLN B O   1 
ATOM   6065 C CB  A GLN B 1 249 ? 3.983   -39.311 -31.034 0.42 56.43  ? 250 GLN B CB  1 
ATOM   6066 C CB  B GLN B 1 249 ? 3.929   -39.324 -31.004 0.58 56.30  ? 250 GLN B CB  1 
ATOM   6067 C CG  A GLN B 1 249 ? 5.366   -38.775 -30.664 0.42 65.71  ? 250 GLN B CG  1 
ATOM   6068 C CG  B GLN B 1 249 ? 5.399   -39.154 -30.575 0.58 65.64  ? 250 GLN B CG  1 
ATOM   6069 C CD  A GLN B 1 249 ? 5.746   -39.004 -29.217 0.42 61.30  ? 250 GLN B CD  1 
ATOM   6070 C CD  B GLN B 1 249 ? 5.933   -37.715 -30.666 0.58 67.75  ? 250 GLN B CD  1 
ATOM   6071 O OE1 A GLN B 1 249 ? 5.192   -39.871 -28.545 0.42 73.25  ? 250 GLN B OE1 1 
ATOM   6072 O OE1 B GLN B 1 249 ? 5.290   -36.814 -31.221 0.58 63.05  ? 250 GLN B OE1 1 
ATOM   6073 N NE2 A GLN B 1 249 ? 6.700   -38.219 -28.728 0.42 65.54  ? 250 GLN B NE2 1 
ATOM   6074 N NE2 B GLN B 1 249 ? 7.127   -37.505 -30.113 0.58 58.34  ? 250 GLN B NE2 1 
ATOM   6075 N N   . LEU B 1 250 ? 4.230   -41.137 -33.646 1.00 55.18  ? 251 LEU B N   1 
ATOM   6076 C CA  . LEU B 1 250 ? 5.035   -41.977 -34.516 1.00 57.66  ? 251 LEU B CA  1 
ATOM   6077 C C   . LEU B 1 250 ? 5.107   -41.343 -35.898 1.00 55.02  ? 251 LEU B C   1 
ATOM   6078 O O   . LEU B 1 250 ? 6.188   -41.161 -36.432 1.00 57.52  ? 251 LEU B O   1 
ATOM   6079 C CB  . LEU B 1 250 ? 4.473   -43.394 -34.613 1.00 54.33  ? 251 LEU B CB  1 
ATOM   6080 C CG  . LEU B 1 250 ? 5.240   -44.249 -35.629 1.00 55.46  ? 251 LEU B CG  1 
ATOM   6081 C CD1 . LEU B 1 250 ? 6.627   -44.610 -35.125 1.00 48.81  ? 251 LEU B CD1 1 
ATOM   6082 C CD2 . LEU B 1 250 ? 4.465   -45.484 -35.988 1.00 42.90  ? 251 LEU B CD2 1 
ATOM   6083 N N   . ALA B 1 251 ? 3.953   -40.970 -36.440 1.00 48.71  ? 252 ALA B N   1 
ATOM   6084 C CA  . ALA B 1 251 ? 3.880   -40.290 -37.728 1.00 60.40  ? 252 ALA B CA  1 
ATOM   6085 C C   . ALA B 1 251 ? 4.810   -39.081 -37.760 1.00 63.78  ? 252 ALA B C   1 
ATOM   6086 O O   . ALA B 1 251 ? 5.663   -38.962 -38.642 1.00 58.74  ? 252 ALA B O   1 
ATOM   6087 C CB  . ALA B 1 251 ? 2.445   -39.875 -38.027 1.00 49.43  ? 252 ALA B CB  1 
ATOM   6088 N N   . HIS B 1 252 ? 4.650   -38.200 -36.779 1.00 61.53  ? 253 HIS B N   1 
ATOM   6089 C CA  . HIS B 1 252 ? 5.492   -37.025 -36.644 1.00 52.79  ? 253 HIS B CA  1 
ATOM   6090 C C   . HIS B 1 252 ? 6.975   -37.375 -36.694 1.00 59.13  ? 253 HIS B C   1 
ATOM   6091 O O   . HIS B 1 252 ? 7.743   -36.740 -37.418 1.00 65.44  ? 253 HIS B O   1 
ATOM   6092 C CB  . HIS B 1 252 ? 5.175   -36.290 -35.335 1.00 64.83  ? 253 HIS B CB  1 
ATOM   6093 C CG  . HIS B 1 252 ? 6.046   -35.098 -35.092 1.00 70.70  ? 253 HIS B CG  1 
ATOM   6094 N ND1 . HIS B 1 252 ? 5.901   -33.915 -35.790 1.00 74.52  ? 253 HIS B ND1 1 
ATOM   6095 C CD2 . HIS B 1 252 ? 7.094   -34.915 -34.252 1.00 72.20  ? 253 HIS B CD2 1 
ATOM   6096 C CE1 . HIS B 1 252 ? 6.816   -33.053 -35.383 1.00 77.48  ? 253 HIS B CE1 1 
ATOM   6097 N NE2 . HIS B 1 252 ? 7.554   -33.634 -34.452 1.00 80.32  ? 253 HIS B NE2 1 
ATOM   6098 N N   . LEU B 1 253 ? 7.374   -38.388 -35.931 1.00 58.51  ? 254 LEU B N   1 
ATOM   6099 C CA  . LEU B 1 253 ? 8.781   -38.772 -35.851 1.00 56.68  ? 254 LEU B CA  1 
ATOM   6100 C C   . LEU B 1 253 ? 9.352   -39.292 -37.173 1.00 64.06  ? 254 LEU B C   1 
ATOM   6101 O O   . LEU B 1 253 ? 10.562  -39.244 -37.379 1.00 63.44  ? 254 LEU B O   1 
ATOM   6102 C CB  . LEU B 1 253 ? 8.985   -39.829 -34.769 1.00 55.01  ? 254 LEU B CB  1 
ATOM   6103 C CG  . LEU B 1 253 ? 8.945   -39.316 -33.325 1.00 67.13  ? 254 LEU B CG  1 
ATOM   6104 C CD1 . LEU B 1 253 ? 8.708   -40.458 -32.389 1.00 62.75  ? 254 LEU B CD1 1 
ATOM   6105 C CD2 . LEU B 1 253 ? 10.238  -38.639 -32.950 1.00 64.80  ? 254 LEU B CD2 1 
ATOM   6106 N N   . VAL B 1 254 ? 8.508   -39.799 -38.064 1.00 48.75  ? 255 VAL B N   1 
ATOM   6107 C CA  . VAL B 1 254 ? 9.022   -40.271 -39.344 1.00 60.32  ? 255 VAL B CA  1 
ATOM   6108 C C   . VAL B 1 254 ? 8.663   -39.278 -40.443 1.00 70.31  ? 255 VAL B C   1 
ATOM   6109 O O   . VAL B 1 254 ? 8.542   -39.634 -41.618 1.00 68.92  ? 255 VAL B O   1 
ATOM   6110 C CB  . VAL B 1 254 ? 8.499   -41.685 -39.693 1.00 56.77  ? 255 VAL B CB  1 
ATOM   6111 C CG1 . VAL B 1 254 ? 8.864   -42.650 -38.586 1.00 54.00  ? 255 VAL B CG1 1 
ATOM   6112 C CG2 . VAL B 1 254 ? 6.997   -41.686 -39.929 1.00 56.15  ? 255 VAL B CG2 1 
ATOM   6113 N N   . GLY B 1 255 ? 8.490   -38.025 -40.035 1.00 63.22  ? 256 GLY B N   1 
ATOM   6114 C CA  . GLY B 1 255 ? 8.210   -36.939 -40.955 1.00 65.49  ? 256 GLY B CA  1 
ATOM   6115 C C   . GLY B 1 255 ? 6.830   -36.935 -41.579 1.00 63.13  ? 256 GLY B C   1 
ATOM   6116 O O   . GLY B 1 255 ? 6.644   -36.409 -42.670 1.00 70.09  ? 256 GLY B O   1 
ATOM   6117 N N   . CYS B 1 256 ? 5.842   -37.499 -40.901 1.00 69.77  ? 257 CYS B N   1 
ATOM   6118 C CA  . CYS B 1 256 ? 4.549   -37.614 -41.554 1.00 69.79  ? 257 CYS B CA  1 
ATOM   6119 C C   . CYS B 1 256 ? 3.608   -36.496 -41.162 1.00 86.84  ? 257 CYS B C   1 
ATOM   6120 O O   . CYS B 1 256 ? 3.668   -35.991 -40.041 1.00 82.78  ? 257 CYS B O   1 
ATOM   6121 C CB  . CYS B 1 256 ? 3.951   -38.980 -41.298 1.00 69.51  ? 257 CYS B CB  1 
ATOM   6122 S SG  . CYS B 1 256 ? 4.522   -40.056 -42.604 1.00 76.75  ? 257 CYS B SG  1 
ATOM   6123 N N   . PRO B 1 257 ? 2.662   -36.183 -42.068 1.00 113.00 ? 258 PRO B N   1 
ATOM   6124 C CA  . PRO B 1 257 ? 2.454   -34.817 -42.538 1.00 92.66  ? 258 PRO B CA  1 
ATOM   6125 C C   . PRO B 1 257 ? 3.717   -33.978 -42.429 1.00 87.38  ? 258 PRO B C   1 
ATOM   6126 O O   . PRO B 1 257 ? 4.113   -33.592 -41.326 1.00 89.62  ? 258 PRO B O   1 
ATOM   6127 C CB  . PRO B 1 257 ? 1.331   -34.335 -41.632 1.00 86.84  ? 258 PRO B CB  1 
ATOM   6128 C CG  . PRO B 1 257 ? 0.420   -35.570 -41.615 1.00 99.57  ? 258 PRO B CG  1 
ATOM   6129 C CD  . PRO B 1 257 ? 1.345   -36.805 -41.859 1.00 107.64 ? 258 PRO B CD  1 
ATOM   6130 N N   . PRO B 1 258 ? 4.370   -33.731 -43.579 1.00 99.09  ? 259 PRO B N   1 
ATOM   6131 C CA  . PRO B 1 258 ? 5.513   -32.814 -43.680 1.00 88.07  ? 259 PRO B CA  1 
ATOM   6132 C C   . PRO B 1 258 ? 5.062   -31.354 -43.730 1.00 86.49  ? 259 PRO B C   1 
ATOM   6133 O O   . PRO B 1 258 ? 5.180   -30.660 -42.718 1.00 83.01  ? 259 PRO B O   1 
ATOM   6134 C CB  . PRO B 1 258 ? 6.185   -33.230 -44.993 1.00 90.40  ? 259 PRO B CB  1 
ATOM   6135 C CG  . PRO B 1 258 ? 5.064   -33.776 -45.826 1.00 81.62  ? 259 PRO B CG  1 
ATOM   6136 C CD  . PRO B 1 258 ? 4.100   -34.429 -44.852 1.00 85.84  ? 259 PRO B CD  1 
ATOM   6137 N N   . THR B 1 261 ? 2.064   -32.280 -37.986 1.00 89.26  ? 262 THR B N   1 
ATOM   6138 C CA  . THR B 1 261 ? 1.496   -33.163 -36.961 1.00 94.43  ? 262 THR B CA  1 
ATOM   6139 C C   . THR B 1 261 ? -0.013  -33.294 -37.142 1.00 75.17  ? 262 THR B C   1 
ATOM   6140 O O   . THR B 1 261 ? -0.717  -32.299 -37.301 1.00 90.84  ? 262 THR B O   1 
ATOM   6141 C CB  . THR B 1 261 ? 1.787   -32.662 -35.504 1.00 84.49  ? 262 THR B CB  1 
ATOM   6142 O OG1 . THR B 1 261 ? 3.132   -32.176 -35.406 1.00 96.75  ? 262 THR B OG1 1 
ATOM   6143 C CG2 . THR B 1 261 ? 1.591   -33.786 -34.478 1.00 73.20  ? 262 THR B CG2 1 
ATOM   6144 N N   . GLY B 1 262 ? -0.504  -34.526 -37.123 1.00 78.32  ? 263 GLY B N   1 
ATOM   6145 C CA  . GLY B 1 262 ? -1.930  -34.778 -37.189 1.00 73.65  ? 263 GLY B CA  1 
ATOM   6146 C C   . GLY B 1 262 ? -2.542  -34.466 -38.540 1.00 73.98  ? 263 GLY B C   1 
ATOM   6147 O O   . GLY B 1 262 ? -1.983  -34.807 -39.581 1.00 87.32  ? 263 GLY B O   1 
ATOM   6148 N N   . GLY B 1 263 ? -3.702  -33.814 -38.516 1.00 79.77  ? 264 GLY B N   1 
ATOM   6149 C CA  . GLY B 1 263 ? -4.443  -33.497 -39.724 1.00 74.17  ? 264 GLY B CA  1 
ATOM   6150 C C   . GLY B 1 263 ? -5.409  -34.595 -40.138 1.00 72.62  ? 264 GLY B C   1 
ATOM   6151 O O   . GLY B 1 263 ? -5.767  -35.454 -39.333 1.00 76.39  ? 264 GLY B O   1 
ATOM   6152 N N   . ASN B 1 264 ? -5.833  -34.547 -41.400 1.00 81.51  ? 265 ASN B N   1 
ATOM   6153 C CA  . ASN B 1 264 ? -6.670  -35.573 -42.026 1.00 73.67  ? 265 ASN B CA  1 
ATOM   6154 C C   . ASN B 1 264 ? -6.054  -36.945 -41.800 1.00 60.04  ? 265 ASN B C   1 
ATOM   6155 O O   . ASN B 1 264 ? -4.857  -37.128 -42.041 1.00 56.68  ? 265 ASN B O   1 
ATOM   6156 C CB  . ASN B 1 264 ? -6.813  -35.242 -43.527 1.00 70.98  ? 265 ASN B CB  1 
ATOM   6157 C CG  . ASN B 1 264 ? -7.649  -36.252 -44.323 1.00 67.62  ? 265 ASN B CG  1 
ATOM   6158 O OD1 . ASN B 1 264 ? -7.748  -37.432 -43.999 1.00 76.30  ? 265 ASN B OD1 1 
ATOM   6159 N ND2 . ASN B 1 264 ? -8.247  -35.764 -45.399 1.00 89.88  ? 265 ASN B ND2 1 
ATOM   6160 N N   . ASP B 1 265 ? -6.851  -37.903 -41.330 1.00 52.09  ? 266 ASP B N   1 
ATOM   6161 C CA  . ASP B 1 265 ? -6.302  -39.230 -41.049 1.00 57.70  ? 266 ASP B CA  1 
ATOM   6162 C C   . ASP B 1 265 ? -5.846  -39.941 -42.343 1.00 62.93  ? 266 ASP B C   1 
ATOM   6163 O O   . ASP B 1 265 ? -4.800  -40.602 -42.375 1.00 58.55  ? 266 ASP B O   1 
ATOM   6164 C CB  . ASP B 1 265 ? -7.323  -40.092 -40.285 1.00 49.84  ? 266 ASP B CB  1 
ATOM   6165 C CG  . ASP B 1 265 ? -7.320  -39.818 -38.771 1.00 69.39  ? 266 ASP B CG  1 
ATOM   6166 O OD1 . ASP B 1 265 ? -6.291  -39.323 -38.245 1.00 58.14  ? 266 ASP B OD1 1 
ATOM   6167 O OD2 . ASP B 1 265 ? -8.345  -40.105 -38.102 1.00 52.63  ? 266 ASP B OD2 1 
ATOM   6168 N N   . THR B 1 266 ? -6.624  -39.788 -43.410 1.00 69.10  ? 267 THR B N   1 
ATOM   6169 C CA  . THR B 1 266 ? -6.334  -40.465 -44.668 1.00 54.73  ? 267 THR B CA  1 
ATOM   6170 C C   . THR B 1 266 ? -4.982  -40.024 -45.213 1.00 60.58  ? 267 THR B C   1 
ATOM   6171 O O   . THR B 1 266 ? -4.179  -40.850 -45.645 1.00 61.63  ? 267 THR B O   1 
ATOM   6172 C CB  . THR B 1 266 ? -7.436  -40.216 -45.704 1.00 57.26  ? 267 THR B CB  1 
ATOM   6173 O OG1 . THR B 1 266 ? -8.661  -40.812 -45.251 1.00 55.42  ? 267 THR B OG1 1 
ATOM   6174 C CG2 . THR B 1 266 ? -7.060  -40.846 -47.037 1.00 56.98  ? 267 THR B CG2 1 
ATOM   6175 N N   . GLU B 1 267 ? -4.704  -38.730 -45.158 1.00 53.56  ? 268 GLU B N   1 
ATOM   6176 C CA  . GLU B 1 267 ? -3.400  -38.261 -45.590 1.00 58.82  ? 268 GLU B CA  1 
ATOM   6177 C C   . GLU B 1 267 ? -2.299  -38.808 -44.705 1.00 57.18  ? 268 GLU B C   1 
ATOM   6178 O O   . GLU B 1 267 ? -1.245  -39.202 -45.194 1.00 60.68  ? 268 GLU B O   1 
ATOM   6179 C CB  . GLU B 1 267 ? -3.341  -36.736 -45.602 1.00 63.76  ? 268 GLU B CB  1 
ATOM   6180 C CG  . GLU B 1 267 ? -4.146  -36.099 -46.728 1.00 95.20  ? 268 GLU B CG  1 
ATOM   6181 C CD  . GLU B 1 267 ? -4.219  -34.581 -46.613 1.00 114.42 ? 268 GLU B CD  1 
ATOM   6182 O OE1 . GLU B 1 267 ? -3.681  -34.029 -45.621 1.00 112.59 ? 268 GLU B OE1 1 
ATOM   6183 O OE2 . GLU B 1 267 ? -4.816  -33.944 -47.513 1.00 110.88 ? 268 GLU B OE2 1 
ATOM   6184 N N   . LEU B 1 268 ? -2.539  -38.826 -43.395 1.00 65.31  ? 269 LEU B N   1 
ATOM   6185 C CA  . LEU B 1 268 ? -1.489  -39.182 -42.453 1.00 53.20  ? 269 LEU B CA  1 
ATOM   6186 C C   . LEU B 1 268 ? -1.110  -40.642 -42.640 1.00 51.55  ? 269 LEU B C   1 
ATOM   6187 O O   . LEU B 1 268 ? 0.071   -40.991 -42.662 1.00 52.58  ? 269 LEU B O   1 
ATOM   6188 C CB  . LEU B 1 268 ? -1.930  -38.909 -41.014 1.00 60.56  ? 269 LEU B CB  1 
ATOM   6189 C CG  . LEU B 1 268 ? -0.811  -39.044 -39.982 1.00 53.51  ? 269 LEU B CG  1 
ATOM   6190 C CD1 . LEU B 1 268 ? -0.973  -38.037 -38.880 1.00 67.02  ? 269 LEU B CD1 1 
ATOM   6191 C CD2 . LEU B 1 268 ? -0.860  -40.429 -39.410 1.00 63.60  ? 269 LEU B CD2 1 
ATOM   6192 N N   . VAL B 1 269 ? -2.119  -41.488 -42.792 1.00 44.96  ? 270 VAL B N   1 
ATOM   6193 C CA  . VAL B 1 269 ? -1.873  -42.911 -42.931 1.00 58.46  ? 270 VAL B CA  1 
ATOM   6194 C C   . VAL B 1 269 ? -1.184  -43.213 -44.271 1.00 56.47  ? 270 VAL B C   1 
ATOM   6195 O O   . VAL B 1 269 ? -0.249  -44.012 -44.319 1.00 59.40  ? 270 VAL B O   1 
ATOM   6196 C CB  . VAL B 1 269 ? -3.177  -43.700 -42.786 1.00 57.68  ? 270 VAL B CB  1 
ATOM   6197 C CG1 . VAL B 1 269 ? -2.967  -45.154 -43.120 1.00 55.00  ? 270 VAL B CG1 1 
ATOM   6198 C CG2 . VAL B 1 269 ? -3.684  -43.570 -41.352 1.00 51.07  ? 270 VAL B CG2 1 
ATOM   6199 N N   . ALA B 1 270 ? -1.610  -42.547 -45.340 1.00 56.22  ? 271 ALA B N   1 
ATOM   6200 C CA  . ALA B 1 270 ? -0.971  -42.726 -46.651 1.00 55.53  ? 271 ALA B CA  1 
ATOM   6201 C C   . ALA B 1 270 ? 0.496   -42.343 -46.578 1.00 48.40  ? 271 ALA B C   1 
ATOM   6202 O O   . ALA B 1 270 ? 1.347   -43.041 -47.114 1.00 60.97  ? 271 ALA B O   1 
ATOM   6203 C CB  . ALA B 1 270 ? -1.673  -41.915 -47.706 1.00 52.05  ? 271 ALA B CB  1 
ATOM   6204 N N   . CYS B 1 271 ? 0.804   -41.265 -45.869 1.00 52.20  ? 272 CYS B N   1 
ATOM   6205 C CA  . CYS B 1 271 ? 2.197   -40.913 -45.660 1.00 48.87  ? 272 CYS B CA  1 
ATOM   6206 C C   . CYS B 1 271 ? 2.913   -42.020 -44.849 1.00 65.04  ? 272 CYS B C   1 
ATOM   6207 O O   . CYS B 1 271 ? 4.066   -42.357 -45.143 1.00 60.29  ? 272 CYS B O   1 
ATOM   6208 C CB  . CYS B 1 271 ? 2.298   -39.541 -44.981 1.00 51.99  ? 272 CYS B CB  1 
ATOM   6209 S SG  . CYS B 1 271 ? 3.933   -39.094 -44.327 1.00 93.19  ? 272 CYS B SG  1 
ATOM   6210 N N   . LEU B 1 272 ? 2.242   -42.607 -43.854 1.00 55.44  ? 273 LEU B N   1 
ATOM   6211 C CA  . LEU B 1 272 ? 2.861   -43.704 -43.093 1.00 58.67  ? 273 LEU B CA  1 
ATOM   6212 C C   . LEU B 1 272 ? 3.111   -44.933 -43.985 1.00 58.96  ? 273 LEU B C   1 
ATOM   6213 O O   . LEU B 1 272 ? 4.089   -45.654 -43.805 1.00 50.27  ? 273 LEU B O   1 
ATOM   6214 C CB  . LEU B 1 272 ? 2.005   -44.122 -41.886 1.00 43.66  ? 273 LEU B CB  1 
ATOM   6215 C CG  . LEU B 1 272 ? 2.141   -43.344 -40.575 1.00 56.80  ? 273 LEU B CG  1 
ATOM   6216 C CD1 . LEU B 1 272 ? 1.119   -43.848 -39.576 1.00 48.04  ? 273 LEU B CD1 1 
ATOM   6217 C CD2 . LEU B 1 272 ? 3.531   -43.442 -39.980 1.00 43.45  ? 273 LEU B CD2 1 
ATOM   6218 N N   . ARG B 1 273 ? 2.223   -45.180 -44.939 1.00 53.76  ? 274 ARG B N   1 
ATOM   6219 C CA  . ARG B 1 273 ? 2.366   -46.353 -45.797 1.00 56.22  ? 274 ARG B CA  1 
ATOM   6220 C C   . ARG B 1 273 ? 3.551   -46.251 -46.747 1.00 57.08  ? 274 ARG B C   1 
ATOM   6221 O O   . ARG B 1 273 ? 3.960   -47.258 -47.314 1.00 53.55  ? 274 ARG B O   1 
ATOM   6222 C CB  . ARG B 1 273 ? 1.072   -46.603 -46.583 1.00 40.77  ? 274 ARG B CB  1 
ATOM   6223 C CG  . ARG B 1 273 ? -0.005  -47.128 -45.650 1.00 50.38  ? 274 ARG B CG  1 
ATOM   6224 C CD  . ARG B 1 273 ? -1.093  -47.873 -46.347 1.00 47.63  ? 274 ARG B CD  1 
ATOM   6225 N NE  . ARG B 1 273 ? -2.245  -47.017 -46.555 1.00 66.13  ? 274 ARG B NE  1 
ATOM   6226 C CZ  . ARG B 1 273 ? -3.428  -47.185 -45.976 1.00 69.13  ? 274 ARG B CZ  1 
ATOM   6227 N NH1 . ARG B 1 273 ? -3.641  -48.200 -45.144 1.00 53.40  ? 274 ARG B NH1 1 
ATOM   6228 N NH2 . ARG B 1 273 ? -4.409  -46.334 -46.251 1.00 70.70  ? 274 ARG B NH2 1 
ATOM   6229 N N   . THR B 1 274 ? 4.127   -45.059 -46.894 1.00 49.14  ? 275 THR B N   1 
ATOM   6230 C CA  . THR B 1 274 ? 5.235   -44.887 -47.833 1.00 58.33  ? 275 THR B CA  1 
ATOM   6231 C C   . THR B 1 274 ? 6.552   -45.058 -47.144 1.00 62.01  ? 275 THR B C   1 
ATOM   6232 O O   . THR B 1 274 ? 7.590   -45.029 -47.795 1.00 60.56  ? 275 THR B O   1 
ATOM   6233 C CB  . THR B 1 274 ? 5.263   -43.497 -48.525 1.00 57.07  ? 275 THR B CB  1 
ATOM   6234 O OG1 . THR B 1 274 ? 5.781   -42.501 -47.624 1.00 54.49  ? 275 THR B OG1 1 
ATOM   6235 C CG2 . THR B 1 274 ? 3.875   -43.106 -49.054 1.00 45.92  ? 275 THR B CG2 1 
ATOM   6236 N N   . ARG B 1 275 ? 6.513   -45.204 -45.825 1.00 55.06  ? 276 ARG B N   1 
ATOM   6237 C CA  . ARG B 1 275 ? 7.738   -45.428 -45.054 1.00 64.38  ? 276 ARG B CA  1 
ATOM   6238 C C   . ARG B 1 275 ? 8.142   -46.908 -45.083 1.00 54.94  ? 276 ARG B C   1 
ATOM   6239 O O   . ARG B 1 275 ? 7.284   -47.788 -45.023 1.00 58.07  ? 276 ARG B O   1 
ATOM   6240 C CB  . ARG B 1 275 ? 7.547   -44.948 -43.612 1.00 57.33  ? 276 ARG B CB  1 
ATOM   6241 C CG  . ARG B 1 275 ? 7.280   -43.456 -43.501 1.00 62.45  ? 276 ARG B CG  1 
ATOM   6242 C CD  . ARG B 1 275 ? 8.497   -42.657 -43.949 1.00 62.07  ? 276 ARG B CD  1 
ATOM   6243 N NE  . ARG B 1 275 ? 8.317   -41.223 -43.752 1.00 72.43  ? 276 ARG B NE  1 
ATOM   6244 C CZ  . ARG B 1 275 ? 7.781   -40.402 -44.654 1.00 75.70  ? 276 ARG B CZ  1 
ATOM   6245 N NH1 . ARG B 1 275 ? 7.367   -40.866 -45.830 1.00 68.52  ? 276 ARG B NH1 1 
ATOM   6246 N NH2 . ARG B 1 275 ? 7.658   -39.110 -44.378 1.00 71.00  ? 276 ARG B NH2 1 
ATOM   6247 N N   . PRO B 1 276 ? 9.447   -47.193 -45.199 1.00 56.88  ? 277 PRO B N   1 
ATOM   6248 C CA  . PRO B 1 276 ? 9.866   -48.598 -45.112 1.00 53.80  ? 277 PRO B CA  1 
ATOM   6249 C C   . PRO B 1 276 ? 9.578   -49.179 -43.724 1.00 54.74  ? 277 PRO B C   1 
ATOM   6250 O O   . PRO B 1 276 ? 9.783   -48.488 -42.727 1.00 47.86  ? 277 PRO B O   1 
ATOM   6251 C CB  . PRO B 1 276 ? 11.376  -48.540 -45.378 1.00 54.40  ? 277 PRO B CB  1 
ATOM   6252 C CG  . PRO B 1 276 ? 11.598  -47.242 -46.099 1.00 54.01  ? 277 PRO B CG  1 
ATOM   6253 C CD  . PRO B 1 276 ? 10.571  -46.298 -45.519 1.00 58.12  ? 277 PRO B CD  1 
ATOM   6254 N N   . ALA B 1 277 ? 9.117   -50.426 -43.672 1.00 49.58  ? 278 ALA B N   1 
ATOM   6255 C CA  . ALA B 1 277 ? 8.771   -51.079 -42.421 1.00 43.72  ? 278 ALA B CA  1 
ATOM   6256 C C   . ALA B 1 277 ? 9.827   -50.843 -41.362 1.00 51.79  ? 278 ALA B C   1 
ATOM   6257 O O   . ALA B 1 277 ? 9.512   -50.434 -40.244 1.00 55.46  ? 278 ALA B O   1 
ATOM   6258 C CB  . ALA B 1 277 ? 8.573   -52.558 -42.640 1.00 43.69  ? 278 ALA B CB  1 
ATOM   6259 N N   . GLN B 1 278 ? 11.086  -51.056 -41.728 1.00 52.99  ? 279 GLN B N   1 
ATOM   6260 C CA  . GLN B 1 278 ? 12.172  -50.958 -40.759 1.00 55.62  ? 279 GLN B CA  1 
ATOM   6261 C C   . GLN B 1 278 ? 12.277  -49.567 -40.119 1.00 54.75  ? 279 GLN B C   1 
ATOM   6262 O O   . GLN B 1 278 ? 12.791  -49.423 -39.008 1.00 58.22  ? 279 GLN B O   1 
ATOM   6263 C CB  . GLN B 1 278 ? 13.503  -51.329 -41.419 1.00 42.44  ? 279 GLN B CB  1 
ATOM   6264 C CG  . GLN B 1 278 ? 14.625  -51.556 -40.411 1.00 46.92  ? 279 GLN B CG  1 
ATOM   6265 C CD  . GLN B 1 278 ? 14.311  -52.691 -39.444 1.00 60.59  ? 279 GLN B CD  1 
ATOM   6266 O OE1 . GLN B 1 278 ? 14.040  -53.816 -39.862 1.00 63.60  ? 279 GLN B OE1 1 
ATOM   6267 N NE2 . GLN B 1 278 ? 14.338  -52.393 -38.138 1.00 47.01  ? 279 GLN B NE2 1 
ATOM   6268 N N   . VAL B 1 279 ? 11.786  -48.549 -40.820 1.00 54.92  ? 280 VAL B N   1 
ATOM   6269 C CA  . VAL B 1 279 ? 11.839  -47.182 -40.312 1.00 61.30  ? 280 VAL B CA  1 
ATOM   6270 C C   . VAL B 1 279 ? 10.813  -46.980 -39.186 1.00 51.17  ? 280 VAL B C   1 
ATOM   6271 O O   . VAL B 1 279 ? 11.117  -46.346 -38.180 1.00 55.22  ? 280 VAL B O   1 
ATOM   6272 C CB  . VAL B 1 279 ? 11.625  -46.150 -41.458 1.00 60.14  ? 280 VAL B CB  1 
ATOM   6273 C CG1 . VAL B 1 279 ? 11.417  -44.744 -40.913 1.00 55.29  ? 280 VAL B CG1 1 
ATOM   6274 C CG2 . VAL B 1 279 ? 12.822  -46.164 -42.396 1.00 53.14  ? 280 VAL B CG2 1 
ATOM   6275 N N   . LEU B 1 280 ? 9.610   -47.526 -39.351 1.00 51.83  ? 281 LEU B N   1 
ATOM   6276 C CA  . LEU B 1 280 ? 8.607   -47.459 -38.298 1.00 46.58  ? 281 LEU B CA  1 
ATOM   6277 C C   . LEU B 1 280 ? 9.128   -48.169 -37.055 1.00 61.29  ? 281 LEU B C   1 
ATOM   6278 O O   . LEU B 1 280 ? 9.088   -47.615 -35.939 1.00 58.02  ? 281 LEU B O   1 
ATOM   6279 C CB  . LEU B 1 280 ? 7.285   -48.072 -38.766 1.00 50.52  ? 281 LEU B CB  1 
ATOM   6280 C CG  . LEU B 1 280 ? 6.709   -47.382 -40.006 1.00 50.62  ? 281 LEU B CG  1 
ATOM   6281 C CD1 . LEU B 1 280 ? 5.298   -47.861 -40.350 1.00 42.88  ? 281 LEU B CD1 1 
ATOM   6282 C CD2 . LEU B 1 280 ? 6.715   -45.882 -39.799 1.00 47.66  ? 281 LEU B CD2 1 
ATOM   6283 N N   . VAL B 1 281 ? 9.656   -49.374 -37.261 1.00 49.18  ? 282 VAL B N   1 
ATOM   6284 C CA  . VAL B 1 281 ? 10.196  -50.193 -36.174 1.00 49.28  ? 282 VAL B CA  1 
ATOM   6285 C C   . VAL B 1 281 ? 11.248  -49.452 -35.388 1.00 50.96  ? 282 VAL B C   1 
ATOM   6286 O O   . VAL B 1 281 ? 11.280  -49.521 -34.160 1.00 59.81  ? 282 VAL B O   1 
ATOM   6287 C CB  . VAL B 1 281 ? 10.809  -51.505 -36.700 1.00 44.59  ? 282 VAL B CB  1 
ATOM   6288 C CG1 . VAL B 1 281 ? 11.613  -52.199 -35.627 1.00 45.09  ? 282 VAL B CG1 1 
ATOM   6289 C CG2 . VAL B 1 281 ? 9.722   -52.413 -37.210 1.00 47.03  ? 282 VAL B CG2 1 
ATOM   6290 N N   . ASN B 1 282 ? 12.096  -48.726 -36.105 1.00 52.56  ? 283 ASN B N   1 
ATOM   6291 C CA  . ASN B 1 282 ? 13.207  -48.024 -35.486 1.00 50.90  ? 283 ASN B CA  1 
ATOM   6292 C C   . ASN B 1 282 ? 12.770  -46.868 -34.601 1.00 57.53  ? 283 ASN B C   1 
ATOM   6293 O O   . ASN B 1 282 ? 13.487  -46.493 -33.673 1.00 62.58  ? 283 ASN B O   1 
ATOM   6294 C CB  . ASN B 1 282 ? 14.176  -47.510 -36.553 1.00 58.05  ? 283 ASN B CB  1 
ATOM   6295 C CG  . ASN B 1 282 ? 14.975  -48.629 -37.210 1.00 64.41  ? 283 ASN B CG  1 
ATOM   6296 O OD1 . ASN B 1 282 ? 15.005  -49.769 -36.727 1.00 57.52  ? 283 ASN B OD1 1 
ATOM   6297 N ND2 . ASN B 1 282 ? 15.635  -48.303 -38.320 1.00 63.15  ? 283 ASN B ND2 1 
ATOM   6298 N N   . HIS B 1 283 ? 11.599  -46.305 -34.874 1.00 56.71  ? 284 HIS B N   1 
ATOM   6299 C CA  . HIS B 1 283 ? 11.145  -45.145 -34.117 1.00 58.52  ? 284 HIS B CA  1 
ATOM   6300 C C   . HIS B 1 283 ? 10.107  -45.481 -33.049 1.00 65.53  ? 284 HIS B C   1 
ATOM   6301 O O   . HIS B 1 283 ? 9.772   -44.635 -32.224 1.00 61.86  ? 284 HIS B O   1 
ATOM   6302 C CB  . HIS B 1 283 ? 10.573  -44.085 -35.064 1.00 52.00  ? 284 HIS B CB  1 
ATOM   6303 C CG  . HIS B 1 283 ? 11.616  -43.351 -35.847 1.00 61.49  ? 284 HIS B CG  1 
ATOM   6304 N ND1 . HIS B 1 283 ? 11.859  -43.596 -37.183 1.00 69.98  ? 284 HIS B ND1 1 
ATOM   6305 C CD2 . HIS B 1 283 ? 12.490  -42.386 -35.476 1.00 64.30  ? 284 HIS B CD2 1 
ATOM   6306 C CE1 . HIS B 1 283 ? 12.831  -42.805 -37.601 1.00 67.48  ? 284 HIS B CE1 1 
ATOM   6307 N NE2 . HIS B 1 283 ? 13.232  -42.063 -36.584 1.00 59.45  ? 284 HIS B NE2 1 
ATOM   6308 N N   . GLU B 1 284 ? 9.604   -46.711 -33.053 1.00 61.51  ? 285 GLU B N   1 
ATOM   6309 C CA  . GLU B 1 284 ? 8.472   -47.057 -32.202 1.00 60.87  ? 285 GLU B CA  1 
ATOM   6310 C C   . GLU B 1 284 ? 8.794   -46.983 -30.701 1.00 71.49  ? 285 GLU B C   1 
ATOM   6311 O O   . GLU B 1 284 ? 7.884   -46.822 -29.898 1.00 61.54  ? 285 GLU B O   1 
ATOM   6312 C CB  . GLU B 1 284 ? 7.940   -48.453 -32.547 1.00 61.77  ? 285 GLU B CB  1 
ATOM   6313 C CG  . GLU B 1 284 ? 8.612   -49.592 -31.779 1.00 79.62  ? 285 GLU B CG  1 
ATOM   6314 C CD  . GLU B 1 284 ? 7.748   -50.851 -31.677 1.00 77.93  ? 285 GLU B CD  1 
ATOM   6315 O OE1 . GLU B 1 284 ? 6.668   -50.903 -32.304 1.00 75.41  ? 285 GLU B OE1 1 
ATOM   6316 O OE2 . GLU B 1 284 ? 8.150   -51.789 -30.955 1.00 85.74  ? 285 GLU B OE2 1 
ATOM   6317 N N   . TRP B 1 285 ? 10.068  -47.080 -30.319 1.00 69.75  ? 286 TRP B N   1 
ATOM   6318 C CA  . TRP B 1 285 ? 10.432  -46.954 -28.901 1.00 72.75  ? 286 TRP B CA  1 
ATOM   6319 C C   . TRP B 1 285 ? 10.254  -45.519 -28.397 1.00 74.08  ? 286 TRP B C   1 
ATOM   6320 O O   . TRP B 1 285 ? 10.056  -45.307 -27.208 1.00 77.15  ? 286 TRP B O   1 
ATOM   6321 C CB  . TRP B 1 285 ? 11.875  -47.413 -28.657 1.00 76.32  ? 286 TRP B CB  1 
ATOM   6322 C CG  . TRP B 1 285 ? 12.922  -46.448 -29.169 1.00 99.82  ? 286 TRP B CG  1 
ATOM   6323 C CD1 . TRP B 1 285 ? 13.330  -46.279 -30.473 1.00 86.08  ? 286 TRP B CD1 1 
ATOM   6324 C CD2 . TRP B 1 285 ? 13.697  -45.522 -28.386 1.00 116.39 ? 286 TRP B CD2 1 
ATOM   6325 N NE1 . TRP B 1 285 ? 14.303  -45.304 -30.543 1.00 92.33  ? 286 TRP B NE1 1 
ATOM   6326 C CE2 . TRP B 1 285 ? 14.548  -44.825 -29.280 1.00 112.84 ? 286 TRP B CE2 1 
ATOM   6327 C CE3 . TRP B 1 285 ? 13.754  -45.214 -27.018 1.00 111.35 ? 286 TRP B CE3 1 
ATOM   6328 C CZ2 . TRP B 1 285 ? 15.447  -43.842 -28.845 1.00 103.22 ? 286 TRP B CZ2 1 
ATOM   6329 C CZ3 . TRP B 1 285 ? 14.646  -44.233 -26.591 1.00 112.72 ? 286 TRP B CZ3 1 
ATOM   6330 C CH2 . TRP B 1 285 ? 15.479  -43.560 -27.505 1.00 109.75 ? 286 TRP B CH2 1 
ATOM   6331 N N   . HIS B 1 286 ? 10.309  -44.547 -29.309 1.00 76.10  ? 287 HIS B N   1 
ATOM   6332 C CA  . HIS B 1 286 ? 10.176  -43.121 -28.980 1.00 68.04  ? 287 HIS B CA  1 
ATOM   6333 C C   . HIS B 1 286 ? 8.787   -42.662 -28.534 1.00 64.78  ? 287 HIS B C   1 
ATOM   6334 O O   . HIS B 1 286 ? 8.657   -41.642 -27.860 1.00 81.64  ? 287 HIS B O   1 
ATOM   6335 C CB  . HIS B 1 286 ? 10.550  -42.269 -30.182 1.00 79.47  ? 287 HIS B CB  1 
ATOM   6336 C CG  . HIS B 1 286 ? 12.013  -42.015 -30.339 1.00 94.73  ? 287 HIS B CG  1 
ATOM   6337 N ND1 . HIS B 1 286 ? 12.641  -40.921 -29.780 1.00 112.02 ? 287 HIS B ND1 1 
ATOM   6338 C CD2 . HIS B 1 286 ? 12.961  -42.673 -31.045 1.00 99.66  ? 287 HIS B CD2 1 
ATOM   6339 C CE1 . HIS B 1 286 ? 13.921  -40.935 -30.110 1.00 114.21 ? 287 HIS B CE1 1 
ATOM   6340 N NE2 . HIS B 1 286 ? 14.141  -41.988 -30.877 1.00 115.15 ? 287 HIS B NE2 1 
ATOM   6341 N N   . VAL B 1 287 ? 7.742   -43.378 -28.926 1.00 61.75  ? 288 VAL B N   1 
ATOM   6342 C CA  . VAL B 1 287 ? 6.395   -42.846 -28.735 1.00 66.23  ? 288 VAL B CA  1 
ATOM   6343 C C   . VAL B 1 287 ? 5.840   -43.029 -27.315 1.00 78.33  ? 288 VAL B C   1 
ATOM   6344 O O   . VAL B 1 287 ? 4.762   -42.529 -27.008 1.00 83.59  ? 288 VAL B O   1 
ATOM   6345 C CB  . VAL B 1 287 ? 5.402   -43.461 -29.768 1.00 62.59  ? 288 VAL B CB  1 
ATOM   6346 C CG1 . VAL B 1 287 ? 6.125   -43.734 -31.076 1.00 77.01  ? 288 VAL B CG1 1 
ATOM   6347 C CG2 . VAL B 1 287 ? 4.768   -44.732 -29.264 1.00 57.52  ? 288 VAL B CG2 1 
ATOM   6348 N N   . LEU B 1 288 ? 6.569   -43.716 -26.439 1.00 80.39  ? 289 LEU B N   1 
ATOM   6349 C CA  . LEU B 1 288 ? 6.087   -43.906 -25.070 1.00 74.94  ? 289 LEU B CA  1 
ATOM   6350 C C   . LEU B 1 288 ? 6.220   -42.633 -24.234 1.00 92.99  ? 289 LEU B C   1 
ATOM   6351 O O   . LEU B 1 288 ? 7.233   -41.923 -24.330 1.00 85.07  ? 289 LEU B O   1 
ATOM   6352 C CB  . LEU B 1 288 ? 6.836   -45.044 -24.387 1.00 75.18  ? 289 LEU B CB  1 
ATOM   6353 C CG  . LEU B 1 288 ? 6.308   -46.438 -24.705 1.00 88.60  ? 289 LEU B CG  1 
ATOM   6354 C CD1 . LEU B 1 288 ? 7.112   -47.518 -23.962 1.00 83.10  ? 289 LEU B CD1 1 
ATOM   6355 C CD2 . LEU B 1 288 ? 4.822   -46.499 -24.375 1.00 69.64  ? 289 LEU B CD2 1 
ATOM   6356 N N   . PRO B 1 289 ? 5.195   -42.351 -23.401 1.00 110.08 ? 290 PRO B N   1 
ATOM   6357 C CA  . PRO B 1 289 ? 5.148   -41.187 -22.500 1.00 110.28 ? 290 PRO B CA  1 
ATOM   6358 C C   . PRO B 1 289 ? 6.184   -41.223 -21.366 1.00 103.65 ? 290 PRO B C   1 
ATOM   6359 O O   . PRO B 1 289 ? 6.718   -40.168 -21.016 1.00 108.11 ? 290 PRO B O   1 
ATOM   6360 C CB  . PRO B 1 289 ? 3.720   -41.240 -21.928 1.00 99.66  ? 290 PRO B CB  1 
ATOM   6361 C CG  . PRO B 1 289 ? 3.309   -42.671 -22.045 1.00 89.92  ? 290 PRO B CG  1 
ATOM   6362 C CD  . PRO B 1 289 ? 3.957   -43.153 -23.321 1.00 97.59  ? 290 PRO B CD  1 
ATOM   6363 N N   . GLN B 1 290 ? 6.459   -42.405 -20.814 1.00 96.27  ? 291 GLN B N   1 
ATOM   6364 C CA  . GLN B 1 290 ? 7.397   -42.545 -19.696 1.00 103.07 ? 291 GLN B CA  1 
ATOM   6365 C C   . GLN B 1 290 ? 8.466   -43.610 -19.972 1.00 95.65  ? 291 GLN B C   1 
ATOM   6366 O O   . GLN B 1 290 ? 8.191   -44.621 -20.623 1.00 95.79  ? 291 GLN B O   1 
ATOM   6367 C CB  . GLN B 1 290 ? 6.631   -42.885 -18.405 1.00 94.27  ? 291 GLN B CB  1 
ATOM   6368 C CG  . GLN B 1 290 ? 7.493   -43.000 -17.142 1.00 102.33 ? 291 GLN B CG  1 
ATOM   6369 C CD  . GLN B 1 290 ? 6.684   -43.295 -15.867 1.00 113.47 ? 291 GLN B CD  1 
ATOM   6370 O OE1 . GLN B 1 290 ? 5.447   -43.332 -15.883 1.00 111.37 ? 291 GLN B OE1 1 
ATOM   6371 N NE2 . GLN B 1 290 ? 7.391   -43.498 -14.756 1.00 98.43  ? 291 GLN B NE2 1 
ATOM   6372 N N   . GLU B 1 291 ? 9.686   -43.371 -19.495 1.00 84.93  ? 292 GLU B N   1 
ATOM   6373 C CA  . GLU B 1 291 ? 10.694  -44.422 -19.455 1.00 90.47  ? 292 GLU B CA  1 
ATOM   6374 C C   . GLU B 1 291 ? 10.160  -45.562 -18.582 1.00 99.43  ? 292 GLU B C   1 
ATOM   6375 O O   . GLU B 1 291 ? 9.737   -45.347 -17.444 1.00 94.18  ? 292 GLU B O   1 
ATOM   6376 C CB  . GLU B 1 291 ? 12.039  -43.900 -18.918 1.00 94.94  ? 292 GLU B CB  1 
ATOM   6377 C CG  . GLU B 1 291 ? 11.948  -43.079 -17.616 1.00 106.30 ? 292 GLU B CG  1 
ATOM   6378 C CD  . GLU B 1 291 ? 13.310  -42.824 -16.944 1.00 112.91 ? 292 GLU B CD  1 
ATOM   6379 O OE1 . GLU B 1 291 ? 14.210  -43.689 -17.035 1.00 111.88 ? 292 GLU B OE1 1 
ATOM   6380 O OE2 . GLU B 1 291 ? 13.479  -41.755 -16.311 1.00 103.87 ? 292 GLU B OE2 1 
ATOM   6381 N N   . SER B 1 292 ? 10.152  -46.774 -19.126 1.00 100.67 ? 293 SER B N   1 
ATOM   6382 C CA  . SER B 1 292 ? 9.676   -47.933 -18.378 1.00 78.17  ? 293 SER B CA  1 
ATOM   6383 C C   . SER B 1 292 ? 10.435  -49.193 -18.790 1.00 88.41  ? 293 SER B C   1 
ATOM   6384 O O   . SER B 1 292 ? 11.332  -49.149 -19.647 1.00 97.28  ? 293 SER B O   1 
ATOM   6385 C CB  . SER B 1 292 ? 8.168   -48.122 -18.577 1.00 79.38  ? 293 SER B CB  1 
ATOM   6386 O OG  . SER B 1 292 ? 7.823   -48.267 -19.947 1.00 78.20  ? 293 SER B OG  1 
ATOM   6387 N N   . VAL B 1 293 ? 10.087  -50.315 -18.169 1.00 82.68  ? 294 VAL B N   1 
ATOM   6388 C CA  . VAL B 1 293 ? 10.651  -51.599 -18.579 1.00 93.51  ? 294 VAL B CA  1 
ATOM   6389 C C   . VAL B 1 293 ? 9.723   -52.312 -19.571 1.00 91.33  ? 294 VAL B C   1 
ATOM   6390 O O   . VAL B 1 293 ? 10.103  -53.309 -20.190 1.00 90.76  ? 294 VAL B O   1 
ATOM   6391 C CB  . VAL B 1 293 ? 10.928  -52.502 -17.368 1.00 77.39  ? 294 VAL B CB  1 
ATOM   6392 C CG1 . VAL B 1 293 ? 12.143  -52.001 -16.622 1.00 73.31  ? 294 VAL B CG1 1 
ATOM   6393 C CG2 . VAL B 1 293 ? 9.721   -52.545 -16.451 1.00 71.00  ? 294 VAL B CG2 1 
ATOM   6394 N N   . PHE B 1 294 ? 8.511   -51.776 -19.724 1.00 98.07  ? 295 PHE B N   1 
ATOM   6395 C CA  . PHE B 1 294 ? 7.538   -52.304 -20.678 1.00 85.31  ? 295 PHE B CA  1 
ATOM   6396 C C   . PHE B 1 294 ? 7.440   -51.442 -21.930 1.00 99.55  ? 295 PHE B C   1 
ATOM   6397 O O   . PHE B 1 294 ? 6.554   -50.579 -22.066 1.00 93.30  ? 295 PHE B O   1 
ATOM   6398 C CB  . PHE B 1 294 ? 6.176   -52.451 -20.018 1.00 67.67  ? 295 PHE B CB  1 
ATOM   6399 C CG  . PHE B 1 294 ? 6.210   -53.349 -18.830 1.00 87.50  ? 295 PHE B CG  1 
ATOM   6400 C CD1 . PHE B 1 294 ? 6.184   -54.730 -18.988 1.00 88.05  ? 295 PHE B CD1 1 
ATOM   6401 C CD2 . PHE B 1 294 ? 6.332   -52.823 -17.555 1.00 78.48  ? 295 PHE B CD2 1 
ATOM   6402 C CE1 . PHE B 1 294 ? 6.236   -55.578 -17.888 1.00 69.64  ? 295 PHE B CE1 1 
ATOM   6403 C CE2 . PHE B 1 294 ? 6.385   -53.656 -16.458 1.00 70.35  ? 295 PHE B CE2 1 
ATOM   6404 C CZ  . PHE B 1 294 ? 6.344   -55.040 -16.627 1.00 73.42  ? 295 PHE B CZ  1 
ATOM   6405 N N   . ARG B 1 295 ? 8.380   -51.715 -22.834 1.00 86.78  ? 296 ARG B N   1 
ATOM   6406 C CA  . ARG B 1 295 ? 8.447   -51.172 -24.196 1.00 104.64 ? 296 ARG B CA  1 
ATOM   6407 C C   . ARG B 1 295 ? 7.187   -51.392 -25.083 1.00 95.10  ? 296 ARG B C   1 
ATOM   6408 O O   . ARG B 1 295 ? 7.300   -51.826 -26.238 1.00 88.83  ? 296 ARG B O   1 
ATOM   6409 C CB  . ARG B 1 295 ? 9.671   -51.805 -24.874 1.00 89.97  ? 296 ARG B CB  1 
ATOM   6410 C CG  . ARG B 1 295 ? 10.091  -51.219 -26.188 1.00 89.51  ? 296 ARG B CG  1 
ATOM   6411 C CD  . ARG B 1 295 ? 10.434  -52.329 -27.147 1.00 70.83  ? 296 ARG B CD  1 
ATOM   6412 N NE  . ARG B 1 295 ? 10.454  -51.812 -28.504 1.00 81.55  ? 296 ARG B NE  1 
ATOM   6413 C CZ  . ARG B 1 295 ? 11.455  -51.098 -29.002 1.00 85.23  ? 296 ARG B CZ  1 
ATOM   6414 N NH1 . ARG B 1 295 ? 12.514  -50.834 -28.243 1.00 90.43  ? 296 ARG B NH1 1 
ATOM   6415 N NH2 . ARG B 1 295 ? 11.399  -50.652 -30.254 1.00 92.63  ? 296 ARG B NH2 1 
ATOM   6416 N N   . PHE B 1 296 ? 5.988   -51.108 -24.570 1.00 79.36  ? 297 PHE B N   1 
ATOM   6417 C CA  . PHE B 1 296 ? 4.791   -51.513 -25.306 1.00 65.21  ? 297 PHE B CA  1 
ATOM   6418 C C   . PHE B 1 296 ? 4.079   -50.327 -25.933 1.00 67.37  ? 297 PHE B C   1 
ATOM   6419 O O   . PHE B 1 296 ? 3.024   -49.891 -25.454 1.00 72.62  ? 297 PHE B O   1 
ATOM   6420 C CB  . PHE B 1 296 ? 3.802   -52.267 -24.411 1.00 70.33  ? 297 PHE B CB  1 
ATOM   6421 C CG  . PHE B 1 296 ? 4.369   -53.491 -23.743 1.00 68.30  ? 297 PHE B CG  1 
ATOM   6422 C CD1 . PHE B 1 296 ? 5.672   -53.906 -23.965 1.00 67.19  ? 297 PHE B CD1 1 
ATOM   6423 C CD2 . PHE B 1 296 ? 3.586   -54.230 -22.886 1.00 56.52  ? 297 PHE B CD2 1 
ATOM   6424 C CE1 . PHE B 1 296 ? 6.184   -55.012 -23.320 1.00 78.66  ? 297 PHE B CE1 1 
ATOM   6425 C CE2 . PHE B 1 296 ? 4.085   -55.338 -22.254 1.00 64.22  ? 297 PHE B CE2 1 
ATOM   6426 C CZ  . PHE B 1 296 ? 5.388   -55.729 -22.465 1.00 70.94  ? 297 PHE B CZ  1 
ATOM   6427 N N   . SER B 1 297 ? 4.633   -49.819 -27.020 1.00 54.84  ? 298 SER B N   1 
ATOM   6428 C CA  . SER B 1 297 ? 4.031   -48.671 -27.690 1.00 64.84  ? 298 SER B CA  1 
ATOM   6429 C C   . SER B 1 297 ? 2.634   -48.928 -28.280 1.00 53.71  ? 298 SER B C   1 
ATOM   6430 O O   . SER B 1 297 ? 1.695   -48.203 -27.987 1.00 45.52  ? 298 SER B O   1 
ATOM   6431 C CB  . SER B 1 297 ? 4.980   -48.167 -28.770 1.00 65.40  ? 298 SER B CB  1 
ATOM   6432 O OG  . SER B 1 297 ? 6.086   -47.508 -28.165 1.00 77.22  ? 298 SER B OG  1 
ATOM   6433 N N   . PHE B 1 298 ? 2.474   -49.952 -29.101 1.00 40.27  ? 299 PHE B N   1 
ATOM   6434 C CA  . PHE B 1 298 ? 1.174   -50.174 -29.709 1.00 38.49  ? 299 PHE B CA  1 
ATOM   6435 C C   . PHE B 1 298 ? 0.562   -51.483 -29.253 1.00 45.19  ? 299 PHE B C   1 
ATOM   6436 O O   . PHE B 1 298 ? 1.140   -52.553 -29.421 1.00 46.62  ? 299 PHE B O   1 
ATOM   6437 C CB  . PHE B 1 298 ? 1.292   -50.134 -31.247 1.00 48.94  ? 299 PHE B CB  1 
ATOM   6438 C CG  . PHE B 1 298 ? 1.860   -48.846 -31.763 1.00 49.56  ? 299 PHE B CG  1 
ATOM   6439 C CD1 . PHE B 1 298 ? 1.045   -47.740 -31.936 1.00 40.77  ? 299 PHE B CD1 1 
ATOM   6440 C CD2 . PHE B 1 298 ? 3.217   -48.723 -32.024 1.00 50.56  ? 299 PHE B CD2 1 
ATOM   6441 C CE1 . PHE B 1 298 ? 1.563   -46.539 -32.373 1.00 45.96  ? 299 PHE B CE1 1 
ATOM   6442 C CE2 . PHE B 1 298 ? 3.745   -47.522 -32.475 1.00 53.40  ? 299 PHE B CE2 1 
ATOM   6443 C CZ  . PHE B 1 298 ? 2.915   -46.429 -32.659 1.00 48.19  ? 299 PHE B CZ  1 
ATOM   6444 N N   . VAL B 1 299 ? -0.628  -51.389 -28.676 1.00 39.79  ? 300 VAL B N   1 
ATOM   6445 C CA  . VAL B 1 299 ? -1.285  -52.530 -28.072 1.00 33.82  ? 300 VAL B CA  1 
ATOM   6446 C C   . VAL B 1 299 ? -2.756  -52.415 -28.447 1.00 38.69  ? 300 VAL B C   1 
ATOM   6447 O O   . VAL B 1 299 ? -3.154  -51.396 -29.012 1.00 37.96  ? 300 VAL B O   1 
ATOM   6448 C CB  . VAL B 1 299 ? -1.070  -52.548 -26.517 1.00 38.67  ? 300 VAL B CB  1 
ATOM   6449 C CG1 . VAL B 1 299 ? 0.438   -52.532 -26.179 1.00 30.88  ? 300 VAL B CG1 1 
ATOM   6450 C CG2 . VAL B 1 299 ? -1.820  -51.387 -25.862 1.00 36.77  ? 300 VAL B CG2 1 
ATOM   6451 N N   . PRO B 1 300 ? -3.569  -53.450 -28.169 1.00 38.63  ? 301 PRO B N   1 
ATOM   6452 C CA  . PRO B 1 300 ? -4.997  -53.304 -28.470 1.00 46.44  ? 301 PRO B CA  1 
ATOM   6453 C C   . PRO B 1 300 ? -5.639  -52.040 -27.873 1.00 50.55  ? 301 PRO B C   1 
ATOM   6454 O O   . PRO B 1 300 ? -5.262  -51.610 -26.773 1.00 46.15  ? 301 PRO B O   1 
ATOM   6455 C CB  . PRO B 1 300 ? -5.608  -54.560 -27.845 1.00 42.61  ? 301 PRO B CB  1 
ATOM   6456 C CG  . PRO B 1 300 ? -4.526  -55.544 -27.882 1.00 35.75  ? 301 PRO B CG  1 
ATOM   6457 C CD  . PRO B 1 300 ? -3.271  -54.784 -27.624 1.00 33.38  ? 301 PRO B CD  1 
ATOM   6458 N N   . VAL B 1 301 ? -6.601  -51.471 -28.603 1.00 52.06  ? 302 VAL B N   1 
ATOM   6459 C CA  . VAL B 1 301 ? -7.285  -50.237 -28.222 1.00 40.85  ? 302 VAL B CA  1 
ATOM   6460 C C   . VAL B 1 301 ? -8.750  -50.497 -27.866 1.00 47.60  ? 302 VAL B C   1 
ATOM   6461 O O   . VAL B 1 301 ? -9.445  -51.260 -28.546 1.00 47.49  ? 302 VAL B O   1 
ATOM   6462 C CB  . VAL B 1 301 ? -7.206  -49.176 -29.361 1.00 45.36  ? 302 VAL B CB  1 
ATOM   6463 C CG1 . VAL B 1 301 ? -7.714  -49.742 -30.679 1.00 38.69  ? 302 VAL B CG1 1 
ATOM   6464 C CG2 . VAL B 1 301 ? -7.977  -47.927 -28.978 1.00 45.49  ? 302 VAL B CG2 1 
ATOM   6465 N N   . VAL B 1 302 ? -9.207  -49.888 -26.770 1.00 48.95  ? 303 VAL B N   1 
ATOM   6466 C CA  . VAL B 1 302 ? -10.612 -49.981 -26.376 1.00 53.97  ? 303 VAL B CA  1 
ATOM   6467 C C   . VAL B 1 302 ? -11.396 -48.918 -27.137 1.00 54.12  ? 303 VAL B C   1 
ATOM   6468 O O   . VAL B 1 302 ? -11.302 -47.724 -26.819 1.00 48.87  ? 303 VAL B O   1 
ATOM   6469 C CB  . VAL B 1 302 ? -10.815 -49.777 -24.848 1.00 53.02  ? 303 VAL B CB  1 
ATOM   6470 C CG1 . VAL B 1 302 ? -12.233 -50.141 -24.468 1.00 46.15  ? 303 VAL B CG1 1 
ATOM   6471 C CG2 . VAL B 1 302 ? -9.823  -50.621 -24.047 1.00 47.90  ? 303 VAL B CG2 1 
ATOM   6472 N N   . ASP B 1 303 ? -12.160 -49.339 -28.139 1.00 48.31  ? 304 ASP B N   1 
ATOM   6473 C CA  . ASP B 1 303 ? -12.714 -48.380 -29.093 1.00 58.73  ? 304 ASP B CA  1 
ATOM   6474 C C   . ASP B 1 303 ? -14.157 -48.696 -29.425 1.00 55.86  ? 304 ASP B C   1 
ATOM   6475 O O   . ASP B 1 303 ? -14.748 -48.090 -30.316 1.00 63.08  ? 304 ASP B O   1 
ATOM   6476 C CB  . ASP B 1 303 ? -11.876 -48.355 -30.373 1.00 54.03  ? 304 ASP B CB  1 
ATOM   6477 C CG  . ASP B 1 303 ? -12.107 -49.587 -31.252 1.00 62.11  ? 304 ASP B CG  1 
ATOM   6478 O OD1 . ASP B 1 303 ? -12.458 -50.670 -30.721 1.00 60.73  ? 304 ASP B OD1 1 
ATOM   6479 O OD2 . ASP B 1 303 ? -11.928 -49.471 -32.483 1.00 85.07  ? 304 ASP B OD2 1 
ATOM   6480 N N   . GLY B 1 304 ? -14.713 -49.666 -28.718 1.00 48.33  ? 305 GLY B N   1 
ATOM   6481 C CA  . GLY B 1 304 ? -16.119 -49.982 -28.855 1.00 59.21  ? 305 GLY B CA  1 
ATOM   6482 C C   . GLY B 1 304 ? -16.382 -51.091 -29.843 1.00 59.87  ? 305 GLY B C   1 
ATOM   6483 O O   . GLY B 1 304 ? -17.439 -51.721 -29.821 1.00 71.97  ? 305 GLY B O   1 
ATOM   6484 N N   . ASP B 1 305 ? -15.409 -51.342 -30.707 1.00 63.48  ? 306 ASP B N   1 
ATOM   6485 C CA  . ASP B 1 305 ? -15.565 -52.324 -31.774 1.00 55.80  ? 306 ASP B CA  1 
ATOM   6486 C C   . ASP B 1 305 ? -15.184 -53.757 -31.341 1.00 60.95  ? 306 ASP B C   1 
ATOM   6487 O O   . ASP B 1 305 ? -16.052 -54.545 -30.965 1.00 59.87  ? 306 ASP B O   1 
ATOM   6488 C CB  . ASP B 1 305 ? -14.733 -51.874 -32.968 1.00 67.67  ? 306 ASP B CB  1 
ATOM   6489 C CG  . ASP B 1 305 ? -15.061 -52.625 -34.234 1.00 64.10  ? 306 ASP B CG  1 
ATOM   6490 O OD1 . ASP B 1 305 ? -15.860 -53.589 -34.184 1.00 60.07  ? 306 ASP B OD1 1 
ATOM   6491 O OD2 . ASP B 1 305 ? -14.497 -52.238 -35.280 1.00 73.49  ? 306 ASP B OD2 1 
ATOM   6492 N N   . PHE B 1 306 ? -13.899 -54.103 -31.409 1.00 58.13  ? 307 PHE B N   1 
ATOM   6493 C CA  . PHE B 1 306 ? -13.461 -55.437 -30.981 1.00 51.73  ? 307 PHE B CA  1 
ATOM   6494 C C   . PHE B 1 306 ? -13.810 -55.626 -29.495 1.00 52.26  ? 307 PHE B C   1 
ATOM   6495 O O   . PHE B 1 306 ? -14.375 -56.640 -29.092 1.00 49.09  ? 307 PHE B O   1 
ATOM   6496 C CB  . PHE B 1 306 ? -11.959 -55.612 -31.215 1.00 41.63  ? 307 PHE B CB  1 
ATOM   6497 C CG  . PHE B 1 306 ? -11.486 -57.037 -31.126 1.00 52.72  ? 307 PHE B CG  1 
ATOM   6498 C CD1 . PHE B 1 306 ? -11.160 -57.600 -29.894 1.00 47.19  ? 307 PHE B CD1 1 
ATOM   6499 C CD2 . PHE B 1 306 ? -11.335 -57.809 -32.275 1.00 42.89  ? 307 PHE B CD2 1 
ATOM   6500 C CE1 . PHE B 1 306 ? -10.723 -58.913 -29.802 1.00 42.93  ? 307 PHE B CE1 1 
ATOM   6501 C CE2 . PHE B 1 306 ? -10.895 -59.127 -32.191 1.00 52.40  ? 307 PHE B CE2 1 
ATOM   6502 C CZ  . PHE B 1 306 ? -10.590 -59.680 -30.948 1.00 50.59  ? 307 PHE B CZ  1 
ATOM   6503 N N   . LEU B 1 307 ? -13.445 -54.621 -28.702 1.00 46.50  ? 308 LEU B N   1 
ATOM   6504 C CA  . LEU B 1 307 ? -13.813 -54.520 -27.294 1.00 55.39  ? 308 LEU B CA  1 
ATOM   6505 C C   . LEU B 1 307 ? -14.849 -53.418 -27.069 1.00 59.20  ? 308 LEU B C   1 
ATOM   6506 O O   . LEU B 1 307 ? -14.526 -52.231 -27.191 1.00 58.21  ? 308 LEU B O   1 
ATOM   6507 C CB  . LEU B 1 307 ? -12.574 -54.234 -26.453 1.00 48.38  ? 308 LEU B CB  1 
ATOM   6508 C CG  . LEU B 1 307 ? -11.507 -55.313 -26.582 1.00 57.41  ? 308 LEU B CG  1 
ATOM   6509 C CD1 . LEU B 1 307 ? -10.212 -54.846 -25.945 1.00 50.38  ? 308 LEU B CD1 1 
ATOM   6510 C CD2 . LEU B 1 307 ? -12.022 -56.614 -25.963 1.00 38.27  ? 308 LEU B CD2 1 
ATOM   6511 N N   . SER B 1 308 ? -16.082 -53.801 -26.736 1.00 57.94  ? 309 SER B N   1 
ATOM   6512 C CA  . SER B 1 308 ? -17.158 -52.819 -26.499 1.00 66.62  ? 309 SER B CA  1 
ATOM   6513 C C   . SER B 1 308 ? -17.001 -52.029 -25.184 1.00 61.44  ? 309 SER B C   1 
ATOM   6514 O O   . SER B 1 308 ? -17.724 -51.070 -24.927 1.00 74.16  ? 309 SER B O   1 
ATOM   6515 C CB  . SER B 1 308 ? -18.525 -53.516 -26.521 1.00 53.31  ? 309 SER B CB  1 
ATOM   6516 O OG  . SER B 1 308 ? -18.668 -54.440 -25.456 1.00 74.36  ? 309 SER B OG  1 
ATOM   6517 N N   . ASP B 1 309 ? -16.049 -52.426 -24.355 1.00 57.46  ? 310 ASP B N   1 
ATOM   6518 C CA  . ASP B 1 309 ? -15.772 -51.714 -23.106 1.00 66.33  ? 310 ASP B CA  1 
ATOM   6519 C C   . ASP B 1 309 ? -14.420 -52.216 -22.636 1.00 58.83  ? 310 ASP B C   1 
ATOM   6520 O O   . ASP B 1 309 ? -13.888 -53.166 -23.214 1.00 60.09  ? 310 ASP B O   1 
ATOM   6521 C CB  . ASP B 1 309 ? -16.862 -51.978 -22.058 1.00 67.45  ? 310 ASP B CB  1 
ATOM   6522 C CG  . ASP B 1 309 ? -16.919 -50.910 -20.961 1.00 71.63  ? 310 ASP B CG  1 
ATOM   6523 O OD1 . ASP B 1 309 ? -15.928 -50.166 -20.747 1.00 62.08  ? 310 ASP B OD1 1 
ATOM   6524 O OD2 . ASP B 1 309 ? -17.982 -50.834 -20.305 1.00 74.47  ? 310 ASP B OD2 1 
ATOM   6525 N N   . THR B 1 310 ? -13.856 -51.595 -21.608 1.00 54.76  ? 311 THR B N   1 
ATOM   6526 C CA  . THR B 1 310 ? -12.596 -52.072 -21.065 1.00 51.95  ? 311 THR B CA  1 
ATOM   6527 C C   . THR B 1 310 ? -12.746 -53.537 -20.695 1.00 55.98  ? 311 THR B C   1 
ATOM   6528 O O   . THR B 1 310 ? -13.843 -53.981 -20.327 1.00 54.47  ? 311 THR B O   1 
ATOM   6529 C CB  . THR B 1 310 ? -12.160 -51.286 -19.821 1.00 58.59  ? 311 THR B CB  1 
ATOM   6530 O OG1 . THR B 1 310 ? -12.940 -51.712 -18.699 1.00 55.41  ? 311 THR B OG1 1 
ATOM   6531 C CG2 . THR B 1 310 ? -12.325 -49.794 -20.037 1.00 49.76  ? 311 THR B CG2 1 
ATOM   6532 N N   . PRO B 1 311 ? -11.651 -54.298 -20.805 1.00 52.32  ? 312 PRO B N   1 
ATOM   6533 C CA  . PRO B 1 311 ? -11.678 -55.709 -20.413 1.00 58.46  ? 312 PRO B CA  1 
ATOM   6534 C C   . PRO B 1 311 ? -12.132 -55.876 -18.952 1.00 59.74  ? 312 PRO B C   1 
ATOM   6535 O O   . PRO B 1 311 ? -12.920 -56.772 -18.652 1.00 61.22  ? 312 PRO B O   1 
ATOM   6536 C CB  . PRO B 1 311 ? -10.229 -56.152 -20.604 1.00 46.70  ? 312 PRO B CB  1 
ATOM   6537 C CG  . PRO B 1 311 ? -9.665  -55.189 -21.601 1.00 53.93  ? 312 PRO B CG  1 
ATOM   6538 C CD  . PRO B 1 311 ? -10.339 -53.887 -21.327 1.00 51.04  ? 312 PRO B CD  1 
ATOM   6539 N N   . GLU B 1 312 ? -11.654 -55.012 -18.063 1.00 58.89  ? 313 GLU B N   1 
ATOM   6540 C CA  . GLU B 1 312 ? -12.095 -55.045 -16.669 1.00 60.15  ? 313 GLU B CA  1 
ATOM   6541 C C   . GLU B 1 312 ? -13.624 -55.030 -16.587 1.00 64.72  ? 313 GLU B C   1 
ATOM   6542 O O   . GLU B 1 312 ? -14.227 -55.940 -16.019 1.00 63.98  ? 313 GLU B O   1 
ATOM   6543 C CB  . GLU B 1 312 ? -11.509 -53.875 -15.894 1.00 64.95  ? 313 GLU B CB  1 
ATOM   6544 C CG  . GLU B 1 312 ? -11.612 -54.040 -14.379 1.00 89.08  ? 313 GLU B CG  1 
ATOM   6545 C CD  . GLU B 1 312 ? -11.759 -52.711 -13.654 1.00 101.11 ? 313 GLU B CD  1 
ATOM   6546 O OE1 . GLU B 1 312 ? -12.052 -51.691 -14.323 1.00 101.75 ? 313 GLU B OE1 1 
ATOM   6547 O OE2 . GLU B 1 312 ? -11.585 -52.689 -12.412 1.00 118.95 ? 313 GLU B OE2 1 
ATOM   6548 N N   . ALA B 1 313 ? -14.240 -54.021 -17.199 1.00 58.50  ? 314 ALA B N   1 
ATOM   6549 C CA  . ALA B 1 313 ? -15.691 -53.911 -17.247 1.00 47.58  ? 314 ALA B CA  1 
ATOM   6550 C C   . ALA B 1 313 ? -16.357 -55.127 -17.869 1.00 61.18  ? 314 ALA B C   1 
ATOM   6551 O O   . ALA B 1 313 ? -17.342 -55.637 -17.333 1.00 69.70  ? 314 ALA B O   1 
ATOM   6552 C CB  . ALA B 1 313 ? -16.090 -52.666 -18.007 1.00 56.48  ? 314 ALA B CB  1 
ATOM   6553 N N   . LEU B 1 314 ? -15.830 -55.593 -19.000 1.00 57.80  ? 315 LEU B N   1 
ATOM   6554 C CA  . LEU B 1 314 ? -16.442 -56.724 -19.707 1.00 54.98  ? 315 LEU B CA  1 
ATOM   6555 C C   . LEU B 1 314 ? -16.423 -57.999 -18.880 1.00 52.82  ? 315 LEU B C   1 
ATOM   6556 O O   . LEU B 1 314 ? -17.370 -58.785 -18.900 1.00 60.74  ? 315 LEU B O   1 
ATOM   6557 C CB  . LEU B 1 314 ? -15.737 -56.978 -21.038 1.00 55.89  ? 315 LEU B CB  1 
ATOM   6558 C CG  . LEU B 1 314 ? -15.999 -55.973 -22.153 1.00 59.94  ? 315 LEU B CG  1 
ATOM   6559 C CD1 . LEU B 1 314 ? -15.100 -56.260 -23.353 1.00 59.22  ? 315 LEU B CD1 1 
ATOM   6560 C CD2 . LEU B 1 314 ? -17.447 -56.054 -22.555 1.00 57.22  ? 315 LEU B CD2 1 
ATOM   6561 N N   . ILE B 1 315 ? -15.316 -58.213 -18.188 1.00 46.37  ? 316 ILE B N   1 
ATOM   6562 C CA  . ILE B 1 315 ? -15.199 -59.323 -17.270 1.00 58.11  ? 316 ILE B CA  1 
ATOM   6563 C C   . ILE B 1 315 ? -16.279 -59.255 -16.173 1.00 72.00  ? 316 ILE B C   1 
ATOM   6564 O O   . ILE B 1 315 ? -16.982 -60.244 -15.926 1.00 64.98  ? 316 ILE B O   1 
ATOM   6565 C CB  . ILE B 1 315 ? -13.807 -59.348 -16.628 1.00 56.12  ? 316 ILE B CB  1 
ATOM   6566 C CG1 . ILE B 1 315 ? -12.769 -59.751 -17.668 1.00 57.56  ? 316 ILE B CG1 1 
ATOM   6567 C CG2 . ILE B 1 315 ? -13.773 -60.330 -15.499 1.00 60.53  ? 316 ILE B CG2 1 
ATOM   6568 C CD1 . ILE B 1 315 ? -11.335 -59.575 -17.219 1.00 53.74  ? 316 ILE B CD1 1 
ATOM   6569 N N   . ASN B 1 316 ? -16.427 -58.095 -15.532 1.00 61.48  ? 317 ASN B N   1 
ATOM   6570 C CA  . ASN B 1 316 ? -17.371 -57.971 -14.406 1.00 73.46  ? 317 ASN B CA  1 
ATOM   6571 C C   . ASN B 1 316 ? -18.811 -58.214 -14.835 1.00 73.24  ? 317 ASN B C   1 
ATOM   6572 O O   . ASN B 1 316 ? -19.598 -58.801 -14.096 1.00 73.29  ? 317 ASN B O   1 
ATOM   6573 C CB  . ASN B 1 316 ? -17.264 -56.600 -13.747 1.00 53.59  ? 317 ASN B CB  1 
ATOM   6574 C CG  . ASN B 1 316 ? -15.887 -56.338 -13.176 1.00 60.78  ? 317 ASN B CG  1 
ATOM   6575 O OD1 . ASN B 1 316 ? -15.124 -57.272 -12.925 1.00 66.21  ? 317 ASN B OD1 1 
ATOM   6576 N ND2 . ASN B 1 316 ? -15.552 -55.064 -12.978 1.00 56.10  ? 317 ASN B ND2 1 
ATOM   6577 N N   . ALA B 1 317 ? -19.136 -57.790 -16.050 1.00 63.78  ? 318 ALA B N   1 
ATOM   6578 C CA  . ALA B 1 317 ? -20.509 -57.838 -16.534 1.00 65.73  ? 318 ALA B CA  1 
ATOM   6579 C C   . ALA B 1 317 ? -20.878 -59.164 -17.182 1.00 73.68  ? 318 ALA B C   1 
ATOM   6580 O O   . ALA B 1 317 ? -22.029 -59.379 -17.552 1.00 80.29  ? 318 ALA B O   1 
ATOM   6581 C CB  . ALA B 1 317 ? -20.747 -56.706 -17.526 1.00 54.82  ? 318 ALA B CB  1 
ATOM   6582 N N   . GLY B 1 318 ? -19.910 -60.054 -17.332 1.00 73.27  ? 319 GLY B N   1 
ATOM   6583 C CA  . GLY B 1 318 ? -20.117 -61.194 -18.197 1.00 65.33  ? 319 GLY B CA  1 
ATOM   6584 C C   . GLY B 1 318 ? -20.673 -62.431 -17.530 1.00 59.73  ? 319 GLY B C   1 
ATOM   6585 O O   . GLY B 1 318 ? -20.407 -62.696 -16.360 1.00 67.85  ? 319 GLY B O   1 
ATOM   6586 N N   . ASP B 1 319 ? -21.447 -63.188 -18.300 1.00 66.85  ? 320 ASP B N   1 
ATOM   6587 C CA  . ASP B 1 319 ? -21.892 -64.518 -17.914 1.00 67.25  ? 320 ASP B CA  1 
ATOM   6588 C C   . ASP B 1 319 ? -20.960 -65.546 -18.552 1.00 69.74  ? 320 ASP B C   1 
ATOM   6589 O O   . ASP B 1 319 ? -20.865 -65.624 -19.777 1.00 69.10  ? 320 ASP B O   1 
ATOM   6590 C CB  . ASP B 1 319 ? -23.339 -64.752 -18.358 1.00 64.51  ? 320 ASP B CB  1 
ATOM   6591 C CG  . ASP B 1 319 ? -23.939 -66.046 -17.804 1.00 76.43  ? 320 ASP B CG  1 
ATOM   6592 O OD1 . ASP B 1 319 ? -23.203 -66.970 -17.391 1.00 71.47  ? 320 ASP B OD1 1 
ATOM   6593 O OD2 . ASP B 1 319 ? -25.183 -66.140 -17.791 1.00 100.48 ? 320 ASP B OD2 1 
ATOM   6594 N N   . PHE B 1 320 ? -20.285 -66.335 -17.723 1.00 61.83  ? 321 PHE B N   1 
ATOM   6595 C CA  . PHE B 1 320 ? -19.276 -67.259 -18.210 1.00 50.91  ? 321 PHE B CA  1 
ATOM   6596 C C   . PHE B 1 320 ? -19.629 -68.709 -17.932 1.00 63.41  ? 321 PHE B C   1 
ATOM   6597 O O   . PHE B 1 320 ? -18.750 -69.573 -17.847 1.00 63.12  ? 321 PHE B O   1 
ATOM   6598 C CB  . PHE B 1 320 ? -17.918 -66.913 -17.591 1.00 59.04  ? 321 PHE B CB  1 
ATOM   6599 C CG  . PHE B 1 320 ? -17.423 -65.554 -17.979 1.00 60.70  ? 321 PHE B CG  1 
ATOM   6600 C CD1 . PHE B 1 320 ? -16.986 -65.307 -19.279 1.00 53.95  ? 321 PHE B CD1 1 
ATOM   6601 C CD2 . PHE B 1 320 ? -17.432 -64.511 -17.069 1.00 55.45  ? 321 PHE B CD2 1 
ATOM   6602 C CE1 . PHE B 1 320 ? -16.548 -64.051 -19.655 1.00 48.61  ? 321 PHE B CE1 1 
ATOM   6603 C CE2 . PHE B 1 320 ? -16.980 -63.244 -17.442 1.00 61.03  ? 321 PHE B CE2 1 
ATOM   6604 C CZ  . PHE B 1 320 ? -16.542 -63.018 -18.738 1.00 46.78  ? 321 PHE B CZ  1 
ATOM   6605 N N   . HIS B 1 321 ? -20.923 -68.972 -17.792 1.00 67.40  ? 322 HIS B N   1 
ATOM   6606 C CA  . HIS B 1 321 ? -21.409 -70.340 -17.659 1.00 72.58  ? 322 HIS B CA  1 
ATOM   6607 C C   . HIS B 1 321 ? -21.095 -71.160 -18.912 1.00 65.70  ? 322 HIS B C   1 
ATOM   6608 O O   . HIS B 1 321 ? -21.237 -70.672 -20.035 1.00 56.12  ? 322 HIS B O   1 
ATOM   6609 C CB  . HIS B 1 321 ? -22.909 -70.340 -17.377 1.00 63.70  ? 322 HIS B CB  1 
ATOM   6610 C CG  . HIS B 1 321 ? -23.249 -69.937 -15.979 1.00 67.73  ? 322 HIS B CG  1 
ATOM   6611 N ND1 . HIS B 1 321 ? -23.698 -68.674 -15.656 1.00 77.39  ? 322 HIS B ND1 1 
ATOM   6612 C CD2 . HIS B 1 321 ? -23.173 -70.621 -14.812 1.00 60.43  ? 322 HIS B CD2 1 
ATOM   6613 C CE1 . HIS B 1 321 ? -23.899 -68.601 -14.351 1.00 67.20  ? 322 HIS B CE1 1 
ATOM   6614 N NE2 . HIS B 1 321 ? -23.588 -69.769 -13.815 1.00 70.62  ? 322 HIS B NE2 1 
ATOM   6615 N N   . GLY B 1 322 ? -20.643 -72.396 -18.708 1.00 67.64  ? 323 GLY B N   1 
ATOM   6616 C CA  . GLY B 1 322 ? -20.285 -73.275 -19.808 1.00 62.14  ? 323 GLY B CA  1 
ATOM   6617 C C   . GLY B 1 322 ? -18.897 -73.005 -20.366 1.00 64.02  ? 323 GLY B C   1 
ATOM   6618 O O   . GLY B 1 322 ? -18.572 -73.391 -21.495 1.00 74.50  ? 323 GLY B O   1 
ATOM   6619 N N   . LEU B 1 323 ? -18.084 -72.322 -19.572 1.00 62.39  ? 324 LEU B N   1 
ATOM   6620 C CA  . LEU B 1 323 ? -16.709 -72.033 -19.937 1.00 59.00  ? 324 LEU B CA  1 
ATOM   6621 C C   . LEU B 1 323 ? -15.755 -72.687 -18.951 1.00 62.42  ? 324 LEU B C   1 
ATOM   6622 O O   . LEU B 1 323 ? -15.940 -72.589 -17.726 1.00 58.54  ? 324 LEU B O   1 
ATOM   6623 C CB  . LEU B 1 323 ? -16.470 -70.527 -19.981 1.00 57.29  ? 324 LEU B CB  1 
ATOM   6624 C CG  . LEU B 1 323 ? -15.022 -70.129 -20.246 1.00 57.72  ? 324 LEU B CG  1 
ATOM   6625 C CD1 . LEU B 1 323 ? -14.646 -70.523 -21.654 1.00 49.03  ? 324 LEU B CD1 1 
ATOM   6626 C CD2 . LEU B 1 323 ? -14.816 -68.636 -20.021 1.00 45.15  ? 324 LEU B CD2 1 
ATOM   6627 N N   . GLN B 1 324 ? -14.749 -73.378 -19.480 1.00 52.77  ? 325 GLN B N   1 
ATOM   6628 C CA  . GLN B 1 324 ? -13.677 -73.890 -18.646 1.00 44.01  ? 325 GLN B CA  1 
ATOM   6629 C C   . GLN B 1 324 ? -12.405 -73.169 -19.049 1.00 55.54  ? 325 GLN B C   1 
ATOM   6630 O O   . GLN B 1 324 ? -12.120 -72.995 -20.244 1.00 56.82  ? 325 GLN B O   1 
ATOM   6631 C CB  . GLN B 1 324 ? -13.498 -75.403 -18.776 1.00 51.79  ? 325 GLN B CB  1 
ATOM   6632 C CG  . GLN B 1 324 ? -14.742 -76.248 -18.579 1.00 53.21  ? 325 GLN B CG  1 
ATOM   6633 C CD  . GLN B 1 324 ? -15.593 -76.329 -19.828 1.00 61.77  ? 325 GLN B CD  1 
ATOM   6634 O OE1 . GLN B 1 324 ? -15.091 -76.211 -20.949 1.00 70.13  ? 325 GLN B OE1 1 
ATOM   6635 N NE2 . GLN B 1 324 ? -16.896 -76.509 -19.643 1.00 78.57  ? 325 GLN B NE2 1 
ATOM   6636 N N   . VAL B 1 325 ? -11.647 -72.742 -18.046 1.00 44.12  ? 326 VAL B N   1 
ATOM   6637 C CA  . VAL B 1 325 ? -10.417 -71.994 -18.241 1.00 42.06  ? 326 VAL B CA  1 
ATOM   6638 C C   . VAL B 1 325 ? -9.297  -72.533 -17.345 1.00 49.08  ? 326 VAL B C   1 
ATOM   6639 O O   . VAL B 1 325 ? -9.537  -72.971 -16.223 1.00 51.20  ? 326 VAL B O   1 
ATOM   6640 C CB  . VAL B 1 325 ? -10.633 -70.499 -17.952 1.00 46.78  ? 326 VAL B CB  1 
ATOM   6641 C CG1 . VAL B 1 325 ? -9.434  -69.718 -18.334 1.00 52.65  ? 326 VAL B CG1 1 
ATOM   6642 C CG2 . VAL B 1 325 ? -11.799 -69.985 -18.738 1.00 54.06  ? 326 VAL B CG2 1 
ATOM   6643 N N   . LEU B 1 326 ? -8.076  -72.499 -17.852 1.00 49.27  ? 327 LEU B N   1 
ATOM   6644 C CA  . LEU B 1 326 ? -6.902  -72.886 -17.088 1.00 42.70  ? 327 LEU B CA  1 
ATOM   6645 C C   . LEU B 1 326 ? -5.974  -71.688 -17.075 1.00 45.88  ? 327 LEU B C   1 
ATOM   6646 O O   . LEU B 1 326 ? -5.709  -71.110 -18.128 1.00 49.15  ? 327 LEU B O   1 
ATOM   6647 C CB  . LEU B 1 326 ? -6.238  -74.100 -17.715 1.00 43.91  ? 327 LEU B CB  1 
ATOM   6648 C CG  . LEU B 1 326 ? -4.831  -74.528 -17.342 1.00 47.94  ? 327 LEU B CG  1 
ATOM   6649 C CD1 . LEU B 1 326 ? -4.734  -74.886 -15.902 1.00 44.14  ? 327 LEU B CD1 1 
ATOM   6650 C CD2 . LEU B 1 326 ? -4.504  -75.731 -18.190 1.00 44.13  ? 327 LEU B CD2 1 
ATOM   6651 N N   . VAL B 1 327 ? -5.556  -71.251 -15.889 1.00 42.23  ? 328 VAL B N   1 
ATOM   6652 C CA  . VAL B 1 327 ? -4.743  -70.041 -15.755 1.00 40.51  ? 328 VAL B CA  1 
ATOM   6653 C C   . VAL B 1 327 ? -3.598  -70.260 -14.779 1.00 42.61  ? 328 VAL B C   1 
ATOM   6654 O O   . VAL B 1 327 ? -3.682  -71.067 -13.843 1.00 45.30  ? 328 VAL B O   1 
ATOM   6655 C CB  . VAL B 1 327 ? -5.583  -68.814 -15.287 1.00 37.16  ? 328 VAL B CB  1 
ATOM   6656 C CG1 . VAL B 1 327 ? -6.741  -68.594 -16.240 1.00 36.35  ? 328 VAL B CG1 1 
ATOM   6657 C CG2 . VAL B 1 327 ? -6.103  -69.008 -13.852 1.00 37.44  ? 328 VAL B CG2 1 
ATOM   6658 N N   . GLY B 1 328 ? -2.514  -69.537 -14.987 1.00 40.49  ? 329 GLY B N   1 
ATOM   6659 C CA  . GLY B 1 328 ? -1.408  -69.687 -14.073 1.00 44.45  ? 329 GLY B CA  1 
ATOM   6660 C C   . GLY B 1 328 ? -0.339  -68.673 -14.323 1.00 43.99  ? 329 GLY B C   1 
ATOM   6661 O O   . GLY B 1 328 ? -0.470  -67.817 -15.203 1.00 41.76  ? 329 GLY B O   1 
ATOM   6662 N N   . VAL B 1 329 ? 0.715   -68.779 -13.526 1.00 43.11  ? 330 VAL B N   1 
ATOM   6663 C CA  . VAL B 1 329 ? 1.823   -67.850 -13.558 1.00 34.38  ? 330 VAL B CA  1 
ATOM   6664 C C   . VAL B 1 329 ? 3.072   -68.635 -13.208 1.00 42.08  ? 330 VAL B C   1 
ATOM   6665 O O   . VAL B 1 329 ? 2.975   -69.751 -12.673 1.00 45.02  ? 330 VAL B O   1 
ATOM   6666 C CB  . VAL B 1 329 ? 1.630   -66.702 -12.551 1.00 48.34  ? 330 VAL B CB  1 
ATOM   6667 C CG1 . VAL B 1 329 ? 0.402   -65.879 -12.887 1.00 36.07  ? 330 VAL B CG1 1 
ATOM   6668 C CG2 . VAL B 1 329 ? 1.504   -67.272 -11.137 1.00 38.01  ? 330 VAL B CG2 1 
ATOM   6669 N N   . VAL B 1 330 ? 4.238   -68.057 -13.481 1.00 34.81  ? 331 VAL B N   1 
ATOM   6670 C CA  . VAL B 1 330 ? 5.480   -68.634 -12.998 1.00 38.70  ? 331 VAL B CA  1 
ATOM   6671 C C   . VAL B 1 330 ? 5.773   -68.032 -11.610 1.00 49.31  ? 331 VAL B C   1 
ATOM   6672 O O   . VAL B 1 330 ? 5.164   -67.032 -11.197 1.00 42.15  ? 331 VAL B O   1 
ATOM   6673 C CB  . VAL B 1 330 ? 6.662   -68.385 -13.964 1.00 39.08  ? 331 VAL B CB  1 
ATOM   6674 C CG1 . VAL B 1 330 ? 6.360   -68.972 -15.344 1.00 41.74  ? 331 VAL B CG1 1 
ATOM   6675 C CG2 . VAL B 1 330 ? 6.976   -66.898 -14.071 1.00 38.44  ? 331 VAL B CG2 1 
ATOM   6676 N N   . LYS B 1 331 ? 6.711   -68.636 -10.900 1.00 49.84  ? 332 LYS B N   1 
ATOM   6677 C CA  . LYS B 1 331 ? 7.022   -68.221 -9.539  1.00 46.42  ? 332 LYS B CA  1 
ATOM   6678 C C   . LYS B 1 331 ? 7.598   -66.808 -9.471  1.00 51.01  ? 332 LYS B C   1 
ATOM   6679 O O   . LYS B 1 331 ? 7.267   -66.048 -8.564  1.00 48.46  ? 332 LYS B O   1 
ATOM   6680 C CB  . LYS B 1 331 ? 7.991   -69.218 -8.894  1.00 48.99  ? 332 LYS B CB  1 
ATOM   6681 C CG  . LYS B 1 331 ? 8.174   -69.025 -7.395  1.00 56.41  ? 332 LYS B CG  1 
ATOM   6682 C CD  . LYS B 1 331 ? 8.547   -70.333 -6.736  1.00 59.55  ? 332 LYS B CD  1 
ATOM   6683 C CE  . LYS B 1 331 ? 9.883   -70.247 -6.037  1.00 70.77  ? 332 LYS B CE  1 
ATOM   6684 N NZ  . LYS B 1 331 ? 9.876   -69.238 -4.938  1.00 64.64  ? 332 LYS B NZ  1 
ATOM   6685 N N   . ASP B 1 332 ? 8.434   -66.430 -10.435 1.00 52.28  ? 333 ASP B N   1 
ATOM   6686 C CA  . ASP B 1 332 ? 9.018   -65.085 -10.402 1.00 37.91  ? 333 ASP B CA  1 
ATOM   6687 C C   . ASP B 1 332 ? 8.735   -64.271 -11.671 1.00 49.69  ? 333 ASP B C   1 
ATOM   6688 O O   . ASP B 1 332 ? 9.609   -64.062 -12.511 1.00 51.57  ? 333 ASP B O   1 
ATOM   6689 C CB  . ASP B 1 332 ? 10.519  -65.189 -10.143 1.00 44.60  ? 333 ASP B CB  1 
ATOM   6690 C CG  . ASP B 1 332 ? 10.833  -65.916 -8.819  1.00 59.07  ? 333 ASP B CG  1 
ATOM   6691 O OD1 . ASP B 1 332 ? 10.983  -65.234 -7.772  1.00 70.26  ? 333 ASP B OD1 1 
ATOM   6692 O OD2 . ASP B 1 332 ? 10.912  -67.172 -8.832  1.00 53.11  ? 333 ASP B OD2 1 
ATOM   6693 N N   . GLU B 1 333 ? 7.505   -63.781 -11.779 1.00 42.64  ? 334 GLU B N   1 
ATOM   6694 C CA  . GLU B 1 333 ? 7.059   -63.055 -12.955 1.00 44.47  ? 334 GLU B CA  1 
ATOM   6695 C C   . GLU B 1 333 ? 7.839   -61.786 -13.229 1.00 54.37  ? 334 GLU B C   1 
ATOM   6696 O O   . GLU B 1 333 ? 8.031   -61.410 -14.397 1.00 44.49  ? 334 GLU B O   1 
ATOM   6697 C CB  . GLU B 1 333 ? 5.576   -62.727 -12.826 1.00 35.68  ? 334 GLU B CB  1 
ATOM   6698 C CG  . GLU B 1 333 ? 4.678   -63.950 -12.947 1.00 45.40  ? 334 GLU B CG  1 
ATOM   6699 C CD  . GLU B 1 333 ? 4.597   -64.488 -14.393 1.00 51.27  ? 334 GLU B CD  1 
ATOM   6700 O OE1 . GLU B 1 333 ? 5.244   -63.909 -15.299 1.00 47.17  ? 334 GLU B OE1 1 
ATOM   6701 O OE2 . GLU B 1 333 ? 3.876   -65.488 -14.622 1.00 47.43  ? 334 GLU B OE2 1 
ATOM   6702 N N   . GLY B 1 334 ? 8.317   -61.145 -12.164 1.00 43.89  ? 335 GLY B N   1 
ATOM   6703 C CA  . GLY B 1 334 ? 8.864   -59.806 -12.268 1.00 37.11  ? 335 GLY B CA  1 
ATOM   6704 C C   . GLY B 1 334 ? 10.335  -59.684 -12.613 1.00 48.37  ? 335 GLY B C   1 
ATOM   6705 O O   . GLY B 1 334 ? 10.750  -58.700 -13.237 1.00 47.57  ? 335 GLY B O   1 
ATOM   6706 N N   . SER B 1 335 ? 11.121  -60.681 -12.214 1.00 47.20  ? 336 SER B N   1 
ATOM   6707 C CA  . SER B 1 335 ? 12.586  -60.612 -12.304 1.00 51.41  ? 336 SER B CA  1 
ATOM   6708 C C   . SER B 1 335 ? 13.124  -60.367 -13.717 1.00 54.89  ? 336 SER B C   1 
ATOM   6709 O O   . SER B 1 335 ? 13.996  -59.516 -13.910 1.00 49.64  ? 336 SER B O   1 
ATOM   6710 C CB  . SER B 1 335 ? 13.194  -61.897 -11.749 1.00 52.50  ? 336 SER B CB  1 
ATOM   6711 O OG  . SER B 1 335 ? 12.767  -63.016 -12.508 1.00 52.53  ? 336 SER B OG  1 
ATOM   6712 N N   . TYR B 1 336 ? 12.602  -61.109 -14.695 1.00 50.66  ? 337 TYR B N   1 
ATOM   6713 C CA  . TYR B 1 336 ? 13.002  -60.959 -16.096 1.00 52.13  ? 337 TYR B CA  1 
ATOM   6714 C C   . TYR B 1 336 ? 12.993  -59.501 -16.526 1.00 60.02  ? 337 TYR B C   1 
ATOM   6715 O O   . TYR B 1 336 ? 13.961  -59.019 -17.114 1.00 56.10  ? 337 TYR B O   1 
ATOM   6716 C CB  . TYR B 1 336 ? 12.076  -61.781 -17.009 1.00 62.35  ? 337 TYR B CB  1 
ATOM   6717 C CG  . TYR B 1 336 ? 12.388  -61.726 -18.499 1.00 55.49  ? 337 TYR B CG  1 
ATOM   6718 C CD1 . TYR B 1 336 ? 13.354  -62.557 -19.054 1.00 71.14  ? 337 TYR B CD1 1 
ATOM   6719 C CD2 . TYR B 1 336 ? 11.690  -60.868 -19.358 1.00 64.61  ? 337 TYR B CD2 1 
ATOM   6720 C CE1 . TYR B 1 336 ? 13.639  -62.529 -20.429 1.00 78.10  ? 337 TYR B CE1 1 
ATOM   6721 C CE2 . TYR B 1 336 ? 11.971  -60.826 -20.735 1.00 68.56  ? 337 TYR B CE2 1 
ATOM   6722 C CZ  . TYR B 1 336 ? 12.951  -61.660 -21.268 1.00 81.79  ? 337 TYR B CZ  1 
ATOM   6723 O OH  . TYR B 1 336 ? 13.252  -61.641 -22.629 1.00 81.26  ? 337 TYR B OH  1 
ATOM   6724 N N   . PHE B 1 337 ? 11.912  -58.794 -16.206 1.00 45.37  ? 338 PHE B N   1 
ATOM   6725 C CA  . PHE B 1 337 ? 11.721  -57.438 -16.716 1.00 54.04  ? 338 PHE B CA  1 
ATOM   6726 C C   . PHE B 1 337 ? 12.662  -56.391 -16.129 1.00 55.41  ? 338 PHE B C   1 
ATOM   6727 O O   . PHE B 1 337 ? 12.884  -55.344 -16.748 1.00 54.62  ? 338 PHE B O   1 
ATOM   6728 C CB  . PHE B 1 337 ? 10.273  -57.013 -16.496 1.00 50.76  ? 338 PHE B CB  1 
ATOM   6729 C CG  . PHE B 1 337 ? 9.291   -57.935 -17.140 1.00 53.68  ? 338 PHE B CG  1 
ATOM   6730 C CD1 . PHE B 1 337 ? 9.190   -57.993 -18.528 1.00 64.45  ? 338 PHE B CD1 1 
ATOM   6731 C CD2 . PHE B 1 337 ? 8.500   -58.777 -16.375 1.00 58.57  ? 338 PHE B CD2 1 
ATOM   6732 C CE1 . PHE B 1 337 ? 8.302   -58.852 -19.146 1.00 54.54  ? 338 PHE B CE1 1 
ATOM   6733 C CE2 . PHE B 1 337 ? 7.610   -59.648 -16.982 1.00 53.89  ? 338 PHE B CE2 1 
ATOM   6734 C CZ  . PHE B 1 337 ? 7.506   -59.677 -18.373 1.00 58.98  ? 338 PHE B CZ  1 
ATOM   6735 N N   . LEU B 1 338 ? 13.240  -56.687 -14.966 1.00 50.82  ? 339 LEU B N   1 
ATOM   6736 C CA  . LEU B 1 338 ? 14.039  -55.704 -14.236 1.00 56.30  ? 339 LEU B CA  1 
ATOM   6737 C C   . LEU B 1 338 ? 15.375  -55.380 -14.904 1.00 62.59  ? 339 LEU B C   1 
ATOM   6738 O O   . LEU B 1 338 ? 15.852  -54.245 -14.812 1.00 60.04  ? 339 LEU B O   1 
ATOM   6739 C CB  . LEU B 1 338 ? 14.276  -56.185 -12.800 1.00 56.88  ? 339 LEU B CB  1 
ATOM   6740 C CG  . LEU B 1 338 ? 12.979  -56.118 -11.997 1.00 55.67  ? 339 LEU B CG  1 
ATOM   6741 C CD1 . LEU B 1 338 ? 13.180  -56.589 -10.560 1.00 50.31  ? 339 LEU B CD1 1 
ATOM   6742 C CD2 . LEU B 1 338 ? 12.392  -54.699 -12.054 1.00 55.19  ? 339 LEU B CD2 1 
ATOM   6743 N N   . VAL B 1 339 ? 15.974  -56.350 -15.594 1.00 64.34  ? 340 VAL B N   1 
ATOM   6744 C CA  . VAL B 1 339 ? 17.242  -56.076 -16.273 1.00 66.23  ? 340 VAL B CA  1 
ATOM   6745 C C   . VAL B 1 339 ? 17.057  -55.281 -17.557 1.00 58.44  ? 340 VAL B C   1 
ATOM   6746 O O   . VAL B 1 339 ? 18.027  -54.920 -18.211 1.00 67.32  ? 340 VAL B O   1 
ATOM   6747 C CB  . VAL B 1 339 ? 18.007  -57.358 -16.600 1.00 65.09  ? 340 VAL B CB  1 
ATOM   6748 C CG1 . VAL B 1 339 ? 18.390  -58.044 -15.312 1.00 62.56  ? 340 VAL B CG1 1 
ATOM   6749 C CG2 . VAL B 1 339 ? 17.181  -58.267 -17.491 1.00 63.14  ? 340 VAL B CG2 1 
ATOM   6750 N N   . TYR B 1 340 ? 15.814  -54.980 -17.903 1.00 60.35  ? 341 TYR B N   1 
ATOM   6751 C CA  . TYR B 1 340 ? 15.551  -54.137 -19.064 1.00 66.19  ? 341 TYR B CA  1 
ATOM   6752 C C   . TYR B 1 340 ? 15.261  -52.700 -18.682 1.00 73.47  ? 341 TYR B C   1 
ATOM   6753 O O   . TYR B 1 340 ? 14.342  -52.096 -19.229 1.00 74.67  ? 341 TYR B O   1 
ATOM   6754 C CB  . TYR B 1 340 ? 14.379  -54.685 -19.871 1.00 53.02  ? 341 TYR B CB  1 
ATOM   6755 C CG  . TYR B 1 340 ? 14.734  -55.918 -20.642 1.00 56.80  ? 341 TYR B CG  1 
ATOM   6756 C CD1 . TYR B 1 340 ? 14.798  -57.157 -20.016 1.00 56.61  ? 341 TYR B CD1 1 
ATOM   6757 C CD2 . TYR B 1 340 ? 15.013  -55.850 -22.003 1.00 64.91  ? 341 TYR B CD2 1 
ATOM   6758 C CE1 . TYR B 1 340 ? 15.129  -58.302 -20.719 1.00 66.55  ? 341 TYR B CE1 1 
ATOM   6759 C CE2 . TYR B 1 340 ? 15.345  -56.989 -22.719 1.00 68.00  ? 341 TYR B CE2 1 
ATOM   6760 C CZ  . TYR B 1 340 ? 15.407  -58.212 -22.073 1.00 70.71  ? 341 TYR B CZ  1 
ATOM   6761 O OH  . TYR B 1 340 ? 15.735  -59.347 -22.781 1.00 74.41  ? 341 TYR B OH  1 
ATOM   6762 N N   . GLY B 1 341 ? 16.017  -52.145 -17.741 1.00 72.03  ? 342 GLY B N   1 
ATOM   6763 C CA  . GLY B 1 341 ? 15.837  -50.739 -17.431 1.00 60.83  ? 342 GLY B CA  1 
ATOM   6764 C C   . GLY B 1 341 ? 15.990  -50.314 -15.990 1.00 72.09  ? 342 GLY B C   1 
ATOM   6765 O O   . GLY B 1 341 ? 16.493  -49.221 -15.734 1.00 74.13  ? 342 GLY B O   1 
ATOM   6766 N N   . ALA B 1 342 ? 15.550  -51.152 -15.051 1.00 74.59  ? 343 ALA B N   1 
ATOM   6767 C CA  . ALA B 1 342 ? 15.578  -50.774 -13.641 1.00 62.14  ? 343 ALA B CA  1 
ATOM   6768 C C   . ALA B 1 342 ? 17.018  -50.546 -13.189 1.00 69.91  ? 343 ALA B C   1 
ATOM   6769 O O   . ALA B 1 342 ? 17.891  -51.389 -13.435 1.00 62.47  ? 343 ALA B O   1 
ATOM   6770 C CB  . ALA B 1 342 ? 14.899  -51.831 -12.771 1.00 57.63  ? 343 ALA B CB  1 
ATOM   6771 N N   . PRO B 1 343 ? 17.266  -49.394 -12.540 1.00 67.58  ? 344 PRO B N   1 
ATOM   6772 C CA  . PRO B 1 343 ? 18.606  -49.007 -12.091 1.00 65.03  ? 344 PRO B CA  1 
ATOM   6773 C C   . PRO B 1 343 ? 19.183  -50.027 -11.130 1.00 67.92  ? 344 PRO B C   1 
ATOM   6774 O O   . PRO B 1 343 ? 18.478  -50.455 -10.214 1.00 67.60  ? 344 PRO B O   1 
ATOM   6775 C CB  . PRO B 1 343 ? 18.375  -47.662 -11.392 1.00 67.31  ? 344 PRO B CB  1 
ATOM   6776 C CG  . PRO B 1 343 ? 16.928  -47.664 -11.017 1.00 71.58  ? 344 PRO B CG  1 
ATOM   6777 C CD  . PRO B 1 343 ? 16.243  -48.420 -12.124 1.00 69.82  ? 344 PRO B CD  1 
ATOM   6778 N N   . GLY B 1 344 ? 20.432  -50.425 -11.356 1.00 62.31  ? 345 GLY B N   1 
ATOM   6779 C CA  . GLY B 1 344 ? 21.108  -51.370 -10.490 1.00 59.24  ? 345 GLY B CA  1 
ATOM   6780 C C   . GLY B 1 344 ? 20.969  -52.828 -10.894 1.00 66.46  ? 345 GLY B C   1 
ATOM   6781 O O   . GLY B 1 344 ? 21.599  -53.699 -10.297 1.00 64.89  ? 345 GLY B O   1 
ATOM   6782 N N   . PHE B 1 345 ? 20.152  -53.107 -11.904 1.00 67.70  ? 346 PHE B N   1 
ATOM   6783 C CA  . PHE B 1 345 ? 19.923  -54.490 -12.312 1.00 66.12  ? 346 PHE B CA  1 
ATOM   6784 C C   . PHE B 1 345 ? 20.786  -54.929 -13.486 1.00 64.86  ? 346 PHE B C   1 
ATOM   6785 O O   . PHE B 1 345 ? 21.016  -54.167 -14.429 1.00 68.04  ? 346 PHE B O   1 
ATOM   6786 C CB  . PHE B 1 345 ? 18.447  -54.701 -12.642 1.00 58.89  ? 346 PHE B CB  1 
ATOM   6787 C CG  . PHE B 1 345 ? 17.589  -54.850 -11.429 1.00 64.25  ? 346 PHE B CG  1 
ATOM   6788 C CD1 . PHE B 1 345 ? 17.098  -53.735 -10.773 1.00 58.96  ? 346 PHE B CD1 1 
ATOM   6789 C CD2 . PHE B 1 345 ? 17.304  -56.109 -10.920 1.00 58.80  ? 346 PHE B CD2 1 
ATOM   6790 C CE1 . PHE B 1 345 ? 16.311  -53.874 -9.633  1.00 63.61  ? 346 PHE B CE1 1 
ATOM   6791 C CE2 . PHE B 1 345 ? 16.524  -56.259 -9.796  1.00 59.21  ? 346 PHE B CE2 1 
ATOM   6792 C CZ  . PHE B 1 345 ? 16.025  -55.133 -9.142  1.00 57.70  ? 346 PHE B CZ  1 
ATOM   6793 N N   . SER B 1 346 ? 21.270  -56.164 -13.402 1.00 69.44  ? 347 SER B N   1 
ATOM   6794 C CA  . SER B 1 346 ? 21.982  -56.812 -14.496 1.00 68.25  ? 347 SER B CA  1 
ATOM   6795 C C   . SER B 1 346 ? 21.859  -58.326 -14.358 1.00 69.31  ? 347 SER B C   1 
ATOM   6796 O O   . SER B 1 346 ? 21.707  -58.844 -13.251 1.00 64.10  ? 347 SER B O   1 
ATOM   6797 C CB  . SER B 1 346 ? 23.454  -56.396 -14.520 1.00 65.48  ? 347 SER B CB  1 
ATOM   6798 O OG  . SER B 1 346 ? 24.193  -57.213 -15.412 1.00 74.53  ? 347 SER B OG  1 
ATOM   6799 N N   . LYS B 1 347 ? 21.910  -59.045 -15.475 1.00 65.04  ? 348 LYS B N   1 
ATOM   6800 C CA  . LYS B 1 347 ? 21.881  -60.500 -15.389 1.00 60.77  ? 348 LYS B CA  1 
ATOM   6801 C C   . LYS B 1 347 ? 23.237  -60.981 -14.882 1.00 63.81  ? 348 LYS B C   1 
ATOM   6802 O O   . LYS B 1 347 ? 23.361  -62.091 -14.356 1.00 62.33  ? 348 LYS B O   1 
ATOM   6803 C CB  . LYS B 1 347 ? 21.535  -61.135 -16.742 1.00 68.32  ? 348 LYS B CB  1 
ATOM   6804 C CG  . LYS B 1 347 ? 22.700  -61.259 -17.709 1.00 63.84  ? 348 LYS B CG  1 
ATOM   6805 C CD  . LYS B 1 347 ? 22.273  -61.933 -19.012 1.00 70.74  ? 348 LYS B CD  1 
ATOM   6806 C CE  . LYS B 1 347 ? 23.474  -62.262 -19.898 1.00 55.62  ? 348 LYS B CE  1 
ATOM   6807 N NZ  . LYS B 1 347 ? 24.379  -63.267 -19.236 1.00 58.15  ? 348 LYS B NZ  1 
ATOM   6808 N N   . ASP B 1 348 ? 24.239  -60.110 -15.000 1.00 62.09  ? 349 ASP B N   1 
ATOM   6809 C CA  . ASP B 1 348 ? 25.630  -60.486 -14.755 1.00 74.65  ? 349 ASP B CA  1 
ATOM   6810 C C   . ASP B 1 348 ? 26.192  -60.118 -13.379 1.00 75.67  ? 349 ASP B C   1 
ATOM   6811 O O   . ASP B 1 348 ? 27.391  -60.281 -13.140 1.00 77.87  ? 349 ASP B O   1 
ATOM   6812 C CB  . ASP B 1 348 ? 26.512  -59.874 -15.842 1.00 79.61  ? 349 ASP B CB  1 
ATOM   6813 C CG  . ASP B 1 348 ? 26.235  -60.470 -17.211 1.00 73.94  ? 349 ASP B CG  1 
ATOM   6814 O OD1 . ASP B 1 348 ? 26.034  -61.706 -17.281 1.00 64.45  ? 349 ASP B OD1 1 
ATOM   6815 O OD2 . ASP B 1 348 ? 26.200  -59.702 -18.199 1.00 70.73  ? 349 ASP B OD2 1 
ATOM   6816 N N   . ASN B 1 349 ? 25.343  -59.611 -12.488 1.00 75.94  ? 350 ASN B N   1 
ATOM   6817 C CA  . ASN B 1 349 ? 25.693  -59.534 -11.068 1.00 72.84  ? 350 ASN B CA  1 
ATOM   6818 C C   . ASN B 1 349 ? 24.456  -59.812 -10.229 1.00 72.37  ? 350 ASN B C   1 
ATOM   6819 O O   . ASN B 1 349 ? 23.446  -60.307 -10.746 1.00 70.54  ? 350 ASN B O   1 
ATOM   6820 C CB  . ASN B 1 349 ? 26.347  -58.186 -10.696 1.00 61.29  ? 350 ASN B CB  1 
ATOM   6821 C CG  . ASN B 1 349 ? 25.436  -56.972 -10.897 1.00 63.46  ? 350 ASN B CG  1 
ATOM   6822 O OD1 . ASN B 1 349 ? 24.224  -57.037 -10.727 1.00 70.96  ? 350 ASN B OD1 1 
ATOM   6823 N ND2 . ASN B 1 349 ? 26.049  -55.842 -11.253 1.00 75.29  ? 350 ASN B ND2 1 
ATOM   6824 N N   . GLU B 1 350 ? 24.529  -59.497 -8.944  1.00 61.60  ? 351 GLU B N   1 
ATOM   6825 C CA  . GLU B 1 350 ? 23.509  -59.955 -8.014  1.00 69.70  ? 351 GLU B CA  1 
ATOM   6826 C C   . GLU B 1 350 ? 22.340  -58.984 -7.949  1.00 61.33  ? 351 GLU B C   1 
ATOM   6827 O O   . GLU B 1 350 ? 21.286  -59.305 -7.397  1.00 65.25  ? 351 GLU B O   1 
ATOM   6828 C CB  . GLU B 1 350 ? 24.121  -60.180 -6.626  1.00 61.35  ? 351 GLU B CB  1 
ATOM   6829 C CG  . GLU B 1 350 ? 24.886  -61.493 -6.520  1.00 61.82  ? 351 GLU B CG  1 
ATOM   6830 C CD  . GLU B 1 350 ? 24.068  -62.675 -7.036  1.00 90.32  ? 351 GLU B CD  1 
ATOM   6831 O OE1 . GLU B 1 350 ? 24.258  -63.068 -8.214  1.00 94.18  ? 351 GLU B OE1 1 
ATOM   6832 O OE2 . GLU B 1 350 ? 23.228  -63.206 -6.269  1.00 80.83  ? 351 GLU B OE2 1 
ATOM   6833 N N   . SER B 1 351 ? 22.534  -57.806 -8.529  1.00 51.92  ? 352 SER B N   1 
ATOM   6834 C CA  . SER B 1 351 ? 21.496  -56.784 -8.579  1.00 61.18  ? 352 SER B CA  1 
ATOM   6835 C C   . SER B 1 351 ? 21.024  -56.389 -7.178  1.00 64.35  ? 352 SER B C   1 
ATOM   6836 O O   . SER B 1 351 ? 19.844  -56.127 -6.967  1.00 59.45  ? 352 SER B O   1 
ATOM   6837 C CB  . SER B 1 351 ? 20.301  -57.258 -9.424  1.00 54.17  ? 352 SER B CB  1 
ATOM   6838 O OG  . SER B 1 351 ? 20.643  -57.380 -10.793 1.00 61.78  ? 352 SER B OG  1 
ATOM   6839 N N   . LEU B 1 352 ? 21.952  -56.355 -6.227  1.00 62.55  ? 353 LEU B N   1 
ATOM   6840 C CA  . LEU B 1 352 ? 21.659  -55.912 -4.871  1.00 56.97  ? 353 LEU B CA  1 
ATOM   6841 C C   . LEU B 1 352 ? 21.465  -54.396 -4.865  1.00 57.18  ? 353 LEU B C   1 
ATOM   6842 O O   . LEU B 1 352 ? 22.424  -53.641 -4.771  1.00 73.86  ? 353 LEU B O   1 
ATOM   6843 C CB  . LEU B 1 352 ? 22.784  -56.340 -3.925  1.00 52.37  ? 353 LEU B CB  1 
ATOM   6844 C CG  . LEU B 1 352 ? 23.005  -57.857 -3.974  1.00 55.60  ? 353 LEU B CG  1 
ATOM   6845 C CD1 . LEU B 1 352 ? 24.229  -58.287 -3.194  1.00 58.32  ? 353 LEU B CD1 1 
ATOM   6846 C CD2 . LEU B 1 352 ? 21.776  -58.600 -3.465  1.00 55.76  ? 353 LEU B CD2 1 
ATOM   6847 N N   . ILE B 1 353 ? 20.220  -53.949 -4.984  1.00 56.20  ? 354 ILE B N   1 
ATOM   6848 C CA  . ILE B 1 353 ? 19.945  -52.525 -5.153  1.00 56.66  ? 354 ILE B CA  1 
ATOM   6849 C C   . ILE B 1 353 ? 19.839  -51.774 -3.828  1.00 57.01  ? 354 ILE B C   1 
ATOM   6850 O O   . ILE B 1 353 ? 19.611  -52.365 -2.768  1.00 45.98  ? 354 ILE B O   1 
ATOM   6851 C CB  . ILE B 1 353 ? 18.638  -52.288 -5.958  1.00 53.95  ? 354 ILE B CB  1 
ATOM   6852 C CG1 . ILE B 1 353 ? 17.462  -53.026 -5.311  1.00 48.69  ? 354 ILE B CG1 1 
ATOM   6853 C CG2 . ILE B 1 353 ? 18.816  -52.761 -7.394  1.00 60.96  ? 354 ILE B CG2 1 
ATOM   6854 C CD1 . ILE B 1 353 ? 16.098  -52.605 -5.837  1.00 46.22  ? 354 ILE B CD1 1 
ATOM   6855 N N   . SER B 1 354 ? 20.008  -50.461 -3.923  1.00 58.71  ? 355 SER B N   1 
ATOM   6856 C CA  . SER B 1 354 ? 19.833  -49.542 -2.806  1.00 62.00  ? 355 SER B CA  1 
ATOM   6857 C C   . SER B 1 354 ? 18.378  -49.117 -2.667  1.00 64.49  ? 355 SER B C   1 
ATOM   6858 O O   . SER B 1 354 ? 17.561  -49.311 -3.575  1.00 61.92  ? 355 SER B O   1 
ATOM   6859 C CB  . SER B 1 354 ? 20.704  -48.296 -3.000  1.00 66.17  ? 355 SER B CB  1 
ATOM   6860 O OG  . SER B 1 354 ? 20.217  -47.487 -4.067  1.00 62.92  ? 355 SER B OG  1 
ATOM   6861 N N   . ARG B 1 355 ? 18.069  -48.491 -1.543  1.00 55.93  ? 356 ARG B N   1 
ATOM   6862 C CA  . ARG B 1 355 ? 16.720  -48.008 -1.311  1.00 59.60  ? 356 ARG B CA  1 
ATOM   6863 C C   . ARG B 1 355 ? 16.357  -46.944 -2.331  1.00 57.62  ? 356 ARG B C   1 
ATOM   6864 O O   . ARG B 1 355 ? 15.226  -46.884 -2.801  1.00 67.50  ? 356 ARG B O   1 
ATOM   6865 C CB  . ARG B 1 355 ? 16.580  -47.457 0.105   1.00 60.39  ? 356 ARG B CB  1 
ATOM   6866 C CG  . ARG B 1 355 ? 15.258  -46.780 0.340   1.00 53.45  ? 356 ARG B CG  1 
ATOM   6867 C CD  . ARG B 1 355 ? 14.494  -47.459 1.440   1.00 68.12  ? 356 ARG B CD  1 
ATOM   6868 N NE  . ARG B 1 355 ? 13.115  -46.998 1.497   1.00 58.05  ? 356 ARG B NE  1 
ATOM   6869 C CZ  . ARG B 1 355 ? 12.082  -47.818 1.616   1.00 55.62  ? 356 ARG B CZ  1 
ATOM   6870 N NH1 . ARG B 1 355 ? 12.292  -49.128 1.691   1.00 49.04  ? 356 ARG B NH1 1 
ATOM   6871 N NH2 . ARG B 1 355 ? 10.849  -47.331 1.655   1.00 49.21  ? 356 ARG B NH2 1 
ATOM   6872 N N   . ALA B 1 356 ? 17.319  -46.107 -2.692  1.00 59.18  ? 357 ALA B N   1 
ATOM   6873 C CA  . ALA B 1 356 ? 17.027  -45.052 -3.650  1.00 59.20  ? 357 ALA B CA  1 
ATOM   6874 C C   . ALA B 1 356 ? 16.825  -45.649 -5.048  1.00 59.53  ? 357 ALA B C   1 
ATOM   6875 O O   . ALA B 1 356 ? 16.037  -45.135 -5.844  1.00 60.12  ? 357 ALA B O   1 
ATOM   6876 C CB  . ALA B 1 356 ? 18.135  -44.015 -3.650  1.00 53.26  ? 357 ALA B CB  1 
ATOM   6877 N N   . GLU B 1 357 ? 17.535  -46.745 -5.326  1.00 63.44  ? 358 GLU B N   1 
ATOM   6878 C CA  . GLU B 1 357 ? 17.366  -47.506 -6.570  1.00 67.02  ? 358 GLU B CA  1 
ATOM   6879 C C   . GLU B 1 357 ? 16.011  -48.224 -6.587  1.00 60.52  ? 358 GLU B C   1 
ATOM   6880 O O   . GLU B 1 357 ? 15.381  -48.346 -7.633  1.00 57.06  ? 358 GLU B O   1 
ATOM   6881 C CB  . GLU B 1 357 ? 18.512  -48.518 -6.756  1.00 67.90  ? 358 GLU B CB  1 
ATOM   6882 C CG  . GLU B 1 357 ? 19.827  -47.926 -7.323  1.00 67.60  ? 358 GLU B CG  1 
ATOM   6883 C CD  . GLU B 1 357 ? 21.000  -48.929 -7.328  1.00 78.31  ? 358 GLU B CD  1 
ATOM   6884 O OE1 . GLU B 1 357 ? 21.106  -49.733 -6.376  1.00 76.82  ? 358 GLU B OE1 1 
ATOM   6885 O OE2 . GLU B 1 357 ? 21.821  -48.914 -8.284  1.00 73.23  ? 358 GLU B OE2 1 
ATOM   6886 N N   . PHE B 1 358 ? 15.566  -48.686 -5.419  1.00 57.25  ? 359 PHE B N   1 
ATOM   6887 C CA  . PHE B 1 358 ? 14.262  -49.323 -5.274  1.00 43.93  ? 359 PHE B CA  1 
ATOM   6888 C C   . PHE B 1 358 ? 13.143  -48.349 -5.575  1.00 54.10  ? 359 PHE B C   1 
ATOM   6889 O O   . PHE B 1 358 ? 12.213  -48.681 -6.321  1.00 50.26  ? 359 PHE B O   1 
ATOM   6890 C CB  . PHE B 1 358 ? 14.103  -49.894 -3.863  1.00 52.99  ? 359 PHE B CB  1 
ATOM   6891 C CG  . PHE B 1 358 ? 12.713  -50.372 -3.536  1.00 51.31  ? 359 PHE B CG  1 
ATOM   6892 C CD1 . PHE B 1 358 ? 12.249  -51.591 -4.013  1.00 53.90  ? 359 PHE B CD1 1 
ATOM   6893 C CD2 . PHE B 1 358 ? 11.884  -49.623 -2.713  1.00 54.75  ? 359 PHE B CD2 1 
ATOM   6894 C CE1 . PHE B 1 358 ? 10.980  -52.037 -3.694  1.00 45.94  ? 359 PHE B CE1 1 
ATOM   6895 C CE2 . PHE B 1 358 ? 10.613  -50.063 -2.387  1.00 43.21  ? 359 PHE B CE2 1 
ATOM   6896 C CZ  . PHE B 1 358 ? 10.162  -51.268 -2.874  1.00 55.45  ? 359 PHE B CZ  1 
ATOM   6897 N N   . LEU B 1 359 ? 13.230  -47.146 -5.008  1.00 57.10  ? 360 LEU B N   1 
ATOM   6898 C CA  . LEU B 1 359 ? 12.194  -46.136 -5.207  1.00 55.24  ? 360 LEU B CA  1 
ATOM   6899 C C   . LEU B 1 359 ? 12.139  -45.751 -6.673  1.00 57.53  ? 360 LEU B C   1 
ATOM   6900 O O   . LEU B 1 359 ? 11.058  -45.590 -7.245  1.00 68.18  ? 360 LEU B O   1 
ATOM   6901 C CB  . LEU B 1 359 ? 12.440  -44.898 -4.336  1.00 54.01  ? 360 LEU B CB  1 
ATOM   6902 C CG  . LEU B 1 359 ? 12.566  -45.124 -2.814  1.00 73.50  ? 360 LEU B CG  1 
ATOM   6903 C CD1 . LEU B 1 359 ? 12.743  -43.818 -2.041  1.00 66.19  ? 360 LEU B CD1 1 
ATOM   6904 C CD2 . LEU B 1 359 ? 11.398  -45.927 -2.232  1.00 62.79  ? 360 LEU B CD2 1 
ATOM   6905 N N   . ALA B 1 360 ? 13.309  -45.632 -7.290  1.00 60.13  ? 361 ALA B N   1 
ATOM   6906 C CA  . ALA B 1 360 ? 13.372  -45.291 -8.707  1.00 67.72  ? 361 ALA B CA  1 
ATOM   6907 C C   . ALA B 1 360 ? 12.802  -46.422 -9.570  1.00 64.46  ? 361 ALA B C   1 
ATOM   6908 O O   . ALA B 1 360 ? 12.134  -46.180 -10.573 1.00 69.64  ? 361 ALA B O   1 
ATOM   6909 C CB  . ALA B 1 360 ? 14.804  -44.972 -9.113  1.00 58.48  ? 361 ALA B CB  1 
ATOM   6910 N N   . GLY B 1 361 ? 13.071  -47.659 -9.165  1.00 64.78  ? 362 GLY B N   1 
ATOM   6911 C CA  . GLY B 1 361 ? 12.562  -48.824 -9.863  1.00 54.67  ? 362 GLY B CA  1 
ATOM   6912 C C   . GLY B 1 361 ? 11.050  -48.927 -9.830  1.00 55.80  ? 362 GLY B C   1 
ATOM   6913 O O   . GLY B 1 361 ? 10.446  -49.407 -10.784 1.00 58.78  ? 362 GLY B O   1 
ATOM   6914 N N   . VAL B 1 362 ? 10.430  -48.472 -8.747  1.00 56.31  ? 363 VAL B N   1 
ATOM   6915 C CA  . VAL B 1 362 ? 8.979   -48.529 -8.654  1.00 56.78  ? 363 VAL B CA  1 
ATOM   6916 C C   . VAL B 1 362 ? 8.316   -47.676 -9.756  1.00 55.41  ? 363 VAL B C   1 
ATOM   6917 O O   . VAL B 1 362 ? 7.282   -48.064 -10.310 1.00 56.34  ? 363 VAL B O   1 
ATOM   6918 C CB  . VAL B 1 362 ? 8.476   -48.076 -7.251  1.00 59.39  ? 363 VAL B CB  1 
ATOM   6919 C CG1 . VAL B 1 362 ? 6.985   -47.974 -7.236  1.00 51.42  ? 363 VAL B CG1 1 
ATOM   6920 C CG2 . VAL B 1 362 ? 8.907   -49.045 -6.175  1.00 48.47  ? 363 VAL B CG2 1 
ATOM   6921 N N   . ARG B 1 363 ? 8.910   -46.527 -10.077 1.00 59.34  ? 364 ARG B N   1 
ATOM   6922 C CA  . ARG B 1 363 ? 8.316   -45.614 -11.058 1.00 68.57  ? 364 ARG B CA  1 
ATOM   6923 C C   . ARG B 1 363 ? 8.432   -46.203 -12.455 1.00 61.36  ? 364 ARG B C   1 
ATOM   6924 O O   . ARG B 1 363 ? 7.576   -46.003 -13.300 1.00 65.08  ? 364 ARG B O   1 
ATOM   6925 C CB  . ARG B 1 363 ? 8.981   -44.226 -11.035 1.00 67.08  ? 364 ARG B CB  1 
ATOM   6926 C CG  . ARG B 1 363 ? 8.960   -43.477 -9.703  1.00 70.23  ? 364 ARG B CG  1 
ATOM   6927 C CD  . ARG B 1 363 ? 7.595   -43.494 -8.995  1.00 84.77  ? 364 ARG B CD  1 
ATOM   6928 N NE  . ARG B 1 363 ? 6.545   -42.678 -9.622  1.00 91.25  ? 364 ARG B NE  1 
ATOM   6929 C CZ  . ARG B 1 363 ? 6.180   -41.461 -9.212  1.00 84.02  ? 364 ARG B CZ  1 
ATOM   6930 N NH1 . ARG B 1 363 ? 6.797   -40.891 -8.181  1.00 85.05  ? 364 ARG B NH1 1 
ATOM   6931 N NH2 . ARG B 1 363 ? 5.196   -40.811 -9.833  1.00 75.18  ? 364 ARG B NH2 1 
ATOM   6932 N N   . VAL B 1 364 ? 9.511   -46.934 -12.679 1.00 64.61  ? 365 VAL B N   1 
ATOM   6933 C CA  . VAL B 1 364 ? 9.763   -47.559 -13.962 1.00 66.51  ? 365 VAL B CA  1 
ATOM   6934 C C   . VAL B 1 364 ? 8.925   -48.829 -14.121 1.00 69.94  ? 365 VAL B C   1 
ATOM   6935 O O   . VAL B 1 364 ? 8.435   -49.125 -15.210 1.00 67.12  ? 365 VAL B O   1 
ATOM   6936 C CB  . VAL B 1 364 ? 11.263  -47.879 -14.120 1.00 66.07  ? 365 VAL B CB  1 
ATOM   6937 C CG1 . VAL B 1 364 ? 11.490  -48.799 -15.276 1.00 70.25  ? 365 VAL B CG1 1 
ATOM   6938 C CG2 . VAL B 1 364 ? 12.045  -46.599 -14.314 1.00 67.09  ? 365 VAL B CG2 1 
ATOM   6939 N N   . GLY B 1 365 ? 8.735   -49.561 -13.024 1.00 61.17  ? 366 GLY B N   1 
ATOM   6940 C CA  . GLY B 1 365 ? 8.010   -50.823 -13.060 1.00 57.57  ? 366 GLY B CA  1 
ATOM   6941 C C   . GLY B 1 365 ? 6.508   -50.637 -12.967 1.00 54.90  ? 366 GLY B C   1 
ATOM   6942 O O   . GLY B 1 365 ? 5.727   -51.527 -13.314 1.00 61.40  ? 366 GLY B O   1 
ATOM   6943 N N   . VAL B 1 366 ? 6.112   -49.467 -12.487 1.00 46.70  ? 367 VAL B N   1 
ATOM   6944 C CA  . VAL B 1 366 ? 4.717   -49.083 -12.390 1.00 47.06  ? 367 VAL B CA  1 
ATOM   6945 C C   . VAL B 1 366 ? 4.549   -47.700 -12.999 1.00 61.39  ? 367 VAL B C   1 
ATOM   6946 O O   . VAL B 1 366 ? 4.285   -46.719 -12.282 1.00 60.58  ? 367 VAL B O   1 
ATOM   6947 C CB  . VAL B 1 366 ? 4.228   -49.067 -10.928 1.00 54.20  ? 367 VAL B CB  1 
ATOM   6948 C CG1 . VAL B 1 366 ? 2.701   -48.968 -10.871 1.00 42.53  ? 367 VAL B CG1 1 
ATOM   6949 C CG2 . VAL B 1 366 ? 4.710   -50.294 -10.220 1.00 46.72  ? 367 VAL B CG2 1 
ATOM   6950 N N   . PRO B 1 367 ? 4.701   -47.611 -14.329 1.00 64.67  ? 368 PRO B N   1 
ATOM   6951 C CA  . PRO B 1 367 ? 4.654   -46.305 -14.976 1.00 60.74  ? 368 PRO B CA  1 
ATOM   6952 C C   . PRO B 1 367 ? 3.238   -45.761 -15.021 1.00 62.48  ? 368 PRO B C   1 
ATOM   6953 O O   . PRO B 1 367 ? 2.265   -46.526 -14.942 1.00 55.17  ? 368 PRO B O   1 
ATOM   6954 C CB  . PRO B 1 367 ? 5.180   -46.598 -16.373 1.00 71.19  ? 368 PRO B CB  1 
ATOM   6955 C CG  . PRO B 1 367 ? 4.721   -47.994 -16.626 1.00 63.29  ? 368 PRO B CG  1 
ATOM   6956 C CD  . PRO B 1 367 ? 4.791   -48.708 -15.310 1.00 59.73  ? 368 PRO B CD  1 
ATOM   6957 N N   . GLN B 1 368 ? 3.142   -44.439 -15.122 1.00 66.75  ? 369 GLN B N   1 
ATOM   6958 C CA  . GLN B 1 368 ? 1.859   -43.748 -15.222 1.00 82.99  ? 369 GLN B CA  1 
ATOM   6959 C C   . GLN B 1 368 ? 0.930   -44.009 -14.032 1.00 84.36  ? 369 GLN B C   1 
ATOM   6960 O O   . GLN B 1 368 ? -0.230  -44.377 -14.219 1.00 78.52  ? 369 GLN B O   1 
ATOM   6961 C CB  . GLN B 1 368 ? 1.144   -44.132 -16.528 1.00 96.51  ? 369 GLN B CB  1 
ATOM   6962 C CG  . GLN B 1 368 ? 1.954   -43.866 -17.806 1.00 98.37  ? 369 GLN B CG  1 
ATOM   6963 C CD  . GLN B 1 368 ? 2.406   -42.414 -17.934 1.00 103.59 ? 369 GLN B CD  1 
ATOM   6964 O OE1 . GLN B 1 368 ? 3.558   -42.139 -18.274 1.00 106.40 ? 369 GLN B OE1 1 
ATOM   6965 N NE2 . GLN B 1 368 ? 1.495   -41.480 -17.667 1.00 95.18  ? 369 GLN B NE2 1 
ATOM   6966 N N   . VAL B 1 369 ? 1.448   -43.843 -12.813 1.00 79.58  ? 370 VAL B N   1 
ATOM   6967 C CA  . VAL B 1 369 ? 0.593   -43.683 -11.639 1.00 62.19  ? 370 VAL B CA  1 
ATOM   6968 C C   . VAL B 1 369 ? 1.024   -42.420 -10.895 1.00 61.58  ? 370 VAL B C   1 
ATOM   6969 O O   . VAL B 1 369 ? 2.177   -41.998 -10.983 1.00 64.51  ? 370 VAL B O   1 
ATOM   6970 C CB  . VAL B 1 369 ? 0.639   -44.901 -10.686 1.00 70.74  ? 370 VAL B CB  1 
ATOM   6971 C CG1 . VAL B 1 369 ? 0.031   -46.137 -11.346 1.00 54.86  ? 370 VAL B CG1 1 
ATOM   6972 C CG2 . VAL B 1 369 ? 2.062   -45.166 -10.200 1.00 63.98  ? 370 VAL B CG2 1 
ATOM   6973 N N   . SER B 1 370 ? 0.095   -41.810 -10.168 1.00 70.60  ? 371 SER B N   1 
ATOM   6974 C CA  . SER B 1 370 ? 0.391   -40.603 -9.395  1.00 72.89  ? 371 SER B CA  1 
ATOM   6975 C C   . SER B 1 370 ? 1.455   -40.840 -8.321  1.00 72.48  ? 371 SER B C   1 
ATOM   6976 O O   . SER B 1 370 ? 1.766   -41.982 -7.976  1.00 73.79  ? 371 SER B O   1 
ATOM   6977 C CB  . SER B 1 370 ? -0.889  -40.071 -8.743  1.00 75.39  ? 371 SER B CB  1 
ATOM   6978 O OG  . SER B 1 370 ? -1.431  -41.015 -7.829  1.00 79.06  ? 371 SER B OG  1 
ATOM   6979 N N   . ASP B 1 371 ? 2.007   -39.756 -7.786  1.00 79.98  ? 372 ASP B N   1 
ATOM   6980 C CA  . ASP B 1 371 ? 2.985   -39.863 -6.705  1.00 72.59  ? 372 ASP B CA  1 
ATOM   6981 C C   . ASP B 1 371 ? 2.362   -40.531 -5.483  1.00 72.05  ? 372 ASP B C   1 
ATOM   6982 O O   . ASP B 1 371 ? 2.990   -41.350 -4.819  1.00 73.78  ? 372 ASP B O   1 
ATOM   6983 C CB  . ASP B 1 371 ? 3.532   -38.485 -6.337  1.00 75.92  ? 372 ASP B CB  1 
ATOM   6984 C CG  . ASP B 1 371 ? 4.216   -37.800 -7.510  1.00 89.63  ? 372 ASP B CG  1 
ATOM   6985 O OD1 . ASP B 1 371 ? 4.710   -38.519 -8.414  1.00 89.86  ? 372 ASP B OD1 1 
ATOM   6986 O OD2 . ASP B 1 371 ? 4.255   -36.546 -7.529  1.00 86.67  ? 372 ASP B OD2 1 
ATOM   6987 N N   . LEU B 1 372 ? 1.114   -40.182 -5.203  1.00 68.20  ? 373 LEU B N   1 
ATOM   6988 C CA  . LEU B 1 372 ? 0.401   -40.779 -4.091  1.00 66.92  ? 373 LEU B CA  1 
ATOM   6989 C C   . LEU B 1 372 ? 0.315   -42.301 -4.263  1.00 75.97  ? 373 LEU B C   1 
ATOM   6990 O O   . LEU B 1 372 ? 0.481   -43.059 -3.294  1.00 69.38  ? 373 LEU B O   1 
ATOM   6991 C CB  . LEU B 1 372 ? -0.994  -40.159 -3.952  1.00 57.65  ? 373 LEU B CB  1 
ATOM   6992 C CG  . LEU B 1 372 ? -1.937  -40.770 -2.912  1.00 70.54  ? 373 LEU B CG  1 
ATOM   6993 C CD1 . LEU B 1 372 ? -1.309  -40.793 -1.504  1.00 64.77  ? 373 LEU B CD1 1 
ATOM   6994 C CD2 . LEU B 1 372 ? -3.263  -40.034 -2.916  1.00 68.00  ? 373 LEU B CD2 1 
ATOM   6995 N N   . ALA B 1 373 ? 0.081   -42.744 -5.497  1.00 79.20  ? 374 ALA B N   1 
ATOM   6996 C CA  . ALA B 1 373 ? -0.050  -44.169 -5.788  1.00 64.90  ? 374 ALA B CA  1 
ATOM   6997 C C   . ALA B 1 373 ? 1.294   -44.856 -5.611  1.00 54.60  ? 374 ALA B C   1 
ATOM   6998 O O   . ALA B 1 373 ? 1.382   -45.931 -5.012  1.00 51.72  ? 374 ALA B O   1 
ATOM   6999 C CB  . ALA B 1 373 ? -0.584  -44.387 -7.195  1.00 64.47  ? 374 ALA B CB  1 
ATOM   7000 N N   . ALA B 1 374 ? 2.340   -44.215 -6.120  1.00 50.79  ? 375 ALA B N   1 
ATOM   7001 C CA  . ALA B 1 374 ? 3.685   -44.745 -5.988  1.00 52.07  ? 375 ALA B CA  1 
ATOM   7002 C C   . ALA B 1 374 ? 4.062   -44.901 -4.506  1.00 71.28  ? 375 ALA B C   1 
ATOM   7003 O O   . ALA B 1 374 ? 4.653   -45.911 -4.109  1.00 65.84  ? 375 ALA B O   1 
ATOM   7004 C CB  . ALA B 1 374 ? 4.672   -43.850 -6.706  1.00 55.95  ? 375 ALA B CB  1 
ATOM   7005 N N   . GLU B 1 375 ? 3.701   -43.904 -3.692  1.00 68.70  ? 376 GLU B N   1 
ATOM   7006 C CA  . GLU B 1 375 ? 3.950   -43.948 -2.256  1.00 62.86  ? 376 GLU B CA  1 
ATOM   7007 C C   . GLU B 1 375 ? 3.244   -45.140 -1.651  1.00 62.46  ? 376 GLU B C   1 
ATOM   7008 O O   . GLU B 1 375 ? 3.830   -45.888 -0.856  1.00 53.74  ? 376 GLU B O   1 
ATOM   7009 C CB  . GLU B 1 375 ? 3.481   -42.658 -1.563  1.00 80.32  ? 376 GLU B CB  1 
ATOM   7010 C CG  . GLU B 1 375 ? 4.321   -41.428 -1.870  1.00 88.37  ? 376 GLU B CG  1 
ATOM   7011 C CD  . GLU B 1 375 ? 5.804   -41.681 -1.673  1.00 107.09 ? 376 GLU B CD  1 
ATOM   7012 O OE1 . GLU B 1 375 ? 6.255   -41.670 -0.499  1.00 91.37  ? 376 GLU B OE1 1 
ATOM   7013 O OE2 . GLU B 1 375 ? 6.511   -41.906 -2.691  1.00 108.68 ? 376 GLU B OE2 1 
ATOM   7014 N N   . ALA B 1 376 ? 1.983   -45.318 -2.030  1.00 49.74  ? 377 ALA B N   1 
ATOM   7015 C CA  . ALA B 1 376 ? 1.237   -46.482 -1.575  1.00 49.98  ? 377 ALA B CA  1 
ATOM   7016 C C   . ALA B 1 376 ? 1.987   -47.778 -1.897  1.00 57.28  ? 377 ALA B C   1 
ATOM   7017 O O   . ALA B 1 376 ? 2.010   -48.702 -1.072  1.00 58.38  ? 377 ALA B O   1 
ATOM   7018 C CB  . ALA B 1 376 ? -0.142  -46.507 -2.180  1.00 49.58  ? 377 ALA B CB  1 
ATOM   7019 N N   . VAL B 1 377 ? 2.618   -47.835 -3.073  1.00 51.00  ? 378 VAL B N   1 
ATOM   7020 C CA  . VAL B 1 377 ? 3.321   -49.040 -3.469  1.00 52.94  ? 378 VAL B CA  1 
ATOM   7021 C C   . VAL B 1 377 ? 4.545   -49.253 -2.578  1.00 47.51  ? 378 VAL B C   1 
ATOM   7022 O O   . VAL B 1 377 ? 4.777   -50.352 -2.063  1.00 44.81  ? 378 VAL B O   1 
ATOM   7023 C CB  . VAL B 1 377 ? 3.757   -49.008 -4.963  1.00 44.89  ? 378 VAL B CB  1 
ATOM   7024 C CG1 . VAL B 1 377 ? 4.672   -50.179 -5.246  1.00 34.70  ? 378 VAL B CG1 1 
ATOM   7025 C CG2 . VAL B 1 377 ? 2.551   -49.029 -5.853  1.00 37.91  ? 378 VAL B CG2 1 
ATOM   7026 N N   . VAL B 1 378 ? 5.334   -48.198 -2.428  1.00 47.27  ? 379 VAL B N   1 
ATOM   7027 C CA  . VAL B 1 378 ? 6.510   -48.236 -1.573  1.00 56.17  ? 379 VAL B CA  1 
ATOM   7028 C C   . VAL B 1 378 ? 6.169   -48.654 -0.138  1.00 55.52  ? 379 VAL B C   1 
ATOM   7029 O O   . VAL B 1 378 ? 6.867   -49.466 0.451   1.00 58.41  ? 379 VAL B O   1 
ATOM   7030 C CB  . VAL B 1 378 ? 7.200   -46.880 -1.580  1.00 62.18  ? 379 VAL B CB  1 
ATOM   7031 C CG1 . VAL B 1 378 ? 8.227   -46.795 -0.461  1.00 67.33  ? 379 VAL B CG1 1 
ATOM   7032 C CG2 . VAL B 1 378 ? 7.852   -46.663 -2.936  1.00 50.68  ? 379 VAL B CG2 1 
ATOM   7033 N N   . LEU B 1 379 ? 5.073   -48.128 0.396   1.00 53.85  ? 380 LEU B N   1 
ATOM   7034 C CA  . LEU B 1 379 ? 4.613   -48.491 1.742   1.00 61.84  ? 380 LEU B CA  1 
ATOM   7035 C C   . LEU B 1 379 ? 4.315   -49.971 1.839   1.00 59.83  ? 380 LEU B C   1 
ATOM   7036 O O   . LEU B 1 379 ? 4.762   -50.649 2.769   1.00 59.01  ? 380 LEU B O   1 
ATOM   7037 C CB  . LEU B 1 379 ? 3.331   -47.718 2.147   1.00 58.64  ? 380 LEU B CB  1 
ATOM   7038 C CG  . LEU B 1 379 ? 2.424   -48.412 3.207   1.00 72.23  ? 380 LEU B CG  1 
ATOM   7039 C CD1 . LEU B 1 379 ? 2.834   -48.081 4.667   1.00 53.86  ? 380 LEU B CD1 1 
ATOM   7040 C CD2 . LEU B 1 379 ? 0.914   -48.177 3.010   1.00 62.39  ? 380 LEU B CD2 1 
ATOM   7041 N N   A HIS B 1 380 ? 3.539   -50.486 0.893   0.42 51.46  ? 381 HIS B N   1 
ATOM   7042 N N   B HIS B 1 380 ? 3.534   -50.457 0.876   0.58 51.97  ? 381 HIS B N   1 
ATOM   7043 C CA  A HIS B 1 380 ? 3.080   -51.863 1.007   0.42 52.08  ? 381 HIS B CA  1 
ATOM   7044 C CA  B HIS B 1 380 ? 3.064   -51.831 0.902   0.58 52.09  ? 381 HIS B CA  1 
ATOM   7045 C C   A HIS B 1 380 ? 4.188   -52.880 0.718   0.42 55.16  ? 381 HIS B C   1 
ATOM   7046 C C   B HIS B 1 380 ? 4.231   -52.814 0.800   0.58 55.17  ? 381 HIS B C   1 
ATOM   7047 O O   A HIS B 1 380 ? 4.114   -54.017 1.185   0.42 54.39  ? 381 HIS B O   1 
ATOM   7048 O O   B HIS B 1 380 ? 4.239   -53.842 1.477   0.58 53.52  ? 381 HIS B O   1 
ATOM   7049 C CB  A HIS B 1 380 ? 1.874   -52.103 0.092   0.42 54.26  ? 381 HIS B CB  1 
ATOM   7050 C CB  B HIS B 1 380 ? 2.052   -52.090 -0.226  0.58 54.12  ? 381 HIS B CB  1 
ATOM   7051 C CG  A HIS B 1 380 ? 0.553   -51.890 0.768   0.42 56.76  ? 381 HIS B CG  1 
ATOM   7052 C CG  B HIS B 1 380 ? 1.380   -53.423 -0.124  0.58 46.32  ? 381 HIS B CG  1 
ATOM   7053 N ND1 A HIS B 1 380 ? -0.058  -50.656 0.846   0.42 59.05  ? 381 HIS B ND1 1 
ATOM   7054 N ND1 B HIS B 1 380 ? 0.131   -53.589 0.434   0.58 53.84  ? 381 HIS B ND1 1 
ATOM   7055 C CD2 A HIS B 1 380 ? -0.271  -52.756 1.406   0.42 55.88  ? 381 HIS B CD2 1 
ATOM   7056 C CD2 B HIS B 1 380 ? 1.810   -54.662 -0.459  0.58 50.64  ? 381 HIS B CD2 1 
ATOM   7057 C CE1 A HIS B 1 380 ? -1.203  -50.773 1.495   0.42 56.26  ? 381 HIS B CE1 1 
ATOM   7058 C CE1 B HIS B 1 380 ? -0.188  -54.872 0.423   0.58 52.03  ? 381 HIS B CE1 1 
ATOM   7059 N NE2 A HIS B 1 380 ? -1.357  -52.038 1.844   0.42 53.14  ? 381 HIS B NE2 1 
ATOM   7060 N NE2 B HIS B 1 380 ? 0.816   -55.546 -0.110  0.58 58.67  ? 381 HIS B NE2 1 
ATOM   7061 N N   . TYR B 1 381 ? 5.222   -52.485 -0.026  1.00 47.39  ? 382 TYR B N   1 
ATOM   7062 C CA  . TYR B 1 381 ? 6.293   -53.434 -0.322  1.00 49.44  ? 382 TYR B CA  1 
ATOM   7063 C C   . TYR B 1 381 ? 7.565   -53.247 0.510   1.00 49.56  ? 382 TYR B C   1 
ATOM   7064 O O   . TYR B 1 381 ? 8.491   -54.054 0.431   1.00 48.38  ? 382 TYR B O   1 
ATOM   7065 C CB  . TYR B 1 381 ? 6.626   -53.402 -1.813  1.00 41.83  ? 382 TYR B CB  1 
ATOM   7066 C CG  . TYR B 1 381 ? 5.594   -54.131 -2.631  1.00 46.80  ? 382 TYR B CG  1 
ATOM   7067 C CD1 . TYR B 1 381 ? 4.429   -53.497 -3.022  1.00 40.44  ? 382 TYR B CD1 1 
ATOM   7068 C CD2 . TYR B 1 381 ? 5.762   -55.468 -2.982  1.00 46.32  ? 382 TYR B CD2 1 
ATOM   7069 C CE1 . TYR B 1 381 ? 3.469   -54.153 -3.762  1.00 46.96  ? 382 TYR B CE1 1 
ATOM   7070 C CE2 . TYR B 1 381 ? 4.795   -56.141 -3.736  1.00 44.39  ? 382 TYR B CE2 1 
ATOM   7071 C CZ  . TYR B 1 381 ? 3.656   -55.469 -4.125  1.00 45.53  ? 382 TYR B CZ  1 
ATOM   7072 O OH  . TYR B 1 381 ? 2.675   -56.096 -4.867  1.00 44.47  ? 382 TYR B OH  1 
ATOM   7073 N N   . THR B 1 382 ? 7.612   -52.210 1.332   1.00 52.91  ? 383 THR B N   1 
ATOM   7074 C CA  . THR B 1 382 ? 8.734   -52.079 2.252   1.00 46.66  ? 383 THR B CA  1 
ATOM   7075 C C   . THR B 1 382 ? 8.548   -52.941 3.489   1.00 48.29  ? 383 THR B C   1 
ATOM   7076 O O   . THR B 1 382 ? 7.461   -53.031 4.046   1.00 49.40  ? 383 THR B O   1 
ATOM   7077 C CB  . THR B 1 382 ? 8.938   -50.633 2.678   1.00 54.35  ? 383 THR B CB  1 
ATOM   7078 O OG1 . THR B 1 382 ? 9.376   -49.880 1.544   1.00 52.28  ? 383 THR B OG1 1 
ATOM   7079 C CG2 . THR B 1 382 ? 9.998   -50.544 3.786   1.00 49.80  ? 383 THR B CG2 1 
ATOM   7080 N N   . ASP B 1 383 ? 9.607   -53.615 3.894   1.00 58.95  ? 384 ASP B N   1 
ATOM   7081 C CA  . ASP B 1 383 ? 9.620   -54.251 5.196   1.00 49.85  ? 384 ASP B CA  1 
ATOM   7082 C C   . ASP B 1 383 ? 10.192  -53.234 6.176   1.00 55.55  ? 384 ASP B C   1 
ATOM   7083 O O   . ASP B 1 383 ? 11.398  -52.993 6.174   1.00 53.34  ? 384 ASP B O   1 
ATOM   7084 C CB  . ASP B 1 383 ? 10.468  -55.518 5.158   1.00 55.79  ? 384 ASP B CB  1 
ATOM   7085 C CG  . ASP B 1 383 ? 10.523  -56.241 6.494   1.00 63.29  ? 384 ASP B CG  1 
ATOM   7086 O OD1 . ASP B 1 383 ? 10.307  -55.620 7.572   1.00 58.81  ? 384 ASP B OD1 1 
ATOM   7087 O OD2 . ASP B 1 383 ? 10.809  -57.456 6.449   1.00 61.71  ? 384 ASP B OD2 1 
ATOM   7088 N N   . TRP B 1 384 ? 9.357   -52.642 7.022   1.00 47.98  ? 385 TRP B N   1 
ATOM   7089 C CA  . TRP B 1 384 ? 9.841   -51.525 7.821   1.00 54.81  ? 385 TRP B CA  1 
ATOM   7090 C C   . TRP B 1 384 ? 10.750  -51.914 8.998   1.00 55.25  ? 385 TRP B C   1 
ATOM   7091 O O   . TRP B 1 384 ? 11.260  -51.038 9.696   1.00 57.65  ? 385 TRP B O   1 
ATOM   7092 C CB  . TRP B 1 384 ? 8.661   -50.713 8.293   1.00 52.86  ? 385 TRP B CB  1 
ATOM   7093 C CG  . TRP B 1 384 ? 7.975   -50.140 7.123   1.00 51.68  ? 385 TRP B CG  1 
ATOM   7094 C CD1 . TRP B 1 384 ? 6.863   -50.625 6.501   1.00 50.80  ? 385 TRP B CD1 1 
ATOM   7095 C CD2 . TRP B 1 384 ? 8.383   -48.989 6.383   1.00 51.23  ? 385 TRP B CD2 1 
ATOM   7096 N NE1 . TRP B 1 384 ? 6.537   -49.827 5.422   1.00 55.06  ? 385 TRP B NE1 1 
ATOM   7097 C CE2 . TRP B 1 384 ? 7.454   -48.812 5.336   1.00 55.56  ? 385 TRP B CE2 1 
ATOM   7098 C CE3 . TRP B 1 384 ? 9.442   -48.085 6.507   1.00 47.23  ? 385 TRP B CE3 1 
ATOM   7099 C CZ2 . TRP B 1 384 ? 7.552   -47.762 4.423   1.00 56.21  ? 385 TRP B CZ2 1 
ATOM   7100 C CZ3 . TRP B 1 384 ? 9.536   -47.044 5.605   1.00 50.57  ? 385 TRP B CZ3 1 
ATOM   7101 C CH2 . TRP B 1 384 ? 8.599   -46.892 4.573   1.00 56.02  ? 385 TRP B CH2 1 
ATOM   7102 N N   . LEU B 1 385 ? 10.987  -53.210 9.184   1.00 53.72  ? 386 LEU B N   1 
ATOM   7103 C CA  . LEU B 1 385 ? 12.033  -53.678 10.097  1.00 52.12  ? 386 LEU B CA  1 
ATOM   7104 C C   . LEU B 1 385 ? 13.376  -53.848 9.398   1.00 59.36  ? 386 LEU B C   1 
ATOM   7105 O O   . LEU B 1 385 ? 14.396  -54.102 10.042  1.00 60.36  ? 386 LEU B O   1 
ATOM   7106 C CB  . LEU B 1 385 ? 11.628  -55.003 10.728  1.00 52.77  ? 386 LEU B CB  1 
ATOM   7107 C CG  . LEU B 1 385 ? 10.563  -54.851 11.800  1.00 65.61  ? 386 LEU B CG  1 
ATOM   7108 C CD1 . LEU B 1 385 ? 10.219  -56.212 12.385  1.00 55.98  ? 386 LEU B CD1 1 
ATOM   7109 C CD2 . LEU B 1 385 ? 11.087  -53.887 12.843  1.00 58.19  ? 386 LEU B CD2 1 
ATOM   7110 N N   . HIS B 1 386 ? 13.360  -53.751 8.072   1.00 56.83  ? 387 HIS B N   1 
ATOM   7111 C CA  . HIS B 1 386 ? 14.563  -53.885 7.262   1.00 44.25  ? 387 HIS B CA  1 
ATOM   7112 C C   . HIS B 1 386 ? 14.428  -53.032 6.014   1.00 56.40  ? 387 HIS B C   1 
ATOM   7113 O O   . HIS B 1 386 ? 14.433  -53.557 4.907   1.00 51.73  ? 387 HIS B O   1 
ATOM   7114 C CB  . HIS B 1 386 ? 14.792  -55.336 6.846   1.00 53.11  ? 387 HIS B CB  1 
ATOM   7115 C CG  . HIS B 1 386 ? 14.868  -56.301 7.986   1.00 61.84  ? 387 HIS B CG  1 
ATOM   7116 N ND1 . HIS B 1 386 ? 16.001  -56.454 8.759   1.00 63.70  ? 387 HIS B ND1 1 
ATOM   7117 C CD2 . HIS B 1 386 ? 13.962  -57.190 8.461   1.00 58.15  ? 387 HIS B CD2 1 
ATOM   7118 C CE1 . HIS B 1 386 ? 15.780  -57.383 9.673   1.00 65.72  ? 387 HIS B CE1 1 
ATOM   7119 N NE2 . HIS B 1 386 ? 14.551  -57.844 9.514   1.00 65.01  ? 387 HIS B NE2 1 
ATOM   7120 N N   . PRO B 1 387 ? 14.299  -51.714 6.182   1.00 60.78  ? 388 PRO B N   1 
ATOM   7121 C CA  . PRO B 1 387 ? 13.926  -50.924 5.002   1.00 51.55  ? 388 PRO B CA  1 
ATOM   7122 C C   . PRO B 1 387 ? 14.997  -50.817 3.921   1.00 55.64  ? 388 PRO B C   1 
ATOM   7123 O O   . PRO B 1 387 ? 14.687  -50.354 2.822   1.00 58.70  ? 388 PRO B O   1 
ATOM   7124 C CB  . PRO B 1 387 ? 13.643  -49.530 5.585   1.00 54.30  ? 388 PRO B CB  1 
ATOM   7125 C CG  . PRO B 1 387 ? 14.411  -49.501 6.892   1.00 57.81  ? 388 PRO B CG  1 
ATOM   7126 C CD  . PRO B 1 387 ? 14.349  -50.906 7.413   1.00 44.95  ? 388 PRO B CD  1 
ATOM   7127 N N   . GLU B 1 388 ? 16.224  -51.231 4.211   1.00 51.19  ? 389 GLU B N   1 
ATOM   7128 C CA  . GLU B 1 388 ? 17.330  -50.940 3.302   1.00 57.51  ? 389 GLU B CA  1 
ATOM   7129 C C   . GLU B 1 388 ? 18.166  -52.170 2.944   1.00 46.75  ? 389 GLU B C   1 
ATOM   7130 O O   . GLU B 1 388 ? 19.210  -52.052 2.318   1.00 59.64  ? 389 GLU B O   1 
ATOM   7131 C CB  . GLU B 1 388 ? 18.224  -49.854 3.904   1.00 56.49  ? 389 GLU B CB  1 
ATOM   7132 C CG  . GLU B 1 388 ? 17.443  -48.705 4.515   1.00 64.22  ? 389 GLU B CG  1 
ATOM   7133 C CD  . GLU B 1 388 ? 18.189  -47.391 4.461   1.00 90.40  ? 389 GLU B CD  1 
ATOM   7134 O OE1 . GLU B 1 388 ? 18.388  -46.870 3.341   1.00 89.63  ? 389 GLU B OE1 1 
ATOM   7135 O OE2 . GLU B 1 388 ? 18.579  -46.879 5.533   1.00 114.09 ? 389 GLU B OE2 1 
ATOM   7136 N N   . ASP B 1 389 ? 17.700  -53.346 3.346   1.00 48.28  ? 390 ASP B N   1 
ATOM   7137 C CA  . ASP B 1 389 ? 18.356  -54.596 2.990   1.00 49.55  ? 390 ASP B CA  1 
ATOM   7138 C C   . ASP B 1 389 ? 18.293  -54.845 1.480   1.00 58.84  ? 390 ASP B C   1 
ATOM   7139 O O   . ASP B 1 389 ? 17.224  -55.123 0.944   1.00 54.15  ? 390 ASP B O   1 
ATOM   7140 C CB  . ASP B 1 389 ? 17.707  -55.756 3.727   1.00 46.96  ? 390 ASP B CB  1 
ATOM   7141 C CG  . ASP B 1 389 ? 18.368  -57.082 3.411   1.00 65.93  ? 390 ASP B CG  1 
ATOM   7142 O OD1 . ASP B 1 389 ? 19.607  -57.114 3.264   1.00 71.35  ? 390 ASP B OD1 1 
ATOM   7143 O OD2 . ASP B 1 389 ? 17.660  -58.098 3.310   1.00 78.22  ? 390 ASP B OD2 1 
ATOM   7144 N N   . PRO B 1 390 ? 19.440  -54.756 0.795   1.00 63.53  ? 391 PRO B N   1 
ATOM   7145 C CA  . PRO B 1 390 ? 19.498  -54.849 -0.676  1.00 59.11  ? 391 PRO B CA  1 
ATOM   7146 C C   . PRO B 1 390 ? 18.820  -56.100 -1.250  1.00 54.34  ? 391 PRO B C   1 
ATOM   7147 O O   . PRO B 1 390 ? 17.994  -55.981 -2.151  1.00 51.81  ? 391 PRO B O   1 
ATOM   7148 C CB  . PRO B 1 390 ? 20.998  -54.868 -0.963  1.00 60.63  ? 391 PRO B CB  1 
ATOM   7149 C CG  . PRO B 1 390 ? 21.612  -54.164 0.235   1.00 57.15  ? 391 PRO B CG  1 
ATOM   7150 C CD  . PRO B 1 390 ? 20.775  -54.604 1.397   1.00 57.83  ? 391 PRO B CD  1 
ATOM   7151 N N   . ALA B 1 391 ? 19.143  -57.271 -0.712  1.00 51.17  ? 392 ALA B N   1 
ATOM   7152 C CA  . ALA B 1 391 ? 18.522  -58.519 -1.143  1.00 56.88  ? 392 ALA B CA  1 
ATOM   7153 C C   . ALA B 1 391 ? 16.999  -58.441 -1.090  1.00 63.04  ? 392 ALA B C   1 
ATOM   7154 O O   . ALA B 1 391 ? 16.312  -58.853 -2.029  1.00 59.91  ? 392 ALA B O   1 
ATOM   7155 C CB  . ALA B 1 391 ? 19.018  -59.673 -0.288  1.00 58.54  ? 392 ALA B CB  1 
ATOM   7156 N N   . ARG B 1 392 ? 16.485  -57.912 0.017   1.00 56.17  ? 393 ARG B N   1 
ATOM   7157 C CA  . ARG B 1 392 ? 15.048  -57.782 0.225   1.00 51.02  ? 393 ARG B CA  1 
ATOM   7158 C C   . ARG B 1 392 ? 14.429  -56.773 -0.723  1.00 51.45  ? 393 ARG B C   1 
ATOM   7159 O O   . ARG B 1 392 ? 13.297  -56.957 -1.155  1.00 48.93  ? 393 ARG B O   1 
ATOM   7160 C CB  . ARG B 1 392 ? 14.738  -57.372 1.672   1.00 54.44  ? 393 ARG B CB  1 
ATOM   7161 C CG  . ARG B 1 392 ? 14.619  -58.532 2.666   1.00 53.95  ? 393 ARG B CG  1 
ATOM   7162 C CD  . ARG B 1 392 ? 14.435  -57.987 4.079   1.00 50.17  ? 393 ARG B CD  1 
ATOM   7163 N NE  . ARG B 1 392 ? 14.301  -59.024 5.097   1.00 58.41  ? 393 ARG B NE  1 
ATOM   7164 C CZ  . ARG B 1 392 ? 15.270  -59.359 5.948   1.00 68.11  ? 393 ARG B CZ  1 
ATOM   7165 N NH1 . ARG B 1 392 ? 16.448  -58.748 5.893   1.00 67.85  ? 393 ARG B NH1 1 
ATOM   7166 N NH2 . ARG B 1 392 ? 15.062  -60.298 6.860   1.00 67.20  ? 393 ARG B NH2 1 
ATOM   7167 N N   . LEU B 1 393 ? 15.154  -55.695 -1.004  1.00 38.77  ? 394 LEU B N   1 
ATOM   7168 C CA  . LEU B 1 393 ? 14.664  -54.658 -1.885  1.00 42.02  ? 394 LEU B CA  1 
ATOM   7169 C C   . LEU B 1 393 ? 14.572  -55.178 -3.328  1.00 53.88  ? 394 LEU B C   1 
ATOM   7170 O O   . LEU B 1 393 ? 13.627  -54.865 -4.057  1.00 45.67  ? 394 LEU B O   1 
ATOM   7171 C CB  . LEU B 1 393 ? 15.565  -53.434 -1.810  1.00 50.47  ? 394 LEU B CB  1 
ATOM   7172 C CG  . LEU B 1 393 ? 15.488  -52.645 -0.499  1.00 55.44  ? 394 LEU B CG  1 
ATOM   7173 C CD1 . LEU B 1 393 ? 16.706  -51.773 -0.353  1.00 50.25  ? 394 LEU B CD1 1 
ATOM   7174 C CD2 . LEU B 1 393 ? 14.236  -51.790 -0.470  1.00 44.11  ? 394 LEU B CD2 1 
ATOM   7175 N N   . ARG B 1 394 ? 15.552  -55.989 -3.717  1.00 55.25  ? 395 ARG B N   1 
ATOM   7176 C CA  . ARG B 1 394 ? 15.567  -56.648 -5.024  1.00 58.20  ? 395 ARG B CA  1 
ATOM   7177 C C   . ARG B 1 394 ? 14.332  -57.517 -5.182  1.00 51.97  ? 395 ARG B C   1 
ATOM   7178 O O   . ARG B 1 394 ? 13.565  -57.359 -6.135  1.00 49.73  ? 395 ARG B O   1 
ATOM   7179 C CB  . ARG B 1 394 ? 16.833  -57.501 -5.183  1.00 59.79  ? 395 ARG B CB  1 
ATOM   7180 C CG  . ARG B 1 394 ? 17.092  -58.041 -6.590  1.00 59.44  ? 395 ARG B CG  1 
ATOM   7181 C CD  . ARG B 1 394 ? 18.232  -59.072 -6.589  1.00 53.26  ? 395 ARG B CD  1 
ATOM   7182 N NE  . ARG B 1 394 ? 17.937  -60.214 -5.725  1.00 56.66  ? 395 ARG B NE  1 
ATOM   7183 C CZ  . ARG B 1 394 ? 18.864  -61.012 -5.197  1.00 66.81  ? 395 ARG B CZ  1 
ATOM   7184 N NH1 . ARG B 1 394 ? 20.152  -60.803 -5.443  1.00 61.26  ? 395 ARG B NH1 1 
ATOM   7185 N NH2 . ARG B 1 394 ? 18.507  -62.023 -4.421  1.00 56.71  ? 395 ARG B NH2 1 
ATOM   7186 N N   . GLU B 1 395 ? 14.142  -58.420 -4.225  1.00 53.57  ? 396 GLU B N   1 
ATOM   7187 C CA  . GLU B 1 395 ? 12.969  -59.288 -4.184  1.00 51.47  ? 396 GLU B CA  1 
ATOM   7188 C C   . GLU B 1 395 ? 11.657  -58.498 -4.205  1.00 51.20  ? 396 GLU B C   1 
ATOM   7189 O O   . GLU B 1 395 ? 10.703  -58.862 -4.893  1.00 53.00  ? 396 GLU B O   1 
ATOM   7190 C CB  . GLU B 1 395 ? 13.018  -60.177 -2.942  1.00 49.14  ? 396 GLU B CB  1 
ATOM   7191 C CG  . GLU B 1 395 ? 13.237  -61.660 -3.203  1.00 71.27  ? 396 GLU B CG  1 
ATOM   7192 C CD  . GLU B 1 395 ? 14.559  -61.975 -3.914  1.00 95.06  ? 396 GLU B CD  1 
ATOM   7193 O OE1 . GLU B 1 395 ? 14.609  -61.915 -5.175  1.00 89.44  ? 396 GLU B OE1 1 
ATOM   7194 O OE2 . GLU B 1 395 ? 15.541  -62.306 -3.202  1.00 78.81  ? 396 GLU B OE2 1 
ATOM   7195 N N   . ALA B 1 396 ? 11.611  -57.407 -3.457  1.00 49.51  ? 397 ALA B N   1 
ATOM   7196 C CA  . ALA B 1 396 ? 10.381  -56.650 -3.344  1.00 47.76  ? 397 ALA B CA  1 
ATOM   7197 C C   . ALA B 1 396 ? 10.057  -55.984 -4.680  1.00 48.51  ? 397 ALA B C   1 
ATOM   7198 O O   . ALA B 1 396 ? 8.902   -55.945 -5.105  1.00 51.62  ? 397 ALA B O   1 
ATOM   7199 C CB  . ALA B 1 396 ? 10.487  -55.608 -2.219  1.00 40.40  ? 397 ALA B CB  1 
ATOM   7200 N N   . LEU B 1 397 ? 11.075  -55.446 -5.335  1.00 43.04  ? 398 LEU B N   1 
ATOM   7201 C CA  . LEU B 1 397 ? 10.861  -54.788 -6.613  1.00 46.48  ? 398 LEU B CA  1 
ATOM   7202 C C   . LEU B 1 397 ? 10.427  -55.812 -7.664  1.00 48.42  ? 398 LEU B C   1 
ATOM   7203 O O   . LEU B 1 397 ? 9.548   -55.532 -8.475  1.00 45.53  ? 398 LEU B O   1 
ATOM   7204 C CB  . LEU B 1 397 ? 12.113  -54.050 -7.076  1.00 49.62  ? 398 LEU B CB  1 
ATOM   7205 C CG  . LEU B 1 397 ? 11.822  -53.229 -8.336  1.00 52.98  ? 398 LEU B CG  1 
ATOM   7206 C CD1 . LEU B 1 397 ? 10.618  -52.314 -8.071  1.00 47.20  ? 398 LEU B CD1 1 
ATOM   7207 C CD2 . LEU B 1 397 ? 13.036  -52.443 -8.822  1.00 43.32  ? 398 LEU B CD2 1 
ATOM   7208 N N   . SER B 1 398 ? 11.009  -57.005 -7.632  1.00 48.04  ? 399 SER B N   1 
ATOM   7209 C CA  . SER B 1 398 ? 10.559  -58.069 -8.521  1.00 46.12  ? 399 SER B CA  1 
ATOM   7210 C C   . SER B 1 398 ? 9.086   -58.413 -8.285  1.00 46.44  ? 399 SER B C   1 
ATOM   7211 O O   . SER B 1 398 ? 8.340   -58.700 -9.228  1.00 52.05  ? 399 SER B O   1 
ATOM   7212 C CB  . SER B 1 398 ? 11.417  -59.316 -8.349  1.00 39.87  ? 399 SER B CB  1 
ATOM   7213 O OG  . SER B 1 398 ? 10.860  -60.394 -9.097  1.00 56.94  ? 399 SER B OG  1 
ATOM   7214 N N   . ASP B 1 399 ? 8.665   -58.370 -7.028  1.00 45.06  ? 400 ASP B N   1 
ATOM   7215 C CA  . ASP B 1 399 ? 7.265   -58.610 -6.674  1.00 40.12  ? 400 ASP B CA  1 
ATOM   7216 C C   . ASP B 1 399 ? 6.362   -57.480 -7.142  1.00 43.16  ? 400 ASP B C   1 
ATOM   7217 O O   . ASP B 1 399 ? 5.256   -57.723 -7.593  1.00 44.53  ? 400 ASP B O   1 
ATOM   7218 C CB  . ASP B 1 399 ? 7.107   -58.790 -5.163  1.00 48.73  ? 400 ASP B CB  1 
ATOM   7219 C CG  . ASP B 1 399 ? 7.543   -60.161 -4.688  1.00 59.27  ? 400 ASP B CG  1 
ATOM   7220 O OD1 . ASP B 1 399 ? 7.478   -61.109 -5.505  1.00 64.56  ? 400 ASP B OD1 1 
ATOM   7221 O OD2 . ASP B 1 399 ? 7.943   -60.289 -3.502  1.00 74.68  ? 400 ASP B OD2 1 
ATOM   7222 N N   . VAL B 1 400 ? 6.826   -56.245 -7.006  1.00 38.54  ? 401 VAL B N   1 
ATOM   7223 C CA  . VAL B 1 400 ? 6.047   -55.111 -7.461  1.00 44.76  ? 401 VAL B CA  1 
ATOM   7224 C C   . VAL B 1 400 ? 5.731   -55.255 -8.956  1.00 46.42  ? 401 VAL B C   1 
ATOM   7225 O O   . VAL B 1 400 ? 4.562   -55.182 -9.366  1.00 42.56  ? 401 VAL B O   1 
ATOM   7226 C CB  . VAL B 1 400 ? 6.775   -53.771 -7.190  1.00 45.19  ? 401 VAL B CB  1 
ATOM   7227 C CG1 . VAL B 1 400 ? 6.166   -52.642 -8.001  1.00 36.61  ? 401 VAL B CG1 1 
ATOM   7228 C CG2 . VAL B 1 400 ? 6.719   -53.437 -5.710  1.00 40.56  ? 401 VAL B CG2 1 
ATOM   7229 N N   . VAL B 1 401 ? 6.768   -55.483 -9.758  1.00 43.16  ? 402 VAL B N   1 
ATOM   7230 C CA  . VAL B 1 401 ? 6.600   -55.548 -11.209 1.00 48.89  ? 402 VAL B CA  1 
ATOM   7231 C C   . VAL B 1 401 ? 5.741   -56.741 -11.589 1.00 43.10  ? 402 VAL B C   1 
ATOM   7232 O O   . VAL B 1 401 ? 4.785   -56.612 -12.356 1.00 43.28  ? 402 VAL B O   1 
ATOM   7233 C CB  . VAL B 1 401 ? 7.950   -55.617 -11.922 1.00 47.66  ? 402 VAL B CB  1 
ATOM   7234 C CG1 . VAL B 1 401 ? 7.737   -55.827 -13.393 1.00 47.60  ? 402 VAL B CG1 1 
ATOM   7235 C CG2 . VAL B 1 401 ? 8.707   -54.322 -11.700 1.00 41.80  ? 402 VAL B CG2 1 
ATOM   7236 N N   . GLY B 1 402 ? 6.045   -57.891 -10.997 1.00 45.97  ? 403 GLY B N   1 
ATOM   7237 C CA  . GLY B 1 402 ? 5.296   -59.109 -11.265 1.00 32.29  ? 403 GLY B CA  1 
ATOM   7238 C C   . GLY B 1 402 ? 3.850   -59.049 -10.831 1.00 48.37  ? 403 GLY B C   1 
ATOM   7239 O O   . GLY B 1 402 ? 2.972   -59.500 -11.576 1.00 42.50  ? 403 GLY B O   1 
ATOM   7240 N N   . ASP B 1 403 ? 3.590   -58.514 -9.634  1.00 40.65  ? 404 ASP B N   1 
ATOM   7241 C CA  . ASP B 1 403 ? 2.226   -58.510 -9.096  1.00 41.44  ? 404 ASP B CA  1 
ATOM   7242 C C   . ASP B 1 403 ? 1.344   -57.620 -9.951  1.00 42.55  ? 404 ASP B C   1 
ATOM   7243 O O   . ASP B 1 403 ? 0.228   -57.980 -10.313 1.00 46.76  ? 404 ASP B O   1 
ATOM   7244 C CB  . ASP B 1 403 ? 2.170   -58.004 -7.636  1.00 37.63  ? 404 ASP B CB  1 
ATOM   7245 C CG  . ASP B 1 403 ? 2.825   -58.956 -6.639  1.00 37.58  ? 404 ASP B CG  1 
ATOM   7246 O OD1 . ASP B 1 403 ? 3.032   -60.142 -6.955  1.00 54.80  ? 404 ASP B OD1 1 
ATOM   7247 O OD2 . ASP B 1 403 ? 3.136   -58.505 -5.526  1.00 51.81  ? 404 ASP B OD2 1 
ATOM   7248 N N   . HIS B 1 404 ? 1.866   -56.439 -10.232 1.00 35.55  ? 405 HIS B N   1 
ATOM   7249 C CA  . HIS B 1 404 ? 1.147   -55.396 -10.925 1.00 41.67  ? 405 HIS B CA  1 
ATOM   7250 C C   . HIS B 1 404 ? 0.843   -55.783 -12.383 1.00 41.15  ? 405 HIS B C   1 
ATOM   7251 O O   . HIS B 1 404 ? -0.269  -55.612 -12.870 1.00 42.12  ? 405 HIS B O   1 
ATOM   7252 C CB  . HIS B 1 404 ? 1.976   -54.104 -10.876 1.00 37.65  ? 405 HIS B CB  1 
ATOM   7253 C CG  . HIS B 1 404 ? 1.430   -52.997 -11.725 1.00 42.06  ? 405 HIS B CG  1 
ATOM   7254 N ND1 . HIS B 1 404 ? 0.120   -52.571 -11.639 1.00 49.59  ? 405 HIS B ND1 1 
ATOM   7255 C CD2 . HIS B 1 404 ? 2.017   -52.231 -12.676 1.00 41.79  ? 405 HIS B CD2 1 
ATOM   7256 C CE1 . HIS B 1 404 ? -0.071  -51.581 -12.496 1.00 37.80  ? 405 HIS B CE1 1 
ATOM   7257 N NE2 . HIS B 1 404 ? 1.062   -51.359 -13.138 1.00 45.47  ? 405 HIS B NE2 1 
ATOM   7258 N N   . ASN B 1 405 ? 1.836   -56.319 -13.070 1.00 38.84  ? 406 ASN B N   1 
ATOM   7259 C CA  . ASN B 1 405 ? 1.686   -56.558 -14.495 1.00 49.56  ? 406 ASN B CA  1 
ATOM   7260 C C   . ASN B 1 405 ? 1.153   -57.947 -14.856 1.00 43.94  ? 406 ASN B C   1 
ATOM   7261 O O   . ASN B 1 405 ? 0.509   -58.087 -15.885 1.00 40.95  ? 406 ASN B O   1 
ATOM   7262 C CB  . ASN B 1 405 ? 3.015   -56.298 -15.197 1.00 37.75  ? 406 ASN B CB  1 
ATOM   7263 C CG  . ASN B 1 405 ? 3.430   -54.847 -15.123 1.00 45.86  ? 406 ASN B CG  1 
ATOM   7264 O OD1 . ASN B 1 405 ? 2.952   -54.004 -15.892 1.00 54.48  ? 406 ASN B OD1 1 
ATOM   7265 N ND2 . ASN B 1 405 ? 4.334   -54.543 -14.203 1.00 47.65  ? 406 ASN B ND2 1 
ATOM   7266 N N   . VAL B 1 406 ? 1.369   -58.957 -14.008 1.00 41.39  ? 407 VAL B N   1 
ATOM   7267 C CA  . VAL B 1 406 ? 0.925   -60.327 -14.340 1.00 40.88  ? 407 VAL B CA  1 
ATOM   7268 C C   . VAL B 1 406 ? 0.035   -61.020 -13.298 1.00 39.31  ? 407 VAL B C   1 
ATOM   7269 O O   . VAL B 1 406 ? -1.131  -61.317 -13.573 1.00 44.19  ? 407 VAL B O   1 
ATOM   7270 C CB  . VAL B 1 406 ? 2.137   -61.286 -14.587 1.00 43.14  ? 407 VAL B CB  1 
ATOM   7271 C CG1 . VAL B 1 406 ? 1.631   -62.647 -15.029 1.00 46.28  ? 407 VAL B CG1 1 
ATOM   7272 C CG2 . VAL B 1 406 ? 3.058   -60.733 -15.637 1.00 41.80  ? 407 VAL B CG2 1 
ATOM   7273 N N   . VAL B 1 407 ? 0.597   -61.316 -12.121 1.00 45.67  ? 408 VAL B N   1 
ATOM   7274 C CA  . VAL B 1 407 ? -0.089  -62.144 -11.120 1.00 41.70  ? 408 VAL B CA  1 
ATOM   7275 C C   . VAL B 1 407 ? -1.459  -61.597 -10.727 1.00 37.88  ? 408 VAL B C   1 
ATOM   7276 O O   . VAL B 1 407 ? -2.456  -62.327 -10.776 1.00 46.46  ? 408 VAL B O   1 
ATOM   7277 C CB  . VAL B 1 407 ? 0.749   -62.319 -9.817  1.00 45.83  ? 408 VAL B CB  1 
ATOM   7278 C CG1 . VAL B 1 407 ? 0.034   -63.275 -8.861  1.00 32.04  ? 408 VAL B CG1 1 
ATOM   7279 C CG2 . VAL B 1 407 ? 2.128   -62.846 -10.142 1.00 32.12  ? 408 VAL B CG2 1 
ATOM   7280 N N   . CYS B 1 408 ? -1.532  -60.311 -10.386 1.00 36.63  ? 409 CYS B N   1 
ATOM   7281 C CA  . CYS B 1 408 ? -2.802  -59.755 -9.910  1.00 37.05  ? 409 CYS B CA  1 
ATOM   7282 C C   . CYS B 1 408 ? -3.838  -59.587 -11.040 1.00 45.60  ? 409 CYS B C   1 
ATOM   7283 O O   . CYS B 1 408 ? -5.025  -59.864 -10.823 1.00 43.92  ? 409 CYS B O   1 
ATOM   7284 C CB  . CYS B 1 408 ? -2.559  -58.437 -9.158  1.00 40.28  ? 409 CYS B CB  1 
ATOM   7285 S SG  . CYS B 1 408 ? -1.554  -58.706 -7.653  1.00 45.00  ? 409 CYS B SG  1 
ATOM   7286 N N   . PRO B 1 409 ? -3.408  -59.165 -12.254 1.00 46.18  ? 410 PRO B N   1 
ATOM   7287 C CA  . PRO B 1 409 ? -4.410  -59.232 -13.328 1.00 39.10  ? 410 PRO B CA  1 
ATOM   7288 C C   . PRO B 1 409 ? -4.941  -60.642 -13.542 1.00 37.70  ? 410 PRO B C   1 
ATOM   7289 O O   . PRO B 1 409 ? -6.138  -60.810 -13.764 1.00 36.86  ? 410 PRO B O   1 
ATOM   7290 C CB  . PRO B 1 409 ? -3.645  -58.740 -14.561 1.00 44.72  ? 410 PRO B CB  1 
ATOM   7291 C CG  . PRO B 1 409 ? -2.652  -57.769 -13.986 1.00 41.11  ? 410 PRO B CG  1 
ATOM   7292 C CD  . PRO B 1 409 ? -2.211  -58.407 -12.671 1.00 38.06  ? 410 PRO B CD  1 
ATOM   7293 N N   . VAL B 1 410 ? -4.073  -61.641 -13.427 1.00 35.68  ? 411 VAL B N   1 
ATOM   7294 C CA  . VAL B 1 410 ? -4.499  -63.031 -13.614 1.00 36.91  ? 411 VAL B CA  1 
ATOM   7295 C C   . VAL B 1 410 ? -5.437  -63.481 -12.479 1.00 50.02  ? 411 VAL B C   1 
ATOM   7296 O O   . VAL B 1 410 ? -6.486  -64.090 -12.730 1.00 43.25  ? 411 VAL B O   1 
ATOM   7297 C CB  . VAL B 1 410 ? -3.275  -63.979 -13.712 1.00 39.21  ? 411 VAL B CB  1 
ATOM   7298 C CG1 . VAL B 1 410 ? -3.689  -65.415 -13.494 1.00 33.00  ? 411 VAL B CG1 1 
ATOM   7299 C CG2 . VAL B 1 410 ? -2.578  -63.830 -15.078 1.00 42.60  ? 411 VAL B CG2 1 
ATOM   7300 N N   . ALA B 1 411 ? -5.067  -63.168 -11.233 1.00 37.02  ? 412 ALA B N   1 
ATOM   7301 C CA  . ALA B 1 411 ? -5.925  -63.486 -10.069 1.00 40.40  ? 412 ALA B CA  1 
ATOM   7302 C C   . ALA B 1 411 ? -7.283  -62.808 -10.162 1.00 40.96  ? 412 ALA B C   1 
ATOM   7303 O O   . ALA B 1 411 ? -8.312  -63.434 -9.916  1.00 43.62  ? 412 ALA B O   1 
ATOM   7304 C CB  . ALA B 1 411 ? -5.227  -63.089 -8.735  1.00 38.79  ? 412 ALA B CB  1 
ATOM   7305 N N   . GLN B 1 412 ? -7.301  -61.537 -10.543 1.00 39.32  ? 413 GLN B N   1 
ATOM   7306 C CA  . GLN B 1 412 ? -8.584  -60.872 -10.702 1.00 41.32  ? 413 GLN B CA  1 
ATOM   7307 C C   . GLN B 1 412 ? -9.459  -61.550 -11.772 1.00 50.06  ? 413 GLN B C   1 
ATOM   7308 O O   . GLN B 1 412 ? -10.666 -61.733 -11.570 1.00 49.90  ? 413 GLN B O   1 
ATOM   7309 C CB  . GLN B 1 412 ? -8.388  -59.400 -11.049 1.00 40.39  ? 413 GLN B CB  1 
ATOM   7310 C CG  . GLN B 1 412 ? -9.677  -58.744 -11.489 1.00 46.30  ? 413 GLN B CG  1 
ATOM   7311 C CD  . GLN B 1 412 ? -9.890  -57.392 -10.872 1.00 80.40  ? 413 GLN B CD  1 
ATOM   7312 O OE1 . GLN B 1 412 ? -9.547  -56.370 -11.477 1.00 94.59  ? 413 GLN B OE1 1 
ATOM   7313 N NE2 . GLN B 1 412 ? -10.469 -57.364 -9.659  1.00 77.41  ? 413 GLN B NE2 1 
ATOM   7314 N N   . LEU B 1 413 ? -8.849  -61.925 -12.900 1.00 46.22  ? 414 LEU B N   1 
ATOM   7315 C CA  . LEU B 1 413 ? -9.564  -62.623 -13.972 1.00 42.87  ? 414 LEU B CA  1 
ATOM   7316 C C   . LEU B 1 413 ? -10.099 -63.945 -13.469 1.00 40.09  ? 414 LEU B C   1 
ATOM   7317 O O   . LEU B 1 413 ? -11.257 -64.270 -13.687 1.00 43.37  ? 414 LEU B O   1 
ATOM   7318 C CB  . LEU B 1 413 ? -8.653  -62.868 -15.189 1.00 41.62  ? 414 LEU B CB  1 
ATOM   7319 C CG  . LEU B 1 413 ? -9.279  -63.692 -16.325 1.00 39.39  ? 414 LEU B CG  1 
ATOM   7320 C CD1 . LEU B 1 413 ? -10.579 -63.062 -16.740 1.00 53.55  ? 414 LEU B CD1 1 
ATOM   7321 C CD2 . LEU B 1 413 ? -8.357  -63.691 -17.516 1.00 46.32  ? 414 LEU B CD2 1 
ATOM   7322 N N   . ALA B 1 414 ? -9.241  -64.710 -12.802 1.00 38.58  ? 415 ALA B N   1 
ATOM   7323 C CA  . ALA B 1 414 ? -9.627  -66.024 -12.309 1.00 35.31  ? 415 ALA B CA  1 
ATOM   7324 C C   . ALA B 1 414 ? -10.795 -65.927 -11.344 1.00 48.38  ? 415 ALA B C   1 
ATOM   7325 O O   . ALA B 1 414 ? -11.733 -66.715 -11.408 1.00 45.47  ? 415 ALA B O   1 
ATOM   7326 C CB  . ALA B 1 414 ? -8.459  -66.690 -11.630 1.00 39.81  ? 415 ALA B CB  1 
ATOM   7327 N N   . GLY B 1 415 ? -10.723 -64.955 -10.441 1.00 50.36  ? 416 GLY B N   1 
ATOM   7328 C CA  . GLY B 1 415 ? -11.748 -64.788 -9.426  1.00 43.31  ? 416 GLY B CA  1 
ATOM   7329 C C   . GLY B 1 415 ? -13.084 -64.393 -10.005 1.00 45.79  ? 416 GLY B C   1 
ATOM   7330 O O   . GLY B 1 415 ? -14.104 -64.990 -9.685  1.00 52.95  ? 416 GLY B O   1 
ATOM   7331 N N   . ARG B 1 416 ? -13.090 -63.393 -10.873 1.00 46.87  ? 417 ARG B N   1 
ATOM   7332 C CA  . ARG B 1 416 ? -14.343 -62.962 -11.462 1.00 48.31  ? 417 ARG B CA  1 
ATOM   7333 C C   . ARG B 1 416 ? -14.965 -64.042 -12.353 1.00 54.46  ? 417 ARG B C   1 
ATOM   7334 O O   . ARG B 1 416 ? -16.183 -64.222 -12.346 1.00 58.32  ? 417 ARG B O   1 
ATOM   7335 C CB  . ARG B 1 416 ? -14.137 -61.674 -12.251 1.00 55.08  ? 417 ARG B CB  1 
ATOM   7336 C CG  . ARG B 1 416 ? -13.989 -60.470 -11.355 1.00 57.84  ? 417 ARG B CG  1 
ATOM   7337 C CD  . ARG B 1 416 ? -15.156 -60.404 -10.387 1.00 59.21  ? 417 ARG B CD  1 
ATOM   7338 N NE  . ARG B 1 416 ? -15.359 -59.048 -9.888  1.00 85.30  ? 417 ARG B NE  1 
ATOM   7339 C CZ  . ARG B 1 416 ? -16.428 -58.300 -10.154 1.00 77.74  ? 417 ARG B CZ  1 
ATOM   7340 N NH1 . ARG B 1 416 ? -17.413 -58.782 -10.909 1.00 67.03  ? 417 ARG B NH1 1 
ATOM   7341 N NH2 . ARG B 1 416 ? -16.514 -57.073 -9.651  1.00 78.50  ? 417 ARG B NH2 1 
ATOM   7342 N N   . LEU B 1 417 ? -14.140 -64.760 -13.111 1.00 53.08  ? 418 LEU B N   1 
ATOM   7343 C CA  . LEU B 1 417 ? -14.657 -65.813 -13.978 1.00 55.28  ? 418 LEU B CA  1 
ATOM   7344 C C   . LEU B 1 417 ? -15.296 -66.924 -13.150 1.00 51.97  ? 418 LEU B C   1 
ATOM   7345 O O   . LEU B 1 417 ? -16.393 -67.383 -13.460 1.00 52.17  ? 418 LEU B O   1 
ATOM   7346 C CB  . LEU B 1 417 ? -13.554 -66.407 -14.860 1.00 39.67  ? 418 LEU B CB  1 
ATOM   7347 C CG  . LEU B 1 417 ? -13.027 -65.623 -16.065 1.00 52.35  ? 418 LEU B CG  1 
ATOM   7348 C CD1 . LEU B 1 417 ? -12.096 -66.497 -16.852 1.00 45.54  ? 418 LEU B CD1 1 
ATOM   7349 C CD2 . LEU B 1 417 ? -14.128 -65.145 -16.948 1.00 50.80  ? 418 LEU B CD2 1 
ATOM   7350 N N   . ALA B 1 418 ? -14.593 -67.372 -12.111 1.00 49.11  ? 419 ALA B N   1 
ATOM   7351 C CA  . ALA B 1 418 ? -15.090 -68.463 -11.273 1.00 55.43  ? 419 ALA B CA  1 
ATOM   7352 C C   . ALA B 1 418 ? -16.431 -68.109 -10.670 1.00 51.67  ? 419 ALA B C   1 
ATOM   7353 O O   . ALA B 1 418 ? -17.352 -68.930 -10.642 1.00 64.29  ? 419 ALA B O   1 
ATOM   7354 C CB  . ALA B 1 418 ? -14.093 -68.796 -10.173 1.00 50.71  ? 419 ALA B CB  1 
ATOM   7355 N N   . ALA B 1 419 ? -16.533 -66.868 -10.216 1.00 52.45  ? 420 ALA B N   1 
ATOM   7356 C CA  . ALA B 1 419 ? -17.702 -66.392 -9.487  1.00 59.00  ? 420 ALA B CA  1 
ATOM   7357 C C   . ALA B 1 419 ? -18.857 -66.153 -10.431 1.00 56.57  ? 420 ALA B C   1 
ATOM   7358 O O   . ALA B 1 419 ? -20.001 -66.055 -10.008 1.00 61.34  ? 420 ALA B O   1 
ATOM   7359 C CB  . ALA B 1 419 ? -17.365 -65.106 -8.711  1.00 42.04  ? 420 ALA B CB  1 
ATOM   7360 N N   . GLN B 1 420 ? -18.568 -66.070 -11.723 1.00 64.43  ? 421 GLN B N   1 
ATOM   7361 C CA  . GLN B 1 420 ? -19.631 -65.769 -12.671 1.00 49.85  ? 421 GLN B CA  1 
ATOM   7362 C C   . GLN B 1 420 ? -19.861 -66.894 -13.665 1.00 54.10  ? 421 GLN B C   1 
ATOM   7363 O O   . GLN B 1 420 ? -20.344 -66.673 -14.777 1.00 58.65  ? 421 GLN B O   1 
ATOM   7364 C CB  . GLN B 1 420 ? -19.335 -64.450 -13.369 1.00 58.23  ? 421 GLN B CB  1 
ATOM   7365 C CG  . GLN B 1 420 ? -19.408 -63.296 -12.379 1.00 51.68  ? 421 GLN B CG  1 
ATOM   7366 C CD  . GLN B 1 420 ? -18.594 -62.100 -12.798 1.00 65.84  ? 421 GLN B CD  1 
ATOM   7367 O OE1 . GLN B 1 420 ? -18.079 -61.361 -11.957 1.00 67.62  ? 421 GLN B OE1 1 
ATOM   7368 N NE2 . GLN B 1 420 ? -18.479 -61.891 -14.107 1.00 57.10  ? 421 GLN B NE2 1 
ATOM   7369 N N   . GLY B 1 421 ? -19.538 -68.115 -13.244 1.00 60.00  ? 422 GLY B N   1 
ATOM   7370 C CA  . GLY B 1 421 ? -20.038 -69.285 -13.942 1.00 57.61  ? 422 GLY B CA  1 
ATOM   7371 C C   . GLY B 1 421 ? -19.026 -70.233 -14.544 1.00 64.97  ? 422 GLY B C   1 
ATOM   7372 O O   . GLY B 1 421 ? -19.374 -71.342 -14.944 1.00 77.03  ? 422 GLY B O   1 
ATOM   7373 N N   . ALA B 1 422 ? -17.772 -69.810 -14.623 1.00 58.72  ? 423 ALA B N   1 
ATOM   7374 C CA  . ALA B 1 422 ? -16.775 -70.631 -15.292 1.00 59.75  ? 423 ALA B CA  1 
ATOM   7375 C C   . ALA B 1 422 ? -16.135 -71.630 -14.335 1.00 50.43  ? 423 ALA B C   1 
ATOM   7376 O O   . ALA B 1 422 ? -15.982 -71.344 -13.150 1.00 60.37  ? 423 ALA B O   1 
ATOM   7377 C CB  . ALA B 1 422 ? -15.713 -69.746 -15.931 1.00 54.94  ? 423 ALA B CB  1 
ATOM   7378 N N   . ARG B 1 423 ? -15.765 -72.801 -14.842 1.00 47.00  ? 424 ARG B N   1 
ATOM   7379 C CA  . ARG B 1 423 ? -14.884 -73.703 -14.105 1.00 50.01  ? 424 ARG B CA  1 
ATOM   7380 C C   . ARG B 1 423 ? -13.427 -73.303 -14.376 1.00 59.91  ? 424 ARG B C   1 
ATOM   7381 O O   . ARG B 1 423 ? -12.962 -73.357 -15.511 1.00 53.72  ? 424 ARG B O   1 
ATOM   7382 C CB  . ARG B 1 423 ? -15.120 -75.166 -14.501 1.00 50.57  ? 424 ARG B CB  1 
ATOM   7383 C CG  . ARG B 1 423 ? -14.546 -76.205 -13.501 1.00 66.99  ? 424 ARG B CG  1 
ATOM   7384 C CD  . ARG B 1 423 ? -15.165 -77.606 -13.706 1.00 89.04  ? 424 ARG B CD  1 
ATOM   7385 N NE  . ARG B 1 423 ? -14.946 -78.111 -15.072 1.00 102.61 ? 424 ARG B NE  1 
ATOM   7386 C CZ  . ARG B 1 423 ? -15.759 -78.951 -15.721 1.00 96.17  ? 424 ARG B CZ  1 
ATOM   7387 N NH1 . ARG B 1 423 ? -16.871 -79.393 -15.139 1.00 97.98  ? 424 ARG B NH1 1 
ATOM   7388 N NH2 . ARG B 1 423 ? -15.465 -79.343 -16.961 1.00 82.64  ? 424 ARG B NH2 1 
ATOM   7389 N N   . VAL B 1 424 ? -12.721 -72.897 -13.328 1.00 48.62  ? 425 VAL B N   1 
ATOM   7390 C CA  . VAL B 1 424 ? -11.381 -72.360 -13.450 1.00 43.08  ? 425 VAL B CA  1 
ATOM   7391 C C   . VAL B 1 424 ? -10.354 -73.246 -12.756 1.00 48.47  ? 425 VAL B C   1 
ATOM   7392 O O   . VAL B 1 424 ? -10.610 -73.752 -11.677 1.00 49.70  ? 425 VAL B O   1 
ATOM   7393 C CB  . VAL B 1 424 ? -11.311 -70.940 -12.851 1.00 43.23  ? 425 VAL B CB  1 
ATOM   7394 C CG1 . VAL B 1 424 ? -9.918  -70.370 -12.990 1.00 34.76  ? 425 VAL B CG1 1 
ATOM   7395 C CG2 . VAL B 1 424 ? -12.347 -70.022 -13.517 1.00 38.56  ? 425 VAL B CG2 1 
ATOM   7396 N N   . TYR B 1 425 ? -9.196  -73.446 -13.382 1.00 46.39  ? 426 TYR B N   1 
ATOM   7397 C CA  . TYR B 1 425 ? -8.102  -74.182 -12.760 1.00 43.26  ? 426 TYR B CA  1 
ATOM   7398 C C   . TYR B 1 425 ? -6.885  -73.285 -12.747 1.00 51.51  ? 426 TYR B C   1 
ATOM   7399 O O   . TYR B 1 425 ? -6.624  -72.582 -13.721 1.00 48.70  ? 426 TYR B O   1 
ATOM   7400 C CB  . TYR B 1 425 ? -7.814  -75.489 -13.500 1.00 47.46  ? 426 TYR B CB  1 
ATOM   7401 C CG  . TYR B 1 425 ? -8.950  -76.471 -13.409 1.00 49.30  ? 426 TYR B CG  1 
ATOM   7402 C CD1 . TYR B 1 425 ? -9.008  -77.384 -12.361 1.00 53.35  ? 426 TYR B CD1 1 
ATOM   7403 C CD2 . TYR B 1 425 ? -9.977  -76.479 -14.351 1.00 48.29  ? 426 TYR B CD2 1 
ATOM   7404 C CE1 . TYR B 1 425 ? -10.050 -78.283 -12.246 1.00 53.51  ? 426 TYR B CE1 1 
ATOM   7405 C CE2 . TYR B 1 425 ? -11.037 -77.374 -14.245 1.00 54.94  ? 426 TYR B CE2 1 
ATOM   7406 C CZ  . TYR B 1 425 ? -11.066 -78.274 -13.179 1.00 58.42  ? 426 TYR B CZ  1 
ATOM   7407 O OH  . TYR B 1 425 ? -12.094 -79.178 -13.038 1.00 63.18  ? 426 TYR B OH  1 
ATOM   7408 N N   . ALA B 1 426 ? -6.141  -73.291 -11.646 1.00 41.30  ? 427 ALA B N   1 
ATOM   7409 C CA  . ALA B 1 426 ? -5.056  -72.335 -11.504 1.00 38.82  ? 427 ALA B CA  1 
ATOM   7410 C C   . ALA B 1 426 ? -3.777  -73.022 -11.071 1.00 37.22  ? 427 ALA B C   1 
ATOM   7411 O O   . ALA B 1 426 ? -3.818  -74.036 -10.372 1.00 45.98  ? 427 ALA B O   1 
ATOM   7412 C CB  . ALA B 1 426 ? -5.445  -71.240 -10.532 1.00 37.29  ? 427 ALA B CB  1 
ATOM   7413 N N   . TYR B 1 427 ? -2.641  -72.484 -11.498 1.00 36.66  ? 428 TYR B N   1 
ATOM   7414 C CA  . TYR B 1 427 ? -1.351  -73.091 -11.194 1.00 35.59  ? 428 TYR B CA  1 
ATOM   7415 C C   . TYR B 1 427 ? -0.300  -72.037 -10.954 1.00 37.77  ? 428 TYR B C   1 
ATOM   7416 O O   . TYR B 1 427 ? -0.415  -70.901 -11.405 1.00 41.31  ? 428 TYR B O   1 
ATOM   7417 C CB  . TYR B 1 427 ? -0.859  -74.018 -12.334 1.00 42.79  ? 428 TYR B CB  1 
ATOM   7418 C CG  . TYR B 1 427 ? -0.515  -73.266 -13.616 1.00 45.33  ? 428 TYR B CG  1 
ATOM   7419 C CD1 . TYR B 1 427 ? 0.709   -72.636 -13.767 1.00 40.30  ? 428 TYR B CD1 1 
ATOM   7420 C CD2 . TYR B 1 427 ? -1.419  -73.193 -14.667 1.00 42.31  ? 428 TYR B CD2 1 
ATOM   7421 C CE1 . TYR B 1 427 ? 1.024   -71.929 -14.917 1.00 46.59  ? 428 TYR B CE1 1 
ATOM   7422 C CE2 . TYR B 1 427 ? -1.100  -72.504 -15.857 1.00 43.56  ? 428 TYR B CE2 1 
ATOM   7423 C CZ  . TYR B 1 427 ? 0.122   -71.872 -15.958 1.00 41.13  ? 428 TYR B CZ  1 
ATOM   7424 O OH  . TYR B 1 427 ? 0.456   -71.149 -17.068 1.00 48.22  ? 428 TYR B OH  1 
ATOM   7425 N N   . VAL B 1 428 ? 0.758   -72.445 -10.282 1.00 38.84  ? 429 VAL B N   1 
ATOM   7426 C CA  . VAL B 1 428 ? 1.968   -71.668 -10.230 1.00 44.10  ? 429 VAL B CA  1 
ATOM   7427 C C   . VAL B 1 428 ? 3.064   -72.622 -10.643 1.00 45.06  ? 429 VAL B C   1 
ATOM   7428 O O   . VAL B 1 428 ? 3.175   -73.726 -10.098 1.00 48.28  ? 429 VAL B O   1 
ATOM   7429 C CB  . VAL B 1 428 ? 2.216   -71.073 -8.815  1.00 45.77  ? 429 VAL B CB  1 
ATOM   7430 C CG1 . VAL B 1 428 ? 3.562   -70.381 -8.751  1.00 39.77  ? 429 VAL B CG1 1 
ATOM   7431 C CG2 . VAL B 1 428 ? 1.111   -70.098 -8.478  1.00 42.06  ? 429 VAL B CG2 1 
ATOM   7432 N N   . PHE B 1 429 ? 3.853   -72.207 -11.627 1.00 47.85  ? 430 PHE B N   1 
ATOM   7433 C CA  . PHE B 1 429 ? 4.915   -73.033 -12.176 1.00 42.92  ? 430 PHE B CA  1 
ATOM   7434 C C   . PHE B 1 429 ? 6.204   -72.745 -11.442 1.00 38.95  ? 430 PHE B C   1 
ATOM   7435 O O   . PHE B 1 429 ? 6.706   -71.622 -11.493 1.00 42.92  ? 430 PHE B O   1 
ATOM   7436 C CB  . PHE B 1 429 ? 5.072   -72.757 -13.673 1.00 43.13  ? 430 PHE B CB  1 
ATOM   7437 C CG  . PHE B 1 429 ? 6.136   -73.558 -14.326 1.00 34.78  ? 430 PHE B CG  1 
ATOM   7438 C CD1 . PHE B 1 429 ? 5.852   -74.815 -14.836 1.00 40.21  ? 430 PHE B CD1 1 
ATOM   7439 C CD2 . PHE B 1 429 ? 7.422   -73.061 -14.445 1.00 43.39  ? 430 PHE B CD2 1 
ATOM   7440 C CE1 . PHE B 1 429 ? 6.836   -75.572 -15.459 1.00 36.15  ? 430 PHE B CE1 1 
ATOM   7441 C CE2 . PHE B 1 429 ? 8.415   -73.807 -15.075 1.00 45.95  ? 430 PHE B CE2 1 
ATOM   7442 C CZ  . PHE B 1 429 ? 8.119   -75.067 -15.573 1.00 41.23  ? 430 PHE B CZ  1 
ATOM   7443 N N   . GLU B 1 430 ? 6.761   -73.750 -10.773 1.00 40.68  ? 431 GLU B N   1 
ATOM   7444 C CA  . GLU B 1 430 ? 7.852   -73.474 -9.842  1.00 49.25  ? 431 GLU B CA  1 
ATOM   7445 C C   . GLU B 1 430 ? 9.159   -74.168 -10.132 1.00 53.61  ? 431 GLU B C   1 
ATOM   7446 O O   . GLU B 1 430 ? 10.064  -74.125 -9.299  1.00 58.70  ? 431 GLU B O   1 
ATOM   7447 C CB  . GLU B 1 430 ? 7.424   -73.827 -8.421  1.00 40.09  ? 431 GLU B CB  1 
ATOM   7448 C CG  . GLU B 1 430 ? 6.181   -73.092 -8.000  1.00 53.98  ? 431 GLU B CG  1 
ATOM   7449 C CD  . GLU B 1 430 ? 5.957   -73.119 -6.492  1.00 64.10  ? 431 GLU B CD  1 
ATOM   7450 O OE1 . GLU B 1 430 ? 6.254   -74.157 -5.841  1.00 74.03  ? 431 GLU B OE1 1 
ATOM   7451 O OE2 . GLU B 1 430 ? 5.487   -72.087 -5.962  1.00 62.98  ? 431 GLU B OE2 1 
ATOM   7452 N N   . HIS B 1 431 ? 9.285   -74.793 -11.296 1.00 50.44  ? 432 HIS B N   1 
ATOM   7453 C CA  . HIS B 1 431 ? 10.519  -75.511 -11.595 1.00 48.71  ? 432 HIS B CA  1 
ATOM   7454 C C   . HIS B 1 431 ? 11.487  -74.639 -12.352 1.00 52.06  ? 432 HIS B C   1 
ATOM   7455 O O   . HIS B 1 431 ? 11.152  -74.069 -13.386 1.00 57.83  ? 432 HIS B O   1 
ATOM   7456 C CB  . HIS B 1 431 ? 10.268  -76.796 -12.406 1.00 48.14  ? 432 HIS B CB  1 
ATOM   7457 C CG  . HIS B 1 431 ? 11.535  -77.470 -12.841 1.00 67.54  ? 432 HIS B CG  1 
ATOM   7458 N ND1 . HIS B 1 431 ? 12.396  -78.085 -11.952 1.00 62.97  ? 432 HIS B ND1 1 
ATOM   7459 C CD2 . HIS B 1 431 ? 12.117  -77.579 -14.063 1.00 61.17  ? 432 HIS B CD2 1 
ATOM   7460 C CE1 . HIS B 1 431 ? 13.440  -78.561 -12.609 1.00 56.47  ? 432 HIS B CE1 1 
ATOM   7461 N NE2 . HIS B 1 431 ? 13.297  -78.264 -13.889 1.00 61.92  ? 432 HIS B NE2 1 
ATOM   7462 N N   . ARG B 1 432 ? 12.703  -74.548 -11.842 1.00 47.26  ? 433 ARG B N   1 
ATOM   7463 C CA  . ARG B 1 432 ? 13.736  -73.849 -12.570 1.00 55.50  ? 433 ARG B CA  1 
ATOM   7464 C C   . ARG B 1 432 ? 14.535  -74.853 -13.392 1.00 61.92  ? 433 ARG B C   1 
ATOM   7465 O O   . ARG B 1 432 ? 15.186  -75.738 -12.838 1.00 54.70  ? 433 ARG B O   1 
ATOM   7466 C CB  . ARG B 1 432 ? 14.646  -73.074 -11.623 1.00 54.12  ? 433 ARG B CB  1 
ATOM   7467 C CG  . ARG B 1 432 ? 15.773  -72.377 -12.336 1.00 51.64  ? 433 ARG B CG  1 
ATOM   7468 C CD  . ARG B 1 432 ? 16.608  -71.603 -11.373 1.00 53.99  ? 433 ARG B CD  1 
ATOM   7469 N NE  . ARG B 1 432 ? 17.882  -71.248 -11.976 1.00 56.95  ? 433 ARG B NE  1 
ATOM   7470 C CZ  . ARG B 1 432 ? 18.184  -70.039 -12.431 1.00 60.52  ? 433 ARG B CZ  1 
ATOM   7471 N NH1 . ARG B 1 432 ? 17.289  -69.056 -12.353 1.00 58.50  ? 433 ARG B NH1 1 
ATOM   7472 N NH2 . ARG B 1 432 ? 19.384  -69.816 -12.963 1.00 53.93  ? 433 ARG B NH2 1 
ATOM   7473 N N   . ALA B 1 433 ? 14.457  -74.720 -14.714 1.00 58.57  ? 434 ALA B N   1 
ATOM   7474 C CA  . ALA B 1 433 ? 15.153  -75.617 -15.640 1.00 64.89  ? 434 ALA B CA  1 
ATOM   7475 C C   . ALA B 1 433 ? 16.650  -75.737 -15.370 1.00 60.33  ? 434 ALA B C   1 
ATOM   7476 O O   . ALA B 1 433 ? 17.333  -74.747 -15.118 1.00 62.48  ? 434 ALA B O   1 
ATOM   7477 C CB  . ALA B 1 433 ? 14.932  -75.151 -17.087 1.00 52.97  ? 434 ALA B CB  1 
ATOM   7478 N N   . SER B 1 434 ? 17.151  -76.963 -15.442 1.00 64.27  ? 435 SER B N   1 
ATOM   7479 C CA  . SER B 1 434 ? 18.586  -77.232 -15.386 1.00 54.65  ? 435 SER B CA  1 
ATOM   7480 C C   . SER B 1 434 ? 19.338  -76.481 -16.489 1.00 57.24  ? 435 SER B C   1 
ATOM   7481 O O   . SER B 1 434 ? 20.513  -76.146 -16.337 1.00 61.77  ? 435 SER B O   1 
ATOM   7482 C CB  . SER B 1 434 ? 18.841  -78.741 -15.508 1.00 61.55  ? 435 SER B CB  1 
ATOM   7483 O OG  . SER B 1 434 ? 18.354  -79.252 -16.749 1.00 62.37  ? 435 SER B OG  1 
ATOM   7484 N N   . THR B 1 435 ? 18.651  -76.199 -17.591 1.00 57.75  ? 436 THR B N   1 
ATOM   7485 C CA  . THR B 1 435 ? 19.296  -75.571 -18.740 1.00 62.10  ? 436 THR B CA  1 
ATOM   7486 C C   . THR B 1 435 ? 19.223  -74.050 -18.714 1.00 63.23  ? 436 THR B C   1 
ATOM   7487 O O   . THR B 1 435 ? 19.810  -73.376 -19.566 1.00 69.14  ? 436 THR B O   1 
ATOM   7488 C CB  . THR B 1 435 ? 18.670  -76.050 -20.046 1.00 55.23  ? 436 THR B CB  1 
ATOM   7489 O OG1 . THR B 1 435 ? 17.287  -75.673 -20.066 1.00 76.41  ? 436 THR B OG1 1 
ATOM   7490 C CG2 . THR B 1 435 ? 18.770  -77.565 -20.157 1.00 55.97  ? 436 THR B CG2 1 
ATOM   7491 N N   . LEU B 1 436 ? 18.502  -73.517 -17.737 1.00 61.41  ? 437 LEU B N   1 
ATOM   7492 C CA  . LEU B 1 436 ? 18.223  -72.087 -17.680 1.00 65.83  ? 437 LEU B CA  1 
ATOM   7493 C C   . LEU B 1 436 ? 19.504  -71.254 -17.606 1.00 64.47  ? 437 LEU B C   1 
ATOM   7494 O O   . LEU B 1 436 ? 20.360  -71.499 -16.758 1.00 61.27  ? 437 LEU B O   1 
ATOM   7495 C CB  . LEU B 1 436 ? 17.317  -71.786 -16.485 1.00 65.94  ? 437 LEU B CB  1 
ATOM   7496 C CG  . LEU B 1 436 ? 16.730  -70.377 -16.412 1.00 68.34  ? 437 LEU B CG  1 
ATOM   7497 C CD1 . LEU B 1 436 ? 15.864  -70.089 -17.613 1.00 54.99  ? 437 LEU B CD1 1 
ATOM   7498 C CD2 . LEU B 1 436 ? 15.925  -70.241 -15.155 1.00 75.73  ? 437 LEU B CD2 1 
ATOM   7499 N N   . SER B 1 437 ? 19.617  -70.265 -18.493 1.00 64.17  ? 438 SER B N   1 
ATOM   7500 C CA  . SER B 1 437 ? 20.846  -69.488 -18.637 1.00 60.56  ? 438 SER B CA  1 
ATOM   7501 C C   . SER B 1 437 ? 20.821  -68.138 -17.904 1.00 64.10  ? 438 SER B C   1 
ATOM   7502 O O   . SER B 1 437 ? 21.852  -67.462 -17.813 1.00 68.87  ? 438 SER B O   1 
ATOM   7503 C CB  . SER B 1 437 ? 21.141  -69.258 -20.125 1.00 63.01  ? 438 SER B CB  1 
ATOM   7504 O OG  . SER B 1 437 ? 20.047  -68.616 -20.771 1.00 75.01  ? 438 SER B OG  1 
ATOM   7505 N N   . TRP B 1 438 ? 19.652  -67.739 -17.399 1.00 64.86  ? 439 TRP B N   1 
ATOM   7506 C CA  . TRP B 1 438 ? 19.556  -66.550 -16.540 1.00 65.59  ? 439 TRP B CA  1 
ATOM   7507 C C   . TRP B 1 438 ? 20.133  -66.858 -15.156 1.00 58.08  ? 439 TRP B C   1 
ATOM   7508 O O   . TRP B 1 438 ? 20.171  -68.020 -14.754 1.00 59.92  ? 439 TRP B O   1 
ATOM   7509 C CB  . TRP B 1 438 ? 18.106  -66.071 -16.417 1.00 53.46  ? 439 TRP B CB  1 
ATOM   7510 C CG  . TRP B 1 438 ? 17.526  -65.546 -17.692 1.00 54.25  ? 439 TRP B CG  1 
ATOM   7511 C CD1 . TRP B 1 438 ? 16.677  -66.207 -18.534 1.00 58.36  ? 439 TRP B CD1 1 
ATOM   7512 C CD2 . TRP B 1 438 ? 17.742  -64.253 -18.275 1.00 48.65  ? 439 TRP B CD2 1 
ATOM   7513 N NE1 . TRP B 1 438 ? 16.356  -65.410 -19.609 1.00 55.27  ? 439 TRP B NE1 1 
ATOM   7514 C CE2 . TRP B 1 438 ? 16.993  -64.205 -19.476 1.00 60.47  ? 439 TRP B CE2 1 
ATOM   7515 C CE3 . TRP B 1 438 ? 18.500  -63.137 -17.909 1.00 54.53  ? 439 TRP B CE3 1 
ATOM   7516 C CZ2 . TRP B 1 438 ? 16.977  -63.078 -20.311 1.00 57.27  ? 439 TRP B CZ2 1 
ATOM   7517 C CZ3 . TRP B 1 438 ? 18.488  -62.017 -18.740 1.00 57.77  ? 439 TRP B CZ3 1 
ATOM   7518 C CH2 . TRP B 1 438 ? 17.724  -61.996 -19.926 1.00 65.36  ? 439 TRP B CH2 1 
ATOM   7519 N N   . PRO B 1 439 ? 20.598  -65.823 -14.426 1.00 66.62  ? 440 PRO B N   1 
ATOM   7520 C CA  . PRO B 1 439 ? 21.201  -66.032 -13.100 1.00 58.86  ? 440 PRO B CA  1 
ATOM   7521 C C   . PRO B 1 439 ? 20.246  -66.606 -12.071 1.00 61.93  ? 440 PRO B C   1 
ATOM   7522 O O   . PRO B 1 439 ? 19.034  -66.584 -12.255 1.00 64.00  ? 440 PRO B O   1 
ATOM   7523 C CB  . PRO B 1 439 ? 21.635  -64.630 -12.681 1.00 58.33  ? 440 PRO B CB  1 
ATOM   7524 C CG  . PRO B 1 439 ? 20.789  -63.713 -13.478 1.00 71.45  ? 440 PRO B CG  1 
ATOM   7525 C CD  . PRO B 1 439 ? 20.621  -64.402 -14.808 1.00 68.26  ? 440 PRO B CD  1 
ATOM   7526 N N   . LEU B 1 440 ? 20.808  -67.101 -10.978 1.00 64.18  ? 441 LEU B N   1 
ATOM   7527 C CA  . LEU B 1 440 ? 20.037  -67.819 -9.983  1.00 58.82  ? 441 LEU B CA  1 
ATOM   7528 C C   . LEU B 1 440 ? 19.018  -66.923 -9.277  1.00 62.26  ? 441 LEU B C   1 
ATOM   7529 O O   . LEU B 1 440 ? 17.940  -67.382 -8.893  1.00 59.31  ? 441 LEU B O   1 
ATOM   7530 C CB  . LEU B 1 440 ? 20.978  -68.453 -8.957  1.00 71.03  ? 441 LEU B CB  1 
ATOM   7531 C CG  . LEU B 1 440 ? 20.432  -69.651 -8.177  1.00 77.58  ? 441 LEU B CG  1 
ATOM   7532 C CD1 . LEU B 1 440 ? 20.351  -70.866 -9.090  1.00 70.18  ? 441 LEU B CD1 1 
ATOM   7533 C CD2 . LEU B 1 440 ? 21.290  -69.940 -6.950  1.00 74.28  ? 441 LEU B CD2 1 
ATOM   7534 N N   . TRP B 1 441 ? 19.360  -65.647 -9.104  1.00 59.87  ? 442 TRP B N   1 
ATOM   7535 C CA  . TRP B 1 441 ? 18.510  -64.739 -8.326  1.00 58.10  ? 442 TRP B CA  1 
ATOM   7536 C C   . TRP B 1 441 ? 17.200  -64.414 -9.054  1.00 63.33  ? 442 TRP B C   1 
ATOM   7537 O O   . TRP B 1 441 ? 16.276  -63.869 -8.451  1.00 60.33  ? 442 TRP B O   1 
ATOM   7538 C CB  . TRP B 1 441 ? 19.259  -63.436 -7.974  1.00 50.12  ? 442 TRP B CB  1 
ATOM   7539 C CG  . TRP B 1 441 ? 19.603  -62.538 -9.150  1.00 61.51  ? 442 TRP B CG  1 
ATOM   7540 C CD1 . TRP B 1 441 ? 20.818  -62.431 -9.771  1.00 60.99  ? 442 TRP B CD1 1 
ATOM   7541 C CD2 . TRP B 1 441 ? 18.728  -61.615 -9.824  1.00 57.38  ? 442 TRP B CD2 1 
ATOM   7542 N NE1 . TRP B 1 441 ? 20.751  -61.510 -10.794 1.00 58.34  ? 442 TRP B NE1 1 
ATOM   7543 C CE2 . TRP B 1 441 ? 19.482  -60.998 -10.851 1.00 59.57  ? 442 TRP B CE2 1 
ATOM   7544 C CE3 . TRP B 1 441 ? 17.382  -61.258 -9.667  1.00 55.45  ? 442 TRP B CE3 1 
ATOM   7545 C CZ2 . TRP B 1 441 ? 18.930  -60.048 -11.722 1.00 63.15  ? 442 TRP B CZ2 1 
ATOM   7546 C CZ3 . TRP B 1 441 ? 16.835  -60.311 -10.533 1.00 58.96  ? 442 TRP B CZ3 1 
ATOM   7547 C CH2 . TRP B 1 441 ? 17.609  -59.721 -11.549 1.00 60.12  ? 442 TRP B CH2 1 
ATOM   7548 N N   . MET B 1 442 ? 17.122  -64.742 -10.347 1.00 61.08  ? 443 MET B N   1 
ATOM   7549 C CA  . MET B 1 442 ? 15.894  -64.511 -11.106 1.00 48.72  ? 443 MET B CA  1 
ATOM   7550 C C   . MET B 1 442 ? 14.839  -65.606 -10.866 1.00 52.04  ? 443 MET B C   1 
ATOM   7551 O O   . MET B 1 442 ? 13.673  -65.434 -11.211 1.00 55.88  ? 443 MET B O   1 
ATOM   7552 C CB  . MET B 1 442 ? 16.198  -64.396 -12.588 1.00 53.81  ? 443 MET B CB  1 
ATOM   7553 C CG  . MET B 1 442 ? 16.948  -63.141 -12.979 1.00 52.06  ? 443 MET B CG  1 
ATOM   7554 S SD  . MET B 1 442 ? 16.816  -62.933 -14.762 1.00 63.83  ? 443 MET B SD  1 
ATOM   7555 C CE  . MET B 1 442 ? 17.568  -61.342 -14.964 1.00 71.21  ? 443 MET B CE  1 
ATOM   7556 N N   . GLY B 1 443 ? 15.240  -66.715 -10.252 1.00 56.25  ? 444 GLY B N   1 
ATOM   7557 C CA  . GLY B 1 443 ? 14.306  -67.776 -9.902  1.00 47.01  ? 444 GLY B CA  1 
ATOM   7558 C C   . GLY B 1 443 ? 13.728  -68.476 -11.119 1.00 55.83  ? 444 GLY B C   1 
ATOM   7559 O O   . GLY B 1 443 ? 14.461  -68.908 -12.016 1.00 48.38  ? 444 GLY B O   1 
ATOM   7560 N N   . VAL B 1 444 ? 12.406  -68.599 -11.147 1.00 45.86  ? 445 VAL B N   1 
ATOM   7561 C CA  . VAL B 1 444 ? 11.713  -69.124 -12.317 1.00 51.22  ? 445 VAL B CA  1 
ATOM   7562 C C   . VAL B 1 444 ? 11.069  -67.963 -13.071 1.00 41.55  ? 445 VAL B C   1 
ATOM   7563 O O   . VAL B 1 444 ? 9.964   -67.562 -12.736 1.00 51.32  ? 445 VAL B O   1 
ATOM   7564 C CB  . VAL B 1 444 ? 10.633  -70.159 -11.935 1.00 48.73  ? 445 VAL B CB  1 
ATOM   7565 C CG1 . VAL B 1 444 ? 10.152  -70.896 -13.173 1.00 47.50  ? 445 VAL B CG1 1 
ATOM   7566 C CG2 . VAL B 1 444 ? 11.174  -71.151 -10.909 1.00 41.78  ? 445 VAL B CG2 1 
ATOM   7567 N N   . PRO B 1 445 ? 11.766  -67.426 -14.093 1.00 43.95  ? 446 PRO B N   1 
ATOM   7568 C CA  . PRO B 1 445 ? 11.359  -66.173 -14.749 1.00 48.31  ? 446 PRO B CA  1 
ATOM   7569 C C   . PRO B 1 445 ? 10.184  -66.318 -15.696 1.00 40.32  ? 446 PRO B C   1 
ATOM   7570 O O   . PRO B 1 445 ? 9.835   -67.419 -16.116 1.00 42.73  ? 446 PRO B O   1 
ATOM   7571 C CB  . PRO B 1 445 ? 12.616  -65.748 -15.536 1.00 40.34  ? 446 PRO B CB  1 
ATOM   7572 C CG  . PRO B 1 445 ? 13.697  -66.702 -15.121 1.00 53.52  ? 446 PRO B CG  1 
ATOM   7573 C CD  . PRO B 1 445 ? 13.008  -67.954 -14.680 1.00 41.43  ? 446 PRO B CD  1 
ATOM   7574 N N   . HIS B 1 446 ? 9.575   -65.180 -15.994 1.00 42.38  ? 447 HIS B N   1 
ATOM   7575 C CA  . HIS B 1 446 ? 8.511   -65.065 -16.987 1.00 51.25  ? 447 HIS B CA  1 
ATOM   7576 C C   . HIS B 1 446 ? 8.895   -65.770 -18.289 1.00 45.80  ? 447 HIS B C   1 
ATOM   7577 O O   . HIS B 1 446 ? 9.990   -65.567 -18.800 1.00 44.79  ? 447 HIS B O   1 
ATOM   7578 C CB  . HIS B 1 446 ? 8.229   -63.586 -17.242 1.00 38.60  ? 447 HIS B CB  1 
ATOM   7579 C CG  . HIS B 1 446 ? 7.178   -63.325 -18.263 1.00 43.85  ? 447 HIS B CG  1 
ATOM   7580 N ND1 . HIS B 1 446 ? 5.833   -63.419 -17.984 1.00 46.47  ? 447 HIS B ND1 1 
ATOM   7581 C CD2 . HIS B 1 446 ? 7.271   -62.926 -19.556 1.00 40.28  ? 447 HIS B CD2 1 
ATOM   7582 C CE1 . HIS B 1 446 ? 5.140   -63.104 -19.065 1.00 41.57  ? 447 HIS B CE1 1 
ATOM   7583 N NE2 . HIS B 1 446 ? 5.990   -62.802 -20.032 1.00 48.43  ? 447 HIS B NE2 1 
ATOM   7584 N N   . GLY B 1 447 ? 8.005   -66.617 -18.799 1.00 41.26  ? 448 GLY B N   1 
ATOM   7585 C CA  . GLY B 1 447 ? 8.251   -67.320 -20.043 1.00 42.37  ? 448 GLY B CA  1 
ATOM   7586 C C   . GLY B 1 447 ? 8.808   -68.733 -19.951 1.00 52.70  ? 448 GLY B C   1 
ATOM   7587 O O   . GLY B 1 447 ? 8.752   -69.448 -20.940 1.00 47.26  ? 448 GLY B O   1 
ATOM   7588 N N   . TYR B 1 448 ? 9.306   -69.173 -18.793 1.00 44.41  ? 449 TYR B N   1 
ATOM   7589 C CA  . TYR B 1 448 ? 10.105  -70.398 -18.797 1.00 41.04  ? 449 TYR B CA  1 
ATOM   7590 C C   . TYR B 1 448 ? 9.347   -71.664 -18.420 1.00 42.92  ? 449 TYR B C   1 
ATOM   7591 O O   . TYR B 1 448 ? 9.943   -72.725 -18.239 1.00 50.58  ? 449 TYR B O   1 
ATOM   7592 C CB  . TYR B 1 448 ? 11.360  -70.182 -17.933 1.00 37.49  ? 449 TYR B CB  1 
ATOM   7593 C CG  . TYR B 1 448 ? 12.308  -69.358 -18.771 1.00 48.12  ? 449 TYR B CG  1 
ATOM   7594 C CD1 . TYR B 1 448 ? 13.085  -69.968 -19.765 1.00 46.53  ? 449 TYR B CD1 1 
ATOM   7595 C CD2 . TYR B 1 448 ? 12.318  -67.957 -18.694 1.00 44.52  ? 449 TYR B CD2 1 
ATOM   7596 C CE1 . TYR B 1 448 ? 13.905  -69.212 -20.615 1.00 42.97  ? 449 TYR B CE1 1 
ATOM   7597 C CE2 . TYR B 1 448 ? 13.131  -67.196 -19.536 1.00 50.28  ? 449 TYR B CE2 1 
ATOM   7598 C CZ  . TYR B 1 448 ? 13.923  -67.837 -20.500 1.00 54.68  ? 449 TYR B CZ  1 
ATOM   7599 O OH  . TYR B 1 448 ? 14.733  -67.104 -21.339 1.00 54.88  ? 449 TYR B OH  1 
ATOM   7600 N N   . GLU B 1 449 ? 8.025   -71.565 -18.395 1.00 45.76  ? 450 GLU B N   1 
ATOM   7601 C CA  . GLU B 1 449 ? 7.173   -72.742 -18.350 1.00 41.94  ? 450 GLU B CA  1 
ATOM   7602 C C   . GLU B 1 449 ? 6.796   -73.220 -19.767 1.00 45.15  ? 450 GLU B C   1 
ATOM   7603 O O   . GLU B 1 449 ? 6.399   -74.366 -19.945 1.00 43.72  ? 450 GLU B O   1 
ATOM   7604 C CB  . GLU B 1 449 ? 5.898   -72.451 -17.552 1.00 35.29  ? 450 GLU B CB  1 
ATOM   7605 C CG  . GLU B 1 449 ? 4.717   -71.907 -18.373 1.00 41.46  ? 450 GLU B CG  1 
ATOM   7606 C CD  . GLU B 1 449 ? 4.890   -70.454 -18.859 1.00 56.68  ? 450 GLU B CD  1 
ATOM   7607 O OE1 . GLU B 1 449 ? 6.016   -69.907 -18.788 1.00 43.04  ? 450 GLU B OE1 1 
ATOM   7608 O OE2 . GLU B 1 449 ? 3.881   -69.861 -19.314 1.00 55.87  ? 450 GLU B OE2 1 
ATOM   7609 N N   . ILE B 1 450 ? 6.890   -72.345 -20.773 1.00 43.78  ? 451 ILE B N   1 
ATOM   7610 C CA  . ILE B 1 450 ? 6.430   -72.693 -22.134 1.00 45.87  ? 451 ILE B CA  1 
ATOM   7611 C C   . ILE B 1 450 ? 7.136   -73.939 -22.671 1.00 40.79  ? 451 ILE B C   1 
ATOM   7612 O O   . ILE B 1 450 ? 6.500   -74.882 -23.132 1.00 40.97  ? 451 ILE B O   1 
ATOM   7613 C CB  . ILE B 1 450 ? 6.648   -71.549 -23.147 1.00 46.98  ? 451 ILE B CB  1 
ATOM   7614 C CG1 . ILE B 1 450 ? 5.810   -70.324 -22.764 1.00 41.63  ? 451 ILE B CG1 1 
ATOM   7615 C CG2 . ILE B 1 450 ? 6.248   -72.030 -24.540 1.00 36.69  ? 451 ILE B CG2 1 
ATOM   7616 C CD1 . ILE B 1 450 ? 6.246   -69.031 -23.419 1.00 36.17  ? 451 ILE B CD1 1 
ATOM   7617 N N   . GLU B 1 451 ? 8.458   -73.940 -22.574 1.00 42.07  ? 452 GLU B N   1 
ATOM   7618 C CA  . GLU B 1 451 ? 9.251   -75.045 -23.075 1.00 44.52  ? 452 GLU B CA  1 
ATOM   7619 C C   . GLU B 1 451 ? 8.869   -76.392 -22.460 1.00 47.26  ? 452 GLU B C   1 
ATOM   7620 O O   . GLU B 1 451 ? 9.022   -77.423 -23.121 1.00 46.91  ? 452 GLU B O   1 
ATOM   7621 C CB  . GLU B 1 451 ? 10.735  -74.758 -22.859 1.00 46.00  ? 452 GLU B CB  1 
ATOM   7622 C CG  . GLU B 1 451 ? 11.136  -74.566 -21.403 1.00 58.86  ? 452 GLU B CG  1 
ATOM   7623 C CD  . GLU B 1 451 ? 12.519  -73.950 -21.280 1.00 61.47  ? 452 GLU B CD  1 
ATOM   7624 O OE1 . GLU B 1 451 ? 13.378  -74.556 -20.606 1.00 55.16  ? 452 GLU B OE1 1 
ATOM   7625 O OE2 . GLU B 1 451 ? 12.756  -72.869 -21.864 1.00 59.31  ? 452 GLU B OE2 1 
ATOM   7626 N N   . PHE B 1 452 ? 8.345   -76.402 -21.232 1.00 40.77  ? 453 PHE B N   1 
ATOM   7627 C CA  . PHE B 1 452 ? 7.859   -77.658 -20.669 1.00 39.51  ? 453 PHE B CA  1 
ATOM   7628 C C   . PHE B 1 452 ? 6.509   -78.015 -21.215 1.00 39.55  ? 453 PHE B C   1 
ATOM   7629 O O   . PHE B 1 452 ? 6.217   -79.190 -21.436 1.00 44.98  ? 453 PHE B O   1 
ATOM   7630 C CB  . PHE B 1 452 ? 7.815   -77.610 -19.120 1.00 41.27  ? 453 PHE B CB  1 
ATOM   7631 C CG  . PHE B 1 452 ? 9.168   -77.708 -18.520 1.00 43.57  ? 453 PHE B CG  1 
ATOM   7632 C CD1 . PHE B 1 452 ? 9.715   -78.942 -18.221 1.00 37.96  ? 453 PHE B CD1 1 
ATOM   7633 C CD2 . PHE B 1 452 ? 9.948   -76.571 -18.366 1.00 42.47  ? 453 PHE B CD2 1 
ATOM   7634 C CE1 . PHE B 1 452 ? 11.017  -79.032 -17.733 1.00 42.96  ? 453 PHE B CE1 1 
ATOM   7635 C CE2 . PHE B 1 452 ? 11.238  -76.651 -17.870 1.00 44.57  ? 453 PHE B CE2 1 
ATOM   7636 C CZ  . PHE B 1 452 ? 11.775  -77.885 -17.561 1.00 44.10  ? 453 PHE B CZ  1 
ATOM   7637 N N   . ILE B 1 453 ? 5.667   -77.013 -21.409 1.00 39.59  ? 454 ILE B N   1 
ATOM   7638 C CA  . ILE B 1 453 ? 4.327   -77.250 -21.945 1.00 38.83  ? 454 ILE B CA  1 
ATOM   7639 C C   . ILE B 1 453 ? 4.423   -77.844 -23.364 1.00 48.77  ? 454 ILE B C   1 
ATOM   7640 O O   . ILE B 1 453 ? 3.675   -78.751 -23.740 1.00 43.65  ? 454 ILE B O   1 
ATOM   7641 C CB  . ILE B 1 453 ? 3.502   -75.951 -21.948 1.00 49.49  ? 454 ILE B CB  1 
ATOM   7642 C CG1 . ILE B 1 453 ? 3.391   -75.395 -20.517 1.00 40.38  ? 454 ILE B CG1 1 
ATOM   7643 C CG2 . ILE B 1 453 ? 2.119   -76.202 -22.500 1.00 36.88  ? 454 ILE B CG2 1 
ATOM   7644 C CD1 . ILE B 1 453 ? 2.763   -76.390 -19.612 1.00 51.01  ? 454 ILE B CD1 1 
ATOM   7645 N N   . PHE B 1 454 ? 5.376   -77.355 -24.147 1.00 42.92  ? 455 PHE B N   1 
ATOM   7646 C CA  . PHE B 1 454 ? 5.514   -77.817 -25.524 1.00 44.45  ? 455 PHE B CA  1 
ATOM   7647 C C   . PHE B 1 454 ? 6.352   -79.088 -25.613 1.00 49.61  ? 455 PHE B C   1 
ATOM   7648 O O   . PHE B 1 454 ? 6.561   -79.616 -26.695 1.00 51.62  ? 455 PHE B O   1 
ATOM   7649 C CB  . PHE B 1 454 ? 6.104   -76.700 -26.391 1.00 37.65  ? 455 PHE B CB  1 
ATOM   7650 C CG  . PHE B 1 454 ? 5.058   -75.789 -26.966 1.00 49.37  ? 455 PHE B CG  1 
ATOM   7651 C CD1 . PHE B 1 454 ? 4.546   -74.737 -26.218 1.00 39.49  ? 455 PHE B CD1 1 
ATOM   7652 C CD2 . PHE B 1 454 ? 4.545   -76.014 -28.232 1.00 35.38  ? 455 PHE B CD2 1 
ATOM   7653 C CE1 . PHE B 1 454 ? 3.551   -73.905 -26.738 1.00 43.42  ? 455 PHE B CE1 1 
ATOM   7654 C CE2 . PHE B 1 454 ? 3.549   -75.181 -28.753 1.00 39.32  ? 455 PHE B CE2 1 
ATOM   7655 C CZ  . PHE B 1 454 ? 3.052   -74.133 -28.010 1.00 37.89  ? 455 PHE B CZ  1 
ATOM   7656 N N   . GLY B 1 455 ? 6.836   -79.571 -24.470 1.00 47.33  ? 456 GLY B N   1 
ATOM   7657 C CA  . GLY B 1 455 ? 7.540   -80.842 -24.435 1.00 41.64  ? 456 GLY B CA  1 
ATOM   7658 C C   . GLY B 1 455 ? 8.949   -80.793 -24.987 1.00 51.66  ? 456 GLY B C   1 
ATOM   7659 O O   . GLY B 1 455 ? 9.564   -81.833 -25.257 1.00 49.41  ? 456 GLY B O   1 
ATOM   7660 N N   . ILE B 1 456 ? 9.480   -79.587 -25.135 1.00 46.34  ? 457 ILE B N   1 
ATOM   7661 C CA  . ILE B 1 456 ? 10.850  -79.403 -25.616 1.00 42.57  ? 457 ILE B CA  1 
ATOM   7662 C C   . ILE B 1 456 ? 11.929  -80.282 -24.935 1.00 55.34  ? 457 ILE B C   1 
ATOM   7663 O O   . ILE B 1 456 ? 12.873  -80.704 -25.606 1.00 54.84  ? 457 ILE B O   1 
ATOM   7664 C CB  . ILE B 1 456 ? 11.242  -77.918 -25.482 1.00 49.43  ? 457 ILE B CB  1 
ATOM   7665 C CG1 . ILE B 1 456 ? 10.204  -77.059 -26.202 1.00 44.71  ? 457 ILE B CG1 1 
ATOM   7666 C CG2 . ILE B 1 456 ? 12.641  -77.647 -26.011 1.00 48.56  ? 457 ILE B CG2 1 
ATOM   7667 C CD1 . ILE B 1 456 ? 10.016  -77.418 -27.661 1.00 38.97  ? 457 ILE B CD1 1 
ATOM   7668 N N   . PRO B 1 457 ? 11.803  -80.583 -23.619 1.00 49.90  ? 458 PRO B N   1 
ATOM   7669 C CA  . PRO B 1 457 ? 12.863  -81.432 -23.055 1.00 47.32  ? 458 PRO B CA  1 
ATOM   7670 C C   . PRO B 1 457 ? 12.992  -82.833 -23.679 1.00 50.82  ? 458 PRO B C   1 
ATOM   7671 O O   . PRO B 1 457 ? 14.034  -83.465 -23.499 1.00 49.21  ? 458 PRO B O   1 
ATOM   7672 C CB  . PRO B 1 457 ? 12.466  -81.548 -21.573 1.00 53.59  ? 458 PRO B CB  1 
ATOM   7673 C CG  . PRO B 1 457 ? 11.736  -80.322 -21.286 1.00 55.63  ? 458 PRO B CG  1 
ATOM   7674 C CD  . PRO B 1 457 ? 10.948  -80.030 -22.551 1.00 48.47  ? 458 PRO B CD  1 
ATOM   7675 N N   . LEU B 1 458 ? 11.968  -83.302 -24.387 1.00 47.53  ? 459 LEU B N   1 
ATOM   7676 C CA  . LEU B 1 458 ? 12.057  -84.560 -25.118 1.00 45.85  ? 459 LEU B CA  1 
ATOM   7677 C C   . LEU B 1 458 ? 12.947  -84.467 -26.372 1.00 57.62  ? 459 LEU B C   1 
ATOM   7678 O O   . LEU B 1 458 ? 13.209  -85.471 -27.025 1.00 60.37  ? 459 LEU B O   1 
ATOM   7679 C CB  . LEU B 1 458 ? 10.665  -85.035 -25.522 1.00 41.19  ? 459 LEU B CB  1 
ATOM   7680 C CG  . LEU B 1 458 ? 9.636   -85.208 -24.408 1.00 50.25  ? 459 LEU B CG  1 
ATOM   7681 C CD1 . LEU B 1 458 ? 8.356   -85.804 -24.984 1.00 40.93  ? 459 LEU B CD1 1 
ATOM   7682 C CD2 . LEU B 1 458 ? 10.197  -86.094 -23.297 1.00 53.74  ? 459 LEU B CD2 1 
ATOM   7683 N N   . ASP B 1 459 ? 13.405  -83.268 -26.714 1.00 53.00  ? 460 ASP B N   1 
ATOM   7684 C CA  . ASP B 1 459 ? 14.309  -83.111 -27.854 1.00 57.67  ? 460 ASP B CA  1 
ATOM   7685 C C   . ASP B 1 459 ? 15.710  -83.608 -27.486 1.00 62.60  ? 460 ASP B C   1 
ATOM   7686 O O   . ASP B 1 459 ? 16.425  -82.974 -26.696 1.00 59.97  ? 460 ASP B O   1 
ATOM   7687 C CB  . ASP B 1 459 ? 14.343  -81.649 -28.307 1.00 62.01  ? 460 ASP B CB  1 
ATOM   7688 C CG  . ASP B 1 459 ? 15.247  -81.397 -29.516 1.00 60.95  ? 460 ASP B CG  1 
ATOM   7689 O OD1 . ASP B 1 459 ? 16.113  -82.231 -29.875 1.00 65.71  ? 460 ASP B OD1 1 
ATOM   7690 O OD2 . ASP B 1 459 ? 15.098  -80.309 -30.100 1.00 73.29  ? 460 ASP B OD2 1 
ATOM   7691 N N   . PRO B 1 460 ? 16.124  -84.720 -28.109 1.00 75.85  ? 461 PRO B N   1 
ATOM   7692 C CA  . PRO B 1 460 ? 17.396  -85.384 -27.796 1.00 71.50  ? 461 PRO B CA  1 
ATOM   7693 C C   . PRO B 1 460 ? 18.591  -84.428 -27.843 1.00 72.12  ? 461 PRO B C   1 
ATOM   7694 O O   . PRO B 1 460 ? 19.474  -84.515 -26.985 1.00 78.96  ? 461 PRO B O   1 
ATOM   7695 C CB  . PRO B 1 460 ? 17.508  -86.456 -28.879 1.00 65.24  ? 461 PRO B CB  1 
ATOM   7696 C CG  . PRO B 1 460 ? 16.619  -85.971 -30.001 1.00 70.88  ? 461 PRO B CG  1 
ATOM   7697 C CD  . PRO B 1 460 ? 15.485  -85.278 -29.316 1.00 64.24  ? 461 PRO B CD  1 
ATOM   7698 N N   . SER B 1 461 ? 18.591  -83.502 -28.799 1.00 65.80  ? 462 SER B N   1 
ATOM   7699 C CA  . SER B 1 461 ? 19.711  -82.573 -28.951 1.00 63.44  ? 462 SER B CA  1 
ATOM   7700 C C   . SER B 1 461 ? 19.788  -81.612 -27.782 1.00 58.49  ? 462 SER B C   1 
ATOM   7701 O O   . SER B 1 461 ? 20.784  -80.921 -27.599 1.00 75.00  ? 462 SER B O   1 
ATOM   7702 C CB  . SER B 1 461 ? 19.595  -81.791 -30.259 1.00 68.14  ? 462 SER B CB  1 
ATOM   7703 O OG  . SER B 1 461 ? 18.530  -80.862 -30.190 1.00 66.88  ? 462 SER B OG  1 
ATOM   7704 N N   . ARG B 1 462 ? 18.731  -81.553 -26.984 1.00 66.74  ? 463 ARG B N   1 
ATOM   7705 C CA  . ARG B 1 462 ? 18.781  -80.724 -25.788 1.00 73.18  ? 463 ARG B CA  1 
ATOM   7706 C C   . ARG B 1 462 ? 19.214  -81.563 -24.588 1.00 70.99  ? 463 ARG B C   1 
ATOM   7707 O O   . ARG B 1 462 ? 19.086  -82.793 -24.594 1.00 78.85  ? 463 ARG B O   1 
ATOM   7708 C CB  . ARG B 1 462 ? 17.435  -80.042 -25.556 1.00 62.40  ? 463 ARG B CB  1 
ATOM   7709 C CG  . ARG B 1 462 ? 17.384  -78.692 -26.253 1.00 69.22  ? 463 ARG B CG  1 
ATOM   7710 C CD  . ARG B 1 462 ? 16.025  -78.388 -26.814 1.00 56.42  ? 463 ARG B CD  1 
ATOM   7711 N NE  . ARG B 1 462 ? 16.119  -77.558 -28.007 1.00 75.03  ? 463 ARG B NE  1 
ATOM   7712 C CZ  . ARG B 1 462 ? 16.148  -76.228 -28.005 1.00 86.89  ? 463 ARG B CZ  1 
ATOM   7713 N NH1 . ARG B 1 462 ? 16.091  -75.567 -26.857 1.00 93.69  ? 463 ARG B NH1 1 
ATOM   7714 N NH2 . ARG B 1 462 ? 16.232  -75.557 -29.154 1.00 78.43  ? 463 ARG B NH2 1 
ATOM   7715 N N   . ASN B 1 463 ? 19.756  -80.903 -23.573 1.00 61.96  ? 464 ASN B N   1 
ATOM   7716 C CA  . ASN B 1 463 ? 20.377  -81.620 -22.470 1.00 65.60  ? 464 ASN B CA  1 
ATOM   7717 C C   . ASN B 1 463 ? 19.595  -81.505 -21.169 1.00 56.58  ? 464 ASN B C   1 
ATOM   7718 O O   . ASN B 1 463 ? 20.154  -81.166 -20.140 1.00 64.77  ? 464 ASN B O   1 
ATOM   7719 C CB  . ASN B 1 463 ? 21.806  -81.116 -22.278 1.00 62.00  ? 464 ASN B CB  1 
ATOM   7720 C CG  . ASN B 1 463 ? 22.610  -81.142 -23.570 1.00 78.36  ? 464 ASN B CG  1 
ATOM   7721 O OD1 . ASN B 1 463 ? 22.773  -82.193 -24.197 1.00 76.45  ? 464 ASN B OD1 1 
ATOM   7722 N ND2 . ASN B 1 463 ? 23.093  -79.974 -23.992 1.00 87.28  ? 464 ASN B ND2 1 
ATOM   7723 N N   . TYR B 1 464 ? 18.297  -81.791 -21.222 1.00 59.27  ? 465 TYR B N   1 
ATOM   7724 C CA  . TYR B 1 464 ? 17.473  -81.820 -20.017 1.00 54.69  ? 465 TYR B CA  1 
ATOM   7725 C C   . TYR B 1 464 ? 17.671  -83.130 -19.266 1.00 62.07  ? 465 TYR B C   1 
ATOM   7726 O O   . TYR B 1 464 ? 18.046  -84.148 -19.851 1.00 68.02  ? 465 TYR B O   1 
ATOM   7727 C CB  . TYR B 1 464 ? 15.988  -81.648 -20.354 1.00 47.75  ? 465 TYR B CB  1 
ATOM   7728 C CG  . TYR B 1 464 ? 15.581  -80.257 -20.809 1.00 69.36  ? 465 TYR B CG  1 
ATOM   7729 C CD1 . TYR B 1 464 ? 15.689  -79.879 -22.160 1.00 55.61  ? 465 TYR B CD1 1 
ATOM   7730 C CD2 . TYR B 1 464 ? 15.055  -79.328 -19.904 1.00 48.60  ? 465 TYR B CD2 1 
ATOM   7731 C CE1 . TYR B 1 464 ? 15.309  -78.625 -22.592 1.00 46.71  ? 465 TYR B CE1 1 
ATOM   7732 C CE2 . TYR B 1 464 ? 14.676  -78.056 -20.331 1.00 53.50  ? 465 TYR B CE2 1 
ATOM   7733 C CZ  . TYR B 1 464 ? 14.803  -77.716 -21.677 1.00 62.61  ? 465 TYR B CZ  1 
ATOM   7734 O OH  . TYR B 1 464 ? 14.434  -76.468 -22.117 1.00 52.29  ? 465 TYR B OH  1 
ATOM   7735 N N   . THR B 1 465 ? 17.403  -83.121 -17.968 1.00 53.44  ? 466 THR B N   1 
ATOM   7736 C CA  . THR B 1 465 ? 17.465  -84.356 -17.206 1.00 53.76  ? 466 THR B CA  1 
ATOM   7737 C C   . THR B 1 465 ? 16.265  -85.240 -17.501 1.00 55.01  ? 466 THR B C   1 
ATOM   7738 O O   . THR B 1 465 ? 15.250  -84.786 -18.031 1.00 53.21  ? 466 THR B O   1 
ATOM   7739 C CB  . THR B 1 465 ? 17.489  -84.111 -15.704 1.00 55.08  ? 466 THR B CB  1 
ATOM   7740 O OG1 . THR B 1 465 ? 16.146  -83.876 -15.258 1.00 54.45  ? 466 THR B OG1 1 
ATOM   7741 C CG2 . THR B 1 465 ? 18.389  -82.931 -15.373 1.00 49.58  ? 466 THR B CG2 1 
ATOM   7742 N N   . ALA B 1 466 ? 16.380  -86.503 -17.114 1.00 53.28  ? 467 ALA B N   1 
ATOM   7743 C CA  . ALA B 1 466 ? 15.318  -87.468 -17.324 1.00 55.29  ? 467 ALA B CA  1 
ATOM   7744 C C   . ALA B 1 466 ? 14.069  -87.108 -16.520 1.00 56.86  ? 467 ALA B C   1 
ATOM   7745 O O   . ALA B 1 466 ? 12.943  -87.345 -16.976 1.00 59.83  ? 467 ALA B O   1 
ATOM   7746 C CB  . ALA B 1 466 ? 15.811  -88.867 -16.966 1.00 55.40  ? 467 ALA B CB  1 
ATOM   7747 N N   . GLU B 1 467 ? 14.260  -86.549 -15.324 1.00 57.02  ? 468 GLU B N   1 
ATOM   7748 C CA  . GLU B 1 467 ? 13.123  -86.125 -14.502 1.00 58.05  ? 468 GLU B CA  1 
ATOM   7749 C C   . GLU B 1 467 ? 12.389  -84.984 -15.188 1.00 52.62  ? 468 GLU B C   1 
ATOM   7750 O O   . GLU B 1 467 ? 11.157  -84.929 -15.195 1.00 46.81  ? 468 GLU B O   1 
ATOM   7751 C CB  . GLU B 1 467 ? 13.573  -85.678 -13.113 1.00 66.25  ? 468 GLU B CB  1 
ATOM   7752 C CG  . GLU B 1 467 ? 14.156  -86.763 -12.244 1.00 69.71  ? 468 GLU B CG  1 
ATOM   7753 C CD  . GLU B 1 467 ? 14.528  -86.242 -10.862 1.00 104.41 ? 468 GLU B CD  1 
ATOM   7754 O OE1 . GLU B 1 467 ? 14.405  -85.015 -10.645 1.00 84.87  ? 468 GLU B OE1 1 
ATOM   7755 O OE2 . GLU B 1 467 ? 14.937  -87.053 -9.995  1.00 123.49 ? 468 GLU B OE2 1 
ATOM   7756 N N   . GLU B 1 468 ? 13.156  -84.066 -15.765 1.00 41.77  ? 469 GLU B N   1 
ATOM   7757 C CA  . GLU B 1 468 ? 12.558  -82.987 -16.539 1.00 49.85  ? 469 GLU B CA  1 
ATOM   7758 C C   . GLU B 1 468 ? 11.743  -83.515 -17.730 1.00 47.71  ? 469 GLU B C   1 
ATOM   7759 O O   . GLU B 1 468 ? 10.698  -82.940 -18.056 1.00 50.77  ? 469 GLU B O   1 
ATOM   7760 C CB  . GLU B 1 468 ? 13.638  -82.007 -16.991 1.00 55.46  ? 469 GLU B CB  1 
ATOM   7761 C CG  . GLU B 1 468 ? 14.025  -81.041 -15.878 1.00 42.82  ? 469 GLU B CG  1 
ATOM   7762 C CD  . GLU B 1 468 ? 15.277  -80.254 -16.169 1.00 58.28  ? 469 GLU B CD  1 
ATOM   7763 O OE1 . GLU B 1 468 ? 16.142  -80.762 -16.922 1.00 55.89  ? 469 GLU B OE1 1 
ATOM   7764 O OE2 . GLU B 1 468 ? 15.406  -79.122 -15.637 1.00 57.26  ? 469 GLU B OE2 1 
ATOM   7765 N N   . LYS B 1 469 ? 12.164  -84.633 -18.330 1.00 46.86  ? 470 LYS B N   1 
ATOM   7766 C CA  . LYS B 1 469 ? 11.376  -85.251 -19.412 1.00 50.64  ? 470 LYS B CA  1 
ATOM   7767 C C   . LYS B 1 469 ? 10.061  -85.775 -18.868 1.00 48.13  ? 470 LYS B C   1 
ATOM   7768 O O   . LYS B 1 469 ? 9.000   -85.582 -19.478 1.00 46.74  ? 470 LYS B O   1 
ATOM   7769 C CB  . LYS B 1 469 ? 12.164  -86.374 -20.107 1.00 39.06  ? 470 LYS B CB  1 
ATOM   7770 C CG  . LYS B 1 469 ? 13.424  -85.828 -20.756 1.00 49.42  ? 470 LYS B CG  1 
ATOM   7771 C CD  . LYS B 1 469 ? 14.311  -86.857 -21.418 1.00 43.64  ? 470 LYS B CD  1 
ATOM   7772 C CE  . LYS B 1 469 ? 15.582  -86.178 -21.862 1.00 55.66  ? 470 LYS B CE  1 
ATOM   7773 N NZ  . LYS B 1 469 ? 16.518  -87.089 -22.546 1.00 62.56  ? 470 LYS B NZ  1 
ATOM   7774 N N   . ILE B 1 470 ? 10.128  -86.414 -17.703 1.00 51.46  ? 471 ILE B N   1 
ATOM   7775 C CA  . ILE B 1 470 ? 8.932   -86.965 -17.065 1.00 48.19  ? 471 ILE B CA  1 
ATOM   7776 C C   . ILE B 1 470 ? 7.951   -85.849 -16.717 1.00 47.95  ? 471 ILE B C   1 
ATOM   7777 O O   . ILE B 1 470 ? 6.737   -85.975 -16.924 1.00 54.65  ? 471 ILE B O   1 
ATOM   7778 C CB  . ILE B 1 470 ? 9.292   -87.780 -15.770 1.00 59.89  ? 471 ILE B CB  1 
ATOM   7779 C CG1 . ILE B 1 470 ? 9.962   -89.105 -16.137 1.00 56.84  ? 471 ILE B CG1 1 
ATOM   7780 C CG2 . ILE B 1 470 ? 8.059   -88.041 -14.916 1.00 41.91  ? 471 ILE B CG2 1 
ATOM   7781 C CD1 . ILE B 1 470 ? 9.204   -89.901 -17.215 1.00 68.42  ? 471 ILE B CD1 1 
ATOM   7782 N N   . PHE B 1 471 ? 8.499   -84.766 -16.169 1.00 45.29  ? 472 PHE B N   1 
ATOM   7783 C CA  . PHE B 1 471 ? 7.733   -83.587 -15.772 1.00 48.63  ? 472 PHE B CA  1 
ATOM   7784 C C   . PHE B 1 471 ? 7.041   -82.973 -16.994 1.00 42.07  ? 472 PHE B C   1 
ATOM   7785 O O   . PHE B 1 471 ? 5.809   -82.775 -17.012 1.00 43.41  ? 472 PHE B O   1 
ATOM   7786 C CB  . PHE B 1 471 ? 8.683   -82.592 -15.102 1.00 47.99  ? 472 PHE B CB  1 
ATOM   7787 C CG  . PHE B 1 471 ? 8.047   -81.298 -14.681 1.00 53.78  ? 472 PHE B CG  1 
ATOM   7788 C CD1 . PHE B 1 471 ? 6.846   -81.285 -13.978 1.00 45.99  ? 472 PHE B CD1 1 
ATOM   7789 C CD2 . PHE B 1 471 ? 8.692   -80.084 -14.942 1.00 52.77  ? 472 PHE B CD2 1 
ATOM   7790 C CE1 . PHE B 1 471 ? 6.275   -80.077 -13.559 1.00 46.12  ? 472 PHE B CE1 1 
ATOM   7791 C CE2 . PHE B 1 471 ? 8.133   -78.873 -14.535 1.00 49.29  ? 472 PHE B CE2 1 
ATOM   7792 C CZ  . PHE B 1 471 ? 6.921   -78.872 -13.825 1.00 49.24  ? 472 PHE B CZ  1 
ATOM   7793 N N   . ALA B 1 472 ? 7.838   -82.698 -18.024 1.00 35.97  ? 473 ALA B N   1 
ATOM   7794 C CA  . ALA B 1 472 ? 7.286   -82.242 -19.314 1.00 40.11  ? 473 ALA B CA  1 
ATOM   7795 C C   . ALA B 1 472 ? 6.114   -83.111 -19.787 1.00 38.83  ? 473 ALA B C   1 
ATOM   7796 O O   . ALA B 1 472 ? 5.084   -82.598 -20.246 1.00 49.79  ? 473 ALA B O   1 
ATOM   7797 C CB  . ALA B 1 472 ? 8.370   -82.209 -20.367 1.00 38.69  ? 473 ALA B CB  1 
ATOM   7798 N N   . GLN B 1 473 ? 6.248   -84.424 -19.637 1.00 40.73  ? 474 GLN B N   1 
ATOM   7799 C CA  . GLN B 1 473 ? 5.175   -85.314 -20.071 1.00 51.31  ? 474 GLN B CA  1 
ATOM   7800 C C   . GLN B 1 473 ? 3.936   -85.148 -19.194 1.00 53.59  ? 474 GLN B C   1 
ATOM   7801 O O   . GLN B 1 473 ? 2.808   -85.201 -19.706 1.00 51.41  ? 474 GLN B O   1 
ATOM   7802 C CB  . GLN B 1 473 ? 5.657   -86.767 -20.093 1.00 54.27  ? 474 GLN B CB  1 
ATOM   7803 C CG  . GLN B 1 473 ? 6.645   -87.070 -21.240 1.00 54.21  ? 474 GLN B CG  1 
ATOM   7804 C CD  . GLN B 1 473 ? 7.246   -88.479 -21.169 1.00 65.04  ? 474 GLN B CD  1 
ATOM   7805 O OE1 . GLN B 1 473 ? 7.642   -88.957 -20.105 1.00 76.92  ? 474 GLN B OE1 1 
ATOM   7806 N NE2 . GLN B 1 473 ? 7.315   -89.141 -22.308 1.00 63.94  ? 474 GLN B NE2 1 
ATOM   7807 N N   . ARG B 1 474 ? 4.141   -84.927 -17.890 1.00 43.49  ? 475 ARG B N   1 
ATOM   7808 C CA  . ARG B 1 474 ? 3.022   -84.609 -16.989 1.00 49.12  ? 475 ARG B CA  1 
ATOM   7809 C C   . ARG B 1 474 ? 2.281   -83.352 -17.424 1.00 38.27  ? 475 ARG B C   1 
ATOM   7810 O O   . ARG B 1 474 ? 1.048   -83.355 -17.537 1.00 46.74  ? 475 ARG B O   1 
ATOM   7811 C CB  . ARG B 1 474 ? 3.500   -84.436 -15.535 1.00 51.33  ? 475 ARG B CB  1 
ATOM   7812 C CG  . ARG B 1 474 ? 3.736   -85.733 -14.789 1.00 56.64  ? 475 ARG B CG  1 
ATOM   7813 C CD  . ARG B 1 474 ? 4.199   -85.482 -13.348 1.00 69.81  ? 475 ARG B CD  1 
ATOM   7814 N NE  . ARG B 1 474 ? 3.288   -84.564 -12.674 1.00 48.11  ? 475 ARG B NE  1 
ATOM   7815 C CZ  . ARG B 1 474 ? 3.675   -83.563 -11.888 1.00 61.65  ? 475 ARG B CZ  1 
ATOM   7816 N NH1 . ARG B 1 474 ? 4.973   -83.348 -11.643 1.00 43.70  ? 475 ARG B NH1 1 
ATOM   7817 N NH2 . ARG B 1 474 ? 2.750   -82.774 -11.342 1.00 52.52  ? 475 ARG B NH2 1 
ATOM   7818 N N   . LEU B 1 475 ? 3.020   -82.276 -17.666 1.00 37.03  ? 476 LEU B N   1 
ATOM   7819 C CA  . LEU B 1 475 ? 2.369   -81.017 -18.051 1.00 47.08  ? 476 LEU B CA  1 
ATOM   7820 C C   . LEU B 1 475 ? 1.619   -81.152 -19.370 1.00 46.84  ? 476 LEU B C   1 
ATOM   7821 O O   . LEU B 1 475 ? 0.472   -80.681 -19.502 1.00 48.86  ? 476 LEU B O   1 
ATOM   7822 C CB  . LEU B 1 475 ? 3.385   -79.875 -18.129 1.00 44.77  ? 476 LEU B CB  1 
ATOM   7823 C CG  . LEU B 1 475 ? 4.090   -79.599 -16.794 1.00 55.11  ? 476 LEU B CG  1 
ATOM   7824 C CD1 . LEU B 1 475 ? 4.840   -78.298 -16.812 1.00 53.60  ? 476 LEU B CD1 1 
ATOM   7825 C CD2 . LEU B 1 475 ? 3.090   -79.598 -15.644 1.00 53.18  ? 476 LEU B CD2 1 
ATOM   7826 N N   . MET B 1 476 ? 2.237   -81.822 -20.341 1.00 46.16  ? 477 MET B N   1 
ATOM   7827 C CA  . MET B 1 476 ? 1.577   -81.999 -21.635 1.00 45.22  ? 477 MET B CA  1 
ATOM   7828 C C   . MET B 1 476 ? 0.271   -82.750 -21.425 1.00 43.15  ? 477 MET B C   1 
ATOM   7829 O O   . MET B 1 476 ? -0.750  -82.465 -22.080 1.00 41.99  ? 477 MET B O   1 
ATOM   7830 C CB  . MET B 1 476 ? 2.481   -82.743 -22.618 1.00 40.26  ? 477 MET B CB  1 
ATOM   7831 C CG  . MET B 1 476 ? 3.691   -81.940 -23.089 1.00 48.64  ? 477 MET B CG  1 
ATOM   7832 S SD  . MET B 1 476 ? 4.479   -82.679 -24.553 1.00 57.81  ? 477 MET B SD  1 
ATOM   7833 C CE  . MET B 1 476 ? 5.410   -83.988 -23.755 1.00 55.68  ? 477 MET B CE  1 
ATOM   7834 N N   . ARG B 1 477 ? 0.305   -83.689 -20.477 1.00 46.37  ? 478 ARG B N   1 
ATOM   7835 C CA  . ARG B 1 477 ? -0.864  -84.499 -20.163 1.00 43.79  ? 478 ARG B CA  1 
ATOM   7836 C C   . ARG B 1 477 ? -1.993  -83.627 -19.564 1.00 49.09  ? 478 ARG B C   1 
ATOM   7837 O O   . ARG B 1 477 ? -3.149  -83.742 -19.986 1.00 50.92  ? 478 ARG B O   1 
ATOM   7838 C CB  . ARG B 1 477 ? -0.466  -85.653 -19.223 1.00 46.89  ? 478 ARG B CB  1 
ATOM   7839 C CG  . ARG B 1 477 ? -1.636  -86.550 -18.786 1.00 52.24  ? 478 ARG B CG  1 
ATOM   7840 C CD  . ARG B 1 477 ? -2.499  -87.031 -19.975 1.00 62.90  ? 478 ARG B CD  1 
ATOM   7841 N NE  . ARG B 1 477 ? -1.725  -87.939 -20.809 1.00 65.59  ? 478 ARG B NE  1 
ATOM   7842 C CZ  . ARG B 1 477 ? -1.569  -89.235 -20.552 1.00 72.14  ? 478 ARG B CZ  1 
ATOM   7843 N NH1 . ARG B 1 477 ? -2.164  -89.778 -19.501 1.00 74.18  ? 478 ARG B NH1 1 
ATOM   7844 N NH2 . ARG B 1 477 ? -0.821  -89.989 -21.345 1.00 66.88  ? 478 ARG B NH2 1 
ATOM   7845 N N   . TYR B 1 478 ? -1.649  -82.741 -18.617 1.00 49.41  ? 479 TYR B N   1 
ATOM   7846 C CA  . TYR B 1 478 ? -2.614  -81.807 -18.004 1.00 45.46  ? 479 TYR B CA  1 
ATOM   7847 C C   . TYR B 1 478 ? -3.284  -80.898 -19.035 1.00 47.85  ? 479 TYR B C   1 
ATOM   7848 O O   . TYR B 1 478 ? -4.519  -80.742 -19.070 1.00 42.53  ? 479 TYR B O   1 
ATOM   7849 C CB  . TYR B 1 478 ? -1.924  -80.919 -16.960 1.00 52.75  ? 479 TYR B CB  1 
ATOM   7850 C CG  . TYR B 1 478 ? -1.424  -81.584 -15.688 1.00 41.26  ? 479 TYR B CG  1 
ATOM   7851 C CD1 . TYR B 1 478 ? -2.191  -82.503 -15.000 1.00 45.05  ? 479 TYR B CD1 1 
ATOM   7852 C CD2 . TYR B 1 478 ? -0.174  -81.259 -15.171 1.00 54.59  ? 479 TYR B CD2 1 
ATOM   7853 C CE1 . TYR B 1 478 ? -1.711  -83.096 -13.809 1.00 54.58  ? 479 TYR B CE1 1 
ATOM   7854 C CE2 . TYR B 1 478 ? 0.313   -81.843 -14.013 1.00 54.39  ? 479 TYR B CE2 1 
ATOM   7855 C CZ  . TYR B 1 478 ? -0.460  -82.757 -13.333 1.00 48.99  ? 479 TYR B CZ  1 
ATOM   7856 O OH  . TYR B 1 478 ? 0.041   -83.322 -12.191 1.00 55.12  ? 479 TYR B OH  1 
ATOM   7857 N N   . TRP B 1 479 ? -2.448  -80.263 -19.853 1.00 47.37  ? 480 TRP B N   1 
ATOM   7858 C CA  . TRP B 1 479 ? -2.935  -79.404 -20.933 1.00 39.72  ? 480 TRP B CA  1 
ATOM   7859 C C   . TRP B 1 479 ? -3.826  -80.158 -21.921 1.00 35.47  ? 480 TRP B C   1 
ATOM   7860 O O   . TRP B 1 479 ? -4.905  -79.683 -22.276 1.00 47.36  ? 480 TRP B O   1 
ATOM   7861 C CB  . TRP B 1 479 ? -1.754  -78.766 -21.668 1.00 40.45  ? 480 TRP B CB  1 
ATOM   7862 C CG  . TRP B 1 479 ? -1.406  -77.370 -21.173 1.00 49.78  ? 480 TRP B CG  1 
ATOM   7863 C CD1 . TRP B 1 479 ? -1.477  -76.202 -21.887 1.00 45.80  ? 480 TRP B CD1 1 
ATOM   7864 C CD2 . TRP B 1 479 ? -0.950  -77.009 -19.864 1.00 46.13  ? 480 TRP B CD2 1 
ATOM   7865 N NE1 . TRP B 1 479 ? -1.086  -75.141 -21.107 1.00 49.43  ? 480 TRP B NE1 1 
ATOM   7866 C CE2 . TRP B 1 479 ? -0.753  -75.609 -19.861 1.00 48.91  ? 480 TRP B CE2 1 
ATOM   7867 C CE3 . TRP B 1 479 ? -0.683  -77.734 -18.691 1.00 50.02  ? 480 TRP B CE3 1 
ATOM   7868 C CZ2 . TRP B 1 479 ? -0.316  -74.917 -18.720 1.00 50.43  ? 480 TRP B CZ2 1 
ATOM   7869 C CZ3 . TRP B 1 479 ? -0.234  -77.044 -17.563 1.00 44.28  ? 480 TRP B CZ3 1 
ATOM   7870 C CH2 . TRP B 1 479 ? -0.064  -75.654 -17.585 1.00 44.45  ? 480 TRP B CH2 1 
ATOM   7871 N N   . ALA B 1 480 ? -3.414  -81.354 -22.337 1.00 46.11  ? 481 ALA B N   1 
ATOM   7872 C CA  . ALA B 1 480 ? -4.246  -82.095 -23.301 1.00 47.64  ? 481 ALA B CA  1 
ATOM   7873 C C   . ALA B 1 480 ? -5.515  -82.614 -22.620 1.00 49.71  ? 481 ALA B C   1 
ATOM   7874 O O   . ALA B 1 480 ? -6.594  -82.617 -23.220 1.00 49.97  ? 481 ALA B O   1 
ATOM   7875 C CB  . ALA B 1 480 ? -3.473  -83.234 -23.934 1.00 35.73  ? 481 ALA B CB  1 
ATOM   7876 N N   . ASN B 1 481 ? -5.397  -83.034 -21.359 1.00 48.44  ? 482 ASN B N   1 
ATOM   7877 C CA  . ASN B 1 481 ? -6.595  -83.394 -20.604 1.00 43.56  ? 482 ASN B CA  1 
ATOM   7878 C C   . ASN B 1 481 ? -7.569  -82.232 -20.591 1.00 50.22  ? 482 ASN B C   1 
ATOM   7879 O O   . ASN B 1 481 ? -8.766  -82.405 -20.866 1.00 52.38  ? 482 ASN B O   1 
ATOM   7880 C CB  . ASN B 1 481 ? -6.252  -83.808 -19.176 1.00 54.90  ? 482 ASN B CB  1 
ATOM   7881 C CG  . ASN B 1 481 ? -5.699  -85.214 -19.090 1.00 54.36  ? 482 ASN B CG  1 
ATOM   7882 O OD1 . ASN B 1 481 ? -5.730  -85.977 -20.055 1.00 56.93  ? 482 ASN B OD1 1 
ATOM   7883 N ND2 . ASN B 1 481 ? -5.191  -85.567 -17.923 1.00 55.50  ? 482 ASN B ND2 1 
ATOM   7884 N N   . PHE B 1 482 ? -7.055  -81.039 -20.294 1.00 44.87  ? 483 PHE B N   1 
ATOM   7885 C CA  . PHE B 1 482 ? -7.911  -79.871 -20.248 1.00 45.87  ? 483 PHE B CA  1 
ATOM   7886 C C   . PHE B 1 482 ? -8.519  -79.599 -21.628 1.00 52.66  ? 483 PHE B C   1 
ATOM   7887 O O   . PHE B 1 482 ? -9.719  -79.321 -21.739 1.00 50.86  ? 483 PHE B O   1 
ATOM   7888 C CB  . PHE B 1 482 ? -7.152  -78.635 -19.734 1.00 41.46  ? 483 PHE B CB  1 
ATOM   7889 C CG  . PHE B 1 482 ? -7.984  -77.388 -19.757 1.00 51.35  ? 483 PHE B CG  1 
ATOM   7890 C CD1 . PHE B 1 482 ? -8.947  -77.160 -18.779 1.00 43.04  ? 483 PHE B CD1 1 
ATOM   7891 C CD2 . PHE B 1 482 ? -7.833  -76.455 -20.777 1.00 40.45  ? 483 PHE B CD2 1 
ATOM   7892 C CE1 . PHE B 1 482 ? -9.750  -76.020 -18.819 1.00 45.41  ? 483 PHE B CE1 1 
ATOM   7893 C CE2 . PHE B 1 482 ? -8.612  -75.311 -20.815 1.00 46.60  ? 483 PHE B CE2 1 
ATOM   7894 C CZ  . PHE B 1 482 ? -9.582  -75.092 -19.836 1.00 44.41  ? 483 PHE B CZ  1 
ATOM   7895 N N   . ALA B 1 483 ? -7.710  -79.691 -22.683 1.00 43.52  ? 484 ALA B N   1 
ATOM   7896 C CA  . ALA B 1 483 ? -8.240  -79.456 -24.034 1.00 50.51  ? 484 ALA B CA  1 
ATOM   7897 C C   . ALA B 1 483 ? -9.336  -80.473 -24.388 1.00 49.17  ? 484 ALA B C   1 
ATOM   7898 O O   . ALA B 1 483 ? -10.386 -80.108 -24.924 1.00 42.89  ? 484 ALA B O   1 
ATOM   7899 C CB  . ALA B 1 483 ? -7.112  -79.494 -25.077 1.00 42.10  ? 484 ALA B CB  1 
ATOM   7900 N N   . ARG B 1 484 ? -9.100  -81.744 -24.066 1.00 43.33  ? 485 ARG B N   1 
ATOM   7901 C CA  . ARG B 1 484 ? -10.098 -82.797 -24.316 1.00 52.33  ? 485 ARG B CA  1 
ATOM   7902 C C   . ARG B 1 484 ? -11.356 -82.713 -23.459 1.00 53.89  ? 485 ARG B C   1 
ATOM   7903 O O   . ARG B 1 484 ? -12.449 -82.943 -23.953 1.00 61.38  ? 485 ARG B O   1 
ATOM   7904 C CB  . ARG B 1 484 ? -9.474  -84.177 -24.116 1.00 48.24  ? 485 ARG B CB  1 
ATOM   7905 C CG  . ARG B 1 484 ? -8.352  -84.470 -25.093 1.00 49.68  ? 485 ARG B CG  1 
ATOM   7906 C CD  . ARG B 1 484 ? -7.847  -85.869 -24.922 1.00 43.93  ? 485 ARG B CD  1 
ATOM   7907 N NE  . ARG B 1 484 ? -6.972  -85.990 -23.771 1.00 45.81  ? 485 ARG B NE  1 
ATOM   7908 C CZ  . ARG B 1 484 ? -5.661  -86.172 -23.865 1.00 53.78  ? 485 ARG B CZ  1 
ATOM   7909 N NH1 . ARG B 1 484 ? -5.095  -86.244 -25.067 1.00 48.77  ? 485 ARG B NH1 1 
ATOM   7910 N NH2 . ARG B 1 484 ? -4.915  -86.269 -22.770 1.00 45.44  ? 485 ARG B NH2 1 
ATOM   7911 N N   . THR B 1 485 ? -11.215 -82.406 -22.173 1.00 48.83  ? 486 THR B N   1 
ATOM   7912 C CA  . THR B 1 485 ? -12.348 -82.580 -21.264 1.00 52.11  ? 486 THR B CA  1 
ATOM   7913 C C   . THR B 1 485 ? -12.751 -81.350 -20.472 1.00 61.05  ? 486 THR B C   1 
ATOM   7914 O O   . THR B 1 485 ? -13.802 -81.346 -19.847 1.00 67.41  ? 486 THR B O   1 
ATOM   7915 C CB  . THR B 1 485 ? -12.061 -83.684 -20.235 1.00 56.42  ? 486 THR B CB  1 
ATOM   7916 O OG1 . THR B 1 485 ? -11.057 -83.226 -19.321 1.00 54.11  ? 486 THR B OG1 1 
ATOM   7917 C CG2 . THR B 1 485 ? -11.565 -84.947 -20.911 1.00 43.97  ? 486 THR B CG2 1 
ATOM   7918 N N   . GLY B 1 486 ? -11.911 -80.322 -20.466 1.00 56.61  ? 487 GLY B N   1 
ATOM   7919 C CA  . GLY B 1 486 ? -12.182 -79.143 -19.658 1.00 54.51  ? 487 GLY B CA  1 
ATOM   7920 C C   . GLY B 1 486 ? -11.706 -79.323 -18.226 1.00 60.32  ? 487 GLY B C   1 
ATOM   7921 O O   . GLY B 1 486 ? -12.049 -78.557 -17.342 1.00 56.86  ? 487 GLY B O   1 
ATOM   7922 N N   . ASP B 1 487 ? -10.898 -80.347 -18.009 1.00 55.42  ? 488 ASP B N   1 
ATOM   7923 C CA  . ASP B 1 487 ? -10.470 -80.724 -16.684 1.00 51.23  ? 488 ASP B CA  1 
ATOM   7924 C C   . ASP B 1 487 ? -9.083  -81.330 -16.838 1.00 51.52  ? 488 ASP B C   1 
ATOM   7925 O O   . ASP B 1 487 ? -8.918  -82.295 -17.569 1.00 52.95  ? 488 ASP B O   1 
ATOM   7926 C CB  . ASP B 1 487 ? -11.477 -81.716 -16.079 1.00 63.53  ? 488 ASP B CB  1 
ATOM   7927 C CG  . ASP B 1 487 ? -11.113 -82.184 -14.659 1.00 64.44  ? 488 ASP B CG  1 
ATOM   7928 O OD1 . ASP B 1 487 ? -9.939  -82.107 -14.230 1.00 49.60  ? 488 ASP B OD1 1 
ATOM   7929 O OD2 . ASP B 1 487 ? -12.040 -82.672 -13.974 1.00 75.91  ? 488 ASP B OD2 1 
ATOM   7930 N N   . PRO B 1 488 ? -8.076  -80.761 -16.161 1.00 48.24  ? 489 PRO B N   1 
ATOM   7931 C CA  . PRO B 1 488 ? -6.704  -81.255 -16.357 1.00 46.41  ? 489 PRO B CA  1 
ATOM   7932 C C   . PRO B 1 488 ? -6.484  -82.597 -15.686 1.00 53.49  ? 489 PRO B C   1 
ATOM   7933 O O   . PRO B 1 488 ? -5.462  -83.246 -15.919 1.00 54.53  ? 489 PRO B O   1 
ATOM   7934 C CB  . PRO B 1 488 ? -5.835  -80.174 -15.696 1.00 48.94  ? 489 PRO B CB  1 
ATOM   7935 C CG  . PRO B 1 488 ? -6.730  -79.593 -14.622 1.00 48.70  ? 489 PRO B CG  1 
ATOM   7936 C CD  . PRO B 1 488 ? -8.138  -79.628 -15.217 1.00 48.11  ? 489 PRO B CD  1 
ATOM   7937 N N   . ASN B 1 489 ? -7.429  -82.997 -14.841 1.00 52.14  ? 490 ASN B N   1 
ATOM   7938 C CA  . ASN B 1 489 ? -7.246  -84.198 -14.041 1.00 62.70  ? 490 ASN B CA  1 
ATOM   7939 C C   . ASN B 1 489 ? -7.386  -85.435 -14.879 1.00 70.48  ? 490 ASN B C   1 
ATOM   7940 O O   . ASN B 1 489 ? -8.251  -85.510 -15.763 1.00 56.87  ? 490 ASN B O   1 
ATOM   7941 C CB  . ASN B 1 489 ? -8.241  -84.264 -12.883 1.00 51.88  ? 490 ASN B CB  1 
ATOM   7942 C CG  . ASN B 1 489 ? -7.961  -83.234 -11.834 1.00 55.40  ? 490 ASN B CG  1 
ATOM   7943 O OD1 . ASN B 1 489 ? -6.965  -83.324 -11.110 1.00 58.38  ? 490 ASN B OD1 1 
ATOM   7944 N ND2 . ASN B 1 489 ? -8.833  -82.237 -11.741 1.00 51.43  ? 490 ASN B ND2 1 
ATOM   7945 N N   . GLU B 1 490 ? -6.530  -86.403 -14.570 1.00 75.04  ? 491 GLU B N   1 
ATOM   7946 C CA  . GLU B 1 490 ? -6.527  -87.695 -15.230 1.00 83.51  ? 491 GLU B CA  1 
ATOM   7947 C C   . GLU B 1 490 ? -7.882  -88.380 -15.114 1.00 95.75  ? 491 GLU B C   1 
ATOM   7948 O O   . GLU B 1 490 ? -8.249  -88.844 -14.026 1.00 102.59 ? 491 GLU B O   1 
ATOM   7949 C CB  . GLU B 1 490 ? -5.436  -88.578 -14.634 1.00 90.16  ? 491 GLU B CB  1 
ATOM   7950 C CG  . GLU B 1 490 ? -4.028  -88.084 -14.880 1.00 89.47  ? 491 GLU B CG  1 
ATOM   7951 C CD  . GLU B 1 490 ? -3.454  -88.630 -16.170 1.00 97.81  ? 491 GLU B CD  1 
ATOM   7952 O OE1 . GLU B 1 490 ? -4.222  -88.791 -17.160 1.00 75.95  ? 491 GLU B OE1 1 
ATOM   7953 O OE2 . GLU B 1 490 ? -2.234  -88.914 -16.180 1.00 103.62 ? 491 GLU B OE2 1 
ATOM   7954 N N   . PRO B 1 491 ? -8.629  -88.448 -16.238 1.00 106.82 ? 492 PRO B N   1 
ATOM   7955 C CA  . PRO B 1 491 ? -9.949  -89.079 -16.172 1.00 97.98  ? 492 PRO B CA  1 
ATOM   7956 C C   . PRO B 1 491 ? -9.754  -90.547 -15.830 1.00 114.74 ? 492 PRO B C   1 
ATOM   7957 O O   . PRO B 1 491 ? -9.057  -91.219 -16.600 1.00 125.16 ? 492 PRO B O   1 
ATOM   7958 C CB  . PRO B 1 491 ? -10.516 -88.901 -17.589 1.00 85.76  ? 492 PRO B CB  1 
ATOM   7959 C CG  . PRO B 1 491 ? -9.491  -88.071 -18.355 1.00 78.40  ? 492 PRO B CG  1 
ATOM   7960 C CD  . PRO B 1 491 ? -8.199  -88.215 -17.631 1.00 80.11  ? 492 PRO B CD  1 
ATOM   7961 N N   . ARG B 1 492 ? -10.302 -90.986 -14.692 1.00 111.74 ? 493 ARG B N   1 
ATOM   7962 C CA  . ARG B 1 492 ? -10.243 -92.371 -14.175 1.00 124.76 ? 493 ARG B CA  1 
ATOM   7963 C C   . ARG B 1 492 ? -9.018  -92.649 -13.260 1.00 122.11 ? 493 ARG B C   1 
ATOM   7964 O O   . ARG B 1 492 ? -8.962  -93.701 -12.613 1.00 127.00 ? 493 ARG B O   1 
ATOM   7965 C CB  . ARG B 1 492 ? -10.299 -93.403 -15.334 1.00 119.08 ? 493 ARG B CB  1 
ATOM   7966 C CG  . ARG B 1 492 ? -10.489 -94.866 -14.917 1.00 120.71 ? 493 ARG B CG  1 
ATOM   7967 C CD  . ARG B 1 492 ? -11.656 -95.542 -15.636 1.00 119.10 ? 493 ARG B CD  1 
ATOM   7968 N NE  . ARG B 1 492 ? -11.239 -96.258 -16.841 1.00 133.64 ? 493 ARG B NE  1 
ATOM   7969 C CZ  . ARG B 1 492 ? -10.687 -97.471 -16.842 1.00 134.19 ? 493 ARG B CZ  1 
ATOM   7970 N NH1 . ARG B 1 492 ? -10.470 -98.101 -15.691 1.00 128.06 ? 493 ARG B NH1 1 
ATOM   7971 N NH2 . ARG B 1 492 ? -10.344 -98.051 -17.990 1.00 115.06 ? 493 ARG B NH2 1 
ATOM   7972 N N   . ASP B 1 493 ? -8.059  -91.725 -13.163 1.00 106.26 ? 494 ASP B N   1 
ATOM   7973 C CA  . ASP B 1 493 ? -6.929  -91.942 -12.241 1.00 117.86 ? 494 ASP B CA  1 
ATOM   7974 C C   . ASP B 1 493 ? -7.245  -91.370 -10.852 1.00 126.81 ? 494 ASP B C   1 
ATOM   7975 O O   . ASP B 1 493 ? -7.463  -90.157 -10.712 1.00 119.47 ? 494 ASP B O   1 
ATOM   7976 C CB  . ASP B 1 493 ? -5.635  -91.327 -12.794 1.00 106.94 ? 494 ASP B CB  1 
ATOM   7977 C CG  . ASP B 1 493 ? -4.372  -91.765 -12.022 1.00 115.31 ? 494 ASP B CG  1 
ATOM   7978 O OD1 . ASP B 1 493 ? -4.472  -92.333 -10.906 1.00 105.65 ? 494 ASP B OD1 1 
ATOM   7979 O OD2 . ASP B 1 493 ? -3.260  -91.518 -12.544 1.00 110.34 ? 494 ASP B OD2 1 
ATOM   7980 N N   . PRO B 1 494 ? -7.275  -92.249 -9.824  1.00 122.42 ? 495 PRO B N   1 
ATOM   7981 C CA  . PRO B 1 494 ? -7.629  -91.866 -8.450  1.00 113.19 ? 495 PRO B CA  1 
ATOM   7982 C C   . PRO B 1 494 ? -6.439  -91.642 -7.489  1.00 115.89 ? 495 PRO B C   1 
ATOM   7983 O O   . PRO B 1 494 ? -6.493  -90.685 -6.711  1.00 113.56 ? 495 PRO B O   1 
ATOM   7984 C CB  . PRO B 1 494 ? -8.483  -93.050 -7.986  1.00 108.44 ? 495 PRO B CB  1 
ATOM   7985 C CG  . PRO B 1 494 ? -7.893  -94.238 -8.725  1.00 108.56 ? 495 PRO B CG  1 
ATOM   7986 C CD  . PRO B 1 494 ? -7.227  -93.717 -9.985  1.00 104.23 ? 495 PRO B CD  1 
ATOM   7987 N N   . LYS B 1 495 ? -5.405  -92.488 -7.531  1.00 119.22 ? 496 LYS B N   1 
ATOM   7988 C CA  . LYS B 1 495 ? -4.284  -92.380 -6.583  1.00 116.61 ? 496 LYS B CA  1 
ATOM   7989 C C   . LYS B 1 495 ? -3.360  -91.193 -6.889  1.00 122.42 ? 496 LYS B C   1 
ATOM   7990 O O   . LYS B 1 495 ? -2.474  -90.865 -6.087  1.00 120.66 ? 496 LYS B O   1 
ATOM   7991 C CB  . LYS B 1 495 ? -3.465  -93.678 -6.548  1.00 112.36 ? 496 LYS B CB  1 
ATOM   7992 C CG  . LYS B 1 495 ? -3.986  -94.734 -5.559  1.00 108.70 ? 496 LYS B CG  1 
ATOM   7993 C CD  . LYS B 1 495 ? -2.833  -95.538 -4.936  1.00 114.80 ? 496 LYS B CD  1 
ATOM   7994 C CE  . LYS B 1 495 ? -3.330  -96.677 -4.031  1.00 114.35 ? 496 LYS B CE  1 
ATOM   7995 N NZ  . LYS B 1 495 ? -2.226  -97.434 -3.337  1.00 86.31  ? 496 LYS B NZ  1 
ATOM   7996 N N   . ALA B 1 496 ? -3.569  -90.559 -8.045  1.00 118.72 ? 497 ALA B N   1 
ATOM   7997 C CA  . ALA B 1 496 ? -2.887  -89.308 -8.386  1.00 109.36 ? 497 ALA B CA  1 
ATOM   7998 C C   . ALA B 1 496 ? -3.536  -88.122 -7.654  1.00 108.61 ? 497 ALA B C   1 
ATOM   7999 O O   . ALA B 1 496 ? -4.772  -88.005 -7.638  1.00 100.05 ? 497 ALA B O   1 
ATOM   8000 C CB  . ALA B 1 496 ? -2.909  -89.085 -9.899  1.00 92.79  ? 497 ALA B CB  1 
ATOM   8001 N N   . PRO B 1 497 ? -2.708  -87.243 -7.046  1.00 102.14 ? 498 PRO B N   1 
ATOM   8002 C CA  . PRO B 1 497 ? -3.221  -86.063 -6.329  1.00 93.47  ? 498 PRO B CA  1 
ATOM   8003 C C   . PRO B 1 497 ? -4.092  -85.208 -7.250  1.00 77.99  ? 498 PRO B C   1 
ATOM   8004 O O   . PRO B 1 497 ? -3.784  -85.078 -8.439  1.00 86.19  ? 498 PRO B O   1 
ATOM   8005 C CB  . PRO B 1 497 ? -1.951  -85.310 -5.903  1.00 89.51  ? 498 PRO B CB  1 
ATOM   8006 C CG  . PRO B 1 497 ? -0.842  -86.326 -5.997  1.00 98.13  ? 498 PRO B CG  1 
ATOM   8007 C CD  . PRO B 1 497 ? -1.234  -87.264 -7.100  1.00 93.24  ? 498 PRO B CD  1 
ATOM   8008 N N   . GLN B 1 498 ? -5.177  -84.655 -6.718  1.00 69.44  ? 499 GLN B N   1 
ATOM   8009 C CA  . GLN B 1 498 ? -6.166  -83.997 -7.557  1.00 59.15  ? 499 GLN B CA  1 
ATOM   8010 C C   . GLN B 1 498 ? -5.996  -82.491 -7.583  1.00 69.14  ? 499 GLN B C   1 
ATOM   8011 O O   . GLN B 1 498 ? -5.732  -81.853 -6.569  1.00 65.48  ? 499 GLN B O   1 
ATOM   8012 C CB  . GLN B 1 498 ? -7.584  -84.344 -7.101  1.00 58.86  ? 499 GLN B CB  1 
ATOM   8013 C CG  . GLN B 1 498 ? -7.983  -85.789 -7.393  1.00 73.22  ? 499 GLN B CG  1 
ATOM   8014 C CD  . GLN B 1 498 ? -8.021  -86.105 -8.883  1.00 77.45  ? 499 GLN B CD  1 
ATOM   8015 O OE1 . GLN B 1 498 ? -8.928  -85.664 -9.597  1.00 75.47  ? 499 GLN B OE1 1 
ATOM   8016 N NE2 . GLN B 1 498 ? -7.036  -86.877 -9.358  1.00 63.63  ? 499 GLN B NE2 1 
ATOM   8017 N N   . TRP B 1 499 ? -6.160  -81.942 -8.776  1.00 58.04  ? 500 TRP B N   1 
ATOM   8018 C CA  . TRP B 1 499 ? -6.129  -80.516 -9.016  1.00 54.27  ? 500 TRP B CA  1 
ATOM   8019 C C   . TRP B 1 499 ? -7.562  -79.991 -8.904  1.00 55.55  ? 500 TRP B C   1 
ATOM   8020 O O   . TRP B 1 499 ? -8.407  -80.320 -9.729  1.00 56.79  ? 500 TRP B O   1 
ATOM   8021 C CB  . TRP B 1 499 ? -5.509  -80.269 -10.395 1.00 54.06  ? 500 TRP B CB  1 
ATOM   8022 C CG  . TRP B 1 499 ? -5.256  -78.866 -10.815 1.00 54.39  ? 500 TRP B CG  1 
ATOM   8023 C CD1 . TRP B 1 499 ? -5.771  -77.722 -10.271 1.00 55.51  ? 500 TRP B CD1 1 
ATOM   8024 C CD2 . TRP B 1 499 ? -4.431  -78.457 -11.906 1.00 62.08  ? 500 TRP B CD2 1 
ATOM   8025 N NE1 . TRP B 1 499 ? -5.299  -76.622 -10.947 1.00 52.49  ? 500 TRP B NE1 1 
ATOM   8026 C CE2 . TRP B 1 499 ? -4.483  -77.048 -11.966 1.00 65.73  ? 500 TRP B CE2 1 
ATOM   8027 C CE3 . TRP B 1 499 ? -3.648  -79.147 -12.841 1.00 53.34  ? 500 TRP B CE3 1 
ATOM   8028 C CZ2 . TRP B 1 499 ? -3.777  -76.317 -12.924 1.00 48.17  ? 500 TRP B CZ2 1 
ATOM   8029 C CZ3 . TRP B 1 499 ? -2.945  -78.424 -13.778 1.00 54.13  ? 500 TRP B CZ3 1 
ATOM   8030 C CH2 . TRP B 1 499 ? -3.011  -77.022 -13.814 1.00 53.01  ? 500 TRP B CH2 1 
ATOM   8031 N N   . PRO B 1 500 ? -7.857  -79.223 -7.841  1.00 52.38  ? 501 PRO B N   1 
ATOM   8032 C CA  . PRO B 1 500 ? -9.214  -78.709 -7.645  1.00 49.30  ? 501 PRO B CA  1 
ATOM   8033 C C   . PRO B 1 500 ? -9.440  -77.396 -8.354  1.00 51.12  ? 501 PRO B C   1 
ATOM   8034 O O   . PRO B 1 500 ? -8.482  -76.674 -8.612  1.00 52.21  ? 501 PRO B O   1 
ATOM   8035 C CB  . PRO B 1 500 ? -9.300  -78.505 -6.126  1.00 47.22  ? 501 PRO B CB  1 
ATOM   8036 C CG  . PRO B 1 500 ? -7.934  -78.198 -5.731  1.00 42.60  ? 501 PRO B CG  1 
ATOM   8037 C CD  . PRO B 1 500 ? -7.034  -79.033 -6.639  1.00 52.04  ? 501 PRO B CD  1 
ATOM   8038 N N   . PRO B 1 501 ? -10.703 -77.079 -8.652  1.00 49.10  ? 502 PRO B N   1 
ATOM   8039 C CA  . PRO B 1 501 ? -11.026 -75.784 -9.249  1.00 48.22  ? 502 PRO B CA  1 
ATOM   8040 C C   . PRO B 1 501 ? -10.705 -74.587 -8.352  1.00 53.30  ? 502 PRO B C   1 
ATOM   8041 O O   . PRO B 1 501 ? -10.841 -74.643 -7.128  1.00 58.34  ? 502 PRO B O   1 
ATOM   8042 C CB  . PRO B 1 501 ? -12.536 -75.885 -9.502  1.00 45.22  ? 502 PRO B CB  1 
ATOM   8043 C CG  . PRO B 1 501 ? -12.768 -77.350 -9.672  1.00 52.89  ? 502 PRO B CG  1 
ATOM   8044 C CD  . PRO B 1 501 ? -11.840 -78.014 -8.702  1.00 39.79  ? 502 PRO B CD  1 
ATOM   8045 N N   . TYR B 1 502 ? -10.277 -73.505 -8.991  1.00 58.48  ? 503 TYR B N   1 
ATOM   8046 C CA  . TYR B 1 502 ? -10.094 -72.219 -8.335  1.00 53.56  ? 503 TYR B CA  1 
ATOM   8047 C C   . TYR B 1 502 ? -11.430 -71.496 -8.168  1.00 54.39  ? 503 TYR B C   1 
ATOM   8048 O O   . TYR B 1 502 ? -12.193 -71.332 -9.125  1.00 57.87  ? 503 TYR B O   1 
ATOM   8049 C CB  . TYR B 1 502 ? -9.126  -71.349 -9.136  1.00 47.50  ? 503 TYR B CB  1 
ATOM   8050 C CG  . TYR B 1 502 ? -8.796  -70.011 -8.516  1.00 39.38  ? 503 TYR B CG  1 
ATOM   8051 C CD1 . TYR B 1 502 ? -7.644  -69.846 -7.756  1.00 35.33  ? 503 TYR B CD1 1 
ATOM   8052 C CD2 . TYR B 1 502 ? -9.632  -68.906 -8.705  1.00 43.01  ? 503 TYR B CD2 1 
ATOM   8053 C CE1 . TYR B 1 502 ? -7.335  -68.630 -7.209  1.00 42.83  ? 503 TYR B CE1 1 
ATOM   8054 C CE2 . TYR B 1 502 ? -9.338  -67.689 -8.156  1.00 38.11  ? 503 TYR B CE2 1 
ATOM   8055 C CZ  . TYR B 1 502 ? -8.187  -67.547 -7.405  1.00 50.76  ? 503 TYR B CZ  1 
ATOM   8056 O OH  . TYR B 1 502 ? -7.881  -66.322 -6.847  1.00 53.95  ? 503 TYR B OH  1 
ATOM   8057 N N   . THR B 1 503 ? -11.694 -71.038 -6.951  1.00 53.62  ? 504 THR B N   1 
ATOM   8058 C CA  . THR B 1 503 ? -12.924 -70.301 -6.657  1.00 69.34  ? 504 THR B CA  1 
ATOM   8059 C C   . THR B 1 503 ? -12.584 -69.000 -5.940  1.00 44.87  ? 504 THR B C   1 
ATOM   8060 O O   . THR B 1 503 ? -11.516 -68.903 -5.333  1.00 57.12  ? 504 THR B O   1 
ATOM   8061 C CB  . THR B 1 503 ? -13.867 -71.143 -5.801  1.00 63.70  ? 504 THR B CB  1 
ATOM   8062 O OG1 . THR B 1 503 ? -13.146 -71.595 -4.646  1.00 60.24  ? 504 THR B OG1 1 
ATOM   8063 C CG2 . THR B 1 503 ? -14.340 -72.357 -6.595  1.00 52.82  ? 504 THR B CG2 1 
ATOM   8064 N N   . ALA B 1 504 ? -13.475 -68.009 -6.008  1.00 57.64  ? 505 ALA B N   1 
ATOM   8065 C CA  . ALA B 1 504 ? -13.186 -66.702 -5.401  1.00 58.44  ? 505 ALA B CA  1 
ATOM   8066 C C   . ALA B 1 504 ? -12.987 -66.799 -3.883  1.00 54.43  ? 505 ALA B C   1 
ATOM   8067 O O   . ALA B 1 504 ? -12.221 -66.023 -3.296  1.00 61.94  ? 505 ALA B O   1 
ATOM   8068 C CB  . ALA B 1 504 ? -14.287 -65.697 -5.727  1.00 51.48  ? 505 ALA B CB  1 
ATOM   8069 N N   . GLY B 1 505 ? -13.632 -67.777 -3.252  1.00 61.26  ? 506 GLY B N   1 
ATOM   8070 C CA  . GLY B 1 505 ? -13.446 -67.990 -1.826  1.00 48.73  ? 506 GLY B CA  1 
ATOM   8071 C C   . GLY B 1 505 ? -12.222 -68.793 -1.415  1.00 50.58  ? 506 GLY B C   1 
ATOM   8072 O O   . GLY B 1 505 ? -11.316 -68.266 -0.772  1.00 59.89  ? 506 GLY B O   1 
ATOM   8073 N N   . ALA B 1 506 ? -12.188 -70.079 -1.750  1.00 50.56  ? 507 ALA B N   1 
ATOM   8074 C CA  . ALA B 1 506 ? -11.058 -70.917 -1.331  1.00 47.46  ? 507 ALA B CA  1 
ATOM   8075 C C   . ALA B 1 506 ? -9.760  -70.565 -2.070  1.00 57.18  ? 507 ALA B C   1 
ATOM   8076 O O   . ALA B 1 506 ? -8.661  -70.796 -1.540  1.00 53.70  ? 507 ALA B O   1 
ATOM   8077 C CB  . ALA B 1 506 ? -11.386 -72.394 -1.516  1.00 40.70  ? 507 ALA B CB  1 
ATOM   8078 N N   . GLN B 1 507 ? -9.891  -70.037 -3.294  1.00 54.79  ? 508 GLN B N   1 
ATOM   8079 C CA  . GLN B 1 507 ? -8.744  -69.560 -4.067  1.00 50.03  ? 508 GLN B CA  1 
ATOM   8080 C C   . GLN B 1 507 ? -7.649  -70.616 -4.205  1.00 38.05  ? 508 GLN B C   1 
ATOM   8081 O O   . GLN B 1 507 ? -6.470  -70.309 -4.083  1.00 44.30  ? 508 GLN B O   1 
ATOM   8082 C CB  . GLN B 1 507 ? -8.162  -68.293 -3.423  1.00 49.93  ? 508 GLN B CB  1 
ATOM   8083 C CG  . GLN B 1 507 ? -9.095  -67.074 -3.422  1.00 49.46  ? 508 GLN B CG  1 
ATOM   8084 C CD  . GLN B 1 507 ? -8.638  -65.989 -2.429  1.00 57.87  ? 508 GLN B CD  1 
ATOM   8085 O OE1 . GLN B 1 507 ? -7.623  -65.325 -2.635  1.00 51.70  ? 508 GLN B OE1 1 
ATOM   8086 N NE2 . GLN B 1 507 ? -9.385  -65.818 -1.352  1.00 61.06  ? 508 GLN B NE2 1 
ATOM   8087 N N   . GLN B 1 508 ? -8.034  -71.865 -4.425  1.00 38.66  ? 509 GLN B N   1 
ATOM   8088 C CA  . GLN B 1 508 ? -7.051  -72.944 -4.484  1.00 39.30  ? 509 GLN B CA  1 
ATOM   8089 C C   . GLN B 1 508 ? -6.330  -73.018 -5.840  1.00 52.00  ? 509 GLN B C   1 
ATOM   8090 O O   . GLN B 1 508 ? -6.927  -72.747 -6.886  1.00 43.81  ? 509 GLN B O   1 
ATOM   8091 C CB  . GLN B 1 508 ? -7.726  -74.273 -4.204  1.00 46.81  ? 509 GLN B CB  1 
ATOM   8092 C CG  . GLN B 1 508 ? -8.189  -74.476 -2.768  1.00 60.55  ? 509 GLN B CG  1 
ATOM   8093 C CD  . GLN B 1 508 ? -9.014  -75.739 -2.627  1.00 49.61  ? 509 GLN B CD  1 
ATOM   8094 O OE1 . GLN B 1 508 ? -10.157 -75.807 -3.100  1.00 61.43  ? 509 GLN B OE1 1 
ATOM   8095 N NE2 . GLN B 1 508 ? -8.435  -76.757 -2.002  1.00 57.49  ? 509 GLN B NE2 1 
ATOM   8096 N N   . TYR B 1 509 ? -5.051  -73.384 -5.808  1.00 46.53  ? 510 TYR B N   1 
ATOM   8097 C CA  . TYR B 1 509 ? -4.241  -73.556 -7.016  1.00 46.00  ? 510 TYR B CA  1 
ATOM   8098 C C   . TYR B 1 509 ? -3.217  -74.654 -6.762  1.00 52.93  ? 510 TYR B C   1 
ATOM   8099 O O   . TYR B 1 509 ? -2.945  -74.980 -5.601  1.00 49.13  ? 510 TYR B O   1 
ATOM   8100 C CB  . TYR B 1 509 ? -3.545  -72.247 -7.388  1.00 43.26  ? 510 TYR B CB  1 
ATOM   8101 C CG  . TYR B 1 509 ? -2.421  -71.820 -6.449  1.00 47.71  ? 510 TYR B CG  1 
ATOM   8102 C CD1 . TYR B 1 509 ? -2.655  -70.965 -5.358  1.00 52.63  ? 510 TYR B CD1 1 
ATOM   8103 C CD2 . TYR B 1 509 ? -1.119  -72.246 -6.671  1.00 44.41  ? 510 TYR B CD2 1 
ATOM   8104 C CE1 . TYR B 1 509 ? -1.593  -70.564 -4.511  1.00 38.61  ? 510 TYR B CE1 1 
ATOM   8105 C CE2 . TYR B 1 509 ? -0.081  -71.868 -5.851  1.00 46.21  ? 510 TYR B CE2 1 
ATOM   8106 C CZ  . TYR B 1 509 ? -0.311  -71.027 -4.777  1.00 57.42  ? 510 TYR B CZ  1 
ATOM   8107 O OH  . TYR B 1 509 ? 0.780   -70.684 -4.006  1.00 54.28  ? 510 TYR B OH  1 
ATOM   8108 N N   . VAL B 1 510 ? -2.652  -75.243 -7.814  1.00 47.87  ? 511 VAL B N   1 
ATOM   8109 C CA  . VAL B 1 510 ? -1.588  -76.224 -7.592  1.00 37.74  ? 511 VAL B CA  1 
ATOM   8110 C C   . VAL B 1 510 ? -0.225  -75.684 -7.969  1.00 46.73  ? 511 VAL B C   1 
ATOM   8111 O O   . VAL B 1 510 ? -0.091  -74.787 -8.817  1.00 46.95  ? 511 VAL B O   1 
ATOM   8112 C CB  . VAL B 1 510 ? -1.833  -77.528 -8.356  1.00 49.13  ? 511 VAL B CB  1 
ATOM   8113 C CG1 . VAL B 1 510 ? -3.136  -78.122 -7.919  1.00 44.65  ? 511 VAL B CG1 1 
ATOM   8114 C CG2 . VAL B 1 510 ? -1.824  -77.287 -9.883  1.00 40.70  ? 511 VAL B CG2 1 
ATOM   8115 N N   . SER B 1 511 ? 0.799   -76.220 -7.325  1.00 41.16  ? 512 SER B N   1 
ATOM   8116 C CA  . SER B 1 511 ? 2.161   -75.893 -7.705  1.00 46.23  ? 512 SER B CA  1 
ATOM   8117 C C   . SER B 1 511 ? 2.641   -76.924 -8.733  1.00 51.98  ? 512 SER B C   1 
ATOM   8118 O O   . SER B 1 511 ? 2.409   -78.127 -8.577  1.00 49.16  ? 512 SER B O   1 
ATOM   8119 C CB  . SER B 1 511 ? 3.079   -75.864 -6.483  1.00 50.63  ? 512 SER B CB  1 
ATOM   8120 O OG  . SER B 1 511 ? 3.270   -77.164 -5.968  1.00 57.72  ? 512 SER B OG  1 
ATOM   8121 N N   . LEU B 1 512 ? 3.282   -76.457 -9.800  1.00 47.70  ? 513 LEU B N   1 
ATOM   8122 C CA  . LEU B 1 512 ? 3.817   -77.369 -10.814 1.00 37.60  ? 513 LEU B CA  1 
ATOM   8123 C C   . LEU B 1 512 ? 5.342   -77.434 -10.723 1.00 46.36  ? 513 LEU B C   1 
ATOM   8124 O O   . LEU B 1 512 ? 6.032   -76.453 -11.024 1.00 48.64  ? 513 LEU B O   1 
ATOM   8125 C CB  . LEU B 1 512 ? 3.388   -76.926 -12.195 1.00 37.89  ? 513 LEU B CB  1 
ATOM   8126 C CG  . LEU B 1 512 ? 1.889   -76.896 -12.424 1.00 43.81  ? 513 LEU B CG  1 
ATOM   8127 C CD1 . LEU B 1 512 ? 1.619   -76.333 -13.801 1.00 43.43  ? 513 LEU B CD1 1 
ATOM   8128 C CD2 . LEU B 1 512 ? 1.313   -78.292 -12.282 1.00 44.54  ? 513 LEU B CD2 1 
ATOM   8129 N N   . ASP B 1 513 ? 5.867   -78.572 -10.273 1.00 44.31  ? 514 ASP B N   1 
ATOM   8130 C CA  . ASP B 1 513 ? 7.318   -78.797 -10.275 1.00 49.18  ? 514 ASP B CA  1 
ATOM   8131 C C   . ASP B 1 513 ? 7.561   -80.300 -10.337 1.00 44.57  ? 514 ASP B C   1 
ATOM   8132 O O   . ASP B 1 513 ? 6.644   -81.059 -10.666 1.00 50.61  ? 514 ASP B O   1 
ATOM   8133 C CB  . ASP B 1 513 ? 8.015   -78.148 -9.048  1.00 49.21  ? 514 ASP B CB  1 
ATOM   8134 C CG  . ASP B 1 513 ? 7.409   -78.575 -7.700  1.00 62.19  ? 514 ASP B CG  1 
ATOM   8135 O OD1 . ASP B 1 513 ? 6.767   -79.644 -7.623  1.00 62.03  ? 514 ASP B OD1 1 
ATOM   8136 O OD2 . ASP B 1 513 ? 7.587   -77.839 -6.698  1.00 82.83  ? 514 ASP B OD2 1 
ATOM   8137 N N   . LEU B 1 514 ? 8.776   -80.731 -10.014 1.00 46.12  ? 515 LEU B N   1 
ATOM   8138 C CA  . LEU B 1 514 ? 9.123   -82.154 -10.062 1.00 53.16  ? 515 LEU B CA  1 
ATOM   8139 C C   . LEU B 1 514 ? 8.343   -82.994 -9.047  1.00 63.29  ? 515 LEU B C   1 
ATOM   8140 O O   . LEU B 1 514 ? 8.061   -84.168 -9.296  1.00 69.04  ? 515 LEU B O   1 
ATOM   8141 C CB  . LEU B 1 514 ? 10.628  -82.338 -9.844  1.00 42.74  ? 515 LEU B CB  1 
ATOM   8142 C CG  . LEU B 1 514 ? 11.486  -81.540 -10.825 1.00 53.52  ? 515 LEU B CG  1 
ATOM   8143 C CD1 . LEU B 1 514 ? 12.953  -81.866 -10.663 1.00 44.65  ? 515 LEU B CD1 1 
ATOM   8144 C CD2 . LEU B 1 514 ? 11.023  -81.767 -12.283 1.00 47.57  ? 515 LEU B CD2 1 
ATOM   8145 N N   . ARG B 1 515 ? 7.992   -82.390 -7.914  1.00 49.64  ? 516 ARG B N   1 
ATOM   8146 C CA  . ARG B 1 515 ? 7.245   -83.085 -6.866  1.00 62.13  ? 516 ARG B CA  1 
ATOM   8147 C C   . ARG B 1 515 ? 5.821   -83.239 -7.336  1.00 51.66  ? 516 ARG B C   1 
ATOM   8148 O O   . ARG B 1 515 ? 5.414   -82.547 -8.254  1.00 58.11  ? 516 ARG B O   1 
ATOM   8149 C CB  . ARG B 1 515 ? 7.297   -82.316 -5.541  1.00 53.62  ? 516 ARG B CB  1 
ATOM   8150 C CG  . ARG B 1 515 ? 8.706   -81.939 -5.079  1.00 59.90  ? 516 ARG B CG  1 
ATOM   8151 C CD  . ARG B 1 515 ? 8.641   -80.952 -3.899  1.00 84.45  ? 516 ARG B CD  1 
ATOM   8152 N NE  . ARG B 1 515 ? 7.849   -79.764 -4.234  1.00 95.86  ? 516 ARG B NE  1 
ATOM   8153 C CZ  . ARG B 1 515 ? 6.707   -79.411 -3.642  1.00 97.73  ? 516 ARG B CZ  1 
ATOM   8154 N NH1 . ARG B 1 515 ? 6.206   -80.149 -2.647  1.00 86.96  ? 516 ARG B NH1 1 
ATOM   8155 N NH2 . ARG B 1 515 ? 6.066   -78.310 -4.041  1.00 77.72  ? 516 ARG B NH2 1 
ATOM   8156 N N   . PRO B 1 516 ? 5.051   -84.143 -6.713  1.00 63.21  ? 517 PRO B N   1 
ATOM   8157 C CA  . PRO B 1 516 ? 3.633   -84.240 -7.092  1.00 47.03  ? 517 PRO B CA  1 
ATOM   8158 C C   . PRO B 1 516 ? 2.877   -82.952 -6.792  1.00 60.28  ? 517 PRO B C   1 
ATOM   8159 O O   . PRO B 1 516 ? 3.375   -82.120 -6.022  1.00 58.86  ? 517 PRO B O   1 
ATOM   8160 C CB  . PRO B 1 516 ? 3.102   -85.388 -6.220  1.00 58.33  ? 517 PRO B CB  1 
ATOM   8161 C CG  . PRO B 1 516 ? 4.314   -86.172 -5.835  1.00 51.40  ? 517 PRO B CG  1 
ATOM   8162 C CD  . PRO B 1 516 ? 5.446   -85.181 -5.746  1.00 52.49  ? 517 PRO B CD  1 
ATOM   8163 N N   . LEU B 1 517 ? 1.695   -82.794 -7.383  1.00 54.04  ? 518 LEU B N   1 
ATOM   8164 C CA  . LEU B 1 517 ? 0.860   -81.624 -7.125  1.00 54.84  ? 518 LEU B CA  1 
ATOM   8165 C C   . LEU B 1 517 ? 0.669   -81.352 -5.640  1.00 66.58  ? 518 LEU B C   1 
ATOM   8166 O O   . LEU B 1 517 ? 0.306   -82.244 -4.868  1.00 60.00  ? 518 LEU B O   1 
ATOM   8167 C CB  . LEU B 1 517 ? -0.517  -81.775 -7.756  1.00 46.21  ? 518 LEU B CB  1 
ATOM   8168 C CG  . LEU B 1 517 ? -0.652  -81.882 -9.263  1.00 52.69  ? 518 LEU B CG  1 
ATOM   8169 C CD1 . LEU B 1 517 ? -2.101  -81.625 -9.617  1.00 55.91  ? 518 LEU B CD1 1 
ATOM   8170 C CD2 . LEU B 1 517 ? 0.279   -80.912 -9.988  1.00 50.53  ? 518 LEU B CD2 1 
ATOM   8171 N N   . GLU B 1 518 ? 0.911   -80.107 -5.258  1.00 59.06  ? 519 GLU B N   1 
ATOM   8172 C CA  . GLU B 1 518 ? 0.572   -79.631 -3.931  1.00 57.77  ? 519 GLU B CA  1 
ATOM   8173 C C   . GLU B 1 518 ? -0.525  -78.576 -4.064  1.00 57.37  ? 519 GLU B C   1 
ATOM   8174 O O   . GLU B 1 518 ? -0.394  -77.631 -4.849  1.00 52.87  ? 519 GLU B O   1 
ATOM   8175 C CB  . GLU B 1 518 ? 1.814   -79.064 -3.238  1.00 55.86  ? 519 GLU B CB  1 
ATOM   8176 C CG  . GLU B 1 518 ? 1.595   -78.613 -1.813  1.00 80.92  ? 519 GLU B CG  1 
ATOM   8177 C CD  . GLU B 1 518 ? 2.771   -77.790 -1.283  1.00 97.02  ? 519 GLU B CD  1 
ATOM   8178 O OE1 . GLU B 1 518 ? 3.837   -77.798 -1.949  1.00 89.90  ? 519 GLU B OE1 1 
ATOM   8179 O OE2 . GLU B 1 518 ? 2.626   -77.132 -0.219  1.00 92.27  ? 519 GLU B OE2 1 
ATOM   8180 N N   . VAL B 1 519 ? -1.624  -78.753 -3.332  1.00 56.98  ? 520 VAL B N   1 
ATOM   8181 C CA  . VAL B 1 519 ? -2.693  -77.763 -3.337  1.00 47.59  ? 520 VAL B CA  1 
ATOM   8182 C C   . VAL B 1 519 ? -2.361  -76.633 -2.372  1.00 49.80  ? 520 VAL B C   1 
ATOM   8183 O O   . VAL B 1 519 ? -1.874  -76.870 -1.271  1.00 63.42  ? 520 VAL B O   1 
ATOM   8184 C CB  . VAL B 1 519 ? -4.040  -78.380 -2.980  1.00 49.76  ? 520 VAL B CB  1 
ATOM   8185 C CG1 . VAL B 1 519 ? -5.118  -77.301 -2.913  1.00 36.20  ? 520 VAL B CG1 1 
ATOM   8186 C CG2 . VAL B 1 519 ? -4.414  -79.447 -4.024  1.00 45.68  ? 520 VAL B CG2 1 
ATOM   8187 N N   . ARG B 1 520 ? -2.583  -75.397 -2.809  1.00 47.43  ? 521 ARG B N   1 
ATOM   8188 C CA  . ARG B 1 520 ? -2.282  -74.231 -1.995  1.00 43.99  ? 521 ARG B CA  1 
ATOM   8189 C C   . ARG B 1 520 ? -3.366  -73.185 -2.155  1.00 48.18  ? 521 ARG B C   1 
ATOM   8190 O O   . ARG B 1 520 ? -4.228  -73.313 -3.026  1.00 60.65  ? 521 ARG B O   1 
ATOM   8191 C CB  . ARG B 1 520 ? -0.934  -73.638 -2.366  1.00 49.74  ? 521 ARG B CB  1 
ATOM   8192 C CG  . ARG B 1 520 ? 0.215   -74.583 -2.227  1.00 45.72  ? 521 ARG B CG  1 
ATOM   8193 C CD  . ARG B 1 520 ? 1.504   -73.800 -2.251  1.00 52.06  ? 521 ARG B CD  1 
ATOM   8194 N NE  . ARG B 1 520 ? 2.656   -74.667 -2.439  1.00 58.59  ? 521 ARG B NE  1 
ATOM   8195 C CZ  . ARG B 1 520 ? 3.700   -74.351 -3.198  1.00 72.47  ? 521 ARG B CZ  1 
ATOM   8196 N NH1 . ARG B 1 520 ? 3.724   -73.181 -3.835  1.00 64.85  ? 521 ARG B NH1 1 
ATOM   8197 N NH2 . ARG B 1 520 ? 4.715   -75.203 -3.318  1.00 70.85  ? 521 ARG B NH2 1 
ATOM   8198 N N   . ARG B 1 521 ? -3.299  -72.141 -1.331  1.00 53.46  ? 522 ARG B N   1 
ATOM   8199 C CA  . ARG B 1 521 ? -4.354  -71.137 -1.270  1.00 52.21  ? 522 ARG B CA  1 
ATOM   8200 C C   . ARG B 1 521 ? -3.833  -69.749 -1.558  1.00 58.35  ? 522 ARG B C   1 
ATOM   8201 O O   . ARG B 1 521 ? -2.760  -69.356 -1.075  1.00 56.31  ? 522 ARG B O   1 
ATOM   8202 C CB  . ARG B 1 521 ? -5.039  -71.142 0.095   1.00 56.76  ? 522 ARG B CB  1 
ATOM   8203 C CG  . ARG B 1 521 ? -6.030  -72.259 0.277   1.00 65.17  ? 522 ARG B CG  1 
ATOM   8204 C CD  . ARG B 1 521 ? -7.011  -71.940 1.385   1.00 56.20  ? 522 ARG B CD  1 
ATOM   8205 N NE  . ARG B 1 521 ? -7.882  -70.834 0.997   1.00 59.60  ? 522 ARG B NE  1 
ATOM   8206 C CZ  . ARG B 1 521 ? -8.240  -69.847 1.810   1.00 66.53  ? 522 ARG B CZ  1 
ATOM   8207 N NH1 . ARG B 1 521 ? -7.799  -69.824 3.070   1.00 64.83  ? 522 ARG B NH1 1 
ATOM   8208 N NH2 . ARG B 1 521 ? -9.032  -68.886 1.363   1.00 47.09  ? 522 ARG B NH2 1 
ATOM   8209 N N   . GLY B 1 522 ? -4.615  -69.027 -2.360  1.00 49.74  ? 523 GLY B N   1 
ATOM   8210 C CA  . GLY B 1 522 ? -4.360  -67.638 -2.689  1.00 46.53  ? 523 GLY B CA  1 
ATOM   8211 C C   . GLY B 1 522 ? -3.229  -67.329 -3.650  1.00 52.10  ? 523 GLY B C   1 
ATOM   8212 O O   . GLY B 1 522 ? -2.084  -67.720 -3.434  1.00 52.52  ? 523 GLY B O   1 
ATOM   8213 N N   . LEU B 1 523 ? -3.558  -66.598 -4.711  1.00 54.20  ? 524 LEU B N   1 
ATOM   8214 C CA  . LEU B 1 523 ? -2.557  -66.144 -5.667  1.00 54.82  ? 524 LEU B CA  1 
ATOM   8215 C C   . LEU B 1 523 ? -2.018  -64.787 -5.251  1.00 52.09  ? 524 LEU B C   1 
ATOM   8216 O O   . LEU B 1 523 ? -2.520  -63.754 -5.710  1.00 48.40  ? 524 LEU B O   1 
ATOM   8217 C CB  . LEU B 1 523 ? -3.148  -66.070 -7.084  1.00 48.21  ? 524 LEU B CB  1 
ATOM   8218 C CG  . LEU B 1 523 ? -3.429  -67.428 -7.729  1.00 53.46  ? 524 LEU B CG  1 
ATOM   8219 C CD1 . LEU B 1 523 ? -4.302  -67.278 -8.968  1.00 47.71  ? 524 LEU B CD1 1 
ATOM   8220 C CD2 . LEU B 1 523 ? -2.126  -68.141 -8.059  1.00 45.51  ? 524 LEU B CD2 1 
ATOM   8221 N N   . ARG B 1 524 ? -0.994  -64.785 -4.399  1.00 46.62  ? 525 ARG B N   1 
ATOM   8222 C CA  . ARG B 1 524 ? -0.510  -63.542 -3.782  1.00 53.18  ? 525 ARG B CA  1 
ATOM   8223 C C   . ARG B 1 524 ? -1.690  -62.697 -3.281  1.00 49.75  ? 525 ARG B C   1 
ATOM   8224 O O   . ARG B 1 524 ? -1.837  -61.517 -3.663  1.00 49.70  ? 525 ARG B O   1 
ATOM   8225 C CB  . ARG B 1 524 ? 0.341   -62.728 -4.770  1.00 56.59  ? 525 ARG B CB  1 
ATOM   8226 C CG  . ARG B 1 524 ? 1.458   -63.507 -5.463  1.00 58.37  ? 525 ARG B CG  1 
ATOM   8227 C CD  . ARG B 1 524 ? 2.779   -63.313 -4.767  1.00 61.60  ? 525 ARG B CD  1 
ATOM   8228 N NE  . ARG B 1 524 ? 3.087   -61.896 -4.589  1.00 71.55  ? 525 ARG B NE  1 
ATOM   8229 C CZ  . ARG B 1 524 ? 3.758   -61.391 -3.549  1.00 71.07  ? 525 ARG B CZ  1 
ATOM   8230 N NH1 . ARG B 1 524 ? 4.205   -62.196 -2.579  1.00 56.38  ? 525 ARG B NH1 1 
ATOM   8231 N NH2 . ARG B 1 524 ? 3.990   -60.079 -3.479  1.00 45.69  ? 525 ARG B NH2 1 
ATOM   8232 N N   . ALA B 1 525 ? -2.532  -63.308 -2.446  1.00 47.61  ? 526 ALA B N   1 
ATOM   8233 C CA  . ALA B 1 525 ? -3.798  -62.691 -2.029  1.00 45.59  ? 526 ALA B CA  1 
ATOM   8234 C C   . ALA B 1 525 ? -3.655  -61.333 -1.328  1.00 49.60  ? 526 ALA B C   1 
ATOM   8235 O O   . ALA B 1 525 ? -4.394  -60.392 -1.665  1.00 56.12  ? 526 ALA B O   1 
ATOM   8236 C CB  . ALA B 1 525 ? -4.572  -63.649 -1.144  1.00 48.52  ? 526 ALA B CB  1 
ATOM   8237 N N   . GLN B 1 526 ? -2.726  -61.207 -0.378  1.00 46.06  ? 527 GLN B N   1 
ATOM   8238 C CA  . GLN B 1 526 ? -2.561  -59.919 0.292   1.00 46.64  ? 527 GLN B CA  1 
ATOM   8239 C C   . GLN B 1 526 ? -2.108  -58.874 -0.702  1.00 46.31  ? 527 GLN B C   1 
ATOM   8240 O O   . GLN B 1 526 ? -2.659  -57.772 -0.764  1.00 53.20  ? 527 GLN B O   1 
ATOM   8241 C CB  . GLN B 1 526 ? -1.558  -59.993 1.443   1.00 44.32  ? 527 GLN B CB  1 
ATOM   8242 C CG  . GLN B 1 526 ? -2.035  -60.811 2.619   1.00 52.52  ? 527 GLN B CG  1 
ATOM   8243 C CD  . GLN B 1 526 ? -3.403  -60.388 3.110   1.00 49.09  ? 527 GLN B CD  1 
ATOM   8244 O OE1 . GLN B 1 526 ? -4.340  -61.188 3.124   1.00 59.52  ? 527 GLN B OE1 1 
ATOM   8245 N NE2 . GLN B 1 526 ? -3.524  -59.134 3.530   1.00 53.10  ? 527 GLN B NE2 1 
ATOM   8246 N N   . ALA B 1 527 ? -1.089  -59.220 -1.475  1.00 47.76  ? 528 ALA B N   1 
ATOM   8247 C CA  . ALA B 1 527 ? -0.557  -58.273 -2.446  1.00 50.06  ? 528 ALA B CA  1 
ATOM   8248 C C   . ALA B 1 527 ? -1.633  -57.846 -3.433  1.00 44.71  ? 528 ALA B C   1 
ATOM   8249 O O   . ALA B 1 527 ? -1.792  -56.661 -3.715  1.00 58.04  ? 528 ALA B O   1 
ATOM   8250 C CB  . ALA B 1 527 ? 0.638   -58.872 -3.185  1.00 58.20  ? 528 ALA B CB  1 
ATOM   8251 N N   . CYS B 1 528 ? -2.399  -58.801 -3.944  1.00 42.56  ? 529 CYS B N   1 
ATOM   8252 C CA  . CYS B 1 528 ? -3.325  -58.462 -5.017  1.00 38.66  ? 529 CYS B CA  1 
ATOM   8253 C C   . CYS B 1 528 ? -4.561  -57.687 -4.528  1.00 56.32  ? 529 CYS B C   1 
ATOM   8254 O O   . CYS B 1 528 ? -5.207  -56.966 -5.321  1.00 43.73  ? 529 CYS B O   1 
ATOM   8255 C CB  . CYS B 1 528 ? -3.703  -59.734 -5.784  1.00 48.35  ? 529 CYS B CB  1 
ATOM   8256 S SG  . CYS B 1 528 ? -2.232  -60.407 -6.740  1.00 49.49  ? 529 CYS B SG  1 
ATOM   8257 N N   . ALA B 1 529 ? -4.879  -57.791 -3.229  1.00 48.63  ? 530 ALA B N   1 
ATOM   8258 C CA  . ALA B 1 529 ? -5.934  -56.943 -2.652  1.00 45.65  ? 530 ALA B CA  1 
ATOM   8259 C C   . ALA B 1 529 ? -5.560  -55.485 -2.808  1.00 39.10  ? 530 ALA B C   1 
ATOM   8260 O O   . ALA B 1 529 ? -6.398  -54.646 -3.132  1.00 44.85  ? 530 ALA B O   1 
ATOM   8261 C CB  . ALA B 1 529 ? -6.169  -57.268 -1.193  1.00 45.69  ? 530 ALA B CB  1 
ATOM   8262 N N   . PHE B 1 530 ? -4.285  -55.193 -2.603  1.00 38.56  ? 531 PHE B N   1 
ATOM   8263 C CA  . PHE B 1 530 ? -3.771  -53.858 -2.860  1.00 40.53  ? 531 PHE B CA  1 
ATOM   8264 C C   . PHE B 1 530 ? -4.016  -53.437 -4.323  1.00 53.04  ? 531 PHE B C   1 
ATOM   8265 O O   . PHE B 1 530 ? -4.641  -52.402 -4.571  1.00 55.56  ? 531 PHE B O   1 
ATOM   8266 C CB  . PHE B 1 530 ? -2.273  -53.783 -2.511  1.00 46.21  ? 531 PHE B CB  1 
ATOM   8267 C CG  . PHE B 1 530 ? -1.606  -52.517 -2.975  1.00 56.45  ? 531 PHE B CG  1 
ATOM   8268 C CD1 . PHE B 1 530 ? -1.649  -51.372 -2.192  1.00 51.46  ? 531 PHE B CD1 1 
ATOM   8269 C CD2 . PHE B 1 530 ? -0.933  -52.473 -4.195  1.00 52.48  ? 531 PHE B CD2 1 
ATOM   8270 C CE1 . PHE B 1 530 ? -1.058  -50.197 -2.619  1.00 56.39  ? 531 PHE B CE1 1 
ATOM   8271 C CE2 . PHE B 1 530 ? -0.342  -51.300 -4.636  1.00 59.63  ? 531 PHE B CE2 1 
ATOM   8272 C CZ  . PHE B 1 530 ? -0.400  -50.156 -3.841  1.00 62.88  ? 531 PHE B CZ  1 
ATOM   8273 N N   . TRP B 1 531 ? -3.556  -54.230 -5.292  1.00 41.93  ? 532 TRP B N   1 
ATOM   8274 C CA  . TRP B 1 531 ? -3.643  -53.783 -6.686  1.00 43.53  ? 532 TRP B CA  1 
ATOM   8275 C C   . TRP B 1 531 ? -5.068  -53.816 -7.221  1.00 41.34  ? 532 TRP B C   1 
ATOM   8276 O O   . TRP B 1 531 ? -5.470  -52.953 -8.010  1.00 46.65  ? 532 TRP B O   1 
ATOM   8277 C CB  . TRP B 1 531 ? -2.733  -54.628 -7.597  1.00 44.28  ? 532 TRP B CB  1 
ATOM   8278 C CG  . TRP B 1 531 ? -1.296  -54.457 -7.291  1.00 39.30  ? 532 TRP B CG  1 
ATOM   8279 C CD1 . TRP B 1 531 ? -0.515  -55.281 -6.531  1.00 36.68  ? 532 TRP B CD1 1 
ATOM   8280 C CD2 . TRP B 1 531 ? -0.463  -53.368 -7.693  1.00 38.70  ? 532 TRP B CD2 1 
ATOM   8281 N NE1 . TRP B 1 531 ? 0.759   -54.785 -6.463  1.00 41.53  ? 532 TRP B NE1 1 
ATOM   8282 C CE2 . TRP B 1 531 ? 0.818   -53.609 -7.162  1.00 33.92  ? 532 TRP B CE2 1 
ATOM   8283 C CE3 . TRP B 1 531 ? -0.675  -52.215 -8.455  1.00 33.79  ? 532 TRP B CE3 1 
ATOM   8284 C CZ2 . TRP B 1 531 ? 1.880   -52.743 -7.361  1.00 38.00  ? 532 TRP B CZ2 1 
ATOM   8285 C CZ3 . TRP B 1 531 ? 0.375   -51.359 -8.658  1.00 36.16  ? 532 TRP B CZ3 1 
ATOM   8286 C CH2 . TRP B 1 531 ? 1.644   -51.626 -8.123  1.00 40.07  ? 532 TRP B CH2 1 
ATOM   8287 N N   . ASN B 1 532 ? -5.843  -54.793 -6.769  1.00 44.84  ? 533 ASN B N   1 
ATOM   8288 C CA  . ASN B 1 532 ? -7.161  -55.012 -7.359  1.00 50.33  ? 533 ASN B CA  1 
ATOM   8289 C C   . ASN B 1 532 ? -8.308  -54.309 -6.630  1.00 60.86  ? 533 ASN B C   1 
ATOM   8290 O O   . ASN B 1 532 ? -9.274  -53.890 -7.262  1.00 62.18  ? 533 ASN B O   1 
ATOM   8291 C CB  . ASN B 1 532 ? -7.419  -56.521 -7.466  1.00 49.25  ? 533 ASN B CB  1 
ATOM   8292 C CG  . ASN B 1 532 ? -6.480  -57.195 -8.476  1.00 47.03  ? 533 ASN B CG  1 
ATOM   8293 O OD1 . ASN B 1 532 ? -6.059  -56.561 -9.438  1.00 50.17  ? 533 ASN B OD1 1 
ATOM   8294 N ND2 . ASN B 1 532 ? -6.144  -58.460 -8.254  1.00 45.36  ? 533 ASN B ND2 1 
ATOM   8295 N N   . ARG B 1 533 ? -8.188  -54.134 -5.316  1.00 60.00  ? 534 ARG B N   1 
ATOM   8296 C CA  . ARG B 1 533 ? -9.296  -53.567 -4.546  1.00 64.68  ? 534 ARG B CA  1 
ATOM   8297 C C   . ARG B 1 533 ? -9.089  -52.120 -4.101  1.00 60.21  ? 534 ARG B C   1 
ATOM   8298 O O   . ARG B 1 533 ? -10.000 -51.307 -4.218  1.00 61.66  ? 534 ARG B O   1 
ATOM   8299 C CB  . ARG B 1 533 ? -9.573  -54.433 -3.329  1.00 59.02  ? 534 ARG B CB  1 
ATOM   8300 C CG  . ARG B 1 533 ? -9.811  -55.863 -3.677  1.00 48.56  ? 534 ARG B CG  1 
ATOM   8301 C CD  . ARG B 1 533 ? -10.071 -56.661 -2.437  1.00 58.65  ? 534 ARG B CD  1 
ATOM   8302 N NE  . ARG B 1 533 ? -10.296 -58.057 -2.770  1.00 69.98  ? 534 ARG B NE  1 
ATOM   8303 C CZ  . ARG B 1 533 ? -11.500 -58.598 -2.896  1.00 72.02  ? 534 ARG B CZ  1 
ATOM   8304 N NH1 . ARG B 1 533 ? -12.576 -57.844 -2.703  1.00 62.56  ? 534 ARG B NH1 1 
ATOM   8305 N NH2 . ARG B 1 533 ? -11.618 -59.889 -3.203  1.00 67.99  ? 534 ARG B NH2 1 
ATOM   8306 N N   . PHE B 1 534 ? -7.910  -51.794 -3.580  1.00 63.31  ? 535 PHE B N   1 
ATOM   8307 C CA  . PHE B 1 534 ? -7.680  -50.429 -3.105  1.00 69.54  ? 535 PHE B CA  1 
ATOM   8308 C C   . PHE B 1 534 ? -7.230  -49.435 -4.179  1.00 73.33  ? 535 PHE B C   1 
ATOM   8309 O O   . PHE B 1 534 ? -7.870  -48.401 -4.387  1.00 69.10  ? 535 PHE B O   1 
ATOM   8310 C CB  . PHE B 1 534 ? -6.648  -50.403 -1.989  1.00 51.17  ? 535 PHE B CB  1 
ATOM   8311 C CG  . PHE B 1 534 ? -6.291  -49.011 -1.555  1.00 59.79  ? 535 PHE B CG  1 
ATOM   8312 C CD1 . PHE B 1 534 ? -7.220  -48.217 -0.884  1.00 61.76  ? 535 PHE B CD1 1 
ATOM   8313 C CD2 . PHE B 1 534 ? -5.042  -48.479 -1.826  1.00 65.11  ? 535 PHE B CD2 1 
ATOM   8314 C CE1 . PHE B 1 534 ? -6.904  -46.917 -0.488  1.00 61.19  ? 535 PHE B CE1 1 
ATOM   8315 C CE2 . PHE B 1 534 ? -4.716  -47.175 -1.425  1.00 83.08  ? 535 PHE B CE2 1 
ATOM   8316 C CZ  . PHE B 1 534 ? -5.652  -46.396 -0.752  1.00 62.11  ? 535 PHE B CZ  1 
ATOM   8317 N N   . LEU B 1 535 ? -6.117  -49.737 -4.839  1.00 57.14  ? 536 LEU B N   1 
ATOM   8318 C CA  . LEU B 1 535 ? -5.507  -48.785 -5.751  1.00 77.10  ? 536 LEU B CA  1 
ATOM   8319 C C   . LEU B 1 535 ? -6.460  -48.170 -6.785  1.00 74.25  ? 536 LEU B C   1 
ATOM   8320 O O   . LEU B 1 535 ? -6.270  -47.014 -7.166  1.00 73.42  ? 536 LEU B O   1 
ATOM   8321 C CB  . LEU B 1 535 ? -4.339  -49.432 -6.488  1.00 77.87  ? 536 LEU B CB  1 
ATOM   8322 C CG  . LEU B 1 535 ? -3.431  -48.369 -7.101  1.00 80.31  ? 536 LEU B CG  1 
ATOM   8323 C CD1 . LEU B 1 535 ? -2.430  -47.880 -6.042  1.00 88.09  ? 536 LEU B CD1 1 
ATOM   8324 C CD2 . LEU B 1 535 ? -2.747  -48.858 -8.366  1.00 80.06  ? 536 LEU B CD2 1 
ATOM   8325 N N   . PRO B 1 536 ? -7.478  -48.923 -7.255  1.00 81.01  ? 537 PRO B N   1 
ATOM   8326 C CA  . PRO B 1 536 ? -8.334  -48.211 -8.218  1.00 92.74  ? 537 PRO B CA  1 
ATOM   8327 C C   . PRO B 1 536 ? -9.239  -47.153 -7.569  1.00 91.11  ? 537 PRO B C   1 
ATOM   8328 O O   . PRO B 1 536 ? -9.686  -46.240 -8.275  1.00 85.25  ? 537 PRO B O   1 
ATOM   8329 C CB  . PRO B 1 536 ? -9.176  -49.333 -8.852  1.00 77.85  ? 537 PRO B CB  1 
ATOM   8330 C CG  . PRO B 1 536 ? -8.436  -50.599 -8.561  1.00 77.11  ? 537 PRO B CG  1 
ATOM   8331 C CD  . PRO B 1 536 ? -7.766  -50.371 -7.237  1.00 70.99  ? 537 PRO B CD  1 
ATOM   8332 N N   . LYS B 1 537 ? -9.501  -47.276 -6.265  1.00 80.97  ? 538 LYS B N   1 
ATOM   8333 C CA  . LYS B 1 537 ? -10.319 -46.293 -5.545  1.00 72.50  ? 538 LYS B CA  1 
ATOM   8334 C C   . LYS B 1 537 ? -9.540  -45.001 -5.318  1.00 75.20  ? 538 LYS B C   1 
ATOM   8335 O O   . LYS B 1 537 ? -10.090 -43.899 -5.384  1.00 80.45  ? 538 LYS B O   1 
ATOM   8336 C CB  . LYS B 1 537 ? -10.802 -46.875 -4.214  1.00 83.39  ? 538 LYS B CB  1 
ATOM   8337 C CG  . LYS B 1 537 ? -11.790 -48.016 -4.388  1.00 73.72  ? 538 LYS B CG  1 
ATOM   8338 C CD  . LYS B 1 537 ? -12.206 -48.615 -3.060  1.00 86.75  ? 538 LYS B CD  1 
ATOM   8339 C CE  . LYS B 1 537 ? -13.287 -49.670 -3.272  1.00 94.75  ? 538 LYS B CE  1 
ATOM   8340 N NZ  . LYS B 1 537 ? -12.829 -50.766 -4.179  1.00 94.29  ? 538 LYS B NZ  1 
ATOM   8341 N N   . LEU B 1 538 ? -8.249  -45.156 -5.060  1.00 73.74  ? 539 LEU B N   1 
ATOM   8342 C CA  . LEU B 1 538 ? -7.337  -44.031 -4.960  1.00 84.05  ? 539 LEU B CA  1 
ATOM   8343 C C   . LEU B 1 538 ? -7.256  -43.276 -6.289  1.00 87.96  ? 539 LEU B C   1 
ATOM   8344 O O   . LEU B 1 538 ? -6.893  -42.102 -6.324  1.00 103.32 ? 539 LEU B O   1 
ATOM   8345 C CB  . LEU B 1 538 ? -5.955  -44.523 -4.518  1.00 79.79  ? 539 LEU B CB  1 
ATOM   8346 C CG  . LEU B 1 538 ? -4.734  -43.605 -4.574  1.00 71.89  ? 539 LEU B CG  1 
ATOM   8347 C CD1 . LEU B 1 538 ? -3.782  -43.952 -3.451  1.00 79.42  ? 539 LEU B CD1 1 
ATOM   8348 C CD2 . LEU B 1 538 ? -4.029  -43.745 -5.914  1.00 85.99  ? 539 LEU B CD2 1 
ATOM   8349 N N   . LEU B 1 539 ? -7.599  -43.952 -7.379  1.00 91.14  ? 540 LEU B N   1 
ATOM   8350 C CA  . LEU B 1 539 ? -7.595  -43.333 -8.706  1.00 99.83  ? 540 LEU B CA  1 
ATOM   8351 C C   . LEU B 1 539 ? -8.767  -42.351 -8.918  1.00 97.81  ? 540 LEU B C   1 
ATOM   8352 O O   . LEU B 1 539 ? -8.609  -41.307 -9.558  1.00 98.12  ? 540 LEU B O   1 
ATOM   8353 C CB  . LEU B 1 539 ? -7.623  -44.419 -9.782  1.00 102.03 ? 540 LEU B CB  1 
ATOM   8354 C CG  . LEU B 1 539 ? -6.541  -44.391 -10.863 1.00 105.30 ? 540 LEU B CG  1 
ATOM   8355 C CD1 . LEU B 1 539 ? -6.710  -45.599 -11.773 1.00 100.26 ? 540 LEU B CD1 1 
ATOM   8356 C CD2 . LEU B 1 539 ? -6.587  -43.085 -11.664 1.00 94.21  ? 540 LEU B CD2 1 
ATOM   8357 N N   . SER B 1 540 ? -9.937  -42.694 -8.382  1.00 95.89  ? 541 SER B N   1 
ATOM   8358 C CA  . SER B 1 540 ? -11.112 -41.823 -8.442  1.00 98.58  ? 541 SER B CA  1 
ATOM   8359 C C   . SER B 1 540 ? -10.936 -40.510 -7.645  1.00 109.78 ? 541 SER B C   1 
ATOM   8360 O O   . SER B 1 540 ? -11.237 -39.421 -8.150  1.00 108.72 ? 541 SER B O   1 
ATOM   8361 C CB  . SER B 1 540 ? -12.347 -42.580 -7.936  1.00 94.93  ? 541 SER B CB  1 
ATOM   8362 O OG  . SER B 1 540 ? -12.466 -43.847 -8.568  1.00 83.48  ? 541 SER B OG  1 
ATOM   8363 N N   . ALA B 1 541 ? -10.454 -40.612 -6.406  1.00 106.50 ? 542 ALA B N   1 
ATOM   8364 C CA  . ALA B 1 541 ? -10.253 -39.429 -5.564  1.00 106.59 ? 542 ALA B CA  1 
ATOM   8365 C C   . ALA B 1 541 ? -8.800  -38.954 -5.586  1.00 98.86  ? 542 ALA B C   1 
ATOM   8366 O O   . ALA B 1 541 ? -8.149  -38.956 -6.635  1.00 95.95  ? 542 ALA B O   1 
ATOM   8367 C CB  . ALA B 1 541 ? -10.695 -39.717 -4.137  1.00 88.92  ? 542 ALA B CB  1 
HETATM 8368 C C1  . NAG C 2 .   ? -22.810 -59.904 22.057  1.00 74.51  ? 1   NAG C C1  1 
HETATM 8369 C C2  . NAG C 2 .   ? -23.737 -60.422 20.949  1.00 84.85  ? 1   NAG C C2  1 
HETATM 8370 C C3  . NAG C 2 .   ? -24.163 -59.279 20.029  1.00 72.30  ? 1   NAG C C3  1 
HETATM 8371 C C4  . NAG C 2 .   ? -24.739 -58.131 20.846  1.00 75.50  ? 1   NAG C C4  1 
HETATM 8372 C C5  . NAG C 2 .   ? -23.747 -57.719 21.928  1.00 71.12  ? 1   NAG C C5  1 
HETATM 8373 C C6  . NAG C 2 .   ? -24.253 -56.617 22.836  1.00 91.28  ? 1   NAG C C6  1 
HETATM 8374 C C7  . NAG C 2 .   ? -23.686 -62.684 19.995  1.00 93.91  ? 1   NAG C C7  1 
HETATM 8375 C C8  . NAG C 2 .   ? -25.056 -62.863 20.590  1.00 76.61  ? 1   NAG C C8  1 
HETATM 8376 N N2  . NAG C 2 .   ? -23.108 -61.493 20.191  1.00 86.46  ? 1   NAG C N2  1 
HETATM 8377 O O3  . NAG C 2 .   ? -25.137 -59.743 19.101  1.00 83.90  ? 1   NAG C O3  1 
HETATM 8378 O O4  . NAG C 2 .   ? -25.015 -57.024 19.997  1.00 92.93  ? 1   NAG C O4  1 
HETATM 8379 O O5  . NAG C 2 .   ? -23.456 -58.851 22.761  1.00 70.82  ? 1   NAG C O5  1 
HETATM 8380 O O6  . NAG C 2 .   ? -25.622 -56.789 23.180  1.00 100.61 ? 1   NAG C O6  1 
HETATM 8381 O O7  . NAG C 2 .   ? -23.132 -63.576 19.360  1.00 107.77 ? 1   NAG C O7  1 
HETATM 8382 C C1  . NAG C 2 .   ? -26.407 -56.681 20.142  1.00 100.70 ? 2   NAG C C1  1 
HETATM 8383 C C2  . NAG C 2 .   ? -26.577 -55.235 19.687  1.00 101.34 ? 2   NAG C C2  1 
HETATM 8384 C C3  . NAG C 2 .   ? -28.041 -54.812 19.807  1.00 113.55 ? 2   NAG C C3  1 
HETATM 8385 C C4  . NAG C 2 .   ? -28.937 -55.794 19.059  1.00 122.27 ? 2   NAG C C4  1 
HETATM 8386 C C5  . NAG C 2 .   ? -28.662 -57.227 19.525  1.00 117.51 ? 2   NAG C C5  1 
HETATM 8387 C C6  . NAG C 2 .   ? -29.427 -58.266 18.738  1.00 109.06 ? 2   NAG C C6  1 
HETATM 8388 C C7  . NAG C 2 .   ? -24.619 -53.781 19.920  1.00 91.42  ? 2   NAG C C7  1 
HETATM 8389 C C8  . NAG C 2 .   ? -23.838 -52.879 20.832  1.00 83.20  ? 2   NAG C C8  1 
HETATM 8390 N N2  . NAG C 2 .   ? -25.716 -54.340 20.443  1.00 99.59  ? 2   NAG C N2  1 
HETATM 8391 O O3  . NAG C 2 .   ? -28.206 -53.499 19.279  1.00 108.57 ? 2   NAG C O3  1 
HETATM 8392 O O4  . NAG C 2 .   ? -30.310 -55.467 19.253  1.00 112.71 ? 2   NAG C O4  1 
HETATM 8393 O O5  . NAG C 2 .   ? -27.267 -57.536 19.369  1.00 118.38 ? 2   NAG C O5  1 
HETATM 8394 O O6  . NAG C 2 .   ? -30.703 -57.781 18.341  1.00 113.74 ? 2   NAG C O6  1 
HETATM 8395 O O7  . NAG C 2 .   ? -24.275 -53.990 18.758  1.00 82.75  ? 2   NAG C O7  1 
HETATM 8396 C C1  . FUC C 2 .   ? -25.813 -56.699 24.617  1.00 98.35  ? 3   FUC C C1  1 
HETATM 8397 C C2  . FUC C 2 .   ? -27.340 -56.796 24.875  1.00 100.46 ? 3   FUC C C2  1 
HETATM 8398 C C3  . FUC C 2 .   ? -27.858 -58.262 24.751  1.00 105.05 ? 3   FUC C C3  1 
HETATM 8399 C C4  . FUC C 2 .   ? -27.002 -59.271 25.558  1.00 104.27 ? 3   FUC C C4  1 
HETATM 8400 C C5  . FUC C 2 .   ? -25.505 -59.098 25.245  1.00 98.71  ? 3   FUC C C5  1 
HETATM 8401 C C6  . FUC C 2 .   ? -24.600 -59.948 26.146  1.00 71.66  ? 3   FUC C C6  1 
HETATM 8402 O O2  . FUC C 2 .   ? -28.063 -55.920 23.997  1.00 96.91  ? 3   FUC C O2  1 
HETATM 8403 O O3  . FUC C 2 .   ? -29.187 -58.364 25.249  1.00 103.62 ? 3   FUC C O3  1 
HETATM 8404 O O4  . FUC C 2 .   ? -27.233 -59.108 26.951  1.00 109.43 ? 3   FUC C O4  1 
HETATM 8405 O O5  . FUC C 2 .   ? -25.072 -57.699 25.366  1.00 99.57  ? 3   FUC C O5  1 
HETATM 8406 C C1  . NAG D 2 .   ? 25.399  -54.566 -11.474 1.00 83.07  ? 1   NAG D C1  1 
HETATM 8407 C C2  . NAG D 2 .   ? 26.220  -53.469 -10.813 1.00 92.05  ? 1   NAG D C2  1 
HETATM 8408 C C3  . NAG D 2 .   ? 25.540  -52.127 -11.016 1.00 80.76  ? 1   NAG D C3  1 
HETATM 8409 C C4  . NAG D 2 .   ? 25.441  -51.844 -12.509 1.00 92.06  ? 1   NAG D C4  1 
HETATM 8410 C C5  . NAG D 2 .   ? 24.690  -52.984 -13.214 1.00 89.89  ? 1   NAG D C5  1 
HETATM 8411 C C6  . NAG D 2 .   ? 24.742  -52.886 -14.728 1.00 96.79  ? 1   NAG D C6  1 
HETATM 8412 C C7  . NAG D 2 .   ? 27.667  -53.996 -8.907  1.00 100.58 ? 1   NAG D C7  1 
HETATM 8413 C C8  . NAG D 2 .   ? 28.801  -53.993 -9.897  1.00 89.06  ? 1   NAG D C8  1 
HETATM 8414 N N2  . NAG D 2 .   ? 26.450  -53.735 -9.402  1.00 85.34  ? 1   NAG D N2  1 
HETATM 8415 O O3  . NAG D 2 .   ? 26.270  -51.099 -10.355 1.00 98.07  ? 1   NAG D O3  1 
HETATM 8416 O O4  . NAG D 2 .   ? 24.787  -50.597 -12.723 1.00 96.51  ? 1   NAG D O4  1 
HETATM 8417 O O5  . NAG D 2 .   ? 25.246  -54.272 -12.876 1.00 86.77  ? 1   NAG D O5  1 
HETATM 8418 O O6  . NAG D 2 .   ? 26.022  -52.475 -15.198 1.00 107.30 ? 1   NAG D O6  1 
HETATM 8419 O O7  . NAG D 2 .   ? 27.847  -54.224 -7.715  1.00 103.60 ? 1   NAG D O7  1 
HETATM 8420 C C1  . NAG D 2 .   ? 25.579  -49.717 -13.562 1.00 98.60  ? 2   NAG D C1  1 
HETATM 8421 C C2  . NAG D 2 .   ? 24.646  -48.617 -14.076 1.00 101.71 ? 2   NAG D C2  1 
HETATM 8422 C C3  . NAG D 2 .   ? 25.417  -47.632 -14.962 1.00 114.12 ? 2   NAG D C3  1 
HETATM 8423 C C4  . NAG D 2 .   ? 26.646  -47.105 -14.227 1.00 120.60 ? 2   NAG D C4  1 
HETATM 8424 C C5  . NAG D 2 .   ? 27.498  -48.271 -13.728 1.00 114.59 ? 2   NAG D C5  1 
HETATM 8425 C C6  . NAG D 2 .   ? 28.696  -47.829 -12.919 1.00 107.13 ? 2   NAG D C6  1 
HETATM 8426 C C7  . NAG D 2 .   ? 22.291  -49.276 -14.278 1.00 88.60  ? 2   NAG D C7  1 
HETATM 8427 C C8  . NAG D 2 .   ? 21.251  -49.914 -15.147 1.00 83.37  ? 2   NAG D C8  1 
HETATM 8428 N N2  . NAG D 2 .   ? 23.521  -49.194 -14.796 1.00 96.94  ? 2   NAG D N2  1 
HETATM 8429 O O3  . NAG D 2 .   ? 24.567  -46.549 -15.327 1.00 109.07 ? 2   NAG D O3  1 
HETATM 8430 O O4  . NAG D 2 .   ? 27.422  -46.259 -15.071 1.00 101.38 ? 2   NAG D O4  1 
HETATM 8431 O O5  . NAG D 2 .   ? 26.706  -49.118 -12.878 1.00 114.93 ? 2   NAG D O5  1 
HETATM 8432 O O6  . NAG D 2 .   ? 28.304  -47.215 -11.698 1.00 115.64 ? 2   NAG D O6  1 
HETATM 8433 O O7  . NAG D 2 .   ? 22.030  -48.852 -13.157 1.00 86.91  ? 2   NAG D O7  1 
HETATM 8434 C C1  . FUC D 2 .   ? 26.561  -53.353 -16.223 1.00 97.15  ? 3   FUC D C1  1 
HETATM 8435 C C2  . FUC D 2 .   ? 28.007  -52.872 -16.562 1.00 94.97  ? 3   FUC D C2  1 
HETATM 8436 C C3  . FUC D 2 .   ? 29.021  -53.273 -15.450 1.00 105.44 ? 3   FUC D C3  1 
HETATM 8437 C C4  . FUC D 2 .   ? 28.952  -54.782 -15.138 1.00 101.87 ? 3   FUC D C4  1 
HETATM 8438 C C5  . FUC D 2 .   ? 27.512  -55.152 -14.797 1.00 93.63  ? 3   FUC D C5  1 
HETATM 8439 C C6  . FUC D 2 .   ? 27.311  -56.642 -14.540 1.00 85.62  ? 3   FUC D C6  1 
HETATM 8440 O O2  . FUC D 2 .   ? 28.051  -51.474 -16.797 1.00 93.32  ? 3   FUC D O2  1 
HETATM 8441 O O3  . FUC D 2 .   ? 30.366  -52.968 -15.836 1.00 113.02 ? 3   FUC D O3  1 
HETATM 8442 O O4  . FUC D 2 .   ? 29.416  -55.558 -16.246 1.00 105.47 ? 3   FUC D O4  1 
HETATM 8443 O O5  . FUC D 2 .   ? 26.557  -54.742 -15.846 1.00 103.87 ? 3   FUC D O5  1 
HETATM 8444 C C12 . EFS E 3 .   ? -7.298  -42.582 24.291  1.00 59.13  ? 604 EFS A C12 1 
HETATM 8445 C C11 . EFS E 3 .   ? -8.016  -42.905 25.624  1.00 72.60  ? 604 EFS A C11 1 
HETATM 8446 O O2  . EFS E 3 .   ? -7.784  -41.971 26.512  1.00 50.67  ? 604 EFS A O2  1 
HETATM 8447 P P   . EFS E 3 .   ? -6.995  -42.428 28.043  1.00 48.19  ? 604 EFS A P   1 
HETATM 8448 O O4  . EFS E 3 .   ? -7.124  -41.116 28.835  1.00 44.47  ? 604 EFS A O4  1 
HETATM 8449 O O3  . EFS E 3 .   ? -7.800  -43.615 28.520  1.00 58.36  ? 604 EFS A O3  1 
HETATM 8450 C C1  . EDO F 4 .   ? -9.384  -59.620 9.621   1.00 48.08  ? 605 EDO A C1  1 
HETATM 8451 O O1  . EDO F 4 .   ? -7.974  -59.428 9.433   1.00 52.98  ? 605 EDO A O1  1 
HETATM 8452 C C2  . EDO F 4 .   ? -9.815  -60.907 8.927   1.00 57.54  ? 605 EDO A C2  1 
HETATM 8453 O O2  . EDO F 4 .   ? -9.670  -60.753 7.510   1.00 49.42  ? 605 EDO A O2  1 
HETATM 8454 C C1  . EDO G 4 .   ? 8.579   -47.864 11.659  0.93 52.18  ? 606 EDO A C1  1 
HETATM 8455 O O1  . EDO G 4 .   ? 9.628   -46.993 11.209  0.93 61.48  ? 606 EDO A O1  1 
HETATM 8456 C C2  . EDO G 4 .   ? 7.396   -47.818 10.689  0.93 55.20  ? 606 EDO A C2  1 
HETATM 8457 O O2  . EDO G 4 .   ? 6.934   -46.470 10.486  0.93 48.31  ? 606 EDO A O2  1 
HETATM 8458 C C1  . NAG H 5 .   ? -9.026  -36.569 -46.305 1.00 86.09  ? 604 NAG B C1  1 
HETATM 8459 C C2  . NAG H 5 .   ? -10.539 -36.273 -46.300 1.00 88.98  ? 604 NAG B C2  1 
HETATM 8460 C C3  . NAG H 5 .   ? -11.243 -36.957 -47.486 1.00 99.01  ? 604 NAG B C3  1 
HETATM 8461 C C4  . NAG H 5 .   ? -10.509 -36.738 -48.806 1.00 106.28 ? 604 NAG B C4  1 
HETATM 8462 C C5  . NAG H 5 .   ? -9.036  -37.102 -48.649 1.00 111.67 ? 604 NAG B C5  1 
HETATM 8463 C C6  . NAG H 5 .   ? -8.189  -36.862 -49.886 1.00 97.51  ? 604 NAG B C6  1 
HETATM 8464 C C7  . NAG H 5 .   ? -12.123 -36.075 -44.416 1.00 96.80  ? 604 NAG B C7  1 
HETATM 8465 C C8  . NAG H 5 .   ? -12.621 -36.708 -43.150 1.00 82.79  ? 604 NAG B C8  1 
HETATM 8466 N N2  . NAG H 5 .   ? -11.133 -36.719 -45.047 1.00 101.78 ? 604 NAG B N2  1 
HETATM 8467 O O3  . NAG H 5 .   ? -12.566 -36.441 -47.584 1.00 100.52 ? 604 NAG B O3  1 
HETATM 8468 O O4  . NAG H 5 .   ? -11.105 -37.539 -49.824 1.00 97.03  ? 604 NAG B O4  1 
HETATM 8469 O O5  . NAG H 5 .   ? -8.479  -36.296 -47.603 1.00 101.87 ? 604 NAG B O5  1 
HETATM 8470 O O6  . NAG H 5 .   ? -8.932  -36.359 -50.989 1.00 103.43 ? 604 NAG B O6  1 
HETATM 8471 O O7  . NAG H 5 .   ? -12.589 -35.025 -44.841 1.00 110.51 ? 604 NAG B O7  1 
HETATM 8472 C C12 . EFS I 3 .   ? 3.901   -58.700 -19.626 1.00 57.33  ? 605 EFS B C12 1 
HETATM 8473 C C11 . EFS I 3 .   ? 4.955   -58.769 -20.737 1.00 62.73  ? 605 EFS B C11 1 
HETATM 8474 O O2  . EFS I 3 .   ? 4.394   -59.112 -21.866 1.00 48.62  ? 605 EFS B O2  1 
HETATM 8475 P P   . EFS I 3 .   ? 4.621   -60.781 -22.509 1.00 46.94  ? 605 EFS B P   1 
HETATM 8476 O O4  . EFS I 3 .   ? 6.084   -61.033 -22.394 1.00 50.68  ? 605 EFS B O4  1 
HETATM 8477 O O3  . EFS I 3 .   ? 4.033   -60.664 -23.921 1.00 39.73  ? 605 EFS B O3  1 
HETATM 8478 C C1  . EDO J 4 .   ? 12.759  -53.973 2.104   0.96 53.17  ? 606 EDO B C1  1 
HETATM 8479 O O1  . EDO J 4 .   ? 12.024  -53.285 3.136   0.96 51.88  ? 606 EDO B O1  1 
HETATM 8480 C C2  . EDO J 4 .   ? 11.857  -54.292 0.908   0.96 54.88  ? 606 EDO B C2  1 
HETATM 8481 O O2  . EDO J 4 .   ? 10.751  -55.117 1.313   0.96 53.61  ? 606 EDO B O2  1 
HETATM 8482 C C1  . EDO K 4 .   ? -7.773  -61.817 -2.936  0.90 51.45  ? 607 EDO B C1  1 
HETATM 8483 O O1  . EDO K 4 .   ? -9.210  -61.850 -2.954  0.90 50.74  ? 607 EDO B O1  1 
HETATM 8484 C C2  . EDO K 4 .   ? -7.281  -60.369 -3.011  0.90 56.73  ? 607 EDO B C2  1 
HETATM 8485 O O2  . EDO K 4 .   ? -8.256  -59.526 -3.652  0.90 49.90  ? 607 EDO B O2  1 
HETATM 8486 O O   . HOH L 6 .   ? 4.563   -53.227 4.492   0.85 58.80  ? 701 HOH A O   1 
HETATM 8487 O O   . HOH L 6 .   ? -7.422  -28.600 60.662  1.00 71.72  ? 702 HOH A O   1 
HETATM 8488 O O   . HOH L 6 .   ? -6.607  -34.683 61.344  1.00 69.94  ? 703 HOH A O   1 
HETATM 8489 O O   . HOH L 6 .   ? -2.015  -23.903 22.535  0.93 51.77  ? 704 HOH A O   1 
HETATM 8490 O O   . HOH L 6 .   ? 0.845   -45.721 62.336  0.84 63.37  ? 705 HOH A O   1 
HETATM 8491 O O   . HOH L 6 .   ? 1.548   -34.577 67.897  1.00 67.06  ? 706 HOH A O   1 
HETATM 8492 O O   . HOH L 6 .   ? 24.398  -54.792 27.702  1.00 71.42  ? 707 HOH A O   1 
HETATM 8493 O O   . HOH L 6 .   ? -21.714 -47.251 37.263  1.00 67.22  ? 708 HOH A O   1 
HETATM 8494 O O   . HOH L 6 .   ? -13.236 -45.363 41.554  0.80 39.74  ? 709 HOH A O   1 
HETATM 8495 O O   . HOH L 6 .   ? -9.208  -62.714 35.214  1.00 69.40  ? 710 HOH A O   1 
HETATM 8496 O O   . HOH L 6 .   ? 5.828   -62.097 26.494  0.82 59.09  ? 711 HOH A O   1 
HETATM 8497 O O   . HOH L 6 .   ? -7.395  -58.859 44.276  0.70 57.29  ? 712 HOH A O   1 
HETATM 8498 O O   . HOH L 6 .   ? -19.830 -45.319 40.362  1.00 66.70  ? 713 HOH A O   1 
HETATM 8499 O O   . HOH L 6 .   ? 19.647  -47.763 36.003  0.82 54.87  ? 714 HOH A O   1 
HETATM 8500 O O   . HOH L 6 .   ? -8.096  -19.154 49.360  1.00 65.08  ? 715 HOH A O   1 
HETATM 8501 O O   . HOH L 6 .   ? 18.610  -30.576 23.714  1.00 67.57  ? 716 HOH A O   1 
HETATM 8502 O O   . HOH L 6 .   ? 12.728  -30.618 26.055  1.00 63.10  ? 717 HOH A O   1 
HETATM 8503 O O   . HOH L 6 .   ? 11.142  -46.498 52.691  0.89 47.17  ? 718 HOH A O   1 
HETATM 8504 O O   . HOH L 6 .   ? -6.523  -61.074 10.540  1.00 55.29  ? 719 HOH A O   1 
HETATM 8505 O O   . HOH L 6 .   ? 9.477   -61.108 29.070  0.83 56.62  ? 720 HOH A O   1 
HETATM 8506 O O   . HOH L 6 .   ? -13.379 -13.343 22.223  1.00 68.71  ? 721 HOH A O   1 
HETATM 8507 O O   . HOH L 6 .   ? -3.757  -67.282 9.702   1.00 65.27  ? 722 HOH A O   1 
HETATM 8508 O O   . HOH L 6 .   ? 8.243   -55.153 9.164   0.75 59.81  ? 723 HOH A O   1 
HETATM 8509 O O   . HOH L 6 .   ? 2.285   -46.889 45.062  0.97 44.58  ? 724 HOH A O   1 
HETATM 8510 O O   . HOH L 6 .   ? -7.853  -25.424 45.790  1.00 38.37  ? 725 HOH A O   1 
HETATM 8511 O O   . HOH L 6 .   ? -7.963  -41.663 35.828  1.00 34.36  ? 726 HOH A O   1 
HETATM 8512 O O   . HOH L 6 .   ? -2.683  -34.302 18.879  0.76 37.80  ? 727 HOH A O   1 
HETATM 8513 O O   . HOH L 6 .   ? 13.607  -41.520 56.007  0.93 57.93  ? 728 HOH A O   1 
HETATM 8514 O O   . HOH L 6 .   ? 18.777  -41.426 20.679  0.93 46.36  ? 729 HOH A O   1 
HETATM 8515 O O   . HOH L 6 .   ? -19.235 -44.177 22.602  1.00 65.99  ? 730 HOH A O   1 
HETATM 8516 O O   . HOH L 6 .   ? -16.647 -35.146 31.781  0.90 42.59  ? 731 HOH A O   1 
HETATM 8517 O O   . HOH L 6 .   ? 10.082  -45.325 15.472  0.99 57.95  ? 732 HOH A O   1 
HETATM 8518 O O   . HOH L 6 .   ? 21.610  -57.189 38.818  1.00 72.08  ? 733 HOH A O   1 
HETATM 8519 O O   . HOH L 6 .   ? 0.946   -39.356 15.156  0.95 59.51  ? 734 HOH A O   1 
HETATM 8520 O O   . HOH L 6 .   ? -21.762 -42.054 26.661  1.00 66.92  ? 735 HOH A O   1 
HETATM 8521 O O   . HOH L 6 .   ? -8.227  -44.316 47.047  0.87 44.82  ? 736 HOH A O   1 
HETATM 8522 O O   . HOH L 6 .   ? -4.357  -42.622 34.072  0.82 32.98  ? 737 HOH A O   1 
HETATM 8523 O O   . HOH L 6 .   ? -9.817  -43.636 49.583  1.00 63.27  ? 738 HOH A O   1 
HETATM 8524 O O   . HOH L 6 .   ? 15.782  -40.301 50.456  1.00 61.50  ? 739 HOH A O   1 
HETATM 8525 O O   . HOH L 6 .   ? 10.620  -52.212 44.034  1.00 42.50  ? 740 HOH A O   1 
HETATM 8526 O O   . HOH L 6 .   ? 8.797   -45.070 54.502  1.00 40.83  ? 741 HOH A O   1 
HETATM 8527 O O   . HOH L 6 .   ? -2.622  -40.305 43.088  1.00 43.60  ? 742 HOH A O   1 
HETATM 8528 O O   . HOH L 6 .   ? -5.437  -64.138 41.835  1.00 58.00  ? 743 HOH A O   1 
HETATM 8529 O O   . HOH L 6 .   ? 7.334   -56.399 17.185  1.00 62.01  ? 744 HOH A O   1 
HETATM 8530 O O   . HOH L 6 .   ? -4.238  -68.981 6.168   1.00 67.09  ? 745 HOH A O   1 
HETATM 8531 O O   . HOH L 6 .   ? -1.059  -21.455 58.203  1.00 57.12  ? 746 HOH A O   1 
HETATM 8532 O O   . HOH L 6 .   ? -13.134 -24.166 34.941  1.00 41.96  ? 747 HOH A O   1 
HETATM 8533 O O   . HOH L 6 .   ? -11.200 -27.889 23.476  1.00 47.70  ? 748 HOH A O   1 
HETATM 8534 O O   . HOH L 6 .   ? -14.688 -43.605 25.291  1.00 76.81  ? 749 HOH A O   1 
HETATM 8535 O O   . HOH L 6 .   ? -2.414  -48.429 29.629  0.91 45.09  ? 750 HOH A O   1 
HETATM 8536 O O   . HOH L 6 .   ? 18.768  -45.875 40.797  1.00 56.49  ? 751 HOH A O   1 
HETATM 8537 O O   . HOH L 6 .   ? -14.582 -24.990 37.281  0.92 38.13  ? 752 HOH A O   1 
HETATM 8538 O O   . HOH L 6 .   ? -13.457 -64.253 26.632  0.94 67.56  ? 753 HOH A O   1 
HETATM 8539 O O   . HOH L 6 .   ? 8.082   -29.370 39.541  0.89 44.50  ? 754 HOH A O   1 
HETATM 8540 O O   . HOH L 6 .   ? -4.723  -20.977 28.374  1.00 59.26  ? 755 HOH A O   1 
HETATM 8541 O O   . HOH L 6 .   ? -12.502 -18.624 43.780  0.94 56.19  ? 756 HOH A O   1 
HETATM 8542 O O   . HOH L 6 .   ? -30.869 -29.284 24.957  0.82 46.68  ? 757 HOH A O   1 
HETATM 8543 O O   . HOH L 6 .   ? 0.003   -41.968 14.766  1.00 48.73  ? 758 HOH A O   1 
HETATM 8544 O O   . HOH L 6 .   ? -14.037 -25.705 23.207  1.00 45.50  ? 759 HOH A O   1 
HETATM 8545 O O   . HOH L 6 .   ? -8.752  -40.352 51.834  0.97 47.10  ? 760 HOH A O   1 
HETATM 8546 O O   . HOH L 6 .   ? 0.242   -18.563 56.148  0.86 55.47  ? 761 HOH A O   1 
HETATM 8547 O O   . HOH L 6 .   ? -8.180  -20.480 40.315  1.00 45.25  ? 762 HOH A O   1 
HETATM 8548 O O   . HOH L 6 .   ? 15.619  -49.037 45.546  0.85 46.76  ? 763 HOH A O   1 
HETATM 8549 O O   . HOH L 6 .   ? 1.931   -23.260 49.625  1.00 45.07  ? 764 HOH A O   1 
HETATM 8550 O O   . HOH L 6 .   ? 3.999   -22.500 46.275  0.98 61.84  ? 765 HOH A O   1 
HETATM 8551 O O   . HOH L 6 .   ? 1.494   -48.537 29.169  1.00 43.47  ? 766 HOH A O   1 
HETATM 8552 O O   . HOH L 6 .   ? -4.727  -42.763 45.037  0.82 44.31  ? 767 HOH A O   1 
HETATM 8553 O O   . HOH L 6 .   ? -4.373  -15.973 44.076  1.00 59.22  ? 768 HOH A O   1 
HETATM 8554 O O   . HOH L 6 .   ? 8.470   -42.776 5.156   1.00 59.72  ? 769 HOH A O   1 
HETATM 8555 O O   . HOH L 6 .   ? -18.960 -64.455 1.321   1.00 70.36  ? 770 HOH A O   1 
HETATM 8556 O O   . HOH L 6 .   ? -6.922  -60.704 13.145  0.99 55.59  ? 771 HOH A O   1 
HETATM 8557 O O   . HOH L 6 .   ? 16.055  -56.915 34.002  1.00 60.59  ? 772 HOH A O   1 
HETATM 8558 O O   . HOH L 6 .   ? -7.633  -52.147 25.557  0.99 44.08  ? 773 HOH A O   1 
HETATM 8559 O O   . HOH L 6 .   ? 3.208   -57.747 21.647  1.00 67.06  ? 774 HOH A O   1 
HETATM 8560 O O   . HOH L 6 .   ? -14.329 -55.228 2.314   1.00 61.88  ? 775 HOH A O   1 
HETATM 8561 O O   . HOH L 6 .   ? -15.674 -40.746 35.356  1.00 45.64  ? 776 HOH A O   1 
HETATM 8562 O O   . HOH L 6 .   ? -10.275 -25.984 44.378  0.97 44.47  ? 777 HOH A O   1 
HETATM 8563 O O   . HOH L 6 .   ? -12.229 -34.662 26.873  1.00 45.87  ? 778 HOH A O   1 
HETATM 8564 O O   . HOH L 6 .   ? 16.215  -60.667 24.706  1.00 62.71  ? 779 HOH A O   1 
HETATM 8565 O O   . HOH L 6 .   ? -10.170 -36.305 44.156  0.89 44.42  ? 780 HOH A O   1 
HETATM 8566 O O   . HOH L 6 .   ? -2.780  -36.924 38.747  1.00 33.20  ? 781 HOH A O   1 
HETATM 8567 O O   . HOH L 6 .   ? 1.092   -65.978 38.685  1.00 59.98  ? 782 HOH A O   1 
HETATM 8568 O O   . HOH L 6 .   ? -13.559 -29.691 47.848  1.00 50.01  ? 783 HOH A O   1 
HETATM 8569 O O   . HOH L 6 .   ? 8.922   -49.417 15.840  1.00 52.32  ? 784 HOH A O   1 
HETATM 8570 O O   . HOH L 6 .   ? 20.183  -37.187 25.567  1.00 60.44  ? 785 HOH A O   1 
HETATM 8571 O O   . HOH L 6 .   ? -11.849 -42.597 33.080  1.00 47.90  ? 786 HOH A O   1 
HETATM 8572 O O   . HOH L 6 .   ? -18.923 -22.225 39.138  0.83 45.08  ? 787 HOH A O   1 
HETATM 8573 O O   . HOH L 6 .   ? 1.734   -20.546 32.562  1.00 61.37  ? 788 HOH A O   1 
HETATM 8574 O O   . HOH L 6 .   ? 8.177   -53.992 48.027  0.80 51.20  ? 789 HOH A O   1 
HETATM 8575 O O   . HOH L 6 .   ? 0.018   -22.249 44.213  1.00 47.58  ? 790 HOH A O   1 
HETATM 8576 O O   . HOH L 6 .   ? -6.755  -34.663 47.011  1.00 39.03  ? 791 HOH A O   1 
HETATM 8577 O O   . HOH L 6 .   ? -4.551  -19.654 25.435  1.00 67.16  ? 792 HOH A O   1 
HETATM 8578 O O   . HOH L 6 .   ? 7.568   -62.772 39.057  0.75 54.01  ? 793 HOH A O   1 
HETATM 8579 O O   . HOH L 6 .   ? -17.914 -53.248 15.329  1.00 76.08  ? 794 HOH A O   1 
HETATM 8580 O O   . HOH L 6 .   ? -10.504 -62.613 -0.450  0.83 53.00  ? 795 HOH A O   1 
HETATM 8581 O O   . HOH L 6 .   ? -12.553 -40.394 38.096  0.70 36.13  ? 796 HOH A O   1 
HETATM 8582 O O   . HOH L 6 .   ? 14.579  -59.634 33.398  0.96 68.33  ? 797 HOH A O   1 
HETATM 8583 O O   . HOH L 6 .   ? -19.844 -48.684 34.432  0.90 66.94  ? 798 HOH A O   1 
HETATM 8584 O O   . HOH L 6 .   ? 13.744  -49.832 24.411  0.87 38.50  ? 799 HOH A O   1 
HETATM 8585 O O   . HOH L 6 .   ? -14.278 -17.500 42.366  0.98 61.57  ? 800 HOH A O   1 
HETATM 8586 O O   . HOH L 6 .   ? 14.277  -28.896 32.871  1.00 59.66  ? 801 HOH A O   1 
HETATM 8587 O O   . HOH L 6 .   ? 22.970  -51.495 29.923  1.00 55.73  ? 802 HOH A O   1 
HETATM 8588 O O   . HOH L 6 .   ? 12.984  -38.059 39.680  0.89 43.90  ? 803 HOH A O   1 
HETATM 8589 O O   . HOH L 6 .   ? -9.362  -47.589 41.390  0.96 45.29  ? 804 HOH A O   1 
HETATM 8590 O O   . HOH L 6 .   ? -20.466 -63.248 20.066  0.99 77.05  ? 805 HOH A O   1 
HETATM 8591 O O   . HOH L 6 .   ? 9.768   -58.944 31.630  1.00 49.09  ? 806 HOH A O   1 
HETATM 8592 O O   . HOH L 6 .   ? -10.884 -22.042 28.997  1.00 45.27  ? 807 HOH A O   1 
HETATM 8593 O O   . HOH L 6 .   ? -1.753  -53.017 21.404  0.95 44.39  ? 808 HOH A O   1 
HETATM 8594 O O   . HOH L 6 .   ? -2.293  -58.776 46.453  0.89 52.05  ? 809 HOH A O   1 
HETATM 8595 O O   . HOH L 6 .   ? -8.236  -37.177 31.706  0.95 31.89  ? 810 HOH A O   1 
HETATM 8596 O O   . HOH L 6 .   ? -0.444  -24.324 48.558  0.91 50.31  ? 811 HOH A O   1 
HETATM 8597 O O   . HOH L 6 .   ? -13.296 -65.857 6.035   1.00 60.58  ? 812 HOH A O   1 
HETATM 8598 O O   . HOH L 6 .   ? -2.259  -40.410 10.270  1.00 69.80  ? 813 HOH A O   1 
HETATM 8599 O O   . HOH L 6 .   ? 5.997   -36.539 13.752  0.99 73.86  ? 814 HOH A O   1 
HETATM 8600 O O   . HOH L 6 .   ? 16.938  -49.987 19.573  1.00 49.81  ? 815 HOH A O   1 
HETATM 8601 O O   . HOH L 6 .   ? -24.126 -37.109 32.974  1.00 64.70  ? 816 HOH A O   1 
HETATM 8602 O O   . HOH L 6 .   ? -4.180  -50.895 36.528  0.90 37.51  ? 817 HOH A O   1 
HETATM 8603 O O   . HOH L 6 .   ? -9.551  -20.141 37.617  0.74 41.86  ? 818 HOH A O   1 
HETATM 8604 O O   . HOH L 6 .   ? -29.041 -31.504 32.696  1.00 67.98  ? 819 HOH A O   1 
HETATM 8605 O O   . HOH L 6 .   ? 11.218  -45.815 13.185  1.00 56.25  ? 820 HOH A O   1 
HETATM 8606 O O   . HOH L 6 .   ? -8.736  -26.265 25.532  0.94 46.32  ? 821 HOH A O   1 
HETATM 8607 O O   . HOH L 6 .   ? -14.404 -42.318 9.602   1.00 74.97  ? 822 HOH A O   1 
HETATM 8608 O O   . HOH L 6 .   ? -14.834 -33.845 26.854  1.00 62.19  ? 823 HOH A O   1 
HETATM 8609 O O   . HOH L 6 .   ? 9.901   -21.987 49.992  1.00 61.90  ? 824 HOH A O   1 
HETATM 8610 O O   . HOH L 6 .   ? -2.839  -43.216 50.045  1.00 57.07  ? 825 HOH A O   1 
HETATM 8611 O O   . HOH L 6 .   ? -1.518  -54.557 9.752   1.00 62.81  ? 826 HOH A O   1 
HETATM 8612 O O   . HOH L 6 .   ? -12.010 -24.321 49.402  1.00 50.76  ? 827 HOH A O   1 
HETATM 8613 O O   . HOH L 6 .   ? 5.574   -22.790 60.434  1.00 59.41  ? 828 HOH A O   1 
HETATM 8614 O O   . HOH L 6 .   ? -15.185 -46.076 33.897  1.00 52.31  ? 829 HOH A O   1 
HETATM 8615 O O   . HOH L 6 .   ? 20.649  -38.362 27.420  0.98 61.17  ? 830 HOH A O   1 
HETATM 8616 O O   . HOH L 6 .   ? -5.191  -63.421 10.050  1.00 53.31  ? 831 HOH A O   1 
HETATM 8617 O O   . HOH L 6 .   ? 9.799   -27.800 19.163  1.00 67.47  ? 832 HOH A O   1 
HETATM 8618 O O   . HOH L 6 .   ? -17.709 -31.453 30.519  1.00 60.57  ? 833 HOH A O   1 
HETATM 8619 O O   . HOH L 6 .   ? 3.849   -19.957 22.360  1.00 58.06  ? 834 HOH A O   1 
HETATM 8620 O O   . HOH L 6 .   ? -31.511 -24.402 23.439  0.60 48.02  ? 835 HOH A O   1 
HETATM 8621 O O   . HOH L 6 .   ? -21.604 -36.641 36.483  1.00 45.85  ? 836 HOH A O   1 
HETATM 8622 O O   . HOH L 6 .   ? -8.038  -29.977 52.316  1.00 56.87  ? 837 HOH A O   1 
HETATM 8623 O O   . HOH L 6 .   ? -7.700  -15.500 30.609  1.00 50.70  ? 838 HOH A O   1 
HETATM 8624 O O   . HOH L 6 .   ? -12.085 -46.352 45.787  1.00 66.52  ? 839 HOH A O   1 
HETATM 8625 O O   . HOH L 6 .   ? -19.534 -20.779 37.012  0.83 41.93  ? 840 HOH A O   1 
HETATM 8626 O O   . HOH L 6 .   ? -8.760  -23.877 13.158  1.00 68.54  ? 841 HOH A O   1 
HETATM 8627 O O   . HOH L 6 .   ? 17.384  -43.575 22.288  1.00 46.72  ? 842 HOH A O   1 
HETATM 8628 O O   . HOH L 6 .   ? 6.219   -21.506 34.090  1.00 57.38  ? 843 HOH A O   1 
HETATM 8629 O O   . HOH L 6 .   ? 11.062  -27.258 46.960  1.00 48.58  ? 844 HOH A O   1 
HETATM 8630 O O   . HOH L 6 .   ? 12.294  -36.464 59.329  1.00 63.39  ? 845 HOH A O   1 
HETATM 8631 O O   . HOH L 6 .   ? -6.361  -63.962 25.967  1.00 69.16  ? 846 HOH A O   1 
HETATM 8632 O O   . HOH L 6 .   ? 12.945  -52.085 46.868  0.87 51.93  ? 847 HOH A O   1 
HETATM 8633 O O   . HOH L 6 .   ? -13.188 -64.936 29.594  1.00 58.44  ? 848 HOH A O   1 
HETATM 8634 O O   . HOH L 6 .   ? 18.639  -49.970 42.234  0.85 54.86  ? 849 HOH A O   1 
HETATM 8635 O O   . HOH L 6 .   ? -20.585 -51.796 21.712  1.00 63.60  ? 850 HOH A O   1 
HETATM 8636 O O   . HOH L 6 .   ? -3.028  -60.895 24.606  1.00 62.07  ? 851 HOH A O   1 
HETATM 8637 O O   . HOH L 6 .   ? 2.593   -18.665 55.017  0.93 60.22  ? 852 HOH A O   1 
HETATM 8638 O O   . HOH L 6 .   ? -3.602  -56.760 12.213  1.00 67.02  ? 853 HOH A O   1 
HETATM 8639 O O   . HOH L 6 .   ? -16.296 -37.069 49.016  1.00 58.38  ? 854 HOH A O   1 
HETATM 8640 O O   . HOH L 6 .   ? -20.854 -36.178 43.622  1.00 50.06  ? 855 HOH A O   1 
HETATM 8641 O O   . HOH L 6 .   ? 4.763   -24.808 22.337  0.96 47.26  ? 856 HOH A O   1 
HETATM 8642 O O   . HOH L 6 .   ? -10.387 -34.894 39.161  0.88 35.22  ? 857 HOH A O   1 
HETATM 8643 O O   . HOH L 6 .   ? -13.612 -30.923 35.690  0.98 42.95  ? 858 HOH A O   1 
HETATM 8644 O O   . HOH L 6 .   ? 17.852  -36.547 44.886  0.99 66.02  ? 859 HOH A O   1 
HETATM 8645 O O   . HOH L 6 .   ? 12.670  -49.528 51.224  1.00 57.75  ? 860 HOH A O   1 
HETATM 8646 O O   . HOH L 6 .   ? 8.332   -23.716 53.837  0.99 55.53  ? 861 HOH A O   1 
HETATM 8647 O O   . HOH L 6 .   ? -0.139  -62.913 31.159  1.00 58.92  ? 862 HOH A O   1 
HETATM 8648 O O   . HOH L 6 .   ? -20.247 -26.007 41.273  0.80 39.56  ? 863 HOH A O   1 
HETATM 8649 O O   . HOH L 6 .   ? -5.289  -53.976 20.386  1.00 53.09  ? 864 HOH A O   1 
HETATM 8650 O O   . HOH L 6 .   ? -2.755  -58.468 17.097  1.00 65.94  ? 865 HOH A O   1 
HETATM 8651 O O   . HOH L 6 .   ? -4.976  -44.022 50.380  1.00 52.76  ? 866 HOH A O   1 
HETATM 8652 O O   . HOH L 6 .   ? -10.505 -42.459 35.498  0.72 29.99  ? 867 HOH A O   1 
HETATM 8653 O O   . HOH L 6 .   ? -21.630 -25.085 16.773  0.98 58.36  ? 868 HOH A O   1 
HETATM 8654 O O   . HOH L 6 .   ? 6.880   -54.654 14.437  1.00 55.46  ? 869 HOH A O   1 
HETATM 8655 O O   . HOH L 6 .   ? 4.485   -31.758 10.707  1.00 65.81  ? 870 HOH A O   1 
HETATM 8656 O O   . HOH L 6 .   ? -22.433 -37.110 16.689  1.00 69.68  ? 871 HOH A O   1 
HETATM 8657 O O   . HOH L 6 .   ? 5.817   -62.752 46.502  1.00 63.69  ? 872 HOH A O   1 
HETATM 8658 O O   . HOH L 6 .   ? 4.368   -27.445 60.323  1.00 46.70  ? 873 HOH A O   1 
HETATM 8659 O O   . HOH L 6 .   ? 8.030   -27.861 57.639  1.00 52.99  ? 874 HOH A O   1 
HETATM 8660 O O   . HOH L 6 .   ? -13.373 -28.719 22.057  0.79 46.31  ? 875 HOH A O   1 
HETATM 8661 O O   . HOH L 6 .   ? -3.211  -22.033 25.228  1.00 62.58  ? 876 HOH A O   1 
HETATM 8662 O O   . HOH L 6 .   ? -9.005  -24.309 48.286  1.00 50.36  ? 877 HOH A O   1 
HETATM 8663 O O   . HOH L 6 .   ? -22.647 -26.371 40.034  0.93 48.60  ? 878 HOH A O   1 
HETATM 8664 O O   . HOH L 6 .   ? -17.001 -56.904 39.227  0.90 58.16  ? 879 HOH A O   1 
HETATM 8665 O O   . HOH L 6 .   ? -3.057  -37.575 61.342  1.00 58.59  ? 880 HOH A O   1 
HETATM 8666 O O   . HOH L 6 .   ? -5.611  -24.378 15.140  1.00 60.97  ? 881 HOH A O   1 
HETATM 8667 O O   . HOH L 6 .   ? -7.070  -18.576 56.507  1.00 66.69  ? 882 HOH A O   1 
HETATM 8668 O O   . HOH L 6 .   ? -18.946 -27.330 42.895  0.92 43.57  ? 883 HOH A O   1 
HETATM 8669 O O   . HOH L 6 .   ? -14.403 -13.569 35.307  1.00 65.67  ? 884 HOH A O   1 
HETATM 8670 O O   . HOH L 6 .   ? -6.948  -63.128 34.019  1.00 55.59  ? 885 HOH A O   1 
HETATM 8671 O O   . HOH L 6 .   ? -10.868 -26.510 51.215  1.00 52.78  ? 886 HOH A O   1 
HETATM 8672 O O   . HOH L 6 .   ? -2.401  -42.527 14.099  1.00 51.14  ? 887 HOH A O   1 
HETATM 8673 O O   . HOH L 6 .   ? 6.607   -48.566 14.580  1.00 54.23  ? 888 HOH A O   1 
HETATM 8674 O O   . HOH L 6 .   ? 9.851   -28.985 56.417  1.00 53.00  ? 889 HOH A O   1 
HETATM 8675 O O   . HOH L 6 .   ? -16.602 -32.604 32.706  0.90 43.98  ? 890 HOH A O   1 
HETATM 8676 O O   . HOH L 6 .   ? -10.174 -55.673 37.265  1.00 61.58  ? 891 HOH A O   1 
HETATM 8677 O O   . HOH L 6 .   ? -14.850 -43.153 34.320  1.00 40.38  ? 892 HOH A O   1 
HETATM 8678 O O   . HOH L 6 .   ? -13.500 -27.195 38.273  0.89 37.49  ? 893 HOH A O   1 
HETATM 8679 O O   . HOH L 6 .   ? 4.812   -20.462 55.458  1.00 71.99  ? 894 HOH A O   1 
HETATM 8680 O O   . HOH L 6 .   ? 8.091   -28.728 12.196  0.91 61.43  ? 895 HOH A O   1 
HETATM 8681 O O   . HOH L 6 .   ? 15.420  -43.040 45.607  1.00 60.44  ? 896 HOH A O   1 
HETATM 8682 O O   . HOH L 6 .   ? -22.617 -38.308 34.608  1.00 58.25  ? 897 HOH A O   1 
HETATM 8683 O O   . HOH L 6 .   ? 0.618   -53.020 21.461  0.83 51.66  ? 898 HOH A O   1 
HETATM 8684 O O   . HOH L 6 .   ? -14.856 -26.687 12.650  1.00 55.90  ? 899 HOH A O   1 
HETATM 8685 O O   . HOH L 6 .   ? -3.123  -47.198 56.647  1.00 56.90  ? 900 HOH A O   1 
HETATM 8686 O O   . HOH L 6 .   ? -5.354  -58.024 18.612  1.00 67.49  ? 901 HOH A O   1 
HETATM 8687 O O   . HOH L 6 .   ? 1.641   -21.316 28.002  1.00 58.13  ? 902 HOH A O   1 
HETATM 8688 O O   . HOH L 6 .   ? 3.004   -63.278 32.282  1.00 56.60  ? 903 HOH A O   1 
HETATM 8689 O O   . HOH L 6 .   ? 7.133   -60.204 47.141  1.00 66.22  ? 904 HOH A O   1 
HETATM 8690 O O   . HOH L 6 .   ? -11.530 -19.284 16.601  1.00 73.50  ? 905 HOH A O   1 
HETATM 8691 O O   . HOH L 6 .   ? -14.557 -29.304 37.779  0.92 40.44  ? 906 HOH A O   1 
HETATM 8692 O O   . HOH L 6 .   ? 10.365  -26.071 50.009  1.00 54.17  ? 907 HOH A O   1 
HETATM 8693 O O   . HOH L 6 .   ? -9.710  -40.617 17.511  1.00 65.70  ? 908 HOH A O   1 
HETATM 8694 O O   . HOH L 6 .   ? -23.879 -29.008 39.612  1.00 54.29  ? 909 HOH A O   1 
HETATM 8695 O O   . HOH L 6 .   ? -5.037  -48.804 47.371  1.00 61.70  ? 910 HOH A O   1 
HETATM 8696 O O   . HOH L 6 .   ? -15.021 -49.469 3.837   1.00 67.84  ? 911 HOH A O   1 
HETATM 8697 O O   . HOH L 6 .   ? 2.972   -67.412 42.035  1.00 67.70  ? 912 HOH A O   1 
HETATM 8698 O O   . HOH L 6 .   ? -20.682 -63.724 13.616  1.00 63.67  ? 913 HOH A O   1 
HETATM 8699 O O   . HOH L 6 .   ? 12.003  -59.206 17.546  1.00 59.69  ? 914 HOH A O   1 
HETATM 8700 O O   . HOH L 6 .   ? -9.496  -30.548 15.049  1.00 50.58  ? 915 HOH A O   1 
HETATM 8701 O O   . HOH L 6 .   ? 18.054  -54.555 33.729  1.00 60.91  ? 916 HOH A O   1 
HETATM 8702 O O   . HOH L 6 .   ? 6.746   -57.852 54.246  1.00 60.19  ? 917 HOH A O   1 
HETATM 8703 O O   . HOH L 6 .   ? -11.270 -35.198 20.026  1.00 62.50  ? 918 HOH A O   1 
HETATM 8704 O O   . HOH L 6 .   ? -1.726  -39.933 61.361  0.97 51.82  ? 919 HOH A O   1 
HETATM 8705 O O   . HOH L 6 .   ? -30.240 -18.381 30.349  1.00 67.78  ? 920 HOH A O   1 
HETATM 8706 O O   . HOH L 6 .   ? 15.078  -55.362 46.478  1.00 59.53  ? 921 HOH A O   1 
HETATM 8707 O O   . HOH L 6 .   ? 17.698  -43.185 16.799  1.00 58.08  ? 922 HOH A O   1 
HETATM 8708 O O   . HOH L 6 .   ? 6.457   -45.591 13.469  1.00 55.12  ? 923 HOH A O   1 
HETATM 8709 O O   . HOH L 6 .   ? -9.721  -40.072 14.743  1.00 76.24  ? 924 HOH A O   1 
HETATM 8710 O O   . HOH L 6 .   ? 3.067   -50.033 58.171  0.85 46.30  ? 925 HOH A O   1 
HETATM 8711 O O   . HOH L 6 .   ? 21.077  -49.761 28.379  0.99 64.63  ? 926 HOH A O   1 
HETATM 8712 O O   . HOH L 6 .   ? -15.795 -48.967 6.419   1.00 57.96  ? 927 HOH A O   1 
HETATM 8713 O O   . HOH L 6 .   ? -11.023 -46.240 43.095  1.00 47.80  ? 928 HOH A O   1 
HETATM 8714 O O   . HOH L 6 .   ? 1.941   -27.675 60.410  0.89 46.02  ? 929 HOH A O   1 
HETATM 8715 O O   . HOH L 6 .   ? 6.760   -30.735 11.016  0.74 57.56  ? 930 HOH A O   1 
HETATM 8716 O O   . HOH L 6 .   ? 10.047  -27.038 25.194  1.00 61.11  ? 931 HOH A O   1 
HETATM 8717 O O   . HOH L 6 .   ? -21.753 -33.478 43.708  0.88 55.41  ? 932 HOH A O   1 
HETATM 8718 O O   . HOH L 6 .   ? -5.799  -46.064 54.179  1.00 59.69  ? 933 HOH A O   1 
HETATM 8719 O O   . HOH L 6 .   ? -3.126  -52.292 19.100  0.95 63.35  ? 934 HOH A O   1 
HETATM 8720 O O   . HOH L 6 .   ? 13.190  -31.327 54.603  1.00 56.17  ? 935 HOH A O   1 
HETATM 8721 O O   . HOH L 6 .   ? -0.099  -21.819 46.756  1.00 60.03  ? 936 HOH A O   1 
HETATM 8722 O O   . HOH L 6 .   ? -19.099 -42.243 40.862  1.00 52.11  ? 937 HOH A O   1 
HETATM 8723 O O   . HOH L 6 .   ? 8.963   -61.406 37.479  1.00 65.57  ? 938 HOH A O   1 
HETATM 8724 O O   . HOH L 6 .   ? 8.425   -24.582 50.952  1.00 50.31  ? 939 HOH A O   1 
HETATM 8725 O O   . HOH L 6 .   ? 1.215   -38.751 11.498  1.00 68.18  ? 940 HOH A O   1 
HETATM 8726 O O   . HOH L 6 .   ? 2.503   -54.609 12.488  1.00 52.54  ? 941 HOH A O   1 
HETATM 8727 O O   . HOH L 6 .   ? 15.207  -39.732 57.401  1.00 66.26  ? 942 HOH A O   1 
HETATM 8728 O O   . HOH L 6 .   ? -10.236 -45.994 31.621  1.00 58.69  ? 943 HOH A O   1 
HETATM 8729 O O   . HOH L 6 .   ? 23.388  -50.638 37.133  1.00 65.71  ? 944 HOH A O   1 
HETATM 8730 O O   . HOH L 6 .   ? -13.501 -38.059 52.321  1.00 70.41  ? 945 HOH A O   1 
HETATM 8731 O O   . HOH L 6 .   ? -10.408 -19.817 49.257  1.00 70.51  ? 946 HOH A O   1 
HETATM 8732 O O   . HOH L 6 .   ? -7.724  -55.406 37.963  1.00 60.33  ? 947 HOH A O   1 
HETATM 8733 O O   . HOH L 6 .   ? -7.103  -41.570 54.092  1.00 59.78  ? 948 HOH A O   1 
HETATM 8734 O O   . HOH L 6 .   ? 9.125   -27.349 22.162  1.00 60.77  ? 949 HOH A O   1 
HETATM 8735 O O   . HOH L 6 .   ? 5.551   -55.333 12.461  1.00 64.85  ? 950 HOH A O   1 
HETATM 8736 O O   . HOH L 6 .   ? 21.450  -49.334 38.654  1.00 59.71  ? 951 HOH A O   1 
HETATM 8737 O O   . HOH L 6 .   ? -0.902  -57.666 12.251  1.00 68.87  ? 952 HOH A O   1 
HETATM 8738 O O   . HOH L 6 .   ? -0.071  -22.088 35.651  1.00 54.04  ? 953 HOH A O   1 
HETATM 8739 O O   . HOH L 6 .   ? 17.269  -31.270 16.037  1.00 57.61  ? 954 HOH A O   1 
HETATM 8740 O O   . HOH L 6 .   ? 10.756  -53.953 46.384  1.00 50.00  ? 955 HOH A O   1 
HETATM 8741 O O   . HOH L 6 .   ? -1.625  -51.551 52.757  1.00 58.27  ? 956 HOH A O   1 
HETATM 8742 O O   . HOH L 6 .   ? -12.845 -25.654 11.933  1.00 59.51  ? 957 HOH A O   1 
HETATM 8743 O O   . HOH L 6 .   ? 3.023   -20.717 42.244  1.00 67.34  ? 958 HOH A O   1 
HETATM 8744 O O   . HOH L 6 .   ? 15.381  -31.402 51.450  1.00 67.48  ? 959 HOH A O   1 
HETATM 8745 O O   . HOH L 6 .   ? -14.920 -30.894 50.448  1.00 71.65  ? 960 HOH A O   1 
HETATM 8746 O O   . HOH L 6 .   ? -7.809  -22.948 53.025  1.00 54.97  ? 961 HOH A O   1 
HETATM 8747 O O   . HOH L 6 .   ? 15.310  -32.574 53.322  1.00 63.10  ? 962 HOH A O   1 
HETATM 8748 O O   . HOH L 6 .   ? -16.705 -46.197 42.547  1.00 62.10  ? 963 HOH A O   1 
HETATM 8749 O O   . HOH L 6 .   ? -18.474 -41.886 45.123  1.00 58.84  ? 964 HOH A O   1 
HETATM 8750 O O   . HOH L 6 .   ? 2.484   -21.481 47.934  1.00 56.54  ? 965 HOH A O   1 
HETATM 8751 O O   . HOH L 6 .   ? -5.454  -44.186 47.616  0.85 53.34  ? 966 HOH A O   1 
HETATM 8752 O O   . HOH L 6 .   ? -2.252  -21.603 28.001  1.00 69.04  ? 967 HOH A O   1 
HETATM 8753 O O   . HOH L 6 .   ? 1.614   -19.140 48.828  1.00 62.13  ? 968 HOH A O   1 
HETATM 8754 O O   . HOH L 6 .   ? -10.231 -51.247 -0.360  1.00 62.41  ? 969 HOH A O   1 
HETATM 8755 O O   . HOH L 6 .   ? -4.247  -58.340 10.108  1.00 65.06  ? 970 HOH A O   1 
HETATM 8756 O O   . HOH L 6 .   ? -14.283 -34.926 49.588  1.00 63.49  ? 971 HOH A O   1 
HETATM 8757 O O   . HOH L 6 .   ? -2.012  -19.947 16.029  1.00 61.02  ? 972 HOH A O   1 
HETATM 8758 O O   . HOH L 6 .   ? -1.889  -20.255 34.938  1.00 55.64  ? 973 HOH A O   1 
HETATM 8759 O O   . HOH L 6 .   ? 2.815   -22.366 43.529  1.00 55.87  ? 974 HOH A O   1 
HETATM 8760 O O   . HOH L 6 .   ? -0.650  -64.891 37.174  1.00 66.04  ? 975 HOH A O   1 
HETATM 8761 O O   . HOH L 6 .   ? -10.520 -52.935 0.773   1.00 58.98  ? 976 HOH A O   1 
HETATM 8762 O O   . HOH L 6 .   ? -7.745  -44.444 32.306  1.00 44.34  ? 977 HOH A O   1 
HETATM 8763 O O   . HOH L 6 .   ? 17.768  -49.366 44.447  0.79 51.73  ? 978 HOH A O   1 
HETATM 8764 O O   . HOH L 6 .   ? -3.622  -59.366 7.968   1.00 61.46  ? 979 HOH A O   1 
HETATM 8765 O O   . HOH L 6 .   ? -13.197 -49.584 42.636  1.00 64.78  ? 980 HOH A O   1 
HETATM 8766 O O   . HOH L 6 .   ? -13.094 -38.955 19.569  1.00 73.25  ? 981 HOH A O   1 
HETATM 8767 O O   . HOH L 6 .   ? -23.261 -22.282 39.129  1.00 52.30  ? 982 HOH A O   1 
HETATM 8768 O O   . HOH L 6 .   ? -6.546  -16.918 18.417  1.00 70.30  ? 983 HOH A O   1 
HETATM 8769 O O   . HOH L 6 .   ? -9.116  -50.313 42.027  1.00 59.87  ? 984 HOH A O   1 
HETATM 8770 O O   . HOH L 6 .   ? -5.801  -61.854 23.411  1.00 68.54  ? 985 HOH A O   1 
HETATM 8771 O O   . HOH L 6 .   ? -4.137  -18.488 29.323  1.00 62.43  ? 986 HOH A O   1 
HETATM 8772 O O   . HOH L 6 .   ? -31.096 -31.660 24.700  1.00 67.77  ? 987 HOH A O   1 
HETATM 8773 O O   . HOH L 6 .   ? -1.255  -22.031 15.304  1.00 58.90  ? 988 HOH A O   1 
HETATM 8774 O O   . HOH L 6 .   ? 13.505  -55.987 42.207  1.00 61.57  ? 989 HOH A O   1 
HETATM 8775 O O   . HOH L 6 .   ? -8.460  -26.822 52.046  1.00 61.70  ? 990 HOH A O   1 
HETATM 8776 O O   . HOH L 6 .   ? 2.276   -48.308 60.229  0.57 46.69  ? 991 HOH A O   1 
HETATM 8777 O O   . HOH L 6 .   ? -5.867  -16.183 29.416  1.00 64.66  ? 992 HOH A O   1 
HETATM 8778 O O   . HOH L 6 .   ? 2.400   -54.200 20.487  1.00 52.52  ? 993 HOH A O   1 
HETATM 8779 O O   . HOH L 6 .   ? -5.871  -62.662 14.696  1.00 62.53  ? 994 HOH A O   1 
HETATM 8780 O O   . HOH L 6 .   ? 18.008  -41.872 46.087  1.00 62.70  ? 995 HOH A O   1 
HETATM 8781 O O   . HOH L 6 .   ? -2.631  -17.834 31.264  1.00 67.78  ? 996 HOH A O   1 
HETATM 8782 O O   . HOH M 6 .   ? -12.095 -52.187 -29.266 0.81 59.77  ? 701 HOH B O   1 
HETATM 8783 O O   . HOH M 6 .   ? -9.835  -85.276 -17.279 1.00 65.46  ? 702 HOH B O   1 
HETATM 8784 O O   . HOH M 6 .   ? 6.275   -50.881 -34.503 1.00 51.09  ? 703 HOH B O   1 
HETATM 8785 O O   . HOH M 6 .   ? -3.402  -57.058 4.380   1.00 58.16  ? 704 HOH B O   1 
HETATM 8786 O O   . HOH M 6 .   ? -2.373  -85.532 -42.454 1.00 66.85  ? 705 HOH B O   1 
HETATM 8787 O O   . HOH M 6 .   ? 6.439   -89.664 -46.616 1.00 68.52  ? 706 HOH B O   1 
HETATM 8788 O O   . HOH M 6 .   ? -2.968  -39.251 -23.889 0.70 55.28  ? 707 HOH B O   1 
HETATM 8789 O O   . HOH M 6 .   ? -10.915 -33.297 -44.991 1.00 72.86  ? 708 HOH B O   1 
HETATM 8790 O O   . HOH M 6 .   ? 19.699  -85.718 -24.908 1.00 59.26  ? 709 HOH B O   1 
HETATM 8791 O O   . HOH M 6 .   ? 18.392  -60.406 3.532   1.00 72.23  ? 710 HOH B O   1 
HETATM 8792 O O   . HOH M 6 .   ? -10.163 -52.990 -35.927 0.99 63.17  ? 711 HOH B O   1 
HETATM 8793 O O   . HOH M 6 .   ? 2.255   -86.618 -22.326 1.00 47.55  ? 712 HOH B O   1 
HETATM 8794 O O   . HOH M 6 .   ? 2.387   -69.626 -16.793 1.00 46.07  ? 713 HOH B O   1 
HETATM 8795 O O   . HOH M 6 .   ? 16.461  -82.958 -23.465 0.99 51.68  ? 714 HOH B O   1 
HETATM 8796 O O   . HOH M 6 .   ? 19.616  -78.419 -23.500 0.86 66.78  ? 715 HOH B O   1 
HETATM 8797 O O   . HOH M 6 .   ? -12.789 -84.390 -30.727 1.00 67.98  ? 716 HOH B O   1 
HETATM 8798 O O   . HOH M 6 .   ? 21.175  -57.758 1.399   0.95 58.61  ? 717 HOH B O   1 
HETATM 8799 O O   . HOH M 6 .   ? 4.729   -79.617 -6.134  0.86 55.03  ? 718 HOH B O   1 
HETATM 8800 O O   . HOH M 6 .   ? -14.221 -59.696 -37.244 1.00 62.53  ? 719 HOH B O   1 
HETATM 8801 O O   . HOH M 6 .   ? 9.806   -60.905 -27.543 1.00 46.32  ? 720 HOH B O   1 
HETATM 8802 O O   . HOH M 6 .   ? 2.528   -57.416 -0.322  1.00 56.35  ? 721 HOH B O   1 
HETATM 8803 O O   . HOH M 6 .   ? -10.868 -50.514 -42.140 0.83 44.06  ? 722 HOH B O   1 
HETATM 8804 O O   . HOH M 6 .   ? 12.025  -59.448 -31.626 0.94 50.29  ? 723 HOH B O   1 
HETATM 8805 O O   . HOH M 6 .   ? 15.068  -54.802 -42.001 1.00 61.54  ? 724 HOH B O   1 
HETATM 8806 O O   . HOH M 6 .   ? 7.866   -79.988 -51.073 1.00 51.35  ? 725 HOH B O   1 
HETATM 8807 O O   . HOH M 6 .   ? -0.153  -67.824 -1.736  1.00 60.42  ? 726 HOH B O   1 
HETATM 8808 O O   . HOH M 6 .   ? -18.600 -71.495 -44.658 1.00 73.29  ? 727 HOH B O   1 
HETATM 8809 O O   . HOH M 6 .   ? 4.145   -72.720 -33.179 1.00 49.07  ? 728 HOH B O   1 
HETATM 8810 O O   . HOH M 6 .   ? -2.696  -35.713 -42.289 1.00 62.21  ? 729 HOH B O   1 
HETATM 8811 O O   . HOH M 6 .   ? -1.989  -46.065 -31.854 1.00 49.19  ? 730 HOH B O   1 
HETATM 8812 O O   . HOH M 6 .   ? -5.029  -75.738 -55.345 0.92 43.67  ? 731 HOH B O   1 
HETATM 8813 O O   . HOH M 6 .   ? -12.374 -81.009 -11.209 0.90 57.23  ? 732 HOH B O   1 
HETATM 8814 O O   . HOH M 6 .   ? -4.673  -37.349 -37.732 1.00 69.24  ? 733 HOH B O   1 
HETATM 8815 O O   . HOH M 6 .   ? 11.470  -48.447 9.497   0.94 50.07  ? 734 HOH B O   1 
HETATM 8816 O O   . HOH M 6 .   ? 11.448  -59.183 4.599   0.98 61.26  ? 735 HOH B O   1 
HETATM 8817 O O   . HOH M 6 .   ? 2.609   -49.786 -46.938 0.93 45.07  ? 736 HOH B O   1 
HETATM 8818 O O   . HOH M 6 .   ? -0.333  -64.583 -46.280 0.88 35.37  ? 737 HOH B O   1 
HETATM 8819 O O   . HOH M 6 .   ? 10.354  -62.896 -14.734 0.90 42.60  ? 738 HOH B O   1 
HETATM 8820 O O   . HOH M 6 .   ? -12.740 -77.955 -40.062 1.00 50.41  ? 739 HOH B O   1 
HETATM 8821 O O   . HOH M 6 .   ? -4.830  -56.243 -11.736 1.00 55.43  ? 740 HOH B O   1 
HETATM 8822 O O   . HOH M 6 .   ? -11.158 -70.951 -45.225 1.00 65.59  ? 741 HOH B O   1 
HETATM 8823 O O   . HOH M 6 .   ? 13.728  -78.095 -29.737 0.98 61.65  ? 742 HOH B O   1 
HETATM 8824 O O   . HOH M 6 .   ? -2.732  -45.265 -48.455 0.73 53.37  ? 743 HOH B O   1 
HETATM 8825 O O   . HOH M 6 .   ? 5.095   -79.769 -28.878 0.91 45.96  ? 744 HOH B O   1 
HETATM 8826 O O   . HOH M 6 .   ? -9.850  -61.804 -49.969 1.00 66.84  ? 745 HOH B O   1 
HETATM 8827 O O   . HOH M 6 .   ? -17.680 -62.500 -25.243 1.00 62.83  ? 746 HOH B O   1 
HETATM 8828 O O   . HOH M 6 .   ? 4.021   -52.123 -47.090 0.88 47.78  ? 747 HOH B O   1 
HETATM 8829 O O   . HOH M 6 .   ? -6.019  -65.632 -4.875  1.00 47.16  ? 748 HOH B O   1 
HETATM 8830 O O   . HOH M 6 .   ? -4.308  -55.777 -44.623 0.98 54.39  ? 749 HOH B O   1 
HETATM 8831 O O   . HOH M 6 .   ? 17.702  -54.436 -33.047 1.00 65.36  ? 750 HOH B O   1 
HETATM 8832 O O   . HOH M 6 .   ? 10.873  -57.609 2.217   1.00 59.14  ? 751 HOH B O   1 
HETATM 8833 O O   . HOH M 6 .   ? -16.187 -56.869 -26.469 1.00 56.22  ? 752 HOH B O   1 
HETATM 8834 O O   . HOH M 6 .   ? 7.627   -54.017 -46.508 0.92 49.03  ? 753 HOH B O   1 
HETATM 8835 O O   . HOH M 6 .   ? 7.016   -64.977 -28.810 0.87 36.54  ? 754 HOH B O   1 
HETATM 8836 O O   . HOH M 6 .   ? 10.022  -85.686 -12.911 1.00 61.97  ? 755 HOH B O   1 
HETATM 8837 O O   . HOH M 6 .   ? 4.665   -51.248 -29.875 1.00 58.91  ? 756 HOH B O   1 
HETATM 8838 O O   . HOH M 6 .   ? 7.239   -83.285 -48.266 1.00 59.24  ? 757 HOH B O   1 
HETATM 8839 O O   . HOH M 6 .   ? 4.715   -66.478 -25.804 1.00 38.89  ? 758 HOH B O   1 
HETATM 8840 O O   . HOH M 6 .   ? 13.583  -57.935 -43.821 0.76 47.63  ? 759 HOH B O   1 
HETATM 8841 O O   . HOH M 6 .   ? -2.453  -48.990 -29.914 1.00 42.07  ? 760 HOH B O   1 
HETATM 8842 O O   . HOH M 6 .   ? -11.420 -72.348 -34.346 0.81 42.69  ? 761 HOH B O   1 
HETATM 8843 O O   . HOH M 6 .   ? 8.443   -54.108 -32.648 1.00 46.36  ? 762 HOH B O   1 
HETATM 8844 O O   . HOH M 6 .   ? 7.977   -73.586 -33.625 0.70 37.01  ? 763 HOH B O   1 
HETATM 8845 O O   . HOH M 6 .   ? -4.947  -58.775 -45.812 0.96 48.32  ? 764 HOH B O   1 
HETATM 8846 O O   . HOH M 6 .   ? 1.592   -76.158 -57.748 0.97 55.08  ? 765 HOH B O   1 
HETATM 8847 O O   . HOH M 6 .   ? -5.088  -82.833 -51.311 0.95 52.14  ? 766 HOH B O   1 
HETATM 8848 O O   . HOH M 6 .   ? 0.856   -68.049 -32.295 0.93 37.17  ? 767 HOH B O   1 
HETATM 8849 O O   . HOH M 6 .   ? -0.380  -53.871 -41.143 1.00 41.42  ? 768 HOH B O   1 
HETATM 8850 O O   . HOH M 6 .   ? -11.820 -52.621 -32.469 1.00 55.09  ? 769 HOH B O   1 
HETATM 8851 O O   . HOH M 6 .   ? -4.810  -51.272 -31.858 0.99 42.91  ? 770 HOH B O   1 
HETATM 8852 O O   . HOH M 6 .   ? 3.413   -53.213 -28.106 0.84 46.12  ? 771 HOH B O   1 
HETATM 8853 O O   . HOH M 6 .   ? 7.204   -63.740 -46.446 0.80 40.09  ? 772 HOH B O   1 
HETATM 8854 O O   . HOH M 6 .   ? 5.412   -67.285 -18.359 1.00 46.35  ? 773 HOH B O   1 
HETATM 8855 O O   . HOH M 6 .   ? -9.493  -64.158 -7.155  0.99 47.30  ? 774 HOH B O   1 
HETATM 8856 O O   . HOH M 6 .   ? -5.004  -50.415 -37.728 1.00 47.96  ? 775 HOH B O   1 
HETATM 8857 O O   . HOH M 6 .   ? 1.050   -62.618 -45.536 0.88 35.71  ? 776 HOH B O   1 
HETATM 8858 O O   . HOH M 6 .   ? 5.671   -64.066 -9.532  0.90 52.28  ? 777 HOH B O   1 
HETATM 8859 O O   . HOH M 6 .   ? 16.154  -82.728 -12.786 1.00 60.89  ? 778 HOH B O   1 
HETATM 8860 O O   . HOH M 6 .   ? 7.580   -67.159 -38.427 1.00 40.02  ? 779 HOH B O   1 
HETATM 8861 O O   . HOH M 6 .   ? -2.456  -89.203 -23.796 1.00 66.36  ? 780 HOH B O   1 
HETATM 8862 O O   . HOH M 6 .   ? -4.185  -83.701 -4.358  1.00 66.57  ? 781 HOH B O   1 
HETATM 8863 O O   . HOH M 6 .   ? -5.981  -53.926 -20.056 0.72 41.60  ? 782 HOH B O   1 
HETATM 8864 O O   . HOH M 6 .   ? -18.910 -59.355 -21.097 1.00 66.58  ? 783 HOH B O   1 
HETATM 8865 O O   . HOH M 6 .   ? -11.657 -66.707 1.464   1.00 67.79  ? 784 HOH B O   1 
HETATM 8866 O O   . HOH M 6 .   ? 11.553  -58.892 -0.277  1.00 61.60  ? 785 HOH B O   1 
HETATM 8867 O O   . HOH M 6 .   ? -10.950 -45.438 -25.122 1.00 59.76  ? 786 HOH B O   1 
HETATM 8868 O O   . HOH M 6 .   ? 1.712   -89.155 -34.817 1.00 63.23  ? 787 HOH B O   1 
HETATM 8869 O O   . HOH M 6 .   ? 0.180   -91.086 -31.812 1.00 73.34  ? 788 HOH B O   1 
HETATM 8870 O O   . HOH M 6 .   ? -14.016 -72.774 -10.892 0.95 55.69  ? 789 HOH B O   1 
HETATM 8871 O O   . HOH M 6 .   ? 1.831   -54.911 -42.618 0.89 38.32  ? 790 HOH B O   1 
HETATM 8872 O O   . HOH M 6 .   ? 4.704   -71.965 -47.382 0.85 34.06  ? 791 HOH B O   1 
HETATM 8873 O O   . HOH M 6 .   ? 12.316  -73.025 -15.672 0.86 53.45  ? 792 HOH B O   1 
HETATM 8874 O O   . HOH M 6 .   ? 6.791   -71.692 -46.181 0.88 34.29  ? 793 HOH B O   1 
HETATM 8875 O O   . HOH M 6 .   ? 3.969   -80.465 -9.385  1.00 56.46  ? 794 HOH B O   1 
HETATM 8876 O O   . HOH M 6 .   ? 17.793  -70.149 -21.319 1.00 64.60  ? 795 HOH B O   1 
HETATM 8877 O O   . HOH M 6 .   ? 23.053  -65.057 -17.099 1.00 64.57  ? 796 HOH B O   1 
HETATM 8878 O O   . HOH M 6 .   ? -6.866  -74.477 -9.235  0.88 43.45  ? 797 HOH B O   1 
HETATM 8879 O O   . HOH M 6 .   ? 15.129  -67.513 -31.807 0.89 51.40  ? 798 HOH B O   1 
HETATM 8880 O O   . HOH M 6 .   ? 16.786  -62.307 -34.598 1.00 50.92  ? 799 HOH B O   1 
HETATM 8881 O O   . HOH M 6 .   ? 4.635   -70.243 -40.776 0.92 34.78  ? 800 HOH B O   1 
HETATM 8882 O O   . HOH M 6 .   ? 15.040  -51.263 -34.367 0.88 51.17  ? 801 HOH B O   1 
HETATM 8883 O O   . HOH M 6 .   ? -9.438  -53.325 -18.279 1.00 55.10  ? 802 HOH B O   1 
HETATM 8884 O O   . HOH M 6 .   ? 15.676  -50.435 -9.469  0.89 57.51  ? 803 HOH B O   1 
HETATM 8885 O O   . HOH M 6 .   ? -15.714 -79.465 -26.888 1.00 59.41  ? 804 HOH B O   1 
HETATM 8886 O O   . HOH M 6 .   ? -11.731 -77.324 -45.602 1.00 63.28  ? 805 HOH B O   1 
HETATM 8887 O O   . HOH M 6 .   ? -4.559  -37.228 -34.815 1.00 60.90  ? 806 HOH B O   1 
HETATM 8888 O O   . HOH M 6 .   ? 4.475   -56.718 -37.406 1.00 37.32  ? 807 HOH B O   1 
HETATM 8889 O O   . HOH M 6 .   ? 10.062  -71.686 -22.122 0.93 47.95  ? 808 HOH B O   1 
HETATM 8890 O O   . HOH M 6 .   ? 5.515   -62.707 -36.178 0.93 37.20  ? 809 HOH B O   1 
HETATM 8891 O O   . HOH M 6 .   ? 19.528  -45.700 -1.005  1.00 76.83  ? 810 HOH B O   1 
HETATM 8892 O O   . HOH M 6 .   ? -8.535  -73.728 -55.234 0.97 49.82  ? 811 HOH B O   1 
HETATM 8893 O O   . HOH M 6 .   ? -10.570 -73.142 -4.753  1.00 52.78  ? 812 HOH B O   1 
HETATM 8894 O O   . HOH M 6 .   ? 18.599  -52.628 -15.877 1.00 63.72  ? 813 HOH B O   1 
HETATM 8895 O O   . HOH M 6 .   ? -8.710  -67.513 -44.718 0.96 52.47  ? 814 HOH B O   1 
HETATM 8896 O O   . HOH M 6 .   ? -3.006  -70.002 -58.027 1.00 58.13  ? 815 HOH B O   1 
HETATM 8897 O O   . HOH M 6 .   ? -16.128 -64.573 -36.393 0.97 62.70  ? 816 HOH B O   1 
HETATM 8898 O O   . HOH M 6 .   ? 13.085  -70.502 -29.221 1.00 51.87  ? 817 HOH B O   1 
HETATM 8899 O O   . HOH M 6 .   ? 10.287  -63.156 -32.442 0.79 46.07  ? 818 HOH B O   1 
HETATM 8900 O O   . HOH M 6 .   ? 13.489  -75.664 -9.352  1.00 60.89  ? 819 HOH B O   1 
HETATM 8901 O O   . HOH M 6 .   ? -2.517  -54.588 -11.449 0.90 51.62  ? 820 HOH B O   1 
HETATM 8902 O O   . HOH M 6 .   ? 15.187  -59.919 -41.392 1.00 49.44  ? 821 HOH B O   1 
HETATM 8903 O O   . HOH M 6 .   ? 4.815   -57.001 -40.168 0.69 38.33  ? 822 HOH B O   1 
HETATM 8904 O O   . HOH M 6 .   ? 10.317  -68.883 -45.034 0.78 42.72  ? 823 HOH B O   1 
HETATM 8905 O O   . HOH M 6 .   ? -8.559  -84.441 -45.677 1.00 56.25  ? 824 HOH B O   1 
HETATM 8906 O O   . HOH M 6 .   ? 0.234   -65.219 -49.142 1.00 43.84  ? 825 HOH B O   1 
HETATM 8907 O O   . HOH M 6 .   ? 9.163   -43.988 -5.806  1.00 56.09  ? 826 HOH B O   1 
HETATM 8908 O O   . HOH M 6 .   ? -9.538  -78.811 -27.549 0.94 47.30  ? 827 HOH B O   1 
HETATM 8909 O O   . HOH M 6 .   ? 26.494  -64.084 -20.999 1.00 69.75  ? 828 HOH B O   1 
HETATM 8910 O O   . HOH M 6 .   ? 13.964  -70.062 -31.798 1.00 48.51  ? 829 HOH B O   1 
HETATM 8911 O O   . HOH M 6 .   ? -4.961  -45.337 -22.117 1.00 55.61  ? 830 HOH B O   1 
HETATM 8912 O O   . HOH M 6 .   ? 14.222  -55.027 -36.478 1.00 53.27  ? 831 HOH B O   1 
HETATM 8913 O O   . HOH M 6 .   ? 8.022   -78.254 -36.324 1.00 54.09  ? 832 HOH B O   1 
HETATM 8914 O O   . HOH M 6 .   ? 2.827   -57.022 -41.651 0.84 37.44  ? 833 HOH B O   1 
HETATM 8915 O O   . HOH M 6 .   ? 3.148   -60.141 -28.959 0.96 34.85  ? 834 HOH B O   1 
HETATM 8916 O O   . HOH M 6 .   ? -1.677  -65.486 -0.747  1.00 66.92  ? 835 HOH B O   1 
HETATM 8917 O O   . HOH M 6 .   ? 23.555  -53.524 -8.173  1.00 62.55  ? 836 HOH B O   1 
HETATM 8918 O O   . HOH M 6 .   ? 10.747  -44.463 2.058   1.00 67.95  ? 837 HOH B O   1 
HETATM 8919 O O   . HOH M 6 .   ? -5.805  -70.931 -46.754 1.00 52.82  ? 838 HOH B O   1 
HETATM 8920 O O   . HOH M 6 .   ? 4.780   -69.649 -48.902 0.99 42.91  ? 839 HOH B O   1 
HETATM 8921 O O   . HOH M 6 .   ? -6.741  -55.120 -47.291 1.00 66.65  ? 840 HOH B O   1 
HETATM 8922 O O   . HOH M 6 .   ? 15.642  -61.940 -38.950 1.00 58.81  ? 841 HOH B O   1 
HETATM 8923 O O   . HOH M 6 .   ? 16.708  -87.090 -13.853 1.00 63.02  ? 842 HOH B O   1 
HETATM 8924 O O   . HOH M 6 .   ? 8.090   -56.766 -46.256 1.00 48.69  ? 843 HOH B O   1 
HETATM 8925 O O   . HOH M 6 .   ? -18.078 -60.129 -23.603 1.00 55.70  ? 844 HOH B O   1 
HETATM 8926 O O   . HOH M 6 .   ? 1.786   -49.386 -15.257 1.00 63.43  ? 845 HOH B O   1 
HETATM 8927 O O   . HOH M 6 .   ? -12.693 -76.374 -5.678  0.87 54.33  ? 846 HOH B O   1 
HETATM 8928 O O   . HOH M 6 .   ? 12.468  -60.404 -28.713 1.00 48.81  ? 847 HOH B O   1 
HETATM 8929 O O   . HOH M 6 .   ? 11.895  -76.678 -42.584 1.00 57.79  ? 848 HOH B O   1 
HETATM 8930 O O   . HOH M 6 .   ? -16.691 -82.340 -35.459 0.93 70.27  ? 849 HOH B O   1 
HETATM 8931 O O   . HOH M 6 .   ? 9.235   -63.452 -28.673 1.00 40.90  ? 850 HOH B O   1 
HETATM 8932 O O   . HOH M 6 .   ? 8.321   -85.315 -45.801 1.00 55.55  ? 851 HOH B O   1 
HETATM 8933 O O   . HOH M 6 .   ? 15.472  -53.872 -34.221 0.93 48.01  ? 852 HOH B O   1 
HETATM 8934 O O   . HOH M 6 .   ? 11.204  -59.501 -46.586 0.91 66.21  ? 853 HOH B O   1 
HETATM 8935 O O   . HOH M 6 .   ? 13.352  -62.646 -7.747  1.00 56.13  ? 854 HOH B O   1 
HETATM 8936 O O   . HOH M 6 .   ? 12.395  -68.970 -7.015  1.00 62.31  ? 855 HOH B O   1 
HETATM 8937 O O   . HOH M 6 .   ? 20.040  -49.602 0.866   1.00 61.41  ? 856 HOH B O   1 
HETATM 8938 O O   . HOH M 6 .   ? 12.180  -52.344 -44.391 1.00 57.14  ? 857 HOH B O   1 
HETATM 8939 O O   . HOH M 6 .   ? 1.782   -36.425 -36.993 0.85 65.48  ? 858 HOH B O   1 
HETATM 8940 O O   . HOH M 6 .   ? 11.041  -56.701 -46.299 1.00 64.57  ? 859 HOH B O   1 
HETATM 8941 O O   . HOH M 6 .   ? -5.386  -63.023 -5.301  0.95 48.02  ? 860 HOH B O   1 
HETATM 8942 O O   . HOH M 6 .   ? 1.914   -83.352 -2.606  0.94 65.65  ? 861 HOH B O   1 
HETATM 8943 O O   . HOH M 6 .   ? 4.560   -43.782 -11.794 1.00 70.40  ? 862 HOH B O   1 
HETATM 8944 O O   . HOH M 6 .   ? 3.736   -65.566 -9.016  0.57 42.38  ? 863 HOH B O   1 
HETATM 8945 O O   . HOH M 6 .   ? 4.460   -88.821 -23.160 1.00 65.37  ? 864 HOH B O   1 
HETATM 8946 O O   . HOH M 6 .   ? 14.407  -61.157 -26.590 1.00 56.21  ? 865 HOH B O   1 
HETATM 8947 O O   . HOH M 6 .   ? -12.976 -54.872 -2.582  1.00 69.77  ? 866 HOH B O   1 
HETATM 8948 O O   . HOH M 6 .   ? 9.551   -52.190 -46.066 1.00 52.19  ? 867 HOH B O   1 
HETATM 8949 O O   . HOH M 6 .   ? 18.960  -85.167 -22.539 0.98 64.66  ? 868 HOH B O   1 
HETATM 8950 O O   . HOH M 6 .   ? -18.278 -71.397 -28.521 1.00 66.60  ? 869 HOH B O   1 
HETATM 8951 O O   . HOH M 6 .   ? -8.212  -71.998 -47.161 1.00 52.37  ? 870 HOH B O   1 
HETATM 8952 O O   . HOH M 6 .   ? -2.675  -81.915 -51.721 0.87 50.17  ? 871 HOH B O   1 
HETATM 8953 O O   . HOH M 6 .   ? 12.572  -77.504 -31.599 1.00 67.10  ? 872 HOH B O   1 
HETATM 8954 O O   . HOH M 6 .   ? 11.198  -66.475 -44.470 0.79 49.37  ? 873 HOH B O   1 
HETATM 8955 O O   . HOH M 6 .   ? -11.461 -47.446 -34.813 1.00 69.87  ? 874 HOH B O   1 
HETATM 8956 O O   . HOH M 6 .   ? 7.554   -64.721 -23.192 1.00 61.65  ? 875 HOH B O   1 
HETATM 8957 O O   . HOH M 6 .   ? -7.015  -60.731 -6.162  1.00 57.22  ? 876 HOH B O   1 
HETATM 8958 O O   . HOH M 6 .   ? -12.076 -57.204 -7.069  1.00 60.21  ? 877 HOH B O   1 
HETATM 8959 O O   . HOH M 6 .   ? -2.622  -43.206 -9.961  1.00 75.82  ? 878 HOH B O   1 
HETATM 8960 O O   . HOH M 6 .   ? 7.366   -85.161 -12.251 1.00 58.08  ? 879 HOH B O   1 
HETATM 8961 O O   . HOH M 6 .   ? -9.297  -40.584 -30.991 1.00 58.58  ? 880 HOH B O   1 
HETATM 8962 O O   . HOH M 6 .   ? 1.202   -49.724 -22.992 1.00 52.36  ? 881 HOH B O   1 
HETATM 8963 O O   . HOH M 6 .   ? 4.465   -82.623 -3.183  1.00 73.45  ? 882 HOH B O   1 
HETATM 8964 O O   . HOH M 6 .   ? -19.934 -63.690 -21.989 1.00 63.11  ? 883 HOH B O   1 
HETATM 8965 O O   . HOH M 6 .   ? -17.251 -47.517 -32.021 1.00 62.61  ? 884 HOH B O   1 
HETATM 8966 O O   . HOH M 6 .   ? 13.841  -66.636 -43.650 0.97 52.02  ? 885 HOH B O   1 
HETATM 8967 O O   . HOH M 6 .   ? 6.840   -53.570 -35.077 0.90 44.17  ? 886 HOH B O   1 
HETATM 8968 O O   . HOH M 6 .   ? 2.564   -51.161 -17.109 1.00 52.64  ? 887 HOH B O   1 
HETATM 8969 O O   . HOH M 6 .   ? -6.485  -87.052 -27.740 1.00 57.55  ? 888 HOH B O   1 
HETATM 8970 O O   . HOH M 6 .   ? 9.012   -63.178 -2.991  1.00 78.78  ? 889 HOH B O   1 
HETATM 8971 O O   . HOH M 6 .   ? 17.767  -52.556 6.585   1.00 56.05  ? 890 HOH B O   1 
HETATM 8972 O O   . HOH M 6 .   ? 12.626  -88.303 -25.833 0.79 50.38  ? 891 HOH B O   1 
HETATM 8973 O O   . HOH M 6 .   ? -12.359 -79.375 -43.317 1.00 67.12  ? 892 HOH B O   1 
HETATM 8974 O O   . HOH M 6 .   ? -10.942 -68.606 -43.401 1.00 54.19  ? 893 HOH B O   1 
HETATM 8975 O O   . HOH M 6 .   ? 6.105   -58.858 -1.357  1.00 64.82  ? 894 HOH B O   1 
HETATM 8976 O O   . HOH M 6 .   ? -12.435 -64.492 -0.524  1.00 62.90  ? 895 HOH B O   1 
HETATM 8977 O O   . HOH M 6 .   ? 1.343   -85.234 -9.384  1.00 60.52  ? 896 HOH B O   1 
HETATM 8978 O O   . HOH M 6 .   ? 5.101   -88.683 -17.197 1.00 63.51  ? 897 HOH B O   1 
HETATM 8979 O O   . HOH M 6 .   ? -8.566  -66.368 -56.611 1.00 67.81  ? 898 HOH B O   1 
HETATM 8980 O O   . HOH M 6 .   ? -14.034 -55.786 -35.624 1.00 67.44  ? 899 HOH B O   1 
HETATM 8981 O O   . HOH M 6 .   ? -6.503  -72.196 4.816   1.00 61.69  ? 900 HOH B O   1 
HETATM 8982 O O   . HOH M 6 .   ? 0.495   -62.001 -1.007  1.00 49.85  ? 901 HOH B O   1 
HETATM 8983 O O   . HOH M 6 .   ? 1.516   -36.630 -30.953 1.00 63.13  ? 902 HOH B O   1 
HETATM 8984 O O   . HOH M 6 .   ? 5.397   -60.921 0.147   1.00 64.81  ? 903 HOH B O   1 
HETATM 8985 O O   . HOH M 6 .   ? -1.489  -71.483 1.300   1.00 57.09  ? 904 HOH B O   1 
HETATM 8986 O O   . HOH M 6 .   ? 14.751  -87.763 -25.226 0.91 53.58  ? 905 HOH B O   1 
HETATM 8987 O O   . HOH M 6 .   ? -3.087  -55.867 1.886   1.00 69.35  ? 906 HOH B O   1 
HETATM 8988 O O   . HOH M 6 .   ? 2.960   -64.462 -50.983 1.00 67.03  ? 907 HOH B O   1 
HETATM 8989 O O   . HOH M 6 .   ? 10.560  -62.353 -5.002  1.00 60.77  ? 908 HOH B O   1 
HETATM 8990 O O   . HOH M 6 .   ? 1.139   -67.308 -5.024  1.00 70.89  ? 909 HOH B O   1 
HETATM 8991 O O   . HOH M 6 .   ? 18.610  -55.135 7.094   1.00 73.94  ? 910 HOH B O   1 
HETATM 8992 O O   . HOH M 6 .   ? 7.212   -49.178 -48.092 1.00 58.41  ? 911 HOH B O   1 
HETATM 8993 O O   . HOH M 6 .   ? -12.468 -67.130 -44.052 1.00 70.83  ? 912 HOH B O   1 
HETATM 8994 O O   . HOH M 6 .   ? 2.084   -53.995 4.153   1.00 70.18  ? 913 HOH B O   1 
HETATM 8995 O O   . HOH M 6 .   ? -7.991  -69.078 -47.025 1.00 54.24  ? 914 HOH B O   1 
HETATM 8996 O O   . HOH M 6 .   ? 5.859   -45.250 2.252   1.00 59.90  ? 915 HOH B O   1 
HETATM 8997 O O   . HOH M 6 .   ? -0.728  -48.815 -21.938 1.00 60.78  ? 916 HOH B O   1 
HETATM 8998 O O   . HOH M 6 .   ? -12.066 -54.742 -34.614 0.96 64.03  ? 917 HOH B O   1 
HETATM 8999 O O   . HOH M 6 .   ? 12.795  -74.147 -37.835 0.99 62.40  ? 918 HOH B O   1 
HETATM 9000 O O   . HOH M 6 .   ? 8.301   -70.311 -46.983 0.61 41.44  ? 919 HOH B O   1 
HETATM 9001 O O   . HOH M 6 .   ? -11.410 -61.064 -39.005 1.00 58.23  ? 920 HOH B O   1 
HETATM 9002 O O   . HOH M 6 .   ? 7.485   -63.608 -24.845 1.00 48.81  ? 921 HOH B O   1 
HETATM 9003 O O   . HOH M 6 .   ? -12.964 -82.434 -43.925 1.00 63.31  ? 922 HOH B O   1 
HETATM 9004 O O   . HOH M 6 .   ? 2.740   -65.416 -1.608  1.00 72.96  ? 923 HOH B O   1 
HETATM 9005 O O   . HOH M 6 .   ? 1.226   -72.670 -56.239 1.00 58.68  ? 924 HOH B O   1 
HETATM 9006 O O   . HOH M 6 .   ? -11.274 -69.985 4.474   1.00 69.78  ? 925 HOH B O   1 
HETATM 9007 O O   . HOH M 6 .   ? -9.357  -60.978 -7.269  1.00 59.53  ? 926 HOH B O   1 
HETATM 9008 O O   . HOH M 6 .   ? 4.242   -43.584 2.118   1.00 64.91  ? 927 HOH B O   1 
HETATM 9009 O O   . HOH M 6 .   ? 15.262  -71.985 -28.345 1.00 62.77  ? 928 HOH B O   1 
HETATM 9010 O O   . HOH M 6 .   ? 10.446  -75.000 -34.580 1.00 49.16  ? 929 HOH B O   1 
HETATM 9011 O O   . HOH M 6 .   ? -10.947 -58.613 -40.238 1.00 67.68  ? 930 HOH B O   1 
HETATM 9012 O O   . HOH M 6 .   ? 2.311   -88.598 -17.657 1.00 61.49  ? 931 HOH B O   1 
HETATM 9013 O O   . HOH M 6 .   ? -1.990  -61.255 6.636   1.00 67.89  ? 932 HOH B O   1 
HETATM 9014 O O   . HOH M 6 .   ? 14.563  -66.874 -6.212  1.00 55.55  ? 933 HOH B O   1 
HETATM 9015 O O   . HOH M 6 .   ? 11.537  -54.625 -47.964 1.00 66.96  ? 934 HOH B O   1 
HETATM 9016 O O   . HOH M 6 .   ? -12.450 -50.919 -40.533 1.00 60.58  ? 935 HOH B O   1 
HETATM 9017 O O   . HOH M 6 .   ? 3.280   -66.637 -6.878  1.00 57.38  ? 936 HOH B O   1 
HETATM 9018 O O   . HOH M 6 .   ? -18.131 -49.726 -33.770 1.00 78.19  ? 937 HOH B O   1 
HETATM 9019 O O   . HOH M 6 .   ? 16.224  -57.601 -40.441 0.85 53.27  ? 938 HOH B O   1 
HETATM 9020 O O   . HOH M 6 .   ? -2.928  -46.122 -21.266 1.00 60.96  ? 939 HOH B O   1 
HETATM 9021 O O   . HOH M 6 .   ? -18.151 -80.563 -36.783 1.00 64.13  ? 940 HOH B O   1 
HETATM 9022 O O   . HOH M 6 .   ? -4.532  -84.683 -53.582 1.00 71.76  ? 941 HOH B O   1 
HETATM 9023 O O   . HOH M 6 .   ? 8.805   -88.419 -46.006 1.00 71.50  ? 942 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   2   ?   ?   ?   A . n 
A 1 2   ARG 2   3   ?   ?   ?   A . n 
A 1 3   GLU 3   4   ?   ?   ?   A . n 
A 1 4   ASP 4   5   5   ASP ASP A . n 
A 1 5   ALA 5   6   6   ALA ALA A . n 
A 1 6   GLU 6   7   7   GLU GLU A . n 
A 1 7   LEU 7   8   8   LEU LEU A . n 
A 1 8   LEU 8   9   9   LEU LEU A . n 
A 1 9   VAL 9   10  10  VAL VAL A . n 
A 1 10  THR 10  11  11  THR THR A . n 
A 1 11  VAL 11  12  12  VAL VAL A . n 
A 1 12  ARG 12  13  13  ARG ARG A . n 
A 1 13  GLY 13  14  14  GLY GLY A . n 
A 1 14  GLY 14  15  15  GLY GLY A . n 
A 1 15  ARG 15  16  16  ARG ARG A . n 
A 1 16  LEU 16  17  17  LEU LEU A . n 
A 1 17  ARG 17  18  18  ARG ARG A . n 
A 1 18  GLY 18  19  19  GLY GLY A . n 
A 1 19  ILE 19  20  20  ILE ILE A . n 
A 1 20  ARG 20  21  21  ARG ARG A . n 
A 1 21  LEU 21  22  22  LEU LEU A . n 
A 1 22  LYS 22  23  23  LYS LYS A . n 
A 1 23  THR 23  24  24  THR THR A . n 
A 1 24  PRO 24  25  25  PRO PRO A . n 
A 1 25  GLY 25  26  26  GLY GLY A . n 
A 1 26  GLY 26  27  27  GLY GLY A . n 
A 1 27  PRO 27  28  28  PRO PRO A . n 
A 1 28  VAL 28  29  29  VAL VAL A . n 
A 1 29  SER 29  30  30  SER SER A . n 
A 1 30  ALA 30  31  31  ALA ALA A . n 
A 1 31  PHE 31  32  32  PHE PHE A . n 
A 1 32  LEU 32  33  33  LEU LEU A . n 
A 1 33  GLY 33  34  34  GLY GLY A . n 
A 1 34  ILE 34  35  35  ILE ILE A . n 
A 1 35  PRO 35  36  36  PRO PRO A . n 
A 1 36  PHE 36  37  37  PHE PHE A . n 
A 1 37  ALA 37  38  38  ALA ALA A . n 
A 1 38  GLU 38  39  39  GLU GLU A . n 
A 1 39  PRO 39  40  40  PRO PRO A . n 
A 1 40  PRO 40  41  41  PRO PRO A . n 
A 1 41  MET 41  42  42  MET MET A . n 
A 1 42  GLY 42  43  43  GLY GLY A . n 
A 1 43  PRO 43  44  44  PRO PRO A . n 
A 1 44  ARG 44  45  45  ARG ARG A . n 
A 1 45  ARG 45  46  46  ARG ARG A . n 
A 1 46  PHE 46  47  47  PHE PHE A . n 
A 1 47  LEU 47  48  48  LEU LEU A . n 
A 1 48  PRO 48  49  49  PRO PRO A . n 
A 1 49  PRO 49  50  50  PRO PRO A . n 
A 1 50  GLU 50  51  51  GLU GLU A . n 
A 1 51  PRO 51  52  52  PRO PRO A . n 
A 1 52  LYS 52  53  53  LYS LYS A . n 
A 1 53  GLN 53  54  54  GLN GLN A . n 
A 1 54  PRO 54  55  55  PRO PRO A . n 
A 1 55  TRP 55  56  56  TRP TRP A . n 
A 1 56  SER 56  57  57  SER SER A . n 
A 1 57  GLY 57  58  58  GLY GLY A . n 
A 1 58  VAL 58  59  59  VAL VAL A . n 
A 1 59  VAL 59  60  60  VAL VAL A . n 
A 1 60  ASP 60  61  61  ASP ASP A . n 
A 1 61  ALA 61  62  62  ALA ALA A . n 
A 1 62  THR 62  63  63  THR THR A . n 
A 1 63  THR 63  64  64  THR THR A . n 
A 1 64  PHE 64  65  65  PHE PHE A . n 
A 1 65  GLN 65  66  66  GLN GLN A . n 
A 1 66  SER 66  67  67  SER SER A . n 
A 1 67  VAL 67  68  68  VAL VAL A . n 
A 1 68  CYS 68  69  69  CYS CYS A . n 
A 1 69  TYR 69  70  70  TYR TYR A . n 
A 1 70  GLN 70  71  71  GLN GLN A . n 
A 1 71  TYR 71  72  72  TYR TYR A . n 
A 1 72  VAL 72  73  73  VAL VAL A . n 
A 1 73  ASP 73  74  74  ASP ASP A . n 
A 1 74  THR 74  75  75  THR THR A . n 
A 1 75  LEU 75  76  76  LEU LEU A . n 
A 1 76  TYR 76  77  77  TYR TYR A . n 
A 1 77  PRO 77  78  78  PRO PRO A . n 
A 1 78  GLY 78  79  79  GLY GLY A . n 
A 1 79  PHE 79  80  80  PHE PHE A . n 
A 1 80  GLU 80  81  81  GLU GLU A . n 
A 1 81  GLY 81  82  82  GLY GLY A . n 
A 1 82  THR 82  83  83  THR THR A . n 
A 1 83  GLU 83  84  84  GLU GLU A . n 
A 1 84  MET 84  85  85  MET MET A . n 
A 1 85  TRP 85  86  86  TRP TRP A . n 
A 1 86  ASN 86  87  87  ASN ASN A . n 
A 1 87  PRO 87  88  88  PRO PRO A . n 
A 1 88  ASN 88  89  89  ASN ASN A . n 
A 1 89  ARG 89  90  90  ARG ARG A . n 
A 1 90  GLU 90  91  91  GLU GLU A . n 
A 1 91  LEU 91  92  92  LEU LEU A . n 
A 1 92  SER 92  93  93  SER SER A . n 
A 1 93  GLU 93  94  94  GLU GLU A . n 
A 1 94  ASP 94  95  95  ASP ASP A . n 
A 1 95  CYS 95  96  96  CYS CYS A . n 
A 1 96  LEU 96  97  97  LEU LEU A . n 
A 1 97  TYR 97  98  98  TYR TYR A . n 
A 1 98  LEU 98  99  99  LEU LEU A . n 
A 1 99  ASN 99  100 100 ASN ASN A . n 
A 1 100 VAL 100 101 101 VAL VAL A . n 
A 1 101 TRP 101 102 102 TRP TRP A . n 
A 1 102 THR 102 103 103 THR THR A . n 
A 1 103 PRO 103 104 104 PRO PRO A . n 
A 1 104 TYR 104 105 105 TYR TYR A . n 
A 1 105 PRO 105 106 106 PRO PRO A . n 
A 1 106 ARG 106 107 107 ARG ARG A . n 
A 1 107 PRO 107 108 108 PRO PRO A . n 
A 1 108 THR 108 109 109 THR THR A . n 
A 1 109 SER 109 110 110 SER SER A . n 
A 1 110 PRO 110 111 111 PRO PRO A . n 
A 1 111 THR 111 112 112 THR THR A . n 
A 1 112 PRO 112 113 113 PRO PRO A . n 
A 1 113 VAL 113 114 114 VAL VAL A . n 
A 1 114 LEU 114 115 115 LEU LEU A . n 
A 1 115 VAL 115 116 116 VAL VAL A . n 
A 1 116 TRP 116 117 117 TRP TRP A . n 
A 1 117 ILE 117 118 118 ILE ILE A . n 
A 1 118 TYR 118 119 119 TYR TYR A . n 
A 1 119 GLY 119 120 120 GLY GLY A . n 
A 1 120 GLY 120 121 121 GLY GLY A . n 
A 1 121 GLY 121 122 122 GLY GLY A . n 
A 1 122 PHE 122 123 123 PHE PHE A . n 
A 1 123 TYR 123 124 124 TYR TYR A . n 
A 1 124 SER 124 125 125 SER SER A . n 
A 1 125 GLY 125 126 126 GLY GLY A . n 
A 1 126 ALA 126 127 127 ALA ALA A . n 
A 1 127 SER 127 128 128 SER SER A . n 
A 1 128 SER 128 129 129 SER SER A . n 
A 1 129 LEU 129 130 130 LEU LEU A . n 
A 1 130 ASP 130 131 131 ASP ASP A . n 
A 1 131 VAL 131 132 132 VAL VAL A . n 
A 1 132 TYR 132 133 133 TYR TYR A . n 
A 1 133 ASP 133 134 134 ASP ASP A . n 
A 1 134 GLY 134 135 135 GLY GLY A . n 
A 1 135 ARG 135 136 136 ARG ARG A . n 
A 1 136 PHE 136 137 137 PHE PHE A . n 
A 1 137 LEU 137 138 138 LEU LEU A . n 
A 1 138 VAL 138 139 139 VAL VAL A . n 
A 1 139 GLN 139 140 140 GLN GLN A . n 
A 1 140 ALA 140 141 141 ALA ALA A . n 
A 1 141 GLU 141 142 142 GLU GLU A . n 
A 1 142 ARG 142 143 143 ARG ARG A . n 
A 1 143 THR 143 144 144 THR THR A . n 
A 1 144 VAL 144 145 145 VAL VAL A . n 
A 1 145 LEU 145 146 146 LEU LEU A . n 
A 1 146 VAL 146 147 147 VAL VAL A . n 
A 1 147 SER 147 148 148 SER SER A . n 
A 1 148 MET 148 149 149 MET MET A . n 
A 1 149 ASN 149 150 150 ASN ASN A . n 
A 1 150 TYR 150 151 151 TYR TYR A . n 
A 1 151 ARG 151 152 152 ARG ARG A . n 
A 1 152 VAL 152 153 153 VAL VAL A . n 
A 1 153 GLY 153 154 154 GLY GLY A . n 
A 1 154 ALA 154 155 155 ALA ALA A . n 
A 1 155 PHE 155 156 156 PHE PHE A . n 
A 1 156 GLY 156 157 157 GLY GLY A . n 
A 1 157 PHE 157 158 158 PHE PHE A . n 
A 1 158 LEU 158 159 159 LEU LEU A . n 
A 1 159 ALA 159 160 160 ALA ALA A . n 
A 1 160 LEU 160 161 161 LEU LEU A . n 
A 1 161 PRO 161 162 162 PRO PRO A . n 
A 1 162 GLY 162 163 163 GLY GLY A . n 
A 1 163 SER 163 164 164 SER SER A . n 
A 1 164 ARG 164 165 165 ARG ARG A . n 
A 1 165 GLU 165 166 166 GLU GLU A . n 
A 1 166 ALA 166 167 167 ALA ALA A . n 
A 1 167 PRO 167 168 168 PRO PRO A . n 
A 1 168 GLY 168 169 169 GLY GLY A . n 
A 1 169 ASN 169 170 170 ASN ASN A . n 
A 1 170 VAL 170 171 171 VAL VAL A . n 
A 1 171 GLY 171 172 172 GLY GLY A . n 
A 1 172 LEU 172 173 173 LEU LEU A . n 
A 1 173 LEU 173 174 174 LEU LEU A . n 
A 1 174 ASP 174 175 175 ASP ASP A . n 
A 1 175 GLN 175 176 176 GLN GLN A . n 
A 1 176 ARG 176 177 177 ARG ARG A . n 
A 1 177 LEU 177 178 178 LEU LEU A . n 
A 1 178 ALA 178 179 179 ALA ALA A . n 
A 1 179 LEU 179 180 180 LEU LEU A . n 
A 1 180 GLN 180 181 181 GLN GLN A . n 
A 1 181 TRP 181 182 182 TRP TRP A . n 
A 1 182 VAL 182 183 183 VAL VAL A . n 
A 1 183 GLN 183 184 184 GLN GLN A . n 
A 1 184 GLU 184 185 185 GLU GLU A . n 
A 1 185 ASN 185 186 186 ASN ASN A . n 
A 1 186 VAL 186 187 187 VAL VAL A . n 
A 1 187 ALA 187 188 188 ALA ALA A . n 
A 1 188 ALA 188 189 189 ALA ALA A . n 
A 1 189 PHE 189 190 190 PHE PHE A . n 
A 1 190 GLY 190 191 191 GLY GLY A . n 
A 1 191 GLY 191 192 192 GLY GLY A . n 
A 1 192 ASP 192 193 193 ASP ASP A . n 
A 1 193 PRO 193 194 194 PRO PRO A . n 
A 1 194 THR 194 195 195 THR THR A . n 
A 1 195 SER 195 196 196 SER SER A . n 
A 1 196 VAL 196 197 197 VAL VAL A . n 
A 1 197 THR 197 198 198 THR THR A . n 
A 1 198 LEU 198 199 199 LEU LEU A . n 
A 1 199 PHE 199 200 200 PHE PHE A . n 
A 1 200 GLY 200 201 201 GLY GLY A . n 
A 1 201 GLU 201 202 202 GLU GLU A . n 
A 1 202 SER 202 203 203 SER SER A . n 
A 1 203 ALA 203 204 204 ALA ALA A . n 
A 1 204 GLY 204 205 205 GLY GLY A . n 
A 1 205 ALA 205 206 206 ALA ALA A . n 
A 1 206 ALA 206 207 207 ALA ALA A . n 
A 1 207 SER 207 208 208 SER SER A . n 
A 1 208 VAL 208 209 209 VAL VAL A . n 
A 1 209 GLY 209 210 210 GLY GLY A . n 
A 1 210 MET 210 211 211 MET MET A . n 
A 1 211 HIS 211 212 212 HIS HIS A . n 
A 1 212 LEU 212 213 213 LEU LEU A . n 
A 1 213 LEU 213 214 214 LEU LEU A . n 
A 1 214 SER 214 215 215 SER SER A . n 
A 1 215 PRO 215 216 216 PRO PRO A . n 
A 1 216 PRO 216 217 217 PRO PRO A . n 
A 1 217 SER 217 218 218 SER SER A . n 
A 1 218 ARG 218 219 219 ARG ARG A . n 
A 1 219 GLY 219 220 220 GLY GLY A . n 
A 1 220 LEU 220 221 221 LEU LEU A . n 
A 1 221 PHE 221 222 222 PHE PHE A . n 
A 1 222 HIS 222 223 223 HIS HIS A . n 
A 1 223 ARG 223 224 224 ARG ARG A . n 
A 1 224 ALA 224 225 225 ALA ALA A . n 
A 1 225 VAL 225 226 226 VAL VAL A . n 
A 1 226 LEU 226 227 227 LEU LEU A . n 
A 1 227 GLN 227 228 228 GLN GLN A . n 
A 1 228 SER 228 229 229 SER SER A . n 
A 1 229 GLY 229 230 230 GLY GLY A . n 
A 1 230 ALA 230 231 231 ALA ALA A . n 
A 1 231 PRO 231 232 232 PRO PRO A . n 
A 1 232 ASN 232 233 233 ASN ASN A . n 
A 1 233 GLY 233 234 234 GLY GLY A . n 
A 1 234 PRO 234 235 235 PRO PRO A . n 
A 1 235 TRP 235 236 236 TRP TRP A . n 
A 1 236 ALA 236 237 237 ALA ALA A . n 
A 1 237 THR 237 238 238 THR THR A . n 
A 1 238 VAL 238 239 239 VAL VAL A . n 
A 1 239 GLY 239 240 240 GLY GLY A . n 
A 1 240 MET 240 241 241 MET MET A . n 
A 1 241 GLY 241 242 242 GLY GLY A . n 
A 1 242 GLU 242 243 243 GLU GLU A . n 
A 1 243 ALA 243 244 244 ALA ALA A . n 
A 1 244 ARG 244 245 245 ARG ARG A . n 
A 1 245 ARG 245 246 246 ARG ARG A . n 
A 1 246 ARG 246 247 247 ARG ARG A . n 
A 1 247 ALA 247 248 248 ALA ALA A . n 
A 1 248 THR 248 249 249 THR THR A . n 
A 1 249 GLN 249 250 250 GLN GLN A . n 
A 1 250 LEU 250 251 251 LEU LEU A . n 
A 1 251 ALA 251 252 252 ALA ALA A . n 
A 1 252 HIS 252 253 253 HIS HIS A . n 
A 1 253 LEU 253 254 254 LEU LEU A . n 
A 1 254 VAL 254 255 255 VAL VAL A . n 
A 1 255 GLY 255 256 256 GLY GLY A . n 
A 1 256 CYS 256 257 257 CYS CYS A . n 
A 1 257 PRO 257 258 258 PRO PRO A . n 
A 1 258 PRO 258 259 ?   ?   ?   A . n 
A 1 259 GLY 259 260 ?   ?   ?   A . n 
A 1 260 GLY 260 261 ?   ?   ?   A . n 
A 1 261 THR 261 262 ?   ?   ?   A . n 
A 1 262 GLY 262 263 ?   ?   ?   A . n 
A 1 263 GLY 263 264 ?   ?   ?   A . n 
A 1 264 ASN 264 265 265 ASN ASN A . n 
A 1 265 ASP 265 266 266 ASP ASP A . n 
A 1 266 THR 266 267 267 THR THR A . n 
A 1 267 GLU 267 268 268 GLU GLU A . n 
A 1 268 LEU 268 269 269 LEU LEU A . n 
A 1 269 VAL 269 270 270 VAL VAL A . n 
A 1 270 ALA 270 271 271 ALA ALA A . n 
A 1 271 CYS 271 272 272 CYS CYS A . n 
A 1 272 LEU 272 273 273 LEU LEU A . n 
A 1 273 ARG 273 274 274 ARG ARG A . n 
A 1 274 THR 274 275 275 THR THR A . n 
A 1 275 ARG 275 276 276 ARG ARG A . n 
A 1 276 PRO 276 277 277 PRO PRO A . n 
A 1 277 ALA 277 278 278 ALA ALA A . n 
A 1 278 GLN 278 279 279 GLN GLN A . n 
A 1 279 VAL 279 280 280 VAL VAL A . n 
A 1 280 LEU 280 281 281 LEU LEU A . n 
A 1 281 VAL 281 282 282 VAL VAL A . n 
A 1 282 ASN 282 283 283 ASN ASN A . n 
A 1 283 HIS 283 284 284 HIS HIS A . n 
A 1 284 GLU 284 285 285 GLU GLU A . n 
A 1 285 TRP 285 286 286 TRP TRP A . n 
A 1 286 HIS 286 287 287 HIS HIS A . n 
A 1 287 VAL 287 288 288 VAL VAL A . n 
A 1 288 LEU 288 289 289 LEU LEU A . n 
A 1 289 PRO 289 290 290 PRO PRO A . n 
A 1 290 GLN 290 291 291 GLN GLN A . n 
A 1 291 GLU 291 292 292 GLU GLU A . n 
A 1 292 SER 292 293 293 SER SER A . n 
A 1 293 VAL 293 294 294 VAL VAL A . n 
A 1 294 PHE 294 295 295 PHE PHE A . n 
A 1 295 ARG 295 296 296 ARG ARG A . n 
A 1 296 PHE 296 297 297 PHE PHE A . n 
A 1 297 SER 297 298 298 SER SER A . n 
A 1 298 PHE 298 299 299 PHE PHE A . n 
A 1 299 VAL 299 300 300 VAL VAL A . n 
A 1 300 PRO 300 301 301 PRO PRO A . n 
A 1 301 VAL 301 302 302 VAL VAL A . n 
A 1 302 VAL 302 303 303 VAL VAL A . n 
A 1 303 ASP 303 304 304 ASP ASP A . n 
A 1 304 GLY 304 305 305 GLY GLY A . n 
A 1 305 ASP 305 306 306 ASP ASP A . n 
A 1 306 PHE 306 307 307 PHE PHE A . n 
A 1 307 LEU 307 308 308 LEU LEU A . n 
A 1 308 SER 308 309 309 SER SER A . n 
A 1 309 ASP 309 310 310 ASP ASP A . n 
A 1 310 THR 310 311 311 THR THR A . n 
A 1 311 PRO 311 312 312 PRO PRO A . n 
A 1 312 GLU 312 313 313 GLU GLU A . n 
A 1 313 ALA 313 314 314 ALA ALA A . n 
A 1 314 LEU 314 315 315 LEU LEU A . n 
A 1 315 ILE 315 316 316 ILE ILE A . n 
A 1 316 ASN 316 317 317 ASN ASN A . n 
A 1 317 ALA 317 318 318 ALA ALA A . n 
A 1 318 GLY 318 319 319 GLY GLY A . n 
A 1 319 ASP 319 320 320 ASP ASP A . n 
A 1 320 PHE 320 321 321 PHE PHE A . n 
A 1 321 HIS 321 322 322 HIS HIS A . n 
A 1 322 GLY 322 323 323 GLY GLY A . n 
A 1 323 LEU 323 324 324 LEU LEU A . n 
A 1 324 GLN 324 325 325 GLN GLN A . n 
A 1 325 VAL 325 326 326 VAL VAL A . n 
A 1 326 LEU 326 327 327 LEU LEU A . n 
A 1 327 VAL 327 328 328 VAL VAL A . n 
A 1 328 GLY 328 329 329 GLY GLY A . n 
A 1 329 VAL 329 330 330 VAL VAL A . n 
A 1 330 VAL 330 331 331 VAL VAL A . n 
A 1 331 LYS 331 332 332 LYS LYS A . n 
A 1 332 ASP 332 333 333 ASP ASP A . n 
A 1 333 GLU 333 334 334 GLU GLU A . n 
A 1 334 GLY 334 335 335 GLY GLY A . n 
A 1 335 SER 335 336 336 SER SER A . n 
A 1 336 TYR 336 337 337 TYR TYR A . n 
A 1 337 PHE 337 338 338 PHE PHE A . n 
A 1 338 LEU 338 339 339 LEU LEU A . n 
A 1 339 VAL 339 340 340 VAL VAL A . n 
A 1 340 TYR 340 341 341 TYR TYR A . n 
A 1 341 GLY 341 342 342 GLY GLY A . n 
A 1 342 ALA 342 343 343 ALA ALA A . n 
A 1 343 PRO 343 344 344 PRO PRO A . n 
A 1 344 GLY 344 345 345 GLY GLY A . n 
A 1 345 PHE 345 346 346 PHE PHE A . n 
A 1 346 SER 346 347 347 SER SER A . n 
A 1 347 LYS 347 348 348 LYS LYS A . n 
A 1 348 ASP 348 349 349 ASP ASP A . n 
A 1 349 ASN 349 350 350 ASN ASN A . n 
A 1 350 GLU 350 351 351 GLU GLU A . n 
A 1 351 SER 351 352 352 SER SER A . n 
A 1 352 LEU 352 353 353 LEU LEU A . n 
A 1 353 ILE 353 354 354 ILE ILE A . n 
A 1 354 SER 354 355 355 SER SER A . n 
A 1 355 ARG 355 356 356 ARG ARG A . n 
A 1 356 ALA 356 357 357 ALA ALA A . n 
A 1 357 GLU 357 358 358 GLU GLU A . n 
A 1 358 PHE 358 359 359 PHE PHE A . n 
A 1 359 LEU 359 360 360 LEU LEU A . n 
A 1 360 ALA 360 361 361 ALA ALA A . n 
A 1 361 GLY 361 362 362 GLY GLY A . n 
A 1 362 VAL 362 363 363 VAL VAL A . n 
A 1 363 ARG 363 364 364 ARG ARG A . n 
A 1 364 VAL 364 365 365 VAL VAL A . n 
A 1 365 GLY 365 366 366 GLY GLY A . n 
A 1 366 VAL 366 367 367 VAL VAL A . n 
A 1 367 PRO 367 368 368 PRO PRO A . n 
A 1 368 GLN 368 369 369 GLN GLN A . n 
A 1 369 VAL 369 370 370 VAL VAL A . n 
A 1 370 SER 370 371 371 SER SER A . n 
A 1 371 ASP 371 372 372 ASP ASP A . n 
A 1 372 LEU 372 373 373 LEU LEU A . n 
A 1 373 ALA 373 374 374 ALA ALA A . n 
A 1 374 ALA 374 375 375 ALA ALA A . n 
A 1 375 GLU 375 376 376 GLU GLU A . n 
A 1 376 ALA 376 377 377 ALA ALA A . n 
A 1 377 VAL 377 378 378 VAL VAL A . n 
A 1 378 VAL 378 379 379 VAL VAL A . n 
A 1 379 LEU 379 380 380 LEU LEU A . n 
A 1 380 HIS 380 381 381 HIS HIS A . n 
A 1 381 TYR 381 382 382 TYR TYR A . n 
A 1 382 THR 382 383 383 THR THR A . n 
A 1 383 ASP 383 384 384 ASP ASP A . n 
A 1 384 TRP 384 385 385 TRP TRP A . n 
A 1 385 LEU 385 386 386 LEU LEU A . n 
A 1 386 HIS 386 387 387 HIS HIS A . n 
A 1 387 PRO 387 388 388 PRO PRO A . n 
A 1 388 GLU 388 389 389 GLU GLU A . n 
A 1 389 ASP 389 390 390 ASP ASP A . n 
A 1 390 PRO 390 391 391 PRO PRO A . n 
A 1 391 ALA 391 392 392 ALA ALA A . n 
A 1 392 ARG 392 393 393 ARG ARG A . n 
A 1 393 LEU 393 394 394 LEU LEU A . n 
A 1 394 ARG 394 395 395 ARG ARG A . n 
A 1 395 GLU 395 396 396 GLU GLU A . n 
A 1 396 ALA 396 397 397 ALA ALA A . n 
A 1 397 LEU 397 398 398 LEU LEU A . n 
A 1 398 SER 398 399 399 SER SER A . n 
A 1 399 ASP 399 400 400 ASP ASP A . n 
A 1 400 VAL 400 401 401 VAL VAL A . n 
A 1 401 VAL 401 402 402 VAL VAL A . n 
A 1 402 GLY 402 403 403 GLY GLY A . n 
A 1 403 ASP 403 404 404 ASP ASP A . n 
A 1 404 HIS 404 405 405 HIS HIS A . n 
A 1 405 ASN 405 406 406 ASN ASN A . n 
A 1 406 VAL 406 407 407 VAL VAL A . n 
A 1 407 VAL 407 408 408 VAL VAL A . n 
A 1 408 CYS 408 409 409 CYS CYS A . n 
A 1 409 PRO 409 410 410 PRO PRO A . n 
A 1 410 VAL 410 411 411 VAL VAL A . n 
A 1 411 ALA 411 412 412 ALA ALA A . n 
A 1 412 GLN 412 413 413 GLN GLN A . n 
A 1 413 LEU 413 414 414 LEU LEU A . n 
A 1 414 ALA 414 415 415 ALA ALA A . n 
A 1 415 GLY 415 416 416 GLY GLY A . n 
A 1 416 ARG 416 417 417 ARG ARG A . n 
A 1 417 LEU 417 418 418 LEU LEU A . n 
A 1 418 ALA 418 419 419 ALA ALA A . n 
A 1 419 ALA 419 420 420 ALA ALA A . n 
A 1 420 GLN 420 421 421 GLN GLN A . n 
A 1 421 GLY 421 422 422 GLY GLY A . n 
A 1 422 ALA 422 423 423 ALA ALA A . n 
A 1 423 ARG 423 424 424 ARG ARG A . n 
A 1 424 VAL 424 425 425 VAL VAL A . n 
A 1 425 TYR 425 426 426 TYR TYR A . n 
A 1 426 ALA 426 427 427 ALA ALA A . n 
A 1 427 TYR 427 428 428 TYR TYR A . n 
A 1 428 VAL 428 429 429 VAL VAL A . n 
A 1 429 PHE 429 430 430 PHE PHE A . n 
A 1 430 GLU 430 431 431 GLU GLU A . n 
A 1 431 HIS 431 432 432 HIS HIS A . n 
A 1 432 ARG 432 433 433 ARG ARG A . n 
A 1 433 ALA 433 434 434 ALA ALA A . n 
A 1 434 SER 434 435 435 SER SER A . n 
A 1 435 THR 435 436 436 THR THR A . n 
A 1 436 LEU 436 437 437 LEU LEU A . n 
A 1 437 SER 437 438 438 SER SER A . n 
A 1 438 TRP 438 439 439 TRP TRP A . n 
A 1 439 PRO 439 440 440 PRO PRO A . n 
A 1 440 LEU 440 441 441 LEU LEU A . n 
A 1 441 TRP 441 442 442 TRP TRP A . n 
A 1 442 MET 442 443 443 MET MET A . n 
A 1 443 GLY 443 444 444 GLY GLY A . n 
A 1 444 VAL 444 445 445 VAL VAL A . n 
A 1 445 PRO 445 446 446 PRO PRO A . n 
A 1 446 HIS 446 447 447 HIS HIS A . n 
A 1 447 GLY 447 448 448 GLY GLY A . n 
A 1 448 TYR 448 449 449 TYR TYR A . n 
A 1 449 GLU 449 450 450 GLU GLU A . n 
A 1 450 ILE 450 451 451 ILE ILE A . n 
A 1 451 GLU 451 452 452 GLU GLU A . n 
A 1 452 PHE 452 453 453 PHE PHE A . n 
A 1 453 ILE 453 454 454 ILE ILE A . n 
A 1 454 PHE 454 455 455 PHE PHE A . n 
A 1 455 GLY 455 456 456 GLY GLY A . n 
A 1 456 ILE 456 457 457 ILE ILE A . n 
A 1 457 PRO 457 458 458 PRO PRO A . n 
A 1 458 LEU 458 459 459 LEU LEU A . n 
A 1 459 ASP 459 460 460 ASP ASP A . n 
A 1 460 PRO 460 461 461 PRO PRO A . n 
A 1 461 SER 461 462 462 SER SER A . n 
A 1 462 ARG 462 463 463 ARG ARG A . n 
A 1 463 ASN 463 464 464 ASN ASN A . n 
A 1 464 TYR 464 465 465 TYR TYR A . n 
A 1 465 THR 465 466 466 THR THR A . n 
A 1 466 ALA 466 467 467 ALA ALA A . n 
A 1 467 GLU 467 468 468 GLU GLU A . n 
A 1 468 GLU 468 469 469 GLU GLU A . n 
A 1 469 LYS 469 470 470 LYS LYS A . n 
A 1 470 ILE 470 471 471 ILE ILE A . n 
A 1 471 PHE 471 472 472 PHE PHE A . n 
A 1 472 ALA 472 473 473 ALA ALA A . n 
A 1 473 GLN 473 474 474 GLN GLN A . n 
A 1 474 ARG 474 475 475 ARG ARG A . n 
A 1 475 LEU 475 476 476 LEU LEU A . n 
A 1 476 MET 476 477 477 MET MET A . n 
A 1 477 ARG 477 478 478 ARG ARG A . n 
A 1 478 TYR 478 479 479 TYR TYR A . n 
A 1 479 TRP 479 480 480 TRP TRP A . n 
A 1 480 ALA 480 481 481 ALA ALA A . n 
A 1 481 ASN 481 482 482 ASN ASN A . n 
A 1 482 PHE 482 483 483 PHE PHE A . n 
A 1 483 ALA 483 484 484 ALA ALA A . n 
A 1 484 ARG 484 485 485 ARG ARG A . n 
A 1 485 THR 485 486 486 THR THR A . n 
A 1 486 GLY 486 487 487 GLY GLY A . n 
A 1 487 ASP 487 488 488 ASP ASP A . n 
A 1 488 PRO 488 489 489 PRO PRO A . n 
A 1 489 ASN 489 490 490 ASN ASN A . n 
A 1 490 GLU 490 491 491 GLU GLU A . n 
A 1 491 PRO 491 492 492 PRO PRO A . n 
A 1 492 ARG 492 493 493 ARG ARG A . n 
A 1 493 ASP 493 494 ?   ?   ?   A . n 
A 1 494 PRO 494 495 ?   ?   ?   A . n 
A 1 495 LYS 495 496 ?   ?   ?   A . n 
A 1 496 ALA 496 497 497 ALA ALA A . n 
A 1 497 PRO 497 498 498 PRO PRO A . n 
A 1 498 GLN 498 499 499 GLN GLN A . n 
A 1 499 TRP 499 500 500 TRP TRP A . n 
A 1 500 PRO 500 501 501 PRO PRO A . n 
A 1 501 PRO 501 502 502 PRO PRO A . n 
A 1 502 TYR 502 503 503 TYR TYR A . n 
A 1 503 THR 503 504 504 THR THR A . n 
A 1 504 ALA 504 505 505 ALA ALA A . n 
A 1 505 GLY 505 506 506 GLY GLY A . n 
A 1 506 ALA 506 507 507 ALA ALA A . n 
A 1 507 GLN 507 508 508 GLN GLN A . n 
A 1 508 GLN 508 509 509 GLN GLN A . n 
A 1 509 TYR 509 510 510 TYR TYR A . n 
A 1 510 VAL 510 511 511 VAL VAL A . n 
A 1 511 SER 511 512 512 SER SER A . n 
A 1 512 LEU 512 513 513 LEU LEU A . n 
A 1 513 ASP 513 514 514 ASP ASP A . n 
A 1 514 LEU 514 515 515 LEU LEU A . n 
A 1 515 ARG 515 516 516 ARG ARG A . n 
A 1 516 PRO 516 517 517 PRO PRO A . n 
A 1 517 LEU 517 518 518 LEU LEU A . n 
A 1 518 GLU 518 519 519 GLU GLU A . n 
A 1 519 VAL 519 520 520 VAL VAL A . n 
A 1 520 ARG 520 521 521 ARG ARG A . n 
A 1 521 ARG 521 522 522 ARG ARG A . n 
A 1 522 GLY 522 523 523 GLY GLY A . n 
A 1 523 LEU 523 524 524 LEU LEU A . n 
A 1 524 ARG 524 525 525 ARG ARG A . n 
A 1 525 ALA 525 526 526 ALA ALA A . n 
A 1 526 GLN 526 527 527 GLN GLN A . n 
A 1 527 ALA 527 528 528 ALA ALA A . n 
A 1 528 CYS 528 529 529 CYS CYS A . n 
A 1 529 ALA 529 530 530 ALA ALA A . n 
A 1 530 PHE 530 531 531 PHE PHE A . n 
A 1 531 TRP 531 532 532 TRP TRP A . n 
A 1 532 ASN 532 533 533 ASN ASN A . n 
A 1 533 ARG 533 534 534 ARG ARG A . n 
A 1 534 PHE 534 535 535 PHE PHE A . n 
A 1 535 LEU 535 536 536 LEU LEU A . n 
A 1 536 PRO 536 537 537 PRO PRO A . n 
A 1 537 LYS 537 538 538 LYS LYS A . n 
A 1 538 LEU 538 539 539 LEU LEU A . n 
A 1 539 LEU 539 540 540 LEU LEU A . n 
A 1 540 SER 540 541 541 SER SER A . n 
A 1 541 ALA 541 542 ?   ?   ?   A . n 
A 1 542 THR 542 543 ?   ?   ?   A . n 
B 1 1   GLY 1   2   ?   ?   ?   B . n 
B 1 2   ARG 2   3   3   ARG ARG B . n 
B 1 3   GLU 3   4   4   GLU GLU B . n 
B 1 4   ASP 4   5   5   ASP ASP B . n 
B 1 5   ALA 5   6   6   ALA ALA B . n 
B 1 6   GLU 6   7   7   GLU GLU B . n 
B 1 7   LEU 7   8   8   LEU LEU B . n 
B 1 8   LEU 8   9   9   LEU LEU B . n 
B 1 9   VAL 9   10  10  VAL VAL B . n 
B 1 10  THR 10  11  11  THR THR B . n 
B 1 11  VAL 11  12  12  VAL VAL B . n 
B 1 12  ARG 12  13  13  ARG ARG B . n 
B 1 13  GLY 13  14  14  GLY GLY B . n 
B 1 14  GLY 14  15  15  GLY GLY B . n 
B 1 15  ARG 15  16  16  ARG ARG B . n 
B 1 16  LEU 16  17  17  LEU LEU B . n 
B 1 17  ARG 17  18  18  ARG ARG B . n 
B 1 18  GLY 18  19  19  GLY GLY B . n 
B 1 19  ILE 19  20  20  ILE ILE B . n 
B 1 20  ARG 20  21  21  ARG ARG B . n 
B 1 21  LEU 21  22  22  LEU LEU B . n 
B 1 22  LYS 22  23  23  LYS LYS B . n 
B 1 23  THR 23  24  24  THR THR B . n 
B 1 24  PRO 24  25  25  PRO PRO B . n 
B 1 25  GLY 25  26  26  GLY GLY B . n 
B 1 26  GLY 26  27  27  GLY GLY B . n 
B 1 27  PRO 27  28  28  PRO PRO B . n 
B 1 28  VAL 28  29  29  VAL VAL B . n 
B 1 29  SER 29  30  30  SER SER B . n 
B 1 30  ALA 30  31  31  ALA ALA B . n 
B 1 31  PHE 31  32  32  PHE PHE B . n 
B 1 32  LEU 32  33  33  LEU LEU B . n 
B 1 33  GLY 33  34  34  GLY GLY B . n 
B 1 34  ILE 34  35  35  ILE ILE B . n 
B 1 35  PRO 35  36  36  PRO PRO B . n 
B 1 36  PHE 36  37  37  PHE PHE B . n 
B 1 37  ALA 37  38  38  ALA ALA B . n 
B 1 38  GLU 38  39  39  GLU GLU B . n 
B 1 39  PRO 39  40  40  PRO PRO B . n 
B 1 40  PRO 40  41  41  PRO PRO B . n 
B 1 41  MET 41  42  42  MET MET B . n 
B 1 42  GLY 42  43  43  GLY GLY B . n 
B 1 43  PRO 43  44  44  PRO PRO B . n 
B 1 44  ARG 44  45  45  ARG ARG B . n 
B 1 45  ARG 45  46  46  ARG ARG B . n 
B 1 46  PHE 46  47  47  PHE PHE B . n 
B 1 47  LEU 47  48  48  LEU LEU B . n 
B 1 48  PRO 48  49  49  PRO PRO B . n 
B 1 49  PRO 49  50  50  PRO PRO B . n 
B 1 50  GLU 50  51  51  GLU GLU B . n 
B 1 51  PRO 51  52  52  PRO PRO B . n 
B 1 52  LYS 52  53  53  LYS LYS B . n 
B 1 53  GLN 53  54  54  GLN GLN B . n 
B 1 54  PRO 54  55  55  PRO PRO B . n 
B 1 55  TRP 55  56  56  TRP TRP B . n 
B 1 56  SER 56  57  57  SER SER B . n 
B 1 57  GLY 57  58  58  GLY GLY B . n 
B 1 58  VAL 58  59  59  VAL VAL B . n 
B 1 59  VAL 59  60  60  VAL VAL B . n 
B 1 60  ASP 60  61  61  ASP ASP B . n 
B 1 61  ALA 61  62  62  ALA ALA B . n 
B 1 62  THR 62  63  63  THR THR B . n 
B 1 63  THR 63  64  64  THR THR B . n 
B 1 64  PHE 64  65  65  PHE PHE B . n 
B 1 65  GLN 65  66  66  GLN GLN B . n 
B 1 66  SER 66  67  67  SER SER B . n 
B 1 67  VAL 67  68  68  VAL VAL B . n 
B 1 68  CYS 68  69  69  CYS CYS B . n 
B 1 69  TYR 69  70  70  TYR TYR B . n 
B 1 70  GLN 70  71  71  GLN GLN B . n 
B 1 71  TYR 71  72  72  TYR TYR B . n 
B 1 72  VAL 72  73  73  VAL VAL B . n 
B 1 73  ASP 73  74  74  ASP ASP B . n 
B 1 74  THR 74  75  75  THR THR B . n 
B 1 75  LEU 75  76  76  LEU LEU B . n 
B 1 76  TYR 76  77  77  TYR TYR B . n 
B 1 77  PRO 77  78  78  PRO PRO B . n 
B 1 78  GLY 78  79  79  GLY GLY B . n 
B 1 79  PHE 79  80  80  PHE PHE B . n 
B 1 80  GLU 80  81  81  GLU GLU B . n 
B 1 81  GLY 81  82  82  GLY GLY B . n 
B 1 82  THR 82  83  83  THR THR B . n 
B 1 83  GLU 83  84  84  GLU GLU B . n 
B 1 84  MET 84  85  85  MET MET B . n 
B 1 85  TRP 85  86  86  TRP TRP B . n 
B 1 86  ASN 86  87  87  ASN ASN B . n 
B 1 87  PRO 87  88  88  PRO PRO B . n 
B 1 88  ASN 88  89  89  ASN ASN B . n 
B 1 89  ARG 89  90  90  ARG ARG B . n 
B 1 90  GLU 90  91  91  GLU GLU B . n 
B 1 91  LEU 91  92  92  LEU LEU B . n 
B 1 92  SER 92  93  93  SER SER B . n 
B 1 93  GLU 93  94  94  GLU GLU B . n 
B 1 94  ASP 94  95  95  ASP ASP B . n 
B 1 95  CYS 95  96  96  CYS CYS B . n 
B 1 96  LEU 96  97  97  LEU LEU B . n 
B 1 97  TYR 97  98  98  TYR TYR B . n 
B 1 98  LEU 98  99  99  LEU LEU B . n 
B 1 99  ASN 99  100 100 ASN ASN B . n 
B 1 100 VAL 100 101 101 VAL VAL B . n 
B 1 101 TRP 101 102 102 TRP TRP B . n 
B 1 102 THR 102 103 103 THR THR B . n 
B 1 103 PRO 103 104 104 PRO PRO B . n 
B 1 104 TYR 104 105 105 TYR TYR B . n 
B 1 105 PRO 105 106 106 PRO PRO B . n 
B 1 106 ARG 106 107 107 ARG ARG B . n 
B 1 107 PRO 107 108 108 PRO PRO B . n 
B 1 108 THR 108 109 109 THR THR B . n 
B 1 109 SER 109 110 110 SER SER B . n 
B 1 110 PRO 110 111 111 PRO PRO B . n 
B 1 111 THR 111 112 112 THR THR B . n 
B 1 112 PRO 112 113 113 PRO PRO B . n 
B 1 113 VAL 113 114 114 VAL VAL B . n 
B 1 114 LEU 114 115 115 LEU LEU B . n 
B 1 115 VAL 115 116 116 VAL VAL B . n 
B 1 116 TRP 116 117 117 TRP TRP B . n 
B 1 117 ILE 117 118 118 ILE ILE B . n 
B 1 118 TYR 118 119 119 TYR TYR B . n 
B 1 119 GLY 119 120 120 GLY GLY B . n 
B 1 120 GLY 120 121 121 GLY GLY B . n 
B 1 121 GLY 121 122 122 GLY GLY B . n 
B 1 122 PHE 122 123 123 PHE PHE B . n 
B 1 123 TYR 123 124 124 TYR TYR B . n 
B 1 124 SER 124 125 125 SER SER B . n 
B 1 125 GLY 125 126 126 GLY GLY B . n 
B 1 126 ALA 126 127 127 ALA ALA B . n 
B 1 127 SER 127 128 128 SER SER B . n 
B 1 128 SER 128 129 129 SER SER B . n 
B 1 129 LEU 129 130 130 LEU LEU B . n 
B 1 130 ASP 130 131 131 ASP ASP B . n 
B 1 131 VAL 131 132 132 VAL VAL B . n 
B 1 132 TYR 132 133 133 TYR TYR B . n 
B 1 133 ASP 133 134 134 ASP ASP B . n 
B 1 134 GLY 134 135 135 GLY GLY B . n 
B 1 135 ARG 135 136 136 ARG ARG B . n 
B 1 136 PHE 136 137 137 PHE PHE B . n 
B 1 137 LEU 137 138 138 LEU LEU B . n 
B 1 138 VAL 138 139 139 VAL VAL B . n 
B 1 139 GLN 139 140 140 GLN GLN B . n 
B 1 140 ALA 140 141 141 ALA ALA B . n 
B 1 141 GLU 141 142 142 GLU GLU B . n 
B 1 142 ARG 142 143 143 ARG ARG B . n 
B 1 143 THR 143 144 144 THR THR B . n 
B 1 144 VAL 144 145 145 VAL VAL B . n 
B 1 145 LEU 145 146 146 LEU LEU B . n 
B 1 146 VAL 146 147 147 VAL VAL B . n 
B 1 147 SER 147 148 148 SER SER B . n 
B 1 148 MET 148 149 149 MET MET B . n 
B 1 149 ASN 149 150 150 ASN ASN B . n 
B 1 150 TYR 150 151 151 TYR TYR B . n 
B 1 151 ARG 151 152 152 ARG ARG B . n 
B 1 152 VAL 152 153 153 VAL VAL B . n 
B 1 153 GLY 153 154 154 GLY GLY B . n 
B 1 154 ALA 154 155 155 ALA ALA B . n 
B 1 155 PHE 155 156 156 PHE PHE B . n 
B 1 156 GLY 156 157 157 GLY GLY B . n 
B 1 157 PHE 157 158 158 PHE PHE B . n 
B 1 158 LEU 158 159 159 LEU LEU B . n 
B 1 159 ALA 159 160 160 ALA ALA B . n 
B 1 160 LEU 160 161 161 LEU LEU B . n 
B 1 161 PRO 161 162 162 PRO PRO B . n 
B 1 162 GLY 162 163 163 GLY GLY B . n 
B 1 163 SER 163 164 164 SER SER B . n 
B 1 164 ARG 164 165 165 ARG ARG B . n 
B 1 165 GLU 165 166 166 GLU GLU B . n 
B 1 166 ALA 166 167 167 ALA ALA B . n 
B 1 167 PRO 167 168 168 PRO PRO B . n 
B 1 168 GLY 168 169 169 GLY GLY B . n 
B 1 169 ASN 169 170 170 ASN ASN B . n 
B 1 170 VAL 170 171 171 VAL VAL B . n 
B 1 171 GLY 171 172 172 GLY GLY B . n 
B 1 172 LEU 172 173 173 LEU LEU B . n 
B 1 173 LEU 173 174 174 LEU LEU B . n 
B 1 174 ASP 174 175 175 ASP ASP B . n 
B 1 175 GLN 175 176 176 GLN GLN B . n 
B 1 176 ARG 176 177 177 ARG ARG B . n 
B 1 177 LEU 177 178 178 LEU LEU B . n 
B 1 178 ALA 178 179 179 ALA ALA B . n 
B 1 179 LEU 179 180 180 LEU LEU B . n 
B 1 180 GLN 180 181 181 GLN GLN B . n 
B 1 181 TRP 181 182 182 TRP TRP B . n 
B 1 182 VAL 182 183 183 VAL VAL B . n 
B 1 183 GLN 183 184 184 GLN GLN B . n 
B 1 184 GLU 184 185 185 GLU GLU B . n 
B 1 185 ASN 185 186 186 ASN ASN B . n 
B 1 186 VAL 186 187 187 VAL VAL B . n 
B 1 187 ALA 187 188 188 ALA ALA B . n 
B 1 188 ALA 188 189 189 ALA ALA B . n 
B 1 189 PHE 189 190 190 PHE PHE B . n 
B 1 190 GLY 190 191 191 GLY GLY B . n 
B 1 191 GLY 191 192 192 GLY GLY B . n 
B 1 192 ASP 192 193 193 ASP ASP B . n 
B 1 193 PRO 193 194 194 PRO PRO B . n 
B 1 194 THR 194 195 195 THR THR B . n 
B 1 195 SER 195 196 196 SER SER B . n 
B 1 196 VAL 196 197 197 VAL VAL B . n 
B 1 197 THR 197 198 198 THR THR B . n 
B 1 198 LEU 198 199 199 LEU LEU B . n 
B 1 199 PHE 199 200 200 PHE PHE B . n 
B 1 200 GLY 200 201 201 GLY GLY B . n 
B 1 201 GLU 201 202 202 GLU GLU B . n 
B 1 202 SER 202 203 203 SER SER B . n 
B 1 203 ALA 203 204 204 ALA ALA B . n 
B 1 204 GLY 204 205 205 GLY GLY B . n 
B 1 205 ALA 205 206 206 ALA ALA B . n 
B 1 206 ALA 206 207 207 ALA ALA B . n 
B 1 207 SER 207 208 208 SER SER B . n 
B 1 208 VAL 208 209 209 VAL VAL B . n 
B 1 209 GLY 209 210 210 GLY GLY B . n 
B 1 210 MET 210 211 211 MET MET B . n 
B 1 211 HIS 211 212 212 HIS HIS B . n 
B 1 212 LEU 212 213 213 LEU LEU B . n 
B 1 213 LEU 213 214 214 LEU LEU B . n 
B 1 214 SER 214 215 215 SER SER B . n 
B 1 215 PRO 215 216 216 PRO PRO B . n 
B 1 216 PRO 216 217 217 PRO PRO B . n 
B 1 217 SER 217 218 218 SER SER B . n 
B 1 218 ARG 218 219 219 ARG ARG B . n 
B 1 219 GLY 219 220 220 GLY GLY B . n 
B 1 220 LEU 220 221 221 LEU LEU B . n 
B 1 221 PHE 221 222 222 PHE PHE B . n 
B 1 222 HIS 222 223 223 HIS HIS B . n 
B 1 223 ARG 223 224 224 ARG ARG B . n 
B 1 224 ALA 224 225 225 ALA ALA B . n 
B 1 225 VAL 225 226 226 VAL VAL B . n 
B 1 226 LEU 226 227 227 LEU LEU B . n 
B 1 227 GLN 227 228 228 GLN GLN B . n 
B 1 228 SER 228 229 229 SER SER B . n 
B 1 229 GLY 229 230 230 GLY GLY B . n 
B 1 230 ALA 230 231 231 ALA ALA B . n 
B 1 231 PRO 231 232 232 PRO PRO B . n 
B 1 232 ASN 232 233 233 ASN ASN B . n 
B 1 233 GLY 233 234 234 GLY GLY B . n 
B 1 234 PRO 234 235 235 PRO PRO B . n 
B 1 235 TRP 235 236 236 TRP TRP B . n 
B 1 236 ALA 236 237 237 ALA ALA B . n 
B 1 237 THR 237 238 238 THR THR B . n 
B 1 238 VAL 238 239 239 VAL VAL B . n 
B 1 239 GLY 239 240 240 GLY GLY B . n 
B 1 240 MET 240 241 241 MET MET B . n 
B 1 241 GLY 241 242 242 GLY GLY B . n 
B 1 242 GLU 242 243 243 GLU GLU B . n 
B 1 243 ALA 243 244 244 ALA ALA B . n 
B 1 244 ARG 244 245 245 ARG ARG B . n 
B 1 245 ARG 245 246 246 ARG ARG B . n 
B 1 246 ARG 246 247 247 ARG ARG B . n 
B 1 247 ALA 247 248 248 ALA ALA B . n 
B 1 248 THR 248 249 249 THR THR B . n 
B 1 249 GLN 249 250 250 GLN GLN B . n 
B 1 250 LEU 250 251 251 LEU LEU B . n 
B 1 251 ALA 251 252 252 ALA ALA B . n 
B 1 252 HIS 252 253 253 HIS HIS B . n 
B 1 253 LEU 253 254 254 LEU LEU B . n 
B 1 254 VAL 254 255 255 VAL VAL B . n 
B 1 255 GLY 255 256 256 GLY GLY B . n 
B 1 256 CYS 256 257 257 CYS CYS B . n 
B 1 257 PRO 257 258 258 PRO PRO B . n 
B 1 258 PRO 258 259 259 PRO PRO B . n 
B 1 259 GLY 259 260 ?   ?   ?   B . n 
B 1 260 GLY 260 261 ?   ?   ?   B . n 
B 1 261 THR 261 262 262 THR THR B . n 
B 1 262 GLY 262 263 263 GLY GLY B . n 
B 1 263 GLY 263 264 264 GLY GLY B . n 
B 1 264 ASN 264 265 265 ASN ASN B . n 
B 1 265 ASP 265 266 266 ASP ASP B . n 
B 1 266 THR 266 267 267 THR THR B . n 
B 1 267 GLU 267 268 268 GLU GLU B . n 
B 1 268 LEU 268 269 269 LEU LEU B . n 
B 1 269 VAL 269 270 270 VAL VAL B . n 
B 1 270 ALA 270 271 271 ALA ALA B . n 
B 1 271 CYS 271 272 272 CYS CYS B . n 
B 1 272 LEU 272 273 273 LEU LEU B . n 
B 1 273 ARG 273 274 274 ARG ARG B . n 
B 1 274 THR 274 275 275 THR THR B . n 
B 1 275 ARG 275 276 276 ARG ARG B . n 
B 1 276 PRO 276 277 277 PRO PRO B . n 
B 1 277 ALA 277 278 278 ALA ALA B . n 
B 1 278 GLN 278 279 279 GLN GLN B . n 
B 1 279 VAL 279 280 280 VAL VAL B . n 
B 1 280 LEU 280 281 281 LEU LEU B . n 
B 1 281 VAL 281 282 282 VAL VAL B . n 
B 1 282 ASN 282 283 283 ASN ASN B . n 
B 1 283 HIS 283 284 284 HIS HIS B . n 
B 1 284 GLU 284 285 285 GLU GLU B . n 
B 1 285 TRP 285 286 286 TRP TRP B . n 
B 1 286 HIS 286 287 287 HIS HIS B . n 
B 1 287 VAL 287 288 288 VAL VAL B . n 
B 1 288 LEU 288 289 289 LEU LEU B . n 
B 1 289 PRO 289 290 290 PRO PRO B . n 
B 1 290 GLN 290 291 291 GLN GLN B . n 
B 1 291 GLU 291 292 292 GLU GLU B . n 
B 1 292 SER 292 293 293 SER SER B . n 
B 1 293 VAL 293 294 294 VAL VAL B . n 
B 1 294 PHE 294 295 295 PHE PHE B . n 
B 1 295 ARG 295 296 296 ARG ARG B . n 
B 1 296 PHE 296 297 297 PHE PHE B . n 
B 1 297 SER 297 298 298 SER SER B . n 
B 1 298 PHE 298 299 299 PHE PHE B . n 
B 1 299 VAL 299 300 300 VAL VAL B . n 
B 1 300 PRO 300 301 301 PRO PRO B . n 
B 1 301 VAL 301 302 302 VAL VAL B . n 
B 1 302 VAL 302 303 303 VAL VAL B . n 
B 1 303 ASP 303 304 304 ASP ASP B . n 
B 1 304 GLY 304 305 305 GLY GLY B . n 
B 1 305 ASP 305 306 306 ASP ASP B . n 
B 1 306 PHE 306 307 307 PHE PHE B . n 
B 1 307 LEU 307 308 308 LEU LEU B . n 
B 1 308 SER 308 309 309 SER SER B . n 
B 1 309 ASP 309 310 310 ASP ASP B . n 
B 1 310 THR 310 311 311 THR THR B . n 
B 1 311 PRO 311 312 312 PRO PRO B . n 
B 1 312 GLU 312 313 313 GLU GLU B . n 
B 1 313 ALA 313 314 314 ALA ALA B . n 
B 1 314 LEU 314 315 315 LEU LEU B . n 
B 1 315 ILE 315 316 316 ILE ILE B . n 
B 1 316 ASN 316 317 317 ASN ASN B . n 
B 1 317 ALA 317 318 318 ALA ALA B . n 
B 1 318 GLY 318 319 319 GLY GLY B . n 
B 1 319 ASP 319 320 320 ASP ASP B . n 
B 1 320 PHE 320 321 321 PHE PHE B . n 
B 1 321 HIS 321 322 322 HIS HIS B . n 
B 1 322 GLY 322 323 323 GLY GLY B . n 
B 1 323 LEU 323 324 324 LEU LEU B . n 
B 1 324 GLN 324 325 325 GLN GLN B . n 
B 1 325 VAL 325 326 326 VAL VAL B . n 
B 1 326 LEU 326 327 327 LEU LEU B . n 
B 1 327 VAL 327 328 328 VAL VAL B . n 
B 1 328 GLY 328 329 329 GLY GLY B . n 
B 1 329 VAL 329 330 330 VAL VAL B . n 
B 1 330 VAL 330 331 331 VAL VAL B . n 
B 1 331 LYS 331 332 332 LYS LYS B . n 
B 1 332 ASP 332 333 333 ASP ASP B . n 
B 1 333 GLU 333 334 334 GLU GLU B . n 
B 1 334 GLY 334 335 335 GLY GLY B . n 
B 1 335 SER 335 336 336 SER SER B . n 
B 1 336 TYR 336 337 337 TYR TYR B . n 
B 1 337 PHE 337 338 338 PHE PHE B . n 
B 1 338 LEU 338 339 339 LEU LEU B . n 
B 1 339 VAL 339 340 340 VAL VAL B . n 
B 1 340 TYR 340 341 341 TYR TYR B . n 
B 1 341 GLY 341 342 342 GLY GLY B . n 
B 1 342 ALA 342 343 343 ALA ALA B . n 
B 1 343 PRO 343 344 344 PRO PRO B . n 
B 1 344 GLY 344 345 345 GLY GLY B . n 
B 1 345 PHE 345 346 346 PHE PHE B . n 
B 1 346 SER 346 347 347 SER SER B . n 
B 1 347 LYS 347 348 348 LYS LYS B . n 
B 1 348 ASP 348 349 349 ASP ASP B . n 
B 1 349 ASN 349 350 350 ASN ASN B . n 
B 1 350 GLU 350 351 351 GLU GLU B . n 
B 1 351 SER 351 352 352 SER SER B . n 
B 1 352 LEU 352 353 353 LEU LEU B . n 
B 1 353 ILE 353 354 354 ILE ILE B . n 
B 1 354 SER 354 355 355 SER SER B . n 
B 1 355 ARG 355 356 356 ARG ARG B . n 
B 1 356 ALA 356 357 357 ALA ALA B . n 
B 1 357 GLU 357 358 358 GLU GLU B . n 
B 1 358 PHE 358 359 359 PHE PHE B . n 
B 1 359 LEU 359 360 360 LEU LEU B . n 
B 1 360 ALA 360 361 361 ALA ALA B . n 
B 1 361 GLY 361 362 362 GLY GLY B . n 
B 1 362 VAL 362 363 363 VAL VAL B . n 
B 1 363 ARG 363 364 364 ARG ARG B . n 
B 1 364 VAL 364 365 365 VAL VAL B . n 
B 1 365 GLY 365 366 366 GLY GLY B . n 
B 1 366 VAL 366 367 367 VAL VAL B . n 
B 1 367 PRO 367 368 368 PRO PRO B . n 
B 1 368 GLN 368 369 369 GLN GLN B . n 
B 1 369 VAL 369 370 370 VAL VAL B . n 
B 1 370 SER 370 371 371 SER SER B . n 
B 1 371 ASP 371 372 372 ASP ASP B . n 
B 1 372 LEU 372 373 373 LEU LEU B . n 
B 1 373 ALA 373 374 374 ALA ALA B . n 
B 1 374 ALA 374 375 375 ALA ALA B . n 
B 1 375 GLU 375 376 376 GLU GLU B . n 
B 1 376 ALA 376 377 377 ALA ALA B . n 
B 1 377 VAL 377 378 378 VAL VAL B . n 
B 1 378 VAL 378 379 379 VAL VAL B . n 
B 1 379 LEU 379 380 380 LEU LEU B . n 
B 1 380 HIS 380 381 381 HIS HIS B . n 
B 1 381 TYR 381 382 382 TYR TYR B . n 
B 1 382 THR 382 383 383 THR THR B . n 
B 1 383 ASP 383 384 384 ASP ASP B . n 
B 1 384 TRP 384 385 385 TRP TRP B . n 
B 1 385 LEU 385 386 386 LEU LEU B . n 
B 1 386 HIS 386 387 387 HIS HIS B . n 
B 1 387 PRO 387 388 388 PRO PRO B . n 
B 1 388 GLU 388 389 389 GLU GLU B . n 
B 1 389 ASP 389 390 390 ASP ASP B . n 
B 1 390 PRO 390 391 391 PRO PRO B . n 
B 1 391 ALA 391 392 392 ALA ALA B . n 
B 1 392 ARG 392 393 393 ARG ARG B . n 
B 1 393 LEU 393 394 394 LEU LEU B . n 
B 1 394 ARG 394 395 395 ARG ARG B . n 
B 1 395 GLU 395 396 396 GLU GLU B . n 
B 1 396 ALA 396 397 397 ALA ALA B . n 
B 1 397 LEU 397 398 398 LEU LEU B . n 
B 1 398 SER 398 399 399 SER SER B . n 
B 1 399 ASP 399 400 400 ASP ASP B . n 
B 1 400 VAL 400 401 401 VAL VAL B . n 
B 1 401 VAL 401 402 402 VAL VAL B . n 
B 1 402 GLY 402 403 403 GLY GLY B . n 
B 1 403 ASP 403 404 404 ASP ASP B . n 
B 1 404 HIS 404 405 405 HIS HIS B . n 
B 1 405 ASN 405 406 406 ASN ASN B . n 
B 1 406 VAL 406 407 407 VAL VAL B . n 
B 1 407 VAL 407 408 408 VAL VAL B . n 
B 1 408 CYS 408 409 409 CYS CYS B . n 
B 1 409 PRO 409 410 410 PRO PRO B . n 
B 1 410 VAL 410 411 411 VAL VAL B . n 
B 1 411 ALA 411 412 412 ALA ALA B . n 
B 1 412 GLN 412 413 413 GLN GLN B . n 
B 1 413 LEU 413 414 414 LEU LEU B . n 
B 1 414 ALA 414 415 415 ALA ALA B . n 
B 1 415 GLY 415 416 416 GLY GLY B . n 
B 1 416 ARG 416 417 417 ARG ARG B . n 
B 1 417 LEU 417 418 418 LEU LEU B . n 
B 1 418 ALA 418 419 419 ALA ALA B . n 
B 1 419 ALA 419 420 420 ALA ALA B . n 
B 1 420 GLN 420 421 421 GLN GLN B . n 
B 1 421 GLY 421 422 422 GLY GLY B . n 
B 1 422 ALA 422 423 423 ALA ALA B . n 
B 1 423 ARG 423 424 424 ARG ARG B . n 
B 1 424 VAL 424 425 425 VAL VAL B . n 
B 1 425 TYR 425 426 426 TYR TYR B . n 
B 1 426 ALA 426 427 427 ALA ALA B . n 
B 1 427 TYR 427 428 428 TYR TYR B . n 
B 1 428 VAL 428 429 429 VAL VAL B . n 
B 1 429 PHE 429 430 430 PHE PHE B . n 
B 1 430 GLU 430 431 431 GLU GLU B . n 
B 1 431 HIS 431 432 432 HIS HIS B . n 
B 1 432 ARG 432 433 433 ARG ARG B . n 
B 1 433 ALA 433 434 434 ALA ALA B . n 
B 1 434 SER 434 435 435 SER SER B . n 
B 1 435 THR 435 436 436 THR THR B . n 
B 1 436 LEU 436 437 437 LEU LEU B . n 
B 1 437 SER 437 438 438 SER SER B . n 
B 1 438 TRP 438 439 439 TRP TRP B . n 
B 1 439 PRO 439 440 440 PRO PRO B . n 
B 1 440 LEU 440 441 441 LEU LEU B . n 
B 1 441 TRP 441 442 442 TRP TRP B . n 
B 1 442 MET 442 443 443 MET MET B . n 
B 1 443 GLY 443 444 444 GLY GLY B . n 
B 1 444 VAL 444 445 445 VAL VAL B . n 
B 1 445 PRO 445 446 446 PRO PRO B . n 
B 1 446 HIS 446 447 447 HIS HIS B . n 
B 1 447 GLY 447 448 448 GLY GLY B . n 
B 1 448 TYR 448 449 449 TYR TYR B . n 
B 1 449 GLU 449 450 450 GLU GLU B . n 
B 1 450 ILE 450 451 451 ILE ILE B . n 
B 1 451 GLU 451 452 452 GLU GLU B . n 
B 1 452 PHE 452 453 453 PHE PHE B . n 
B 1 453 ILE 453 454 454 ILE ILE B . n 
B 1 454 PHE 454 455 455 PHE PHE B . n 
B 1 455 GLY 455 456 456 GLY GLY B . n 
B 1 456 ILE 456 457 457 ILE ILE B . n 
B 1 457 PRO 457 458 458 PRO PRO B . n 
B 1 458 LEU 458 459 459 LEU LEU B . n 
B 1 459 ASP 459 460 460 ASP ASP B . n 
B 1 460 PRO 460 461 461 PRO PRO B . n 
B 1 461 SER 461 462 462 SER SER B . n 
B 1 462 ARG 462 463 463 ARG ARG B . n 
B 1 463 ASN 463 464 464 ASN ASN B . n 
B 1 464 TYR 464 465 465 TYR TYR B . n 
B 1 465 THR 465 466 466 THR THR B . n 
B 1 466 ALA 466 467 467 ALA ALA B . n 
B 1 467 GLU 467 468 468 GLU GLU B . n 
B 1 468 GLU 468 469 469 GLU GLU B . n 
B 1 469 LYS 469 470 470 LYS LYS B . n 
B 1 470 ILE 470 471 471 ILE ILE B . n 
B 1 471 PHE 471 472 472 PHE PHE B . n 
B 1 472 ALA 472 473 473 ALA ALA B . n 
B 1 473 GLN 473 474 474 GLN GLN B . n 
B 1 474 ARG 474 475 475 ARG ARG B . n 
B 1 475 LEU 475 476 476 LEU LEU B . n 
B 1 476 MET 476 477 477 MET MET B . n 
B 1 477 ARG 477 478 478 ARG ARG B . n 
B 1 478 TYR 478 479 479 TYR TYR B . n 
B 1 479 TRP 479 480 480 TRP TRP B . n 
B 1 480 ALA 480 481 481 ALA ALA B . n 
B 1 481 ASN 481 482 482 ASN ASN B . n 
B 1 482 PHE 482 483 483 PHE PHE B . n 
B 1 483 ALA 483 484 484 ALA ALA B . n 
B 1 484 ARG 484 485 485 ARG ARG B . n 
B 1 485 THR 485 486 486 THR THR B . n 
B 1 486 GLY 486 487 487 GLY GLY B . n 
B 1 487 ASP 487 488 488 ASP ASP B . n 
B 1 488 PRO 488 489 489 PRO PRO B . n 
B 1 489 ASN 489 490 490 ASN ASN B . n 
B 1 490 GLU 490 491 491 GLU GLU B . n 
B 1 491 PRO 491 492 492 PRO PRO B . n 
B 1 492 ARG 492 493 493 ARG ARG B . n 
B 1 493 ASP 493 494 494 ASP ASP B . n 
B 1 494 PRO 494 495 495 PRO PRO B . n 
B 1 495 LYS 495 496 496 LYS LYS B . n 
B 1 496 ALA 496 497 497 ALA ALA B . n 
B 1 497 PRO 497 498 498 PRO PRO B . n 
B 1 498 GLN 498 499 499 GLN GLN B . n 
B 1 499 TRP 499 500 500 TRP TRP B . n 
B 1 500 PRO 500 501 501 PRO PRO B . n 
B 1 501 PRO 501 502 502 PRO PRO B . n 
B 1 502 TYR 502 503 503 TYR TYR B . n 
B 1 503 THR 503 504 504 THR THR B . n 
B 1 504 ALA 504 505 505 ALA ALA B . n 
B 1 505 GLY 505 506 506 GLY GLY B . n 
B 1 506 ALA 506 507 507 ALA ALA B . n 
B 1 507 GLN 507 508 508 GLN GLN B . n 
B 1 508 GLN 508 509 509 GLN GLN B . n 
B 1 509 TYR 509 510 510 TYR TYR B . n 
B 1 510 VAL 510 511 511 VAL VAL B . n 
B 1 511 SER 511 512 512 SER SER B . n 
B 1 512 LEU 512 513 513 LEU LEU B . n 
B 1 513 ASP 513 514 514 ASP ASP B . n 
B 1 514 LEU 514 515 515 LEU LEU B . n 
B 1 515 ARG 515 516 516 ARG ARG B . n 
B 1 516 PRO 516 517 517 PRO PRO B . n 
B 1 517 LEU 517 518 518 LEU LEU B . n 
B 1 518 GLU 518 519 519 GLU GLU B . n 
B 1 519 VAL 519 520 520 VAL VAL B . n 
B 1 520 ARG 520 521 521 ARG ARG B . n 
B 1 521 ARG 521 522 522 ARG ARG B . n 
B 1 522 GLY 522 523 523 GLY GLY B . n 
B 1 523 LEU 523 524 524 LEU LEU B . n 
B 1 524 ARG 524 525 525 ARG ARG B . n 
B 1 525 ALA 525 526 526 ALA ALA B . n 
B 1 526 GLN 526 527 527 GLN GLN B . n 
B 1 527 ALA 527 528 528 ALA ALA B . n 
B 1 528 CYS 528 529 529 CYS CYS B . n 
B 1 529 ALA 529 530 530 ALA ALA B . n 
B 1 530 PHE 530 531 531 PHE PHE B . n 
B 1 531 TRP 531 532 532 TRP TRP B . n 
B 1 532 ASN 532 533 533 ASN ASN B . n 
B 1 533 ARG 533 534 534 ARG ARG B . n 
B 1 534 PHE 534 535 535 PHE PHE B . n 
B 1 535 LEU 535 536 536 LEU LEU B . n 
B 1 536 PRO 536 537 537 PRO PRO B . n 
B 1 537 LYS 537 538 538 LYS LYS B . n 
B 1 538 LEU 538 539 539 LEU LEU B . n 
B 1 539 LEU 539 540 540 LEU LEU B . n 
B 1 540 SER 540 541 541 SER SER B . n 
B 1 541 ALA 541 542 542 ALA ALA B . n 
B 1 542 THR 542 543 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 EFS 1   604 1001 EFS MEP A . 
F 4 EDO 1   605 1    EDO EDO A . 
G 4 EDO 1   606 2    EDO EDO A . 
H 5 NAG 1   604 604  NAG NAG B . 
I 3 EFS 1   605 1001 EFS MEP B . 
J 4 EDO 1   606 3    EDO EDO B . 
K 4 EDO 1   607 4    EDO EDO B . 
L 6 HOH 1   701 424  HOH HOH A . 
L 6 HOH 2   702 351  HOH HOH A . 
L 6 HOH 3   703 348  HOH HOH A . 
L 6 HOH 4   704 358  HOH HOH A . 
L 6 HOH 5   705 341  HOH HOH A . 
L 6 HOH 6   706 372  HOH HOH A . 
L 6 HOH 7   707 469  HOH HOH A . 
L 6 HOH 8   708 258  HOH HOH A . 
L 6 HOH 9   709 110  HOH HOH A . 
L 6 HOH 10  710 416  HOH HOH A . 
L 6 HOH 11  711 422  HOH HOH A . 
L 6 HOH 12  712 291  HOH HOH A . 
L 6 HOH 13  713 525  HOH HOH A . 
L 6 HOH 14  714 316  HOH HOH A . 
L 6 HOH 15  715 195  HOH HOH A . 
L 6 HOH 16  716 410  HOH HOH A . 
L 6 HOH 17  717 453  HOH HOH A . 
L 6 HOH 18  718 71   HOH HOH A . 
L 6 HOH 19  719 65   HOH HOH A . 
L 6 HOH 20  720 217  HOH HOH A . 
L 6 HOH 21  721 376  HOH HOH A . 
L 6 HOH 22  722 450  HOH HOH A . 
L 6 HOH 23  723 205  HOH HOH A . 
L 6 HOH 24  724 26   HOH HOH A . 
L 6 HOH 25  725 95   HOH HOH A . 
L 6 HOH 26  726 9    HOH HOH A . 
L 6 HOH 27  727 171  HOH HOH A . 
L 6 HOH 28  728 289  HOH HOH A . 
L 6 HOH 29  729 111  HOH HOH A . 
L 6 HOH 30  730 520  HOH HOH A . 
L 6 HOH 31  731 125  HOH HOH A . 
L 6 HOH 32  732 397  HOH HOH A . 
L 6 HOH 33  733 355  HOH HOH A . 
L 6 HOH 34  734 294  HOH HOH A . 
L 6 HOH 35  735 540  HOH HOH A . 
L 6 HOH 36  736 415  HOH HOH A . 
L 6 HOH 37  737 114  HOH HOH A . 
L 6 HOH 38  738 430  HOH HOH A . 
L 6 HOH 39  739 377  HOH HOH A . 
L 6 HOH 40  740 58   HOH HOH A . 
L 6 HOH 41  741 38   HOH HOH A . 
L 6 HOH 42  742 1    HOH HOH A . 
L 6 HOH 43  743 226  HOH HOH A . 
L 6 HOH 44  744 198  HOH HOH A . 
L 6 HOH 45  745 272  HOH HOH A . 
L 6 HOH 46  746 225  HOH HOH A . 
L 6 HOH 47  747 22   HOH HOH A . 
L 6 HOH 48  748 52   HOH HOH A . 
L 6 HOH 49  749 378  HOH HOH A . 
L 6 HOH 50  750 30   HOH HOH A . 
L 6 HOH 51  751 139  HOH HOH A . 
L 6 HOH 52  752 120  HOH HOH A . 
L 6 HOH 53  753 145  HOH HOH A . 
L 6 HOH 54  754 44   HOH HOH A . 
L 6 HOH 55  755 387  HOH HOH A . 
L 6 HOH 56  756 142  HOH HOH A . 
L 6 HOH 57  757 179  HOH HOH A . 
L 6 HOH 58  758 36   HOH HOH A . 
L 6 HOH 59  759 4    HOH HOH A . 
L 6 HOH 60  760 174  HOH HOH A . 
L 6 HOH 61  761 261  HOH HOH A . 
L 6 HOH 62  762 45   HOH HOH A . 
L 6 HOH 63  763 163  HOH HOH A . 
L 6 HOH 64  764 98   HOH HOH A . 
L 6 HOH 65  765 300  HOH HOH A . 
L 6 HOH 66  766 19   HOH HOH A . 
L 6 HOH 67  767 50   HOH HOH A . 
L 6 HOH 68  768 262  HOH HOH A . 
L 6 HOH 69  769 432  HOH HOH A . 
L 6 HOH 70  770 380  HOH HOH A . 
L 6 HOH 71  771 249  HOH HOH A . 
L 6 HOH 72  772 278  HOH HOH A . 
L 6 HOH 73  773 20   HOH HOH A . 
L 6 HOH 74  774 254  HOH HOH A . 
L 6 HOH 75  775 426  HOH HOH A . 
L 6 HOH 76  776 59   HOH HOH A . 
L 6 HOH 77  777 18   HOH HOH A . 
L 6 HOH 78  778 302  HOH HOH A . 
L 6 HOH 79  779 172  HOH HOH A . 
L 6 HOH 80  780 76   HOH HOH A . 
L 6 HOH 81  781 5    HOH HOH A . 
L 6 HOH 82  782 204  HOH HOH A . 
L 6 HOH 83  783 28   HOH HOH A . 
L 6 HOH 84  784 57   HOH HOH A . 
L 6 HOH 85  785 256  HOH HOH A . 
L 6 HOH 86  786 167  HOH HOH A . 
L 6 HOH 87  787 192  HOH HOH A . 
L 6 HOH 88  788 295  HOH HOH A . 
L 6 HOH 89  789 176  HOH HOH A . 
L 6 HOH 90  790 202  HOH HOH A . 
L 6 HOH 91  791 25   HOH HOH A . 
L 6 HOH 92  792 371  HOH HOH A . 
L 6 HOH 93  793 264  HOH HOH A . 
L 6 HOH 94  794 99   HOH HOH A . 
L 6 HOH 95  795 245  HOH HOH A . 
L 6 HOH 96  796 88   HOH HOH A . 
L 6 HOH 97  797 234  HOH HOH A . 
L 6 HOH 98  798 221  HOH HOH A . 
L 6 HOH 99  799 42   HOH HOH A . 
L 6 HOH 100 800 112  HOH HOH A . 
L 6 HOH 101 801 447  HOH HOH A . 
L 6 HOH 102 802 309  HOH HOH A . 
L 6 HOH 103 803 37   HOH HOH A . 
L 6 HOH 104 804 61   HOH HOH A . 
L 6 HOH 105 805 339  HOH HOH A . 
L 6 HOH 106 806 92   HOH HOH A . 
L 6 HOH 107 807 55   HOH HOH A . 
L 6 HOH 108 808 96   HOH HOH A . 
L 6 HOH 109 809 66   HOH HOH A . 
L 6 HOH 110 810 14   HOH HOH A . 
L 6 HOH 111 811 173  HOH HOH A . 
L 6 HOH 112 812 79   HOH HOH A . 
L 6 HOH 113 813 373  HOH HOH A . 
L 6 HOH 114 814 336  HOH HOH A . 
L 6 HOH 115 815 3    HOH HOH A . 
L 6 HOH 116 816 328  HOH HOH A . 
L 6 HOH 117 817 41   HOH HOH A . 
L 6 HOH 118 818 175  HOH HOH A . 
L 6 HOH 119 819 273  HOH HOH A . 
L 6 HOH 120 820 201  HOH HOH A . 
L 6 HOH 121 821 6    HOH HOH A . 
L 6 HOH 122 822 318  HOH HOH A . 
L 6 HOH 123 823 301  HOH HOH A . 
L 6 HOH 124 824 292  HOH HOH A . 
L 6 HOH 125 825 499  HOH HOH A . 
L 6 HOH 126 826 497  HOH HOH A . 
L 6 HOH 127 827 396  HOH HOH A . 
L 6 HOH 128 828 284  HOH HOH A . 
L 6 HOH 129 829 40   HOH HOH A . 
L 6 HOH 130 830 299  HOH HOH A . 
L 6 HOH 131 831 182  HOH HOH A . 
L 6 HOH 132 832 253  HOH HOH A . 
L 6 HOH 133 833 340  HOH HOH A . 
L 6 HOH 134 834 425  HOH HOH A . 
L 6 HOH 135 835 465  HOH HOH A . 
L 6 HOH 136 836 46   HOH HOH A . 
L 6 HOH 137 837 227  HOH HOH A . 
L 6 HOH 138 838 505  HOH HOH A . 
L 6 HOH 139 839 521  HOH HOH A . 
L 6 HOH 140 840 43   HOH HOH A . 
L 6 HOH 141 841 277  HOH HOH A . 
L 6 HOH 142 842 135  HOH HOH A . 
L 6 HOH 143 843 409  HOH HOH A . 
L 6 HOH 144 844 507  HOH HOH A . 
L 6 HOH 145 845 250  HOH HOH A . 
L 6 HOH 146 846 220  HOH HOH A . 
L 6 HOH 147 847 312  HOH HOH A . 
L 6 HOH 148 848 466  HOH HOH A . 
L 6 HOH 149 849 315  HOH HOH A . 
L 6 HOH 150 850 148  HOH HOH A . 
L 6 HOH 151 851 423  HOH HOH A . 
L 6 HOH 152 852 366  HOH HOH A . 
L 6 HOH 153 853 401  HOH HOH A . 
L 6 HOH 154 854 189  HOH HOH A . 
L 6 HOH 155 855 121  HOH HOH A . 
L 6 HOH 156 856 194  HOH HOH A . 
L 6 HOH 157 857 82   HOH HOH A . 
L 6 HOH 158 858 11   HOH HOH A . 
L 6 HOH 159 859 477  HOH HOH A . 
L 6 HOH 160 860 230  HOH HOH A . 
L 6 HOH 161 861 282  HOH HOH A . 
L 6 HOH 162 862 133  HOH HOH A . 
L 6 HOH 163 863 213  HOH HOH A . 
L 6 HOH 164 864 64   HOH HOH A . 
L 6 HOH 165 865 403  HOH HOH A . 
L 6 HOH 166 866 500  HOH HOH A . 
L 6 HOH 167 867 56   HOH HOH A . 
L 6 HOH 168 868 216  HOH HOH A . 
L 6 HOH 169 869 150  HOH HOH A . 
L 6 HOH 170 870 429  HOH HOH A . 
L 6 HOH 171 871 511  HOH HOH A . 
L 6 HOH 172 872 243  HOH HOH A . 
L 6 HOH 173 873 211  HOH HOH A . 
L 6 HOH 174 874 208  HOH HOH A . 
L 6 HOH 175 875 252  HOH HOH A . 
L 6 HOH 176 876 385  HOH HOH A . 
L 6 HOH 177 877 178  HOH HOH A . 
L 6 HOH 178 878 160  HOH HOH A . 
L 6 HOH 179 879 223  HOH HOH A . 
L 6 HOH 180 880 357  HOH HOH A . 
L 6 HOH 181 881 196  HOH HOH A . 
L 6 HOH 182 882 206  HOH HOH A . 
L 6 HOH 183 883 152  HOH HOH A . 
L 6 HOH 184 884 288  HOH HOH A . 
L 6 HOH 185 885 412  HOH HOH A . 
L 6 HOH 186 886 236  HOH HOH A . 
L 6 HOH 187 887 501  HOH HOH A . 
L 6 HOH 188 888 93   HOH HOH A . 
L 6 HOH 189 889 287  HOH HOH A . 
L 6 HOH 190 890 73   HOH HOH A . 
L 6 HOH 191 891 143  HOH HOH A . 
L 6 HOH 192 892 89   HOH HOH A . 
L 6 HOH 193 893 74   HOH HOH A . 
L 6 HOH 194 894 268  HOH HOH A . 
L 6 HOH 195 895 483  HOH HOH A . 
L 6 HOH 196 896 414  HOH HOH A . 
L 6 HOH 197 897 166  HOH HOH A . 
L 6 HOH 198 898 263  HOH HOH A . 
L 6 HOH 199 899 242  HOH HOH A . 
L 6 HOH 200 900 400  HOH HOH A . 
L 6 HOH 201 901 197  HOH HOH A . 
L 6 HOH 202 902 214  HOH HOH A . 
L 6 HOH 203 903 151  HOH HOH A . 
L 6 HOH 204 904 360  HOH HOH A . 
L 6 HOH 205 905 541  HOH HOH A . 
L 6 HOH 206 906 90   HOH HOH A . 
L 6 HOH 207 907 131  HOH HOH A . 
L 6 HOH 208 908 229  HOH HOH A . 
L 6 HOH 209 909 199  HOH HOH A . 
L 6 HOH 210 910 417  HOH HOH A . 
L 6 HOH 211 911 365  HOH HOH A . 
L 6 HOH 212 912 528  HOH HOH A . 
L 6 HOH 213 913 459  HOH HOH A . 
L 6 HOH 214 914 451  HOH HOH A . 
L 6 HOH 215 915 427  HOH HOH A . 
L 6 HOH 216 916 325  HOH HOH A . 
L 6 HOH 217 917 498  HOH HOH A . 
L 6 HOH 218 918 510  HOH HOH A . 
L 6 HOH 219 919 78   HOH HOH A . 
L 6 HOH 220 920 169  HOH HOH A . 
L 6 HOH 221 921 361  HOH HOH A . 
L 6 HOH 222 922 534  HOH HOH A . 
L 6 HOH 223 923 181  HOH HOH A . 
L 6 HOH 224 924 532  HOH HOH A . 
L 6 HOH 225 925 492  HOH HOH A . 
L 6 HOH 226 926 319  HOH HOH A . 
L 6 HOH 227 927 207  HOH HOH A . 
L 6 HOH 228 928 394  HOH HOH A . 
L 6 HOH 229 929 81   HOH HOH A . 
L 6 HOH 230 930 487  HOH HOH A . 
L 6 HOH 231 931 240  HOH HOH A . 
L 6 HOH 232 932 337  HOH HOH A . 
L 6 HOH 233 933 419  HOH HOH A . 
L 6 HOH 234 934 402  HOH HOH A . 
L 6 HOH 235 935 286  HOH HOH A . 
L 6 HOH 236 936 310  HOH HOH A . 
L 6 HOH 237 937 156  HOH HOH A . 
L 6 HOH 238 938 308  HOH HOH A . 
L 6 HOH 239 939 153  HOH HOH A . 
L 6 HOH 240 940 484  HOH HOH A . 
L 6 HOH 241 941 85   HOH HOH A . 
L 6 HOH 242 942 448  HOH HOH A . 
L 6 HOH 243 943 495  HOH HOH A . 
L 6 HOH 244 944 537  HOH HOH A . 
L 6 HOH 245 945 345  HOH HOH A . 
L 6 HOH 246 946 235  HOH HOH A . 
L 6 HOH 247 947 535  HOH HOH A . 
L 6 HOH 248 948 421  HOH HOH A . 
L 6 HOH 249 949 276  HOH HOH A . 
L 6 HOH 250 950 313  HOH HOH A . 
L 6 HOH 251 951 508  HOH HOH A . 
L 6 HOH 252 952 390  HOH HOH A . 
L 6 HOH 253 953 108  HOH HOH A . 
L 6 HOH 254 954 539  HOH HOH A . 
L 6 HOH 255 955 162  HOH HOH A . 
L 6 HOH 256 956 536  HOH HOH A . 
L 6 HOH 257 957 379  HOH HOH A . 
L 6 HOH 258 958 320  HOH HOH A . 
L 6 HOH 259 959 335  HOH HOH A . 
L 6 HOH 260 960 474  HOH HOH A . 
L 6 HOH 261 961 516  HOH HOH A . 
L 6 HOH 262 962 343  HOH HOH A . 
L 6 HOH 263 963 524  HOH HOH A . 
L 6 HOH 264 964 523  HOH HOH A . 
L 6 HOH 265 965 334  HOH HOH A . 
L 6 HOH 266 966 456  HOH HOH A . 
L 6 HOH 267 967 251  HOH HOH A . 
L 6 HOH 268 968 463  HOH HOH A . 
L 6 HOH 269 969 265  HOH HOH A . 
L 6 HOH 270 970 388  HOH HOH A . 
L 6 HOH 271 971 231  HOH HOH A . 
L 6 HOH 272 972 381  HOH HOH A . 
L 6 HOH 273 973 321  HOH HOH A . 
L 6 HOH 274 974 209  HOH HOH A . 
L 6 HOH 275 975 344  HOH HOH A . 
L 6 HOH 276 976 364  HOH HOH A . 
L 6 HOH 277 977 494  HOH HOH A . 
L 6 HOH 278 978 342  HOH HOH A . 
L 6 HOH 279 979 458  HOH HOH A . 
L 6 HOH 280 980 522  HOH HOH A . 
L 6 HOH 281 981 509  HOH HOH A . 
L 6 HOH 282 982 496  HOH HOH A . 
L 6 HOH 283 983 529  HOH HOH A . 
L 6 HOH 284 984 435  HOH HOH A . 
L 6 HOH 285 985 445  HOH HOH A . 
L 6 HOH 286 986 237  HOH HOH A . 
L 6 HOH 287 987 393  HOH HOH A . 
L 6 HOH 288 988 370  HOH HOH A . 
L 6 HOH 289 989 504  HOH HOH A . 
L 6 HOH 290 990 271  HOH HOH A . 
L 6 HOH 291 991 493  HOH HOH A . 
L 6 HOH 292 992 506  HOH HOH A . 
L 6 HOH 293 993 266  HOH HOH A . 
L 6 HOH 294 994 411  HOH HOH A . 
L 6 HOH 295 995 384  HOH HOH A . 
L 6 HOH 296 996 333  HOH HOH A . 
M 6 HOH 1   701 352  HOH HOH B . 
M 6 HOH 2   702 533  HOH HOH B . 
M 6 HOH 3   703 303  HOH HOH B . 
M 6 HOH 4   704 368  HOH HOH B . 
M 6 HOH 5   705 48   HOH HOH B . 
M 6 HOH 6   706 290  HOH HOH B . 
M 6 HOH 7   707 275  HOH HOH B . 
M 6 HOH 8   708 442  HOH HOH B . 
M 6 HOH 9   709 62   HOH HOH B . 
M 6 HOH 10  710 332  HOH HOH B . 
M 6 HOH 11  711 297  HOH HOH B . 
M 6 HOH 12  712 146  HOH HOH B . 
M 6 HOH 13  713 35   HOH HOH B . 
M 6 HOH 14  714 113  HOH HOH B . 
M 6 HOH 15  715 238  HOH HOH B . 
M 6 HOH 16  716 244  HOH HOH B . 
M 6 HOH 17  717 296  HOH HOH B . 
M 6 HOH 18  718 60   HOH HOH B . 
M 6 HOH 19  719 127  HOH HOH B . 
M 6 HOH 20  720 398  HOH HOH B . 
M 6 HOH 21  721 83   HOH HOH B . 
M 6 HOH 22  722 218  HOH HOH B . 
M 6 HOH 23  723 187  HOH HOH B . 
M 6 HOH 24  724 267  HOH HOH B . 
M 6 HOH 25  725 517  HOH HOH B . 
M 6 HOH 26  726 80   HOH HOH B . 
M 6 HOH 27  727 470  HOH HOH B . 
M 6 HOH 28  728 10   HOH HOH B . 
M 6 HOH 29  729 247  HOH HOH B . 
M 6 HOH 30  730 15   HOH HOH B . 
M 6 HOH 31  731 141  HOH HOH B . 
M 6 HOH 32  732 241  HOH HOH B . 
M 6 HOH 33  733 407  HOH HOH B . 
M 6 HOH 34  734 170  HOH HOH B . 
M 6 HOH 35  735 298  HOH HOH B . 
M 6 HOH 36  736 123  HOH HOH B . 
M 6 HOH 37  737 97   HOH HOH B . 
M 6 HOH 38  738 17   HOH HOH B . 
M 6 HOH 39  739 47   HOH HOH B . 
M 6 HOH 40  740 395  HOH HOH B . 
M 6 HOH 41  741 439  HOH HOH B . 
M 6 HOH 42  742 482  HOH HOH B . 
M 6 HOH 43  743 468  HOH HOH B . 
M 6 HOH 44  744 12   HOH HOH B . 
M 6 HOH 45  745 437  HOH HOH B . 
M 6 HOH 46  746 452  HOH HOH B . 
M 6 HOH 47  747 75   HOH HOH B . 
M 6 HOH 48  748 70   HOH HOH B . 
M 6 HOH 49  749 107  HOH HOH B . 
M 6 HOH 50  750 260  HOH HOH B . 
M 6 HOH 51  751 200  HOH HOH B . 
M 6 HOH 52  752 149  HOH HOH B . 
M 6 HOH 53  753 186  HOH HOH B . 
M 6 HOH 54  754 31   HOH HOH B . 
M 6 HOH 55  755 257  HOH HOH B . 
M 6 HOH 56  756 305  HOH HOH B . 
M 6 HOH 57  757 285  HOH HOH B . 
M 6 HOH 58  758 87   HOH HOH B . 
M 6 HOH 59  759 481  HOH HOH B . 
M 6 HOH 60  760 67   HOH HOH B . 
M 6 HOH 61  761 49   HOH HOH B . 
M 6 HOH 62  762 94   HOH HOH B . 
M 6 HOH 63  763 101  HOH HOH B . 
M 6 HOH 64  764 116  HOH HOH B . 
M 6 HOH 65  765 307  HOH HOH B . 
M 6 HOH 66  766 147  HOH HOH B . 
M 6 HOH 67  767 2    HOH HOH B . 
M 6 HOH 68  768 69   HOH HOH B . 
M 6 HOH 69  769 8    HOH HOH B . 
M 6 HOH 70  770 32   HOH HOH B . 
M 6 HOH 71  771 306  HOH HOH B . 
M 6 HOH 72  772 63   HOH HOH B . 
M 6 HOH 73  773 13   HOH HOH B . 
M 6 HOH 74  774 165  HOH HOH B . 
M 6 HOH 75  775 104  HOH HOH B . 
M 6 HOH 76  776 27   HOH HOH B . 
M 6 HOH 77  777 23   HOH HOH B . 
M 6 HOH 78  778 255  HOH HOH B . 
M 6 HOH 79  779 84   HOH HOH B . 
M 6 HOH 80  780 464  HOH HOH B . 
M 6 HOH 81  781 382  HOH HOH B . 
M 6 HOH 82  782 404  HOH HOH B . 
M 6 HOH 83  783 454  HOH HOH B . 
M 6 HOH 84  784 338  HOH HOH B . 
M 6 HOH 85  785 232  HOH HOH B . 
M 6 HOH 86  786 405  HOH HOH B . 
M 6 HOH 87  787 157  HOH HOH B . 
M 6 HOH 88  788 136  HOH HOH B . 
M 6 HOH 89  789 77   HOH HOH B . 
M 6 HOH 90  790 109  HOH HOH B . 
M 6 HOH 91  791 54   HOH HOH B . 
M 6 HOH 92  792 193  HOH HOH B . 
M 6 HOH 93  793 34   HOH HOH B . 
M 6 HOH 94  794 132  HOH HOH B . 
M 6 HOH 95  795 479  HOH HOH B . 
M 6 HOH 96  796 159  HOH HOH B . 
M 6 HOH 97  797 91   HOH HOH B . 
M 6 HOH 98  798 180  HOH HOH B . 
M 6 HOH 99  799 215  HOH HOH B . 
M 6 HOH 100 800 21   HOH HOH B . 
M 6 HOH 101 801 279  HOH HOH B . 
M 6 HOH 102 802 515  HOH HOH B . 
M 6 HOH 103 803 119  HOH HOH B . 
M 6 HOH 104 804 185  HOH HOH B . 
M 6 HOH 105 805 327  HOH HOH B . 
M 6 HOH 106 806 233  HOH HOH B . 
M 6 HOH 107 807 16   HOH HOH B . 
M 6 HOH 108 808 118  HOH HOH B . 
M 6 HOH 109 809 33   HOH HOH B . 
M 6 HOH 110 810 386  HOH HOH B . 
M 6 HOH 111 811 210  HOH HOH B . 
M 6 HOH 112 812 72   HOH HOH B . 
M 6 HOH 113 813 183  HOH HOH B . 
M 6 HOH 114 814 322  HOH HOH B . 
M 6 HOH 115 815 531  HOH HOH B . 
M 6 HOH 116 816 478  HOH HOH B . 
M 6 HOH 117 817 117  HOH HOH B . 
M 6 HOH 118 818 138  HOH HOH B . 
M 6 HOH 119 819 164  HOH HOH B . 
M 6 HOH 120 820 140  HOH HOH B . 
M 6 HOH 121 821 105  HOH HOH B . 
M 6 HOH 122 822 124  HOH HOH B . 
M 6 HOH 123 823 491  HOH HOH B . 
M 6 HOH 124 824 246  HOH HOH B . 
M 6 HOH 125 825 106  HOH HOH B . 
M 6 HOH 126 826 168  HOH HOH B . 
M 6 HOH 127 827 130  HOH HOH B . 
M 6 HOH 128 828 444  HOH HOH B . 
M 6 HOH 129 829 68   HOH HOH B . 
M 6 HOH 130 830 115  HOH HOH B . 
M 6 HOH 131 831 154  HOH HOH B . 
M 6 HOH 132 832 7    HOH HOH B . 
M 6 HOH 133 833 86   HOH HOH B . 
M 6 HOH 134 834 24   HOH HOH B . 
M 6 HOH 135 835 503  HOH HOH B . 
M 6 HOH 136 836 224  HOH HOH B . 
M 6 HOH 137 837 538  HOH HOH B . 
M 6 HOH 138 838 129  HOH HOH B . 
M 6 HOH 139 839 161  HOH HOH B . 
M 6 HOH 140 840 311  HOH HOH B . 
M 6 HOH 141 841 461  HOH HOH B . 
M 6 HOH 142 842 103  HOH HOH B . 
M 6 HOH 143 843 134  HOH HOH B . 
M 6 HOH 144 844 473  HOH HOH B . 
M 6 HOH 145 845 406  HOH HOH B . 
M 6 HOH 146 846 485  HOH HOH B . 
M 6 HOH 147 847 53   HOH HOH B . 
M 6 HOH 148 848 418  HOH HOH B . 
M 6 HOH 149 849 270  HOH HOH B . 
M 6 HOH 150 850 29   HOH HOH B . 
M 6 HOH 151 851 239  HOH HOH B . 
M 6 HOH 152 852 100  HOH HOH B . 
M 6 HOH 153 853 440  HOH HOH B . 
M 6 HOH 154 854 408  HOH HOH B . 
M 6 HOH 155 855 526  HOH HOH B . 
M 6 HOH 156 856 433  HOH HOH B . 
M 6 HOH 157 857 184  HOH HOH B . 
M 6 HOH 158 858 323  HOH HOH B . 
M 6 HOH 159 859 441  HOH HOH B . 
M 6 HOH 160 860 39   HOH HOH B . 
M 6 HOH 161 861 375  HOH HOH B . 
M 6 HOH 162 862 219  HOH HOH B . 
M 6 HOH 163 863 331  HOH HOH B . 
M 6 HOH 164 864 283  HOH HOH B . 
M 6 HOH 165 865 102  HOH HOH B . 
M 6 HOH 166 866 436  HOH HOH B . 
M 6 HOH 167 867 122  HOH HOH B . 
M 6 HOH 168 868 314  HOH HOH B . 
M 6 HOH 169 869 383  HOH HOH B . 
M 6 HOH 170 870 128  HOH HOH B . 
M 6 HOH 171 871 248  HOH HOH B . 
M 6 HOH 172 872 460  HOH HOH B . 
M 6 HOH 173 873 144  HOH HOH B . 
M 6 HOH 174 874 274  HOH HOH B . 
M 6 HOH 175 875 359  HOH HOH B . 
M 6 HOH 176 876 392  HOH HOH B . 
M 6 HOH 177 877 514  HOH HOH B . 
M 6 HOH 178 878 475  HOH HOH B . 
M 6 HOH 179 879 191  HOH HOH B . 
M 6 HOH 180 880 489  HOH HOH B . 
M 6 HOH 181 881 399  HOH HOH B . 
M 6 HOH 182 882 349  HOH HOH B . 
M 6 HOH 183 883 530  HOH HOH B . 
M 6 HOH 184 884 446  HOH HOH B . 
M 6 HOH 185 885 190  HOH HOH B . 
M 6 HOH 186 886 51   HOH HOH B . 
M 6 HOH 187 887 126  HOH HOH B . 
M 6 HOH 188 888 329  HOH HOH B . 
M 6 HOH 189 889 480  HOH HOH B . 
M 6 HOH 190 890 155  HOH HOH B . 
M 6 HOH 191 891 158  HOH HOH B . 
M 6 HOH 192 892 324  HOH HOH B . 
M 6 HOH 193 893 330  HOH HOH B . 
M 6 HOH 194 894 281  HOH HOH B . 
M 6 HOH 195 895 356  HOH HOH B . 
M 6 HOH 196 896 203  HOH HOH B . 
M 6 HOH 197 897 177  HOH HOH B . 
M 6 HOH 198 898 367  HOH HOH B . 
M 6 HOH 199 899 449  HOH HOH B . 
M 6 HOH 200 900 512  HOH HOH B . 
M 6 HOH 201 901 502  HOH HOH B . 
M 6 HOH 202 902 222  HOH HOH B . 
M 6 HOH 203 903 374  HOH HOH B . 
M 6 HOH 204 904 269  HOH HOH B . 
M 6 HOH 205 905 212  HOH HOH B . 
M 6 HOH 206 906 434  HOH HOH B . 
M 6 HOH 207 907 391  HOH HOH B . 
M 6 HOH 208 908 228  HOH HOH B . 
M 6 HOH 209 909 346  HOH HOH B . 
M 6 HOH 210 910 293  HOH HOH B . 
M 6 HOH 211 911 519  HOH HOH B . 
M 6 HOH 212 912 363  HOH HOH B . 
M 6 HOH 213 913 455  HOH HOH B . 
M 6 HOH 214 914 188  HOH HOH B . 
M 6 HOH 215 915 326  HOH HOH B . 
M 6 HOH 216 916 431  HOH HOH B . 
M 6 HOH 217 917 443  HOH HOH B . 
M 6 HOH 218 918 488  HOH HOH B . 
M 6 HOH 219 919 137  HOH HOH B . 
M 6 HOH 220 920 420  HOH HOH B . 
M 6 HOH 221 921 317  HOH HOH B . 
M 6 HOH 222 922 354  HOH HOH B . 
M 6 HOH 223 923 467  HOH HOH B . 
M 6 HOH 224 924 490  HOH HOH B . 
M 6 HOH 225 925 486  HOH HOH B . 
M 6 HOH 226 926 513  HOH HOH B . 
M 6 HOH 227 927 353  HOH HOH B . 
M 6 HOH 228 928 472  HOH HOH B . 
M 6 HOH 229 929 518  HOH HOH B . 
M 6 HOH 230 930 471  HOH HOH B . 
M 6 HOH 231 931 259  HOH HOH B . 
M 6 HOH 232 932 457  HOH HOH B . 
M 6 HOH 233 933 527  HOH HOH B . 
M 6 HOH 234 934 389  HOH HOH B . 
M 6 HOH 235 935 280  HOH HOH B . 
M 6 HOH 236 936 350  HOH HOH B . 
M 6 HOH 237 937 476  HOH HOH B . 
M 6 HOH 238 938 438  HOH HOH B . 
M 6 HOH 239 939 369  HOH HOH B . 
M 6 HOH 240 940 428  HOH HOH B . 
M 6 HOH 241 941 362  HOH HOH B . 
M 6 HOH 242 942 462  HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5330  ? 
1 MORE         26    ? 
1 'SSA (A^2)'  38750 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-06-22 
2 'Structure model' 1 1 2016-08-24 
3 'Structure model' 1 2 2017-11-22 
4 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Database references'    
3 3 'Structure model' 'Derived calculations'   
4 3 'Structure model' 'Refinement description' 
5 4 'Structure model' 'Atomic model'           
6 4 'Structure model' 'Data collection'        
7 4 'Structure model' 'Derived calculations'   
8 4 'Structure model' 'Structure summary'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  3 'Structure model' citation                      
2  3 'Structure model' pdbx_struct_oper_list         
3  3 'Structure model' software                      
4  4 'Structure model' atom_site                     
5  4 'Structure model' chem_comp                     
6  4 'Structure model' entity                        
7  4 'Structure model' pdbx_branch_scheme            
8  4 'Structure model' pdbx_chem_comp_identifier     
9  4 'Structure model' pdbx_entity_branch            
10 4 'Structure model' pdbx_entity_branch_descriptor 
11 4 'Structure model' pdbx_entity_branch_link       
12 4 'Structure model' pdbx_entity_branch_list       
13 4 'Structure model' pdbx_entity_nonpoly           
14 4 'Structure model' pdbx_nonpoly_scheme           
15 4 'Structure model' pdbx_struct_assembly_gen      
16 4 'Structure model' struct_asym                   
17 4 'Structure model' struct_conn                   
18 4 'Structure model' struct_site                   
19 4 'Structure model' struct_site_gen               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  3 'Structure model' '_citation.journal_id_CSD'                  
2  3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
3  3 'Structure model' '_software.classification'                  
4  4 'Structure model' '_atom_site.B_iso_or_equiv'                 
5  4 'Structure model' '_atom_site.Cartn_x'                        
6  4 'Structure model' '_atom_site.Cartn_y'                        
7  4 'Structure model' '_atom_site.Cartn_z'                        
8  4 'Structure model' '_atom_site.auth_asym_id'                   
9  4 'Structure model' '_atom_site.auth_atom_id'                   
10 4 'Structure model' '_atom_site.auth_comp_id'                   
11 4 'Structure model' '_atom_site.auth_seq_id'                    
12 4 'Structure model' '_atom_site.label_asym_id'                  
13 4 'Structure model' '_atom_site.label_atom_id'                  
14 4 'Structure model' '_atom_site.label_comp_id'                  
15 4 'Structure model' '_atom_site.label_entity_id'                
16 4 'Structure model' '_atom_site.occupancy'                      
17 4 'Structure model' '_atom_site.type_symbol'                    
18 4 'Structure model' '_chem_comp.name'                           
19 4 'Structure model' '_chem_comp.type'                           
20 4 'Structure model' '_entity.formula_weight'                    
21 4 'Structure model' '_entity.pdbx_description'                  
22 4 'Structure model' '_entity.pdbx_number_of_molecules'          
23 4 'Structure model' '_entity.src_method'                        
24 4 'Structure model' '_entity.type'                              
25 4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list'    
26 4 'Structure model' '_struct_conn.pdbx_role'                    
27 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id'           
28 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'            
29 4 'Structure model' '_struct_conn.ptnr1_label_asym_id'          
30 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id'           
31 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'            
32 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'          
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data collection' ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .    1 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? SCALEPACK   ? ? ? .    2 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? .    3 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 4 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .    5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   B HOH 875 ? ? O B HOH 921 ? ? 1.99 
2 1 O   A HOH 969 ? ? O A HOH 976 ? ? 2.05 
3 1 O   A HOH 958 ? ? O A HOH 974 ? ? 2.10 
4 1 NH2 A ARG 18  ? A O A HOH 702 ? ? 2.18 
5 1 NH1 A ARG 18  ? A O A HOH 703 ? ? 2.18 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             C 
_pdbx_validate_rmsd_angle.auth_asym_id_1             B 
_pdbx_validate_rmsd_angle.auth_comp_id_1             CYS 
_pdbx_validate_rmsd_angle.auth_seq_id_1              257 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             N 
_pdbx_validate_rmsd_angle.auth_asym_id_2             B 
_pdbx_validate_rmsd_angle.auth_comp_id_2             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_2              258 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CD 
_pdbx_validate_rmsd_angle.auth_asym_id_3             B 
_pdbx_validate_rmsd_angle.auth_comp_id_3             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_3              258 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                115.78 
_pdbx_validate_rmsd_angle.angle_target_value         128.40 
_pdbx_validate_rmsd_angle.angle_deviation            -12.62 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.10 
_pdbx_validate_rmsd_angle.linker_flag                Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 47  ? ? 77.56   -5.33   
2  1 ALA A 62  ? ? -119.22 54.78   
3  1 PHE A 158 ? ? -141.08 10.40   
4  1 ALA A 167 ? ? -150.92 72.40   
5  1 SER A 203 ? ? 59.30   -116.51 
6  1 HIS A 287 ? ? -95.85  47.98   
7  1 ARG A 296 ? ? -112.73 51.37   
8  1 PHE A 297 ? ? -110.64 61.79   
9  1 ASP A 306 ? ? -94.45  -83.42  
10 1 VAL A 407 ? ? -125.43 -62.38  
11 1 PHE B 47  ? ? 77.46   -4.10   
12 1 ALA B 167 ? ? -156.27 72.03   
13 1 SER B 203 ? ? 56.51   -123.17 
14 1 PRO B 258 ? ? 26.06   104.76  
15 1 ARG B 296 ? ? -55.42  47.88   
16 1 PHE B 297 ? ? -107.75 75.94   
17 1 ASP B 306 ? ? -87.60  -84.82  
18 1 TYR B 341 ? ? -99.77  42.50   
19 1 VAL B 407 ? ? -125.96 -66.56  
20 1 ASN B 464 ? ? -110.88 50.96   
21 1 GLU B 491 ? ? -56.95  108.07  
22 1 ARG B 493 ? ? 89.90   -8.89   
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   CYS 
_pdbx_validate_peptide_omega.auth_asym_id_1   B 
_pdbx_validate_peptide_omega.auth_seq_id_1    257 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   PRO 
_pdbx_validate_peptide_omega.auth_asym_id_2   B 
_pdbx_validate_peptide_omega.auth_seq_id_2    258 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -127.62 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 2   ? A GLY 1   
2  1 Y 1 A ARG 3   ? A ARG 2   
3  1 Y 1 A GLU 4   ? A GLU 3   
4  1 Y 1 A PRO 259 ? A PRO 258 
5  1 Y 1 A GLY 260 ? A GLY 259 
6  1 Y 1 A GLY 261 ? A GLY 260 
7  1 Y 1 A THR 262 ? A THR 261 
8  1 Y 1 A GLY 263 ? A GLY 262 
9  1 Y 1 A GLY 264 ? A GLY 263 
10 1 Y 1 A ASP 494 ? A ASP 493 
11 1 Y 1 A PRO 495 ? A PRO 494 
12 1 Y 1 A LYS 496 ? A LYS 495 
13 1 Y 1 A ALA 542 ? A ALA 541 
14 1 Y 1 A THR 543 ? A THR 542 
15 1 Y 1 B GLY 2   ? B GLY 1   
16 1 Y 1 B GLY 260 ? B GLY 259 
17 1 Y 1 B GLY 261 ? B GLY 260 
18 1 Y 1 B THR 543 ? B THR 542 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
C 2 NAG 1 C NAG 1 A NAG 601 n 
C 2 NAG 2 C NAG 2 A NAG 603 n 
C 2 FUC 3 C FUC 3 A FUC 602 n 
D 2 NAG 1 D NAG 1 B NAG 601 n 
D 2 NAG 2 D NAG 2 B NAG 603 n 
D 2 FUC 3 D FUC 3 B FUC 602 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
FUC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 LFucpa                         
FUC 'COMMON NAME'                         GMML     1.0 a-L-fucopyranose               
FUC 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-L-Fucp                       
FUC 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Fuc                            
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
_pdbx_entity_branch.entity_id   2 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 'DGlcpNAcb1-4[LFucpa1-6]DGlcpNAcb1-'                                         'Glycam Condensed Sequence' GMML       1.0   
2 2 'WURCS=2.0/2,3,2/[a2122h-1b_1-5_2*NCC/3=O][a1221m-1a_1-5]/1-1-2/a4-b1_a6-c1' WURCS                       PDB2Glycan 1.1.0 
3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}[(6+1)][a-L-Fucp]{}}}'        LINUCS                      PDB-CARE   ?     
# 
loop_
_pdbx_entity_branch_link.link_id 
_pdbx_entity_branch_link.entity_id 
_pdbx_entity_branch_link.entity_branch_list_num_1 
_pdbx_entity_branch_link.comp_id_1 
_pdbx_entity_branch_link.atom_id_1 
_pdbx_entity_branch_link.leaving_atom_id_1 
_pdbx_entity_branch_link.entity_branch_list_num_2 
_pdbx_entity_branch_link.comp_id_2 
_pdbx_entity_branch_link.atom_id_2 
_pdbx_entity_branch_link.leaving_atom_id_2 
_pdbx_entity_branch_link.value_order 
_pdbx_entity_branch_link.details 
1 2 2 NAG C1 O1 1 NAG O4 HO4 sing ? 
2 2 3 FUC C1 O1 1 NAG O6 HO6 sing ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 NAG 1 n 
2 NAG 2 n 
2 FUC 3 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'ETHYL DIHYDROGEN PHOSPHATE'             EFS 
4 1,2-ETHANEDIOL                           EDO 
5 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 
6 water                                    HOH 
#