data_5HF8
# 
_entry.id   5HF8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5HF8         
WWPDB D_1000216489 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 5HF5 PDB . 
unspecified 5HF6 PDB . 
unspecified 5HF9 PDB . 
unspecified 5HFA PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5HF8 
_pdbx_database_status.recvd_initial_deposition_date   2016-01-06 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Franklin, M.F.' 1 
'Rudolph, M.J.'  2 
'Ginter, C.'     3 
'Cassidy, M.S.'  4 
'Cheung, J.'     5 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Proteins 
_citation.journal_id_ASTM           PSFGEY 
_citation.journal_id_CSD            0867 
_citation.journal_id_ISSN           1097-0134 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            84 
_citation.language                  ? 
_citation.page_first                1246 
_citation.page_last                 1256 
_citation.title                     
'Structures of paraoxon-inhibited human acetylcholinesterase reveal perturbations of the acyl loop and the dimer interface.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1002/prot.25073 
_citation.pdbx_database_id_PubMed   27191504 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Franklin, M.C.' 1 ? 
primary 'Rudolph, M.J.'  2 ? 
primary 'Ginter, C.'     3 ? 
primary 'Cassidy, M.S.'  4 ? 
primary 'Cheung, J.'     5 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5HF8 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     104.861 
_cell.length_a_esd                 ? 
_cell.length_b                     104.861 
_cell.length_b_esd                 ? 
_cell.length_c                     326.314 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        12 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5HF8 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Acetylcholinesterase 59447.105 2   3.1.1.7 none 'catalytic domain, UNP residues 33 to 574' ? 
2 branched    man 
'2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose' 570.542   2 
?       ?    ?                                          ? 
3 non-polymer syn 'ETHYL DIHYDROGEN PHOSPHATE' 126.048   2   ?       ?    ?                                          ? 
4 non-polymer syn 'DIETHYL PHOSPHONATE' 138.102   2   ?       ?    ?                                          ? 
5 non-polymer syn 1,2-ETHANEDIOL 62.068    4   ?       ?    ?                                          ? 
6 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   1   ?       ?    ?                                          ? 
7 non-polymer syn 'NITRATE ION' 62.005    1   ?       ?    ?                                          ? 
8 water       nat water 18.015    230 ?       ?    ?                                          ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        AChE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFE
GTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLAL
PGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGM
GEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDF
HGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDV
VGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWA
NFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFE
GTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLAL
PGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGM
GEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDF
HGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDV
VGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWA
NFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ARG n 
1 3   GLU n 
1 4   ASP n 
1 5   ALA n 
1 6   GLU n 
1 7   LEU n 
1 8   LEU n 
1 9   VAL n 
1 10  THR n 
1 11  VAL n 
1 12  ARG n 
1 13  GLY n 
1 14  GLY n 
1 15  ARG n 
1 16  LEU n 
1 17  ARG n 
1 18  GLY n 
1 19  ILE n 
1 20  ARG n 
1 21  LEU n 
1 22  LYS n 
1 23  THR n 
1 24  PRO n 
1 25  GLY n 
1 26  GLY n 
1 27  PRO n 
1 28  VAL n 
1 29  SER n 
1 30  ALA n 
1 31  PHE n 
1 32  LEU n 
1 33  GLY n 
1 34  ILE n 
1 35  PRO n 
1 36  PHE n 
1 37  ALA n 
1 38  GLU n 
1 39  PRO n 
1 40  PRO n 
1 41  MET n 
1 42  GLY n 
1 43  PRO n 
1 44  ARG n 
1 45  ARG n 
1 46  PHE n 
1 47  LEU n 
1 48  PRO n 
1 49  PRO n 
1 50  GLU n 
1 51  PRO n 
1 52  LYS n 
1 53  GLN n 
1 54  PRO n 
1 55  TRP n 
1 56  SER n 
1 57  GLY n 
1 58  VAL n 
1 59  VAL n 
1 60  ASP n 
1 61  ALA n 
1 62  THR n 
1 63  THR n 
1 64  PHE n 
1 65  GLN n 
1 66  SER n 
1 67  VAL n 
1 68  CYS n 
1 69  TYR n 
1 70  GLN n 
1 71  TYR n 
1 72  VAL n 
1 73  ASP n 
1 74  THR n 
1 75  LEU n 
1 76  TYR n 
1 77  PRO n 
1 78  GLY n 
1 79  PHE n 
1 80  GLU n 
1 81  GLY n 
1 82  THR n 
1 83  GLU n 
1 84  MET n 
1 85  TRP n 
1 86  ASN n 
1 87  PRO n 
1 88  ASN n 
1 89  ARG n 
1 90  GLU n 
1 91  LEU n 
1 92  SER n 
1 93  GLU n 
1 94  ASP n 
1 95  CYS n 
1 96  LEU n 
1 97  TYR n 
1 98  LEU n 
1 99  ASN n 
1 100 VAL n 
1 101 TRP n 
1 102 THR n 
1 103 PRO n 
1 104 TYR n 
1 105 PRO n 
1 106 ARG n 
1 107 PRO n 
1 108 THR n 
1 109 SER n 
1 110 PRO n 
1 111 THR n 
1 112 PRO n 
1 113 VAL n 
1 114 LEU n 
1 115 VAL n 
1 116 TRP n 
1 117 ILE n 
1 118 TYR n 
1 119 GLY n 
1 120 GLY n 
1 121 GLY n 
1 122 PHE n 
1 123 TYR n 
1 124 SER n 
1 125 GLY n 
1 126 ALA n 
1 127 SER n 
1 128 SER n 
1 129 LEU n 
1 130 ASP n 
1 131 VAL n 
1 132 TYR n 
1 133 ASP n 
1 134 GLY n 
1 135 ARG n 
1 136 PHE n 
1 137 LEU n 
1 138 VAL n 
1 139 GLN n 
1 140 ALA n 
1 141 GLU n 
1 142 ARG n 
1 143 THR n 
1 144 VAL n 
1 145 LEU n 
1 146 VAL n 
1 147 SER n 
1 148 MET n 
1 149 ASN n 
1 150 TYR n 
1 151 ARG n 
1 152 VAL n 
1 153 GLY n 
1 154 ALA n 
1 155 PHE n 
1 156 GLY n 
1 157 PHE n 
1 158 LEU n 
1 159 ALA n 
1 160 LEU n 
1 161 PRO n 
1 162 GLY n 
1 163 SER n 
1 164 ARG n 
1 165 GLU n 
1 166 ALA n 
1 167 PRO n 
1 168 GLY n 
1 169 ASN n 
1 170 VAL n 
1 171 GLY n 
1 172 LEU n 
1 173 LEU n 
1 174 ASP n 
1 175 GLN n 
1 176 ARG n 
1 177 LEU n 
1 178 ALA n 
1 179 LEU n 
1 180 GLN n 
1 181 TRP n 
1 182 VAL n 
1 183 GLN n 
1 184 GLU n 
1 185 ASN n 
1 186 VAL n 
1 187 ALA n 
1 188 ALA n 
1 189 PHE n 
1 190 GLY n 
1 191 GLY n 
1 192 ASP n 
1 193 PRO n 
1 194 THR n 
1 195 SER n 
1 196 VAL n 
1 197 THR n 
1 198 LEU n 
1 199 PHE n 
1 200 GLY n 
1 201 GLU n 
1 202 SER n 
1 203 ALA n 
1 204 GLY n 
1 205 ALA n 
1 206 ALA n 
1 207 SER n 
1 208 VAL n 
1 209 GLY n 
1 210 MET n 
1 211 HIS n 
1 212 LEU n 
1 213 LEU n 
1 214 SER n 
1 215 PRO n 
1 216 PRO n 
1 217 SER n 
1 218 ARG n 
1 219 GLY n 
1 220 LEU n 
1 221 PHE n 
1 222 HIS n 
1 223 ARG n 
1 224 ALA n 
1 225 VAL n 
1 226 LEU n 
1 227 GLN n 
1 228 SER n 
1 229 GLY n 
1 230 ALA n 
1 231 PRO n 
1 232 ASN n 
1 233 GLY n 
1 234 PRO n 
1 235 TRP n 
1 236 ALA n 
1 237 THR n 
1 238 VAL n 
1 239 GLY n 
1 240 MET n 
1 241 GLY n 
1 242 GLU n 
1 243 ALA n 
1 244 ARG n 
1 245 ARG n 
1 246 ARG n 
1 247 ALA n 
1 248 THR n 
1 249 GLN n 
1 250 LEU n 
1 251 ALA n 
1 252 HIS n 
1 253 LEU n 
1 254 VAL n 
1 255 GLY n 
1 256 CYS n 
1 257 PRO n 
1 258 PRO n 
1 259 GLY n 
1 260 GLY n 
1 261 THR n 
1 262 GLY n 
1 263 GLY n 
1 264 ASN n 
1 265 ASP n 
1 266 THR n 
1 267 GLU n 
1 268 LEU n 
1 269 VAL n 
1 270 ALA n 
1 271 CYS n 
1 272 LEU n 
1 273 ARG n 
1 274 THR n 
1 275 ARG n 
1 276 PRO n 
1 277 ALA n 
1 278 GLN n 
1 279 VAL n 
1 280 LEU n 
1 281 VAL n 
1 282 ASN n 
1 283 HIS n 
1 284 GLU n 
1 285 TRP n 
1 286 HIS n 
1 287 VAL n 
1 288 LEU n 
1 289 PRO n 
1 290 GLN n 
1 291 GLU n 
1 292 SER n 
1 293 VAL n 
1 294 PHE n 
1 295 ARG n 
1 296 PHE n 
1 297 SER n 
1 298 PHE n 
1 299 VAL n 
1 300 PRO n 
1 301 VAL n 
1 302 VAL n 
1 303 ASP n 
1 304 GLY n 
1 305 ASP n 
1 306 PHE n 
1 307 LEU n 
1 308 SER n 
1 309 ASP n 
1 310 THR n 
1 311 PRO n 
1 312 GLU n 
1 313 ALA n 
1 314 LEU n 
1 315 ILE n 
1 316 ASN n 
1 317 ALA n 
1 318 GLY n 
1 319 ASP n 
1 320 PHE n 
1 321 HIS n 
1 322 GLY n 
1 323 LEU n 
1 324 GLN n 
1 325 VAL n 
1 326 LEU n 
1 327 VAL n 
1 328 GLY n 
1 329 VAL n 
1 330 VAL n 
1 331 LYS n 
1 332 ASP n 
1 333 GLU n 
1 334 GLY n 
1 335 SER n 
1 336 TYR n 
1 337 PHE n 
1 338 LEU n 
1 339 VAL n 
1 340 TYR n 
1 341 GLY n 
1 342 ALA n 
1 343 PRO n 
1 344 GLY n 
1 345 PHE n 
1 346 SER n 
1 347 LYS n 
1 348 ASP n 
1 349 ASN n 
1 350 GLU n 
1 351 SER n 
1 352 LEU n 
1 353 ILE n 
1 354 SER n 
1 355 ARG n 
1 356 ALA n 
1 357 GLU n 
1 358 PHE n 
1 359 LEU n 
1 360 ALA n 
1 361 GLY n 
1 362 VAL n 
1 363 ARG n 
1 364 VAL n 
1 365 GLY n 
1 366 VAL n 
1 367 PRO n 
1 368 GLN n 
1 369 VAL n 
1 370 SER n 
1 371 ASP n 
1 372 LEU n 
1 373 ALA n 
1 374 ALA n 
1 375 GLU n 
1 376 ALA n 
1 377 VAL n 
1 378 VAL n 
1 379 LEU n 
1 380 HIS n 
1 381 TYR n 
1 382 THR n 
1 383 ASP n 
1 384 TRP n 
1 385 LEU n 
1 386 HIS n 
1 387 PRO n 
1 388 GLU n 
1 389 ASP n 
1 390 PRO n 
1 391 ALA n 
1 392 ARG n 
1 393 LEU n 
1 394 ARG n 
1 395 GLU n 
1 396 ALA n 
1 397 LEU n 
1 398 SER n 
1 399 ASP n 
1 400 VAL n 
1 401 VAL n 
1 402 GLY n 
1 403 ASP n 
1 404 HIS n 
1 405 ASN n 
1 406 VAL n 
1 407 VAL n 
1 408 CYS n 
1 409 PRO n 
1 410 VAL n 
1 411 ALA n 
1 412 GLN n 
1 413 LEU n 
1 414 ALA n 
1 415 GLY n 
1 416 ARG n 
1 417 LEU n 
1 418 ALA n 
1 419 ALA n 
1 420 GLN n 
1 421 GLY n 
1 422 ALA n 
1 423 ARG n 
1 424 VAL n 
1 425 TYR n 
1 426 ALA n 
1 427 TYR n 
1 428 VAL n 
1 429 PHE n 
1 430 GLU n 
1 431 HIS n 
1 432 ARG n 
1 433 ALA n 
1 434 SER n 
1 435 THR n 
1 436 LEU n 
1 437 SER n 
1 438 TRP n 
1 439 PRO n 
1 440 LEU n 
1 441 TRP n 
1 442 MET n 
1 443 GLY n 
1 444 VAL n 
1 445 PRO n 
1 446 HIS n 
1 447 GLY n 
1 448 TYR n 
1 449 GLU n 
1 450 ILE n 
1 451 GLU n 
1 452 PHE n 
1 453 ILE n 
1 454 PHE n 
1 455 GLY n 
1 456 ILE n 
1 457 PRO n 
1 458 LEU n 
1 459 ASP n 
1 460 PRO n 
1 461 SER n 
1 462 ARG n 
1 463 ASN n 
1 464 TYR n 
1 465 THR n 
1 466 ALA n 
1 467 GLU n 
1 468 GLU n 
1 469 LYS n 
1 470 ILE n 
1 471 PHE n 
1 472 ALA n 
1 473 GLN n 
1 474 ARG n 
1 475 LEU n 
1 476 MET n 
1 477 ARG n 
1 478 TYR n 
1 479 TRP n 
1 480 ALA n 
1 481 ASN n 
1 482 PHE n 
1 483 ALA n 
1 484 ARG n 
1 485 THR n 
1 486 GLY n 
1 487 ASP n 
1 488 PRO n 
1 489 ASN n 
1 490 GLU n 
1 491 PRO n 
1 492 ARG n 
1 493 ASP n 
1 494 PRO n 
1 495 LYS n 
1 496 ALA n 
1 497 PRO n 
1 498 GLN n 
1 499 TRP n 
1 500 PRO n 
1 501 PRO n 
1 502 TYR n 
1 503 THR n 
1 504 ALA n 
1 505 GLY n 
1 506 ALA n 
1 507 GLN n 
1 508 GLN n 
1 509 TYR n 
1 510 VAL n 
1 511 SER n 
1 512 LEU n 
1 513 ASP n 
1 514 LEU n 
1 515 ARG n 
1 516 PRO n 
1 517 LEU n 
1 518 GLU n 
1 519 VAL n 
1 520 ARG n 
1 521 ARG n 
1 522 GLY n 
1 523 LEU n 
1 524 ARG n 
1 525 ALA n 
1 526 GLN n 
1 527 ALA n 
1 528 CYS n 
1 529 ALA n 
1 530 PHE n 
1 531 TRP n 
1 532 ASN n 
1 533 ARG n 
1 534 PHE n 
1 535 LEU n 
1 536 PRO n 
1 537 LYS n 
1 538 LEU n 
1 539 LEU n 
1 540 SER n 
1 541 ALA n 
1 542 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   542 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ACHE 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_HUMAN 
_struct_ref.pdbx_db_accession          P22303 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFE
GTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLAL
PGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGM
GEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDF
HGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDV
VGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWA
NFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT
;
_struct_ref.pdbx_align_begin           33 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5HF8 A 1 ? 542 ? P22303 33 ? 574 ? 2 543 
2 1 5HF8 B 1 ? 542 ? P22303 33 ? 574 ? 2 543 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                  ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE                                 ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                               ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                          ?                 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'           y CYSTEINE                                 ?                 'C3 H7 N O2 S'   121.158 
DEP non-polymer                   . 'DIETHYL PHOSPHONATE'                    ?                 'C4 H11 O3 P'    138.102 
EDO non-polymer                   . 1,2-ETHANEDIOL                           'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
EFS non-polymer                   . 'ETHYL DIHYDROGEN PHOSPHATE'             ?                 'C2 H7 O4 P'     126.048 
FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose                     ?                 'C6 H12 O5'      164.156 
GLN 'L-peptide linking'           y GLUTAMINE                                ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                          ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                                  ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE                                ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                                    ?                 'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                               ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE                                  ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                                   ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'           y METHIONINE                               ?                 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose ?                 'C8 H15 N O6'    221.208 
NO3 non-polymer                   . 'NITRATE ION'                            ?                 'N O3 -1'        62.005  
PHE 'L-peptide linking'           y PHENYLALANINE                            ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE                                  ?                 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                                   ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE                                ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                               ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                                 ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                                   ?                 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5HF8 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            4.38 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         71.91 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '15 - 18% PEG3350, 0.2M potassium nitrate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-02-26 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.075 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.075 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_synchrotron_site       NSLS 
# 
_reflns.B_iso_Wilson_estimate            53.540 
_reflns.entry_id                         5HF8 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.8 
_reflns.d_resolution_low                 100.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       52628 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             100.000 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  19.300 
_reflns.pdbx_Rmerge_I_obs                0.161 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         24.421 
_reflns.pdbx_netI_over_sigmaI            4.700 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 1.087 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.165 
_reflns.pdbx_Rpim_I_all                  0.037 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         1016991 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
2.800 2.850   ? ? ? ? ? 2602 ? 100.000 ? ? ? ? 0.932 ? ? ? ? ? ? ? ? 19.900 ? 0.464 ? ? 0.956 0.211 0 1  1 0.933 ? 
2.850 2.900   ? ? ? ? ? 2571 ? 100.000 ? ? ? ? 0.788 ? ? ? ? ? ? ? ? 19.600 ? 0.483 ? ? 0.809 0.180 0 2  1 0.948 ? 
2.900 2.960   ? ? ? ? ? 2585 ? 100.000 ? ? ? ? 0.685 ? ? ? ? ? ? ? ? 19.000 ? 0.495 ? ? 0.703 0.160 0 3  1 0.963 ? 
2.960 3.020   ? ? ? ? ? 2590 ? 100.000 ? ? ? ? 0.545 ? ? ? ? ? ? ? ? 18.500 ? 0.529 ? ? 0.560 0.129 0 4  1 0.970 ? 
3.020 3.080   ? ? ? ? ? 2604 ? 100.000 ? ? ? ? 0.489 ? ? ? ? ? ? ? ? 20.100 ? 0.550 ? ? 0.501 0.110 0 5  1 0.983 ? 
3.080 3.150   ? ? ? ? ? 2593 ? 100.000 ? ? ? ? 0.407 ? ? ? ? ? ? ? ? 19.700 ? 0.571 ? ? 0.417 0.093 0 6  1 0.985 ? 
3.150 3.230   ? ? ? ? ? 2576 ? 100.000 ? ? ? ? 0.366 ? ? ? ? ? ? ? ? 19.300 ? 0.596 ? ? 0.376 0.085 0 7  1 0.985 ? 
3.230 3.320   ? ? ? ? ? 2597 ? 100.000 ? ? ? ? 0.299 ? ? ? ? ? ? ? ? 18.700 ? 0.671 ? ? 0.307 0.071 0 8  1 0.988 ? 
3.320 3.420   ? ? ? ? ? 2599 ? 100.000 ? ? ? ? 0.253 ? ? ? ? ? ? ? ? 20.300 ? 0.741 ? ? 0.259 0.057 0 9  1 0.992 ? 
3.420 3.530   ? ? ? ? ? 2609 ? 100.000 ? ? ? ? 0.225 ? ? ? ? ? ? ? ? 20.200 ? 0.830 ? ? 0.231 0.051 0 10 1 0.992 ? 
3.530 3.650   ? ? ? ? ? 2612 ? 100.000 ? ? ? ? 0.190 ? ? ? ? ? ? ? ? 19.700 ? 0.961 ? ? 0.195 0.044 0 11 1 0.993 ? 
3.650 3.800   ? ? ? ? ? 2607 ? 100.000 ? ? ? ? 0.167 ? ? ? ? ? ? ? ? 19.000 ? 1.113 ? ? 0.171 0.039 0 12 1 0.994 ? 
3.800 3.970   ? ? ? ? ? 2626 ? 100.000 ? ? ? ? 0.147 ? ? ? ? ? ? ? ? 19.200 ? 1.324 ? ? 0.151 0.034 0 13 1 0.996 ? 
3.970 4.180   ? ? ? ? ? 2634 ? 100.000 ? ? ? ? 0.132 ? ? ? ? ? ? ? ? 19.900 ? 1.451 ? ? 0.136 0.030 0 14 1 0.996 ? 
4.180 4.440   ? ? ? ? ? 2612 ? 100.000 ? ? ? ? 0.119 ? ? ? ? ? ? ? ? 18.700 ? 1.658 ? ? 0.123 0.028 0 15 1 0.997 ? 
4.440 4.790   ? ? ? ? ? 2683 ? 100.000 ? ? ? ? 0.113 ? ? ? ? ? ? ? ? 20.200 ? 1.777 ? ? 0.116 0.026 0 16 1 0.997 ? 
4.790 5.270   ? ? ? ? ? 2643 ? 100.000 ? ? ? ? 0.111 ? ? ? ? ? ? ? ? 19.500 ? 1.675 ? ? 0.114 0.026 0 17 1 0.997 ? 
5.270 6.030   ? ? ? ? ? 2679 ? 100.000 ? ? ? ? 0.111 ? ? ? ? ? ? ? ? 18.700 ? 1.635 ? ? 0.114 0.026 0 18 1 0.997 ? 
6.030 7.600   ? ? ? ? ? 2727 ? 100.000 ? ? ? ? 0.104 ? ? ? ? ? ? ? ? 18.700 ? 1.738 ? ? 0.107 0.024 0 19 1 0.997 ? 
7.600 100.000 ? ? ? ? ? 2879 ? 99.400  ? ? ? ? 0.086 ? ? ? ? ? ? ? ? 17.700 ? 2.422 ? ? 0.089 0.021 0 20 1 0.998 ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                135.450 
_refine.B_iso_mean                               48.4735 
_refine.B_iso_min                                19.480 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5HF8 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.8 
_refine.ls_d_res_low                             49.9160 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     52545 
_refine.ls_number_reflns_R_free                  2588 
_refine.ls_number_reflns_R_work                  49957 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.9600 
_refine.ls_percent_reflns_R_free                 4.9300 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1585 
_refine.ls_R_factor_R_free                       0.1996 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1564 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.360 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4EY4 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 19.3400 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.3100 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.8 
_refine_hist.d_res_low                        49.9160 
_refine_hist.pdbx_number_atoms_ligand         138 
_refine_hist.number_atoms_solvent             230 
_refine_hist.number_atoms_total               8692 
_refine_hist.pdbx_number_residues_total       1070 
_refine_hist.pdbx_B_iso_mean_ligand           82.44 
_refine_hist.pdbx_B_iso_mean_solvent          44.19 
_refine_hist.pdbx_number_atoms_protein        8324 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.007  ? 8778  ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.032  ? 12003 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.042  ? 1289  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.006  ? 1579  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 14.030 ? 3163  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.7960 2.8498  2855 . 143 2712 100.0000 . . . 0.2711 . 0.2062 . . . . . . 18 . . . 
'X-RAY DIFFRACTION' 2.8498 2.9080  2896 . 136 2760 100.0000 . . . 0.2809 . 0.2006 . . . . . . 18 . . . 
'X-RAY DIFFRACTION' 2.9080 2.9712  2851 . 135 2716 100.0000 . . . 0.2648 . 0.1952 . . . . . . 18 . . . 
'X-RAY DIFFRACTION' 2.9712 3.0403  2882 . 146 2736 100.0000 . . . 0.2613 . 0.1846 . . . . . . 18 . . . 
'X-RAY DIFFRACTION' 3.0403 3.1163  2867 . 139 2728 100.0000 . . . 0.2744 . 0.1843 . . . . . . 18 . . . 
'X-RAY DIFFRACTION' 3.1163 3.2006  2884 . 134 2750 100.0000 . . . 0.2122 . 0.1836 . . . . . . 18 . . . 
'X-RAY DIFFRACTION' 3.2006 3.2947  2907 . 138 2769 100.0000 . . . 0.2863 . 0.1948 . . . . . . 18 . . . 
'X-RAY DIFFRACTION' 3.2947 3.4011  2862 . 149 2713 100.0000 . . . 0.2390 . 0.1775 . . . . . . 18 . . . 
'X-RAY DIFFRACTION' 3.4011 3.5226  2901 . 155 2746 100.0000 . . . 0.2280 . 0.1709 . . . . . . 18 . . . 
'X-RAY DIFFRACTION' 3.5226 3.6636  2875 . 138 2737 100.0000 . . . 0.1988 . 0.1538 . . . . . . 18 . . . 
'X-RAY DIFFRACTION' 3.6636 3.8303  2907 . 156 2751 100.0000 . . . 0.1895 . 0.1455 . . . . . . 18 . . . 
'X-RAY DIFFRACTION' 3.8303 4.0321  2942 . 137 2805 100.0000 . . . 0.1662 . 0.1341 . . . . . . 18 . . . 
'X-RAY DIFFRACTION' 4.0321 4.2846  2885 . 135 2750 100.0000 . . . 0.1849 . 0.1309 . . . . . . 18 . . . 
'X-RAY DIFFRACTION' 4.2846 4.6152  2944 . 159 2785 100.0000 . . . 0.1570 . 0.1188 . . . . . . 18 . . . 
'X-RAY DIFFRACTION' 4.6152 5.0793  2937 . 135 2802 100.0000 . . . 0.1303 . 0.1168 . . . . . . 18 . . . 
'X-RAY DIFFRACTION' 5.0793 5.8133  2993 . 161 2832 100.0000 . . . 0.1854 . 0.1387 . . . . . . 18 . . . 
'X-RAY DIFFRACTION' 5.8133 7.3204  2985 . 147 2838 100.0000 . . . 0.1955 . 0.1680 . . . . . . 18 . . . 
'X-RAY DIFFRACTION' 7.3204 49.9244 3172 . 145 3027 100.0000 . . . 0.2006 . 0.1760 . . . . . . 18 . . . 
# 
_struct.entry_id                     5HF8 
_struct.title                        
'Crystal structure of human acetylcholinesterase in complex with paraoxon (alternative acyl loop conformation)' 
_struct.pdbx_descriptor              'Acetylcholinesterase (E.C.3.1.1.7)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5HF8 
_struct_keywords.text            'acetylcholinesterase, hydrolase' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 5 ? 
H N N 5 ? 
I N N 6 ? 
J N N 3 ? 
K N N 4 ? 
L N N 5 ? 
M N N 5 ? 
N N N 7 ? 
O N N 8 ? 
P N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 4   ? GLU A 6   ? ASP A 5   GLU A 7   5 ? 3  
HELX_P HELX_P2  AA2 MET A 41  ? ARG A 45  ? MET A 42  ARG A 46  5 ? 5  
HELX_P HELX_P3  AA3 PHE A 79  ? MET A 84  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P4  AA4 LEU A 129 ? ASP A 133 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P5  AA5 GLY A 134 ? ARG A 142 ? GLY A 135 ARG A 143 1 ? 9  
HELX_P HELX_P6  AA6 VAL A 152 ? LEU A 158 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P7  AA7 ASN A 169 ? VAL A 186 ? ASN A 170 VAL A 187 1 ? 18 
HELX_P HELX_P8  AA8 ALA A 187 ? PHE A 189 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P9  AA9 SER A 202 ? LEU A 213 ? SER A 203 LEU A 214 1 ? 12 
HELX_P HELX_P10 AB1 SER A 214 ? GLY A 219 ? SER A 215 GLY A 220 1 ? 6  
HELX_P HELX_P11 AB2 MET A 240 ? VAL A 254 ? MET A 241 VAL A 255 1 ? 15 
HELX_P HELX_P12 AB3 ASP A 265 ? ARG A 275 ? ASP A 266 ARG A 276 1 ? 11 
HELX_P HELX_P13 AB4 PRO A 276 ? TRP A 285 ? PRO A 277 TRP A 286 1 ? 10 
HELX_P HELX_P14 AB5 THR A 310 ? ALA A 317 ? THR A 311 ALA A 318 1 ? 8  
HELX_P HELX_P15 AB6 GLY A 334 ? GLY A 341 ? GLY A 335 GLY A 342 5 ? 8  
HELX_P HELX_P16 AB7 SER A 354 ? VAL A 366 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P17 AB8 SER A 370 ? THR A 382 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P18 AB9 ASP A 389 ? VAL A 406 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P19 AC1 VAL A 406 ? GLN A 420 ? VAL A 407 GLN A 421 1 ? 15 
HELX_P HELX_P20 AC2 PRO A 439 ? GLY A 443 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P21 AC3 GLU A 449 ? PHE A 454 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P22 AC4 GLY A 455 ? ASP A 459 ? GLY A 456 ASP A 460 5 ? 5  
HELX_P HELX_P23 AC5 THR A 465 ? GLY A 486 ? THR A 466 GLY A 487 1 ? 22 
HELX_P HELX_P24 AC6 ARG A 524 ? ARG A 533 ? ARG A 525 ARG A 534 1 ? 10 
HELX_P HELX_P25 AC7 ARG A 533 ? ALA A 541 ? ARG A 534 ALA A 542 1 ? 9  
HELX_P HELX_P26 AC8 ASP B 4   ? GLU B 6   ? ASP B 5   GLU B 7   5 ? 3  
HELX_P HELX_P27 AC9 MET B 41  ? ARG B 45  ? MET B 42  ARG B 46  5 ? 5  
HELX_P HELX_P28 AD1 PHE B 79  ? MET B 84  ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P29 AD2 LEU B 129 ? ASP B 133 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P30 AD3 GLY B 134 ? ARG B 142 ? GLY B 135 ARG B 143 1 ? 9  
HELX_P HELX_P31 AD4 VAL B 152 ? LEU B 158 ? VAL B 153 LEU B 159 1 ? 7  
HELX_P HELX_P32 AD5 ASN B 169 ? VAL B 186 ? ASN B 170 VAL B 187 1 ? 18 
HELX_P HELX_P33 AD6 ALA B 187 ? PHE B 189 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P34 AD7 SER B 202 ? LEU B 213 ? SER B 203 LEU B 214 1 ? 12 
HELX_P HELX_P35 AD8 SER B 214 ? GLY B 219 ? SER B 215 GLY B 220 1 ? 6  
HELX_P HELX_P36 AD9 MET B 240 ? VAL B 254 ? MET B 241 VAL B 255 1 ? 15 
HELX_P HELX_P37 AE1 ASN B 264 ? ARG B 273 ? ASN B 265 ARG B 274 1 ? 10 
HELX_P HELX_P38 AE2 PRO B 276 ? GLU B 284 ? PRO B 277 GLU B 285 1 ? 9  
HELX_P HELX_P39 AE3 THR B 310 ? ALA B 317 ? THR B 311 ALA B 318 1 ? 8  
HELX_P HELX_P40 AE4 GLY B 334 ? VAL B 339 ? GLY B 335 VAL B 340 1 ? 6  
HELX_P HELX_P41 AE5 SER B 354 ? VAL B 366 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P42 AE6 SER B 370 ? THR B 382 ? SER B 371 THR B 383 1 ? 13 
HELX_P HELX_P43 AE7 ASP B 389 ? VAL B 406 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P44 AE8 VAL B 406 ? GLN B 420 ? VAL B 407 GLN B 421 1 ? 15 
HELX_P HELX_P45 AE9 PRO B 439 ? GLY B 443 ? PRO B 440 GLY B 444 5 ? 5  
HELX_P HELX_P46 AF1 GLU B 449 ? PHE B 454 ? GLU B 450 PHE B 455 1 ? 6  
HELX_P HELX_P47 AF2 GLY B 455 ? ASP B 459 ? GLY B 456 ASP B 460 5 ? 5  
HELX_P HELX_P48 AF3 THR B 465 ? GLY B 486 ? THR B 466 GLY B 487 1 ? 22 
HELX_P HELX_P49 AF4 ARG B 524 ? ARG B 533 ? ARG B 525 ARG B 534 1 ? 10 
HELX_P HELX_P50 AF5 PHE B 534 ? ALA B 541 ? PHE B 535 ALA B 542 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A CYS 68  SG  ? ? ? 1_555 A CYS 95  SG ? ? A CYS 69  A CYS 96  1_555 ? ? ? ? ? ? ? 2.047 ? ?               
disulf2  disulf ?    ? A CYS 256 SG  ? ? ? 1_555 A CYS 271 SG ? ? A CYS 257 A CYS 272 1_555 ? ? ? ? ? ? ? 2.054 ? ?               
disulf3  disulf ?    ? A CYS 408 SG  ? ? ? 1_555 A CYS 528 SG ? ? A CYS 409 A CYS 529 1_555 ? ? ? ? ? ? ? 2.051 ? ?               
disulf4  disulf ?    ? B CYS 68  SG  ? ? ? 1_555 B CYS 95  SG ? ? B CYS 69  B CYS 96  1_555 ? ? ? ? ? ? ? 2.049 ? ?               
disulf5  disulf ?    ? B CYS 256 SG  ? ? ? 1_555 B CYS 271 SG ? ? B CYS 257 B CYS 272 1_555 ? ? ? ? ? ? ? 2.051 ? ?               
disulf6  disulf ?    ? B CYS 408 SG  ? ? ? 1_555 B CYS 528 SG ? ? B CYS 409 B CYS 529 1_555 ? ? ? ? ? ? ? 2.043 ? ?               
covale1  covale none ? A SER 202 OG  ? ? ? 1_555 E EFS .   P  A ? A SER 203 A EFS 604 1_555 ? ? ? ? ? ? ? 1.578 ? ?               
covale2  covale one  ? A SER 202 OG  ? ? ? 1_555 F DEP .   P  B ? A SER 203 A DEP 605 1_555 ? ? ? ? ? ? ? 1.579 ? ?               
covale3  covale one  ? A ASN 349 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 350 C NAG 1   1_555 ? ? ? ? ? ? ? 1.441 ? N-Glycosylation 
covale4  covale none ? B SER 202 OG  ? ? ? 1_555 J EFS .   P  A ? B SER 203 B EFS 605 1_555 ? ? ? ? ? ? ? 1.577 ? ?               
covale5  covale one  ? B SER 202 OG  ? ? ? 1_555 K DEP .   P  B ? B SER 203 B DEP 606 1_555 ? ? ? ? ? ? ? 1.580 ? ?               
covale6  covale one  ? B ASN 264 ND2 ? ? ? 1_555 I NAG .   C1 ? ? B ASN 265 B NAG 604 1_555 ? ? ? ? ? ? ? 1.454 ? N-Glycosylation 
covale7  covale one  ? B ASN 349 ND2 ? ? ? 1_555 D NAG .   C1 ? ? B ASN 350 D NAG 1   1_555 ? ? ? ? ? ? ? 1.447 ? N-Glycosylation 
covale8  covale both ? C NAG .   O4  ? ? ? 1_555 C NAG .   C1 ? ? C NAG 1   C NAG 2   1_555 ? ? ? ? ? ? ? 1.449 ? ?               
covale9  covale one  ? C NAG .   O6  ? ? ? 1_555 C FUC .   C1 ? ? C NAG 1   C FUC 3   1_555 ? ? ? ? ? ? ? 1.451 ? ?               
covale10 covale both ? D NAG .   O4  ? ? ? 1_555 D NAG .   C1 ? ? D NAG 1   D NAG 2   1_555 ? ? ? ? ? ? ? 1.459 ? ?               
covale11 covale one  ? D NAG .   O6  ? ? ? 1_555 D FUC .   C1 ? ? D NAG 1   D FUC 3   1_555 ? ? ? ? ? ? ? 1.446 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 104 A . ? TYR 105 A PRO 105 A ? PRO 106 A 1 0.05  
2 TYR 104 B . ? TYR 105 B PRO 105 B ? PRO 106 B 1 0.41  
3 CYS 256 B . ? CYS 257 B PRO 257 B ? PRO 258 B 1 -4.26 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3  ? 
AA2 ? 11 ? 
AA3 ? 2  ? 
AA4 ? 3  ? 
AA5 ? 11 ? 
AA6 ? 2  ? 
AA7 ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? parallel      
AA2 1  2  ? anti-parallel 
AA2 2  3  ? anti-parallel 
AA2 3  4  ? anti-parallel 
AA2 4  5  ? parallel      
AA2 5  6  ? parallel      
AA2 6  7  ? parallel      
AA2 7  8  ? parallel      
AA2 8  9  ? parallel      
AA2 9  10 ? parallel      
AA2 10 11 ? anti-parallel 
AA3 1  2  ? parallel      
AA4 1  2  ? anti-parallel 
AA4 2  3  ? parallel      
AA5 1  2  ? anti-parallel 
AA5 2  3  ? anti-parallel 
AA5 3  4  ? anti-parallel 
AA5 4  5  ? parallel      
AA5 5  6  ? parallel      
AA5 6  7  ? parallel      
AA5 7  8  ? parallel      
AA5 8  9  ? parallel      
AA5 9  10 ? parallel      
AA5 10 11 ? anti-parallel 
AA6 1  2  ? parallel      
AA7 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  LEU A 8   ? VAL A 11  ? LEU A 9   VAL A 12  
AA1 2  GLY A 14  ? ARG A 17  ? GLY A 15  ARG A 18  
AA1 3  VAL A 58  ? ASP A 60  ? VAL A 59  ASP A 61  
AA2 1  ILE A 19  ? LEU A 21  ? ILE A 20  LEU A 22  
AA2 2  VAL A 28  ? PRO A 35  ? VAL A 29  PRO A 36  
AA2 3  TYR A 97  ? PRO A 103 ? TYR A 98  PRO A 104 
AA2 4  VAL A 144 ? MET A 148 ? VAL A 145 MET A 149 
AA2 5  THR A 111 ? ILE A 117 ? THR A 112 ILE A 118 
AA2 6  GLY A 191 ? GLU A 201 ? GLY A 192 GLU A 202 
AA2 7  ARG A 223 ? GLN A 227 ? ARG A 224 GLN A 228 
AA2 8  GLN A 324 ? VAL A 330 ? GLN A 325 VAL A 331 
AA2 9  ARG A 423 ? PHE A 429 ? ARG A 424 PHE A 430 
AA2 10 GLN A 508 ? LEU A 512 ? GLN A 509 LEU A 513 
AA2 11 GLU A 518 ? ARG A 521 ? GLU A 519 ARG A 522 
AA3 1  VAL A 238 ? GLY A 239 ? VAL A 239 GLY A 240 
AA3 2  VAL A 301 ? VAL A 302 ? VAL A 302 VAL A 303 
AA4 1  LEU B 8   ? VAL B 11  ? LEU B 9   VAL B 12  
AA4 2  GLY B 14  ? ARG B 17  ? GLY B 15  ARG B 18  
AA4 3  VAL B 58  ? ASP B 60  ? VAL B 59  ASP B 61  
AA5 1  ILE B 19  ? THR B 23  ? ILE B 20  THR B 24  
AA5 2  GLY B 26  ? PRO B 35  ? GLY B 27  PRO B 36  
AA5 3  TYR B 97  ? PRO B 103 ? TYR B 98  PRO B 104 
AA5 4  VAL B 144 ? MET B 148 ? VAL B 145 MET B 149 
AA5 5  THR B 111 ? ILE B 117 ? THR B 112 ILE B 118 
AA5 6  GLY B 191 ? GLU B 201 ? GLY B 192 GLU B 202 
AA5 7  ARG B 223 ? GLN B 227 ? ARG B 224 GLN B 228 
AA5 8  GLN B 324 ? VAL B 330 ? GLN B 325 VAL B 331 
AA5 9  ARG B 423 ? PHE B 429 ? ARG B 424 PHE B 430 
AA5 10 GLN B 508 ? LEU B 512 ? GLN B 509 LEU B 513 
AA5 11 GLU B 518 ? ARG B 521 ? GLU B 519 ARG B 522 
AA6 1  VAL B 67  ? CYS B 68  ? VAL B 68  CYS B 69  
AA6 2  LEU B 91  ? SER B 92  ? LEU B 92  SER B 93  
AA7 1  VAL B 238 ? GLY B 239 ? VAL B 239 GLY B 240 
AA7 2  VAL B 301 ? VAL B 302 ? VAL B 302 VAL B 303 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  N VAL A 11  ? N VAL A 12  O GLY A 14  ? O GLY A 15  
AA1 2  3  N ARG A 15  ? N ARG A 16  O VAL A 59  ? O VAL A 60  
AA2 1  2  N LEU A 21  ? N LEU A 22  O VAL A 28  ? O VAL A 29  
AA2 2  3  N PHE A 31  ? N PHE A 32  O VAL A 100 ? O VAL A 101 
AA2 3  4  N TRP A 101 ? N TRP A 102 O LEU A 145 ? O LEU A 146 
AA2 4  5  O VAL A 146 ? O VAL A 147 N TRP A 116 ? N TRP A 117 
AA2 5  6  N THR A 111 ? N THR A 112 O ASP A 192 ? O ASP A 193 
AA2 6  7  N LEU A 198 ? N LEU A 199 O VAL A 225 ? O VAL A 226 
AA2 7  8  N LEU A 226 ? N LEU A 227 O LEU A 326 ? O LEU A 327 
AA2 8  9  N VAL A 327 ? N VAL A 328 O TYR A 425 ? O TYR A 426 
AA2 9  10 N VAL A 428 ? N VAL A 429 O LEU A 512 ? O LEU A 513 
AA2 10 11 N TYR A 509 ? N TYR A 510 O ARG A 520 ? O ARG A 521 
AA3 1  2  N VAL A 238 ? N VAL A 239 O VAL A 302 ? O VAL A 303 
AA4 1  2  N VAL B 11  ? N VAL B 12  O GLY B 14  ? O GLY B 15  
AA4 2  3  N ARG B 15  ? N ARG B 16  O VAL B 59  ? O VAL B 60  
AA5 1  2  N LEU B 21  ? N LEU B 22  O VAL B 28  ? O VAL B 29  
AA5 2  3  N PHE B 31  ? N PHE B 32  O VAL B 100 ? O VAL B 101 
AA5 3  4  N ASN B 99  ? N ASN B 100 O SER B 147 ? O SER B 148 
AA5 4  5  O VAL B 146 ? O VAL B 147 N TRP B 116 ? N TRP B 117 
AA5 5  6  N THR B 111 ? N THR B 112 O ASP B 192 ? O ASP B 193 
AA5 6  7  N GLY B 200 ? N GLY B 201 O GLN B 227 ? O GLN B 228 
AA5 7  8  N LEU B 226 ? N LEU B 227 O LEU B 326 ? O LEU B 327 
AA5 8  9  N VAL B 327 ? N VAL B 328 O TYR B 425 ? O TYR B 426 
AA5 9  10 N VAL B 428 ? N VAL B 429 O LEU B 512 ? O LEU B 513 
AA5 10 11 N TYR B 509 ? N TYR B 510 O ARG B 520 ? O ARG B 521 
AA6 1  2  N VAL B 67  ? N VAL B 68  O SER B 92  ? O SER B 93  
AA7 1  2  N VAL B 238 ? N VAL B 239 O VAL B 302 ? O VAL B 303 
# 
_atom_sites.entry_id                    5HF8 
_atom_sites.fract_transf_matrix[1][1]   0.009536 
_atom_sites.fract_transf_matrix[1][2]   0.005506 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011012 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003065 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 3   ? 2.032   -35.546 70.529  1.00 90.62  ? 4   GLU A N   1 
ATOM   2    C CA  . GLU A 1 3   ? 1.874   -35.062 69.158  1.00 98.84  ? 4   GLU A CA  1 
ATOM   3    C C   . GLU A 1 3   ? 3.037   -35.514 68.262  1.00 92.98  ? 4   GLU A C   1 
ATOM   4    O O   . GLU A 1 3   ? 4.196   -35.528 68.693  1.00 96.31  ? 4   GLU A O   1 
ATOM   5    C CB  . GLU A 1 3   ? 1.753   -33.533 69.148  1.00 93.88  ? 4   GLU A CB  1 
ATOM   6    C CG  . GLU A 1 3   ? 1.515   -32.919 67.767  1.00 94.51  ? 4   GLU A CG  1 
ATOM   7    C CD  . GLU A 1 3   ? 0.086   -33.107 67.259  1.00 102.92 ? 4   GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 3   ? -0.715  -33.780 67.952  1.00 101.24 ? 4   GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 3   ? -0.237  -32.572 66.168  1.00 87.54  ? 4   GLU A OE2 1 
ATOM   10   N N   . ASP A 1 4   ? 2.730   -35.885 67.020  1.00 71.89  ? 5   ASP A N   1 
ATOM   11   C CA  . ASP A 1 4   ? 3.756   -36.403 66.118  1.00 72.54  ? 5   ASP A CA  1 
ATOM   12   C C   . ASP A 1 4   ? 4.343   -35.317 65.214  1.00 76.58  ? 5   ASP A C   1 
ATOM   13   O O   . ASP A 1 4   ? 3.682   -34.862 64.282  1.00 67.91  ? 5   ASP A O   1 
ATOM   14   C CB  . ASP A 1 4   ? 3.189   -37.533 65.266  1.00 59.50  ? 5   ASP A CB  1 
ATOM   15   C CG  . ASP A 1 4   ? 4.275   -38.344 64.579  1.00 76.22  ? 5   ASP A CG  1 
ATOM   16   O OD1 . ASP A 1 4   ? 3.972   -39.481 64.152  1.00 76.60  ? 5   ASP A OD1 1 
ATOM   17   O OD2 . ASP A 1 4   ? 5.429   -37.856 64.470  1.00 69.46  ? 5   ASP A OD2 1 
ATOM   18   N N   . ALA A 1 5   ? 5.591   -34.930 65.479  1.00 76.99  ? 6   ALA A N   1 
ATOM   19   C CA  . ALA A 1 5   ? 6.247   -33.837 64.756  1.00 70.14  ? 6   ALA A CA  1 
ATOM   20   C C   . ALA A 1 5   ? 6.406   -34.122 63.254  1.00 77.52  ? 6   ALA A C   1 
ATOM   21   O O   . ALA A 1 5   ? 6.312   -33.205 62.425  1.00 64.97  ? 6   ALA A O   1 
ATOM   22   C CB  . ALA A 1 5   ? 7.612   -33.538 65.380  1.00 57.67  ? 6   ALA A CB  1 
ATOM   23   N N   . GLU A 1 6   ? 6.632   -35.390 62.909  1.00 64.34  ? 7   GLU A N   1 
ATOM   24   C CA  . GLU A 1 6   ? 6.832   -35.789 61.519  1.00 53.87  ? 7   GLU A CA  1 
ATOM   25   C C   . GLU A 1 6   ? 5.641   -35.471 60.609  1.00 57.36  ? 7   GLU A C   1 
ATOM   26   O O   . GLU A 1 6   ? 5.790   -35.384 59.391  1.00 64.28  ? 7   GLU A O   1 
ATOM   27   C CB  . GLU A 1 6   ? 7.139   -37.283 61.447  1.00 55.52  ? 7   GLU A CB  1 
ATOM   28   C CG  . GLU A 1 6   ? 8.466   -37.673 62.083  1.00 71.48  ? 7   GLU A CG  1 
ATOM   29   C CD  . GLU A 1 6   ? 9.686   -37.199 61.289  1.00 80.97  ? 7   GLU A CD  1 
ATOM   30   O OE1 . GLU A 1 6   ? 9.524   -36.718 60.139  1.00 64.64  ? 7   GLU A OE1 1 
ATOM   31   O OE2 . GLU A 1 6   ? 10.816  -37.316 61.821  1.00 81.03  ? 7   GLU A OE2 1 
ATOM   32   N N   . LEU A 1 7   ? 4.466   -35.295 61.200  1.00 50.61  ? 8   LEU A N   1 
ATOM   33   C CA  . LEU A 1 7   ? 3.265   -35.014 60.429  1.00 44.14  ? 8   LEU A CA  1 
ATOM   34   C C   . LEU A 1 7   ? 2.926   -33.524 60.376  1.00 42.96  ? 8   LEU A C   1 
ATOM   35   O O   . LEU A 1 7   ? 1.894   -33.140 59.827  1.00 43.90  ? 8   LEU A O   1 
ATOM   36   C CB  . LEU A 1 7   ? 2.084   -35.796 61.002  1.00 51.68  ? 8   LEU A CB  1 
ATOM   37   C CG  . LEU A 1 7   ? 2.328   -37.298 61.174  1.00 56.64  ? 8   LEU A CG  1 
ATOM   38   C CD1 . LEU A 1 7   ? 1.080   -37.974 61.718  1.00 45.70  ? 8   LEU A CD1 1 
ATOM   39   C CD2 . LEU A 1 7   ? 2.795   -37.953 59.872  1.00 42.60  ? 8   LEU A CD2 1 
ATOM   40   N N   . LEU A 1 8   ? 3.791   -32.682 60.937  1.00 50.48  ? 9   LEU A N   1 
ATOM   41   C CA  . LEU A 1 8   ? 3.622   -31.236 60.818  1.00 38.64  ? 9   LEU A CA  1 
ATOM   42   C C   . LEU A 1 8   ? 4.675   -30.666 59.881  1.00 46.34  ? 9   LEU A C   1 
ATOM   43   O O   . LEU A 1 8   ? 5.872   -30.856 60.098  1.00 48.39  ? 9   LEU A O   1 
ATOM   44   C CB  . LEU A 1 8   ? 3.706   -30.567 62.183  1.00 46.72  ? 9   LEU A CB  1 
ATOM   45   C CG  . LEU A 1 8   ? 2.607   -30.961 63.174  1.00 56.05  ? 9   LEU A CG  1 
ATOM   46   C CD1 . LEU A 1 8   ? 2.766   -30.240 64.493  1.00 49.67  ? 9   LEU A CD1 1 
ATOM   47   C CD2 . LEU A 1 8   ? 1.245   -30.662 62.585  1.00 45.35  ? 9   LEU A CD2 1 
ATOM   48   N N   . VAL A 1 9   ? 4.220   -29.993 58.825  1.00 42.47  ? 10  VAL A N   1 
ATOM   49   C CA  . VAL A 1 9   ? 5.106   -29.403 57.822  1.00 35.93  ? 10  VAL A CA  1 
ATOM   50   C C   . VAL A 1 9   ? 4.667   -27.973 57.521  1.00 44.89  ? 10  VAL A C   1 
ATOM   51   O O   . VAL A 1 9   ? 3.470   -27.672 57.505  1.00 42.40  ? 10  VAL A O   1 
ATOM   52   C CB  . VAL A 1 9   ? 5.119   -30.223 56.496  1.00 40.36  ? 10  VAL A CB  1 
ATOM   53   C CG1 . VAL A 1 9   ? 6.065   -29.605 55.484  1.00 38.96  ? 10  VAL A CG1 1 
ATOM   54   C CG2 . VAL A 1 9   ? 5.522   -31.653 56.748  1.00 43.69  ? 10  VAL A CG2 1 
ATOM   55   N N   . THR A 1 10  ? 5.631   -27.087 57.289  1.00 43.33  ? 11  THR A N   1 
ATOM   56   C CA  . THR A 1 10  ? 5.312   -25.720 56.905  1.00 40.55  ? 11  THR A CA  1 
ATOM   57   C C   . THR A 1 10  ? 5.753   -25.465 55.466  1.00 39.32  ? 11  THR A C   1 
ATOM   58   O O   . THR A 1 10  ? 6.921   -25.633 55.109  1.00 42.88  ? 11  THR A O   1 
ATOM   59   C CB  . THR A 1 10  ? 5.973   -24.684 57.851  1.00 48.90  ? 11  THR A CB  1 
ATOM   60   O OG1 . THR A 1 10  ? 5.560   -24.924 59.206  1.00 47.69  ? 11  THR A OG1 1 
ATOM   61   C CG2 . THR A 1 10  ? 5.580   -23.269 57.447  1.00 34.33  ? 11  THR A CG2 1 
ATOM   62   N N   . VAL A 1 11  ? 4.798   -25.074 54.636  1.00 33.83  ? 12  VAL A N   1 
ATOM   63   C CA  . VAL A 1 11  ? 5.074   -24.730 53.253  1.00 39.82  ? 12  VAL A CA  1 
ATOM   64   C C   . VAL A 1 11  ? 4.899   -23.225 53.132  1.00 43.60  ? 12  VAL A C   1 
ATOM   65   O O   . VAL A 1 11  ? 4.490   -22.582 54.098  1.00 41.75  ? 12  VAL A O   1 
ATOM   66   C CB  . VAL A 1 11  ? 4.145   -25.483 52.286  1.00 42.54  ? 12  VAL A CB  1 
ATOM   67   C CG1 . VAL A 1 11  ? 4.368   -26.987 52.425  1.00 29.17  ? 12  VAL A CG1 1 
ATOM   68   C CG2 . VAL A 1 11  ? 2.680   -25.119 52.544  1.00 32.72  ? 12  VAL A CG2 1 
ATOM   69   N N   . ARG A 1 12  ? 5.196   -22.655 51.968  1.00 35.08  ? 13  ARG A N   1 
ATOM   70   C CA  . ARG A 1 12  ? 5.245   -21.200 51.867  1.00 33.01  ? 13  ARG A CA  1 
ATOM   71   C C   . ARG A 1 12  ? 3.929   -20.563 52.268  1.00 40.01  ? 13  ARG A C   1 
ATOM   72   O O   . ARG A 1 12  ? 3.912   -19.457 52.795  1.00 52.59  ? 13  ARG A O   1 
ATOM   73   C CB  . ARG A 1 12  ? 5.645   -20.757 50.459  1.00 36.27  ? 13  ARG A CB  1 
ATOM   74   C CG  . ARG A 1 12  ? 7.083   -21.095 50.163  1.00 48.63  ? 13  ARG A CG  1 
ATOM   75   C CD  . ARG A 1 12  ? 7.651   -20.338 48.980  1.00 59.54  ? 13  ARG A CD  1 
ATOM   76   N NE  . ARG A 1 12  ? 8.986   -20.851 48.679  1.00 75.95  ? 13  ARG A NE  1 
ATOM   77   C CZ  . ARG A 1 12  ? 9.738   -20.443 47.665  1.00 72.26  ? 13  ARG A CZ  1 
ATOM   78   N NH1 . ARG A 1 12  ? 9.282   -19.499 46.852  1.00 62.71  ? 13  ARG A NH1 1 
ATOM   79   N NH2 . ARG A 1 12  ? 10.942  -20.979 47.470  1.00 66.59  ? 13  ARG A NH2 1 
ATOM   80   N N   . GLY A 1 13  ? 2.833   -21.280 52.054  1.00 42.88  ? 14  GLY A N   1 
ATOM   81   C CA  . GLY A 1 13  ? 1.518   -20.745 52.337  1.00 37.90  ? 14  GLY A CA  1 
ATOM   82   C C   . GLY A 1 13  ? 1.058   -20.935 53.772  1.00 43.35  ? 14  GLY A C   1 
ATOM   83   O O   . GLY A 1 13  ? 0.025   -20.388 54.175  1.00 42.50  ? 14  GLY A O   1 
ATOM   84   N N   . GLY A 1 14  ? 1.802   -21.721 54.545  1.00 31.74  ? 15  GLY A N   1 
ATOM   85   C CA  . GLY A 1 14  ? 1.403   -21.983 55.915  1.00 39.37  ? 15  GLY A CA  1 
ATOM   86   C C   . GLY A 1 14  ? 1.665   -23.395 56.396  1.00 40.45  ? 15  GLY A C   1 
ATOM   87   O O   . GLY A 1 14  ? 2.504   -24.106 55.841  1.00 45.04  ? 15  GLY A O   1 
ATOM   88   N N   . ARG A 1 15  ? 0.925   -23.802 57.423  1.00 35.93  ? 16  ARG A N   1 
ATOM   89   C CA  . ARG A 1 15  ? 1.181   -25.059 58.110  1.00 43.17  ? 16  ARG A CA  1 
ATOM   90   C C   . ARG A 1 15  ? 0.192   -26.163 57.725  1.00 44.23  ? 16  ARG A C   1 
ATOM   91   O O   . ARG A 1 15  ? -0.979  -25.889 57.453  1.00 43.71  ? 16  ARG A O   1 
ATOM   92   C CB  . ARG A 1 15  ? 1.156   -24.831 59.631  1.00 52.64  ? 16  ARG A CB  1 
ATOM   93   C CG  . ARG A 1 15  ? 2.441   -24.183 60.177  1.00 58.82  ? 16  ARG A CG  1 
ATOM   94   C CD  . ARG A 1 15  ? 2.360   -23.884 61.673  1.00 55.86  ? 16  ARG A CD  1 
ATOM   95   N NE  . ARG A 1 15  ? 1.216   -23.036 61.995  1.00 56.35  ? 16  ARG A NE  1 
ATOM   96   C CZ  . ARG A 1 15  ? 0.498   -23.153 63.106  1.00 60.13  ? 16  ARG A CZ  1 
ATOM   97   N NH1 . ARG A 1 15  ? 0.814   -24.092 63.992  1.00 45.73  ? 16  ARG A NH1 1 
ATOM   98   N NH2 . ARG A 1 15  ? -0.537  -22.346 63.324  1.00 49.63  ? 16  ARG A NH2 1 
ATOM   99   N N   . LEU A 1 16  ? 0.685   -27.406 57.710  1.00 40.26  ? 17  LEU A N   1 
ATOM   100  C CA  . LEU A 1 16  ? -0.113  -28.591 57.392  1.00 34.07  ? 17  LEU A CA  1 
ATOM   101  C C   . LEU A 1 16  ? 0.003   -29.707 58.438  1.00 40.69  ? 17  LEU A C   1 
ATOM   102  O O   . LEU A 1 16  ? 1.068   -29.922 59.028  1.00 43.88  ? 17  LEU A O   1 
ATOM   103  C CB  . LEU A 1 16  ? 0.306   -29.166 56.037  1.00 41.49  ? 17  LEU A CB  1 
ATOM   104  C CG  . LEU A 1 16  ? 0.424   -28.221 54.848  1.00 38.37  ? 17  LEU A CG  1 
ATOM   105  C CD1 . LEU A 1 16  ? 1.228   -28.881 53.751  1.00 34.61  ? 17  LEU A CD1 1 
ATOM   106  C CD2 . LEU A 1 16  ? -0.951  -27.810 54.357  1.00 32.07  ? 17  LEU A CD2 1 
ATOM   107  N N   A ARG A 1 17  ? -1.097  -30.421 58.634  0.43 41.16  ? 18  ARG A N   1 
ATOM   108  N N   B ARG A 1 17  ? -1.092  -30.419 58.676  0.57 40.21  ? 18  ARG A N   1 
ATOM   109  C CA  A ARG A 1 17  ? -1.114  -31.625 59.450  0.43 42.92  ? 18  ARG A CA  1 
ATOM   110  C CA  B ARG A 1 17  ? -1.026  -31.635 59.478  0.57 41.11  ? 18  ARG A CA  1 
ATOM   111  C C   A ARG A 1 17  ? -1.436  -32.832 58.563  0.43 45.07  ? 18  ARG A C   1 
ATOM   112  C C   B ARG A 1 17  ? -1.425  -32.836 58.617  0.57 46.44  ? 18  ARG A C   1 
ATOM   113  O O   A ARG A 1 17  ? -2.536  -32.935 58.014  0.43 44.12  ? 18  ARG A O   1 
ATOM   114  O O   B ARG A 1 17  ? -2.563  -32.942 58.150  0.57 44.15  ? 18  ARG A O   1 
ATOM   115  C CB  A ARG A 1 17  ? -2.134  -31.485 60.587  0.43 43.16  ? 18  ARG A CB  1 
ATOM   116  C CB  B ARG A 1 17  ? -1.917  -31.539 60.724  0.57 42.93  ? 18  ARG A CB  1 
ATOM   117  C CG  A ARG A 1 17  ? -2.605  -32.801 61.198  0.43 44.38  ? 18  ARG A CG  1 
ATOM   118  C CG  B ARG A 1 17  ? -1.727  -32.703 61.709  0.57 42.35  ? 18  ARG A CG  1 
ATOM   119  C CD  A ARG A 1 17  ? -3.672  -32.576 62.270  0.43 46.12  ? 18  ARG A CD  1 
ATOM   120  C CD  B ARG A 1 17  ? -2.653  -32.618 62.930  0.57 46.40  ? 18  ARG A CD  1 
ATOM   121  N NE  A ARG A 1 17  ? -4.391  -31.311 62.106  0.43 47.45  ? 18  ARG A NE  1 
ATOM   122  N NE  B ARG A 1 17  ? -2.305  -31.534 63.853  0.57 53.50  ? 18  ARG A NE  1 
ATOM   123  C CZ  A ARG A 1 17  ? -5.606  -31.186 61.577  0.43 47.29  ? 18  ARG A CZ  1 
ATOM   124  C CZ  B ARG A 1 17  ? -3.017  -30.419 64.014  0.57 50.73  ? 18  ARG A CZ  1 
ATOM   125  N NH1 A ARG A 1 17  ? -6.265  -32.253 61.146  0.43 46.32  ? 18  ARG A NH1 1 
ATOM   126  N NH1 B ARG A 1 17  ? -4.131  -30.225 63.315  0.57 46.93  ? 18  ARG A NH1 1 
ATOM   127  N NH2 A ARG A 1 17  ? -6.164  -29.985 61.483  0.43 42.33  ? 18  ARG A NH2 1 
ATOM   128  N NH2 B ARG A 1 17  ? -2.617  -29.493 64.876  0.57 43.62  ? 18  ARG A NH2 1 
ATOM   129  N N   . GLY A 1 18  ? -0.469  -33.731 58.403  1.00 42.22  ? 19  GLY A N   1 
ATOM   130  C CA  . GLY A 1 18  ? -0.685  -34.927 57.612  1.00 34.95  ? 19  GLY A CA  1 
ATOM   131  C C   . GLY A 1 18  ? -1.109  -36.137 58.429  1.00 44.13  ? 19  GLY A C   1 
ATOM   132  O O   . GLY A 1 18  ? -1.597  -36.021 59.553  1.00 45.65  ? 19  GLY A O   1 
ATOM   133  N N   . ILE A 1 19  ? -0.913  -37.316 57.858  1.00 42.60  ? 20  ILE A N   1 
ATOM   134  C CA  . ILE A 1 19  ? -1.398  -38.538 58.470  1.00 41.48  ? 20  ILE A CA  1 
ATOM   135  C C   . ILE A 1 19  ? -0.406  -39.666 58.223  1.00 44.66  ? 20  ILE A C   1 
ATOM   136  O O   . ILE A 1 19  ? 0.260   -39.707 57.189  1.00 48.99  ? 20  ILE A O   1 
ATOM   137  C CB  . ILE A 1 19  ? -2.801  -38.908 57.924  1.00 47.88  ? 20  ILE A CB  1 
ATOM   138  C CG1 . ILE A 1 19  ? -3.362  -40.147 58.617  1.00 40.04  ? 20  ILE A CG1 1 
ATOM   139  C CG2 . ILE A 1 19  ? -2.777  -39.111 56.410  1.00 38.66  ? 20  ILE A CG2 1 
ATOM   140  C CD1 . ILE A 1 19  ? -4.807  -40.412 58.232  1.00 43.27  ? 20  ILE A CD1 1 
ATOM   141  N N   . ARG A 1 20  ? -0.285  -40.564 59.189  1.00 51.04  ? 21  ARG A N   1 
ATOM   142  C CA  . ARG A 1 20  ? 0.569   -41.728 59.031  1.00 43.13  ? 21  ARG A CA  1 
ATOM   143  C C   . ARG A 1 20  ? -0.233  -42.866 58.381  1.00 44.44  ? 21  ARG A C   1 
ATOM   144  O O   . ARG A 1 20  ? -1.357  -43.163 58.787  1.00 47.14  ? 21  ARG A O   1 
ATOM   145  C CB  . ARG A 1 20  ? 1.137   -42.145 60.382  1.00 39.06  ? 21  ARG A CB  1 
ATOM   146  C CG  . ARG A 1 20  ? 2.494   -42.805 60.303  1.00 48.86  ? 21  ARG A CG  1 
ATOM   147  C CD  . ARG A 1 20  ? 3.052   -43.052 61.693  1.00 56.90  ? 21  ARG A CD  1 
ATOM   148  N NE  . ARG A 1 20  ? 2.060   -43.642 62.591  1.00 63.97  ? 21  ARG A NE  1 
ATOM   149  C CZ  . ARG A 1 20  ? 1.669   -43.095 63.739  1.00 67.17  ? 21  ARG A CZ  1 
ATOM   150  N NH1 . ARG A 1 20  ? 2.195   -41.940 64.141  1.00 56.85  ? 21  ARG A NH1 1 
ATOM   151  N NH2 . ARG A 1 20  ? 0.750   -43.707 64.481  1.00 61.84  ? 21  ARG A NH2 1 
ATOM   152  N N   . LEU A 1 21  ? 0.333   -43.482 57.350  1.00 38.80  ? 22  LEU A N   1 
ATOM   153  C CA  . LEU A 1 21  ? -0.351  -44.563 56.651  1.00 36.51  ? 22  LEU A CA  1 
ATOM   154  C C   . LEU A 1 21  ? 0.383   -45.867 56.878  1.00 36.89  ? 22  LEU A C   1 
ATOM   155  O O   . LEU A 1 21  ? 1.599   -45.873 57.038  1.00 50.64  ? 22  LEU A O   1 
ATOM   156  C CB  . LEU A 1 21  ? -0.462  -44.270 55.152  1.00 33.04  ? 22  LEU A CB  1 
ATOM   157  C CG  . LEU A 1 21  ? -1.346  -43.082 54.769  1.00 41.43  ? 22  LEU A CG  1 
ATOM   158  C CD1 . LEU A 1 21  ? -1.478  -42.994 53.256  1.00 40.12  ? 22  LEU A CD1 1 
ATOM   159  C CD2 . LEU A 1 21  ? -2.716  -43.159 55.431  1.00 32.01  ? 22  LEU A CD2 1 
ATOM   160  N N   . LYS A 1 22  ? -0.351  -46.971 56.909  1.00 46.67  ? 23  LYS A N   1 
ATOM   161  C CA  . LYS A 1 22  ? 0.277   -48.272 57.091  1.00 42.80  ? 23  LYS A CA  1 
ATOM   162  C C   . LYS A 1 22  ? 0.453   -48.984 55.757  1.00 37.06  ? 23  LYS A C   1 
ATOM   163  O O   . LYS A 1 22  ? -0.379  -48.855 54.845  1.00 35.31  ? 23  LYS A O   1 
ATOM   164  C CB  . LYS A 1 22  ? -0.541  -49.135 58.053  1.00 40.57  ? 23  LYS A CB  1 
ATOM   165  C CG  . LYS A 1 22  ? -0.592  -48.589 59.473  1.00 44.70  ? 23  LYS A CG  1 
ATOM   166  C CD  . LYS A 1 22  ? -1.307  -49.540 60.406  1.00 42.28  ? 23  LYS A CD  1 
ATOM   167  C CE  . LYS A 1 22  ? -2.719  -49.809 59.919  1.00 60.95  ? 23  LYS A CE  1 
ATOM   168  N NZ  . LYS A 1 22  ? -3.421  -50.846 60.735  1.00 75.35  ? 23  LYS A NZ  1 
ATOM   169  N N   . THR A 1 23  ? 1.565   -49.701 55.639  1.00 35.93  ? 24  THR A N   1 
ATOM   170  C CA  . THR A 1 23  ? 1.805   -50.618 54.522  1.00 35.07  ? 24  THR A CA  1 
ATOM   171  C C   . THR A 1 23  ? 2.364   -51.902 55.113  1.00 36.61  ? 24  THR A C   1 
ATOM   172  O O   . THR A 1 23  ? 2.796   -51.914 56.263  1.00 43.80  ? 24  THR A O   1 
ATOM   173  C CB  . THR A 1 23  ? 2.806   -50.065 53.475  1.00 37.48  ? 24  THR A CB  1 
ATOM   174  O OG1 . THR A 1 23  ? 4.147   -50.284 53.931  1.00 42.13  ? 24  THR A OG1 1 
ATOM   175  C CG2 . THR A 1 23  ? 2.581   -48.598 53.206  1.00 34.80  ? 24  THR A CG2 1 
ATOM   176  N N   . PRO A 1 24  ? 2.379   -52.986 54.334  1.00 41.65  ? 25  PRO A N   1 
ATOM   177  C CA  . PRO A 1 24  ? 2.982   -54.208 54.879  1.00 38.20  ? 25  PRO A CA  1 
ATOM   178  C C   . PRO A 1 24  ? 4.480   -54.081 55.125  1.00 36.05  ? 25  PRO A C   1 
ATOM   179  O O   . PRO A 1 24  ? 5.069   -54.978 55.721  1.00 40.53  ? 25  PRO A O   1 
ATOM   180  C CB  . PRO A 1 24  ? 2.711   -55.247 53.792  1.00 34.67  ? 25  PRO A CB  1 
ATOM   181  C CG  . PRO A 1 24  ? 1.542   -54.718 53.047  1.00 45.65  ? 25  PRO A CG  1 
ATOM   182  C CD  . PRO A 1 24  ? 1.683   -53.233 53.061  1.00 38.90  ? 25  PRO A CD  1 
ATOM   183  N N   . GLY A 1 25  ? 5.087   -52.991 54.665  1.00 39.98  ? 26  GLY A N   1 
ATOM   184  C CA  . GLY A 1 25  ? 6.518   -52.816 54.810  1.00 32.36  ? 26  GLY A CA  1 
ATOM   185  C C   . GLY A 1 25  ? 6.887   -51.725 55.792  1.00 38.17  ? 26  GLY A C   1 
ATOM   186  O O   . GLY A 1 25  ? 8.066   -51.436 55.997  1.00 35.38  ? 26  GLY A O   1 
ATOM   187  N N   . GLY A 1 26  ? 5.881   -51.107 56.399  1.00 29.56  ? 27  GLY A N   1 
ATOM   188  C CA  . GLY A 1 26  ? 6.139   -50.061 57.364  1.00 30.15  ? 27  GLY A CA  1 
ATOM   189  C C   . GLY A 1 26  ? 5.342   -48.811 57.071  1.00 41.12  ? 27  GLY A C   1 
ATOM   190  O O   . GLY A 1 26  ? 4.707   -48.695 56.026  1.00 40.89  ? 27  GLY A O   1 
ATOM   191  N N   . PRO A 1 27  ? 5.371   -47.857 58.000  1.00 37.71  ? 28  PRO A N   1 
ATOM   192  C CA  . PRO A 1 27  ? 4.595   -46.623 57.853  1.00 37.74  ? 28  PRO A CA  1 
ATOM   193  C C   . PRO A 1 27  ? 5.151   -45.652 56.797  1.00 42.49  ? 28  PRO A C   1 
ATOM   194  O O   . PRO A 1 27  ? 6.320   -45.691 56.409  1.00 36.95  ? 28  PRO A O   1 
ATOM   195  C CB  . PRO A 1 27  ? 4.671   -46.002 59.249  1.00 35.60  ? 28  PRO A CB  1 
ATOM   196  C CG  . PRO A 1 27  ? 5.971   -46.504 59.794  1.00 36.61  ? 28  PRO A CG  1 
ATOM   197  C CD  . PRO A 1 27  ? 6.137   -47.896 59.257  1.00 30.54  ? 28  PRO A CD  1 
ATOM   198  N N   . VAL A 1 28  ? 4.275   -44.762 56.355  1.00 39.43  ? 29  VAL A N   1 
ATOM   199  C CA  . VAL A 1 28  ? 4.589   -43.757 55.362  1.00 31.03  ? 29  VAL A CA  1 
ATOM   200  C C   . VAL A 1 28  ? 3.874   -42.474 55.788  1.00 42.18  ? 29  VAL A C   1 
ATOM   201  O O   . VAL A 1 28  ? 2.793   -42.546 56.378  1.00 42.09  ? 29  VAL A O   1 
ATOM   202  C CB  . VAL A 1 28  ? 4.145   -44.224 53.975  1.00 35.58  ? 29  VAL A CB  1 
ATOM   203  C CG1 . VAL A 1 28  ? 3.566   -43.081 53.162  1.00 40.69  ? 29  VAL A CG1 1 
ATOM   204  C CG2 . VAL A 1 28  ? 5.299   -44.919 53.254  1.00 35.06  ? 29  VAL A CG2 1 
ATOM   205  N N   . SER A 1 29  ? 4.485   -41.312 55.558  1.00 35.35  ? 30  SER A N   1 
ATOM   206  C CA  . SER A 1 29  ? 3.831   -40.047 55.902  1.00 33.94  ? 30  SER A CA  1 
ATOM   207  C C   . SER A 1 29  ? 3.048   -39.587 54.690  1.00 37.53  ? 30  SER A C   1 
ATOM   208  O O   . SER A 1 29  ? 3.556   -39.657 53.575  1.00 34.71  ? 30  SER A O   1 
ATOM   209  C CB  . SER A 1 29  ? 4.838   -38.961 56.306  1.00 36.05  ? 30  SER A CB  1 
ATOM   210  O OG  . SER A 1 29  ? 5.933   -39.472 57.048  1.00 48.38  ? 30  SER A OG  1 
ATOM   211  N N   . ALA A 1 30  ? 1.824   -39.116 54.892  1.00 27.63  ? 31  ALA A N   1 
ATOM   212  C CA  . ALA A 1 30  ? 1.034   -38.637 53.763  1.00 32.84  ? 31  ALA A CA  1 
ATOM   213  C C   . ALA A 1 30  ? 0.413   -37.279 54.048  1.00 34.40  ? 31  ALA A C   1 
ATOM   214  O O   . ALA A 1 30  ? -0.047  -37.010 55.157  1.00 34.74  ? 31  ALA A O   1 
ATOM   215  C CB  . ALA A 1 30  ? -0.048  -39.649 53.388  1.00 33.36  ? 31  ALA A CB  1 
ATOM   216  N N   . PHE A 1 31  ? 0.417   -36.420 53.037  1.00 28.31  ? 32  PHE A N   1 
ATOM   217  C CA  . PHE A 1 31  ? -0.207  -35.112 53.144  1.00 35.14  ? 32  PHE A CA  1 
ATOM   218  C C   . PHE A 1 31  ? -1.180  -34.991 51.993  1.00 34.96  ? 32  PHE A C   1 
ATOM   219  O O   . PHE A 1 31  ? -0.777  -34.833 50.845  1.00 38.67  ? 32  PHE A O   1 
ATOM   220  C CB  . PHE A 1 31  ? 0.849   -34.009 53.133  1.00 33.37  ? 32  PHE A CB  1 
ATOM   221  C CG  . PHE A 1 31  ? 1.808   -34.116 54.269  1.00 36.32  ? 32  PHE A CG  1 
ATOM   222  C CD1 . PHE A 1 31  ? 2.915   -34.944 54.178  1.00 36.90  ? 32  PHE A CD1 1 
ATOM   223  C CD2 . PHE A 1 31  ? 1.575   -33.436 55.455  1.00 36.89  ? 32  PHE A CD2 1 
ATOM   224  C CE1 . PHE A 1 31  ? 3.782   -35.078 55.235  1.00 37.18  ? 32  PHE A CE1 1 
ATOM   225  C CE2 . PHE A 1 31  ? 2.448   -33.561 56.523  1.00 38.13  ? 32  PHE A CE2 1 
ATOM   226  C CZ  . PHE A 1 31  ? 3.545   -34.386 56.416  1.00 40.03  ? 32  PHE A CZ  1 
ATOM   227  N N   . LEU A 1 32  ? -2.464  -35.113 52.308  1.00 33.51  ? 33  LEU A N   1 
ATOM   228  C CA  . LEU A 1 32  ? -3.495  -35.248 51.291  1.00 30.38  ? 33  LEU A CA  1 
ATOM   229  C C   . LEU A 1 32  ? -4.371  -34.017 51.240  1.00 34.12  ? 33  LEU A C   1 
ATOM   230  O O   . LEU A 1 32  ? -4.706  -33.448 52.273  1.00 41.29  ? 33  LEU A O   1 
ATOM   231  C CB  . LEU A 1 32  ? -4.348  -36.487 51.569  1.00 36.93  ? 33  LEU A CB  1 
ATOM   232  C CG  . LEU A 1 32  ? -3.563  -37.784 51.761  1.00 35.23  ? 33  LEU A CG  1 
ATOM   233  C CD1 . LEU A 1 32  ? -4.512  -38.925 52.003  1.00 38.87  ? 33  LEU A CD1 1 
ATOM   234  C CD2 . LEU A 1 32  ? -2.703  -38.067 50.539  1.00 37.58  ? 33  LEU A CD2 1 
ATOM   235  N N   . GLY A 1 33  ? -4.743  -33.608 50.034  1.00 35.15  ? 34  GLY A N   1 
ATOM   236  C CA  . GLY A 1 33  ? -5.625  -32.468 49.868  1.00 35.65  ? 34  GLY A CA  1 
ATOM   237  C C   . GLY A 1 33  ? -5.009  -31.146 50.285  1.00 35.66  ? 34  GLY A C   1 
ATOM   238  O O   . GLY A 1 33  ? -5.659  -30.347 50.961  1.00 34.89  ? 34  GLY A O   1 
ATOM   239  N N   . ILE A 1 34  ? -3.759  -30.922 49.876  1.00 29.95  ? 35  ILE A N   1 
ATOM   240  C CA  . ILE A 1 34  ? -3.093  -29.635 50.051  1.00 32.60  ? 35  ILE A CA  1 
ATOM   241  C C   . ILE A 1 34  ? -3.520  -28.654 48.967  1.00 33.91  ? 35  ILE A C   1 
ATOM   242  O O   . ILE A 1 34  ? -3.368  -28.945 47.788  1.00 38.58  ? 35  ILE A O   1 
ATOM   243  C CB  . ILE A 1 34  ? -1.567  -29.781 49.992  1.00 31.59  ? 35  ILE A CB  1 
ATOM   244  C CG1 . ILE A 1 34  ? -1.089  -30.801 51.019  1.00 32.69  ? 35  ILE A CG1 1 
ATOM   245  C CG2 . ILE A 1 34  ? -0.895  -28.432 50.207  1.00 28.40  ? 35  ILE A CG2 1 
ATOM   246  C CD1 . ILE A 1 34  ? 0.318   -31.253 50.785  1.00 31.29  ? 35  ILE A CD1 1 
ATOM   247  N N   . PRO A 1 35  ? -4.054  -27.487 49.356  1.00 37.88  ? 36  PRO A N   1 
ATOM   248  C CA  . PRO A 1 35  ? -4.476  -26.482 48.364  1.00 35.63  ? 36  PRO A CA  1 
ATOM   249  C C   . PRO A 1 35  ? -3.285  -25.785 47.713  1.00 30.80  ? 36  PRO A C   1 
ATOM   250  O O   . PRO A 1 35  ? -2.369  -25.344 48.411  1.00 37.06  ? 36  PRO A O   1 
ATOM   251  C CB  . PRO A 1 35  ? -5.300  -25.500 49.193  1.00 29.66  ? 36  PRO A CB  1 
ATOM   252  C CG  . PRO A 1 35  ? -4.682  -25.592 50.559  1.00 35.26  ? 36  PRO A CG  1 
ATOM   253  C CD  . PRO A 1 35  ? -4.297  -27.042 50.737  1.00 32.79  ? 36  PRO A CD  1 
ATOM   254  N N   . PHE A 1 36  ? -3.284  -25.695 46.387  1.00 31.86  ? 37  PHE A N   1 
ATOM   255  C CA  . PHE A 1 36  ? -2.135  -25.113 45.699  1.00 30.78  ? 37  PHE A CA  1 
ATOM   256  C C   . PHE A 1 36  ? -2.607  -24.032 44.755  1.00 31.03  ? 37  PHE A C   1 
ATOM   257  O O   . PHE A 1 36  ? -1.806  -23.260 44.239  1.00 34.16  ? 37  PHE A O   1 
ATOM   258  C CB  . PHE A 1 36  ? -1.315  -26.182 44.957  1.00 31.52  ? 37  PHE A CB  1 
ATOM   259  C CG  . PHE A 1 36  ? -1.994  -26.755 43.736  1.00 35.69  ? 37  PHE A CG  1 
ATOM   260  C CD1 . PHE A 1 36  ? -1.850  -26.151 42.490  1.00 32.78  ? 37  PHE A CD1 1 
ATOM   261  C CD2 . PHE A 1 36  ? -2.746  -27.919 43.826  1.00 35.92  ? 37  PHE A CD2 1 
ATOM   262  C CE1 . PHE A 1 36  ? -2.469  -26.678 41.367  1.00 28.19  ? 37  PHE A CE1 1 
ATOM   263  C CE2 . PHE A 1 36  ? -3.364  -28.455 42.699  1.00 33.12  ? 37  PHE A CE2 1 
ATOM   264  C CZ  . PHE A 1 36  ? -3.227  -27.830 41.471  1.00 28.18  ? 37  PHE A CZ  1 
ATOM   265  N N   . ALA A 1 37  ? -3.918  -23.973 44.549  1.00 34.11  ? 38  ALA A N   1 
ATOM   266  C CA  . ALA A 1 37  ? -4.520  -22.857 43.831  1.00 30.61  ? 38  ALA A CA  1 
ATOM   267  C C   . ALA A 1 37  ? -5.713  -22.290 44.595  1.00 33.83  ? 38  ALA A C   1 
ATOM   268  O O   . ALA A 1 37  ? -6.255  -22.936 45.491  1.00 39.13  ? 38  ALA A O   1 
ATOM   269  C CB  . ALA A 1 37  ? -4.942  -23.288 42.446  1.00 27.98  ? 38  ALA A CB  1 
ATOM   270  N N   . GLU A 1 38  ? -6.115  -21.073 44.249  1.00 42.19  ? 39  GLU A N   1 
ATOM   271  C CA  . GLU A 1 38  ? -7.389  -20.541 44.717  1.00 40.69  ? 39  GLU A CA  1 
ATOM   272  C C   . GLU A 1 38  ? -8.503  -21.273 43.978  1.00 38.73  ? 39  GLU A C   1 
ATOM   273  O O   . GLU A 1 38  ? -8.346  -21.595 42.805  1.00 40.70  ? 39  GLU A O   1 
ATOM   274  C CB  . GLU A 1 38  ? -7.459  -19.032 44.490  1.00 42.01  ? 39  GLU A CB  1 
ATOM   275  C CG  . GLU A 1 38  ? -6.596  -18.232 45.478  1.00 52.34  ? 39  GLU A CG  1 
ATOM   276  C CD  . GLU A 1 38  ? -7.162  -18.234 46.902  1.00 51.79  ? 39  GLU A CD  1 
ATOM   277  O OE1 . GLU A 1 38  ? -8.383  -18.010 47.053  1.00 60.36  ? 39  GLU A OE1 1 
ATOM   278  O OE2 . GLU A 1 38  ? -6.392  -18.464 47.864  1.00 56.05  ? 39  GLU A OE2 1 
ATOM   279  N N   . PRO A 1 39  ? -9.615  -21.575 44.666  1.00 43.47  ? 40  PRO A N   1 
ATOM   280  C CA  . PRO A 1 39  ? -10.677 -22.338 43.994  1.00 40.82  ? 40  PRO A CA  1 
ATOM   281  C C   . PRO A 1 39  ? -11.162 -21.629 42.729  1.00 43.95  ? 40  PRO A C   1 
ATOM   282  O O   . PRO A 1 39  ? -11.534 -20.457 42.780  1.00 47.68  ? 40  PRO A O   1 
ATOM   283  C CB  . PRO A 1 39  ? -11.781 -22.411 45.054  1.00 38.92  ? 40  PRO A CB  1 
ATOM   284  C CG  . PRO A 1 39  ? -11.067 -22.242 46.356  1.00 33.09  ? 40  PRO A CG  1 
ATOM   285  C CD  . PRO A 1 39  ? -9.943  -21.288 46.072  1.00 32.93  ? 40  PRO A CD  1 
ATOM   286  N N   . PRO A 1 40  ? -11.114 -22.325 41.584  1.00 39.03  ? 41  PRO A N   1 
ATOM   287  C CA  . PRO A 1 40  ? -11.514 -21.705 40.323  1.00 39.14  ? 41  PRO A CA  1 
ATOM   288  C C   . PRO A 1 40  ? -13.028 -21.719 40.125  1.00 46.33  ? 41  PRO A C   1 
ATOM   289  O O   . PRO A 1 40  ? -13.521 -22.341 39.184  1.00 45.75  ? 41  PRO A O   1 
ATOM   290  C CB  . PRO A 1 40  ? -10.808 -22.571 39.277  1.00 32.92  ? 41  PRO A CB  1 
ATOM   291  C CG  . PRO A 1 40  ? -10.690 -23.882 39.898  1.00 30.43  ? 41  PRO A CG  1 
ATOM   292  C CD  . PRO A 1 40  ? -10.572 -23.679 41.384  1.00 40.92  ? 41  PRO A CD  1 
ATOM   293  N N   . MET A 1 41  ? -13.752 -21.038 41.008  1.00 47.36  ? 42  MET A N   1 
ATOM   294  C CA  . MET A 1 41  ? -15.203 -20.966 40.908  1.00 51.38  ? 42  MET A CA  1 
ATOM   295  C C   . MET A 1 41  ? -15.649 -19.543 40.644  1.00 50.02  ? 42  MET A C   1 
ATOM   296  O O   . MET A 1 41  ? -14.840 -18.612 40.664  1.00 54.37  ? 42  MET A O   1 
ATOM   297  C CB  . MET A 1 41  ? -15.882 -21.478 42.180  1.00 50.84  ? 42  MET A CB  1 
ATOM   298  C CG  . MET A 1 41  ? -14.959 -22.064 43.208  1.00 43.31  ? 42  MET A CG  1 
ATOM   299  S SD  . MET A 1 41  ? -15.919 -22.731 44.571  1.00 88.73  ? 42  MET A SD  1 
ATOM   300  C CE  . MET A 1 41  ? -16.946 -23.928 43.714  1.00 50.57  ? 42  MET A CE  1 
ATOM   301  N N   . GLY A 1 42  ? -16.950 -19.390 40.420  1.00 44.78  ? 43  GLY A N   1 
ATOM   302  C CA  . GLY A 1 42  ? -17.534 -18.104 40.103  1.00 37.95  ? 43  GLY A CA  1 
ATOM   303  C C   . GLY A 1 42  ? -16.838 -17.463 38.925  1.00 44.25  ? 43  GLY A C   1 
ATOM   304  O O   . GLY A 1 42  ? -16.768 -18.038 37.835  1.00 44.76  ? 43  GLY A O   1 
ATOM   305  N N   . PRO A 1 43  ? -16.304 -16.264 39.145  1.00 44.47  ? 44  PRO A N   1 
ATOM   306  C CA  . PRO A 1 43  ? -15.612 -15.501 38.105  1.00 49.91  ? 44  PRO A CA  1 
ATOM   307  C C   . PRO A 1 43  ? -14.311 -16.162 37.655  1.00 41.72  ? 44  PRO A C   1 
ATOM   308  O O   . PRO A 1 43  ? -13.788 -15.809 36.601  1.00 45.23  ? 44  PRO A O   1 
ATOM   309  C CB  . PRO A 1 43  ? -15.339 -14.154 38.785  1.00 41.35  ? 44  PRO A CB  1 
ATOM   310  C CG  . PRO A 1 43  ? -15.364 -14.446 40.232  1.00 37.93  ? 44  PRO A CG  1 
ATOM   311  C CD  . PRO A 1 43  ? -16.358 -15.542 40.427  1.00 36.03  ? 44  PRO A CD  1 
ATOM   312  N N   . ARG A 1 44  ? -13.801 -17.104 38.440  1.00 44.13  ? 45  ARG A N   1 
ATOM   313  C CA  . ARG A 1 44  ? -12.527 -17.745 38.131  1.00 44.92  ? 45  ARG A CA  1 
ATOM   314  C C   . ARG A 1 44  ? -12.670 -18.987 37.251  1.00 43.72  ? 45  ARG A C   1 
ATOM   315  O O   . ARG A 1 44  ? -11.674 -19.602 36.871  1.00 41.42  ? 45  ARG A O   1 
ATOM   316  C CB  . ARG A 1 44  ? -11.797 -18.117 39.419  1.00 44.15  ? 45  ARG A CB  1 
ATOM   317  C CG  . ARG A 1 44  ? -11.210 -16.938 40.151  1.00 49.20  ? 45  ARG A CG  1 
ATOM   318  C CD  . ARG A 1 44  ? -10.254 -17.410 41.228  1.00 68.49  ? 45  ARG A CD  1 
ATOM   319  N NE  . ARG A 1 44  ? -10.160 -16.474 42.349  1.00 90.81  ? 45  ARG A NE  1 
ATOM   320  C CZ  . ARG A 1 44  ? -9.359  -15.414 42.372  1.00 88.88  ? 45  ARG A CZ  1 
ATOM   321  N NH1 . ARG A 1 44  ? -8.585  -15.144 41.325  1.00 91.72  ? 45  ARG A NH1 1 
ATOM   322  N NH2 . ARG A 1 44  ? -9.335  -14.624 43.440  1.00 76.81  ? 45  ARG A NH2 1 
ATOM   323  N N   . ARG A 1 45  ? -13.903 -19.356 36.929  1.00 46.73  ? 46  ARG A N   1 
ATOM   324  C CA  . ARG A 1 45  ? -14.134 -20.461 36.010  1.00 35.70  ? 46  ARG A CA  1 
ATOM   325  C C   . ARG A 1 45  ? -13.567 -20.114 34.640  1.00 37.47  ? 46  ARG A C   1 
ATOM   326  O O   . ARG A 1 45  ? -13.689 -18.974 34.195  1.00 42.57  ? 46  ARG A O   1 
ATOM   327  C CB  . ARG A 1 45  ? -15.620 -20.785 35.912  1.00 33.27  ? 46  ARG A CB  1 
ATOM   328  C CG  . ARG A 1 45  ? -15.930 -21.910 34.943  1.00 38.92  ? 46  ARG A CG  1 
ATOM   329  C CD  . ARG A 1 45  ? -17.414 -22.088 34.777  1.00 39.60  ? 46  ARG A CD  1 
ATOM   330  N NE  . ARG A 1 45  ? -18.000 -22.880 35.853  1.00 40.17  ? 46  ARG A NE  1 
ATOM   331  C CZ  . ARG A 1 45  ? -19.306 -23.076 35.990  1.00 40.65  ? 46  ARG A CZ  1 
ATOM   332  N NH1 . ARG A 1 45  ? -20.146 -22.524 35.121  1.00 39.20  ? 46  ARG A NH1 1 
ATOM   333  N NH2 . ARG A 1 45  ? -19.771 -23.823 36.982  1.00 34.12  ? 46  ARG A NH2 1 
ATOM   334  N N   . PHE A 1 46  ? -12.938 -21.100 34.000  1.00 30.69  ? 47  PHE A N   1 
ATOM   335  C CA  . PHE A 1 46  ? -12.270 -20.942 32.708  1.00 37.54  ? 47  PHE A CA  1 
ATOM   336  C C   . PHE A 1 46  ? -10.976 -20.112 32.753  1.00 36.69  ? 47  PHE A C   1 
ATOM   337  O O   . PHE A 1 46  ? -10.318 -19.948 31.728  1.00 33.85  ? 47  PHE A O   1 
ATOM   338  C CB  . PHE A 1 46  ? -13.212 -20.315 31.686  1.00 33.72  ? 47  PHE A CB  1 
ATOM   339  C CG  . PHE A 1 46  ? -14.503 -21.032 31.538  1.00 38.66  ? 47  PHE A CG  1 
ATOM   340  C CD1 . PHE A 1 46  ? -14.529 -22.394 31.317  1.00 39.53  ? 47  PHE A CD1 1 
ATOM   341  C CD2 . PHE A 1 46  ? -15.699 -20.342 31.605  1.00 39.26  ? 47  PHE A CD2 1 
ATOM   342  C CE1 . PHE A 1 46  ? -15.714 -23.057 31.160  1.00 30.49  ? 47  PHE A CE1 1 
ATOM   343  C CE2 . PHE A 1 46  ? -16.889 -21.005 31.458  1.00 43.58  ? 47  PHE A CE2 1 
ATOM   344  C CZ  . PHE A 1 46  ? -16.894 -22.367 31.233  1.00 41.13  ? 47  PHE A CZ  1 
ATOM   345  N N   . LEU A 1 47  ? -10.618 -19.589 33.922  1.00 30.31  ? 48  LEU A N   1 
ATOM   346  C CA  . LEU A 1 47  ? -9.405  -18.787 34.060  1.00 36.93  ? 48  LEU A CA  1 
ATOM   347  C C   . LEU A 1 47  ? -8.183  -19.617 34.442  1.00 38.44  ? 48  LEU A C   1 
ATOM   348  O O   . LEU A 1 47  ? -8.319  -20.677 35.054  1.00 39.15  ? 48  LEU A O   1 
ATOM   349  C CB  . LEU A 1 47  ? -9.607  -17.700 35.110  1.00 46.54  ? 48  LEU A CB  1 
ATOM   350  C CG  . LEU A 1 47  ? -10.518 -16.532 34.753  1.00 49.60  ? 48  LEU A CG  1 
ATOM   351  C CD1 . LEU A 1 47  ? -10.338 -15.449 35.795  1.00 36.64  ? 48  LEU A CD1 1 
ATOM   352  C CD2 . LEU A 1 47  ? -10.211 -16.017 33.357  1.00 36.59  ? 48  LEU A CD2 1 
ATOM   353  N N   . PRO A 1 48  ? -6.981  -19.134 34.086  1.00 36.22  ? 49  PRO A N   1 
ATOM   354  C CA  . PRO A 1 48  ? -5.756  -19.754 34.607  1.00 38.99  ? 49  PRO A CA  1 
ATOM   355  C C   . PRO A 1 48  ? -5.791  -19.828 36.129  1.00 35.88  ? 49  PRO A C   1 
ATOM   356  O O   . PRO A 1 48  ? -6.463  -19.012 36.751  1.00 45.27  ? 49  PRO A O   1 
ATOM   357  C CB  . PRO A 1 48  ? -4.650  -18.814 34.124  1.00 26.06  ? 49  PRO A CB  1 
ATOM   358  C CG  . PRO A 1 48  ? -5.200  -18.178 32.908  1.00 31.16  ? 49  PRO A CG  1 
ATOM   359  C CD  . PRO A 1 48  ? -6.694  -18.085 33.090  1.00 36.08  ? 49  PRO A CD  1 
ATOM   360  N N   . PRO A 1 49  ? -5.092  -20.803 36.725  1.00 34.32  ? 50  PRO A N   1 
ATOM   361  C CA  . PRO A 1 49  ? -5.126  -20.910 38.187  1.00 32.01  ? 50  PRO A CA  1 
ATOM   362  C C   . PRO A 1 49  ? -4.334  -19.806 38.876  1.00 31.39  ? 50  PRO A C   1 
ATOM   363  O O   . PRO A 1 49  ? -3.237  -19.452 38.453  1.00 35.17  ? 50  PRO A O   1 
ATOM   364  C CB  . PRO A 1 49  ? -4.494  -22.278 38.456  1.00 30.68  ? 50  PRO A CB  1 
ATOM   365  C CG  . PRO A 1 49  ? -3.588  -22.507 37.295  1.00 32.68  ? 50  PRO A CG  1 
ATOM   366  C CD  . PRO A 1 49  ? -4.241  -21.837 36.109  1.00 33.97  ? 50  PRO A CD  1 
ATOM   367  N N   . GLU A 1 50  ? -4.914  -19.258 39.934  1.00 39.16  ? 51  GLU A N   1 
ATOM   368  C CA  . GLU A 1 50  ? -4.212  -18.323 40.798  1.00 43.62  ? 51  GLU A CA  1 
ATOM   369  C C   . GLU A 1 50  ? -3.602  -19.076 41.956  1.00 42.09  ? 51  GLU A C   1 
ATOM   370  O O   . GLU A 1 50  ? -4.258  -19.923 42.561  1.00 38.71  ? 51  GLU A O   1 
ATOM   371  C CB  . GLU A 1 50  ? -5.152  -17.242 41.326  1.00 60.24  ? 51  GLU A CB  1 
ATOM   372  C CG  . GLU A 1 50  ? -5.074  -15.919 40.590  1.00 88.60  ? 51  GLU A CG  1 
ATOM   373  C CD  . GLU A 1 50  ? -5.474  -14.763 41.489  1.00 107.93 ? 51  GLU A CD  1 
ATOM   374  O OE1 . GLU A 1 50  ? -5.707  -15.021 42.698  1.00 88.85  ? 51  GLU A OE1 1 
ATOM   375  O OE2 . GLU A 1 50  ? -5.549  -13.611 40.994  1.00 102.73 ? 51  GLU A OE2 1 
ATOM   376  N N   . PRO A 1 51  ? -2.339  -18.773 42.267  1.00 41.89  ? 52  PRO A N   1 
ATOM   377  C CA  . PRO A 1 51  ? -1.649  -19.403 43.395  1.00 35.55  ? 52  PRO A CA  1 
ATOM   378  C C   . PRO A 1 51  ? -2.430  -19.236 44.695  1.00 39.17  ? 52  PRO A C   1 
ATOM   379  O O   . PRO A 1 51  ? -2.977  -18.157 44.933  1.00 43.82  ? 52  PRO A O   1 
ATOM   380  C CB  . PRO A 1 51  ? -0.319  -18.656 43.445  1.00 30.91  ? 52  PRO A CB  1 
ATOM   381  C CG  . PRO A 1 51  ? -0.110  -18.192 42.050  1.00 32.67  ? 52  PRO A CG  1 
ATOM   382  C CD  . PRO A 1 51  ? -1.467  -17.847 41.531  1.00 32.17  ? 52  PRO A CD  1 
ATOM   383  N N   . LYS A 1 52  ? -2.497  -20.298 45.498  1.00 42.14  ? 53  LYS A N   1 
ATOM   384  C CA  . LYS A 1 52  ? -3.193  -20.279 46.786  1.00 44.06  ? 53  LYS A CA  1 
ATOM   385  C C   . LYS A 1 52  ? -2.668  -19.164 47.683  1.00 40.98  ? 53  LYS A C   1 
ATOM   386  O O   . LYS A 1 52  ? -1.473  -19.102 47.948  1.00 45.59  ? 53  LYS A O   1 
ATOM   387  C CB  . LYS A 1 52  ? -3.032  -21.635 47.490  1.00 37.31  ? 53  LYS A CB  1 
ATOM   388  C CG  . LYS A 1 52  ? -3.709  -21.753 48.859  1.00 35.86  ? 53  LYS A CG  1 
ATOM   389  C CD  . LYS A 1 52  ? -5.220  -21.608 48.754  1.00 39.57  ? 53  LYS A CD  1 
ATOM   390  C CE  . LYS A 1 52  ? -5.897  -21.790 50.105  1.00 42.50  ? 53  LYS A CE  1 
ATOM   391  N NZ  . LYS A 1 52  ? -7.386  -21.711 50.008  1.00 46.58  ? 53  LYS A NZ  1 
ATOM   392  N N   A GLN A 1 53  ? -3.562  -18.296 48.145  0.36 59.79  ? 54  GLN A N   1 
ATOM   393  N N   B GLN A 1 53  ? -3.541  -18.274 48.135  0.64 49.60  ? 54  GLN A N   1 
ATOM   394  C CA  A GLN A 1 53  ? -3.193  -17.256 49.103  0.36 52.87  ? 54  GLN A CA  1 
ATOM   395  C CA  B GLN A 1 53  ? -3.101  -17.212 49.040  0.64 49.27  ? 54  GLN A CA  1 
ATOM   396  C C   A GLN A 1 53  ? -2.788  -17.893 50.430  0.36 46.51  ? 54  GLN A C   1 
ATOM   397  C C   B GLN A 1 53  ? -2.846  -17.791 50.434  0.64 47.37  ? 54  GLN A C   1 
ATOM   398  O O   A GLN A 1 53  ? -3.360  -18.906 50.832  0.36 47.11  ? 54  GLN A O   1 
ATOM   399  O O   B GLN A 1 53  ? -3.586  -18.665 50.889  0.64 47.41  ? 54  GLN A O   1 
ATOM   400  C CB  A GLN A 1 53  ? -4.350  -16.271 49.322  0.36 49.18  ? 54  GLN A CB  1 
ATOM   401  C CB  B GLN A 1 53  ? -4.132  -16.079 49.103  0.64 48.71  ? 54  GLN A CB  1 
ATOM   402  C CG  A GLN A 1 53  ? -4.821  -15.549 48.067  0.36 50.45  ? 54  GLN A CG  1 
ATOM   403  C CG  B GLN A 1 53  ? -4.259  -15.273 47.815  0.64 50.78  ? 54  GLN A CG  1 
ATOM   404  C CD  A GLN A 1 53  ? -5.968  -14.583 48.334  0.36 53.40  ? 54  GLN A CD  1 
ATOM   405  C CD  B GLN A 1 53  ? -3.058  -14.378 47.541  0.64 56.19  ? 54  GLN A CD  1 
ATOM   406  O OE1 A GLN A 1 53  ? -6.007  -13.914 49.370  0.36 50.22  ? 54  GLN A OE1 1 
ATOM   407  O OE1 B GLN A 1 53  ? -2.784  -13.437 48.296  0.64 48.97  ? 54  GLN A OE1 1 
ATOM   408  N NE2 A GLN A 1 53  ? -6.911  -14.510 47.397  0.36 47.41  ? 54  GLN A NE2 1 
ATOM   409  N NE2 B GLN A 1 53  ? -2.342  -14.663 46.448  0.64 44.66  ? 54  GLN A NE2 1 
ATOM   410  N N   . PRO A 1 54  ? -1.792  -17.306 51.114  1.00 46.08  ? 55  PRO A N   1 
ATOM   411  C CA  . PRO A 1 54  ? -1.360  -17.829 52.424  1.00 49.80  ? 55  PRO A CA  1 
ATOM   412  C C   . PRO A 1 54  ? -2.472  -17.876 53.471  1.00 43.65  ? 55  PRO A C   1 
ATOM   413  O O   . PRO A 1 54  ? -3.291  -16.964 53.564  1.00 42.82  ? 55  PRO A O   1 
ATOM   414  C CB  . PRO A 1 54  ? -0.262  -16.847 52.850  1.00 34.46  ? 55  PRO A CB  1 
ATOM   415  C CG  . PRO A 1 54  ? 0.267   -16.301 51.569  1.00 44.41  ? 55  PRO A CG  1 
ATOM   416  C CD  . PRO A 1 54  ? -0.936  -16.199 50.654  1.00 44.53  ? 55  PRO A CD  1 
ATOM   417  N N   . TRP A 1 55  ? -2.495  -18.958 54.239  1.00 43.84  ? 56  TRP A N   1 
ATOM   418  C CA  . TRP A 1 55  ? -3.496  -19.167 55.279  1.00 39.63  ? 56  TRP A CA  1 
ATOM   419  C C   . TRP A 1 55  ? -2.859  -19.138 56.669  1.00 47.69  ? 56  TRP A C   1 
ATOM   420  O O   . TRP A 1 55  ? -1.640  -19.313 56.826  1.00 42.97  ? 56  TRP A O   1 
ATOM   421  C CB  . TRP A 1 55  ? -4.220  -20.505 55.072  1.00 37.70  ? 56  TRP A CB  1 
ATOM   422  C CG  . TRP A 1 55  ? -3.294  -21.698 55.168  1.00 45.16  ? 56  TRP A CG  1 
ATOM   423  C CD1 . TRP A 1 55  ? -2.968  -22.404 56.296  1.00 45.35  ? 56  TRP A CD1 1 
ATOM   424  C CD2 . TRP A 1 55  ? -2.562  -22.301 54.097  1.00 41.05  ? 56  TRP A CD2 1 
ATOM   425  N NE1 . TRP A 1 55  ? -2.083  -23.414 55.988  1.00 41.43  ? 56  TRP A NE1 1 
ATOM   426  C CE2 . TRP A 1 55  ? -1.821  -23.372 54.643  1.00 41.63  ? 56  TRP A CE2 1 
ATOM   427  C CE3 . TRP A 1 55  ? -2.466  -22.048 52.728  1.00 32.56  ? 56  TRP A CE3 1 
ATOM   428  C CZ2 . TRP A 1 55  ? -1.002  -24.179 53.868  1.00 36.13  ? 56  TRP A CZ2 1 
ATOM   429  C CZ3 . TRP A 1 55  ? -1.651  -22.846 51.968  1.00 32.79  ? 56  TRP A CZ3 1 
ATOM   430  C CH2 . TRP A 1 55  ? -0.928  -23.896 52.536  1.00 32.73  ? 56  TRP A CH2 1 
ATOM   431  N N   . SER A 1 56  ? -3.692  -18.914 57.677  1.00 52.41  ? 57  SER A N   1 
ATOM   432  C CA  . SER A 1 56  ? -3.243  -18.962 59.058  1.00 53.19  ? 57  SER A CA  1 
ATOM   433  C C   . SER A 1 56  ? -3.837  -20.194 59.708  1.00 60.58  ? 57  SER A C   1 
ATOM   434  O O   . SER A 1 56  ? -4.848  -20.735 59.242  1.00 57.50  ? 57  SER A O   1 
ATOM   435  C CB  . SER A 1 56  ? -3.652  -17.700 59.814  1.00 57.70  ? 57  SER A CB  1 
ATOM   436  O OG  . SER A 1 56  ? -5.062  -17.553 59.800  1.00 62.70  ? 57  SER A OG  1 
ATOM   437  N N   . GLY A 1 57  ? -3.214  -20.646 60.786  1.00 56.19  ? 58  GLY A N   1 
ATOM   438  C CA  . GLY A 1 57  ? -3.670  -21.865 61.414  1.00 57.78  ? 58  GLY A CA  1 
ATOM   439  C C   . GLY A 1 57  ? -3.202  -23.058 60.612  1.00 54.23  ? 58  GLY A C   1 
ATOM   440  O O   . GLY A 1 57  ? -2.329  -22.936 59.751  1.00 51.80  ? 58  GLY A O   1 
ATOM   441  N N   . VAL A 1 58  ? -3.782  -24.217 60.892  1.00 53.19  ? 59  VAL A N   1 
ATOM   442  C CA  . VAL A 1 58  ? -3.265  -25.461 60.342  1.00 48.01  ? 59  VAL A CA  1 
ATOM   443  C C   . VAL A 1 58  ? -4.276  -26.103 59.409  1.00 52.59  ? 59  VAL A C   1 
ATOM   444  O O   . VAL A 1 58  ? -5.384  -26.448 59.833  1.00 54.90  ? 59  VAL A O   1 
ATOM   445  C CB  . VAL A 1 58  ? -2.892  -26.455 61.463  1.00 47.10  ? 59  VAL A CB  1 
ATOM   446  C CG1 . VAL A 1 58  ? -2.212  -27.695 60.879  1.00 44.54  ? 59  VAL A CG1 1 
ATOM   447  C CG2 . VAL A 1 58  ? -1.997  -25.778 62.497  1.00 41.40  ? 59  VAL A CG2 1 
ATOM   448  N N   . VAL A 1 59  ? -3.894  -26.245 58.139  1.00 45.73  ? 60  VAL A N   1 
ATOM   449  C CA  . VAL A 1 59  ? -4.744  -26.902 57.147  1.00 37.53  ? 60  VAL A CA  1 
ATOM   450  C C   . VAL A 1 59  ? -4.741  -28.401 57.394  1.00 45.28  ? 60  VAL A C   1 
ATOM   451  O O   . VAL A 1 59  ? -3.683  -29.010 57.548  1.00 44.86  ? 60  VAL A O   1 
ATOM   452  C CB  . VAL A 1 59  ? -4.282  -26.607 55.703  1.00 41.66  ? 60  VAL A CB  1 
ATOM   453  C CG1 . VAL A 1 59  ? -4.747  -27.697 54.737  1.00 38.49  ? 60  VAL A CG1 1 
ATOM   454  C CG2 . VAL A 1 59  ? -4.775  -25.248 55.259  1.00 37.58  ? 60  VAL A CG2 1 
ATOM   455  N N   . ASP A 1 60  ? -5.932  -28.983 57.462  1.00 51.38  ? 61  ASP A N   1 
ATOM   456  C CA  . ASP A 1 60  ? -6.076  -30.420 57.651  1.00 53.35  ? 61  ASP A CA  1 
ATOM   457  C C   . ASP A 1 60  ? -5.736  -31.143 56.349  1.00 49.84  ? 61  ASP A C   1 
ATOM   458  O O   . ASP A 1 60  ? -6.451  -31.021 55.353  1.00 51.64  ? 61  ASP A O   1 
ATOM   459  C CB  . ASP A 1 60  ? -7.504  -30.743 58.115  1.00 69.84  ? 61  ASP A CB  1 
ATOM   460  C CG  . ASP A 1 60  ? -7.827  -32.227 58.068  1.00 74.59  ? 61  ASP A CG  1 
ATOM   461  O OD1 . ASP A 1 60  ? -6.904  -33.057 58.240  1.00 74.57  ? 61  ASP A OD1 1 
ATOM   462  O OD2 . ASP A 1 60  ? -9.020  -32.559 57.863  1.00 80.79  ? 61  ASP A OD2 1 
ATOM   463  N N   . ALA A 1 61  ? -4.634  -31.881 56.350  1.00 46.68  ? 62  ALA A N   1 
ATOM   464  C CA  . ALA A 1 61  ? -4.222  -32.598 55.150  1.00 44.68  ? 62  ALA A CA  1 
ATOM   465  C C   . ALA A 1 61  ? -4.219  -34.108 55.366  1.00 44.66  ? 62  ALA A C   1 
ATOM   466  O O   . ALA A 1 61  ? -3.232  -34.780 55.062  1.00 40.57  ? 62  ALA A O   1 
ATOM   467  C CB  . ALA A 1 61  ? -2.851  -32.131 54.701  1.00 40.81  ? 62  ALA A CB  1 
ATOM   468  N N   . THR A 1 62  ? -5.323  -34.647 55.877  1.00 44.63  ? 63  THR A N   1 
ATOM   469  C CA  . THR A 1 62  ? -5.347  -36.052 56.274  1.00 50.28  ? 63  THR A CA  1 
ATOM   470  C C   . THR A 1 62  ? -6.256  -36.911 55.400  1.00 50.35  ? 63  THR A C   1 
ATOM   471  O O   . THR A 1 62  ? -6.321  -38.132 55.567  1.00 51.06  ? 63  THR A O   1 
ATOM   472  C CB  . THR A 1 62  ? -5.788  -36.193 57.729  1.00 50.06  ? 63  THR A CB  1 
ATOM   473  O OG1 . THR A 1 62  ? -7.035  -35.514 57.903  1.00 51.28  ? 63  THR A OG1 1 
ATOM   474  C CG2 . THR A 1 62  ? -4.754  -35.569 58.646  1.00 42.72  ? 63  THR A CG2 1 
ATOM   475  N N   . THR A 1 63  ? -6.944  -36.270 54.464  1.00 45.50  ? 64  THR A N   1 
ATOM   476  C CA  . THR A 1 63  ? -7.865  -36.967 53.585  1.00 45.90  ? 64  THR A CA  1 
ATOM   477  C C   . THR A 1 63  ? -7.858  -36.353 52.176  1.00 40.89  ? 64  THR A C   1 
ATOM   478  O O   . THR A 1 63  ? -7.498  -35.190 52.008  1.00 42.96  ? 64  THR A O   1 
ATOM   479  C CB  . THR A 1 63  ? -9.305  -36.954 54.173  1.00 45.32  ? 64  THR A CB  1 
ATOM   480  O OG1 . THR A 1 63  ? -10.164 -37.776 53.366  1.00 79.13  ? 64  THR A OG1 1 
ATOM   481  C CG2 . THR A 1 63  ? -9.863  -35.530 54.257  1.00 38.37  ? 64  THR A CG2 1 
ATOM   482  N N   . PHE A 1 64  ? -8.247  -37.137 51.169  1.00 40.78  ? 65  PHE A N   1 
ATOM   483  C CA  . PHE A 1 64  ? -8.362  -36.628 49.805  1.00 32.56  ? 65  PHE A CA  1 
ATOM   484  C C   . PHE A 1 64  ? -9.449  -35.565 49.700  1.00 34.47  ? 65  PHE A C   1 
ATOM   485  O O   . PHE A 1 64  ? -10.492 -35.658 50.348  1.00 47.71  ? 65  PHE A O   1 
ATOM   486  C CB  . PHE A 1 64  ? -8.652  -37.762 48.819  1.00 30.59  ? 65  PHE A CB  1 
ATOM   487  C CG  . PHE A 1 64  ? -7.466  -38.628 48.528  1.00 35.79  ? 65  PHE A CG  1 
ATOM   488  C CD1 . PHE A 1 64  ? -6.351  -38.105 47.883  1.00 32.23  ? 65  PHE A CD1 1 
ATOM   489  C CD2 . PHE A 1 64  ? -7.465  -39.970 48.875  1.00 37.78  ? 65  PHE A CD2 1 
ATOM   490  C CE1 . PHE A 1 64  ? -5.248  -38.902 47.607  1.00 28.86  ? 65  PHE A CE1 1 
ATOM   491  C CE2 . PHE A 1 64  ? -6.361  -40.771 48.606  1.00 34.37  ? 65  PHE A CE2 1 
ATOM   492  C CZ  . PHE A 1 64  ? -5.253  -40.232 47.971  1.00 33.26  ? 65  PHE A CZ  1 
ATOM   493  N N   . GLN A 1 65  ? -9.199  -34.560 48.872  1.00 33.65  ? 66  GLN A N   1 
ATOM   494  C CA  . GLN A 1 65  ? -10.177 -33.517 48.603  1.00 36.74  ? 66  GLN A CA  1 
ATOM   495  C C   . GLN A 1 65  ? -11.051 -33.842 47.393  1.00 37.08  ? 66  GLN A C   1 
ATOM   496  O O   . GLN A 1 65  ? -10.885 -34.877 46.758  1.00 34.71  ? 66  GLN A O   1 
ATOM   497  C CB  . GLN A 1 65  ? -9.472  -32.184 48.388  1.00 36.79  ? 66  GLN A CB  1 
ATOM   498  C CG  . GLN A 1 65  ? -9.225  -31.418 49.660  1.00 44.34  ? 66  GLN A CG  1 
ATOM   499  C CD  . GLN A 1 65  ? -10.482 -30.771 50.186  1.00 46.53  ? 66  GLN A CD  1 
ATOM   500  O OE1 . GLN A 1 65  ? -11.499 -30.702 49.495  1.00 47.31  ? 66  GLN A OE1 1 
ATOM   501  N NE2 . GLN A 1 65  ? -10.419 -30.286 51.414  1.00 54.94  ? 66  GLN A NE2 1 
ATOM   502  N N   . SER A 1 66  ? -11.969 -32.937 47.075  1.00 36.32  ? 67  SER A N   1 
ATOM   503  C CA  . SER A 1 66  ? -12.948 -33.151 46.014  1.00 36.10  ? 67  SER A CA  1 
ATOM   504  C C   . SER A 1 66  ? -12.357 -33.484 44.637  1.00 39.81  ? 67  SER A C   1 
ATOM   505  O O   . SER A 1 66  ? -11.223 -33.125 44.318  1.00 39.26  ? 67  SER A O   1 
ATOM   506  C CB  . SER A 1 66  ? -13.835 -31.911 45.894  1.00 40.12  ? 67  SER A CB  1 
ATOM   507  O OG  . SER A 1 66  ? -14.449 -31.613 47.135  1.00 52.52  ? 67  SER A OG  1 
ATOM   508  N N   . VAL A 1 67  ? -13.156 -34.179 43.832  1.00 38.75  ? 68  VAL A N   1 
ATOM   509  C CA  . VAL A 1 67  ? -12.830 -34.483 42.443  1.00 33.27  ? 68  VAL A CA  1 
ATOM   510  C C   . VAL A 1 67  ? -13.315 -33.351 41.539  1.00 32.23  ? 68  VAL A C   1 
ATOM   511  O O   . VAL A 1 67  ? -14.384 -32.796 41.761  1.00 33.66  ? 68  VAL A O   1 
ATOM   512  C CB  . VAL A 1 67  ? -13.473 -35.820 42.007  1.00 31.57  ? 68  VAL A CB  1 
ATOM   513  C CG1 . VAL A 1 67  ? -13.330 -36.037 40.519  1.00 26.35  ? 68  VAL A CG1 1 
ATOM   514  C CG2 . VAL A 1 67  ? -12.853 -36.976 42.774  1.00 29.67  ? 68  VAL A CG2 1 
ATOM   515  N N   . CYS A 1 68  ? -12.530 -32.985 40.535  1.00 29.74  ? 69  CYS A N   1 
ATOM   516  C CA  . CYS A 1 68  ? -12.973 -31.956 39.603  1.00 37.02  ? 69  CYS A CA  1 
ATOM   517  C C   . CYS A 1 68  ? -14.186 -32.452 38.848  1.00 37.81  ? 69  CYS A C   1 
ATOM   518  O O   . CYS A 1 68  ? -14.269 -33.636 38.525  1.00 44.88  ? 69  CYS A O   1 
ATOM   519  C CB  . CYS A 1 68  ? -11.847 -31.572 38.641  1.00 36.13  ? 69  CYS A CB  1 
ATOM   520  S SG  . CYS A 1 68  ? -10.456 -30.763 39.481  1.00 42.58  ? 69  CYS A SG  1 
ATOM   521  N N   . TYR A 1 69  ? -15.128 -31.551 38.581  1.00 41.05  ? 70  TYR A N   1 
ATOM   522  C CA  . TYR A 1 69  ? -16.371 -31.912 37.896  1.00 39.16  ? 70  TYR A CA  1 
ATOM   523  C C   . TYR A 1 69  ? -16.149 -32.644 36.579  1.00 35.86  ? 70  TYR A C   1 
ATOM   524  O O   . TYR A 1 69  ? -15.375 -32.201 35.737  1.00 43.42  ? 70  TYR A O   1 
ATOM   525  C CB  . TYR A 1 69  ? -17.210 -30.671 37.631  1.00 40.91  ? 70  TYR A CB  1 
ATOM   526  C CG  . TYR A 1 69  ? -18.428 -30.591 38.505  1.00 42.84  ? 70  TYR A CG  1 
ATOM   527  C CD1 . TYR A 1 69  ? -18.401 -29.883 39.695  1.00 44.90  ? 70  TYR A CD1 1 
ATOM   528  C CD2 . TYR A 1 69  ? -19.609 -31.228 38.142  1.00 45.57  ? 70  TYR A CD2 1 
ATOM   529  C CE1 . TYR A 1 69  ? -19.517 -29.803 40.503  1.00 57.02  ? 70  TYR A CE1 1 
ATOM   530  C CE2 . TYR A 1 69  ? -20.734 -31.158 38.944  1.00 56.50  ? 70  TYR A CE2 1 
ATOM   531  C CZ  . TYR A 1 69  ? -20.681 -30.442 40.128  1.00 60.91  ? 70  TYR A CZ  1 
ATOM   532  O OH  . TYR A 1 69  ? -21.789 -30.358 40.945  1.00 64.69  ? 70  TYR A OH  1 
ATOM   533  N N   . GLN A 1 70  ? -16.858 -33.752 36.400  1.00 34.59  ? 71  GLN A N   1 
ATOM   534  C CA  . GLN A 1 70  ? -16.663 -34.606 35.239  1.00 32.38  ? 71  GLN A CA  1 
ATOM   535  C C   . GLN A 1 70  ? -17.838 -35.542 35.053  1.00 39.89  ? 71  GLN A C   1 
ATOM   536  O O   . GLN A 1 70  ? -18.546 -35.845 36.013  1.00 39.97  ? 71  GLN A O   1 
ATOM   537  C CB  . GLN A 1 70  ? -15.386 -35.413 35.396  1.00 35.89  ? 71  GLN A CB  1 
ATOM   538  C CG  . GLN A 1 70  ? -15.400 -36.343 36.593  1.00 35.10  ? 71  GLN A CG  1 
ATOM   539  C CD  . GLN A 1 70  ? -14.032 -36.893 36.880  1.00 33.25  ? 71  GLN A CD  1 
ATOM   540  O OE1 . GLN A 1 70  ? -13.747 -38.064 36.637  1.00 36.62  ? 71  GLN A OE1 1 
ATOM   541  N NE2 . GLN A 1 70  ? -13.166 -36.042 37.383  1.00 31.28  ? 71  GLN A NE2 1 
ATOM   542  N N   . TYR A 1 71  ? -18.050 -35.994 33.820  1.00 43.23  ? 72  TYR A N   1 
ATOM   543  C CA  . TYR A 1 71  ? -19.064 -37.002 33.560  1.00 40.59  ? 72  TYR A CA  1 
ATOM   544  C C   . TYR A 1 71  ? -18.723 -38.277 34.326  1.00 45.06  ? 72  TYR A C   1 
ATOM   545  O O   . TYR A 1 71  ? -17.554 -38.654 34.417  1.00 47.93  ? 72  TYR A O   1 
ATOM   546  C CB  . TYR A 1 71  ? -19.183 -37.293 32.058  1.00 50.95  ? 72  TYR A CB  1 
ATOM   547  C CG  . TYR A 1 71  ? -20.101 -38.469 31.753  1.00 65.06  ? 72  TYR A CG  1 
ATOM   548  C CD1 . TYR A 1 71  ? -21.495 -38.327 31.794  1.00 62.33  ? 72  TYR A CD1 1 
ATOM   549  C CD2 . TYR A 1 71  ? -19.577 -39.725 31.444  1.00 58.99  ? 72  TYR A CD2 1 
ATOM   550  C CE1 . TYR A 1 71  ? -22.345 -39.408 31.530  1.00 65.10  ? 72  TYR A CE1 1 
ATOM   551  C CE2 . TYR A 1 71  ? -20.413 -40.811 31.180  1.00 74.97  ? 72  TYR A CE2 1 
ATOM   552  C CZ  . TYR A 1 71  ? -21.797 -40.651 31.221  1.00 82.65  ? 72  TYR A CZ  1 
ATOM   553  O OH  . TYR A 1 71  ? -22.624 -41.734 30.957  1.00 65.37  ? 72  TYR A OH  1 
ATOM   554  N N   . VAL A 1 72  ? -19.736 -38.927 34.890  1.00 40.33  ? 73  VAL A N   1 
ATOM   555  C CA  . VAL A 1 72  ? -19.530 -40.212 35.545  1.00 46.09  ? 73  VAL A CA  1 
ATOM   556  C C   . VAL A 1 72  ? -20.017 -41.365 34.675  1.00 56.97  ? 73  VAL A C   1 
ATOM   557  O O   . VAL A 1 72  ? -21.195 -41.448 34.327  1.00 56.49  ? 73  VAL A O   1 
ATOM   558  C CB  . VAL A 1 72  ? -20.240 -40.290 36.902  1.00 41.26  ? 73  VAL A CB  1 
ATOM   559  C CG1 . VAL A 1 72  ? -19.900 -41.608 37.579  1.00 41.18  ? 73  VAL A CG1 1 
ATOM   560  C CG2 . VAL A 1 72  ? -19.828 -39.137 37.770  1.00 36.88  ? 73  VAL A CG2 1 
ATOM   561  N N   . ASP A 1 73  ? -19.099 -42.265 34.345  1.00 59.58  ? 74  ASP A N   1 
ATOM   562  C CA  . ASP A 1 73  ? -19.387 -43.372 33.444  1.00 62.76  ? 74  ASP A CA  1 
ATOM   563  C C   . ASP A 1 73  ? -20.432 -44.350 33.996  1.00 58.18  ? 74  ASP A C   1 
ATOM   564  O O   . ASP A 1 73  ? -20.222 -44.972 35.035  1.00 54.75  ? 74  ASP A O   1 
ATOM   565  C CB  . ASP A 1 73  ? -18.098 -44.119 33.129  1.00 53.03  ? 74  ASP A CB  1 
ATOM   566  C CG  . ASP A 1 73  ? -18.321 -45.291 32.209  1.00 63.92  ? 74  ASP A CG  1 
ATOM   567  O OD1 . ASP A 1 73  ? -17.727 -46.356 32.485  1.00 62.71  ? 74  ASP A OD1 1 
ATOM   568  O OD2 . ASP A 1 73  ? -19.082 -45.148 31.214  1.00 64.91  ? 74  ASP A OD2 1 
ATOM   569  N N   . THR A 1 74  ? -21.547 -44.492 33.279  1.00 67.83  ? 75  THR A N   1 
ATOM   570  C CA  . THR A 1 74  ? -22.651 -45.357 33.711  1.00 71.84  ? 75  THR A CA  1 
ATOM   571  C C   . THR A 1 74  ? -22.931 -46.502 32.739  1.00 66.84  ? 75  THR A C   1 
ATOM   572  O O   . THR A 1 74  ? -24.073 -46.955 32.621  1.00 72.27  ? 75  THR A O   1 
ATOM   573  C CB  . THR A 1 74  ? -23.966 -44.553 33.894  1.00 70.31  ? 75  THR A CB  1 
ATOM   574  O OG1 . THR A 1 74  ? -24.183 -43.698 32.758  1.00 60.72  ? 75  THR A OG1 1 
ATOM   575  C CG2 . THR A 1 74  ? -23.908 -43.713 35.159  1.00 55.27  ? 75  THR A CG2 1 
ATOM   576  N N   . LEU A 1 75  ? -21.893 -46.974 32.055  1.00 62.18  ? 76  LEU A N   1 
ATOM   577  C CA  . LEU A 1 75  ? -22.051 -48.026 31.052  1.00 70.19  ? 76  LEU A CA  1 
ATOM   578  C C   . LEU A 1 75  ? -22.335 -49.389 31.686  1.00 69.94  ? 76  LEU A C   1 
ATOM   579  O O   . LEU A 1 75  ? -23.243 -50.100 31.257  1.00 70.19  ? 76  LEU A O   1 
ATOM   580  C CB  . LEU A 1 75  ? -20.807 -48.112 30.166  1.00 62.83  ? 76  LEU A CB  1 
ATOM   581  C CG  . LEU A 1 75  ? -20.843 -49.153 29.050  1.00 62.62  ? 76  LEU A CG  1 
ATOM   582  C CD1 . LEU A 1 75  ? -21.961 -48.835 28.062  1.00 58.39  ? 76  LEU A CD1 1 
ATOM   583  C CD2 . LEU A 1 75  ? -19.492 -49.219 28.348  1.00 66.18  ? 76  LEU A CD2 1 
ATOM   584  N N   . TYR A 1 76  ? -21.553 -49.748 32.700  1.00 55.04  ? 77  TYR A N   1 
ATOM   585  C CA  . TYR A 1 76  ? -21.778 -50.988 33.433  1.00 55.53  ? 77  TYR A CA  1 
ATOM   586  C C   . TYR A 1 76  ? -21.843 -50.712 34.929  1.00 65.55  ? 77  TYR A C   1 
ATOM   587  O O   . TYR A 1 76  ? -20.899 -51.027 35.655  1.00 61.57  ? 77  TYR A O   1 
ATOM   588  C CB  . TYR A 1 76  ? -20.672 -52.015 33.147  1.00 57.57  ? 77  TYR A CB  1 
ATOM   589  C CG  . TYR A 1 76  ? -20.561 -52.469 31.703  1.00 70.43  ? 77  TYR A CG  1 
ATOM   590  C CD1 . TYR A 1 76  ? -21.580 -53.196 31.100  1.00 69.14  ? 77  TYR A CD1 1 
ATOM   591  C CD2 . TYR A 1 76  ? -19.424 -52.193 30.950  1.00 71.36  ? 77  TYR A CD2 1 
ATOM   592  C CE1 . TYR A 1 76  ? -21.478 -53.621 29.784  1.00 71.24  ? 77  TYR A CE1 1 
ATOM   593  C CE2 . TYR A 1 76  ? -19.313 -52.612 29.632  1.00 65.49  ? 77  TYR A CE2 1 
ATOM   594  C CZ  . TYR A 1 76  ? -20.343 -53.326 29.054  1.00 66.67  ? 77  TYR A CZ  1 
ATOM   595  O OH  . TYR A 1 76  ? -20.243 -53.751 27.746  1.00 68.60  ? 77  TYR A OH  1 
ATOM   596  N N   . PRO A 1 77  ? -22.954 -50.119 35.400  1.00 73.61  ? 78  PRO A N   1 
ATOM   597  C CA  . PRO A 1 77  ? -23.037 -49.724 36.816  1.00 62.00  ? 78  PRO A CA  1 
ATOM   598  C C   . PRO A 1 77  ? -22.731 -50.881 37.765  1.00 62.94  ? 78  PRO A C   1 
ATOM   599  O O   . PRO A 1 77  ? -23.210 -51.997 37.552  1.00 62.71  ? 78  PRO A O   1 
ATOM   600  C CB  . PRO A 1 77  ? -24.486 -49.243 36.970  1.00 52.65  ? 78  PRO A CB  1 
ATOM   601  C CG  . PRO A 1 77  ? -25.204 -49.734 35.756  1.00 63.70  ? 78  PRO A CG  1 
ATOM   602  C CD  . PRO A 1 77  ? -24.190 -49.807 34.664  1.00 59.06  ? 78  PRO A CD  1 
ATOM   603  N N   . GLY A 1 78  ? -21.904 -50.615 38.775  1.00 66.51  ? 79  GLY A N   1 
ATOM   604  C CA  . GLY A 1 78  ? -21.533 -51.616 39.761  1.00 52.07  ? 79  GLY A CA  1 
ATOM   605  C C   . GLY A 1 78  ? -20.374 -52.516 39.359  1.00 55.27  ? 79  GLY A C   1 
ATOM   606  O O   . GLY A 1 78  ? -19.777 -53.183 40.205  1.00 54.42  ? 79  GLY A O   1 
ATOM   607  N N   . PHE A 1 79  ? -20.057 -52.541 38.067  1.00 55.80  ? 80  PHE A N   1 
ATOM   608  C CA  . PHE A 1 79  ? -18.937 -53.334 37.559  1.00 53.51  ? 80  PHE A CA  1 
ATOM   609  C C   . PHE A 1 79  ? -17.582 -52.782 38.014  1.00 50.11  ? 80  PHE A C   1 
ATOM   610  O O   . PHE A 1 79  ? -17.291 -51.602 37.819  1.00 53.76  ? 80  PHE A O   1 
ATOM   611  C CB  . PHE A 1 79  ? -18.996 -53.390 36.032  1.00 49.72  ? 80  PHE A CB  1 
ATOM   612  C CG  . PHE A 1 79  ? -17.869 -54.143 35.403  1.00 48.00  ? 80  PHE A CG  1 
ATOM   613  C CD1 . PHE A 1 79  ? -17.540 -55.419 35.839  1.00 46.04  ? 80  PHE A CD1 1 
ATOM   614  C CD2 . PHE A 1 79  ? -17.148 -53.585 34.354  1.00 51.08  ? 80  PHE A CD2 1 
ATOM   615  C CE1 . PHE A 1 79  ? -16.502 -56.123 35.250  1.00 52.09  ? 80  PHE A CE1 1 
ATOM   616  C CE2 . PHE A 1 79  ? -16.113 -54.281 33.754  1.00 45.62  ? 80  PHE A CE2 1 
ATOM   617  C CZ  . PHE A 1 79  ? -15.789 -55.554 34.201  1.00 57.58  ? 80  PHE A CZ  1 
ATOM   618  N N   . GLU A 1 80  ? -16.754 -53.644 38.600  1.00 49.13  ? 81  GLU A N   1 
ATOM   619  C CA  . GLU A 1 80  ? -15.462 -53.231 39.148  1.00 52.13  ? 81  GLU A CA  1 
ATOM   620  C C   . GLU A 1 80  ? -14.568 -52.551 38.104  1.00 59.67  ? 81  GLU A C   1 
ATOM   621  O O   . GLU A 1 80  ? -13.897 -51.556 38.394  1.00 52.99  ? 81  GLU A O   1 
ATOM   622  C CB  . GLU A 1 80  ? -14.738 -54.437 39.755  1.00 57.12  ? 81  GLU A CB  1 
ATOM   623  C CG  . GLU A 1 80  ? -13.928 -54.107 41.007  1.00 85.89  ? 81  GLU A CG  1 
ATOM   624  C CD  . GLU A 1 80  ? -12.419 -54.183 40.787  1.00 106.28 ? 81  GLU A CD  1 
ATOM   625  O OE1 . GLU A 1 80  ? -11.953 -55.158 40.148  1.00 104.02 ? 81  GLU A OE1 1 
ATOM   626  O OE2 . GLU A 1 80  ? -11.704 -53.263 41.259  1.00 89.95  ? 81  GLU A OE2 1 
ATOM   627  N N   . GLY A 1 81  ? -14.582 -53.087 36.887  1.00 57.81  ? 82  GLY A N   1 
ATOM   628  C CA  . GLY A 1 81  ? -13.744 -52.593 35.812  1.00 47.19  ? 82  GLY A CA  1 
ATOM   629  C C   . GLY A 1 81  ? -13.998 -51.153 35.399  1.00 53.54  ? 82  GLY A C   1 
ATOM   630  O O   . GLY A 1 81  ? -13.091 -50.482 34.910  1.00 52.78  ? 82  GLY A O   1 
ATOM   631  N N   . THR A 1 82  ? -15.222 -50.668 35.570  1.00 42.18  ? 83  THR A N   1 
ATOM   632  C CA  . THR A 1 82  ? -15.493 -49.280 35.228  1.00 50.49  ? 83  THR A CA  1 
ATOM   633  C C   . THR A 1 82  ? -15.468 -48.377 36.461  1.00 56.43  ? 83  THR A C   1 
ATOM   634  O O   . THR A 1 82  ? -15.022 -47.232 36.382  1.00 51.27  ? 83  THR A O   1 
ATOM   635  C CB  . THR A 1 82  ? -16.844 -49.113 34.523  1.00 47.50  ? 83  THR A CB  1 
ATOM   636  O OG1 . THR A 1 82  ? -17.869 -49.718 35.316  1.00 63.77  ? 83  THR A OG1 1 
ATOM   637  C CG2 . THR A 1 82  ? -16.813 -49.752 33.153  1.00 45.74  ? 83  THR A CG2 1 
ATOM   638  N N   . GLU A 1 83  ? -15.940 -48.894 37.595  1.00 52.49  ? 84  GLU A N   1 
ATOM   639  C CA  . GLU A 1 83  ? -16.083 -48.081 38.797  1.00 53.28  ? 84  GLU A CA  1 
ATOM   640  C C   . GLU A 1 83  ? -14.729 -47.653 39.354  1.00 52.34  ? 84  GLU A C   1 
ATOM   641  O O   . GLU A 1 83  ? -14.613 -46.589 39.974  1.00 46.44  ? 84  GLU A O   1 
ATOM   642  C CB  . GLU A 1 83  ? -16.879 -48.829 39.877  1.00 56.10  ? 84  GLU A CB  1 
ATOM   643  C CG  . GLU A 1 83  ? -18.373 -49.034 39.564  1.00 65.43  ? 84  GLU A CG  1 
ATOM   644  C CD  . GLU A 1 83  ? -19.177 -47.732 39.410  1.00 79.59  ? 84  GLU A CD  1 
ATOM   645  O OE1 . GLU A 1 83  ? -20.300 -47.796 38.847  1.00 70.74  ? 84  GLU A OE1 1 
ATOM   646  O OE2 . GLU A 1 83  ? -18.704 -46.657 39.857  1.00 75.15  ? 84  GLU A OE2 1 
ATOM   647  N N   . MET A 1 84  ? -13.704 -48.463 39.110  1.00 44.98  ? 85  MET A N   1 
ATOM   648  C CA  . MET A 1 84  ? -12.374 -48.171 39.631  1.00 39.35  ? 85  MET A CA  1 
ATOM   649  C C   . MET A 1 84  ? -11.778 -46.905 39.022  1.00 39.27  ? 85  MET A C   1 
ATOM   650  O O   . MET A 1 84  ? -10.769 -46.418 39.506  1.00 40.53  ? 85  MET A O   1 
ATOM   651  C CB  . MET A 1 84  ? -11.435 -49.337 39.380  1.00 41.20  ? 85  MET A CB  1 
ATOM   652  C CG  . MET A 1 84  ? -11.114 -49.522 37.907  1.00 47.97  ? 85  MET A CG  1 
ATOM   653  S SD  . MET A 1 84  ? -10.019 -50.920 37.599  1.00 54.30  ? 85  MET A SD  1 
ATOM   654  C CE  . MET A 1 84  ? -8.497  -50.346 38.368  1.00 40.04  ? 85  MET A CE  1 
ATOM   655  N N   . TRP A 1 85  ? -12.400 -46.381 37.968  1.00 37.61  ? 86  TRP A N   1 
ATOM   656  C CA  . TRP A 1 85  ? -11.941 -45.149 37.329  1.00 36.90  ? 86  TRP A CA  1 
ATOM   657  C C   . TRP A 1 85  ? -12.856 -43.996 37.666  1.00 33.04  ? 86  TRP A C   1 
ATOM   658  O O   . TRP A 1 85  ? -12.573 -42.847 37.341  1.00 48.19  ? 86  TRP A O   1 
ATOM   659  C CB  . TRP A 1 85  ? -11.856 -45.311 35.800  1.00 34.40  ? 86  TRP A CB  1 
ATOM   660  C CG  . TRP A 1 85  ? -11.016 -46.473 35.396  1.00 37.39  ? 86  TRP A CG  1 
ATOM   661  C CD1 . TRP A 1 85  ? -11.446 -47.632 34.833  1.00 40.37  ? 86  TRP A CD1 1 
ATOM   662  C CD2 . TRP A 1 85  ? -9.603  -46.611 35.573  1.00 38.04  ? 86  TRP A CD2 1 
ATOM   663  N NE1 . TRP A 1 85  ? -10.388 -48.484 34.627  1.00 41.39  ? 86  TRP A NE1 1 
ATOM   664  C CE2 . TRP A 1 85  ? -9.243  -47.882 35.075  1.00 41.62  ? 86  TRP A CE2 1 
ATOM   665  C CE3 . TRP A 1 85  ? -8.604  -45.782 36.095  1.00 34.72  ? 86  TRP A CE3 1 
ATOM   666  C CZ2 . TRP A 1 85  ? -7.924  -48.345 35.078  1.00 34.36  ? 86  TRP A CZ2 1 
ATOM   667  C CZ3 . TRP A 1 85  ? -7.292  -46.240 36.097  1.00 35.64  ? 86  TRP A CZ3 1 
ATOM   668  C CH2 . TRP A 1 85  ? -6.966  -47.510 35.591  1.00 36.03  ? 86  TRP A CH2 1 
ATOM   669  N N   . ASN A 1 86  ? -13.964 -44.302 38.319  1.00 40.17  ? 87  ASN A N   1 
ATOM   670  C CA  . ASN A 1 86  ? -14.952 -43.276 38.613  1.00 43.41  ? 87  ASN A CA  1 
ATOM   671  C C   . ASN A 1 86  ? -14.581 -42.448 39.845  1.00 38.51  ? 87  ASN A C   1 
ATOM   672  O O   . ASN A 1 86  ? -13.868 -42.928 40.729  1.00 35.51  ? 87  ASN A O   1 
ATOM   673  C CB  . ASN A 1 86  ? -16.325 -43.923 38.790  1.00 45.09  ? 87  ASN A CB  1 
ATOM   674  C CG  . ASN A 1 86  ? -17.028 -44.179 37.464  1.00 53.59  ? 87  ASN A CG  1 
ATOM   675  O OD1 . ASN A 1 86  ? -16.825 -43.458 36.475  1.00 51.16  ? 87  ASN A OD1 1 
ATOM   676  N ND2 . ASN A 1 86  ? -17.868 -45.209 37.440  1.00 61.30  ? 87  ASN A ND2 1 
ATOM   677  N N   . PRO A 1 87  ? -15.052 -41.194 39.897  1.00 35.84  ? 88  PRO A N   1 
ATOM   678  C CA  . PRO A 1 87  ? -14.809 -40.333 41.064  1.00 33.07  ? 88  PRO A CA  1 
ATOM   679  C C   . PRO A 1 87  ? -15.145 -41.032 42.376  1.00 37.96  ? 88  PRO A C   1 
ATOM   680  O O   . PRO A 1 87  ? -16.222 -41.602 42.495  1.00 46.24  ? 88  PRO A O   1 
ATOM   681  C CB  . PRO A 1 87  ? -15.749 -39.151 40.831  1.00 28.56  ? 88  PRO A CB  1 
ATOM   682  C CG  . PRO A 1 87  ? -15.924 -39.099 39.352  1.00 38.79  ? 88  PRO A CG  1 
ATOM   683  C CD  . PRO A 1 87  ? -15.839 -40.511 38.851  1.00 36.20  ? 88  PRO A CD  1 
ATOM   684  N N   . ASN A 1 88  ? -14.240 -41.004 43.342  1.00 37.49  ? 89  ASN A N   1 
ATOM   685  C CA  . ASN A 1 88  ? -14.536 -41.603 44.638  1.00 33.53  ? 89  ASN A CA  1 
ATOM   686  C C   . ASN A 1 88  ? -14.517 -40.574 45.776  1.00 35.91  ? 89  ASN A C   1 
ATOM   687  O O   . ASN A 1 88  ? -14.321 -40.923 46.934  1.00 37.19  ? 89  ASN A O   1 
ATOM   688  C CB  . ASN A 1 88  ? -13.557 -42.735 44.930  1.00 36.17  ? 89  ASN A CB  1 
ATOM   689  C CG  . ASN A 1 88  ? -12.133 -42.253 44.989  1.00 44.64  ? 89  ASN A CG  1 
ATOM   690  O OD1 . ASN A 1 88  ? -11.800 -41.219 44.408  1.00 40.90  ? 89  ASN A OD1 1 
ATOM   691  N ND2 . ASN A 1 88  ? -11.282 -42.990 45.698  1.00 45.62  ? 89  ASN A ND2 1 
ATOM   692  N N   . ARG A 1 89  ? -14.699 -39.305 45.420  1.00 37.24  ? 90  ARG A N   1 
ATOM   693  C CA  . ARG A 1 89  ? -15.025 -38.228 46.361  1.00 31.47  ? 90  ARG A CA  1 
ATOM   694  C C   . ARG A 1 89  ? -16.111 -37.394 45.694  1.00 35.64  ? 90  ARG A C   1 
ATOM   695  O O   . ARG A 1 89  ? -16.369 -37.561 44.493  1.00 35.94  ? 90  ARG A O   1 
ATOM   696  C CB  . ARG A 1 89  ? -13.804 -37.354 46.702  1.00 33.23  ? 90  ARG A CB  1 
ATOM   697  C CG  . ARG A 1 89  ? -12.694 -38.059 47.478  1.00 30.62  ? 90  ARG A CG  1 
ATOM   698  C CD  . ARG A 1 89  ? -13.164 -38.499 48.860  1.00 32.79  ? 90  ARG A CD  1 
ATOM   699  N NE  . ARG A 1 89  ? -12.095 -39.110 49.647  1.00 40.83  ? 90  ARG A NE  1 
ATOM   700  C CZ  . ARG A 1 89  ? -11.707 -40.383 49.538  1.00 48.40  ? 90  ARG A CZ  1 
ATOM   701  N NH1 . ARG A 1 89  ? -12.295 -41.196 48.668  1.00 41.25  ? 90  ARG A NH1 1 
ATOM   702  N NH2 . ARG A 1 89  ? -10.721 -40.846 50.296  1.00 48.45  ? 90  ARG A NH2 1 
ATOM   703  N N   . GLU A 1 90  ? -16.752 -36.502 46.439  1.00 33.45  ? 91  GLU A N   1 
ATOM   704  C CA  . GLU A 1 90  ? -17.787 -35.677 45.825  1.00 46.92  ? 91  GLU A CA  1 
ATOM   705  C C   . GLU A 1 90  ? -17.162 -34.775 44.754  1.00 41.04  ? 91  GLU A C   1 
ATOM   706  O O   . GLU A 1 90  ? -15.988 -34.419 44.843  1.00 41.37  ? 91  GLU A O   1 
ATOM   707  C CB  . GLU A 1 90  ? -18.533 -34.849 46.877  1.00 44.85  ? 91  GLU A CB  1 
ATOM   708  C CG  . GLU A 1 90  ? -17.656 -33.887 47.669  1.00 71.19  ? 91  GLU A CG  1 
ATOM   709  C CD  . GLU A 1 90  ? -18.464 -32.959 48.573  1.00 96.29  ? 91  GLU A CD  1 
ATOM   710  O OE1 . GLU A 1 90  ? -19.688 -33.187 48.714  1.00 97.85  ? 91  GLU A OE1 1 
ATOM   711  O OE2 . GLU A 1 90  ? -17.875 -32.003 49.137  1.00 88.10  ? 91  GLU A OE2 1 
ATOM   712  N N   . LEU A 1 91  ? -17.934 -34.444 43.725  1.00 38.53  ? 92  LEU A N   1 
ATOM   713  C CA  . LEU A 1 91  ? -17.469 -33.524 42.694  1.00 34.88  ? 92  LEU A CA  1 
ATOM   714  C C   . LEU A 1 91  ? -17.520 -32.089 43.196  1.00 35.17  ? 92  LEU A C   1 
ATOM   715  O O   . LEU A 1 91  ? -18.359 -31.750 44.020  1.00 43.61  ? 92  LEU A O   1 
ATOM   716  C CB  . LEU A 1 91  ? -18.310 -33.644 41.423  1.00 34.62  ? 92  LEU A CB  1 
ATOM   717  C CG  . LEU A 1 91  ? -18.508 -35.028 40.811  1.00 31.92  ? 92  LEU A CG  1 
ATOM   718  C CD1 . LEU A 1 91  ? -19.358 -34.884 39.567  1.00 37.27  ? 92  LEU A CD1 1 
ATOM   719  C CD2 . LEU A 1 91  ? -17.188 -35.705 40.492  1.00 30.83  ? 92  LEU A CD2 1 
ATOM   720  N N   . SER A 1 92  ? -16.617 -31.256 42.692  1.00 39.56  ? 93  SER A N   1 
ATOM   721  C CA  . SER A 1 92  ? -16.596 -29.830 43.007  1.00 37.67  ? 93  SER A CA  1 
ATOM   722  C C   . SER A 1 92  ? -15.622 -29.078 42.103  1.00 37.10  ? 93  SER A C   1 
ATOM   723  O O   . SER A 1 92  ? -14.577 -29.612 41.724  1.00 36.90  ? 93  SER A O   1 
ATOM   724  C CB  . SER A 1 92  ? -16.205 -29.595 44.466  1.00 30.30  ? 93  SER A CB  1 
ATOM   725  O OG  . SER A 1 92  ? -16.030 -28.211 44.703  1.00 30.80  ? 93  SER A OG  1 
ATOM   726  N N   . GLU A 1 93  ? -15.957 -27.837 41.766  1.00 32.35  ? 94  GLU A N   1 
ATOM   727  C CA  . GLU A 1 93  ? -15.009 -26.988 41.066  1.00 36.35  ? 94  GLU A CA  1 
ATOM   728  C C   . GLU A 1 93  ? -13.884 -26.585 42.016  1.00 41.14  ? 94  GLU A C   1 
ATOM   729  O O   . GLU A 1 93  ? -12.804 -26.185 41.591  1.00 45.83  ? 94  GLU A O   1 
ATOM   730  C CB  . GLU A 1 93  ? -15.698 -25.762 40.493  1.00 31.60  ? 94  GLU A CB  1 
ATOM   731  C CG  . GLU A 1 93  ? -16.619 -26.074 39.327  1.00 38.46  ? 94  GLU A CG  1 
ATOM   732  C CD  . GLU A 1 93  ? -17.089 -24.818 38.603  1.00 46.81  ? 94  GLU A CD  1 
ATOM   733  O OE1 . GLU A 1 93  ? -16.387 -24.364 37.666  1.00 43.05  ? 94  GLU A OE1 1 
ATOM   734  O OE2 . GLU A 1 93  ? -18.157 -24.284 38.978  1.00 44.97  ? 94  GLU A OE2 1 
ATOM   735  N N   . ASP A 1 94  ? -14.158 -26.696 43.310  1.00 34.10  ? 95  ASP A N   1 
ATOM   736  C CA  . ASP A 1 94  ? -13.160 -26.500 44.343  1.00 33.99  ? 95  ASP A CA  1 
ATOM   737  C C   . ASP A 1 94  ? -12.392 -27.811 44.464  1.00 34.55  ? 95  ASP A C   1 
ATOM   738  O O   . ASP A 1 94  ? -12.653 -28.611 45.362  1.00 41.02  ? 95  ASP A O   1 
ATOM   739  C CB  . ASP A 1 94  ? -13.833 -26.105 45.664  1.00 38.65  ? 95  ASP A CB  1 
ATOM   740  C CG  . ASP A 1 94  ? -12.852 -25.621 46.719  1.00 45.35  ? 95  ASP A CG  1 
ATOM   741  O OD1 . ASP A 1 94  ? -11.639 -25.893 46.600  1.00 42.87  ? 95  ASP A OD1 1 
ATOM   742  O OD2 . ASP A 1 94  ? -13.311 -24.973 47.686  1.00 47.34  ? 95  ASP A OD2 1 
ATOM   743  N N   . CYS A 1 95  ? -11.450 -28.025 43.550  1.00 31.00  ? 96  CYS A N   1 
ATOM   744  C CA  . CYS A 1 95  ? -10.806 -29.325 43.398  1.00 36.04  ? 96  CYS A CA  1 
ATOM   745  C C   . CYS A 1 95  ? -9.298  -29.259 43.166  1.00 34.15  ? 96  CYS A C   1 
ATOM   746  O O   . CYS A 1 95  ? -8.647  -30.295 43.017  1.00 32.12  ? 96  CYS A O   1 
ATOM   747  C CB  . CYS A 1 95  ? -11.433 -30.074 42.234  1.00 32.89  ? 96  CYS A CB  1 
ATOM   748  S SG  . CYS A 1 95  ? -11.151 -29.231 40.647  1.00 36.36  ? 96  CYS A SG  1 
ATOM   749  N N   . LEU A 1 96  ? -8.745  -28.055 43.118  1.00 29.73  ? 97  LEU A N   1 
ATOM   750  C CA  . LEU A 1 96  ? -7.317  -27.913 42.874  1.00 29.93  ? 97  LEU A CA  1 
ATOM   751  C C   . LEU A 1 96  ? -6.516  -28.163 44.152  1.00 34.12  ? 97  LEU A C   1 
ATOM   752  O O   . LEU A 1 96  ? -6.150  -27.247 44.888  1.00 30.64  ? 97  LEU A O   1 
ATOM   753  C CB  . LEU A 1 96  ? -7.012  -26.541 42.276  1.00 25.19  ? 97  LEU A CB  1 
ATOM   754  C CG  . LEU A 1 96  ? -7.653  -26.405 40.884  1.00 35.03  ? 97  LEU A CG  1 
ATOM   755  C CD1 . LEU A 1 96  ? -7.215  -25.127 40.169  1.00 38.81  ? 97  LEU A CD1 1 
ATOM   756  C CD2 . LEU A 1 96  ? -7.407  -27.645 40.005  1.00 21.82  ? 97  LEU A CD2 1 
ATOM   757  N N   . TYR A 1 97  ? -6.265  -29.441 44.401  1.00 33.19  ? 98  TYR A N   1 
ATOM   758  C CA  . TYR A 1 97  ? -5.496  -29.880 45.549  1.00 30.03  ? 98  TYR A CA  1 
ATOM   759  C C   . TYR A 1 97  ? -4.454  -30.884 45.076  1.00 35.10  ? 98  TYR A C   1 
ATOM   760  O O   . TYR A 1 97  ? -4.643  -31.533 44.040  1.00 34.70  ? 98  TYR A O   1 
ATOM   761  C CB  . TYR A 1 97  ? -6.411  -30.501 46.604  1.00 29.70  ? 98  TYR A CB  1 
ATOM   762  C CG  . TYR A 1 97  ? -7.413  -29.519 47.170  1.00 39.10  ? 98  TYR A CG  1 
ATOM   763  C CD1 . TYR A 1 97  ? -7.149  -28.830 48.355  1.00 34.67  ? 98  TYR A CD1 1 
ATOM   764  C CD2 . TYR A 1 97  ? -8.622  -29.277 46.521  1.00 35.72  ? 98  TYR A CD2 1 
ATOM   765  C CE1 . TYR A 1 97  ? -8.056  -27.927 48.872  1.00 35.40  ? 98  TYR A CE1 1 
ATOM   766  C CE2 . TYR A 1 97  ? -9.533  -28.374 47.031  1.00 40.14  ? 98  TYR A CE2 1 
ATOM   767  C CZ  . TYR A 1 97  ? -9.245  -27.702 48.207  1.00 40.41  ? 98  TYR A CZ  1 
ATOM   768  O OH  . TYR A 1 97  ? -10.151 -26.801 48.709  1.00 47.86  ? 98  TYR A OH  1 
ATOM   769  N N   . LEU A 1 98  ? -3.352  -31.003 45.814  1.00 26.63  ? 99  LEU A N   1 
ATOM   770  C CA  . LEU A 1 98  ? -2.357  -32.019 45.508  1.00 23.03  ? 99  LEU A CA  1 
ATOM   771  C C   . LEU A 1 98  ? -2.021  -32.844 46.757  1.00 29.62  ? 99  LEU A C   1 
ATOM   772  O O   . LEU A 1 98  ? -2.410  -32.501 47.879  1.00 27.27  ? 99  LEU A O   1 
ATOM   773  C CB  . LEU A 1 98  ? -1.094  -31.386 44.900  1.00 27.53  ? 99  LEU A CB  1 
ATOM   774  C CG  . LEU A 1 98  ? -0.309  -30.271 45.602  1.00 28.31  ? 99  LEU A CG  1 
ATOM   775  C CD1 . LEU A 1 98  ? 0.570   -30.820 46.727  1.00 22.72  ? 99  LEU A CD1 1 
ATOM   776  C CD2 . LEU A 1 98  ? 0.530   -29.499 44.601  1.00 23.65  ? 99  LEU A CD2 1 
ATOM   777  N N   . ASN A 1 99  ? -1.299  -33.938 46.540  1.00 26.73  ? 100 ASN A N   1 
ATOM   778  C CA  . ASN A 1 99  ? -1.030  -34.908 47.583  1.00 25.27  ? 100 ASN A CA  1 
ATOM   779  C C   . ASN A 1 99  ? 0.439   -35.248 47.605  1.00 31.74  ? 100 ASN A C   1 
ATOM   780  O O   . ASN A 1 99  ? 1.052   -35.413 46.547  1.00 33.95  ? 100 ASN A O   1 
ATOM   781  C CB  . ASN A 1 99  ? -1.859  -36.178 47.365  1.00 29.52  ? 100 ASN A CB  1 
ATOM   782  C CG  . ASN A 1 99  ? -3.252  -35.876 46.841  1.00 34.41  ? 100 ASN A CG  1 
ATOM   783  O OD1 . ASN A 1 99  ? -4.097  -35.325 47.558  1.00 29.22  ? 100 ASN A OD1 1 
ATOM   784  N ND2 . ASN A 1 99  ? -3.497  -36.226 45.575  1.00 27.47  ? 100 ASN A ND2 1 
ATOM   785  N N   . VAL A 1 100 ? 1.005   -35.339 48.805  1.00 26.68  ? 101 VAL A N   1 
ATOM   786  C CA  . VAL A 1 100 ? 2.402   -35.703 48.958  1.00 29.73  ? 101 VAL A CA  1 
ATOM   787  C C   . VAL A 1 100 ? 2.516   -36.927 49.851  1.00 29.16  ? 101 VAL A C   1 
ATOM   788  O O   . VAL A 1 100 ? 1.991   -36.947 50.964  1.00 35.59  ? 101 VAL A O   1 
ATOM   789  C CB  . VAL A 1 100 ? 3.242   -34.554 49.568  1.00 31.81  ? 101 VAL A CB  1 
ATOM   790  C CG1 . VAL A 1 100 ? 4.700   -34.961 49.665  1.00 28.98  ? 101 VAL A CG1 1 
ATOM   791  C CG2 . VAL A 1 100 ? 3.098   -33.264 48.759  1.00 26.70  ? 101 VAL A CG2 1 
ATOM   792  N N   . TRP A 1 101 ? 3.192   -37.947 49.346  1.00 27.29  ? 102 TRP A N   1 
ATOM   793  C CA  . TRP A 1 101 ? 3.592   -39.103 50.139  1.00 31.82  ? 102 TRP A CA  1 
ATOM   794  C C   . TRP A 1 101 ? 5.100   -39.058 50.329  1.00 32.05  ? 102 TRP A C   1 
ATOM   795  O O   . TRP A 1 101 ? 5.837   -38.697 49.408  1.00 32.47  ? 102 TRP A O   1 
ATOM   796  C CB  . TRP A 1 101 ? 3.221   -40.423 49.453  1.00 33.18  ? 102 TRP A CB  1 
ATOM   797  C CG  . TRP A 1 101 ? 1.768   -40.748 49.342  1.00 30.67  ? 102 TRP A CG  1 
ATOM   798  C CD1 . TRP A 1 101 ? 1.036   -41.515 50.198  1.00 32.39  ? 102 TRP A CD1 1 
ATOM   799  C CD2 . TRP A 1 101 ? 0.878   -40.353 48.297  1.00 33.10  ? 102 TRP A CD2 1 
ATOM   800  N NE1 . TRP A 1 101 ? -0.259  -41.611 49.759  1.00 38.24  ? 102 TRP A NE1 1 
ATOM   801  C CE2 . TRP A 1 101 ? -0.383  -40.908 48.591  1.00 32.88  ? 102 TRP A CE2 1 
ATOM   802  C CE3 . TRP A 1 101 ? 1.020   -39.577 47.143  1.00 27.99  ? 102 TRP A CE3 1 
ATOM   803  C CZ2 . TRP A 1 101 ? -1.490  -40.718 47.774  1.00 32.36  ? 102 TRP A CZ2 1 
ATOM   804  C CZ3 . TRP A 1 101 ? -0.081  -39.381 46.338  1.00 29.89  ? 102 TRP A CZ3 1 
ATOM   805  C CH2 . TRP A 1 101 ? -1.321  -39.952 46.653  1.00 36.67  ? 102 TRP A CH2 1 
ATOM   806  N N   . THR A 1 102 ? 5.568   -39.462 51.498  1.00 35.77  ? 103 THR A N   1 
ATOM   807  C CA  . THR A 1 102 ? 6.992   -39.407 51.785  1.00 38.72  ? 103 THR A CA  1 
ATOM   808  C C   . THR A 1 102 ? 7.310   -40.468 52.836  1.00 34.33  ? 103 THR A C   1 
ATOM   809  O O   . THR A 1 102 ? 6.424   -40.849 53.597  1.00 44.52  ? 103 THR A O   1 
ATOM   810  C CB  . THR A 1 102 ? 7.395   -37.982 52.252  1.00 39.58  ? 103 THR A CB  1 
ATOM   811  O OG1 . THR A 1 102 ? 8.774   -37.739 51.952  1.00 54.57  ? 103 THR A OG1 1 
ATOM   812  C CG2 . THR A 1 102 ? 7.149   -37.800 53.731  1.00 37.81  ? 103 THR A CG2 1 
ATOM   813  N N   . PRO A 1 103 ? 8.554   -40.987 52.854  1.00 36.76  ? 104 PRO A N   1 
ATOM   814  C CA  . PRO A 1 103 ? 8.917   -41.990 53.866  1.00 43.02  ? 104 PRO A CA  1 
ATOM   815  C C   . PRO A 1 103 ? 8.743   -41.479 55.290  1.00 42.68  ? 104 PRO A C   1 
ATOM   816  O O   . PRO A 1 103 ? 8.719   -40.269 55.512  1.00 41.80  ? 104 PRO A O   1 
ATOM   817  C CB  . PRO A 1 103 ? 10.395  -42.269 53.575  1.00 33.86  ? 104 PRO A CB  1 
ATOM   818  C CG  . PRO A 1 103 ? 10.556  -41.946 52.150  1.00 35.56  ? 104 PRO A CG  1 
ATOM   819  C CD  . PRO A 1 103 ? 9.658   -40.758 51.909  1.00 39.90  ? 104 PRO A CD  1 
ATOM   820  N N   . TYR A 1 104 ? 8.604   -42.409 56.231  1.00 47.70  ? 105 TYR A N   1 
ATOM   821  C CA  . TYR A 1 104 ? 8.502   -42.103 57.658  1.00 48.57  ? 105 TYR A CA  1 
ATOM   822  C C   . TYR A 1 104 ? 9.643   -42.797 58.404  1.00 50.00  ? 105 TYR A C   1 
ATOM   823  O O   . TYR A 1 104 ? 9.771   -44.020 58.333  1.00 52.25  ? 105 TYR A O   1 
ATOM   824  C CB  . TYR A 1 104 ? 7.151   -42.552 58.201  1.00 34.64  ? 105 TYR A CB  1 
ATOM   825  C CG  . TYR A 1 104 ? 6.870   -42.139 59.619  1.00 55.91  ? 105 TYR A CG  1 
ATOM   826  C CD1 . TYR A 1 104 ? 7.580   -42.700 60.687  1.00 61.99  ? 105 TYR A CD1 1 
ATOM   827  C CD2 . TYR A 1 104 ? 5.864   -41.215 59.905  1.00 56.44  ? 105 TYR A CD2 1 
ATOM   828  C CE1 . TYR A 1 104 ? 7.315   -42.332 62.001  1.00 52.51  ? 105 TYR A CE1 1 
ATOM   829  C CE2 . TYR A 1 104 ? 5.590   -40.840 61.219  1.00 66.23  ? 105 TYR A CE2 1 
ATOM   830  C CZ  . TYR A 1 104 ? 6.318   -41.405 62.263  1.00 63.86  ? 105 TYR A CZ  1 
ATOM   831  O OH  . TYR A 1 104 ? 6.055   -41.046 63.568  1.00 60.62  ? 105 TYR A OH  1 
ATOM   832  N N   . PRO A 1 105 ? 10.478  -42.021 59.117  1.00 58.00  ? 106 PRO A N   1 
ATOM   833  C CA  . PRO A 1 105 ? 10.380  -40.564 59.236  1.00 59.34  ? 106 PRO A CA  1 
ATOM   834  C C   . PRO A 1 105 ? 10.870  -39.860 57.960  1.00 51.33  ? 106 PRO A C   1 
ATOM   835  O O   . PRO A 1 105 ? 11.559  -40.497 57.155  1.00 41.64  ? 106 PRO A O   1 
ATOM   836  C CB  . PRO A 1 105 ? 11.285  -40.263 60.432  1.00 46.48  ? 106 PRO A CB  1 
ATOM   837  C CG  . PRO A 1 105 ? 12.333  -41.321 60.363  1.00 41.88  ? 106 PRO A CG  1 
ATOM   838  C CD  . PRO A 1 105 ? 11.655  -42.549 59.837  1.00 45.90  ? 106 PRO A CD  1 
ATOM   839  N N   . ARG A 1 106 ? 10.507  -38.588 57.781  1.00 49.10  ? 107 ARG A N   1 
ATOM   840  C CA  . ARG A 1 106 ? 10.829  -37.856 56.554  1.00 58.42  ? 107 ARG A CA  1 
ATOM   841  C C   . ARG A 1 106 ? 12.309  -37.905 56.255  1.00 51.50  ? 107 ARG A C   1 
ATOM   842  O O   . ARG A 1 106 ? 13.125  -37.829 57.168  1.00 66.52  ? 107 ARG A O   1 
ATOM   843  C CB  . ARG A 1 106 ? 10.378  -36.396 56.641  1.00 52.46  ? 107 ARG A CB  1 
ATOM   844  C CG  . ARG A 1 106 ? 8.902   -36.225 56.971  1.00 71.31  ? 107 ARG A CG  1 
ATOM   845  C CD  . ARG A 1 106 ? 8.408   -34.869 56.500  1.00 68.48  ? 107 ARG A CD  1 
ATOM   846  N NE  . ARG A 1 106 ? 9.225   -33.770 57.012  1.00 59.94  ? 107 ARG A NE  1 
ATOM   847  C CZ  . ARG A 1 106 ? 8.846   -32.967 58.000  1.00 67.29  ? 107 ARG A CZ  1 
ATOM   848  N NH1 . ARG A 1 106 ? 7.665   -33.147 58.577  1.00 60.57  ? 107 ARG A NH1 1 
ATOM   849  N NH2 . ARG A 1 106 ? 9.641   -31.985 58.412  1.00 80.72  ? 107 ARG A NH2 1 
ATOM   850  N N   . PRO A 1 107 ? 12.660  -38.054 54.971  1.00 54.71  ? 108 PRO A N   1 
ATOM   851  C CA  . PRO A 1 107 ? 14.073  -38.051 54.583  1.00 58.38  ? 108 PRO A CA  1 
ATOM   852  C C   . PRO A 1 107 ? 14.757  -36.768 55.050  1.00 65.85  ? 108 PRO A C   1 
ATOM   853  O O   . PRO A 1 107 ? 14.140  -35.690 55.081  1.00 56.88  ? 108 PRO A O   1 
ATOM   854  C CB  . PRO A 1 107 ? 14.028  -38.130 53.049  1.00 51.42  ? 108 PRO A CB  1 
ATOM   855  C CG  . PRO A 1 107 ? 12.670  -38.643 52.720  1.00 48.96  ? 108 PRO A CG  1 
ATOM   856  C CD  . PRO A 1 107 ? 11.759  -38.159 53.810  1.00 45.98  ? 108 PRO A CD  1 
ATOM   857  N N   . THR A 1 108 ? 16.019  -36.883 55.434  1.00 66.14  ? 109 THR A N   1 
ATOM   858  C CA  . THR A 1 108 ? 16.736  -35.718 55.923  1.00 68.69  ? 109 THR A CA  1 
ATOM   859  C C   . THR A 1 108 ? 17.789  -35.314 54.905  1.00 67.86  ? 109 THR A C   1 
ATOM   860  O O   . THR A 1 108 ? 18.352  -34.223 54.978  1.00 74.91  ? 109 THR A O   1 
ATOM   861  C CB  . THR A 1 108 ? 17.369  -35.979 57.301  1.00 65.24  ? 109 THR A CB  1 
ATOM   862  O OG1 . THR A 1 108 ? 18.217  -37.137 57.237  1.00 60.33  ? 109 THR A OG1 1 
ATOM   863  C CG2 . THR A 1 108 ? 16.274  -36.184 58.353  1.00 53.95  ? 109 THR A CG2 1 
ATOM   864  N N   . SER A 1 109 ? 18.037  -36.204 53.948  1.00 59.07  ? 110 SER A N   1 
ATOM   865  C CA  . SER A 1 109 ? 18.810  -35.868 52.756  1.00 68.54  ? 110 SER A CA  1 
ATOM   866  C C   . SER A 1 109 ? 17.868  -35.821 51.556  1.00 56.87  ? 110 SER A C   1 
ATOM   867  O O   . SER A 1 109 ? 16.887  -36.555 51.532  1.00 59.41  ? 110 SER A O   1 
ATOM   868  C CB  . SER A 1 109 ? 19.922  -36.889 52.538  1.00 57.67  ? 110 SER A CB  1 
ATOM   869  O OG  . SER A 1 109 ? 19.601  -38.092 53.214  1.00 65.67  ? 110 SER A OG  1 
ATOM   870  N N   . PRO A 1 110 ? 18.157  -34.957 50.564  1.00 61.02  ? 111 PRO A N   1 
ATOM   871  C CA  . PRO A 1 110 ? 17.309  -34.810 49.365  1.00 62.89  ? 111 PRO A CA  1 
ATOM   872  C C   . PRO A 1 110 ? 17.009  -36.135 48.655  1.00 57.46  ? 111 PRO A C   1 
ATOM   873  O O   . PRO A 1 110 ? 17.895  -36.944 48.355  1.00 58.86  ? 111 PRO A O   1 
ATOM   874  C CB  . PRO A 1 110 ? 18.129  -33.886 48.460  1.00 48.30  ? 111 PRO A CB  1 
ATOM   875  C CG  . PRO A 1 110 ? 18.987  -33.124 49.381  1.00 63.43  ? 111 PRO A CG  1 
ATOM   876  C CD  . PRO A 1 110 ? 19.300  -34.033 50.540  1.00 61.22  ? 111 PRO A CD  1 
ATOM   877  N N   . THR A 1 111 ? 15.724  -36.333 48.396  1.00 49.55  ? 112 THR A N   1 
ATOM   878  C CA  . THR A 1 111 ? 15.193  -37.571 47.848  1.00 45.53  ? 112 THR A CA  1 
ATOM   879  C C   . THR A 1 111 ? 14.570  -37.279 46.483  1.00 48.21  ? 112 THR A C   1 
ATOM   880  O O   . THR A 1 111 ? 13.905  -36.251 46.319  1.00 45.60  ? 112 THR A O   1 
ATOM   881  C CB  . THR A 1 111 ? 14.141  -38.175 48.805  1.00 48.87  ? 112 THR A CB  1 
ATOM   882  O OG1 . THR A 1 111 ? 14.753  -38.475 50.066  1.00 56.90  ? 112 THR A OG1 1 
ATOM   883  C CG2 . THR A 1 111 ? 13.547  -39.426 48.237  1.00 44.33  ? 112 THR A CG2 1 
ATOM   884  N N   . PRO A 1 112 ? 14.801  -38.160 45.494  1.00 45.40  ? 113 PRO A N   1 
ATOM   885  C CA  . PRO A 1 112 ? 14.175  -37.983 44.173  1.00 41.37  ? 113 PRO A CA  1 
ATOM   886  C C   . PRO A 1 112 ? 12.649  -37.908 44.259  1.00 38.90  ? 113 PRO A C   1 
ATOM   887  O O   . PRO A 1 112 ? 12.040  -38.566 45.111  1.00 37.32  ? 113 PRO A O   1 
ATOM   888  C CB  . PRO A 1 112 ? 14.622  -39.230 43.395  1.00 39.71  ? 113 PRO A CB  1 
ATOM   889  C CG  . PRO A 1 112 ? 15.043  -40.210 44.432  1.00 44.30  ? 113 PRO A CG  1 
ATOM   890  C CD  . PRO A 1 112 ? 15.633  -39.373 45.541  1.00 43.54  ? 113 PRO A CD  1 
ATOM   891  N N   . VAL A 1 113 ? 12.048  -37.101 43.391  1.00 31.07  ? 114 VAL A N   1 
ATOM   892  C CA  . VAL A 1 113 ? 10.610  -36.870 43.424  1.00 29.09  ? 114 VAL A CA  1 
ATOM   893  C C   . VAL A 1 113 ? 9.909   -37.412 42.172  1.00 33.66  ? 114 VAL A C   1 
ATOM   894  O O   . VAL A 1 113 ? 10.341  -37.166 41.042  1.00 35.61  ? 114 VAL A O   1 
ATOM   895  C CB  . VAL A 1 113 ? 10.301  -35.362 43.573  1.00 35.51  ? 114 VAL A CB  1 
ATOM   896  C CG1 . VAL A 1 113 ? 8.798   -35.116 43.598  1.00 28.40  ? 114 VAL A CG1 1 
ATOM   897  C CG2 . VAL A 1 113 ? 10.955  -34.807 44.826  1.00 29.94  ? 114 VAL A CG2 1 
ATOM   898  N N   . LEU A 1 114 ? 8.830   -38.161 42.376  1.00 35.50  ? 115 LEU A N   1 
ATOM   899  C CA  . LEU A 1 114 ? 7.986   -38.604 41.265  1.00 30.99  ? 115 LEU A CA  1 
ATOM   900  C C   . LEU A 1 114 ? 6.671   -37.826 41.261  1.00 32.68  ? 115 LEU A C   1 
ATOM   901  O O   . LEU A 1 114 ? 5.972   -37.781 42.276  1.00 29.65  ? 115 LEU A O   1 
ATOM   902  C CB  . LEU A 1 114 ? 7.711   -40.101 41.363  1.00 25.52  ? 115 LEU A CB  1 
ATOM   903  C CG  . LEU A 1 114 ? 8.800   -41.038 40.851  1.00 35.23  ? 115 LEU A CG  1 
ATOM   904  C CD1 . LEU A 1 114 ? 8.755   -42.350 41.603  1.00 40.79  ? 115 LEU A CD1 1 
ATOM   905  C CD2 . LEU A 1 114 ? 8.627   -41.279 39.353  1.00 39.11  ? 115 LEU A CD2 1 
ATOM   906  N N   . VAL A 1 115 ? 6.329   -37.199 40.139  1.00 29.71  ? 116 VAL A N   1 
ATOM   907  C CA  . VAL A 1 115 ? 5.051   -36.503 40.068  1.00 31.27  ? 116 VAL A CA  1 
ATOM   908  C C   . VAL A 1 115 ? 4.092   -37.202 39.110  1.00 29.67  ? 116 VAL A C   1 
ATOM   909  O O   . VAL A 1 115 ? 4.363   -37.317 37.912  1.00 31.34  ? 116 VAL A O   1 
ATOM   910  C CB  . VAL A 1 115 ? 5.227   -35.040 39.649  1.00 36.72  ? 116 VAL A CB  1 
ATOM   911  C CG1 . VAL A 1 115 ? 3.874   -34.365 39.501  1.00 23.44  ? 116 VAL A CG1 1 
ATOM   912  C CG2 . VAL A 1 115 ? 6.081   -34.306 40.668  1.00 27.33  ? 116 VAL A CG2 1 
ATOM   913  N N   . TRP A 1 116 ? 2.971   -37.673 39.653  1.00 30.44  ? 117 TRP A N   1 
ATOM   914  C CA  . TRP A 1 116 ? 1.964   -38.389 38.870  1.00 29.69  ? 117 TRP A CA  1 
ATOM   915  C C   . TRP A 1 116 ? 0.884   -37.493 38.273  1.00 32.00  ? 117 TRP A C   1 
ATOM   916  O O   . TRP A 1 116 ? 0.305   -36.657 38.968  1.00 36.49  ? 117 TRP A O   1 
ATOM   917  C CB  . TRP A 1 116 ? 1.292   -39.447 39.732  1.00 31.12  ? 117 TRP A CB  1 
ATOM   918  C CG  . TRP A 1 116 ? 0.170   -40.158 39.029  1.00 34.36  ? 117 TRP A CG  1 
ATOM   919  C CD1 . TRP A 1 116 ? -1.170  -40.009 39.251  1.00 31.05  ? 117 TRP A CD1 1 
ATOM   920  C CD2 . TRP A 1 116 ? 0.297   -41.129 37.989  1.00 32.68  ? 117 TRP A CD2 1 
ATOM   921  N NE1 . TRP A 1 116 ? -1.886  -40.833 38.412  1.00 29.68  ? 117 TRP A NE1 1 
ATOM   922  C CE2 . TRP A 1 116 ? -1.006  -41.533 37.630  1.00 33.71  ? 117 TRP A CE2 1 
ATOM   923  C CE3 . TRP A 1 116 ? 1.384   -41.692 37.321  1.00 32.88  ? 117 TRP A CE3 1 
ATOM   924  C CZ2 . TRP A 1 116 ? -1.247  -42.471 36.638  1.00 31.03  ? 117 TRP A CZ2 1 
ATOM   925  C CZ3 . TRP A 1 116 ? 1.141   -42.632 36.337  1.00 31.61  ? 117 TRP A CZ3 1 
ATOM   926  C CH2 . TRP A 1 116 ? -0.162  -43.012 36.009  1.00 33.28  ? 117 TRP A CH2 1 
ATOM   927  N N   . ILE A 1 117 ? 0.599   -37.693 36.989  1.00 30.15  ? 118 ILE A N   1 
ATOM   928  C CA  . ILE A 1 117 ? -0.491  -36.993 36.312  1.00 27.54  ? 118 ILE A CA  1 
ATOM   929  C C   . ILE A 1 117 ? -1.507  -37.979 35.731  1.00 28.83  ? 118 ILE A C   1 
ATOM   930  O O   . ILE A 1 117 ? -1.177  -38.746 34.820  1.00 30.28  ? 118 ILE A O   1 
ATOM   931  C CB  . ILE A 1 117 ? 0.050   -36.107 35.193  1.00 28.43  ? 118 ILE A CB  1 
ATOM   932  C CG1 . ILE A 1 117 ? 1.095   -35.138 35.755  1.00 25.53  ? 118 ILE A CG1 1 
ATOM   933  C CG2 . ILE A 1 117 ? -1.084  -35.375 34.507  1.00 27.11  ? 118 ILE A CG2 1 
ATOM   934  C CD1 . ILE A 1 117 ? 1.634   -34.167 34.728  1.00 27.94  ? 118 ILE A CD1 1 
ATOM   935  N N   . TYR A 1 118 ? -2.737  -37.969 36.244  1.00 30.98  ? 119 TYR A N   1 
ATOM   936  C CA  . TYR A 1 118 ? -3.707  -39.004 35.861  1.00 31.85  ? 119 TYR A CA  1 
ATOM   937  C C   . TYR A 1 118 ? -4.257  -38.790 34.456  1.00 30.85  ? 119 TYR A C   1 
ATOM   938  O O   . TYR A 1 118 ? -4.289  -37.662 33.950  1.00 27.33  ? 119 TYR A O   1 
ATOM   939  C CB  . TYR A 1 118 ? -4.882  -39.090 36.860  1.00 23.56  ? 119 TYR A CB  1 
ATOM   940  C CG  . TYR A 1 118 ? -5.653  -37.797 37.054  1.00 28.28  ? 119 TYR A CG  1 
ATOM   941  C CD1 . TYR A 1 118 ? -6.560  -37.327 36.099  1.00 25.21  ? 119 TYR A CD1 1 
ATOM   942  C CD2 . TYR A 1 118 ? -5.485  -37.054 38.214  1.00 27.41  ? 119 TYR A CD2 1 
ATOM   943  C CE1 . TYR A 1 118 ? -7.255  -36.123 36.300  1.00 27.95  ? 119 TYR A CE1 1 
ATOM   944  C CE2 . TYR A 1 118 ? -6.170  -35.881 38.429  1.00 25.77  ? 119 TYR A CE2 1 
ATOM   945  C CZ  . TYR A 1 118 ? -7.045  -35.407 37.482  1.00 32.33  ? 119 TYR A CZ  1 
ATOM   946  O OH  . TYR A 1 118 ? -7.696  -34.217 37.756  1.00 30.47  ? 119 TYR A OH  1 
ATOM   947  N N   . GLY A 1 119 ? -4.692  -39.888 33.842  1.00 30.59  ? 120 GLY A N   1 
ATOM   948  C CA  . GLY A 1 119 ? -5.380  -39.840 32.567  1.00 30.43  ? 120 GLY A CA  1 
ATOM   949  C C   . GLY A 1 119 ? -6.888  -39.821 32.758  1.00 31.31  ? 120 GLY A C   1 
ATOM   950  O O   . GLY A 1 119 ? -7.381  -39.621 33.870  1.00 35.69  ? 120 GLY A O   1 
ATOM   951  N N   . GLY A 1 120 ? -7.621  -40.032 31.671  1.00 33.35  ? 121 GLY A N   1 
ATOM   952  C CA  . GLY A 1 120 ? -9.064  -39.928 31.693  1.00 24.62  ? 121 GLY A CA  1 
ATOM   953  C C   . GLY A 1 120 ? -9.549  -39.121 30.510  1.00 29.81  ? 121 GLY A C   1 
ATOM   954  O O   . GLY A 1 120 ? -10.612 -38.503 30.569  1.00 29.90  ? 121 GLY A O   1 
ATOM   955  N N   . GLY A 1 121 ? -8.738  -39.105 29.450  1.00 29.89  ? 122 GLY A N   1 
ATOM   956  C CA  . GLY A 1 121 ? -9.108  -38.546 28.163  1.00 28.25  ? 122 GLY A CA  1 
ATOM   957  C C   . GLY A 1 121 ? -9.308  -37.051 28.118  1.00 26.37  ? 122 GLY A C   1 
ATOM   958  O O   . GLY A 1 121 ? -9.826  -36.530 27.134  1.00 31.28  ? 122 GLY A O   1 
ATOM   959  N N   . PHE A 1 122 ? -8.874  -36.374 29.176  1.00 27.10  ? 123 PHE A N   1 
ATOM   960  C CA  . PHE A 1 122 ? -9.074  -34.939 29.388  1.00 26.48  ? 123 PHE A CA  1 
ATOM   961  C C   . PHE A 1 122 ? -10.528 -34.630 29.707  1.00 33.09  ? 123 PHE A C   1 
ATOM   962  O O   . PHE A 1 122 ? -10.912 -33.462 29.742  1.00 36.93  ? 123 PHE A O   1 
ATOM   963  C CB  . PHE A 1 122 ? -8.615  -34.090 28.184  1.00 24.55  ? 123 PHE A CB  1 
ATOM   964  C CG  . PHE A 1 122 ? -7.124  -34.082 27.971  1.00 22.82  ? 123 PHE A CG  1 
ATOM   965  C CD1 . PHE A 1 122 ? -6.272  -33.559 28.929  1.00 25.52  ? 123 PHE A CD1 1 
ATOM   966  C CD2 . PHE A 1 122 ? -6.573  -34.602 26.809  1.00 29.19  ? 123 PHE A CD2 1 
ATOM   967  C CE1 . PHE A 1 122 ? -4.898  -33.560 28.735  1.00 24.70  ? 123 PHE A CE1 1 
ATOM   968  C CE2 . PHE A 1 122 ? -5.199  -34.603 26.608  1.00 27.53  ? 123 PHE A CE2 1 
ATOM   969  C CZ  . PHE A 1 122 ? -4.361  -34.080 27.576  1.00 25.72  ? 123 PHE A CZ  1 
ATOM   970  N N   . TYR A 1 123 ? -11.330 -35.663 29.963  1.00 30.46  ? 124 TYR A N   1 
ATOM   971  C CA  . TYR A 1 123 ? -12.737 -35.463 30.317  1.00 34.01  ? 124 TYR A CA  1 
ATOM   972  C C   . TYR A 1 123 ? -13.030 -36.050 31.702  1.00 34.13  ? 124 TYR A C   1 
ATOM   973  O O   . TYR A 1 123 ? -14.133 -35.911 32.229  1.00 41.67  ? 124 TYR A O   1 
ATOM   974  C CB  . TYR A 1 123 ? -13.675 -36.081 29.255  1.00 31.39  ? 124 TYR A CB  1 
ATOM   975  C CG  . TYR A 1 123 ? -13.472 -37.571 29.021  1.00 38.24  ? 124 TYR A CG  1 
ATOM   976  C CD1 . TYR A 1 123 ? -13.994 -38.519 29.907  1.00 32.46  ? 124 TYR A CD1 1 
ATOM   977  C CD2 . TYR A 1 123 ? -12.763 -38.032 27.912  1.00 32.50  ? 124 TYR A CD2 1 
ATOM   978  C CE1 . TYR A 1 123 ? -13.799 -39.877 29.697  1.00 38.92  ? 124 TYR A CE1 1 
ATOM   979  C CE2 . TYR A 1 123 ? -12.566 -39.390 27.691  1.00 31.61  ? 124 TYR A CE2 1 
ATOM   980  C CZ  . TYR A 1 123 ? -13.084 -40.307 28.582  1.00 37.65  ? 124 TYR A CZ  1 
ATOM   981  O OH  . TYR A 1 123 ? -12.891 -41.659 28.367  1.00 45.36  ? 124 TYR A OH  1 
ATOM   982  N N   . SER A 1 124 ? -12.042 -36.710 32.288  1.00 25.34  ? 125 SER A N   1 
ATOM   983  C CA  . SER A 1 124 ? -12.236 -37.289 33.606  1.00 31.75  ? 125 SER A CA  1 
ATOM   984  C C   . SER A 1 124 ? -10.913 -37.548 34.298  1.00 34.11  ? 125 SER A C   1 
ATOM   985  O O   . SER A 1 124 ? -9.852  -37.302 33.734  1.00 34.88  ? 125 SER A O   1 
ATOM   986  C CB  . SER A 1 124 ? -13.018 -38.595 33.505  1.00 32.85  ? 125 SER A CB  1 
ATOM   987  O OG  . SER A 1 124 ? -12.276 -39.564 32.790  1.00 28.63  ? 125 SER A OG  1 
ATOM   988  N N   . GLY A 1 125 ? -10.992 -38.057 35.522  1.00 33.70  ? 126 GLY A N   1 
ATOM   989  C CA  . GLY A 1 125 ? -9.824  -38.516 36.243  1.00 23.26  ? 126 GLY A CA  1 
ATOM   990  C C   . GLY A 1 125 ? -9.766  -37.876 37.607  1.00 29.96  ? 126 GLY A C   1 
ATOM   991  O O   . GLY A 1 125 ? -10.372 -36.826 37.844  1.00 26.11  ? 126 GLY A O   1 
ATOM   992  N N   . ALA A 1 126 ? -9.039  -38.504 38.517  1.00 19.48  ? 127 ALA A N   1 
ATOM   993  C CA  . ALA A 1 126 ? -8.815  -37.895 39.815  1.00 27.29  ? 127 ALA A CA  1 
ATOM   994  C C   . ALA A 1 126 ? -7.588  -38.513 40.465  1.00 32.42  ? 127 ALA A C   1 
ATOM   995  O O   . ALA A 1 126 ? -7.249  -39.671 40.193  1.00 30.27  ? 127 ALA A O   1 
ATOM   996  C CB  . ALA A 1 126 ? -10.035 -38.053 40.700  1.00 27.50  ? 127 ALA A CB  1 
ATOM   997  N N   . SER A 1 127 ? -6.919  -37.739 41.314  1.00 24.17  ? 128 SER A N   1 
ATOM   998  C CA  . SER A 1 127 ? -5.700  -38.204 41.956  1.00 27.84  ? 128 SER A CA  1 
ATOM   999  C C   . SER A 1 127 ? -6.010  -39.089 43.154  1.00 29.85  ? 128 SER A C   1 
ATOM   1000 O O   . SER A 1 127 ? -5.107  -39.664 43.754  1.00 32.89  ? 128 SER A O   1 
ATOM   1001 C CB  . SER A 1 127 ? -4.830  -37.017 42.388  1.00 29.39  ? 128 SER A CB  1 
ATOM   1002 O OG  . SER A 1 127 ? -5.545  -36.133 43.234  1.00 34.48  ? 128 SER A OG  1 
ATOM   1003 N N   . SER A 1 128 ? -7.289  -39.214 43.494  1.00 35.52  ? 129 SER A N   1 
ATOM   1004 C CA  . SER A 1 128 ? -7.676  -39.947 44.695  1.00 29.67  ? 129 SER A CA  1 
ATOM   1005 C C   . SER A 1 128 ? -8.109  -41.381 44.451  1.00 35.81  ? 129 SER A C   1 
ATOM   1006 O O   . SER A 1 128 ? -8.450  -42.076 45.409  1.00 35.58  ? 129 SER A O   1 
ATOM   1007 C CB  . SER A 1 128 ? -8.804  -39.217 45.414  1.00 31.63  ? 129 SER A CB  1 
ATOM   1008 O OG  . SER A 1 128 ? -9.861  -38.924 44.528  1.00 34.06  ? 129 SER A OG  1 
ATOM   1009 N N   . LEU A 1 129 ? -8.113  -41.827 43.192  1.00 28.16  ? 130 LEU A N   1 
ATOM   1010 C CA  . LEU A 1 129 ? -8.473  -43.214 42.905  1.00 28.67  ? 130 LEU A CA  1 
ATOM   1011 C C   . LEU A 1 129 ? -7.542  -44.170 43.640  1.00 32.92  ? 130 LEU A C   1 
ATOM   1012 O O   . LEU A 1 129 ? -6.335  -43.935 43.705  1.00 34.29  ? 130 LEU A O   1 
ATOM   1013 C CB  . LEU A 1 129 ? -8.421  -43.507 41.412  1.00 29.36  ? 130 LEU A CB  1 
ATOM   1014 C CG  . LEU A 1 129 ? -9.213  -42.615 40.463  1.00 35.45  ? 130 LEU A CG  1 
ATOM   1015 C CD1 . LEU A 1 129 ? -9.232  -43.245 39.080  1.00 27.04  ? 130 LEU A CD1 1 
ATOM   1016 C CD2 . LEU A 1 129 ? -10.613 -42.349 40.977  1.00 28.36  ? 130 LEU A CD2 1 
ATOM   1017 N N   . ASP A 1 130 ? -8.109  -45.245 44.185  1.00 37.71  ? 131 ASP A N   1 
ATOM   1018 C CA  . ASP A 1 130 ? -7.353  -46.223 44.969  1.00 35.74  ? 131 ASP A CA  1 
ATOM   1019 C C   . ASP A 1 130 ? -6.121  -46.711 44.229  1.00 34.20  ? 131 ASP A C   1 
ATOM   1020 O O   . ASP A 1 130 ? -5.088  -46.987 44.830  1.00 36.99  ? 131 ASP A O   1 
ATOM   1021 C CB  . ASP A 1 130 ? -8.221  -47.436 45.329  1.00 45.79  ? 131 ASP A CB  1 
ATOM   1022 C CG  . ASP A 1 130 ? -9.433  -47.074 46.168  1.00 45.29  ? 131 ASP A CG  1 
ATOM   1023 O OD1 . ASP A 1 130 ? -9.536  -45.922 46.629  1.00 53.77  ? 131 ASP A OD1 1 
ATOM   1024 O OD2 . ASP A 1 130 ? -10.283 -47.961 46.374  1.00 57.16  ? 131 ASP A OD2 1 
ATOM   1025 N N   . VAL A 1 131 ? -6.247  -46.809 42.915  1.00 33.58  ? 132 VAL A N   1 
ATOM   1026 C CA  . VAL A 1 131 ? -5.216  -47.399 42.083  1.00 35.63  ? 132 VAL A CA  1 
ATOM   1027 C C   . VAL A 1 131 ? -3.990  -46.466 41.955  1.00 35.00  ? 132 VAL A C   1 
ATOM   1028 O O   . VAL A 1 131 ? -2.919  -46.901 41.549  1.00 32.55  ? 132 VAL A O   1 
ATOM   1029 C CB  . VAL A 1 131 ? -5.824  -47.767 40.690  1.00 32.16  ? 132 VAL A CB  1 
ATOM   1030 C CG1 . VAL A 1 131 ? -6.187  -46.521 39.910  1.00 27.70  ? 132 VAL A CG1 1 
ATOM   1031 C CG2 . VAL A 1 131 ? -4.914  -48.694 39.890  1.00 30.44  ? 132 VAL A CG2 1 
ATOM   1032 N N   . TYR A 1 132 ? -4.130  -45.194 42.327  1.00 34.40  ? 133 TYR A N   1 
ATOM   1033 C CA  . TYR A 1 132 ? -2.980  -44.281 42.310  1.00 35.70  ? 133 TYR A CA  1 
ATOM   1034 C C   . TYR A 1 132 ? -2.401  -44.047 43.718  1.00 38.61  ? 133 TYR A C   1 
ATOM   1035 O O   . TYR A 1 132 ? -1.679  -43.073 43.939  1.00 40.11  ? 133 TYR A O   1 
ATOM   1036 C CB  . TYR A 1 132 ? -3.341  -42.916 41.707  1.00 28.23  ? 133 TYR A CB  1 
ATOM   1037 C CG  . TYR A 1 132 ? -4.027  -42.934 40.370  1.00 26.17  ? 133 TYR A CG  1 
ATOM   1038 C CD1 . TYR A 1 132 ? -3.725  -43.900 39.415  1.00 27.54  ? 133 TYR A CD1 1 
ATOM   1039 C CD2 . TYR A 1 132 ? -4.980  -41.969 40.053  1.00 25.94  ? 133 TYR A CD2 1 
ATOM   1040 C CE1 . TYR A 1 132 ? -4.360  -43.911 38.183  1.00 22.76  ? 133 TYR A CE1 1 
ATOM   1041 C CE2 . TYR A 1 132 ? -5.616  -41.967 38.823  1.00 26.14  ? 133 TYR A CE2 1 
ATOM   1042 C CZ  . TYR A 1 132 ? -5.305  -42.941 37.892  1.00 30.73  ? 133 TYR A CZ  1 
ATOM   1043 O OH  . TYR A 1 132 ? -5.944  -42.944 36.669  1.00 23.04  ? 133 TYR A OH  1 
ATOM   1044 N N   . ASP A 1 133 ? -2.730  -44.927 44.660  1.00 33.34  ? 134 ASP A N   1 
ATOM   1045 C CA  . ASP A 1 133 ? -2.210  -44.862 46.031  1.00 35.64  ? 134 ASP A CA  1 
ATOM   1046 C C   . ASP A 1 133 ? -0.678  -44.833 46.072  1.00 33.13  ? 134 ASP A C   1 
ATOM   1047 O O   . ASP A 1 133 ? -0.018  -45.799 45.683  1.00 41.68  ? 134 ASP A O   1 
ATOM   1048 C CB  . ASP A 1 133 ? -2.726  -46.062 46.836  1.00 43.74  ? 134 ASP A CB  1 
ATOM   1049 C CG  . ASP A 1 133 ? -2.623  -45.859 48.339  1.00 49.34  ? 134 ASP A CG  1 
ATOM   1050 O OD1 . ASP A 1 133 ? -1.982  -44.879 48.781  1.00 40.31  ? 134 ASP A OD1 1 
ATOM   1051 O OD2 . ASP A 1 133 ? -3.189  -46.700 49.079  1.00 57.53  ? 134 ASP A OD2 1 
ATOM   1052 N N   . GLY A 1 134 ? -0.115  -43.732 46.565  1.00 33.86  ? 135 GLY A N   1 
ATOM   1053 C CA  . GLY A 1 134 ? 1.328   -43.540 46.549  1.00 35.01  ? 135 GLY A CA  1 
ATOM   1054 C C   . GLY A 1 134 ? 2.133   -44.313 47.587  1.00 39.41  ? 135 GLY A C   1 
ATOM   1055 O O   . GLY A 1 134 ? 3.354   -44.454 47.463  1.00 42.81  ? 135 GLY A O   1 
ATOM   1056 N N   . ARG A 1 135 ? 1.453   -44.839 48.598  1.00 34.50  ? 136 ARG A N   1 
ATOM   1057 C CA  . ARG A 1 135 ? 2.133   -45.404 49.758  1.00 31.40  ? 136 ARG A CA  1 
ATOM   1058 C C   . ARG A 1 135 ? 3.107   -46.564 49.471  1.00 32.76  ? 136 ARG A C   1 
ATOM   1059 O O   . ARG A 1 135 ? 4.136   -46.660 50.127  1.00 37.78  ? 136 ARG A O   1 
ATOM   1060 C CB  . ARG A 1 135 ? 1.088   -45.840 50.791  1.00 36.08  ? 136 ARG A CB  1 
ATOM   1061 C CG  . ARG A 1 135 ? 0.491   -47.216 50.581  1.00 41.12  ? 136 ARG A CG  1 
ATOM   1062 C CD  . ARG A 1 135 ? -0.533  -47.521 51.652  1.00 35.95  ? 136 ARG A CD  1 
ATOM   1063 N NE  . ARG A 1 135 ? -1.742  -46.723 51.484  1.00 39.63  ? 136 ARG A NE  1 
ATOM   1064 C CZ  . ARG A 1 135 ? -2.661  -46.567 52.428  1.00 40.12  ? 136 ARG A CZ  1 
ATOM   1065 N NH1 . ARG A 1 135 ? -2.493  -47.150 53.613  1.00 39.45  ? 136 ARG A NH1 1 
ATOM   1066 N NH2 . ARG A 1 135 ? -3.734  -45.816 52.195  1.00 35.57  ? 136 ARG A NH2 1 
ATOM   1067 N N   . PHE A 1 136 ? 2.823   -47.431 48.502  1.00 37.46  ? 137 PHE A N   1 
ATOM   1068 C CA  . PHE A 1 136 ? 3.706   -48.586 48.292  1.00 38.67  ? 137 PHE A CA  1 
ATOM   1069 C C   . PHE A 1 136 ? 5.002   -48.203 47.567  1.00 39.16  ? 137 PHE A C   1 
ATOM   1070 O O   . PHE A 1 136 ? 6.069   -48.720 47.889  1.00 39.94  ? 137 PHE A O   1 
ATOM   1071 C CB  . PHE A 1 136 ? 2.973   -49.701 47.536  1.00 31.08  ? 137 PHE A CB  1 
ATOM   1072 C CG  . PHE A 1 136 ? 1.698   -50.119 48.195  1.00 39.58  ? 137 PHE A CG  1 
ATOM   1073 C CD1 . PHE A 1 136 ? 0.475   -49.704 47.694  1.00 37.02  ? 137 PHE A CD1 1 
ATOM   1074 C CD2 . PHE A 1 136 ? 1.722   -50.893 49.351  1.00 40.48  ? 137 PHE A CD2 1 
ATOM   1075 C CE1 . PHE A 1 136 ? -0.703  -50.070 48.322  1.00 40.35  ? 137 PHE A CE1 1 
ATOM   1076 C CE2 . PHE A 1 136 ? 0.555   -51.260 49.984  1.00 33.75  ? 137 PHE A CE2 1 
ATOM   1077 C CZ  . PHE A 1 136 ? -0.663  -50.847 49.471  1.00 39.70  ? 137 PHE A CZ  1 
ATOM   1078 N N   . LEU A 1 137 ? 4.908   -47.292 46.603  1.00 41.66  ? 138 LEU A N   1 
ATOM   1079 C CA  . LEU A 1 137 ? 6.089   -46.791 45.906  1.00 37.40  ? 138 LEU A CA  1 
ATOM   1080 C C   . LEU A 1 137 ? 7.034   -46.104 46.862  1.00 37.79  ? 138 LEU A C   1 
ATOM   1081 O O   . LEU A 1 137 ? 8.244   -46.353 46.866  1.00 38.22  ? 138 LEU A O   1 
ATOM   1082 C CB  . LEU A 1 137 ? 5.701   -45.806 44.813  1.00 37.48  ? 138 LEU A CB  1 
ATOM   1083 C CG  . LEU A 1 137 ? 5.816   -46.347 43.404  1.00 32.59  ? 138 LEU A CG  1 
ATOM   1084 C CD1 . LEU A 1 137 ? 5.055   -45.410 42.479  1.00 31.73  ? 138 LEU A CD1 1 
ATOM   1085 C CD2 . LEU A 1 137 ? 7.271   -46.488 43.022  1.00 27.16  ? 138 LEU A CD2 1 
ATOM   1086 N N   . VAL A 1 138 ? 6.461   -45.218 47.661  1.00 32.36  ? 139 VAL A N   1 
ATOM   1087 C CA  . VAL A 1 138 ? 7.232   -44.461 48.622  1.00 36.49  ? 139 VAL A CA  1 
ATOM   1088 C C   . VAL A 1 138 ? 7.961   -45.368 49.607  1.00 39.32  ? 139 VAL A C   1 
ATOM   1089 O O   . VAL A 1 138 ? 9.141   -45.165 49.874  1.00 38.67  ? 139 VAL A O   1 
ATOM   1090 C CB  . VAL A 1 138 ? 6.337   -43.485 49.376  1.00 30.38  ? 139 VAL A CB  1 
ATOM   1091 C CG1 . VAL A 1 138 ? 7.081   -42.885 50.537  1.00 32.92  ? 139 VAL A CG1 1 
ATOM   1092 C CG2 . VAL A 1 138 ? 5.873   -42.405 48.425  1.00 33.80  ? 139 VAL A CG2 1 
ATOM   1093 N N   . GLN A 1 139 ? 7.275   -46.384 50.125  1.00 36.13  ? 140 GLN A N   1 
ATOM   1094 C CA  . GLN A 1 139 ? 7.877   -47.237 51.137  1.00 36.46  ? 140 GLN A CA  1 
ATOM   1095 C C   . GLN A 1 139 ? 8.979   -48.088 50.521  1.00 36.26  ? 140 GLN A C   1 
ATOM   1096 O O   . GLN A 1 139 ? 10.076  -48.191 51.063  1.00 42.37  ? 140 GLN A O   1 
ATOM   1097 C CB  . GLN A 1 139 ? 6.816   -48.120 51.806  1.00 35.22  ? 140 GLN A CB  1 
ATOM   1098 C CG  . GLN A 1 139 ? 7.300   -48.839 53.059  1.00 31.00  ? 140 GLN A CG  1 
ATOM   1099 C CD  . GLN A 1 139 ? 8.113   -50.086 52.747  1.00 43.60  ? 140 GLN A CD  1 
ATOM   1100 O OE1 . GLN A 1 139 ? 7.753   -50.870 51.866  1.00 41.72  ? 140 GLN A OE1 1 
ATOM   1101 N NE2 . GLN A 1 139 ? 9.224   -50.268 53.460  1.00 40.07  ? 140 GLN A NE2 1 
ATOM   1102 N N   . ALA A 1 140 ? 8.680   -48.682 49.375  1.00 38.28  ? 141 ALA A N   1 
ATOM   1103 C CA  . ALA A 1 140 ? 9.575   -49.639 48.743  1.00 33.43  ? 141 ALA A CA  1 
ATOM   1104 C C   . ALA A 1 140 ? 10.800  -49.005 48.071  1.00 35.52  ? 141 ALA A C   1 
ATOM   1105 O O   . ALA A 1 140 ? 11.851  -49.631 47.955  1.00 39.65  ? 141 ALA A O   1 
ATOM   1106 C CB  . ALA A 1 140 ? 8.793   -50.455 47.721  1.00 34.86  ? 141 ALA A CB  1 
ATOM   1107 N N   . GLU A 1 141 ? 10.668  -47.774 47.602  1.00 32.90  ? 142 GLU A N   1 
ATOM   1108 C CA  . GLU A 1 141 ? 11.720  -47.197 46.774  1.00 39.60  ? 142 GLU A CA  1 
ATOM   1109 C C   . GLU A 1 141 ? 12.192  -45.869 47.331  1.00 38.21  ? 142 GLU A C   1 
ATOM   1110 O O   . GLU A 1 141 ? 13.088  -45.233 46.782  1.00 41.35  ? 142 GLU A O   1 
ATOM   1111 C CB  . GLU A 1 141 ? 11.236  -47.043 45.326  1.00 31.84  ? 142 GLU A CB  1 
ATOM   1112 C CG  . GLU A 1 141 ? 11.039  -48.379 44.613  1.00 34.27  ? 142 GLU A CG  1 
ATOM   1113 C CD  . GLU A 1 141 ? 12.337  -49.178 44.469  1.00 42.31  ? 142 GLU A CD  1 
ATOM   1114 O OE1 . GLU A 1 141 ? 13.433  -48.573 44.463  1.00 44.37  ? 142 GLU A OE1 1 
ATOM   1115 O OE2 . GLU A 1 141 ? 12.264  -50.420 44.364  1.00 42.66  ? 142 GLU A OE2 1 
ATOM   1116 N N   . ARG A 1 142 ? 11.573  -45.468 48.432  1.00 37.22  ? 143 ARG A N   1 
ATOM   1117 C CA  . ARG A 1 142 ? 12.020  -44.328 49.214  1.00 41.03  ? 143 ARG A CA  1 
ATOM   1118 C C   . ARG A 1 142 ? 12.210  -43.108 48.334  1.00 35.18  ? 143 ARG A C   1 
ATOM   1119 O O   . ARG A 1 142 ? 13.231  -42.444 48.385  1.00 41.00  ? 143 ARG A O   1 
ATOM   1120 C CB  . ARG A 1 142 ? 13.299  -44.683 49.979  1.00 37.69  ? 143 ARG A CB  1 
ATOM   1121 C CG  . ARG A 1 142 ? 13.082  -45.835 50.966  1.00 37.71  ? 143 ARG A CG  1 
ATOM   1122 C CD  . ARG A 1 142 ? 14.249  -46.053 51.907  1.00 46.12  ? 143 ARG A CD  1 
ATOM   1123 N NE  . ARG A 1 142 ? 14.609  -44.835 52.632  1.00 67.81  ? 143 ARG A NE  1 
ATOM   1124 C CZ  . ARG A 1 142 ? 13.976  -44.386 53.711  1.00 60.51  ? 143 ARG A CZ  1 
ATOM   1125 N NH1 . ARG A 1 142 ? 12.935  -45.052 54.201  1.00 47.33  ? 143 ARG A NH1 1 
ATOM   1126 N NH2 . ARG A 1 142 ? 14.384  -43.266 54.299  1.00 68.78  ? 143 ARG A NH2 1 
ATOM   1127 N N   . THR A 1 143 ? 11.213  -42.854 47.500  1.00 33.55  ? 144 THR A N   1 
ATOM   1128 C CA  . THR A 1 143 ? 11.097  -41.594 46.783  1.00 40.02  ? 144 THR A CA  1 
ATOM   1129 C C   . THR A 1 143 ? 10.037  -40.748 47.453  1.00 34.42  ? 144 THR A C   1 
ATOM   1130 O O   . THR A 1 143 ? 9.276   -41.238 48.281  1.00 35.37  ? 144 THR A O   1 
ATOM   1131 C CB  . THR A 1 143 ? 10.693  -41.794 45.326  1.00 38.45  ? 144 THR A CB  1 
ATOM   1132 O OG1 . THR A 1 143 ? 9.628   -42.749 45.282  1.00 41.38  ? 144 THR A OG1 1 
ATOM   1133 C CG2 . THR A 1 143 ? 11.868  -42.305 44.500  1.00 42.04  ? 144 THR A CG2 1 
ATOM   1134 N N   . VAL A 1 144 ? 9.981   -39.478 47.093  1.00 32.84  ? 145 VAL A N   1 
ATOM   1135 C CA  . VAL A 1 144 ? 8.819   -38.678 47.424  1.00 29.52  ? 145 VAL A CA  1 
ATOM   1136 C C   . VAL A 1 144 ? 7.877   -38.760 46.225  1.00 40.17  ? 145 VAL A C   1 
ATOM   1137 O O   . VAL A 1 144 ? 8.329   -38.744 45.070  1.00 37.64  ? 145 VAL A O   1 
ATOM   1138 C CB  . VAL A 1 144 ? 9.193   -37.224 47.732  1.00 35.73  ? 145 VAL A CB  1 
ATOM   1139 C CG1 . VAL A 1 144 ? 7.950   -36.343 47.759  1.00 31.81  ? 145 VAL A CG1 1 
ATOM   1140 C CG2 . VAL A 1 144 ? 9.963   -37.143 49.049  1.00 34.55  ? 145 VAL A CG2 1 
ATOM   1141 N N   . LEU A 1 145 ? 6.580   -38.890 46.491  1.00 31.64  ? 146 LEU A N   1 
ATOM   1142 C CA  . LEU A 1 145 ? 5.611   -38.969 45.411  1.00 26.80  ? 146 LEU A CA  1 
ATOM   1143 C C   . LEU A 1 145 ? 4.556   -37.887 45.567  1.00 30.90  ? 146 LEU A C   1 
ATOM   1144 O O   . LEU A 1 145 ? 4.023   -37.680 46.657  1.00 34.79  ? 146 LEU A O   1 
ATOM   1145 C CB  . LEU A 1 145 ? 4.963   -40.354 45.360  1.00 31.78  ? 146 LEU A CB  1 
ATOM   1146 C CG  . LEU A 1 145 ? 4.272   -40.759 44.049  1.00 28.85  ? 146 LEU A CG  1 
ATOM   1147 C CD1 . LEU A 1 145 ? 4.168   -42.254 43.998  1.00 46.63  ? 146 LEU A CD1 1 
ATOM   1148 C CD2 . LEU A 1 145 ? 2.879   -40.170 43.930  1.00 38.76  ? 146 LEU A CD2 1 
ATOM   1149 N N   . VAL A 1 146 ? 4.274   -37.206 44.458  1.00 28.45  ? 147 VAL A N   1 
ATOM   1150 C CA  . VAL A 1 146 ? 3.294   -36.125 44.394  1.00 29.73  ? 147 VAL A CA  1 
ATOM   1151 C C   . VAL A 1 146 ? 2.319   -36.380 43.258  1.00 29.19  ? 147 VAL A C   1 
ATOM   1152 O O   . VAL A 1 146 ? 2.735   -36.733 42.156  1.00 32.80  ? 147 VAL A O   1 
ATOM   1153 C CB  . VAL A 1 146 ? 3.957   -34.740 44.151  1.00 25.85  ? 147 VAL A CB  1 
ATOM   1154 C CG1 . VAL A 1 146 ? 2.906   -33.659 44.085  1.00 22.07  ? 147 VAL A CG1 1 
ATOM   1155 C CG2 . VAL A 1 146 ? 4.976   -34.420 45.227  1.00 32.19  ? 147 VAL A CG2 1 
ATOM   1156 N N   . SER A 1 147 ? 1.028   -36.202 43.522  1.00 29.57  ? 148 SER A N   1 
ATOM   1157 C CA  . SER A 1 147 ? 0.023   -36.177 42.459  1.00 30.81  ? 148 SER A CA  1 
ATOM   1158 C C   . SER A 1 147 ? -0.875  -34.962 42.674  1.00 31.03  ? 148 SER A C   1 
ATOM   1159 O O   . SER A 1 147 ? -1.085  -34.544 43.818  1.00 30.04  ? 148 SER A O   1 
ATOM   1160 C CB  . SER A 1 147 ? -0.800  -37.472 42.436  1.00 29.39  ? 148 SER A CB  1 
ATOM   1161 O OG  . SER A 1 147 ? -1.495  -37.682 43.655  1.00 27.62  ? 148 SER A OG  1 
ATOM   1162 N N   . MET A 1 148 ? -1.374  -34.377 41.588  1.00 26.31  ? 149 MET A N   1 
ATOM   1163 C CA  . MET A 1 148 ? -2.288  -33.243 41.688  1.00 24.51  ? 149 MET A CA  1 
ATOM   1164 C C   . MET A 1 148 ? -3.621  -33.516 40.988  1.00 28.93  ? 149 MET A C   1 
ATOM   1165 O O   . MET A 1 148 ? -3.727  -34.408 40.147  1.00 31.26  ? 149 MET A O   1 
ATOM   1166 C CB  . MET A 1 148 ? -1.654  -31.982 41.093  1.00 32.76  ? 149 MET A CB  1 
ATOM   1167 C CG  . MET A 1 148 ? -1.793  -31.847 39.566  1.00 27.99  ? 149 MET A CG  1 
ATOM   1168 S SD  . MET A 1 148 ? -0.888  -33.117 38.672  1.00 33.05  ? 149 MET A SD  1 
ATOM   1169 C CE  . MET A 1 148 ? 0.796   -32.610 38.956  1.00 34.08  ? 149 MET A CE  1 
ATOM   1170 N N   . ASN A 1 149 ? -4.642  -32.749 41.348  1.00 25.96  ? 150 ASN A N   1 
ATOM   1171 C CA  . ASN A 1 149 ? -5.855  -32.718 40.553  1.00 28.48  ? 150 ASN A CA  1 
ATOM   1172 C C   . ASN A 1 149 ? -5.728  -31.605 39.537  1.00 30.97  ? 150 ASN A C   1 
ATOM   1173 O O   . ASN A 1 149 ? -5.118  -30.582 39.824  1.00 31.60  ? 150 ASN A O   1 
ATOM   1174 C CB  . ASN A 1 149 ? -7.092  -32.498 41.425  1.00 30.78  ? 150 ASN A CB  1 
ATOM   1175 C CG  . ASN A 1 149 ? -7.569  -33.765 42.089  1.00 32.91  ? 150 ASN A CG  1 
ATOM   1176 O OD1 . ASN A 1 149 ? -7.204  -34.871 41.684  1.00 33.31  ? 150 ASN A OD1 1 
ATOM   1177 N ND2 . ASN A 1 149 ? -8.400  -33.613 43.110  1.00 38.60  ? 150 ASN A ND2 1 
ATOM   1178 N N   . TYR A 1 150 ? -6.286  -31.798 38.349  1.00 29.29  ? 151 TYR A N   1 
ATOM   1179 C CA  . TYR A 1 150 ? -6.353  -30.705 37.391  1.00 28.64  ? 151 TYR A CA  1 
ATOM   1180 C C   . TYR A 1 150 ? -7.726  -30.711 36.738  1.00 30.75  ? 151 TYR A C   1 
ATOM   1181 O O   . TYR A 1 150 ? -8.327  -31.766 36.556  1.00 31.09  ? 151 TYR A O   1 
ATOM   1182 C CB  . TYR A 1 150 ? -5.236  -30.810 36.348  1.00 21.62  ? 151 TYR A CB  1 
ATOM   1183 C CG  . TYR A 1 150 ? -5.300  -32.060 35.512  1.00 27.23  ? 151 TYR A CG  1 
ATOM   1184 C CD1 . TYR A 1 150 ? -4.740  -33.247 35.965  1.00 20.09  ? 151 TYR A CD1 1 
ATOM   1185 C CD2 . TYR A 1 150 ? -5.931  -32.056 34.272  1.00 24.16  ? 151 TYR A CD2 1 
ATOM   1186 C CE1 . TYR A 1 150 ? -4.796  -34.388 35.212  1.00 19.68  ? 151 TYR A CE1 1 
ATOM   1187 C CE2 . TYR A 1 150 ? -5.997  -33.197 33.507  1.00 21.86  ? 151 TYR A CE2 1 
ATOM   1188 C CZ  . TYR A 1 150 ? -5.431  -34.363 33.978  1.00 28.82  ? 151 TYR A CZ  1 
ATOM   1189 O OH  . TYR A 1 150 ? -5.495  -35.498 33.202  1.00 24.61  ? 151 TYR A OH  1 
ATOM   1190 N N   . ARG A 1 151 ? -8.227  -29.529 36.402  1.00 31.58  ? 152 ARG A N   1 
ATOM   1191 C CA  . ARG A 1 151 ? -9.548  -29.413 35.802  1.00 28.81  ? 152 ARG A CA  1 
ATOM   1192 C C   . ARG A 1 151 ? -9.631  -30.165 34.470  1.00 34.31  ? 152 ARG A C   1 
ATOM   1193 O O   . ARG A 1 151 ? -8.683  -30.168 33.678  1.00 32.33  ? 152 ARG A O   1 
ATOM   1194 C CB  . ARG A 1 151 ? -9.906  -27.943 35.604  1.00 28.25  ? 152 ARG A CB  1 
ATOM   1195 C CG  . ARG A 1 151 ? -10.096 -27.200 36.905  1.00 33.46  ? 152 ARG A CG  1 
ATOM   1196 C CD  . ARG A 1 151 ? -10.271 -25.724 36.668  1.00 29.07  ? 152 ARG A CD  1 
ATOM   1197 N NE  . ARG A 1 151 ? -8.990  -25.053 36.514  1.00 29.67  ? 152 ARG A NE  1 
ATOM   1198 C CZ  . ARG A 1 151 ? -8.860  -23.771 36.190  1.00 37.41  ? 152 ARG A CZ  1 
ATOM   1199 N NH1 . ARG A 1 151 ? -9.943  -23.036 35.975  1.00 30.77  ? 152 ARG A NH1 1 
ATOM   1200 N NH2 . ARG A 1 151 ? -7.653  -23.226 36.074  1.00 34.47  ? 152 ARG A NH2 1 
ATOM   1201 N N   . VAL A 1 152 ? -10.766 -30.817 34.241  1.00 31.99  ? 153 VAL A N   1 
ATOM   1202 C CA  . VAL A 1 152 ? -10.968 -31.559 33.008  1.00 30.65  ? 153 VAL A CA  1 
ATOM   1203 C C   . VAL A 1 152 ? -12.216 -31.071 32.298  1.00 30.64  ? 153 VAL A C   1 
ATOM   1204 O O   . VAL A 1 152 ? -12.899 -30.168 32.783  1.00 33.65  ? 153 VAL A O   1 
ATOM   1205 C CB  . VAL A 1 152 ? -11.063 -33.076 33.264  1.00 28.10  ? 153 VAL A CB  1 
ATOM   1206 C CG1 . VAL A 1 152 ? -9.719  -33.609 33.709  1.00 24.14  ? 153 VAL A CG1 1 
ATOM   1207 C CG2 . VAL A 1 152 ? -12.136 -33.392 34.301  1.00 29.45  ? 153 VAL A CG2 1 
ATOM   1208 N N   . GLY A 1 153 ? -12.502 -31.666 31.144  1.00 30.84  ? 154 GLY A N   1 
ATOM   1209 C CA  . GLY A 1 153 ? -13.660 -31.285 30.358  1.00 29.52  ? 154 GLY A CA  1 
ATOM   1210 C C   . GLY A 1 153 ? -13.678 -29.802 30.068  1.00 32.71  ? 154 GLY A C   1 
ATOM   1211 O O   . GLY A 1 153 ? -12.628 -29.192 29.871  1.00 37.71  ? 154 GLY A O   1 
ATOM   1212 N N   . ALA A 1 154 ? -14.863 -29.205 30.060  1.00 37.58  ? 155 ALA A N   1 
ATOM   1213 C CA  . ALA A 1 154 ? -14.970 -27.803 29.682  1.00 35.52  ? 155 ALA A CA  1 
ATOM   1214 C C   . ALA A 1 154 ? -14.273 -26.911 30.704  1.00 35.91  ? 155 ALA A C   1 
ATOM   1215 O O   . ALA A 1 154 ? -13.711 -25.877 30.346  1.00 39.42  ? 155 ALA A O   1 
ATOM   1216 C CB  . ALA A 1 154 ? -16.426 -27.400 29.517  1.00 36.21  ? 155 ALA A CB  1 
ATOM   1217 N N   . PHE A 1 155 ? -14.285 -27.330 31.967  1.00 35.11  ? 156 PHE A N   1 
ATOM   1218 C CA  . PHE A 1 155 ? -13.672 -26.549 33.041  1.00 32.47  ? 156 PHE A CA  1 
ATOM   1219 C C   . PHE A 1 155 ? -12.173 -26.406 32.858  1.00 35.10  ? 156 PHE A C   1 
ATOM   1220 O O   . PHE A 1 155 ? -11.579 -25.443 33.324  1.00 41.82  ? 156 PHE A O   1 
ATOM   1221 C CB  . PHE A 1 155 ? -13.980 -27.181 34.398  1.00 26.31  ? 156 PHE A CB  1 
ATOM   1222 C CG  . PHE A 1 155 ? -15.428 -27.460 34.591  1.00 40.75  ? 156 PHE A CG  1 
ATOM   1223 C CD1 . PHE A 1 155 ? -15.949 -28.714 34.307  1.00 45.73  ? 156 PHE A CD1 1 
ATOM   1224 C CD2 . PHE A 1 155 ? -16.289 -26.449 34.995  1.00 37.42  ? 156 PHE A CD2 1 
ATOM   1225 C CE1 . PHE A 1 155 ? -17.295 -28.966 34.464  1.00 37.46  ? 156 PHE A CE1 1 
ATOM   1226 C CE2 . PHE A 1 155 ? -17.632 -26.687 35.140  1.00 32.36  ? 156 PHE A CE2 1 
ATOM   1227 C CZ  . PHE A 1 155 ? -18.137 -27.951 34.879  1.00 42.39  ? 156 PHE A CZ  1 
ATOM   1228 N N   . GLY A 1 156 ? -11.566 -27.359 32.161  1.00 36.27  ? 157 GLY A N   1 
ATOM   1229 C CA  . GLY A 1 156 ? -10.133 -27.335 31.956  1.00 31.38  ? 157 GLY A CA  1 
ATOM   1230 C C   . GLY A 1 156 ? -9.695  -26.907 30.569  1.00 31.88  ? 157 GLY A C   1 
ATOM   1231 O O   . GLY A 1 156 ? -8.580  -26.401 30.405  1.00 30.61  ? 157 GLY A O   1 
ATOM   1232 N N   . PHE A 1 157 ? -10.551 -27.098 29.565  1.00 29.53  ? 158 PHE A N   1 
ATOM   1233 C CA  . PHE A 1 157 ? -10.096 -26.938 28.185  1.00 32.91  ? 158 PHE A CA  1 
ATOM   1234 C C   . PHE A 1 157 ? -11.073 -26.280 27.233  1.00 35.82  ? 158 PHE A C   1 
ATOM   1235 O O   . PHE A 1 157 ? -10.842 -26.281 26.030  1.00 39.39  ? 158 PHE A O   1 
ATOM   1236 C CB  . PHE A 1 157 ? -9.686  -28.299 27.626  1.00 24.01  ? 158 PHE A CB  1 
ATOM   1237 C CG  . PHE A 1 157 ? -8.605  -28.943 28.419  1.00 29.69  ? 158 PHE A CG  1 
ATOM   1238 C CD1 . PHE A 1 157 ? -8.908  -29.882 29.397  1.00 32.58  ? 158 PHE A CD1 1 
ATOM   1239 C CD2 . PHE A 1 157 ? -7.287  -28.556 28.249  1.00 31.84  ? 158 PHE A CD2 1 
ATOM   1240 C CE1 . PHE A 1 157 ? -7.907  -30.458 30.166  1.00 31.35  ? 158 PHE A CE1 1 
ATOM   1241 C CE2 . PHE A 1 157 ? -6.278  -29.125 29.017  1.00 36.50  ? 158 PHE A CE2 1 
ATOM   1242 C CZ  . PHE A 1 157 ? -6.588  -30.078 29.976  1.00 30.70  ? 158 PHE A CZ  1 
ATOM   1243 N N   . LEU A 1 158 ? -12.155 -25.708 27.748  1.00 38.95  ? 159 LEU A N   1 
ATOM   1244 C CA  . LEU A 1 158 ? -12.979 -24.858 26.899  1.00 38.39  ? 159 LEU A CA  1 
ATOM   1245 C C   . LEU A 1 158 ? -12.145 -23.639 26.512  1.00 40.62  ? 159 LEU A C   1 
ATOM   1246 O O   . LEU A 1 158 ? -11.518 -23.017 27.358  1.00 42.22  ? 159 LEU A O   1 
ATOM   1247 C CB  . LEU A 1 158 ? -14.266 -24.440 27.603  1.00 36.47  ? 159 LEU A CB  1 
ATOM   1248 C CG  . LEU A 1 158 ? -15.111 -23.404 26.863  1.00 38.62  ? 159 LEU A CG  1 
ATOM   1249 C CD1 . LEU A 1 158 ? -16.577 -23.771 26.982  1.00 36.40  ? 159 LEU A CD1 1 
ATOM   1250 C CD2 . LEU A 1 158 ? -14.859 -21.994 27.392  1.00 30.50  ? 159 LEU A CD2 1 
ATOM   1251 N N   . ALA A 1 159 ? -12.122 -23.305 25.231  1.00 40.71  ? 160 ALA A N   1 
ATOM   1252 C CA  . ALA A 1 159 ? -11.270 -22.218 24.787  1.00 40.84  ? 160 ALA A CA  1 
ATOM   1253 C C   . ALA A 1 159 ? -11.978 -21.308 23.800  1.00 44.31  ? 160 ALA A C   1 
ATOM   1254 O O   . ALA A 1 159 ? -12.563 -21.769 22.820  1.00 42.19  ? 160 ALA A O   1 
ATOM   1255 C CB  . ALA A 1 159 ? -9.990  -22.773 24.168  1.00 37.60  ? 160 ALA A CB  1 
ATOM   1256 N N   . LEU A 1 160 ? -11.934 -20.010 24.083  1.00 46.88  ? 161 LEU A N   1 
ATOM   1257 C CA  . LEU A 1 160 ? -12.229 -18.988 23.088  1.00 48.92  ? 161 LEU A CA  1 
ATOM   1258 C C   . LEU A 1 160 ? -10.929 -18.260 22.768  1.00 49.08  ? 161 LEU A C   1 
ATOM   1259 O O   . LEU A 1 160 ? -10.639 -17.214 23.351  1.00 48.73  ? 161 LEU A O   1 
ATOM   1260 C CB  . LEU A 1 160 ? -13.292 -18.018 23.590  1.00 42.45  ? 161 LEU A CB  1 
ATOM   1261 C CG  . LEU A 1 160 ? -14.688 -18.628 23.614  1.00 45.04  ? 161 LEU A CG  1 
ATOM   1262 C CD1 . LEU A 1 160 ? -15.682 -17.694 24.282  1.00 55.66  ? 161 LEU A CD1 1 
ATOM   1263 C CD2 . LEU A 1 160 ? -15.119 -18.939 22.204  1.00 43.45  ? 161 LEU A CD2 1 
ATOM   1264 N N   . PRO A 1 161 ? -10.134 -18.826 21.844  1.00 52.95  ? 162 PRO A N   1 
ATOM   1265 C CA  . PRO A 1 161 ? -8.773  -18.368 21.530  1.00 55.43  ? 162 PRO A CA  1 
ATOM   1266 C C   . PRO A 1 161 ? -8.677  -16.865 21.291  1.00 56.59  ? 162 PRO A C   1 
ATOM   1267 O O   . PRO A 1 161 ? -9.370  -16.318 20.430  1.00 51.94  ? 162 PRO A O   1 
ATOM   1268 C CB  . PRO A 1 161 ? -8.434  -19.138 20.255  1.00 44.95  ? 162 PRO A CB  1 
ATOM   1269 C CG  . PRO A 1 161 ? -9.259  -20.379 20.352  1.00 53.31  ? 162 PRO A CG  1 
ATOM   1270 C CD  . PRO A 1 161 ? -10.553 -19.933 20.968  1.00 48.53  ? 162 PRO A CD  1 
ATOM   1271 N N   . GLY A 1 162 ? -7.823  -16.210 22.069  1.00 49.10  ? 163 GLY A N   1 
ATOM   1272 C CA  . GLY A 1 162 ? -7.586  -14.791 21.913  1.00 57.31  ? 163 GLY A CA  1 
ATOM   1273 C C   . GLY A 1 162 ? -8.223  -13.990 23.024  1.00 65.57  ? 163 GLY A C   1 
ATOM   1274 O O   . GLY A 1 162 ? -7.824  -12.857 23.286  1.00 69.51  ? 163 GLY A O   1 
ATOM   1275 N N   . SER A 1 163 ? -9.217  -14.583 23.679  1.00 61.75  ? 164 SER A N   1 
ATOM   1276 C CA  . SER A 1 163 ? -9.927  -13.919 24.765  1.00 56.63  ? 164 SER A CA  1 
ATOM   1277 C C   . SER A 1 163 ? -9.215  -14.150 26.079  1.00 57.29  ? 164 SER A C   1 
ATOM   1278 O O   . SER A 1 163 ? -8.590  -15.189 26.267  1.00 60.52  ? 164 SER A O   1 
ATOM   1279 C CB  . SER A 1 163 ? -11.364 -14.427 24.870  1.00 67.55  ? 164 SER A CB  1 
ATOM   1280 O OG  . SER A 1 163 ? -11.401 -15.689 25.513  1.00 58.74  ? 164 SER A OG  1 
ATOM   1281 N N   . ARG A 1 164 ? -9.309  -13.193 26.994  1.00 62.79  ? 165 ARG A N   1 
ATOM   1282 C CA  . ARG A 1 164 ? -8.692  -13.378 28.298  1.00 70.79  ? 165 ARG A CA  1 
ATOM   1283 C C   . ARG A 1 164 ? -9.667  -14.048 29.269  1.00 65.97  ? 165 ARG A C   1 
ATOM   1284 O O   . ARG A 1 164 ? -9.283  -14.426 30.374  1.00 64.92  ? 165 ARG A O   1 
ATOM   1285 C CB  . ARG A 1 164 ? -8.195  -12.043 28.867  1.00 73.40  ? 165 ARG A CB  1 
ATOM   1286 C CG  . ARG A 1 164 ? -9.259  -10.957 28.988  1.00 92.81  ? 165 ARG A CG  1 
ATOM   1287 C CD  . ARG A 1 164 ? -9.001  -10.068 30.208  1.00 102.34 ? 165 ARG A CD  1 
ATOM   1288 N NE  . ARG A 1 164 ? -9.297  -8.659  29.949  1.00 106.59 ? 165 ARG A NE  1 
ATOM   1289 C CZ  . ARG A 1 164 ? -9.288  -7.705  30.878  1.00 110.45 ? 165 ARG A CZ  1 
ATOM   1290 N NH1 . ARG A 1 164 ? -9.009  -8.003  32.143  1.00 97.06  ? 165 ARG A NH1 1 
ATOM   1291 N NH2 . ARG A 1 164 ? -9.567  -6.450  30.542  1.00 102.75 ? 165 ARG A NH2 1 
ATOM   1292 N N   . GLU A 1 165 ? -10.920 -14.209 28.849  1.00 60.94  ? 166 GLU A N   1 
ATOM   1293 C CA  . GLU A 1 165 ? -11.945 -14.780 29.719  1.00 56.55  ? 166 GLU A CA  1 
ATOM   1294 C C   . GLU A 1 165 ? -11.961 -16.295 29.640  1.00 51.15  ? 166 GLU A C   1 
ATOM   1295 O O   . GLU A 1 165 ? -12.401 -16.959 30.574  1.00 56.47  ? 166 GLU A O   1 
ATOM   1296 C CB  . GLU A 1 165 ? -13.335 -14.234 29.377  1.00 61.28  ? 166 GLU A CB  1 
ATOM   1297 C CG  . GLU A 1 165 ? -13.535 -12.748 29.687  1.00 74.34  ? 166 GLU A CG  1 
ATOM   1298 C CD  . GLU A 1 165 ? -13.229 -11.831 28.496  1.00 98.03  ? 166 GLU A CD  1 
ATOM   1299 O OE1 . GLU A 1 165 ? -12.785 -12.326 27.425  1.00 85.47  ? 166 GLU A OE1 1 
ATOM   1300 O OE2 . GLU A 1 165 ? -13.442 -10.603 28.640  1.00 97.16  ? 166 GLU A OE2 1 
ATOM   1301 N N   . ALA A 1 166 ? -11.498 -16.840 28.522  1.00 49.27  ? 167 ALA A N   1 
ATOM   1302 C CA  . ALA A 1 166 ? -11.340 -18.287 28.387  1.00 45.85  ? 167 ALA A CA  1 
ATOM   1303 C C   . ALA A 1 166 ? -10.259 -18.592 27.362  1.00 45.05  ? 167 ALA A C   1 
ATOM   1304 O O   . ALA A 1 166 ? -10.561 -18.866 26.201  1.00 43.37  ? 167 ALA A O   1 
ATOM   1305 C CB  . ALA A 1 166 ? -12.649 -18.945 27.991  1.00 39.92  ? 167 ALA A CB  1 
ATOM   1306 N N   . PRO A 1 167 ? -8.991  -18.545 27.799  1.00 41.95  ? 168 PRO A N   1 
ATOM   1307 C CA  . PRO A 1 167 ? -7.808  -18.691 26.937  1.00 40.95  ? 168 PRO A CA  1 
ATOM   1308 C C   . PRO A 1 167 ? -7.486  -20.126 26.519  1.00 44.95  ? 168 PRO A C   1 
ATOM   1309 O O   . PRO A 1 167 ? -6.776  -20.323 25.534  1.00 47.31  ? 168 PRO A O   1 
ATOM   1310 C CB  . PRO A 1 167 ? -6.682  -18.131 27.805  1.00 34.17  ? 168 PRO A CB  1 
ATOM   1311 C CG  . PRO A 1 167 ? -7.157  -18.314 29.193  1.00 39.44  ? 168 PRO A CG  1 
ATOM   1312 C CD  . PRO A 1 167 ? -8.634  -18.190 29.181  1.00 36.61  ? 168 PRO A CD  1 
ATOM   1313 N N   . GLY A 1 168 ? -7.988  -21.110 27.255  1.00 40.86  ? 169 GLY A N   1 
ATOM   1314 C CA  . GLY A 1 168 ? -7.711  -22.497 26.932  1.00 40.29  ? 169 GLY A CA  1 
ATOM   1315 C C   . GLY A 1 168 ? -6.503  -23.054 27.662  1.00 39.60  ? 169 GLY A C   1 
ATOM   1316 O O   . GLY A 1 168 ? -5.646  -22.305 28.131  1.00 46.36  ? 169 GLY A O   1 
ATOM   1317 N N   . ASN A 1 169 ? -6.462  -24.378 27.771  1.00 40.89  ? 170 ASN A N   1 
ATOM   1318 C CA  . ASN A 1 169 ? -5.353  -25.106 28.382  1.00 35.20  ? 170 ASN A CA  1 
ATOM   1319 C C   . ASN A 1 169 ? -5.178  -24.841 29.886  1.00 33.44  ? 170 ASN A C   1 
ATOM   1320 O O   . ASN A 1 169 ? -4.122  -25.129 30.448  1.00 32.41  ? 170 ASN A O   1 
ATOM   1321 C CB  . ASN A 1 169 ? -4.046  -24.789 27.637  1.00 25.51  ? 170 ASN A CB  1 
ATOM   1322 C CG  . ASN A 1 169 ? -4.117  -25.132 26.153  1.00 39.05  ? 170 ASN A CG  1 
ATOM   1323 O OD1 . ASN A 1 169 ? -4.711  -26.139 25.756  1.00 35.94  ? 170 ASN A OD1 1 
ATOM   1324 N ND2 . ASN A 1 169 ? -3.515  -24.289 25.327  1.00 36.78  ? 170 ASN A ND2 1 
ATOM   1325 N N   . VAL A 1 170 ? -6.202  -24.319 30.555  1.00 30.96  ? 171 VAL A N   1 
ATOM   1326 C CA  . VAL A 1 170 ? -6.024  -23.983 31.969  1.00 33.54  ? 171 VAL A CA  1 
ATOM   1327 C C   . VAL A 1 170 ? -5.793  -25.246 32.820  1.00 33.32  ? 171 VAL A C   1 
ATOM   1328 O O   . VAL A 1 170 ? -5.196  -25.182 33.894  1.00 31.72  ? 171 VAL A O   1 
ATOM   1329 C CB  . VAL A 1 170 ? -7.218  -23.175 32.527  1.00 35.57  ? 171 VAL A CB  1 
ATOM   1330 C CG1 . VAL A 1 170 ? -7.427  -21.900 31.710  1.00 25.84  ? 171 VAL A CG1 1 
ATOM   1331 C CG2 . VAL A 1 170 ? -8.489  -24.022 32.578  1.00 30.44  ? 171 VAL A CG2 1 
ATOM   1332 N N   . GLY A 1 171 ? -6.226  -26.398 32.321  1.00 29.60  ? 172 GLY A N   1 
ATOM   1333 C CA  . GLY A 1 171 ? -5.985  -27.644 33.023  1.00 30.80  ? 172 GLY A CA  1 
ATOM   1334 C C   . GLY A 1 171 ? -4.512  -27.979 32.980  1.00 36.68  ? 172 GLY A C   1 
ATOM   1335 O O   . GLY A 1 171 ? -3.932  -28.459 33.963  1.00 34.75  ? 172 GLY A O   1 
ATOM   1336 N N   . LEU A 1 172 ? -3.909  -27.734 31.820  1.00 32.14  ? 173 LEU A N   1 
ATOM   1337 C CA  . LEU A 1 172 ? -2.467  -27.842 31.683  1.00 33.39  ? 173 LEU A CA  1 
ATOM   1338 C C   . LEU A 1 172 ? -1.787  -26.860 32.621  1.00 32.44  ? 173 LEU A C   1 
ATOM   1339 O O   . LEU A 1 172 ? -0.774  -27.190 33.238  1.00 33.62  ? 173 LEU A O   1 
ATOM   1340 C CB  . LEU A 1 172 ? -2.030  -27.592 30.240  1.00 30.52  ? 173 LEU A CB  1 
ATOM   1341 C CG  . LEU A 1 172 ? -2.376  -28.740 29.301  1.00 32.85  ? 173 LEU A CG  1 
ATOM   1342 C CD1 . LEU A 1 172 ? -1.983  -28.386 27.887  1.00 26.59  ? 173 LEU A CD1 1 
ATOM   1343 C CD2 . LEU A 1 172 ? -1.700  -30.035 29.774  1.00 24.86  ? 173 LEU A CD2 1 
ATOM   1344 N N   . LEU A 1 173 ? -2.362  -25.666 32.748  1.00 25.43  ? 174 LEU A N   1 
ATOM   1345 C CA  . LEU A 1 173 ? -1.809  -24.670 33.648  1.00 23.13  ? 174 LEU A CA  1 
ATOM   1346 C C   . LEU A 1 173 ? -1.968  -25.086 35.105  1.00 36.00  ? 174 LEU A C   1 
ATOM   1347 O O   . LEU A 1 173 ? -1.096  -24.780 35.923  1.00 40.19  ? 174 LEU A O   1 
ATOM   1348 C CB  . LEU A 1 173 ? -2.444  -23.306 33.407  1.00 26.36  ? 174 LEU A CB  1 
ATOM   1349 C CG  . LEU A 1 173 ? -2.116  -22.635 32.059  1.00 32.61  ? 174 LEU A CG  1 
ATOM   1350 C CD1 . LEU A 1 173 ? -2.918  -21.345 31.876  1.00 25.10  ? 174 LEU A CD1 1 
ATOM   1351 C CD2 . LEU A 1 173 ? -0.630  -22.379 31.916  1.00 24.28  ? 174 LEU A CD2 1 
ATOM   1352 N N   . ASP A 1 174 ? -3.057  -25.791 35.433  1.00 34.68  ? 175 ASP A N   1 
ATOM   1353 C CA  . ASP A 1 174 ? -3.200  -26.362 36.775  1.00 27.98  ? 175 ASP A CA  1 
ATOM   1354 C C   . ASP A 1 174 ? -2.014  -27.276 37.061  1.00 33.81  ? 175 ASP A C   1 
ATOM   1355 O O   . ASP A 1 174 ? -1.406  -27.219 38.139  1.00 36.54  ? 175 ASP A O   1 
ATOM   1356 C CB  . ASP A 1 174 ? -4.503  -27.156 36.936  1.00 29.38  ? 175 ASP A CB  1 
ATOM   1357 C CG  . ASP A 1 174 ? -5.748  -26.302 36.762  1.00 39.04  ? 175 ASP A CG  1 
ATOM   1358 O OD1 . ASP A 1 174 ? -5.651  -25.067 36.938  1.00 34.03  ? 175 ASP A OD1 1 
ATOM   1359 O OD2 . ASP A 1 174 ? -6.828  -26.872 36.455  1.00 32.86  ? 175 ASP A OD2 1 
ATOM   1360 N N   . GLN A 1 175 ? -1.686  -28.121 36.088  1.00 31.49  ? 176 GLN A N   1 
ATOM   1361 C CA  . GLN A 1 175 ? -0.590  -29.069 36.250  1.00 33.58  ? 176 GLN A CA  1 
ATOM   1362 C C   . GLN A 1 175 ? 0.723   -28.325 36.454  1.00 35.63  ? 176 GLN A C   1 
ATOM   1363 O O   . GLN A 1 175 ? 1.542   -28.697 37.301  1.00 31.38  ? 176 GLN A O   1 
ATOM   1364 C CB  . GLN A 1 175 ? -0.492  -30.001 35.042  1.00 29.63  ? 176 GLN A CB  1 
ATOM   1365 C CG  . GLN A 1 175 ? -1.665  -30.943 34.872  1.00 30.84  ? 176 GLN A CG  1 
ATOM   1366 C CD  . GLN A 1 175 ? -1.637  -31.631 33.529  1.00 32.37  ? 176 GLN A CD  1 
ATOM   1367 O OE1 . GLN A 1 175 ? -0.609  -31.641 32.860  1.00 40.71  ? 176 GLN A OE1 1 
ATOM   1368 N NE2 . GLN A 1 175 ? -2.767  -32.193 33.115  1.00 24.14  ? 176 GLN A NE2 1 
ATOM   1369 N N   . ARG A 1 176 ? 0.908   -27.259 35.683  1.00 34.11  ? 177 ARG A N   1 
ATOM   1370 C CA  . ARG A 1 176 ? 2.120   -26.471 35.786  1.00 31.74  ? 177 ARG A CA  1 
ATOM   1371 C C   . ARG A 1 176 ? 2.233   -25.810 37.151  1.00 31.48  ? 177 ARG A C   1 
ATOM   1372 O O   . ARG A 1 176 ? 3.317   -25.755 37.732  1.00 32.49  ? 177 ARG A O   1 
ATOM   1373 C CB  . ARG A 1 176 ? 2.176   -25.413 34.691  1.00 26.49  ? 177 ARG A CB  1 
ATOM   1374 C CG  . ARG A 1 176 ? 3.420   -24.563 34.777  1.00 31.95  ? 177 ARG A CG  1 
ATOM   1375 C CD  . ARG A 1 176 ? 3.434   -23.527 33.707  1.00 34.54  ? 177 ARG A CD  1 
ATOM   1376 N NE  . ARG A 1 176 ? 3.749   -24.125 32.420  1.00 39.60  ? 177 ARG A NE  1 
ATOM   1377 C CZ  . ARG A 1 176 ? 3.649   -23.470 31.272  1.00 45.88  ? 177 ARG A CZ  1 
ATOM   1378 N NH1 . ARG A 1 176 ? 3.233   -22.207 31.287  1.00 38.02  ? 177 ARG A NH1 1 
ATOM   1379 N NH2 . ARG A 1 176 ? 3.954   -24.073 30.123  1.00 31.75  ? 177 ARG A NH2 1 
ATOM   1380 N N   . LEU A 1 177 ? 1.117   -25.303 37.661  1.00 32.22  ? 178 LEU A N   1 
ATOM   1381 C CA  . LEU A 1 177 ? 1.130   -24.648 38.958  1.00 28.78  ? 178 LEU A CA  1 
ATOM   1382 C C   . LEU A 1 177 ? 1.550   -25.641 40.040  1.00 37.46  ? 178 LEU A C   1 
ATOM   1383 O O   . LEU A 1 177 ? 2.345   -25.321 40.930  1.00 35.49  ? 178 LEU A O   1 
ATOM   1384 C CB  . LEU A 1 177 ? -0.234  -24.053 39.274  1.00 30.02  ? 178 LEU A CB  1 
ATOM   1385 C CG  . LEU A 1 177 ? -0.218  -23.144 40.500  1.00 32.93  ? 178 LEU A CG  1 
ATOM   1386 C CD1 . LEU A 1 177 ? 0.781   -22.035 40.277  1.00 33.28  ? 178 LEU A CD1 1 
ATOM   1387 C CD2 . LEU A 1 177 ? -1.596  -22.567 40.779  1.00 35.44  ? 178 LEU A CD2 1 
ATOM   1388 N N   . ALA A 1 178 ? 1.027   -26.857 39.951  1.00 35.02  ? 179 ALA A N   1 
ATOM   1389 C CA  . ALA A 1 178 ? 1.439   -27.909 40.864  1.00 31.79  ? 179 ALA A CA  1 
ATOM   1390 C C   . ALA A 1 178 ? 2.943   -28.205 40.723  1.00 31.33  ? 179 ALA A C   1 
ATOM   1391 O O   . ALA A 1 178 ? 3.634   -28.401 41.713  1.00 31.82  ? 179 ALA A O   1 
ATOM   1392 C CB  . ALA A 1 178 ? 0.620   -29.154 40.622  1.00 32.19  ? 179 ALA A CB  1 
ATOM   1393 N N   . LEU A 1 179 ? 3.458   -28.231 39.498  1.00 31.72  ? 180 LEU A N   1 
ATOM   1394 C CA  . LEU A 1 179 ? 4.898   -28.394 39.311  1.00 32.90  ? 180 LEU A CA  1 
ATOM   1395 C C   . LEU A 1 179 ? 5.695   -27.217 39.915  1.00 38.09  ? 180 LEU A C   1 
ATOM   1396 O O   . LEU A 1 179 ? 6.755   -27.425 40.500  1.00 32.39  ? 180 LEU A O   1 
ATOM   1397 C CB  . LEU A 1 179 ? 5.228   -28.558 37.832  1.00 26.02  ? 180 LEU A CB  1 
ATOM   1398 C CG  . LEU A 1 179 ? 4.716   -29.855 37.205  1.00 30.82  ? 180 LEU A CG  1 
ATOM   1399 C CD1 . LEU A 1 179 ? 4.923   -29.869 35.678  1.00 24.61  ? 180 LEU A CD1 1 
ATOM   1400 C CD2 . LEU A 1 179 ? 5.393   -31.035 37.854  1.00 23.96  ? 180 LEU A CD2 1 
ATOM   1401 N N   . GLN A 1 180 ? 5.183   -25.993 39.782  1.00 33.55  ? 181 GLN A N   1 
ATOM   1402 C CA  . GLN A 1 180 ? 5.793   -24.842 40.443  1.00 31.52  ? 181 GLN A CA  1 
ATOM   1403 C C   . GLN A 1 180 ? 5.751   -25.045 41.958  1.00 37.22  ? 181 GLN A C   1 
ATOM   1404 O O   . GLN A 1 180 ? 6.747   -24.819 42.652  1.00 34.26  ? 181 GLN A O   1 
ATOM   1405 C CB  . GLN A 1 180 ? 5.086   -23.530 40.052  1.00 30.61  ? 181 GLN A CB  1 
ATOM   1406 C CG  . GLN A 1 180 ? 5.636   -22.845 38.789  1.00 48.59  ? 181 GLN A CG  1 
ATOM   1407 C CD  . GLN A 1 180 ? 4.582   -21.983 38.053  1.00 60.96  ? 181 GLN A CD  1 
ATOM   1408 O OE1 . GLN A 1 180 ? 3.549   -21.624 38.617  1.00 61.43  ? 181 GLN A OE1 1 
ATOM   1409 N NE2 . GLN A 1 180 ? 4.850   -21.662 36.789  1.00 51.44  ? 181 GLN A NE2 1 
ATOM   1410 N N   . TRP A 1 181 ? 4.593   -25.478 42.460  1.00 37.81  ? 182 TRP A N   1 
ATOM   1411 C CA  . TRP A 1 181 ? 4.417   -25.734 43.886  1.00 29.76  ? 182 TRP A CA  1 
ATOM   1412 C C   . TRP A 1 181 ? 5.470   -26.711 44.378  1.00 32.22  ? 182 TRP A C   1 
ATOM   1413 O O   . TRP A 1 181 ? 6.050   -26.519 45.441  1.00 35.72  ? 182 TRP A O   1 
ATOM   1414 C CB  . TRP A 1 181 ? 3.020   -26.283 44.181  1.00 27.64  ? 182 TRP A CB  1 
ATOM   1415 C CG  . TRP A 1 181 ? 2.689   -26.381 45.657  1.00 30.64  ? 182 TRP A CG  1 
ATOM   1416 C CD1 . TRP A 1 181 ? 2.009   -25.465 46.397  1.00 33.79  ? 182 TRP A CD1 1 
ATOM   1417 C CD2 . TRP A 1 181 ? 3.022   -27.452 46.558  1.00 28.66  ? 182 TRP A CD2 1 
ATOM   1418 N NE1 . TRP A 1 181 ? 1.899   -25.889 47.705  1.00 38.85  ? 182 TRP A NE1 1 
ATOM   1419 C CE2 . TRP A 1 181 ? 2.513   -27.106 47.829  1.00 27.42  ? 182 TRP A CE2 1 
ATOM   1420 C CE3 . TRP A 1 181 ? 3.708   -28.662 46.414  1.00 23.39  ? 182 TRP A CE3 1 
ATOM   1421 C CZ2 . TRP A 1 181 ? 2.660   -27.926 48.944  1.00 25.72  ? 182 TRP A CZ2 1 
ATOM   1422 C CZ3 . TRP A 1 181 ? 3.863   -29.473 47.522  1.00 24.22  ? 182 TRP A CZ3 1 
ATOM   1423 C CH2 . TRP A 1 181 ? 3.338   -29.105 48.773  1.00 32.12  ? 182 TRP A CH2 1 
ATOM   1424 N N   . VAL A 1 182 ? 5.725   -27.750 43.589  1.00 35.48  ? 183 VAL A N   1 
ATOM   1425 C CA  . VAL A 1 182 ? 6.683   -28.777 43.969  1.00 35.55  ? 183 VAL A CA  1 
ATOM   1426 C C   . VAL A 1 182 ? 8.086   -28.197 44.004  1.00 33.97  ? 183 VAL A C   1 
ATOM   1427 O O   . VAL A 1 182 ? 8.863   -28.521 44.898  1.00 42.45  ? 183 VAL A O   1 
ATOM   1428 C CB  . VAL A 1 182 ? 6.605   -29.996 43.014  1.00 35.61  ? 183 VAL A CB  1 
ATOM   1429 C CG1 . VAL A 1 182 ? 7.840   -30.891 43.124  1.00 24.60  ? 183 VAL A CG1 1 
ATOM   1430 C CG2 . VAL A 1 182 ? 5.368   -30.792 43.344  1.00 28.26  ? 183 VAL A CG2 1 
ATOM   1431 N N   . GLN A 1 183 ? 8.394   -27.315 43.058  1.00 37.49  ? 184 GLN A N   1 
ATOM   1432 C CA  . GLN A 1 183 ? 9.681   -26.611 43.037  1.00 36.24  ? 184 GLN A CA  1 
ATOM   1433 C C   . GLN A 1 183 ? 9.921   -25.826 44.322  1.00 38.87  ? 184 GLN A C   1 
ATOM   1434 O O   . GLN A 1 183 ? 10.978  -25.944 44.949  1.00 36.15  ? 184 GLN A O   1 
ATOM   1435 C CB  . GLN A 1 183 ? 9.762   -25.675 41.831  1.00 26.67  ? 184 GLN A CB  1 
ATOM   1436 C CG  . GLN A 1 183 ? 10.167  -26.396 40.558  1.00 30.81  ? 184 GLN A CG  1 
ATOM   1437 C CD  . GLN A 1 183 ? 11.474  -27.149 40.728  1.00 39.02  ? 184 GLN A CD  1 
ATOM   1438 O OE1 . GLN A 1 183 ? 12.534  -26.544 40.902  1.00 41.80  ? 184 GLN A OE1 1 
ATOM   1439 N NE2 . GLN A 1 183 ? 11.405  -28.474 40.696  1.00 36.56  ? 184 GLN A NE2 1 
ATOM   1440 N N   . GLU A 1 184 ? 8.927   -25.050 44.733  1.00 30.86  ? 185 GLU A N   1 
ATOM   1441 C CA  . GLU A 1 184 ? 9.070   -24.244 45.932  1.00 38.27  ? 185 GLU A CA  1 
ATOM   1442 C C   . GLU A 1 184 ? 8.946   -25.010 47.262  1.00 40.54  ? 185 GLU A C   1 
ATOM   1443 O O   . GLU A 1 184 ? 9.553   -24.607 48.248  1.00 45.28  ? 185 GLU A O   1 
ATOM   1444 C CB  . GLU A 1 184 ? 8.059   -23.103 45.885  1.00 43.02  ? 185 GLU A CB  1 
ATOM   1445 C CG  . GLU A 1 184 ? 8.399   -22.096 44.777  1.00 57.85  ? 185 GLU A CG  1 
ATOM   1446 C CD  . GLU A 1 184 ? 7.258   -21.141 44.433  1.00 72.97  ? 185 GLU A CD  1 
ATOM   1447 O OE1 . GLU A 1 184 ? 7.371   -20.440 43.396  1.00 57.09  ? 185 GLU A OE1 1 
ATOM   1448 O OE2 . GLU A 1 184 ? 6.259   -21.090 45.193  1.00 67.24  ? 185 GLU A OE2 1 
ATOM   1449 N N   . ASN A 1 185 ? 8.206   -26.119 47.302  1.00 38.55  ? 186 ASN A N   1 
ATOM   1450 C CA  . ASN A 1 185 ? 7.876   -26.725 48.596  1.00 31.18  ? 186 ASN A CA  1 
ATOM   1451 C C   . ASN A 1 185 ? 8.290   -28.164 48.847  1.00 35.89  ? 186 ASN A C   1 
ATOM   1452 O O   . ASN A 1 185 ? 8.226   -28.623 49.982  1.00 41.36  ? 186 ASN A O   1 
ATOM   1453 C CB  . ASN A 1 185 ? 6.372   -26.628 48.837  1.00 26.93  ? 186 ASN A CB  1 
ATOM   1454 C CG  . ASN A 1 185 ? 5.891   -25.197 48.876  1.00 38.86  ? 186 ASN A CG  1 
ATOM   1455 O OD1 . ASN A 1 185 ? 6.012   -24.520 49.897  1.00 44.96  ? 186 ASN A OD1 1 
ATOM   1456 N ND2 . ASN A 1 185 ? 5.358   -24.718 47.758  1.00 36.40  ? 186 ASN A ND2 1 
ATOM   1457 N N   . VAL A 1 186 ? 8.722   -28.886 47.825  1.00 35.23  ? 187 VAL A N   1 
ATOM   1458 C CA  . VAL A 1 186 ? 8.942   -30.310 48.031  1.00 34.83  ? 187 VAL A CA  1 
ATOM   1459 C C   . VAL A 1 186 ? 10.080  -30.548 49.027  1.00 40.98  ? 187 VAL A C   1 
ATOM   1460 O O   . VAL A 1 186 ? 10.106  -31.579 49.710  1.00 38.34  ? 187 VAL A O   1 
ATOM   1461 C CB  . VAL A 1 186 ? 9.213   -31.058 46.694  1.00 29.33  ? 187 VAL A CB  1 
ATOM   1462 C CG1 . VAL A 1 186 ? 10.634  -30.854 46.212  1.00 27.96  ? 187 VAL A CG1 1 
ATOM   1463 C CG2 . VAL A 1 186 ? 8.890   -32.537 46.847  1.00 27.51  ? 187 VAL A CG2 1 
ATOM   1464 N N   . ALA A 1 187 ? 10.987  -29.581 49.146  1.00 47.26  ? 188 ALA A N   1 
ATOM   1465 C CA  . ALA A 1 187 ? 12.146  -29.734 50.024  1.00 37.77  ? 188 ALA A CA  1 
ATOM   1466 C C   . ALA A 1 187 ? 11.718  -29.834 51.490  1.00 39.98  ? 188 ALA A C   1 
ATOM   1467 O O   . ALA A 1 187 ? 12.368  -30.511 52.293  1.00 44.98  ? 188 ALA A O   1 
ATOM   1468 C CB  . ALA A 1 187 ? 13.097  -28.603 49.830  1.00 29.35  ? 188 ALA A CB  1 
ATOM   1469 N N   . ALA A 1 188 ? 10.604  -29.188 51.822  1.00 33.04  ? 189 ALA A N   1 
ATOM   1470 C CA  . ALA A 1 188 ? 10.022  -29.273 53.160  1.00 37.01  ? 189 ALA A CA  1 
ATOM   1471 C C   . ALA A 1 188 ? 9.568   -30.687 53.522  1.00 39.76  ? 189 ALA A C   1 
ATOM   1472 O O   . ALA A 1 188 ? 9.278   -30.961 54.686  1.00 54.26  ? 189 ALA A O   1 
ATOM   1473 C CB  . ALA A 1 188 ? 8.845   -28.313 53.288  1.00 30.69  ? 189 ALA A CB  1 
ATOM   1474 N N   . PHE A 1 189 ? 9.491   -31.571 52.527  1.00 42.50  ? 190 PHE A N   1 
ATOM   1475 C CA  . PHE A 1 189 ? 9.118   -32.969 52.747  1.00 31.50  ? 190 PHE A CA  1 
ATOM   1476 C C   . PHE A 1 189 ? 10.306  -33.913 52.564  1.00 35.30  ? 190 PHE A C   1 
ATOM   1477 O O   . PHE A 1 189 ? 10.179  -35.113 52.755  1.00 41.80  ? 190 PHE A O   1 
ATOM   1478 C CB  . PHE A 1 189 ? 7.988   -33.381 51.800  1.00 32.16  ? 190 PHE A CB  1 
ATOM   1479 C CG  . PHE A 1 189 ? 6.753   -32.535 51.923  1.00 29.54  ? 190 PHE A CG  1 
ATOM   1480 C CD1 . PHE A 1 189 ? 6.595   -31.404 51.147  1.00 25.73  ? 190 PHE A CD1 1 
ATOM   1481 C CD2 . PHE A 1 189 ? 5.755   -32.866 52.824  1.00 29.22  ? 190 PHE A CD2 1 
ATOM   1482 C CE1 . PHE A 1 189 ? 5.465   -30.626 51.257  1.00 26.47  ? 190 PHE A CE1 1 
ATOM   1483 C CE2 . PHE A 1 189 ? 4.622   -32.092 52.937  1.00 27.24  ? 190 PHE A CE2 1 
ATOM   1484 C CZ  . PHE A 1 189 ? 4.475   -30.972 52.152  1.00 28.13  ? 190 PHE A CZ  1 
ATOM   1485 N N   . GLY A 1 190 ? 11.462  -33.377 52.186  1.00 36.14  ? 191 GLY A N   1 
ATOM   1486 C CA  . GLY A 1 190 ? 12.634  -34.206 51.994  1.00 33.71  ? 191 GLY A CA  1 
ATOM   1487 C C   . GLY A 1 190 ? 12.914  -34.475 50.530  1.00 46.74  ? 191 GLY A C   1 
ATOM   1488 O O   . GLY A 1 190 ? 13.846  -35.201 50.183  1.00 43.73  ? 191 GLY A O   1 
ATOM   1489 N N   . GLY A 1 191 ? 12.110  -33.881 49.657  1.00 42.15  ? 192 GLY A N   1 
ATOM   1490 C CA  . GLY A 1 191 ? 12.283  -34.099 48.238  1.00 40.17  ? 192 GLY A CA  1 
ATOM   1491 C C   . GLY A 1 191 ? 13.322  -33.182 47.633  1.00 42.82  ? 192 GLY A C   1 
ATOM   1492 O O   . GLY A 1 191 ? 13.492  -32.050 48.074  1.00 46.01  ? 192 GLY A O   1 
ATOM   1493 N N   . ASP A 1 192 ? 14.010  -33.677 46.612  1.00 38.46  ? 193 ASP A N   1 
ATOM   1494 C CA  . ASP A 1 192 ? 14.974  -32.877 45.875  1.00 33.73  ? 193 ASP A CA  1 
ATOM   1495 C C   . ASP A 1 192 ? 14.338  -32.240 44.656  1.00 41.83  ? 193 ASP A C   1 
ATOM   1496 O O   . ASP A 1 192 ? 14.061  -32.926 43.674  1.00 44.35  ? 193 ASP A O   1 
ATOM   1497 C CB  . ASP A 1 192 ? 16.166  -33.735 45.448  1.00 37.08  ? 193 ASP A CB  1 
ATOM   1498 C CG  . ASP A 1 192 ? 17.175  -32.961 44.611  1.00 47.34  ? 193 ASP A CG  1 
ATOM   1499 O OD1 . ASP A 1 192 ? 17.195  -31.704 44.686  1.00 47.87  ? 193 ASP A OD1 1 
ATOM   1500 O OD2 . ASP A 1 192 ? 17.948  -33.612 43.872  1.00 57.39  ? 193 ASP A OD2 1 
ATOM   1501 N N   . PRO A 1 193 ? 14.135  -30.918 44.692  1.00 39.95  ? 194 PRO A N   1 
ATOM   1502 C CA  . PRO A 1 193 ? 13.491  -30.205 43.581  1.00 40.74  ? 194 PRO A CA  1 
ATOM   1503 C C   . PRO A 1 193 ? 14.297  -30.202 42.285  1.00 42.03  ? 194 PRO A C   1 
ATOM   1504 O O   . PRO A 1 193 ? 13.772  -29.759 41.267  1.00 45.18  ? 194 PRO A O   1 
ATOM   1505 C CB  . PRO A 1 193 ? 13.340  -28.777 44.114  1.00 40.50  ? 194 PRO A CB  1 
ATOM   1506 C CG  . PRO A 1 193 ? 14.385  -28.649 45.140  1.00 35.70  ? 194 PRO A CG  1 
ATOM   1507 C CD  . PRO A 1 193 ? 14.518  -30.006 45.778  1.00 40.47  ? 194 PRO A CD  1 
ATOM   1508 N N   . THR A 1 194 ? 15.540  -30.673 42.312  1.00 44.08  ? 195 THR A N   1 
ATOM   1509 C CA  . THR A 1 194 ? 16.342  -30.716 41.089  1.00 46.40  ? 195 THR A CA  1 
ATOM   1510 C C   . THR A 1 194 ? 16.269  -32.111 40.471  1.00 43.64  ? 195 THR A C   1 
ATOM   1511 O O   . THR A 1 194 ? 16.858  -32.373 39.422  1.00 44.80  ? 195 THR A O   1 
ATOM   1512 C CB  . THR A 1 194 ? 17.828  -30.336 41.339  1.00 35.52  ? 195 THR A CB  1 
ATOM   1513 O OG1 . THR A 1 194 ? 18.517  -31.442 41.935  1.00 44.18  ? 195 THR A OG1 1 
ATOM   1514 C CG2 . THR A 1 194 ? 17.936  -29.133 42.249  1.00 35.34  ? 195 THR A CG2 1 
ATOM   1515 N N   . SER A 1 195 ? 15.536  -33.005 41.127  1.00 38.65  ? 196 SER A N   1 
ATOM   1516 C CA  . SER A 1 195 ? 15.400  -34.371 40.640  1.00 34.21  ? 196 SER A CA  1 
ATOM   1517 C C   . SER A 1 195 ? 13.933  -34.818 40.544  1.00 45.86  ? 196 SER A C   1 
ATOM   1518 O O   . SER A 1 195 ? 13.540  -35.848 41.095  1.00 43.59  ? 196 SER A O   1 
ATOM   1519 C CB  . SER A 1 195 ? 16.185  -35.320 41.539  1.00 37.14  ? 196 SER A CB  1 
ATOM   1520 O OG  . SER A 1 195 ? 16.330  -36.585 40.910  1.00 69.05  ? 196 SER A OG  1 
ATOM   1521 N N   . VAL A 1 196 ? 13.130  -34.040 39.828  1.00 32.00  ? 197 VAL A N   1 
ATOM   1522 C CA  . VAL A 1 196 ? 11.721  -34.361 39.637  1.00 31.27  ? 197 VAL A CA  1 
ATOM   1523 C C   . VAL A 1 196 ? 11.470  -35.140 38.333  1.00 34.45  ? 197 VAL A C   1 
ATOM   1524 O O   . VAL A 1 196 ? 11.907  -34.735 37.253  1.00 33.25  ? 197 VAL A O   1 
ATOM   1525 C CB  . VAL A 1 196 ? 10.877  -33.079 39.643  1.00 33.37  ? 197 VAL A CB  1 
ATOM   1526 C CG1 . VAL A 1 196 ? 9.455   -33.376 39.240  1.00 25.67  ? 197 VAL A CG1 1 
ATOM   1527 C CG2 . VAL A 1 196 ? 10.933  -32.433 41.010  1.00 27.41  ? 197 VAL A CG2 1 
ATOM   1528 N N   . THR A 1 197 ? 10.780  -36.271 38.454  1.00 31.38  ? 198 THR A N   1 
ATOM   1529 C CA  . THR A 1 197 ? 10.405  -37.095 37.306  1.00 31.12  ? 198 THR A CA  1 
ATOM   1530 C C   . THR A 1 197 ? 8.886   -37.114 37.112  1.00 33.42  ? 198 THR A C   1 
ATOM   1531 O O   . THR A 1 197 ? 8.152   -37.568 37.990  1.00 37.49  ? 198 THR A O   1 
ATOM   1532 C CB  . THR A 1 197 ? 10.896  -38.545 37.470  1.00 36.60  ? 198 THR A CB  1 
ATOM   1533 O OG1 . THR A 1 197 ? 12.310  -38.556 37.686  1.00 46.20  ? 198 THR A OG1 1 
ATOM   1534 C CG2 . THR A 1 197 ? 10.565  -39.361 36.244  1.00 32.07  ? 198 THR A CG2 1 
ATOM   1535 N N   . LEU A 1 198 ? 8.422   -36.608 35.973  1.00 31.29  ? 199 LEU A N   1 
ATOM   1536 C CA  . LEU A 1 198 ? 7.012   -36.700 35.596  1.00 32.09  ? 199 LEU A CA  1 
ATOM   1537 C C   . LEU A 1 198 ? 6.649   -38.079 35.082  1.00 34.66  ? 199 LEU A C   1 
ATOM   1538 O O   . LEU A 1 198 ? 7.353   -38.636 34.236  1.00 35.77  ? 199 LEU A O   1 
ATOM   1539 C CB  . LEU A 1 198 ? 6.671   -35.687 34.503  1.00 30.38  ? 199 LEU A CB  1 
ATOM   1540 C CG  . LEU A 1 198 ? 6.751   -34.218 34.869  1.00 32.72  ? 199 LEU A CG  1 
ATOM   1541 C CD1 . LEU A 1 198 ? 6.163   -33.364 33.759  1.00 23.69  ? 199 LEU A CD1 1 
ATOM   1542 C CD2 . LEU A 1 198 ? 6.004   -34.023 36.164  1.00 35.85  ? 199 LEU A CD2 1 
ATOM   1543 N N   . PHE A 1 199 ? 5.544   -38.632 35.559  1.00 27.18  ? 200 PHE A N   1 
ATOM   1544 C CA  . PHE A 1 199 ? 4.975   -39.758 34.834  1.00 31.48  ? 200 PHE A CA  1 
ATOM   1545 C C   . PHE A 1 199 ? 3.460   -39.693 34.829  1.00 36.58  ? 200 PHE A C   1 
ATOM   1546 O O   . PHE A 1 199 ? 2.833   -39.176 35.753  1.00 38.54  ? 200 PHE A O   1 
ATOM   1547 C CB  . PHE A 1 199 ? 5.486   -41.111 35.371  1.00 28.97  ? 200 PHE A CB  1 
ATOM   1548 C CG  . PHE A 1 199 ? 5.036   -41.476 36.772  1.00 38.22  ? 200 PHE A CG  1 
ATOM   1549 C CD1 . PHE A 1 199 ? 5.004   -40.539 37.797  1.00 35.00  ? 200 PHE A CD1 1 
ATOM   1550 C CD2 . PHE A 1 199 ? 4.692   -42.794 37.064  1.00 34.33  ? 200 PHE A CD2 1 
ATOM   1551 C CE1 . PHE A 1 199 ? 4.609   -40.894 39.073  1.00 32.04  ? 200 PHE A CE1 1 
ATOM   1552 C CE2 . PHE A 1 199 ? 4.291   -43.164 38.343  1.00 33.16  ? 200 PHE A CE2 1 
ATOM   1553 C CZ  . PHE A 1 199 ? 4.247   -42.212 39.351  1.00 34.68  ? 200 PHE A CZ  1 
ATOM   1554 N N   . GLY A 1 200 ? 2.884   -40.185 33.742  1.00 31.12  ? 201 GLY A N   1 
ATOM   1555 C CA  . GLY A 1 200 ? 1.449   -40.197 33.582  1.00 32.99  ? 201 GLY A CA  1 
ATOM   1556 C C   . GLY A 1 200 ? 1.017   -41.290 32.631  1.00 38.08  ? 201 GLY A C   1 
ATOM   1557 O O   . GLY A 1 200 ? 1.837   -41.866 31.913  1.00 32.21  ? 201 GLY A O   1 
ATOM   1558 N N   . GLU A 1 201 ? -0.281  -41.576 32.634  1.00 34.08  ? 202 GLU A N   1 
ATOM   1559 C CA  . GLU A 1 201 ? -0.844  -42.574 31.747  1.00 31.39  ? 202 GLU A CA  1 
ATOM   1560 C C   . GLU A 1 201 ? -1.903  -41.929 30.854  1.00 34.04  ? 202 GLU A C   1 
ATOM   1561 O O   . GLU A 1 201 ? -2.594  -41.012 31.298  1.00 30.38  ? 202 GLU A O   1 
ATOM   1562 C CB  . GLU A 1 201 ? -1.425  -43.725 32.560  1.00 38.68  ? 202 GLU A CB  1 
ATOM   1563 C CG  . GLU A 1 201 ? -1.596  -45.020 31.798  1.00 35.38  ? 202 GLU A CG  1 
ATOM   1564 C CD  . GLU A 1 201 ? -3.007  -45.217 31.277  1.00 50.82  ? 202 GLU A CD  1 
ATOM   1565 O OE1 . GLU A 1 201 ? -3.882  -44.339 31.509  1.00 45.07  ? 202 GLU A OE1 1 
ATOM   1566 O OE2 . GLU A 1 201 ? -3.234  -46.269 30.633  1.00 63.75  ? 202 GLU A OE2 1 
ATOM   1567 N N   . SER A 1 202 ? -1.984  -42.381 29.594  1.00 36.82  ? 203 SER A N   1 
ATOM   1568 C CA  . SER A 1 202 ? -2.995  -41.929 28.612  1.00 41.26  ? 203 SER A CA  1 
ATOM   1569 C C   . SER A 1 202 ? -2.990  -40.390 28.401  1.00 37.49  ? 203 SER A C   1 
ATOM   1570 O O   . SER A 1 202 ? -2.013  -39.846 27.891  1.00 39.04  ? 203 SER A O   1 
ATOM   1571 C CB  . SER A 1 202 ? -4.386  -42.425 29.044  1.00 54.27  ? 203 SER A CB  1 
ATOM   1572 O OG  . SER A 1 202 ? -5.327  -42.466 27.979  1.00 52.34  ? 203 SER A OG  1 
ATOM   1573 N N   . ALA A 1 203 ? -4.067  -39.696 28.778  1.00 32.69  ? 204 ALA A N   1 
ATOM   1574 C CA  . ALA A 1 203 ? -4.088  -38.230 28.736  1.00 30.28  ? 204 ALA A CA  1 
ATOM   1575 C C   . ALA A 1 203 ? -3.051  -37.647 29.692  1.00 30.31  ? 204 ALA A C   1 
ATOM   1576 O O   . ALA A 1 203 ? -2.562  -36.538 29.482  1.00 29.70  ? 204 ALA A O   1 
ATOM   1577 C CB  . ALA A 1 203 ? -5.461  -37.694 29.071  1.00 25.58  ? 204 ALA A CB  1 
ATOM   1578 N N   . GLY A 1 204 ? -2.727  -38.393 30.746  1.00 28.08  ? 205 GLY A N   1 
ATOM   1579 C CA  . GLY A 1 204 ? -1.656  -38.004 31.645  1.00 32.39  ? 205 GLY A CA  1 
ATOM   1580 C C   . GLY A 1 204 ? -0.305  -38.043 30.950  1.00 35.16  ? 205 GLY A C   1 
ATOM   1581 O O   . GLY A 1 204 ? 0.518   -37.141 31.103  1.00 27.85  ? 205 GLY A O   1 
ATOM   1582 N N   . ALA A 1 205 ? -0.080  -39.107 30.185  1.00 34.06  ? 206 ALA A N   1 
ATOM   1583 C CA  . ALA A 1 205 ? 1.112   -39.226 29.358  1.00 33.03  ? 206 ALA A CA  1 
ATOM   1584 C C   . ALA A 1 205 ? 1.173   -38.108 28.313  1.00 31.01  ? 206 ALA A C   1 
ATOM   1585 O O   . ALA A 1 205 ? 2.216   -37.486 28.114  1.00 36.39  ? 206 ALA A O   1 
ATOM   1586 C CB  . ALA A 1 205 ? 1.152   -40.580 28.690  1.00 34.68  ? 206 ALA A CB  1 
ATOM   1587 N N   . ALA A 1 206 ? 0.054   -37.847 27.651  1.00 30.28  ? 207 ALA A N   1 
ATOM   1588 C CA  . ALA A 1 206 ? -0.006  -36.738 26.715  1.00 31.47  ? 207 ALA A CA  1 
ATOM   1589 C C   . ALA A 1 206 ? 0.342   -35.426 27.419  1.00 30.99  ? 207 ALA A C   1 
ATOM   1590 O O   . ALA A 1 206 ? 1.040   -34.587 26.858  1.00 31.45  ? 207 ALA A O   1 
ATOM   1591 C CB  . ALA A 1 206 ? -1.374  -36.657 26.075  1.00 26.14  ? 207 ALA A CB  1 
ATOM   1592 N N   . SER A 1 207 ? -0.142  -35.257 28.649  1.00 32.20  ? 208 SER A N   1 
ATOM   1593 C CA  . SER A 1 207 ? 0.135   -34.050 29.426  1.00 30.69  ? 208 SER A CA  1 
ATOM   1594 C C   . SER A 1 207 ? 1.630   -33.892 29.651  1.00 31.52  ? 208 SER A C   1 
ATOM   1595 O O   . SER A 1 207 ? 2.185   -32.815 29.443  1.00 33.78  ? 208 SER A O   1 
ATOM   1596 C CB  . SER A 1 207 ? -0.584  -34.087 30.776  1.00 29.58  ? 208 SER A CB  1 
ATOM   1597 O OG  . SER A 1 207 ? -1.986  -34.016 30.624  1.00 29.53  ? 208 SER A OG  1 
ATOM   1598 N N   . VAL A 1 208 ? 2.264   -34.979 30.084  1.00 31.88  ? 209 VAL A N   1 
ATOM   1599 C CA  . VAL A 1 208 ? 3.703   -35.016 30.311  1.00 29.50  ? 209 VAL A CA  1 
ATOM   1600 C C   . VAL A 1 208 ? 4.448   -34.549 29.071  1.00 34.61  ? 209 VAL A C   1 
ATOM   1601 O O   . VAL A 1 208 ? 5.282   -33.651 29.146  1.00 34.08  ? 209 VAL A O   1 
ATOM   1602 C CB  . VAL A 1 208 ? 4.177   -36.423 30.675  1.00 27.01  ? 209 VAL A CB  1 
ATOM   1603 C CG1 . VAL A 1 208 ? 5.680   -36.539 30.477  1.00 27.25  ? 209 VAL A CG1 1 
ATOM   1604 C CG2 . VAL A 1 208 ? 3.775   -36.767 32.100  1.00 27.90  ? 209 VAL A CG2 1 
ATOM   1605 N N   . GLY A 1 209 ? 4.120   -35.159 27.933  1.00 28.61  ? 210 GLY A N   1 
ATOM   1606 C CA  . GLY A 1 209 ? 4.681   -34.779 26.654  1.00 23.05  ? 210 GLY A CA  1 
ATOM   1607 C C   . GLY A 1 209 ? 4.487   -33.318 26.319  1.00 28.49  ? 210 GLY A C   1 
ATOM   1608 O O   . GLY A 1 209 ? 5.353   -32.682 25.718  1.00 33.42  ? 210 GLY A O   1 
ATOM   1609 N N   . MET A 1 210 ? 3.354   -32.760 26.707  1.00 29.62  ? 211 MET A N   1 
ATOM   1610 C CA  . MET A 1 210 ? 3.119   -31.363 26.395  1.00 32.11  ? 211 MET A CA  1 
ATOM   1611 C C   . MET A 1 210 ? 3.943   -30.472 27.305  1.00 35.81  ? 211 MET A C   1 
ATOM   1612 O O   . MET A 1 210 ? 4.359   -29.395 26.900  1.00 41.39  ? 211 MET A O   1 
ATOM   1613 C CB  . MET A 1 210 ? 1.640   -31.028 26.493  1.00 33.97  ? 211 MET A CB  1 
ATOM   1614 C CG  . MET A 1 210 ? 0.894   -31.353 25.213  1.00 32.96  ? 211 MET A CG  1 
ATOM   1615 S SD  . MET A 1 210 ? -0.879  -31.339 25.495  1.00 44.80  ? 211 MET A SD  1 
ATOM   1616 C CE  . MET A 1 210 ? -1.432  -32.561 24.300  1.00 38.05  ? 211 MET A CE  1 
ATOM   1617 N N   . HIS A 1 211 ? 4.198   -30.921 28.527  1.00 31.00  ? 212 HIS A N   1 
ATOM   1618 C CA  . HIS A 1 211 ? 5.115   -30.186 29.383  1.00 33.61  ? 212 HIS A CA  1 
ATOM   1619 C C   . HIS A 1 211 ? 6.550   -30.249 28.833  1.00 36.34  ? 212 HIS A C   1 
ATOM   1620 O O   . HIS A 1 211 ? 7.297   -29.278 28.941  1.00 40.21  ? 212 HIS A O   1 
ATOM   1621 C CB  . HIS A 1 211 ? 5.046   -30.707 30.820  1.00 29.13  ? 212 HIS A CB  1 
ATOM   1622 C CG  . HIS A 1 211 ? 3.795   -30.309 31.535  1.00 29.40  ? 212 HIS A CG  1 
ATOM   1623 N ND1 . HIS A 1 211 ? 3.433   -28.990 31.719  1.00 33.55  ? 212 HIS A ND1 1 
ATOM   1624 C CD2 . HIS A 1 211 ? 2.810   -31.049 32.094  1.00 30.13  ? 212 HIS A CD2 1 
ATOM   1625 C CE1 . HIS A 1 211 ? 2.284   -28.937 32.370  1.00 30.39  ? 212 HIS A CE1 1 
ATOM   1626 N NE2 . HIS A 1 211 ? 1.883   -30.172 32.605  1.00 33.89  ? 212 HIS A NE2 1 
ATOM   1627 N N   . LEU A 1 212 ? 6.925   -31.373 28.228  1.00 33.86  ? 213 LEU A N   1 
ATOM   1628 C CA  . LEU A 1 212 ? 8.207   -31.473 27.533  1.00 35.73  ? 213 LEU A CA  1 
ATOM   1629 C C   . LEU A 1 212 ? 8.356   -30.408 26.458  1.00 40.80  ? 213 LEU A C   1 
ATOM   1630 O O   . LEU A 1 212 ? 9.446   -29.894 26.231  1.00 45.90  ? 213 LEU A O   1 
ATOM   1631 C CB  . LEU A 1 212 ? 8.376   -32.848 26.886  1.00 27.83  ? 213 LEU A CB  1 
ATOM   1632 C CG  . LEU A 1 212 ? 8.795   -33.956 27.842  1.00 46.21  ? 213 LEU A CG  1 
ATOM   1633 C CD1 . LEU A 1 212 ? 8.867   -35.272 27.099  1.00 36.90  ? 213 LEU A CD1 1 
ATOM   1634 C CD2 . LEU A 1 212 ? 10.127  -33.621 28.499  1.00 43.25  ? 213 LEU A CD2 1 
ATOM   1635 N N   . LEU A 1 213 ? 7.247   -30.084 25.802  1.00 42.97  ? 214 LEU A N   1 
ATOM   1636 C CA  . LEU A 1 213 ? 7.271   -29.279 24.587  1.00 32.13  ? 214 LEU A CA  1 
ATOM   1637 C C   . LEU A 1 213 ? 6.909   -27.824 24.832  1.00 36.98  ? 214 LEU A C   1 
ATOM   1638 O O   . LEU A 1 213 ? 6.871   -27.020 23.898  1.00 40.31  ? 214 LEU A O   1 
ATOM   1639 C CB  . LEU A 1 213 ? 6.322   -29.882 23.559  1.00 31.49  ? 214 LEU A CB  1 
ATOM   1640 C CG  . LEU A 1 213 ? 6.711   -31.306 23.184  1.00 34.09  ? 214 LEU A CG  1 
ATOM   1641 C CD1 . LEU A 1 213 ? 5.690   -31.918 22.244  1.00 37.69  ? 214 LEU A CD1 1 
ATOM   1642 C CD2 . LEU A 1 213 ? 8.093   -31.296 22.563  1.00 33.63  ? 214 LEU A CD2 1 
ATOM   1643 N N   . SER A 1 214 ? 6.644   -27.490 26.088  1.00 30.87  ? 215 SER A N   1 
ATOM   1644 C CA  . SER A 1 214 ? 6.322   -26.121 26.467  1.00 35.17  ? 215 SER A CA  1 
ATOM   1645 C C   . SER A 1 214 ? 7.391   -25.595 27.424  1.00 40.44  ? 215 SER A C   1 
ATOM   1646 O O   . SER A 1 214 ? 7.431   -25.993 28.589  1.00 42.47  ? 215 SER A O   1 
ATOM   1647 C CB  . SER A 1 214 ? 4.928   -26.059 27.097  1.00 35.00  ? 215 SER A CB  1 
ATOM   1648 O OG  . SER A 1 214 ? 4.630   -24.775 27.619  1.00 38.75  ? 215 SER A OG  1 
ATOM   1649 N N   . PRO A 1 215 ? 8.274   -24.713 26.921  1.00 46.18  ? 216 PRO A N   1 
ATOM   1650 C CA  . PRO A 1 215 ? 9.464   -24.238 27.651  1.00 41.53  ? 216 PRO A CA  1 
ATOM   1651 C C   . PRO A 1 215 ? 9.224   -23.725 29.088  1.00 38.62  ? 216 PRO A C   1 
ATOM   1652 O O   . PRO A 1 215 ? 10.062  -24.017 29.942  1.00 43.07  ? 216 PRO A O   1 
ATOM   1653 C CB  . PRO A 1 215 ? 9.995   -23.120 26.746  1.00 37.87  ? 216 PRO A CB  1 
ATOM   1654 C CG  . PRO A 1 215 ? 9.581   -23.553 25.368  1.00 30.51  ? 216 PRO A CG  1 
ATOM   1655 C CD  . PRO A 1 215 ? 8.225   -24.184 25.544  1.00 33.90  ? 216 PRO A CD  1 
ATOM   1656 N N   . PRO A 1 216 ? 8.116   -23.004 29.367  1.00 38.98  ? 217 PRO A N   1 
ATOM   1657 C CA  . PRO A 1 216 ? 7.913   -22.645 30.787  1.00 36.02  ? 217 PRO A CA  1 
ATOM   1658 C C   . PRO A 1 216 ? 7.717   -23.844 31.724  1.00 33.70  ? 217 PRO A C   1 
ATOM   1659 O O   . PRO A 1 216 ? 7.952   -23.713 32.925  1.00 44.95  ? 217 PRO A O   1 
ATOM   1660 C CB  . PRO A 1 216 ? 6.645   -21.782 30.762  1.00 27.77  ? 217 PRO A CB  1 
ATOM   1661 C CG  . PRO A 1 216 ? 6.586   -21.248 29.384  1.00 36.28  ? 217 PRO A CG  1 
ATOM   1662 C CD  . PRO A 1 216 ? 7.151   -22.320 28.488  1.00 27.72  ? 217 PRO A CD  1 
ATOM   1663 N N   . SER A 1 217 ? 7.302   -24.989 31.189  1.00 37.08  ? 218 SER A N   1 
ATOM   1664 C CA  . SER A 1 217 ? 7.153   -26.203 31.995  1.00 40.94  ? 218 SER A CA  1 
ATOM   1665 C C   . SER A 1 217 ? 8.456   -26.976 32.086  1.00 42.36  ? 218 SER A C   1 
ATOM   1666 O O   . SER A 1 217 ? 8.748   -27.597 33.112  1.00 36.98  ? 218 SER A O   1 
ATOM   1667 C CB  . SER A 1 217 ? 6.066   -27.129 31.423  1.00 32.11  ? 218 SER A CB  1 
ATOM   1668 O OG  . SER A 1 217 ? 4.766   -26.592 31.593  1.00 38.20  ? 218 SER A OG  1 
ATOM   1669 N N   . ARG A 1 218 ? 9.234   -26.943 31.006  1.00 40.96  ? 219 ARG A N   1 
ATOM   1670 C CA  . ARG A 1 218 ? 10.388  -27.827 30.867  1.00 43.35  ? 219 ARG A CA  1 
ATOM   1671 C C   . ARG A 1 218 ? 11.441  -27.633 31.982  1.00 42.67  ? 219 ARG A C   1 
ATOM   1672 O O   . ARG A 1 218 ? 12.129  -28.578 32.361  1.00 42.24  ? 219 ARG A O   1 
ATOM   1673 C CB  . ARG A 1 218 ? 11.010  -27.633 29.482  1.00 42.23  ? 219 ARG A CB  1 
ATOM   1674 C CG  . ARG A 1 218 ? 12.159  -28.567 29.155  1.00 41.32  ? 219 ARG A CG  1 
ATOM   1675 C CD  . ARG A 1 218 ? 11.716  -29.997 29.160  1.00 46.57  ? 219 ARG A CD  1 
ATOM   1676 N NE  . ARG A 1 218 ? 12.835  -30.928 29.042  1.00 62.57  ? 219 ARG A NE  1 
ATOM   1677 C CZ  . ARG A 1 218 ? 13.481  -31.457 30.079  1.00 49.02  ? 219 ARG A CZ  1 
ATOM   1678 N NH1 . ARG A 1 218 ? 13.125  -31.136 31.315  1.00 35.24  ? 219 ARG A NH1 1 
ATOM   1679 N NH2 . ARG A 1 218 ? 14.482  -32.308 29.878  1.00 42.44  ? 219 ARG A NH2 1 
ATOM   1680 N N   . GLY A 1 219 ? 11.538  -26.425 32.530  1.00 33.88  ? 220 GLY A N   1 
ATOM   1681 C CA  . GLY A 1 219 ? 12.449  -26.170 33.632  1.00 31.97  ? 220 GLY A CA  1 
ATOM   1682 C C   . GLY A 1 219 ? 11.899  -26.528 35.005  1.00 49.33  ? 220 GLY A C   1 
ATOM   1683 O O   . GLY A 1 219 ? 12.475  -26.159 36.031  1.00 47.13  ? 220 GLY A O   1 
ATOM   1684 N N   . LEU A 1 220 ? 10.787  -27.257 35.038  1.00 43.20  ? 221 LEU A N   1 
ATOM   1685 C CA  . LEU A 1 220 ? 10.172  -27.612 36.313  1.00 36.96  ? 221 LEU A CA  1 
ATOM   1686 C C   . LEU A 1 220 ? 10.340  -29.095 36.631  1.00 36.74  ? 221 LEU A C   1 
ATOM   1687 O O   . LEU A 1 220 ? 9.912   -29.564 37.686  1.00 35.18  ? 221 LEU A O   1 
ATOM   1688 C CB  . LEU A 1 220 ? 8.687   -27.244 36.323  1.00 33.83  ? 221 LEU A CB  1 
ATOM   1689 C CG  . LEU A 1 220 ? 8.331   -25.775 36.072  1.00 37.15  ? 221 LEU A CG  1 
ATOM   1690 C CD1 . LEU A 1 220 ? 6.813   -25.584 36.101  1.00 33.58  ? 221 LEU A CD1 1 
ATOM   1691 C CD2 . LEU A 1 220 ? 9.010   -24.890 37.089  1.00 27.77  ? 221 LEU A CD2 1 
ATOM   1692 N N   . PHE A 1 221 ? 10.964  -29.833 35.721  1.00 31.96  ? 222 PHE A N   1 
ATOM   1693 C CA  . PHE A 1 221 ? 11.180  -31.258 35.937  1.00 37.47  ? 222 PHE A CA  1 
ATOM   1694 C C   . PHE A 1 221 ? 12.364  -31.752 35.110  1.00 39.36  ? 222 PHE A C   1 
ATOM   1695 O O   . PHE A 1 221 ? 12.803  -31.082 34.180  1.00 39.12  ? 222 PHE A O   1 
ATOM   1696 C CB  . PHE A 1 221 ? 9.914   -32.053 35.598  1.00 36.22  ? 222 PHE A CB  1 
ATOM   1697 C CG  . PHE A 1 221 ? 9.549   -32.018 34.148  1.00 33.15  ? 222 PHE A CG  1 
ATOM   1698 C CD1 . PHE A 1 221 ? 8.890   -30.921 33.611  1.00 34.78  ? 222 PHE A CD1 1 
ATOM   1699 C CD2 . PHE A 1 221 ? 9.864   -33.086 33.318  1.00 32.58  ? 222 PHE A CD2 1 
ATOM   1700 C CE1 . PHE A 1 221 ? 8.557   -30.885 32.263  1.00 36.34  ? 222 PHE A CE1 1 
ATOM   1701 C CE2 . PHE A 1 221 ? 9.534   -33.063 31.970  1.00 39.54  ? 222 PHE A CE2 1 
ATOM   1702 C CZ  . PHE A 1 221 ? 8.879   -31.962 31.441  1.00 42.97  ? 222 PHE A CZ  1 
ATOM   1703 N N   . HIS A 1 222 ? 12.868  -32.932 35.444  1.00 33.36  ? 223 HIS A N   1 
ATOM   1704 C CA  . HIS A 1 222 ? 14.101  -33.426 34.859  1.00 31.87  ? 223 HIS A CA  1 
ATOM   1705 C C   . HIS A 1 222 ? 13.863  -34.549 33.850  1.00 34.60  ? 223 HIS A C   1 
ATOM   1706 O O   . HIS A 1 222 ? 14.330  -34.476 32.723  1.00 43.22  ? 223 HIS A O   1 
ATOM   1707 C CB  . HIS A 1 222 ? 15.037  -33.905 35.977  1.00 42.19  ? 223 HIS A CB  1 
ATOM   1708 C CG  . HIS A 1 222 ? 16.429  -34.205 35.516  1.00 55.90  ? 223 HIS A CG  1 
ATOM   1709 N ND1 . HIS A 1 222 ? 17.121  -33.384 34.651  1.00 63.76  ? 223 HIS A ND1 1 
ATOM   1710 C CD2 . HIS A 1 222 ? 17.261  -35.235 35.803  1.00 57.43  ? 223 HIS A CD2 1 
ATOM   1711 C CE1 . HIS A 1 222 ? 18.317  -33.896 34.421  1.00 68.02  ? 223 HIS A CE1 1 
ATOM   1712 N NE2 . HIS A 1 222 ? 18.426  -35.022 35.105  1.00 69.92  ? 223 HIS A NE2 1 
ATOM   1713 N N   . ARG A 1 223 ? 13.157  -35.594 34.272  1.00 32.82  ? 224 ARG A N   1 
ATOM   1714 C CA  . ARG A 1 223 ? 12.918  -36.767 33.440  1.00 29.70  ? 224 ARG A CA  1 
ATOM   1715 C C   . ARG A 1 223 ? 11.427  -36.971 33.225  1.00 36.21  ? 224 ARG A C   1 
ATOM   1716 O O   . ARG A 1 223 ? 10.606  -36.397 33.945  1.00 30.33  ? 224 ARG A O   1 
ATOM   1717 C CB  . ARG A 1 223 ? 13.513  -38.020 34.080  1.00 33.95  ? 224 ARG A CB  1 
ATOM   1718 C CG  . ARG A 1 223 ? 14.938  -37.860 34.533  1.00 45.86  ? 224 ARG A CG  1 
ATOM   1719 C CD  . ARG A 1 223 ? 15.584  -39.176 34.916  1.00 43.70  ? 224 ARG A CD  1 
ATOM   1720 N NE  . ARG A 1 223 ? 17.036  -39.021 34.995  1.00 52.97  ? 224 ARG A NE  1 
ATOM   1721 C CZ  . ARG A 1 223 ? 17.702  -38.739 36.109  1.00 54.97  ? 224 ARG A CZ  1 
ATOM   1722 N NH1 . ARG A 1 223 ? 17.047  -38.591 37.253  1.00 55.46  ? 224 ARG A NH1 1 
ATOM   1723 N NH2 . ARG A 1 223 ? 19.022  -38.610 36.081  1.00 54.26  ? 224 ARG A NH2 1 
ATOM   1724 N N   . ALA A 1 224 ? 11.077  -37.811 32.254  1.00 25.49  ? 225 ALA A N   1 
ATOM   1725 C CA  . ALA A 1 224 ? 9.677   -38.045 31.927  1.00 25.51  ? 225 ALA A CA  1 
ATOM   1726 C C   . ALA A 1 224 ? 9.385   -39.514 31.639  1.00 32.35  ? 225 ALA A C   1 
ATOM   1727 O O   . ALA A 1 224 ? 10.206  -40.219 31.051  1.00 33.49  ? 225 ALA A O   1 
ATOM   1728 C CB  . ALA A 1 224 ? 9.267   -37.194 30.744  1.00 30.07  ? 225 ALA A CB  1 
ATOM   1729 N N   . VAL A 1 225 ? 8.212   -39.966 32.073  1.00 31.99  ? 226 VAL A N   1 
ATOM   1730 C CA  . VAL A 1 225 ? 7.711   -41.292 31.742  1.00 24.57  ? 226 VAL A CA  1 
ATOM   1731 C C   . VAL A 1 225 ? 6.348   -41.140 31.097  1.00 33.73  ? 226 VAL A C   1 
ATOM   1732 O O   . VAL A 1 225 ? 5.476   -40.450 31.625  1.00 33.75  ? 226 VAL A O   1 
ATOM   1733 C CB  . VAL A 1 225 ? 7.574   -42.194 32.973  1.00 32.64  ? 226 VAL A CB  1 
ATOM   1734 C CG1 . VAL A 1 225 ? 7.088   -43.574 32.564  1.00 29.88  ? 226 VAL A CG1 1 
ATOM   1735 C CG2 . VAL A 1 225 ? 8.866   -42.269 33.733  1.00 24.47  ? 226 VAL A CG2 1 
ATOM   1736 N N   . LEU A 1 226 ? 6.164   -41.775 29.950  1.00 35.58  ? 227 LEU A N   1 
ATOM   1737 C CA  . LEU A 1 226 ? 4.893   -41.695 29.247  1.00 28.89  ? 227 LEU A CA  1 
ATOM   1738 C C   . LEU A 1 226 ? 4.356   -43.084 29.021  1.00 31.98  ? 227 LEU A C   1 
ATOM   1739 O O   . LEU A 1 226 ? 4.911   -43.836 28.226  1.00 40.28  ? 227 LEU A O   1 
ATOM   1740 C CB  . LEU A 1 226 ? 5.040   -40.981 27.913  1.00 31.27  ? 227 LEU A CB  1 
ATOM   1741 C CG  . LEU A 1 226 ? 5.381   -39.502 27.946  1.00 27.82  ? 227 LEU A CG  1 
ATOM   1742 C CD1 . LEU A 1 226 ? 6.865   -39.309 28.071  1.00 23.96  ? 227 LEU A CD1 1 
ATOM   1743 C CD2 . LEU A 1 226 ? 4.869   -38.893 26.661  1.00 29.89  ? 227 LEU A CD2 1 
ATOM   1744 N N   . GLN A 1 227 ? 3.276   -43.414 29.719  1.00 30.63  ? 228 GLN A N   1 
ATOM   1745 C CA  . GLN A 1 227 ? 2.646   -44.718 29.591  1.00 35.48  ? 228 GLN A CA  1 
ATOM   1746 C C   . GLN A 1 227 ? 1.351   -44.657 28.784  1.00 39.02  ? 228 GLN A C   1 
ATOM   1747 O O   . GLN A 1 227 ? 0.375   -44.042 29.225  1.00 34.71  ? 228 GLN A O   1 
ATOM   1748 C CB  . GLN A 1 227 ? 2.357   -45.289 30.967  1.00 31.00  ? 228 GLN A CB  1 
ATOM   1749 C CG  . GLN A 1 227 ? 3.516   -45.180 31.922  1.00 32.76  ? 228 GLN A CG  1 
ATOM   1750 C CD  . GLN A 1 227 ? 3.112   -45.499 33.341  1.00 42.30  ? 228 GLN A CD  1 
ATOM   1751 O OE1 . GLN A 1 227 ? 3.751   -45.052 34.293  1.00 41.45  ? 228 GLN A OE1 1 
ATOM   1752 N NE2 . GLN A 1 227 ? 2.037   -46.273 33.494  1.00 45.15  ? 228 GLN A NE2 1 
ATOM   1753 N N   . SER A 1 228 ? 1.359   -45.290 27.607  1.00 32.38  ? 229 SER A N   1 
ATOM   1754 C CA  . SER A 1 228 ? 0.160   -45.473 26.785  1.00 30.05  ? 229 SER A CA  1 
ATOM   1755 C C   . SER A 1 228 ? -0.487  -44.154 26.412  1.00 32.25  ? 229 SER A C   1 
ATOM   1756 O O   . SER A 1 228 ? -1.702  -44.001 26.491  1.00 39.42  ? 229 SER A O   1 
ATOM   1757 C CB  . SER A 1 228 ? -0.860  -46.359 27.499  1.00 26.36  ? 229 SER A CB  1 
ATOM   1758 O OG  . SER A 1 228 ? -0.305  -47.631 27.797  1.00 37.10  ? 229 SER A OG  1 
ATOM   1759 N N   . GLY A 1 229 ? 0.337   -43.203 25.998  1.00 31.40  ? 230 GLY A N   1 
ATOM   1760 C CA  . GLY A 1 229 ? -0.149  -41.886 25.658  1.00 24.65  ? 230 GLY A CA  1 
ATOM   1761 C C   . GLY A 1 229 ? 0.987   -41.018 25.158  1.00 33.54  ? 230 GLY A C   1 
ATOM   1762 O O   . GLY A 1 229 ? 2.154   -41.248 25.469  1.00 33.29  ? 230 GLY A O   1 
ATOM   1763 N N   . ALA A 1 230 ? 0.633   -40.000 24.390  1.00 31.41  ? 231 ALA A N   1 
ATOM   1764 C CA  . ALA A 1 230 ? 1.614   -39.181 23.720  1.00 29.38  ? 231 ALA A CA  1 
ATOM   1765 C C   . ALA A 1 230 ? 0.956   -37.876 23.287  1.00 35.27  ? 231 ALA A C   1 
ATOM   1766 O O   . ALA A 1 230 ? -0.210  -37.863 22.897  1.00 34.86  ? 231 ALA A O   1 
ATOM   1767 C CB  . ALA A 1 230 ? 2.200   -39.935 22.522  1.00 25.65  ? 231 ALA A CB  1 
ATOM   1768 N N   . PRO A 1 231 ? 1.706   -36.770 23.332  1.00 36.53  ? 232 PRO A N   1 
ATOM   1769 C CA  . PRO A 1 231 ? 1.080   -35.489 22.994  1.00 31.87  ? 232 PRO A CA  1 
ATOM   1770 C C   . PRO A 1 231 ? 0.668   -35.398 21.523  1.00 30.96  ? 232 PRO A C   1 
ATOM   1771 O O   . PRO A 1 231 ? -0.113  -34.520 21.169  1.00 40.27  ? 232 PRO A O   1 
ATOM   1772 C CB  . PRO A 1 231 ? 2.178   -34.478 23.323  1.00 30.64  ? 232 PRO A CB  1 
ATOM   1773 C CG  . PRO A 1 231 ? 3.451   -35.241 23.095  1.00 33.86  ? 232 PRO A CG  1 
ATOM   1774 C CD  . PRO A 1 231 ? 3.161   -36.645 23.538  1.00 31.89  ? 232 PRO A CD  1 
ATOM   1775 N N   . ASN A 1 232 ? 1.177   -36.303 20.690  1.00 34.78  ? 233 ASN A N   1 
ATOM   1776 C CA  . ASN A 1 232 ? 0.967   -36.233 19.250  1.00 28.43  ? 233 ASN A CA  1 
ATOM   1777 C C   . ASN A 1 232 ? -0.134  -37.184 18.754  1.00 34.65  ? 233 ASN A C   1 
ATOM   1778 O O   . ASN A 1 232 ? -0.410  -37.268 17.553  1.00 40.55  ? 233 ASN A O   1 
ATOM   1779 C CB  . ASN A 1 232 ? 2.285   -36.510 18.510  1.00 35.25  ? 233 ASN A CB  1 
ATOM   1780 C CG  . ASN A 1 232 ? 3.023   -37.722 19.052  1.00 36.39  ? 233 ASN A CG  1 
ATOM   1781 O OD1 . ASN A 1 232 ? 3.323   -37.791 20.240  1.00 42.26  ? 233 ASN A OD1 1 
ATOM   1782 N ND2 . ASN A 1 232 ? 3.305   -38.692 18.186  1.00 32.85  ? 233 ASN A ND2 1 
ATOM   1783 N N   . GLY A 1 233 ? -0.775  -37.893 19.678  1.00 39.54  ? 234 GLY A N   1 
ATOM   1784 C CA  . GLY A 1 233 ? -1.965  -38.653 19.329  1.00 46.82  ? 234 GLY A CA  1 
ATOM   1785 C C   . GLY A 1 233 ? -3.058  -37.774 18.726  1.00 47.93  ? 234 GLY A C   1 
ATOM   1786 O O   . GLY A 1 233 ? -3.189  -36.600 19.083  1.00 49.48  ? 234 GLY A O   1 
ATOM   1787 N N   . PRO A 1 234 ? -3.864  -38.347 17.819  1.00 37.90  ? 235 PRO A N   1 
ATOM   1788 C CA  . PRO A 1 234 ? -4.927  -37.649 17.088  1.00 35.46  ? 235 PRO A CA  1 
ATOM   1789 C C   . PRO A 1 234 ? -6.070  -37.127 17.983  1.00 43.09  ? 235 PRO A C   1 
ATOM   1790 O O   . PRO A 1 234 ? -6.865  -36.285 17.551  1.00 44.23  ? 235 PRO A O   1 
ATOM   1791 C CB  . PRO A 1 234 ? -5.441  -38.729 16.130  1.00 32.26  ? 235 PRO A CB  1 
ATOM   1792 C CG  . PRO A 1 234 ? -5.184  -40.002 16.846  1.00 32.87  ? 235 PRO A CG  1 
ATOM   1793 C CD  . PRO A 1 234 ? -3.882  -39.797 17.558  1.00 40.40  ? 235 PRO A CD  1 
ATOM   1794 N N   . TRP A 1 235 ? -6.143  -37.622 19.213  1.00 31.61  ? 236 TRP A N   1 
ATOM   1795 C CA  . TRP A 1 235 ? -7.207  -37.249 20.139  1.00 40.22  ? 236 TRP A CA  1 
ATOM   1796 C C   . TRP A 1 235 ? -6.810  -36.166 21.152  1.00 44.04  ? 236 TRP A C   1 
ATOM   1797 O O   . TRP A 1 235 ? -7.665  -35.652 21.863  1.00 40.73  ? 236 TRP A O   1 
ATOM   1798 C CB  . TRP A 1 235 ? -7.674  -38.489 20.909  1.00 37.76  ? 236 TRP A CB  1 
ATOM   1799 C CG  . TRP A 1 235 ? -6.529  -39.207 21.552  1.00 37.68  ? 236 TRP A CG  1 
ATOM   1800 C CD1 . TRP A 1 235 ? -5.836  -40.259 21.036  1.00 37.08  ? 236 TRP A CD1 1 
ATOM   1801 C CD2 . TRP A 1 235 ? -5.911  -38.897 22.807  1.00 39.70  ? 236 TRP A CD2 1 
ATOM   1802 N NE1 . TRP A 1 235 ? -4.840  -40.641 21.899  1.00 38.52  ? 236 TRP A NE1 1 
ATOM   1803 C CE2 . TRP A 1 235 ? -4.859  -39.819 22.994  1.00 41.65  ? 236 TRP A CE2 1 
ATOM   1804 C CE3 . TRP A 1 235 ? -6.147  -37.938 23.798  1.00 36.66  ? 236 TRP A CE3 1 
ATOM   1805 C CZ2 . TRP A 1 235 ? -4.045  -39.810 24.126  1.00 36.63  ? 236 TRP A CZ2 1 
ATOM   1806 C CZ3 . TRP A 1 235 ? -5.338  -37.930 24.923  1.00 38.32  ? 236 TRP A CZ3 1 
ATOM   1807 C CH2 . TRP A 1 235 ? -4.301  -38.859 25.078  1.00 37.55  ? 236 TRP A CH2 1 
ATOM   1808 N N   . ALA A 1 236 ? -5.524  -35.831 21.226  1.00 36.86  ? 237 ALA A N   1 
ATOM   1809 C CA  . ALA A 1 236 ? -5.006  -35.069 22.361  1.00 30.07  ? 237 ALA A CA  1 
ATOM   1810 C C   . ALA A 1 236 ? -4.946  -33.552 22.140  1.00 34.18  ? 237 ALA A C   1 
ATOM   1811 O O   . ALA A 1 236 ? -4.720  -32.788 23.084  1.00 35.57  ? 237 ALA A O   1 
ATOM   1812 C CB  . ALA A 1 236 ? -3.634  -35.588 22.739  1.00 30.79  ? 237 ALA A CB  1 
ATOM   1813 N N   . THR A 1 237 ? -5.156  -33.109 20.905  1.00 32.72  ? 238 THR A N   1 
ATOM   1814 C CA  . THR A 1 237 ? -5.150  -31.680 20.627  1.00 28.43  ? 238 THR A CA  1 
ATOM   1815 C C   . THR A 1 237 ? -6.230  -31.287 19.631  1.00 39.85  ? 238 THR A C   1 
ATOM   1816 O O   . THR A 1 237 ? -6.786  -32.118 18.918  1.00 37.16  ? 238 THR A O   1 
ATOM   1817 C CB  . THR A 1 237 ? -3.773  -31.188 20.088  1.00 35.19  ? 238 THR A CB  1 
ATOM   1818 O OG1 . THR A 1 237 ? -3.268  -32.102 19.103  1.00 39.10  ? 238 THR A OG1 1 
ATOM   1819 C CG2 . THR A 1 237 ? -2.761  -31.055 21.224  1.00 36.92  ? 238 THR A CG2 1 
ATOM   1820 N N   . VAL A 1 238 ? -6.513  -29.995 19.600  1.00 36.60  ? 239 VAL A N   1 
ATOM   1821 C CA  . VAL A 1 238 ? -7.518  -29.447 18.725  1.00 31.88  ? 239 VAL A CA  1 
ATOM   1822 C C   . VAL A 1 238 ? -6.971  -28.103 18.268  1.00 42.04  ? 239 VAL A C   1 
ATOM   1823 O O   . VAL A 1 238 ? -6.202  -27.472 19.000  1.00 41.31  ? 239 VAL A O   1 
ATOM   1824 C CB  . VAL A 1 238 ? -8.885  -29.302 19.448  1.00 39.58  ? 239 VAL A CB  1 
ATOM   1825 C CG1 . VAL A 1 238 ? -8.782  -28.310 20.599  1.00 29.08  ? 239 VAL A CG1 1 
ATOM   1826 C CG2 . VAL A 1 238 ? -9.979  -28.890 18.483  1.00 37.66  ? 239 VAL A CG2 1 
ATOM   1827 N N   . GLY A 1 239 ? -7.331  -27.683 17.057  1.00 32.81  ? 240 GLY A N   1 
ATOM   1828 C CA  . GLY A 1 239 ? -6.901  -26.394 16.550  1.00 33.26  ? 240 GLY A CA  1 
ATOM   1829 C C   . GLY A 1 239 ? -7.752  -25.251 17.072  1.00 43.84  ? 240 GLY A C   1 
ATOM   1830 O O   . GLY A 1 239 ? -8.851  -25.466 17.594  1.00 44.44  ? 240 GLY A O   1 
ATOM   1831 N N   . MET A 1 240 ? -7.246  -24.031 16.918  1.00 41.78  ? 241 MET A N   1 
ATOM   1832 C CA  . MET A 1 240 ? -7.916  -22.832 17.418  1.00 42.46  ? 241 MET A CA  1 
ATOM   1833 C C   . MET A 1 240 ? -9.319  -22.643 16.876  1.00 48.79  ? 241 MET A C   1 
ATOM   1834 O O   . MET A 1 240 ? -10.245 -22.337 17.627  1.00 45.90  ? 241 MET A O   1 
ATOM   1835 C CB  . MET A 1 240 ? -7.091  -21.593 17.086  1.00 43.05  ? 241 MET A CB  1 
ATOM   1836 C CG  . MET A 1 240 ? -5.969  -21.322 18.070  1.00 54.47  ? 241 MET A CG  1 
ATOM   1837 S SD  . MET A 1 240 ? -4.976  -19.939 17.510  1.00 61.92  ? 241 MET A SD  1 
ATOM   1838 C CE  . MET A 1 240 ? -6.275  -18.765 17.102  1.00 70.92  ? 241 MET A CE  1 
ATOM   1839 N N   . GLY A 1 241 ? -9.462  -22.808 15.566  1.00 48.41  ? 242 GLY A N   1 
ATOM   1840 C CA  . GLY A 1 241 ? -10.726 -22.554 14.908  1.00 42.61  ? 242 GLY A CA  1 
ATOM   1841 C C   . GLY A 1 241 ? -11.781 -23.543 15.338  1.00 47.93  ? 242 GLY A C   1 
ATOM   1842 O O   . GLY A 1 241 ? -12.936 -23.185 15.571  1.00 53.07  ? 242 GLY A O   1 
ATOM   1843 N N   . GLU A 1 242 ? -11.373 -24.799 15.450  1.00 47.05  ? 243 GLU A N   1 
ATOM   1844 C CA  . GLU A 1 242 ? -12.280 -25.850 15.867  1.00 43.49  ? 243 GLU A CA  1 
ATOM   1845 C C   . GLU A 1 242 ? -12.620 -25.698 17.351  1.00 48.98  ? 243 GLU A C   1 
ATOM   1846 O O   . GLU A 1 242 ? -13.735 -25.998 17.764  1.00 42.98  ? 243 GLU A O   1 
ATOM   1847 C CB  . GLU A 1 242 ? -11.673 -27.227 15.563  1.00 40.31  ? 243 GLU A CB  1 
ATOM   1848 C CG  . GLU A 1 242 ? -12.465 -28.438 16.058  1.00 46.17  ? 243 GLU A CG  1 
ATOM   1849 C CD  . GLU A 1 242 ? -13.863 -28.565 15.458  1.00 63.62  ? 243 GLU A CD  1 
ATOM   1850 O OE1 . GLU A 1 242 ? -14.208 -27.791 14.530  1.00 63.26  ? 243 GLU A OE1 1 
ATOM   1851 O OE2 . GLU A 1 242 ? -14.618 -29.456 15.921  1.00 54.17  ? 243 GLU A OE2 1 
ATOM   1852 N N   . ALA A 1 243 ? -11.673 -25.211 18.149  1.00 51.78  ? 244 ALA A N   1 
ATOM   1853 C CA  . ALA A 1 243 ? -11.943 -24.984 19.569  1.00 49.34  ? 244 ALA A CA  1 
ATOM   1854 C C   . ALA A 1 243 ? -13.040 -23.940 19.738  1.00 46.55  ? 244 ALA A C   1 
ATOM   1855 O O   . ALA A 1 243 ? -13.971 -24.128 20.521  1.00 51.07  ? 244 ALA A O   1 
ATOM   1856 C CB  . ALA A 1 243 ? -10.683 -24.552 20.306  1.00 36.63  ? 244 ALA A CB  1 
ATOM   1857 N N   . ARG A 1 244 ? -12.937 -22.851 18.984  1.00 45.63  ? 245 ARG A N   1 
ATOM   1858 C CA  . ARG A 1 244 ? -13.907 -21.771 19.093  1.00 49.75  ? 245 ARG A CA  1 
ATOM   1859 C C   . ARG A 1 244 ? -15.300 -22.260 18.725  1.00 48.57  ? 245 ARG A C   1 
ATOM   1860 O O   . ARG A 1 244 ? -16.278 -21.942 19.390  1.00 45.46  ? 245 ARG A O   1 
ATOM   1861 C CB  . ARG A 1 244 ? -13.513 -20.595 18.208  1.00 40.05  ? 245 ARG A CB  1 
ATOM   1862 C CG  . ARG A 1 244 ? -14.495 -19.457 18.278  1.00 40.79  ? 245 ARG A CG  1 
ATOM   1863 C CD  . ARG A 1 244 ? -13.990 -18.244 17.537  1.00 42.91  ? 245 ARG A CD  1 
ATOM   1864 N NE  . ARG A 1 244 ? -12.923 -17.590 18.277  1.00 49.84  ? 245 ARG A NE  1 
ATOM   1865 C CZ  . ARG A 1 244 ? -13.138 -16.779 19.305  1.00 57.56  ? 245 ARG A CZ  1 
ATOM   1866 N NH1 . ARG A 1 244 ? -14.381 -16.536 19.697  1.00 50.48  ? 245 ARG A NH1 1 
ATOM   1867 N NH2 . ARG A 1 244 ? -12.117 -16.214 19.940  1.00 53.94  ? 245 ARG A NH2 1 
ATOM   1868 N N   . ARG A 1 245 ? -15.377 -23.041 17.659  1.00 48.15  ? 246 ARG A N   1 
ATOM   1869 C CA  . ARG A 1 245 ? -16.634 -23.630 17.252  1.00 48.14  ? 246 ARG A CA  1 
ATOM   1870 C C   . ARG A 1 245 ? -17.229 -24.434 18.413  1.00 48.95  ? 246 ARG A C   1 
ATOM   1871 O O   . ARG A 1 245 ? -18.385 -24.240 18.791  1.00 50.25  ? 246 ARG A O   1 
ATOM   1872 C CB  . ARG A 1 245 ? -16.428 -24.514 16.017  1.00 58.99  ? 246 ARG A CB  1 
ATOM   1873 C CG  . ARG A 1 245 ? -17.634 -24.620 15.097  1.00 64.25  ? 246 ARG A CG  1 
ATOM   1874 C CD  . ARG A 1 245 ? -17.559 -25.860 14.197  1.00 70.62  ? 246 ARG A CD  1 
ATOM   1875 N NE  . ARG A 1 245 ? -17.503 -27.121 14.950  1.00 75.00  ? 246 ARG A NE  1 
ATOM   1876 C CZ  . ARG A 1 245 ? -18.513 -27.640 15.657  1.00 79.57  ? 246 ARG A CZ  1 
ATOM   1877 N NH1 . ARG A 1 245 ? -19.685 -27.011 15.743  1.00 75.54  ? 246 ARG A NH1 1 
ATOM   1878 N NH2 . ARG A 1 245 ? -18.348 -28.796 16.292  1.00 61.90  ? 246 ARG A NH2 1 
ATOM   1879 N N   . ARG A 1 246 ? -16.415 -25.305 18.999  1.00 52.32  ? 247 ARG A N   1 
ATOM   1880 C CA  . ARG A 1 246 ? -16.866 -26.185 20.074  1.00 47.07  ? 247 ARG A CA  1 
ATOM   1881 C C   . ARG A 1 246 ? -17.296 -25.413 21.322  1.00 46.11  ? 247 ARG A C   1 
ATOM   1882 O O   . ARG A 1 246 ? -18.302 -25.741 21.950  1.00 38.53  ? 247 ARG A O   1 
ATOM   1883 C CB  . ARG A 1 246 ? -15.766 -27.181 20.434  1.00 39.12  ? 247 ARG A CB  1 
ATOM   1884 C CG  . ARG A 1 246 ? -15.407 -28.135 19.320  1.00 40.58  ? 247 ARG A CG  1 
ATOM   1885 C CD  . ARG A 1 246 ? -14.412 -29.162 19.796  1.00 39.54  ? 247 ARG A CD  1 
ATOM   1886 N NE  . ARG A 1 246 ? -13.846 -29.920 18.692  1.00 46.75  ? 247 ARG A NE  1 
ATOM   1887 C CZ  . ARG A 1 246 ? -13.051 -30.973 18.839  1.00 46.52  ? 247 ARG A CZ  1 
ATOM   1888 N NH1 . ARG A 1 246 ? -12.743 -31.406 20.053  1.00 46.19  ? 247 ARG A NH1 1 
ATOM   1889 N NH2 . ARG A 1 246 ? -12.574 -31.598 17.773  1.00 44.96  ? 247 ARG A NH2 1 
ATOM   1890 N N   . ALA A 1 247 ? -16.533 -24.389 21.681  1.00 45.81  ? 248 ALA A N   1 
ATOM   1891 C CA  . ALA A 1 247 ? -16.890 -23.561 22.823  1.00 42.72  ? 248 ALA A CA  1 
ATOM   1892 C C   . ALA A 1 247 ? -18.245 -22.903 22.595  1.00 43.90  ? 248 ALA A C   1 
ATOM   1893 O O   . ALA A 1 247 ? -19.078 -22.843 23.503  1.00 43.56  ? 248 ALA A O   1 
ATOM   1894 C CB  . ALA A 1 247 ? -15.824 -22.509 23.075  1.00 41.63  ? 248 ALA A CB  1 
ATOM   1895 N N   . THR A 1 248 ? -18.459 -22.432 21.369  1.00 45.20  ? 249 THR A N   1 
ATOM   1896 C CA  . THR A 1 248 ? -19.691 -21.747 20.992  1.00 40.96  ? 249 THR A CA  1 
ATOM   1897 C C   . THR A 1 248 ? -20.880 -22.705 21.001  1.00 45.20  ? 249 THR A C   1 
ATOM   1898 O O   . THR A 1 248 ? -21.972 -22.356 21.451  1.00 42.11  ? 249 THR A O   1 
ATOM   1899 C CB  . THR A 1 248 ? -19.566 -21.097 19.600  1.00 42.03  ? 249 THR A CB  1 
ATOM   1900 O OG1 . THR A 1 248 ? -18.567 -20.068 19.638  1.00 48.76  ? 249 THR A OG1 1 
ATOM   1901 C CG2 . THR A 1 248 ? -20.885 -20.482 19.177  1.00 44.05  ? 249 THR A CG2 1 
ATOM   1902 N N   . GLN A 1 249 ? -20.659 -23.921 20.521  1.00 39.51  ? 250 GLN A N   1 
ATOM   1903 C CA  . GLN A 1 249 ? -21.723 -24.913 20.483  1.00 43.27  ? 250 GLN A CA  1 
ATOM   1904 C C   . GLN A 1 249 ? -22.184 -25.304 21.888  1.00 48.42  ? 250 GLN A C   1 
ATOM   1905 O O   . GLN A 1 249 ? -23.382 -25.493 22.127  1.00 49.54  ? 250 GLN A O   1 
ATOM   1906 C CB  . GLN A 1 249 ? -21.271 -26.152 19.700  1.00 42.77  ? 250 GLN A CB  1 
ATOM   1907 C CG  . GLN A 1 249 ? -22.327 -27.247 19.572  1.00 49.13  ? 250 GLN A CG  1 
ATOM   1908 C CD  . GLN A 1 249 ? -23.589 -26.788 18.836  1.00 60.20  ? 250 GLN A CD  1 
ATOM   1909 O OE1 . GLN A 1 249 ? -23.624 -25.706 18.233  1.00 54.70  ? 250 GLN A OE1 1 
ATOM   1910 N NE2 . GLN A 1 249 ? -24.633 -27.614 18.888  1.00 50.58  ? 250 GLN A NE2 1 
ATOM   1911 N N   . LEU A 1 250 ? -21.240 -25.424 22.817  1.00 46.10  ? 251 LEU A N   1 
ATOM   1912 C CA  . LEU A 1 250 ? -21.604 -25.757 24.183  1.00 47.78  ? 251 LEU A CA  1 
ATOM   1913 C C   . LEU A 1 250 ? -22.462 -24.640 24.750  1.00 48.13  ? 251 LEU A C   1 
ATOM   1914 O O   . LEU A 1 250 ? -23.420 -24.893 25.477  1.00 44.12  ? 251 LEU A O   1 
ATOM   1915 C CB  . LEU A 1 250 ? -20.376 -25.975 25.061  1.00 45.05  ? 251 LEU A CB  1 
ATOM   1916 C CG  . LEU A 1 250 ? -20.748 -26.301 26.508  1.00 41.39  ? 251 LEU A CG  1 
ATOM   1917 C CD1 . LEU A 1 250 ? -21.180 -27.757 26.658  1.00 42.04  ? 251 LEU A CD1 1 
ATOM   1918 C CD2 . LEU A 1 250 ? -19.612 -25.969 27.439  1.00 45.10  ? 251 LEU A CD2 1 
ATOM   1919 N N   . ALA A 1 251 ? -22.120 -23.405 24.400  1.00 39.97  ? 252 ALA A N   1 
ATOM   1920 C CA  . ALA A 1 251 ? -22.884 -22.257 24.858  1.00 44.26  ? 252 ALA A CA  1 
ATOM   1921 C C   . ALA A 1 251 ? -24.337 -22.340 24.401  1.00 45.98  ? 252 ALA A C   1 
ATOM   1922 O O   . ALA A 1 251 ? -25.248 -22.154 25.202  1.00 45.46  ? 252 ALA A O   1 
ATOM   1923 C CB  . ALA A 1 251 ? -22.255 -20.983 24.371  1.00 43.06  ? 252 ALA A CB  1 
ATOM   1924 N N   . HIS A 1 252 ? -24.550 -22.627 23.121  1.00 51.08  ? 253 HIS A N   1 
ATOM   1925 C CA  . HIS A 1 252 ? -25.902 -22.685 22.568  1.00 54.03  ? 253 HIS A CA  1 
ATOM   1926 C C   . HIS A 1 252 ? -26.710 -23.812 23.218  1.00 51.06  ? 253 HIS A C   1 
ATOM   1927 O O   . HIS A 1 252 ? -27.891 -23.637 23.539  1.00 53.58  ? 253 HIS A O   1 
ATOM   1928 C CB  . HIS A 1 252 ? -25.861 -22.851 21.039  1.00 47.33  ? 253 HIS A CB  1 
ATOM   1929 C CG  . HIS A 1 252 ? -25.303 -21.658 20.311  1.00 70.95  ? 253 HIS A CG  1 
ATOM   1930 N ND1 . HIS A 1 252 ? -25.057 -20.449 20.932  1.00 67.89  ? 253 HIS A ND1 1 
ATOM   1931 C CD2 . HIS A 1 252 ? -24.935 -21.493 19.016  1.00 73.39  ? 253 HIS A CD2 1 
ATOM   1932 C CE1 . HIS A 1 252 ? -24.570 -19.590 20.052  1.00 62.69  ? 253 HIS A CE1 1 
ATOM   1933 N NE2 . HIS A 1 252 ? -24.481 -20.200 18.882  1.00 68.25  ? 253 HIS A NE2 1 
ATOM   1934 N N   . LEU A 1 253 ? -26.066 -24.954 23.435  1.00 43.60  ? 254 LEU A N   1 
ATOM   1935 C CA  . LEU A 1 253 ? -26.733 -26.109 24.034  1.00 45.76  ? 254 LEU A CA  1 
ATOM   1936 C C   . LEU A 1 253 ? -27.226 -25.867 25.470  1.00 48.24  ? 254 LEU A C   1 
ATOM   1937 O O   . LEU A 1 253 ? -28.124 -26.576 25.944  1.00 43.02  ? 254 LEU A O   1 
ATOM   1938 C CB  . LEU A 1 253 ? -25.802 -27.325 24.021  1.00 43.07  ? 254 LEU A CB  1 
ATOM   1939 C CG  . LEU A 1 253 ? -25.534 -28.016 22.690  1.00 46.63  ? 254 LEU A CG  1 
ATOM   1940 C CD1 . LEU A 1 253 ? -24.434 -29.051 22.864  1.00 48.19  ? 254 LEU A CD1 1 
ATOM   1941 C CD2 . LEU A 1 253 ? -26.798 -28.664 22.161  1.00 38.61  ? 254 LEU A CD2 1 
ATOM   1942 N N   . VAL A 1 254 ? -26.643 -24.883 26.157  1.00 37.75  ? 255 VAL A N   1 
ATOM   1943 C CA  . VAL A 1 254 ? -27.014 -24.600 27.542  1.00 43.33  ? 255 VAL A CA  1 
ATOM   1944 C C   . VAL A 1 254 ? -27.718 -23.243 27.680  1.00 49.12  ? 255 VAL A C   1 
ATOM   1945 O O   . VAL A 1 254 ? -27.892 -22.724 28.789  1.00 41.99  ? 255 VAL A O   1 
ATOM   1946 C CB  . VAL A 1 254 ? -25.783 -24.649 28.493  1.00 49.75  ? 255 VAL A CB  1 
ATOM   1947 C CG1 . VAL A 1 254 ? -25.141 -26.033 28.467  1.00 41.66  ? 255 VAL A CG1 1 
ATOM   1948 C CG2 . VAL A 1 254 ? -24.764 -23.557 28.155  1.00 43.10  ? 255 VAL A CG2 1 
ATOM   1949 N N   . GLY A 1 255 ? -28.138 -22.685 26.548  1.00 44.31  ? 256 GLY A N   1 
ATOM   1950 C CA  . GLY A 1 255 ? -28.998 -21.518 26.547  1.00 39.70  ? 256 GLY A CA  1 
ATOM   1951 C C   . GLY A 1 255 ? -28.250 -20.208 26.616  1.00 44.94  ? 256 GLY A C   1 
ATOM   1952 O O   . GLY A 1 255 ? -28.746 -19.233 27.170  1.00 49.51  ? 256 GLY A O   1 
ATOM   1953 N N   . CYS A 1 256 ? -27.056 -20.178 26.040  1.00 54.10  ? 257 CYS A N   1 
ATOM   1954 C CA  . CYS A 1 256 ? -26.228 -18.988 26.095  1.00 52.01  ? 257 CYS A CA  1 
ATOM   1955 C C   . CYS A 1 256 ? -26.016 -18.438 24.708  1.00 61.39  ? 257 CYS A C   1 
ATOM   1956 O O   . CYS A 1 256 ? -25.834 -19.199 23.762  1.00 58.90  ? 257 CYS A O   1 
ATOM   1957 C CB  . CYS A 1 256 ? -24.890 -19.291 26.771  1.00 47.02  ? 257 CYS A CB  1 
ATOM   1958 S SG  . CYS A 1 256 ? -25.053 -19.439 28.568  1.00 67.76  ? 257 CYS A SG  1 
ATOM   1959 N N   . PRO A 1 257 ? -26.067 -17.105 24.586  1.00 72.72  ? 258 PRO A N   1 
ATOM   1960 C CA  . PRO A 1 257 ? -25.970 -16.406 23.302  1.00 70.74  ? 258 PRO A CA  1 
ATOM   1961 C C   . PRO A 1 257 ? -24.557 -16.431 22.701  1.00 81.58  ? 258 PRO A C   1 
ATOM   1962 O O   . PRO A 1 257 ? -24.397 -16.597 21.478  1.00 85.94  ? 258 PRO A O   1 
ATOM   1963 C CB  . PRO A 1 257 ? -26.398 -14.974 23.659  1.00 85.09  ? 258 PRO A CB  1 
ATOM   1964 C CG  . PRO A 1 257 ? -27.177 -15.109 24.967  1.00 85.63  ? 258 PRO A CG  1 
ATOM   1965 C CD  . PRO A 1 257 ? -26.455 -16.197 25.682  1.00 73.98  ? 258 PRO A CD  1 
ATOM   1966 N N   . ASN A 1 264 ? -19.800 -11.779 20.698  1.00 61.75  ? 265 ASN A N   1 
ATOM   1967 C CA  . ASN A 1 264 ? -18.965 -11.216 21.756  1.00 69.38  ? 265 ASN A CA  1 
ATOM   1968 C C   . ASN A 1 264 ? -18.525 -12.290 22.773  1.00 78.38  ? 265 ASN A C   1 
ATOM   1969 O O   . ASN A 1 264 ? -19.356 -12.879 23.472  1.00 68.12  ? 265 ASN A O   1 
ATOM   1970 C CB  . ASN A 1 264 ? -19.724 -10.077 22.453  1.00 75.67  ? 265 ASN A CB  1 
ATOM   1971 C CG  . ASN A 1 264 ? -18.815 -9.172  23.278  1.00 85.67  ? 265 ASN A CG  1 
ATOM   1972 O OD1 . ASN A 1 264 ? -17.937 -9.643  24.003  1.00 76.26  ? 265 ASN A OD1 1 
ATOM   1973 N ND2 . ASN A 1 264 ? -19.035 -7.859  23.176  1.00 88.14  ? 265 ASN A ND2 1 
ATOM   1974 N N   . ASP A 1 265 ? -17.218 -12.545 22.848  1.00 73.78  ? 266 ASP A N   1 
ATOM   1975 C CA  . ASP A 1 265 ? -16.675 -13.564 23.755  1.00 63.97  ? 266 ASP A CA  1 
ATOM   1976 C C   . ASP A 1 265 ? -16.972 -13.283 25.225  1.00 66.08  ? 266 ASP A C   1 
ATOM   1977 O O   . ASP A 1 265 ? -17.229 -14.205 25.998  1.00 64.12  ? 266 ASP A O   1 
ATOM   1978 C CB  . ASP A 1 265 ? -15.157 -13.701 23.579  1.00 68.42  ? 266 ASP A CB  1 
ATOM   1979 C CG  . ASP A 1 265 ? -14.773 -14.453 22.314  1.00 73.94  ? 266 ASP A CG  1 
ATOM   1980 O OD1 . ASP A 1 265 ? -15.663 -15.086 21.699  1.00 69.79  ? 266 ASP A OD1 1 
ATOM   1981 O OD2 . ASP A 1 265 ? -13.573 -14.413 21.947  1.00 59.10  ? 266 ASP A OD2 1 
ATOM   1982 N N   . THR A 1 266 ? -16.917 -12.014 25.612  1.00 64.24  ? 267 THR A N   1 
ATOM   1983 C CA  . THR A 1 266 ? -17.166 -11.629 26.995  1.00 62.00  ? 267 THR A CA  1 
ATOM   1984 C C   . THR A 1 266 ? -18.581 -12.003 27.445  1.00 65.60  ? 267 THR A C   1 
ATOM   1985 O O   . THR A 1 266 ? -18.767 -12.519 28.549  1.00 64.38  ? 267 THR A O   1 
ATOM   1986 C CB  . THR A 1 266 ? -16.954 -10.118 27.199  1.00 65.95  ? 267 THR A CB  1 
ATOM   1987 O OG1 . THR A 1 266 ? -15.654 -9.748  26.725  1.00 66.91  ? 267 THR A OG1 1 
ATOM   1988 C CG2 . THR A 1 266 ? -17.081 -9.747  28.674  1.00 60.16  ? 267 THR A CG2 1 
ATOM   1989 N N   . GLU A 1 267 ? -19.573 -11.749 26.594  1.00 67.33  ? 268 GLU A N   1 
ATOM   1990 C CA  . GLU A 1 267 ? -20.961 -12.063 26.933  1.00 66.37  ? 268 GLU A CA  1 
ATOM   1991 C C   . GLU A 1 267 ? -21.173 -13.571 26.992  1.00 65.18  ? 268 GLU A C   1 
ATOM   1992 O O   . GLU A 1 267 ? -21.934 -14.076 27.823  1.00 67.69  ? 268 GLU A O   1 
ATOM   1993 C CB  . GLU A 1 267 ? -21.931 -11.437 25.924  1.00 78.21  ? 268 GLU A CB  1 
ATOM   1994 C CG  . GLU A 1 267 ? -22.068 -9.916  26.026  1.00 92.69  ? 268 GLU A CG  1 
ATOM   1995 C CD  . GLU A 1 267 ? -22.809 -9.305  24.831  1.00 119.70 ? 268 GLU A CD  1 
ATOM   1996 O OE1 . GLU A 1 267 ? -22.863 -8.052  24.741  1.00 110.37 ? 268 GLU A OE1 1 
ATOM   1997 O OE2 . GLU A 1 267 ? -23.329 -10.076 23.986  1.00 109.21 ? 268 GLU A OE2 1 
ATOM   1998 N N   . LEU A 1 268 ? -20.488 -14.284 26.107  1.00 59.14  ? 269 LEU A N   1 
ATOM   1999 C CA  . LEU A 1 268 ? -20.609 -15.730 26.024  1.00 52.23  ? 269 LEU A CA  1 
ATOM   2000 C C   . LEU A 1 268 ? -20.057 -16.411 27.283  1.00 57.29  ? 269 LEU A C   1 
ATOM   2001 O O   . LEU A 1 268 ? -20.699 -17.288 27.864  1.00 52.63  ? 269 LEU A O   1 
ATOM   2002 C CB  . LEU A 1 268 ? -19.891 -16.228 24.768  1.00 58.55  ? 269 LEU A CB  1 
ATOM   2003 C CG  . LEU A 1 268 ? -20.270 -17.580 24.167  1.00 56.18  ? 269 LEU A CG  1 
ATOM   2004 C CD1 . LEU A 1 268 ? -19.857 -17.649 22.700  1.00 60.18  ? 269 LEU A CD1 1 
ATOM   2005 C CD2 . LEU A 1 268 ? -19.586 -18.672 24.932  1.00 62.65  ? 269 LEU A CD2 1 
ATOM   2006 N N   . VAL A 1 269 ? -18.866 -16.001 27.705  1.00 59.52  ? 270 VAL A N   1 
ATOM   2007 C CA  . VAL A 1 269 ? -18.223 -16.617 28.859  1.00 51.88  ? 270 VAL A CA  1 
ATOM   2008 C C   . VAL A 1 269 ? -18.960 -16.245 30.138  1.00 49.90  ? 270 VAL A C   1 
ATOM   2009 O O   . VAL A 1 269 ? -19.107 -17.068 31.046  1.00 46.75  ? 270 VAL A O   1 
ATOM   2010 C CB  . VAL A 1 269 ? -16.739 -16.206 28.969  1.00 51.78  ? 270 VAL A CB  1 
ATOM   2011 C CG1 . VAL A 1 269 ? -16.113 -16.796 30.211  1.00 44.66  ? 270 VAL A CG1 1 
ATOM   2012 C CG2 . VAL A 1 269 ? -15.977 -16.659 27.743  1.00 51.70  ? 270 VAL A CG2 1 
ATOM   2013 N N   . ALA A 1 270 ? -19.439 -15.008 30.204  1.00 50.02  ? 271 ALA A N   1 
ATOM   2014 C CA  . ALA A 1 270 ? -20.160 -14.552 31.385  1.00 51.27  ? 271 ALA A CA  1 
ATOM   2015 C C   . ALA A 1 270 ? -21.408 -15.394 31.596  1.00 50.67  ? 271 ALA A C   1 
ATOM   2016 O O   . ALA A 1 270 ? -21.761 -15.720 32.727  1.00 47.21  ? 271 ALA A O   1 
ATOM   2017 C CB  . ALA A 1 270 ? -20.518 -13.093 31.262  1.00 45.13  ? 271 ALA A CB  1 
ATOM   2018 N N   . CYS A 1 271 ? -22.057 -15.762 30.496  1.00 53.72  ? 272 CYS A N   1 
ATOM   2019 C CA  . CYS A 1 271 ? -23.259 -16.578 30.561  1.00 50.10  ? 272 CYS A CA  1 
ATOM   2020 C C   . CYS A 1 271 ? -22.918 -18.008 30.988  1.00 51.13  ? 272 CYS A C   1 
ATOM   2021 O O   . CYS A 1 271 ? -23.611 -18.587 31.830  1.00 48.85  ? 272 CYS A O   1 
ATOM   2022 C CB  . CYS A 1 271 ? -23.990 -16.563 29.211  1.00 54.61  ? 272 CYS A CB  1 
ATOM   2023 S SG  . CYS A 1 271 ? -25.543 -17.529 29.144  1.00 62.17  ? 272 CYS A SG  1 
ATOM   2024 N N   . LEU A 1 272 ? -21.857 -18.575 30.414  1.00 51.09  ? 273 LEU A N   1 
ATOM   2025 C CA  . LEU A 1 272 ? -21.391 -19.901 30.824  1.00 43.64  ? 273 LEU A CA  1 
ATOM   2026 C C   . LEU A 1 272 ? -21.092 -19.941 32.330  1.00 50.46  ? 273 LEU A C   1 
ATOM   2027 O O   . LEU A 1 272 ? -21.305 -20.962 32.998  1.00 46.70  ? 273 LEU A O   1 
ATOM   2028 C CB  . LEU A 1 272 ? -20.149 -20.310 30.033  1.00 38.83  ? 273 LEU A CB  1 
ATOM   2029 C CG  . LEU A 1 272 ? -20.314 -20.628 28.545  1.00 50.78  ? 273 LEU A CG  1 
ATOM   2030 C CD1 . LEU A 1 272 ? -18.960 -20.639 27.846  1.00 39.86  ? 273 LEU A CD1 1 
ATOM   2031 C CD2 . LEU A 1 272 ? -21.033 -21.964 28.340  1.00 40.35  ? 273 LEU A CD2 1 
ATOM   2032 N N   . ARG A 1 273 ? -20.621 -18.822 32.869  1.00 37.24  ? 274 ARG A N   1 
ATOM   2033 C CA  . ARG A 1 273 ? -20.254 -18.787 34.273  1.00 46.21  ? 274 ARG A CA  1 
ATOM   2034 C C   . ARG A 1 273 ? -21.485 -18.819 35.196  1.00 45.41  ? 274 ARG A C   1 
ATOM   2035 O O   . ARG A 1 273 ? -21.383 -19.176 36.376  1.00 43.64  ? 274 ARG A O   1 
ATOM   2036 C CB  . ARG A 1 273 ? -19.388 -17.559 34.553  1.00 44.09  ? 274 ARG A CB  1 
ATOM   2037 C CG  . ARG A 1 273 ? -17.999 -17.641 33.939  1.00 44.94  ? 274 ARG A CG  1 
ATOM   2038 C CD  . ARG A 1 273 ? -17.006 -16.768 34.690  1.00 48.63  ? 274 ARG A CD  1 
ATOM   2039 N NE  . ARG A 1 273 ? -16.510 -15.640 33.899  1.00 60.15  ? 274 ARG A NE  1 
ATOM   2040 C CZ  . ARG A 1 273 ? -15.306 -15.586 33.326  1.00 65.37  ? 274 ARG A CZ  1 
ATOM   2041 N NH1 . ARG A 1 273 ? -14.456 -16.602 33.434  1.00 54.02  ? 274 ARG A NH1 1 
ATOM   2042 N NH2 . ARG A 1 273 ? -14.948 -14.511 32.636  1.00 73.54  ? 274 ARG A NH2 1 
ATOM   2043 N N   . THR A 1 274 ? -22.650 -18.481 34.654  1.00 44.84  ? 275 THR A N   1 
ATOM   2044 C CA  . THR A 1 274 ? -23.877 -18.471 35.442  1.00 41.40  ? 275 THR A CA  1 
ATOM   2045 C C   . THR A 1 274 ? -24.473 -19.863 35.571  1.00 48.07  ? 275 THR A C   1 
ATOM   2046 O O   . THR A 1 274 ? -25.288 -20.099 36.459  1.00 48.90  ? 275 THR A O   1 
ATOM   2047 C CB  . THR A 1 274 ? -24.954 -17.543 34.840  1.00 49.99  ? 275 THR A CB  1 
ATOM   2048 O OG1 . THR A 1 274 ? -25.446 -18.095 33.608  1.00 47.44  ? 275 THR A OG1 1 
ATOM   2049 C CG2 . THR A 1 274 ? -24.399 -16.150 34.600  1.00 44.76  ? 275 THR A CG2 1 
ATOM   2050 N N   . ARG A 1 275 ? -24.066 -20.779 34.690  1.00 43.98  ? 276 ARG A N   1 
ATOM   2051 C CA  . ARG A 1 275 ? -24.613 -22.137 34.671  1.00 33.60  ? 276 ARG A CA  1 
ATOM   2052 C C   . ARG A 1 275 ? -23.959 -23.058 35.701  1.00 40.45  ? 276 ARG A C   1 
ATOM   2053 O O   . ARG A 1 275 ? -22.745 -23.033 35.874  1.00 47.37  ? 276 ARG A O   1 
ATOM   2054 C CB  . ARG A 1 275 ? -24.450 -22.739 33.281  1.00 43.84  ? 276 ARG A CB  1 
ATOM   2055 C CG  . ARG A 1 275 ? -25.119 -21.947 32.171  1.00 44.42  ? 276 ARG A CG  1 
ATOM   2056 C CD  . ARG A 1 275 ? -26.607 -22.157 32.206  1.00 41.17  ? 276 ARG A CD  1 
ATOM   2057 N NE  . ARG A 1 275 ? -27.297 -21.541 31.080  1.00 49.05  ? 276 ARG A NE  1 
ATOM   2058 C CZ  . ARG A 1 275 ? -27.780 -20.302 31.077  1.00 54.69  ? 276 ARG A CZ  1 
ATOM   2059 N NH1 . ARG A 1 275 ? -27.640 -19.521 32.144  1.00 46.44  ? 276 ARG A NH1 1 
ATOM   2060 N NH2 . ARG A 1 275 ? -28.396 -19.840 29.998  1.00 50.12  ? 276 ARG A NH2 1 
ATOM   2061 N N   . PRO A 1 276 ? -24.765 -23.876 36.393  1.00 43.54  ? 277 PRO A N   1 
ATOM   2062 C CA  . PRO A 1 276 ? -24.228 -24.883 37.317  1.00 40.02  ? 277 PRO A CA  1 
ATOM   2063 C C   . PRO A 1 276 ? -23.283 -25.853 36.618  1.00 39.39  ? 277 PRO A C   1 
ATOM   2064 O O   . PRO A 1 276 ? -23.495 -26.180 35.450  1.00 35.37  ? 277 PRO A O   1 
ATOM   2065 C CB  . PRO A 1 276 ? -25.481 -25.610 37.817  1.00 36.58  ? 277 PRO A CB  1 
ATOM   2066 C CG  . PRO A 1 276 ? -26.574 -24.627 37.658  1.00 36.94  ? 277 PRO A CG  1 
ATOM   2067 C CD  . PRO A 1 276 ? -26.236 -23.840 36.418  1.00 44.01  ? 277 PRO A CD  1 
ATOM   2068 N N   . ALA A 1 277 ? -22.258 -26.308 37.328  1.00 44.50  ? 278 ALA A N   1 
ATOM   2069 C CA  . ALA A 1 277 ? -21.261 -27.194 36.739  1.00 37.05  ? 278 ALA A CA  1 
ATOM   2070 C C   . ALA A 1 277 ? -21.898 -28.413 36.072  1.00 40.80  ? 278 ALA A C   1 
ATOM   2071 O O   . ALA A 1 277 ? -21.508 -28.802 34.959  1.00 38.90  ? 278 ALA A O   1 
ATOM   2072 C CB  . ALA A 1 277 ? -20.262 -27.629 37.789  1.00 35.57  ? 278 ALA A CB  1 
ATOM   2073 N N   . GLN A 1 278 ? -22.892 -28.993 36.740  1.00 37.37  ? 279 GLN A N   1 
ATOM   2074 C CA  . GLN A 1 278 ? -23.515 -30.222 36.262  1.00 41.25  ? 279 GLN A CA  1 
ATOM   2075 C C   . GLN A 1 278 ? -24.173 -30.030 34.886  1.00 45.14  ? 279 GLN A C   1 
ATOM   2076 O O   . GLN A 1 278 ? -24.222 -30.960 34.076  1.00 38.40  ? 279 GLN A O   1 
ATOM   2077 C CB  . GLN A 1 278 ? -24.530 -30.729 37.289  1.00 42.18  ? 279 GLN A CB  1 
ATOM   2078 C CG  . GLN A 1 278 ? -24.962 -32.192 37.089  1.00 60.96  ? 279 GLN A CG  1 
ATOM   2079 C CD  . GLN A 1 278 ? -23.789 -33.166 36.873  1.00 56.59  ? 279 GLN A CD  1 
ATOM   2080 O OE1 . GLN A 1 278 ? -22.993 -33.432 37.782  1.00 49.36  ? 279 GLN A OE1 1 
ATOM   2081 N NE2 . GLN A 1 278 ? -23.695 -33.704 35.663  1.00 44.80  ? 279 GLN A NE2 1 
ATOM   2082 N N   . VAL A 1 279 ? -24.653 -28.816 34.627  1.00 35.98  ? 280 VAL A N   1 
ATOM   2083 C CA  . VAL A 1 279 ? -25.235 -28.467 33.336  1.00 40.64  ? 280 VAL A CA  1 
ATOM   2084 C C   . VAL A 1 279 ? -24.199 -28.554 32.201  1.00 47.28  ? 280 VAL A C   1 
ATOM   2085 O O   . VAL A 1 279 ? -24.478 -29.100 31.123  1.00 41.01  ? 280 VAL A O   1 
ATOM   2086 C CB  . VAL A 1 279 ? -25.844 -27.043 33.382  1.00 43.72  ? 280 VAL A CB  1 
ATOM   2087 C CG1 . VAL A 1 279 ? -26.328 -26.590 32.001  1.00 35.16  ? 280 VAL A CG1 1 
ATOM   2088 C CG2 . VAL A 1 279 ? -26.961 -26.996 34.400  1.00 34.76  ? 280 VAL A CG2 1 
ATOM   2089 N N   . LEU A 1 280 ? -23.005 -28.019 32.444  1.00 40.84  ? 281 LEU A N   1 
ATOM   2090 C CA  . LEU A 1 280 ? -21.943 -28.085 31.454  1.00 34.08  ? 281 LEU A CA  1 
ATOM   2091 C C   . LEU A 1 280 ? -21.520 -29.535 31.217  1.00 43.01  ? 281 LEU A C   1 
ATOM   2092 O O   . LEU A 1 280 ? -21.337 -29.954 30.075  1.00 38.20  ? 281 LEU A O   1 
ATOM   2093 C CB  . LEU A 1 280 ? -20.748 -27.246 31.883  1.00 34.88  ? 281 LEU A CB  1 
ATOM   2094 C CG  . LEU A 1 280 ? -20.933 -25.732 31.974  1.00 38.61  ? 281 LEU A CG  1 
ATOM   2095 C CD1 . LEU A 1 280 ? -19.581 -25.051 32.168  1.00 43.63  ? 281 LEU A CD1 1 
ATOM   2096 C CD2 . LEU A 1 280 ? -21.623 -25.198 30.751  1.00 32.86  ? 281 LEU A CD2 1 
ATOM   2097 N N   . VAL A 1 281 ? -21.381 -30.306 32.289  1.00 38.99  ? 282 VAL A N   1 
ATOM   2098 C CA  . VAL A 1 281 ? -21.039 -31.713 32.139  1.00 41.31  ? 282 VAL A CA  1 
ATOM   2099 C C   . VAL A 1 281 ? -22.051 -32.442 31.258  1.00 36.27  ? 282 VAL A C   1 
ATOM   2100 O O   . VAL A 1 281 ? -21.668 -33.239 30.413  1.00 47.46  ? 282 VAL A O   1 
ATOM   2101 C CB  . VAL A 1 281 ? -20.939 -32.428 33.506  1.00 41.36  ? 282 VAL A CB  1 
ATOM   2102 C CG1 . VAL A 1 281 ? -20.788 -33.929 33.313  1.00 36.15  ? 282 VAL A CG1 1 
ATOM   2103 C CG2 . VAL A 1 281 ? -19.773 -31.881 34.299  1.00 36.90  ? 282 VAL A CG2 1 
ATOM   2104 N N   . ASN A 1 282 ? -23.339 -32.143 31.427  1.00 48.96  ? 283 ASN A N   1 
ATOM   2105 C CA  . ASN A 1 282 ? -24.391 -32.890 30.727  1.00 49.38  ? 283 ASN A CA  1 
ATOM   2106 C C   . ASN A 1 282 ? -24.467 -32.609 29.232  1.00 50.97  ? 283 ASN A C   1 
ATOM   2107 O O   . ASN A 1 282 ? -25.149 -33.320 28.497  1.00 59.68  ? 283 ASN A O   1 
ATOM   2108 C CB  . ASN A 1 282 ? -25.756 -32.614 31.356  1.00 39.25  ? 283 ASN A CB  1 
ATOM   2109 C CG  . ASN A 1 282 ? -25.868 -33.164 32.764  1.00 51.80  ? 283 ASN A CG  1 
ATOM   2110 O OD1 . ASN A 1 282 ? -25.115 -34.061 33.157  1.00 48.29  ? 283 ASN A OD1 1 
ATOM   2111 N ND2 . ASN A 1 282 ? -26.809 -32.625 33.539  1.00 48.52  ? 283 ASN A ND2 1 
ATOM   2112 N N   . HIS A 1 283 ? -23.767 -31.579 28.779  1.00 48.70  ? 284 HIS A N   1 
ATOM   2113 C CA  . HIS A 1 283 ? -23.802 -31.226 27.369  1.00 49.23  ? 284 HIS A CA  1 
ATOM   2114 C C   . HIS A 1 283 ? -22.436 -31.327 26.690  1.00 51.60  ? 284 HIS A C   1 
ATOM   2115 O O   . HIS A 1 283 ? -22.354 -31.337 25.466  1.00 53.07  ? 284 HIS A O   1 
ATOM   2116 C CB  . HIS A 1 283 ? -24.391 -29.829 27.213  1.00 49.16  ? 284 HIS A CB  1 
ATOM   2117 C CG  . HIS A 1 283 ? -25.856 -29.778 27.510  1.00 60.04  ? 284 HIS A CG  1 
ATOM   2118 N ND1 . HIS A 1 283 ? -26.354 -29.437 28.749  1.00 63.94  ? 284 HIS A ND1 1 
ATOM   2119 C CD2 . HIS A 1 283 ? -26.932 -30.073 26.743  1.00 52.10  ? 284 HIS A CD2 1 
ATOM   2120 C CE1 . HIS A 1 283 ? -27.672 -29.503 28.727  1.00 49.80  ? 284 HIS A CE1 1 
ATOM   2121 N NE2 . HIS A 1 283 ? -28.049 -29.889 27.520  1.00 52.64  ? 284 HIS A NE2 1 
ATOM   2122 N N   . GLU A 1 284 ? -21.385 -31.406 27.503  1.00 57.36  ? 285 GLU A N   1 
ATOM   2123 C CA  . GLU A 1 284 ? -20.012 -31.689 27.079  1.00 43.50  ? 285 GLU A CA  1 
ATOM   2124 C C   . GLU A 1 284 ? -19.891 -32.725 25.964  1.00 54.09  ? 285 GLU A C   1 
ATOM   2125 O O   . GLU A 1 284 ? -19.132 -32.560 25.007  1.00 51.53  ? 285 GLU A O   1 
ATOM   2126 C CB  . GLU A 1 284 ? -19.223 -32.207 28.273  1.00 44.35  ? 285 GLU A CB  1 
ATOM   2127 C CG  . GLU A 1 284 ? -18.084 -31.365 28.741  1.00 39.49  ? 285 GLU A CG  1 
ATOM   2128 C CD  . GLU A 1 284 ? -17.487 -31.953 29.992  1.00 51.54  ? 285 GLU A CD  1 
ATOM   2129 O OE1 . GLU A 1 284 ? -16.884 -31.194 30.781  1.00 68.37  ? 285 GLU A OE1 1 
ATOM   2130 O OE2 . GLU A 1 284 ? -17.638 -33.182 30.193  1.00 53.18  ? 285 GLU A OE2 1 
ATOM   2131 N N   . TRP A 1 285 ? -20.627 -33.815 26.123  1.00 50.93  ? 286 TRP A N   1 
ATOM   2132 C CA  . TRP A 1 285 ? -20.491 -34.957 25.244  1.00 44.13  ? 286 TRP A CA  1 
ATOM   2133 C C   . TRP A 1 285 ? -21.382 -34.888 24.012  1.00 50.10  ? 286 TRP A C   1 
ATOM   2134 O O   . TRP A 1 285 ? -21.547 -35.883 23.309  1.00 54.74  ? 286 TRP A O   1 
ATOM   2135 C CB  . TRP A 1 285 ? -20.801 -36.224 26.019  1.00 45.86  ? 286 TRP A CB  1 
ATOM   2136 C CG  . TRP A 1 285 ? -19.688 -36.653 26.891  1.00 52.09  ? 286 TRP A CG  1 
ATOM   2137 C CD1 . TRP A 1 285 ? -19.543 -36.398 28.221  1.00 51.77  ? 286 TRP A CD1 1 
ATOM   2138 C CD2 . TRP A 1 285 ? -18.545 -37.418 26.499  1.00 52.48  ? 286 TRP A CD2 1 
ATOM   2139 N NE1 . TRP A 1 285 ? -18.384 -36.963 28.684  1.00 53.94  ? 286 TRP A NE1 1 
ATOM   2140 C CE2 . TRP A 1 285 ? -17.752 -37.598 27.647  1.00 49.42  ? 286 TRP A CE2 1 
ATOM   2141 C CE3 . TRP A 1 285 ? -18.114 -37.969 25.285  1.00 56.72  ? 286 TRP A CE3 1 
ATOM   2142 C CZ2 . TRP A 1 285 ? -16.549 -38.308 27.624  1.00 52.37  ? 286 TRP A CZ2 1 
ATOM   2143 C CZ3 . TRP A 1 285 ? -16.920 -38.676 25.264  1.00 64.22  ? 286 TRP A CZ3 1 
ATOM   2144 C CH2 . TRP A 1 285 ? -16.150 -38.839 26.428  1.00 46.89  ? 286 TRP A CH2 1 
ATOM   2145 N N   . HIS A 1 286 ? -21.951 -33.719 23.748  1.00 48.71  ? 287 HIS A N   1 
ATOM   2146 C CA  . HIS A 1 286 ? -22.930 -33.578 22.683  1.00 48.01  ? 287 HIS A CA  1 
ATOM   2147 C C   . HIS A 1 286 ? -22.607 -32.391 21.794  1.00 48.66  ? 287 HIS A C   1 
ATOM   2148 O O   . HIS A 1 286 ? -23.443 -31.938 21.024  1.00 51.43  ? 287 HIS A O   1 
ATOM   2149 C CB  . HIS A 1 286 ? -24.332 -33.441 23.279  1.00 42.50  ? 287 HIS A CB  1 
ATOM   2150 C CG  . HIS A 1 286 ? -24.753 -34.633 24.076  1.00 49.40  ? 287 HIS A CG  1 
ATOM   2151 N ND1 . HIS A 1 286 ? -25.012 -35.859 23.501  1.00 55.84  ? 287 HIS A ND1 1 
ATOM   2152 C CD2 . HIS A 1 286 ? -24.937 -34.795 25.408  1.00 50.69  ? 287 HIS A CD2 1 
ATOM   2153 C CE1 . HIS A 1 286 ? -25.343 -36.725 24.443  1.00 53.51  ? 287 HIS A CE1 1 
ATOM   2154 N NE2 . HIS A 1 286 ? -25.304 -36.105 25.610  1.00 53.10  ? 287 HIS A NE2 1 
ATOM   2155 N N   . VAL A 1 287 ? -21.383 -31.895 21.906  1.00 47.22  ? 288 VAL A N   1 
ATOM   2156 C CA  . VAL A 1 287 ? -20.959 -30.727 21.149  1.00 54.94  ? 288 VAL A CA  1 
ATOM   2157 C C   . VAL A 1 287 ? -20.509 -31.128 19.743  1.00 50.81  ? 288 VAL A C   1 
ATOM   2158 O O   . VAL A 1 287 ? -20.555 -30.341 18.798  1.00 57.82  ? 288 VAL A O   1 
ATOM   2159 C CB  . VAL A 1 287 ? -19.835 -30.001 21.891  1.00 49.60  ? 288 VAL A CB  1 
ATOM   2160 C CG1 . VAL A 1 287 ? -19.364 -28.780 21.127  1.00 52.21  ? 288 VAL A CG1 1 
ATOM   2161 C CG2 . VAL A 1 287 ? -20.298 -29.617 23.277  1.00 49.22  ? 288 VAL A CG2 1 
ATOM   2162 N N   . LEU A 1 288 ? -20.081 -32.372 19.612  1.00 61.06  ? 289 LEU A N   1 
ATOM   2163 C CA  . LEU A 1 288 ? -19.747 -32.932 18.318  1.00 55.12  ? 289 LEU A CA  1 
ATOM   2164 C C   . LEU A 1 288 ? -20.765 -34.002 17.958  1.00 72.81  ? 289 LEU A C   1 
ATOM   2165 O O   . LEU A 1 288 ? -21.232 -34.743 18.835  1.00 67.78  ? 289 LEU A O   1 
ATOM   2166 C CB  . LEU A 1 288 ? -18.346 -33.529 18.331  1.00 61.60  ? 289 LEU A CB  1 
ATOM   2167 C CG  . LEU A 1 288 ? -17.198 -32.599 18.687  1.00 58.99  ? 289 LEU A CG  1 
ATOM   2168 C CD1 . LEU A 1 288 ? -15.965 -33.442 19.005  1.00 52.87  ? 289 LEU A CD1 1 
ATOM   2169 C CD2 . LEU A 1 288 ? -16.947 -31.630 17.546  1.00 50.50  ? 289 LEU A CD2 1 
ATOM   2170 N N   . PRO A 1 289 ? -21.108 -34.092 16.662  1.00 82.23  ? 290 PRO A N   1 
ATOM   2171 C CA  . PRO A 1 289 ? -22.056 -35.099 16.167  1.00 77.05  ? 290 PRO A CA  1 
ATOM   2172 C C   . PRO A 1 289 ? -21.586 -36.532 16.448  1.00 79.91  ? 290 PRO A C   1 
ATOM   2173 O O   . PRO A 1 289 ? -22.332 -37.329 17.037  1.00 70.24  ? 290 PRO A O   1 
ATOM   2174 C CB  . PRO A 1 289 ? -22.105 -34.819 14.659  1.00 77.49  ? 290 PRO A CB  1 
ATOM   2175 C CG  . PRO A 1 289 ? -20.812 -34.094 14.359  1.00 76.57  ? 290 PRO A CG  1 
ATOM   2176 C CD  . PRO A 1 289 ? -20.550 -33.266 15.574  1.00 71.41  ? 290 PRO A CD  1 
ATOM   2177 N N   . GLN A 1 290 ? -20.362 -36.853 16.031  1.00 69.79  ? 291 GLN A N   1 
ATOM   2178 C CA  . GLN A 1 290 ? -19.808 -38.187 16.248  1.00 83.88  ? 291 GLN A CA  1 
ATOM   2179 C C   . GLN A 1 290 ? -18.758 -38.147 17.353  1.00 81.73  ? 291 GLN A C   1 
ATOM   2180 O O   . GLN A 1 290 ? -17.559 -38.350 17.103  1.00 72.84  ? 291 GLN A O   1 
ATOM   2181 C CB  . GLN A 1 290 ? -19.202 -38.746 14.954  1.00 87.38  ? 291 GLN A CB  1 
ATOM   2182 C CG  . GLN A 1 290 ? -19.972 -39.918 14.338  1.00 101.27 ? 291 GLN A CG  1 
ATOM   2183 C CD  . GLN A 1 290 ? -21.168 -39.480 13.493  1.00 106.86 ? 291 GLN A CD  1 
ATOM   2184 O OE1 . GLN A 1 290 ? -22.243 -39.172 14.020  1.00 88.65  ? 291 GLN A OE1 1 
ATOM   2185 N NE2 . GLN A 1 290 ? -20.984 -39.460 12.173  1.00 96.10  ? 291 GLN A NE2 1 
ATOM   2186 N N   . GLU A 1 291 ? -19.212 -37.881 18.575  1.00 73.06  ? 292 GLU A N   1 
ATOM   2187 C CA  . GLU A 1 291 ? -18.294 -37.657 19.687  1.00 72.89  ? 292 GLU A CA  1 
ATOM   2188 C C   . GLU A 1 291 ? -18.102 -38.930 20.506  1.00 65.28  ? 292 GLU A C   1 
ATOM   2189 O O   . GLU A 1 291 ? -19.059 -39.630 20.841  1.00 58.74  ? 292 GLU A O   1 
ATOM   2190 C CB  . GLU A 1 291 ? -18.791 -36.504 20.570  1.00 60.97  ? 292 GLU A CB  1 
ATOM   2191 C CG  . GLU A 1 291 ? -17.859 -36.144 21.719  1.00 57.83  ? 292 GLU A CG  1 
ATOM   2192 C CD  . GLU A 1 291 ? -18.180 -34.781 22.339  1.00 66.58  ? 292 GLU A CD  1 
ATOM   2193 O OE1 . GLU A 1 291 ? -19.013 -34.045 21.762  1.00 60.52  ? 292 GLU A OE1 1 
ATOM   2194 O OE2 . GLU A 1 291 ? -17.597 -34.440 23.401  1.00 61.02  ? 292 GLU A OE2 1 
ATOM   2195 N N   . SER A 1 292 ? -16.845 -39.224 20.810  1.00 58.38  ? 293 SER A N   1 
ATOM   2196 C CA  . SER A 1 292 ? -16.494 -40.436 21.527  1.00 55.64  ? 293 SER A CA  1 
ATOM   2197 C C   . SER A 1 292 ? -15.320 -40.161 22.450  1.00 61.04  ? 293 SER A C   1 
ATOM   2198 O O   . SER A 1 292 ? -14.903 -39.007 22.609  1.00 53.79  ? 293 SER A O   1 
ATOM   2199 C CB  . SER A 1 292 ? -16.145 -41.556 20.550  1.00 64.53  ? 293 SER A CB  1 
ATOM   2200 O OG  . SER A 1 292 ? -14.990 -41.226 19.788  1.00 61.24  ? 293 SER A OG  1 
ATOM   2201 N N   . VAL A 1 293 ? -14.775 -41.225 23.037  1.00 59.86  ? 294 VAL A N   1 
ATOM   2202 C CA  . VAL A 1 293 ? -13.653 -41.105 23.964  1.00 55.85  ? 294 VAL A CA  1 
ATOM   2203 C C   . VAL A 1 293 ? -12.365 -40.748 23.224  1.00 56.41  ? 294 VAL A C   1 
ATOM   2204 O O   . VAL A 1 293 ? -11.386 -40.319 23.837  1.00 57.61  ? 294 VAL A O   1 
ATOM   2205 C CB  . VAL A 1 293 ? -13.453 -42.405 24.769  1.00 53.46  ? 294 VAL A CB  1 
ATOM   2206 C CG1 . VAL A 1 293 ? -14.613 -42.612 25.735  1.00 48.36  ? 294 VAL A CG1 1 
ATOM   2207 C CG2 . VAL A 1 293 ? -13.334 -43.595 23.835  1.00 58.72  ? 294 VAL A CG2 1 
ATOM   2208 N N   . PHE A 1 294 ? -12.389 -40.917 21.903  1.00 57.24  ? 295 PHE A N   1 
ATOM   2209 C CA  . PHE A 1 294 ? -11.246 -40.639 21.034  1.00 53.16  ? 295 PHE A CA  1 
ATOM   2210 C C   . PHE A 1 294 ? -11.456 -39.399 20.192  1.00 58.46  ? 295 PHE A C   1 
ATOM   2211 O O   . PHE A 1 294 ? -10.681 -39.104 19.273  1.00 51.85  ? 295 PHE A O   1 
ATOM   2212 C CB  . PHE A 1 294 ? -10.980 -41.830 20.124  1.00 60.28  ? 295 PHE A CB  1 
ATOM   2213 C CG  . PHE A 1 294 ? -10.271 -42.937 20.810  1.00 69.03  ? 295 PHE A CG  1 
ATOM   2214 C CD1 . PHE A 1 294 ? -9.158  -42.664 21.602  1.00 61.60  ? 295 PHE A CD1 1 
ATOM   2215 C CD2 . PHE A 1 294 ? -10.725 -44.243 20.706  1.00 64.77  ? 295 PHE A CD2 1 
ATOM   2216 C CE1 . PHE A 1 294 ? -8.490  -43.680 22.265  1.00 65.60  ? 295 PHE A CE1 1 
ATOM   2217 C CE2 . PHE A 1 294 ? -10.065 -45.264 21.369  1.00 67.47  ? 295 PHE A CE2 1 
ATOM   2218 C CZ  . PHE A 1 294 ? -8.939  -44.981 22.146  1.00 64.35  ? 295 PHE A CZ  1 
ATOM   2219 N N   . ARG A 1 295 ? -12.535 -38.694 20.496  1.00 55.49  ? 296 ARG A N   1 
ATOM   2220 C CA  . ARG A 1 295 ? -12.797 -37.411 19.886  1.00 50.58  ? 296 ARG A CA  1 
ATOM   2221 C C   . ARG A 1 295 ? -13.645 -36.609 20.855  1.00 52.04  ? 296 ARG A C   1 
ATOM   2222 O O   . ARG A 1 295 ? -14.810 -36.322 20.579  1.00 57.38  ? 296 ARG A O   1 
ATOM   2223 C CB  . ARG A 1 295 ? -13.490 -37.570 18.530  1.00 57.08  ? 296 ARG A CB  1 
ATOM   2224 C CG  . ARG A 1 295 ? -13.463 -36.306 17.686  1.00 65.22  ? 296 ARG A CG  1 
ATOM   2225 C CD  . ARG A 1 295 ? -14.097 -36.494 16.316  1.00 62.85  ? 296 ARG A CD  1 
ATOM   2226 N NE  . ARG A 1 295 ? -14.473 -35.205 15.738  1.00 72.37  ? 296 ARG A NE  1 
ATOM   2227 C CZ  . ARG A 1 295 ? -13.613 -34.340 15.201  1.00 84.91  ? 296 ARG A CZ  1 
ATOM   2228 N NH1 . ARG A 1 295 ? -12.313 -34.631 15.150  1.00 73.08  ? 296 ARG A NH1 1 
ATOM   2229 N NH2 . ARG A 1 295 ? -14.054 -33.185 14.706  1.00 71.88  ? 296 ARG A NH2 1 
ATOM   2230 N N   . PHE A 1 296 ? -13.057 -36.263 22.000  1.00 53.66  ? 297 PHE A N   1 
ATOM   2231 C CA  . PHE A 1 296 ? -13.773 -35.485 23.005  1.00 47.25  ? 297 PHE A CA  1 
ATOM   2232 C C   . PHE A 1 296 ? -13.706 -33.992 22.702  1.00 47.36  ? 297 PHE A C   1 
ATOM   2233 O O   . PHE A 1 296 ? -12.785 -33.515 22.037  1.00 42.00  ? 297 PHE A O   1 
ATOM   2234 C CB  . PHE A 1 296 ? -13.233 -35.768 24.402  1.00 42.44  ? 297 PHE A CB  1 
ATOM   2235 C CG  . PHE A 1 296 ? -13.926 -34.990 25.482  1.00 51.16  ? 297 PHE A CG  1 
ATOM   2236 C CD1 . PHE A 1 296 ? -15.221 -35.312 25.860  1.00 49.85  ? 297 PHE A CD1 1 
ATOM   2237 C CD2 . PHE A 1 296 ? -13.285 -33.928 26.116  1.00 46.56  ? 297 PHE A CD2 1 
ATOM   2238 C CE1 . PHE A 1 296 ? -15.868 -34.592 26.852  1.00 45.91  ? 297 PHE A CE1 1 
ATOM   2239 C CE2 . PHE A 1 296 ? -13.924 -33.199 27.105  1.00 46.68  ? 297 PHE A CE2 1 
ATOM   2240 C CZ  . PHE A 1 296 ? -15.219 -33.531 27.475  1.00 46.37  ? 297 PHE A CZ  1 
ATOM   2241 N N   . SER A 1 297 ? -14.702 -33.266 23.192  1.00 45.69  ? 298 SER A N   1 
ATOM   2242 C CA  . SER A 1 297 ? -14.863 -31.848 22.901  1.00 45.83  ? 298 SER A CA  1 
ATOM   2243 C C   . SER A 1 297 ? -13.713 -30.974 23.342  1.00 40.47  ? 298 SER A C   1 
ATOM   2244 O O   . SER A 1 297 ? -13.183 -30.181 22.569  1.00 39.87  ? 298 SER A O   1 
ATOM   2245 C CB  . SER A 1 297 ? -16.131 -31.330 23.569  1.00 50.71  ? 298 SER A CB  1 
ATOM   2246 O OG  . SER A 1 297 ? -17.138 -31.133 22.605  1.00 74.98  ? 298 SER A OG  1 
ATOM   2247 N N   . PHE A 1 298 ? -13.347 -31.106 24.607  1.00 42.17  ? 299 PHE A N   1 
ATOM   2248 C CA  . PHE A 1 298 ? -12.481 -30.128 25.223  1.00 38.94  ? 299 PHE A CA  1 
ATOM   2249 C C   . PHE A 1 298 ? -11.177 -30.749 25.650  1.00 39.82  ? 299 PHE A C   1 
ATOM   2250 O O   . PHE A 1 298 ? -11.075 -31.394 26.693  1.00 39.27  ? 299 PHE A O   1 
ATOM   2251 C CB  . PHE A 1 298 ? -13.219 -29.468 26.377  1.00 36.18  ? 299 PHE A CB  1 
ATOM   2252 C CG  . PHE A 1 298 ? -14.504 -28.831 25.942  1.00 40.95  ? 299 PHE A CG  1 
ATOM   2253 C CD1 . PHE A 1 298 ? -14.485 -27.749 25.061  1.00 34.57  ? 299 PHE A CD1 1 
ATOM   2254 C CD2 . PHE A 1 298 ? -15.725 -29.340 26.352  1.00 39.84  ? 299 PHE A CD2 1 
ATOM   2255 C CE1 . PHE A 1 298 ? -15.656 -27.172 24.614  1.00 33.37  ? 299 PHE A CE1 1 
ATOM   2256 C CE2 . PHE A 1 298 ? -16.903 -28.759 25.914  1.00 47.52  ? 299 PHE A CE2 1 
ATOM   2257 C CZ  . PHE A 1 298 ? -16.864 -27.672 25.039  1.00 39.43  ? 299 PHE A CZ  1 
ATOM   2258 N N   . VAL A 1 299 ? -10.186 -30.547 24.791  1.00 36.03  ? 300 VAL A N   1 
ATOM   2259 C CA  . VAL A 1 299 ? -8.850  -31.080 24.962  1.00 35.44  ? 300 VAL A CA  1 
ATOM   2260 C C   . VAL A 1 299 ? -7.883  -29.899 24.839  1.00 35.04  ? 300 VAL A C   1 
ATOM   2261 O O   . VAL A 1 299 ? -8.325  -28.779 24.571  1.00 33.06  ? 300 VAL A O   1 
ATOM   2262 C CB  . VAL A 1 299 ? -8.559  -32.182 23.908  1.00 33.65  ? 300 VAL A CB  1 
ATOM   2263 C CG1 . VAL A 1 299 ? -9.495  -33.344 24.114  1.00 27.90  ? 300 VAL A CG1 1 
ATOM   2264 C CG2 . VAL A 1 299 ? -8.688  -31.624 22.495  1.00 28.74  ? 300 VAL A CG2 1 
ATOM   2265 N N   . PRO A 1 300 ? -6.572  -30.125 25.058  1.00 35.65  ? 301 PRO A N   1 
ATOM   2266 C CA  . PRO A 1 300 ? -5.592  -29.056 24.813  1.00 33.83  ? 301 PRO A CA  1 
ATOM   2267 C C   . PRO A 1 300 ? -5.679  -28.394 23.436  1.00 32.54  ? 301 PRO A C   1 
ATOM   2268 O O   . PRO A 1 300 ? -5.811  -29.074 22.422  1.00 36.41  ? 301 PRO A O   1 
ATOM   2269 C CB  . PRO A 1 300 ? -4.269  -29.786 24.971  1.00 26.20  ? 301 PRO A CB  1 
ATOM   2270 C CG  . PRO A 1 300 ? -4.559  -30.743 26.088  1.00 32.98  ? 301 PRO A CG  1 
ATOM   2271 C CD  . PRO A 1 300 ? -5.966  -31.234 25.819  1.00 31.50  ? 301 PRO A CD  1 
ATOM   2272 N N   . VAL A 1 301 ? -5.604  -27.067 23.416  1.00 31.42  ? 302 VAL A N   1 
ATOM   2273 C CA  . VAL A 1 301 ? -5.668  -26.319 22.170  1.00 36.91  ? 302 VAL A CA  1 
ATOM   2274 C C   . VAL A 1 301 ? -4.270  -25.836 21.751  1.00 38.42  ? 302 VAL A C   1 
ATOM   2275 O O   . VAL A 1 301 ? -3.483  -25.402 22.581  1.00 38.07  ? 302 VAL A O   1 
ATOM   2276 C CB  . VAL A 1 301 ? -6.653  -25.113 22.295  1.00 32.97  ? 302 VAL A CB  1 
ATOM   2277 C CG1 . VAL A 1 301 ? -6.181  -24.117 23.337  1.00 28.66  ? 302 VAL A CG1 1 
ATOM   2278 C CG2 . VAL A 1 301 ? -6.870  -24.433 20.950  1.00 32.38  ? 302 VAL A CG2 1 
ATOM   2279 N N   . VAL A 1 302 ? -3.955  -25.948 20.463  1.00 37.06  ? 303 VAL A N   1 
ATOM   2280 C CA  . VAL A 1 302 ? -2.728  -25.370 19.920  1.00 37.09  ? 303 VAL A CA  1 
ATOM   2281 C C   . VAL A 1 302 ? -2.972  -23.920 19.528  1.00 41.22  ? 303 VAL A C   1 
ATOM   2282 O O   . VAL A 1 302 ? -3.552  -23.647 18.480  1.00 42.11  ? 303 VAL A O   1 
ATOM   2283 C CB  . VAL A 1 302 ? -2.224  -26.132 18.681  1.00 38.16  ? 303 VAL A CB  1 
ATOM   2284 C CG1 . VAL A 1 302 ? -0.906  -25.546 18.204  1.00 36.25  ? 303 VAL A CG1 1 
ATOM   2285 C CG2 . VAL A 1 302 ? -2.088  -27.612 18.976  1.00 32.31  ? 303 VAL A CG2 1 
ATOM   2286 N N   . ASP A 1 303 ? -2.528  -22.992 20.364  1.00 42.38  ? 304 ASP A N   1 
ATOM   2287 C CA  . ASP A 1 303 ? -2.846  -21.583 20.157  1.00 46.53  ? 304 ASP A CA  1 
ATOM   2288 C C   . ASP A 1 303 ? -1.630  -20.667 20.111  1.00 47.02  ? 304 ASP A C   1 
ATOM   2289 O O   . ASP A 1 303 ? -1.770  -19.455 20.219  1.00 57.75  ? 304 ASP A O   1 
ATOM   2290 C CB  . ASP A 1 303 ? -3.790  -21.098 21.260  1.00 45.92  ? 304 ASP A CB  1 
ATOM   2291 C CG  . ASP A 1 303 ? -3.204  -21.272 22.657  1.00 60.10  ? 304 ASP A CG  1 
ATOM   2292 O OD1 . ASP A 1 303 ? -2.079  -21.810 22.791  1.00 50.03  ? 304 ASP A OD1 1 
ATOM   2293 O OD2 . ASP A 1 303 ? -3.885  -20.881 23.634  1.00 73.99  ? 304 ASP A OD2 1 
ATOM   2294 N N   . GLY A 1 304 ? -0.441  -21.241 19.970  1.00 43.96  ? 305 GLY A N   1 
ATOM   2295 C CA  . GLY A 1 304 ? 0.780   -20.455 19.975  1.00 40.30  ? 305 GLY A CA  1 
ATOM   2296 C C   . GLY A 1 304 ? 1.325   -20.114 21.355  1.00 52.35  ? 305 GLY A C   1 
ATOM   2297 O O   . GLY A 1 304 ? 2.501   -19.762 21.490  1.00 50.41  ? 305 GLY A O   1 
ATOM   2298 N N   . ASP A 1 305 ? 0.486   -20.209 22.385  1.00 43.77  ? 306 ASP A N   1 
ATOM   2299 C CA  . ASP A 1 305 ? 0.931   -19.877 23.738  1.00 48.69  ? 306 ASP A CA  1 
ATOM   2300 C C   . ASP A 1 305 ? 1.550   -21.090 24.448  1.00 43.84  ? 306 ASP A C   1 
ATOM   2301 O O   . ASP A 1 305 ? 2.764   -21.281 24.398  1.00 48.43  ? 306 ASP A O   1 
ATOM   2302 C CB  . ASP A 1 305 ? -0.223  -19.304 24.564  1.00 44.48  ? 306 ASP A CB  1 
ATOM   2303 C CG  . ASP A 1 305 ? 0.259   -18.571 25.807  1.00 58.85  ? 306 ASP A CG  1 
ATOM   2304 O OD1 . ASP A 1 305 ? 1.502   -18.460 25.982  1.00 50.72  ? 306 ASP A OD1 1 
ATOM   2305 O OD2 . ASP A 1 305 ? -0.600  -18.096 26.594  1.00 53.68  ? 306 ASP A OD2 1 
ATOM   2306 N N   . PHE A 1 306 ? 0.729   -21.905 25.102  1.00 39.24  ? 307 PHE A N   1 
ATOM   2307 C CA  . PHE A 1 306 ? 1.247   -23.081 25.794  1.00 36.32  ? 307 PHE A CA  1 
ATOM   2308 C C   . PHE A 1 306 ? 2.003   -23.975 24.819  1.00 41.82  ? 307 PHE A C   1 
ATOM   2309 O O   . PHE A 1 306 ? 3.105   -24.429 25.110  1.00 46.36  ? 307 PHE A O   1 
ATOM   2310 C CB  . PHE A 1 306 ? 0.118   -23.867 26.470  1.00 38.13  ? 307 PHE A CB  1 
ATOM   2311 C CG  . PHE A 1 306 ? 0.600   -24.850 27.494  1.00 31.04  ? 307 PHE A CG  1 
ATOM   2312 C CD1 . PHE A 1 306 ? 1.162   -26.062 27.104  1.00 32.82  ? 307 PHE A CD1 1 
ATOM   2313 C CD2 . PHE A 1 306 ? 0.498   -24.565 28.848  1.00 32.85  ? 307 PHE A CD2 1 
ATOM   2314 C CE1 . PHE A 1 306 ? 1.622   -26.981 28.045  1.00 26.97  ? 307 PHE A CE1 1 
ATOM   2315 C CE2 . PHE A 1 306 ? 0.949   -25.480 29.799  1.00 42.79  ? 307 PHE A CE2 1 
ATOM   2316 C CZ  . PHE A 1 306 ? 1.516   -26.690 29.394  1.00 33.15  ? 307 PHE A CZ  1 
ATOM   2317 N N   . LEU A 1 307 ? 1.390   -24.217 23.664  1.00 38.41  ? 308 LEU A N   1 
ATOM   2318 C CA  . LEU A 1 307 ? 2.017   -24.916 22.551  1.00 40.86  ? 308 LEU A CA  1 
ATOM   2319 C C   . LEU A 1 307 ? 2.206   -23.965 21.370  1.00 48.78  ? 308 LEU A C   1 
ATOM   2320 O O   . LEU A 1 307 ? 1.224   -23.541 20.760  1.00 53.11  ? 308 LEU A O   1 
ATOM   2321 C CB  . LEU A 1 307 ? 1.162   -26.111 22.123  1.00 46.77  ? 308 LEU A CB  1 
ATOM   2322 C CG  . LEU A 1 307 ? 0.953   -27.220 23.153  1.00 47.38  ? 308 LEU A CG  1 
ATOM   2323 C CD1 . LEU A 1 307 ? -0.020  -28.251 22.618  1.00 44.62  ? 308 LEU A CD1 1 
ATOM   2324 C CD2 . LEU A 1 307 ? 2.286   -27.872 23.514  1.00 37.47  ? 308 LEU A CD2 1 
ATOM   2325 N N   . SER A 1 308 ? 3.454   -23.636 21.042  1.00 45.12  ? 309 SER A N   1 
ATOM   2326 C CA  . SER A 1 308 ? 3.743   -22.673 19.967  1.00 44.50  ? 309 SER A CA  1 
ATOM   2327 C C   . SER A 1 308 ? 3.416   -23.227 18.567  1.00 48.82  ? 309 SER A C   1 
ATOM   2328 O O   . SER A 1 308 ? 3.085   -22.478 17.647  1.00 51.52  ? 309 SER A O   1 
ATOM   2329 C CB  . SER A 1 308 ? 5.210   -22.232 20.028  1.00 49.00  ? 309 SER A CB  1 
ATOM   2330 O OG  . SER A 1 308 ? 6.094   -23.308 19.769  1.00 55.72  ? 309 SER A OG  1 
ATOM   2331 N N   . ASP A 1 309 ? 3.509   -24.543 18.422  1.00 44.45  ? 310 ASP A N   1 
ATOM   2332 C CA  . ASP A 1 309 ? 3.116   -25.228 17.200  1.00 45.72  ? 310 ASP A CA  1 
ATOM   2333 C C   . ASP A 1 309 ? 2.449   -26.557 17.584  1.00 41.39  ? 310 ASP A C   1 
ATOM   2334 O O   . ASP A 1 309 ? 2.244   -26.821 18.762  1.00 43.82  ? 310 ASP A O   1 
ATOM   2335 C CB  . ASP A 1 309 ? 4.335   -25.448 16.302  1.00 47.92  ? 310 ASP A CB  1 
ATOM   2336 C CG  . ASP A 1 309 ? 3.964   -25.635 14.834  1.00 60.11  ? 310 ASP A CG  1 
ATOM   2337 O OD1 . ASP A 1 309 ? 2.965   -26.342 14.546  1.00 50.22  ? 310 ASP A OD1 1 
ATOM   2338 O OD2 . ASP A 1 309 ? 4.684   -25.081 13.968  1.00 59.85  ? 310 ASP A OD2 1 
ATOM   2339 N N   . THR A 1 310 ? 2.109   -27.392 16.609  1.00 36.91  ? 311 THR A N   1 
ATOM   2340 C CA  . THR A 1 310 ? 1.565   -28.706 16.928  1.00 39.33  ? 311 THR A CA  1 
ATOM   2341 C C   . THR A 1 310 ? 2.627   -29.567 17.607  1.00 41.71  ? 311 THR A C   1 
ATOM   2342 O O   . THR A 1 310 ? 3.820   -29.370 17.401  1.00 47.59  ? 311 THR A O   1 
ATOM   2343 C CB  . THR A 1 310 ? 1.040   -29.448 15.672  1.00 39.08  ? 311 THR A CB  1 
ATOM   2344 O OG1 . THR A 1 310 ? 2.144   -29.929 14.898  1.00 44.23  ? 311 THR A OG1 1 
ATOM   2345 C CG2 . THR A 1 310 ? 0.162   -28.541 14.831  1.00 35.61  ? 311 THR A CG2 1 
ATOM   2346 N N   . PRO A 1 311 ? 2.198   -30.523 18.436  1.00 46.28  ? 312 PRO A N   1 
ATOM   2347 C CA  . PRO A 1 311 ? 3.203   -31.399 19.046  1.00 44.17  ? 312 PRO A CA  1 
ATOM   2348 C C   . PRO A 1 311 ? 4.037   -32.151 17.995  1.00 43.70  ? 312 PRO A C   1 
ATOM   2349 O O   . PRO A 1 311 ? 5.228   -32.337 18.226  1.00 49.99  ? 312 PRO A O   1 
ATOM   2350 C CB  . PRO A 1 311 ? 2.360   -32.355 19.900  1.00 34.72  ? 312 PRO A CB  1 
ATOM   2351 C CG  . PRO A 1 311 ? 1.128   -31.557 20.215  1.00 37.36  ? 312 PRO A CG  1 
ATOM   2352 C CD  . PRO A 1 311 ? 0.851   -30.737 18.994  1.00 33.15  ? 312 PRO A CD  1 
ATOM   2353 N N   . GLU A 1 312 ? 3.427   -32.568 16.882  1.00 52.87  ? 313 GLU A N   1 
ATOM   2354 C CA  A GLU A 1 312 ? 4.166   -33.205 15.792  0.56 73.82  ? 313 GLU A CA  1 
ATOM   2355 C CA  B GLU A 1 312 ? 4.153   -33.193 15.781  0.44 70.99  ? 313 GLU A CA  1 
ATOM   2356 C C   . GLU A 1 312 ? 5.307   -32.305 15.337  1.00 52.73  ? 313 GLU A C   1 
ATOM   2357 O O   . GLU A 1 312 ? 6.465   -32.729 15.302  1.00 50.67  ? 313 GLU A O   1 
ATOM   2358 C CB  A GLU A 1 312 ? 3.244   -33.516 14.609  0.56 56.28  ? 313 GLU A CB  1 
ATOM   2359 C CB  B GLU A 1 312 ? 3.218   -33.449 14.600  0.44 60.69  ? 313 GLU A CB  1 
ATOM   2360 C CG  A GLU A 1 312 ? 3.962   -34.067 13.374  0.56 56.57  ? 313 GLU A CG  1 
ATOM   2361 C CG  B GLU A 1 312 ? 2.113   -34.457 14.868  0.44 57.68  ? 313 GLU A CG  1 
ATOM   2362 C CD  A GLU A 1 312 ? 3.221   -33.760 12.071  0.56 66.52  ? 313 GLU A CD  1 
ATOM   2363 C CD  B GLU A 1 312 ? 2.571   -35.878 14.633  0.44 54.72  ? 313 GLU A CD  1 
ATOM   2364 O OE1 A GLU A 1 312 ? 2.431   -34.625 11.621  0.56 58.27  ? 313 GLU A OE1 1 
ATOM   2365 O OE1 B GLU A 1 312 ? 3.730   -36.054 14.191  0.44 50.38  ? 313 GLU A OE1 1 
ATOM   2366 O OE2 A GLU A 1 312 ? 3.433   -32.656 11.500  0.56 55.93  ? 313 GLU A OE2 1 
ATOM   2367 O OE2 B GLU A 1 312 ? 1.773   -36.810 14.888  0.44 50.59  ? 313 GLU A OE2 1 
ATOM   2368 N N   . ALA A 1 313 ? 4.970   -31.064 15.003  1.00 48.01  ? 314 ALA A N   1 
ATOM   2369 C CA  . ALA A 1 313 ? 5.943   -30.074 14.574  1.00 41.26  ? 314 ALA A CA  1 
ATOM   2370 C C   . ALA A 1 313 ? 7.028   -29.830 15.624  1.00 49.68  ? 314 ALA A C   1 
ATOM   2371 O O   . ALA A 1 313 ? 8.213   -29.824 15.292  1.00 48.29  ? 314 ALA A O   1 
ATOM   2372 C CB  . ALA A 1 313 ? 5.242   -28.774 14.231  1.00 39.12  ? 314 ALA A CB  1 
ATOM   2373 N N   . LEU A 1 314 ? 6.626   -29.629 16.882  1.00 44.48  ? 315 LEU A N   1 
ATOM   2374 C CA  . LEU A 1 314 ? 7.576   -29.316 17.956  1.00 44.40  ? 315 LEU A CA  1 
ATOM   2375 C C   . LEU A 1 314 ? 8.535   -30.476 18.206  1.00 49.07  ? 315 LEU A C   1 
ATOM   2376 O O   . LEU A 1 314 ? 9.725   -30.278 18.481  1.00 45.06  ? 315 LEU A O   1 
ATOM   2377 C CB  . LEU A 1 314 ? 6.838   -28.951 19.249  1.00 39.44  ? 315 LEU A CB  1 
ATOM   2378 C CG  . LEU A 1 314 ? 6.188   -27.561 19.254  1.00 48.42  ? 315 LEU A CG  1 
ATOM   2379 C CD1 . LEU A 1 314 ? 5.290   -27.348 20.468  1.00 35.17  ? 315 LEU A CD1 1 
ATOM   2380 C CD2 . LEU A 1 314 ? 7.251   -26.473 19.173  1.00 42.42  ? 315 LEU A CD2 1 
ATOM   2381 N N   . ILE A 1 315 ? 8.015   -31.690 18.095  1.00 45.73  ? 316 ILE A N   1 
ATOM   2382 C CA  . ILE A 1 315 ? 8.844   -32.873 18.221  1.00 46.21  ? 316 ILE A CA  1 
ATOM   2383 C C   . ILE A 1 315 ? 9.914   -32.918 17.130  1.00 53.57  ? 316 ILE A C   1 
ATOM   2384 O O   . ILE A 1 315 ? 11.092  -33.091 17.430  1.00 56.07  ? 316 ILE A O   1 
ATOM   2385 C CB  . ILE A 1 315 ? 7.991   -34.139 18.179  1.00 46.59  ? 316 ILE A CB  1 
ATOM   2386 C CG1 . ILE A 1 315 ? 7.311   -34.338 19.528  1.00 39.92  ? 316 ILE A CG1 1 
ATOM   2387 C CG2 . ILE A 1 315 ? 8.833   -35.344 17.858  1.00 43.61  ? 316 ILE A CG2 1 
ATOM   2388 C CD1 . ILE A 1 315 ? 6.159   -35.288 19.465  1.00 49.33  ? 316 ILE A CD1 1 
ATOM   2389 N N   . ASN A 1 316 ? 9.515   -32.735 15.873  1.00 54.77  ? 317 ASN A N   1 
ATOM   2390 C CA  . ASN A 1 316 ? 10.465  -32.801 14.758  1.00 52.80  ? 317 ASN A CA  1 
ATOM   2391 C C   . ASN A 1 316 ? 11.562  -31.733 14.800  1.00 57.27  ? 317 ASN A C   1 
ATOM   2392 O O   . ASN A 1 316 ? 12.685  -31.970 14.350  1.00 65.78  ? 317 ASN A O   1 
ATOM   2393 C CB  . ASN A 1 316 ? 9.720   -32.706 13.433  1.00 44.53  ? 317 ASN A CB  1 
ATOM   2394 C CG  . ASN A 1 316 ? 8.828   -33.893 13.196  1.00 55.72  ? 317 ASN A CG  1 
ATOM   2395 O OD1 . ASN A 1 316 ? 8.960   -34.918 13.865  1.00 58.44  ? 317 ASN A OD1 1 
ATOM   2396 N ND2 . ASN A 1 316 ? 7.908   -33.768 12.245  1.00 56.70  ? 317 ASN A ND2 1 
ATOM   2397 N N   . ALA A 1 317 ? 11.234  -30.568 15.351  1.00 43.30  ? 318 ALA A N   1 
ATOM   2398 C CA  . ALA A 1 317 ? 12.158  -29.441 15.373  1.00 53.76  ? 318 ALA A CA  1 
ATOM   2399 C C   . ALA A 1 317 ? 12.992  -29.407 16.656  1.00 63.17  ? 318 ALA A C   1 
ATOM   2400 O O   . ALA A 1 317 ? 13.826  -28.516 16.851  1.00 61.99  ? 318 ALA A O   1 
ATOM   2401 C CB  . ALA A 1 317 ? 11.390  -28.135 15.214  1.00 44.12  ? 318 ALA A CB  1 
ATOM   2402 N N   . GLY A 1 318 ? 12.774  -30.378 17.529  1.00 41.81  ? 319 GLY A N   1 
ATOM   2403 C CA  . GLY A 1 318 ? 13.345  -30.302 18.854  1.00 50.87  ? 319 GLY A CA  1 
ATOM   2404 C C   . GLY A 1 318 ? 14.745  -30.855 19.020  1.00 51.79  ? 319 GLY A C   1 
ATOM   2405 O O   . GLY A 1 318 ? 15.163  -31.796 18.332  1.00 47.21  ? 319 GLY A O   1 
ATOM   2406 N N   . ASP A 1 319 ? 15.470  -30.260 19.957  1.00 38.85  ? 320 ASP A N   1 
ATOM   2407 C CA  . ASP A 1 319 ? 16.771  -30.773 20.353  1.00 48.71  ? 320 ASP A CA  1 
ATOM   2408 C C   . ASP A 1 319 ? 16.616  -31.431 21.718  1.00 50.80  ? 320 ASP A C   1 
ATOM   2409 O O   . ASP A 1 319 ? 16.403  -30.756 22.727  1.00 55.17  ? 320 ASP A O   1 
ATOM   2410 C CB  . ASP A 1 319 ? 17.806  -29.645 20.383  1.00 54.95  ? 320 ASP A CB  1 
ATOM   2411 C CG  . ASP A 1 319 ? 19.194  -30.120 20.773  1.00 50.67  ? 320 ASP A CG  1 
ATOM   2412 O OD1 . ASP A 1 319 ? 20.088  -29.256 20.891  1.00 50.49  ? 320 ASP A OD1 1 
ATOM   2413 O OD2 . ASP A 1 319 ? 19.397  -31.340 20.957  1.00 48.76  ? 320 ASP A OD2 1 
ATOM   2414 N N   . PHE A 1 320 ? 16.708  -32.752 21.753  1.00 43.43  ? 321 PHE A N   1 
ATOM   2415 C CA  . PHE A 1 320 ? 16.373  -33.463 22.980  1.00 48.30  ? 321 PHE A CA  1 
ATOM   2416 C C   . PHE A 1 320 ? 17.561  -34.134 23.631  1.00 45.15  ? 321 PHE A C   1 
ATOM   2417 O O   . PHE A 1 320 ? 17.394  -35.075 24.395  1.00 47.38  ? 321 PHE A O   1 
ATOM   2418 C CB  . PHE A 1 320 ? 15.266  -34.486 22.709  1.00 44.68  ? 321 PHE A CB  1 
ATOM   2419 C CG  . PHE A 1 320 ? 13.978  -33.849 22.324  1.00 45.36  ? 321 PHE A CG  1 
ATOM   2420 C CD1 . PHE A 1 320 ? 13.211  -33.202 23.277  1.00 33.67  ? 321 PHE A CD1 1 
ATOM   2421 C CD2 . PHE A 1 320 ? 13.561  -33.841 21.003  1.00 42.93  ? 321 PHE A CD2 1 
ATOM   2422 C CE1 . PHE A 1 320 ? 12.045  -32.581 22.927  1.00 40.34  ? 321 PHE A CE1 1 
ATOM   2423 C CE2 . PHE A 1 320 ? 12.386  -33.226 20.643  1.00 36.45  ? 321 PHE A CE2 1 
ATOM   2424 C CZ  . PHE A 1 320 ? 11.624  -32.592 21.604  1.00 44.03  ? 321 PHE A CZ  1 
ATOM   2425 N N   . HIS A 1 321 ? 18.758  -33.642 23.341  1.00 49.23  ? 322 HIS A N   1 
ATOM   2426 C CA  . HIS A 1 321 ? 19.918  -34.038 24.121  1.00 50.30  ? 322 HIS A CA  1 
ATOM   2427 C C   . HIS A 1 321 ? 19.681  -33.611 25.572  1.00 47.65  ? 322 HIS A C   1 
ATOM   2428 O O   . HIS A 1 321 ? 19.062  -32.575 25.823  1.00 44.12  ? 322 HIS A O   1 
ATOM   2429 C CB  . HIS A 1 321 ? 21.203  -33.427 23.549  1.00 37.52  ? 322 HIS A CB  1 
ATOM   2430 C CG  . HIS A 1 321 ? 21.632  -34.047 22.257  1.00 37.39  ? 322 HIS A CG  1 
ATOM   2431 N ND1 . HIS A 1 321 ? 21.277  -33.531 21.030  1.00 46.90  ? 322 HIS A ND1 1 
ATOM   2432 C CD2 . HIS A 1 321 ? 22.357  -35.163 21.999  1.00 46.20  ? 322 HIS A CD2 1 
ATOM   2433 C CE1 . HIS A 1 321 ? 21.770  -34.296 20.070  1.00 45.68  ? 322 HIS A CE1 1 
ATOM   2434 N NE2 . HIS A 1 321 ? 22.429  -35.294 20.632  1.00 45.12  ? 322 HIS A NE2 1 
ATOM   2435 N N   . GLY A 1 322 ? 20.124  -34.427 26.523  1.00 38.98  ? 323 GLY A N   1 
ATOM   2436 C CA  . GLY A 1 322 ? 19.949  -34.086 27.923  1.00 49.52  ? 323 GLY A CA  1 
ATOM   2437 C C   . GLY A 1 322 ? 18.626  -34.543 28.514  1.00 50.49  ? 323 GLY A C   1 
ATOM   2438 O O   . GLY A 1 322 ? 18.279  -34.190 29.641  1.00 55.79  ? 323 GLY A O   1 
ATOM   2439 N N   . LEU A 1 323 ? 17.887  -35.334 27.746  1.00 48.54  ? 324 LEU A N   1 
ATOM   2440 C CA  . LEU A 1 323 ? 16.597  -35.848 28.168  1.00 34.66  ? 324 LEU A CA  1 
ATOM   2441 C C   . LEU A 1 323 ? 16.568  -37.371 28.165  1.00 41.36  ? 324 LEU A C   1 
ATOM   2442 O O   . LEU A 1 323 ? 16.937  -38.007 27.165  1.00 37.12  ? 324 LEU A O   1 
ATOM   2443 C CB  . LEU A 1 323 ? 15.500  -35.316 27.252  1.00 43.41  ? 324 LEU A CB  1 
ATOM   2444 C CG  . LEU A 1 323 ? 14.112  -35.918 27.465  1.00 38.47  ? 324 LEU A CG  1 
ATOM   2445 C CD1 . LEU A 1 323 ? 13.586  -35.517 28.830  1.00 42.51  ? 324 LEU A CD1 1 
ATOM   2446 C CD2 . LEU A 1 323 ? 13.169  -35.473 26.372  1.00 35.75  ? 324 LEU A CD2 1 
ATOM   2447 N N   . GLN A 1 324 ? 16.142  -37.956 29.282  1.00 35.34  ? 325 GLN A N   1 
ATOM   2448 C CA  . GLN A 1 324 ? 15.869  -39.396 29.331  1.00 39.93  ? 325 GLN A CA  1 
ATOM   2449 C C   . GLN A 1 324 ? 14.368  -39.648 29.438  1.00 34.28  ? 325 GLN A C   1 
ATOM   2450 O O   . GLN A 1 324 ? 13.684  -39.038 30.256  1.00 40.04  ? 325 GLN A O   1 
ATOM   2451 C CB  . GLN A 1 324 ? 16.584  -40.068 30.507  1.00 44.38  ? 325 GLN A CB  1 
ATOM   2452 C CG  . GLN A 1 324 ? 18.097  -39.976 30.483  1.00 48.09  ? 325 GLN A CG  1 
ATOM   2453 C CD  . GLN A 1 324 ? 18.613  -38.717 31.142  1.00 50.12  ? 325 GLN A CD  1 
ATOM   2454 O OE1 . GLN A 1 324 ? 18.200  -38.364 32.247  1.00 50.99  ? 325 GLN A OE1 1 
ATOM   2455 N NE2 . GLN A 1 324 ? 19.516  -38.026 30.459  1.00 58.22  ? 325 GLN A NE2 1 
ATOM   2456 N N   . VAL A 1 325 ? 13.850  -40.540 28.605  1.00 40.01  ? 326 VAL A N   1 
ATOM   2457 C CA  . VAL A 1 325 ? 12.420  -40.801 28.590  1.00 37.77  ? 326 VAL A CA  1 
ATOM   2458 C C   . VAL A 1 325 ? 12.158  -42.286 28.724  1.00 36.34  ? 326 VAL A C   1 
ATOM   2459 O O   . VAL A 1 325 ? 12.841  -43.109 28.115  1.00 38.93  ? 326 VAL A O   1 
ATOM   2460 C CB  . VAL A 1 325 ? 11.744  -40.289 27.297  1.00 35.29  ? 326 VAL A CB  1 
ATOM   2461 C CG1 . VAL A 1 325 ? 10.319  -39.921 27.579  1.00 36.11  ? 326 VAL A CG1 1 
ATOM   2462 C CG2 . VAL A 1 325 ? 12.446  -39.082 26.786  1.00 45.34  ? 326 VAL A CG2 1 
ATOM   2463 N N   . LEU A 1 326 ? 11.166  -42.623 29.534  1.00 34.05  ? 327 LEU A N   1 
ATOM   2464 C CA  . LEU A 1 326 ? 10.675  -43.988 29.619  1.00 37.21  ? 327 LEU A CA  1 
ATOM   2465 C C   . LEU A 1 326 ? 9.276   -44.029 28.988  1.00 33.88  ? 327 LEU A C   1 
ATOM   2466 O O   . LEU A 1 326 ? 8.377   -43.307 29.422  1.00 35.02  ? 327 LEU A O   1 
ATOM   2467 C CB  . LEU A 1 326 ? 10.660  -44.451 31.080  1.00 33.51  ? 327 LEU A CB  1 
ATOM   2468 C CG  . LEU A 1 326 ? 10.216  -45.885 31.364  1.00 35.92  ? 327 LEU A CG  1 
ATOM   2469 C CD1 . LEU A 1 326 ? 11.101  -46.835 30.639  1.00 35.16  ? 327 LEU A CD1 1 
ATOM   2470 C CD2 . LEU A 1 326 ? 10.278  -46.169 32.852  1.00 41.09  ? 327 LEU A CD2 1 
ATOM   2471 N N   . VAL A 1 327 ? 9.092   -44.831 27.943  1.00 27.98  ? 328 VAL A N   1 
ATOM   2472 C CA  . VAL A 1 327 ? 7.787   -44.889 27.265  1.00 28.42  ? 328 VAL A CA  1 
ATOM   2473 C C   . VAL A 1 327 ? 7.335   -46.325 27.063  1.00 31.58  ? 328 VAL A C   1 
ATOM   2474 O O   . VAL A 1 327 ? 8.157   -47.236 26.985  1.00 32.96  ? 328 VAL A O   1 
ATOM   2475 C CB  . VAL A 1 327 ? 7.797   -44.183 25.879  1.00 31.30  ? 328 VAL A CB  1 
ATOM   2476 C CG1 . VAL A 1 327 ? 8.308   -42.750 25.984  1.00 26.26  ? 328 VAL A CG1 1 
ATOM   2477 C CG2 . VAL A 1 327 ? 8.620   -44.966 24.888  1.00 26.14  ? 328 VAL A CG2 1 
ATOM   2478 N N   . GLY A 1 328 ? 6.027   -46.540 26.973  1.00 30.80  ? 329 GLY A N   1 
ATOM   2479 C CA  . GLY A 1 328 ? 5.533   -47.886 26.726  1.00 28.28  ? 329 GLY A CA  1 
ATOM   2480 C C   . GLY A 1 328 ? 4.042   -48.031 26.523  1.00 29.27  ? 329 GLY A C   1 
ATOM   2481 O O   . GLY A 1 328 ? 3.266   -47.084 26.677  1.00 31.92  ? 329 GLY A O   1 
ATOM   2482 N N   . VAL A 1 329 ? 3.637   -49.240 26.169  1.00 24.38  ? 330 VAL A N   1 
ATOM   2483 C CA  . VAL A 1 329 ? 2.245   -49.516 25.863  1.00 26.13  ? 330 VAL A CA  1 
ATOM   2484 C C   . VAL A 1 329 ? 1.847   -50.838 26.488  1.00 28.26  ? 330 VAL A C   1 
ATOM   2485 O O   . VAL A 1 329 ? 2.707   -51.629 26.866  1.00 33.64  ? 330 VAL A O   1 
ATOM   2486 C CB  . VAL A 1 329 ? 2.000   -49.575 24.332  1.00 32.97  ? 330 VAL A CB  1 
ATOM   2487 C CG1 . VAL A 1 329 ? 2.140   -48.195 23.694  1.00 29.33  ? 330 VAL A CG1 1 
ATOM   2488 C CG2 . VAL A 1 329 ? 2.948   -50.564 23.682  1.00 27.00  ? 330 VAL A CG2 1 
ATOM   2489 N N   . VAL A 1 330 ? 0.550   -51.094 26.593  1.00 31.21  ? 331 VAL A N   1 
ATOM   2490 C CA  . VAL A 1 330 ? 0.103   -52.428 26.980  1.00 37.16  ? 331 VAL A CA  1 
ATOM   2491 C C   . VAL A 1 330 ? -0.089  -53.274 25.716  1.00 39.56  ? 331 VAL A C   1 
ATOM   2492 O O   . VAL A 1 330 ? -0.124  -52.739 24.606  1.00 39.01  ? 331 VAL A O   1 
ATOM   2493 C CB  . VAL A 1 330 ? -1.207  -52.398 27.821  1.00 32.90  ? 331 VAL A CB  1 
ATOM   2494 C CG1 . VAL A 1 330 ? -0.988  -51.664 29.111  1.00 34.68  ? 331 VAL A CG1 1 
ATOM   2495 C CG2 . VAL A 1 330 ? -2.360  -51.777 27.046  1.00 32.25  ? 331 VAL A CG2 1 
ATOM   2496 N N   . LYS A 1 331 ? -0.208  -54.587 25.897  1.00 41.42  ? 332 LYS A N   1 
ATOM   2497 C CA  . LYS A 1 331 ? -0.274  -55.544 24.793  1.00 36.76  ? 332 LYS A CA  1 
ATOM   2498 C C   . LYS A 1 331 ? -1.493  -55.329 23.903  1.00 41.61  ? 332 LYS A C   1 
ATOM   2499 O O   . LYS A 1 331 ? -1.429  -55.532 22.694  1.00 49.86  ? 332 LYS A O   1 
ATOM   2500 C CB  . LYS A 1 331 ? -0.278  -56.970 25.348  1.00 42.71  ? 332 LYS A CB  1 
ATOM   2501 C CG  . LYS A 1 331 ? -0.056  -58.069 24.335  1.00 49.50  ? 332 LYS A CG  1 
ATOM   2502 C CD  . LYS A 1 331 ? -0.155  -59.435 25.009  1.00 65.44  ? 332 LYS A CD  1 
ATOM   2503 C CE  . LYS A 1 331 ? 0.640   -60.503 24.261  1.00 71.07  ? 332 LYS A CE  1 
ATOM   2504 N NZ  . LYS A 1 331 ? 0.010   -60.888 22.973  1.00 73.04  ? 332 LYS A NZ  1 
ATOM   2505 N N   . ASP A 1 332 ? -2.595  -54.896 24.504  1.00 38.31  ? 333 ASP A N   1 
ATOM   2506 C CA  . ASP A 1 332 ? -3.857  -54.759 23.785  1.00 43.77  ? 333 ASP A CA  1 
ATOM   2507 C C   . ASP A 1 332 ? -4.519  -53.387 23.992  1.00 42.93  ? 333 ASP A C   1 
ATOM   2508 O O   . ASP A 1 332 ? -5.582  -53.285 24.607  1.00 47.54  ? 333 ASP A O   1 
ATOM   2509 C CB  . ASP A 1 332 ? -4.809  -55.882 24.214  1.00 45.03  ? 333 ASP A CB  1 
ATOM   2510 C CG  . ASP A 1 332 ? -4.243  -57.275 23.921  1.00 62.24  ? 333 ASP A CG  1 
ATOM   2511 O OD1 . ASP A 1 332 ? -4.239  -57.674 22.724  1.00 51.18  ? 333 ASP A OD1 1 
ATOM   2512 O OD2 . ASP A 1 332 ? -3.809  -57.969 24.882  1.00 55.92  ? 333 ASP A OD2 1 
ATOM   2513 N N   . GLU A 1 333 ? -3.898  -52.339 23.457  1.00 42.47  ? 334 GLU A N   1 
ATOM   2514 C CA  . GLU A 1 333 ? -4.321  -50.970 23.744  1.00 35.09  ? 334 GLU A CA  1 
ATOM   2515 C C   . GLU A 1 333 ? -5.745  -50.639 23.314  1.00 42.11  ? 334 GLU A C   1 
ATOM   2516 O O   . GLU A 1 333 ? -6.390  -49.786 23.916  1.00 49.39  ? 334 GLU A O   1 
ATOM   2517 C CB  . GLU A 1 333 ? -3.362  -49.977 23.092  1.00 31.24  ? 334 GLU A CB  1 
ATOM   2518 C CG  . GLU A 1 333 ? -2.013  -49.905 23.775  1.00 43.19  ? 334 GLU A CG  1 
ATOM   2519 C CD  . GLU A 1 333 ? -2.052  -49.151 25.111  1.00 54.98  ? 334 GLU A CD  1 
ATOM   2520 O OE1 . GLU A 1 333 ? -3.133  -48.627 25.491  1.00 47.01  ? 334 GLU A OE1 1 
ATOM   2521 O OE2 . GLU A 1 333 ? -0.992  -49.092 25.785  1.00 44.28  ? 334 GLU A OE2 1 
ATOM   2522 N N   . GLY A 1 334 ? -6.240  -51.320 22.291  1.00 34.73  ? 335 GLY A N   1 
ATOM   2523 C CA  . GLY A 1 334 ? -7.514  -50.959 21.705  1.00 36.07  ? 335 GLY A CA  1 
ATOM   2524 C C   . GLY A 1 334 ? -8.739  -51.652 22.268  1.00 39.97  ? 335 GLY A C   1 
ATOM   2525 O O   . GLY A 1 334 ? -9.836  -51.097 22.221  1.00 42.40  ? 335 GLY A O   1 
ATOM   2526 N N   . SER A 1 335 ? -8.556  -52.853 22.808  1.00 37.99  ? 336 SER A N   1 
ATOM   2527 C CA  . SER A 1 335 ? -9.677  -53.688 23.229  1.00 40.17  ? 336 SER A CA  1 
ATOM   2528 C C   . SER A 1 335 ? -10.642 -52.999 24.197  1.00 47.56  ? 336 SER A C   1 
ATOM   2529 O O   . SER A 1 335 ? -11.852 -53.062 24.000  1.00 50.89  ? 336 SER A O   1 
ATOM   2530 C CB  . SER A 1 335 ? -9.157  -54.975 23.860  1.00 44.58  ? 336 SER A CB  1 
ATOM   2531 O OG  . SER A 1 335 ? -8.592  -54.722 25.130  1.00 50.94  ? 336 SER A OG  1 
ATOM   2532 N N   . TYR A 1 336 ? -10.102 -52.347 25.227  1.00 51.73  ? 337 TYR A N   1 
ATOM   2533 C CA  . TYR A 1 336 ? -10.901 -51.637 26.236  1.00 53.06  ? 337 TYR A CA  1 
ATOM   2534 C C   . TYR A 1 336 ? -11.855 -50.615 25.621  1.00 50.04  ? 337 TYR A C   1 
ATOM   2535 O O   . TYR A 1 336 ? -13.007 -50.501 26.028  1.00 52.10  ? 337 TYR A O   1 
ATOM   2536 C CB  . TYR A 1 336 ? -9.965  -50.946 27.254  1.00 65.40  ? 337 TYR A CB  1 
ATOM   2537 C CG  . TYR A 1 336 ? -10.593 -49.858 28.123  1.00 57.56  ? 337 TYR A CG  1 
ATOM   2538 C CD1 . TYR A 1 336 ? -11.298 -50.180 29.284  1.00 60.93  ? 337 TYR A CD1 1 
ATOM   2539 C CD2 . TYR A 1 336 ? -10.451 -48.506 27.797  1.00 60.53  ? 337 TYR A CD2 1 
ATOM   2540 C CE1 . TYR A 1 336 ? -11.867 -49.187 30.091  1.00 66.28  ? 337 TYR A CE1 1 
ATOM   2541 C CE2 . TYR A 1 336 ? -11.020 -47.503 28.592  1.00 69.74  ? 337 TYR A CE2 1 
ATOM   2542 C CZ  . TYR A 1 336 ? -11.725 -47.849 29.742  1.00 84.83  ? 337 TYR A CZ  1 
ATOM   2543 O OH  . TYR A 1 336 ? -12.283 -46.858 30.539  1.00 73.01  ? 337 TYR A OH  1 
ATOM   2544 N N   . PHE A 1 337 ? -11.375 -49.882 24.627  1.00 55.69  ? 338 PHE A N   1 
ATOM   2545 C CA  . PHE A 1 337 ? -12.144 -48.781 24.062  1.00 55.63  ? 338 PHE A CA  1 
ATOM   2546 C C   . PHE A 1 337 ? -13.299 -49.225 23.184  1.00 53.00  ? 338 PHE A C   1 
ATOM   2547 O O   . PHE A 1 337 ? -14.194 -48.432 22.891  1.00 55.64  ? 338 PHE A O   1 
ATOM   2548 C CB  . PHE A 1 337 ? -11.234 -47.877 23.244  1.00 57.33  ? 338 PHE A CB  1 
ATOM   2549 C CG  . PHE A 1 337 ? -10.143 -47.242 24.037  1.00 56.16  ? 338 PHE A CG  1 
ATOM   2550 C CD1 . PHE A 1 337 ? -8.842  -47.703 23.934  1.00 61.66  ? 338 PHE A CD1 1 
ATOM   2551 C CD2 . PHE A 1 337 ? -10.412 -46.176 24.878  1.00 60.20  ? 338 PHE A CD2 1 
ATOM   2552 C CE1 . PHE A 1 337 ? -7.819  -47.107 24.652  1.00 61.62  ? 338 PHE A CE1 1 
ATOM   2553 C CE2 . PHE A 1 337 ? -9.402  -45.578 25.605  1.00 68.63  ? 338 PHE A CE2 1 
ATOM   2554 C CZ  . PHE A 1 337 ? -8.099  -46.045 25.493  1.00 68.03  ? 338 PHE A CZ  1 
ATOM   2555 N N   . LEU A 1 338 ? -13.273 -50.483 22.757  1.00 48.01  ? 339 LEU A N   1 
ATOM   2556 C CA  . LEU A 1 338 ? -14.241 -50.977 21.792  1.00 45.16  ? 339 LEU A CA  1 
ATOM   2557 C C   . LEU A 1 338 ? -15.667 -51.033 22.340  1.00 58.25  ? 339 LEU A C   1 
ATOM   2558 O O   . LEU A 1 338 ? -16.620 -50.893 21.574  1.00 60.46  ? 339 LEU A O   1 
ATOM   2559 C CB  . LEU A 1 338 ? -13.819 -52.356 21.291  1.00 49.94  ? 339 LEU A CB  1 
ATOM   2560 C CG  . LEU A 1 338 ? -12.572 -52.337 20.406  1.00 49.42  ? 339 LEU A CG  1 
ATOM   2561 C CD1 . LEU A 1 338 ? -12.122 -53.745 20.049  1.00 42.59  ? 339 LEU A CD1 1 
ATOM   2562 C CD2 . LEU A 1 338 ? -12.823 -51.506 19.158  1.00 42.79  ? 339 LEU A CD2 1 
ATOM   2563 N N   . VAL A 1 339 ? -15.824 -51.215 23.653  1.00 50.00  ? 340 VAL A N   1 
ATOM   2564 C CA  . VAL A 1 339 ? -17.164 -51.267 24.244  1.00 50.55  ? 340 VAL A CA  1 
ATOM   2565 C C   . VAL A 1 339 ? -17.761 -49.876 24.494  1.00 56.89  ? 340 VAL A C   1 
ATOM   2566 O O   . VAL A 1 339 ? -18.848 -49.744 25.054  1.00 63.45  ? 340 VAL A O   1 
ATOM   2567 C CB  . VAL A 1 339 ? -17.169 -52.052 25.563  1.00 54.41  ? 340 VAL A CB  1 
ATOM   2568 C CG1 . VAL A 1 339 ? -16.580 -53.435 25.348  1.00 54.21  ? 340 VAL A CG1 1 
ATOM   2569 C CG2 . VAL A 1 339 ? -16.414 -51.300 26.643  1.00 56.68  ? 340 VAL A CG2 1 
ATOM   2570 N N   . TYR A 1 340 ? -17.057 -48.843 24.052  1.00 59.53  ? 341 TYR A N   1 
ATOM   2571 C CA  . TYR A 1 340 ? -17.521 -47.473 24.212  1.00 61.46  ? 341 TYR A CA  1 
ATOM   2572 C C   . TYR A 1 340 ? -17.872 -46.834 22.869  1.00 64.42  ? 341 TYR A C   1 
ATOM   2573 O O   . TYR A 1 340 ? -17.540 -45.668 22.629  1.00 65.96  ? 341 TYR A O   1 
ATOM   2574 C CB  . TYR A 1 340 ? -16.457 -46.627 24.935  1.00 62.35  ? 341 TYR A CB  1 
ATOM   2575 C CG  . TYR A 1 340 ? -16.367 -46.894 26.423  1.00 58.77  ? 341 TYR A CG  1 
ATOM   2576 C CD1 . TYR A 1 340 ? -17.057 -46.100 27.337  1.00 63.95  ? 341 TYR A CD1 1 
ATOM   2577 C CD2 . TYR A 1 340 ? -15.605 -47.947 26.915  1.00 58.96  ? 341 TYR A CD2 1 
ATOM   2578 C CE1 . TYR A 1 340 ? -16.987 -46.347 28.700  1.00 59.43  ? 341 TYR A CE1 1 
ATOM   2579 C CE2 . TYR A 1 340 ? -15.530 -48.205 28.279  1.00 57.31  ? 341 TYR A CE2 1 
ATOM   2580 C CZ  . TYR A 1 340 ? -16.223 -47.403 29.164  1.00 64.45  ? 341 TYR A CZ  1 
ATOM   2581 O OH  . TYR A 1 340 ? -16.144 -47.656 30.515  1.00 62.40  ? 341 TYR A OH  1 
ATOM   2582 N N   . GLY A 1 341 ? -18.532 -47.592 21.992  1.00 64.24  ? 342 GLY A N   1 
ATOM   2583 C CA  . GLY A 1 341 ? -19.046 -47.022 20.754  1.00 69.99  ? 342 GLY A CA  1 
ATOM   2584 C C   . GLY A 1 341 ? -19.019 -47.900 19.511  1.00 70.40  ? 342 GLY A C   1 
ATOM   2585 O O   . GLY A 1 341 ? -19.787 -47.681 18.565  1.00 60.84  ? 342 GLY A O   1 
ATOM   2586 N N   . ALA A 1 342 ? -18.129 -48.887 19.499  1.00 69.40  ? 343 ALA A N   1 
ATOM   2587 C CA  . ALA A 1 342 ? -18.017 -49.785 18.356  1.00 62.30  ? 343 ALA A CA  1 
ATOM   2588 C C   . ALA A 1 342 ? -19.150 -50.815 18.367  1.00 73.97  ? 343 ALA A C   1 
ATOM   2589 O O   . ALA A 1 342 ? -19.333 -51.540 19.353  1.00 70.48  ? 343 ALA A O   1 
ATOM   2590 C CB  . ALA A 1 342 ? -16.657 -50.475 18.354  1.00 54.95  ? 343 ALA A CB  1 
ATOM   2591 N N   . PRO A 1 343 ? -19.922 -50.875 17.268  1.00 78.30  ? 344 PRO A N   1 
ATOM   2592 C CA  . PRO A 1 343 ? -21.072 -51.784 17.168  1.00 63.27  ? 344 PRO A CA  1 
ATOM   2593 C C   . PRO A 1 343 ? -20.682 -53.257 17.281  1.00 64.82  ? 344 PRO A C   1 
ATOM   2594 O O   . PRO A 1 343 ? -19.660 -53.674 16.723  1.00 59.15  ? 344 PRO A O   1 
ATOM   2595 C CB  . PRO A 1 343 ? -21.649 -51.477 15.779  1.00 59.96  ? 344 PRO A CB  1 
ATOM   2596 C CG  . PRO A 1 343 ? -20.546 -50.796 15.030  1.00 63.57  ? 344 PRO A CG  1 
ATOM   2597 C CD  . PRO A 1 343 ? -19.758 -50.049 16.057  1.00 68.09  ? 344 PRO A CD  1 
ATOM   2598 N N   . GLY A 1 344 ? -21.495 -54.021 18.009  1.00 67.15  ? 345 GLY A N   1 
ATOM   2599 C CA  . GLY A 1 344 ? -21.307 -55.454 18.155  1.00 61.42  ? 345 GLY A CA  1 
ATOM   2600 C C   . GLY A 1 344 ? -20.533 -55.844 19.401  1.00 70.05  ? 345 GLY A C   1 
ATOM   2601 O O   . GLY A 1 344 ? -20.357 -57.031 19.690  1.00 72.07  ? 345 GLY A O   1 
ATOM   2602 N N   . PHE A 1 345 ? -20.073 -54.848 20.153  1.00 70.58  ? 346 PHE A N   1 
ATOM   2603 C CA  . PHE A 1 345 ? -19.171 -55.112 21.271  1.00 67.43  ? 346 PHE A CA  1 
ATOM   2604 C C   . PHE A 1 345 ? -19.827 -55.039 22.647  1.00 65.33  ? 346 PHE A C   1 
ATOM   2605 O O   . PHE A 1 345 ? -20.645 -54.156 22.928  1.00 72.72  ? 346 PHE A O   1 
ATOM   2606 C CB  . PHE A 1 345 ? -17.989 -54.145 21.220  1.00 61.91  ? 346 PHE A CB  1 
ATOM   2607 C CG  . PHE A 1 345 ? -16.944 -54.534 20.225  1.00 60.08  ? 346 PHE A CG  1 
ATOM   2608 C CD1 . PHE A 1 345 ? -15.903 -55.374 20.590  1.00 57.57  ? 346 PHE A CD1 1 
ATOM   2609 C CD2 . PHE A 1 345 ? -17.005 -54.073 18.918  1.00 60.34  ? 346 PHE A CD2 1 
ATOM   2610 C CE1 . PHE A 1 345 ? -14.936 -55.750 19.670  1.00 61.44  ? 346 PHE A CE1 1 
ATOM   2611 C CE2 . PHE A 1 345 ? -16.042 -54.439 17.992  1.00 58.50  ? 346 PHE A CE2 1 
ATOM   2612 C CZ  . PHE A 1 345 ? -15.004 -55.281 18.368  1.00 54.79  ? 346 PHE A CZ  1 
ATOM   2613 N N   . SER A 1 346 ? -19.441 -55.983 23.500  1.00 58.73  ? 347 SER A N   1 
ATOM   2614 C CA  . SER A 1 346 ? -19.875 -56.024 24.889  1.00 68.59  ? 347 SER A CA  1 
ATOM   2615 C C   . SER A 1 346 ? -18.890 -56.840 25.724  1.00 69.88  ? 347 SER A C   1 
ATOM   2616 O O   . SER A 1 346 ? -18.283 -57.798 25.232  1.00 61.93  ? 347 SER A O   1 
ATOM   2617 C CB  . SER A 1 346 ? -21.283 -56.614 25.004  1.00 65.95  ? 347 SER A CB  1 
ATOM   2618 O OG  . SER A 1 346 ? -21.609 -56.920 26.351  1.00 65.30  ? 347 SER A OG  1 
ATOM   2619 N N   . LYS A 1 347 ? -18.738 -56.454 26.988  1.00 60.94  ? 348 LYS A N   1 
ATOM   2620 C CA  . LYS A 1 347 ? -17.880 -57.178 27.919  1.00 62.83  ? 348 LYS A CA  1 
ATOM   2621 C C   . LYS A 1 347 ? -18.491 -58.527 28.309  1.00 67.13  ? 348 LYS A C   1 
ATOM   2622 O O   . LYS A 1 347 ? -17.843 -59.350 28.967  1.00 54.35  ? 348 LYS A O   1 
ATOM   2623 C CB  . LYS A 1 347 ? -17.636 -56.340 29.181  1.00 59.67  ? 348 LYS A CB  1 
ATOM   2624 C CG  . LYS A 1 347 ? -18.787 -56.390 30.179  1.00 57.52  ? 348 LYS A CG  1 
ATOM   2625 C CD  . LYS A 1 347 ? -18.471 -55.659 31.468  1.00 55.14  ? 348 LYS A CD  1 
ATOM   2626 C CE  . LYS A 1 347 ? -19.426 -56.072 32.583  1.00 51.54  ? 348 LYS A CE  1 
ATOM   2627 N NZ  . LYS A 1 347 ? -19.187 -57.477 33.023  1.00 54.24  ? 348 LYS A NZ  1 
ATOM   2628 N N   . ASP A 1 348 ? -19.743 -58.747 27.912  1.00 66.14  ? 349 ASP A N   1 
ATOM   2629 C CA  . ASP A 1 348 ? -20.499 -59.892 28.408  1.00 68.79  ? 349 ASP A CA  1 
ATOM   2630 C C   . ASP A 1 348 ? -20.635 -61.020 27.386  1.00 73.35  ? 349 ASP A C   1 
ATOM   2631 O O   . ASP A 1 348 ? -21.133 -62.096 27.724  1.00 73.27  ? 349 ASP A O   1 
ATOM   2632 C CB  . ASP A 1 348 ? -21.882 -59.438 28.887  1.00 64.69  ? 349 ASP A CB  1 
ATOM   2633 C CG  . ASP A 1 348 ? -21.828 -58.723 30.236  1.00 64.08  ? 349 ASP A CG  1 
ATOM   2634 O OD1 . ASP A 1 348 ? -21.123 -59.211 31.151  1.00 54.37  ? 349 ASP A OD1 1 
ATOM   2635 O OD2 . ASP A 1 348 ? -22.487 -57.669 30.375  1.00 70.33  ? 349 ASP A OD2 1 
ATOM   2636 N N   . ASN A 1 349 ? -20.199 -60.773 26.148  1.00 67.96  ? 350 ASN A N   1 
ATOM   2637 C CA  . ASN A 1 349 ? -20.034 -61.849 25.170  1.00 67.84  ? 350 ASN A CA  1 
ATOM   2638 C C   . ASN A 1 349 ? -18.678 -61.751 24.454  1.00 73.69  ? 350 ASN A C   1 
ATOM   2639 O O   . ASN A 1 349 ? -17.862 -60.890 24.787  1.00 68.17  ? 350 ASN A O   1 
ATOM   2640 C CB  . ASN A 1 349 ? -21.200 -61.870 24.164  1.00 64.86  ? 350 ASN A CB  1 
ATOM   2641 C CG  . ASN A 1 349 ? -21.285 -60.617 23.294  1.00 68.63  ? 350 ASN A CG  1 
ATOM   2642 O OD1 . ASN A 1 349 ? -20.280 -59.989 22.961  1.00 70.58  ? 350 ASN A OD1 1 
ATOM   2643 N ND2 . ASN A 1 349 ? -22.508 -60.261 22.913  1.00 71.16  ? 350 ASN A ND2 1 
ATOM   2644 N N   . GLU A 1 350 ? -18.445 -62.630 23.479  1.00 68.72  ? 351 GLU A N   1 
ATOM   2645 C CA  . GLU A 1 350 ? -17.147 -62.729 22.808  1.00 61.95  ? 351 GLU A CA  1 
ATOM   2646 C C   . GLU A 1 350 ? -16.881 -61.575 21.849  1.00 57.97  ? 351 GLU A C   1 
ATOM   2647 O O   . GLU A 1 350 ? -15.755 -61.393 21.373  1.00 50.18  ? 351 GLU A O   1 
ATOM   2648 C CB  . GLU A 1 350 ? -17.046 -64.053 22.048  1.00 69.09  ? 351 GLU A CB  1 
ATOM   2649 C CG  . GLU A 1 350 ? -16.889 -65.259 22.942  1.00 66.78  ? 351 GLU A CG  1 
ATOM   2650 C CD  . GLU A 1 350 ? -15.588 -65.223 23.712  1.00 81.59  ? 351 GLU A CD  1 
ATOM   2651 O OE1 . GLU A 1 350 ? -14.514 -65.226 23.065  1.00 78.51  ? 351 GLU A OE1 1 
ATOM   2652 O OE2 . GLU A 1 350 ? -15.641 -65.179 24.962  1.00 85.32  ? 351 GLU A OE2 1 
ATOM   2653 N N   . SER A 1 351 ? -17.924 -60.807 21.563  1.00 53.82  ? 352 SER A N   1 
ATOM   2654 C CA  . SER A 1 351 ? -17.822 -59.673 20.652  1.00 66.69  ? 352 SER A CA  1 
ATOM   2655 C C   . SER A 1 351 ? -17.314 -60.065 19.258  1.00 63.77  ? 352 SER A C   1 
ATOM   2656 O O   . SER A 1 351 ? -16.583 -59.311 18.620  1.00 61.75  ? 352 SER A O   1 
ATOM   2657 C CB  . SER A 1 351 ? -16.920 -58.594 21.254  1.00 57.19  ? 352 SER A CB  1 
ATOM   2658 O OG  . SER A 1 351 ? -17.542 -57.981 22.368  1.00 63.05  ? 352 SER A OG  1 
ATOM   2659 N N   . LEU A 1 352 ? -17.708 -61.247 18.794  1.00 63.31  ? 353 LEU A N   1 
ATOM   2660 C CA  . LEU A 1 352 ? -17.434 -61.656 17.424  1.00 53.66  ? 353 LEU A CA  1 
ATOM   2661 C C   . LEU A 1 352 ? -18.292 -60.824 16.468  1.00 59.23  ? 353 LEU A C   1 
ATOM   2662 O O   . LEU A 1 352 ? -19.517 -60.871 16.527  1.00 64.36  ? 353 LEU A O   1 
ATOM   2663 C CB  . LEU A 1 352 ? -17.703 -63.148 17.254  1.00 49.55  ? 353 LEU A CB  1 
ATOM   2664 C CG  . LEU A 1 352 ? -16.904 -64.013 18.235  1.00 55.35  ? 353 LEU A CG  1 
ATOM   2665 C CD1 . LEU A 1 352 ? -17.235 -65.484 18.078  1.00 47.07  ? 353 LEU A CD1 1 
ATOM   2666 C CD2 . LEU A 1 352 ? -15.413 -63.787 18.052  1.00 48.93  ? 353 LEU A CD2 1 
ATOM   2667 N N   . ILE A 1 353 ? -17.650 -60.042 15.605  1.00 55.53  ? 354 ILE A N   1 
ATOM   2668 C CA  . ILE A 1 353 ? -18.384 -59.121 14.744  1.00 55.85  ? 354 ILE A CA  1 
ATOM   2669 C C   . ILE A 1 353 ? -18.348 -59.523 13.265  1.00 65.16  ? 354 ILE A C   1 
ATOM   2670 O O   . ILE A 1 353 ? -17.442 -60.229 12.804  1.00 57.53  ? 354 ILE A O   1 
ATOM   2671 C CB  . ILE A 1 353 ? -17.848 -57.678 14.888  1.00 57.72  ? 354 ILE A CB  1 
ATOM   2672 C CG1 . ILE A 1 353 ? -16.341 -57.637 14.624  1.00 56.27  ? 354 ILE A CG1 1 
ATOM   2673 C CG2 . ILE A 1 353 ? -18.147 -57.141 16.277  1.00 55.84  ? 354 ILE A CG2 1 
ATOM   2674 C CD1 . ILE A 1 353 ? -15.769 -56.243 14.555  1.00 47.91  ? 354 ILE A CD1 1 
ATOM   2675 N N   . SER A 1 354 ? -19.361 -59.073 12.534  1.00 63.95  ? 355 SER A N   1 
ATOM   2676 C CA  . SER A 1 354 ? -19.442 -59.282 11.094  1.00 61.71  ? 355 SER A CA  1 
ATOM   2677 C C   . SER A 1 354 ? -18.659 -58.200 10.353  1.00 64.15  ? 355 SER A C   1 
ATOM   2678 O O   . SER A 1 354 ? -18.390 -57.130 10.905  1.00 58.63  ? 355 SER A O   1 
ATOM   2679 C CB  . SER A 1 354 ? -20.898 -59.269 10.637  1.00 56.70  ? 355 SER A CB  1 
ATOM   2680 O OG  . SER A 1 354 ? -21.446 -57.964 10.778  1.00 58.50  ? 355 SER A OG  1 
ATOM   2681 N N   . ARG A 1 355 ? -18.322 -58.461 9.094   1.00 56.16  ? 356 ARG A N   1 
ATOM   2682 C CA  . ARG A 1 355 ? -17.546 -57.502 8.324   1.00 57.42  ? 356 ARG A CA  1 
ATOM   2683 C C   . ARG A 1 355 ? -18.249 -56.142 8.207   1.00 59.54  ? 356 ARG A C   1 
ATOM   2684 O O   . ARG A 1 355 ? -17.594 -55.097 8.170   1.00 58.32  ? 356 ARG A O   1 
ATOM   2685 C CB  . ARG A 1 355 ? -17.228 -58.053 6.934   1.00 47.16  ? 356 ARG A CB  1 
ATOM   2686 C CG  . ARG A 1 355 ? -16.428 -57.067 6.109   1.00 50.71  ? 356 ARG A CG  1 
ATOM   2687 C CD  . ARG A 1 355 ? -15.528 -57.726 5.101   1.00 50.90  ? 356 ARG A CD  1 
ATOM   2688 N NE  . ARG A 1 355 ? -14.648 -56.739 4.487   1.00 53.89  ? 356 ARG A NE  1 
ATOM   2689 C CZ  . ARG A 1 355 ? -13.384 -56.553 4.851   1.00 50.40  ? 356 ARG A CZ  1 
ATOM   2690 N NH1 . ARG A 1 355 ? -12.866 -57.304 5.811   1.00 51.27  ? 356 ARG A NH1 1 
ATOM   2691 N NH2 . ARG A 1 355 ? -12.636 -55.633 4.252   1.00 40.28  ? 356 ARG A NH2 1 
ATOM   2692 N N   . ALA A 1 356 ? -19.576 -56.147 8.161   1.00 59.98  ? 357 ALA A N   1 
ATOM   2693 C CA  . ALA A 1 356 ? -20.308 -54.892 8.087   1.00 48.29  ? 357 ALA A CA  1 
ATOM   2694 C C   . ALA A 1 356 ? -20.040 -54.073 9.346   1.00 63.13  ? 357 ALA A C   1 
ATOM   2695 O O   . ALA A 1 356 ? -19.755 -52.870 9.266   1.00 53.10  ? 357 ALA A O   1 
ATOM   2696 C CB  . ALA A 1 356 ? -21.783 -55.144 7.910   1.00 49.86  ? 357 ALA A CB  1 
ATOM   2697 N N   . GLU A 1 357 ? -20.105 -54.740 10.501  1.00 57.93  ? 358 GLU A N   1 
ATOM   2698 C CA  . GLU A 1 357 ? -19.804 -54.101 11.781  1.00 58.96  ? 358 GLU A CA  1 
ATOM   2699 C C   . GLU A 1 357 ? -18.353 -53.605 11.823  1.00 59.90  ? 358 GLU A C   1 
ATOM   2700 O O   . GLU A 1 357 ? -18.074 -52.515 12.323  1.00 55.54  ? 358 GLU A O   1 
ATOM   2701 C CB  . GLU A 1 357 ? -20.079 -55.066 12.941  1.00 59.29  ? 358 GLU A CB  1 
ATOM   2702 C CG  . GLU A 1 357 ? -21.571 -55.340 13.196  1.00 61.11  ? 358 GLU A CG  1 
ATOM   2703 C CD  . GLU A 1 357 ? -21.821 -56.418 14.264  1.00 72.69  ? 358 GLU A CD  1 
ATOM   2704 O OE1 . GLU A 1 357 ? -21.102 -57.448 14.282  1.00 61.99  ? 358 GLU A OE1 1 
ATOM   2705 O OE2 . GLU A 1 357 ? -22.745 -56.233 15.090  1.00 70.73  ? 358 GLU A OE2 1 
ATOM   2706 N N   . PHE A 1 358 ? -17.439 -54.408 11.282  1.00 58.65  ? 359 PHE A N   1 
ATOM   2707 C CA  . PHE A 1 358 ? -16.026 -54.041 11.202  1.00 51.03  ? 359 PHE A CA  1 
ATOM   2708 C C   . PHE A 1 358 ? -15.842 -52.730 10.453  1.00 49.78  ? 359 PHE A C   1 
ATOM   2709 O O   . PHE A 1 358 ? -15.119 -51.844 10.912  1.00 56.26  ? 359 PHE A O   1 
ATOM   2710 C CB  . PHE A 1 358 ? -15.218 -55.159 10.526  1.00 54.60  ? 359 PHE A CB  1 
ATOM   2711 C CG  . PHE A 1 358 ? -13.773 -54.807 10.259  1.00 53.37  ? 359 PHE A CG  1 
ATOM   2712 C CD1 . PHE A 1 358 ? -12.827 -54.890 11.266  1.00 53.51  ? 359 PHE A CD1 1 
ATOM   2713 C CD2 . PHE A 1 358 ? -13.358 -54.419 8.994   1.00 51.61  ? 359 PHE A CD2 1 
ATOM   2714 C CE1 . PHE A 1 358 ? -11.496 -54.576 11.021  1.00 44.70  ? 359 PHE A CE1 1 
ATOM   2715 C CE2 . PHE A 1 358 ? -12.032 -54.103 8.745   1.00 47.85  ? 359 PHE A CE2 1 
ATOM   2716 C CZ  . PHE A 1 358 ? -11.102 -54.182 9.765   1.00 47.08  ? 359 PHE A CZ  1 
ATOM   2717 N N   . LEU A 1 359 ? -16.503 -52.603 9.308   1.00 49.60  ? 360 LEU A N   1 
ATOM   2718 C CA  . LEU A 1 359 ? -16.366 -51.402 8.493   1.00 53.03  ? 360 LEU A CA  1 
ATOM   2719 C C   . LEU A 1 359 ? -16.937 -50.198 9.230   1.00 56.59  ? 360 LEU A C   1 
ATOM   2720 O O   . LEU A 1 359 ? -16.359 -49.118 9.200   1.00 62.93  ? 360 LEU A O   1 
ATOM   2721 C CB  . LEU A 1 359 ? -17.046 -51.584 7.135   1.00 51.54  ? 360 LEU A CB  1 
ATOM   2722 C CG  . LEU A 1 359 ? -16.499 -52.727 6.262   1.00 58.95  ? 360 LEU A CG  1 
ATOM   2723 C CD1 . LEU A 1 359 ? -17.379 -52.988 5.054   1.00 63.26  ? 360 LEU A CD1 1 
ATOM   2724 C CD2 . LEU A 1 359 ? -15.099 -52.428 5.806   1.00 46.59  ? 360 LEU A CD2 1 
ATOM   2725 N N   . ALA A 1 360 ? -18.064 -50.394 9.907   1.00 61.18  ? 361 ALA A N   1 
ATOM   2726 C CA  . ALA A 1 360 ? -18.660 -49.333 10.712  1.00 55.37  ? 361 ALA A CA  1 
ATOM   2727 C C   . ALA A 1 360 ? -17.779 -48.997 11.913  1.00 60.39  ? 361 ALA A C   1 
ATOM   2728 O O   . ALA A 1 360 ? -17.636 -47.827 12.280  1.00 57.30  ? 361 ALA A O   1 
ATOM   2729 C CB  . ALA A 1 360 ? -20.048 -49.733 11.173  1.00 62.62  ? 361 ALA A CB  1 
ATOM   2730 N N   . GLY A 1 361 ? -17.194 -50.031 12.517  1.00 56.18  ? 362 GLY A N   1 
ATOM   2731 C CA  . GLY A 1 361 ? -16.301 -49.867 13.653  1.00 55.90  ? 362 GLY A CA  1 
ATOM   2732 C C   . GLY A 1 361 ? -15.100 -49.001 13.321  1.00 58.50  ? 362 GLY A C   1 
ATOM   2733 O O   . GLY A 1 361 ? -14.622 -48.226 14.150  1.00 55.03  ? 362 GLY A O   1 
ATOM   2734 N N   . VAL A 1 362 ? -14.624 -49.124 12.089  1.00 58.22  ? 363 VAL A N   1 
ATOM   2735 C CA  . VAL A 1 362 ? -13.480 -48.352 11.631  1.00 55.88  ? 363 VAL A CA  1 
ATOM   2736 C C   . VAL A 1 362 ? -13.779 -46.848 11.559  1.00 57.99  ? 363 VAL A C   1 
ATOM   2737 O O   . VAL A 1 362 ? -12.929 -46.031 11.927  1.00 65.90  ? 363 VAL A O   1 
ATOM   2738 C CB  . VAL A 1 362 ? -12.996 -48.871 10.266  1.00 51.81  ? 363 VAL A CB  1 
ATOM   2739 C CG1 . VAL A 1 362 ? -12.029 -47.901 9.622   1.00 46.70  ? 363 VAL A CG1 1 
ATOM   2740 C CG2 . VAL A 1 362 ? -12.345 -50.235 10.445  1.00 48.93  ? 363 VAL A CG2 1 
ATOM   2741 N N   . ARG A 1 363 ? -14.979 -46.474 11.120  1.00 54.40  ? 364 ARG A N   1 
ATOM   2742 C CA  . ARG A 1 363 ? -15.349 -45.053 11.096  1.00 55.53  ? 364 ARG A CA  1 
ATOM   2743 C C   . ARG A 1 363 ? -15.485 -44.455 12.507  1.00 65.80  ? 364 ARG A C   1 
ATOM   2744 O O   . ARG A 1 363 ? -15.408 -43.234 12.675  1.00 68.13  ? 364 ARG A O   1 
ATOM   2745 C CB  . ARG A 1 363 ? -16.654 -44.834 10.331  1.00 52.80  ? 364 ARG A CB  1 
ATOM   2746 C CG  . ARG A 1 363 ? -16.685 -45.404 8.923   1.00 55.92  ? 364 ARG A CG  1 
ATOM   2747 C CD  . ARG A 1 363 ? -15.446 -45.035 8.122   1.00 67.33  ? 364 ARG A CD  1 
ATOM   2748 N NE  . ARG A 1 363 ? -15.290 -43.597 7.888   1.00 69.82  ? 364 ARG A NE  1 
ATOM   2749 C CZ  . ARG A 1 363 ? -15.616 -42.978 6.754   1.00 69.44  ? 364 ARG A CZ  1 
ATOM   2750 N NH1 . ARG A 1 363 ? -16.132 -43.667 5.742   1.00 68.27  ? 364 ARG A NH1 1 
ATOM   2751 N NH2 . ARG A 1 363 ? -15.425 -41.669 6.632   1.00 64.74  ? 364 ARG A NH2 1 
ATOM   2752 N N   . VAL A 1 364 ? -15.690 -45.303 13.516  1.00 57.79  ? 365 VAL A N   1 
ATOM   2753 C CA  . VAL A 1 364 ? -15.789 -44.831 14.900  1.00 55.86  ? 365 VAL A CA  1 
ATOM   2754 C C   . VAL A 1 364 ? -14.405 -44.662 15.519  1.00 62.35  ? 365 VAL A C   1 
ATOM   2755 O O   . VAL A 1 364 ? -14.097 -43.630 16.115  1.00 65.44  ? 365 VAL A O   1 
ATOM   2756 C CB  . VAL A 1 364 ? -16.622 -45.794 15.783  1.00 57.35  ? 365 VAL A CB  1 
ATOM   2757 C CG1 . VAL A 1 364 ? -16.442 -45.471 17.275  1.00 55.41  ? 365 VAL A CG1 1 
ATOM   2758 C CG2 . VAL A 1 364 ? -18.086 -45.748 15.387  1.00 50.13  ? 365 VAL A CG2 1 
ATOM   2759 N N   . GLY A 1 365 ? -13.572 -45.683 15.367  1.00 61.91  ? 366 GLY A N   1 
ATOM   2760 C CA  . GLY A 1 365 ? -12.222 -45.645 15.895  1.00 51.86  ? 366 GLY A CA  1 
ATOM   2761 C C   . GLY A 1 365 ? -11.331 -44.639 15.192  1.00 54.15  ? 366 GLY A C   1 
ATOM   2762 O O   . GLY A 1 365 ? -10.357 -44.166 15.779  1.00 51.30  ? 366 GLY A O   1 
ATOM   2763 N N   . VAL A 1 366 ? -11.640 -44.318 13.936  1.00 46.72  ? 367 VAL A N   1 
ATOM   2764 C CA  . VAL A 1 366 ? -10.879 -43.299 13.218  1.00 49.78  ? 367 VAL A CA  1 
ATOM   2765 C C   . VAL A 1 366 ? -11.808 -42.193 12.715  1.00 54.73  ? 367 VAL A C   1 
ATOM   2766 O O   . VAL A 1 366 ? -12.062 -42.078 11.518  1.00 59.02  ? 367 VAL A O   1 
ATOM   2767 C CB  . VAL A 1 366 ? -10.086 -43.901 12.035  1.00 48.90  ? 367 VAL A CB  1 
ATOM   2768 C CG1 . VAL A 1 366 ? -8.948  -42.972 11.613  1.00 40.37  ? 367 VAL A CG1 1 
ATOM   2769 C CG2 . VAL A 1 366 ? -9.536  -45.283 12.395  1.00 42.76  ? 367 VAL A CG2 1 
ATOM   2770 N N   . PRO A 1 367 ? -12.309 -41.359 13.640  1.00 66.41  ? 368 PRO A N   1 
ATOM   2771 C CA  . PRO A 1 367 ? -13.351 -40.385 13.301  1.00 61.68  ? 368 PRO A CA  1 
ATOM   2772 C C   . PRO A 1 367 ? -12.855 -39.218 12.444  1.00 66.02  ? 368 PRO A C   1 
ATOM   2773 O O   . PRO A 1 367 ? -11.692 -38.805 12.555  1.00 58.82  ? 368 PRO A O   1 
ATOM   2774 C CB  . PRO A 1 367 ? -13.818 -39.893 14.673  1.00 63.99  ? 368 PRO A CB  1 
ATOM   2775 C CG  . PRO A 1 367 ? -12.614 -40.022 15.538  1.00 56.42  ? 368 PRO A CG  1 
ATOM   2776 C CD  . PRO A 1 367 ? -11.873 -41.238 15.045  1.00 62.40  ? 368 PRO A CD  1 
ATOM   2777 N N   . GLN A 1 368 ? -13.755 -38.711 11.597  1.00 72.81  ? 369 GLN A N   1 
ATOM   2778 C CA  . GLN A 1 368 ? -13.530 -37.540 10.739  1.00 72.94  ? 369 GLN A CA  1 
ATOM   2779 C C   . GLN A 1 368 ? -12.323 -37.680 9.817   1.00 68.59  ? 369 GLN A C   1 
ATOM   2780 O O   . GLN A 1 368 ? -11.388 -36.879 9.869   1.00 69.78  ? 369 GLN A O   1 
ATOM   2781 C CB  . GLN A 1 368 ? -13.381 -36.268 11.584  1.00 72.71  ? 369 GLN A CB  1 
ATOM   2782 C CG  . GLN A 1 368 ? -14.533 -36.026 12.554  1.00 81.13  ? 369 GLN A CG  1 
ATOM   2783 C CD  . GLN A 1 368 ? -15.890 -35.861 11.877  1.00 85.69  ? 369 GLN A CD  1 
ATOM   2784 O OE1 . GLN A 1 368 ? -16.186 -34.807 11.298  1.00 76.31  ? 369 GLN A OE1 1 
ATOM   2785 N NE2 . GLN A 1 368 ? -16.731 -36.898 11.965  1.00 66.21  ? 369 GLN A NE2 1 
ATOM   2786 N N   . VAL A 1 369 ? -12.349 -38.709 8.980   1.00 68.06  ? 370 VAL A N   1 
ATOM   2787 C CA  . VAL A 1 369 ? -11.388 -38.832 7.893   1.00 70.42  ? 370 VAL A CA  1 
ATOM   2788 C C   . VAL A 1 369 ? -12.152 -39.197 6.630   1.00 65.01  ? 370 VAL A C   1 
ATOM   2789 O O   . VAL A 1 369 ? -13.237 -39.785 6.713   1.00 63.52  ? 370 VAL A O   1 
ATOM   2790 C CB  . VAL A 1 369 ? -10.308 -39.883 8.182   1.00 65.51  ? 370 VAL A CB  1 
ATOM   2791 C CG1 . VAL A 1 369 ? -9.312  -39.354 9.214   1.00 53.50  ? 370 VAL A CG1 1 
ATOM   2792 C CG2 . VAL A 1 369 ? -10.947 -41.190 8.631   1.00 53.94  ? 370 VAL A CG2 1 
ATOM   2793 N N   . SER A 1 370 ? -11.599 -38.839 5.471   1.00 61.80  ? 371 SER A N   1 
ATOM   2794 C CA  . SER A 1 370 ? -12.272 -39.081 4.191   1.00 67.94  ? 371 SER A CA  1 
ATOM   2795 C C   . SER A 1 370 ? -12.549 -40.566 3.978   1.00 65.86  ? 371 SER A C   1 
ATOM   2796 O O   . SER A 1 370 ? -11.933 -41.417 4.620   1.00 66.56  ? 371 SER A O   1 
ATOM   2797 C CB  . SER A 1 370 ? -11.441 -38.534 3.028   1.00 62.14  ? 371 SER A CB  1 
ATOM   2798 O OG  . SER A 1 370 ? -10.119 -39.048 3.052   1.00 64.88  ? 371 SER A OG  1 
ATOM   2799 N N   . ASP A 1 371 ? -13.491 -40.869 3.090   1.00 69.38  ? 372 ASP A N   1 
ATOM   2800 C CA  . ASP A 1 371 ? -13.802 -42.254 2.753   1.00 67.03  ? 372 ASP A CA  1 
ATOM   2801 C C   . ASP A 1 371 ? -12.556 -42.949 2.214   1.00 60.85  ? 372 ASP A C   1 
ATOM   2802 O O   . ASP A 1 371 ? -12.314 -44.122 2.502   1.00 51.71  ? 372 ASP A O   1 
ATOM   2803 C CB  . ASP A 1 371 ? -14.939 -42.331 1.726   1.00 74.64  ? 372 ASP A CB  1 
ATOM   2804 C CG  . ASP A 1 371 ? -16.274 -41.871 2.289   1.00 80.20  ? 372 ASP A CG  1 
ATOM   2805 O OD1 . ASP A 1 371 ? -16.385 -41.754 3.530   1.00 81.08  ? 372 ASP A OD1 1 
ATOM   2806 O OD2 . ASP A 1 371 ? -17.212 -41.637 1.489   1.00 72.28  ? 372 ASP A OD2 1 
ATOM   2807 N N   . LEU A 1 372 ? -11.769 -42.209 1.436   1.00 51.58  ? 373 LEU A N   1 
ATOM   2808 C CA  . LEU A 1 372 ? -10.512 -42.718 0.918   1.00 58.75  ? 373 LEU A CA  1 
ATOM   2809 C C   . LEU A 1 372 ? -9.597  -43.163 2.069   1.00 61.03  ? 373 LEU A C   1 
ATOM   2810 O O   . LEU A 1 372 ? -9.082  -44.286 2.070   1.00 59.68  ? 373 LEU A O   1 
ATOM   2811 C CB  . LEU A 1 372 ? -9.824  -41.660 0.050   1.00 49.11  ? 373 LEU A CB  1 
ATOM   2812 C CG  . LEU A 1 372 ? -8.494  -42.074 -0.580  1.00 53.03  ? 373 LEU A CG  1 
ATOM   2813 C CD1 . LEU A 1 372 ? -8.652  -43.304 -1.472  1.00 47.04  ? 373 LEU A CD1 1 
ATOM   2814 C CD2 . LEU A 1 372 ? -7.916  -40.915 -1.357  1.00 65.16  ? 373 LEU A CD2 1 
ATOM   2815 N N   . ALA A 1 373 ? -9.419  -42.290 3.056   1.00 63.35  ? 374 ALA A N   1 
ATOM   2816 C CA  . ALA A 1 373 ? -8.600  -42.603 4.224   1.00 52.11  ? 374 ALA A CA  1 
ATOM   2817 C C   . ALA A 1 373 ? -9.114  -43.841 4.957   1.00 45.59  ? 374 ALA A C   1 
ATOM   2818 O O   . ALA A 1 373 ? -8.332  -44.695 5.365   1.00 42.68  ? 374 ALA A O   1 
ATOM   2819 C CB  . ALA A 1 373 ? -8.551  -41.412 5.165   1.00 52.50  ? 374 ALA A CB  1 
ATOM   2820 N N   . ALA A 1 374 ? -10.432 -43.936 5.111   1.00 46.50  ? 375 ALA A N   1 
ATOM   2821 C CA  . ALA A 1 374 ? -11.040 -45.061 5.808   1.00 44.21  ? 375 ALA A CA  1 
ATOM   2822 C C   . ALA A 1 374 ? -10.862 -46.334 5.009   1.00 50.72  ? 375 ALA A C   1 
ATOM   2823 O O   . ALA A 1 374 ? -10.729 -47.423 5.578   1.00 48.43  ? 375 ALA A O   1 
ATOM   2824 C CB  . ALA A 1 374 ? -12.503 -44.801 6.061   1.00 47.11  ? 375 ALA A CB  1 
ATOM   2825 N N   . GLU A 1 375 ? -10.864 -46.182 3.685   1.00 55.88  ? 376 GLU A N   1 
ATOM   2826 C CA  . GLU A 1 375 ? -10.676 -47.300 2.772   1.00 49.02  ? 376 GLU A CA  1 
ATOM   2827 C C   . GLU A 1 375 ? -9.288  -47.885 2.933   1.00 46.02  ? 376 GLU A C   1 
ATOM   2828 O O   . GLU A 1 375 ? -9.117  -49.105 2.961   1.00 49.81  ? 376 GLU A O   1 
ATOM   2829 C CB  . GLU A 1 375 ? -10.893 -46.867 1.319   1.00 68.76  ? 376 GLU A CB  1 
ATOM   2830 C CG  . GLU A 1 375 ? -12.343 -46.883 0.837   1.00 73.49  ? 376 GLU A CG  1 
ATOM   2831 C CD  . GLU A 1 375 ? -12.860 -48.289 0.528   1.00 108.42 ? 376 GLU A CD  1 
ATOM   2832 O OE1 . GLU A 1 375 ? -12.565 -49.240 1.297   1.00 97.31  ? 376 GLU A OE1 1 
ATOM   2833 O OE2 . GLU A 1 375 ? -13.572 -48.438 -0.494  1.00 102.41 ? 376 GLU A OE2 1 
ATOM   2834 N N   . ALA A 1 376 ? -8.298  -47.008 3.043   1.00 42.32  ? 377 ALA A N   1 
ATOM   2835 C CA  . ALA A 1 376 ? -6.922  -47.440 3.261   1.00 48.05  ? 377 ALA A CA  1 
ATOM   2836 C C   . ALA A 1 376 ? -6.775  -48.203 4.584   1.00 46.12  ? 377 ALA A C   1 
ATOM   2837 O O   . ALA A 1 376 ? -6.008  -49.168 4.671   1.00 48.96  ? 377 ALA A O   1 
ATOM   2838 C CB  . ALA A 1 376 ? -5.978  -46.243 3.224   1.00 42.17  ? 377 ALA A CB  1 
ATOM   2839 N N   . VAL A 1 377 ? -7.515  -47.783 5.606   1.00 36.44  ? 378 VAL A N   1 
ATOM   2840 C CA  . VAL A 1 377 ? -7.432  -48.443 6.903   1.00 39.00  ? 378 VAL A CA  1 
ATOM   2841 C C   . VAL A 1 377 ? -7.963  -49.859 6.758   1.00 43.89  ? 378 VAL A C   1 
ATOM   2842 O O   . VAL A 1 377 ? -7.346  -50.830 7.225   1.00 40.88  ? 378 VAL A O   1 
ATOM   2843 C CB  . VAL A 1 377 ? -8.212  -47.674 8.004   1.00 39.62  ? 378 VAL A CB  1 
ATOM   2844 C CG1 . VAL A 1 377 ? -8.202  -48.447 9.311   1.00 33.61  ? 378 VAL A CG1 1 
ATOM   2845 C CG2 . VAL A 1 377 ? -7.611  -46.296 8.217   1.00 35.39  ? 378 VAL A CG2 1 
ATOM   2846 N N   . VAL A 1 378 ? -9.095  -49.980 6.078   1.00 44.08  ? 379 VAL A N   1 
ATOM   2847 C CA  . VAL A 1 378 ? -9.698  -51.290 5.875   1.00 49.15  ? 379 VAL A CA  1 
ATOM   2848 C C   . VAL A 1 378 ? -8.818  -52.186 5.007   1.00 45.23  ? 379 VAL A C   1 
ATOM   2849 O O   . VAL A 1 378 ? -8.744  -53.394 5.243   1.00 47.06  ? 379 VAL A O   1 
ATOM   2850 C CB  . VAL A 1 378 ? -11.084 -51.172 5.253   1.00 47.42  ? 379 VAL A CB  1 
ATOM   2851 C CG1 . VAL A 1 378 ? -11.633 -52.542 4.987   1.00 44.59  ? 379 VAL A CG1 1 
ATOM   2852 C CG2 . VAL A 1 378 ? -12.008 -50.412 6.192   1.00 44.51  ? 379 VAL A CG2 1 
ATOM   2853 N N   . LEU A 1 379 ? -8.136  -51.599 4.022   1.00 50.26  ? 380 LEU A N   1 
ATOM   2854 C CA  . LEU A 1 379 ? -7.187  -52.357 3.203   1.00 46.64  ? 380 LEU A CA  1 
ATOM   2855 C C   . LEU A 1 379 ? -6.060  -52.956 4.043   1.00 39.45  ? 380 LEU A C   1 
ATOM   2856 O O   . LEU A 1 379 ? -5.793  -54.149 3.960   1.00 42.77  ? 380 LEU A O   1 
ATOM   2857 C CB  . LEU A 1 379 ? -6.573  -51.483 2.099   1.00 56.06  ? 380 LEU A CB  1 
ATOM   2858 C CG  . LEU A 1 379 ? -5.229  -51.984 1.514   1.00 49.67  ? 380 LEU A CG  1 
ATOM   2859 C CD1 . LEU A 1 379 ? -5.402  -53.132 0.529   1.00 36.80  ? 380 LEU A CD1 1 
ATOM   2860 C CD2 . LEU A 1 379 ? -4.400  -50.857 0.901   1.00 44.04  ? 380 LEU A CD2 1 
ATOM   2861 N N   A HIS A 1 380 ? -5.402  -52.119 4.841   0.59 35.93  ? 381 HIS A N   1 
ATOM   2862 N N   B HIS A 1 380 ? -5.405  -52.131 4.849   0.41 37.55  ? 381 HIS A N   1 
ATOM   2863 C CA  A HIS A 1 380 ? -4.237  -52.558 5.602   0.59 39.42  ? 381 HIS A CA  1 
ATOM   2864 C CA  B HIS A 1 380 ? -4.231  -52.589 5.581   0.41 39.81  ? 381 HIS A CA  1 
ATOM   2865 C C   A HIS A 1 380 ? -4.609  -53.628 6.623   0.59 41.11  ? 381 HIS A C   1 
ATOM   2866 C C   B HIS A 1 380 ? -4.569  -53.568 6.702   0.41 40.07  ? 381 HIS A C   1 
ATOM   2867 O O   A HIS A 1 380 ? -3.843  -54.570 6.841   0.59 41.43  ? 381 HIS A O   1 
ATOM   2868 O O   B HIS A 1 380 ? -3.728  -54.388 7.079   0.41 41.04  ? 381 HIS A O   1 
ATOM   2869 C CB  A HIS A 1 380 ? -3.563  -51.370 6.310   0.59 38.31  ? 381 HIS A CB  1 
ATOM   2870 C CB  B HIS A 1 380 ? -3.458  -51.397 6.150   0.41 38.38  ? 381 HIS A CB  1 
ATOM   2871 C CG  A HIS A 1 380 ? -2.279  -51.724 7.002   0.59 38.46  ? 381 HIS A CG  1 
ATOM   2872 C CG  B HIS A 1 380 ? -2.398  -50.879 5.230   0.41 39.65  ? 381 HIS A CG  1 
ATOM   2873 N ND1 A HIS A 1 380 ? -1.052  -51.658 6.376   0.59 39.15  ? 381 HIS A ND1 1 
ATOM   2874 N ND1 B HIS A 1 380 ? -2.676  -50.053 4.162   0.41 36.74  ? 381 HIS A ND1 1 
ATOM   2875 C CD2 A HIS A 1 380 ? -2.035  -52.155 8.263   0.59 41.85  ? 381 HIS A CD2 1 
ATOM   2876 C CD2 B HIS A 1 380 ? -1.060  -51.085 5.208   0.41 38.56  ? 381 HIS A CD2 1 
ATOM   2877 C CE1 A HIS A 1 380 ? -0.108  -52.034 7.223   0.59 41.53  ? 381 HIS A CE1 1 
ATOM   2878 C CE1 B HIS A 1 380 ? -1.554  -49.765 3.528   0.41 42.33  ? 381 HIS A CE1 1 
ATOM   2879 N NE2 A HIS A 1 380 ? -0.676  -52.339 8.375   0.59 39.73  ? 381 HIS A NE2 1 
ATOM   2880 N NE2 B HIS A 1 380 ? -0.558  -50.379 4.142   0.41 43.87  ? 381 HIS A NE2 1 
ATOM   2881 N N   . TYR A 1 381 ? -5.785  -53.494 7.224   1.00 39.74  ? 382 TYR A N   1 
ATOM   2882 C CA  . TYR A 1 381 ? -6.165  -54.345 8.349   1.00 34.15  ? 382 TYR A CA  1 
ATOM   2883 C C   . TYR A 1 381 ? -7.064  -55.512 7.979   1.00 43.50  ? 382 TYR A C   1 
ATOM   2884 O O   . TYR A 1 381 ? -7.488  -56.268 8.852   1.00 47.11  ? 382 TYR A O   1 
ATOM   2885 C CB  . TYR A 1 381 ? -6.825  -53.502 9.443   1.00 41.62  ? 382 TYR A CB  1 
ATOM   2886 C CG  . TYR A 1 381 ? -5.821  -52.730 10.279  1.00 37.95  ? 382 TYR A CG  1 
ATOM   2887 C CD1 . TYR A 1 381 ? -5.265  -53.290 11.421  1.00 34.12  ? 382 TYR A CD1 1 
ATOM   2888 C CD2 . TYR A 1 381 ? -5.416  -51.449 9.914   1.00 36.45  ? 382 TYR A CD2 1 
ATOM   2889 C CE1 . TYR A 1 381 ? -4.348  -52.595 12.186  1.00 35.66  ? 382 TYR A CE1 1 
ATOM   2890 C CE2 . TYR A 1 381 ? -4.494  -50.744 10.672  1.00 34.81  ? 382 TYR A CE2 1 
ATOM   2891 C CZ  . TYR A 1 381 ? -3.965  -51.323 11.809  1.00 38.84  ? 382 TYR A CZ  1 
ATOM   2892 O OH  . TYR A 1 381 ? -3.044  -50.636 12.569  1.00 34.94  ? 382 TYR A OH  1 
ATOM   2893 N N   . THR A 1 382 ? -7.343  -55.680 6.691   1.00 44.02  ? 383 THR A N   1 
ATOM   2894 C CA  . THR A 1 382 ? -8.056  -56.875 6.254   1.00 39.38  ? 383 THR A CA  1 
ATOM   2895 C C   . THR A 1 382 ? -7.067  -57.960 5.856   1.00 43.16  ? 383 THR A C   1 
ATOM   2896 O O   . THR A 1 382 ? -6.109  -57.698 5.117   1.00 42.36  ? 383 THR A O   1 
ATOM   2897 C CB  . THR A 1 382 ? -9.008  -56.597 5.067   1.00 45.29  ? 383 THR A CB  1 
ATOM   2898 O OG1 . THR A 1 382 ? -10.064 -55.725 5.487   1.00 47.29  ? 383 THR A OG1 1 
ATOM   2899 C CG2 . THR A 1 382 ? -9.626  -57.887 4.570   1.00 36.23  ? 383 THR A CG2 1 
ATOM   2900 N N   . ASP A 1 383 ? -7.280  -59.164 6.389   1.00 44.61  ? 384 ASP A N   1 
ATOM   2901 C CA  . ASP A 1 383 ? -6.651  -60.372 5.863   1.00 42.55  ? 384 ASP A CA  1 
ATOM   2902 C C   . ASP A 1 383 ? -7.472  -60.862 4.669   1.00 46.25  ? 384 ASP A C   1 
ATOM   2903 O O   . ASP A 1 383 ? -8.573  -61.380 4.844   1.00 47.42  ? 384 ASP A O   1 
ATOM   2904 C CB  . ASP A 1 383 ? -6.563  -61.456 6.931   1.00 40.57  ? 384 ASP A CB  1 
ATOM   2905 C CG  . ASP A 1 383 ? -5.826  -62.700 6.452   1.00 54.88  ? 384 ASP A CG  1 
ATOM   2906 O OD1 . ASP A 1 383 ? -5.797  -62.966 5.226   1.00 51.28  ? 384 ASP A OD1 1 
ATOM   2907 O OD2 . ASP A 1 383 ? -5.269  -63.422 7.311   1.00 56.76  ? 384 ASP A OD2 1 
ATOM   2908 N N   . TRP A 1 384 ? -6.935  -60.724 3.462   1.00 43.19  ? 385 TRP A N   1 
ATOM   2909 C CA  . TRP A 1 384 ? -7.736  -60.978 2.270   1.00 50.12  ? 385 TRP A CA  1 
ATOM   2910 C C   . TRP A 1 384 ? -7.884  -62.465 1.941   1.00 50.57  ? 385 TRP A C   1 
ATOM   2911 O O   . TRP A 1 384 ? -8.616  -62.823 1.022   1.00 51.55  ? 385 TRP A O   1 
ATOM   2912 C CB  . TRP A 1 384 ? -7.161  -60.198 1.085   1.00 44.60  ? 385 TRP A CB  1 
ATOM   2913 C CG  . TRP A 1 384 ? -7.309  -58.732 1.323   1.00 43.83  ? 385 TRP A CG  1 
ATOM   2914 C CD1 . TRP A 1 384 ? -6.352  -57.869 1.789   1.00 43.44  ? 385 TRP A CD1 1 
ATOM   2915 C CD2 . TRP A 1 384 ? -8.509  -57.963 1.186   1.00 40.03  ? 385 TRP A CD2 1 
ATOM   2916 N NE1 . TRP A 1 384 ? -6.880  -56.602 1.918   1.00 38.17  ? 385 TRP A NE1 1 
ATOM   2917 C CE2 . TRP A 1 384 ? -8.203  -56.636 1.562   1.00 40.58  ? 385 TRP A CE2 1 
ATOM   2918 C CE3 . TRP A 1 384 ? -9.811  -58.264 0.772   1.00 45.22  ? 385 TRP A CE3 1 
ATOM   2919 C CZ2 . TRP A 1 384 ? -9.152  -55.614 1.532   1.00 47.26  ? 385 TRP A CZ2 1 
ATOM   2920 C CZ3 . TRP A 1 384 ? -10.752 -57.243 0.741   1.00 43.26  ? 385 TRP A CZ3 1 
ATOM   2921 C CH2 . TRP A 1 384 ? -10.417 -55.937 1.115   1.00 42.69  ? 385 TRP A CH2 1 
ATOM   2922 N N   . LEU A 1 385 ? -7.222  -63.326 2.712   1.00 49.02  ? 386 LEU A N   1 
ATOM   2923 C CA  . LEU A 1 385 ? -7.494  -64.767 2.669   1.00 47.52  ? 386 LEU A CA  1 
ATOM   2924 C C   . LEU A 1 385 ? -8.610  -65.164 3.638   1.00 53.51  ? 386 LEU A C   1 
ATOM   2925 O O   . LEU A 1 385 ? -9.118  -66.283 3.590   1.00 53.17  ? 386 LEU A O   1 
ATOM   2926 C CB  . LEU A 1 385 ? -6.235  -65.565 3.001   1.00 49.82  ? 386 LEU A CB  1 
ATOM   2927 C CG  . LEU A 1 385 ? -5.086  -65.457 2.006   1.00 51.39  ? 386 LEU A CG  1 
ATOM   2928 C CD1 . LEU A 1 385 ? -3.891  -66.240 2.506   1.00 48.58  ? 386 LEU A CD1 1 
ATOM   2929 C CD2 . LEU A 1 385 ? -5.548  -65.974 0.669   1.00 48.88  ? 386 LEU A CD2 1 
ATOM   2930 N N   . HIS A 1 386 ? -8.960  -64.250 4.538   1.00 59.20  ? 387 HIS A N   1 
ATOM   2931 C CA  . HIS A 1 386 ? -9.999  -64.487 5.537   1.00 47.72  ? 387 HIS A CA  1 
ATOM   2932 C C   . HIS A 1 386 ? -10.799 -63.215 5.807   1.00 47.90  ? 387 HIS A C   1 
ATOM   2933 O O   . HIS A 1 386 ? -10.918 -62.787 6.951   1.00 50.61  ? 387 HIS A O   1 
ATOM   2934 C CB  . HIS A 1 386 ? -9.391  -64.974 6.858   1.00 52.23  ? 387 HIS A CB  1 
ATOM   2935 C CG  . HIS A 1 386 ? -8.501  -66.175 6.736   1.00 49.84  ? 387 HIS A CG  1 
ATOM   2936 N ND1 . HIS A 1 386 ? -8.987  -67.466 6.729   1.00 47.03  ? 387 HIS A ND1 1 
ATOM   2937 C CD2 . HIS A 1 386 ? -7.152  -66.283 6.669   1.00 47.65  ? 387 HIS A CD2 1 
ATOM   2938 C CE1 . HIS A 1 386 ? -7.978  -68.314 6.642   1.00 49.34  ? 387 HIS A CE1 1 
ATOM   2939 N NE2 . HIS A 1 386 ? -6.853  -67.623 6.609   1.00 50.26  ? 387 HIS A NE2 1 
ATOM   2940 N N   . PRO A 1 387 ? -11.368 -62.606 4.761   1.00 53.76  ? 388 PRO A N   1 
ATOM   2941 C CA  . PRO A 1 387 ? -11.887 -61.243 4.949   1.00 51.48  ? 388 PRO A CA  1 
ATOM   2942 C C   . PRO A 1 387 ? -13.087 -61.108 5.890   1.00 46.63  ? 388 PRO A C   1 
ATOM   2943 O O   . PRO A 1 387 ? -13.439 -59.975 6.218   1.00 49.30  ? 388 PRO A O   1 
ATOM   2944 C CB  . PRO A 1 387 ? -12.291 -60.830 3.526   1.00 50.31  ? 388 PRO A CB  1 
ATOM   2945 C CG  . PRO A 1 387 ? -12.587 -62.103 2.834   1.00 49.69  ? 388 PRO A CG  1 
ATOM   2946 C CD  . PRO A 1 387 ? -11.637 -63.125 3.409   1.00 50.85  ? 388 PRO A CD  1 
ATOM   2947 N N   . GLU A 1 388 ? -13.705 -62.214 6.303   1.00 56.09  ? 389 GLU A N   1 
ATOM   2948 C CA  . GLU A 1 388 ? -14.979 -62.142 7.026   1.00 54.54  ? 389 GLU A CA  1 
ATOM   2949 C C   . GLU A 1 388 ? -15.003 -62.968 8.315   1.00 54.12  ? 389 GLU A C   1 
ATOM   2950 O O   . GLU A 1 388 ? -16.039 -63.043 8.980   1.00 51.10  ? 389 GLU A O   1 
ATOM   2951 C CB  . GLU A 1 388 ? -16.134 -62.580 6.112   1.00 53.52  ? 389 GLU A CB  1 
ATOM   2952 C CG  . GLU A 1 388 ? -16.160 -61.854 4.763   1.00 62.77  ? 389 GLU A CG  1 
ATOM   2953 C CD  . GLU A 1 388 ? -17.548 -61.757 4.144   1.00 84.95  ? 389 GLU A CD  1 
ATOM   2954 O OE1 . GLU A 1 388 ? -18.234 -60.734 4.378   1.00 72.46  ? 389 GLU A OE1 1 
ATOM   2955 O OE2 . GLU A 1 388 ? -17.944 -62.692 3.408   1.00 96.18  ? 389 GLU A OE2 1 
ATOM   2956 N N   . ASP A 1 389 ? -13.868 -63.569 8.672   1.00 51.34  ? 390 ASP A N   1 
ATOM   2957 C CA  . ASP A 1 389 ? -13.741 -64.314 9.930   1.00 53.62  ? 390 ASP A CA  1 
ATOM   2958 C C   . ASP A 1 389 ? -13.953 -63.394 11.128  1.00 55.30  ? 390 ASP A C   1 
ATOM   2959 O O   . ASP A 1 389 ? -13.158 -62.487 11.356  1.00 56.26  ? 390 ASP A O   1 
ATOM   2960 C CB  . ASP A 1 389 ? -12.367 -64.994 10.023  1.00 56.24  ? 390 ASP A CB  1 
ATOM   2961 C CG  . ASP A 1 389 ? -12.140 -65.698 11.361  1.00 69.11  ? 390 ASP A CG  1 
ATOM   2962 O OD1 . ASP A 1 389 ? -13.131 -66.032 12.050  1.00 67.59  ? 390 ASP A OD1 1 
ATOM   2963 O OD2 . ASP A 1 389 ? -10.962 -65.926 11.724  1.00 66.09  ? 390 ASP A OD2 1 
ATOM   2964 N N   . PRO A 1 390 ? -15.021 -63.640 11.903  1.00 64.68  ? 391 PRO A N   1 
ATOM   2965 C CA  . PRO A 1 390 ? -15.446 -62.783 13.023  1.00 64.06  ? 391 PRO A CA  1 
ATOM   2966 C C   . PRO A 1 390 ? -14.401 -62.596 14.133  1.00 55.27  ? 391 PRO A C   1 
ATOM   2967 O O   . PRO A 1 390 ? -14.263 -61.483 14.638  1.00 55.63  ? 391 PRO A O   1 
ATOM   2968 C CB  . PRO A 1 390 ? -16.678 -63.513 13.567  1.00 58.52  ? 391 PRO A CB  1 
ATOM   2969 C CG  . PRO A 1 390 ? -17.185 -64.309 12.397  1.00 53.65  ? 391 PRO A CG  1 
ATOM   2970 C CD  . PRO A 1 390 ? -15.953 -64.763 11.691  1.00 52.23  ? 391 PRO A CD  1 
ATOM   2971 N N   . ALA A 1 391 ? -13.687 -63.653 14.507  1.00 51.66  ? 392 ALA A N   1 
ATOM   2972 C CA  . ALA A 1 391 ? -12.648 -63.542 15.533  1.00 52.14  ? 392 ALA A CA  1 
ATOM   2973 C C   . ALA A 1 391 ? -11.488 -62.654 15.079  1.00 59.77  ? 392 ALA A C   1 
ATOM   2974 O O   . ALA A 1 391 ? -11.000 -61.824 15.846  1.00 56.38  ? 392 ALA A O   1 
ATOM   2975 C CB  . ALA A 1 391 ? -12.129 -64.920 15.919  1.00 52.04  ? 392 ALA A CB  1 
ATOM   2976 N N   . ARG A 1 392 ? -11.052 -62.841 13.832  1.00 56.53  ? 393 ARG A N   1 
ATOM   2977 C CA  . ARG A 1 392 ? -9.984  -62.031 13.244  1.00 50.48  ? 393 ARG A CA  1 
ATOM   2978 C C   . ARG A 1 392 ? -10.391 -60.558 13.100  1.00 48.42  ? 393 ARG A C   1 
ATOM   2979 O O   . ARG A 1 392 ? -9.549  -59.662 13.182  1.00 40.72  ? 393 ARG A O   1 
ATOM   2980 C CB  . ARG A 1 392 ? -9.578  -62.588 11.872  1.00 51.11  ? 393 ARG A CB  1 
ATOM   2981 C CG  . ARG A 1 392 ? -8.523  -63.700 11.877  1.00 46.09  ? 393 ARG A CG  1 
ATOM   2982 C CD  . ARG A 1 392 ? -8.086  -64.011 10.427  1.00 62.28  ? 393 ARG A CD  1 
ATOM   2983 N NE  . ARG A 1 392 ? -7.114  -65.101 10.312  1.00 51.68  ? 393 ARG A NE  1 
ATOM   2984 C CZ  . ARG A 1 392 ? -7.445  -66.386 10.188  1.00 56.24  ? 393 ARG A CZ  1 
ATOM   2985 N NH1 . ARG A 1 392 ? -8.724  -66.748 10.169  1.00 48.23  ? 393 ARG A NH1 1 
ATOM   2986 N NH2 . ARG A 1 392 ? -6.501  -67.313 10.087  1.00 46.48  ? 393 ARG A NH2 1 
ATOM   2987 N N   . LEU A 1 393 ? -11.683 -60.325 12.880  1.00 48.29  ? 394 LEU A N   1 
ATOM   2988 C CA  . LEU A 1 393 ? -12.218 -58.986 12.669  1.00 41.22  ? 394 LEU A CA  1 
ATOM   2989 C C   . LEU A 1 393 ? -12.280 -58.216 13.971  1.00 51.47  ? 394 LEU A C   1 
ATOM   2990 O O   . LEU A 1 393 ? -12.112 -56.995 13.995  1.00 48.83  ? 394 LEU A O   1 
ATOM   2991 C CB  . LEU A 1 393 ? -13.609 -59.058 12.039  1.00 49.72  ? 394 LEU A CB  1 
ATOM   2992 C CG  . LEU A 1 393 ? -13.677 -59.396 10.546  1.00 50.87  ? 394 LEU A CG  1 
ATOM   2993 C CD1 . LEU A 1 393 ? -15.097 -59.730 10.135  1.00 50.78  ? 394 LEU A CD1 1 
ATOM   2994 C CD2 . LEU A 1 393 ? -13.141 -58.238 9.729   1.00 46.68  ? 394 LEU A CD2 1 
ATOM   2995 N N   . ARG A 1 394 ? -12.534 -58.942 15.054  1.00 53.45  ? 395 ARG A N   1 
ATOM   2996 C CA  . ARG A 1 394 ? -12.539 -58.351 16.380  1.00 44.79  ? 395 ARG A CA  1 
ATOM   2997 C C   . ARG A 1 394 ? -11.124 -57.907 16.743  1.00 49.76  ? 395 ARG A C   1 
ATOM   2998 O O   . ARG A 1 394 ? -10.919 -56.779 17.187  1.00 42.99  ? 395 ARG A O   1 
ATOM   2999 C CB  . ARG A 1 394 ? -13.076 -59.343 17.408  1.00 56.29  ? 395 ARG A CB  1 
ATOM   3000 C CG  . ARG A 1 394 ? -13.271 -58.783 18.812  1.00 45.89  ? 395 ARG A CG  1 
ATOM   3001 C CD  . ARG A 1 394 ? -13.477 -59.919 19.784  1.00 46.19  ? 395 ARG A CD  1 
ATOM   3002 N NE  . ARG A 1 394 ? -12.385 -60.884 19.704  1.00 48.43  ? 395 ARG A NE  1 
ATOM   3003 C CZ  . ARG A 1 394 ? -12.428 -62.111 20.217  1.00 57.29  ? 395 ARG A CZ  1 
ATOM   3004 N NH1 . ARG A 1 394 ? -13.518 -62.532 20.847  1.00 51.64  ? 395 ARG A NH1 1 
ATOM   3005 N NH2 . ARG A 1 394 ? -11.382 -62.921 20.094  1.00 52.96  ? 395 ARG A NH2 1 
ATOM   3006 N N   . GLU A 1 395 ? -10.150 -58.791 16.535  1.00 45.97  ? 396 GLU A N   1 
ATOM   3007 C CA  . GLU A 1 395 ? -8.752  -58.467 16.798  1.00 43.72  ? 396 GLU A CA  1 
ATOM   3008 C C   . GLU A 1 395 ? -8.278  -57.324 15.918  1.00 43.66  ? 396 GLU A C   1 
ATOM   3009 O O   . GLU A 1 395 ? -7.474  -56.509 16.347  1.00 47.04  ? 396 GLU A O   1 
ATOM   3010 C CB  . GLU A 1 395 ? -7.855  -59.687 16.592  1.00 48.27  ? 396 GLU A CB  1 
ATOM   3011 C CG  . GLU A 1 395 ? -7.354  -60.336 17.881  1.00 69.31  ? 396 GLU A CG  1 
ATOM   3012 C CD  . GLU A 1 395 ? -8.477  -60.907 18.764  1.00 96.23  ? 396 GLU A CD  1 
ATOM   3013 O OE1 . GLU A 1 395 ? -8.820  -60.274 19.798  1.00 86.71  ? 396 GLU A OE1 1 
ATOM   3014 O OE2 . GLU A 1 395 ? -9.005  -61.998 18.432  1.00 87.23  ? 396 GLU A OE2 1 
ATOM   3015 N N   . ALA A 1 396 ? -8.789  -57.251 14.692  1.00 47.19  ? 397 ALA A N   1 
ATOM   3016 C CA  . ALA A 1 396 ? -8.294  -56.267 13.737  1.00 43.94  ? 397 ALA A CA  1 
ATOM   3017 C C   . ALA A 1 396 ? -8.779  -54.875 14.089  1.00 43.80  ? 397 ALA A C   1 
ATOM   3018 O O   . ALA A 1 396 ? -8.027  -53.906 13.977  1.00 41.75  ? 397 ALA A O   1 
ATOM   3019 C CB  . ALA A 1 396 ? -8.713  -56.628 12.321  1.00 42.32  ? 397 ALA A CB  1 
ATOM   3020 N N   . LEU A 1 397 ? -10.036 -54.770 14.503  1.00 39.13  ? 398 LEU A N   1 
ATOM   3021 C CA  . LEU A 1 397 ? -10.581 -53.475 14.879  1.00 42.01  ? 398 LEU A CA  1 
ATOM   3022 C C   . LEU A 1 397 ? -9.928  -52.993 16.179  1.00 48.65  ? 398 LEU A C   1 
ATOM   3023 O O   . LEU A 1 397 ? -9.660  -51.797 16.354  1.00 38.97  ? 398 LEU A O   1 
ATOM   3024 C CB  . LEU A 1 397 ? -12.094 -53.554 15.031  1.00 41.98  ? 398 LEU A CB  1 
ATOM   3025 C CG  . LEU A 1 397 ? -12.763 -52.237 15.393  1.00 37.01  ? 398 LEU A CG  1 
ATOM   3026 C CD1 . LEU A 1 397 ? -12.593 -51.248 14.256  1.00 38.02  ? 398 LEU A CD1 1 
ATOM   3027 C CD2 . LEU A 1 397 ? -14.226 -52.469 15.705  1.00 46.94  ? 398 LEU A CD2 1 
ATOM   3028 N N   . SER A 1 398 ? -9.663  -53.935 17.082  1.00 39.08  ? 399 SER A N   1 
ATOM   3029 C CA  . SER A 1 398 ? -8.913  -53.641 18.296  1.00 38.83  ? 399 SER A CA  1 
ATOM   3030 C C   . SER A 1 398 ? -7.548  -53.057 17.935  1.00 41.63  ? 399 SER A C   1 
ATOM   3031 O O   . SER A 1 398 ? -7.135  -52.034 18.485  1.00 38.61  ? 399 SER A O   1 
ATOM   3032 C CB  . SER A 1 398 ? -8.751  -54.896 19.155  1.00 37.31  ? 399 SER A CB  1 
ATOM   3033 O OG  . SER A 1 398 ? -7.888  -54.667 20.257  1.00 47.28  ? 399 SER A OG  1 
ATOM   3034 N N   . ASP A 1 399 ? -6.867  -53.704 16.995  1.00 34.30  ? 400 ASP A N   1 
ATOM   3035 C CA  . ASP A 1 399 ? -5.598  -53.207 16.487  1.00 32.22  ? 400 ASP A CA  1 
ATOM   3036 C C   . ASP A 1 399 ? -5.738  -51.859 15.776  1.00 34.90  ? 400 ASP A C   1 
ATOM   3037 O O   . ASP A 1 399 ? -4.896  -50.993 15.938  1.00 33.03  ? 400 ASP A O   1 
ATOM   3038 C CB  . ASP A 1 399 ? -4.966  -54.225 15.540  1.00 40.68  ? 400 ASP A CB  1 
ATOM   3039 C CG  . ASP A 1 399 ? -4.369  -55.415 16.267  1.00 53.41  ? 400 ASP A CG  1 
ATOM   3040 O OD1 . ASP A 1 399 ? -4.214  -55.358 17.508  1.00 59.77  ? 400 ASP A OD1 1 
ATOM   3041 O OD2 . ASP A 1 399 ? -4.040  -56.412 15.590  1.00 54.85  ? 400 ASP A OD2 1 
ATOM   3042 N N   . VAL A 1 400 ? -6.788  -51.673 14.984  1.00 37.05  ? 401 VAL A N   1 
ATOM   3043 C CA  . VAL A 1 400 ? -6.978  -50.389 14.317  1.00 41.24  ? 401 VAL A CA  1 
ATOM   3044 C C   . VAL A 1 400 ? -7.032  -49.277 15.357  1.00 40.91  ? 401 VAL A C   1 
ATOM   3045 O O   . VAL A 1 400 ? -6.241  -48.334 15.327  1.00 38.17  ? 401 VAL A O   1 
ATOM   3046 C CB  . VAL A 1 400 ? -8.268  -50.356 13.461  1.00 40.63  ? 401 VAL A CB  1 
ATOM   3047 C CG1 . VAL A 1 400 ? -8.643  -48.919 13.089  1.00 30.39  ? 401 VAL A CG1 1 
ATOM   3048 C CG2 . VAL A 1 400 ? -8.100  -51.204 12.219  1.00 37.62  ? 401 VAL A CG2 1 
ATOM   3049 N N   . VAL A 1 401 ? -7.951  -49.422 16.298  1.00 41.19  ? 402 VAL A N   1 
ATOM   3050 C CA  . VAL A 1 401 ? -8.173  -48.417 17.323  1.00 39.31  ? 402 VAL A CA  1 
ATOM   3051 C C   . VAL A 1 401 ? -6.937  -48.210 18.207  1.00 36.70  ? 402 VAL A C   1 
ATOM   3052 O O   . VAL A 1 401 ? -6.517  -47.071 18.446  1.00 34.06  ? 402 VAL A O   1 
ATOM   3053 C CB  . VAL A 1 401 ? -9.391  -48.806 18.168  1.00 45.38  ? 402 VAL A CB  1 
ATOM   3054 C CG1 . VAL A 1 401 ? -9.389  -48.084 19.499  1.00 41.06  ? 402 VAL A CG1 1 
ATOM   3055 C CG2 . VAL A 1 401 ? -10.664 -48.540 17.372  1.00 33.56  ? 402 VAL A CG2 1 
ATOM   3056 N N   . GLY A 1 402 ? -6.346  -49.311 18.663  1.00 38.46  ? 403 GLY A N   1 
ATOM   3057 C CA  . GLY A 1 402 ? -5.140  -49.261 19.476  1.00 34.41  ? 403 GLY A CA  1 
ATOM   3058 C C   . GLY A 1 402 ? -3.940  -48.635 18.786  1.00 36.47  ? 403 GLY A C   1 
ATOM   3059 O O   . GLY A 1 402 ? -3.226  -47.828 19.389  1.00 34.43  ? 403 GLY A O   1 
ATOM   3060 N N   . ASP A 1 403 ? -3.725  -48.993 17.519  1.00 43.55  ? 404 ASP A N   1 
ATOM   3061 C CA  . ASP A 1 403 ? -2.575  -48.498 16.760  1.00 34.57  ? 404 ASP A CA  1 
ATOM   3062 C C   . ASP A 1 403 ? -2.717  -47.007 16.434  1.00 30.85  ? 404 ASP A C   1 
ATOM   3063 O O   . ASP A 1 403 ? -1.759  -46.245 16.551  1.00 33.49  ? 404 ASP A O   1 
ATOM   3064 C CB  . ASP A 1 403 ? -2.376  -49.315 15.465  1.00 31.33  ? 404 ASP A CB  1 
ATOM   3065 C CG  . ASP A 1 403 ? -2.063  -50.805 15.732  1.00 40.25  ? 404 ASP A CG  1 
ATOM   3066 O OD1 . ASP A 1 403 ? -1.793  -51.183 16.894  1.00 45.96  ? 404 ASP A OD1 1 
ATOM   3067 O OD2 . ASP A 1 403 ? -2.098  -51.609 14.773  1.00 42.55  ? 404 ASP A OD2 1 
ATOM   3068 N N   . HIS A 1 404 ? -3.911  -46.586 16.040  1.00 31.84  ? 405 HIS A N   1 
ATOM   3069 C CA  . HIS A 1 404 ? -4.133  -45.201 15.636  1.00 34.79  ? 405 HIS A CA  1 
ATOM   3070 C C   . HIS A 1 404 ? -4.059  -44.231 16.823  1.00 36.81  ? 405 HIS A C   1 
ATOM   3071 O O   . HIS A 1 404 ? -3.515  -43.139 16.703  1.00 35.74  ? 405 HIS A O   1 
ATOM   3072 C CB  . HIS A 1 404 ? -5.490  -45.077 14.925  1.00 27.35  ? 405 HIS A CB  1 
ATOM   3073 C CG  . HIS A 1 404 ? -5.891  -43.668 14.619  1.00 31.38  ? 405 HIS A CG  1 
ATOM   3074 N ND1 . HIS A 1 404 ? -5.048  -42.768 14.001  1.00 39.61  ? 405 HIS A ND1 1 
ATOM   3075 C CD2 . HIS A 1 404 ? -7.052  -43.005 14.842  1.00 31.57  ? 405 HIS A CD2 1 
ATOM   3076 C CE1 . HIS A 1 404 ? -5.671  -41.612 13.853  1.00 37.58  ? 405 HIS A CE1 1 
ATOM   3077 N NE2 . HIS A 1 404 ? -6.886  -41.727 14.360  1.00 40.25  ? 405 HIS A NE2 1 
ATOM   3078 N N   . ASN A 1 405 ? -4.596  -44.626 17.972  1.00 32.39  ? 406 ASN A N   1 
ATOM   3079 C CA  . ASN A 1 405 ? -4.690  -43.694 19.091  1.00 35.63  ? 406 ASN A CA  1 
ATOM   3080 C C   . ASN A 1 405 ? -3.564  -43.781 20.108  1.00 34.57  ? 406 ASN A C   1 
ATOM   3081 O O   . ASN A 1 405 ? -3.284  -42.807 20.791  1.00 33.88  ? 406 ASN A O   1 
ATOM   3082 C CB  . ASN A 1 405 ? -6.018  -43.878 19.815  1.00 32.54  ? 406 ASN A CB  1 
ATOM   3083 C CG  . ASN A 1 405 ? -7.198  -43.549 18.943  1.00 37.36  ? 406 ASN A CG  1 
ATOM   3084 O OD1 . ASN A 1 405 ? -7.486  -42.380 18.678  1.00 38.29  ? 406 ASN A OD1 1 
ATOM   3085 N ND2 . ASN A 1 405 ? -7.894  -44.581 18.483  1.00 38.91  ? 406 ASN A ND2 1 
ATOM   3086 N N   . VAL A 1 406 ? -2.916  -44.934 20.229  1.00 33.18  ? 407 VAL A N   1 
ATOM   3087 C CA  . VAL A 1 406 ? -1.904  -45.065 21.264  1.00 35.07  ? 407 VAL A CA  1 
ATOM   3088 C C   . VAL A 1 406 ? -0.560  -45.512 20.730  1.00 36.05  ? 407 VAL A C   1 
ATOM   3089 O O   . VAL A 1 406 ? 0.415   -44.760 20.807  1.00 38.13  ? 407 VAL A O   1 
ATOM   3090 C CB  . VAL A 1 406 ? -2.336  -46.051 22.363  1.00 36.86  ? 407 VAL A CB  1 
ATOM   3091 C CG1 . VAL A 1 406 ? -1.282  -46.103 23.465  1.00 24.45  ? 407 VAL A CG1 1 
ATOM   3092 C CG2 . VAL A 1 406 ? -3.670  -45.647 22.923  1.00 28.44  ? 407 VAL A CG2 1 
ATOM   3093 N N   . VAL A 1 407 ? -0.502  -46.732 20.198  1.00 31.50  ? 408 VAL A N   1 
ATOM   3094 C CA  . VAL A 1 407 ? 0.787   -47.362 19.907  1.00 33.73  ? 408 VAL A CA  1 
ATOM   3095 C C   . VAL A 1 407 ? 1.617   -46.577 18.896  1.00 31.56  ? 408 VAL A C   1 
ATOM   3096 O O   . VAL A 1 407 ? 2.790   -46.307 19.122  1.00 33.24  ? 408 VAL A O   1 
ATOM   3097 C CB  . VAL A 1 407 ? 0.621   -48.801 19.387  1.00 34.65  ? 408 VAL A CB  1 
ATOM   3098 C CG1 . VAL A 1 407 ? 1.977   -49.423 19.138  1.00 27.92  ? 408 VAL A CG1 1 
ATOM   3099 C CG2 . VAL A 1 407 ? -0.151  -49.641 20.385  1.00 25.78  ? 408 VAL A CG2 1 
ATOM   3100 N N   . CYS A 1 408 ? 1.017   -46.185 17.787  1.00 33.04  ? 409 CYS A N   1 
ATOM   3101 C CA  . CYS A 1 408 ? 1.810   -45.516 16.762  1.00 36.59  ? 409 CYS A CA  1 
ATOM   3102 C C   . CYS A 1 408 ? 2.171   -44.081 17.137  1.00 33.30  ? 409 CYS A C   1 
ATOM   3103 O O   . CYS A 1 408 ? 3.270   -43.633 16.815  1.00 38.42  ? 409 CYS A O   1 
ATOM   3104 C CB  . CYS A 1 408 ? 1.093   -45.577 15.400  1.00 35.28  ? 409 CYS A CB  1 
ATOM   3105 S SG  . CYS A 1 408 ? 0.923   -47.292 14.800  1.00 37.38  ? 409 CYS A SG  1 
ATOM   3106 N N   . PRO A 1 409 ? 1.265   -43.346 17.812  1.00 36.22  ? 410 PRO A N   1 
ATOM   3107 C CA  . PRO A 1 409 ? 1.771   -42.072 18.339  1.00 37.17  ? 410 PRO A CA  1 
ATOM   3108 C C   . PRO A 1 409 ? 2.944   -42.248 19.313  1.00 36.40  ? 410 PRO A C   1 
ATOM   3109 O O   . PRO A 1 409 ? 3.914   -41.491 19.221  1.00 33.76  ? 410 PRO A O   1 
ATOM   3110 C CB  . PRO A 1 409 ? 0.552   -41.484 19.044  1.00 30.68  ? 410 PRO A CB  1 
ATOM   3111 C CG  . PRO A 1 409 ? -0.586  -42.002 18.271  1.00 33.76  ? 410 PRO A CG  1 
ATOM   3112 C CD  . PRO A 1 409 ? -0.206  -43.403 17.871  1.00 32.42  ? 410 PRO A CD  1 
ATOM   3113 N N   . VAL A 1 410 ? 2.876   -43.230 20.206  1.00 26.31  ? 411 VAL A N   1 
ATOM   3114 C CA  . VAL A 1 410 ? 3.987   -43.459 21.120  1.00 35.78  ? 411 VAL A CA  1 
ATOM   3115 C C   . VAL A 1 410 ? 5.232   -43.882 20.338  1.00 34.01  ? 411 VAL A C   1 
ATOM   3116 O O   . VAL A 1 410 ? 6.322   -43.390 20.601  1.00 41.21  ? 411 VAL A O   1 
ATOM   3117 C CB  . VAL A 1 410 ? 3.636   -44.507 22.205  1.00 30.78  ? 411 VAL A CB  1 
ATOM   3118 C CG1 . VAL A 1 410 ? 4.892   -45.041 22.883  1.00 23.31  ? 411 VAL A CG1 1 
ATOM   3119 C CG2 . VAL A 1 410 ? 2.712   -43.884 23.233  1.00 25.87  ? 411 VAL A CG2 1 
ATOM   3120 N N   . ALA A 1 411 ? 5.060   -44.755 19.353  1.00 35.81  ? 412 ALA A N   1 
ATOM   3121 C CA  . ALA A 1 411 ? 6.175   -45.203 18.511  1.00 35.65  ? 412 ALA A CA  1 
ATOM   3122 C C   . ALA A 1 411 ? 6.859   -44.055 17.783  1.00 34.02  ? 412 ALA A C   1 
ATOM   3123 O O   . ALA A 1 411 ? 8.086   -44.018 17.668  1.00 38.98  ? 412 ALA A O   1 
ATOM   3124 C CB  . ALA A 1 411 ? 5.695   -46.220 17.509  1.00 29.16  ? 412 ALA A CB  1 
ATOM   3125 N N   . GLN A 1 412 ? 6.059   -43.122 17.286  1.00 29.90  ? 413 GLN A N   1 
ATOM   3126 C CA  . GLN A 1 412 ? 6.597   -41.960 16.600  1.00 35.46  ? 413 GLN A CA  1 
ATOM   3127 C C   . GLN A 1 412 ? 7.390   -41.066 17.544  1.00 41.67  ? 413 GLN A C   1 
ATOM   3128 O O   . GLN A 1 412 ? 8.474   -40.590 17.202  1.00 38.72  ? 413 GLN A O   1 
ATOM   3129 C CB  . GLN A 1 412 ? 5.478   -41.155 15.957  1.00 31.69  ? 413 GLN A CB  1 
ATOM   3130 C CG  . GLN A 1 412 ? 5.984   -39.948 15.204  1.00 40.62  ? 413 GLN A CG  1 
ATOM   3131 C CD  . GLN A 1 412 ? 4.909   -39.308 14.370  1.00 52.35  ? 413 GLN A CD  1 
ATOM   3132 O OE1 . GLN A 1 412 ? 3.886   -38.851 14.892  1.00 57.76  ? 413 GLN A OE1 1 
ATOM   3133 N NE2 . GLN A 1 412 ? 5.120   -39.287 13.058  1.00 57.31  ? 413 GLN A NE2 1 
ATOM   3134 N N   . LEU A 1 413 ? 6.830   -40.839 18.728  1.00 41.89  ? 414 LEU A N   1 
ATOM   3135 C CA  . LEU A 1 413 ? 7.469   -40.020 19.741  1.00 39.07  ? 414 LEU A CA  1 
ATOM   3136 C C   . LEU A 1 413 ? 8.822   -40.609 20.115  1.00 36.79  ? 414 LEU A C   1 
ATOM   3137 O O   . LEU A 1 413 ? 9.837   -39.913 20.130  1.00 38.99  ? 414 LEU A O   1 
ATOM   3138 C CB  . LEU A 1 413 ? 6.572   -39.906 20.979  1.00 41.04  ? 414 LEU A CB  1 
ATOM   3139 C CG  . LEU A 1 413 ? 7.155   -39.149 22.173  1.00 35.39  ? 414 LEU A CG  1 
ATOM   3140 C CD1 . LEU A 1 413 ? 7.162   -37.671 21.889  1.00 42.84  ? 414 LEU A CD1 1 
ATOM   3141 C CD2 . LEU A 1 413 ? 6.370   -39.433 23.405  1.00 34.44  ? 414 LEU A CD2 1 
ATOM   3142 N N   . ALA A 1 414 ? 8.823   -41.900 20.409  1.00 32.48  ? 415 ALA A N   1 
ATOM   3143 C CA  . ALA A 1 414 ? 10.036  -42.610 20.775  1.00 36.87  ? 415 ALA A CA  1 
ATOM   3144 C C   . ALA A 1 414 ? 11.096  -42.460 19.694  1.00 44.98  ? 415 ALA A C   1 
ATOM   3145 O O   . ALA A 1 414 ? 12.252  -42.138 19.989  1.00 40.85  ? 415 ALA A O   1 
ATOM   3146 C CB  . ALA A 1 414 ? 9.732   -44.098 21.029  1.00 33.26  ? 415 ALA A CB  1 
ATOM   3147 N N   . GLY A 1 415 ? 10.693  -42.678 18.444  1.00 41.08  ? 416 GLY A N   1 
ATOM   3148 C CA  . GLY A 1 415 ? 11.620  -42.635 17.330  1.00 31.70  ? 416 GLY A CA  1 
ATOM   3149 C C   . GLY A 1 415 ? 12.240  -41.264 17.170  1.00 37.73  ? 416 GLY A C   1 
ATOM   3150 O O   . GLY A 1 415 ? 13.459  -41.117 17.045  1.00 38.01  ? 416 GLY A O   1 
ATOM   3151 N N   . ARG A 1 416 ? 11.391  -40.249 17.184  1.00 32.50  ? 417 ARG A N   1 
ATOM   3152 C CA  . ARG A 1 416 ? 11.854  -38.903 16.944  1.00 34.20  ? 417 ARG A CA  1 
ATOM   3153 C C   . ARG A 1 416 ? 12.681  -38.380 18.106  1.00 44.58  ? 417 ARG A C   1 
ATOM   3154 O O   . ARG A 1 416 ? 13.714  -37.743 17.890  1.00 51.56  ? 417 ARG A O   1 
ATOM   3155 C CB  . ARG A 1 416 ? 10.670  -37.980 16.660  1.00 42.80  ? 417 ARG A CB  1 
ATOM   3156 C CG  . ARG A 1 416 ? 10.097  -38.125 15.244  1.00 47.80  ? 417 ARG A CG  1 
ATOM   3157 C CD  . ARG A 1 416 ? 11.208  -38.289 14.195  1.00 49.67  ? 417 ARG A CD  1 
ATOM   3158 N NE  . ARG A 1 416 ? 10.869  -37.620 12.946  1.00 68.23  ? 417 ARG A NE  1 
ATOM   3159 C CZ  . ARG A 1 416 ? 11.341  -36.433 12.572  1.00 67.51  ? 417 ARG A CZ  1 
ATOM   3160 N NH1 . ARG A 1 416 ? 12.193  -35.778 13.348  1.00 56.97  ? 417 ARG A NH1 1 
ATOM   3161 N NH2 . ARG A 1 416 ? 10.964  -35.901 11.411  1.00 74.20  ? 417 ARG A NH2 1 
ATOM   3162 N N   . LEU A 1 417 ? 12.247  -38.653 19.335  1.00 42.72  ? 418 LEU A N   1 
ATOM   3163 C CA  . LEU A 1 417 ? 13.012  -38.206 20.500  1.00 43.89  ? 418 LEU A CA  1 
ATOM   3164 C C   . LEU A 1 417 ? 14.396  -38.838 20.489  1.00 43.14  ? 418 LEU A C   1 
ATOM   3165 O O   . LEU A 1 417 ? 15.378  -38.189 20.849  1.00 47.86  ? 418 LEU A O   1 
ATOM   3166 C CB  . LEU A 1 417 ? 12.295  -38.538 21.816  1.00 34.46  ? 418 LEU A CB  1 
ATOM   3167 C CG  . LEU A 1 417 ? 11.050  -37.722 22.167  1.00 36.37  ? 418 LEU A CG  1 
ATOM   3168 C CD1 . LEU A 1 417 ? 10.557  -38.105 23.538  1.00 36.14  ? 418 LEU A CD1 1 
ATOM   3169 C CD2 . LEU A 1 417 ? 11.347  -36.250 22.112  1.00 40.60  ? 418 LEU A CD2 1 
ATOM   3170 N N   . ALA A 1 418 ? 14.469  -40.099 20.070  1.00 38.43  ? 419 ALA A N   1 
ATOM   3171 C CA  . ALA A 1 418 ? 15.734  -40.818 20.059  1.00 39.68  ? 419 ALA A CA  1 
ATOM   3172 C C   . ALA A 1 418 ? 16.685  -40.199 19.031  1.00 47.29  ? 419 ALA A C   1 
ATOM   3173 O O   . ALA A 1 418 ? 17.819  -39.829 19.355  1.00 46.78  ? 419 ALA A O   1 
ATOM   3174 C CB  . ALA A 1 418 ? 15.508  -42.296 19.774  1.00 33.36  ? 419 ALA A CB  1 
ATOM   3175 N N   . ALA A 1 419 ? 16.201  -40.058 17.804  1.00 46.12  ? 420 ALA A N   1 
ATOM   3176 C CA  . ALA A 1 419 ? 17.005  -39.538 16.708  1.00 45.09  ? 420 ALA A CA  1 
ATOM   3177 C C   . ALA A 1 419 ? 17.486  -38.118 16.960  1.00 52.86  ? 420 ALA A C   1 
ATOM   3178 O O   . ALA A 1 419 ? 18.459  -37.667 16.349  1.00 59.49  ? 420 ALA A O   1 
ATOM   3179 C CB  . ALA A 1 419 ? 16.212  -39.593 15.418  1.00 44.97  ? 420 ALA A CB  1 
ATOM   3180 N N   . GLN A 1 420 ? 16.809  -37.419 17.864  1.00 45.73  ? 421 GLN A N   1 
ATOM   3181 C CA  . GLN A 1 420 ? 17.144  -36.031 18.138  1.00 39.11  ? 421 GLN A CA  1 
ATOM   3182 C C   . GLN A 1 420 ? 17.757  -35.787 19.504  1.00 37.69  ? 421 GLN A C   1 
ATOM   3183 O O   . GLN A 1 420 ? 17.777  -34.649 19.991  1.00 35.74  ? 421 GLN A O   1 
ATOM   3184 C CB  . GLN A 1 420 ? 15.912  -35.170 17.962  1.00 42.48  ? 421 GLN A CB  1 
ATOM   3185 C CG  . GLN A 1 420 ? 15.723  -34.803 16.521  1.00 56.10  ? 421 GLN A CG  1 
ATOM   3186 C CD  . GLN A 1 420 ? 14.297  -34.861 16.108  1.00 51.24  ? 421 GLN A CD  1 
ATOM   3187 O OE1 . GLN A 1 420 ? 13.917  -35.685 15.280  1.00 54.28  ? 421 GLN A OE1 1 
ATOM   3188 N NE2 . GLN A 1 420 ? 13.485  -33.986 16.681  1.00 52.29  ? 421 GLN A NE2 1 
ATOM   3189 N N   . GLY A 1 421 ? 18.262  -36.860 20.111  1.00 36.00  ? 422 GLY A N   1 
ATOM   3190 C CA  . GLY A 1 421 ? 19.166  -36.736 21.239  1.00 43.00  ? 422 GLY A CA  1 
ATOM   3191 C C   . GLY A 1 421 ? 18.720  -37.249 22.591  1.00 49.49  ? 422 GLY A C   1 
ATOM   3192 O O   . GLY A 1 421 ? 19.484  -37.203 23.558  1.00 56.79  ? 422 GLY A O   1 
ATOM   3193 N N   . ALA A 1 422 ? 17.488  -37.728 22.686  1.00 44.02  ? 423 ALA A N   1 
ATOM   3194 C CA  . ALA A 1 422 ? 17.012  -38.217 23.968  1.00 41.15  ? 423 ALA A CA  1 
ATOM   3195 C C   . ALA A 1 422 ? 17.477  -39.646 24.164  1.00 38.47  ? 423 ALA A C   1 
ATOM   3196 O O   . ALA A 1 422 ? 17.597  -40.393 23.192  1.00 46.57  ? 423 ALA A O   1 
ATOM   3197 C CB  . ALA A 1 422 ? 15.490  -38.122 24.049  1.00 37.00  ? 423 ALA A CB  1 
ATOM   3198 N N   . ARG A 1 423 ? 17.754  -40.035 25.404  1.00 31.07  ? 424 ARG A N   1 
ATOM   3199 C CA  . ARG A 1 423 ? 17.899  -41.462 25.681  1.00 36.94  ? 424 ARG A CA  1 
ATOM   3200 C C   . ARG A 1 423 ? 16.522  -42.041 26.047  1.00 40.29  ? 424 ARG A C   1 
ATOM   3201 O O   . ARG A 1 423 ? 15.882  -41.616 27.006  1.00 40.11  ? 424 ARG A O   1 
ATOM   3202 C CB  . ARG A 1 423 ? 18.926  -41.732 26.788  1.00 34.77  ? 424 ARG A CB  1 
ATOM   3203 C CG  . ARG A 1 423 ? 19.349  -43.194 26.831  1.00 40.19  ? 424 ARG A CG  1 
ATOM   3204 C CD  . ARG A 1 423 ? 20.661  -43.431 27.570  1.00 60.95  ? 424 ARG A CD  1 
ATOM   3205 N NE  . ARG A 1 423 ? 20.524  -43.309 29.022  1.00 60.74  ? 424 ARG A NE  1 
ATOM   3206 C CZ  . ARG A 1 423 ? 21.100  -42.355 29.745  1.00 55.97  ? 424 ARG A CZ  1 
ATOM   3207 N NH1 . ARG A 1 423 ? 21.857  -41.441 29.147  1.00 60.75  ? 424 ARG A NH1 1 
ATOM   3208 N NH2 . ARG A 1 423 ? 20.921  -42.317 31.061  1.00 45.64  ? 424 ARG A NH2 1 
ATOM   3209 N N   . VAL A 1 424 ? 16.068  -43.009 25.264  1.00 36.43  ? 425 VAL A N   1 
ATOM   3210 C CA  . VAL A 1 424 ? 14.705  -43.508 25.365  1.00 30.74  ? 425 VAL A CA  1 
ATOM   3211 C C   . VAL A 1 424 ? 14.684  -44.975 25.796  1.00 30.57  ? 425 VAL A C   1 
ATOM   3212 O O   . VAL A 1 424 ? 15.479  -45.770 25.319  1.00 37.80  ? 425 VAL A O   1 
ATOM   3213 C CB  . VAL A 1 424 ? 13.974  -43.348 24.004  1.00 29.22  ? 425 VAL A CB  1 
ATOM   3214 C CG1 . VAL A 1 424 ? 12.565  -43.872 24.072  1.00 31.19  ? 425 VAL A CG1 1 
ATOM   3215 C CG2 . VAL A 1 424 ? 13.981  -41.901 23.572  1.00 29.57  ? 425 VAL A CG2 1 
ATOM   3216 N N   . TYR A 1 425 ? 13.788  -45.339 26.706  1.00 34.98  ? 426 TYR A N   1 
ATOM   3217 C CA  . TYR A 1 425 ? 13.566  -46.757 26.994  1.00 35.05  ? 426 TYR A CA  1 
ATOM   3218 C C   . TYR A 1 425 ? 12.111  -47.114 26.719  1.00 32.72  ? 426 TYR A C   1 
ATOM   3219 O O   . TYR A 1 425 ? 11.206  -46.421 27.180  1.00 38.93  ? 426 TYR A O   1 
ATOM   3220 C CB  . TYR A 1 425 ? 13.940  -47.099 28.435  1.00 29.23  ? 426 TYR A CB  1 
ATOM   3221 C CG  . TYR A 1 425 ? 15.390  -46.846 28.761  1.00 36.03  ? 426 TYR A CG  1 
ATOM   3222 C CD1 . TYR A 1 425 ? 16.342  -47.857 28.635  1.00 33.03  ? 426 TYR A CD1 1 
ATOM   3223 C CD2 . TYR A 1 425 ? 15.813  -45.591 29.187  1.00 30.08  ? 426 TYR A CD2 1 
ATOM   3224 C CE1 . TYR A 1 425 ? 17.677  -47.622 28.929  1.00 31.08  ? 426 TYR A CE1 1 
ATOM   3225 C CE2 . TYR A 1 425 ? 17.143  -45.346 29.486  1.00 35.81  ? 426 TYR A CE2 1 
ATOM   3226 C CZ  . TYR A 1 425 ? 18.072  -46.362 29.359  1.00 42.49  ? 426 TYR A CZ  1 
ATOM   3227 O OH  . TYR A 1 425 ? 19.394  -46.110 29.663  1.00 45.03  ? 426 TYR A OH  1 
ATOM   3228 N N   . ALA A 1 426 ? 11.895  -48.182 25.954  1.00 33.79  ? 427 ALA A N   1 
ATOM   3229 C CA  . ALA A 1 426 ? 10.548  -48.586 25.567  1.00 32.58  ? 427 ALA A CA  1 
ATOM   3230 C C   . ALA A 1 426 ? 10.171  -49.966 26.105  1.00 34.74  ? 427 ALA A C   1 
ATOM   3231 O O   . ALA A 1 426 ? 11.003  -50.870 26.198  1.00 39.83  ? 427 ALA A O   1 
ATOM   3232 C CB  . ALA A 1 426 ? 10.409  -48.557 24.061  1.00 27.10  ? 427 ALA A CB  1 
ATOM   3233 N N   . TYR A 1 427 ? 8.902   -50.126 26.454  1.00 34.50  ? 428 TYR A N   1 
ATOM   3234 C CA  . TYR A 1 427 ? 8.416   -51.409 26.940  1.00 36.05  ? 428 TYR A CA  1 
ATOM   3235 C C   . TYR A 1 427 ? 7.051   -51.740 26.353  1.00 33.85  ? 428 TYR A C   1 
ATOM   3236 O O   . TYR A 1 427 ? 6.308   -50.855 25.931  1.00 34.80  ? 428 TYR A O   1 
ATOM   3237 C CB  . TYR A 1 427 ? 8.324   -51.408 28.470  1.00 26.52  ? 428 TYR A CB  1 
ATOM   3238 C CG  . TYR A 1 427 ? 7.276   -50.452 29.002  1.00 33.09  ? 428 TYR A CG  1 
ATOM   3239 C CD1 . TYR A 1 427 ? 5.941   -50.834 29.110  1.00 32.16  ? 428 TYR A CD1 1 
ATOM   3240 C CD2 . TYR A 1 427 ? 7.618   -49.161 29.388  1.00 32.91  ? 428 TYR A CD2 1 
ATOM   3241 C CE1 . TYR A 1 427 ? 4.975   -49.956 29.580  1.00 32.53  ? 428 TYR A CE1 1 
ATOM   3242 C CE2 . TYR A 1 427 ? 6.663   -48.279 29.874  1.00 28.36  ? 428 TYR A CE2 1 
ATOM   3243 C CZ  . TYR A 1 427 ? 5.342   -48.679 29.965  1.00 33.96  ? 428 TYR A CZ  1 
ATOM   3244 O OH  . TYR A 1 427 ? 4.389   -47.802 30.436  1.00 32.75  ? 428 TYR A OH  1 
ATOM   3245 N N   . VAL A 1 428 ? 6.723   -53.023 26.346  1.00 35.14  ? 429 VAL A N   1 
ATOM   3246 C CA  . VAL A 1 428 ? 5.352   -53.451 26.135  1.00 38.33  ? 429 VAL A CA  1 
ATOM   3247 C C   . VAL A 1 428 ? 4.948   -54.273 27.338  1.00 37.85  ? 429 VAL A C   1 
ATOM   3248 O O   . VAL A 1 428 ? 5.609   -55.249 27.672  1.00 42.93  ? 429 VAL A O   1 
ATOM   3249 C CB  . VAL A 1 428 ? 5.174   -54.280 24.856  1.00 38.61  ? 429 VAL A CB  1 
ATOM   3250 C CG1 . VAL A 1 428 ? 3.782   -54.871 24.811  1.00 31.27  ? 429 VAL A CG1 1 
ATOM   3251 C CG2 . VAL A 1 428 ? 5.415   -53.414 23.647  1.00 45.04  ? 429 VAL A CG2 1 
ATOM   3252 N N   . PHE A 1 429 ? 3.867   -53.866 27.987  1.00 32.74  ? 430 PHE A N   1 
ATOM   3253 C CA  . PHE A 1 429 ? 3.402   -54.520 29.201  1.00 38.70  ? 430 PHE A CA  1 
ATOM   3254 C C   . PHE A 1 429 ? 2.475   -55.685 28.842  1.00 43.60  ? 430 PHE A C   1 
ATOM   3255 O O   . PHE A 1 429 ? 1.404   -55.480 28.260  1.00 39.60  ? 430 PHE A O   1 
ATOM   3256 C CB  . PHE A 1 429 ? 2.694   -53.502 30.101  1.00 31.32  ? 430 PHE A CB  1 
ATOM   3257 C CG  . PHE A 1 429 ? 2.296   -54.046 31.430  1.00 37.37  ? 430 PHE A CG  1 
ATOM   3258 C CD1 . PHE A 1 429 ? 3.185   -54.027 32.493  1.00 40.51  ? 430 PHE A CD1 1 
ATOM   3259 C CD2 . PHE A 1 429 ? 1.030   -54.578 31.623  1.00 39.54  ? 430 PHE A CD2 1 
ATOM   3260 C CE1 . PHE A 1 429 ? 2.823   -54.535 33.724  1.00 35.50  ? 430 PHE A CE1 1 
ATOM   3261 C CE2 . PHE A 1 429 ? 0.660   -55.081 32.849  1.00 38.87  ? 430 PHE A CE2 1 
ATOM   3262 C CZ  . PHE A 1 429 ? 1.559   -55.061 33.905  1.00 39.25  ? 430 PHE A CZ  1 
ATOM   3263 N N   . GLU A 1 430 ? 2.878   -56.903 29.194  1.00 41.40  ? 431 GLU A N   1 
ATOM   3264 C CA  . GLU A 1 430 ? 2.204   -58.078 28.655  1.00 41.48  ? 431 GLU A CA  1 
ATOM   3265 C C   . GLU A 1 430 ? 1.525   -58.973 29.677  1.00 45.45  ? 431 GLU A C   1 
ATOM   3266 O O   . GLU A 1 430 ? 0.992   -60.017 29.317  1.00 46.01  ? 431 GLU A O   1 
ATOM   3267 C CB  . GLU A 1 430 ? 3.194   -58.905 27.844  1.00 42.47  ? 431 GLU A CB  1 
ATOM   3268 C CG  . GLU A 1 430 ? 3.457   -58.312 26.462  1.00 54.44  ? 431 GLU A CG  1 
ATOM   3269 C CD  . GLU A 1 430 ? 4.345   -59.183 25.599  1.00 65.48  ? 431 GLU A CD  1 
ATOM   3270 O OE1 . GLU A 1 430 ? 4.096   -59.246 24.370  1.00 70.34  ? 431 GLU A OE1 1 
ATOM   3271 O OE2 . GLU A 1 430 ? 5.289   -59.799 26.149  1.00 75.57  ? 431 GLU A OE2 1 
ATOM   3272 N N   . HIS A 1 431 ? 1.511   -58.566 30.940  1.00 45.51  ? 432 HIS A N   1 
ATOM   3273 C CA  . HIS A 1 431 ? 0.870   -59.389 31.951  1.00 35.38  ? 432 HIS A CA  1 
ATOM   3274 C C   . HIS A 1 431 ? -0.578  -58.993 32.185  1.00 44.63  ? 432 HIS A C   1 
ATOM   3275 O O   . HIS A 1 431 ? -0.891  -57.833 32.439  1.00 43.18  ? 432 HIS A O   1 
ATOM   3276 C CB  . HIS A 1 431 ? 1.623   -59.324 33.272  1.00 43.64  ? 432 HIS A CB  1 
ATOM   3277 C CG  . HIS A 1 431 ? 0.969   -60.108 34.366  1.00 50.23  ? 432 HIS A CG  1 
ATOM   3278 N ND1 . HIS A 1 431 ? 0.999   -61.485 34.415  1.00 52.85  ? 432 HIS A ND1 1 
ATOM   3279 C CD2 . HIS A 1 431 ? 0.248   -59.706 35.441  1.00 43.34  ? 432 HIS A CD2 1 
ATOM   3280 C CE1 . HIS A 1 431 ? 0.337   -61.899 35.480  1.00 47.62  ? 432 HIS A CE1 1 
ATOM   3281 N NE2 . HIS A 1 431 ? -0.130  -60.840 36.120  1.00 51.39  ? 432 HIS A NE2 1 
ATOM   3282 N N   . ARG A 1 432 ? -1.462  -59.977 32.107  1.00 47.43  ? 433 ARG A N   1 
ATOM   3283 C CA  . ARG A 1 432 ? -2.854  -59.755 32.438  1.00 43.89  ? 433 ARG A CA  1 
ATOM   3284 C C   . ARG A 1 432 ? -3.067  -60.013 33.930  1.00 46.23  ? 433 ARG A C   1 
ATOM   3285 O O   . ARG A 1 432 ? -2.770  -61.098 34.435  1.00 44.57  ? 433 ARG A O   1 
ATOM   3286 C CB  . ARG A 1 432 ? -3.750  -60.654 31.590  1.00 46.08  ? 433 ARG A CB  1 
ATOM   3287 C CG  . ARG A 1 432 ? -5.221  -60.432 31.816  1.00 45.16  ? 433 ARG A CG  1 
ATOM   3288 C CD  . ARG A 1 432 ? -6.046  -61.465 31.088  1.00 43.65  ? 433 ARG A CD  1 
ATOM   3289 N NE  . ARG A 1 432 ? -7.415  -61.481 31.594  1.00 51.51  ? 433 ARG A NE  1 
ATOM   3290 C CZ  . ARG A 1 432 ? -8.424  -60.816 31.044  1.00 53.91  ? 433 ARG A CZ  1 
ATOM   3291 N NH1 . ARG A 1 432 ? -8.226  -60.084 29.949  1.00 40.39  ? 433 ARG A NH1 1 
ATOM   3292 N NH2 . ARG A 1 432 ? -9.635  -60.892 31.584  1.00 55.30  ? 433 ARG A NH2 1 
ATOM   3293 N N   . ALA A 1 433 ? -3.568  -59.006 34.634  1.00 47.25  ? 434 ALA A N   1 
ATOM   3294 C CA  . ALA A 1 433 ? -3.791  -59.113 36.070  1.00 50.43  ? 434 ALA A CA  1 
ATOM   3295 C C   . ALA A 1 433 ? -4.729  -60.264 36.435  1.00 51.02  ? 434 ALA A C   1 
ATOM   3296 O O   . ALA A 1 433 ? -5.830  -60.377 35.895  1.00 48.47  ? 434 ALA A O   1 
ATOM   3297 C CB  . ALA A 1 433 ? -4.341  -57.801 36.602  1.00 55.78  ? 434 ALA A CB  1 
ATOM   3298 N N   . SER A 1 434 ? -4.292  -61.104 37.369  1.00 45.40  ? 435 SER A N   1 
ATOM   3299 C CA  . SER A 1 434 ? -5.109  -62.216 37.857  1.00 40.22  ? 435 SER A CA  1 
ATOM   3300 C C   . SER A 1 434 ? -6.463  -61.752 38.415  1.00 42.34  ? 435 SER A C   1 
ATOM   3301 O O   . SER A 1 434 ? -7.388  -62.546 38.528  1.00 42.02  ? 435 SER A O   1 
ATOM   3302 C CB  . SER A 1 434 ? -4.353  -63.007 38.939  1.00 43.12  ? 435 SER A CB  1 
ATOM   3303 O OG  . SER A 1 434 ? -4.414  -62.358 40.207  1.00 41.81  ? 435 SER A OG  1 
ATOM   3304 N N   . THR A 1 435 ? -6.572  -60.470 38.750  1.00 42.19  ? 436 THR A N   1 
ATOM   3305 C CA  . THR A 1 435 ? -7.779  -59.914 39.356  1.00 40.37  ? 436 THR A CA  1 
ATOM   3306 C C   . THR A 1 435 ? -8.640  -59.146 38.347  1.00 46.55  ? 436 THR A C   1 
ATOM   3307 O O   . THR A 1 435 ? -9.600  -58.460 38.717  1.00 48.68  ? 436 THR A O   1 
ATOM   3308 C CB  . THR A 1 435 ? -7.413  -58.974 40.523  1.00 47.79  ? 436 THR A CB  1 
ATOM   3309 O OG1 . THR A 1 435 ? -6.774  -57.790 40.016  1.00 46.20  ? 436 THR A OG1 1 
ATOM   3310 C CG2 . THR A 1 435 ? -6.461  -59.675 41.481  1.00 53.39  ? 436 THR A CG2 1 
ATOM   3311 N N   . LEU A 1 436 ? -8.295  -59.266 37.071  1.00 43.72  ? 437 LEU A N   1 
ATOM   3312 C CA  . LEU A 1 436 ? -8.935  -58.466 36.038  1.00 38.79  ? 437 LEU A CA  1 
ATOM   3313 C C   . LEU A 1 436 ? -10.369 -58.912 35.787  1.00 50.08  ? 437 LEU A C   1 
ATOM   3314 O O   . LEU A 1 436 ? -10.627 -60.088 35.509  1.00 52.11  ? 437 LEU A O   1 
ATOM   3315 C CB  . LEU A 1 436 ? -8.119  -58.532 34.748  1.00 47.76  ? 437 LEU A CB  1 
ATOM   3316 C CG  . LEU A 1 436 ? -8.476  -57.558 33.625  1.00 44.91  ? 437 LEU A CG  1 
ATOM   3317 C CD1 . LEU A 1 436 ? -8.647  -56.154 34.148  1.00 47.92  ? 437 LEU A CD1 1 
ATOM   3318 C CD2 . LEU A 1 436 ? -7.392  -57.591 32.586  1.00 54.37  ? 437 LEU A CD2 1 
ATOM   3319 N N   . SER A 1 437 ? -11.295 -57.958 35.875  1.00 50.36  ? 438 SER A N   1 
ATOM   3320 C CA  . SER A 1 437 ? -12.726 -58.243 35.776  1.00 52.29  ? 438 SER A CA  1 
ATOM   3321 C C   . SER A 1 437 ? -13.284 -58.087 34.356  1.00 51.35  ? 438 SER A C   1 
ATOM   3322 O O   . SER A 1 437 ? -14.442 -58.433 34.094  1.00 52.46  ? 438 SER A O   1 
ATOM   3323 C CB  . SER A 1 437 ? -13.509 -57.347 36.747  1.00 56.10  ? 438 SER A CB  1 
ATOM   3324 O OG  . SER A 1 437 ? -13.281 -55.972 36.494  1.00 56.23  ? 438 SER A OG  1 
ATOM   3325 N N   . TRP A 1 438 ? -12.467 -57.570 33.442  1.00 50.62  ? 439 TRP A N   1 
ATOM   3326 C CA  . TRP A 1 438 ? -12.833 -57.540 32.026  1.00 51.44  ? 439 TRP A CA  1 
ATOM   3327 C C   . TRP A 1 438 ? -12.647 -58.931 31.399  1.00 53.12  ? 439 TRP A C   1 
ATOM   3328 O O   . TRP A 1 438 ? -11.861 -59.743 31.896  1.00 41.00  ? 439 TRP A O   1 
ATOM   3329 C CB  . TRP A 1 438 ? -12.010 -56.494 31.273  1.00 52.65  ? 439 TRP A CB  1 
ATOM   3330 C CG  . TRP A 1 438 ? -12.272 -55.068 31.693  1.00 52.52  ? 439 TRP A CG  1 
ATOM   3331 C CD1 . TRP A 1 438 ? -11.529 -54.325 32.564  1.00 46.10  ? 439 TRP A CD1 1 
ATOM   3332 C CD2 . TRP A 1 438 ? -13.329 -54.209 31.241  1.00 45.00  ? 439 TRP A CD2 1 
ATOM   3333 N NE1 . TRP A 1 438 ? -12.060 -53.068 32.691  1.00 46.07  ? 439 TRP A NE1 1 
ATOM   3334 C CE2 . TRP A 1 438 ? -13.167 -52.966 31.891  1.00 46.63  ? 439 TRP A CE2 1 
ATOM   3335 C CE3 . TRP A 1 438 ? -14.395 -54.367 30.350  1.00 44.78  ? 439 TRP A CE3 1 
ATOM   3336 C CZ2 . TRP A 1 438 ? -14.030 -51.886 31.685  1.00 43.62  ? 439 TRP A CZ2 1 
ATOM   3337 C CZ3 . TRP A 1 438 ? -15.258 -53.287 30.143  1.00 53.45  ? 439 TRP A CZ3 1 
ATOM   3338 C CH2 . TRP A 1 438 ? -15.066 -52.065 30.810  1.00 48.88  ? 439 TRP A CH2 1 
ATOM   3339 N N   . PRO A 1 439 ? -13.382 -59.213 30.308  1.00 53.30  ? 440 PRO A N   1 
ATOM   3340 C CA  . PRO A 1 439 ? -13.350 -60.535 29.665  1.00 49.28  ? 440 PRO A CA  1 
ATOM   3341 C C   . PRO A 1 439 ? -11.988 -60.942 29.109  1.00 56.09  ? 440 PRO A C   1 
ATOM   3342 O O   . PRO A 1 439 ? -11.134 -60.107 28.819  1.00 54.12  ? 440 PRO A O   1 
ATOM   3343 C CB  . PRO A 1 439 ? -14.362 -60.396 28.522  1.00 46.46  ? 440 PRO A CB  1 
ATOM   3344 C CG  . PRO A 1 439 ? -14.465 -58.940 28.275  1.00 56.63  ? 440 PRO A CG  1 
ATOM   3345 C CD  . PRO A 1 439 ? -14.315 -58.303 29.621  1.00 52.21  ? 440 PRO A CD  1 
ATOM   3346 N N   . LEU A 1 440 ? -11.817 -62.245 28.936  1.00 58.23  ? 441 LEU A N   1 
ATOM   3347 C CA  . LEU A 1 440 ? -10.568 -62.811 28.461  1.00 49.50  ? 441 LEU A CA  1 
ATOM   3348 C C   . LEU A 1 440 ? -10.141 -62.292 27.070  1.00 54.87  ? 441 LEU A C   1 
ATOM   3349 O O   . LEU A 1 440 ? -8.939  -62.185 26.783  1.00 47.29  ? 441 LEU A O   1 
ATOM   3350 C CB  . LEU A 1 440 ? -10.697 -64.329 28.450  1.00 56.61  ? 441 LEU A CB  1 
ATOM   3351 C CG  . LEU A 1 440 ? -9.414  -65.144 28.553  1.00 64.02  ? 441 LEU A CG  1 
ATOM   3352 C CD1 . LEU A 1 440 ? -8.712  -64.814 29.846  1.00 52.10  ? 441 LEU A CD1 1 
ATOM   3353 C CD2 . LEU A 1 440 ? -9.737  -66.629 28.469  1.00 58.10  ? 441 LEU A CD2 1 
ATOM   3354 N N   . TRP A 1 441 ? -11.111 -61.946 26.221  1.00 45.60  ? 442 TRP A N   1 
ATOM   3355 C CA  . TRP A 1 441 ? -10.800 -61.551 24.846  1.00 52.69  ? 442 TRP A CA  1 
ATOM   3356 C C   . TRP A 1 441 ? -10.165 -60.168 24.741  1.00 50.20  ? 442 TRP A C   1 
ATOM   3357 O O   . TRP A 1 441 ? -9.638  -59.793 23.687  1.00 50.01  ? 442 TRP A O   1 
ATOM   3358 C CB  . TRP A 1 441 ? -12.056 -61.608 23.960  1.00 51.39  ? 442 TRP A CB  1 
ATOM   3359 C CG  . TRP A 1 441 ? -13.130 -60.586 24.247  1.00 51.87  ? 442 TRP A CG  1 
ATOM   3360 C CD1 . TRP A 1 441 ? -14.284 -60.789 24.949  1.00 61.43  ? 442 TRP A CD1 1 
ATOM   3361 C CD2 . TRP A 1 441 ? -13.168 -59.220 23.807  1.00 46.43  ? 442 TRP A CD2 1 
ATOM   3362 N NE1 . TRP A 1 441 ? -15.031 -59.632 24.985  1.00 49.59  ? 442 TRP A NE1 1 
ATOM   3363 C CE2 . TRP A 1 441 ? -14.366 -58.654 24.291  1.00 47.82  ? 442 TRP A CE2 1 
ATOM   3364 C CE3 . TRP A 1 441 ? -12.303 -58.418 23.055  1.00 50.36  ? 442 TRP A CE3 1 
ATOM   3365 C CZ2 . TRP A 1 441 ? -14.721 -57.324 24.054  1.00 56.11  ? 442 TRP A CZ2 1 
ATOM   3366 C CZ3 . TRP A 1 441 ? -12.659 -57.093 22.817  1.00 59.48  ? 442 TRP A CZ3 1 
ATOM   3367 C CH2 . TRP A 1 441 ? -13.857 -56.561 23.316  1.00 52.83  ? 442 TRP A CH2 1 
ATOM   3368 N N   . MET A 1 442 ? -10.218 -59.408 25.826  1.00 52.16  ? 443 MET A N   1 
ATOM   3369 C CA  . MET A 1 442 ? -9.633  -58.074 25.837  1.00 52.96  ? 443 MET A CA  1 
ATOM   3370 C C   . MET A 1 442 ? -8.127  -58.092 26.119  1.00 52.15  ? 443 MET A C   1 
ATOM   3371 O O   . MET A 1 442 ? -7.439  -57.092 25.909  1.00 49.76  ? 443 MET A O   1 
ATOM   3372 C CB  . MET A 1 442 ? -10.336 -57.198 26.863  1.00 50.46  ? 443 MET A CB  1 
ATOM   3373 C CG  . MET A 1 442 ? -11.715 -56.743 26.456  1.00 46.12  ? 443 MET A CG  1 
ATOM   3374 S SD  . MET A 1 442 ? -12.274 -55.469 27.599  1.00 54.01  ? 443 MET A SD  1 
ATOM   3375 C CE  . MET A 1 442 ? -13.685 -54.803 26.727  1.00 51.74  ? 443 MET A CE  1 
ATOM   3376 N N   . GLY A 1 443 ? -7.622  -59.226 26.590  1.00 46.78  ? 444 GLY A N   1 
ATOM   3377 C CA  . GLY A 1 443 ? -6.200  -59.380 26.836  1.00 44.07  ? 444 GLY A CA  1 
ATOM   3378 C C   . GLY A 1 443 ? -5.669  -58.513 27.965  1.00 49.19  ? 444 GLY A C   1 
ATOM   3379 O O   . GLY A 1 443 ? -6.140  -58.582 29.102  1.00 49.92  ? 444 GLY A O   1 
ATOM   3380 N N   . VAL A 1 444 ? -4.659  -57.712 27.647  1.00 43.08  ? 445 VAL A N   1 
ATOM   3381 C CA  . VAL A 1 444 ? -4.127  -56.735 28.579  1.00 38.88  ? 445 VAL A CA  1 
ATOM   3382 C C   . VAL A 1 444 ? -4.623  -55.362 28.167  1.00 38.66  ? 445 VAL A C   1 
ATOM   3383 O O   . VAL A 1 444 ? -4.031  -54.727 27.303  1.00 42.37  ? 445 VAL A O   1 
ATOM   3384 C CB  . VAL A 1 444 ? -2.597  -56.744 28.599  1.00 47.05  ? 445 VAL A CB  1 
ATOM   3385 C CG1 . VAL A 1 444 ? -2.073  -55.904 29.770  1.00 37.27  ? 445 VAL A CG1 1 
ATOM   3386 C CG2 . VAL A 1 444 ? -2.083  -58.174 28.670  1.00 42.08  ? 445 VAL A CG2 1 
ATOM   3387 N N   . PRO A 1 445 ? -5.725  -54.905 28.771  1.00 38.75  ? 446 PRO A N   1 
ATOM   3388 C CA  . PRO A 1 445 ? -6.382  -53.675 28.324  1.00 39.80  ? 446 PRO A CA  1 
ATOM   3389 C C   . PRO A 1 445 ? -5.722  -52.400 28.834  1.00 40.87  ? 446 PRO A C   1 
ATOM   3390 O O   . PRO A 1 445 ? -4.971  -52.403 29.812  1.00 35.13  ? 446 PRO A O   1 
ATOM   3391 C CB  . PRO A 1 445 ? -7.801  -53.803 28.900  1.00 38.60  ? 446 PRO A CB  1 
ATOM   3392 C CG  . PRO A 1 445 ? -7.884  -55.202 29.461  1.00 45.05  ? 446 PRO A CG  1 
ATOM   3393 C CD  . PRO A 1 445 ? -6.499  -55.573 29.822  1.00 37.10  ? 446 PRO A CD  1 
ATOM   3394 N N   . HIS A 1 446 ? -6.032  -51.308 28.147  1.00 48.99  ? 447 HIS A N   1 
ATOM   3395 C CA  . HIS A 1 446 ? -5.540  -49.983 28.488  1.00 40.71  ? 447 HIS A CA  1 
ATOM   3396 C C   . HIS A 1 446 ? -5.735  -49.640 29.965  1.00 48.04  ? 447 HIS A C   1 
ATOM   3397 O O   . HIS A 1 446 ? -6.841  -49.744 30.514  1.00 41.10  ? 447 HIS A O   1 
ATOM   3398 C CB  . HIS A 1 446 ? -6.239  -48.953 27.612  1.00 40.06  ? 447 HIS A CB  1 
ATOM   3399 C CG  . HIS A 1 446 ? -5.845  -47.541 27.898  1.00 49.74  ? 447 HIS A CG  1 
ATOM   3400 N ND1 . HIS A 1 446 ? -4.768  -46.934 27.291  1.00 49.09  ? 447 HIS A ND1 1 
ATOM   3401 C CD2 . HIS A 1 446 ? -6.401  -46.610 28.708  1.00 52.20  ? 447 HIS A CD2 1 
ATOM   3402 C CE1 . HIS A 1 446 ? -4.670  -45.688 27.722  1.00 49.70  ? 447 HIS A CE1 1 
ATOM   3403 N NE2 . HIS A 1 446 ? -5.647  -45.467 28.584  1.00 61.30  ? 447 HIS A NE2 1 
ATOM   3404 N N   . GLY A 1 447 ? -4.643  -49.240 30.604  1.00 46.83  ? 448 GLY A N   1 
ATOM   3405 C CA  . GLY A 1 447 ? -4.710  -48.762 31.967  1.00 39.78  ? 448 GLY A CA  1 
ATOM   3406 C C   . GLY A 1 447 ? -4.420  -49.795 33.035  1.00 34.79  ? 448 GLY A C   1 
ATOM   3407 O O   . GLY A 1 447 ? -4.447  -49.464 34.208  1.00 40.58  ? 448 GLY A O   1 
ATOM   3408 N N   . TYR A 1 448 ? -4.120  -51.034 32.656  1.00 40.25  ? 449 TYR A N   1 
ATOM   3409 C CA  . TYR A 1 448 ? -3.979  -52.068 33.674  1.00 36.02  ? 449 TYR A CA  1 
ATOM   3410 C C   . TYR A 1 448 ? -2.534  -52.466 33.956  1.00 42.41  ? 449 TYR A C   1 
ATOM   3411 O O   . TYR A 1 448 ? -2.268  -53.526 34.523  1.00 47.61  ? 449 TYR A O   1 
ATOM   3412 C CB  . TYR A 1 448 ? -4.843  -53.273 33.300  1.00 32.46  ? 449 TYR A CB  1 
ATOM   3413 C CG  . TYR A 1 448 ? -6.272  -52.944 33.620  1.00 40.32  ? 449 TYR A CG  1 
ATOM   3414 C CD1 . TYR A 1 448 ? -6.781  -53.162 34.896  1.00 40.29  ? 449 TYR A CD1 1 
ATOM   3415 C CD2 . TYR A 1 448 ? -7.085  -52.316 32.686  1.00 34.13  ? 449 TYR A CD2 1 
ATOM   3416 C CE1 . TYR A 1 448 ? -8.078  -52.811 35.216  1.00 40.54  ? 449 TYR A CE1 1 
ATOM   3417 C CE2 . TYR A 1 448 ? -8.379  -51.959 32.997  1.00 38.82  ? 449 TYR A CE2 1 
ATOM   3418 C CZ  . TYR A 1 448 ? -8.872  -52.207 34.262  1.00 42.77  ? 449 TYR A CZ  1 
ATOM   3419 O OH  . TYR A 1 448 ? -10.165 -51.851 34.573  1.00 42.78  ? 449 TYR A OH  1 
ATOM   3420 N N   . GLU A 1 449 ? -1.609  -51.583 33.598  1.00 39.58  ? 450 GLU A N   1 
ATOM   3421 C CA  . GLU A 1 449 ? -0.236  -51.689 34.073  1.00 39.17  ? 450 GLU A CA  1 
ATOM   3422 C C   . GLU A 1 449 ? -0.073  -50.804 35.314  1.00 40.20  ? 450 GLU A C   1 
ATOM   3423 O O   . GLU A 1 449 ? 0.807   -51.036 36.148  1.00 38.66  ? 450 GLU A O   1 
ATOM   3424 C CB  . GLU A 1 449 ? 0.758   -51.287 32.972  1.00 32.16  ? 450 GLU A CB  1 
ATOM   3425 C CG  . GLU A 1 449 ? 1.008   -49.785 32.813  1.00 42.74  ? 450 GLU A CG  1 
ATOM   3426 C CD  . GLU A 1 449 ? -0.151  -49.019 32.171  1.00 49.27  ? 450 GLU A CD  1 
ATOM   3427 O OE1 . GLU A 1 449 ? -1.312  -49.476 32.255  1.00 49.83  ? 450 GLU A OE1 1 
ATOM   3428 O OE2 . GLU A 1 449 ? 0.107   -47.945 31.581  1.00 50.10  ? 450 GLU A OE2 1 
ATOM   3429 N N   . ILE A 1 450 ? -0.947  -49.807 35.436  1.00 37.68  ? 451 ILE A N   1 
ATOM   3430 C CA  . ILE A 1 450 ? -0.851  -48.811 36.494  1.00 33.07  ? 451 ILE A CA  1 
ATOM   3431 C C   . ILE A 1 450 ? -0.808  -49.430 37.896  1.00 37.58  ? 451 ILE A C   1 
ATOM   3432 O O   . ILE A 1 450 ? 0.046   -49.078 38.713  1.00 37.03  ? 451 ILE A O   1 
ATOM   3433 C CB  . ILE A 1 450 ? -2.017  -47.826 36.436  1.00 33.44  ? 451 ILE A CB  1 
ATOM   3434 C CG1 . ILE A 1 450 ? -2.113  -47.179 35.057  1.00 37.97  ? 451 ILE A CG1 1 
ATOM   3435 C CG2 . ILE A 1 450 ? -1.857  -46.762 37.495  1.00 32.64  ? 451 ILE A CG2 1 
ATOM   3436 C CD1 . ILE A 1 450 ? -3.197  -46.127 34.969  1.00 28.16  ? 451 ILE A CD1 1 
ATOM   3437 N N   . GLU A 1 451 ? -1.715  -50.360 38.168  1.00 36.91  ? 452 GLU A N   1 
ATOM   3438 C CA  . GLU A 1 451 ? -1.803  -50.962 39.497  1.00 36.74  ? 452 GLU A CA  1 
ATOM   3439 C C   . GLU A 1 451 ? -0.502  -51.661 39.881  1.00 38.60  ? 452 GLU A C   1 
ATOM   3440 O O   . GLU A 1 451 ? -0.125  -51.691 41.056  1.00 36.20  ? 452 GLU A O   1 
ATOM   3441 C CB  . GLU A 1 451 ? -2.971  -51.942 39.559  1.00 42.14  ? 452 GLU A CB  1 
ATOM   3442 C CG  . GLU A 1 451 ? -2.915  -53.052 38.513  1.00 45.97  ? 452 GLU A CG  1 
ATOM   3443 C CD  . GLU A 1 451 ? -4.264  -53.730 38.298  1.00 54.77  ? 452 GLU A CD  1 
ATOM   3444 O OE1 . GLU A 1 451 ? -4.271  -54.926 37.942  1.00 62.60  ? 452 GLU A OE1 1 
ATOM   3445 O OE2 . GLU A 1 451 ? -5.314  -53.069 38.479  1.00 59.01  ? 452 GLU A OE2 1 
ATOM   3446 N N   . PHE A 1 452 ? 0.197   -52.201 38.891  1.00 30.15  ? 453 PHE A N   1 
ATOM   3447 C CA  . PHE A 1 452 ? 1.497   -52.794 39.154  1.00 36.05  ? 453 PHE A CA  1 
ATOM   3448 C C   . PHE A 1 452 ? 2.594   -51.760 39.387  1.00 39.25  ? 453 PHE A C   1 
ATOM   3449 O O   . PHE A 1 452 ? 3.488   -51.995 40.190  1.00 37.23  ? 453 PHE A O   1 
ATOM   3450 C CB  . PHE A 1 452 ? 1.884   -53.732 38.019  1.00 31.06  ? 453 PHE A CB  1 
ATOM   3451 C CG  . PHE A 1 452 ? 1.073   -54.969 38.007  1.00 41.21  ? 453 PHE A CG  1 
ATOM   3452 C CD1 . PHE A 1 452 ? -0.080  -55.041 37.250  1.00 35.73  ? 453 PHE A CD1 1 
ATOM   3453 C CD2 . PHE A 1 452 ? 1.419   -56.040 38.815  1.00 42.36  ? 453 PHE A CD2 1 
ATOM   3454 C CE1 . PHE A 1 452 ? -0.853  -56.176 37.269  1.00 38.02  ? 453 PHE A CE1 1 
ATOM   3455 C CE2 . PHE A 1 452 ? 0.652   -57.178 38.837  1.00 37.74  ? 453 PHE A CE2 1 
ATOM   3456 C CZ  . PHE A 1 452 ? -0.484  -57.250 38.060  1.00 40.20  ? 453 PHE A CZ  1 
ATOM   3457 N N   . ILE A 1 453 ? 2.541   -50.621 38.702  1.00 34.95  ? 454 ILE A N   1 
ATOM   3458 C CA  . ILE A 1 453 ? 3.585   -49.631 38.912  1.00 33.52  ? 454 ILE A CA  1 
ATOM   3459 C C   . ILE A 1 453 ? 3.478   -49.055 40.317  1.00 37.21  ? 454 ILE A C   1 
ATOM   3460 O O   . ILE A 1 453 ? 4.491   -48.811 40.982  1.00 33.58  ? 454 ILE A O   1 
ATOM   3461 C CB  . ILE A 1 453 ? 3.529   -48.488 37.907  1.00 36.71  ? 454 ILE A CB  1 
ATOM   3462 C CG1 . ILE A 1 453 ? 3.502   -49.026 36.475  1.00 36.46  ? 454 ILE A CG1 1 
ATOM   3463 C CG2 . ILE A 1 453 ? 4.735   -47.601 38.099  1.00 27.03  ? 454 ILE A CG2 1 
ATOM   3464 C CD1 . ILE A 1 453 ? 4.727   -49.810 36.110  1.00 38.12  ? 454 ILE A CD1 1 
ATOM   3465 N N   . PHE A 1 454 ? 2.247   -48.859 40.778  1.00 32.34  ? 455 PHE A N   1 
ATOM   3466 C CA  . PHE A 1 454 ? 2.031   -48.295 42.104  1.00 31.10  ? 455 PHE A CA  1 
ATOM   3467 C C   . PHE A 1 454 ? 2.141   -49.343 43.213  1.00 36.07  ? 455 PHE A C   1 
ATOM   3468 O O   . PHE A 1 454 ? 2.069   -49.010 44.398  1.00 38.68  ? 455 PHE A O   1 
ATOM   3469 C CB  . PHE A 1 454 ? 0.683   -47.584 42.161  1.00 21.85  ? 455 PHE A CB  1 
ATOM   3470 C CG  . PHE A 1 454 ? 0.718   -46.202 41.581  1.00 24.54  ? 455 PHE A CG  1 
ATOM   3471 C CD1 . PHE A 1 454 ? 0.651   -46.007 40.210  1.00 29.95  ? 455 PHE A CD1 1 
ATOM   3472 C CD2 . PHE A 1 454 ? 0.840   -45.095 42.399  1.00 24.80  ? 455 PHE A CD2 1 
ATOM   3473 C CE1 . PHE A 1 454 ? 0.687   -44.731 39.667  1.00 28.64  ? 455 PHE A CE1 1 
ATOM   3474 C CE2 . PHE A 1 454 ? 0.876   -43.822 41.869  1.00 29.05  ? 455 PHE A CE2 1 
ATOM   3475 C CZ  . PHE A 1 454 ? 0.798   -43.637 40.497  1.00 30.80  ? 455 PHE A CZ  1 
ATOM   3476 N N   . GLY A 1 455 ? 2.345   -50.599 42.826  1.00 34.86  ? 456 GLY A N   1 
ATOM   3477 C CA  . GLY A 1 455 ? 2.595   -51.660 43.782  1.00 32.94  ? 456 GLY A CA  1 
ATOM   3478 C C   . GLY A 1 455 ? 1.350   -52.095 44.535  1.00 41.60  ? 456 GLY A C   1 
ATOM   3479 O O   . GLY A 1 455 ? 1.439   -52.639 45.634  1.00 39.54  ? 456 GLY A O   1 
ATOM   3480 N N   . ILE A 1 456 ? 0.182   -51.858 43.949  1.00 34.77  ? 457 ILE A N   1 
ATOM   3481 C CA  . ILE A 1 456 ? -1.063  -52.243 44.591  1.00 32.68  ? 457 ILE A CA  1 
ATOM   3482 C C   . ILE A 1 456 ? -1.099  -53.738 44.971  1.00 44.55  ? 457 ILE A C   1 
ATOM   3483 O O   . ILE A 1 456 ? -1.600  -54.083 46.045  1.00 43.27  ? 457 ILE A O   1 
ATOM   3484 C CB  . ILE A 1 456 ? -2.271  -51.899 43.710  1.00 37.25  ? 457 ILE A CB  1 
ATOM   3485 C CG1 . ILE A 1 456 ? -2.212  -50.433 43.269  1.00 36.89  ? 457 ILE A CG1 1 
ATOM   3486 C CG2 . ILE A 1 456 ? -3.555  -52.138 44.467  1.00 35.52  ? 457 ILE A CG2 1 
ATOM   3487 C CD1 . ILE A 1 456 ? -2.324  -49.446 44.391  1.00 27.63  ? 457 ILE A CD1 1 
ATOM   3488 N N   . PRO A 1 457 ? -0.540  -54.632 44.130  1.00 44.19  ? 458 PRO A N   1 
ATOM   3489 C CA  . PRO A 1 457 ? -0.452  -56.033 44.572  1.00 43.58  ? 458 PRO A CA  1 
ATOM   3490 C C   . PRO A 1 457 ? 0.191   -56.302 45.954  1.00 45.18  ? 458 PRO A C   1 
ATOM   3491 O O   . PRO A 1 457 ? 0.092   -57.428 46.439  1.00 54.57  ? 458 PRO A O   1 
ATOM   3492 C CB  . PRO A 1 457 ? 0.402   -56.673 43.479  1.00 47.13  ? 458 PRO A CB  1 
ATOM   3493 C CG  . PRO A 1 457 ? 0.047   -55.904 42.257  1.00 40.31  ? 458 PRO A CG  1 
ATOM   3494 C CD  . PRO A 1 457 ? -0.145  -54.494 42.713  1.00 37.43  ? 458 PRO A CD  1 
ATOM   3495 N N   . LEU A 1 458 ? 0.838   -55.311 46.562  1.00 43.93  ? 459 LEU A N   1 
ATOM   3496 C CA  . LEU A 1 458 ? 1.438   -55.486 47.882  1.00 45.65  ? 459 LEU A CA  1 
ATOM   3497 C C   . LEU A 1 458 ? 0.389   -55.346 48.973  1.00 49.88  ? 459 LEU A C   1 
ATOM   3498 O O   . LEU A 1 458 ? 0.593   -55.805 50.096  1.00 54.43  ? 459 LEU A O   1 
ATOM   3499 C CB  . LEU A 1 458 ? 2.568   -54.479 48.121  1.00 35.46  ? 459 LEU A CB  1 
ATOM   3500 C CG  . LEU A 1 458 ? 3.806   -54.636 47.242  1.00 37.48  ? 459 LEU A CG  1 
ATOM   3501 C CD1 . LEU A 1 458 ? 4.928   -53.739 47.736  1.00 43.96  ? 459 LEU A CD1 1 
ATOM   3502 C CD2 . LEU A 1 458 ? 4.241   -56.079 47.218  1.00 45.23  ? 459 LEU A CD2 1 
ATOM   3503 N N   . ASP A 1 459 ? -0.725  -54.697 48.640  1.00 43.02  ? 460 ASP A N   1 
ATOM   3504 C CA  . ASP A 1 459 ? -1.869  -54.610 49.540  1.00 45.85  ? 460 ASP A CA  1 
ATOM   3505 C C   . ASP A 1 459 ? -2.461  -56.004 49.709  1.00 59.01  ? 460 ASP A C   1 
ATOM   3506 O O   . ASP A 1 459 ? -3.024  -56.566 48.765  1.00 55.78  ? 460 ASP A O   1 
ATOM   3507 C CB  . ASP A 1 459 ? -2.915  -53.641 48.988  1.00 50.89  ? 460 ASP A CB  1 
ATOM   3508 C CG  . ASP A 1 459 ? -4.028  -53.336 49.985  1.00 65.59  ? 460 ASP A CG  1 
ATOM   3509 O OD1 . ASP A 1 459 ? -4.050  -53.953 51.077  1.00 61.16  ? 460 ASP A OD1 1 
ATOM   3510 O OD2 . ASP A 1 459 ? -4.886  -52.477 49.659  1.00 54.82  ? 460 ASP A OD2 1 
ATOM   3511 N N   . PRO A 1 460 ? -2.330  -56.577 50.915  1.00 69.18  ? 461 PRO A N   1 
ATOM   3512 C CA  . PRO A 1 460 ? -2.734  -57.981 51.066  1.00 70.41  ? 461 PRO A CA  1 
ATOM   3513 C C   . PRO A 1 460 ? -4.261  -58.129 51.080  1.00 72.85  ? 461 PRO A C   1 
ATOM   3514 O O   . PRO A 1 460 ? -4.774  -59.213 50.785  1.00 69.53  ? 461 PRO A O   1 
ATOM   3515 C CB  . PRO A 1 460 ? -2.099  -58.383 52.402  1.00 57.07  ? 461 PRO A CB  1 
ATOM   3516 C CG  . PRO A 1 460 ? -2.019  -57.098 53.178  1.00 60.80  ? 461 PRO A CG  1 
ATOM   3517 C CD  . PRO A 1 460 ? -1.863  -55.978 52.178  1.00 64.46  ? 461 PRO A CD  1 
ATOM   3518 N N   . SER A 1 461 ? -4.970  -57.039 51.369  1.00 52.76  ? 462 SER A N   1 
ATOM   3519 C CA  . SER A 1 461 ? -6.428  -57.043 51.358  1.00 52.55  ? 462 SER A CA  1 
ATOM   3520 C C   . SER A 1 461 ? -6.992  -57.206 49.942  1.00 65.90  ? 462 SER A C   1 
ATOM   3521 O O   . SER A 1 461 ? -8.205  -57.288 49.737  1.00 64.24  ? 462 SER A O   1 
ATOM   3522 C CB  . SER A 1 461 ? -6.960  -55.754 51.974  1.00 55.12  ? 462 SER A CB  1 
ATOM   3523 O OG  . SER A 1 461 ? -7.248  -54.804 50.966  1.00 52.07  ? 462 SER A OG  1 
ATOM   3524 N N   . ARG A 1 462 ? -6.098  -57.220 48.965  1.00 59.01  ? 463 ARG A N   1 
ATOM   3525 C CA  . ARG A 1 462 ? -6.469  -57.472 47.589  1.00 54.03  ? 463 ARG A CA  1 
ATOM   3526 C C   . ARG A 1 462 ? -5.909  -58.837 47.231  1.00 66.40  ? 463 ARG A C   1 
ATOM   3527 O O   . ARG A 1 462 ? -5.190  -59.442 48.032  1.00 73.16  ? 463 ARG A O   1 
ATOM   3528 C CB  . ARG A 1 462 ? -5.954  -56.358 46.688  1.00 53.53  ? 463 ARG A CB  1 
ATOM   3529 C CG  . ARG A 1 462 ? -6.496  -55.015 47.135  1.00 53.02  ? 463 ARG A CG  1 
ATOM   3530 C CD  . ARG A 1 462 ? -5.985  -53.862 46.318  1.00 55.70  ? 463 ARG A CD  1 
ATOM   3531 N NE  . ARG A 1 462 ? -6.780  -52.656 46.551  1.00 66.72  ? 463 ARG A NE  1 
ATOM   3532 C CZ  . ARG A 1 462 ? -7.894  -52.360 45.881  1.00 69.14  ? 463 ARG A CZ  1 
ATOM   3533 N NH1 . ARG A 1 462 ? -8.338  -53.192 44.940  1.00 50.10  ? 463 ARG A NH1 1 
ATOM   3534 N NH2 . ARG A 1 462 ? -8.565  -51.240 46.152  1.00 48.10  ? 463 ARG A NH2 1 
ATOM   3535 N N   . ASN A 1 463 ? -6.250  -59.354 46.061  1.00 52.30  ? 464 ASN A N   1 
ATOM   3536 C CA  . ASN A 1 463 ? -6.097  -60.790 45.880  1.00 63.05  ? 464 ASN A CA  1 
ATOM   3537 C C   . ASN A 1 463 ? -5.099  -61.178 44.801  1.00 57.35  ? 464 ASN A C   1 
ATOM   3538 O O   . ASN A 1 463 ? -5.309  -62.141 44.064  1.00 65.83  ? 464 ASN A O   1 
ATOM   3539 C CB  . ASN A 1 463 ? -7.472  -61.416 45.601  1.00 66.42  ? 464 ASN A CB  1 
ATOM   3540 C CG  . ASN A 1 463 ? -8.444  -61.246 46.777  1.00 75.66  ? 464 ASN A CG  1 
ATOM   3541 O OD1 . ASN A 1 463 ? -8.089  -61.508 47.934  1.00 75.22  ? 464 ASN A OD1 1 
ATOM   3542 N ND2 . ASN A 1 463 ? -9.668  -60.794 46.483  1.00 66.51  ? 464 ASN A ND2 1 
ATOM   3543 N N   . TYR A 1 464 ? -3.999  -60.438 44.724  1.00 50.55  ? 465 TYR A N   1 
ATOM   3544 C CA  . TYR A 1 464 ? -2.955  -60.751 43.756  1.00 49.58  ? 465 TYR A CA  1 
ATOM   3545 C C   . TYR A 1 464 ? -2.129  -61.948 44.238  1.00 49.07  ? 465 TYR A C   1 
ATOM   3546 O O   . TYR A 1 464 ? -2.136  -62.281 45.422  1.00 48.23  ? 465 TYR A O   1 
ATOM   3547 C CB  . TYR A 1 464 ? -2.056  -59.531 43.508  1.00 47.37  ? 465 TYR A CB  1 
ATOM   3548 C CG  . TYR A 1 464 ? -2.744  -58.359 42.829  1.00 46.00  ? 465 TYR A CG  1 
ATOM   3549 C CD1 . TYR A 1 464 ? -3.457  -57.427 43.570  1.00 44.29  ? 465 TYR A CD1 1 
ATOM   3550 C CD2 . TYR A 1 464 ? -2.669  -58.181 41.450  1.00 45.36  ? 465 TYR A CD2 1 
ATOM   3551 C CE1 . TYR A 1 464 ? -4.084  -56.350 42.964  1.00 40.31  ? 465 TYR A CE1 1 
ATOM   3552 C CE2 . TYR A 1 464 ? -3.298  -57.105 40.829  1.00 45.07  ? 465 TYR A CE2 1 
ATOM   3553 C CZ  . TYR A 1 464 ? -4.003  -56.188 41.596  1.00 49.10  ? 465 TYR A CZ  1 
ATOM   3554 O OH  . TYR A 1 464 ? -4.631  -55.103 41.002  1.00 45.59  ? 465 TYR A OH  1 
ATOM   3555 N N   . THR A 1 465 ? -1.422  -62.590 43.313  1.00 49.95  ? 466 THR A N   1 
ATOM   3556 C CA  . THR A 1 465 ? -0.609  -63.760 43.631  1.00 48.66  ? 466 THR A CA  1 
ATOM   3557 C C   . THR A 1 465 ? 0.777   -63.395 44.141  1.00 50.17  ? 466 THR A C   1 
ATOM   3558 O O   . THR A 1 465 ? 1.236   -62.273 43.961  1.00 55.20  ? 466 THR A O   1 
ATOM   3559 C CB  . THR A 1 465 ? -0.430  -64.658 42.401  1.00 50.76  ? 466 THR A CB  1 
ATOM   3560 O OG1 . THR A 1 465 ? 0.569   -64.095 41.538  1.00 52.50  ? 466 THR A OG1 1 
ATOM   3561 C CG2 . THR A 1 465 ? -1.738  -64.798 41.655  1.00 40.53  ? 466 THR A CG2 1 
ATOM   3562 N N   . ALA A 1 466 ? 1.455   -64.356 44.754  1.00 52.37  ? 467 ALA A N   1 
ATOM   3563 C CA  . ALA A 1 466 ? 2.823   -64.134 45.202  1.00 49.92  ? 467 ALA A CA  1 
ATOM   3564 C C   . ALA A 1 466 ? 3.722   -63.742 44.028  1.00 54.87  ? 467 ALA A C   1 
ATOM   3565 O O   . ALA A 1 466 ? 4.597   -62.882 44.169  1.00 56.99  ? 467 ALA A O   1 
ATOM   3566 C CB  . ALA A 1 466 ? 3.367   -65.375 45.901  1.00 42.25  ? 467 ALA A CB  1 
ATOM   3567 N N   . GLU A 1 467 ? 3.500   -64.368 42.873  1.00 55.02  ? 468 GLU A N   1 
ATOM   3568 C CA  . GLU A 1 467 ? 4.263   -64.040 41.670  1.00 54.55  ? 468 GLU A CA  1 
ATOM   3569 C C   . GLU A 1 467 ? 4.054   -62.580 41.279  1.00 55.60  ? 468 GLU A C   1 
ATOM   3570 O O   . GLU A 1 467 ? 4.996   -61.894 40.869  1.00 49.12  ? 468 GLU A O   1 
ATOM   3571 C CB  . GLU A 1 467 ? 3.866   -64.939 40.501  1.00 57.75  ? 468 GLU A CB  1 
ATOM   3572 C CG  . GLU A 1 467 ? 4.602   -66.261 40.402  1.00 71.59  ? 468 GLU A CG  1 
ATOM   3573 C CD  . GLU A 1 467 ? 4.149   -67.081 39.183  1.00 109.16 ? 468 GLU A CD  1 
ATOM   3574 O OE1 . GLU A 1 467 ? 2.928   -67.092 38.873  1.00 92.81  ? 468 GLU A OE1 1 
ATOM   3575 O OE2 . GLU A 1 467 ? 5.018   -67.705 38.527  1.00 103.28 ? 468 GLU A OE2 1 
ATOM   3576 N N   . GLU A 1 468 ? 2.817   -62.106 41.418  1.00 46.11  ? 469 GLU A N   1 
ATOM   3577 C CA  . GLU A 1 468 ? 2.477   -60.741 41.035  1.00 45.31  ? 469 GLU A CA  1 
ATOM   3578 C C   . GLU A 1 468 ? 3.073   -59.682 41.973  1.00 48.60  ? 469 GLU A C   1 
ATOM   3579 O O   . GLU A 1 468 ? 3.411   -58.587 41.530  1.00 46.47  ? 469 GLU A O   1 
ATOM   3580 C CB  . GLU A 1 468 ? 0.959   -60.592 40.943  1.00 38.88  ? 469 GLU A CB  1 
ATOM   3581 C CG  . GLU A 1 468 ? 0.395   -61.233 39.675  1.00 43.06  ? 469 GLU A CG  1 
ATOM   3582 C CD  . GLU A 1 468 ? -1.121  -61.230 39.629  1.00 48.18  ? 469 GLU A CD  1 
ATOM   3583 O OE1 . GLU A 1 468 ? -1.751  -61.422 40.694  1.00 46.87  ? 469 GLU A OE1 1 
ATOM   3584 O OE2 . GLU A 1 468 ? -1.685  -61.031 38.528  1.00 46.16  ? 469 GLU A OE2 1 
ATOM   3585 N N   . LYS A 1 469 ? 3.225   -60.008 43.253  1.00 48.41  ? 470 LYS A N   1 
ATOM   3586 C CA  . LYS A 1 469 ? 3.901   -59.107 44.182  1.00 37.82  ? 470 LYS A CA  1 
ATOM   3587 C C   . LYS A 1 469 ? 5.373   -58.970 43.804  1.00 40.46  ? 470 LYS A C   1 
ATOM   3588 O O   . LYS A 1 469 ? 5.925   -57.874 43.829  1.00 41.99  ? 470 LYS A O   1 
ATOM   3589 C CB  . LYS A 1 469 ? 3.769   -59.595 45.631  1.00 45.96  ? 470 LYS A CB  1 
ATOM   3590 C CG  . LYS A 1 469 ? 2.328   -59.744 46.108  1.00 53.19  ? 470 LYS A CG  1 
ATOM   3591 C CD  . LYS A 1 469 ? 2.250   -60.145 47.574  1.00 69.94  ? 470 LYS A CD  1 
ATOM   3592 C CE  . LYS A 1 469 ? 0.803   -60.212 48.063  1.00 68.82  ? 470 LYS A CE  1 
ATOM   3593 N NZ  . LYS A 1 469 ? 0.714   -60.075 49.551  1.00 55.04  ? 470 LYS A NZ  1 
ATOM   3594 N N   . ILE A 1 470 ? 6.011   -60.080 43.455  1.00 42.14  ? 471 ILE A N   1 
ATOM   3595 C CA  . ILE A 1 470 ? 7.399   -60.039 42.999  1.00 45.79  ? 471 ILE A CA  1 
ATOM   3596 C C   . ILE A 1 470 ? 7.502   -59.233 41.699  1.00 44.17  ? 471 ILE A C   1 
ATOM   3597 O O   . ILE A 1 470 ? 8.476   -58.509 41.473  1.00 38.84  ? 471 ILE A O   1 
ATOM   3598 C CB  . ILE A 1 470 ? 7.963   -61.462 42.786  1.00 49.77  ? 471 ILE A CB  1 
ATOM   3599 C CG1 . ILE A 1 470 ? 7.900   -62.249 44.099  1.00 46.13  ? 471 ILE A CG1 1 
ATOM   3600 C CG2 . ILE A 1 470 ? 9.387   -61.413 42.245  1.00 35.53  ? 471 ILE A CG2 1 
ATOM   3601 C CD1 . ILE A 1 470 ? 8.179   -63.735 43.952  1.00 43.73  ? 471 ILE A CD1 1 
ATOM   3602 N N   . PHE A 1 471 ? 6.480   -59.357 40.857  1.00 41.17  ? 472 PHE A N   1 
ATOM   3603 C CA  . PHE A 1 471 ? 6.448   -58.662 39.577  1.00 38.99  ? 472 PHE A CA  1 
ATOM   3604 C C   . PHE A 1 471 ? 6.303   -57.160 39.807  1.00 44.55  ? 472 PHE A C   1 
ATOM   3605 O O   . PHE A 1 471 ? 7.041   -56.352 39.230  1.00 38.10  ? 472 PHE A O   1 
ATOM   3606 C CB  . PHE A 1 471 ? 5.309   -59.211 38.710  1.00 33.81  ? 472 PHE A CB  1 
ATOM   3607 C CG  . PHE A 1 471 ? 5.143   -58.509 37.399  1.00 32.16  ? 472 PHE A CG  1 
ATOM   3608 C CD1 . PHE A 1 471 ? 6.216   -58.340 36.547  1.00 32.99  ? 472 PHE A CD1 1 
ATOM   3609 C CD2 . PHE A 1 471 ? 3.899   -58.028 37.012  1.00 37.68  ? 472 PHE A CD2 1 
ATOM   3610 C CE1 . PHE A 1 471 ? 6.061   -57.680 35.338  1.00 44.91  ? 472 PHE A CE1 1 
ATOM   3611 C CE2 . PHE A 1 471 ? 3.730   -57.375 35.794  1.00 36.60  ? 472 PHE A CE2 1 
ATOM   3612 C CZ  . PHE A 1 471 ? 4.810   -57.200 34.957  1.00 35.88  ? 472 PHE A CZ  1 
ATOM   3613 N N   . ALA A 1 472 ? 5.365   -56.796 40.675  1.00 37.02  ? 473 ALA A N   1 
ATOM   3614 C CA  . ALA A 1 472 ? 5.155   -55.401 41.027  1.00 37.95  ? 473 ALA A CA  1 
ATOM   3615 C C   . ALA A 1 472 ? 6.430   -54.759 41.586  1.00 40.16  ? 473 ALA A C   1 
ATOM   3616 O O   . ALA A 1 472 ? 6.710   -53.588 41.330  1.00 43.72  ? 473 ALA A O   1 
ATOM   3617 C CB  . ALA A 1 472 ? 4.014   -55.275 42.028  1.00 32.58  ? 473 ALA A CB  1 
ATOM   3618 N N   . GLN A 1 473 ? 7.209   -55.525 42.339  1.00 38.61  ? 474 GLN A N   1 
ATOM   3619 C CA  . GLN A 1 473 ? 8.388   -54.971 42.987  1.00 39.26  ? 474 GLN A CA  1 
ATOM   3620 C C   . GLN A 1 473 ? 9.478   -54.709 41.953  1.00 41.13  ? 474 GLN A C   1 
ATOM   3621 O O   . GLN A 1 473 ? 10.237  -53.745 42.068  1.00 36.74  ? 474 GLN A O   1 
ATOM   3622 C CB  . GLN A 1 473 ? 8.872   -55.903 44.100  1.00 33.32  ? 474 GLN A CB  1 
ATOM   3623 C CG  . GLN A 1 473 ? 7.905   -55.936 45.284  1.00 41.31  ? 474 GLN A CG  1 
ATOM   3624 C CD  . GLN A 1 473 ? 8.347   -56.847 46.419  1.00 45.97  ? 474 GLN A CD  1 
ATOM   3625 O OE1 . GLN A 1 473 ? 8.587   -58.044 46.227  1.00 41.99  ? 474 GLN A OE1 1 
ATOM   3626 N NE2 . GLN A 1 473 ? 8.450   -56.278 47.617  1.00 54.09  ? 474 GLN A NE2 1 
ATOM   3627 N N   . ARG A 1 474 ? 9.523   -55.557 40.930  1.00 42.46  ? 475 ARG A N   1 
ATOM   3628 C CA  . ARG A 1 474 ? 10.445  -55.389 39.813  1.00 36.88  ? 475 ARG A CA  1 
ATOM   3629 C C   . ARG A 1 474 ? 10.140  -54.096 39.075  1.00 41.51  ? 475 ARG A C   1 
ATOM   3630 O O   . ARG A 1 474 ? 11.041  -53.308 38.758  1.00 39.09  ? 475 ARG A O   1 
ATOM   3631 C CB  . ARG A 1 474 ? 10.344  -56.568 38.842  1.00 41.30  ? 475 ARG A CB  1 
ATOM   3632 C CG  . ARG A 1 474 ? 11.380  -57.656 39.036  1.00 56.94  ? 475 ARG A CG  1 
ATOM   3633 C CD  . ARG A 1 474 ? 11.230  -58.756 37.989  1.00 45.32  ? 475 ARG A CD  1 
ATOM   3634 N NE  . ARG A 1 474 ? 11.522  -58.274 36.642  1.00 40.93  ? 475 ARG A NE  1 
ATOM   3635 C CZ  . ARG A 1 474 ? 10.827  -58.615 35.560  1.00 41.94  ? 475 ARG A CZ  1 
ATOM   3636 N NH1 . ARG A 1 474 ? 9.790   -59.442 35.663  1.00 36.17  ? 475 ARG A NH1 1 
ATOM   3637 N NH2 . ARG A 1 474 ? 11.170  -58.124 34.377  1.00 45.80  ? 475 ARG A NH2 1 
ATOM   3638 N N   . LEU A 1 475 ? 8.857   -53.891 38.802  1.00 33.18  ? 476 LEU A N   1 
ATOM   3639 C CA  . LEU A 1 475 ? 8.422   -52.728 38.061  1.00 32.86  ? 476 LEU A CA  1 
ATOM   3640 C C   . LEU A 1 475 ? 8.674   -51.442 38.842  1.00 37.95  ? 476 LEU A C   1 
ATOM   3641 O O   . LEU A 1 475 ? 9.109   -50.443 38.265  1.00 38.10  ? 476 LEU A O   1 
ATOM   3642 C CB  . LEU A 1 475 ? 6.945   -52.856 37.699  1.00 34.59  ? 476 LEU A CB  1 
ATOM   3643 C CG  . LEU A 1 475 ? 6.627   -53.930 36.656  1.00 35.38  ? 476 LEU A CG  1 
ATOM   3644 C CD1 . LEU A 1 475 ? 5.259   -53.696 36.038  1.00 39.78  ? 476 LEU A CD1 1 
ATOM   3645 C CD2 . LEU A 1 475 ? 7.687   -53.950 35.580  1.00 38.41  ? 476 LEU A CD2 1 
ATOM   3646 N N   . MET A 1 476 ? 8.418   -51.469 40.149  1.00 32.73  ? 477 MET A N   1 
ATOM   3647 C CA  . MET A 1 476 ? 8.646   -50.291 40.978  1.00 36.84  ? 477 MET A CA  1 
ATOM   3648 C C   . MET A 1 476 ? 10.135  -49.940 40.996  1.00 40.66  ? 477 MET A C   1 
ATOM   3649 O O   . MET A 1 476 ? 10.498  -48.764 41.027  1.00 36.53  ? 477 MET A O   1 
ATOM   3650 C CB  . MET A 1 476 ? 8.125   -50.505 42.404  1.00 36.41  ? 477 MET A CB  1 
ATOM   3651 C CG  . MET A 1 476 ? 6.598   -50.541 42.529  1.00 36.58  ? 477 MET A CG  1 
ATOM   3652 S SD  . MET A 1 476 ? 6.003   -50.572 44.250  1.00 41.84  ? 477 MET A SD  1 
ATOM   3653 C CE  . MET A 1 476 ? 6.807   -52.047 44.870  1.00 36.76  ? 477 MET A CE  1 
ATOM   3654 N N   . ARG A 1 477 ? 10.986  -50.966 40.955  1.00 36.79  ? 478 ARG A N   1 
ATOM   3655 C CA  . ARG A 1 477 ? 12.433  -50.787 40.910  1.00 29.48  ? 478 ARG A CA  1 
ATOM   3656 C C   . ARG A 1 477 ? 12.870  -50.169 39.574  1.00 37.58  ? 478 ARG A C   1 
ATOM   3657 O O   . ARG A 1 477 ? 13.631  -49.201 39.569  1.00 32.79  ? 478 ARG A O   1 
ATOM   3658 C CB  . ARG A 1 477 ? 13.137  -52.130 41.156  1.00 33.46  ? 478 ARG A CB  1 
ATOM   3659 C CG  . ARG A 1 477 ? 14.647  -52.136 40.994  1.00 38.73  ? 478 ARG A CG  1 
ATOM   3660 C CD  . ARG A 1 477 ? 15.338  -51.220 41.983  1.00 44.28  ? 478 ARG A CD  1 
ATOM   3661 N NE  . ARG A 1 477 ? 14.816  -51.420 43.328  1.00 59.98  ? 478 ARG A NE  1 
ATOM   3662 C CZ  . ARG A 1 477 ? 15.301  -52.303 44.194  1.00 59.00  ? 478 ARG A CZ  1 
ATOM   3663 N NH1 . ARG A 1 477 ? 16.332  -53.067 43.859  1.00 53.98  ? 478 ARG A NH1 1 
ATOM   3664 N NH2 . ARG A 1 477 ? 14.754  -52.417 45.395  1.00 47.45  ? 478 ARG A NH2 1 
ATOM   3665 N N   . TYR A 1 478 ? 12.387  -50.714 38.451  1.00 33.51  ? 479 TYR A N   1 
ATOM   3666 C CA  . TYR A 1 478 ? 12.681  -50.146 37.129  1.00 34.09  ? 479 TYR A CA  1 
ATOM   3667 C C   . TYR A 1 478 ? 12.338  -48.659 37.098  1.00 38.45  ? 479 TYR A C   1 
ATOM   3668 O O   . TYR A 1 478 ? 13.173  -47.821 36.737  1.00 41.17  ? 479 TYR A O   1 
ATOM   3669 C CB  . TYR A 1 478 ? 11.901  -50.860 36.015  1.00 35.68  ? 479 TYR A CB  1 
ATOM   3670 C CG  . TYR A 1 478 ? 12.379  -52.251 35.648  1.00 35.11  ? 479 TYR A CG  1 
ATOM   3671 C CD1 . TYR A 1 478 ? 13.729  -52.547 35.534  1.00 27.72  ? 479 TYR A CD1 1 
ATOM   3672 C CD2 . TYR A 1 478 ? 11.465  -53.270 35.409  1.00 37.35  ? 479 TYR A CD2 1 
ATOM   3673 C CE1 . TYR A 1 478 ? 14.148  -53.821 35.201  1.00 31.43  ? 479 TYR A CE1 1 
ATOM   3674 C CE2 . TYR A 1 478 ? 11.878  -54.549 35.083  1.00 39.71  ? 479 TYR A CE2 1 
ATOM   3675 C CZ  . TYR A 1 478 ? 13.216  -54.820 34.977  1.00 39.08  ? 479 TYR A CZ  1 
ATOM   3676 O OH  . TYR A 1 478 ? 13.610  -56.102 34.646  1.00 41.20  ? 479 TYR A OH  1 
ATOM   3677 N N   . TRP A 1 479 ? 11.102  -48.350 37.483  1.00 31.78  ? 480 TRP A N   1 
ATOM   3678 C CA  . TRP A 1 479 ? 10.590  -46.983 37.461  1.00 32.25  ? 480 TRP A CA  1 
ATOM   3679 C C   . TRP A 1 479 ? 11.408  -46.069 38.378  1.00 34.31  ? 480 TRP A C   1 
ATOM   3680 O O   . TRP A 1 479 ? 11.839  -44.997 37.963  1.00 38.39  ? 480 TRP A O   1 
ATOM   3681 C CB  . TRP A 1 479 ? 9.105   -46.967 37.858  1.00 32.79  ? 480 TRP A CB  1 
ATOM   3682 C CG  . TRP A 1 479 ? 8.133   -46.821 36.696  1.00 31.77  ? 480 TRP A CG  1 
ATOM   3683 C CD1 . TRP A 1 479 ? 7.260   -45.788 36.483  1.00 34.88  ? 480 TRP A CD1 1 
ATOM   3684 C CD2 . TRP A 1 479 ? 7.946   -47.733 35.599  1.00 38.18  ? 480 TRP A CD2 1 
ATOM   3685 N NE1 . TRP A 1 479 ? 6.542   -46.000 35.326  1.00 35.08  ? 480 TRP A NE1 1 
ATOM   3686 C CE2 . TRP A 1 479 ? 6.942   -47.184 34.764  1.00 32.34  ? 480 TRP A CE2 1 
ATOM   3687 C CE3 . TRP A 1 479 ? 8.524   -48.959 35.242  1.00 27.18  ? 480 TRP A CE3 1 
ATOM   3688 C CZ2 . TRP A 1 479 ? 6.509   -47.816 33.599  1.00 29.49  ? 480 TRP A CZ2 1 
ATOM   3689 C CZ3 . TRP A 1 479 ? 8.092   -49.584 34.083  1.00 31.01  ? 480 TRP A CZ3 1 
ATOM   3690 C CH2 . TRP A 1 479 ? 7.094   -49.012 33.275  1.00 26.67  ? 480 TRP A CH2 1 
ATOM   3691 N N   . ALA A 1 480 ? 11.638  -46.504 39.612  1.00 34.01  ? 481 ALA A N   1 
ATOM   3692 C CA  . ALA A 1 480 ? 12.437  -45.735 40.567  1.00 31.28  ? 481 ALA A CA  1 
ATOM   3693 C C   . ALA A 1 480 ? 13.904  -45.614 40.150  1.00 37.62  ? 481 ALA A C   1 
ATOM   3694 O O   . ALA A 1 480 ? 14.528  -44.574 40.383  1.00 34.01  ? 481 ALA A O   1 
ATOM   3695 C CB  . ALA A 1 480 ? 12.347  -46.355 41.943  1.00 31.73  ? 481 ALA A CB  1 
ATOM   3696 N N   . ASN A 1 481 ? 14.459  -46.679 39.567  1.00 32.04  ? 482 ASN A N   1 
ATOM   3697 C CA  . ASN A 1 481 ? 15.794  -46.603 38.978  1.00 33.82  ? 482 ASN A CA  1 
ATOM   3698 C C   . ASN A 1 481 ? 15.846  -45.478 37.976  1.00 38.82  ? 482 ASN A C   1 
ATOM   3699 O O   . ASN A 1 481 ? 16.737  -44.625 38.032  1.00 35.02  ? 482 ASN A O   1 
ATOM   3700 C CB  . ASN A 1 481 ? 16.192  -47.910 38.290  1.00 33.05  ? 482 ASN A CB  1 
ATOM   3701 C CG  . ASN A 1 481 ? 16.760  -48.924 39.256  1.00 40.04  ? 482 ASN A CG  1 
ATOM   3702 O OD1 . ASN A 1 481 ? 16.834  -48.678 40.458  1.00 38.76  ? 482 ASN A OD1 1 
ATOM   3703 N ND2 . ASN A 1 481 ? 17.155  -50.076 38.737  1.00 44.17  ? 482 ASN A ND2 1 
ATOM   3704 N N   . PHE A 1 482 ? 14.871  -45.475 37.069  1.00 35.21  ? 483 PHE A N   1 
ATOM   3705 C CA  . PHE A 1 482 ? 14.822  -44.473 36.024  1.00 31.32  ? 483 PHE A CA  1 
ATOM   3706 C C   . PHE A 1 482 ? 14.738  -43.074 36.627  1.00 33.29  ? 483 PHE A C   1 
ATOM   3707 O O   . PHE A 1 482 ? 15.433  -42.158 36.196  1.00 42.61  ? 483 PHE A O   1 
ATOM   3708 C CB  . PHE A 1 482 ? 13.648  -44.729 35.089  1.00 33.15  ? 483 PHE A CB  1 
ATOM   3709 C CG  . PHE A 1 482 ? 13.490  -43.682 34.034  1.00 38.60  ? 483 PHE A CG  1 
ATOM   3710 C CD1 . PHE A 1 482 ? 14.291  -43.700 32.897  1.00 36.58  ? 483 PHE A CD1 1 
ATOM   3711 C CD2 . PHE A 1 482 ? 12.561  -42.662 34.184  1.00 28.09  ? 483 PHE A CD2 1 
ATOM   3712 C CE1 . PHE A 1 482 ? 14.159  -42.729 31.924  1.00 32.54  ? 483 PHE A CE1 1 
ATOM   3713 C CE2 . PHE A 1 482 ? 12.427  -41.683 33.216  1.00 32.04  ? 483 PHE A CE2 1 
ATOM   3714 C CZ  . PHE A 1 482 ? 13.223  -41.719 32.083  1.00 35.60  ? 483 PHE A CZ  1 
ATOM   3715 N N   . ALA A 1 483 ? 13.898  -42.922 37.639  1.00 31.43  ? 484 ALA A N   1 
ATOM   3716 C CA  . ALA A 1 483 ? 13.737  -41.647 38.328  1.00 35.94  ? 484 ALA A CA  1 
ATOM   3717 C C   . ALA A 1 483 ? 15.022  -41.154 39.043  1.00 41.30  ? 484 ALA A C   1 
ATOM   3718 O O   . ALA A 1 483 ? 15.240  -39.952 39.202  1.00 45.32  ? 484 ALA A O   1 
ATOM   3719 C CB  . ALA A 1 483 ? 12.596  -41.763 39.322  1.00 35.24  ? 484 ALA A CB  1 
ATOM   3720 N N   . ARG A 1 484 ? 15.870  -42.082 39.470  1.00 40.07  ? 485 ARG A N   1 
ATOM   3721 C CA  . ARG A 1 484 ? 17.101  -41.728 40.162  1.00 38.89  ? 485 ARG A CA  1 
ATOM   3722 C C   . ARG A 1 484 ? 18.274  -41.452 39.225  1.00 41.55  ? 485 ARG A C   1 
ATOM   3723 O O   . ARG A 1 484 ? 19.063  -40.543 39.473  1.00 45.47  ? 485 ARG A O   1 
ATOM   3724 C CB  . ARG A 1 484 ? 17.490  -42.837 41.138  1.00 39.07  ? 485 ARG A CB  1 
ATOM   3725 C CG  . ARG A 1 484 ? 16.621  -42.891 42.373  1.00 33.89  ? 485 ARG A CG  1 
ATOM   3726 C CD  . ARG A 1 484 ? 17.112  -43.929 43.348  1.00 29.00  ? 485 ARG A CD  1 
ATOM   3727 N NE  . ARG A 1 484 ? 16.944  -45.284 42.834  1.00 41.87  ? 485 ARG A NE  1 
ATOM   3728 C CZ  . ARG A 1 484 ? 15.961  -46.100 43.199  1.00 40.11  ? 485 ARG A CZ  1 
ATOM   3729 N NH1 . ARG A 1 484 ? 15.054  -45.691 44.076  1.00 36.12  ? 485 ARG A NH1 1 
ATOM   3730 N NH2 . ARG A 1 484 ? 15.884  -47.320 42.690  1.00 34.72  ? 485 ARG A NH2 1 
ATOM   3731 N N   . THR A 1 485 ? 18.387  -42.235 38.154  1.00 44.87  ? 486 THR A N   1 
ATOM   3732 C CA  . THR A 1 485 ? 19.575  -42.202 37.296  1.00 42.22  ? 486 THR A CA  1 
ATOM   3733 C C   . THR A 1 485 ? 19.321  -41.963 35.822  1.00 40.61  ? 486 THR A C   1 
ATOM   3734 O O   . THR A 1 485 ? 20.258  -41.695 35.078  1.00 55.72  ? 486 THR A O   1 
ATOM   3735 C CB  . THR A 1 485 ? 20.349  -43.519 37.359  1.00 42.94  ? 486 THR A CB  1 
ATOM   3736 O OG1 . THR A 1 485 ? 19.560  -44.549 36.743  1.00 43.47  ? 486 THR A OG1 1 
ATOM   3737 C CG2 . THR A 1 485 ? 20.679  -43.890 38.799  1.00 35.48  ? 486 THR A CG2 1 
ATOM   3738 N N   . GLY A 1 486 ? 18.072  -42.106 35.391  1.00 43.00  ? 487 GLY A N   1 
ATOM   3739 C CA  . GLY A 1 486 ? 17.742  -42.016 33.978  1.00 33.56  ? 487 GLY A CA  1 
ATOM   3740 C C   . GLY A 1 486 ? 17.962  -43.336 33.263  1.00 36.43  ? 487 GLY A C   1 
ATOM   3741 O O   . GLY A 1 486 ? 18.052  -43.388 32.040  1.00 38.45  ? 487 GLY A O   1 
ATOM   3742 N N   . ASP A 1 487 ? 18.048  -44.410 34.042  1.00 43.25  ? 488 ASP A N   1 
ATOM   3743 C CA  . ASP A 1 487 ? 18.335  -45.742 33.521  1.00 42.36  ? 488 ASP A CA  1 
ATOM   3744 C C   . ASP A 1 487 ? 17.567  -46.744 34.378  1.00 40.67  ? 488 ASP A C   1 
ATOM   3745 O O   . ASP A 1 487 ? 17.819  -46.845 35.579  1.00 47.55  ? 488 ASP A O   1 
ATOM   3746 C CB  . ASP A 1 487 ? 19.850  -46.009 33.559  1.00 47.00  ? 488 ASP A CB  1 
ATOM   3747 C CG  . ASP A 1 487 ? 20.276  -47.247 32.772  1.00 44.63  ? 488 ASP A CG  1 
ATOM   3748 O OD1 . ASP A 1 487 ? 19.456  -48.157 32.530  1.00 46.35  ? 488 ASP A OD1 1 
ATOM   3749 O OD2 . ASP A 1 487 ? 21.468  -47.315 32.413  1.00 57.17  ? 488 ASP A OD2 1 
ATOM   3750 N N   . PRO A 1 488 ? 16.620  -47.475 33.773  1.00 37.23  ? 489 PRO A N   1 
ATOM   3751 C CA  . PRO A 1 488 ? 15.779  -48.432 34.506  1.00 42.18  ? 489 PRO A CA  1 
ATOM   3752 C C   . PRO A 1 488 ? 16.565  -49.639 34.999  1.00 43.81  ? 489 PRO A C   1 
ATOM   3753 O O   . PRO A 1 488 ? 16.143  -50.309 35.944  1.00 36.26  ? 489 PRO A O   1 
ATOM   3754 C CB  . PRO A 1 488 ? 14.738  -48.860 33.462  1.00 37.57  ? 489 PRO A CB  1 
ATOM   3755 C CG  . PRO A 1 488 ? 15.445  -48.708 32.160  1.00 34.54  ? 489 PRO A CG  1 
ATOM   3756 C CD  . PRO A 1 488 ? 16.327  -47.483 32.327  1.00 38.84  ? 489 PRO A CD  1 
ATOM   3757 N N   . ASN A 1 489 ? 17.695  -49.909 34.351  1.00 42.51  ? 490 ASN A N   1 
ATOM   3758 C CA  . ASN A 1 489 ? 18.500  -51.086 34.650  1.00 51.80  ? 490 ASN A CA  1 
ATOM   3759 C C   . ASN A 1 489 ? 19.101  -51.059 36.040  1.00 53.91  ? 490 ASN A C   1 
ATOM   3760 O O   . ASN A 1 489 ? 19.620  -50.027 36.481  1.00 53.22  ? 490 ASN A O   1 
ATOM   3761 C CB  . ASN A 1 489 ? 19.611  -51.234 33.623  1.00 44.89  ? 490 ASN A CB  1 
ATOM   3762 C CG  . ASN A 1 489 ? 19.087  -51.629 32.271  1.00 53.59  ? 490 ASN A CG  1 
ATOM   3763 O OD1 . ASN A 1 489 ? 18.717  -52.786 32.052  1.00 50.98  ? 490 ASN A OD1 1 
ATOM   3764 N ND2 . ASN A 1 489 ? 19.043  -50.670 31.349  1.00 42.30  ? 490 ASN A ND2 1 
ATOM   3765 N N   . GLU A 1 490 ? 19.024  -52.205 36.716  1.00 61.55  ? 491 GLU A N   1 
ATOM   3766 C CA  . GLU A 1 490 ? 19.549  -52.345 38.072  1.00 92.93  ? 491 GLU A CA  1 
ATOM   3767 C C   . GLU A 1 490 ? 21.015  -51.937 38.089  1.00 103.02 ? 491 GLU A C   1 
ATOM   3768 O O   . GLU A 1 490 ? 21.873  -52.709 37.632  1.00 87.27  ? 491 GLU A O   1 
ATOM   3769 C CB  . GLU A 1 490 ? 19.366  -53.776 38.586  1.00 92.62  ? 491 GLU A CB  1 
ATOM   3770 C CG  . GLU A 1 490 ? 18.014  -54.033 39.259  1.00 82.29  ? 491 GLU A CG  1 
ATOM   3771 C CD  . GLU A 1 490 ? 17.933  -53.481 40.687  1.00 80.11  ? 491 GLU A CD  1 
ATOM   3772 O OE1 . GLU A 1 490 ? 18.221  -52.280 40.902  1.00 66.00  ? 491 GLU A OE1 1 
ATOM   3773 O OE2 . GLU A 1 490 ? 17.579  -54.261 41.603  1.00 84.18  ? 491 GLU A OE2 1 
ATOM   3774 N N   . PRO A 1 491 ? 21.284  -50.725 38.642  1.00 109.82 ? 492 PRO A N   1 
ATOM   3775 C CA  . PRO A 1 491 ? 22.433  -49.841 38.388  1.00 107.81 ? 492 PRO A CA  1 
ATOM   3776 C C   . PRO A 1 491 ? 23.696  -50.634 38.113  1.00 110.81 ? 492 PRO A C   1 
ATOM   3777 O O   . PRO A 1 491 ? 24.332  -50.484 37.064  1.00 90.20  ? 492 PRO A O   1 
ATOM   3778 C CB  . PRO A 1 491 ? 22.537  -49.036 39.687  1.00 91.20  ? 492 PRO A CB  1 
ATOM   3779 C CG  . PRO A 1 491 ? 21.129  -48.927 40.140  1.00 72.40  ? 492 PRO A CG  1 
ATOM   3780 C CD  . PRO A 1 491 ? 20.522  -50.270 39.824  1.00 83.53  ? 492 PRO A CD  1 
ATOM   3781 N N   . ARG A 1 492 ? 24.031  -51.484 39.077  1.00 118.66 ? 493 ARG A N   1 
ATOM   3782 C CA  . ARG A 1 492 ? 24.964  -52.573 38.868  1.00 120.12 ? 493 ARG A CA  1 
ATOM   3783 C C   . ARG A 1 492 ? 24.209  -53.878 39.103  1.00 116.20 ? 493 ARG A C   1 
ATOM   3784 O O   . ARG A 1 492 ? 23.754  -54.158 40.216  1.00 108.27 ? 493 ARG A O   1 
ATOM   3785 C CB  . ARG A 1 492 ? 26.180  -52.460 39.798  1.00 114.31 ? 493 ARG A CB  1 
ATOM   3786 C CG  . ARG A 1 492 ? 25.869  -51.886 41.175  1.00 109.15 ? 493 ARG A CG  1 
ATOM   3787 C CD  . ARG A 1 492 ? 26.513  -52.700 42.291  1.00 111.47 ? 493 ARG A CD  1 
ATOM   3788 N NE  . ARG A 1 492 ? 27.102  -51.844 43.323  1.00 134.07 ? 493 ARG A NE  1 
ATOM   3789 C CZ  . ARG A 1 492 ? 26.408  -51.187 44.252  1.00 123.20 ? 493 ARG A CZ  1 
ATOM   3790 N NH1 . ARG A 1 492 ? 25.084  -51.275 44.288  1.00 122.09 ? 493 ARG A NH1 1 
ATOM   3791 N NH2 . ARG A 1 492 ? 27.042  -50.435 45.146  1.00 102.52 ? 493 ARG A NH2 1 
ATOM   3792 N N   . ASP A 1 493 ? 24.031  -54.644 38.033  1.00 107.24 ? 494 ASP A N   1 
ATOM   3793 C CA  . ASP A 1 493 ? 23.534  -56.006 38.144  1.00 113.04 ? 494 ASP A CA  1 
ATOM   3794 C C   . ASP A 1 493 ? 23.900  -56.754 36.873  1.00 108.33 ? 494 ASP A C   1 
ATOM   3795 O O   . ASP A 1 493 ? 23.241  -56.610 35.843  1.00 99.07  ? 494 ASP A O   1 
ATOM   3796 C CB  . ASP A 1 493 ? 22.025  -56.038 38.388  1.00 109.27 ? 494 ASP A CB  1 
ATOM   3797 C CG  . ASP A 1 493 ? 21.552  -57.379 38.932  1.00 106.48 ? 494 ASP A CG  1 
ATOM   3798 O OD1 . ASP A 1 493 ? 22.414  -58.213 39.291  1.00 100.60 ? 494 ASP A OD1 1 
ATOM   3799 O OD2 . ASP A 1 493 ? 20.321  -57.594 39.008  1.00 103.28 ? 494 ASP A OD2 1 
ATOM   3800 N N   . PRO A 1 494 ? 24.978  -57.546 36.946  1.00 111.29 ? 495 PRO A N   1 
ATOM   3801 C CA  . PRO A 1 494 ? 25.540  -58.233 35.783  1.00 110.31 ? 495 PRO A CA  1 
ATOM   3802 C C   . PRO A 1 494 ? 24.576  -59.220 35.122  1.00 111.43 ? 495 PRO A C   1 
ATOM   3803 O O   . PRO A 1 494 ? 24.149  -58.966 33.993  1.00 113.73 ? 495 PRO A O   1 
ATOM   3804 C CB  . PRO A 1 494 ? 26.756  -58.969 36.369  1.00 112.45 ? 495 PRO A CB  1 
ATOM   3805 C CG  . PRO A 1 494 ? 27.115  -58.189 37.599  1.00 102.75 ? 495 PRO A CG  1 
ATOM   3806 C CD  . PRO A 1 494 ? 25.797  -57.747 38.156  1.00 108.13 ? 495 PRO A CD  1 
ATOM   3807 N N   . LYS A 1 495 ? 24.229  -60.306 35.811  1.00 104.89 ? 496 LYS A N   1 
ATOM   3808 C CA  . LYS A 1 495 ? 23.618  -61.457 35.144  1.00 103.35 ? 496 LYS A CA  1 
ATOM   3809 C C   . LYS A 1 495 ? 22.175  -61.227 34.687  1.00 110.39 ? 496 LYS A C   1 
ATOM   3810 O O   . LYS A 1 495 ? 21.751  -61.796 33.670  1.00 105.89 ? 496 LYS A O   1 
ATOM   3811 C CB  . LYS A 1 495 ? 23.682  -62.691 36.050  1.00 104.64 ? 496 LYS A CB  1 
ATOM   3812 C CG  . LYS A 1 495 ? 23.338  -63.991 35.323  1.00 105.40 ? 496 LYS A CG  1 
ATOM   3813 C CD  . LYS A 1 495 ? 24.286  -65.124 35.692  1.00 107.12 ? 496 LYS A CD  1 
ATOM   3814 C CE  . LYS A 1 495 ? 24.029  -66.358 34.832  1.00 106.15 ? 496 LYS A CE  1 
ATOM   3815 N NZ  . LYS A 1 495 ? 25.026  -67.441 35.072  1.00 99.96  ? 496 LYS A NZ  1 
ATOM   3816 N N   . ALA A 1 496 ? 21.424  -60.409 35.427  1.00 113.34 ? 497 ALA A N   1 
ATOM   3817 C CA  . ALA A 1 496 ? 20.058  -60.046 35.024  1.00 105.91 ? 497 ALA A CA  1 
ATOM   3818 C C   . ALA A 1 496 ? 20.076  -59.309 33.679  1.00 95.55  ? 497 ALA A C   1 
ATOM   3819 O O   . ALA A 1 496 ? 20.846  -58.358 33.499  1.00 81.45  ? 497 ALA A O   1 
ATOM   3820 C CB  . ALA A 1 496 ? 19.386  -59.195 36.096  1.00 90.84  ? 497 ALA A CB  1 
ATOM   3821 N N   . PRO A 1 497 ? 19.230  -59.754 32.730  1.00 94.06  ? 498 PRO A N   1 
ATOM   3822 C CA  . PRO A 1 497 ? 19.282  -59.255 31.345  1.00 83.94  ? 498 PRO A CA  1 
ATOM   3823 C C   . PRO A 1 497 ? 19.031  -57.748 31.278  1.00 72.65  ? 498 PRO A C   1 
ATOM   3824 O O   . PRO A 1 497 ? 18.238  -57.216 32.058  1.00 67.53  ? 498 PRO A O   1 
ATOM   3825 C CB  . PRO A 1 497 ? 18.177  -60.048 30.638  1.00 70.52  ? 498 PRO A CB  1 
ATOM   3826 C CG  . PRO A 1 497 ? 17.243  -60.455 31.742  1.00 74.51  ? 498 PRO A CG  1 
ATOM   3827 C CD  . PRO A 1 497 ? 18.103  -60.677 32.951  1.00 77.72  ? 498 PRO A CD  1 
ATOM   3828 N N   . GLN A 1 498 ? 19.725  -57.071 30.369  1.00 61.35  ? 499 GLN A N   1 
ATOM   3829 C CA  . GLN A 1 498 ? 19.723  -55.619 30.356  1.00 52.76  ? 499 GLN A CA  1 
ATOM   3830 C C   . GLN A 1 498 ? 18.683  -55.064 29.396  1.00 59.68  ? 499 GLN A C   1 
ATOM   3831 O O   . GLN A 1 498 ? 18.457  -55.602 28.314  1.00 62.70  ? 499 GLN A O   1 
ATOM   3832 C CB  . GLN A 1 498 ? 21.110  -55.082 29.988  1.00 51.62  ? 499 GLN A CB  1 
ATOM   3833 C CG  . GLN A 1 498 ? 22.199  -55.379 31.005  1.00 60.02  ? 499 GLN A CG  1 
ATOM   3834 C CD  . GLN A 1 498 ? 22.036  -54.605 32.310  1.00 68.91  ? 499 GLN A CD  1 
ATOM   3835 O OE1 . GLN A 1 498 ? 22.169  -53.377 32.342  1.00 62.12  ? 499 GLN A OE1 1 
ATOM   3836 N NE2 . GLN A 1 498 ? 21.759  -55.325 33.395  1.00 63.50  ? 499 GLN A NE2 1 
ATOM   3837 N N   . TRP A 1 499 ? 18.062  -53.970 29.817  1.00 51.54  ? 500 TRP A N   1 
ATOM   3838 C CA  . TRP A 1 499 ? 17.097  -53.227 29.020  1.00 40.10  ? 500 TRP A CA  1 
ATOM   3839 C C   . TRP A 1 499 ? 17.850  -52.172 28.210  1.00 35.87  ? 500 TRP A C   1 
ATOM   3840 O O   . TRP A 1 499 ? 18.395  -51.227 28.772  1.00 39.37  ? 500 TRP A O   1 
ATOM   3841 C CB  . TRP A 1 499 ? 16.058  -52.615 29.963  1.00 39.00  ? 500 TRP A CB  1 
ATOM   3842 C CG  . TRP A 1 499 ? 14.914  -51.854 29.372  1.00 41.53  ? 500 TRP A CG  1 
ATOM   3843 C CD1 . TRP A 1 499 ? 14.782  -51.406 28.091  1.00 39.95  ? 500 TRP A CD1 1 
ATOM   3844 C CD2 . TRP A 1 499 ? 13.736  -51.429 30.070  1.00 44.52  ? 500 TRP A CD2 1 
ATOM   3845 N NE1 . TRP A 1 499 ? 13.591  -50.735 27.947  1.00 41.17  ? 500 TRP A NE1 1 
ATOM   3846 C CE2 . TRP A 1 499 ? 12.929  -50.733 29.148  1.00 37.78  ? 500 TRP A CE2 1 
ATOM   3847 C CE3 . TRP A 1 499 ? 13.288  -51.567 31.396  1.00 35.09  ? 500 TRP A CE3 1 
ATOM   3848 C CZ2 . TRP A 1 499 ? 11.695  -50.181 29.498  1.00 36.64  ? 500 TRP A CZ2 1 
ATOM   3849 C CZ3 . TRP A 1 499 ? 12.063  -51.018 31.746  1.00 33.22  ? 500 TRP A CZ3 1 
ATOM   3850 C CH2 . TRP A 1 499 ? 11.278  -50.335 30.797  1.00 35.86  ? 500 TRP A CH2 1 
ATOM   3851 N N   . PRO A 1 500 ? 17.925  -52.356 26.886  1.00 37.56  ? 501 PRO A N   1 
ATOM   3852 C CA  . PRO A 1 500 ? 18.665  -51.432 26.009  1.00 38.70  ? 501 PRO A CA  1 
ATOM   3853 C C   . PRO A 1 500 ? 17.850  -50.213 25.591  1.00 37.41  ? 501 PRO A C   1 
ATOM   3854 O O   . PRO A 1 500 ? 16.631  -50.298 25.500  1.00 48.64  ? 501 PRO A O   1 
ATOM   3855 C CB  . PRO A 1 500 ? 18.982  -52.295 24.791  1.00 33.88  ? 501 PRO A CB  1 
ATOM   3856 C CG  . PRO A 1 500 ? 17.838  -53.257 24.728  1.00 38.15  ? 501 PRO A CG  1 
ATOM   3857 C CD  . PRO A 1 500 ? 17.415  -53.527 26.154  1.00 34.35  ? 501 PRO A CD  1 
ATOM   3858 N N   . PRO A 1 501 ? 18.517  -49.080 25.349  1.00 40.62  ? 502 PRO A N   1 
ATOM   3859 C CA  . PRO A 1 501 ? 17.783  -47.910 24.853  1.00 36.92  ? 502 PRO A CA  1 
ATOM   3860 C C   . PRO A 1 501 ? 17.121  -48.171 23.497  1.00 42.28  ? 502 PRO A C   1 
ATOM   3861 O O   . PRO A 1 501 ? 17.628  -48.946 22.692  1.00 49.51  ? 502 PRO A O   1 
ATOM   3862 C CB  . PRO A 1 501 ? 18.868  -46.835 24.737  1.00 32.33  ? 502 PRO A CB  1 
ATOM   3863 C CG  . PRO A 1 501 ? 19.930  -47.274 25.697  1.00 37.19  ? 502 PRO A CG  1 
ATOM   3864 C CD  . PRO A 1 501 ? 19.924  -48.771 25.649  1.00 31.90  ? 502 PRO A CD  1 
ATOM   3865 N N   . TYR A 1 502 ? 15.975  -47.539 23.277  1.00 47.70  ? 503 TYR A N   1 
ATOM   3866 C CA  . TYR A 1 502 ? 15.251  -47.620 22.016  1.00 41.19  ? 503 TYR A CA  1 
ATOM   3867 C C   . TYR A 1 502 ? 15.832  -46.615 21.028  1.00 45.12  ? 503 TYR A C   1 
ATOM   3868 O O   . TYR A 1 502 ? 16.015  -45.444 21.370  1.00 43.36  ? 503 TYR A O   1 
ATOM   3869 C CB  . TYR A 1 502 ? 13.759  -47.351 22.250  1.00 38.21  ? 503 TYR A CB  1 
ATOM   3870 C CG  . TYR A 1 502 ? 12.900  -47.292 21.001  1.00 35.41  ? 503 TYR A CG  1 
ATOM   3871 C CD1 . TYR A 1 502 ? 12.813  -46.125 20.237  1.00 32.70  ? 503 TYR A CD1 1 
ATOM   3872 C CD2 . TYR A 1 502 ? 12.151  -48.391 20.606  1.00 32.78  ? 503 TYR A CD2 1 
ATOM   3873 C CE1 . TYR A 1 502 ? 12.029  -46.069 19.106  1.00 31.61  ? 503 TYR A CE1 1 
ATOM   3874 C CE2 . TYR A 1 502 ? 11.356  -48.346 19.475  1.00 35.71  ? 503 TYR A CE2 1 
ATOM   3875 C CZ  . TYR A 1 502 ? 11.299  -47.184 18.722  1.00 42.73  ? 503 TYR A CZ  1 
ATOM   3876 O OH  . TYR A 1 502 ? 10.504  -47.144 17.587  1.00 43.74  ? 503 TYR A OH  1 
ATOM   3877 N N   . THR A 1 503 ? 16.125  -47.071 19.811  1.00 43.30  ? 504 THR A N   1 
ATOM   3878 C CA  . THR A 1 503 ? 16.655  -46.193 18.761  1.00 48.23  ? 504 THR A CA  1 
ATOM   3879 C C   . THR A 1 503 ? 15.834  -46.307 17.464  1.00 46.15  ? 504 THR A C   1 
ATOM   3880 O O   . THR A 1 503 ? 15.127  -47.301 17.252  1.00 42.88  ? 504 THR A O   1 
ATOM   3881 C CB  . THR A 1 503 ? 18.139  -46.505 18.465  1.00 47.71  ? 504 THR A CB  1 
ATOM   3882 O OG1 . THR A 1 503 ? 18.248  -47.779 17.819  1.00 60.62  ? 504 THR A OG1 1 
ATOM   3883 C CG2 . THR A 1 503 ? 18.944  -46.531 19.749  1.00 35.52  ? 504 THR A CG2 1 
ATOM   3884 N N   . ALA A 1 504 ? 15.923  -45.291 16.604  1.00 50.36  ? 505 ALA A N   1 
ATOM   3885 C CA  . ALA A 1 504 ? 15.098  -45.235 15.387  1.00 46.39  ? 505 ALA A CA  1 
ATOM   3886 C C   . ALA A 1 504 ? 15.427  -46.372 14.427  1.00 51.30  ? 505 ALA A C   1 
ATOM   3887 O O   . ALA A 1 504 ? 14.541  -46.909 13.752  1.00 46.41  ? 505 ALA A O   1 
ATOM   3888 C CB  . ALA A 1 504 ? 15.264  -43.906 14.693  1.00 36.34  ? 505 ALA A CB  1 
ATOM   3889 N N   . GLY A 1 505 ? 16.710  -46.727 14.382  1.00 48.30  ? 506 GLY A N   1 
ATOM   3890 C CA  . GLY A 1 505 ? 17.174  -47.879 13.642  1.00 38.06  ? 506 GLY A CA  1 
ATOM   3891 C C   . GLY A 1 505 ? 16.761  -49.192 14.276  1.00 47.47  ? 506 GLY A C   1 
ATOM   3892 O O   . GLY A 1 505 ? 15.866  -49.875 13.782  1.00 50.33  ? 506 GLY A O   1 
ATOM   3893 N N   . ALA A 1 506 ? 17.403  -49.556 15.380  1.00 48.84  ? 507 ALA A N   1 
ATOM   3894 C CA  . ALA A 1 506 ? 17.206  -50.894 15.930  1.00 48.91  ? 507 ALA A CA  1 
ATOM   3895 C C   . ALA A 1 506 ? 15.800  -51.098 16.517  1.00 53.67  ? 507 ALA A C   1 
ATOM   3896 O O   . ALA A 1 506 ? 15.277  -52.217 16.482  1.00 48.41  ? 507 ALA A O   1 
ATOM   3897 C CB  . ALA A 1 506 ? 18.273  -51.190 16.970  1.00 40.32  ? 507 ALA A CB  1 
ATOM   3898 N N   . GLN A 1 507 ? 15.202  -50.028 17.053  1.00 47.09  ? 508 GLN A N   1 
ATOM   3899 C CA  . GLN A 1 507 ? 13.839  -50.070 17.604  1.00 45.12  ? 508 GLN A CA  1 
ATOM   3900 C C   . GLN A 1 507 ? 13.634  -51.150 18.682  1.00 47.54  ? 508 GLN A C   1 
ATOM   3901 O O   . GLN A 1 507 ? 12.629  -51.868 18.680  1.00 44.60  ? 508 GLN A O   1 
ATOM   3902 C CB  . GLN A 1 507 ? 12.829  -50.272 16.469  1.00 38.97  ? 508 GLN A CB  1 
ATOM   3903 C CG  . GLN A 1 507 ? 12.913  -49.202 15.403  1.00 46.20  ? 508 GLN A CG  1 
ATOM   3904 C CD  . GLN A 1 507 ? 12.067  -49.513 14.181  1.00 60.12  ? 508 GLN A CD  1 
ATOM   3905 O OE1 . GLN A 1 507 ? 10.842  -49.628 14.269  1.00 64.98  ? 508 GLN A OE1 1 
ATOM   3906 N NE2 . GLN A 1 507 ? 12.719  -49.654 13.032  1.00 52.95  ? 508 GLN A NE2 1 
ATOM   3907 N N   . GLN A 1 508 ? 14.584  -51.251 19.607  1.00 43.31  ? 509 GLN A N   1 
ATOM   3908 C CA  . GLN A 1 508 ? 14.542  -52.284 20.633  1.00 38.01  ? 509 GLN A CA  1 
ATOM   3909 C C   . GLN A 1 508 ? 13.706  -51.881 21.855  1.00 45.10  ? 509 GLN A C   1 
ATOM   3910 O O   . GLN A 1 508 ? 13.789  -50.756 22.365  1.00 43.04  ? 509 GLN A O   1 
ATOM   3911 C CB  . GLN A 1 508 ? 15.961  -52.647 21.074  1.00 41.90  ? 509 GLN A CB  1 
ATOM   3912 C CG  . GLN A 1 508 ? 16.822  -53.239 19.966  1.00 46.58  ? 509 GLN A CG  1 
ATOM   3913 C CD  . GLN A 1 508 ? 18.156  -53.767 20.475  1.00 49.72  ? 509 GLN A CD  1 
ATOM   3914 O OE1 . GLN A 1 508 ? 19.050  -52.995 20.817  1.00 47.98  ? 509 GLN A OE1 1 
ATOM   3915 N NE2 . GLN A 1 508 ? 18.291  -55.090 20.535  1.00 47.75  ? 509 GLN A NE2 1 
ATOM   3916 N N   . TYR A 1 509 ? 12.898  -52.820 22.323  1.00 38.31  ? 510 TYR A N   1 
ATOM   3917 C CA  . TYR A 1 509 ? 12.097  -52.599 23.504  1.00 38.37  ? 510 TYR A CA  1 
ATOM   3918 C C   . TYR A 1 509 ? 12.055  -53.889 24.311  1.00 42.87  ? 510 TYR A C   1 
ATOM   3919 O O   . TYR A 1 509 ? 12.405  -54.941 23.789  1.00 43.26  ? 510 TYR A O   1 
ATOM   3920 C CB  . TYR A 1 509 ? 10.700  -52.137 23.108  1.00 35.34  ? 510 TYR A CB  1 
ATOM   3921 C CG  . TYR A 1 509 ? 9.869   -53.191 22.427  1.00 37.28  ? 510 TYR A CG  1 
ATOM   3922 C CD1 . TYR A 1 509 ? 9.883   -53.334 21.046  1.00 40.14  ? 510 TYR A CD1 1 
ATOM   3923 C CD2 . TYR A 1 509 ? 9.053   -54.035 23.164  1.00 40.46  ? 510 TYR A CD2 1 
ATOM   3924 C CE1 . TYR A 1 509 ? 9.107   -54.298 20.420  1.00 40.25  ? 510 TYR A CE1 1 
ATOM   3925 C CE2 . TYR A 1 509 ? 8.288   -54.996 22.556  1.00 41.53  ? 510 TYR A CE2 1 
ATOM   3926 C CZ  . TYR A 1 509 ? 8.311   -55.123 21.188  1.00 39.23  ? 510 TYR A CZ  1 
ATOM   3927 O OH  . TYR A 1 509 ? 7.536   -56.091 20.602  1.00 45.44  ? 510 TYR A OH  1 
ATOM   3928 N N   . VAL A 1 510 ? 11.641  -53.819 25.576  1.00 38.80  ? 511 VAL A N   1 
ATOM   3929 C CA  . VAL A 1 510 ? 11.522  -55.033 26.384  1.00 32.35  ? 511 VAL A CA  1 
ATOM   3930 C C   . VAL A 1 510 ? 10.079  -55.392 26.692  1.00 39.18  ? 511 VAL A C   1 
ATOM   3931 O O   . VAL A 1 510 ? 9.200   -54.535 26.720  1.00 47.13  ? 511 VAL A O   1 
ATOM   3932 C CB  . VAL A 1 510 ? 12.271  -54.909 27.708  1.00 37.53  ? 511 VAL A CB  1 
ATOM   3933 C CG1 . VAL A 1 510 ? 13.747  -54.644 27.448  1.00 46.55  ? 511 VAL A CG1 1 
ATOM   3934 C CG2 . VAL A 1 510 ? 11.667  -53.806 28.549  1.00 39.56  ? 511 VAL A CG2 1 
ATOM   3935 N N   . SER A 1 511 ? 9.833   -56.675 26.909  1.00 42.33  ? 512 SER A N   1 
ATOM   3936 C CA  . SER A 1 511 ? 8.524   -57.112 27.358  1.00 39.44  ? 512 SER A CA  1 
ATOM   3937 C C   . SER A 1 511 ? 8.531   -57.223 28.875  1.00 48.05  ? 512 SER A C   1 
ATOM   3938 O O   . SER A 1 511 ? 9.445   -57.807 29.466  1.00 47.07  ? 512 SER A O   1 
ATOM   3939 C CB  . SER A 1 511 ? 8.148   -58.449 26.740  1.00 44.22  ? 512 SER A CB  1 
ATOM   3940 O OG  . SER A 1 511 ? 8.964   -59.477 27.268  1.00 66.70  ? 512 SER A OG  1 
ATOM   3941 N N   . LEU A 1 512 ? 7.511   -56.658 29.502  1.00 41.26  ? 513 LEU A N   1 
ATOM   3942 C CA  . LEU A 1 512 ? 7.357   -56.765 30.935  1.00 34.94  ? 513 LEU A CA  1 
ATOM   3943 C C   . LEU A 1 512 ? 6.238   -57.740 31.276  1.00 40.70  ? 513 LEU A C   1 
ATOM   3944 O O   . LEU A 1 512 ? 5.072   -57.477 30.976  1.00 42.81  ? 513 LEU A O   1 
ATOM   3945 C CB  . LEU A 1 512 ? 7.075   -55.391 31.536  1.00 32.55  ? 513 LEU A CB  1 
ATOM   3946 C CG  . LEU A 1 512 ? 8.126   -54.330 31.215  1.00 36.45  ? 513 LEU A CG  1 
ATOM   3947 C CD1 . LEU A 1 512 ? 7.695   -52.949 31.699  1.00 35.38  ? 513 LEU A CD1 1 
ATOM   3948 C CD2 . LEU A 1 512 ? 9.441   -54.715 31.834  1.00 30.21  ? 513 LEU A CD2 1 
ATOM   3949 N N   . ASP A 1 513 ? 6.601   -58.884 31.851  1.00 39.58  ? 514 ASP A N   1 
ATOM   3950 C CA  . ASP A 1 513 ? 5.653   -59.693 32.626  1.00 52.91  ? 514 ASP A CA  1 
ATOM   3951 C C   . ASP A 1 513 ? 6.413   -60.635 33.557  1.00 50.37  ? 514 ASP A C   1 
ATOM   3952 O O   . ASP A 1 513 ? 7.532   -60.335 33.966  1.00 47.57  ? 514 ASP A O   1 
ATOM   3953 C CB  . ASP A 1 513 ? 4.657   -60.475 31.742  1.00 56.37  ? 514 ASP A CB  1 
ATOM   3954 C CG  . ASP A 1 513 ? 5.324   -61.325 30.694  1.00 69.85  ? 514 ASP A CG  1 
ATOM   3955 O OD1 . ASP A 1 513 ? 6.557   -61.211 30.515  1.00 82.93  ? 514 ASP A OD1 1 
ATOM   3956 O OD2 . ASP A 1 513 ? 4.596   -62.097 30.030  1.00 75.50  ? 514 ASP A OD2 1 
ATOM   3957 N N   . LEU A 1 514 ? 5.799   -61.757 33.907  1.00 50.91  ? 515 LEU A N   1 
ATOM   3958 C CA  . LEU A 1 514 ? 6.337   -62.582 34.973  1.00 42.82  ? 515 LEU A CA  1 
ATOM   3959 C C   . LEU A 1 514 ? 7.673   -63.207 34.590  1.00 48.34  ? 515 LEU A C   1 
ATOM   3960 O O   . LEU A 1 514 ? 8.518   -63.427 35.454  1.00 56.66  ? 515 LEU A O   1 
ATOM   3961 C CB  . LEU A 1 514 ? 5.324   -63.650 35.368  1.00 48.16  ? 515 LEU A CB  1 
ATOM   3962 C CG  . LEU A 1 514 ? 3.939   -63.105 35.742  1.00 46.81  ? 515 LEU A CG  1 
ATOM   3963 C CD1 . LEU A 1 514 ? 3.046   -64.201 36.299  1.00 46.15  ? 515 LEU A CD1 1 
ATOM   3964 C CD2 . LEU A 1 514 ? 4.060   -61.961 36.730  1.00 43.38  ? 515 LEU A CD2 1 
ATOM   3965 N N   . ARG A 1 515 ? 7.875   -63.474 33.301  1.00 54.69  ? 516 ARG A N   1 
ATOM   3966 C CA  . ARG A 1 515 ? 9.171   -63.962 32.808  1.00 56.87  ? 516 ARG A CA  1 
ATOM   3967 C C   . ARG A 1 515 ? 10.198  -62.830 32.864  1.00 51.46  ? 516 ARG A C   1 
ATOM   3968 O O   . ARG A 1 515 ? 9.821   -61.664 32.914  1.00 58.59  ? 516 ARG A O   1 
ATOM   3969 C CB  . ARG A 1 515 ? 9.049   -64.490 31.370  1.00 67.32  ? 516 ARG A CB  1 
ATOM   3970 C CG  . ARG A 1 515 ? 7.969   -65.555 31.146  1.00 80.49  ? 516 ARG A CG  1 
ATOM   3971 C CD  . ARG A 1 515 ? 7.684   -65.762 29.651  1.00 79.76  ? 516 ARG A CD  1 
ATOM   3972 N NE  . ARG A 1 515 ? 7.267   -64.513 29.006  1.00 102.44 ? 516 ARG A NE  1 
ATOM   3973 C CZ  . ARG A 1 515 ? 7.894   -63.931 27.981  1.00 106.02 ? 516 ARG A CZ  1 
ATOM   3974 N NH1 . ARG A 1 515 ? 8.978   -64.488 27.448  1.00 97.91  ? 516 ARG A NH1 1 
ATOM   3975 N NH2 . ARG A 1 515 ? 7.425   -62.790 27.479  1.00 83.72  ? 516 ARG A NH2 1 
ATOM   3976 N N   . PRO A 1 516 ? 11.498  -63.158 32.862  1.00 50.60  ? 517 PRO A N   1 
ATOM   3977 C CA  . PRO A 1 516 ? 12.528  -62.108 32.790  1.00 55.58  ? 517 PRO A CA  1 
ATOM   3978 C C   . PRO A 1 516 ? 12.443  -61.262 31.516  1.00 45.19  ? 517 PRO A C   1 
ATOM   3979 O O   . PRO A 1 516 ? 11.753  -61.655 30.579  1.00 53.01  ? 517 PRO A O   1 
ATOM   3980 C CB  . PRO A 1 516 ? 13.839  -62.899 32.825  1.00 46.70  ? 517 PRO A CB  1 
ATOM   3981 C CG  . PRO A 1 516 ? 13.495  -64.138 33.554  1.00 41.49  ? 517 PRO A CG  1 
ATOM   3982 C CD  . PRO A 1 516 ? 12.079  -64.475 33.164  1.00 48.35  ? 517 PRO A CD  1 
ATOM   3983 N N   . LEU A 1 517 ? 13.129  -60.119 31.494  1.00 52.10  ? 518 LEU A N   1 
ATOM   3984 C CA  . LEU A 1 517 ? 13.115  -59.220 30.332  1.00 45.82  ? 518 LEU A CA  1 
ATOM   3985 C C   . LEU A 1 517 ? 13.453  -59.931 29.038  1.00 45.13  ? 518 LEU A C   1 
ATOM   3986 O O   . LEU A 1 517 ? 14.431  -60.678 28.962  1.00 50.08  ? 518 LEU A O   1 
ATOM   3987 C CB  . LEU A 1 517 ? 14.107  -58.067 30.502  1.00 45.39  ? 518 LEU A CB  1 
ATOM   3988 C CG  . LEU A 1 517 ? 13.866  -56.961 31.522  1.00 46.93  ? 518 LEU A CG  1 
ATOM   3989 C CD1 . LEU A 1 517 ? 14.769  -55.792 31.217  1.00 37.14  ? 518 LEU A CD1 1 
ATOM   3990 C CD2 . LEU A 1 517 ? 12.427  -56.529 31.497  1.00 52.31  ? 518 LEU A CD2 1 
ATOM   3991 N N   . GLU A 1 518 ? 12.645  -59.681 28.017  1.00 51.82  ? 519 GLU A N   1 
ATOM   3992 C CA  . GLU A 1 518 ? 12.935  -60.176 26.683  1.00 48.05  ? 519 GLU A CA  1 
ATOM   3993 C C   . GLU A 1 518 ? 13.025  -58.987 25.735  1.00 42.79  ? 519 GLU A C   1 
ATOM   3994 O O   . GLU A 1 518 ? 12.102  -58.189 25.662  1.00 54.39  ? 519 GLU A O   1 
ATOM   3995 C CB  . GLU A 1 518 ? 11.866  -61.170 26.235  1.00 51.14  ? 519 GLU A CB  1 
ATOM   3996 C CG  . GLU A 1 518 ? 12.201  -61.887 24.940  1.00 80.66  ? 519 GLU A CG  1 
ATOM   3997 C CD  . GLU A 1 518 ? 11.122  -62.873 24.517  1.00 97.37  ? 519 GLU A CD  1 
ATOM   3998 O OE1 . GLU A 1 518 ? 10.554  -62.697 23.409  1.00 78.33  ? 519 GLU A OE1 1 
ATOM   3999 O OE2 . GLU A 1 518 ? 10.853  -63.823 25.292  1.00 97.51  ? 519 GLU A OE2 1 
ATOM   4000 N N   . VAL A 1 519 ? 14.147  -58.850 25.037  1.00 45.95  ? 520 VAL A N   1 
ATOM   4001 C CA  . VAL A 1 519 ? 14.328  -57.760 24.075  1.00 44.68  ? 520 VAL A CA  1 
ATOM   4002 C C   . VAL A 1 519 ? 13.745  -58.083 22.693  1.00 40.65  ? 520 VAL A C   1 
ATOM   4003 O O   . VAL A 1 519 ? 13.993  -59.148 22.143  1.00 49.59  ? 520 VAL A O   1 
ATOM   4004 C CB  . VAL A 1 519 ? 15.814  -57.412 23.906  1.00 37.27  ? 520 VAL A CB  1 
ATOM   4005 C CG1 . VAL A 1 519 ? 16.001  -56.417 22.774  1.00 36.20  ? 520 VAL A CG1 1 
ATOM   4006 C CG2 . VAL A 1 519 ? 16.372  -56.861 25.204  1.00 36.02  ? 520 VAL A CG2 1 
ATOM   4007 N N   . ARG A 1 520 ? 12.966  -57.160 22.138  1.00 43.28  ? 521 ARG A N   1 
ATOM   4008 C CA  . ARG A 1 520 ? 12.396  -57.335 20.808  1.00 36.64  ? 521 ARG A CA  1 
ATOM   4009 C C   . ARG A 1 520 ? 12.618  -56.095 19.944  1.00 48.42  ? 521 ARG A C   1 
ATOM   4010 O O   . ARG A 1 520 ? 13.110  -55.070 20.422  1.00 42.31  ? 521 ARG A O   1 
ATOM   4011 C CB  . ARG A 1 520 ? 10.907  -57.654 20.901  1.00 36.98  ? 521 ARG A CB  1 
ATOM   4012 C CG  . ARG A 1 520 ? 10.614  -58.873 21.735  1.00 45.64  ? 521 ARG A CG  1 
ATOM   4013 C CD  . ARG A 1 520 ? 9.134   -59.061 21.974  1.00 45.96  ? 521 ARG A CD  1 
ATOM   4014 N NE  . ARG A 1 520 ? 8.896   -60.164 22.899  1.00 60.91  ? 521 ARG A NE  1 
ATOM   4015 C CZ  . ARG A 1 520 ? 7.754   -60.361 23.548  1.00 60.38  ? 521 ARG A CZ  1 
ATOM   4016 N NH1 . ARG A 1 520 ? 6.742   -59.521 23.373  1.00 55.39  ? 521 ARG A NH1 1 
ATOM   4017 N NH2 . ARG A 1 520 ? 7.625   -61.393 24.372  1.00 59.65  ? 521 ARG A NH2 1 
ATOM   4018 N N   . ARG A 1 521 ? 12.260  -56.204 18.665  1.00 49.90  ? 522 ARG A N   1 
ATOM   4019 C CA  . ARG A 1 521 ? 12.445  -55.120 17.710  1.00 38.99  ? 522 ARG A CA  1 
ATOM   4020 C C   . ARG A 1 521 ? 11.115  -54.685 17.127  1.00 47.70  ? 522 ARG A C   1 
ATOM   4021 O O   . ARG A 1 521 ? 10.300  -55.527 16.758  1.00 51.45  ? 522 ARG A O   1 
ATOM   4022 C CB  . ARG A 1 521 ? 13.371  -55.545 16.570  1.00 53.53  ? 522 ARG A CB  1 
ATOM   4023 C CG  . ARG A 1 521 ? 14.813  -55.812 16.940  1.00 51.26  ? 522 ARG A CG  1 
ATOM   4024 C CD  . ARG A 1 521 ? 15.678  -55.822 15.682  1.00 61.37  ? 522 ARG A CD  1 
ATOM   4025 N NE  . ARG A 1 521 ? 15.751  -54.504 15.044  1.00 71.07  ? 522 ARG A NE  1 
ATOM   4026 C CZ  . ARG A 1 521 ? 15.576  -54.279 13.742  1.00 57.07  ? 522 ARG A CZ  1 
ATOM   4027 N NH1 . ARG A 1 521 ? 15.314  -55.286 12.921  1.00 68.04  ? 522 ARG A NH1 1 
ATOM   4028 N NH2 . ARG A 1 521 ? 15.665  -53.042 13.260  1.00 48.23  ? 522 ARG A NH2 1 
ATOM   4029 N N   . GLY A 1 522 ? 10.901  -53.373 17.039  1.00 47.53  ? 523 GLY A N   1 
ATOM   4030 C CA  . GLY A 1 522 ? 9.727   -52.824 16.377  1.00 48.95  ? 523 GLY A CA  1 
ATOM   4031 C C   . GLY A 1 522 ? 8.431   -52.749 17.174  1.00 43.96  ? 523 GLY A C   1 
ATOM   4032 O O   . GLY A 1 522 ? 7.857   -53.763 17.567  1.00 52.00  ? 523 GLY A O   1 
ATOM   4033 N N   . LEU A 1 523 ? 7.960   -51.534 17.413  1.00 44.78  ? 524 LEU A N   1 
ATOM   4034 C CA  . LEU A 1 523 ? 6.654   -51.344 18.031  1.00 43.53  ? 524 LEU A CA  1 
ATOM   4035 C C   . LEU A 1 523 ? 5.619   -51.352 16.929  1.00 43.66  ? 524 LEU A C   1 
ATOM   4036 O O   . LEU A 1 523 ? 5.190   -50.290 16.476  1.00 45.68  ? 524 LEU A O   1 
ATOM   4037 C CB  . LEU A 1 523 ? 6.594   -50.028 18.813  1.00 35.62  ? 524 LEU A CB  1 
ATOM   4038 C CG  . LEU A 1 523 ? 7.450   -49.995 20.066  1.00 36.00  ? 524 LEU A CG  1 
ATOM   4039 C CD1 . LEU A 1 523 ? 7.616   -48.567 20.545  1.00 36.39  ? 524 LEU A CD1 1 
ATOM   4040 C CD2 . LEU A 1 523 ? 6.807   -50.888 21.128  1.00 30.93  ? 524 LEU A CD2 1 
ATOM   4041 N N   . ARG A 1 524 ? 5.244   -52.548 16.489  1.00 44.34  ? 525 ARG A N   1 
ATOM   4042 C CA  . ARG A 1 524 ? 4.389   -52.713 15.320  1.00 35.08  ? 525 ARG A CA  1 
ATOM   4043 C C   . ARG A 1 524 ? 4.844   -51.809 14.178  1.00 44.36  ? 525 ARG A C   1 
ATOM   4044 O O   . ARG A 1 524 ? 4.095   -50.933 13.734  1.00 42.67  ? 525 ARG A O   1 
ATOM   4045 C CB  . ARG A 1 524 ? 2.938   -52.421 15.684  1.00 41.87  ? 525 ARG A CB  1 
ATOM   4046 C CG  . ARG A 1 524 ? 2.457   -53.212 16.879  1.00 43.57  ? 525 ARG A CG  1 
ATOM   4047 C CD  . ARG A 1 524 ? 0.962   -53.095 17.066  1.00 38.54  ? 525 ARG A CD  1 
ATOM   4048 N NE  . ARG A 1 524 ? 0.508   -53.980 18.133  1.00 56.03  ? 525 ARG A NE  1 
ATOM   4049 C CZ  . ARG A 1 524 ? -0.764  -54.307 18.349  1.00 66.26  ? 525 ARG A CZ  1 
ATOM   4050 N NH1 . ARG A 1 524 ? -1.717  -53.815 17.567  1.00 64.76  ? 525 ARG A NH1 1 
ATOM   4051 N NH2 . ARG A 1 524 ? -1.082  -55.128 19.347  1.00 52.67  ? 525 ARG A NH2 1 
ATOM   4052 N N   . ALA A 1 525 ? 6.075   -52.013 13.715  1.00 40.08  ? 526 ALA A N   1 
ATOM   4053 C CA  . ALA A 1 525 ? 6.673   -51.124 12.717  1.00 45.50  ? 526 ALA A CA  1 
ATOM   4054 C C   . ALA A 1 525 ? 5.903   -51.093 11.394  1.00 42.49  ? 526 ALA A C   1 
ATOM   4055 O O   . ALA A 1 525 ? 5.782   -50.042 10.761  1.00 43.52  ? 526 ALA A O   1 
ATOM   4056 C CB  . ALA A 1 525 ? 8.118   -51.520 12.468  1.00 43.12  ? 526 ALA A CB  1 
ATOM   4057 N N   . GLN A 1 526 ? 5.386   -52.238 10.971  1.00 41.53  ? 527 GLN A N   1 
ATOM   4058 C CA  . GLN A 1 526 ? 4.660   -52.277 9.713   1.00 42.12  ? 527 GLN A CA  1 
ATOM   4059 C C   . GLN A 1 526 ? 3.396   -51.432 9.795   1.00 42.73  ? 527 GLN A C   1 
ATOM   4060 O O   . GLN A 1 526 ? 3.138   -50.607 8.922   1.00 43.35  ? 527 GLN A O   1 
ATOM   4061 C CB  . GLN A 1 526 ? 4.323   -53.717 9.327   1.00 41.95  ? 527 GLN A CB  1 
ATOM   4062 C CG  . GLN A 1 526 ? 5.540   -54.527 8.918   1.00 51.59  ? 527 GLN A CG  1 
ATOM   4063 C CD  . GLN A 1 526 ? 6.393   -53.826 7.869   1.00 58.00  ? 527 GLN A CD  1 
ATOM   4064 O OE1 . GLN A 1 526 ? 7.611   -53.684 8.044   1.00 50.35  ? 527 GLN A OE1 1 
ATOM   4065 N NE2 . GLN A 1 526 ? 5.759   -53.392 6.765   1.00 47.22  ? 527 GLN A NE2 1 
ATOM   4066 N N   . ALA A 1 527 ? 2.618   -51.625 10.854  1.00 40.61  ? 528 ALA A N   1 
ATOM   4067 C CA  . ALA A 1 527 ? 1.369   -50.889 11.012  1.00 41.45  ? 528 ALA A CA  1 
ATOM   4068 C C   . ALA A 1 527 ? 1.630   -49.405 11.263  1.00 39.54  ? 528 ALA A C   1 
ATOM   4069 O O   . ALA A 1 527 ? 0.892   -48.535 10.799  1.00 40.24  ? 528 ALA A O   1 
ATOM   4070 C CB  . ALA A 1 527 ? 0.539   -51.484 12.147  1.00 37.75  ? 528 ALA A CB  1 
ATOM   4071 N N   . CYS A 1 528 ? 2.691   -49.106 11.995  1.00 35.90  ? 529 CYS A N   1 
ATOM   4072 C CA  . CYS A 1 528 ? 2.908   -47.730 12.374  1.00 33.18  ? 529 CYS A CA  1 
ATOM   4073 C C   . CYS A 1 528 ? 3.477   -46.949 11.209  1.00 39.09  ? 529 CYS A C   1 
ATOM   4074 O O   . CYS A 1 528 ? 3.305   -45.731 11.128  1.00 40.10  ? 529 CYS A O   1 
ATOM   4075 C CB  . CYS A 1 528 ? 3.788   -47.659 13.620  1.00 34.43  ? 529 CYS A CB  1 
ATOM   4076 S SG  . CYS A 1 528 ? 2.797   -48.070 15.102  1.00 44.03  ? 529 CYS A SG  1 
ATOM   4077 N N   . ALA A 1 529 ? 4.108   -47.650 10.275  1.00 39.91  ? 530 ALA A N   1 
ATOM   4078 C CA  . ALA A 1 529 ? 4.542   -46.997 9.050   1.00 36.91  ? 530 ALA A CA  1 
ATOM   4079 C C   . ALA A 1 529 ? 3.331   -46.453 8.333   1.00 35.37  ? 530 ALA A C   1 
ATOM   4080 O O   . ALA A 1 529 ? 3.360   -45.351 7.797   1.00 37.14  ? 530 ALA A O   1 
ATOM   4081 C CB  . ALA A 1 529 ? 5.285   -47.941 8.180   1.00 37.94  ? 530 ALA A CB  1 
ATOM   4082 N N   . PHE A 1 530 ? 2.253   -47.229 8.355   1.00 35.56  ? 531 PHE A N   1 
ATOM   4083 C CA  . PHE A 1 530 ? 1.016   -46.831 7.710   1.00 32.39  ? 531 PHE A CA  1 
ATOM   4084 C C   . PHE A 1 530 ? 0.473   -45.557 8.342   1.00 38.23  ? 531 PHE A C   1 
ATOM   4085 O O   . PHE A 1 530 ? 0.193   -44.585 7.642   1.00 40.31  ? 531 PHE A O   1 
ATOM   4086 C CB  . PHE A 1 530 ? -0.026  -47.956 7.787   1.00 35.32  ? 531 PHE A CB  1 
ATOM   4087 C CG  . PHE A 1 530 ? -1.406  -47.518 7.403   1.00 35.72  ? 531 PHE A CG  1 
ATOM   4088 C CD1 . PHE A 1 530 ? -1.715  -47.244 6.085   1.00 40.41  ? 531 PHE A CD1 1 
ATOM   4089 C CD2 . PHE A 1 530 ? -2.388  -47.345 8.364   1.00 43.70  ? 531 PHE A CD2 1 
ATOM   4090 C CE1 . PHE A 1 530 ? -2.980  -46.822 5.728   1.00 41.77  ? 531 PHE A CE1 1 
ATOM   4091 C CE2 . PHE A 1 530 ? -3.651  -46.913 8.011   1.00 42.93  ? 531 PHE A CE2 1 
ATOM   4092 C CZ  . PHE A 1 530 ? -3.945  -46.656 6.688   1.00 41.05  ? 531 PHE A CZ  1 
ATOM   4093 N N   . TRP A 1 531 ? 0.352   -45.559 9.668   1.00 37.69  ? 532 TRP A N   1 
ATOM   4094 C CA  . TRP A 1 531 ? -0.255  -44.442 10.386  1.00 30.95  ? 532 TRP A CA  1 
ATOM   4095 C C   . TRP A 1 531 ? 0.641   -43.214 10.467  1.00 35.16  ? 532 TRP A C   1 
ATOM   4096 O O   . TRP A 1 531 ? 0.147   -42.088 10.485  1.00 43.97  ? 532 TRP A O   1 
ATOM   4097 C CB  . TRP A 1 531 ? -0.645  -44.867 11.802  1.00 33.19  ? 532 TRP A CB  1 
ATOM   4098 C CG  . TRP A 1 531 ? -1.759  -45.868 11.854  1.00 35.66  ? 532 TRP A CG  1 
ATOM   4099 C CD1 . TRP A 1 531 ? -1.650  -47.201 12.117  1.00 33.18  ? 532 TRP A CD1 1 
ATOM   4100 C CD2 . TRP A 1 531 ? -3.155  -45.615 11.640  1.00 36.45  ? 532 TRP A CD2 1 
ATOM   4101 N NE1 . TRP A 1 531 ? -2.887  -47.796 12.079  1.00 34.21  ? 532 TRP A NE1 1 
ATOM   4102 C CE2 . TRP A 1 531 ? -3.829  -46.846 11.786  1.00 33.92  ? 532 TRP A CE2 1 
ATOM   4103 C CE3 . TRP A 1 531 ? -3.900  -44.465 11.328  1.00 30.34  ? 532 TRP A CE3 1 
ATOM   4104 C CZ2 . TRP A 1 531 ? -5.210  -46.964 11.635  1.00 28.16  ? 532 TRP A CZ2 1 
ATOM   4105 C CZ3 . TRP A 1 531 ? -5.263  -44.579 11.186  1.00 31.03  ? 532 TRP A CZ3 1 
ATOM   4106 C CH2 . TRP A 1 531 ? -5.908  -45.821 11.338  1.00 34.19  ? 532 TRP A CH2 1 
ATOM   4107 N N   . ASN A 1 532 ? 1.953   -43.419 10.531  1.00 33.50  ? 533 ASN A N   1 
ATOM   4108 C CA  . ASN A 1 532 ? 2.858   -42.302 10.793  1.00 39.56  ? 533 ASN A CA  1 
ATOM   4109 C C   . ASN A 1 532 ? 3.464   -41.710 9.536   1.00 44.91  ? 533 ASN A C   1 
ATOM   4110 O O   . ASN A 1 532 ? 3.837   -40.544 9.521   1.00 40.23  ? 533 ASN A O   1 
ATOM   4111 C CB  . ASN A 1 532 ? 3.983   -42.733 11.733  1.00 35.13  ? 533 ASN A CB  1 
ATOM   4112 C CG  . ASN A 1 532 ? 3.498   -42.981 13.144  1.00 40.20  ? 533 ASN A CG  1 
ATOM   4113 O OD1 . ASN A 1 532 ? 2.516   -42.380 13.584  1.00 44.10  ? 533 ASN A OD1 1 
ATOM   4114 N ND2 . ASN A 1 532 ? 4.182   -43.869 13.866  1.00 35.31  ? 533 ASN A ND2 1 
ATOM   4115 N N   . ARG A 1 533 ? 3.558   -42.519 8.485   1.00 44.42  ? 534 ARG A N   1 
ATOM   4116 C CA  . ARG A 1 533 ? 4.226   -42.100 7.266   1.00 38.20  ? 534 ARG A CA  1 
ATOM   4117 C C   . ARG A 1 533 ? 3.272   -41.859 6.104   1.00 48.84  ? 534 ARG A C   1 
ATOM   4118 O O   . ARG A 1 533 ? 3.290   -40.782 5.509   1.00 54.16  ? 534 ARG A O   1 
ATOM   4119 C CB  . ARG A 1 533 ? 5.274   -43.129 6.871   1.00 39.31  ? 534 ARG A CB  1 
ATOM   4120 C CG  . ARG A 1 533 ? 6.383   -43.244 7.883   1.00 40.72  ? 534 ARG A CG  1 
ATOM   4121 C CD  . ARG A 1 533 ? 7.319   -44.389 7.563   1.00 53.05  ? 534 ARG A CD  1 
ATOM   4122 N NE  . ARG A 1 533 ? 8.256   -44.603 8.657   1.00 60.27  ? 534 ARG A NE  1 
ATOM   4123 C CZ  . ARG A 1 533 ? 9.393   -43.932 8.807   1.00 70.54  ? 534 ARG A CZ  1 
ATOM   4124 N NH1 . ARG A 1 533 ? 9.744   -43.005 7.916   1.00 47.55  ? 534 ARG A NH1 1 
ATOM   4125 N NH2 . ARG A 1 533 ? 10.177  -44.193 9.850   1.00 58.97  ? 534 ARG A NH2 1 
ATOM   4126 N N   . PHE A 1 534 ? 2.437   -42.841 5.776   1.00 52.77  ? 535 PHE A N   1 
ATOM   4127 C CA  . PHE A 1 534 ? 1.583   -42.698 4.600   1.00 48.55  ? 535 PHE A CA  1 
ATOM   4128 C C   . PHE A 1 534 ? 0.322   -41.874 4.834   1.00 52.14  ? 535 PHE A C   1 
ATOM   4129 O O   . PHE A 1 534 ? 0.082   -40.890 4.139   1.00 55.59  ? 535 PHE A O   1 
ATOM   4130 C CB  . PHE A 1 534 ? 1.168   -44.054 4.046   1.00 40.86  ? 535 PHE A CB  1 
ATOM   4131 C CG  . PHE A 1 534 ? 0.262   -43.942 2.861   1.00 46.16  ? 535 PHE A CG  1 
ATOM   4132 C CD1 . PHE A 1 534 ? 0.706   -43.326 1.696   1.00 42.50  ? 535 PHE A CD1 1 
ATOM   4133 C CD2 . PHE A 1 534 ? -1.042  -44.412 2.912   1.00 53.14  ? 535 PHE A CD2 1 
ATOM   4134 C CE1 . PHE A 1 534 ? -0.133  -43.192 0.598   1.00 45.63  ? 535 PHE A CE1 1 
ATOM   4135 C CE2 . PHE A 1 534 ? -1.889  -44.285 1.811   1.00 57.62  ? 535 PHE A CE2 1 
ATOM   4136 C CZ  . PHE A 1 534 ? -1.433  -43.670 0.654   1.00 45.61  ? 535 PHE A CZ  1 
ATOM   4137 N N   . LEU A 1 535 ? -0.486  -42.286 5.801   1.00 48.50  ? 536 LEU A N   1 
ATOM   4138 C CA  . LEU A 1 535 ? -1.798  -41.687 6.001   1.00 45.78  ? 536 LEU A CA  1 
ATOM   4139 C C   . LEU A 1 535 ? -1.833  -40.145 6.132   1.00 55.00  ? 536 LEU A C   1 
ATOM   4140 O O   . LEU A 1 535 ? -2.811  -39.525 5.713   1.00 58.45  ? 536 LEU A O   1 
ATOM   4141 C CB  . LEU A 1 535 ? -2.458  -42.314 7.224   1.00 45.44  ? 536 LEU A CB  1 
ATOM   4142 C CG  . LEU A 1 535 ? -3.977  -42.137 7.233   1.00 58.47  ? 536 LEU A CG  1 
ATOM   4143 C CD1 . LEU A 1 535 ? -4.628  -43.268 6.478   1.00 50.64  ? 536 LEU A CD1 1 
ATOM   4144 C CD2 . LEU A 1 535 ? -4.537  -42.020 8.643   1.00 50.81  ? 536 LEU A CD2 1 
ATOM   4145 N N   . PRO A 1 536 ? -0.792  -39.516 6.720   1.00 64.41  ? 537 PRO A N   1 
ATOM   4146 C CA  . PRO A 1 536 ? -0.819  -38.044 6.692   1.00 67.07  ? 537 PRO A CA  1 
ATOM   4147 C C   . PRO A 1 536 ? -0.718  -37.448 5.281   1.00 68.22  ? 537 PRO A C   1 
ATOM   4148 O O   . PRO A 1 536 ? -1.427  -36.479 4.989   1.00 66.73  ? 537 PRO A O   1 
ATOM   4149 C CB  . PRO A 1 536 ? 0.409   -37.655 7.527   1.00 50.68  ? 537 PRO A CB  1 
ATOM   4150 C CG  . PRO A 1 536 ? 0.614   -38.795 8.433   1.00 47.48  ? 537 PRO A CG  1 
ATOM   4151 C CD  . PRO A 1 536 ? 0.233   -40.016 7.657   1.00 55.71  ? 537 PRO A CD  1 
ATOM   4152 N N   . LYS A 1 537 ? 0.153   -38.015 4.441   1.00 61.35  ? 538 LYS A N   1 
ATOM   4153 C CA  . LYS A 1 537 ? 0.324   -37.589 3.045   1.00 64.25  ? 538 LYS A CA  1 
ATOM   4154 C C   . LYS A 1 537 ? -0.983  -37.689 2.259   1.00 67.49  ? 538 LYS A C   1 
ATOM   4155 O O   . LYS A 1 537 ? -1.241  -36.904 1.342   1.00 70.41  ? 538 LYS A O   1 
ATOM   4156 C CB  . LYS A 1 537 ? 1.406   -38.432 2.349   1.00 59.53  ? 538 LYS A CB  1 
ATOM   4157 C CG  . LYS A 1 537 ? 2.823   -38.224 2.877   1.00 57.06  ? 538 LYS A CG  1 
ATOM   4158 C CD  . LYS A 1 537 ? 3.849   -38.979 2.040   1.00 64.21  ? 538 LYS A CD  1 
ATOM   4159 C CE  . LYS A 1 537 ? 5.280   -38.646 2.467   1.00 70.53  ? 538 LYS A CE  1 
ATOM   4160 N NZ  . LYS A 1 537 ? 5.665   -39.235 3.788   1.00 78.78  ? 538 LYS A NZ  1 
ATOM   4161 N N   . LEU A 1 538 ? -1.793  -38.676 2.629   1.00 68.93  ? 539 LEU A N   1 
ATOM   4162 C CA  . LEU A 1 538 ? -3.100  -38.891 2.032   1.00 65.74  ? 539 LEU A CA  1 
ATOM   4163 C C   . LEU A 1 538 ? -4.051  -37.766 2.410   1.00 70.75  ? 539 LEU A C   1 
ATOM   4164 O O   . LEU A 1 538 ? -4.647  -37.133 1.537   1.00 89.31  ? 539 LEU A O   1 
ATOM   4165 C CB  . LEU A 1 538 ? -3.661  -40.244 2.474   1.00 62.90  ? 539 LEU A CB  1 
ATOM   4166 C CG  . LEU A 1 538 ? -5.004  -40.713 1.919   1.00 59.40  ? 539 LEU A CG  1 
ATOM   4167 C CD1 . LEU A 1 538 ? -5.047  -42.224 1.937   1.00 59.63  ? 539 LEU A CD1 1 
ATOM   4168 C CD2 . LEU A 1 538 ? -6.158  -40.150 2.730   1.00 64.83  ? 539 LEU A CD2 1 
ATOM   4169 N N   . LEU A 1 539 ? -4.193  -37.528 3.713   1.00 77.57  ? 540 LEU A N   1 
ATOM   4170 C CA  . LEU A 1 539 ? -5.097  -36.497 4.239   1.00 84.22  ? 540 LEU A CA  1 
ATOM   4171 C C   . LEU A 1 539 ? -4.824  -35.086 3.694   1.00 82.47  ? 540 LEU A C   1 
ATOM   4172 O O   . LEU A 1 539 ? -5.735  -34.257 3.648   1.00 84.38  ? 540 LEU A O   1 
ATOM   4173 C CB  . LEU A 1 539 ? -5.034  -36.478 5.768   1.00 68.55  ? 540 LEU A CB  1 
ATOM   4174 C CG  . LEU A 1 539 ? -5.594  -37.738 6.440   1.00 73.48  ? 540 LEU A CG  1 
ATOM   4175 C CD1 . LEU A 1 539 ? -5.445  -37.680 7.958   1.00 63.92  ? 540 LEU A CD1 1 
ATOM   4176 C CD2 . LEU A 1 539 ? -7.054  -37.972 6.041   1.00 71.44  ? 540 LEU A CD2 1 
ATOM   4177 N N   . SER A 1 540 ? -3.583  -34.822 3.284   1.00 73.38  ? 541 SER A N   1 
ATOM   4178 C CA  . SER A 1 540 ? -3.251  -33.590 2.564   1.00 82.59  ? 541 SER A CA  1 
ATOM   4179 C C   . SER A 1 540 ? -3.790  -33.603 1.126   1.00 96.29  ? 541 SER A C   1 
ATOM   4180 O O   . SER A 1 540 ? -4.959  -33.274 0.882   1.00 91.65  ? 541 SER A O   1 
ATOM   4181 C CB  . SER A 1 540 ? -1.738  -33.368 2.546   1.00 72.57  ? 541 SER A CB  1 
ATOM   4182 O OG  . SER A 1 540 ? -1.245  -33.148 3.854   1.00 79.36  ? 541 SER A OG  1 
ATOM   4183 N N   . ALA A 1 541 ? -2.933  -33.983 0.179   1.00 94.99  ? 542 ALA A N   1 
ATOM   4184 C CA  . ALA A 1 541 ? -3.314  -34.037 -1.233  1.00 102.55 ? 542 ALA A CA  1 
ATOM   4185 C C   . ALA A 1 541 ? -4.275  -35.196 -1.511  1.00 90.61  ? 542 ALA A C   1 
ATOM   4186 O O   . ALA A 1 541 ? -5.484  -35.090 -1.285  1.00 84.04  ? 542 ALA A O   1 
ATOM   4187 C CB  . ALA A 1 541 ? -2.064  -34.148 -2.124  1.00 90.96  ? 542 ALA A CB  1 
ATOM   4188 N N   . GLU B 1 3   ? 4.141   -88.198 -54.942 1.00 80.82  ? 4   GLU B N   1 
ATOM   4189 C CA  . GLU B 1 3   ? 3.461   -87.252 -54.057 1.00 89.45  ? 4   GLU B CA  1 
ATOM   4190 C C   . GLU B 1 3   ? 2.655   -87.956 -52.945 1.00 85.43  ? 4   GLU B C   1 
ATOM   4191 O O   . GLU B 1 3   ? 1.912   -88.903 -53.205 1.00 81.91  ? 4   GLU B O   1 
ATOM   4192 C CB  . GLU B 1 3   ? 2.545   -86.338 -54.877 1.00 84.16  ? 4   GLU B CB  1 
ATOM   4193 C CG  . GLU B 1 3   ? 2.051   -85.105 -54.121 1.00 102.59 ? 4   GLU B CG  1 
ATOM   4194 C CD  . GLU B 1 3   ? 2.669   -83.799 -54.619 1.00 94.13  ? 4   GLU B CD  1 
ATOM   4195 O OE1 . GLU B 1 3   ? 3.728   -83.394 -54.078 1.00 85.44  ? 4   GLU B OE1 1 
ATOM   4196 O OE2 . GLU B 1 3   ? 2.081   -83.176 -55.540 1.00 72.48  ? 4   GLU B OE2 1 
ATOM   4197 N N   . ASP B 1 4   ? 2.807   -87.479 -51.709 1.00 82.78  ? 5   ASP B N   1 
ATOM   4198 C CA  . ASP B 1 4   ? 2.160   -88.084 -50.537 1.00 77.35  ? 5   ASP B CA  1 
ATOM   4199 C C   . ASP B 1 4   ? 0.813   -87.417 -50.216 1.00 72.74  ? 5   ASP B C   1 
ATOM   4200 O O   . ASP B 1 4   ? 0.709   -86.192 -50.166 1.00 79.34  ? 5   ASP B O   1 
ATOM   4201 C CB  . ASP B 1 4   ? 3.110   -88.007 -49.333 1.00 71.42  ? 5   ASP B CB  1 
ATOM   4202 C CG  . ASP B 1 4   ? 2.530   -88.627 -48.062 1.00 81.82  ? 5   ASP B CG  1 
ATOM   4203 O OD1 . ASP B 1 4   ? 1.385   -89.142 -48.076 1.00 74.63  ? 5   ASP B OD1 1 
ATOM   4204 O OD2 . ASP B 1 4   ? 3.251   -88.607 -47.037 1.00 78.95  ? 5   ASP B OD2 1 
ATOM   4205 N N   . ALA B 1 5   ? -0.211  -88.234 -49.982 1.00 69.83  ? 6   ALA B N   1 
ATOM   4206 C CA  . ALA B 1 5   ? -1.581  -87.733 -49.834 1.00 70.69  ? 6   ALA B CA  1 
ATOM   4207 C C   . ALA B 1 5   ? -1.872  -87.134 -48.453 1.00 75.60  ? 6   ALA B C   1 
ATOM   4208 O O   . ALA B 1 5   ? -2.853  -86.397 -48.287 1.00 62.70  ? 6   ALA B O   1 
ATOM   4209 C CB  . ALA B 1 5   ? -2.578  -88.845 -50.136 1.00 64.50  ? 6   ALA B CB  1 
ATOM   4210 N N   . GLU B 1 6   ? -1.034  -87.456 -47.467 1.00 72.30  ? 7   GLU B N   1 
ATOM   4211 C CA  . GLU B 1 6   ? -1.180  -86.887 -46.128 1.00 69.02  ? 7   GLU B CA  1 
ATOM   4212 C C   . GLU B 1 6   ? -0.745  -85.418 -46.101 1.00 69.81  ? 7   GLU B C   1 
ATOM   4213 O O   . GLU B 1 6   ? -1.220  -84.629 -45.281 1.00 58.64  ? 7   GLU B O   1 
ATOM   4214 C CB  . GLU B 1 6   ? -0.377  -87.697 -45.107 1.00 64.15  ? 7   GLU B CB  1 
ATOM   4215 C CG  . GLU B 1 6   ? -1.030  -89.017 -44.716 1.00 87.18  ? 7   GLU B CG  1 
ATOM   4216 C CD  . GLU B 1 6   ? -2.379  -88.836 -44.021 1.00 89.45  ? 7   GLU B CD  1 
ATOM   4217 O OE1 . GLU B 1 6   ? -2.599  -87.776 -43.402 1.00 91.72  ? 7   GLU B OE1 1 
ATOM   4218 O OE2 . GLU B 1 6   ? -3.223  -89.757 -44.094 1.00 99.81  ? 7   GLU B OE2 1 
ATOM   4219 N N   . LEU B 1 7   ? 0.151   -85.058 -47.016 1.00 64.54  ? 8   LEU B N   1 
ATOM   4220 C CA  . LEU B 1 7   ? 0.682   -83.705 -47.082 1.00 46.55  ? 8   LEU B CA  1 
ATOM   4221 C C   . LEU B 1 7   ? -0.072  -82.839 -48.081 1.00 50.83  ? 8   LEU B C   1 
ATOM   4222 O O   . LEU B 1 7   ? 0.413   -81.781 -48.486 1.00 47.51  ? 8   LEU B O   1 
ATOM   4223 C CB  . LEU B 1 7   ? 2.160   -83.742 -47.441 1.00 46.09  ? 8   LEU B CB  1 
ATOM   4224 C CG  . LEU B 1 7   ? 2.970   -84.705 -46.576 1.00 47.82  ? 8   LEU B CG  1 
ATOM   4225 C CD1 . LEU B 1 7   ? 4.429   -84.663 -46.981 1.00 43.14  ? 8   LEU B CD1 1 
ATOM   4226 C CD2 . LEU B 1 7   ? 2.796   -84.361 -45.100 1.00 48.69  ? 8   LEU B CD2 1 
ATOM   4227 N N   . LEU B 1 8   ? -1.263  -83.282 -48.472 1.00 51.86  ? 9   LEU B N   1 
ATOM   4228 C CA  . LEU B 1 8   ? -2.082  -82.512 -49.398 1.00 48.10  ? 9   LEU B CA  1 
ATOM   4229 C C   . LEU B 1 8   ? -3.460  -82.226 -48.810 1.00 45.77  ? 9   LEU B C   1 
ATOM   4230 O O   . LEU B 1 8   ? -4.204  -83.134 -48.445 1.00 56.48  ? 9   LEU B O   1 
ATOM   4231 C CB  . LEU B 1 8   ? -2.216  -83.241 -50.738 1.00 53.03  ? 9   LEU B CB  1 
ATOM   4232 C CG  . LEU B 1 8   ? -0.962  -83.316 -51.609 1.00 51.51  ? 9   LEU B CG  1 
ATOM   4233 C CD1 . LEU B 1 8   ? -1.245  -84.145 -52.836 1.00 60.74  ? 9   LEU B CD1 1 
ATOM   4234 C CD2 . LEU B 1 8   ? -0.500  -81.927 -52.010 1.00 48.94  ? 9   LEU B CD2 1 
ATOM   4235 N N   . VAL B 1 9   ? -3.790  -80.944 -48.736 1.00 42.77  ? 10  VAL B N   1 
ATOM   4236 C CA  . VAL B 1 9   ? -5.019  -80.496 -48.110 1.00 42.31  ? 10  VAL B CA  1 
ATOM   4237 C C   . VAL B 1 9   ? -5.632  -79.383 -48.938 1.00 37.37  ? 10  VAL B C   1 
ATOM   4238 O O   . VAL B 1 9   ? -4.921  -78.520 -49.440 1.00 43.37  ? 10  VAL B O   1 
ATOM   4239 C CB  . VAL B 1 9   ? -4.758  -79.993 -46.659 1.00 48.30  ? 10  VAL B CB  1 
ATOM   4240 C CG1 . VAL B 1 9   ? -5.946  -79.218 -46.121 1.00 44.33  ? 10  VAL B CG1 1 
ATOM   4241 C CG2 . VAL B 1 9   ? -4.443  -81.152 -45.745 1.00 43.02  ? 10  VAL B CG2 1 
ATOM   4242 N N   . THR B 1 10  ? -6.947  -79.398 -49.095 1.00 35.24  ? 11  THR B N   1 
ATOM   4243 C CA  . THR B 1 10  ? -7.603  -78.288 -49.767 1.00 42.00  ? 11  THR B CA  1 
ATOM   4244 C C   . THR B 1 10  ? -8.386  -77.442 -48.769 1.00 42.75  ? 11  THR B C   1 
ATOM   4245 O O   . THR B 1 10  ? -9.198  -77.952 -47.994 1.00 43.62  ? 11  THR B O   1 
ATOM   4246 C CB  . THR B 1 10  ? -8.545  -78.772 -50.895 1.00 40.50  ? 11  THR B CB  1 
ATOM   4247 O OG1 . THR B 1 10  ? -7.790  -79.531 -51.852 1.00 40.69  ? 11  THR B OG1 1 
ATOM   4248 C CG2 . THR B 1 10  ? -9.209  -77.583 -51.595 1.00 33.27  ? 11  THR B CG2 1 
ATOM   4249 N N   . VAL B 1 11  ? -8.119  -76.144 -48.788 1.00 38.78  ? 12  VAL B N   1 
ATOM   4250 C CA  . VAL B 1 11  ? -8.844  -75.197 -47.960 1.00 37.77  ? 12  VAL B CA  1 
ATOM   4251 C C   . VAL B 1 11  ? -9.599  -74.260 -48.886 1.00 42.78  ? 12  VAL B C   1 
ATOM   4252 O O   . VAL B 1 11  ? -9.431  -74.337 -50.099 1.00 50.05  ? 12  VAL B O   1 
ATOM   4253 C CB  . VAL B 1 11  ? -7.900  -74.427 -47.029 1.00 38.96  ? 12  VAL B CB  1 
ATOM   4254 C CG1 . VAL B 1 11  ? -7.222  -75.399 -46.074 1.00 33.96  ? 12  VAL B CG1 1 
ATOM   4255 C CG2 . VAL B 1 11  ? -6.868  -73.657 -47.832 1.00 37.35  ? 12  VAL B CG2 1 
ATOM   4256 N N   . ARG B 1 12  ? -10.430 -73.381 -48.336 1.00 42.05  ? 13  ARG B N   1 
ATOM   4257 C CA  . ARG B 1 12  ? -11.304 -72.573 -49.184 1.00 50.97  ? 13  ARG B CA  1 
ATOM   4258 C C   . ARG B 1 12  ? -10.543 -71.746 -50.211 1.00 50.31  ? 13  ARG B C   1 
ATOM   4259 O O   . ARG B 1 12  ? -11.085 -71.412 -51.267 1.00 53.32  ? 13  ARG B O   1 
ATOM   4260 C CB  . ARG B 1 12  ? -12.193 -71.665 -48.333 1.00 45.73  ? 13  ARG B CB  1 
ATOM   4261 C CG  . ARG B 1 12  ? -13.370 -72.432 -47.771 1.00 61.57  ? 13  ARG B CG  1 
ATOM   4262 C CD  . ARG B 1 12  ? -14.333 -71.580 -46.979 1.00 73.03  ? 13  ARG B CD  1 
ATOM   4263 N NE  . ARG B 1 12  ? -15.086 -72.443 -46.071 1.00 88.68  ? 13  ARG B NE  1 
ATOM   4264 C CZ  . ARG B 1 12  ? -16.039 -72.028 -45.243 1.00 92.21  ? 13  ARG B CZ  1 
ATOM   4265 N NH1 . ARG B 1 12  ? -16.381 -70.742 -45.202 1.00 95.31  ? 13  ARG B NH1 1 
ATOM   4266 N NH2 . ARG B 1 12  ? -16.654 -72.905 -44.457 1.00 88.48  ? 13  ARG B NH2 1 
ATOM   4267 N N   . GLY B 1 13  ? -9.283  -71.446 -49.914 1.00 48.29  ? 14  GLY B N   1 
ATOM   4268 C CA  . GLY B 1 13  ? -8.476  -70.607 -50.783 1.00 45.69  ? 14  GLY B CA  1 
ATOM   4269 C C   . GLY B 1 13  ? -7.874  -71.382 -51.938 1.00 51.16  ? 14  GLY B C   1 
ATOM   4270 O O   . GLY B 1 13  ? -7.554  -70.820 -52.993 1.00 46.44  ? 14  GLY B O   1 
ATOM   4271 N N   . GLY B 1 14  ? -7.725  -72.685 -51.737 1.00 42.06  ? 15  GLY B N   1 
ATOM   4272 C CA  . GLY B 1 14  ? -7.106  -73.529 -52.733 1.00 39.01  ? 15  GLY B CA  1 
ATOM   4273 C C   . GLY B 1 14  ? -6.292  -74.625 -52.090 1.00 41.58  ? 15  GLY B C   1 
ATOM   4274 O O   . GLY B 1 14  ? -6.501  -74.965 -50.928 1.00 53.44  ? 15  GLY B O   1 
ATOM   4275 N N   . ARG B 1 15  ? -5.343  -75.162 -52.844 1.00 46.58  ? 16  ARG B N   1 
ATOM   4276 C CA  . ARG B 1 15  ? -4.612  -76.348 -52.427 1.00 47.67  ? 16  ARG B CA  1 
ATOM   4277 C C   . ARG B 1 15  ? -3.281  -76.045 -51.743 1.00 43.75  ? 16  ARG B C   1 
ATOM   4278 O O   . ARG B 1 15  ? -2.580  -75.089 -52.091 1.00 43.60  ? 16  ARG B O   1 
ATOM   4279 C CB  . ARG B 1 15  ? -4.379  -77.253 -53.638 1.00 52.98  ? 16  ARG B CB  1 
ATOM   4280 C CG  . ARG B 1 15  ? -5.647  -77.877 -54.171 1.00 52.05  ? 16  ARG B CG  1 
ATOM   4281 C CD  . ARG B 1 15  ? -5.340  -78.874 -55.269 1.00 59.97  ? 16  ARG B CD  1 
ATOM   4282 N NE  . ARG B 1 15  ? -5.094  -78.193 -56.535 1.00 71.56  ? 16  ARG B NE  1 
ATOM   4283 C CZ  . ARG B 1 15  ? -4.213  -78.602 -57.443 1.00 72.55  ? 16  ARG B CZ  1 
ATOM   4284 N NH1 . ARG B 1 15  ? -3.484  -79.694 -57.221 1.00 63.12  ? 16  ARG B NH1 1 
ATOM   4285 N NH2 . ARG B 1 15  ? -4.056  -77.910 -58.569 1.00 59.77  ? 16  ARG B NH2 1 
ATOM   4286 N N   . LEU B 1 16  ? -2.940  -76.893 -50.776 1.00 44.34  ? 17  LEU B N   1 
ATOM   4287 C CA  . LEU B 1 16  ? -1.718  -76.757 -49.996 1.00 38.06  ? 17  LEU B CA  1 
ATOM   4288 C C   . LEU B 1 16  ? -0.899  -78.049 -49.988 1.00 43.95  ? 17  LEU B C   1 
ATOM   4289 O O   . LEU B 1 16  ? -1.444  -79.162 -49.988 1.00 38.74  ? 17  LEU B O   1 
ATOM   4290 C CB  . LEU B 1 16  ? -2.046  -76.361 -48.548 1.00 36.16  ? 17  LEU B CB  1 
ATOM   4291 C CG  . LEU B 1 16  ? -2.800  -75.073 -48.242 1.00 36.60  ? 17  LEU B CG  1 
ATOM   4292 C CD1 . LEU B 1 16  ? -3.256  -75.058 -46.790 1.00 35.54  ? 17  LEU B CD1 1 
ATOM   4293 C CD2 . LEU B 1 16  ? -1.902  -73.895 -48.528 1.00 36.87  ? 17  LEU B CD2 1 
ATOM   4294 N N   . ARG B 1 17  ? 0.417   -77.883 -49.958 1.00 37.85  ? 18  ARG B N   1 
ATOM   4295 C CA  . ARG B 1 17  ? 1.333   -78.994 -49.783 1.00 40.40  ? 18  ARG B CA  1 
ATOM   4296 C C   . ARG B 1 17  ? 2.153   -78.752 -48.517 1.00 40.64  ? 18  ARG B C   1 
ATOM   4297 O O   . ARG B 1 17  ? 2.773   -77.702 -48.353 1.00 35.83  ? 18  ARG B O   1 
ATOM   4298 C CB  . ARG B 1 17  ? 2.239   -79.148 -51.015 1.00 46.35  ? 18  ARG B CB  1 
ATOM   4299 C CG  . ARG B 1 17  ? 3.199   -80.333 -50.981 1.00 39.46  ? 18  ARG B CG  1 
ATOM   4300 C CD  . ARG B 1 17  ? 4.077   -80.389 -52.234 1.00 44.71  ? 18  ARG B CD  1 
ATOM   4301 N NE  . ARG B 1 17  ? 3.280   -80.555 -53.452 1.00 62.10  ? 18  ARG B NE  1 
ATOM   4302 C CZ  . ARG B 1 17  ? 3.130   -79.631 -54.406 1.00 53.92  ? 18  ARG B CZ  1 
ATOM   4303 N NH1 . ARG B 1 17  ? 3.738   -78.453 -54.317 1.00 50.85  ? 18  ARG B NH1 1 
ATOM   4304 N NH2 . ARG B 1 17  ? 2.375   -79.891 -55.467 1.00 48.93  ? 18  ARG B NH2 1 
ATOM   4305 N N   . GLY B 1 18  ? 2.153   -79.721 -47.615 1.00 50.08  ? 19  GLY B N   1 
ATOM   4306 C CA  . GLY B 1 18  ? 2.894   -79.581 -46.382 1.00 32.07  ? 19  GLY B CA  1 
ATOM   4307 C C   . GLY B 1 18  ? 4.120   -80.462 -46.336 1.00 38.70  ? 19  GLY B C   1 
ATOM   4308 O O   . GLY B 1 18  ? 4.536   -81.048 -47.332 1.00 45.97  ? 19  GLY B O   1 
ATOM   4309 N N   . ILE B 1 19  ? 4.696   -80.559 -45.151 1.00 38.62  ? 20  ILE B N   1 
ATOM   4310 C CA  . ILE B 1 19  ? 5.936   -81.270 -44.961 1.00 37.51  ? 20  ILE B CA  1 
ATOM   4311 C C   . ILE B 1 19  ? 5.738   -82.254 -43.799 1.00 46.56  ? 20  ILE B C   1 
ATOM   4312 O O   . ILE B 1 19  ? 4.965   -81.991 -42.879 1.00 44.23  ? 20  ILE B O   1 
ATOM   4313 C CB  . ILE B 1 19  ? 7.093   -80.266 -44.709 1.00 41.00  ? 20  ILE B CB  1 
ATOM   4314 C CG1 . ILE B 1 19  ? 8.453   -80.949 -44.759 1.00 58.72  ? 20  ILE B CG1 1 
ATOM   4315 C CG2 . ILE B 1 19  ? 6.918   -79.522 -43.382 1.00 41.00  ? 20  ILE B CG2 1 
ATOM   4316 C CD1 . ILE B 1 19  ? 9.609   -80.013 -44.397 1.00 61.87  ? 20  ILE B CD1 1 
ATOM   4317 N N   . ARG B 1 20  ? 6.385   -83.410 -43.871 1.00 48.40  ? 21  ARG B N   1 
ATOM   4318 C CA  . ARG B 1 20  ? 6.307   -84.396 -42.798 1.00 45.62  ? 21  ARG B CA  1 
ATOM   4319 C C   . ARG B 1 20  ? 7.482   -84.227 -41.838 1.00 52.29  ? 21  ARG B C   1 
ATOM   4320 O O   . ARG B 1 20  ? 8.644   -84.337 -42.230 1.00 40.09  ? 21  ARG B O   1 
ATOM   4321 C CB  . ARG B 1 20  ? 6.281   -85.814 -43.364 1.00 49.24  ? 21  ARG B CB  1 
ATOM   4322 C CG  . ARG B 1 20  ? 6.516   -86.930 -42.346 1.00 53.73  ? 21  ARG B CG  1 
ATOM   4323 C CD  . ARG B 1 20  ? 7.074   -88.154 -43.070 1.00 72.11  ? 21  ARG B CD  1 
ATOM   4324 N NE  . ARG B 1 20  ? 6.658   -89.436 -42.505 1.00 72.75  ? 21  ARG B NE  1 
ATOM   4325 C CZ  . ARG B 1 20  ? 7.439   -90.220 -41.762 1.00 75.26  ? 21  ARG B CZ  1 
ATOM   4326 N NH1 . ARG B 1 20  ? 8.686   -89.848 -41.479 1.00 65.35  ? 21  ARG B NH1 1 
ATOM   4327 N NH2 . ARG B 1 20  ? 6.974   -91.375 -41.295 1.00 62.50  ? 21  ARG B NH2 1 
ATOM   4328 N N   . LEU B 1 21  ? 7.158   -83.959 -40.577 1.00 57.00  ? 22  LEU B N   1 
ATOM   4329 C CA  . LEU B 1 21  ? 8.154   -83.662 -39.557 1.00 48.80  ? 22  LEU B CA  1 
ATOM   4330 C C   . LEU B 1 21  ? 8.507   -84.859 -38.680 1.00 50.63  ? 22  LEU B C   1 
ATOM   4331 O O   . LEU B 1 21  ? 7.627   -85.575 -38.196 1.00 45.30  ? 22  LEU B O   1 
ATOM   4332 C CB  . LEU B 1 21  ? 7.663   -82.526 -38.665 1.00 48.10  ? 22  LEU B CB  1 
ATOM   4333 C CG  . LEU B 1 21  ? 7.605   -81.126 -39.256 1.00 50.55  ? 22  LEU B CG  1 
ATOM   4334 C CD1 . LEU B 1 21  ? 7.377   -80.137 -38.128 1.00 65.73  ? 22  LEU B CD1 1 
ATOM   4335 C CD2 . LEU B 1 21  ? 8.887   -80.809 -40.000 1.00 51.64  ? 22  LEU B CD2 1 
ATOM   4336 N N   . LYS B 1 22  ? 9.803   -85.059 -38.465 1.00 46.64  ? 23  LYS B N   1 
ATOM   4337 C CA  . LYS B 1 22  ? 10.253  -86.055 -37.507 1.00 54.99  ? 23  LYS B CA  1 
ATOM   4338 C C   . LYS B 1 22  ? 10.215  -85.497 -36.082 1.00 53.75  ? 23  LYS B C   1 
ATOM   4339 O O   . LYS B 1 22  ? 10.760  -84.432 -35.813 1.00 66.25  ? 23  LYS B O   1 
ATOM   4340 C CB  . LYS B 1 22  ? 11.667  -86.525 -37.850 1.00 56.65  ? 23  LYS B CB  1 
ATOM   4341 C CG  . LYS B 1 22  ? 11.776  -87.280 -39.169 1.00 68.75  ? 23  LYS B CG  1 
ATOM   4342 C CD  . LYS B 1 22  ? 13.210  -87.727 -39.425 1.00 64.17  ? 23  LYS B CD  1 
ATOM   4343 C CE  . LYS B 1 22  ? 13.414  -88.132 -40.876 1.00 68.29  ? 23  LYS B CE  1 
ATOM   4344 N NZ  . LYS B 1 22  ? 14.777  -87.749 -41.362 1.00 71.25  ? 23  LYS B NZ  1 
ATOM   4345 N N   . THR B 1 23  ? 9.553   -86.202 -35.173 1.00 56.42  ? 24  THR B N   1 
ATOM   4346 C CA  . THR B 1 23  ? 9.671   -85.886 -33.751 1.00 62.69  ? 24  THR B CA  1 
ATOM   4347 C C   . THR B 1 23  ? 10.206  -87.115 -33.030 1.00 63.77  ? 24  THR B C   1 
ATOM   4348 O O   . THR B 1 23  ? 10.031  -88.237 -33.505 1.00 70.15  ? 24  THR B O   1 
ATOM   4349 C CB  . THR B 1 23  ? 8.321   -85.458 -33.106 1.00 58.79  ? 24  THR B CB  1 
ATOM   4350 O OG1 . THR B 1 23  ? 7.671   -86.601 -32.534 1.00 62.17  ? 24  THR B OG1 1 
ATOM   4351 C CG2 . THR B 1 23  ? 7.414   -84.789 -34.113 1.00 48.40  ? 24  THR B CG2 1 
ATOM   4352 N N   . PRO B 1 24  ? 10.871  -86.908 -31.886 1.00 69.20  ? 25  PRO B N   1 
ATOM   4353 C CA  . PRO B 1 24  ? 11.383  -88.014 -31.071 1.00 69.29  ? 25  PRO B CA  1 
ATOM   4354 C C   . PRO B 1 24  ? 10.374  -89.138 -30.883 1.00 65.87  ? 25  PRO B C   1 
ATOM   4355 O O   . PRO B 1 24  ? 10.741  -90.304 -31.030 1.00 83.05  ? 25  PRO B O   1 
ATOM   4356 C CB  . PRO B 1 24  ? 11.700  -87.336 -29.741 1.00 68.77  ? 25  PRO B CB  1 
ATOM   4357 C CG  . PRO B 1 24  ? 12.131  -85.968 -30.150 1.00 67.54  ? 25  PRO B CG  1 
ATOM   4358 C CD  . PRO B 1 24  ? 11.275  -85.600 -31.339 1.00 72.05  ? 25  PRO B CD  1 
ATOM   4359 N N   . GLY B 1 25  ? 9.123   -88.789 -30.606 1.00 59.95  ? 26  GLY B N   1 
ATOM   4360 C CA  . GLY B 1 25  ? 8.098   -89.785 -30.362 1.00 54.58  ? 26  GLY B CA  1 
ATOM   4361 C C   . GLY B 1 25  ? 7.338   -90.263 -31.588 1.00 62.57  ? 26  GLY B C   1 
ATOM   4362 O O   . GLY B 1 25  ? 6.494   -91.146 -31.467 1.00 64.19  ? 26  GLY B O   1 
ATOM   4363 N N   . GLY B 1 26  ? 7.622   -89.695 -32.760 1.00 55.27  ? 27  GLY B N   1 
ATOM   4364 C CA  . GLY B 1 26  ? 6.914   -90.087 -33.975 1.00 59.67  ? 27  GLY B CA  1 
ATOM   4365 C C   . GLY B 1 26  ? 6.844   -89.029 -35.070 1.00 65.61  ? 27  GLY B C   1 
ATOM   4366 O O   . GLY B 1 26  ? 7.442   -87.965 -34.947 1.00 68.40  ? 27  GLY B O   1 
ATOM   4367 N N   . PRO B 1 27  ? 6.131   -89.327 -36.169 1.00 68.92  ? 28  PRO B N   1 
ATOM   4368 C CA  . PRO B 1 27  ? 5.952   -88.352 -37.255 1.00 62.50  ? 28  PRO B CA  1 
ATOM   4369 C C   . PRO B 1 27  ? 4.733   -87.439 -37.086 1.00 51.27  ? 28  PRO B C   1 
ATOM   4370 O O   . PRO B 1 27  ? 3.727   -87.831 -36.496 1.00 52.75  ? 28  PRO B O   1 
ATOM   4371 C CB  . PRO B 1 27  ? 5.780   -89.241 -38.488 1.00 52.66  ? 28  PRO B CB  1 
ATOM   4372 C CG  . PRO B 1 27  ? 5.111   -90.459 -37.952 1.00 55.49  ? 28  PRO B CG  1 
ATOM   4373 C CD  . PRO B 1 27  ? 5.738   -90.684 -36.587 1.00 61.70  ? 28  PRO B CD  1 
ATOM   4374 N N   . VAL B 1 28  ? 4.842   -86.229 -37.628 1.00 53.26  ? 29  VAL B N   1 
ATOM   4375 C CA  . VAL B 1 28  ? 3.797   -85.207 -37.556 1.00 50.48  ? 29  VAL B CA  1 
ATOM   4376 C C   . VAL B 1 28  ? 3.671   -84.495 -38.901 1.00 47.51  ? 29  VAL B C   1 
ATOM   4377 O O   . VAL B 1 28  ? 4.674   -84.197 -39.546 1.00 47.89  ? 29  VAL B O   1 
ATOM   4378 C CB  . VAL B 1 28  ? 4.102   -84.152 -36.450 1.00 49.48  ? 29  VAL B CB  1 
ATOM   4379 C CG1 . VAL B 1 28  ? 3.267   -82.903 -36.653 1.00 47.36  ? 29  VAL B CG1 1 
ATOM   4380 C CG2 . VAL B 1 28  ? 3.878   -84.734 -35.055 1.00 42.16  ? 29  VAL B CG2 1 
ATOM   4381 N N   . SER B 1 29  ? 2.446   -84.227 -39.335 1.00 47.11  ? 30  SER B N   1 
ATOM   4382 C CA  . SER B 1 29  ? 2.242   -83.419 -40.531 1.00 38.90  ? 30  SER B CA  1 
ATOM   4383 C C   . SER B 1 29  ? 2.246   -81.936 -40.177 1.00 44.45  ? 30  SER B C   1 
ATOM   4384 O O   . SER B 1 29  ? 1.591   -81.525 -39.220 1.00 49.28  ? 30  SER B O   1 
ATOM   4385 C CB  . SER B 1 29  ? 0.931   -83.792 -41.219 1.00 46.07  ? 30  SER B CB  1 
ATOM   4386 O OG  . SER B 1 29  ? 1.020   -85.072 -41.821 1.00 62.16  ? 30  SER B OG  1 
ATOM   4387 N N   . ALA B 1 30  ? 2.990   -81.138 -40.940 1.00 40.83  ? 31  ALA B N   1 
ATOM   4388 C CA  . ALA B 1 30  ? 3.055   -79.693 -40.704 1.00 37.67  ? 31  ALA B CA  1 
ATOM   4389 C C   . ALA B 1 30  ? 2.819   -78.894 -41.981 1.00 39.18  ? 31  ALA B C   1 
ATOM   4390 O O   . ALA B 1 30  ? 3.359   -79.194 -43.038 1.00 43.74  ? 31  ALA B O   1 
ATOM   4391 C CB  . ALA B 1 30  ? 4.400   -79.302 -40.088 1.00 32.65  ? 31  ALA B CB  1 
ATOM   4392 N N   . PHE B 1 31  ? 2.005   -77.863 -41.856 1.00 36.27  ? 32  PHE B N   1 
ATOM   4393 C CA  . PHE B 1 31  ? 1.775   -76.924 -42.923 1.00 32.66  ? 32  PHE B CA  1 
ATOM   4394 C C   . PHE B 1 31  ? 2.189   -75.548 -42.408 1.00 39.90  ? 32  PHE B C   1 
ATOM   4395 O O   . PHE B 1 31  ? 1.430   -74.888 -41.704 1.00 40.75  ? 32  PHE B O   1 
ATOM   4396 C CB  . PHE B 1 31  ? 0.310   -76.953 -43.355 1.00 37.88  ? 32  PHE B CB  1 
ATOM   4397 C CG  . PHE B 1 31  ? -0.150  -78.303 -43.833 1.00 42.40  ? 32  PHE B CG  1 
ATOM   4398 C CD1 . PHE B 1 31  ? -0.472  -79.305 -42.930 1.00 39.35  ? 32  PHE B CD1 1 
ATOM   4399 C CD2 . PHE B 1 31  ? -0.257  -78.572 -45.189 1.00 42.98  ? 32  PHE B CD2 1 
ATOM   4400 C CE1 . PHE B 1 31  ? -0.888  -80.547 -43.371 1.00 43.62  ? 32  PHE B CE1 1 
ATOM   4401 C CE2 . PHE B 1 31  ? -0.672  -79.811 -45.637 1.00 36.95  ? 32  PHE B CE2 1 
ATOM   4402 C CZ  . PHE B 1 31  ? -0.988  -80.801 -44.731 1.00 36.51  ? 32  PHE B CZ  1 
ATOM   4403 N N   . LEU B 1 32  ? 3.408   -75.140 -42.747 1.00 28.31  ? 33  LEU B N   1 
ATOM   4404 C CA  . LEU B 1 32  ? 3.971   -73.891 -42.273 1.00 26.86  ? 33  LEU B CA  1 
ATOM   4405 C C   . LEU B 1 32  ? 3.908   -72.801 -43.329 1.00 33.24  ? 33  LEU B C   1 
ATOM   4406 O O   . LEU B 1 32  ? 4.187   -73.050 -44.479 1.00 38.79  ? 33  LEU B O   1 
ATOM   4407 C CB  . LEU B 1 32  ? 5.416   -74.111 -41.854 1.00 30.93  ? 33  LEU B CB  1 
ATOM   4408 C CG  . LEU B 1 32  ? 5.663   -75.391 -41.066 1.00 34.46  ? 33  LEU B CG  1 
ATOM   4409 C CD1 . LEU B 1 32  ? 7.149   -75.548 -40.834 1.00 29.58  ? 33  LEU B CD1 1 
ATOM   4410 C CD2 . LEU B 1 32  ? 4.898   -75.375 -39.742 1.00 31.28  ? 33  LEU B CD2 1 
ATOM   4411 N N   . GLY B 1 33  ? 3.546   -71.585 -42.942 1.00 37.13  ? 34  GLY B N   1 
ATOM   4412 C CA  . GLY B 1 33  ? 3.515   -70.484 -43.890 1.00 28.41  ? 34  GLY B CA  1 
ATOM   4413 C C   . GLY B 1 33  ? 2.297   -70.414 -44.798 1.00 35.47  ? 34  GLY B C   1 
ATOM   4414 O O   . GLY B 1 33  ? 2.409   -70.021 -45.961 1.00 37.44  ? 34  GLY B O   1 
ATOM   4415 N N   . ILE B 1 34  ? 1.130   -70.782 -44.279 1.00 27.50  ? 35  ILE B N   1 
ATOM   4416 C CA  . ILE B 1 34  ? -0.111  -70.618 -45.029 1.00 32.87  ? 35  ILE B CA  1 
ATOM   4417 C C   . ILE B 1 34  ? -0.556  -69.156 -45.031 1.00 35.68  ? 35  ILE B C   1 
ATOM   4418 O O   . ILE B 1 34  ? -0.728  -68.565 -43.972 1.00 37.14  ? 35  ILE B O   1 
ATOM   4419 C CB  . ILE B 1 34  ? -1.236  -71.468 -44.441 1.00 30.36  ? 35  ILE B CB  1 
ATOM   4420 C CG1 . ILE B 1 34  ? -0.763  -72.906 -44.246 1.00 34.74  ? 35  ILE B CG1 1 
ATOM   4421 C CG2 . ILE B 1 34  ? -2.480  -71.388 -45.320 1.00 33.65  ? 35  ILE B CG2 1 
ATOM   4422 C CD1 . ILE B 1 34  ? -1.802  -73.790 -43.628 1.00 35.48  ? 35  ILE B CD1 1 
ATOM   4423 N N   . PRO B 1 35  ? -0.742  -68.565 -46.222 1.00 37.60  ? 36  PRO B N   1 
ATOM   4424 C CA  . PRO B 1 35  ? -1.187  -67.164 -46.269 1.00 38.05  ? 36  PRO B CA  1 
ATOM   4425 C C   . PRO B 1 35  ? -2.643  -67.037 -45.847 1.00 35.66  ? 36  PRO B C   1 
ATOM   4426 O O   . PRO B 1 35  ? -3.489  -67.716 -46.434 1.00 35.68  ? 36  PRO B O   1 
ATOM   4427 C CB  . PRO B 1 35  ? -1.003  -66.787 -47.747 1.00 37.33  ? 36  PRO B CB  1 
ATOM   4428 C CG  . PRO B 1 35  ? -1.183  -68.082 -48.486 1.00 32.77  ? 36  PRO B CG  1 
ATOM   4429 C CD  . PRO B 1 35  ? -0.618  -69.160 -47.566 1.00 35.32  ? 36  PRO B CD  1 
ATOM   4430 N N   . PHE B 1 36  ? -2.952  -66.213 -44.847 1.00 34.85  ? 37  PHE B N   1 
ATOM   4431 C CA  . PHE B 1 36  ? -4.358  -66.106 -44.460 1.00 36.50  ? 37  PHE B CA  1 
ATOM   4432 C C   . PHE B 1 36  ? -4.892  -64.716 -44.754 1.00 38.11  ? 37  PHE B C   1 
ATOM   4433 O O   . PHE B 1 36  ? -6.083  -64.454 -44.619 1.00 36.77  ? 37  PHE B O   1 
ATOM   4434 C CB  . PHE B 1 36  ? -4.577  -66.491 -42.990 1.00 32.48  ? 37  PHE B CB  1 
ATOM   4435 C CG  . PHE B 1 36  ? -3.993  -65.528 -41.990 1.00 37.85  ? 37  PHE B CG  1 
ATOM   4436 C CD1 . PHE B 1 36  ? -4.674  -64.373 -41.631 1.00 31.81  ? 37  PHE B CD1 1 
ATOM   4437 C CD2 . PHE B 1 36  ? -2.790  -65.815 -41.358 1.00 36.46  ? 37  PHE B CD2 1 
ATOM   4438 C CE1 . PHE B 1 36  ? -4.139  -63.493 -40.705 1.00 38.29  ? 37  PHE B CE1 1 
ATOM   4439 C CE2 . PHE B 1 36  ? -2.255  -64.951 -40.427 1.00 35.61  ? 37  PHE B CE2 1 
ATOM   4440 C CZ  . PHE B 1 36  ? -2.927  -63.781 -40.100 1.00 37.65  ? 37  PHE B CZ  1 
ATOM   4441 N N   . ALA B 1 37  ? -4.008  -63.839 -45.198 1.00 35.78  ? 38  ALA B N   1 
ATOM   4442 C CA  . ALA B 1 37  ? -4.414  -62.501 -45.554 1.00 32.12  ? 38  ALA B CA  1 
ATOM   4443 C C   . ALA B 1 37  ? -3.592  -61.984 -46.736 1.00 44.90  ? 38  ALA B C   1 
ATOM   4444 O O   . ALA B 1 37  ? -2.500  -62.485 -47.008 1.00 39.27  ? 38  ALA B O   1 
ATOM   4445 C CB  . ALA B 1 37  ? -4.273  -61.592 -44.362 1.00 36.40  ? 38  ALA B CB  1 
ATOM   4446 N N   . GLU B 1 38  ? -4.127  -60.999 -47.450 1.00 41.60  ? 39  GLU B N   1 
ATOM   4447 C CA  . GLU B 1 38  ? -3.344  -60.300 -48.454 1.00 39.29  ? 39  GLU B CA  1 
ATOM   4448 C C   . GLU B 1 38  ? -2.264  -59.524 -47.726 1.00 42.64  ? 39  GLU B C   1 
ATOM   4449 O O   . GLU B 1 38  ? -2.493  -59.048 -46.615 1.00 48.96  ? 39  GLU B O   1 
ATOM   4450 C CB  . GLU B 1 38  ? -4.223  -59.375 -49.296 1.00 42.85  ? 39  GLU B CB  1 
ATOM   4451 C CG  . GLU B 1 38  ? -5.255  -60.119 -50.120 1.00 48.75  ? 39  GLU B CG  1 
ATOM   4452 C CD  . GLU B 1 38  ? -4.625  -60.979 -51.214 1.00 59.13  ? 39  GLU B CD  1 
ATOM   4453 O OE1 . GLU B 1 38  ? -3.621  -60.521 -51.817 1.00 52.65  ? 39  GLU B OE1 1 
ATOM   4454 O OE2 . GLU B 1 38  ? -5.129  -62.106 -51.467 1.00 45.14  ? 39  GLU B OE2 1 
ATOM   4455 N N   . PRO B 1 39  ? -1.070  -59.429 -48.329 1.00 42.57  ? 40  PRO B N   1 
ATOM   4456 C CA  . PRO B 1 39  ? 0.058   -58.739 -47.687 1.00 44.89  ? 40  PRO B CA  1 
ATOM   4457 C C   . PRO B 1 39  ? -0.248  -57.280 -47.355 1.00 47.85  ? 40  PRO B C   1 
ATOM   4458 O O   . PRO B 1 39  ? -0.612  -56.510 -48.243 1.00 57.22  ? 40  PRO B O   1 
ATOM   4459 C CB  . PRO B 1 39  ? 1.172   -58.848 -48.738 1.00 39.70  ? 40  PRO B CB  1 
ATOM   4460 C CG  . PRO B 1 39  ? 0.859   -60.111 -49.464 1.00 35.04  ? 40  PRO B CG  1 
ATOM   4461 C CD  . PRO B 1 39  ? -0.649  -60.170 -49.531 1.00 35.70  ? 40  PRO B CD  1 
ATOM   4462 N N   . PRO B 1 40  ? -0.109  -56.903 -46.078 1.00 43.32  ? 41  PRO B N   1 
ATOM   4463 C CA  . PRO B 1 40  ? -0.374  -55.521 -45.654 1.00 46.90  ? 41  PRO B CA  1 
ATOM   4464 C C   . PRO B 1 40  ? 0.741   -54.568 -46.059 1.00 49.53  ? 41  PRO B C   1 
ATOM   4465 O O   . PRO B 1 40  ? 1.311   -53.877 -45.208 1.00 45.29  ? 41  PRO B O   1 
ATOM   4466 C CB  . PRO B 1 40  ? -0.474  -55.632 -44.133 1.00 35.88  ? 41  PRO B CB  1 
ATOM   4467 C CG  . PRO B 1 40  ? 0.321   -56.844 -43.788 1.00 42.79  ? 41  PRO B CG  1 
ATOM   4468 C CD  . PRO B 1 40  ? 0.189   -57.792 -44.943 1.00 41.94  ? 41  PRO B CD  1 
ATOM   4469 N N   . MET B 1 41  ? 1.025   -54.533 -47.359 1.00 51.96  ? 42  MET B N   1 
ATOM   4470 C CA  . MET B 1 41  ? 2.122   -53.754 -47.921 1.00 51.53  ? 42  MET B CA  1 
ATOM   4471 C C   . MET B 1 41  ? 1.600   -52.460 -48.523 1.00 48.11  ? 42  MET B C   1 
ATOM   4472 O O   . MET B 1 41  ? 0.402   -52.345 -48.800 1.00 49.33  ? 42  MET B O   1 
ATOM   4473 C CB  . MET B 1 41  ? 2.849   -54.558 -49.010 1.00 57.80  ? 42  MET B CB  1 
ATOM   4474 C CG  . MET B 1 41  ? 3.385   -55.900 -48.575 1.00 46.05  ? 42  MET B CG  1 
ATOM   4475 S SD  . MET B 1 41  ? 5.167   -55.853 -48.317 1.00 98.31  ? 42  MET B SD  1 
ATOM   4476 C CE  . MET B 1 41  ? 5.751   -55.708 -50.009 1.00 85.37  ? 42  MET B CE  1 
ATOM   4477 N N   . GLY B 1 42  ? 2.507   -51.510 -48.760 1.00 47.62  ? 43  GLY B N   1 
ATOM   4478 C CA  . GLY B 1 42  ? 2.200   -50.291 -49.496 1.00 39.62  ? 43  GLY B CA  1 
ATOM   4479 C C   . GLY B 1 42  ? 0.950   -49.570 -49.028 1.00 49.72  ? 43  GLY B C   1 
ATOM   4480 O O   . GLY B 1 42  ? 0.893   -49.103 -47.888 1.00 53.17  ? 43  GLY B O   1 
ATOM   4481 N N   . PRO B 1 43  ? -0.066  -49.487 -49.900 1.00 52.51  ? 44  PRO B N   1 
ATOM   4482 C CA  . PRO B 1 43  ? -1.344  -48.855 -49.551 1.00 52.28  ? 44  PRO B CA  1 
ATOM   4483 C C   . PRO B 1 43  ? -2.078  -49.563 -48.409 1.00 46.63  ? 44  PRO B C   1 
ATOM   4484 O O   . PRO B 1 43  ? -2.921  -48.945 -47.766 1.00 50.21  ? 44  PRO B O   1 
ATOM   4485 C CB  . PRO B 1 43  ? -2.155  -48.954 -50.853 1.00 46.73  ? 44  PRO B CB  1 
ATOM   4486 C CG  . PRO B 1 43  ? -1.535  -50.080 -51.606 1.00 37.55  ? 44  PRO B CG  1 
ATOM   4487 C CD  . PRO B 1 43  ? -0.069  -49.994 -51.284 1.00 44.81  ? 44  PRO B CD  1 
ATOM   4488 N N   . ARG B 1 44  ? -1.769  -50.834 -48.169 1.00 46.06  ? 45  ARG B N   1 
ATOM   4489 C CA  . ARG B 1 44  ? -2.477  -51.610 -47.154 1.00 43.62  ? 45  ARG B CA  1 
ATOM   4490 C C   . ARG B 1 44  ? -1.808  -51.578 -45.769 1.00 49.71  ? 45  ARG B C   1 
ATOM   4491 O O   . ARG B 1 44  ? -2.291  -52.218 -44.826 1.00 45.69  ? 45  ARG B O   1 
ATOM   4492 C CB  . ARG B 1 44  ? -2.623  -53.054 -47.602 1.00 41.97  ? 45  ARG B CB  1 
ATOM   4493 C CG  . ARG B 1 44  ? -3.564  -53.274 -48.762 1.00 46.28  ? 45  ARG B CG  1 
ATOM   4494 C CD  . ARG B 1 44  ? -3.554  -54.749 -49.092 1.00 61.47  ? 45  ARG B CD  1 
ATOM   4495 N NE  . ARG B 1 44  ? -3.914  -55.050 -50.472 1.00 90.34  ? 45  ARG B NE  1 
ATOM   4496 C CZ  . ARG B 1 44  ? -5.112  -55.488 -50.838 1.00 89.14  ? 45  ARG B CZ  1 
ATOM   4497 N NH1 . ARG B 1 44  ? -6.054  -55.659 -49.915 1.00 78.99  ? 45  ARG B NH1 1 
ATOM   4498 N NH2 . ARG B 1 44  ? -5.368  -55.756 -52.114 1.00 67.26  ? 45  ARG B NH2 1 
ATOM   4499 N N   . ARG B 1 45  ? -0.702  -50.845 -45.654 1.00 41.03  ? 46  ARG B N   1 
ATOM   4500 C CA  . ARG B 1 45  ? -0.091  -50.599 -44.357 1.00 36.02  ? 46  ARG B CA  1 
ATOM   4501 C C   . ARG B 1 45  ? -1.084  -49.840 -43.470 1.00 45.31  ? 46  ARG B C   1 
ATOM   4502 O O   . ARG B 1 45  ? -1.751  -48.921 -43.946 1.00 46.98  ? 46  ARG B O   1 
ATOM   4503 C CB  . ARG B 1 45  ? 1.220   -49.822 -44.512 1.00 34.84  ? 46  ARG B CB  1 
ATOM   4504 C CG  . ARG B 1 45  ? 1.948   -49.540 -43.197 1.00 41.02  ? 46  ARG B CG  1 
ATOM   4505 C CD  . ARG B 1 45  ? 3.110   -48.557 -43.351 1.00 36.61  ? 46  ARG B CD  1 
ATOM   4506 N NE  . ARG B 1 45  ? 4.319   -49.194 -43.860 1.00 36.19  ? 46  ARG B NE  1 
ATOM   4507 C CZ  . ARG B 1 45  ? 5.441   -48.541 -44.139 1.00 40.74  ? 46  ARG B CZ  1 
ATOM   4508 N NH1 . ARG B 1 45  ? 5.508   -47.231 -43.963 1.00 44.01  ? 46  ARG B NH1 1 
ATOM   4509 N NH2 . ARG B 1 45  ? 6.498   -49.196 -44.598 1.00 43.97  ? 46  ARG B NH2 1 
ATOM   4510 N N   . PHE B 1 46  ? -1.180  -50.255 -42.202 1.00 43.52  ? 47  PHE B N   1 
ATOM   4511 C CA  . PHE B 1 46  ? -2.104  -49.705 -41.190 1.00 32.42  ? 47  PHE B CA  1 
ATOM   4512 C C   . PHE B 1 46  ? -3.570  -50.106 -41.402 1.00 28.89  ? 47  PHE B C   1 
ATOM   4513 O O   . PHE B 1 46  ? -4.404  -49.827 -40.560 1.00 41.17  ? 47  PHE B O   1 
ATOM   4514 C CB  . PHE B 1 46  ? -2.024  -48.170 -41.107 1.00 31.39  ? 47  PHE B CB  1 
ATOM   4515 C CG  . PHE B 1 46  ? -0.632  -47.632 -40.941 1.00 30.89  ? 47  PHE B CG  1 
ATOM   4516 C CD1 . PHE B 1 46  ? 0.155   -48.014 -39.878 1.00 31.04  ? 47  PHE B CD1 1 
ATOM   4517 C CD2 . PHE B 1 46  ? -0.120  -46.721 -41.838 1.00 39.09  ? 47  PHE B CD2 1 
ATOM   4518 C CE1 . PHE B 1 46  ? 1.426   -47.517 -39.725 1.00 31.77  ? 47  PHE B CE1 1 
ATOM   4519 C CE2 . PHE B 1 46  ? 1.161   -46.217 -41.681 1.00 39.38  ? 47  PHE B CE2 1 
ATOM   4520 C CZ  . PHE B 1 46  ? 1.931   -46.620 -40.628 1.00 32.56  ? 47  PHE B CZ  1 
ATOM   4521 N N   . LEU B 1 47  ? -3.902  -50.746 -42.513 1.00 35.18  ? 48  LEU B N   1 
ATOM   4522 C CA  . LEU B 1 47  ? -5.297  -51.130 -42.739 1.00 38.51  ? 48  LEU B CA  1 
ATOM   4523 C C   . LEU B 1 47  ? -5.619  -52.470 -42.101 1.00 37.70  ? 48  LEU B C   1 
ATOM   4524 O O   . LEU B 1 47  ? -4.712  -53.250 -41.814 1.00 45.75  ? 48  LEU B O   1 
ATOM   4525 C CB  . LEU B 1 47  ? -5.607  -51.202 -44.233 1.00 38.15  ? 48  LEU B CB  1 
ATOM   4526 C CG  . LEU B 1 47  ? -5.541  -49.923 -45.061 1.00 46.62  ? 48  LEU B CG  1 
ATOM   4527 C CD1 . LEU B 1 47  ? -6.313  -50.154 -46.345 1.00 41.39  ? 48  LEU B CD1 1 
ATOM   4528 C CD2 . LEU B 1 47  ? -6.078  -48.715 -44.290 1.00 41.77  ? 48  LEU B CD2 1 
ATOM   4529 N N   . PRO B 1 48  ? -6.911  -52.749 -41.883 1.00 35.68  ? 49  PRO B N   1 
ATOM   4530 C CA  . PRO B 1 48  ? -7.318  -54.104 -41.492 1.00 45.01  ? 49  PRO B CA  1 
ATOM   4531 C C   . PRO B 1 48  ? -6.838  -55.154 -42.484 1.00 39.66  ? 49  PRO B C   1 
ATOM   4532 O O   . PRO B 1 48  ? -6.572  -54.835 -43.632 1.00 43.35  ? 49  PRO B O   1 
ATOM   4533 C CB  . PRO B 1 48  ? -8.844  -54.022 -41.487 1.00 29.57  ? 49  PRO B CB  1 
ATOM   4534 C CG  . PRO B 1 48  ? -9.117  -52.629 -41.122 1.00 30.85  ? 49  PRO B CG  1 
ATOM   4535 C CD  . PRO B 1 48  ? -8.022  -51.793 -41.752 1.00 39.21  ? 49  PRO B CD  1 
ATOM   4536 N N   . PRO B 1 49  ? -6.705  -56.402 -42.042 1.00 43.83  ? 50  PRO B N   1 
ATOM   4537 C CA  . PRO B 1 49  ? -6.340  -57.424 -43.019 1.00 40.42  ? 50  PRO B CA  1 
ATOM   4538 C C   . PRO B 1 49  ? -7.473  -57.729 -43.999 1.00 40.62  ? 50  PRO B C   1 
ATOM   4539 O O   . PRO B 1 49  ? -8.611  -57.931 -43.573 1.00 43.23  ? 50  PRO B O   1 
ATOM   4540 C CB  . PRO B 1 49  ? -6.039  -58.646 -42.148 1.00 42.54  ? 50  PRO B CB  1 
ATOM   4541 C CG  . PRO B 1 49  ? -6.842  -58.423 -40.895 1.00 28.49  ? 50  PRO B CG  1 
ATOM   4542 C CD  . PRO B 1 49  ? -6.790  -56.942 -40.671 1.00 34.87  ? 50  PRO B CD  1 
ATOM   4543 N N   . GLU B 1 50  ? -7.166  -57.758 -45.293 1.00 46.03  ? 51  GLU B N   1 
ATOM   4544 C CA  . GLU B 1 50  ? -8.102  -58.284 -46.279 1.00 45.01  ? 51  GLU B CA  1 
ATOM   4545 C C   . GLU B 1 50  ? -7.869  -59.788 -46.369 1.00 45.60  ? 51  GLU B C   1 
ATOM   4546 O O   . GLU B 1 50  ? -6.725  -60.233 -46.353 1.00 44.55  ? 51  GLU B O   1 
ATOM   4547 C CB  . GLU B 1 50  ? -7.911  -57.615 -47.641 1.00 48.40  ? 51  GLU B CB  1 
ATOM   4548 C CG  . GLU B 1 50  ? -9.014  -57.946 -48.641 1.00 77.69  ? 51  GLU B CG  1 
ATOM   4549 C CD  . GLU B 1 50  ? -8.550  -57.887 -50.097 1.00 96.77  ? 51  GLU B CD  1 
ATOM   4550 O OE1 . GLU B 1 50  ? -9.123  -58.617 -50.946 1.00 89.17  ? 51  GLU B OE1 1 
ATOM   4551 O OE2 . GLU B 1 50  ? -7.615  -57.110 -50.391 1.00 90.32  ? 51  GLU B OE2 1 
ATOM   4552 N N   . PRO B 1 51  ? -8.947  -60.582 -46.437 1.00 49.62  ? 52  PRO B N   1 
ATOM   4553 C CA  . PRO B 1 51  ? -8.747  -62.036 -46.513 1.00 43.25  ? 52  PRO B CA  1 
ATOM   4554 C C   . PRO B 1 51  ? -7.933  -62.444 -47.733 1.00 49.81  ? 52  PRO B C   1 
ATOM   4555 O O   . PRO B 1 51  ? -7.978  -61.746 -48.749 1.00 53.01  ? 52  PRO B O   1 
ATOM   4556 C CB  . PRO B 1 51  ? -10.172 -62.584 -46.600 1.00 37.19  ? 52  PRO B CB  1 
ATOM   4557 C CG  . PRO B 1 51  ? -11.010 -61.543 -45.944 1.00 39.46  ? 52  PRO B CG  1 
ATOM   4558 C CD  . PRO B 1 51  ? -10.368 -60.224 -46.295 1.00 38.03  ? 52  PRO B CD  1 
ATOM   4559 N N   . LYS B 1 52  ? -7.195  -63.550 -47.621 1.00 48.76  ? 53  LYS B N   1 
ATOM   4560 C CA  . LYS B 1 52  ? -6.379  -64.055 -48.722 1.00 47.78  ? 53  LYS B CA  1 
ATOM   4561 C C   . LYS B 1 52  ? -7.263  -64.466 -49.908 1.00 52.10  ? 53  LYS B C   1 
ATOM   4562 O O   . LYS B 1 52  ? -8.175  -65.286 -49.760 1.00 45.91  ? 53  LYS B O   1 
ATOM   4563 C CB  . LYS B 1 52  ? -5.519  -65.235 -48.248 1.00 42.49  ? 53  LYS B CB  1 
ATOM   4564 C CG  . LYS B 1 52  ? -4.614  -65.853 -49.332 1.00 45.21  ? 53  LYS B CG  1 
ATOM   4565 C CD  . LYS B 1 52  ? -3.622  -64.851 -49.890 1.00 43.22  ? 53  LYS B CD  1 
ATOM   4566 C CE  . LYS B 1 52  ? -2.678  -65.474 -50.913 1.00 51.94  ? 53  LYS B CE  1 
ATOM   4567 N NZ  . LYS B 1 52  ? -1.755  -64.431 -51.490 1.00 47.82  ? 53  LYS B NZ  1 
ATOM   4568 N N   . GLN B 1 53  ? -7.008  -63.879 -51.075 1.00 50.05  ? 54  GLN B N   1 
ATOM   4569 C CA  . GLN B 1 53  ? -7.772  -64.213 -52.276 1.00 52.36  ? 54  GLN B CA  1 
ATOM   4570 C C   . GLN B 1 53  ? -7.413  -65.619 -52.761 1.00 48.14  ? 54  GLN B C   1 
ATOM   4571 O O   . GLN B 1 53  ? -6.263  -66.042 -52.641 1.00 50.35  ? 54  GLN B O   1 
ATOM   4572 C CB  . GLN B 1 53  ? -7.524  -63.182 -53.380 1.00 49.33  ? 54  GLN B CB  1 
ATOM   4573 C CG  . GLN B 1 53  ? -8.249  -61.852 -53.187 1.00 62.95  ? 54  GLN B CG  1 
ATOM   4574 C CD  . GLN B 1 53  ? -9.778  -61.980 -53.274 1.00 100.11 ? 54  GLN B CD  1 
ATOM   4575 O OE1 . GLN B 1 53  ? -10.476 -61.959 -52.252 1.00 92.33  ? 54  GLN B OE1 1 
ATOM   4576 N NE2 . GLN B 1 53  ? -10.300 -62.104 -54.500 1.00 86.33  ? 54  GLN B NE2 1 
ATOM   4577 N N   . PRO B 1 54  ? -8.398  -66.352 -53.313 1.00 55.48  ? 55  PRO B N   1 
ATOM   4578 C CA  . PRO B 1 54  ? -8.155  -67.733 -53.753 1.00 45.72  ? 55  PRO B CA  1 
ATOM   4579 C C   . PRO B 1 54  ? -7.064  -67.837 -54.820 1.00 45.13  ? 55  PRO B C   1 
ATOM   4580 O O   . PRO B 1 54  ? -6.844  -66.901 -55.598 1.00 44.99  ? 55  PRO B O   1 
ATOM   4581 C CB  . PRO B 1 54  ? -9.510  -68.168 -54.319 1.00 37.33  ? 55  PRO B CB  1 
ATOM   4582 C CG  . PRO B 1 54  ? -10.494 -67.257 -53.712 1.00 37.99  ? 55  PRO B CG  1 
ATOM   4583 C CD  . PRO B 1 54  ? -9.792  -65.943 -53.551 1.00 48.34  ? 55  PRO B CD  1 
ATOM   4584 N N   . TRP B 1 55  ? -6.383  -68.977 -54.839 1.00 42.77  ? 56  TRP B N   1 
ATOM   4585 C CA  . TRP B 1 55  ? -5.271  -69.213 -55.754 1.00 43.68  ? 56  TRP B CA  1 
ATOM   4586 C C   . TRP B 1 55  ? -5.478  -70.512 -56.527 1.00 45.16  ? 56  TRP B C   1 
ATOM   4587 O O   . TRP B 1 55  ? -6.108  -71.458 -56.032 1.00 42.79  ? 56  TRP B O   1 
ATOM   4588 C CB  . TRP B 1 55  ? -3.936  -69.270 -54.989 1.00 37.33  ? 56  TRP B CB  1 
ATOM   4589 C CG  . TRP B 1 55  ? -3.859  -70.409 -53.998 1.00 40.72  ? 56  TRP B CG  1 
ATOM   4590 C CD1 . TRP B 1 55  ? -3.421  -71.677 -54.241 1.00 47.50  ? 56  TRP B CD1 1 
ATOM   4591 C CD2 . TRP B 1 55  ? -4.250  -70.383 -52.615 1.00 42.31  ? 56  TRP B CD2 1 
ATOM   4592 N NE1 . TRP B 1 55  ? -3.510  -72.441 -53.102 1.00 42.67  ? 56  TRP B NE1 1 
ATOM   4593 C CE2 . TRP B 1 55  ? -4.014  -71.670 -52.089 1.00 47.12  ? 56  TRP B CE2 1 
ATOM   4594 C CE3 . TRP B 1 55  ? -4.774  -69.396 -51.773 1.00 45.38  ? 56  TRP B CE3 1 
ATOM   4595 C CZ2 . TRP B 1 55  ? -4.287  -71.999 -50.759 1.00 42.30  ? 56  TRP B CZ2 1 
ATOM   4596 C CZ3 . TRP B 1 55  ? -5.044  -69.726 -50.448 1.00 46.69  ? 56  TRP B CZ3 1 
ATOM   4597 C CH2 . TRP B 1 55  ? -4.802  -71.016 -49.959 1.00 39.47  ? 56  TRP B CH2 1 
ATOM   4598 N N   . SER B 1 56  ? -4.948  -70.568 -57.741 1.00 48.44  ? 57  SER B N   1 
ATOM   4599 C CA  . SER B 1 56  ? -4.920  -71.833 -58.460 1.00 47.31  ? 57  SER B CA  1 
ATOM   4600 C C   . SER B 1 56  ? -3.564  -72.499 -58.247 1.00 49.87  ? 57  SER B C   1 
ATOM   4601 O O   . SER B 1 56  ? -2.569  -71.841 -57.920 1.00 52.22  ? 57  SER B O   1 
ATOM   4602 C CB  . SER B 1 56  ? -5.202  -71.627 -59.947 1.00 45.93  ? 57  SER B CB  1 
ATOM   4603 O OG  . SER B 1 56  ? -4.200  -70.825 -60.558 1.00 63.76  ? 57  SER B OG  1 
ATOM   4604 N N   . GLY B 1 57  ? -3.522  -73.808 -58.428 1.00 41.04  ? 58  GLY B N   1 
ATOM   4605 C CA  . GLY B 1 57  ? -2.279  -74.524 -58.247 1.00 54.49  ? 58  GLY B CA  1 
ATOM   4606 C C   . GLY B 1 57  ? -2.059  -74.841 -56.785 1.00 52.70  ? 58  GLY B C   1 
ATOM   4607 O O   . GLY B 1 57  ? -2.970  -74.721 -55.966 1.00 47.40  ? 58  GLY B O   1 
ATOM   4608 N N   . VAL B 1 58  ? -0.846  -75.246 -56.449 1.00 42.11  ? 59  VAL B N   1 
ATOM   4609 C CA  . VAL B 1 58  ? -0.572  -75.667 -55.085 1.00 43.81  ? 59  VAL B CA  1 
ATOM   4610 C C   . VAL B 1 58  ? 0.414   -74.732 -54.391 1.00 42.99  ? 59  VAL B C   1 
ATOM   4611 O O   . VAL B 1 58  ? 1.544   -74.540 -54.863 1.00 39.62  ? 59  VAL B O   1 
ATOM   4612 C CB  . VAL B 1 58  ? -0.027  -77.108 -55.056 1.00 42.75  ? 59  VAL B CB  1 
ATOM   4613 C CG1 . VAL B 1 58  ? 0.235   -77.543 -53.639 1.00 43.04  ? 59  VAL B CG1 1 
ATOM   4614 C CG2 . VAL B 1 58  ? -1.004  -78.053 -55.736 1.00 39.85  ? 59  VAL B CG2 1 
ATOM   4615 N N   . VAL B 1 59  ? -0.017  -74.145 -53.271 1.00 41.56  ? 60  VAL B N   1 
ATOM   4616 C CA  . VAL B 1 59  ? 0.898   -73.389 -52.416 1.00 36.99  ? 60  VAL B CA  1 
ATOM   4617 C C   . VAL B 1 59  ? 1.701   -74.339 -51.529 1.00 32.43  ? 60  VAL B C   1 
ATOM   4618 O O   . VAL B 1 59  ? 1.135   -75.196 -50.859 1.00 36.55  ? 60  VAL B O   1 
ATOM   4619 C CB  . VAL B 1 59  ? 0.158   -72.369 -51.533 1.00 40.93  ? 60  VAL B CB  1 
ATOM   4620 C CG1 . VAL B 1 59  ? 1.067   -71.878 -50.401 1.00 31.04  ? 60  VAL B CG1 1 
ATOM   4621 C CG2 . VAL B 1 59  ? -0.345  -71.206 -52.379 1.00 35.16  ? 60  VAL B CG2 1 
ATOM   4622 N N   . ASP B 1 60  ? 3.022   -74.206 -51.561 1.00 30.07  ? 61  ASP B N   1 
ATOM   4623 C CA  . ASP B 1 60  ? 3.883   -74.989 -50.687 1.00 37.46  ? 61  ASP B CA  1 
ATOM   4624 C C   . ASP B 1 60  ? 3.951   -74.362 -49.290 1.00 40.56  ? 61  ASP B C   1 
ATOM   4625 O O   . ASP B 1 60  ? 4.548   -73.297 -49.094 1.00 43.72  ? 61  ASP B O   1 
ATOM   4626 C CB  . ASP B 1 60  ? 5.295   -75.116 -51.272 1.00 44.04  ? 61  ASP B CB  1 
ATOM   4627 C CG  . ASP B 1 60  ? 5.360   -76.073 -52.454 1.00 53.61  ? 61  ASP B CG  1 
ATOM   4628 O OD1 . ASP B 1 60  ? 5.181   -77.295 -52.243 1.00 58.41  ? 61  ASP B OD1 1 
ATOM   4629 O OD2 . ASP B 1 60  ? 5.609   -75.604 -53.591 1.00 54.91  ? 61  ASP B OD2 1 
ATOM   4630 N N   . ALA B 1 61  ? 3.324   -75.022 -48.324 1.00 34.97  ? 62  ALA B N   1 
ATOM   4631 C CA  . ALA B 1 61  ? 3.379   -74.576 -46.944 1.00 32.88  ? 62  ALA B CA  1 
ATOM   4632 C C   . ALA B 1 61  ? 4.416   -75.404 -46.204 1.00 38.88  ? 62  ALA B C   1 
ATOM   4633 O O   . ALA B 1 61  ? 4.066   -76.261 -45.388 1.00 35.73  ? 62  ALA B O   1 
ATOM   4634 C CB  . ALA B 1 61  ? 2.022   -74.699 -46.279 1.00 29.68  ? 62  ALA B CB  1 
ATOM   4635 N N   . THR B 1 62  ? 5.691   -75.141 -46.479 1.00 28.87  ? 63  THR B N   1 
ATOM   4636 C CA  . THR B 1 62  ? 6.724   -76.082 -46.087 1.00 29.03  ? 63  THR B CA  1 
ATOM   4637 C C   . THR B 1 62  ? 7.805   -75.470 -45.204 1.00 31.30  ? 63  THR B C   1 
ATOM   4638 O O   . THR B 1 62  ? 8.734   -76.149 -44.781 1.00 34.75  ? 63  THR B O   1 
ATOM   4639 C CB  . THR B 1 62  ? 7.357   -76.692 -47.336 1.00 40.25  ? 63  THR B CB  1 
ATOM   4640 O OG1 . THR B 1 62  ? 7.779   -75.637 -48.207 1.00 39.13  ? 63  THR B OG1 1 
ATOM   4641 C CG2 . THR B 1 62  ? 6.327   -77.554 -48.075 1.00 32.47  ? 63  THR B CG2 1 
ATOM   4642 N N   . THR B 1 63  ? 7.685   -74.183 -44.921 1.00 35.55  ? 64  THR B N   1 
ATOM   4643 C CA  . THR B 1 63  ? 8.614   -73.533 -44.008 1.00 37.22  ? 64  THR B CA  1 
ATOM   4644 C C   . THR B 1 63  ? 7.929   -72.322 -43.396 1.00 41.09  ? 64  THR B C   1 
ATOM   4645 O O   . THR B 1 63  ? 6.931   -71.834 -43.934 1.00 32.58  ? 64  THR B O   1 
ATOM   4646 C CB  . THR B 1 63  ? 9.927   -73.105 -44.717 1.00 35.25  ? 64  THR B CB  1 
ATOM   4647 O OG1 . THR B 1 63  ? 10.950  -72.874 -43.741 1.00 49.75  ? 64  THR B OG1 1 
ATOM   4648 C CG2 . THR B 1 63  ? 9.729   -71.846 -45.524 1.00 31.92  ? 64  THR B CG2 1 
ATOM   4649 N N   . PHE B 1 64  ? 8.449   -71.855 -42.262 1.00 38.72  ? 65  PHE B N   1 
ATOM   4650 C CA  . PHE B 1 64  ? 7.960   -70.628 -41.652 1.00 30.55  ? 65  PHE B CA  1 
ATOM   4651 C C   . PHE B 1 64  ? 8.147   -69.456 -42.594 1.00 38.98  ? 65  PHE B C   1 
ATOM   4652 O O   . PHE B 1 64  ? 9.190   -69.327 -43.237 1.00 37.55  ? 65  PHE B O   1 
ATOM   4653 C CB  . PHE B 1 64  ? 8.679   -70.343 -40.333 1.00 31.50  ? 65  PHE B CB  1 
ATOM   4654 C CG  . PHE B 1 64  ? 8.289   -71.269 -39.226 1.00 37.55  ? 65  PHE B CG  1 
ATOM   4655 C CD1 . PHE B 1 64  ? 6.965   -71.365 -38.829 1.00 28.34  ? 65  PHE B CD1 1 
ATOM   4656 C CD2 . PHE B 1 64  ? 9.243   -72.038 -38.577 1.00 31.19  ? 65  PHE B CD2 1 
ATOM   4657 C CE1 . PHE B 1 64  ? 6.602   -72.213 -37.824 1.00 31.66  ? 65  PHE B CE1 1 
ATOM   4658 C CE2 . PHE B 1 64  ? 8.883   -72.894 -37.577 1.00 28.42  ? 65  PHE B CE2 1 
ATOM   4659 C CZ  . PHE B 1 64  ? 7.564   -72.986 -37.198 1.00 37.32  ? 65  PHE B CZ  1 
ATOM   4660 N N   . GLN B 1 65  ? 7.141   -68.593 -42.666 1.00 33.82  ? 66  GLN B N   1 
ATOM   4661 C CA  . GLN B 1 65  ? 7.267   -67.371 -43.441 1.00 33.46  ? 66  GLN B CA  1 
ATOM   4662 C C   . GLN B 1 65  ? 7.923   -66.260 -42.621 1.00 37.67  ? 66  GLN B C   1 
ATOM   4663 O O   . GLN B 1 65  ? 8.352   -66.492 -41.482 1.00 30.29  ? 66  GLN B O   1 
ATOM   4664 C CB  . GLN B 1 65  ? 5.906   -66.935 -43.950 1.00 36.83  ? 66  GLN B CB  1 
ATOM   4665 C CG  . GLN B 1 65  ? 5.690   -67.264 -45.408 1.00 37.33  ? 66  GLN B CG  1 
ATOM   4666 C CD  . GLN B 1 65  ? 6.324   -66.236 -46.327 1.00 41.88  ? 66  GLN B CD  1 
ATOM   4667 O OE1 . GLN B 1 65  ? 7.039   -65.338 -45.873 1.00 45.33  ? 66  GLN B OE1 1 
ATOM   4668 N NE2 . GLN B 1 65  ? 6.048   -66.349 -47.626 1.00 39.36  ? 66  GLN B NE2 1 
ATOM   4669 N N   . SER B 1 66  ? 8.004   -65.060 -43.195 1.00 27.64  ? 67  SER B N   1 
ATOM   4670 C CA  . SER B 1 66  ? 8.757   -63.972 -42.568 1.00 35.74  ? 67  SER B CA  1 
ATOM   4671 C C   . SER B 1 66  ? 8.150   -63.483 -41.249 1.00 36.28  ? 67  SER B C   1 
ATOM   4672 O O   . SER B 1 66  ? 6.954   -63.637 -40.995 1.00 34.92  ? 67  SER B O   1 
ATOM   4673 C CB  . SER B 1 66  ? 8.895   -62.782 -43.526 1.00 39.24  ? 67  SER B CB  1 
ATOM   4674 O OG  . SER B 1 66  ? 9.479   -63.166 -44.761 1.00 55.81  ? 67  SER B OG  1 
ATOM   4675 N N   . VAL B 1 67  ? 9.007   -62.896 -40.420 1.00 36.01  ? 68  VAL B N   1 
ATOM   4676 C CA  . VAL B 1 67  ? 8.615   -62.232 -39.184 1.00 34.76  ? 68  VAL B CA  1 
ATOM   4677 C C   . VAL B 1 67  ? 8.123   -60.798 -39.456 1.00 34.32  ? 68  VAL B C   1 
ATOM   4678 O O   . VAL B 1 67  ? 8.731   -60.076 -40.246 1.00 39.34  ? 68  VAL B O   1 
ATOM   4679 C CB  . VAL B 1 67  ? 9.808   -62.202 -38.199 1.00 31.84  ? 68  VAL B CB  1 
ATOM   4680 C CG1 . VAL B 1 67  ? 9.466   -61.416 -36.959 1.00 32.01  ? 68  VAL B CG1 1 
ATOM   4681 C CG2 . VAL B 1 67  ? 10.236  -63.612 -37.844 1.00 28.87  ? 68  VAL B CG2 1 
ATOM   4682 N N   . CYS B 1 68  ? 7.031   -60.380 -38.814 1.00 35.16  ? 69  CYS B N   1 
ATOM   4683 C CA  . CYS B 1 68  ? 6.522   -59.011 -38.988 1.00 30.62  ? 69  CYS B CA  1 
ATOM   4684 C C   . CYS B 1 68  ? 7.539   -57.990 -38.488 1.00 34.99  ? 69  CYS B C   1 
ATOM   4685 O O   . CYS B 1 68  ? 8.230   -58.248 -37.501 1.00 41.46  ? 69  CYS B O   1 
ATOM   4686 C CB  . CYS B 1 68  ? 5.187   -58.838 -38.265 1.00 28.47  ? 69  CYS B CB  1 
ATOM   4687 S SG  . CYS B 1 68  ? 3.861   -59.870 -38.953 1.00 45.28  ? 69  CYS B SG  1 
ATOM   4688 N N   . TYR B 1 69  ? 7.646   -56.849 -39.171 1.00 32.94  ? 70  TYR B N   1 
ATOM   4689 C CA  . TYR B 1 69  ? 8.682   -55.857 -38.842 1.00 37.01  ? 70  TYR B CA  1 
ATOM   4690 C C   . TYR B 1 69  ? 8.654   -55.440 -37.379 1.00 37.11  ? 70  TYR B C   1 
ATOM   4691 O O   . TYR B 1 69  ? 7.606   -55.104 -36.831 1.00 40.59  ? 70  TYR B O   1 
ATOM   4692 C CB  . TYR B 1 69  ? 8.555   -54.606 -39.717 1.00 35.80  ? 70  TYR B CB  1 
ATOM   4693 C CG  . TYR B 1 69  ? 9.648   -54.492 -40.757 1.00 41.33  ? 70  TYR B CG  1 
ATOM   4694 C CD1 . TYR B 1 69  ? 9.431   -54.920 -42.059 1.00 43.89  ? 70  TYR B CD1 1 
ATOM   4695 C CD2 . TYR B 1 69  ? 10.899  -53.972 -40.434 1.00 35.21  ? 70  TYR B CD2 1 
ATOM   4696 C CE1 . TYR B 1 69  ? 10.420  -54.831 -43.016 1.00 45.84  ? 70  TYR B CE1 1 
ATOM   4697 C CE2 . TYR B 1 69  ? 11.904  -53.881 -41.384 1.00 39.67  ? 70  TYR B CE2 1 
ATOM   4698 C CZ  . TYR B 1 69  ? 11.654  -54.313 -42.680 1.00 54.82  ? 70  TYR B CZ  1 
ATOM   4699 O OH  . TYR B 1 69  ? 12.629  -54.232 -43.660 1.00 67.16  ? 70  TYR B OH  1 
ATOM   4700 N N   . GLN B 1 70  ? 9.818   -55.449 -36.749 1.00 34.61  ? 71  GLN B N   1 
ATOM   4701 C CA  . GLN B 1 70  ? 9.877   -55.136 -35.339 1.00 39.19  ? 71  GLN B CA  1 
ATOM   4702 C C   . GLN B 1 70  ? 11.273  -54.735 -34.889 1.00 36.82  ? 71  GLN B C   1 
ATOM   4703 O O   . GLN B 1 70  ? 12.263  -55.024 -35.556 1.00 45.88  ? 71  GLN B O   1 
ATOM   4704 C CB  . GLN B 1 70  ? 9.381   -56.334 -34.528 1.00 36.18  ? 71  GLN B CB  1 
ATOM   4705 C CG  . GLN B 1 70  ? 10.211  -57.591 -34.705 1.00 35.65  ? 71  GLN B CG  1 
ATOM   4706 C CD  . GLN B 1 70  ? 9.579   -58.800 -34.047 1.00 37.97  ? 71  GLN B CD  1 
ATOM   4707 O OE1 . GLN B 1 70  ? 10.053  -59.277 -33.011 1.00 39.64  ? 71  GLN B OE1 1 
ATOM   4708 N NE2 . GLN B 1 70  ? 8.502   -59.301 -34.642 1.00 25.60  ? 71  GLN B NE2 1 
ATOM   4709 N N   . TYR B 1 71  ? 11.338  -54.058 -33.750 1.00 44.63  ? 72  TYR B N   1 
ATOM   4710 C CA  . TYR B 1 71  ? 12.610  -53.748 -33.113 1.00 53.18  ? 72  TYR B CA  1 
ATOM   4711 C C   . TYR B 1 71  ? 13.325  -55.042 -32.722 1.00 51.25  ? 72  TYR B C   1 
ATOM   4712 O O   . TYR B 1 71  ? 12.687  -56.021 -32.317 1.00 48.95  ? 72  TYR B O   1 
ATOM   4713 C CB  . TYR B 1 71  ? 12.394  -52.852 -31.885 1.00 53.63  ? 72  TYR B CB  1 
ATOM   4714 C CG  . TYR B 1 71  ? 13.618  -52.713 -31.004 1.00 65.88  ? 72  TYR B CG  1 
ATOM   4715 C CD1 . TYR B 1 71  ? 14.717  -51.951 -31.413 1.00 71.70  ? 72  TYR B CD1 1 
ATOM   4716 C CD2 . TYR B 1 71  ? 13.679  -53.344 -29.761 1.00 66.33  ? 72  TYR B CD2 1 
ATOM   4717 C CE1 . TYR B 1 71  ? 15.847  -51.823 -30.607 1.00 77.47  ? 72  TYR B CE1 1 
ATOM   4718 C CE2 . TYR B 1 71  ? 14.800  -53.224 -28.946 1.00 79.06  ? 72  TYR B CE2 1 
ATOM   4719 C CZ  . TYR B 1 71  ? 15.883  -52.463 -29.374 1.00 90.05  ? 72  TYR B CZ  1 
ATOM   4720 O OH  . TYR B 1 71  ? 16.999  -52.348 -28.565 1.00 93.33  ? 72  TYR B OH  1 
ATOM   4721 N N   . VAL B 1 72  ? 14.645  -55.053 -32.859 1.00 47.62  ? 73  VAL B N   1 
ATOM   4722 C CA  . VAL B 1 72  ? 15.417  -56.223 -32.476 1.00 55.23  ? 73  VAL B CA  1 
ATOM   4723 C C   . VAL B 1 72  ? 16.267  -55.920 -31.257 1.00 66.57  ? 73  VAL B C   1 
ATOM   4724 O O   . VAL B 1 72  ? 17.147  -55.056 -31.307 1.00 68.57  ? 73  VAL B O   1 
ATOM   4725 C CB  . VAL B 1 72  ? 16.321  -56.719 -33.615 1.00 51.25  ? 73  VAL B CB  1 
ATOM   4726 C CG1 . VAL B 1 72  ? 17.164  -57.876 -33.130 1.00 52.52  ? 73  VAL B CG1 1 
ATOM   4727 C CG2 . VAL B 1 72  ? 15.484  -57.143 -34.805 1.00 45.16  ? 73  VAL B CG2 1 
ATOM   4728 N N   . ASP B 1 73  ? 15.991  -56.638 -30.167 1.00 63.64  ? 74  ASP B N   1 
ATOM   4729 C CA  . ASP B 1 73  ? 16.681  -56.446 -28.891 1.00 69.46  ? 74  ASP B CA  1 
ATOM   4730 C C   . ASP B 1 73  ? 18.197  -56.664 -28.986 1.00 73.25  ? 74  ASP B C   1 
ATOM   4731 O O   . ASP B 1 73  ? 18.663  -57.718 -29.433 1.00 69.10  ? 74  ASP B O   1 
ATOM   4732 C CB  . ASP B 1 73  ? 16.091  -57.383 -27.838 1.00 65.27  ? 74  ASP B CB  1 
ATOM   4733 C CG  . ASP B 1 73  ? 16.649  -57.129 -26.451 1.00 69.32  ? 74  ASP B CG  1 
ATOM   4734 O OD1 . ASP B 1 73  ? 17.099  -55.994 -26.174 1.00 78.61  ? 74  ASP B OD1 1 
ATOM   4735 O OD2 . ASP B 1 73  ? 16.630  -58.071 -25.636 1.00 68.56  ? 74  ASP B OD2 1 
ATOM   4736 N N   . THR B 1 74  ? 18.961  -55.663 -28.553 1.00 70.60  ? 75  THR B N   1 
ATOM   4737 C CA  . THR B 1 74  ? 20.418  -55.715 -28.645 1.00 73.50  ? 75  THR B CA  1 
ATOM   4738 C C   . THR B 1 74  ? 21.066  -55.500 -27.288 1.00 65.75  ? 75  THR B C   1 
ATOM   4739 O O   . THR B 1 74  ? 22.238  -55.132 -27.210 1.00 72.14  ? 75  THR B O   1 
ATOM   4740 C CB  . THR B 1 74  ? 20.978  -54.656 -29.641 1.00 79.36  ? 75  THR B CB  1 
ATOM   4741 O OG1 . THR B 1 74  ? 20.344  -53.386 -29.416 1.00 72.39  ? 75  THR B OG1 1 
ATOM   4742 C CG2 . THR B 1 74  ? 20.758  -55.099 -31.095 1.00 61.15  ? 75  THR B CG2 1 
ATOM   4743 N N   . LEU B 1 75  ? 20.301  -55.737 -26.225 1.00 69.73  ? 76  LEU B N   1 
ATOM   4744 C CA  . LEU B 1 75  ? 20.778  -55.510 -24.861 1.00 72.01  ? 76  LEU B CA  1 
ATOM   4745 C C   . LEU B 1 75  ? 21.962  -56.408 -24.513 1.00 72.61  ? 76  LEU B C   1 
ATOM   4746 O O   . LEU B 1 75  ? 22.958  -55.950 -23.946 1.00 76.19  ? 76  LEU B O   1 
ATOM   4747 C CB  . LEU B 1 75  ? 19.645  -55.726 -23.851 1.00 70.41  ? 76  LEU B CB  1 
ATOM   4748 C CG  . LEU B 1 75  ? 20.007  -55.393 -22.398 1.00 73.89  ? 76  LEU B CG  1 
ATOM   4749 C CD1 . LEU B 1 75  ? 20.520  -53.954 -22.273 1.00 60.44  ? 76  LEU B CD1 1 
ATOM   4750 C CD2 . LEU B 1 75  ? 18.824  -55.645 -21.462 1.00 64.08  ? 76  LEU B CD2 1 
ATOM   4751 N N   . TYR B 1 76  ? 21.844  -57.687 -24.854 1.00 69.27  ? 77  TYR B N   1 
ATOM   4752 C CA  . TYR B 1 76  ? 22.920  -58.640 -24.621 1.00 69.52  ? 77  TYR B CA  1 
ATOM   4753 C C   . TYR B 1 76  ? 23.184  -59.490 -25.864 1.00 67.95  ? 77  TYR B C   1 
ATOM   4754 O O   . TYR B 1 76  ? 22.715  -60.623 -25.948 1.00 69.89  ? 77  TYR B O   1 
ATOM   4755 C CB  . TYR B 1 76  ? 22.588  -59.549 -23.434 1.00 61.97  ? 77  TYR B CB  1 
ATOM   4756 C CG  . TYR B 1 76  ? 22.472  -58.858 -22.087 1.00 63.33  ? 77  TYR B CG  1 
ATOM   4757 C CD1 . TYR B 1 76  ? 23.596  -58.362 -21.434 1.00 66.13  ? 77  TYR B CD1 1 
ATOM   4758 C CD2 . TYR B 1 76  ? 21.243  -58.740 -21.451 1.00 66.26  ? 77  TYR B CD2 1 
ATOM   4759 C CE1 . TYR B 1 76  ? 23.495  -57.746 -20.190 1.00 67.21  ? 77  TYR B CE1 1 
ATOM   4760 C CE2 . TYR B 1 76  ? 21.129  -58.130 -20.209 1.00 75.99  ? 77  TYR B CE2 1 
ATOM   4761 C CZ  . TYR B 1 76  ? 22.257  -57.632 -19.581 1.00 75.92  ? 77  TYR B CZ  1 
ATOM   4762 O OH  . TYR B 1 76  ? 22.134  -57.026 -18.343 1.00 62.47  ? 77  TYR B OH  1 
ATOM   4763 N N   . PRO B 1 77  ? 23.934  -58.942 -26.837 1.00 65.81  ? 78  PRO B N   1 
ATOM   4764 C CA  . PRO B 1 77  ? 24.236  -59.639 -28.098 1.00 66.12  ? 78  PRO B CA  1 
ATOM   4765 C C   . PRO B 1 77  ? 24.923  -60.998 -27.912 1.00 74.09  ? 78  PRO B C   1 
ATOM   4766 O O   . PRO B 1 77  ? 25.888  -61.106 -27.148 1.00 69.13  ? 78  PRO B O   1 
ATOM   4767 C CB  . PRO B 1 77  ? 25.166  -58.658 -28.821 1.00 60.28  ? 78  PRO B CB  1 
ATOM   4768 C CG  . PRO B 1 77  ? 24.755  -57.322 -28.303 1.00 68.27  ? 78  PRO B CG  1 
ATOM   4769 C CD  . PRO B 1 77  ? 24.438  -57.558 -26.844 1.00 65.88  ? 78  PRO B CD  1 
ATOM   4770 N N   . GLY B 1 78  ? 24.414  -62.019 -28.605 1.00 71.80  ? 79  GLY B N   1 
ATOM   4771 C CA  . GLY B 1 78  ? 24.968  -63.361 -28.539 1.00 57.48  ? 79  GLY B CA  1 
ATOM   4772 C C   . GLY B 1 78  ? 24.504  -64.166 -27.339 1.00 64.30  ? 79  GLY B C   1 
ATOM   4773 O O   . GLY B 1 78  ? 24.763  -65.365 -27.245 1.00 61.87  ? 79  GLY B O   1 
ATOM   4774 N N   . PHE B 1 79  ? 23.820  -63.505 -26.412 1.00 64.68  ? 80  PHE B N   1 
ATOM   4775 C CA  . PHE B 1 79  ? 23.321  -64.164 -25.211 1.00 58.27  ? 80  PHE B CA  1 
ATOM   4776 C C   . PHE B 1 79  ? 22.042  -64.936 -25.532 1.00 59.27  ? 80  PHE B C   1 
ATOM   4777 O O   . PHE B 1 79  ? 21.093  -64.373 -26.075 1.00 60.96  ? 80  PHE B O   1 
ATOM   4778 C CB  . PHE B 1 79  ? 23.089  -63.126 -24.108 1.00 52.06  ? 80  PHE B CB  1 
ATOM   4779 C CG  . PHE B 1 79  ? 22.434  -63.675 -22.870 1.00 55.74  ? 80  PHE B CG  1 
ATOM   4780 C CD1 . PHE B 1 79  ? 23.000  -64.729 -22.173 1.00 51.75  ? 80  PHE B CD1 1 
ATOM   4781 C CD2 . PHE B 1 79  ? 21.258  -63.114 -22.388 1.00 56.61  ? 80  PHE B CD2 1 
ATOM   4782 C CE1 . PHE B 1 79  ? 22.398  -65.228 -21.028 1.00 54.49  ? 80  PHE B CE1 1 
ATOM   4783 C CE2 . PHE B 1 79  ? 20.653  -63.605 -21.241 1.00 49.67  ? 80  PHE B CE2 1 
ATOM   4784 C CZ  . PHE B 1 79  ? 21.223  -64.663 -20.561 1.00 54.62  ? 80  PHE B CZ  1 
ATOM   4785 N N   . GLU B 1 80  ? 22.019  -66.224 -25.201 1.00 53.37  ? 81  GLU B N   1 
ATOM   4786 C CA  . GLU B 1 80  ? 20.908  -67.081 -25.608 1.00 65.46  ? 81  GLU B CA  1 
ATOM   4787 C C   . GLU B 1 80  ? 19.590  -66.661 -24.955 1.00 62.70  ? 81  GLU B C   1 
ATOM   4788 O O   . GLU B 1 80  ? 18.515  -66.815 -25.541 1.00 64.50  ? 81  GLU B O   1 
ATOM   4789 C CB  . GLU B 1 80  ? 21.212  -68.551 -25.288 1.00 72.48  ? 81  GLU B CB  1 
ATOM   4790 C CG  . GLU B 1 80  ? 20.346  -69.552 -26.063 1.00 72.46  ? 81  GLU B CG  1 
ATOM   4791 C CD  . GLU B 1 80  ? 19.345  -70.280 -25.171 1.00 99.12  ? 81  GLU B CD  1 
ATOM   4792 O OE1 . GLU B 1 80  ? 19.659  -70.504 -23.975 1.00 97.16  ? 81  GLU B OE1 1 
ATOM   4793 O OE2 . GLU B 1 80  ? 18.246  -70.626 -25.671 1.00 90.17  ? 81  GLU B OE2 1 
ATOM   4794 N N   . GLY B 1 81  ? 19.678  -66.114 -23.750 1.00 61.25  ? 82  GLY B N   1 
ATOM   4795 C CA  . GLY B 1 81  ? 18.496  -65.688 -23.028 1.00 57.59  ? 82  GLY B CA  1 
ATOM   4796 C C   . GLY B 1 81  ? 17.712  -64.590 -23.725 1.00 54.34  ? 82  GLY B C   1 
ATOM   4797 O O   . GLY B 1 81  ? 16.514  -64.448 -23.504 1.00 57.73  ? 82  GLY B O   1 
ATOM   4798 N N   . THR B 1 82  ? 18.378  -63.802 -24.560 1.00 52.85  ? 83  THR B N   1 
ATOM   4799 C CA  . THR B 1 82  ? 17.675  -62.761 -25.295 1.00 54.85  ? 83  THR B CA  1 
ATOM   4800 C C   . THR B 1 82  ? 17.479  -63.148 -26.755 1.00 54.11  ? 83  THR B C   1 
ATOM   4801 O O   . THR B 1 82  ? 16.428  -62.875 -27.328 1.00 55.21  ? 83  THR B O   1 
ATOM   4802 C CB  . THR B 1 82  ? 18.406  -61.409 -25.227 1.00 48.60  ? 83  THR B CB  1 
ATOM   4803 O OG1 . THR B 1 82  ? 19.755  -61.571 -25.672 1.00 59.60  ? 83  THR B OG1 1 
ATOM   4804 C CG2 . THR B 1 82  ? 18.399  -60.872 -23.806 1.00 51.23  ? 83  THR B CG2 1 
ATOM   4805 N N   . GLU B 1 83  ? 18.478  -63.794 -27.349 1.00 48.13  ? 84  GLU B N   1 
ATOM   4806 C CA  . GLU B 1 83  ? 18.407  -64.163 -28.761 1.00 52.77  ? 84  GLU B CA  1 
ATOM   4807 C C   . GLU B 1 83  ? 17.254  -65.127 -29.049 1.00 50.95  ? 84  GLU B C   1 
ATOM   4808 O O   . GLU B 1 83  ? 16.680  -65.111 -30.142 1.00 43.60  ? 84  GLU B O   1 
ATOM   4809 C CB  . GLU B 1 83  ? 19.731  -64.781 -29.234 1.00 56.15  ? 84  GLU B CB  1 
ATOM   4810 C CG  . GLU B 1 83  ? 20.946  -63.840 -29.186 1.00 70.84  ? 84  GLU B CG  1 
ATOM   4811 C CD  . GLU B 1 83  ? 20.818  -62.625 -30.104 1.00 80.27  ? 84  GLU B CD  1 
ATOM   4812 O OE1 . GLU B 1 83  ? 19.957  -62.638 -31.019 1.00 77.73  ? 84  GLU B OE1 1 
ATOM   4813 O OE2 . GLU B 1 83  ? 21.588  -61.654 -29.908 1.00 69.52  ? 84  GLU B OE2 1 
ATOM   4814 N N   . MET B 1 84  ? 16.898  -65.947 -28.066 1.00 45.30  ? 85  MET B N   1 
ATOM   4815 C CA  . MET B 1 84  ? 15.842  -66.937 -28.259 1.00 48.16  ? 85  MET B CA  1 
ATOM   4816 C C   . MET B 1 84  ? 14.470  -66.309 -28.532 1.00 47.57  ? 85  MET B C   1 
ATOM   4817 O O   . MET B 1 84  ? 13.553  -66.996 -28.986 1.00 45.33  ? 85  MET B O   1 
ATOM   4818 C CB  . MET B 1 84  ? 15.750  -67.860 -27.042 1.00 56.31  ? 85  MET B CB  1 
ATOM   4819 C CG  . MET B 1 84  ? 15.297  -67.170 -25.761 1.00 56.44  ? 85  MET B CG  1 
ATOM   4820 S SD  . MET B 1 84  ? 14.927  -68.334 -24.432 1.00 59.54  ? 85  MET B SD  1 
ATOM   4821 C CE  . MET B 1 84  ? 13.434  -69.079 -25.085 1.00 45.37  ? 85  MET B CE  1 
ATOM   4822 N N   . TRP B 1 85  ? 14.336  -65.011 -28.256 1.00 46.26  ? 86  TRP B N   1 
ATOM   4823 C CA  . TRP B 1 85  ? 13.079  -64.291 -28.468 1.00 43.35  ? 86  TRP B CA  1 
ATOM   4824 C C   . TRP B 1 85  ? 13.117  -63.434 -29.731 1.00 37.12  ? 86  TRP B C   1 
ATOM   4825 O O   . TRP B 1 85  ? 12.081  -63.015 -30.234 1.00 37.76  ? 86  TRP B O   1 
ATOM   4826 C CB  . TRP B 1 85  ? 12.751  -63.405 -27.258 1.00 36.41  ? 86  TRP B CB  1 
ATOM   4827 C CG  . TRP B 1 85  ? 12.703  -64.144 -25.964 1.00 42.52  ? 86  TRP B CG  1 
ATOM   4828 C CD1 . TRP B 1 85  ? 13.583  -64.044 -24.931 1.00 43.71  ? 86  TRP B CD1 1 
ATOM   4829 C CD2 . TRP B 1 85  ? 11.723  -65.111 -25.562 1.00 45.78  ? 86  TRP B CD2 1 
ATOM   4830 N NE1 . TRP B 1 85  ? 13.210  -64.877 -23.907 1.00 38.51  ? 86  TRP B NE1 1 
ATOM   4831 C CE2 . TRP B 1 85  ? 12.074  -65.547 -24.272 1.00 35.00  ? 86  TRP B CE2 1 
ATOM   4832 C CE3 . TRP B 1 85  ? 10.582  -65.646 -26.169 1.00 42.13  ? 86  TRP B CE3 1 
ATOM   4833 C CZ2 . TRP B 1 85  ? 11.332  -66.488 -23.578 1.00 34.86  ? 86  TRP B CZ2 1 
ATOM   4834 C CZ3 . TRP B 1 85  ? 9.847   -66.578 -25.479 1.00 36.84  ? 86  TRP B CZ3 1 
ATOM   4835 C CH2 . TRP B 1 85  ? 10.223  -66.991 -24.197 1.00 41.35  ? 86  TRP B CH2 1 
ATOM   4836 N N   . ASN B 1 86  ? 14.321  -63.171 -30.226 1.00 41.33  ? 87  ASN B N   1 
ATOM   4837 C CA  . ASN B 1 86  ? 14.526  -62.327 -31.400 1.00 41.46  ? 87  ASN B CA  1 
ATOM   4838 C C   . ASN B 1 86  ? 14.064  -63.015 -32.685 1.00 42.01  ? 87  ASN B C   1 
ATOM   4839 O O   . ASN B 1 86  ? 13.946  -64.241 -32.728 1.00 38.95  ? 87  ASN B O   1 
ATOM   4840 C CB  . ASN B 1 86  ? 16.005  -61.929 -31.502 1.00 48.15  ? 87  ASN B CB  1 
ATOM   4841 C CG  . ASN B 1 86  ? 16.393  -60.845 -30.506 1.00 60.51  ? 87  ASN B CG  1 
ATOM   4842 O OD1 . ASN B 1 86  ? 15.536  -60.143 -29.959 1.00 61.19  ? 87  ASN B OD1 1 
ATOM   4843 N ND2 . ASN B 1 86  ? 17.694  -60.697 -30.276 1.00 69.73  ? 87  ASN B ND2 1 
ATOM   4844 N N   . PRO B 1 87  ? 13.793  -62.231 -33.739 1.00 38.64  ? 88  PRO B N   1 
ATOM   4845 C CA  . PRO B 1 87  ? 13.266  -62.832 -34.976 1.00 41.77  ? 88  PRO B CA  1 
ATOM   4846 C C   . PRO B 1 87  ? 14.241  -63.810 -35.620 1.00 41.72  ? 88  PRO B C   1 
ATOM   4847 O O   . PRO B 1 87  ? 15.434  -63.518 -35.667 1.00 43.58  ? 88  PRO B O   1 
ATOM   4848 C CB  . PRO B 1 87  ? 13.046  -61.623 -35.891 1.00 33.93  ? 88  PRO B CB  1 
ATOM   4849 C CG  . PRO B 1 87  ? 13.041  -60.440 -34.985 1.00 39.19  ? 88  PRO B CG  1 
ATOM   4850 C CD  . PRO B 1 87  ? 13.936  -60.771 -33.849 1.00 36.46  ? 88  PRO B CD  1 
ATOM   4851 N N   . ASN B 1 88  ? 13.736  -64.935 -36.118 1.00 41.31  ? 89  ASN B N   1 
ATOM   4852 C CA  . ASN B 1 88  ? 14.583  -65.964 -36.722 1.00 33.57  ? 89  ASN B CA  1 
ATOM   4853 C C   . ASN B 1 88  ? 14.197  -66.270 -38.173 1.00 40.41  ? 89  ASN B C   1 
ATOM   4854 O O   . ASN B 1 88  ? 14.420  -67.373 -38.674 1.00 44.55  ? 89  ASN B O   1 
ATOM   4855 C CB  . ASN B 1 88  ? 14.520  -67.240 -35.892 1.00 33.02  ? 89  ASN B CB  1 
ATOM   4856 C CG  . ASN B 1 88  ? 13.146  -67.881 -35.926 1.00 43.70  ? 89  ASN B CG  1 
ATOM   4857 O OD1 . ASN B 1 88  ? 12.137  -67.200 -36.101 1.00 45.31  ? 89  ASN B OD1 1 
ATOM   4858 N ND2 . ASN B 1 88  ? 13.102  -69.196 -35.774 1.00 52.02  ? 89  ASN B ND2 1 
ATOM   4859 N N   . ARG B 1 89  ? 13.565  -65.294 -38.814 1.00 36.48  ? 90  ARG B N   1 
ATOM   4860 C CA  . ARG B 1 89  ? 13.381  -65.252 -40.263 1.00 37.36  ? 90  ARG B CA  1 
ATOM   4861 C C   . ARG B 1 89  ? 13.595  -63.800 -40.642 1.00 39.78  ? 90  ARG B C   1 
ATOM   4862 O O   . ARG B 1 89  ? 13.670  -62.941 -39.761 1.00 53.28  ? 90  ARG B O   1 
ATOM   4863 C CB  . ARG B 1 89  ? 11.995  -65.729 -40.697 1.00 33.72  ? 90  ARG B CB  1 
ATOM   4864 C CG  . ARG B 1 89  ? 11.756  -67.213 -40.546 1.00 40.10  ? 90  ARG B CG  1 
ATOM   4865 C CD  . ARG B 1 89  ? 12.728  -68.040 -41.371 1.00 48.70  ? 90  ARG B CD  1 
ATOM   4866 N NE  . ARG B 1 89  ? 12.243  -69.406 -41.562 1.00 47.31  ? 90  ARG B NE  1 
ATOM   4867 C CZ  . ARG B 1 89  ? 12.456  -70.401 -40.706 1.00 58.84  ? 90  ARG B CZ  1 
ATOM   4868 N NH1 . ARG B 1 89  ? 13.148  -70.192 -39.586 1.00 48.10  ? 90  ARG B NH1 1 
ATOM   4869 N NH2 . ARG B 1 89  ? 11.965  -71.606 -40.963 1.00 63.55  ? 90  ARG B NH2 1 
ATOM   4870 N N   . GLU B 1 90  ? 13.700  -63.495 -41.927 1.00 42.05  ? 91  GLU B N   1 
ATOM   4871 C CA  . GLU B 1 90  ? 13.888  -62.096 -42.285 1.00 50.20  ? 91  GLU B CA  1 
ATOM   4872 C C   . GLU B 1 90  ? 12.641  -61.264 -41.929 1.00 46.54  ? 91  GLU B C   1 
ATOM   4873 O O   . GLU B 1 90  ? 11.510  -61.768 -41.917 1.00 31.95  ? 91  GLU B O   1 
ATOM   4874 C CB  . GLU B 1 90  ? 14.239  -61.958 -43.764 1.00 44.05  ? 91  GLU B CB  1 
ATOM   4875 C CG  . GLU B 1 90  ? 13.121  -62.284 -44.721 1.00 56.61  ? 91  GLU B CG  1 
ATOM   4876 C CD  . GLU B 1 90  ? 13.506  -61.975 -46.157 1.00 89.06  ? 91  GLU B CD  1 
ATOM   4877 O OE1 . GLU B 1 90  ? 14.722  -61.788 -46.417 1.00 89.56  ? 91  GLU B OE1 1 
ATOM   4878 O OE2 . GLU B 1 90  ? 12.600  -61.916 -47.021 1.00 83.87  ? 91  GLU B OE2 1 
ATOM   4879 N N   . LEU B 1 91  ? 12.862  -59.997 -41.598 1.00 33.37  ? 92  LEU B N   1 
ATOM   4880 C CA  . LEU B 1 91  ? 11.754  -59.088 -41.377 1.00 31.79  ? 92  LEU B CA  1 
ATOM   4881 C C   . LEU B 1 91  ? 11.130  -58.667 -42.698 1.00 39.67  ? 92  LEU B C   1 
ATOM   4882 O O   . LEU B 1 91  ? 11.823  -58.423 -43.696 1.00 41.99  ? 92  LEU B O   1 
ATOM   4883 C CB  . LEU B 1 91  ? 12.203  -57.852 -40.611 1.00 32.60  ? 92  LEU B CB  1 
ATOM   4884 C CG  . LEU B 1 91  ? 12.958  -58.080 -39.314 1.00 35.59  ? 92  LEU B CG  1 
ATOM   4885 C CD1 . LEU B 1 91  ? 13.331  -56.731 -38.754 1.00 34.11  ? 92  LEU B CD1 1 
ATOM   4886 C CD2 . LEU B 1 91  ? 12.124  -58.891 -38.318 1.00 31.26  ? 92  LEU B CD2 1 
ATOM   4887 N N   . SER B 1 92  ? 9.810   -58.568 -42.685 1.00 38.64  ? 93  SER B N   1 
ATOM   4888 C CA  . SER B 1 92  ? 9.060   -58.139 -43.844 1.00 31.41  ? 93  SER B CA  1 
ATOM   4889 C C   . SER B 1 92  ? 7.685   -57.669 -43.392 1.00 40.49  ? 93  SER B C   1 
ATOM   4890 O O   . SER B 1 92  ? 7.156   -58.169 -42.396 1.00 40.07  ? 93  SER B O   1 
ATOM   4891 C CB  . SER B 1 92  ? 8.936   -59.282 -44.844 1.00 32.15  ? 93  SER B CB  1 
ATOM   4892 O OG  . SER B 1 92  ? 8.079   -58.927 -45.904 1.00 32.63  ? 93  SER B OG  1 
ATOM   4893 N N   . GLU B 1 93  ? 7.103   -56.715 -44.109 1.00 31.96  ? 94  GLU B N   1 
ATOM   4894 C CA  . GLU B 1 93  ? 5.708   -56.379 -43.881 1.00 32.77  ? 94  GLU B CA  1 
ATOM   4895 C C   . GLU B 1 93  ? 4.799   -57.472 -44.449 1.00 34.40  ? 94  GLU B C   1 
ATOM   4896 O O   . GLU B 1 93  ? 3.627   -57.580 -44.080 1.00 42.63  ? 94  GLU B O   1 
ATOM   4897 C CB  . GLU B 1 93  ? 5.365   -55.026 -44.490 1.00 35.32  ? 94  GLU B CB  1 
ATOM   4898 C CG  . GLU B 1 93  ? 6.010   -53.835 -43.780 1.00 41.36  ? 94  GLU B CG  1 
ATOM   4899 C CD  . GLU B 1 93  ? 5.398   -52.510 -44.212 1.00 51.11  ? 94  GLU B CD  1 
ATOM   4900 O OE1 . GLU B 1 93  ? 4.431   -52.052 -43.558 1.00 48.81  ? 94  GLU B OE1 1 
ATOM   4901 O OE2 . GLU B 1 93  ? 5.875   -51.937 -45.216 1.00 52.49  ? 94  GLU B OE2 1 
ATOM   4902 N N   . ASP B 1 94  ? 5.351   -58.283 -45.347 1.00 38.79  ? 95  ASP B N   1 
ATOM   4903 C CA  . ASP B 1 94  ? 4.643   -59.426 -45.914 1.00 36.70  ? 95  ASP B CA  1 
ATOM   4904 C C   . ASP B 1 94  ? 4.804   -60.629 -44.969 1.00 43.78  ? 95  ASP B C   1 
ATOM   4905 O O   . ASP B 1 94  ? 5.683   -61.465 -45.169 1.00 46.87  ? 95  ASP B O   1 
ATOM   4906 C CB  . ASP B 1 94  ? 5.177   -59.718 -47.320 1.00 31.50  ? 95  ASP B CB  1 
ATOM   4907 C CG  . ASP B 1 94  ? 4.462   -60.876 -48.009 1.00 39.85  ? 95  ASP B CG  1 
ATOM   4908 O OD1 . ASP B 1 94  ? 3.509   -61.434 -47.430 1.00 35.99  ? 95  ASP B OD1 1 
ATOM   4909 O OD2 . ASP B 1 94  ? 4.849   -61.218 -49.156 1.00 36.42  ? 95  ASP B OD2 1 
ATOM   4910 N N   . CYS B 1 95  ? 3.936   -60.703 -43.954 1.00 39.96  ? 96  CYS B N   1 
ATOM   4911 C CA  . CYS B 1 95  ? 4.122   -61.598 -42.803 1.00 35.96  ? 96  CYS B CA  1 
ATOM   4912 C C   . CYS B 1 95  ? 2.847   -62.251 -42.262 1.00 34.20  ? 96  CYS B C   1 
ATOM   4913 O O   . CYS B 1 95  ? 2.894   -62.975 -41.262 1.00 29.37  ? 96  CYS B O   1 
ATOM   4914 C CB  . CYS B 1 95  ? 4.780   -60.836 -41.649 1.00 36.56  ? 96  CYS B CB  1 
ATOM   4915 S SG  . CYS B 1 95  ? 3.747   -59.513 -40.967 1.00 40.31  ? 96  CYS B SG  1 
ATOM   4916 N N   . LEU B 1 96  ? 1.714   -62.008 -42.903 1.00 33.24  ? 97  LEU B N   1 
ATOM   4917 C CA  . LEU B 1 96  ? 0.469   -62.557 -42.394 1.00 34.97  ? 97  LEU B CA  1 
ATOM   4918 C C   . LEU B 1 96  ? 0.267   -64.001 -42.860 1.00 36.91  ? 97  LEU B C   1 
ATOM   4919 O O   . LEU B 1 96  ? -0.546  -64.283 -43.741 1.00 39.07  ? 97  LEU B O   1 
ATOM   4920 C CB  . LEU B 1 96  ? -0.712  -61.662 -42.793 1.00 31.97  ? 97  LEU B CB  1 
ATOM   4921 C CG  . LEU B 1 96  ? -0.686  -60.289 -42.089 1.00 37.10  ? 97  LEU B CG  1 
ATOM   4922 C CD1 . LEU B 1 96  ? -1.975  -59.511 -42.281 1.00 37.90  ? 97  LEU B CD1 1 
ATOM   4923 C CD2 . LEU B 1 96  ? -0.374  -60.409 -40.591 1.00 32.58  ? 97  LEU B CD2 1 
ATOM   4924 N N   . TYR B 1 97  ? 1.009   -64.911 -42.231 1.00 35.29  ? 98  TYR B N   1 
ATOM   4925 C CA  . TYR B 1 97  ? 0.900   -66.349 -42.491 1.00 31.73  ? 98  TYR B CA  1 
ATOM   4926 C C   . TYR B 1 97  ? 0.646   -67.101 -41.194 1.00 33.97  ? 98  TYR B C   1 
ATOM   4927 O O   . TYR B 1 97  ? 1.072   -66.655 -40.128 1.00 37.77  ? 98  TYR B O   1 
ATOM   4928 C CB  . TYR B 1 97  ? 2.176   -66.883 -43.153 1.00 31.59  ? 98  TYR B CB  1 
ATOM   4929 C CG  . TYR B 1 97  ? 2.531   -66.150 -44.417 1.00 34.37  ? 98  TYR B CG  1 
ATOM   4930 C CD1 . TYR B 1 97  ? 2.190   -66.670 -45.663 1.00 33.99  ? 98  TYR B CD1 1 
ATOM   4931 C CD2 . TYR B 1 97  ? 3.185   -64.919 -44.367 1.00 26.22  ? 98  TYR B CD2 1 
ATOM   4932 C CE1 . TYR B 1 97  ? 2.493   -65.985 -46.825 1.00 37.38  ? 98  TYR B CE1 1 
ATOM   4933 C CE2 . TYR B 1 97  ? 3.498   -64.235 -45.514 1.00 34.62  ? 98  TYR B CE2 1 
ATOM   4934 C CZ  . TYR B 1 97  ? 3.150   -64.770 -46.744 1.00 37.48  ? 98  TYR B CZ  1 
ATOM   4935 O OH  . TYR B 1 97  ? 3.455   -64.085 -47.892 1.00 38.62  ? 98  TYR B OH  1 
ATOM   4936 N N   . LEU B 1 98  ? -0.025  -68.247 -41.280 1.00 32.34  ? 99  LEU B N   1 
ATOM   4937 C CA  . LEU B 1 98  ? -0.228  -69.086 -40.099 1.00 29.04  ? 99  LEU B CA  1 
ATOM   4938 C C   . LEU B 1 98  ? 0.295   -70.503 -40.307 1.00 32.01  ? 99  LEU B C   1 
ATOM   4939 O O   . LEU B 1 98  ? 0.629   -70.901 -41.419 1.00 36.82  ? 99  LEU B O   1 
ATOM   4940 C CB  . LEU B 1 98  ? -1.712  -69.110 -39.705 1.00 34.41  ? 99  LEU B CB  1 
ATOM   4941 C CG  . LEU B 1 98  ? -2.789  -69.585 -40.685 1.00 30.76  ? 99  LEU B CG  1 
ATOM   4942 C CD1 . LEU B 1 98  ? -2.843  -71.094 -40.710 1.00 30.47  ? 99  LEU B CD1 1 
ATOM   4943 C CD2 . LEU B 1 98  ? -4.151  -69.017 -40.308 1.00 29.06  ? 99  LEU B CD2 1 
ATOM   4944 N N   . ASN B 1 99  ? 0.351   -71.267 -39.225 1.00 35.12  ? 100 ASN B N   1 
ATOM   4945 C CA  . ASN B 1 99  ? 0.891   -72.619 -39.268 1.00 31.73  ? 100 ASN B CA  1 
ATOM   4946 C C   . ASN B 1 99  ? -0.070  -73.629 -38.686 1.00 36.42  ? 100 ASN B C   1 
ATOM   4947 O O   . ASN B 1 99  ? -0.753  -73.346 -37.702 1.00 44.64  ? 100 ASN B O   1 
ATOM   4948 C CB  . ASN B 1 99  ? 2.218   -72.690 -38.510 1.00 37.15  ? 100 ASN B CB  1 
ATOM   4949 C CG  . ASN B 1 99  ? 3.107   -71.505 -38.792 1.00 40.39  ? 100 ASN B CG  1 
ATOM   4950 O OD1 . ASN B 1 99  ? 3.673   -71.389 -39.877 1.00 36.31  ? 100 ASN B OD1 1 
ATOM   4951 N ND2 . ASN B 1 99  ? 3.230   -70.609 -37.818 1.00 40.55  ? 100 ASN B ND2 1 
ATOM   4952 N N   . VAL B 1 100 ? -0.111  -74.814 -39.285 1.00 34.17  ? 101 VAL B N   1 
ATOM   4953 C CA  . VAL B 1 100 ? -0.924  -75.901 -38.762 1.00 35.63  ? 101 VAL B CA  1 
ATOM   4954 C C   . VAL B 1 100 ? -0.068  -77.142 -38.540 1.00 35.80  ? 101 VAL B C   1 
ATOM   4955 O O   . VAL B 1 100 ? 0.680   -77.540 -39.424 1.00 40.64  ? 101 VAL B O   1 
ATOM   4956 C CB  . VAL B 1 100 ? -2.092  -76.237 -39.712 1.00 36.96  ? 101 VAL B CB  1 
ATOM   4957 C CG1 . VAL B 1 100 ? -2.829  -77.461 -39.224 1.00 32.63  ? 101 VAL B CG1 1 
ATOM   4958 C CG2 . VAL B 1 100 ? -3.047  -75.043 -39.847 1.00 34.60  ? 101 VAL B CG2 1 
ATOM   4959 N N   . TRP B 1 101 ? -0.143  -77.722 -37.344 1.00 36.28  ? 102 TRP B N   1 
ATOM   4960 C CA  . TRP B 1 101 ? 0.437   -79.042 -37.081 1.00 32.27  ? 102 TRP B CA  1 
ATOM   4961 C C   . TRP B 1 101 ? -0.686  -80.026 -36.811 1.00 37.58  ? 102 TRP B C   1 
ATOM   4962 O O   . TRP B 1 101 ? -1.659  -79.696 -36.133 1.00 40.27  ? 102 TRP B O   1 
ATOM   4963 C CB  . TRP B 1 101 ? 1.374   -79.030 -35.889 1.00 28.15  ? 102 TRP B CB  1 
ATOM   4964 C CG  . TRP B 1 101 ? 2.664   -78.337 -36.057 1.00 29.23  ? 102 TRP B CG  1 
ATOM   4965 C CD1 . TRP B 1 101 ? 3.855   -78.901 -36.399 1.00 31.71  ? 102 TRP B CD1 1 
ATOM   4966 C CD2 . TRP B 1 101 ? 2.929   -76.948 -35.826 1.00 36.46  ? 102 TRP B CD2 1 
ATOM   4967 N NE1 . TRP B 1 101 ? 4.842   -77.948 -36.418 1.00 34.87  ? 102 TRP B NE1 1 
ATOM   4968 C CE2 . TRP B 1 101 ? 4.299   -76.742 -36.066 1.00 37.02  ? 102 TRP B CE2 1 
ATOM   4969 C CE3 . TRP B 1 101 ? 2.136   -75.860 -35.445 1.00 33.60  ? 102 TRP B CE3 1 
ATOM   4970 C CZ2 . TRP B 1 101 ? 4.893   -75.490 -35.939 1.00 35.21  ? 102 TRP B CZ2 1 
ATOM   4971 C CZ3 . TRP B 1 101 ? 2.723   -74.630 -35.325 1.00 31.15  ? 102 TRP B CZ3 1 
ATOM   4972 C CH2 . TRP B 1 101 ? 4.090   -74.450 -35.571 1.00 34.36  ? 102 TRP B CH2 1 
ATOM   4973 N N   . THR B 1 102 ? -0.553  -81.240 -37.323 1.00 43.47  ? 103 THR B N   1 
ATOM   4974 C CA  . THR B 1 102 ? -1.610  -82.227 -37.171 1.00 35.78  ? 103 THR B CA  1 
ATOM   4975 C C   . THR B 1 102 ? -0.966  -83.606 -37.118 1.00 39.90  ? 103 THR B C   1 
ATOM   4976 O O   . THR B 1 102 ? 0.127   -83.802 -37.648 1.00 46.40  ? 103 THR B O   1 
ATOM   4977 C CB  . THR B 1 102 ? -2.645  -82.100 -38.317 1.00 41.45  ? 103 THR B CB  1 
ATOM   4978 O OG1 . THR B 1 102 ? -3.881  -82.723 -37.945 1.00 56.01  ? 103 THR B OG1 1 
ATOM   4979 C CG2 . THR B 1 102 ? -2.119  -82.703 -39.594 1.00 41.93  ? 103 THR B CG2 1 
ATOM   4980 N N   . PRO B 1 103 ? -1.602  -84.558 -36.424 1.00 53.40  ? 104 PRO B N   1 
ATOM   4981 C CA  . PRO B 1 103 ? -0.996  -85.890 -36.291 1.00 56.12  ? 104 PRO B CA  1 
ATOM   4982 C C   . PRO B 1 103 ? -0.835  -86.635 -37.617 1.00 57.08  ? 104 PRO B C   1 
ATOM   4983 O O   . PRO B 1 103 ? -1.451  -86.277 -38.624 1.00 53.45  ? 104 PRO B O   1 
ATOM   4984 C CB  . PRO B 1 103 ? -1.976  -86.628 -35.374 1.00 58.71  ? 104 PRO B CB  1 
ATOM   4985 C CG  . PRO B 1 103 ? -2.630  -85.546 -34.579 1.00 52.59  ? 104 PRO B CG  1 
ATOM   4986 C CD  . PRO B 1 103 ? -2.760  -84.384 -35.528 1.00 51.59  ? 104 PRO B CD  1 
ATOM   4987 N N   . TYR B 1 104 ? 0.011   -87.662 -37.600 1.00 67.16  ? 105 TYR B N   1 
ATOM   4988 C CA  . TYR B 1 104 ? 0.269   -88.504 -38.766 1.00 69.28  ? 105 TYR B CA  1 
ATOM   4989 C C   . TYR B 1 104 ? -0.046  -89.958 -38.411 1.00 76.87  ? 105 TYR B C   1 
ATOM   4990 O O   . TYR B 1 104 ? 0.597   -90.539 -37.537 1.00 83.20  ? 105 TYR B O   1 
ATOM   4991 C CB  . TYR B 1 104 ? 1.725   -88.366 -39.220 1.00 61.25  ? 105 TYR B CB  1 
ATOM   4992 C CG  . TYR B 1 104 ? 2.017   -88.823 -40.640 1.00 84.59  ? 105 TYR B CG  1 
ATOM   4993 C CD1 . TYR B 1 104 ? 2.031   -90.177 -40.972 1.00 84.78  ? 105 TYR B CD1 1 
ATOM   4994 C CD2 . TYR B 1 104 ? 2.314   -87.896 -41.642 1.00 81.37  ? 105 TYR B CD2 1 
ATOM   4995 C CE1 . TYR B 1 104 ? 2.313   -90.593 -42.269 1.00 83.19  ? 105 TYR B CE1 1 
ATOM   4996 C CE2 . TYR B 1 104 ? 2.595   -88.300 -42.940 1.00 86.60  ? 105 TYR B CE2 1 
ATOM   4997 C CZ  . TYR B 1 104 ? 2.594   -89.650 -43.249 1.00 99.50  ? 105 TYR B CZ  1 
ATOM   4998 O OH  . TYR B 1 104 ? 2.874   -90.056 -44.540 1.00 92.12  ? 105 TYR B OH  1 
ATOM   4999 N N   . PRO B 1 105 ? -1.041  -90.550 -39.081 1.00 69.48  ? 106 PRO B N   1 
ATOM   5000 C CA  . PRO B 1 105 ? -1.846  -89.920 -40.132 1.00 76.35  ? 106 PRO B CA  1 
ATOM   5001 C C   . PRO B 1 105 ? -2.971  -89.038 -39.591 1.00 62.11  ? 106 PRO B C   1 
ATOM   5002 O O   . PRO B 1 105 ? -3.373  -89.163 -38.437 1.00 60.90  ? 106 PRO B O   1 
ATOM   5003 C CB  . PRO B 1 105 ? -2.419  -91.118 -40.888 1.00 79.93  ? 106 PRO B CB  1 
ATOM   5004 C CG  . PRO B 1 105 ? -2.552  -92.170 -39.835 1.00 85.81  ? 106 PRO B CG  1 
ATOM   5005 C CD  . PRO B 1 105 ? -1.400  -91.965 -38.884 1.00 74.42  ? 106 PRO B CD  1 
ATOM   5006 N N   . ARG B 1 106 ? -3.457  -88.153 -40.451 1.00 61.03  ? 107 ARG B N   1 
ATOM   5007 C CA  . ARG B 1 106 ? -4.536  -87.228 -40.146 1.00 58.58  ? 107 ARG B CA  1 
ATOM   5008 C C   . ARG B 1 106 ? -5.673  -87.907 -39.392 1.00 62.98  ? 107 ARG B C   1 
ATOM   5009 O O   . ARG B 1 106 ? -6.130  -88.976 -39.784 1.00 73.96  ? 107 ARG B O   1 
ATOM   5010 C CB  . ARG B 1 106 ? -5.041  -86.611 -41.447 1.00 56.73  ? 107 ARG B CB  1 
ATOM   5011 C CG  . ARG B 1 106 ? -6.142  -85.590 -41.312 1.00 61.54  ? 107 ARG B CG  1 
ATOM   5012 C CD  . ARG B 1 106 ? -6.464  -85.020 -42.691 1.00 55.03  ? 107 ARG B CD  1 
ATOM   5013 N NE  . ARG B 1 106 ? -5.230  -84.799 -43.444 1.00 67.58  ? 107 ARG B NE  1 
ATOM   5014 C CZ  . ARG B 1 106 ? -5.175  -84.449 -44.727 1.00 68.71  ? 107 ARG B CZ  1 
ATOM   5015 N NH1 . ARG B 1 106 ? -6.291  -84.270 -45.426 1.00 61.18  ? 107 ARG B NH1 1 
ATOM   5016 N NH2 . ARG B 1 106 ? -3.996  -84.281 -45.314 1.00 61.30  ? 107 ARG B NH2 1 
ATOM   5017 N N   . PRO B 1 107 ? -6.104  -87.297 -38.276 1.00 74.85  ? 108 PRO B N   1 
ATOM   5018 C CA  . PRO B 1 107 ? -7.187  -87.816 -37.431 1.00 76.13  ? 108 PRO B CA  1 
ATOM   5019 C C   . PRO B 1 107 ? -8.450  -88.140 -38.222 1.00 74.79  ? 108 PRO B C   1 
ATOM   5020 O O   . PRO B 1 107 ? -8.800  -87.414 -39.157 1.00 75.38  ? 108 PRO B O   1 
ATOM   5021 C CB  . PRO B 1 107 ? -7.442  -86.668 -36.452 1.00 68.51  ? 108 PRO B CB  1 
ATOM   5022 C CG  . PRO B 1 107 ? -6.130  -85.979 -36.348 1.00 63.94  ? 108 PRO B CG  1 
ATOM   5023 C CD  . PRO B 1 107 ? -5.503  -86.075 -37.710 1.00 69.87  ? 108 PRO B CD  1 
ATOM   5024 N N   . THR B 1 108 ? -9.131  -89.215 -37.842 1.00 77.56  ? 109 THR B N   1 
ATOM   5025 C CA  . THR B 1 108 ? -10.317 -89.650 -38.571 1.00 84.14  ? 109 THR B CA  1 
ATOM   5026 C C   . THR B 1 108 ? -11.596 -89.102 -37.948 1.00 81.65  ? 109 THR B C   1 
ATOM   5027 O O   . THR B 1 108 ? -12.572 -88.827 -38.651 1.00 84.92  ? 109 THR B O   1 
ATOM   5028 C CB  . THR B 1 108 ? -10.387 -91.179 -38.639 1.00 87.44  ? 109 THR B CB  1 
ATOM   5029 O OG1 . THR B 1 108 ? -9.948  -91.734 -37.389 1.00 71.28  ? 109 THR B OG1 1 
ATOM   5030 C CG2 . THR B 1 108 ? -9.489  -91.683 -39.764 1.00 75.91  ? 109 THR B CG2 1 
ATOM   5031 N N   . SER B 1 109 ? -11.590 -88.945 -36.628 1.00 72.21  ? 110 SER B N   1 
ATOM   5032 C CA  . SER B 1 109 ? -12.685 -88.266 -35.944 1.00 79.47  ? 110 SER B CA  1 
ATOM   5033 C C   . SER B 1 109 ? -12.184 -86.907 -35.457 1.00 74.15  ? 110 SER B C   1 
ATOM   5034 O O   . SER B 1 109 ? -11.028 -86.797 -35.048 1.00 77.04  ? 110 SER B O   1 
ATOM   5035 C CB  . SER B 1 109 ? -13.221 -89.113 -34.779 1.00 79.10  ? 110 SER B CB  1 
ATOM   5036 O OG  . SER B 1 109 ? -12.201 -89.415 -33.841 1.00 73.36  ? 110 SER B OG  1 
ATOM   5037 N N   . PRO B 1 110 ? -13.046 -85.870 -35.515 1.00 77.40  ? 111 PRO B N   1 
ATOM   5038 C CA  . PRO B 1 110 ? -12.703 -84.488 -35.138 1.00 72.39  ? 111 PRO B CA  1 
ATOM   5039 C C   . PRO B 1 110 ? -11.908 -84.372 -33.831 1.00 66.85  ? 111 PRO B C   1 
ATOM   5040 O O   . PRO B 1 110 ? -12.234 -84.990 -32.806 1.00 62.16  ? 111 PRO B O   1 
ATOM   5041 C CB  . PRO B 1 110 ? -14.071 -83.817 -35.008 1.00 69.23  ? 111 PRO B CB  1 
ATOM   5042 C CG  . PRO B 1 110 ? -14.915 -84.535 -35.999 1.00 67.47  ? 111 PRO B CG  1 
ATOM   5043 C CD  . PRO B 1 110 ? -14.443 -85.973 -35.978 1.00 75.99  ? 111 PRO B CD  1 
ATOM   5044 N N   . THR B 1 111 ? -10.855 -83.564 -33.898 1.00 62.66  ? 112 THR B N   1 
ATOM   5045 C CA  . THR B 1 111 ? -9.858  -83.455 -32.840 1.00 58.28  ? 112 THR B CA  1 
ATOM   5046 C C   . THR B 1 111 ? -9.802  -82.020 -32.298 1.00 53.94  ? 112 THR B C   1 
ATOM   5047 O O   . THR B 1 111 ? -9.985  -81.066 -33.056 1.00 55.50  ? 112 THR B O   1 
ATOM   5048 C CB  . THR B 1 111 ? -8.474  -83.892 -33.377 1.00 51.29  ? 112 THR B CB  1 
ATOM   5049 O OG1 . THR B 1 111 ? -8.536  -85.263 -33.780 1.00 74.59  ? 112 THR B OG1 1 
ATOM   5050 C CG2 . THR B 1 111 ? -7.396  -83.750 -32.336 1.00 57.73  ? 112 THR B CG2 1 
ATOM   5051 N N   . PRO B 1 112 ? -9.591  -81.868 -30.978 1.00 51.90  ? 113 PRO B N   1 
ATOM   5052 C CA  . PRO B 1 112 ? -9.374  -80.575 -30.315 1.00 49.56  ? 113 PRO B CA  1 
ATOM   5053 C C   . PRO B 1 112 ? -8.273  -79.714 -30.950 1.00 49.94  ? 113 PRO B C   1 
ATOM   5054 O O   . PRO B 1 112 ? -7.181  -80.209 -31.284 1.00 37.27  ? 113 PRO B O   1 
ATOM   5055 C CB  . PRO B 1 112 ? -8.968  -80.986 -28.899 1.00 52.46  ? 113 PRO B CB  1 
ATOM   5056 C CG  . PRO B 1 112 ? -9.700  -82.238 -28.668 1.00 57.52  ? 113 PRO B CG  1 
ATOM   5057 C CD  . PRO B 1 112 ? -9.745  -82.955 -29.995 1.00 64.83  ? 113 PRO B CD  1 
ATOM   5058 N N   . VAL B 1 113 ? -8.562  -78.421 -31.083 1.00 35.73  ? 114 VAL B N   1 
ATOM   5059 C CA  . VAL B 1 113 ? -7.629  -77.477 -31.681 1.00 40.46  ? 114 VAL B CA  1 
ATOM   5060 C C   . VAL B 1 113 ? -7.070  -76.489 -30.662 1.00 37.87  ? 114 VAL B C   1 
ATOM   5061 O O   . VAL B 1 113 ? -7.826  -75.754 -30.037 1.00 43.32  ? 114 VAL B O   1 
ATOM   5062 C CB  . VAL B 1 113 ? -8.300  -76.674 -32.818 1.00 39.69  ? 114 VAL B CB  1 
ATOM   5063 C CG1 . VAL B 1 113 ? -7.292  -75.736 -33.473 1.00 32.54  ? 114 VAL B CG1 1 
ATOM   5064 C CG2 . VAL B 1 113 ? -8.908  -77.614 -33.844 1.00 37.10  ? 114 VAL B CG2 1 
ATOM   5065 N N   . LEU B 1 114 ? -5.748  -76.475 -30.504 1.00 40.42  ? 115 LEU B N   1 
ATOM   5066 C CA  . LEU B 1 114 ? -5.062  -75.424 -29.746 1.00 39.94  ? 115 LEU B CA  1 
ATOM   5067 C C   . LEU B 1 114 ? -4.517  -74.331 -30.671 1.00 39.51  ? 115 LEU B C   1 
ATOM   5068 O O   . LEU B 1 114 ? -3.722  -74.605 -31.575 1.00 35.29  ? 115 LEU B O   1 
ATOM   5069 C CB  . LEU B 1 114 ? -3.912  -76.002 -28.924 1.00 40.65  ? 115 LEU B CB  1 
ATOM   5070 C CG  . LEU B 1 114 ? -4.200  -76.708 -27.607 1.00 35.73  ? 115 LEU B CG  1 
ATOM   5071 C CD1 . LEU B 1 114 ? -2.987  -77.528 -27.201 1.00 38.81  ? 115 LEU B CD1 1 
ATOM   5072 C CD2 . LEU B 1 114 ? -4.507  -75.682 -26.554 1.00 37.30  ? 115 LEU B CD2 1 
ATOM   5073 N N   . VAL B 1 115 ? -4.937  -73.093 -30.432 1.00 36.94  ? 116 VAL B N   1 
ATOM   5074 C CA  . VAL B 1 115 ? -4.473  -71.957 -31.212 1.00 29.02  ? 116 VAL B CA  1 
ATOM   5075 C C   . VAL B 1 115 ? -3.584  -71.062 -30.361 1.00 35.81  ? 116 VAL B C   1 
ATOM   5076 O O   . VAL B 1 115 ? -4.006  -70.585 -29.315 1.00 39.67  ? 116 VAL B O   1 
ATOM   5077 C CB  . VAL B 1 115 ? -5.643  -71.138 -31.748 1.00 35.58  ? 116 VAL B CB  1 
ATOM   5078 C CG1 . VAL B 1 115 ? -5.141  -70.031 -32.660 1.00 29.77  ? 116 VAL B CG1 1 
ATOM   5079 C CG2 . VAL B 1 115 ? -6.622  -72.045 -32.468 1.00 31.48  ? 116 VAL B CG2 1 
ATOM   5080 N N   . TRP B 1 116 ? -2.357  -70.832 -30.818 1.00 34.72  ? 117 TRP B N   1 
ATOM   5081 C CA  . TRP B 1 116 ? -1.355  -70.125 -30.029 1.00 30.80  ? 117 TRP B CA  1 
ATOM   5082 C C   . TRP B 1 116 ? -1.167  -68.693 -30.467 1.00 31.47  ? 117 TRP B C   1 
ATOM   5083 O O   . TRP B 1 116 ? -0.996  -68.436 -31.660 1.00 34.18  ? 117 TRP B O   1 
ATOM   5084 C CB  . TRP B 1 116 ? -0.009  -70.845 -30.113 1.00 28.07  ? 117 TRP B CB  1 
ATOM   5085 C CG  . TRP B 1 116 ? 1.141   -70.067 -29.508 1.00 31.18  ? 117 TRP B CG  1 
ATOM   5086 C CD1 . TRP B 1 116 ? 2.140   -69.407 -30.180 1.00 28.04  ? 117 TRP B CD1 1 
ATOM   5087 C CD2 . TRP B 1 116 ? 1.406   -69.879 -28.115 1.00 29.76  ? 117 TRP B CD2 1 
ATOM   5088 N NE1 . TRP B 1 116 ? 3.012   -68.816 -29.287 1.00 24.76  ? 117 TRP B NE1 1 
ATOM   5089 C CE2 . TRP B 1 116 ? 2.588   -69.096 -28.013 1.00 33.02  ? 117 TRP B CE2 1 
ATOM   5090 C CE3 . TRP B 1 116 ? 0.767   -70.298 -26.941 1.00 25.50  ? 117 TRP B CE3 1 
ATOM   5091 C CZ2 . TRP B 1 116 ? 3.138   -68.726 -26.784 1.00 27.00  ? 117 TRP B CZ2 1 
ATOM   5092 C CZ3 . TRP B 1 116 ? 1.314   -69.935 -25.720 1.00 31.44  ? 117 TRP B CZ3 1 
ATOM   5093 C CH2 . TRP B 1 116 ? 2.487   -69.150 -25.651 1.00 33.25  ? 117 TRP B CH2 1 
ATOM   5094 N N   . ILE B 1 117 ? -1.159  -67.764 -29.507 1.00 27.63  ? 118 ILE B N   1 
ATOM   5095 C CA  . ILE B 1 117 ? -0.852  -66.365 -29.814 1.00 30.73  ? 118 ILE B CA  1 
ATOM   5096 C C   . ILE B 1 117 ? 0.389   -65.920 -29.046 1.00 31.17  ? 118 ILE B C   1 
ATOM   5097 O O   . ILE B 1 117 ? 0.392   -65.882 -27.815 1.00 29.82  ? 118 ILE B O   1 
ATOM   5098 C CB  . ILE B 1 117 ? -2.039  -65.409 -29.484 1.00 34.06  ? 118 ILE B CB  1 
ATOM   5099 C CG1 . ILE B 1 117 ? -3.335  -65.887 -30.139 1.00 26.52  ? 118 ILE B CG1 1 
ATOM   5100 C CG2 . ILE B 1 117 ? -1.739  -63.989 -29.940 1.00 24.38  ? 118 ILE B CG2 1 
ATOM   5101 C CD1 . ILE B 1 117 ? -4.507  -64.983 -29.869 1.00 23.24  ? 118 ILE B CD1 1 
ATOM   5102 N N   . TYR B 1 118 ? 1.448   -65.570 -29.766 1.00 27.52  ? 119 TYR B N   1 
ATOM   5103 C CA  . TYR B 1 118 ? 2.690   -65.224 -29.085 1.00 31.20  ? 119 TYR B CA  1 
ATOM   5104 C C   . TYR B 1 118 ? 2.611   -63.870 -28.402 1.00 31.18  ? 119 TYR B C   1 
ATOM   5105 O O   . TYR B 1 118 ? 1.763   -63.042 -28.744 1.00 31.94  ? 119 TYR B O   1 
ATOM   5106 C CB  . TYR B 1 118 ? 3.873   -65.242 -30.052 1.00 33.94  ? 119 TYR B CB  1 
ATOM   5107 C CG  . TYR B 1 118 ? 3.737   -64.328 -31.250 1.00 35.22  ? 119 TYR B CG  1 
ATOM   5108 C CD1 . TYR B 1 118 ? 3.904   -62.946 -31.130 1.00 27.06  ? 119 TYR B CD1 1 
ATOM   5109 C CD2 . TYR B 1 118 ? 3.484   -64.853 -32.513 1.00 26.45  ? 119 TYR B CD2 1 
ATOM   5110 C CE1 . TYR B 1 118 ? 3.789   -62.117 -32.234 1.00 32.62  ? 119 TYR B CE1 1 
ATOM   5111 C CE2 . TYR B 1 118 ? 3.379   -64.033 -33.624 1.00 30.57  ? 119 TYR B CE2 1 
ATOM   5112 C CZ  . TYR B 1 118 ? 3.524   -62.672 -33.481 1.00 32.73  ? 119 TYR B CZ  1 
ATOM   5113 O OH  . TYR B 1 118 ? 3.408   -61.874 -34.594 1.00 30.64  ? 119 TYR B OH  1 
ATOM   5114 N N   . GLY B 1 119 ? 3.512   -63.663 -27.441 1.00 34.51  ? 120 GLY B N   1 
ATOM   5115 C CA  . GLY B 1 119 ? 3.638   -62.404 -26.729 1.00 24.70  ? 120 GLY B CA  1 
ATOM   5116 C C   . GLY B 1 119 ? 4.822   -61.624 -27.281 1.00 34.98  ? 120 GLY B C   1 
ATOM   5117 O O   . GLY B 1 119 ? 5.323   -61.920 -28.369 1.00 34.81  ? 120 GLY B O   1 
ATOM   5118 N N   . GLY B 1 120 ? 5.276   -60.622 -26.541 1.00 33.65  ? 121 GLY B N   1 
ATOM   5119 C CA  . GLY B 1 120 ? 6.320   -59.757 -27.039 1.00 27.48  ? 121 GLY B CA  1 
ATOM   5120 C C   . GLY B 1 120 ? 5.952   -58.298 -26.884 1.00 40.55  ? 121 GLY B C   1 
ATOM   5121 O O   . GLY B 1 120 ? 6.459   -57.461 -27.642 1.00 35.54  ? 121 GLY B O   1 
ATOM   5122 N N   . GLY B 1 121 ? 5.072   -58.007 -25.916 1.00 34.60  ? 122 GLY B N   1 
ATOM   5123 C CA  . GLY B 1 121 ? 4.655   -56.649 -25.574 1.00 33.06  ? 122 GLY B CA  1 
ATOM   5124 C C   . GLY B 1 121 ? 3.941   -55.830 -26.648 1.00 43.82  ? 122 GLY B C   1 
ATOM   5125 O O   . GLY B 1 121 ? 3.860   -54.600 -26.552 1.00 41.81  ? 122 GLY B O   1 
ATOM   5126 N N   . PHE B 1 122 ? 3.425   -56.519 -27.663 1.00 37.54  ? 123 PHE B N   1 
ATOM   5127 C CA  . PHE B 1 122 ? 2.854   -55.901 -28.866 1.00 36.43  ? 123 PHE B CA  1 
ATOM   5128 C C   . PHE B 1 122 ? 3.902   -55.144 -29.700 1.00 34.29  ? 123 PHE B C   1 
ATOM   5129 O O   . PHE B 1 122 ? 3.563   -54.503 -30.693 1.00 36.76  ? 123 PHE B O   1 
ATOM   5130 C CB  . PHE B 1 122 ? 1.691   -54.967 -28.508 1.00 29.65  ? 123 PHE B CB  1 
ATOM   5131 C CG  . PHE B 1 122 ? 0.534   -55.661 -27.854 1.00 29.65  ? 123 PHE B CG  1 
ATOM   5132 C CD1 . PHE B 1 122 ? -0.304  -56.485 -28.594 1.00 26.98  ? 123 PHE B CD1 1 
ATOM   5133 C CD2 . PHE B 1 122 ? 0.273   -55.484 -26.502 1.00 27.74  ? 123 PHE B CD2 1 
ATOM   5134 C CE1 . PHE B 1 122 ? -1.379  -57.132 -27.995 1.00 27.33  ? 123 PHE B CE1 1 
ATOM   5135 C CE2 . PHE B 1 122 ? -0.804  -56.114 -25.894 1.00 27.58  ? 123 PHE B CE2 1 
ATOM   5136 C CZ  . PHE B 1 122 ? -1.635  -56.942 -26.644 1.00 31.49  ? 123 PHE B CZ  1 
ATOM   5137 N N   . TYR B 1 123 ? 5.174   -55.236 -29.330 1.00 32.64  ? 124 TYR B N   1 
ATOM   5138 C CA  . TYR B 1 123 ? 6.216   -54.619 -30.149 1.00 37.43  ? 124 TYR B CA  1 
ATOM   5139 C C   . TYR B 1 123 ? 7.114   -55.650 -30.847 1.00 36.95  ? 124 TYR B C   1 
ATOM   5140 O O   . TYR B 1 123 ? 7.977   -55.290 -31.652 1.00 41.62  ? 124 TYR B O   1 
ATOM   5141 C CB  . TYR B 1 123 ? 7.070   -53.664 -29.304 1.00 32.78  ? 124 TYR B CB  1 
ATOM   5142 C CG  . TYR B 1 123 ? 7.759   -54.299 -28.123 1.00 36.34  ? 124 TYR B CG  1 
ATOM   5143 C CD1 . TYR B 1 123 ? 8.977   -54.944 -28.277 1.00 33.04  ? 124 TYR B CD1 1 
ATOM   5144 C CD2 . TYR B 1 123 ? 7.199   -54.241 -26.847 1.00 37.45  ? 124 TYR B CD2 1 
ATOM   5145 C CE1 . TYR B 1 123 ? 9.622   -55.528 -27.199 1.00 39.14  ? 124 TYR B CE1 1 
ATOM   5146 C CE2 . TYR B 1 123 ? 7.836   -54.822 -25.755 1.00 42.57  ? 124 TYR B CE2 1 
ATOM   5147 C CZ  . TYR B 1 123 ? 9.052   -55.468 -25.942 1.00 49.32  ? 124 TYR B CZ  1 
ATOM   5148 O OH  . TYR B 1 123 ? 9.705   -56.061 -24.879 1.00 49.78  ? 124 TYR B OH  1 
ATOM   5149 N N   . SER B 1 124 ? 6.905   -56.928 -30.550 1.00 33.08  ? 125 SER B N   1 
ATOM   5150 C CA  . SER B 1 124 ? 7.810   -57.965 -31.028 1.00 32.01  ? 125 SER B CA  1 
ATOM   5151 C C   . SER B 1 124 ? 7.147   -59.328 -30.995 1.00 37.27  ? 125 SER B C   1 
ATOM   5152 O O   . SER B 1 124 ? 6.047   -59.473 -30.456 1.00 35.88  ? 125 SER B O   1 
ATOM   5153 C CB  . SER B 1 124 ? 9.084   -57.997 -30.179 1.00 32.24  ? 125 SER B CB  1 
ATOM   5154 O OG  . SER B 1 124 ? 8.828   -58.527 -28.880 1.00 31.63  ? 125 SER B OG  1 
ATOM   5155 N N   . GLY B 1 125 ? 7.824   -60.326 -31.562 1.00 33.55  ? 126 GLY B N   1 
ATOM   5156 C CA  . GLY B 1 125 ? 7.362   -61.703 -31.482 1.00 25.44  ? 126 GLY B CA  1 
ATOM   5157 C C   . GLY B 1 125 ? 7.192   -62.315 -32.848 1.00 27.39  ? 126 GLY B C   1 
ATOM   5158 O O   . GLY B 1 125 ? 7.165   -61.603 -33.860 1.00 30.46  ? 126 GLY B O   1 
ATOM   5159 N N   . ALA B 1 126 ? 7.080   -63.638 -32.884 1.00 28.92  ? 127 ALA B N   1 
ATOM   5160 C CA  . ALA B 1 126 ? 6.908   -64.372 -34.145 1.00 34.75  ? 127 ALA B CA  1 
ATOM   5161 C C   . ALA B 1 126 ? 6.464   -65.783 -33.843 1.00 35.74  ? 127 ALA B C   1 
ATOM   5162 O O   . ALA B 1 126 ? 6.853   -66.348 -32.809 1.00 34.06  ? 127 ALA B O   1 
ATOM   5163 C CB  . ALA B 1 126 ? 8.187   -64.393 -34.944 1.00 25.94  ? 127 ALA B CB  1 
ATOM   5164 N N   . SER B 1 127 ? 5.665   -66.363 -34.734 1.00 27.85  ? 128 SER B N   1 
ATOM   5165 C CA  . SER B 1 127 ? 5.152   -67.709 -34.487 1.00 37.37  ? 128 SER B CA  1 
ATOM   5166 C C   . SER B 1 127 ? 6.192   -68.765 -34.846 1.00 37.24  ? 128 SER B C   1 
ATOM   5167 O O   . SER B 1 127 ? 5.987   -69.957 -34.617 1.00 41.70  ? 128 SER B O   1 
ATOM   5168 C CB  . SER B 1 127 ? 3.863   -67.953 -35.270 1.00 30.63  ? 128 SER B CB  1 
ATOM   5169 O OG  . SER B 1 127 ? 4.122   -67.954 -36.658 1.00 36.39  ? 128 SER B OG  1 
ATOM   5170 N N   . SER B 1 128 ? 7.315   -68.311 -35.391 1.00 35.99  ? 129 SER B N   1 
ATOM   5171 C CA  . SER B 1 128 ? 8.342   -69.197 -35.916 1.00 30.02  ? 129 SER B CA  1 
ATOM   5172 C C   . SER B 1 128 ? 9.505   -69.437 -34.958 1.00 37.98  ? 129 SER B C   1 
ATOM   5173 O O   . SER B 1 128 ? 10.423  -70.193 -35.273 1.00 38.81  ? 129 SER B O   1 
ATOM   5174 C CB  . SER B 1 128 ? 8.880   -68.637 -37.222 1.00 28.34  ? 129 SER B CB  1 
ATOM   5175 O OG  . SER B 1 128 ? 9.631   -67.468 -37.002 1.00 30.10  ? 129 SER B OG  1 
ATOM   5176 N N   . LEU B 1 129 ? 9.478   -68.784 -33.801 1.00 30.89  ? 130 LEU B N   1 
ATOM   5177 C CA  . LEU B 1 129 ? 10.485  -69.022 -32.778 1.00 34.83  ? 130 LEU B CA  1 
ATOM   5178 C C   . LEU B 1 129 ? 10.540  -70.509 -32.390 1.00 36.39  ? 130 LEU B C   1 
ATOM   5179 O O   . LEU B 1 129 ? 9.494   -71.163 -32.271 1.00 35.32  ? 130 LEU B O   1 
ATOM   5180 C CB  . LEU B 1 129 ? 10.194  -68.164 -31.541 1.00 41.75  ? 130 LEU B CB  1 
ATOM   5181 C CG  . LEU B 1 129 ? 10.207  -66.650 -31.744 1.00 37.47  ? 130 LEU B CG  1 
ATOM   5182 C CD1 . LEU B 1 129 ? 10.083  -65.944 -30.410 1.00 31.81  ? 130 LEU B CD1 1 
ATOM   5183 C CD2 . LEU B 1 129 ? 11.475  -66.225 -32.455 1.00 32.34  ? 130 LEU B CD2 1 
ATOM   5184 N N   . ASP B 1 130 ? 11.754  -71.030 -32.189 1.00 39.71  ? 131 ASP B N   1 
ATOM   5185 C CA  . ASP B 1 130 ? 11.970  -72.466 -31.957 1.00 40.22  ? 131 ASP B CA  1 
ATOM   5186 C C   . ASP B 1 130 ? 11.165  -72.945 -30.771 1.00 34.37  ? 131 ASP B C   1 
ATOM   5187 O O   . ASP B 1 130 ? 10.674  -74.066 -30.745 1.00 40.20  ? 131 ASP B O   1 
ATOM   5188 C CB  . ASP B 1 130 ? 13.454  -72.786 -31.727 1.00 37.23  ? 131 ASP B CB  1 
ATOM   5189 C CG  . ASP B 1 130 ? 14.330  -72.435 -32.922 1.00 59.77  ? 131 ASP B CG  1 
ATOM   5190 O OD1 . ASP B 1 130 ? 13.826  -72.447 -34.073 1.00 59.70  ? 131 ASP B OD1 1 
ATOM   5191 O OD2 . ASP B 1 130 ? 15.529  -72.144 -32.705 1.00 57.88  ? 131 ASP B OD2 1 
ATOM   5192 N N   . VAL B 1 131 ? 11.007  -72.061 -29.800 1.00 40.25  ? 132 VAL B N   1 
ATOM   5193 C CA  . VAL B 1 131 ? 10.385  -72.406 -28.538 1.00 38.14  ? 132 VAL B CA  1 
ATOM   5194 C C   . VAL B 1 131 ? 8.849   -72.513 -28.650 1.00 35.45  ? 132 VAL B C   1 
ATOM   5195 O O   . VAL B 1 131 ? 8.183   -72.925 -27.696 1.00 31.32  ? 132 VAL B O   1 
ATOM   5196 C CB  . VAL B 1 131 ? 10.794  -71.367 -27.466 1.00 37.69  ? 132 VAL B CB  1 
ATOM   5197 C CG1 . VAL B 1 131 ? 10.023  -70.056 -27.653 1.00 32.27  ? 132 VAL B CG1 1 
ATOM   5198 C CG2 . VAL B 1 131 ? 10.637  -71.937 -26.071 1.00 39.60  ? 132 VAL B CG2 1 
ATOM   5199 N N   . TYR B 1 132 ? 8.300   -72.157 -29.816 1.00 37.04  ? 133 TYR B N   1 
ATOM   5200 C CA  . TYR B 1 132 ? 6.858   -72.278 -30.087 1.00 36.90  ? 133 TYR B CA  1 
ATOM   5201 C C   . TYR B 1 132 ? 6.570   -73.427 -31.047 1.00 41.83  ? 133 TYR B C   1 
ATOM   5202 O O   . TYR B 1 132 ? 5.496   -73.479 -31.652 1.00 32.69  ? 133 TYR B O   1 
ATOM   5203 C CB  . TYR B 1 132 ? 6.274   -70.995 -30.700 1.00 36.42  ? 133 TYR B CB  1 
ATOM   5204 C CG  . TYR B 1 132 ? 6.422   -69.735 -29.882 1.00 34.98  ? 133 TYR B CG  1 
ATOM   5205 C CD1 . TYR B 1 132 ? 6.473   -69.780 -28.491 1.00 36.20  ? 133 TYR B CD1 1 
ATOM   5206 C CD2 . TYR B 1 132 ? 6.501   -68.489 -30.508 1.00 30.94  ? 133 TYR B CD2 1 
ATOM   5207 C CE1 . TYR B 1 132 ? 6.609   -68.618 -27.746 1.00 33.79  ? 133 TYR B CE1 1 
ATOM   5208 C CE2 . TYR B 1 132 ? 6.638   -67.323 -29.774 1.00 25.97  ? 133 TYR B CE2 1 
ATOM   5209 C CZ  . TYR B 1 132 ? 6.692   -67.395 -28.397 1.00 30.76  ? 133 TYR B CZ  1 
ATOM   5210 O OH  . TYR B 1 132 ? 6.831   -66.246 -27.670 1.00 29.18  ? 133 TYR B OH  1 
ATOM   5211 N N   . ASP B 1 133 ? 7.535   -74.327 -31.210 1.00 40.52  ? 134 ASP B N   1 
ATOM   5212 C CA  . ASP B 1 133 ? 7.379   -75.442 -32.137 1.00 33.46  ? 134 ASP B CA  1 
ATOM   5213 C C   . ASP B 1 133 ? 6.222   -76.350 -31.722 1.00 40.81  ? 134 ASP B C   1 
ATOM   5214 O O   . ASP B 1 133 ? 6.282   -76.999 -30.670 1.00 39.07  ? 134 ASP B O   1 
ATOM   5215 C CB  . ASP B 1 133 ? 8.676   -76.250 -32.223 1.00 40.62  ? 134 ASP B CB  1 
ATOM   5216 C CG  . ASP B 1 133 ? 8.725   -77.166 -33.444 1.00 48.67  ? 134 ASP B CG  1 
ATOM   5217 O OD1 . ASP B 1 133 ? 7.664   -77.668 -33.895 1.00 36.92  ? 134 ASP B OD1 1 
ATOM   5218 O OD2 . ASP B 1 133 ? 9.846   -77.385 -33.951 1.00 66.29  ? 134 ASP B OD2 1 
ATOM   5219 N N   . GLY B 1 134 ? 5.187   -76.406 -32.562 1.00 35.81  ? 135 GLY B N   1 
ATOM   5220 C CA  . GLY B 1 134 ? 4.002   -77.202 -32.280 1.00 27.09  ? 135 GLY B CA  1 
ATOM   5221 C C   . GLY B 1 134 ? 4.151   -78.718 -32.334 1.00 42.14  ? 135 GLY B C   1 
ATOM   5222 O O   . GLY B 1 134 ? 3.241   -79.437 -31.912 1.00 47.54  ? 135 GLY B O   1 
ATOM   5223 N N   . ARG B 1 135 ? 5.283   -79.220 -32.829 1.00 42.95  ? 136 ARG B N   1 
ATOM   5224 C CA  . ARG B 1 135 ? 5.379   -80.641 -33.191 1.00 43.44  ? 136 ARG B CA  1 
ATOM   5225 C C   . ARG B 1 135 ? 5.252   -81.583 -31.991 1.00 46.02  ? 136 ARG B C   1 
ATOM   5226 O O   . ARG B 1 135 ? 4.613   -82.636 -32.095 1.00 44.89  ? 136 ARG B O   1 
ATOM   5227 C CB  . ARG B 1 135 ? 6.691   -80.930 -33.933 1.00 39.85  ? 136 ARG B CB  1 
ATOM   5228 C CG  . ARG B 1 135 ? 7.910   -81.042 -33.035 1.00 46.86  ? 136 ARG B CG  1 
ATOM   5229 C CD  . ARG B 1 135 ? 9.169   -81.325 -33.809 1.00 43.11  ? 136 ARG B CD  1 
ATOM   5230 N NE  . ARG B 1 135 ? 9.426   -80.306 -34.814 1.00 50.49  ? 136 ARG B NE  1 
ATOM   5231 C CZ  . ARG B 1 135 ? 10.494  -80.289 -35.599 1.00 49.28  ? 136 ARG B CZ  1 
ATOM   5232 N NH1 . ARG B 1 135 ? 11.411  -81.237 -35.486 1.00 57.64  ? 136 ARG B NH1 1 
ATOM   5233 N NH2 . ARG B 1 135 ? 10.645  -79.322 -36.493 1.00 47.83  ? 136 ARG B NH2 1 
ATOM   5234 N N   . PHE B 1 136 ? 5.829   -81.205 -30.854 1.00 39.50  ? 137 PHE B N   1 
ATOM   5235 C CA  . PHE B 1 136 ? 5.847   -82.098 -29.700 1.00 42.97  ? 137 PHE B CA  1 
ATOM   5236 C C   . PHE B 1 136 ? 4.481   -82.163 -29.031 1.00 40.93  ? 137 PHE B C   1 
ATOM   5237 O O   . PHE B 1 136 ? 4.068   -83.214 -28.549 1.00 43.62  ? 137 PHE B O   1 
ATOM   5238 C CB  . PHE B 1 136 ? 6.909   -81.662 -28.703 1.00 33.85  ? 137 PHE B CB  1 
ATOM   5239 C CG  . PHE B 1 136 ? 8.241   -81.402 -29.330 1.00 42.14  ? 137 PHE B CG  1 
ATOM   5240 C CD1 . PHE B 1 136 ? 8.674   -80.112 -29.558 1.00 40.91  ? 137 PHE B CD1 1 
ATOM   5241 C CD2 . PHE B 1 136 ? 9.054   -82.450 -29.711 1.00 46.36  ? 137 PHE B CD2 1 
ATOM   5242 C CE1 . PHE B 1 136 ? 9.907   -79.873 -30.140 1.00 45.05  ? 137 PHE B CE1 1 
ATOM   5243 C CE2 . PHE B 1 136 ? 10.285  -82.218 -30.289 1.00 45.04  ? 137 PHE B CE2 1 
ATOM   5244 C CZ  . PHE B 1 136 ? 10.712  -80.928 -30.506 1.00 42.70  ? 137 PHE B CZ  1 
ATOM   5245 N N   . LEU B 1 137 ? 3.769   -81.046 -29.017 1.00 35.16  ? 138 LEU B N   1 
ATOM   5246 C CA  . LEU B 1 137 ? 2.447   -81.030 -28.416 1.00 44.63  ? 138 LEU B CA  1 
ATOM   5247 C C   . LEU B 1 137 ? 1.513   -81.919 -29.219 1.00 49.71  ? 138 LEU B C   1 
ATOM   5248 O O   . LEU B 1 137 ? 0.707   -82.671 -28.657 1.00 44.44  ? 138 LEU B O   1 
ATOM   5249 C CB  . LEU B 1 137 ? 1.896   -79.608 -28.349 1.00 40.19  ? 138 LEU B CB  1 
ATOM   5250 C CG  . LEU B 1 137 ? 1.649   -79.078 -26.947 1.00 44.49  ? 138 LEU B CG  1 
ATOM   5251 C CD1 . LEU B 1 137 ? 1.310   -77.597 -27.012 1.00 47.31  ? 138 LEU B CD1 1 
ATOM   5252 C CD2 . LEU B 1 137 ? 0.537   -79.863 -26.289 1.00 43.44  ? 138 LEU B CD2 1 
ATOM   5253 N N   . VAL B 1 138 ? 1.635   -81.826 -30.541 1.00 47.35  ? 139 VAL B N   1 
ATOM   5254 C CA  . VAL B 1 138 ? 0.758   -82.561 -31.441 1.00 50.82  ? 139 VAL B CA  1 
ATOM   5255 C C   . VAL B 1 138 ? 1.024   -84.067 -31.390 1.00 50.62  ? 139 VAL B C   1 
ATOM   5256 O O   . VAL B 1 138 ? 0.087   -84.871 -31.320 1.00 40.14  ? 139 VAL B O   1 
ATOM   5257 C CB  . VAL B 1 138 ? 0.904   -82.053 -32.871 1.00 35.55  ? 139 VAL B CB  1 
ATOM   5258 C CG1 . VAL B 1 138 ? 0.225   -82.997 -33.834 1.00 41.88  ? 139 VAL B CG1 1 
ATOM   5259 C CG2 . VAL B 1 138 ? 0.295   -80.676 -32.975 1.00 37.22  ? 139 VAL B CG2 1 
ATOM   5260 N N   . GLN B 1 139 ? 2.300   -84.438 -31.401 1.00 43.22  ? 140 GLN B N   1 
ATOM   5261 C CA  . GLN B 1 139 ? 2.690   -85.839 -31.304 1.00 48.75  ? 140 GLN B CA  1 
ATOM   5262 C C   . GLN B 1 139 ? 2.189   -86.473 -30.003 1.00 54.01  ? 140 GLN B C   1 
ATOM   5263 O O   . GLN B 1 139 ? 1.532   -87.519 -30.020 1.00 53.57  ? 140 GLN B O   1 
ATOM   5264 C CB  . GLN B 1 139 ? 4.215   -85.969 -31.405 1.00 55.64  ? 140 GLN B CB  1 
ATOM   5265 C CG  . GLN B 1 139 ? 4.715   -87.339 -31.861 1.00 62.25  ? 140 GLN B CG  1 
ATOM   5266 C CD  . GLN B 1 139 ? 4.590   -88.415 -30.791 1.00 73.12  ? 140 GLN B CD  1 
ATOM   5267 O OE1 . GLN B 1 139 ? 4.896   -88.180 -29.616 1.00 70.82  ? 140 GLN B OE1 1 
ATOM   5268 N NE2 . GLN B 1 139 ? 4.127   -89.603 -31.192 1.00 68.34  ? 140 GLN B NE2 1 
ATOM   5269 N N   . ALA B 1 140 ? 2.495   -85.816 -28.885 1.00 52.76  ? 141 ALA B N   1 
ATOM   5270 C CA  . ALA B 1 140 ? 2.258   -86.364 -27.549 1.00 45.72  ? 141 ALA B CA  1 
ATOM   5271 C C   . ALA B 1 140 ? 0.795   -86.383 -27.127 1.00 38.10  ? 141 ALA B C   1 
ATOM   5272 O O   . ALA B 1 140 ? 0.392   -87.208 -26.316 1.00 43.81  ? 141 ALA B O   1 
ATOM   5273 C CB  . ALA B 1 140 ? 3.067   -85.588 -26.522 1.00 38.74  ? 141 ALA B CB  1 
ATOM   5274 N N   . GLU B 1 141 ? -0.009  -85.480 -27.663 1.00 46.73  ? 142 GLU B N   1 
ATOM   5275 C CA  . GLU B 1 141 ? -1.349  -85.325 -27.125 1.00 43.85  ? 142 GLU B CA  1 
ATOM   5276 C C   . GLU B 1 141 ? -2.420  -85.427 -28.185 1.00 46.16  ? 142 GLU B C   1 
ATOM   5277 O O   . GLU B 1 141 ? -3.612  -85.361 -27.867 1.00 48.23  ? 142 GLU B O   1 
ATOM   5278 C CB  . GLU B 1 141 ? -1.463  -83.991 -26.383 1.00 47.31  ? 142 GLU B CB  1 
ATOM   5279 C CG  . GLU B 1 141 ? -0.775  -83.999 -25.027 1.00 37.55  ? 142 GLU B CG  1 
ATOM   5280 C CD  . GLU B 1 141 ? -1.392  -85.012 -24.065 1.00 51.17  ? 142 GLU B CD  1 
ATOM   5281 O OE1 . GLU B 1 141 ? -2.635  -85.211 -24.110 1.00 46.14  ? 142 GLU B OE1 1 
ATOM   5282 O OE2 . GLU B 1 141 ? -0.631  -85.612 -23.265 1.00 46.26  ? 142 GLU B OE2 1 
ATOM   5283 N N   . ARG B 1 142 ? -1.991  -85.603 -29.434 1.00 48.04  ? 143 ARG B N   1 
ATOM   5284 C CA  . ARG B 1 142 ? -2.907  -85.808 -30.556 1.00 47.74  ? 143 ARG B CA  1 
ATOM   5285 C C   . ARG B 1 142 ? -3.924  -84.694 -30.642 1.00 40.55  ? 143 ARG B C   1 
ATOM   5286 O O   . ARG B 1 142 ? -5.119  -84.927 -30.526 1.00 55.00  ? 143 ARG B O   1 
ATOM   5287 C CB  . ARG B 1 142 ? -3.636  -87.156 -30.446 1.00 50.04  ? 143 ARG B CB  1 
ATOM   5288 C CG  . ARG B 1 142 ? -2.736  -88.376 -30.586 1.00 59.77  ? 143 ARG B CG  1 
ATOM   5289 C CD  . ARG B 1 142 ? -3.546  -89.609 -30.990 1.00 77.53  ? 143 ARG B CD  1 
ATOM   5290 N NE  . ARG B 1 142 ? -4.202  -89.432 -32.287 1.00 80.96  ? 143 ARG B NE  1 
ATOM   5291 C CZ  . ARG B 1 142 ? -3.615  -89.662 -33.461 1.00 82.24  ? 143 ARG B CZ  1 
ATOM   5292 N NH1 . ARG B 1 142 ? -2.352  -90.080 -33.502 1.00 74.34  ? 143 ARG B NH1 1 
ATOM   5293 N NH2 . ARG B 1 142 ? -4.289  -89.472 -34.597 1.00 71.84  ? 143 ARG B NH2 1 
ATOM   5294 N N   . THR B 1 143 ? -3.441  -83.477 -30.812 1.00 41.93  ? 144 THR B N   1 
ATOM   5295 C CA  . THR B 1 143 ? -4.318  -82.343 -31.027 1.00 41.30  ? 144 THR B CA  1 
ATOM   5296 C C   . THR B 1 143 ? -3.868  -81.677 -32.299 1.00 44.83  ? 144 THR B C   1 
ATOM   5297 O O   . THR B 1 143 ? -2.775  -81.953 -32.796 1.00 44.65  ? 144 THR B O   1 
ATOM   5298 C CB  . THR B 1 143 ? -4.271  -81.328 -29.858 1.00 47.65  ? 144 THR B CB  1 
ATOM   5299 O OG1 . THR B 1 143 ? -2.927  -81.212 -29.382 1.00 48.21  ? 144 THR B OG1 1 
ATOM   5300 C CG2 . THR B 1 143 ? -5.139  -81.788 -28.712 1.00 53.93  ? 144 THR B CG2 1 
ATOM   5301 N N   . VAL B 1 144 ? -4.703  -80.806 -32.837 1.00 48.59  ? 145 VAL B N   1 
ATOM   5302 C CA  . VAL B 1 144 ? -4.239  -79.923 -33.887 1.00 40.98  ? 145 VAL B CA  1 
ATOM   5303 C C   . VAL B 1 144 ? -3.738  -78.642 -33.232 1.00 43.45  ? 145 VAL B C   1 
ATOM   5304 O O   . VAL B 1 144 ? -4.411  -78.074 -32.367 1.00 40.09  ? 145 VAL B O   1 
ATOM   5305 C CB  . VAL B 1 144 ? -5.337  -79.605 -34.901 1.00 40.18  ? 145 VAL B CB  1 
ATOM   5306 C CG1 . VAL B 1 144 ? -4.788  -78.697 -35.986 1.00 39.49  ? 145 VAL B CG1 1 
ATOM   5307 C CG2 . VAL B 1 144 ? -5.886  -80.887 -35.497 1.00 47.98  ? 145 VAL B CG2 1 
ATOM   5308 N N   . LEU B 1 145 ? -2.546  -78.202 -33.616 1.00 37.94  ? 146 LEU B N   1 
ATOM   5309 C CA  . LEU B 1 145 ? -2.031  -76.948 -33.107 1.00 33.99  ? 146 LEU B CA  1 
ATOM   5310 C C   . LEU B 1 145 ? -1.927  -75.930 -34.228 1.00 35.29  ? 146 LEU B C   1 
ATOM   5311 O O   . LEU B 1 145 ? -1.446  -76.244 -35.310 1.00 41.13  ? 146 LEU B O   1 
ATOM   5312 C CB  . LEU B 1 145 ? -0.677  -77.152 -32.430 1.00 37.07  ? 146 LEU B CB  1 
ATOM   5313 C CG  . LEU B 1 145 ? -0.232  -75.957 -31.579 1.00 34.47  ? 146 LEU B CG  1 
ATOM   5314 C CD1 . LEU B 1 145 ? 0.373   -76.431 -30.302 1.00 40.98  ? 146 LEU B CD1 1 
ATOM   5315 C CD2 . LEU B 1 145 ? 0.781   -75.126 -32.323 1.00 49.04  ? 146 LEU B CD2 1 
ATOM   5316 N N   . VAL B 1 146 ? -2.394  -74.713 -33.962 1.00 36.18  ? 147 VAL B N   1 
ATOM   5317 C CA  . VAL B 1 146 ? -2.330  -73.614 -34.928 1.00 37.75  ? 147 VAL B CA  1 
ATOM   5318 C C   . VAL B 1 146 ? -1.664  -72.397 -34.300 1.00 34.84  ? 147 VAL B C   1 
ATOM   5319 O O   . VAL B 1 146 ? -1.973  -72.037 -33.169 1.00 33.95  ? 147 VAL B O   1 
ATOM   5320 C CB  . VAL B 1 146 ? -3.743  -73.193 -35.429 1.00 33.47  ? 147 VAL B CB  1 
ATOM   5321 C CG1 . VAL B 1 146 ? -3.642  -72.162 -36.545 1.00 22.86  ? 147 VAL B CG1 1 
ATOM   5322 C CG2 . VAL B 1 146 ? -4.522  -74.391 -35.882 1.00 36.90  ? 147 VAL B CG2 1 
ATOM   5323 N N   . SER B 1 147 ? -0.752  -71.763 -35.026 1.00 34.90  ? 148 SER B N   1 
ATOM   5324 C CA  . SER B 1 147 ? -0.232  -70.468 -34.603 1.00 32.10  ? 148 SER B CA  1 
ATOM   5325 C C   . SER B 1 147 ? -0.236  -69.508 -35.781 1.00 33.33  ? 148 SER B C   1 
ATOM   5326 O O   . SER B 1 147 ? -0.056  -69.927 -36.925 1.00 34.04  ? 148 SER B O   1 
ATOM   5327 C CB  . SER B 1 147 ? 1.176   -70.595 -34.013 1.00 28.13  ? 148 SER B CB  1 
ATOM   5328 O OG  . SER B 1 147 ? 2.123   -71.010 -34.983 1.00 32.84  ? 148 SER B OG  1 
ATOM   5329 N N   . MET B 1 148 ? -0.456  -68.226 -35.503 1.00 33.41  ? 149 MET B N   1 
ATOM   5330 C CA  . MET B 1 148 ? -0.421  -67.212 -36.549 1.00 32.40  ? 149 MET B CA  1 
ATOM   5331 C C   . MET B 1 148 ? 0.592   -66.106 -36.258 1.00 34.62  ? 149 MET B C   1 
ATOM   5332 O O   . MET B 1 148 ? 0.968   -65.870 -35.113 1.00 33.42  ? 149 MET B O   1 
ATOM   5333 C CB  . MET B 1 148 ? -1.810  -66.596 -36.739 1.00 29.09  ? 149 MET B CB  1 
ATOM   5334 C CG  . MET B 1 148 ? -2.128  -65.457 -35.789 1.00 31.86  ? 149 MET B CG  1 
ATOM   5335 S SD  . MET B 1 148 ? -2.211  -65.957 -34.056 1.00 37.00  ? 149 MET B SD  1 
ATOM   5336 C CE  . MET B 1 148 ? -3.753  -66.860 -34.030 1.00 31.44  ? 149 MET B CE  1 
ATOM   5337 N N   . ASN B 1 149 ? 1.037   -65.422 -37.301 1.00 34.04  ? 150 ASN B N   1 
ATOM   5338 C CA  . ASN B 1 149 ? 1.715   -64.148 -37.104 1.00 31.30  ? 150 ASN B CA  1 
ATOM   5339 C C   . ASN B 1 149 ? 0.677   -63.037 -37.078 1.00 35.77  ? 150 ASN B C   1 
ATOM   5340 O O   . ASN B 1 149 ? -0.404  -63.184 -37.644 1.00 32.92  ? 150 ASN B O   1 
ATOM   5341 C CB  . ASN B 1 149 ? 2.742   -63.887 -38.200 1.00 27.25  ? 150 ASN B CB  1 
ATOM   5342 C CG  . ASN B 1 149 ? 4.068   -64.540 -37.919 1.00 28.03  ? 150 ASN B CG  1 
ATOM   5343 O OD1 . ASN B 1 149 ? 4.211   -65.311 -36.973 1.00 39.25  ? 150 ASN B OD1 1 
ATOM   5344 N ND2 . ASN B 1 149 ? 5.052   -64.231 -38.734 1.00 37.24  ? 150 ASN B ND2 1 
ATOM   5345 N N   . TYR B 1 150 ? 0.990   -61.943 -36.392 1.00 32.16  ? 151 TYR B N   1 
ATOM   5346 C CA  . TYR B 1 150 ? 0.136   -60.764 -36.400 1.00 28.62  ? 151 TYR B CA  1 
ATOM   5347 C C   . TYR B 1 150 ? 1.038   -59.552 -36.306 1.00 31.41  ? 151 TYR B C   1 
ATOM   5348 O O   . TYR B 1 150 ? 2.118   -59.626 -35.722 1.00 27.63  ? 151 TYR B O   1 
ATOM   5349 C CB  . TYR B 1 150 ? -0.885  -60.786 -35.253 1.00 29.04  ? 151 TYR B CB  1 
ATOM   5350 C CG  . TYR B 1 150 ? -0.284  -60.729 -33.868 1.00 28.20  ? 151 TYR B CG  1 
ATOM   5351 C CD1 . TYR B 1 150 ? 0.004   -61.893 -33.174 1.00 24.75  ? 151 TYR B CD1 1 
ATOM   5352 C CD2 . TYR B 1 150 ? -0.010  -59.513 -33.252 1.00 29.38  ? 151 TYR B CD2 1 
ATOM   5353 C CE1 . TYR B 1 150 ? 0.557   -61.856 -31.909 1.00 28.90  ? 151 TYR B CE1 1 
ATOM   5354 C CE2 . TYR B 1 150 ? 0.546   -59.461 -31.977 1.00 29.60  ? 151 TYR B CE2 1 
ATOM   5355 C CZ  . TYR B 1 150 ? 0.826   -60.639 -31.307 1.00 34.76  ? 151 TYR B CZ  1 
ATOM   5356 O OH  . TYR B 1 150 ? 1.377   -60.604 -30.036 1.00 26.54  ? 151 TYR B OH  1 
ATOM   5357 N N   . ARG B 1 151 ? 0.607   -58.442 -36.893 1.00 30.95  ? 152 ARG B N   1 
ATOM   5358 C CA  . ARG B 1 151 ? 1.452   -57.256 -36.951 1.00 27.59  ? 152 ARG B CA  1 
ATOM   5359 C C   . ARG B 1 151 ? 1.666   -56.674 -35.556 1.00 28.84  ? 152 ARG B C   1 
ATOM   5360 O O   . ARG B 1 151 ? 0.794   -56.784 -34.704 1.00 32.02  ? 152 ARG B O   1 
ATOM   5361 C CB  . ARG B 1 151 ? 0.838   -56.230 -37.898 1.00 26.19  ? 152 ARG B CB  1 
ATOM   5362 C CG  . ARG B 1 151 ? 1.012   -56.599 -39.353 1.00 26.67  ? 152 ARG B CG  1 
ATOM   5363 C CD  . ARG B 1 151 ? 0.216   -55.687 -40.265 1.00 34.23  ? 152 ARG B CD  1 
ATOM   5364 N NE  . ARG B 1 151 ? -1.187  -56.069 -40.294 1.00 29.32  ? 152 ARG B NE  1 
ATOM   5365 C CZ  . ARG B 1 151 ? -2.157  -55.300 -40.773 1.00 37.37  ? 152 ARG B CZ  1 
ATOM   5366 N NH1 . ARG B 1 151 ? -1.863  -54.093 -41.258 1.00 31.11  ? 152 ARG B NH1 1 
ATOM   5367 N NH2 . ARG B 1 151 ? -3.418  -55.740 -40.756 1.00 31.35  ? 152 ARG B NH2 1 
ATOM   5368 N N   . VAL B 1 152 ? 2.835   -56.087 -35.320 1.00 26.50  ? 153 VAL B N   1 
ATOM   5369 C CA  . VAL B 1 152 ? 3.153   -55.546 -34.005 1.00 25.38  ? 153 VAL B CA  1 
ATOM   5370 C C   . VAL B 1 152 ? 3.683   -54.132 -34.141 1.00 37.25  ? 153 VAL B C   1 
ATOM   5371 O O   . VAL B 1 152 ? 3.839   -53.637 -35.263 1.00 36.58  ? 153 VAL B O   1 
ATOM   5372 C CB  . VAL B 1 152 ? 4.194   -56.413 -33.243 1.00 28.88  ? 153 VAL B CB  1 
ATOM   5373 C CG1 . VAL B 1 152 ? 3.602   -57.765 -32.870 1.00 23.73  ? 153 VAL B CG1 1 
ATOM   5374 C CG2 . VAL B 1 152 ? 5.482   -56.573 -34.050 1.00 27.42  ? 153 VAL B CG2 1 
ATOM   5375 N N   . GLY B 1 153 ? 3.962   -53.492 -33.001 1.00 38.58  ? 154 GLY B N   1 
ATOM   5376 C CA  . GLY B 1 153 ? 4.450   -52.121 -32.976 1.00 32.91  ? 154 GLY B CA  1 
ATOM   5377 C C   . GLY B 1 153 ? 3.559   -51.195 -33.788 1.00 40.74  ? 154 GLY B C   1 
ATOM   5378 O O   . GLY B 1 153 ? 2.333   -51.358 -33.804 1.00 40.61  ? 154 GLY B O   1 
ATOM   5379 N N   . ALA B 1 154 ? 4.170   -50.243 -34.486 1.00 38.66  ? 155 ALA B N   1 
ATOM   5380 C CA  . ALA B 1 154 ? 3.414   -49.265 -35.260 1.00 39.17  ? 155 ALA B CA  1 
ATOM   5381 C C   . ALA B 1 154 ? 2.528   -49.919 -36.311 1.00 39.19  ? 155 ALA B C   1 
ATOM   5382 O O   . ALA B 1 154 ? 1.401   -49.495 -36.534 1.00 51.33  ? 155 ALA B O   1 
ATOM   5383 C CB  . ALA B 1 154 ? 4.350   -48.277 -35.913 1.00 42.71  ? 155 ALA B CB  1 
ATOM   5384 N N   . PHE B 1 155 ? 3.033   -50.969 -36.940 1.00 37.12  ? 156 PHE B N   1 
ATOM   5385 C CA  . PHE B 1 155 ? 2.313   -51.616 -38.024 1.00 31.44  ? 156 PHE B CA  1 
ATOM   5386 C C   . PHE B 1 155 ? 1.030   -52.304 -37.572 1.00 35.81  ? 156 PHE B C   1 
ATOM   5387 O O   . PHE B 1 155 ? 0.089   -52.440 -38.348 1.00 43.78  ? 156 PHE B O   1 
ATOM   5388 C CB  . PHE B 1 155 ? 3.235   -52.611 -38.717 1.00 29.49  ? 156 PHE B CB  1 
ATOM   5389 C CG  . PHE B 1 155 ? 4.507   -51.993 -39.199 1.00 37.97  ? 156 PHE B CG  1 
ATOM   5390 C CD1 . PHE B 1 155 ? 5.658   -52.051 -38.427 1.00 39.27  ? 156 PHE B CD1 1 
ATOM   5391 C CD2 . PHE B 1 155 ? 4.545   -51.323 -40.409 1.00 31.43  ? 156 PHE B CD2 1 
ATOM   5392 C CE1 . PHE B 1 155 ? 6.829   -51.474 -38.865 1.00 41.60  ? 156 PHE B CE1 1 
ATOM   5393 C CE2 . PHE B 1 155 ? 5.712   -50.733 -40.850 1.00 41.86  ? 156 PHE B CE2 1 
ATOM   5394 C CZ  . PHE B 1 155 ? 6.854   -50.806 -40.081 1.00 43.50  ? 156 PHE B CZ  1 
ATOM   5395 N N   . GLY B 1 156 ? 0.984   -52.725 -36.313 1.00 33.15  ? 157 GLY B N   1 
ATOM   5396 C CA  . GLY B 1 156 ? -0.192  -53.396 -35.798 1.00 29.15  ? 157 GLY B CA  1 
ATOM   5397 C C   . GLY B 1 156 ? -1.113  -52.481 -35.010 1.00 32.85  ? 157 GLY B C   1 
ATOM   5398 O O   . GLY B 1 156 ? -2.327  -52.715 -34.925 1.00 25.11  ? 157 GLY B O   1 
ATOM   5399 N N   . PHE B 1 157 ? -0.552  -51.424 -34.440 1.00 25.27  ? 158 PHE B N   1 
ATOM   5400 C CA  . PHE B 1 157 ? -1.273  -50.749 -33.373 1.00 37.15  ? 158 PHE B CA  1 
ATOM   5401 C C   . PHE B 1 157 ? -1.147  -49.238 -33.367 1.00 33.79  ? 158 PHE B C   1 
ATOM   5402 O O   . PHE B 1 157 ? -1.635  -48.584 -32.453 1.00 41.17  ? 158 PHE B O   1 
ATOM   5403 C CB  . PHE B 1 157 ? -0.829  -51.330 -32.019 1.00 30.10  ? 158 PHE B CB  1 
ATOM   5404 C CG  . PHE B 1 157 ? -1.132  -52.789 -31.884 1.00 28.69  ? 158 PHE B CG  1 
ATOM   5405 C CD1 . PHE B 1 157 ? -0.138  -53.738 -32.060 1.00 27.01  ? 158 PHE B CD1 1 
ATOM   5406 C CD2 . PHE B 1 157 ? -2.431  -53.216 -31.653 1.00 26.64  ? 158 PHE B CD2 1 
ATOM   5407 C CE1 . PHE B 1 157 ? -0.430  -55.085 -31.973 1.00 26.01  ? 158 PHE B CE1 1 
ATOM   5408 C CE2 . PHE B 1 157 ? -2.734  -54.567 -31.561 1.00 31.69  ? 158 PHE B CE2 1 
ATOM   5409 C CZ  . PHE B 1 157 ? -1.731  -55.503 -31.715 1.00 32.81  ? 158 PHE B CZ  1 
ATOM   5410 N N   . LEU B 1 158 ? -0.499  -48.672 -34.374 1.00 38.43  ? 159 LEU B N   1 
ATOM   5411 C CA  . LEU B 1 158 ? -0.619  -47.237 -34.547 1.00 48.50  ? 159 LEU B CA  1 
ATOM   5412 C C   . LEU B 1 158 ? -2.095  -46.950 -34.815 1.00 39.09  ? 159 LEU B C   1 
ATOM   5413 O O   . LEU B 1 158 ? -2.721  -47.587 -35.654 1.00 40.47  ? 159 LEU B O   1 
ATOM   5414 C CB  . LEU B 1 158 ? 0.271   -46.721 -35.679 1.00 41.95  ? 159 LEU B CB  1 
ATOM   5415 C CG  . LEU B 1 158 ? 0.180   -45.219 -35.950 1.00 44.97  ? 159 LEU B CG  1 
ATOM   5416 C CD1 . LEU B 1 158 ? 1.552   -44.587 -36.132 1.00 32.50  ? 159 LEU B CD1 1 
ATOM   5417 C CD2 . LEU B 1 158 ? -0.689  -44.978 -37.166 1.00 40.36  ? 159 LEU B CD2 1 
ATOM   5418 N N   . ALA B 1 159 ? -2.664  -46.021 -34.066 1.00 45.60  ? 160 ALA B N   1 
ATOM   5419 C CA  . ALA B 1 159 ? -4.057  -45.671 -34.271 1.00 41.69  ? 160 ALA B CA  1 
ATOM   5420 C C   . ALA B 1 159 ? -4.233  -44.168 -34.403 1.00 41.12  ? 160 ALA B C   1 
ATOM   5421 O O   . ALA B 1 159 ? -3.647  -43.387 -33.653 1.00 45.70  ? 160 ALA B O   1 
ATOM   5422 C CB  . ALA B 1 159 ? -4.903  -46.200 -33.145 1.00 39.10  ? 160 ALA B CB  1 
ATOM   5423 N N   . LEU B 1 160 ? -5.019  -43.776 -35.395 1.00 44.20  ? 161 LEU B N   1 
ATOM   5424 C CA  . LEU B 1 160 ? -5.571  -42.432 -35.477 1.00 37.88  ? 161 LEU B CA  1 
ATOM   5425 C C   . LEU B 1 160 ? -7.070  -42.640 -35.444 1.00 39.75  ? 161 LEU B C   1 
ATOM   5426 O O   . LEU B 1 160 ? -7.707  -42.678 -36.496 1.00 37.01  ? 161 LEU B O   1 
ATOM   5427 C CB  . LEU B 1 160 ? -5.121  -41.706 -36.743 1.00 33.69  ? 161 LEU B CB  1 
ATOM   5428 C CG  . LEU B 1 160 ? -3.642  -41.322 -36.767 1.00 33.52  ? 161 LEU B CG  1 
ATOM   5429 C CD1 . LEU B 1 160 ? -3.202  -40.986 -38.159 1.00 45.40  ? 161 LEU B CD1 1 
ATOM   5430 C CD2 . LEU B 1 160 ? -3.369  -40.148 -35.857 1.00 34.63  ? 161 LEU B CD2 1 
ATOM   5431 N N   . PRO B 1 161 ? -7.628  -42.814 -34.229 1.00 43.74  ? 162 PRO B N   1 
ATOM   5432 C CA  . PRO B 1 161 ? -9.008  -43.282 -34.018 1.00 41.33  ? 162 PRO B CA  1 
ATOM   5433 C C   . PRO B 1 161 ? -10.023 -42.438 -34.780 1.00 44.45  ? 162 PRO B C   1 
ATOM   5434 O O   . PRO B 1 161 ? -9.883  -41.214 -34.853 1.00 47.72  ? 162 PRO B O   1 
ATOM   5435 C CB  . PRO B 1 161 ? -9.203  -43.154 -32.498 1.00 41.89  ? 162 PRO B CB  1 
ATOM   5436 C CG  . PRO B 1 161 ? -7.818  -43.172 -31.919 1.00 37.11  ? 162 PRO B CG  1 
ATOM   5437 C CD  . PRO B 1 161 ? -6.960  -42.475 -32.956 1.00 40.47  ? 162 PRO B CD  1 
ATOM   5438 N N   . GLY B 1 162 ? -11.015 -43.095 -35.370 1.00 51.64  ? 163 GLY B N   1 
ATOM   5439 C CA  . GLY B 1 162 ? -12.003 -42.405 -36.177 1.00 43.58  ? 163 GLY B CA  1 
ATOM   5440 C C   . GLY B 1 162 ? -11.683 -42.400 -37.662 1.00 58.27  ? 163 GLY B C   1 
ATOM   5441 O O   . GLY B 1 162 ? -12.591 -42.440 -38.496 1.00 68.98  ? 163 GLY B O   1 
ATOM   5442 N N   . SER B 1 163 ? -10.397 -42.344 -38.002 1.00 51.46  ? 164 SER B N   1 
ATOM   5443 C CA  . SER B 1 163 ? -9.978  -42.401 -39.404 1.00 51.20  ? 164 SER B CA  1 
ATOM   5444 C C   . SER B 1 163 ? -10.135 -43.800 -39.995 1.00 50.37  ? 164 SER B C   1 
ATOM   5445 O O   . SER B 1 163 ? -10.110 -44.798 -39.274 1.00 50.45  ? 164 SER B O   1 
ATOM   5446 C CB  . SER B 1 163 ? -8.529  -41.975 -39.548 1.00 49.45  ? 164 SER B CB  1 
ATOM   5447 O OG  . SER B 1 163 ? -7.692  -43.038 -39.140 1.00 49.68  ? 164 SER B OG  1 
ATOM   5448 N N   . ARG B 1 164 ? -10.283 -43.880 -41.309 1.00 54.03  ? 165 ARG B N   1 
ATOM   5449 C CA  . ARG B 1 164 ? -10.396 -45.184 -41.947 1.00 61.55  ? 165 ARG B CA  1 
ATOM   5450 C C   . ARG B 1 164 ? -9.026  -45.661 -42.425 1.00 56.39  ? 165 ARG B C   1 
ATOM   5451 O O   . ARG B 1 164 ? -8.839  -46.841 -42.716 1.00 47.78  ? 165 ARG B O   1 
ATOM   5452 C CB  . ARG B 1 164 ? -11.392 -45.134 -43.112 1.00 65.65  ? 165 ARG B CB  1 
ATOM   5453 C CG  . ARG B 1 164 ? -11.008 -44.182 -44.241 1.00 75.08  ? 165 ARG B CG  1 
ATOM   5454 C CD  . ARG B 1 164 ? -12.111 -44.090 -45.296 1.00 91.48  ? 165 ARG B CD  1 
ATOM   5455 N NE  . ARG B 1 164 ? -13.297 -43.394 -44.794 1.00 106.44 ? 165 ARG B NE  1 
ATOM   5456 C CZ  . ARG B 1 164 ? -14.464 -43.333 -45.434 1.00 105.45 ? 165 ARG B CZ  1 
ATOM   5457 N NH1 . ARG B 1 164 ? -14.614 -43.938 -46.606 1.00 95.96  ? 165 ARG B NH1 1 
ATOM   5458 N NH2 . ARG B 1 164 ? -15.486 -42.671 -44.898 1.00 97.64  ? 165 ARG B NH2 1 
ATOM   5459 N N   . GLU B 1 165 ? -8.071  -44.738 -42.487 1.00 48.17  ? 166 GLU B N   1 
ATOM   5460 C CA  . GLU B 1 165 ? -6.763  -45.033 -43.041 1.00 47.70  ? 166 GLU B CA  1 
ATOM   5461 C C   . GLU B 1 165 ? -5.810  -45.612 -42.004 1.00 48.12  ? 166 GLU B C   1 
ATOM   5462 O O   . GLU B 1 165 ? -4.775  -46.178 -42.355 1.00 47.61  ? 166 GLU B O   1 
ATOM   5463 C CB  . GLU B 1 165 ? -6.157  -43.773 -43.665 1.00 58.34  ? 166 GLU B CB  1 
ATOM   5464 C CG  . GLU B 1 165 ? -7.000  -43.153 -44.787 1.00 79.97  ? 166 GLU B CG  1 
ATOM   5465 C CD  . GLU B 1 165 ? -7.308  -44.119 -45.949 1.00 92.63  ? 166 GLU B CD  1 
ATOM   5466 O OE1 . GLU B 1 165 ? -6.509  -45.057 -46.201 1.00 65.23  ? 166 GLU B OE1 1 
ATOM   5467 O OE2 . GLU B 1 165 ? -8.361  -43.930 -46.612 1.00 88.41  ? 166 GLU B OE2 1 
ATOM   5468 N N   . ALA B 1 166 ? -6.164  -45.470 -40.730 1.00 50.04  ? 167 ALA B N   1 
ATOM   5469 C CA  . ALA B 1 166 ? -5.379  -46.032 -39.637 1.00 45.42  ? 167 ALA B CA  1 
ATOM   5470 C C   . ALA B 1 166 ? -6.253  -46.253 -38.405 1.00 42.07  ? 167 ALA B C   1 
ATOM   5471 O O   . ALA B 1 166 ? -6.029  -45.635 -37.367 1.00 40.92  ? 167 ALA B O   1 
ATOM   5472 C CB  . ALA B 1 166 ? -4.202  -45.121 -39.301 1.00 36.24  ? 167 ALA B CB  1 
ATOM   5473 N N   . PRO B 1 167 ? -7.240  -47.157 -38.509 1.00 43.49  ? 168 PRO B N   1 
ATOM   5474 C CA  . PRO B 1 167 ? -8.273  -47.329 -37.471 1.00 44.05  ? 168 PRO B CA  1 
ATOM   5475 C C   . PRO B 1 167 ? -7.754  -47.818 -36.114 1.00 38.81  ? 168 PRO B C   1 
ATOM   5476 O O   . PRO B 1 167 ? -8.330  -47.492 -35.076 1.00 50.31  ? 168 PRO B O   1 
ATOM   5477 C CB  . PRO B 1 167 ? -9.226  -48.368 -38.085 1.00 36.60  ? 168 PRO B CB  1 
ATOM   5478 C CG  . PRO B 1 167 ? -8.424  -49.092 -39.090 1.00 42.88  ? 168 PRO B CG  1 
ATOM   5479 C CD  . PRO B 1 167 ? -7.385  -48.128 -39.607 1.00 36.77  ? 168 PRO B CD  1 
ATOM   5480 N N   . GLY B 1 168 ? -6.681  -48.593 -36.121 1.00 47.54  ? 169 GLY B N   1 
ATOM   5481 C CA  . GLY B 1 168 ? -6.130  -49.098 -34.883 1.00 33.39  ? 169 GLY B CA  1 
ATOM   5482 C C   . GLY B 1 168 ? -6.520  -50.542 -34.650 1.00 40.26  ? 169 GLY B C   1 
ATOM   5483 O O   . GLY B 1 168 ? -7.490  -51.041 -35.241 1.00 38.97  ? 169 GLY B O   1 
ATOM   5484 N N   . ASN B 1 169 ? -5.750  -51.202 -33.788 1.00 40.52  ? 170 ASN B N   1 
ATOM   5485 C CA  . ASN B 1 169 ? -5.973  -52.592 -33.428 1.00 31.91  ? 170 ASN B CA  1 
ATOM   5486 C C   . ASN B 1 169 ? -5.897  -53.541 -34.626 1.00 43.22  ? 170 ASN B C   1 
ATOM   5487 O O   . ASN B 1 169 ? -6.553  -54.593 -34.625 1.00 36.41  ? 170 ASN B O   1 
ATOM   5488 C CB  . ASN B 1 169 ? -7.330  -52.746 -32.731 1.00 30.07  ? 170 ASN B CB  1 
ATOM   5489 C CG  . ASN B 1 169 ? -7.420  -51.958 -31.423 1.00 45.61  ? 170 ASN B CG  1 
ATOM   5490 O OD1 . ASN B 1 169 ? -6.422  -51.745 -30.733 1.00 43.19  ? 170 ASN B OD1 1 
ATOM   5491 N ND2 . ASN B 1 169 ? -8.627  -51.533 -31.077 1.00 42.93  ? 170 ASN B ND2 1 
ATOM   5492 N N   . VAL B 1 170 ? -5.112  -53.204 -35.653 1.00 29.59  ? 171 VAL B N   1 
ATOM   5493 C CA  . VAL B 1 170 ? -5.152  -54.066 -36.832 1.00 32.24  ? 171 VAL B CA  1 
ATOM   5494 C C   . VAL B 1 170 ? -4.461  -55.400 -36.513 1.00 36.68  ? 171 VAL B C   1 
ATOM   5495 O O   . VAL B 1 170 ? -4.894  -56.457 -36.991 1.00 30.06  ? 171 VAL B O   1 
ATOM   5496 C CB  . VAL B 1 170 ? -4.547  -53.387 -38.096 1.00 37.69  ? 171 VAL B CB  1 
ATOM   5497 C CG1 . VAL B 1 170 ? -5.353  -52.132 -38.454 1.00 32.07  ? 171 VAL B CG1 1 
ATOM   5498 C CG2 . VAL B 1 170 ? -3.064  -53.081 -37.946 1.00 26.51  ? 171 VAL B CG2 1 
ATOM   5499 N N   . GLY B 1 171 ? -3.435  -55.352 -35.660 1.00 30.90  ? 172 GLY B N   1 
ATOM   5500 C CA  . GLY B 1 171 ? -2.824  -56.554 -35.115 1.00 28.11  ? 172 GLY B CA  1 
ATOM   5501 C C   . GLY B 1 171 ? -3.813  -57.545 -34.509 1.00 34.57  ? 172 GLY B C   1 
ATOM   5502 O O   . GLY B 1 171 ? -3.722  -58.753 -34.747 1.00 35.61  ? 172 GLY B O   1 
ATOM   5503 N N   . LEU B 1 172 ? -4.758  -57.044 -33.717 1.00 34.97  ? 173 LEU B N   1 
ATOM   5504 C CA  . LEU B 1 172 ? -5.795  -57.896 -33.135 1.00 32.94  ? 173 LEU B CA  1 
ATOM   5505 C C   . LEU B 1 172 ? -6.711  -58.438 -34.214 1.00 35.81  ? 173 LEU B C   1 
ATOM   5506 O O   . LEU B 1 172 ? -7.207  -59.564 -34.115 1.00 38.77  ? 173 LEU B O   1 
ATOM   5507 C CB  . LEU B 1 172 ? -6.624  -57.126 -32.101 1.00 41.47  ? 173 LEU B CB  1 
ATOM   5508 C CG  . LEU B 1 172 ? -5.944  -56.769 -30.784 1.00 42.49  ? 173 LEU B CG  1 
ATOM   5509 C CD1 . LEU B 1 172 ? -6.810  -55.804 -30.003 1.00 36.84  ? 173 LEU B CD1 1 
ATOM   5510 C CD2 . LEU B 1 172 ? -5.659  -58.032 -29.987 1.00 31.98  ? 173 LEU B CD2 1 
ATOM   5511 N N   . LEU B 1 173 ? -6.944  -57.625 -35.241 1.00 36.91  ? 174 LEU B N   1 
ATOM   5512 C CA  . LEU B 1 173 ? -7.769  -58.048 -36.366 1.00 37.92  ? 174 LEU B CA  1 
ATOM   5513 C C   . LEU B 1 173 ? -7.057  -59.112 -37.207 1.00 37.86  ? 174 LEU B C   1 
ATOM   5514 O O   . LEU B 1 173 ? -7.702  -60.016 -37.749 1.00 33.70  ? 174 LEU B O   1 
ATOM   5515 C CB  . LEU B 1 173 ? -8.154  -56.845 -37.219 1.00 36.09  ? 174 LEU B CB  1 
ATOM   5516 C CG  . LEU B 1 173 ? -9.190  -55.916 -36.576 1.00 36.93  ? 174 LEU B CG  1 
ATOM   5517 C CD1 . LEU B 1 173 ? -9.439  -54.711 -37.468 1.00 27.34  ? 174 LEU B CD1 1 
ATOM   5518 C CD2 . LEU B 1 173 ? -10.495 -56.676 -36.267 1.00 28.33  ? 174 LEU B CD2 1 
ATOM   5519 N N   . ASP B 1 174 ? -5.731  -59.014 -37.304 1.00 34.53  ? 175 ASP B N   1 
ATOM   5520 C CA  . ASP B 1 174 ? -4.948  -60.092 -37.894 1.00 33.03  ? 175 ASP B CA  1 
ATOM   5521 C C   . ASP B 1 174 ? -5.271  -61.405 -37.175 1.00 37.79  ? 175 ASP B C   1 
ATOM   5522 O O   . ASP B 1 174 ? -5.551  -62.426 -37.817 1.00 38.07  ? 175 ASP B O   1 
ATOM   5523 C CB  . ASP B 1 174 ? -3.446  -59.816 -37.803 1.00 32.54  ? 175 ASP B CB  1 
ATOM   5524 C CG  . ASP B 1 174 ? -3.012  -58.589 -38.591 1.00 37.93  ? 175 ASP B CG  1 
ATOM   5525 O OD1 . ASP B 1 174 ? -3.755  -58.159 -39.504 1.00 35.97  ? 175 ASP B OD1 1 
ATOM   5526 O OD2 . ASP B 1 174 ? -1.904  -58.064 -38.296 1.00 32.35  ? 175 ASP B OD2 1 
ATOM   5527 N N   . GLN B 1 175 ? -5.236  -61.371 -35.841 1.00 29.68  ? 176 GLN B N   1 
ATOM   5528 C CA  . GLN B 1 175 ? -5.507  -62.566 -35.043 1.00 32.96  ? 176 GLN B CA  1 
ATOM   5529 C C   . GLN B 1 175 ? -6.919  -63.064 -35.274 1.00 34.70  ? 176 GLN B C   1 
ATOM   5530 O O   . GLN B 1 175 ? -7.142  -64.271 -35.380 1.00 33.81  ? 176 GLN B O   1 
ATOM   5531 C CB  . GLN B 1 175 ? -5.306  -62.302 -33.556 1.00 31.23  ? 176 GLN B CB  1 
ATOM   5532 C CG  . GLN B 1 175 ? -3.943  -61.782 -33.184 1.00 31.19  ? 176 GLN B CG  1 
ATOM   5533 C CD  . GLN B 1 175 ? -3.876  -61.388 -31.732 1.00 37.57  ? 176 GLN B CD  1 
ATOM   5534 O OE1 . GLN B 1 175 ? -4.806  -61.667 -30.961 1.00 38.46  ? 176 GLN B OE1 1 
ATOM   5535 N NE2 . GLN B 1 175 ? -2.782  -60.726 -31.342 1.00 28.64  ? 176 GLN B NE2 1 
ATOM   5536 N N   . ARG B 1 176 ? -7.871  -62.136 -35.346 1.00 34.65  ? 177 ARG B N   1 
ATOM   5537 C CA  . ARG B 1 176 ? -9.264  -62.515 -35.544 1.00 36.03  ? 177 ARG B CA  1 
ATOM   5538 C C   . ARG B 1 176 ? -9.438  -63.202 -36.890 1.00 38.89  ? 177 ARG B C   1 
ATOM   5539 O O   . ARG B 1 176 ? -10.161 -64.198 -37.006 1.00 38.71  ? 177 ARG B O   1 
ATOM   5540 C CB  . ARG B 1 176 ? -10.189 -61.304 -35.453 1.00 36.13  ? 177 ARG B CB  1 
ATOM   5541 C CG  . ARG B 1 176 ? -11.665 -61.666 -35.657 1.00 41.95  ? 177 ARG B CG  1 
ATOM   5542 C CD  . ARG B 1 176 ? -12.563 -60.450 -35.552 1.00 40.71  ? 177 ARG B CD  1 
ATOM   5543 N NE  . ARG B 1 176 ? -12.798 -60.093 -34.161 1.00 47.05  ? 177 ARG B NE  1 
ATOM   5544 C CZ  . ARG B 1 176 ? -13.273 -58.921 -33.757 1.00 52.72  ? 177 ARG B CZ  1 
ATOM   5545 N NH1 . ARG B 1 176 ? -13.555 -57.974 -34.644 1.00 48.53  ? 177 ARG B NH1 1 
ATOM   5546 N NH2 . ARG B 1 176 ? -13.462 -58.701 -32.463 1.00 49.19  ? 177 ARG B NH2 1 
ATOM   5547 N N   . LEU B 1 177 ? -8.763  -62.666 -37.901 1.00 39.26  ? 178 LEU B N   1 
ATOM   5548 C CA  . LEU B 1 177 ? -8.838  -63.232 -39.230 1.00 32.84  ? 178 LEU B CA  1 
ATOM   5549 C C   . LEU B 1 177 ? -8.289  -64.651 -39.199 1.00 36.75  ? 178 LEU B C   1 
ATOM   5550 O O   . LEU B 1 177 ? -8.891  -65.577 -39.753 1.00 38.66  ? 178 LEU B O   1 
ATOM   5551 C CB  . LEU B 1 177 ? -8.082  -62.368 -40.234 1.00 30.15  ? 178 LEU B CB  1 
ATOM   5552 C CG  . LEU B 1 177 ? -8.191  -62.886 -41.667 1.00 32.62  ? 178 LEU B CG  1 
ATOM   5553 C CD1 . LEU B 1 177 ? -9.644  -63.149 -42.002 1.00 32.98  ? 178 LEU B CD1 1 
ATOM   5554 C CD2 . LEU B 1 177 ? -7.570  -61.926 -42.673 1.00 35.98  ? 178 LEU B CD2 1 
ATOM   5555 N N   . ALA B 1 178 ? -7.157  -64.830 -38.532 1.00 33.14  ? 179 ALA B N   1 
ATOM   5556 C CA  . ALA B 1 178 ? -6.594  -66.165 -38.403 1.00 36.69  ? 179 ALA B CA  1 
ATOM   5557 C C   . ALA B 1 178 ? -7.601  -67.095 -37.713 1.00 35.45  ? 179 ALA B C   1 
ATOM   5558 O O   . ALA B 1 178 ? -7.777  -68.242 -38.120 1.00 40.03  ? 179 ALA B O   1 
ATOM   5559 C CB  . ALA B 1 178 ? -5.284  -66.117 -37.646 1.00 28.33  ? 179 ALA B CB  1 
ATOM   5560 N N   . LEU B 1 179 ? -8.273  -66.586 -36.683 1.00 39.69  ? 180 LEU B N   1 
ATOM   5561 C CA  . LEU B 1 179 ? -9.290  -67.355 -35.971 1.00 36.87  ? 180 LEU B CA  1 
ATOM   5562 C C   . LEU B 1 179 ? -10.474 -67.737 -36.878 1.00 46.52  ? 180 LEU B C   1 
ATOM   5563 O O   . LEU B 1 179 ? -10.964 -68.869 -36.810 1.00 38.40  ? 180 LEU B O   1 
ATOM   5564 C CB  . LEU B 1 179 ? -9.781  -66.572 -34.752 1.00 32.98  ? 180 LEU B CB  1 
ATOM   5565 C CG  . LEU B 1 179 ? -8.799  -66.558 -33.583 1.00 35.00  ? 180 LEU B CG  1 
ATOM   5566 C CD1 . LEU B 1 179 ? -9.392  -65.879 -32.377 1.00 31.00  ? 180 LEU B CD1 1 
ATOM   5567 C CD2 . LEU B 1 179 ? -8.394  -67.962 -33.237 1.00 32.67  ? 180 LEU B CD2 1 
ATOM   5568 N N   . GLN B 1 180 ? -10.927 -66.802 -37.719 1.00 38.20  ? 181 GLN B N   1 
ATOM   5569 C CA  . GLN B 1 180 ? -11.937 -67.107 -38.734 1.00 42.91  ? 181 GLN B CA  1 
ATOM   5570 C C   . GLN B 1 180 ? -11.451 -68.184 -39.718 1.00 45.65  ? 181 GLN B C   1 
ATOM   5571 O O   . GLN B 1 180 ? -12.196 -69.105 -40.063 1.00 45.79  ? 181 GLN B O   1 
ATOM   5572 C CB  . GLN B 1 180 ? -12.339 -65.837 -39.493 1.00 38.26  ? 181 GLN B CB  1 
ATOM   5573 C CG  . GLN B 1 180 ? -13.262 -64.921 -38.687 1.00 58.28  ? 181 GLN B CG  1 
ATOM   5574 C CD  . GLN B 1 180 ? -13.325 -63.486 -39.214 1.00 63.36  ? 181 GLN B CD  1 
ATOM   5575 O OE1 . GLN B 1 180 ? -12.709 -63.150 -40.228 1.00 67.85  ? 181 GLN B OE1 1 
ATOM   5576 N NE2 . GLN B 1 180 ? -14.069 -62.633 -38.516 1.00 55.37  ? 181 GLN B NE2 1 
ATOM   5577 N N   . TRP B 1 181 ? -10.203 -68.069 -40.164 1.00 41.42  ? 182 TRP B N   1 
ATOM   5578 C CA  . TRP B 1 181 ? -9.609  -69.078 -41.035 1.00 39.58  ? 182 TRP B CA  1 
ATOM   5579 C C   . TRP B 1 181 ? -9.753  -70.474 -40.439 1.00 42.20  ? 182 TRP B C   1 
ATOM   5580 O O   . TRP B 1 181 ? -10.111 -71.424 -41.139 1.00 36.81  ? 182 TRP B O   1 
ATOM   5581 C CB  . TRP B 1 181 ? -8.133  -68.772 -41.287 1.00 34.52  ? 182 TRP B CB  1 
ATOM   5582 C CG  . TRP B 1 181 ? -7.501  -69.645 -42.331 1.00 37.42  ? 182 TRP B CG  1 
ATOM   5583 C CD1 . TRP B 1 181 ? -7.377  -69.370 -43.664 1.00 35.72  ? 182 TRP B CD1 1 
ATOM   5584 C CD2 . TRP B 1 181 ? -6.901  -70.928 -42.129 1.00 29.96  ? 182 TRP B CD2 1 
ATOM   5585 N NE1 . TRP B 1 181 ? -6.746  -70.403 -44.302 1.00 35.33  ? 182 TRP B NE1 1 
ATOM   5586 C CE2 . TRP B 1 181 ? -6.438  -71.370 -43.383 1.00 32.49  ? 182 TRP B CE2 1 
ATOM   5587 C CE3 . TRP B 1 181 ? -6.708  -71.743 -41.013 1.00 30.47  ? 182 TRP B CE3 1 
ATOM   5588 C CZ2 . TRP B 1 181 ? -5.797  -72.596 -43.551 1.00 30.86  ? 182 TRP B CZ2 1 
ATOM   5589 C CZ3 . TRP B 1 181 ? -6.069  -72.959 -41.181 1.00 29.62  ? 182 TRP B CZ3 1 
ATOM   5590 C CH2 . TRP B 1 181 ? -5.622  -73.375 -42.441 1.00 37.64  ? 182 TRP B CH2 1 
ATOM   5591 N N   . VAL B 1 182 ? -9.488  -70.583 -39.138 1.00 42.46  ? 183 VAL B N   1 
ATOM   5592 C CA  . VAL B 1 182 ? -9.546  -71.867 -38.444 1.00 45.02  ? 183 VAL B CA  1 
ATOM   5593 C C   . VAL B 1 182 ? -10.961 -72.457 -38.454 1.00 41.69  ? 183 VAL B C   1 
ATOM   5594 O O   . VAL B 1 182 ? -11.134 -73.647 -38.703 1.00 45.33  ? 183 VAL B O   1 
ATOM   5595 C CB  . VAL B 1 182 ? -9.037  -71.735 -36.993 1.00 42.97  ? 183 VAL B CB  1 
ATOM   5596 C CG1 . VAL B 1 182 ? -9.284  -73.022 -36.206 1.00 33.29  ? 183 VAL B CG1 1 
ATOM   5597 C CG2 . VAL B 1 182 ? -7.564  -71.384 -36.990 1.00 33.55  ? 183 VAL B CG2 1 
ATOM   5598 N N   . GLN B 1 183 ? -11.965 -71.618 -38.208 1.00 38.75  ? 184 GLN B N   1 
ATOM   5599 C CA  . GLN B 1 183 ? -13.363 -72.042 -38.271 1.00 44.38  ? 184 GLN B CA  1 
ATOM   5600 C C   . GLN B 1 183 ? -13.772 -72.556 -39.664 1.00 57.35  ? 184 GLN B C   1 
ATOM   5601 O O   . GLN B 1 183 ? -14.563 -73.504 -39.787 1.00 48.75  ? 184 GLN B O   1 
ATOM   5602 C CB  . GLN B 1 183 ? -14.284 -70.893 -37.861 1.00 39.97  ? 184 GLN B CB  1 
ATOM   5603 C CG  . GLN B 1 183 ? -14.384 -70.682 -36.367 1.00 50.84  ? 184 GLN B CG  1 
ATOM   5604 C CD  . GLN B 1 183 ? -14.773 -71.944 -35.626 1.00 51.69  ? 184 GLN B CD  1 
ATOM   5605 O OE1 . GLN B 1 183 ? -15.794 -72.567 -35.926 1.00 59.28  ? 184 GLN B OE1 1 
ATOM   5606 N NE2 . GLN B 1 183 ? -13.953 -72.336 -34.656 1.00 46.62  ? 184 GLN B NE2 1 
ATOM   5607 N N   . GLU B 1 184 ? -13.239 -71.930 -40.709 1.00 44.12  ? 185 GLU B N   1 
ATOM   5608 C CA  . GLU B 1 184 ? -13.562 -72.339 -42.065 1.00 50.29  ? 185 GLU B CA  1 
ATOM   5609 C C   . GLU B 1 184 ? -12.772 -73.570 -42.527 1.00 52.40  ? 185 GLU B C   1 
ATOM   5610 O O   . GLU B 1 184 ? -13.308 -74.410 -43.250 1.00 51.60  ? 185 GLU B O   1 
ATOM   5611 C CB  . GLU B 1 184 ? -13.328 -71.180 -43.028 1.00 51.56  ? 185 GLU B CB  1 
ATOM   5612 C CG  . GLU B 1 184 ? -14.141 -69.934 -42.687 1.00 65.93  ? 185 GLU B CG  1 
ATOM   5613 C CD  . GLU B 1 184 ? -13.771 -68.731 -43.555 1.00 84.89  ? 185 GLU B CD  1 
ATOM   5614 O OE1 . GLU B 1 184 ? -12.786 -68.833 -44.326 1.00 84.75  ? 185 GLU B OE1 1 
ATOM   5615 O OE2 . GLU B 1 184 ? -14.462 -67.687 -43.467 1.00 74.78  ? 185 GLU B OE2 1 
ATOM   5616 N N   . ASN B 1 185 ? -11.516 -73.692 -42.095 1.00 46.57  ? 186 ASN B N   1 
ATOM   5617 C CA  . ASN B 1 185 ? -10.596 -74.652 -42.711 1.00 35.91  ? 186 ASN B CA  1 
ATOM   5618 C C   . ASN B 1 185 ? -9.975  -75.721 -41.810 1.00 46.46  ? 186 ASN B C   1 
ATOM   5619 O O   . ASN B 1 185 ? -9.372  -76.659 -42.320 1.00 51.52  ? 186 ASN B O   1 
ATOM   5620 C CB  . ASN B 1 185 ? -9.454  -73.897 -43.399 1.00 33.56  ? 186 ASN B CB  1 
ATOM   5621 C CG  . ASN B 1 185 ? -9.947  -72.941 -44.483 1.00 45.87  ? 186 ASN B CG  1 
ATOM   5622 O OD1 . ASN B 1 185 ? -10.514 -73.366 -45.494 1.00 46.57  ? 186 ASN B OD1 1 
ATOM   5623 N ND2 . ASN B 1 185 ? -9.723  -71.645 -44.281 1.00 42.48  ? 186 ASN B ND2 1 
ATOM   5624 N N   . VAL B 1 186 ? -10.101 -75.610 -40.488 1.00 47.68  ? 187 VAL B N   1 
ATOM   5625 C CA  . VAL B 1 186 ? -9.354  -76.529 -39.634 1.00 42.25  ? 187 VAL B CA  1 
ATOM   5626 C C   . VAL B 1 186 ? -9.907  -77.951 -39.746 1.00 48.76  ? 187 VAL B C   1 
ATOM   5627 O O   . VAL B 1 186 ? -9.199  -78.926 -39.455 1.00 43.37  ? 187 VAL B O   1 
ATOM   5628 C CB  . VAL B 1 186 ? -9.343  -76.078 -38.148 1.00 45.24  ? 187 VAL B CB  1 
ATOM   5629 C CG1 . VAL B 1 186 ? -10.578 -76.577 -37.403 1.00 42.76  ? 187 VAL B CG1 1 
ATOM   5630 C CG2 . VAL B 1 186 ? -8.069  -76.557 -37.454 1.00 34.30  ? 187 VAL B CG2 1 
ATOM   5631 N N   . ALA B 1 187 ? -11.158 -78.068 -40.192 1.00 52.60  ? 188 ALA B N   1 
ATOM   5632 C CA  . ALA B 1 187 ? -11.790 -79.378 -40.370 1.00 47.55  ? 188 ALA B CA  1 
ATOM   5633 C C   . ALA B 1 187 ? -11.055 -80.198 -41.426 1.00 46.15  ? 188 ALA B C   1 
ATOM   5634 O O   . ALA B 1 187 ? -10.998 -81.425 -41.341 1.00 42.89  ? 188 ALA B O   1 
ATOM   5635 C CB  . ALA B 1 187 ? -13.250 -79.224 -40.741 1.00 35.77  ? 188 ALA B CB  1 
ATOM   5636 N N   . ALA B 1 188 ? -10.469 -79.505 -42.402 1.00 46.13  ? 189 ALA B N   1 
ATOM   5637 C CA  . ALA B 1 188 ? -9.715  -80.148 -43.476 1.00 42.06  ? 189 ALA B CA  1 
ATOM   5638 C C   . ALA B 1 188 ? -8.441  -80.819 -42.971 1.00 42.19  ? 189 ALA B C   1 
ATOM   5639 O O   . ALA B 1 188 ? -7.866  -81.661 -43.651 1.00 54.98  ? 189 ALA B O   1 
ATOM   5640 C CB  . ALA B 1 188 ? -9.381  -79.138 -44.554 1.00 35.71  ? 189 ALA B CB  1 
ATOM   5641 N N   . PHE B 1 189 ? -8.001  -80.443 -41.778 1.00 48.09  ? 190 PHE B N   1 
ATOM   5642 C CA  . PHE B 1 189 ? -6.830  -81.060 -41.171 1.00 40.63  ? 190 PHE B CA  1 
ATOM   5643 C C   . PHE B 1 189 ? -7.222  -82.040 -40.064 1.00 47.50  ? 190 PHE B C   1 
ATOM   5644 O O   . PHE B 1 189 ? -6.357  -82.572 -39.362 1.00 50.11  ? 190 PHE B O   1 
ATOM   5645 C CB  . PHE B 1 189 ? -5.897  -79.998 -40.595 1.00 39.30  ? 190 PHE B CB  1 
ATOM   5646 C CG  . PHE B 1 189 ? -5.421  -78.996 -41.595 1.00 39.14  ? 190 PHE B CG  1 
ATOM   5647 C CD1 . PHE B 1 189 ? -6.188  -77.887 -41.902 1.00 39.49  ? 190 PHE B CD1 1 
ATOM   5648 C CD2 . PHE B 1 189 ? -4.194  -79.151 -42.215 1.00 40.97  ? 190 PHE B CD2 1 
ATOM   5649 C CE1 . PHE B 1 189 ? -5.741  -76.955 -42.811 1.00 35.73  ? 190 PHE B CE1 1 
ATOM   5650 C CE2 . PHE B 1 189 ? -3.741  -78.219 -43.126 1.00 33.06  ? 190 PHE B CE2 1 
ATOM   5651 C CZ  . PHE B 1 189 ? -4.514  -77.119 -43.420 1.00 33.61  ? 190 PHE B CZ  1 
ATOM   5652 N N   . GLY B 1 190 ? -8.522  -82.263 -39.897 1.00 44.26  ? 191 GLY B N   1 
ATOM   5653 C CA  . GLY B 1 190 ? -9.006  -83.199 -38.897 1.00 47.94  ? 191 GLY B CA  1 
ATOM   5654 C C   . GLY B 1 190 ? -9.277  -82.557 -37.549 1.00 54.29  ? 191 GLY B C   1 
ATOM   5655 O O   . GLY B 1 190 ? -9.463  -83.247 -36.541 1.00 48.27  ? 191 GLY B O   1 
ATOM   5656 N N   . GLY B 1 191 ? -9.302  -81.228 -37.528 1.00 47.47  ? 192 GLY B N   1 
ATOM   5657 C CA  . GLY B 1 191 ? -9.561  -80.499 -36.305 1.00 50.18  ? 192 GLY B CA  1 
ATOM   5658 C C   . GLY B 1 191 ? -11.033 -80.178 -36.157 1.00 54.26  ? 192 GLY B C   1 
ATOM   5659 O O   . GLY B 1 191 ? -11.749 -80.047 -37.148 1.00 48.24  ? 192 GLY B O   1 
ATOM   5660 N N   . ASP B 1 192 ? -11.483 -80.045 -34.912 1.00 49.24  ? 193 ASP B N   1 
ATOM   5661 C CA  . ASP B 1 192 ? -12.878 -79.744 -34.628 1.00 45.45  ? 193 ASP B CA  1 
ATOM   5662 C C   . ASP B 1 192 ? -13.092 -78.254 -34.365 1.00 46.09  ? 193 ASP B C   1 
ATOM   5663 O O   . ASP B 1 192 ? -12.738 -77.753 -33.306 1.00 44.52  ? 193 ASP B O   1 
ATOM   5664 C CB  . ASP B 1 192 ? -13.353 -80.574 -33.435 1.00 45.44  ? 193 ASP B CB  1 
ATOM   5665 C CG  . ASP B 1 192 ? -14.786 -80.275 -33.044 1.00 48.78  ? 193 ASP B CG  1 
ATOM   5666 O OD1 . ASP B 1 192 ? -15.510 -79.620 -33.831 1.00 50.01  ? 193 ASP B OD1 1 
ATOM   5667 O OD2 . ASP B 1 192 ? -15.194 -80.712 -31.946 1.00 48.43  ? 193 ASP B OD2 1 
ATOM   5668 N N   . PRO B 1 193 ? -13.703 -77.543 -35.318 1.00 44.31  ? 194 PRO B N   1 
ATOM   5669 C CA  . PRO B 1 193 ? -13.906 -76.106 -35.138 1.00 45.90  ? 194 PRO B CA  1 
ATOM   5670 C C   . PRO B 1 193 ? -14.825 -75.744 -33.969 1.00 45.29  ? 194 PRO B C   1 
ATOM   5671 O O   . PRO B 1 193 ? -14.954 -74.559 -33.680 1.00 57.23  ? 194 PRO B O   1 
ATOM   5672 C CB  . PRO B 1 193 ? -14.531 -75.672 -36.473 1.00 38.29  ? 194 PRO B CB  1 
ATOM   5673 C CG  . PRO B 1 193 ? -15.153 -76.882 -37.011 1.00 37.25  ? 194 PRO B CG  1 
ATOM   5674 C CD  . PRO B 1 193 ? -14.256 -78.011 -36.600 1.00 44.43  ? 194 PRO B CD  1 
ATOM   5675 N N   . THR B 1 194 ? -15.453 -76.722 -33.319 1.00 46.62  ? 195 THR B N   1 
ATOM   5676 C CA  . THR B 1 194 ? -16.321 -76.421 -32.169 1.00 57.35  ? 195 THR B CA  1 
ATOM   5677 C C   . THR B 1 194 ? -15.596 -76.642 -30.848 1.00 51.60  ? 195 THR B C   1 
ATOM   5678 O O   . THR B 1 194 ? -16.150 -76.400 -29.777 1.00 57.01  ? 195 THR B O   1 
ATOM   5679 C CB  . THR B 1 194 ? -17.616 -77.271 -32.164 1.00 53.17  ? 195 THR B CB  1 
ATOM   5680 O OG1 . THR B 1 194 ? -17.298 -78.659 -31.976 1.00 45.88  ? 195 THR B OG1 1 
ATOM   5681 C CG2 . THR B 1 194 ? -18.377 -77.083 -33.465 1.00 48.53  ? 195 THR B CG2 1 
ATOM   5682 N N   . SER B 1 195 ? -14.359 -77.115 -30.943 1.00 48.65  ? 196 SER B N   1 
ATOM   5683 C CA  . SER B 1 195 ? -13.495 -77.292 -29.789 1.00 44.03  ? 196 SER B CA  1 
ATOM   5684 C C   . SER B 1 195 ? -12.165 -76.551 -29.982 1.00 43.44  ? 196 SER B C   1 
ATOM   5685 O O   . SER B 1 195 ? -11.100 -77.170 -30.018 1.00 43.71  ? 196 SER B O   1 
ATOM   5686 C CB  . SER B 1 195 ? -13.235 -78.780 -29.532 1.00 46.06  ? 196 SER B CB  1 
ATOM   5687 O OG  . SER B 1 195 ? -12.892 -79.028 -28.169 1.00 58.49  ? 196 SER B OG  1 
ATOM   5688 N N   . VAL B 1 196 ? -12.228 -75.228 -30.101 1.00 36.49  ? 197 VAL B N   1 
ATOM   5689 C CA  . VAL B 1 196 ? -11.010 -74.436 -30.209 1.00 42.51  ? 197 VAL B CA  1 
ATOM   5690 C C   . VAL B 1 196 ? -10.650 -73.721 -28.897 1.00 47.79  ? 197 VAL B C   1 
ATOM   5691 O O   . VAL B 1 196 ? -11.453 -72.966 -28.331 1.00 37.35  ? 197 VAL B O   1 
ATOM   5692 C CB  . VAL B 1 196 ? -11.119 -73.395 -31.337 1.00 43.24  ? 197 VAL B CB  1 
ATOM   5693 C CG1 . VAL B 1 196 ? -10.038 -72.337 -31.190 1.00 34.80  ? 197 VAL B CG1 1 
ATOM   5694 C CG2 . VAL B 1 196 ? -11.030 -74.078 -32.696 1.00 36.07  ? 197 VAL B CG2 1 
ATOM   5695 N N   . THR B 1 197 ? -9.429  -73.979 -28.432 1.00 44.36  ? 198 THR B N   1 
ATOM   5696 C CA  . THR B 1 197 ? -8.864  -73.352 -27.241 1.00 39.68  ? 198 THR B CA  1 
ATOM   5697 C C   . THR B 1 197 ? -7.757  -72.356 -27.600 1.00 41.36  ? 198 THR B C   1 
ATOM   5698 O O   . THR B 1 197 ? -6.698  -72.748 -28.083 1.00 37.32  ? 198 THR B O   1 
ATOM   5699 C CB  . THR B 1 197 ? -8.270  -74.404 -26.285 1.00 34.53  ? 198 THR B CB  1 
ATOM   5700 O OG1 . THR B 1 197 ? -9.259  -75.388 -25.964 1.00 48.73  ? 198 THR B OG1 1 
ATOM   5701 C CG2 . THR B 1 197 ? -7.782  -73.752 -25.022 1.00 40.59  ? 198 THR B CG2 1 
ATOM   5702 N N   . LEU B 1 198 ? -8.002  -71.071 -27.372 1.00 38.07  ? 199 LEU B N   1 
ATOM   5703 C CA  . LEU B 1 198 ? -6.945  -70.075 -27.501 1.00 36.24  ? 199 LEU B CA  1 
ATOM   5704 C C   . LEU B 1 198 ? -5.963  -70.195 -26.360 1.00 36.60  ? 199 LEU B C   1 
ATOM   5705 O O   . LEU B 1 198 ? -6.367  -70.403 -25.225 1.00 42.34  ? 199 LEU B O   1 
ATOM   5706 C CB  . LEU B 1 198 ? -7.511  -68.664 -27.499 1.00 36.18  ? 199 LEU B CB  1 
ATOM   5707 C CG  . LEU B 1 198 ? -8.390  -68.243 -28.656 1.00 30.29  ? 199 LEU B CG  1 
ATOM   5708 C CD1 . LEU B 1 198 ? -8.688  -66.744 -28.547 1.00 32.28  ? 199 LEU B CD1 1 
ATOM   5709 C CD2 . LEU B 1 198 ? -7.637  -68.567 -29.907 1.00 40.07  ? 199 LEU B CD2 1 
ATOM   5710 N N   . PHE B 1 199 ? -4.676  -70.054 -26.640 1.00 32.05  ? 200 PHE B N   1 
ATOM   5711 C CA  . PHE B 1 199 ? -3.748  -69.843 -25.544 1.00 32.47  ? 200 PHE B CA  1 
ATOM   5712 C C   . PHE B 1 199 ? -2.587  -68.987 -25.981 1.00 29.50  ? 200 PHE B C   1 
ATOM   5713 O O   . PHE B 1 199 ? -2.183  -69.000 -27.138 1.00 33.64  ? 200 PHE B O   1 
ATOM   5714 C CB  . PHE B 1 199 ? -3.270  -71.173 -24.923 1.00 31.81  ? 200 PHE B CB  1 
ATOM   5715 C CG  . PHE B 1 199 ? -2.351  -72.005 -25.781 1.00 38.98  ? 200 PHE B CG  1 
ATOM   5716 C CD1 . PHE B 1 199 ? -2.646  -72.286 -27.109 1.00 40.09  ? 200 PHE B CD1 1 
ATOM   5717 C CD2 . PHE B 1 199 ? -1.201  -72.557 -25.221 1.00 36.07  ? 200 PHE B CD2 1 
ATOM   5718 C CE1 . PHE B 1 199 ? -1.799  -73.079 -27.872 1.00 33.90  ? 200 PHE B CE1 1 
ATOM   5719 C CE2 . PHE B 1 199 ? -0.347  -73.345 -25.969 1.00 34.94  ? 200 PHE B CE2 1 
ATOM   5720 C CZ  . PHE B 1 199 ? -0.645  -73.607 -27.303 1.00 42.53  ? 200 PHE B CZ  1 
ATOM   5721 N N   . GLY B 1 200 ? -2.088  -68.207 -25.033 1.00 31.03  ? 201 GLY B N   1 
ATOM   5722 C CA  . GLY B 1 200 ? -1.012  -67.273 -25.283 1.00 32.42  ? 201 GLY B CA  1 
ATOM   5723 C C   . GLY B 1 200 ? -0.310  -66.857 -24.005 1.00 33.32  ? 201 GLY B C   1 
ATOM   5724 O O   . GLY B 1 200 ? -0.733  -67.187 -22.896 1.00 36.03  ? 201 GLY B O   1 
ATOM   5725 N N   . GLU B 1 201 ? 0.769   -66.112 -24.162 1.00 31.20  ? 202 GLU B N   1 
ATOM   5726 C CA  . GLU B 1 201 ? 1.575   -65.728 -23.030 1.00 34.31  ? 202 GLU B CA  1 
ATOM   5727 C C   . GLU B 1 201 ? 1.860   -64.229 -23.115 1.00 34.46  ? 202 GLU B C   1 
ATOM   5728 O O   . GLU B 1 201 ? 2.060   -63.703 -24.213 1.00 35.42  ? 202 GLU B O   1 
ATOM   5729 C CB  . GLU B 1 201 ? 2.856   -66.564 -23.012 1.00 36.36  ? 202 GLU B CB  1 
ATOM   5730 C CG  . GLU B 1 201 ? 3.672   -66.457 -21.747 1.00 36.31  ? 202 GLU B CG  1 
ATOM   5731 C CD  . GLU B 1 201 ? 4.727   -65.379 -21.830 1.00 47.73  ? 202 GLU B CD  1 
ATOM   5732 O OE1 . GLU B 1 201 ? 4.895   -64.771 -22.917 1.00 48.09  ? 202 GLU B OE1 1 
ATOM   5733 O OE2 . GLU B 1 201 ? 5.391   -65.141 -20.799 1.00 53.33  ? 202 GLU B OE2 1 
ATOM   5734 N N   . SER B 1 202 ? 1.839   -63.545 -21.968 1.00 38.74  ? 203 SER B N   1 
ATOM   5735 C CA  . SER B 1 202 ? 2.120   -62.096 -21.893 1.00 43.08  ? 203 SER B CA  1 
ATOM   5736 C C   . SER B 1 202 ? 1.154   -61.273 -22.773 1.00 40.21  ? 203 SER B C   1 
ATOM   5737 O O   . SER B 1 202 ? -0.069  -61.343 -22.596 1.00 32.13  ? 203 SER B O   1 
ATOM   5738 C CB  . SER B 1 202 ? 3.579   -61.819 -22.290 1.00 47.83  ? 203 SER B CB  1 
ATOM   5739 O OG  . SER B 1 202 ? 4.058   -60.587 -21.770 1.00 46.55  ? 203 SER B OG  1 
ATOM   5740 N N   . ALA B 1 203 ? 1.689   -60.508 -23.726 1.00 35.12  ? 204 ALA B N   1 
ATOM   5741 C CA  . ALA B 1 203 ? 0.832   -59.812 -24.689 1.00 34.51  ? 204 ALA B CA  1 
ATOM   5742 C C   . ALA B 1 203 ? -0.074  -60.805 -25.423 1.00 35.21  ? 204 ALA B C   1 
ATOM   5743 O O   . ALA B 1 203 ? -1.162  -60.452 -25.859 1.00 36.99  ? 204 ALA B O   1 
ATOM   5744 C CB  . ALA B 1 203 ? 1.660   -59.016 -25.678 1.00 28.54  ? 204 ALA B CB  1 
ATOM   5745 N N   . GLY B 1 204 ? 0.373   -62.051 -25.542 1.00 35.11  ? 205 GLY B N   1 
ATOM   5746 C CA  . GLY B 1 204 ? -0.437  -63.088 -26.147 1.00 32.40  ? 205 GLY B CA  1 
ATOM   5747 C C   . GLY B 1 204 ? -1.605  -63.410 -25.247 1.00 33.39  ? 205 GLY B C   1 
ATOM   5748 O O   . GLY B 1 204 ? -2.728  -63.621 -25.705 1.00 33.97  ? 205 GLY B O   1 
ATOM   5749 N N   . ALA B 1 205 ? -1.338  -63.432 -23.948 1.00 32.19  ? 206 ALA B N   1 
ATOM   5750 C CA  . ALA B 1 205 ? -2.388  -63.685 -22.973 1.00 35.49  ? 206 ALA B CA  1 
ATOM   5751 C C   . ALA B 1 205 ? -3.382  -62.522 -22.936 1.00 35.91  ? 206 ALA B C   1 
ATOM   5752 O O   . ALA B 1 205 ? -4.593  -62.738 -22.900 1.00 35.47  ? 206 ALA B O   1 
ATOM   5753 C CB  . ALA B 1 205 ? -1.790  -63.933 -21.592 1.00 36.88  ? 206 ALA B CB  1 
ATOM   5754 N N   . ALA B 1 206 ? -2.866  -61.295 -22.953 1.00 34.77  ? 207 ALA B N   1 
ATOM   5755 C CA  . ALA B 1 206 ? -3.710  -60.109 -23.066 1.00 29.48  ? 207 ALA B CA  1 
ATOM   5756 C C   . ALA B 1 206 ? -4.575  -60.159 -24.329 1.00 34.59  ? 207 ALA B C   1 
ATOM   5757 O O   . ALA B 1 206 ? -5.747  -59.769 -24.311 1.00 37.90  ? 207 ALA B O   1 
ATOM   5758 C CB  . ALA B 1 206 ? -2.854  -58.849 -23.056 1.00 30.45  ? 207 ALA B CB  1 
ATOM   5759 N N   . SER B 1 207 ? -3.996  -60.650 -25.422 1.00 38.21  ? 208 SER B N   1 
ATOM   5760 C CA  . SER B 1 207 ? -4.718  -60.750 -26.683 1.00 31.78  ? 208 SER B CA  1 
ATOM   5761 C C   . SER B 1 207 ? -5.851  -61.755 -26.556 1.00 35.96  ? 208 SER B C   1 
ATOM   5762 O O   . SER B 1 207 ? -6.976  -61.502 -26.992 1.00 37.98  ? 208 SER B O   1 
ATOM   5763 C CB  . SER B 1 207 ? -3.773  -61.144 -27.816 1.00 29.19  ? 208 SER B CB  1 
ATOM   5764 O OG  . SER B 1 207 ? -2.853  -60.097 -28.086 1.00 39.10  ? 208 SER B OG  1 
ATOM   5765 N N   . VAL B 1 208 ? -5.550  -62.897 -25.954 1.00 29.96  ? 209 VAL B N   1 
ATOM   5766 C CA  . VAL B 1 208 ? -6.569  -63.904 -25.723 1.00 29.70  ? 209 VAL B CA  1 
ATOM   5767 C C   . VAL B 1 208 ? -7.730  -63.301 -24.954 1.00 38.17  ? 209 VAL B C   1 
ATOM   5768 O O   . VAL B 1 208 ? -8.894  -63.501 -25.313 1.00 41.43  ? 209 VAL B O   1 
ATOM   5769 C CB  . VAL B 1 208 ? -6.014  -65.100 -24.951 1.00 26.67  ? 209 VAL B CB  1 
ATOM   5770 C CG1 . VAL B 1 208 ? -7.141  -65.963 -24.448 1.00 30.31  ? 209 VAL B CG1 1 
ATOM   5771 C CG2 . VAL B 1 208 ? -5.091  -65.897 -25.843 1.00 35.69  ? 209 VAL B CG2 1 
ATOM   5772 N N   . GLY B 1 209 ? -7.398  -62.541 -23.910 1.00 39.85  ? 210 GLY B N   1 
ATOM   5773 C CA  . GLY B 1 209 ? -8.387  -61.917 -23.048 1.00 33.02  ? 210 GLY B CA  1 
ATOM   5774 C C   . GLY B 1 209 ? -9.263  -60.937 -23.802 1.00 40.56  ? 210 GLY B C   1 
ATOM   5775 O O   . GLY B 1 209 ? -10.480 -60.908 -23.623 1.00 44.13  ? 210 GLY B O   1 
ATOM   5776 N N   . MET B 1 210 ? -8.654  -60.135 -24.664 1.00 35.28  ? 211 MET B N   1 
ATOM   5777 C CA  . MET B 1 210 ? -9.443  -59.214 -25.473 1.00 39.72  ? 211 MET B CA  1 
ATOM   5778 C C   . MET B 1 210 ? -10.380 -59.910 -26.469 1.00 40.16  ? 211 MET B C   1 
ATOM   5779 O O   . MET B 1 210 ? -11.420 -59.360 -26.821 1.00 45.09  ? 211 MET B O   1 
ATOM   5780 C CB  . MET B 1 210 ? -8.524  -58.256 -26.206 1.00 31.16  ? 211 MET B CB  1 
ATOM   5781 C CG  . MET B 1 210 ? -7.881  -57.286 -25.278 1.00 28.91  ? 211 MET B CG  1 
ATOM   5782 S SD  . MET B 1 210 ? -6.654  -56.338 -26.151 1.00 44.86  ? 211 MET B SD  1 
ATOM   5783 C CE  . MET B 1 210 ? -5.697  -55.683 -24.786 1.00 35.52  ? 211 MET B CE  1 
ATOM   5784 N N   . HIS B 1 211 ? -10.030 -61.109 -26.925 1.00 39.52  ? 212 HIS B N   1 
ATOM   5785 C CA  . HIS B 1 211 ? -10.961 -61.851 -27.765 1.00 40.72  ? 212 HIS B CA  1 
ATOM   5786 C C   . HIS B 1 211 ? -12.148 -62.322 -26.929 1.00 42.96  ? 212 HIS B C   1 
ATOM   5787 O O   . HIS B 1 211 ? -13.257 -62.431 -27.440 1.00 47.66  ? 212 HIS B O   1 
ATOM   5788 C CB  . HIS B 1 211 ? -10.274 -63.032 -28.462 1.00 36.27  ? 212 HIS B CB  1 
ATOM   5789 C CG  . HIS B 1 211 ? -9.297  -62.617 -29.517 1.00 36.30  ? 212 HIS B CG  1 
ATOM   5790 N ND1 . HIS B 1 211 ? -9.673  -61.920 -30.646 1.00 38.45  ? 212 HIS B ND1 1 
ATOM   5791 C CD2 . HIS B 1 211 ? -7.955  -62.778 -29.606 1.00 39.89  ? 212 HIS B CD2 1 
ATOM   5792 C CE1 . HIS B 1 211 ? -8.606  -61.675 -31.388 1.00 39.31  ? 212 HIS B CE1 1 
ATOM   5793 N NE2 . HIS B 1 211 ? -7.550  -62.183 -30.777 1.00 38.86  ? 212 HIS B NE2 1 
ATOM   5794 N N   . LEU B 1 212 ? -11.921 -62.591 -25.645 1.00 43.30  ? 213 LEU B N   1 
ATOM   5795 C CA  . LEU B 1 212 ? -13.011 -62.966 -24.742 1.00 45.33  ? 213 LEU B CA  1 
ATOM   5796 C C   . LEU B 1 212 ? -14.029 -61.840 -24.604 1.00 48.80  ? 213 LEU B C   1 
ATOM   5797 O O   . LEU B 1 212 ? -15.236 -62.067 -24.548 1.00 50.34  ? 213 LEU B O   1 
ATOM   5798 C CB  . LEU B 1 212 ? -12.468 -63.332 -23.363 1.00 42.64  ? 213 LEU B CB  1 
ATOM   5799 C CG  . LEU B 1 212 ? -12.025 -64.781 -23.191 1.00 55.80  ? 213 LEU B CG  1 
ATOM   5800 C CD1 . LEU B 1 212 ? -11.139 -64.924 -21.958 1.00 37.00  ? 213 LEU B CD1 1 
ATOM   5801 C CD2 . LEU B 1 212 ? -13.248 -65.689 -23.096 1.00 54.15  ? 213 LEU B CD2 1 
ATOM   5802 N N   . LEU B 1 213 ? -13.520 -60.617 -24.578 1.00 41.57  ? 214 LEU B N   1 
ATOM   5803 C CA  . LEU B 1 213 ? -14.328 -59.452 -24.289 1.00 36.62  ? 214 LEU B CA  1 
ATOM   5804 C C   . LEU B 1 213 ? -14.839 -58.766 -25.550 1.00 49.40  ? 214 LEU B C   1 
ATOM   5805 O O   . LEU B 1 213 ? -15.442 -57.692 -25.488 1.00 56.35  ? 214 LEU B O   1 
ATOM   5806 C CB  . LEU B 1 213 ? -13.510 -58.479 -23.443 1.00 42.99  ? 214 LEU B CB  1 
ATOM   5807 C CG  . LEU B 1 213 ? -12.909 -59.143 -22.200 1.00 39.81  ? 214 LEU B CG  1 
ATOM   5808 C CD1 . LEU B 1 213 ? -12.053 -58.181 -21.403 1.00 39.34  ? 214 LEU B CD1 1 
ATOM   5809 C CD2 . LEU B 1 213 ? -14.008 -59.724 -21.340 1.00 38.42  ? 214 LEU B CD2 1 
ATOM   5810 N N   . SER B 1 214 ? -14.593 -59.384 -26.699 1.00 43.03  ? 215 SER B N   1 
ATOM   5811 C CA  . SER B 1 214 ? -15.049 -58.822 -27.962 1.00 43.99  ? 215 SER B CA  1 
ATOM   5812 C C   . SER B 1 214 ? -15.942 -59.817 -28.685 1.00 45.94  ? 215 SER B C   1 
ATOM   5813 O O   . SER B 1 214 ? -15.458 -60.803 -29.228 1.00 47.60  ? 215 SER B O   1 
ATOM   5814 C CB  . SER B 1 214 ? -13.862 -58.427 -28.840 1.00 46.95  ? 215 SER B CB  1 
ATOM   5815 O OG  . SER B 1 214 ? -14.296 -57.744 -30.001 1.00 43.49  ? 215 SER B OG  1 
ATOM   5816 N N   . PRO B 1 215 ? -17.258 -59.558 -28.686 1.00 53.75  ? 216 PRO B N   1 
ATOM   5817 C CA  . PRO B 1 215 ? -18.255 -60.497 -29.214 1.00 49.20  ? 216 PRO B CA  1 
ATOM   5818 C C   . PRO B 1 215 ? -17.959 -61.061 -30.616 1.00 46.41  ? 216 PRO B C   1 
ATOM   5819 O O   . PRO B 1 215 ? -18.132 -62.276 -30.782 1.00 42.01  ? 216 PRO B O   1 
ATOM   5820 C CB  . PRO B 1 215 ? -19.539 -59.664 -29.209 1.00 51.24  ? 216 PRO B CB  1 
ATOM   5821 C CG  . PRO B 1 215 ? -19.347 -58.736 -28.054 1.00 41.06  ? 216 PRO B CG  1 
ATOM   5822 C CD  . PRO B 1 215 ? -17.891 -58.364 -28.094 1.00 46.39  ? 216 PRO B CD  1 
ATOM   5823 N N   . PRO B 1 216 ? -17.510 -60.230 -31.588 1.00 42.19  ? 217 PRO B N   1 
ATOM   5824 C CA  . PRO B 1 216 ? -17.225 -60.860 -32.887 1.00 35.59  ? 217 PRO B CA  1 
ATOM   5825 C C   . PRO B 1 216 ? -16.169 -61.962 -32.786 1.00 42.17  ? 217 PRO B C   1 
ATOM   5826 O O   . PRO B 1 216 ? -16.287 -62.961 -33.491 1.00 53.77  ? 217 PRO B O   1 
ATOM   5827 C CB  . PRO B 1 216 ? -16.715 -59.701 -33.750 1.00 36.44  ? 217 PRO B CB  1 
ATOM   5828 C CG  . PRO B 1 216 ? -17.206 -58.467 -33.086 1.00 38.88  ? 217 PRO B CG  1 
ATOM   5829 C CD  . PRO B 1 216 ? -17.240 -58.780 -31.617 1.00 41.73  ? 217 PRO B CD  1 
ATOM   5830 N N   . SER B 1 217 ? -15.175 -61.799 -31.913 1.00 44.01  ? 218 SER B N   1 
ATOM   5831 C CA  . SER B 1 217 ? -14.151 -62.833 -31.721 1.00 44.22  ? 218 SER B CA  1 
ATOM   5832 C C   . SER B 1 217 ? -14.656 -64.013 -30.894 1.00 45.69  ? 218 SER B C   1 
ATOM   5833 O O   . SER B 1 217 ? -14.241 -65.159 -31.110 1.00 44.32  ? 218 SER B O   1 
ATOM   5834 C CB  . SER B 1 217 ? -12.905 -62.248 -31.055 1.00 37.54  ? 218 SER B CB  1 
ATOM   5835 O OG  . SER B 1 217 ? -12.251 -61.316 -31.903 1.00 45.98  ? 218 SER B OG  1 
ATOM   5836 N N   . ARG B 1 218 ? -15.562 -63.727 -29.961 1.00 48.12  ? 219 ARG B N   1 
ATOM   5837 C CA  . ARG B 1 218 ? -16.011 -64.707 -28.970 1.00 53.83  ? 219 ARG B CA  1 
ATOM   5838 C C   . ARG B 1 218 ? -16.681 -65.920 -29.634 1.00 45.90  ? 219 ARG B C   1 
ATOM   5839 O O   . ARG B 1 218 ? -16.680 -67.021 -29.078 1.00 51.66  ? 219 ARG B O   1 
ATOM   5840 C CB  . ARG B 1 218 ? -16.955 -64.033 -27.954 1.00 57.87  ? 219 ARG B CB  1 
ATOM   5841 C CG  . ARG B 1 218 ? -17.347 -64.888 -26.746 1.00 52.29  ? 219 ARG B CG  1 
ATOM   5842 C CD  . ARG B 1 218 ? -16.134 -65.364 -25.940 1.00 54.17  ? 219 ARG B CD  1 
ATOM   5843 N NE  . ARG B 1 218 ? -16.476 -66.436 -25.001 1.00 55.01  ? 219 ARG B NE  1 
ATOM   5844 C CZ  . ARG B 1 218 ? -16.465 -67.735 -25.304 1.00 62.26  ? 219 ARG B CZ  1 
ATOM   5845 N NH1 . ARG B 1 218 ? -16.127 -68.128 -26.524 1.00 59.52  ? 219 ARG B NH1 1 
ATOM   5846 N NH2 . ARG B 1 218 ? -16.791 -68.647 -24.393 1.00 57.00  ? 219 ARG B NH2 1 
ATOM   5847 N N   . GLY B 1 219 ? -17.217 -65.726 -30.836 1.00 43.70  ? 220 GLY B N   1 
ATOM   5848 C CA  . GLY B 1 219 ? -17.798 -66.822 -31.598 1.00 40.40  ? 220 GLY B CA  1 
ATOM   5849 C C   . GLY B 1 219 ? -16.795 -67.818 -32.161 1.00 50.42  ? 220 GLY B C   1 
ATOM   5850 O O   . GLY B 1 219 ? -17.149 -68.953 -32.487 1.00 52.54  ? 220 GLY B O   1 
ATOM   5851 N N   . LEU B 1 220 ? -15.533 -67.406 -32.240 1.00 50.91  ? 221 LEU B N   1 
ATOM   5852 C CA  . LEU B 1 220 ? -14.521 -68.142 -32.997 1.00 42.79  ? 221 LEU B CA  1 
ATOM   5853 C C   . LEU B 1 220 ? -13.724 -69.150 -32.172 1.00 49.78  ? 221 LEU B C   1 
ATOM   5854 O O   . LEU B 1 220 ? -12.843 -69.838 -32.701 1.00 50.89  ? 221 LEU B O   1 
ATOM   5855 C CB  . LEU B 1 220 ? -13.557 -67.152 -33.654 1.00 39.38  ? 221 LEU B CB  1 
ATOM   5856 C CG  . LEU B 1 220 ? -14.248 -66.095 -34.510 1.00 34.83  ? 221 LEU B CG  1 
ATOM   5857 C CD1 . LEU B 1 220 ? -13.258 -65.073 -35.023 1.00 36.59  ? 221 LEU B CD1 1 
ATOM   5858 C CD2 . LEU B 1 220 ? -14.960 -66.780 -35.636 1.00 36.82  ? 221 LEU B CD2 1 
ATOM   5859 N N   . PHE B 1 221 ? -14.020 -69.230 -30.880 1.00 45.64  ? 222 PHE B N   1 
ATOM   5860 C CA  . PHE B 1 221 ? -13.360 -70.205 -30.022 1.00 48.95  ? 222 PHE B CA  1 
ATOM   5861 C C   . PHE B 1 221 ? -14.233 -70.581 -28.819 1.00 47.29  ? 222 PHE B C   1 
ATOM   5862 O O   . PHE B 1 221 ? -15.321 -70.033 -28.642 1.00 48.44  ? 222 PHE B O   1 
ATOM   5863 C CB  . PHE B 1 221 ? -11.997 -69.676 -29.569 1.00 41.57  ? 222 PHE B CB  1 
ATOM   5864 C CG  . PHE B 1 221 ? -12.070 -68.496 -28.654 1.00 44.85  ? 222 PHE B CG  1 
ATOM   5865 C CD1 . PHE B 1 221 ? -12.300 -67.221 -29.158 1.00 44.34  ? 222 PHE B CD1 1 
ATOM   5866 C CD2 . PHE B 1 221 ? -11.882 -68.655 -27.283 1.00 42.50  ? 222 PHE B CD2 1 
ATOM   5867 C CE1 . PHE B 1 221 ? -12.353 -66.122 -28.311 1.00 37.80  ? 222 PHE B CE1 1 
ATOM   5868 C CE2 . PHE B 1 221 ? -11.934 -67.569 -26.433 1.00 40.20  ? 222 PHE B CE2 1 
ATOM   5869 C CZ  . PHE B 1 221 ? -12.170 -66.298 -26.948 1.00 48.00  ? 222 PHE B CZ  1 
ATOM   5870 N N   . HIS B 1 222 ? -13.762 -71.526 -28.009 1.00 39.63  ? 223 HIS B N   1 
ATOM   5871 C CA  . HIS B 1 222 ? -14.587 -72.074 -26.936 1.00 51.63  ? 223 HIS B CA  1 
ATOM   5872 C C   . HIS B 1 222 ? -13.962 -71.979 -25.538 1.00 44.91  ? 223 HIS B C   1 
ATOM   5873 O O   . HIS B 1 222 ? -14.660 -71.739 -24.561 1.00 60.29  ? 223 HIS B O   1 
ATOM   5874 C CB  . HIS B 1 222 ? -14.927 -73.537 -27.235 1.00 52.94  ? 223 HIS B CB  1 
ATOM   5875 C CG  . HIS B 1 222 ? -15.878 -74.139 -26.250 1.00 65.25  ? 223 HIS B CG  1 
ATOM   5876 N ND1 . HIS B 1 222 ? -15.665 -75.368 -25.661 1.00 69.35  ? 223 HIS B ND1 1 
ATOM   5877 C CD2 . HIS B 1 222 ? -17.038 -73.667 -25.732 1.00 58.57  ? 223 HIS B CD2 1 
ATOM   5878 C CE1 . HIS B 1 222 ? -16.656 -75.630 -24.827 1.00 70.26  ? 223 HIS B CE1 1 
ATOM   5879 N NE2 . HIS B 1 222 ? -17.503 -74.615 -24.853 1.00 77.85  ? 223 HIS B NE2 1 
ATOM   5880 N N   . ARG B 1 223 ? -12.657 -72.190 -25.449 1.00 45.96  ? 224 ARG B N   1 
ATOM   5881 C CA  . ARG B 1 223 ? -11.942 -72.137 -24.183 1.00 39.35  ? 224 ARG B CA  1 
ATOM   5882 C C   . ARG B 1 223 ? -10.722 -71.241 -24.295 1.00 41.19  ? 224 ARG B C   1 
ATOM   5883 O O   . ARG B 1 223 ? -10.289 -70.919 -25.401 1.00 40.76  ? 224 ARG B O   1 
ATOM   5884 C CB  . ARG B 1 223 ? -11.509 -73.531 -23.743 1.00 40.47  ? 224 ARG B CB  1 
ATOM   5885 C CG  . ARG B 1 223 ? -12.643 -74.484 -23.524 1.00 47.74  ? 224 ARG B CG  1 
ATOM   5886 C CD  . ARG B 1 223 ? -12.121 -75.854 -23.196 1.00 40.66  ? 224 ARG B CD  1 
ATOM   5887 N NE  . ARG B 1 223 ? -13.205 -76.731 -22.778 1.00 57.13  ? 224 ARG B NE  1 
ATOM   5888 C CZ  . ARG B 1 223 ? -13.683 -77.734 -23.501 1.00 53.79  ? 224 ARG B CZ  1 
ATOM   5889 N NH1 . ARG B 1 223 ? -13.169 -77.993 -24.692 1.00 68.60  ? 224 ARG B NH1 1 
ATOM   5890 N NH2 . ARG B 1 223 ? -14.666 -78.485 -23.026 1.00 60.93  ? 224 ARG B NH2 1 
ATOM   5891 N N   . ALA B 1 224 ? -10.157 -70.866 -23.149 1.00 32.81  ? 225 ALA B N   1 
ATOM   5892 C CA  . ALA B 1 224 ? -9.045  -69.922 -23.121 1.00 37.22  ? 225 ALA B CA  1 
ATOM   5893 C C   . ALA B 1 224 ? -7.984  -70.262 -22.065 1.00 38.90  ? 225 ALA B C   1 
ATOM   5894 O O   . ALA B 1 224 ? -8.303  -70.750 -20.978 1.00 40.82  ? 225 ALA B O   1 
ATOM   5895 C CB  . ALA B 1 224 ? -9.576  -68.515 -22.898 1.00 38.32  ? 225 ALA B CB  1 
ATOM   5896 N N   . VAL B 1 225 ? -6.722  -70.007 -22.406 1.00 32.95  ? 226 VAL B N   1 
ATOM   5897 C CA  . VAL B 1 225 ? -5.602  -70.169 -21.482 1.00 32.30  ? 226 VAL B CA  1 
ATOM   5898 C C   . VAL B 1 225 ? -4.796  -68.884 -21.491 1.00 34.18  ? 226 VAL B C   1 
ATOM   5899 O O   . VAL B 1 225 ? -4.329  -68.444 -22.541 1.00 35.52  ? 226 VAL B O   1 
ATOM   5900 C CB  . VAL B 1 225 ? -4.674  -71.369 -21.858 1.00 32.50  ? 226 VAL B CB  1 
ATOM   5901 C CG1 . VAL B 1 225 ? -3.437  -71.419 -20.976 1.00 25.70  ? 226 VAL B CG1 1 
ATOM   5902 C CG2 . VAL B 1 225 ? -5.415  -72.682 -21.800 1.00 35.07  ? 226 VAL B CG2 1 
ATOM   5903 N N   . LEU B 1 226 ? -4.642  -68.277 -20.321 1.00 33.86  ? 227 LEU B N   1 
ATOM   5904 C CA  . LEU B 1 226 ? -3.900  -67.029 -20.206 1.00 29.85  ? 227 LEU B CA  1 
ATOM   5905 C C   . LEU B 1 226 ? -2.677  -67.195 -19.321 1.00 30.85  ? 227 LEU B C   1 
ATOM   5906 O O   . LEU B 1 226 ? -2.791  -67.240 -18.096 1.00 37.54  ? 227 LEU B O   1 
ATOM   5907 C CB  . LEU B 1 226 ? -4.799  -65.917 -19.658 1.00 31.24  ? 227 LEU B CB  1 
ATOM   5908 C CG  . LEU B 1 226 ? -5.909  -65.383 -20.572 1.00 32.05  ? 227 LEU B CG  1 
ATOM   5909 C CD1 . LEU B 1 226 ? -7.145  -66.244 -20.531 1.00 28.13  ? 227 LEU B CD1 1 
ATOM   5910 C CD2 . LEU B 1 226 ? -6.253  -63.960 -20.207 1.00 35.11  ? 227 LEU B CD2 1 
ATOM   5911 N N   . GLN B 1 227 ? -1.507  -67.276 -19.946 1.00 33.14  ? 228 GLN B N   1 
ATOM   5912 C CA  . GLN B 1 227 ? -0.247  -67.419 -19.213 1.00 34.58  ? 228 GLN B CA  1 
ATOM   5913 C C   . GLN B 1 227 ? 0.468   -66.080 -18.998 1.00 37.45  ? 228 GLN B C   1 
ATOM   5914 O O   . GLN B 1 227 ? 0.891   -65.437 -19.965 1.00 40.49  ? 228 GLN B O   1 
ATOM   5915 C CB  . GLN B 1 227 ? 0.678   -68.386 -19.957 1.00 34.64  ? 228 GLN B CB  1 
ATOM   5916 C CG  . GLN B 1 227 ? -0.014  -69.673 -20.408 1.00 36.28  ? 228 GLN B CG  1 
ATOM   5917 C CD  . GLN B 1 227 ? 0.881   -70.572 -21.257 1.00 49.31  ? 228 GLN B CD  1 
ATOM   5918 O OE1 . GLN B 1 227 ? 0.389   -71.434 -21.981 1.00 42.16  ? 228 GLN B OE1 1 
ATOM   5919 N NE2 . GLN B 1 227 ? 2.197   -70.375 -21.168 1.00 48.13  ? 228 GLN B NE2 1 
ATOM   5920 N N   . SER B 1 228 ? 0.591   -65.664 -17.736 1.00 31.07  ? 229 SER B N   1 
ATOM   5921 C CA  . SER B 1 228 ? 1.395   -64.491 -17.357 1.00 30.54  ? 229 SER B CA  1 
ATOM   5922 C C   . SER B 1 228 ? 1.015   -63.191 -18.065 1.00 36.63  ? 229 SER B C   1 
ATOM   5923 O O   . SER B 1 228 ? 1.890   -62.442 -18.494 1.00 35.72  ? 229 SER B O   1 
ATOM   5924 C CB  . SER B 1 228 ? 2.876   -64.751 -17.623 1.00 34.17  ? 229 SER B CB  1 
ATOM   5925 O OG  . SER B 1 228 ? 3.326   -65.908 -16.950 1.00 40.85  ? 229 SER B OG  1 
ATOM   5926 N N   . GLY B 1 229 ? -0.280  -62.925 -18.185 1.00 35.90  ? 230 GLY B N   1 
ATOM   5927 C CA  . GLY B 1 229 ? -0.749  -61.747 -18.887 1.00 24.82  ? 230 GLY B CA  1 
ATOM   5928 C C   . GLY B 1 229 ? -2.265  -61.696 -18.830 1.00 30.18  ? 230 GLY B C   1 
ATOM   5929 O O   . GLY B 1 229 ? -2.916  -62.718 -18.626 1.00 29.74  ? 230 GLY B O   1 
ATOM   5930 N N   . ALA B 1 230 ? -2.818  -60.503 -19.012 1.00 26.72  ? 231 ALA B N   1 
ATOM   5931 C CA  . ALA B 1 230 ? -4.249  -60.263 -18.913 1.00 28.97  ? 231 ALA B CA  1 
ATOM   5932 C C   . ALA B 1 230 ? -4.567  -58.956 -19.624 1.00 33.42  ? 231 ALA B C   1 
ATOM   5933 O O   . ALA B 1 230 ? -3.721  -58.065 -19.677 1.00 37.24  ? 231 ALA B O   1 
ATOM   5934 C CB  . ALA B 1 230 ? -4.690  -60.200 -17.459 1.00 26.96  ? 231 ALA B CB  1 
ATOM   5935 N N   . PRO B 1 231 ? -5.784  -58.826 -20.168 1.00 31.97  ? 232 PRO B N   1 
ATOM   5936 C CA  . PRO B 1 231 ? -6.139  -57.603 -20.891 1.00 35.25  ? 232 PRO B CA  1 
ATOM   5937 C C   . PRO B 1 231 ? -6.262  -56.362 -19.997 1.00 39.65  ? 232 PRO B C   1 
ATOM   5938 O O   . PRO B 1 231 ? -6.154  -55.250 -20.517 1.00 38.19  ? 232 PRO B O   1 
ATOM   5939 C CB  . PRO B 1 231 ? -7.483  -57.958 -21.535 1.00 31.07  ? 232 PRO B CB  1 
ATOM   5940 C CG  . PRO B 1 231 ? -8.024  -59.050 -20.703 1.00 29.15  ? 232 PRO B CG  1 
ATOM   5941 C CD  . PRO B 1 231 ? -6.842  -59.846 -20.272 1.00 32.02  ? 232 PRO B CD  1 
ATOM   5942 N N   . ASN B 1 232 ? -6.460  -56.542 -18.690 1.00 41.58  ? 233 ASN B N   1 
ATOM   5943 C CA  . ASN B 1 232 ? -6.561  -55.406 -17.767 1.00 37.63  ? 233 ASN B CA  1 
ATOM   5944 C C   . ASN B 1 232 ? -5.215  -54.898 -17.234 1.00 39.76  ? 233 ASN B C   1 
ATOM   5945 O O   . ASN B 1 232 ? -5.172  -53.973 -16.425 1.00 48.60  ? 233 ASN B O   1 
ATOM   5946 C CB  . ASN B 1 232 ? -7.469  -55.759 -16.588 1.00 35.73  ? 233 ASN B CB  1 
ATOM   5947 C CG  . ASN B 1 232 ? -7.324  -57.197 -16.149 1.00 39.07  ? 233 ASN B CG  1 
ATOM   5948 O OD1 . ASN B 1 232 ? -7.203  -58.095 -16.974 1.00 44.81  ? 233 ASN B OD1 1 
ATOM   5949 N ND2 . ASN B 1 232 ? -7.336  -57.425 -14.842 1.00 38.14  ? 233 ASN B ND2 1 
ATOM   5950 N N   . GLY B 1 233 ? -4.118  -55.486 -17.693 1.00 44.32  ? 234 GLY B N   1 
ATOM   5951 C CA  . GLY B 1 233 ? -2.802  -55.009 -17.311 1.00 48.62  ? 234 GLY B CA  1 
ATOM   5952 C C   . GLY B 1 233 ? -2.595  -53.563 -17.720 1.00 47.25  ? 234 GLY B C   1 
ATOM   5953 O O   . GLY B 1 233 ? -3.076  -53.151 -18.774 1.00 52.41  ? 234 GLY B O   1 
ATOM   5954 N N   . PRO B 1 234 ? -1.868  -52.788 -16.899 1.00 43.35  ? 235 PRO B N   1 
ATOM   5955 C CA  . PRO B 1 234 ? -1.614  -51.355 -17.127 1.00 45.97  ? 235 PRO B CA  1 
ATOM   5956 C C   . PRO B 1 234 ? -0.873  -51.041 -18.431 1.00 42.16  ? 235 PRO B C   1 
ATOM   5957 O O   . PRO B 1 234 ? -0.828  -49.882 -18.828 1.00 49.68  ? 235 PRO B O   1 
ATOM   5958 C CB  . PRO B 1 234 ? -0.749  -50.952 -15.925 1.00 40.62  ? 235 PRO B CB  1 
ATOM   5959 C CG  . PRO B 1 234 ? -0.122  -52.219 -15.456 1.00 35.17  ? 235 PRO B CG  1 
ATOM   5960 C CD  . PRO B 1 234 ? -1.130  -53.301 -15.730 1.00 38.24  ? 235 PRO B CD  1 
ATOM   5961 N N   . TRP B 1 235 ? -0.310  -52.061 -19.073 1.00 35.16  ? 236 TRP B N   1 
ATOM   5962 C CA  . TRP B 1 235 ? 0.483   -51.900 -20.286 1.00 41.72  ? 236 TRP B CA  1 
ATOM   5963 C C   . TRP B 1 235 ? -0.260  -52.324 -21.558 1.00 41.29  ? 236 TRP B C   1 
ATOM   5964 O O   . TRP B 1 235 ? 0.157   -51.999 -22.669 1.00 36.49  ? 236 TRP B O   1 
ATOM   5965 C CB  . TRP B 1 235 ? 1.762   -52.721 -20.166 1.00 39.55  ? 236 TRP B CB  1 
ATOM   5966 C CG  . TRP B 1 235 ? 1.467   -54.118 -19.728 1.00 42.11  ? 236 TRP B CG  1 
ATOM   5967 C CD1 . TRP B 1 235 ? 1.393   -54.572 -18.448 1.00 42.20  ? 236 TRP B CD1 1 
ATOM   5968 C CD2 . TRP B 1 235 ? 1.172   -55.238 -20.568 1.00 42.58  ? 236 TRP B CD2 1 
ATOM   5969 N NE1 . TRP B 1 235 ? 1.089   -55.906 -18.436 1.00 40.97  ? 236 TRP B NE1 1 
ATOM   5970 C CE2 . TRP B 1 235 ? 0.941   -56.340 -19.726 1.00 41.23  ? 236 TRP B CE2 1 
ATOM   5971 C CE3 . TRP B 1 235 ? 1.098   -55.422 -21.952 1.00 46.81  ? 236 TRP B CE3 1 
ATOM   5972 C CZ2 . TRP B 1 235 ? 0.637   -57.608 -20.218 1.00 42.22  ? 236 TRP B CZ2 1 
ATOM   5973 C CZ3 . TRP B 1 235 ? 0.794   -56.675 -22.438 1.00 41.47  ? 236 TRP B CZ3 1 
ATOM   5974 C CH2 . TRP B 1 235 ? 0.568   -57.754 -21.574 1.00 39.90  ? 236 TRP B CH2 1 
ATOM   5975 N N   . ALA B 1 236 ? -1.352  -53.057 -21.389 1.00 30.67  ? 237 ALA B N   1 
ATOM   5976 C CA  . ALA B 1 236 ? -1.962  -53.754 -22.507 1.00 30.10  ? 237 ALA B CA  1 
ATOM   5977 C C   . ALA B 1 236 ? -2.919  -52.912 -23.336 1.00 36.82  ? 237 ALA B C   1 
ATOM   5978 O O   . ALA B 1 236 ? -3.314  -53.340 -24.423 1.00 43.32  ? 237 ALA B O   1 
ATOM   5979 C CB  . ALA B 1 236 ? -2.678  -54.985 -22.008 1.00 38.99  ? 237 ALA B CB  1 
ATOM   5980 N N   . THR B 1 237 ? -3.315  -51.741 -22.836 1.00 37.89  ? 238 THR B N   1 
ATOM   5981 C CA  . THR B 1 237 ? -4.212  -50.862 -23.595 1.00 40.29  ? 238 THR B CA  1 
ATOM   5982 C C   . THR B 1 237 ? -3.869  -49.389 -23.461 1.00 43.37  ? 238 THR B C   1 
ATOM   5983 O O   . THR B 1 237 ? -3.034  -48.989 -22.651 1.00 51.98  ? 238 THR B O   1 
ATOM   5984 C CB  . THR B 1 237 ? -5.702  -51.012 -23.184 1.00 39.92  ? 238 THR B CB  1 
ATOM   5985 O OG1 . THR B 1 237 ? -5.860  -50.667 -21.805 1.00 40.54  ? 238 THR B OG1 1 
ATOM   5986 C CG2 . THR B 1 237 ? -6.212  -52.423 -23.427 1.00 40.51  ? 238 THR B CG2 1 
ATOM   5987 N N   . VAL B 1 238 ? -4.546  -48.586 -24.271 1.00 42.88  ? 239 VAL B N   1 
ATOM   5988 C CA  . VAL B 1 238 ? -4.344  -47.150 -24.291 1.00 30.36  ? 239 VAL B CA  1 
ATOM   5989 C C   . VAL B 1 238 ? -5.651  -46.475 -24.711 1.00 45.86  ? 239 VAL B C   1 
ATOM   5990 O O   . VAL B 1 238 ? -6.475  -47.064 -25.436 1.00 35.99  ? 239 VAL B O   1 
ATOM   5991 C CB  . VAL B 1 238 ? -3.194  -46.762 -25.240 1.00 32.56  ? 239 VAL B CB  1 
ATOM   5992 C CG1 . VAL B 1 238 ? -3.603  -46.946 -26.708 1.00 31.61  ? 239 VAL B CG1 1 
ATOM   5993 C CG2 . VAL B 1 238 ? -2.727  -45.355 -24.963 1.00 33.50  ? 239 VAL B CG2 1 
ATOM   5994 N N   . GLY B 1 239 ? -5.861  -45.255 -24.225 1.00 32.78  ? 240 GLY B N   1 
ATOM   5995 C CA  . GLY B 1 239 ? -7.051  -44.504 -24.578 1.00 41.15  ? 240 GLY B CA  1 
ATOM   5996 C C   . GLY B 1 239 ? -6.932  -43.858 -25.945 1.00 41.65  ? 240 GLY B C   1 
ATOM   5997 O O   . GLY B 1 239 ? -5.821  -43.667 -26.461 1.00 32.63  ? 240 GLY B O   1 
ATOM   5998 N N   . MET B 1 240 ? -8.079  -43.504 -26.522 1.00 37.87  ? 241 MET B N   1 
ATOM   5999 C CA  . MET B 1 240 ? -8.128  -42.907 -27.857 1.00 40.42  ? 241 MET B CA  1 
ATOM   6000 C C   . MET B 1 240 ? -7.244  -41.676 -28.016 1.00 32.94  ? 241 MET B C   1 
ATOM   6001 O O   . MET B 1 240 ? -6.451  -41.601 -28.944 1.00 37.83  ? 241 MET B O   1 
ATOM   6002 C CB  . MET B 1 240 ? -9.567  -42.553 -28.219 1.00 37.92  ? 241 MET B CB  1 
ATOM   6003 C CG  . MET B 1 240 ? -10.320 -43.695 -28.853 1.00 50.88  ? 241 MET B CG  1 
ATOM   6004 S SD  . MET B 1 240 ? -12.019 -43.270 -29.212 1.00 57.44  ? 241 MET B SD  1 
ATOM   6005 C CE  . MET B 1 240 ? -12.670 -43.144 -27.545 1.00 59.11  ? 241 MET B CE  1 
ATOM   6006 N N   . GLY B 1 241 ? -7.381  -40.717 -27.110 1.00 38.57  ? 242 GLY B N   1 
ATOM   6007 C CA  . GLY B 1 241 ? -6.626  -39.487 -27.202 1.00 33.37  ? 242 GLY B CA  1 
ATOM   6008 C C   . GLY B 1 241 ? -5.141  -39.740 -27.091 1.00 43.36  ? 242 GLY B C   1 
ATOM   6009 O O   . GLY B 1 241 ? -4.340  -39.135 -27.815 1.00 41.35  ? 242 GLY B O   1 
ATOM   6010 N N   . GLU B 1 242 ? -4.760  -40.642 -26.191 1.00 38.64  ? 243 GLU B N   1 
ATOM   6011 C CA  . GLU B 1 242 ? -3.345  -40.902 -25.989 1.00 38.17  ? 243 GLU B CA  1 
ATOM   6012 C C   . GLU B 1 242 ? -2.759  -41.656 -27.189 1.00 44.17  ? 243 GLU B C   1 
ATOM   6013 O O   . GLU B 1 242 ? -1.619  -41.403 -27.590 1.00 36.17  ? 243 GLU B O   1 
ATOM   6014 C CB  . GLU B 1 242 ? -3.115  -41.667 -24.686 1.00 39.70  ? 243 GLU B CB  1 
ATOM   6015 C CG  . GLU B 1 242 ? -1.644  -42.017 -24.393 1.00 41.66  ? 243 GLU B CG  1 
ATOM   6016 C CD  . GLU B 1 242 ? -0.737  -40.805 -24.214 1.00 50.17  ? 243 GLU B CD  1 
ATOM   6017 O OE1 . GLU B 1 242 ? -1.247  -39.679 -23.997 1.00 60.16  ? 243 GLU B OE1 1 
ATOM   6018 O OE2 . GLU B 1 242 ? 0.499   -40.990 -24.281 1.00 50.32  ? 243 GLU B OE2 1 
ATOM   6019 N N   . ALA B 1 243 ? -3.546  -42.564 -27.766 1.00 31.84  ? 244 ALA B N   1 
ATOM   6020 C CA  . ALA B 1 243 ? -3.155  -43.228 -29.006 1.00 37.27  ? 244 ALA B CA  1 
ATOM   6021 C C   . ALA B 1 243 ? -2.835  -42.202 -30.093 1.00 45.16  ? 244 ALA B C   1 
ATOM   6022 O O   . ALA B 1 243 ? -1.800  -42.281 -30.770 1.00 43.20  ? 244 ALA B O   1 
ATOM   6023 C CB  . ALA B 1 243 ? -4.250  -44.169 -29.480 1.00 33.96  ? 244 ALA B CB  1 
ATOM   6024 N N   . ARG B 1 244 ? -3.725  -41.229 -30.250 1.00 41.40  ? 245 ARG B N   1 
ATOM   6025 C CA  . ARG B 1 244 ? -3.561  -40.240 -31.296 1.00 43.44  ? 245 ARG B CA  1 
ATOM   6026 C C   . ARG B 1 244 ? -2.315  -39.397 -31.055 1.00 41.24  ? 245 ARG B C   1 
ATOM   6027 O O   . ARG B 1 244 ? -1.571  -39.090 -31.987 1.00 43.79  ? 245 ARG B O   1 
ATOM   6028 C CB  . ARG B 1 244 ? -4.799  -39.355 -31.397 1.00 40.54  ? 245 ARG B CB  1 
ATOM   6029 C CG  . ARG B 1 244 ? -4.629  -38.215 -32.387 1.00 43.94  ? 245 ARG B CG  1 
ATOM   6030 C CD  . ARG B 1 244 ? -5.950  -37.545 -32.679 1.00 42.21  ? 245 ARG B CD  1 
ATOM   6031 N NE  . ARG B 1 244 ? -6.832  -38.378 -33.489 1.00 44.09  ? 245 ARG B NE  1 
ATOM   6032 C CZ  . ARG B 1 244 ? -6.805  -38.420 -34.819 1.00 46.21  ? 245 ARG B CZ  1 
ATOM   6033 N NH1 . ARG B 1 244 ? -5.928  -37.682 -35.497 1.00 36.87  ? 245 ARG B NH1 1 
ATOM   6034 N NH2 . ARG B 1 244 ? -7.657  -39.203 -35.471 1.00 39.77  ? 245 ARG B NH2 1 
ATOM   6035 N N   . ARG B 1 245 ? -2.083  -39.031 -29.803 1.00 40.11  ? 246 ARG B N   1 
ATOM   6036 C CA  . ARG B 1 245 ? -0.907  -38.244 -29.465 1.00 44.78  ? 246 ARG B CA  1 
ATOM   6037 C C   . ARG B 1 245 ? 0.359   -38.996 -29.860 1.00 47.56  ? 246 ARG B C   1 
ATOM   6038 O O   . ARG B 1 245 ? 1.285   -38.421 -30.441 1.00 46.85  ? 246 ARG B O   1 
ATOM   6039 C CB  . ARG B 1 245 ? -0.884  -37.915 -27.969 1.00 50.15  ? 246 ARG B CB  1 
ATOM   6040 C CG  . ARG B 1 245 ? 0.134   -36.847 -27.590 1.00 42.40  ? 246 ARG B CG  1 
ATOM   6041 C CD  . ARG B 1 245 ? 0.322   -36.785 -26.090 1.00 50.82  ? 246 ARG B CD  1 
ATOM   6042 N NE  . ARG B 1 245 ? 0.939   -38.008 -25.586 1.00 68.43  ? 246 ARG B NE  1 
ATOM   6043 C CZ  . ARG B 1 245 ? 2.250   -38.245 -25.587 1.00 68.41  ? 246 ARG B CZ  1 
ATOM   6044 N NH1 . ARG B 1 245 ? 3.096   -37.340 -26.062 1.00 60.19  ? 246 ARG B NH1 1 
ATOM   6045 N NH2 . ARG B 1 245 ? 2.715   -39.395 -25.116 1.00 71.25  ? 246 ARG B NH2 1 
ATOM   6046 N N   . ARG B 1 246 ? 0.381   -40.290 -29.545 1.00 45.70  ? 247 ARG B N   1 
ATOM   6047 C CA  . ARG B 1 246 ? 1.527   -41.140 -29.842 1.00 44.40  ? 247 ARG B CA  1 
ATOM   6048 C C   . ARG B 1 246 ? 1.731   -41.321 -31.353 1.00 47.12  ? 247 ARG B C   1 
ATOM   6049 O O   . ARG B 1 246 ? 2.847   -41.174 -31.852 1.00 36.96  ? 247 ARG B O   1 
ATOM   6050 C CB  . ARG B 1 246 ? 1.361   -42.490 -29.155 1.00 38.71  ? 247 ARG B CB  1 
ATOM   6051 C CG  . ARG B 1 246 ? 1.440   -42.407 -27.644 1.00 40.30  ? 247 ARG B CG  1 
ATOM   6052 C CD  . ARG B 1 246 ? 1.142   -43.745 -27.000 1.00 40.16  ? 247 ARG B CD  1 
ATOM   6053 N NE  . ARG B 1 246 ? 1.247   -43.671 -25.551 1.00 40.32  ? 247 ARG B NE  1 
ATOM   6054 C CZ  . ARG B 1 246 ? 1.034   -44.690 -24.726 1.00 50.66  ? 247 ARG B CZ  1 
ATOM   6055 N NH1 . ARG B 1 246 ? 0.702   -45.886 -25.198 1.00 44.92  ? 247 ARG B NH1 1 
ATOM   6056 N NH2 . ARG B 1 246 ? 1.158   -44.511 -23.419 1.00 48.48  ? 247 ARG B NH2 1 
ATOM   6057 N N   . ALA B 1 247 ? 0.650   -41.630 -32.068 1.00 37.54  ? 248 ALA B N   1 
ATOM   6058 C CA  . ALA B 1 247 ? 0.687   -41.747 -33.521 1.00 37.73  ? 248 ALA B CA  1 
ATOM   6059 C C   . ALA B 1 247 ? 1.208   -40.464 -34.157 1.00 39.11  ? 248 ALA B C   1 
ATOM   6060 O O   . ALA B 1 247 ? 2.060   -40.497 -35.045 1.00 38.29  ? 248 ALA B O   1 
ATOM   6061 C CB  . ALA B 1 247 ? -0.696  -42.090 -34.063 1.00 33.10  ? 248 ALA B CB  1 
ATOM   6062 N N   . THR B 1 248 ? 0.703   -39.333 -33.683 1.00 47.01  ? 249 THR B N   1 
ATOM   6063 C CA  . THR B 1 248 ? 1.074   -38.033 -34.231 1.00 48.17  ? 249 THR B CA  1 
ATOM   6064 C C   . THR B 1 248 ? 2.549   -37.730 -33.962 1.00 40.36  ? 249 THR B C   1 
ATOM   6065 O O   . THR B 1 248 ? 3.259   -37.227 -34.830 1.00 54.28  ? 249 THR B O   1 
ATOM   6066 C CB  . THR B 1 248 ? 0.160   -36.914 -33.655 1.00 42.65  ? 249 THR B CB  1 
ATOM   6067 O OG1 . THR B 1 248 ? -1.142  -37.017 -34.249 1.00 49.34  ? 249 THR B OG1 1 
ATOM   6068 C CG2 . THR B 1 248 ? 0.713   -35.533 -33.938 1.00 43.03  ? 249 THR B CG2 1 
ATOM   6069 N N   . GLN B 1 249 ? 3.021   -38.067 -32.770 1.00 46.45  ? 250 GLN B N   1 
ATOM   6070 C CA  . GLN B 1 249 ? 4.416   -37.833 -32.422 1.00 47.72  ? 250 GLN B CA  1 
ATOM   6071 C C   . GLN B 1 249 ? 5.369   -38.679 -33.279 1.00 50.35  ? 250 GLN B C   1 
ATOM   6072 O O   . GLN B 1 249 ? 6.422   -38.201 -33.698 1.00 45.85  ? 250 GLN B O   1 
ATOM   6073 C CB  . GLN B 1 249 ? 4.636   -38.107 -30.928 1.00 47.80  ? 250 GLN B CB  1 
ATOM   6074 C CG  . GLN B 1 249 ? 6.063   -37.871 -30.423 1.00 57.03  ? 250 GLN B CG  1 
ATOM   6075 C CD  . GLN B 1 249 ? 6.593   -36.459 -30.685 1.00 67.93  ? 250 GLN B CD  1 
ATOM   6076 O OE1 . GLN B 1 249 ? 5.842   -35.538 -31.025 1.00 72.21  ? 250 GLN B OE1 1 
ATOM   6077 N NE2 . GLN B 1 249 ? 7.901   -36.290 -30.523 1.00 65.80  ? 250 GLN B NE2 1 
ATOM   6078 N N   . LEU B 1 250 ? 4.997   -39.930 -33.544 1.00 48.02  ? 251 LEU B N   1 
ATOM   6079 C CA  . LEU B 1 250 ? 5.820   -40.795 -34.380 1.00 46.38  ? 251 LEU B CA  1 
ATOM   6080 C C   . LEU B 1 250 ? 5.903   -40.205 -35.767 1.00 46.54  ? 251 LEU B C   1 
ATOM   6081 O O   . LEU B 1 250 ? 6.981   -40.136 -36.357 1.00 45.14  ? 251 LEU B O   1 
ATOM   6082 C CB  . LEU B 1 250 ? 5.262   -42.220 -34.456 1.00 44.43  ? 251 LEU B CB  1 
ATOM   6083 C CG  . LEU B 1 250 ? 5.903   -43.051 -35.576 1.00 35.67  ? 251 LEU B CG  1 
ATOM   6084 C CD1 . LEU B 1 250 ? 7.355   -43.318 -35.269 1.00 39.59  ? 251 LEU B CD1 1 
ATOM   6085 C CD2 . LEU B 1 250 ? 5.176   -44.344 -35.809 1.00 39.24  ? 251 LEU B CD2 1 
ATOM   6086 N N   . ALA B 1 251 ? 4.747   -39.790 -36.279 1.00 48.65  ? 252 ALA B N   1 
ATOM   6087 C CA  . ALA B 1 251 ? 4.663   -39.129 -37.574 1.00 49.27  ? 252 ALA B CA  1 
ATOM   6088 C C   . ALA B 1 251 ? 5.590   -37.916 -37.604 1.00 55.56  ? 252 ALA B C   1 
ATOM   6089 O O   . ALA B 1 251 ? 6.370   -37.737 -38.542 1.00 47.50  ? 252 ALA B O   1 
ATOM   6090 C CB  . ALA B 1 251 ? 3.236   -38.722 -37.866 1.00 42.47  ? 252 ALA B CB  1 
ATOM   6091 N N   . HIS B 1 252 ? 5.522   -37.101 -36.557 1.00 47.77  ? 253 HIS B N   1 
ATOM   6092 C CA  . HIS B 1 252 ? 6.380   -35.933 -36.471 1.00 52.25  ? 253 HIS B CA  1 
ATOM   6093 C C   . HIS B 1 252 ? 7.862   -36.330 -36.523 1.00 56.74  ? 253 HIS B C   1 
ATOM   6094 O O   . HIS B 1 252 ? 8.648   -35.714 -37.241 1.00 59.62  ? 253 HIS B O   1 
ATOM   6095 C CB  . HIS B 1 252 ? 6.078   -35.135 -35.198 1.00 60.81  ? 253 HIS B CB  1 
ATOM   6096 C CG  . HIS B 1 252 ? 6.861   -33.863 -35.088 1.00 73.76  ? 253 HIS B CG  1 
ATOM   6097 N ND1 . HIS B 1 252 ? 6.532   -32.723 -35.791 1.00 73.46  ? 253 HIS B ND1 1 
ATOM   6098 C CD2 . HIS B 1 252 ? 7.973   -33.559 -34.375 1.00 71.78  ? 253 HIS B CD2 1 
ATOM   6099 C CE1 . HIS B 1 252 ? 7.404   -31.770 -35.511 1.00 76.95  ? 253 HIS B CE1 1 
ATOM   6100 N NE2 . HIS B 1 252 ? 8.290   -32.252 -34.656 1.00 74.45  ? 253 HIS B NE2 1 
ATOM   6101 N N   . LEU B 1 253 ? 8.234   -37.377 -35.791 1.00 52.84  ? 254 LEU B N   1 
ATOM   6102 C CA  . LEU B 1 253 ? 9.637   -37.771 -35.689 1.00 51.14  ? 254 LEU B CA  1 
ATOM   6103 C C   . LEU B 1 253 ? 10.232  -38.272 -37.001 1.00 52.44  ? 254 LEU B C   1 
ATOM   6104 O O   . LEU B 1 253 ? 11.448  -38.418 -37.101 1.00 57.43  ? 254 LEU B O   1 
ATOM   6105 C CB  . LEU B 1 253 ? 9.817   -38.847 -34.616 1.00 50.87  ? 254 LEU B CB  1 
ATOM   6106 C CG  . LEU B 1 253 ? 9.768   -38.391 -33.155 1.00 58.37  ? 254 LEU B CG  1 
ATOM   6107 C CD1 . LEU B 1 253 ? 9.889   -39.584 -32.208 1.00 51.79  ? 254 LEU B CD1 1 
ATOM   6108 C CD2 . LEU B 1 253 ? 10.853  -37.364 -32.878 1.00 45.09  ? 254 LEU B CD2 1 
ATOM   6109 N N   . VAL B 1 254 ? 9.386   -38.541 -37.994 1.00 48.21  ? 255 VAL B N   1 
ATOM   6110 C CA  . VAL B 1 254 ? 9.860   -39.010 -39.295 1.00 46.58  ? 255 VAL B CA  1 
ATOM   6111 C C   . VAL B 1 254 ? 9.502   -38.018 -40.403 1.00 61.49  ? 255 VAL B C   1 
ATOM   6112 O O   . VAL B 1 254 ? 9.554   -38.348 -41.591 1.00 64.51  ? 255 VAL B O   1 
ATOM   6113 C CB  . VAL B 1 254 ? 9.291   -40.410 -39.651 1.00 47.18  ? 255 VAL B CB  1 
ATOM   6114 C CG1 . VAL B 1 254 ? 9.768   -41.456 -38.654 1.00 42.31  ? 255 VAL B CG1 1 
ATOM   6115 C CG2 . VAL B 1 254 ? 7.766   -40.386 -39.731 1.00 49.40  ? 255 VAL B CG2 1 
ATOM   6116 N N   . GLY B 1 255 ? 9.135   -36.803 -40.002 1.00 62.20  ? 256 GLY B N   1 
ATOM   6117 C CA  . GLY B 1 255 ? 8.873   -35.721 -40.933 1.00 50.08  ? 256 GLY B CA  1 
ATOM   6118 C C   . GLY B 1 255 ? 7.504   -35.736 -41.584 1.00 55.08  ? 256 GLY B C   1 
ATOM   6119 O O   . GLY B 1 255 ? 7.356   -35.282 -42.711 1.00 71.04  ? 256 GLY B O   1 
ATOM   6120 N N   . CYS B 1 256 ? 6.504   -36.241 -40.873 1.00 58.82  ? 257 CYS B N   1 
ATOM   6121 C CA  . CYS B 1 256 ? 5.147   -36.353 -41.403 1.00 58.16  ? 257 CYS B CA  1 
ATOM   6122 C C   . CYS B 1 256 ? 4.122   -35.580 -40.580 1.00 64.77  ? 257 CYS B C   1 
ATOM   6123 O O   . CYS B 1 256 ? 3.907   -35.887 -39.414 1.00 78.28  ? 257 CYS B O   1 
ATOM   6124 C CB  . CYS B 1 256 ? 4.724   -37.821 -41.468 1.00 53.51  ? 257 CYS B CB  1 
ATOM   6125 S SG  . CYS B 1 256 ? 5.292   -38.696 -42.912 1.00 77.24  ? 257 CYS B SG  1 
ATOM   6126 N N   . PRO B 1 257 ? 3.472   -34.577 -41.187 1.00 84.78  ? 258 PRO B N   1 
ATOM   6127 C CA  . PRO B 1 257 ? 3.711   -34.089 -42.547 1.00 81.52  ? 258 PRO B CA  1 
ATOM   6128 C C   . PRO B 1 257 ? 4.811   -33.027 -42.531 1.00 78.46  ? 258 PRO B C   1 
ATOM   6129 O O   . PRO B 1 257 ? 5.223   -32.619 -41.438 1.00 75.19  ? 258 PRO B O   1 
ATOM   6130 C CB  . PRO B 1 257 ? 2.357   -33.499 -42.937 1.00 75.12  ? 258 PRO B CB  1 
ATOM   6131 C CG  . PRO B 1 257 ? 1.842   -32.950 -41.638 1.00 76.11  ? 258 PRO B CG  1 
ATOM   6132 C CD  . PRO B 1 257 ? 2.340   -33.876 -40.551 1.00 76.00  ? 258 PRO B CD  1 
ATOM   6133 N N   . PRO B 1 258 ? 5.295   -32.593 -43.711 1.00 88.01  ? 259 PRO B N   1 
ATOM   6134 C CA  . PRO B 1 258 ? 6.346   -31.570 -43.701 1.00 86.89  ? 259 PRO B CA  1 
ATOM   6135 C C   . PRO B 1 258 ? 5.789   -30.154 -43.871 1.00 75.06  ? 259 PRO B C   1 
ATOM   6136 O O   . PRO B 1 258 ? 5.794   -29.388 -42.901 1.00 73.93  ? 259 PRO B O   1 
ATOM   6137 C CB  . PRO B 1 258 ? 7.230   -31.971 -44.890 1.00 76.59  ? 259 PRO B CB  1 
ATOM   6138 C CG  . PRO B 1 258 ? 6.325   -32.838 -45.795 1.00 73.59  ? 259 PRO B CG  1 
ATOM   6139 C CD  . PRO B 1 258 ? 5.010   -33.060 -45.080 1.00 75.06  ? 259 PRO B CD  1 
ATOM   6140 N N   . THR B 1 261 ? 2.416   -30.782 -37.797 1.00 70.73  ? 262 THR B N   1 
ATOM   6141 C CA  . THR B 1 261 ? 1.887   -31.784 -36.869 1.00 90.62  ? 262 THR B CA  1 
ATOM   6142 C C   . THR B 1 261 ? 0.406   -32.069 -37.127 1.00 75.64  ? 262 THR B C   1 
ATOM   6143 O O   . THR B 1 261 ? -0.395  -31.146 -37.269 1.00 81.93  ? 262 THR B O   1 
ATOM   6144 C CB  . THR B 1 261 ? 2.054   -31.347 -35.391 1.00 87.68  ? 262 THR B CB  1 
ATOM   6145 O OG1 . THR B 1 261 ? 2.873   -30.171 -35.318 1.00 95.48  ? 262 THR B OG1 1 
ATOM   6146 C CG2 . THR B 1 261 ? 2.681   -32.467 -34.562 1.00 75.20  ? 262 THR B CG2 1 
ATOM   6147 N N   . GLY B 1 262 ? 0.047   -33.346 -37.188 1.00 66.55  ? 263 GLY B N   1 
ATOM   6148 C CA  . GLY B 1 262 ? -1.334  -33.734 -37.414 1.00 61.68  ? 263 GLY B CA  1 
ATOM   6149 C C   . GLY B 1 262 ? -1.880  -33.338 -38.776 1.00 70.25  ? 263 GLY B C   1 
ATOM   6150 O O   . GLY B 1 262 ? -1.306  -33.681 -39.820 1.00 70.13  ? 263 GLY B O   1 
ATOM   6151 N N   . GLY B 1 263 ? -2.996  -32.608 -38.759 1.00 71.39  ? 264 GLY B N   1 
ATOM   6152 C CA  . GLY B 1 263 ? -3.695  -32.211 -39.969 1.00 62.52  ? 264 GLY B CA  1 
ATOM   6153 C C   . GLY B 1 263 ? -4.666  -33.286 -40.425 1.00 66.90  ? 264 GLY B C   1 
ATOM   6154 O O   . GLY B 1 263 ? -5.131  -34.092 -39.616 1.00 64.64  ? 264 GLY B O   1 
ATOM   6155 N N   . ASN B 1 264 ? -4.977  -33.286 -41.721 1.00 73.29  ? 265 ASN B N   1 
ATOM   6156 C CA  . ASN B 1 264 ? -5.796  -34.322 -42.352 1.00 72.78  ? 265 ASN B CA  1 
ATOM   6157 C C   . ASN B 1 264 ? -5.197  -35.700 -42.040 1.00 68.95  ? 265 ASN B C   1 
ATOM   6158 O O   . ASN B 1 264 ? -3.988  -35.905 -42.210 1.00 60.96  ? 265 ASN B O   1 
ATOM   6159 C CB  . ASN B 1 264 ? -5.876  -34.057 -43.869 1.00 64.17  ? 265 ASN B CB  1 
ATOM   6160 C CG  . ASN B 1 264 ? -6.862  -34.981 -44.620 1.00 76.28  ? 265 ASN B CG  1 
ATOM   6161 O OD1 . ASN B 1 264 ? -7.376  -35.971 -44.085 1.00 72.92  ? 265 ASN B OD1 1 
ATOM   6162 N ND2 . ASN B 1 264 ? -7.115  -34.631 -45.893 1.00 86.26  ? 265 ASN B ND2 1 
ATOM   6163 N N   . ASP B 1 265 ? -6.025  -36.623 -41.547 1.00 54.27  ? 266 ASP B N   1 
ATOM   6164 C CA  . ASP B 1 265 ? -5.554  -37.970 -41.232 1.00 52.11  ? 266 ASP B CA  1 
ATOM   6165 C C   . ASP B 1 265 ? -5.094  -38.698 -42.489 1.00 62.52  ? 266 ASP B C   1 
ATOM   6166 O O   . ASP B 1 265 ? -4.044  -39.348 -42.492 1.00 56.44  ? 266 ASP B O   1 
ATOM   6167 C CB  . ASP B 1 265 ? -6.638  -38.787 -40.529 1.00 47.30  ? 266 ASP B CB  1 
ATOM   6168 C CG  . ASP B 1 265 ? -6.634  -38.591 -39.022 1.00 57.23  ? 266 ASP B CG  1 
ATOM   6169 O OD1 . ASP B 1 265 ? -5.624  -38.072 -38.485 1.00 45.47  ? 266 ASP B OD1 1 
ATOM   6170 O OD2 . ASP B 1 265 ? -7.641  -38.960 -38.376 1.00 51.35  ? 266 ASP B OD2 1 
ATOM   6171 N N   . THR B 1 266 ? -5.887  -38.581 -43.552 1.00 63.29  ? 267 THR B N   1 
ATOM   6172 C CA  . THR B 1 266 ? -5.585  -39.241 -44.815 1.00 57.00  ? 267 THR B CA  1 
ATOM   6173 C C   . THR B 1 266 ? -4.208  -38.846 -45.336 1.00 57.49  ? 267 THR B C   1 
ATOM   6174 O O   . THR B 1 266 ? -3.429  -39.701 -45.743 1.00 59.03  ? 267 THR B O   1 
ATOM   6175 C CB  . THR B 1 266 ? -6.633  -38.918 -45.887 1.00 62.37  ? 267 THR B CB  1 
ATOM   6176 O OG1 . THR B 1 266 ? -7.943  -38.975 -45.309 1.00 70.52  ? 267 THR B OG1 1 
ATOM   6177 C CG2 . THR B 1 266 ? -6.548  -39.922 -47.023 1.00 64.97  ? 267 THR B CG2 1 
ATOM   6178 N N   . GLU B 1 267 ? -3.905  -37.556 -45.306 1.00 54.21  ? 268 GLU B N   1 
ATOM   6179 C CA  . GLU B 1 267 ? -2.616  -37.081 -45.783 1.00 59.95  ? 268 GLU B CA  1 
ATOM   6180 C C   . GLU B 1 267 ? -1.479  -37.507 -44.869 1.00 53.24  ? 268 GLU B C   1 
ATOM   6181 O O   . GLU B 1 267 ? -0.386  -37.827 -45.340 1.00 65.07  ? 268 GLU B O   1 
ATOM   6182 C CB  . GLU B 1 267 ? -2.628  -35.559 -45.935 1.00 69.83  ? 268 GLU B CB  1 
ATOM   6183 C CG  . GLU B 1 267 ? -3.333  -35.089 -47.202 1.00 88.32  ? 268 GLU B CG  1 
ATOM   6184 C CD  . GLU B 1 267 ? -3.414  -33.575 -47.310 1.00 111.70 ? 268 GLU B CD  1 
ATOM   6185 O OE1 . GLU B 1 267 ? -2.991  -32.885 -46.352 1.00 108.03 ? 268 GLU B OE1 1 
ATOM   6186 O OE2 . GLU B 1 267 ? -3.901  -33.080 -48.354 1.00 107.33 ? 268 GLU B OE2 1 
ATOM   6187 N N   . LEU B 1 268 ? -1.738  -37.514 -43.566 1.00 59.46  ? 269 LEU B N   1 
ATOM   6188 C CA  . LEU B 1 268 ? -0.732  -37.908 -42.587 1.00 55.15  ? 269 LEU B CA  1 
ATOM   6189 C C   . LEU B 1 268 ? -0.356  -39.376 -42.751 1.00 51.18  ? 269 LEU B C   1 
ATOM   6190 O O   . LEU B 1 268 ? 0.827   -39.715 -42.814 1.00 49.40  ? 269 LEU B O   1 
ATOM   6191 C CB  . LEU B 1 268 ? -1.236  -37.650 -41.165 1.00 57.45  ? 269 LEU B CB  1 
ATOM   6192 C CG  . LEU B 1 268 ? -0.230  -37.612 -40.012 1.00 48.01  ? 269 LEU B CG  1 
ATOM   6193 C CD1 . LEU B 1 268 ? -0.874  -36.946 -38.849 1.00 58.28  ? 269 LEU B CD1 1 
ATOM   6194 C CD2 . LEU B 1 268 ? 0.184   -38.992 -39.596 1.00 60.65  ? 269 LEU B CD2 1 
ATOM   6195 N N   . VAL B 1 269 ? -1.364  -40.241 -42.802 1.00 42.24  ? 270 VAL B N   1 
ATOM   6196 C CA  . VAL B 1 269 ? -1.115  -41.660 -42.956 1.00 49.27  ? 270 VAL B CA  1 
ATOM   6197 C C   . VAL B 1 269 ? -0.438  -41.922 -44.299 1.00 48.98  ? 270 VAL B C   1 
ATOM   6198 O O   . VAL B 1 269 ? 0.506   -42.705 -44.375 1.00 52.11  ? 270 VAL B O   1 
ATOM   6199 C CB  . VAL B 1 269 ? -2.417  -42.489 -42.841 1.00 54.56  ? 270 VAL B CB  1 
ATOM   6200 C CG1 . VAL B 1 269 ? -2.170  -43.937 -43.249 1.00 46.34  ? 270 VAL B CG1 1 
ATOM   6201 C CG2 . VAL B 1 269 ? -2.957  -42.431 -41.425 1.00 46.37  ? 270 VAL B CG2 1 
ATOM   6202 N N   . ALA B 1 270 ? -0.904  -41.248 -45.345 1.00 51.57  ? 271 ALA B N   1 
ATOM   6203 C CA  . ALA B 1 270 ? -0.327  -41.400 -46.679 1.00 49.71  ? 271 ALA B CA  1 
ATOM   6204 C C   . ALA B 1 270 ? 1.152   -41.064 -46.666 1.00 44.97  ? 271 ALA B C   1 
ATOM   6205 O O   . ALA B 1 270 ? 1.957   -41.736 -47.305 1.00 50.83  ? 271 ALA B O   1 
ATOM   6206 C CB  . ALA B 1 270 ? -1.049  -40.531 -47.679 1.00 40.79  ? 271 ALA B CB  1 
ATOM   6207 N N   . CYS B 1 271 ? 1.514   -40.027 -45.929 1.00 41.26  ? 272 CYS B N   1 
ATOM   6208 C CA  . CYS B 1 271 ? 2.916   -39.687 -45.794 1.00 45.84  ? 272 CYS B CA  1 
ATOM   6209 C C   . CYS B 1 271 ? 3.661   -40.795 -45.033 1.00 56.35  ? 272 CYS B C   1 
ATOM   6210 O O   . CYS B 1 271 ? 4.783   -41.161 -45.397 1.00 52.85  ? 272 CYS B O   1 
ATOM   6211 C CB  . CYS B 1 271 ? 3.067   -38.332 -45.098 1.00 48.33  ? 272 CYS B CB  1 
ATOM   6212 S SG  . CYS B 1 271 ? 4.771   -37.866 -44.714 1.00 80.49  ? 272 CYS B SG  1 
ATOM   6213 N N   . LEU B 1 272 ? 3.029   -41.332 -43.988 1.00 53.22  ? 273 LEU B N   1 
ATOM   6214 C CA  . LEU B 1 272 ? 3.618   -42.416 -43.200 1.00 45.79  ? 273 LEU B CA  1 
ATOM   6215 C C   . LEU B 1 272 ? 3.868   -43.660 -44.051 1.00 54.84  ? 273 LEU B C   1 
ATOM   6216 O O   . LEU B 1 272 ? 4.849   -44.378 -43.845 1.00 53.30  ? 273 LEU B O   1 
ATOM   6217 C CB  . LEU B 1 272 ? 2.723   -42.781 -42.005 1.00 43.94  ? 273 LEU B CB  1 
ATOM   6218 C CG  . LEU B 1 272 ? 2.939   -42.016 -40.690 1.00 44.37  ? 273 LEU B CG  1 
ATOM   6219 C CD1 . LEU B 1 272 ? 2.013   -42.530 -39.615 1.00 40.87  ? 273 LEU B CD1 1 
ATOM   6220 C CD2 . LEU B 1 272 ? 4.370   -42.102 -40.220 1.00 38.50  ? 273 LEU B CD2 1 
ATOM   6221 N N   . ARG B 1 273 ? 2.987   -43.907 -45.014 1.00 48.15  ? 274 ARG B N   1 
ATOM   6222 C CA  . ARG B 1 273 ? 3.089   -45.099 -45.838 1.00 45.14  ? 274 ARG B CA  1 
ATOM   6223 C C   . ARG B 1 273 ? 4.297   -45.048 -46.777 1.00 50.83  ? 274 ARG B C   1 
ATOM   6224 O O   . ARG B 1 273 ? 4.711   -46.076 -47.322 1.00 55.51  ? 274 ARG B O   1 
ATOM   6225 C CB  . ARG B 1 273 ? 1.798   -45.305 -46.632 1.00 40.02  ? 274 ARG B CB  1 
ATOM   6226 C CG  . ARG B 1 273 ? 0.615   -45.695 -45.763 1.00 48.99  ? 274 ARG B CG  1 
ATOM   6227 C CD  . ARG B 1 273 ? -0.427  -46.494 -46.538 1.00 50.07  ? 274 ARG B CD  1 
ATOM   6228 N NE  . ARG B 1 273 ? -1.617  -45.708 -46.860 1.00 67.30  ? 274 ARG B NE  1 
ATOM   6229 C CZ  . ARG B 1 273 ? -2.805  -45.859 -46.274 1.00 67.60  ? 274 ARG B CZ  1 
ATOM   6230 N NH1 . ARG B 1 273 ? -2.986  -46.778 -45.325 1.00 50.69  ? 274 ARG B NH1 1 
ATOM   6231 N NH2 . ARG B 1 273 ? -3.821  -45.089 -46.644 1.00 65.80  ? 274 ARG B NH2 1 
ATOM   6232 N N   . THR B 1 274 ? 4.878   -43.866 -46.954 1.00 39.99  ? 275 THR B N   1 
ATOM   6233 C CA  . THR B 1 274 ? 6.004   -43.742 -47.871 1.00 52.70  ? 275 THR B CA  1 
ATOM   6234 C C   . THR B 1 274 ? 7.320   -43.930 -47.139 1.00 46.25  ? 275 THR B C   1 
ATOM   6235 O O   . THR B 1 274 ? 8.371   -44.042 -47.765 1.00 49.80  ? 275 THR B O   1 
ATOM   6236 C CB  . THR B 1 274 ? 6.028   -42.370 -48.616 1.00 43.50  ? 275 THR B CB  1 
ATOM   6237 O OG1 . THR B 1 274 ? 6.414   -41.319 -47.716 1.00 46.12  ? 275 THR B OG1 1 
ATOM   6238 C CG2 . THR B 1 274 ? 4.677   -42.067 -49.245 1.00 38.98  ? 275 THR B CG2 1 
ATOM   6239 N N   . ARG B 1 275 ? 7.271   -43.959 -45.814 1.00 49.41  ? 276 ARG B N   1 
ATOM   6240 C CA  . ARG B 1 275 ? 8.487   -44.186 -45.035 1.00 48.84  ? 276 ARG B CA  1 
ATOM   6241 C C   . ARG B 1 275 ? 8.859   -45.669 -45.039 1.00 49.51  ? 276 ARG B C   1 
ATOM   6242 O O   . ARG B 1 275 ? 7.992   -46.536 -44.897 1.00 49.44  ? 276 ARG B O   1 
ATOM   6243 C CB  . ARG B 1 275 ? 8.312   -43.676 -43.607 1.00 45.20  ? 276 ARG B CB  1 
ATOM   6244 C CG  . ARG B 1 275 ? 8.126   -42.175 -43.520 1.00 43.13  ? 276 ARG B CG  1 
ATOM   6245 C CD  . ARG B 1 275 ? 9.374   -41.458 -43.987 1.00 51.02  ? 276 ARG B CD  1 
ATOM   6246 N NE  . ARG B 1 275 ? 9.287   -40.007 -43.832 1.00 59.36  ? 276 ARG B NE  1 
ATOM   6247 C CZ  . ARG B 1 275 ? 8.656   -39.202 -44.684 1.00 63.87  ? 276 ARG B CZ  1 
ATOM   6248 N NH1 . ARG B 1 275 ? 8.033   -39.706 -45.751 1.00 50.85  ? 276 ARG B NH1 1 
ATOM   6249 N NH2 . ARG B 1 275 ? 8.638   -37.893 -44.463 1.00 51.90  ? 276 ARG B NH2 1 
ATOM   6250 N N   . PRO B 1 276 ? 10.150  -45.968 -45.227 1.00 54.11  ? 277 PRO B N   1 
ATOM   6251 C CA  . PRO B 1 276 ? 10.606  -47.362 -45.205 1.00 50.77  ? 277 PRO B CA  1 
ATOM   6252 C C   . PRO B 1 276 ? 10.311  -47.997 -43.851 1.00 46.05  ? 277 PRO B C   1 
ATOM   6253 O O   . PRO B 1 276 ? 10.521  -47.334 -42.830 1.00 42.57  ? 277 PRO B O   1 
ATOM   6254 C CB  . PRO B 1 276 ? 12.114  -47.246 -45.444 1.00 43.41  ? 277 PRO B CB  1 
ATOM   6255 C CG  . PRO B 1 276 ? 12.297  -45.913 -46.086 1.00 42.64  ? 277 PRO B CG  1 
ATOM   6256 C CD  . PRO B 1 276 ? 11.258  -45.031 -45.472 1.00 45.21  ? 277 PRO B CD  1 
ATOM   6257 N N   . ALA B 1 277 ? 9.835   -49.241 -43.846 1.00 38.82  ? 278 ALA B N   1 
ATOM   6258 C CA  . ALA B 1 277 ? 9.423   -49.904 -42.613 1.00 38.29  ? 278 ALA B CA  1 
ATOM   6259 C C   . ALA B 1 277 ? 10.452  -49.745 -41.494 1.00 43.62  ? 278 ALA B C   1 
ATOM   6260 O O   . ALA B 1 277 ? 10.091  -49.460 -40.351 1.00 44.11  ? 278 ALA B O   1 
ATOM   6261 C CB  . ALA B 1 277 ? 9.151   -51.367 -42.868 1.00 37.53  ? 278 ALA B CB  1 
ATOM   6262 N N   . GLN B 1 278 ? 11.729  -49.892 -41.832 1.00 40.55  ? 279 GLN B N   1 
ATOM   6263 C CA  . GLN B 1 278 ? 12.796  -49.788 -40.840 1.00 43.51  ? 279 GLN B CA  1 
ATOM   6264 C C   . GLN B 1 278 ? 12.851  -48.419 -40.160 1.00 46.75  ? 279 GLN B C   1 
ATOM   6265 O O   . GLN B 1 278 ? 13.201  -48.313 -38.983 1.00 47.15  ? 279 GLN B O   1 
ATOM   6266 C CB  . GLN B 1 278 ? 14.151  -50.087 -41.481 1.00 46.75  ? 279 GLN B CB  1 
ATOM   6267 C CG  . GLN B 1 278 ? 15.251  -50.347 -40.458 1.00 53.66  ? 279 GLN B CG  1 
ATOM   6268 C CD  . GLN B 1 278 ? 14.944  -51.554 -39.574 1.00 61.73  ? 279 GLN B CD  1 
ATOM   6269 O OE1 . GLN B 1 278 ? 14.622  -52.641 -40.078 1.00 55.71  ? 279 GLN B OE1 1 
ATOM   6270 N NE2 . GLN B 1 278 ? 15.021  -51.363 -38.253 1.00 43.93  ? 279 GLN B NE2 1 
ATOM   6271 N N   . VAL B 1 279 ? 12.508  -47.373 -40.904 1.00 42.25  ? 280 VAL B N   1 
ATOM   6272 C CA  . VAL B 1 279 ? 12.544  -46.026 -40.357 1.00 45.32  ? 280 VAL B CA  1 
ATOM   6273 C C   . VAL B 1 279 ? 11.523  -45.905 -39.226 1.00 49.44  ? 280 VAL B C   1 
ATOM   6274 O O   . VAL B 1 279 ? 11.846  -45.403 -38.147 1.00 48.20  ? 280 VAL B O   1 
ATOM   6275 C CB  . VAL B 1 279 ? 12.282  -44.965 -41.449 1.00 47.80  ? 280 VAL B CB  1 
ATOM   6276 C CG1 . VAL B 1 279 ? 12.099  -43.587 -40.838 1.00 40.00  ? 280 VAL B CG1 1 
ATOM   6277 C CG2 . VAL B 1 279 ? 13.423  -44.957 -42.451 1.00 35.98  ? 280 VAL B CG2 1 
ATOM   6278 N N   . LEU B 1 280 ? 10.306  -46.392 -39.461 1.00 41.18  ? 281 LEU B N   1 
ATOM   6279 C CA  . LEU B 1 280 ? 9.290   -46.406 -38.414 1.00 44.17  ? 281 LEU B CA  1 
ATOM   6280 C C   . LEU B 1 280 ? 9.778   -47.143 -37.165 1.00 49.36  ? 281 LEU B C   1 
ATOM   6281 O O   . LEU B 1 280 ? 9.601   -46.657 -36.050 1.00 55.95  ? 281 LEU B O   1 
ATOM   6282 C CB  . LEU B 1 280 ? 7.990   -47.034 -38.923 1.00 41.32  ? 281 LEU B CB  1 
ATOM   6283 C CG  . LEU B 1 280 ? 7.319   -46.263 -40.061 1.00 46.26  ? 281 LEU B CG  1 
ATOM   6284 C CD1 . LEU B 1 280 ? 6.003   -46.901 -40.476 1.00 43.32  ? 281 LEU B CD1 1 
ATOM   6285 C CD2 . LEU B 1 280 ? 7.113   -44.822 -39.649 1.00 42.97  ? 281 LEU B CD2 1 
ATOM   6286 N N   . VAL B 1 281 ? 10.407  -48.300 -37.350 1.00 50.27  ? 282 VAL B N   1 
ATOM   6287 C CA  . VAL B 1 281 ? 10.871  -49.107 -36.221 1.00 50.12  ? 282 VAL B CA  1 
ATOM   6288 C C   . VAL B 1 281 ? 11.918  -48.379 -35.394 1.00 48.20  ? 282 VAL B C   1 
ATOM   6289 O O   . VAL B 1 281 ? 11.944  -48.499 -34.167 1.00 50.19  ? 282 VAL B O   1 
ATOM   6290 C CB  . VAL B 1 281 ? 11.464  -50.450 -36.687 1.00 45.62  ? 282 VAL B CB  1 
ATOM   6291 C CG1 . VAL B 1 281 ? 12.131  -51.162 -35.533 1.00 41.79  ? 282 VAL B CG1 1 
ATOM   6292 C CG2 . VAL B 1 281 ? 10.382  -51.323 -37.294 1.00 45.95  ? 282 VAL B CG2 1 
ATOM   6293 N N   . ASN B 1 282 ? 12.773  -47.612 -36.066 1.00 50.54  ? 283 ASN B N   1 
ATOM   6294 C CA  . ASN B 1 282 ? 13.875  -46.945 -35.387 1.00 45.21  ? 283 ASN B CA  1 
ATOM   6295 C C   . ASN B 1 282 ? 13.399  -45.775 -34.550 1.00 53.21  ? 283 ASN B C   1 
ATOM   6296 O O   . ASN B 1 282 ? 14.067  -45.381 -33.597 1.00 67.39  ? 283 ASN B O   1 
ATOM   6297 C CB  . ASN B 1 282 ? 14.925  -46.473 -36.390 1.00 54.04  ? 283 ASN B CB  1 
ATOM   6298 C CG  . ASN B 1 282 ? 15.636  -47.627 -37.072 1.00 61.49  ? 283 ASN B CG  1 
ATOM   6299 O OD1 . ASN B 1 282 ? 15.791  -48.706 -36.493 1.00 58.49  ? 283 ASN B OD1 1 
ATOM   6300 N ND2 . ASN B 1 282 ? 16.072  -47.408 -38.311 1.00 58.00  ? 283 ASN B ND2 1 
ATOM   6301 N N   . HIS B 1 283 ? 12.238  -45.227 -34.888 1.00 45.55  ? 284 HIS B N   1 
ATOM   6302 C CA  . HIS B 1 283 ? 11.733  -44.076 -34.153 1.00 55.44  ? 284 HIS B CA  1 
ATOM   6303 C C   . HIS B 1 283 ? 10.660  -44.461 -33.140 1.00 53.80  ? 284 HIS B C   1 
ATOM   6304 O O   . HIS B 1 283 ? 10.366  -43.717 -32.207 1.00 50.26  ? 284 HIS B O   1 
ATOM   6305 C CB  . HIS B 1 283 ? 11.220  -43.031 -35.137 1.00 48.93  ? 284 HIS B CB  1 
ATOM   6306 C CG  . HIS B 1 283 ? 12.319  -42.334 -35.878 1.00 54.64  ? 284 HIS B CG  1 
ATOM   6307 N ND1 . HIS B 1 283 ? 12.618  -42.602 -37.197 1.00 57.39  ? 284 HIS B ND1 1 
ATOM   6308 C CD2 . HIS B 1 283 ? 13.217  -41.407 -35.470 1.00 49.89  ? 284 HIS B CD2 1 
ATOM   6309 C CE1 . HIS B 1 283 ? 13.637  -41.852 -37.576 1.00 61.83  ? 284 HIS B CE1 1 
ATOM   6310 N NE2 . HIS B 1 283 ? 14.021  -41.120 -36.547 1.00 59.38  ? 284 HIS B NE2 1 
ATOM   6311 N N   . GLU B 1 284 ? 10.126  -45.660 -33.329 1.00 61.71  ? 285 GLU B N   1 
ATOM   6312 C CA  . GLU B 1 284 ? 9.037   -46.247 -32.549 1.00 50.86  ? 285 GLU B CA  1 
ATOM   6313 C C   . GLU B 1 284 ? 9.218   -46.223 -31.013 1.00 60.76  ? 285 GLU B C   1 
ATOM   6314 O O   . GLU B 1 284 ? 8.246   -46.115 -30.262 1.00 50.36  ? 285 GLU B O   1 
ATOM   6315 C CB  . GLU B 1 284 ? 8.867   -47.680 -33.048 1.00 49.27  ? 285 GLU B CB  1 
ATOM   6316 C CG  . GLU B 1 284 ? 7.689   -48.442 -32.553 1.00 59.50  ? 285 GLU B CG  1 
ATOM   6317 C CD  . GLU B 1 284 ? 7.634   -49.835 -33.158 1.00 65.06  ? 285 GLU B CD  1 
ATOM   6318 O OE1 . GLU B 1 284 ? 6.690   -50.090 -33.939 1.00 65.80  ? 285 GLU B OE1 1 
ATOM   6319 O OE2 . GLU B 1 284 ? 8.538   -50.663 -32.865 1.00 55.70  ? 285 GLU B OE2 1 
ATOM   6320 N N   . TRP B 1 285 ? 10.460  -46.319 -30.550 1.00 63.32  ? 286 TRP B N   1 
ATOM   6321 C CA  . TRP B 1 285 ? 10.727  -46.367 -29.115 1.00 55.93  ? 286 TRP B CA  1 
ATOM   6322 C C   . TRP B 1 285 ? 11.040  -45.001 -28.504 1.00 59.11  ? 286 TRP B C   1 
ATOM   6323 O O   . TRP B 1 285 ? 11.414  -44.914 -27.338 1.00 62.36  ? 286 TRP B O   1 
ATOM   6324 C CB  . TRP B 1 285 ? 11.887  -47.318 -28.827 1.00 53.28  ? 286 TRP B CB  1 
ATOM   6325 C CG  . TRP B 1 285 ? 11.519  -48.773 -28.848 1.00 58.39  ? 286 TRP B CG  1 
ATOM   6326 C CD1 . TRP B 1 285 ? 11.660  -49.646 -29.892 1.00 67.27  ? 286 TRP B CD1 1 
ATOM   6327 C CD2 . TRP B 1 285 ? 10.954  -49.528 -27.771 1.00 58.38  ? 286 TRP B CD2 1 
ATOM   6328 N NE1 . TRP B 1 285 ? 11.211  -50.896 -29.531 1.00 60.62  ? 286 TRP B NE1 1 
ATOM   6329 C CE2 . TRP B 1 285 ? 10.777  -50.851 -28.232 1.00 48.69  ? 286 TRP B CE2 1 
ATOM   6330 C CE3 . TRP B 1 285 ? 10.568  -49.212 -26.463 1.00 61.08  ? 286 TRP B CE3 1 
ATOM   6331 C CZ2 . TRP B 1 285 ? 10.242  -51.855 -27.434 1.00 51.47  ? 286 TRP B CZ2 1 
ATOM   6332 C CZ3 . TRP B 1 285 ? 10.034  -50.211 -25.672 1.00 65.49  ? 286 TRP B CZ3 1 
ATOM   6333 C CH2 . TRP B 1 285 ? 9.875   -51.519 -26.160 1.00 55.05  ? 286 TRP B CH2 1 
ATOM   6334 N N   . HIS B 1 286 ? 10.882  -43.938 -29.282 1.00 58.81  ? 287 HIS B N   1 
ATOM   6335 C CA  . HIS B 1 286 ? 11.277  -42.614 -28.820 1.00 62.01  ? 287 HIS B CA  1 
ATOM   6336 C C   . HIS B 1 286 ? 10.085  -41.665 -28.796 1.00 63.51  ? 287 HIS B C   1 
ATOM   6337 O O   . HIS B 1 286 ? 10.227  -40.462 -28.571 1.00 62.17  ? 287 HIS B O   1 
ATOM   6338 C CB  . HIS B 1 286 ? 12.405  -42.074 -29.701 1.00 68.67  ? 287 HIS B CB  1 
ATOM   6339 C CG  . HIS B 1 286 ? 13.597  -42.978 -29.754 1.00 80.19  ? 287 HIS B CG  1 
ATOM   6340 N ND1 . HIS B 1 286 ? 14.587  -42.962 -28.795 1.00 84.87  ? 287 HIS B ND1 1 
ATOM   6341 C CD2 . HIS B 1 286 ? 13.941  -43.950 -30.632 1.00 75.17  ? 287 HIS B CD2 1 
ATOM   6342 C CE1 . HIS B 1 286 ? 15.496  -43.875 -29.087 1.00 77.74  ? 287 HIS B CE1 1 
ATOM   6343 N NE2 . HIS B 1 286 ? 15.128  -44.489 -30.197 1.00 79.02  ? 287 HIS B NE2 1 
ATOM   6344 N N   . VAL B 1 287 ? 8.907   -42.234 -29.014 1.00 61.22  ? 288 VAL B N   1 
ATOM   6345 C CA  . VAL B 1 287 ? 7.657   -41.492 -28.965 1.00 63.55  ? 288 VAL B CA  1 
ATOM   6346 C C   . VAL B 1 287 ? 7.368   -40.995 -27.551 1.00 68.85  ? 288 VAL B C   1 
ATOM   6347 O O   . VAL B 1 287 ? 6.974   -39.848 -27.350 1.00 75.50  ? 288 VAL B O   1 
ATOM   6348 C CB  . VAL B 1 287 ? 6.493   -42.366 -29.458 1.00 58.72  ? 288 VAL B CB  1 
ATOM   6349 C CG1 . VAL B 1 287 ? 5.156   -41.818 -28.986 1.00 59.90  ? 288 VAL B CG1 1 
ATOM   6350 C CG2 . VAL B 1 287 ? 6.541   -42.504 -30.971 1.00 49.96  ? 288 VAL B CG2 1 
ATOM   6351 N N   . LEU B 1 288 ? 7.573   -41.869 -26.572 1.00 81.92  ? 289 LEU B N   1 
ATOM   6352 C CA  . LEU B 1 288 ? 7.385   -41.520 -25.165 1.00 84.75  ? 289 LEU B CA  1 
ATOM   6353 C C   . LEU B 1 288 ? 8.698   -41.058 -24.522 1.00 84.47  ? 289 LEU B C   1 
ATOM   6354 O O   . LEU B 1 288 ? 9.776   -41.564 -24.859 1.00 71.46  ? 289 LEU B O   1 
ATOM   6355 C CB  . LEU B 1 288 ? 6.801   -42.714 -24.399 1.00 73.75  ? 289 LEU B CB  1 
ATOM   6356 C CG  . LEU B 1 288 ? 5.354   -43.035 -24.779 1.00 61.76  ? 289 LEU B CG  1 
ATOM   6357 C CD1 . LEU B 1 288 ? 4.931   -44.422 -24.322 1.00 54.86  ? 289 LEU B CD1 1 
ATOM   6358 C CD2 . LEU B 1 288 ? 4.445   -41.978 -24.196 1.00 66.30  ? 289 LEU B CD2 1 
ATOM   6359 N N   . PRO B 1 289 ? 8.608   -40.088 -23.592 1.00 94.39  ? 290 PRO B N   1 
ATOM   6360 C CA  . PRO B 1 289 ? 9.786   -39.568 -22.885 1.00 94.44  ? 290 PRO B CA  1 
ATOM   6361 C C   . PRO B 1 289 ? 10.562  -40.682 -22.178 1.00 94.76  ? 290 PRO B C   1 
ATOM   6362 O O   . PRO B 1 289 ? 11.728  -40.914 -22.503 1.00 92.02  ? 290 PRO B O   1 
ATOM   6363 C CB  . PRO B 1 289 ? 9.184   -38.580 -21.874 1.00 93.23  ? 290 PRO B CB  1 
ATOM   6364 C CG  . PRO B 1 289 ? 7.747   -39.011 -21.717 1.00 89.88  ? 290 PRO B CG  1 
ATOM   6365 C CD  . PRO B 1 289 ? 7.356   -39.499 -23.081 1.00 92.02  ? 290 PRO B CD  1 
ATOM   6366 N N   . GLN B 1 290 ? 9.926   -41.360 -21.225 1.00 92.05  ? 291 GLN B N   1 
ATOM   6367 C CA  . GLN B 1 290 ? 10.530  -42.537 -20.614 1.00 93.28  ? 291 GLN B CA  1 
ATOM   6368 C C   . GLN B 1 290 ? 9.758   -43.780 -21.064 1.00 92.20  ? 291 GLN B C   1 
ATOM   6369 O O   . GLN B 1 290 ? 8.761   -44.190 -20.458 1.00 80.13  ? 291 GLN B O   1 
ATOM   6370 C CB  . GLN B 1 290 ? 10.584  -42.414 -19.078 1.00 97.98  ? 291 GLN B CB  1 
ATOM   6371 C CG  . GLN B 1 290 ? 9.290   -41.978 -18.376 1.00 104.11 ? 291 GLN B CG  1 
ATOM   6372 C CD  . GLN B 1 290 ? 9.436   -41.926 -16.850 1.00 114.43 ? 291 GLN B CD  1 
ATOM   6373 O OE1 . GLN B 1 290 ? 10.365  -41.304 -16.327 1.00 108.42 ? 291 GLN B OE1 1 
ATOM   6374 N NE2 . GLN B 1 290 ? 8.518   -42.587 -16.135 1.00 89.71  ? 291 GLN B NE2 1 
ATOM   6375 N N   . GLU B 1 291 ? 10.228  -44.359 -22.165 1.00 95.58  ? 292 GLU B N   1 
ATOM   6376 C CA  . GLU B 1 291 ? 9.610   -45.538 -22.749 1.00 81.17  ? 292 GLU B CA  1 
ATOM   6377 C C   . GLU B 1 291 ? 10.305  -46.784 -22.207 1.00 81.48  ? 292 GLU B C   1 
ATOM   6378 O O   . GLU B 1 291 ? 11.515  -46.776 -21.960 1.00 75.53  ? 292 GLU B O   1 
ATOM   6379 C CB  . GLU B 1 291 ? 9.680   -45.475 -24.281 1.00 75.09  ? 292 GLU B CB  1 
ATOM   6380 C CG  . GLU B 1 291 ? 8.659   -46.350 -25.008 1.00 80.18  ? 292 GLU B CG  1 
ATOM   6381 C CD  . GLU B 1 291 ? 8.298   -45.818 -26.399 1.00 75.63  ? 292 GLU B CD  1 
ATOM   6382 O OE1 . GLU B 1 291 ? 8.545   -44.620 -26.668 1.00 69.17  ? 292 GLU B OE1 1 
ATOM   6383 O OE2 . GLU B 1 291 ? 7.764   -46.599 -27.221 1.00 71.83  ? 292 GLU B OE2 1 
ATOM   6384 N N   . SER B 1 292 ? 9.527   -47.842 -21.998 1.00 78.82  ? 293 SER B N   1 
ATOM   6385 C CA  . SER B 1 292 ? 10.048  -49.095 -21.465 1.00 74.55  ? 293 SER B CA  1 
ATOM   6386 C C   . SER B 1 292 ? 9.244   -50.266 -22.006 1.00 71.77  ? 293 SER B C   1 
ATOM   6387 O O   . SER B 1 292 ? 8.309   -50.075 -22.781 1.00 72.08  ? 293 SER B O   1 
ATOM   6388 C CB  . SER B 1 292 ? 10.009  -49.088 -19.938 1.00 74.34  ? 293 SER B CB  1 
ATOM   6389 O OG  . SER B 1 292 ? 8.727   -48.712 -19.468 1.00 72.81  ? 293 SER B OG  1 
ATOM   6390 N N   . VAL B 1 293 ? 9.600   -51.476 -21.591 1.00 72.77  ? 294 VAL B N   1 
ATOM   6391 C CA  . VAL B 1 293 ? 8.875   -52.666 -22.027 1.00 75.15  ? 294 VAL B CA  1 
ATOM   6392 C C   . VAL B 1 293 ? 7.472   -52.765 -21.397 1.00 65.11  ? 294 VAL B C   1 
ATOM   6393 O O   . VAL B 1 293 ? 6.585   -53.423 -21.942 1.00 66.56  ? 294 VAL B O   1 
ATOM   6394 C CB  . VAL B 1 293 ? 9.677   -53.946 -21.714 1.00 69.58  ? 294 VAL B CB  1 
ATOM   6395 C CG1 . VAL B 1 293 ? 10.857  -54.070 -22.667 1.00 51.64  ? 294 VAL B CG1 1 
ATOM   6396 C CG2 . VAL B 1 293 ? 10.147  -53.937 -20.268 1.00 69.90  ? 294 VAL B CG2 1 
ATOM   6397 N N   . PHE B 1 294 ? 7.264   -52.109 -20.261 1.00 61.85  ? 295 PHE B N   1 
ATOM   6398 C CA  . PHE B 1 294 ? 5.942   -52.100 -19.641 1.00 68.20  ? 295 PHE B CA  1 
ATOM   6399 C C   . PHE B 1 294 ? 5.233   -50.782 -19.945 1.00 71.96  ? 295 PHE B C   1 
ATOM   6400 O O   . PHE B 1 294 ? 4.238   -50.424 -19.306 1.00 69.95  ? 295 PHE B O   1 
ATOM   6401 C CB  . PHE B 1 294 ? 6.030   -52.342 -18.123 1.00 74.78  ? 295 PHE B CB  1 
ATOM   6402 C CG  . PHE B 1 294 ? 7.363   -51.980 -17.521 1.00 83.00  ? 295 PHE B CG  1 
ATOM   6403 C CD1 . PHE B 1 294 ? 7.719   -50.649 -17.334 1.00 87.84  ? 295 PHE B CD1 1 
ATOM   6404 C CD2 . PHE B 1 294 ? 8.261   -52.970 -17.136 1.00 86.08  ? 295 PHE B CD2 1 
ATOM   6405 C CE1 . PHE B 1 294 ? 8.956   -50.306 -16.782 1.00 98.56  ? 295 PHE B CE1 1 
ATOM   6406 C CE2 . PHE B 1 294 ? 9.506   -52.636 -16.582 1.00 90.15  ? 295 PHE B CE2 1 
ATOM   6407 C CZ  . PHE B 1 294 ? 9.852   -51.303 -16.405 1.00 87.28  ? 295 PHE B CZ  1 
ATOM   6408 N N   . ARG B 1 295 ? 5.756   -50.062 -20.930 1.00 67.54  ? 296 ARG B N   1 
ATOM   6409 C CA  . ARG B 1 295 ? 5.080   -48.879 -21.442 1.00 67.73  ? 296 ARG B CA  1 
ATOM   6410 C C   . ARG B 1 295 ? 5.488   -48.633 -22.892 1.00 67.85  ? 296 ARG B C   1 
ATOM   6411 O O   . ARG B 1 295 ? 6.236   -47.701 -23.194 1.00 59.67  ? 296 ARG B O   1 
ATOM   6412 C CB  . ARG B 1 295 ? 5.389   -47.655 -20.576 1.00 72.71  ? 296 ARG B CB  1 
ATOM   6413 C CG  . ARG B 1 295 ? 4.431   -46.501 -20.798 1.00 68.15  ? 296 ARG B CG  1 
ATOM   6414 C CD  . ARG B 1 295 ? 4.752   -45.298 -19.919 1.00 68.07  ? 296 ARG B CD  1 
ATOM   6415 N NE  . ARG B 1 295 ? 3.923   -44.160 -20.309 1.00 77.61  ? 296 ARG B NE  1 
ATOM   6416 C CZ  . ARG B 1 295 ? 2.656   -43.991 -19.931 1.00 97.43  ? 296 ARG B CZ  1 
ATOM   6417 N NH1 . ARG B 1 295 ? 2.070   -44.877 -19.121 1.00 75.07  ? 296 ARG B NH1 1 
ATOM   6418 N NH2 . ARG B 1 295 ? 1.978   -42.924 -20.354 1.00 81.39  ? 296 ARG B NH2 1 
ATOM   6419 N N   . PHE B 1 296 ? 5.001   -49.486 -23.789 1.00 66.81  ? 297 PHE B N   1 
ATOM   6420 C CA  . PHE B 1 296 ? 5.293   -49.325 -25.208 1.00 58.45  ? 297 PHE B CA  1 
ATOM   6421 C C   . PHE B 1 296 ? 4.243   -48.455 -25.909 1.00 54.26  ? 297 PHE B C   1 
ATOM   6422 O O   . PHE B 1 296 ? 3.069   -48.447 -25.538 1.00 61.77  ? 297 PHE B O   1 
ATOM   6423 C CB  . PHE B 1 296 ? 5.395   -50.681 -25.896 1.00 44.42  ? 297 PHE B CB  1 
ATOM   6424 C CG  . PHE B 1 296 ? 5.681   -50.581 -27.356 1.00 48.96  ? 297 PHE B CG  1 
ATOM   6425 C CD1 . PHE B 1 296 ? 6.924   -50.145 -27.797 1.00 50.19  ? 297 PHE B CD1 1 
ATOM   6426 C CD2 . PHE B 1 296 ? 4.704   -50.890 -28.291 1.00 48.54  ? 297 PHE B CD2 1 
ATOM   6427 C CE1 . PHE B 1 296 ? 7.195   -50.035 -29.149 1.00 48.39  ? 297 PHE B CE1 1 
ATOM   6428 C CE2 . PHE B 1 296 ? 4.961   -50.783 -29.644 1.00 44.71  ? 297 PHE B CE2 1 
ATOM   6429 C CZ  . PHE B 1 296 ? 6.210   -50.358 -30.076 1.00 48.86  ? 297 PHE B CZ  1 
ATOM   6430 N N   . SER B 1 297 ? 4.681   -47.725 -26.925 1.00 50.85  ? 298 SER B N   1 
ATOM   6431 C CA  . SER B 1 297 ? 3.836   -46.745 -27.589 1.00 50.52  ? 298 SER B CA  1 
ATOM   6432 C C   . SER B 1 297 ? 2.591   -47.316 -28.237 1.00 44.70  ? 298 SER B C   1 
ATOM   6433 O O   . SER B 1 297 ? 1.513   -46.743 -28.121 1.00 51.72  ? 298 SER B O   1 
ATOM   6434 C CB  . SER B 1 297 ? 4.642   -46.005 -28.649 1.00 52.50  ? 298 SER B CB  1 
ATOM   6435 O OG  . SER B 1 297 ? 5.484   -45.055 -28.033 1.00 81.17  ? 298 SER B OG  1 
ATOM   6436 N N   . PHE B 1 298 ? 2.733   -48.431 -28.938 1.00 41.75  ? 299 PHE B N   1 
ATOM   6437 C CA  . PHE B 1 298 ? 1.641   -48.888 -29.782 1.00 41.90  ? 299 PHE B CA  1 
ATOM   6438 C C   . PHE B 1 298 ? 1.108   -50.229 -29.322 1.00 40.48  ? 299 PHE B C   1 
ATOM   6439 O O   . PHE B 1 298 ? 1.709   -51.273 -29.534 1.00 41.40  ? 299 PHE B O   1 
ATOM   6440 C CB  . PHE B 1 298 ? 2.097   -48.908 -31.243 1.00 37.21  ? 299 PHE B CB  1 
ATOM   6441 C CG  . PHE B 1 298 ? 2.634   -47.587 -31.690 1.00 37.99  ? 299 PHE B CG  1 
ATOM   6442 C CD1 . PHE B 1 298 ? 1.774   -46.537 -31.956 1.00 38.91  ? 299 PHE B CD1 1 
ATOM   6443 C CD2 . PHE B 1 298 ? 3.996   -47.363 -31.763 1.00 45.83  ? 299 PHE B CD2 1 
ATOM   6444 C CE1 . PHE B 1 298 ? 2.265   -45.301 -32.324 1.00 37.19  ? 299 PHE B CE1 1 
ATOM   6445 C CE2 . PHE B 1 298 ? 4.490   -46.125 -32.135 1.00 49.65  ? 299 PHE B CE2 1 
ATOM   6446 C CZ  . PHE B 1 298 ? 3.621   -45.094 -32.411 1.00 37.83  ? 299 PHE B CZ  1 
ATOM   6447 N N   . VAL B 1 299 ? -0.035  -50.156 -28.654 1.00 38.77  ? 300 VAL B N   1 
ATOM   6448 C CA  . VAL B 1 299 ? -0.685  -51.299 -28.040 1.00 37.08  ? 300 VAL B CA  1 
ATOM   6449 C C   . VAL B 1 299 ? -2.161  -51.177 -28.412 1.00 34.92  ? 300 VAL B C   1 
ATOM   6450 O O   . VAL B 1 299 ? -2.546  -50.169 -29.007 1.00 31.82  ? 300 VAL B O   1 
ATOM   6451 C CB  . VAL B 1 299 ? -0.472  -51.309 -26.507 1.00 30.83  ? 300 VAL B CB  1 
ATOM   6452 C CG1 . VAL B 1 299 ? 1.009   -51.285 -26.183 1.00 32.88  ? 300 VAL B CG1 1 
ATOM   6453 C CG2 . VAL B 1 299 ? -1.182  -50.124 -25.862 1.00 37.63  ? 300 VAL B CG2 1 
ATOM   6454 N N   . PRO B 1 300 ? -2.986  -52.199 -28.094 1.00 35.44  ? 301 PRO B N   1 
ATOM   6455 C CA  . PRO B 1 300 ? -4.415  -52.073 -28.400 1.00 36.51  ? 301 PRO B CA  1 
ATOM   6456 C C   . PRO B 1 300 ? -5.066  -50.829 -27.792 1.00 39.30  ? 301 PRO B C   1 
ATOM   6457 O O   . PRO B 1 300 ? -4.749  -50.438 -26.665 1.00 37.16  ? 301 PRO B O   1 
ATOM   6458 C CB  . PRO B 1 300 ? -5.011  -53.346 -27.793 1.00 32.34  ? 301 PRO B CB  1 
ATOM   6459 C CG  . PRO B 1 300 ? -3.935  -54.314 -27.848 1.00 27.69  ? 301 PRO B CG  1 
ATOM   6460 C CD  . PRO B 1 300 ? -2.669  -53.553 -27.607 1.00 34.22  ? 301 PRO B CD  1 
ATOM   6461 N N   . VAL B 1 301 ? -5.975  -50.228 -28.553 1.00 38.53  ? 302 VAL B N   1 
ATOM   6462 C CA  . VAL B 1 301 ? -6.632  -48.983 -28.174 1.00 39.60  ? 302 VAL B CA  1 
ATOM   6463 C C   . VAL B 1 301 ? -8.098  -49.240 -27.803 1.00 38.41  ? 302 VAL B C   1 
ATOM   6464 O O   . VAL B 1 301 ? -8.780  -50.038 -28.443 1.00 40.74  ? 302 VAL B O   1 
ATOM   6465 C CB  . VAL B 1 301 ? -6.535  -47.933 -29.326 1.00 33.18  ? 302 VAL B CB  1 
ATOM   6466 C CG1 . VAL B 1 301 ? -7.181  -48.455 -30.592 1.00 32.59  ? 302 VAL B CG1 1 
ATOM   6467 C CG2 . VAL B 1 301 ? -7.168  -46.626 -28.918 1.00 39.84  ? 302 VAL B CG2 1 
ATOM   6468 N N   . VAL B 1 302 ? -8.581  -48.586 -26.750 1.00 42.84  ? 303 VAL B N   1 
ATOM   6469 C CA  . VAL B 1 302 ? -9.991  -48.713 -26.387 1.00 50.82  ? 303 VAL B CA  1 
ATOM   6470 C C   . VAL B 1 302 ? -10.783 -47.639 -27.105 1.00 47.73  ? 303 VAL B C   1 
ATOM   6471 O O   . VAL B 1 302 ? -10.717 -46.469 -26.730 1.00 56.87  ? 303 VAL B O   1 
ATOM   6472 C CB  . VAL B 1 302 ? -10.218 -48.592 -24.871 1.00 48.26  ? 303 VAL B CB  1 
ATOM   6473 C CG1 . VAL B 1 302 ? -11.705 -48.733 -24.547 1.00 44.72  ? 303 VAL B CG1 1 
ATOM   6474 C CG2 . VAL B 1 302 ? -9.413  -49.649 -24.139 1.00 45.60  ? 303 VAL B CG2 1 
ATOM   6475 N N   . ASP B 1 303 ? -11.532 -48.045 -28.131 1.00 51.02  ? 304 ASP B N   1 
ATOM   6476 C CA  . ASP B 1 303 ? -12.157 -47.107 -29.066 1.00 51.39  ? 304 ASP B CA  1 
ATOM   6477 C C   . ASP B 1 303 ? -13.645 -47.377 -29.294 1.00 47.35  ? 304 ASP B C   1 
ATOM   6478 O O   . ASP B 1 303 ? -14.297 -46.676 -30.066 1.00 51.27  ? 304 ASP B O   1 
ATOM   6479 C CB  . ASP B 1 303 ? -11.425 -47.149 -30.405 1.00 40.43  ? 304 ASP B CB  1 
ATOM   6480 C CG  . ASP B 1 303 ? -11.521 -48.506 -31.073 1.00 52.97  ? 304 ASP B CG  1 
ATOM   6481 O OD1 . ASP B 1 303 ? -11.841 -49.512 -30.385 1.00 55.25  ? 304 ASP B OD1 1 
ATOM   6482 O OD2 . ASP B 1 303 ? -11.269 -48.573 -32.296 1.00 72.00  ? 304 ASP B OD2 1 
ATOM   6483 N N   . GLY B 1 304 ? -14.180 -48.393 -28.631 1.00 43.47  ? 305 GLY B N   1 
ATOM   6484 C CA  . GLY B 1 304 ? -15.591 -48.696 -28.753 1.00 42.40  ? 305 GLY B CA  1 
ATOM   6485 C C   . GLY B 1 304 ? -15.883 -49.696 -29.851 1.00 52.87  ? 305 GLY B C   1 
ATOM   6486 O O   . GLY B 1 304 ? -16.961 -50.290 -29.886 1.00 57.79  ? 305 GLY B O   1 
ATOM   6487 N N   . ASP B 1 305 ? -14.923 -49.889 -30.750 1.00 48.99  ? 306 ASP B N   1 
ATOM   6488 C CA  . ASP B 1 305 ? -15.067 -50.888 -31.799 1.00 43.84  ? 306 ASP B CA  1 
ATOM   6489 C C   . ASP B 1 305 ? -14.665 -52.282 -31.302 1.00 49.88  ? 306 ASP B C   1 
ATOM   6490 O O   . ASP B 1 305 ? -15.524 -53.055 -30.876 1.00 51.84  ? 306 ASP B O   1 
ATOM   6491 C CB  . ASP B 1 305 ? -14.242 -50.504 -33.020 1.00 59.47  ? 306 ASP B CB  1 
ATOM   6492 C CG  . ASP B 1 305 ? -14.693 -51.228 -34.277 1.00 71.19  ? 306 ASP B CG  1 
ATOM   6493 O OD1 . ASP B 1 305 ? -15.497 -52.185 -34.154 1.00 63.24  ? 306 ASP B OD1 1 
ATOM   6494 O OD2 . ASP B 1 305 ? -14.239 -50.839 -35.383 1.00 61.83  ? 306 ASP B OD2 1 
ATOM   6495 N N   . PHE B 1 306 ? -13.373 -52.607 -31.352 1.00 51.45  ? 307 PHE B N   1 
ATOM   6496 C CA  . PHE B 1 306 ? -12.926 -53.942 -30.934 1.00 49.50  ? 307 PHE B CA  1 
ATOM   6497 C C   . PHE B 1 306 ? -13.253 -54.175 -29.461 1.00 48.65  ? 307 PHE B C   1 
ATOM   6498 O O   . PHE B 1 306 ? -13.771 -55.229 -29.089 1.00 43.24  ? 307 PHE B O   1 
ATOM   6499 C CB  . PHE B 1 306 ? -11.424 -54.134 -31.177 1.00 44.45  ? 307 PHE B CB  1 
ATOM   6500 C CG  . PHE B 1 306 ? -10.983 -55.573 -31.119 1.00 46.54  ? 307 PHE B CG  1 
ATOM   6501 C CD1 . PHE B 1 306 ? -10.724 -56.187 -29.903 1.00 44.08  ? 307 PHE B CD1 1 
ATOM   6502 C CD2 . PHE B 1 306 ? -10.832 -56.315 -32.279 1.00 44.82  ? 307 PHE B CD2 1 
ATOM   6503 C CE1 . PHE B 1 306 ? -10.326 -57.518 -29.843 1.00 35.13  ? 307 PHE B CE1 1 
ATOM   6504 C CE2 . PHE B 1 306 ? -10.425 -57.642 -32.222 1.00 43.04  ? 307 PHE B CE2 1 
ATOM   6505 C CZ  . PHE B 1 306 ? -10.175 -58.244 -30.998 1.00 32.38  ? 307 PHE B CZ  1 
ATOM   6506 N N   . LEU B 1 307 ? -12.947 -53.176 -28.637 1.00 46.54  ? 308 LEU B N   1 
ATOM   6507 C CA  . LEU B 1 307 ? -13.339 -53.171 -27.234 1.00 44.78  ? 308 LEU B CA  1 
ATOM   6508 C C   . LEU B 1 307 ? -14.338 -52.036 -26.957 1.00 48.09  ? 308 LEU B C   1 
ATOM   6509 O O   . LEU B 1 307 ? -13.988 -50.857 -27.050 1.00 44.15  ? 308 LEU B O   1 
ATOM   6510 C CB  . LEU B 1 307 ? -12.107 -53.017 -26.343 1.00 48.95  ? 308 LEU B CB  1 
ATOM   6511 C CG  . LEU B 1 307 ? -11.059 -54.117 -26.466 1.00 47.18  ? 308 LEU B CG  1 
ATOM   6512 C CD1 . LEU B 1 307 ? -9.707  -53.616 -25.982 1.00 46.90  ? 308 LEU B CD1 1 
ATOM   6513 C CD2 . LEU B 1 307 ? -11.497 -55.346 -25.692 1.00 42.03  ? 308 LEU B CD2 1 
ATOM   6514 N N   . SER B 1 308 ? -15.574 -52.385 -26.608 1.00 48.64  ? 309 SER B N   1 
ATOM   6515 C CA  . SER B 1 308 ? -16.616 -51.375 -26.392 1.00 53.94  ? 309 SER B CA  1 
ATOM   6516 C C   . SER B 1 308 ? -16.357 -50.518 -25.137 1.00 49.64  ? 309 SER B C   1 
ATOM   6517 O O   . SER B 1 308 ? -16.806 -49.376 -25.046 1.00 56.17  ? 309 SER B O   1 
ATOM   6518 C CB  . SER B 1 308 ? -17.992 -52.045 -26.309 1.00 42.54  ? 309 SER B CB  1 
ATOM   6519 O OG  . SER B 1 308 ? -18.091 -52.895 -25.175 1.00 52.45  ? 309 SER B OG  1 
ATOM   6520 N N   . ASP B 1 309 ? -15.617 -51.075 -24.184 1.00 50.78  ? 310 ASP B N   1 
ATOM   6521 C CA  . ASP B 1 309 ? -15.202 -50.362 -22.974 1.00 54.77  ? 310 ASP B CA  1 
ATOM   6522 C C   . ASP B 1 309 ? -13.802 -50.839 -22.558 1.00 43.82  ? 310 ASP B C   1 
ATOM   6523 O O   . ASP B 1 309 ? -13.226 -51.707 -23.199 1.00 47.70  ? 310 ASP B O   1 
ATOM   6524 C CB  . ASP B 1 309 ? -16.212 -50.596 -21.843 1.00 59.19  ? 310 ASP B CB  1 
ATOM   6525 C CG  . ASP B 1 309 ? -16.358 -49.393 -20.911 1.00 59.51  ? 310 ASP B CG  1 
ATOM   6526 O OD1 . ASP B 1 309 ? -15.370 -48.652 -20.705 1.00 53.93  ? 310 ASP B OD1 1 
ATOM   6527 O OD2 . ASP B 1 309 ? -17.473 -49.200 -20.377 1.00 63.56  ? 310 ASP B OD2 1 
ATOM   6528 N N   . THR B 1 310 ? -13.252 -50.285 -21.487 1.00 48.29  ? 311 THR B N   1 
ATOM   6529 C CA  . THR B 1 310 ? -11.995 -50.806 -20.963 1.00 48.92  ? 311 THR B CA  1 
ATOM   6530 C C   . THR B 1 310 ? -12.164 -52.273 -20.569 1.00 48.91  ? 311 THR B C   1 
ATOM   6531 O O   . THR B 1 310 ? -13.262 -52.718 -20.223 1.00 47.67  ? 311 THR B O   1 
ATOM   6532 C CB  . THR B 1 310 ? -11.500 -50.013 -19.743 1.00 47.46  ? 311 THR B CB  1 
ATOM   6533 O OG1 . THR B 1 310 ? -12.338 -50.302 -18.615 1.00 52.29  ? 311 THR B OG1 1 
ATOM   6534 C CG2 . THR B 1 310 ? -11.501 -48.524 -20.031 1.00 38.64  ? 311 THR B CG2 1 
ATOM   6535 N N   . PRO B 1 311 ? -11.078 -53.041 -20.650 1.00 46.68  ? 312 PRO B N   1 
ATOM   6536 C CA  . PRO B 1 311 ? -11.163 -54.454 -20.284 1.00 49.22  ? 312 PRO B CA  1 
ATOM   6537 C C   . PRO B 1 311 ? -11.595 -54.638 -18.834 1.00 55.81  ? 312 PRO B C   1 
ATOM   6538 O O   . PRO B 1 311 ? -12.300 -55.605 -18.529 1.00 53.72  ? 312 PRO B O   1 
ATOM   6539 C CB  . PRO B 1 311 ? -9.739  -54.955 -20.511 1.00 47.21  ? 312 PRO B CB  1 
ATOM   6540 C CG  . PRO B 1 311 ? -9.216  -54.059 -21.594 1.00 39.74  ? 312 PRO B CG  1 
ATOM   6541 C CD  . PRO B 1 311 ? -9.792  -52.710 -21.289 1.00 44.09  ? 312 PRO B CD  1 
ATOM   6542 N N   . GLU B 1 312 ? -11.200 -53.722 -17.953 1.00 54.96  ? 313 GLU B N   1 
ATOM   6543 C CA  . GLU B 1 312 ? -11.632 -53.816 -16.562 1.00 61.83  ? 313 GLU B CA  1 
ATOM   6544 C C   . GLU B 1 312 ? -13.162 -53.730 -16.474 1.00 59.19  ? 313 GLU B C   1 
ATOM   6545 O O   . GLU B 1 312 ? -13.810 -54.588 -15.869 1.00 54.08  ? 313 GLU B O   1 
ATOM   6546 C CB  . GLU B 1 312 ? -10.975 -52.731 -15.712 1.00 59.23  ? 313 GLU B CB  1 
ATOM   6547 C CG  . GLU B 1 312 ? -10.703 -53.172 -14.269 1.00 68.66  ? 313 GLU B CG  1 
ATOM   6548 C CD  . GLU B 1 312 ? -11.446 -52.316 -13.243 1.00 107.65 ? 313 GLU B CD  1 
ATOM   6549 O OE1 . GLU B 1 312 ? -12.300 -51.490 -13.653 1.00 107.61 ? 313 GLU B OE1 1 
ATOM   6550 O OE2 . GLU B 1 312 ? -11.177 -52.468 -12.027 1.00 101.30 ? 313 GLU B OE2 1 
ATOM   6551 N N   . ALA B 1 313 ? -13.729 -52.713 -17.113 1.00 53.24  ? 314 ALA B N   1 
ATOM   6552 C CA  . ALA B 1 313 ? -15.173 -52.547 -17.193 1.00 45.74  ? 314 ALA B CA  1 
ATOM   6553 C C   . ALA B 1 313 ? -15.896 -53.737 -17.845 1.00 49.00  ? 314 ALA B C   1 
ATOM   6554 O O   . ALA B 1 313 ? -16.936 -54.179 -17.361 1.00 55.29  ? 314 ALA B O   1 
ATOM   6555 C CB  . ALA B 1 313 ? -15.492 -51.271 -17.945 1.00 44.46  ? 314 ALA B CB  1 
ATOM   6556 N N   . LEU B 1 314 ? -15.361 -54.248 -18.949 1.00 54.51  ? 315 LEU B N   1 
ATOM   6557 C CA  . LEU B 1 314 ? -16.023 -55.332 -19.676 1.00 51.95  ? 315 LEU B CA  1 
ATOM   6558 C C   . LEU B 1 314 ? -16.019 -56.617 -18.867 1.00 54.55  ? 315 LEU B C   1 
ATOM   6559 O O   . LEU B 1 314 ? -16.939 -57.434 -18.967 1.00 53.27  ? 315 LEU B O   1 
ATOM   6560 C CB  . LEU B 1 314 ? -15.350 -55.570 -21.028 1.00 49.96  ? 315 LEU B CB  1 
ATOM   6561 C CG  . LEU B 1 314 ? -15.585 -54.515 -22.107 1.00 55.71  ? 315 LEU B CG  1 
ATOM   6562 C CD1 . LEU B 1 314 ? -14.576 -54.664 -23.240 1.00 49.68  ? 315 LEU B CD1 1 
ATOM   6563 C CD2 . LEU B 1 314 ? -16.992 -54.639 -22.636 1.00 47.53  ? 315 LEU B CD2 1 
ATOM   6564 N N   . ILE B 1 315 ? -14.966 -56.793 -18.075 1.00 55.33  ? 316 ILE B N   1 
ATOM   6565 C CA  . ILE B 1 315 ? -14.863 -57.941 -17.191 1.00 56.77  ? 316 ILE B CA  1 
ATOM   6566 C C   . ILE B 1 315 ? -15.967 -57.904 -16.140 1.00 64.55  ? 316 ILE B C   1 
ATOM   6567 O O   . ILE B 1 315 ? -16.742 -58.858 -16.014 1.00 63.63  ? 316 ILE B O   1 
ATOM   6568 C CB  . ILE B 1 315 ? -13.499 -57.990 -16.492 1.00 63.03  ? 316 ILE B CB  1 
ATOM   6569 C CG1 . ILE B 1 315 ? -12.429 -58.541 -17.433 1.00 55.76  ? 316 ILE B CG1 1 
ATOM   6570 C CG2 . ILE B 1 315 ? -13.571 -58.861 -15.257 1.00 57.29  ? 316 ILE B CG2 1 
ATOM   6571 C CD1 . ILE B 1 315 ? -11.013 -58.246 -16.962 1.00 56.69  ? 316 ILE B CD1 1 
ATOM   6572 N N   . ASN B 1 316 ? -16.041 -56.791 -15.408 1.00 64.01  ? 317 ASN B N   1 
ATOM   6573 C CA  . ASN B 1 316 ? -17.014 -56.617 -14.326 1.00 61.18  ? 317 ASN B CA  1 
ATOM   6574 C C   . ASN B 1 316 ? -18.461 -56.745 -14.800 1.00 61.48  ? 317 ASN B C   1 
ATOM   6575 O O   . ASN B 1 316 ? -19.315 -57.278 -14.089 1.00 73.08  ? 317 ASN B O   1 
ATOM   6576 C CB  . ASN B 1 316 ? -16.802 -55.264 -13.646 1.00 51.74  ? 317 ASN B CB  1 
ATOM   6577 C CG  . ASN B 1 316 ? -15.455 -55.174 -12.943 1.00 61.97  ? 317 ASN B CG  1 
ATOM   6578 O OD1 . ASN B 1 316 ? -14.865 -56.195 -12.591 1.00 63.23  ? 317 ASN B OD1 1 
ATOM   6579 N ND2 . ASN B 1 316 ? -14.962 -53.955 -12.739 1.00 58.96  ? 317 ASN B ND2 1 
ATOM   6580 N N   . ALA B 1 317 ? -18.720 -56.282 -16.015 1.00 56.12  ? 318 ALA B N   1 
ATOM   6581 C CA  . ALA B 1 317 ? -20.061 -56.297 -16.580 1.00 55.97  ? 318 ALA B CA  1 
ATOM   6582 C C   . ALA B 1 317 ? -20.400 -57.629 -17.237 1.00 59.81  ? 318 ALA B C   1 
ATOM   6583 O O   . ALA B 1 317 ? -21.500 -57.816 -17.758 1.00 63.04  ? 318 ALA B O   1 
ATOM   6584 C CB  . ALA B 1 317 ? -20.208 -55.164 -17.593 1.00 48.02  ? 318 ALA B CB  1 
ATOM   6585 N N   . GLY B 1 318 ? -19.456 -58.559 -17.215 1.00 60.13  ? 319 GLY B N   1 
ATOM   6586 C CA  . GLY B 1 318 ? -19.581 -59.746 -18.039 1.00 60.03  ? 319 GLY B CA  1 
ATOM   6587 C C   . GLY B 1 318 ? -20.372 -60.892 -17.446 1.00 51.60  ? 319 GLY B C   1 
ATOM   6588 O O   . GLY B 1 318 ? -20.377 -61.112 -16.236 1.00 57.62  ? 319 GLY B O   1 
ATOM   6589 N N   . ASP B 1 319 ? -21.046 -61.632 -18.312 1.00 55.71  ? 320 ASP B N   1 
ATOM   6590 C CA  . ASP B 1 319 ? -21.650 -62.892 -17.911 1.00 59.95  ? 320 ASP B CA  1 
ATOM   6591 C C   . ASP B 1 319 ? -20.842 -64.013 -18.542 1.00 60.88  ? 320 ASP B C   1 
ATOM   6592 O O   . ASP B 1 319 ? -20.877 -64.207 -19.759 1.00 62.96  ? 320 ASP B O   1 
ATOM   6593 C CB  . ASP B 1 319 ? -23.120 -62.962 -18.332 1.00 63.12  ? 320 ASP B CB  1 
ATOM   6594 C CG  . ASP B 1 319 ? -23.814 -64.231 -17.849 1.00 74.44  ? 320 ASP B CG  1 
ATOM   6595 O OD1 . ASP B 1 319 ? -23.180 -65.039 -17.127 1.00 65.90  ? 320 ASP B OD1 1 
ATOM   6596 O OD2 . ASP B 1 319 ? -25.007 -64.412 -18.188 1.00 79.03  ? 320 ASP B OD2 1 
ATOM   6597 N N   . PHE B 1 320 ? -20.110 -64.743 -17.710 1.00 48.20  ? 321 PHE B N   1 
ATOM   6598 C CA  . PHE B 1 320 ? -19.201 -65.766 -18.207 1.00 53.07  ? 321 PHE B CA  1 
ATOM   6599 C C   . PHE B 1 320 ? -19.629 -67.202 -17.894 1.00 53.11  ? 321 PHE B C   1 
ATOM   6600 O O   . PHE B 1 320 ? -18.785 -68.065 -17.684 1.00 53.23  ? 321 PHE B O   1 
ATOM   6601 C CB  . PHE B 1 320 ? -17.798 -65.510 -17.650 1.00 43.56  ? 321 PHE B CB  1 
ATOM   6602 C CG  . PHE B 1 320 ? -17.245 -64.167 -18.022 1.00 50.07  ? 321 PHE B CG  1 
ATOM   6603 C CD1 . PHE B 1 320 ? -16.708 -63.950 -19.280 1.00 44.42  ? 321 PHE B CD1 1 
ATOM   6604 C CD2 . PHE B 1 320 ? -17.275 -63.118 -17.126 1.00 46.41  ? 321 PHE B CD2 1 
ATOM   6605 C CE1 . PHE B 1 320 ? -16.207 -62.709 -19.632 1.00 41.31  ? 321 PHE B CE1 1 
ATOM   6606 C CE2 . PHE B 1 320 ? -16.770 -61.872 -17.472 1.00 51.93  ? 321 PHE B CE2 1 
ATOM   6607 C CZ  . PHE B 1 320 ? -16.239 -61.668 -18.724 1.00 47.49  ? 321 PHE B CZ  1 
ATOM   6608 N N   . HIS B 1 321 ? -20.929 -67.472 -17.872 1.00 58.70  ? 322 HIS B N   1 
ATOM   6609 C CA  . HIS B 1 321 ? -21.369 -68.846 -17.647 1.00 61.51  ? 322 HIS B CA  1 
ATOM   6610 C C   . HIS B 1 321 ? -21.084 -69.691 -18.887 1.00 58.78  ? 322 HIS B C   1 
ATOM   6611 O O   . HIS B 1 321 ? -21.234 -69.223 -20.021 1.00 48.67  ? 322 HIS B O   1 
ATOM   6612 C CB  . HIS B 1 321 ? -22.857 -68.904 -17.277 1.00 54.44  ? 322 HIS B CB  1 
ATOM   6613 C CG  . HIS B 1 321 ? -23.137 -68.518 -15.859 1.00 55.45  ? 322 HIS B CG  1 
ATOM   6614 N ND1 . HIS B 1 321 ? -23.568 -67.257 -15.502 1.00 58.61  ? 322 HIS B ND1 1 
ATOM   6615 C CD2 . HIS B 1 321 ? -23.020 -69.217 -14.703 1.00 57.99  ? 322 HIS B CD2 1 
ATOM   6616 C CE1 . HIS B 1 321 ? -23.710 -67.198 -14.188 1.00 61.37  ? 322 HIS B CE1 1 
ATOM   6617 N NE2 . HIS B 1 321 ? -23.384 -68.374 -13.678 1.00 55.99  ? 322 HIS B NE2 1 
ATOM   6618 N N   . GLY B 1 322 ? -20.643 -70.926 -18.665 1.00 56.03  ? 323 GLY B N   1 
ATOM   6619 C CA  . GLY B 1 322 ? -20.346 -71.834 -19.759 1.00 61.10  ? 323 GLY B CA  1 
ATOM   6620 C C   . GLY B 1 322 ? -18.911 -71.750 -20.251 1.00 63.25  ? 323 GLY B C   1 
ATOM   6621 O O   . GLY B 1 322 ? -18.505 -72.503 -21.137 1.00 67.00  ? 323 GLY B O   1 
ATOM   6622 N N   . LEU B 1 323 ? -18.145 -70.834 -19.665 1.00 64.50  ? 324 LEU B N   1 
ATOM   6623 C CA  . LEU B 1 323 ? -16.751 -70.616 -20.035 1.00 49.32  ? 324 LEU B CA  1 
ATOM   6624 C C   . LEU B 1 323 ? -15.765 -71.308 -19.086 1.00 46.49  ? 324 LEU B C   1 
ATOM   6625 O O   . LEU B 1 323 ? -15.881 -71.192 -17.871 1.00 53.72  ? 324 LEU B O   1 
ATOM   6626 C CB  . LEU B 1 323 ? -16.458 -69.120 -20.073 1.00 43.41  ? 324 LEU B CB  1 
ATOM   6627 C CG  . LEU B 1 323 ? -15.009 -68.732 -20.358 1.00 49.73  ? 324 LEU B CG  1 
ATOM   6628 C CD1 . LEU B 1 323 ? -14.642 -69.053 -21.801 1.00 45.58  ? 324 LEU B CD1 1 
ATOM   6629 C CD2 . LEU B 1 323 ? -14.782 -67.263 -20.049 1.00 41.05  ? 324 LEU B CD2 1 
ATOM   6630 N N   . GLN B 1 324 ? -14.798 -72.030 -19.640 1.00 49.65  ? 325 GLN B N   1 
ATOM   6631 C CA  . GLN B 1 324 ? -13.719 -72.590 -18.830 1.00 44.49  ? 325 GLN B CA  1 
ATOM   6632 C C   . GLN B 1 324 ? -12.422 -71.876 -19.209 1.00 42.39  ? 325 GLN B C   1 
ATOM   6633 O O   . GLN B 1 324 ? -12.180 -71.597 -20.376 1.00 42.75  ? 325 GLN B O   1 
ATOM   6634 C CB  . GLN B 1 324 ? -13.579 -74.107 -19.022 1.00 54.71  ? 325 GLN B CB  1 
ATOM   6635 C CG  . GLN B 1 324 ? -14.847 -74.926 -18.802 1.00 46.61  ? 325 GLN B CG  1 
ATOM   6636 C CD  . GLN B 1 324 ? -15.761 -74.898 -20.008 1.00 63.12  ? 325 GLN B CD  1 
ATOM   6637 O OE1 . GLN B 1 324 ? -15.330 -75.167 -21.130 1.00 67.25  ? 325 GLN B OE1 1 
ATOM   6638 N NE2 . GLN B 1 324 ? -17.027 -74.542 -19.790 1.00 63.29  ? 325 GLN B NE2 1 
ATOM   6639 N N   . VAL B 1 325 ? -11.602 -71.567 -18.214 1.00 42.10  ? 326 VAL B N   1 
ATOM   6640 C CA  . VAL B 1 325 ? -10.413 -70.753 -18.406 1.00 36.25  ? 326 VAL B CA  1 
ATOM   6641 C C   . VAL B 1 325 ? -9.288  -71.290 -17.545 1.00 39.83  ? 326 VAL B C   1 
ATOM   6642 O O   . VAL B 1 325 ? -9.512  -71.681 -16.405 1.00 40.28  ? 326 VAL B O   1 
ATOM   6643 C CB  . VAL B 1 325 ? -10.658 -69.280 -18.026 1.00 36.00  ? 326 VAL B CB  1 
ATOM   6644 C CG1 . VAL B 1 325 ? -9.382  -68.504 -18.126 1.00 44.47  ? 326 VAL B CG1 1 
ATOM   6645 C CG2 . VAL B 1 325 ? -11.688 -68.666 -18.928 1.00 45.51  ? 326 VAL B CG2 1 
ATOM   6646 N N   . LEU B 1 326 ? -8.081  -71.313 -18.088 1.00 39.66  ? 327 LEU B N   1 
ATOM   6647 C CA  . LEU B 1 326 ? -6.915  -71.712 -17.325 1.00 37.73  ? 327 LEU B CA  1 
ATOM   6648 C C   . LEU B 1 326 ? -5.937  -70.534 -17.293 1.00 38.59  ? 327 LEU B C   1 
ATOM   6649 O O   . LEU B 1 326 ? -5.536  -70.031 -18.336 1.00 44.20  ? 327 LEU B O   1 
ATOM   6650 C CB  . LEU B 1 326 ? -6.292  -72.970 -17.940 1.00 33.04  ? 327 LEU B CB  1 
ATOM   6651 C CG  . LEU B 1 326 ? -4.869  -73.342 -17.532 1.00 47.85  ? 327 LEU B CG  1 
ATOM   6652 C CD1 . LEU B 1 326 ? -4.805  -73.670 -16.058 1.00 44.08  ? 327 LEU B CD1 1 
ATOM   6653 C CD2 . LEU B 1 326 ? -4.361  -74.510 -18.359 1.00 47.73  ? 327 LEU B CD2 1 
ATOM   6654 N N   . VAL B 1 327 ? -5.584  -70.071 -16.096 1.00 36.82  ? 328 VAL B N   1 
ATOM   6655 C CA  . VAL B 1 327 ? -4.718  -68.897 -15.941 1.00 37.00  ? 328 VAL B CA  1 
ATOM   6656 C C   . VAL B 1 327 ? -3.569  -69.159 -14.989 1.00 39.40  ? 328 VAL B C   1 
ATOM   6657 O O   . VAL B 1 327 ? -3.668  -70.008 -14.099 1.00 35.72  ? 328 VAL B O   1 
ATOM   6658 C CB  . VAL B 1 327 ? -5.485  -67.672 -15.406 1.00 37.84  ? 328 VAL B CB  1 
ATOM   6659 C CG1 . VAL B 1 327 ? -6.632  -67.312 -16.329 1.00 29.98  ? 328 VAL B CG1 1 
ATOM   6660 C CG2 . VAL B 1 327 ? -5.986  -67.937 -13.995 1.00 34.01  ? 328 VAL B CG2 1 
ATOM   6661 N N   . GLY B 1 328 ? -2.478  -68.420 -15.162 1.00 35.67  ? 329 GLY B N   1 
ATOM   6662 C CA  . GLY B 1 328 ? -1.340  -68.610 -14.286 1.00 35.82  ? 329 GLY B CA  1 
ATOM   6663 C C   . GLY B 1 328 ? -0.201  -67.638 -14.459 1.00 35.32  ? 329 GLY B C   1 
ATOM   6664 O O   . GLY B 1 328 ? -0.207  -66.798 -15.354 1.00 32.92  ? 329 GLY B O   1 
ATOM   6665 N N   . VAL B 1 329 ? 0.784   -67.766 -13.579 1.00 29.39  ? 330 VAL B N   1 
ATOM   6666 C CA  . VAL B 1 329 ? 1.952   -66.909 -13.585 1.00 30.16  ? 330 VAL B CA  1 
ATOM   6667 C C   . VAL B 1 329 ? 3.175   -67.761 -13.275 1.00 34.45  ? 330 VAL B C   1 
ATOM   6668 O O   . VAL B 1 329 ? 3.042   -68.871 -12.755 1.00 36.19  ? 330 VAL B O   1 
ATOM   6669 C CB  . VAL B 1 329 ? 1.837   -65.779 -12.543 1.00 34.57  ? 330 VAL B CB  1 
ATOM   6670 C CG1 . VAL B 1 329 ? 0.711   -64.832 -12.890 1.00 32.58  ? 330 VAL B CG1 1 
ATOM   6671 C CG2 . VAL B 1 329 ? 1.617   -66.371 -11.168 1.00 28.15  ? 330 VAL B CG2 1 
ATOM   6672 N N   . VAL B 1 330 ? 4.360   -67.254 -13.600 1.00 29.46  ? 331 VAL B N   1 
ATOM   6673 C CA  . VAL B 1 330 ? 5.590   -67.865 -13.113 1.00 37.32  ? 331 VAL B CA  1 
ATOM   6674 C C   . VAL B 1 330 ? 5.892   -67.302 -11.723 1.00 41.52  ? 331 VAL B C   1 
ATOM   6675 O O   . VAL B 1 330 ? 5.228   -66.364 -11.270 1.00 37.89  ? 331 VAL B O   1 
ATOM   6676 C CB  . VAL B 1 330 ? 6.780   -67.614 -14.058 1.00 33.50  ? 331 VAL B CB  1 
ATOM   6677 C CG1 . VAL B 1 330 ? 6.431   -68.060 -15.458 1.00 36.43  ? 331 VAL B CG1 1 
ATOM   6678 C CG2 . VAL B 1 330 ? 7.176   -66.145 -14.046 1.00 36.08  ? 331 VAL B CG2 1 
ATOM   6679 N N   . LYS B 1 331 ? 6.894   -67.866 -11.056 1.00 40.24  ? 332 LYS B N   1 
ATOM   6680 C CA  . LYS B 1 331 ? 7.185   -67.532 -9.660  1.00 44.17  ? 332 LYS B CA  1 
ATOM   6681 C C   . LYS B 1 331 ? 7.727   -66.115 -9.491  1.00 45.23  ? 332 LYS B C   1 
ATOM   6682 O O   . LYS B 1 331 ? 7.367   -65.409 -8.545  1.00 49.44  ? 332 LYS B O   1 
ATOM   6683 C CB  . LYS B 1 331 ? 8.181   -68.539 -9.079  1.00 48.02  ? 332 LYS B CB  1 
ATOM   6684 C CG  . LYS B 1 331 ? 8.355   -68.465 -7.570  1.00 62.03  ? 332 LYS B CG  1 
ATOM   6685 C CD  . LYS B 1 331 ? 8.872   -69.784 -7.005  1.00 61.71  ? 332 LYS B CD  1 
ATOM   6686 C CE  . LYS B 1 331 ? 10.169  -69.601 -6.217  1.00 70.84  ? 332 LYS B CE  1 
ATOM   6687 N NZ  . LYS B 1 331 ? 9.946   -69.016 -4.864  1.00 72.01  ? 332 LYS B NZ  1 
ATOM   6688 N N   . ASP B 1 332 ? 8.585   -65.701 -10.418 1.00 45.08  ? 333 ASP B N   1 
ATOM   6689 C CA  . ASP B 1 332 ? 9.248   -64.404 -10.325 1.00 40.30  ? 333 ASP B CA  1 
ATOM   6690 C C   . ASP B 1 332 ? 9.025   -63.576 -11.585 1.00 38.01  ? 333 ASP B C   1 
ATOM   6691 O O   . ASP B 1 332 ? 9.954   -63.328 -12.347 1.00 48.38  ? 333 ASP B O   1 
ATOM   6692 C CB  . ASP B 1 332 ? 10.750  -64.590 -10.053 1.00 46.68  ? 333 ASP B CB  1 
ATOM   6693 C CG  . ASP B 1 332 ? 11.017  -65.418 -8.795  1.00 60.04  ? 333 ASP B CG  1 
ATOM   6694 O OD1 . ASP B 1 332 ? 10.812  -64.883 -7.680  1.00 63.05  ? 333 ASP B OD1 1 
ATOM   6695 O OD2 . ASP B 1 332 ? 11.425  -66.599 -8.915  1.00 55.21  ? 333 ASP B OD2 1 
ATOM   6696 N N   . GLU B 1 333 ? 7.782   -63.141 -11.777 1.00 48.15  ? 334 GLU B N   1 
ATOM   6697 C CA  . GLU B 1 333 ? 7.357   -62.400 -12.961 1.00 34.52  ? 334 GLU B CA  1 
ATOM   6698 C C   . GLU B 1 333 ? 8.128   -61.108 -13.212 1.00 42.28  ? 334 GLU B C   1 
ATOM   6699 O O   . GLU B 1 333 ? 8.317   -60.713 -14.358 1.00 50.29  ? 334 GLU B O   1 
ATOM   6700 C CB  . GLU B 1 333 ? 5.868   -62.067 -12.857 1.00 35.36  ? 334 GLU B CB  1 
ATOM   6701 C CG  . GLU B 1 333 ? 4.932   -63.255 -12.993 1.00 39.08  ? 334 GLU B CG  1 
ATOM   6702 C CD  . GLU B 1 333 ? 4.730   -63.689 -14.442 1.00 53.98  ? 334 GLU B CD  1 
ATOM   6703 O OE1 . GLU B 1 333 ? 5.288   -63.031 -15.355 1.00 49.67  ? 334 GLU B OE1 1 
ATOM   6704 O OE2 . GLU B 1 333 ? 4.006   -64.688 -14.664 1.00 45.69  ? 334 GLU B OE2 1 
ATOM   6705 N N   . GLY B 1 334 ? 8.571   -60.448 -12.150 1.00 35.85  ? 335 GLY B N   1 
ATOM   6706 C CA  . GLY B 1 334 ? 9.137   -59.122 -12.289 1.00 37.20  ? 335 GLY B CA  1 
ATOM   6707 C C   . GLY B 1 334 ? 10.620  -59.018 -12.565 1.00 39.44  ? 335 GLY B C   1 
ATOM   6708 O O   . GLY B 1 334 ? 11.085  -57.981 -13.027 1.00 48.88  ? 335 GLY B O   1 
ATOM   6709 N N   . SER B 1 335 ? 11.361  -60.084 -12.283 1.00 44.42  ? 336 SER B N   1 
ATOM   6710 C CA  . SER B 1 335 ? 12.826  -60.067 -12.353 1.00 46.31  ? 336 SER B CA  1 
ATOM   6711 C C   . SER B 1 335 ? 13.383  -59.805 -13.754 1.00 48.19  ? 336 SER B C   1 
ATOM   6712 O O   . SER B 1 335 ? 14.258  -58.953 -13.934 1.00 48.02  ? 336 SER B O   1 
ATOM   6713 C CB  . SER B 1 335 ? 13.383  -61.394 -11.825 1.00 45.60  ? 336 SER B CB  1 
ATOM   6714 O OG  . SER B 1 335 ? 12.824  -62.494 -12.521 1.00 48.15  ? 336 SER B OG  1 
ATOM   6715 N N   . TYR B 1 336 ? 12.880  -60.553 -14.732 1.00 45.76  ? 337 TYR B N   1 
ATOM   6716 C CA  . TYR B 1 336 ? 13.277  -60.402 -16.130 1.00 61.14  ? 337 TYR B CA  1 
ATOM   6717 C C   . TYR B 1 336 ? 13.274  -58.940 -16.560 1.00 50.72  ? 337 TYR B C   1 
ATOM   6718 O O   . TYR B 1 336 ? 14.179  -58.492 -17.251 1.00 60.76  ? 337 TYR B O   1 
ATOM   6719 C CB  . TYR B 1 336 ? 12.345  -61.234 -17.040 1.00 62.11  ? 337 TYR B CB  1 
ATOM   6720 C CG  . TYR B 1 336 ? 12.491  -60.991 -18.535 1.00 61.99  ? 337 TYR B CG  1 
ATOM   6721 C CD1 . TYR B 1 336 ? 13.481  -61.635 -19.274 1.00 67.15  ? 337 TYR B CD1 1 
ATOM   6722 C CD2 . TYR B 1 336 ? 11.618  -60.139 -19.212 1.00 62.02  ? 337 TYR B CD2 1 
ATOM   6723 C CE1 . TYR B 1 336 ? 13.613  -61.428 -20.644 1.00 68.24  ? 337 TYR B CE1 1 
ATOM   6724 C CE2 . TYR B 1 336 ? 11.742  -59.920 -20.582 1.00 70.89  ? 337 TYR B CE2 1 
ATOM   6725 C CZ  . TYR B 1 336 ? 12.742  -60.568 -21.295 1.00 84.37  ? 337 TYR B CZ  1 
ATOM   6726 O OH  . TYR B 1 336 ? 12.870  -60.358 -22.659 1.00 82.31  ? 337 TYR B OH  1 
ATOM   6727 N N   . PHE B 1 337 ? 12.269  -58.193 -16.120 1.00 56.66  ? 338 PHE B N   1 
ATOM   6728 C CA  . PHE B 1 337 ? 12.052  -56.843 -16.623 1.00 62.22  ? 338 PHE B CA  1 
ATOM   6729 C C   . PHE B 1 337 ? 13.015  -55.816 -16.042 1.00 59.50  ? 338 PHE B C   1 
ATOM   6730 O O   . PHE B 1 337 ? 13.259  -54.770 -16.649 1.00 63.28  ? 338 PHE B O   1 
ATOM   6731 C CB  . PHE B 1 337 ? 10.615  -56.411 -16.346 1.00 55.47  ? 338 PHE B CB  1 
ATOM   6732 C CG  . PHE B 1 337 ? 9.592   -57.276 -17.005 1.00 58.84  ? 338 PHE B CG  1 
ATOM   6733 C CD1 . PHE B 1 337 ? 8.891   -58.216 -16.276 1.00 58.89  ? 338 PHE B CD1 1 
ATOM   6734 C CD2 . PHE B 1 337 ? 9.340   -57.162 -18.361 1.00 71.94  ? 338 PHE B CD2 1 
ATOM   6735 C CE1 . PHE B 1 337 ? 7.940   -59.020 -16.887 1.00 70.37  ? 338 PHE B CE1 1 
ATOM   6736 C CE2 . PHE B 1 337 ? 8.391   -57.967 -18.981 1.00 68.43  ? 338 PHE B CE2 1 
ATOM   6737 C CZ  . PHE B 1 337 ? 7.690   -58.895 -18.243 1.00 59.04  ? 338 PHE B CZ  1 
ATOM   6738 N N   . LEU B 1 338 ? 13.562  -56.117 -14.872 1.00 50.33  ? 339 LEU B N   1 
ATOM   6739 C CA  . LEU B 1 338 ? 14.383  -55.158 -14.147 1.00 59.49  ? 339 LEU B CA  1 
ATOM   6740 C C   . LEU B 1 338 ? 15.679  -54.791 -14.867 1.00 61.79  ? 339 LEU B C   1 
ATOM   6741 O O   . LEU B 1 338 ? 16.193  -53.687 -14.695 1.00 65.93  ? 339 LEU B O   1 
ATOM   6742 C CB  . LEU B 1 338 ? 14.697  -55.698 -12.755 1.00 56.65  ? 339 LEU B CB  1 
ATOM   6743 C CG  . LEU B 1 338 ? 13.439  -55.855 -11.902 1.00 61.73  ? 339 LEU B CG  1 
ATOM   6744 C CD1 . LEU B 1 338 ? 13.745  -56.508 -10.564 1.00 51.20  ? 339 LEU B CD1 1 
ATOM   6745 C CD2 . LEU B 1 338 ? 12.779  -54.497 -11.707 1.00 58.84  ? 339 LEU B CD2 1 
ATOM   6746 N N   . VAL B 1 339 ? 16.205  -55.701 -15.680 1.00 63.15  ? 340 VAL B N   1 
ATOM   6747 C CA  . VAL B 1 339 ? 17.450  -55.420 -16.387 1.00 64.76  ? 340 VAL B CA  1 
ATOM   6748 C C   . VAL B 1 339 ? 17.219  -54.586 -17.647 1.00 62.75  ? 340 VAL B C   1 
ATOM   6749 O O   . VAL B 1 339 ? 18.167  -54.214 -18.334 1.00 73.76  ? 340 VAL B O   1 
ATOM   6750 C CB  . VAL B 1 339 ? 18.189  -56.712 -16.749 1.00 57.16  ? 340 VAL B CB  1 
ATOM   6751 C CG1 . VAL B 1 339 ? 18.746  -57.338 -15.490 1.00 62.15  ? 340 VAL B CG1 1 
ATOM   6752 C CG2 . VAL B 1 339 ? 17.264  -57.678 -17.475 1.00 54.53  ? 340 VAL B CG2 1 
ATOM   6753 N N   . TYR B 1 340 ? 15.957  -54.286 -17.935 1.00 66.64  ? 341 TYR B N   1 
ATOM   6754 C CA  . TYR B 1 340 ? 15.597  -53.395 -19.034 1.00 66.11  ? 341 TYR B CA  1 
ATOM   6755 C C   . TYR B 1 340 ? 15.190  -52.001 -18.539 1.00 64.39  ? 341 TYR B C   1 
ATOM   6756 O O   . TYR B 1 340 ? 14.100  -51.522 -18.857 1.00 68.14  ? 341 TYR B O   1 
ATOM   6757 C CB  . TYR B 1 340 ? 14.452  -53.994 -19.858 1.00 59.18  ? 341 TYR B CB  1 
ATOM   6758 C CG  . TYR B 1 340 ? 14.841  -55.185 -20.700 1.00 68.25  ? 341 TYR B CG  1 
ATOM   6759 C CD1 . TYR B 1 340 ? 15.180  -55.030 -22.044 1.00 70.09  ? 341 TYR B CD1 1 
ATOM   6760 C CD2 . TYR B 1 340 ? 14.869  -56.466 -20.157 1.00 63.05  ? 341 TYR B CD2 1 
ATOM   6761 C CE1 . TYR B 1 340 ? 15.538  -56.121 -22.830 1.00 63.70  ? 341 TYR B CE1 1 
ATOM   6762 C CE2 . TYR B 1 340 ? 15.223  -57.566 -20.933 1.00 70.01  ? 341 TYR B CE2 1 
ATOM   6763 C CZ  . TYR B 1 340 ? 15.559  -57.387 -22.270 1.00 74.53  ? 341 TYR B CZ  1 
ATOM   6764 O OH  . TYR B 1 340 ? 15.910  -58.476 -23.043 1.00 69.49  ? 341 TYR B OH  1 
ATOM   6765 N N   . GLY B 1 341 ? 16.047  -51.354 -17.753 1.00 64.95  ? 342 GLY B N   1 
ATOM   6766 C CA  . GLY B 1 341 ? 15.792  -49.975 -17.368 1.00 66.71  ? 342 GLY B CA  1 
ATOM   6767 C C   . GLY B 1 341 ? 16.036  -49.582 -15.922 1.00 65.84  ? 342 GLY B C   1 
ATOM   6768 O O   . GLY B 1 341 ? 16.464  -48.458 -15.650 1.00 66.49  ? 342 GLY B O   1 
ATOM   6769 N N   . ALA B 1 342 ? 15.756  -50.491 -14.991 1.00 64.65  ? 343 ALA B N   1 
ATOM   6770 C CA  . ALA B 1 342 ? 15.888  -50.183 -13.567 1.00 67.00  ? 343 ALA B CA  1 
ATOM   6771 C C   . ALA B 1 342 ? 17.343  -49.934 -13.171 1.00 73.66  ? 343 ALA B C   1 
ATOM   6772 O O   . ALA B 1 342 ? 18.225  -50.741 -13.477 1.00 71.36  ? 343 ALA B O   1 
ATOM   6773 C CB  . ALA B 1 342 ? 15.296  -51.302 -12.721 1.00 57.30  ? 343 ALA B CB  1 
ATOM   6774 N N   . PRO B 1 343 ? 17.595  -48.802 -12.491 1.00 79.24  ? 344 PRO B N   1 
ATOM   6775 C CA  . PRO B 1 343 ? 18.933  -48.457 -11.994 1.00 77.72  ? 344 PRO B CA  1 
ATOM   6776 C C   . PRO B 1 343 ? 19.521  -49.544 -11.097 1.00 76.83  ? 344 PRO B C   1 
ATOM   6777 O O   . PRO B 1 343 ? 18.851  -50.000 -10.166 1.00 75.14  ? 344 PRO B O   1 
ATOM   6778 C CB  . PRO B 1 343 ? 18.694  -47.164 -11.198 1.00 68.74  ? 344 PRO B CB  1 
ATOM   6779 C CG  . PRO B 1 343 ? 17.215  -47.114 -10.952 1.00 61.13  ? 344 PRO B CG  1 
ATOM   6780 C CD  . PRO B 1 343 ? 16.599  -47.776 -12.141 1.00 66.06  ? 344 PRO B CD  1 
ATOM   6781 N N   . GLY B 1 344 ? 20.752  -49.959 -11.392 1.00 77.37  ? 345 GLY B N   1 
ATOM   6782 C CA  . GLY B 1 344 ? 21.465  -50.915 -10.561 1.00 77.41  ? 345 GLY B CA  1 
ATOM   6783 C C   . GLY B 1 344 ? 21.355  -52.371 -10.981 1.00 69.31  ? 345 GLY B C   1 
ATOM   6784 O O   . GLY B 1 344 ? 21.882  -53.259 -10.311 1.00 66.17  ? 345 GLY B O   1 
ATOM   6785 N N   . PHE B 1 345 ? 20.679  -52.625 -12.093 1.00 77.19  ? 346 PHE B N   1 
ATOM   6786 C CA  . PHE B 1 345 ? 20.445  -53.999 -12.523 1.00 76.67  ? 346 PHE B CA  1 
ATOM   6787 C C   . PHE B 1 345 ? 21.294  -54.412 -13.726 1.00 74.81  ? 346 PHE B C   1 
ATOM   6788 O O   . PHE B 1 345 ? 21.584  -53.612 -14.620 1.00 78.46  ? 346 PHE B O   1 
ATOM   6789 C CB  . PHE B 1 345 ? 18.959  -54.210 -12.839 1.00 64.28  ? 346 PHE B CB  1 
ATOM   6790 C CG  . PHE B 1 345 ? 18.102  -54.385 -11.620 1.00 66.30  ? 346 PHE B CG  1 
ATOM   6791 C CD1 . PHE B 1 345 ? 17.766  -55.652 -11.175 1.00 62.67  ? 346 PHE B CD1 1 
ATOM   6792 C CD2 . PHE B 1 345 ? 17.643  -53.283 -10.910 1.00 70.98  ? 346 PHE B CD2 1 
ATOM   6793 C CE1 . PHE B 1 345 ? 16.985  -55.822 -10.048 1.00 57.92  ? 346 PHE B CE1 1 
ATOM   6794 C CE2 . PHE B 1 345 ? 16.856  -53.445 -9.780  1.00 61.47  ? 346 PHE B CE2 1 
ATOM   6795 C CZ  . PHE B 1 345 ? 16.528  -54.717 -9.347  1.00 55.84  ? 346 PHE B CZ  1 
ATOM   6796 N N   . SER B 1 346 ? 21.693  -55.678 -13.714 1.00 69.51  ? 347 SER B N   1 
ATOM   6797 C CA  . SER B 1 346 ? 22.373  -56.313 -14.832 1.00 75.69  ? 347 SER B CA  1 
ATOM   6798 C C   . SER B 1 346 ? 22.268  -57.822 -14.655 1.00 82.45  ? 347 SER B C   1 
ATOM   6799 O O   . SER B 1 346 ? 22.084  -58.318 -13.535 1.00 77.08  ? 347 SER B O   1 
ATOM   6800 C CB  . SER B 1 346 ? 23.839  -55.882 -14.917 1.00 82.91  ? 347 SER B CB  1 
ATOM   6801 O OG  . SER B 1 346 ? 24.481  -56.459 -16.041 1.00 75.80  ? 347 SER B OG  1 
ATOM   6802 N N   . LYS B 1 347 ? 22.378  -58.553 -15.757 1.00 69.67  ? 348 LYS B N   1 
ATOM   6803 C CA  . LYS B 1 347 ? 22.343  -60.001 -15.686 1.00 62.65  ? 348 LYS B CA  1 
ATOM   6804 C C   . LYS B 1 347 ? 23.676  -60.524 -15.153 1.00 72.80  ? 348 LYS B C   1 
ATOM   6805 O O   . LYS B 1 347 ? 23.794  -61.692 -14.783 1.00 69.44  ? 348 LYS B O   1 
ATOM   6806 C CB  . LYS B 1 347 ? 22.041  -60.599 -17.059 1.00 60.58  ? 348 LYS B CB  1 
ATOM   6807 C CG  . LYS B 1 347 ? 23.200  -60.506 -18.038 1.00 70.36  ? 348 LYS B CG  1 
ATOM   6808 C CD  . LYS B 1 347 ? 22.873  -61.163 -19.379 1.00 67.63  ? 348 LYS B CD  1 
ATOM   6809 C CE  . LYS B 1 347 ? 24.091  -61.873 -19.947 1.00 60.84  ? 348 LYS B CE  1 
ATOM   6810 N NZ  . LYS B 1 347 ? 24.583  -62.901 -18.976 1.00 64.47  ? 348 LYS B NZ  1 
ATOM   6811 N N   . ASP B 1 348 ? 24.674  -59.644 -15.089 1.00 72.29  ? 349 ASP B N   1 
ATOM   6812 C CA  . ASP B 1 348 ? 26.047  -60.076 -14.842 1.00 78.19  ? 349 ASP B CA  1 
ATOM   6813 C C   . ASP B 1 348 ? 26.551  -59.845 -13.410 1.00 84.24  ? 349 ASP B C   1 
ATOM   6814 O O   . ASP B 1 348 ? 27.640  -60.308 -13.059 1.00 89.84  ? 349 ASP B O   1 
ATOM   6815 C CB  . ASP B 1 348 ? 26.988  -59.394 -15.845 1.00 80.74  ? 349 ASP B CB  1 
ATOM   6816 C CG  . ASP B 1 348 ? 26.753  -59.857 -17.283 1.00 72.38  ? 349 ASP B CG  1 
ATOM   6817 O OD1 . ASP B 1 348 ? 26.514  -61.071 -17.493 1.00 61.33  ? 349 ASP B OD1 1 
ATOM   6818 O OD2 . ASP B 1 348 ? 26.808  -59.004 -18.202 1.00 63.14  ? 349 ASP B OD2 1 
ATOM   6819 N N   . ASN B 1 349 ? 25.783  -59.130 -12.587 1.00 82.58  ? 350 ASN B N   1 
ATOM   6820 C CA  . ASN B 1 349 ? 26.051  -59.122 -11.143 1.00 81.54  ? 350 ASN B CA  1 
ATOM   6821 C C   . ASN B 1 349 ? 24.785  -59.461 -10.361 1.00 80.43  ? 350 ASN B C   1 
ATOM   6822 O O   . ASN B 1 349 ? 23.785  -59.884 -10.949 1.00 73.48  ? 350 ASN B O   1 
ATOM   6823 C CB  . ASN B 1 349 ? 26.660  -57.780 -10.669 1.00 79.03  ? 350 ASN B CB  1 
ATOM   6824 C CG  . ASN B 1 349 ? 25.765  -56.562 -10.930 1.00 78.30  ? 350 ASN B CG  1 
ATOM   6825 O OD1 . ASN B 1 349 ? 24.538  -56.639 -10.895 1.00 77.45  ? 350 ASN B OD1 1 
ATOM   6826 N ND2 . ASN B 1 349 ? 26.407  -55.418 -11.183 1.00 84.99  ? 350 ASN B ND2 1 
ATOM   6827 N N   . GLU B 1 350 ? 24.828  -59.291 -9.043  1.00 74.54  ? 351 GLU B N   1 
ATOM   6828 C CA  . GLU B 1 350 ? 23.707  -59.696 -8.199  1.00 72.61  ? 351 GLU B CA  1 
ATOM   6829 C C   . GLU B 1 350 ? 22.605  -58.633 -8.152  1.00 70.55  ? 351 GLU B C   1 
ATOM   6830 O O   . GLU B 1 350 ? 21.513  -58.888 -7.632  1.00 61.03  ? 351 GLU B O   1 
ATOM   6831 C CB  . GLU B 1 350 ? 24.195  -60.021 -6.782  1.00 75.23  ? 351 GLU B CB  1 
ATOM   6832 C CG  . GLU B 1 350 ? 25.075  -61.260 -6.703  1.00 72.28  ? 351 GLU B CG  1 
ATOM   6833 C CD  . GLU B 1 350 ? 24.384  -62.499 -7.250  1.00 90.21  ? 351 GLU B CD  1 
ATOM   6834 O OE1 . GLU B 1 350 ? 24.958  -63.158 -8.146  1.00 100.24 ? 351 GLU B OE1 1 
ATOM   6835 O OE2 . GLU B 1 350 ? 23.267  -62.817 -6.785  1.00 90.37  ? 351 GLU B OE2 1 
ATOM   6836 N N   . SER B 1 351 ? 22.894  -57.456 -8.706  1.00 59.56  ? 352 SER B N   1 
ATOM   6837 C CA  . SER B 1 351 ? 21.924  -56.361 -8.771  1.00 64.56  ? 352 SER B CA  1 
ATOM   6838 C C   . SER B 1 351 ? 21.387  -55.963 -7.391  1.00 67.78  ? 352 SER B C   1 
ATOM   6839 O O   . SER B 1 351 ? 20.193  -55.709 -7.229  1.00 63.03  ? 352 SER B O   1 
ATOM   6840 C CB  . SER B 1 351 ? 20.756  -56.729 -9.695  1.00 61.67  ? 352 SER B CB  1 
ATOM   6841 O OG  . SER B 1 351 ? 21.146  -56.720 -11.057 1.00 58.96  ? 352 SER B OG  1 
ATOM   6842 N N   . LEU B 1 352 ? 22.278  -55.912 -6.404  1.00 69.96  ? 353 LEU B N   1 
ATOM   6843 C CA  . LEU B 1 352 ? 21.915  -55.485 -5.056  1.00 61.21  ? 353 LEU B CA  1 
ATOM   6844 C C   . LEU B 1 352 ? 21.790  -53.962 -4.977  1.00 68.58  ? 353 LEU B C   1 
ATOM   6845 O O   . LEU B 1 352 ? 22.788  -53.257 -4.845  1.00 78.63  ? 353 LEU B O   1 
ATOM   6846 C CB  . LEU B 1 352 ? 22.945  -55.992 -4.050  1.00 52.74  ? 353 LEU B CB  1 
ATOM   6847 C CG  . LEU B 1 352 ? 23.086  -57.513 -4.038  1.00 53.86  ? 353 LEU B CG  1 
ATOM   6848 C CD1 . LEU B 1 352 ? 24.055  -57.962 -2.963  1.00 58.22  ? 353 LEU B CD1 1 
ATOM   6849 C CD2 . LEU B 1 352 ? 21.731  -58.152 -3.822  1.00 59.61  ? 353 LEU B CD2 1 
ATOM   6850 N N   . ILE B 1 353 ? 20.562  -53.459 -5.049  1.00 62.69  ? 354 ILE B N   1 
ATOM   6851 C CA  . ILE B 1 353 ? 20.330  -52.021 -5.151  1.00 60.24  ? 354 ILE B CA  1 
ATOM   6852 C C   . ILE B 1 353 ? 20.215  -51.330 -3.793  1.00 59.57  ? 354 ILE B C   1 
ATOM   6853 O O   . ILE B 1 353 ? 19.904  -51.960 -2.779  1.00 54.87  ? 354 ILE B O   1 
ATOM   6854 C CB  . ILE B 1 353 ? 19.052  -51.722 -5.966  1.00 66.21  ? 354 ILE B CB  1 
ATOM   6855 C CG1 . ILE B 1 353 ? 17.820  -52.333 -5.282  1.00 61.45  ? 354 ILE B CG1 1 
ATOM   6856 C CG2 . ILE B 1 353 ? 19.203  -52.255 -7.371  1.00 61.59  ? 354 ILE B CG2 1 
ATOM   6857 C CD1 . ILE B 1 353 ? 16.524  -52.139 -6.034  1.00 46.37  ? 354 ILE B CD1 1 
ATOM   6858 N N   . SER B 1 354 ? 20.471  -50.024 -3.793  1.00 63.28  ? 355 SER B N   1 
ATOM   6859 C CA  . SER B 1 354 ? 20.359  -49.201 -2.595  1.00 57.31  ? 355 SER B CA  1 
ATOM   6860 C C   . SER B 1 354 ? 18.922  -48.734 -2.388  1.00 64.24  ? 355 SER B C   1 
ATOM   6861 O O   . SER B 1 354 ? 18.081  -48.857 -3.280  1.00 64.75  ? 355 SER B O   1 
ATOM   6862 C CB  . SER B 1 354 ? 21.291  -47.990 -2.685  1.00 52.18  ? 355 SER B CB  1 
ATOM   6863 O OG  . SER B 1 354 ? 20.861  -47.083 -3.692  1.00 55.13  ? 355 SER B OG  1 
ATOM   6864 N N   . ARG B 1 355 ? 18.649  -48.196 -1.207  1.00 61.06  ? 356 ARG B N   1 
ATOM   6865 C CA  . ARG B 1 355 ? 17.335  -47.651 -0.902  1.00 55.01  ? 356 ARG B CA  1 
ATOM   6866 C C   . ARG B 1 355 ? 16.952  -46.576 -1.922  1.00 58.47  ? 356 ARG B C   1 
ATOM   6867 O O   . ARG B 1 355 ? 15.797  -46.485 -2.333  1.00 65.81  ? 356 ARG B O   1 
ATOM   6868 C CB  . ARG B 1 355 ? 17.317  -47.089 0.524   1.00 62.14  ? 356 ARG B CB  1 
ATOM   6869 C CG  . ARG B 1 355 ? 15.999  -46.483 0.964   1.00 60.46  ? 356 ARG B CG  1 
ATOM   6870 C CD  . ARG B 1 355 ? 14.993  -47.540 1.352   1.00 53.35  ? 356 ARG B CD  1 
ATOM   6871 N NE  . ARG B 1 355 ? 13.689  -46.957 1.653   1.00 52.32  ? 356 ARG B NE  1 
ATOM   6872 C CZ  . ARG B 1 355 ? 12.580  -47.666 1.833   1.00 43.72  ? 356 ARG B CZ  1 
ATOM   6873 N NH1 . ARG B 1 355 ? 12.616  -48.987 1.747   1.00 42.04  ? 356 ARG B NH1 1 
ATOM   6874 N NH2 . ARG B 1 355 ? 11.437  -47.055 2.096   1.00 42.61  ? 356 ARG B NH2 1 
ATOM   6875 N N   . ALA B 1 356 ? 17.925  -45.781 -2.351  1.00 49.52  ? 357 ALA B N   1 
ATOM   6876 C CA  . ALA B 1 356 ? 17.648  -44.715 -3.313  1.00 65.35  ? 357 ALA B CA  1 
ATOM   6877 C C   . ALA B 1 356 ? 17.372  -45.268 -4.716  1.00 62.74  ? 357 ALA B C   1 
ATOM   6878 O O   . ALA B 1 356 ? 16.573  -44.711 -5.472  1.00 56.14  ? 357 ALA B O   1 
ATOM   6879 C CB  . ALA B 1 356 ? 18.804  -43.724 -3.354  1.00 52.09  ? 357 ALA B CB  1 
ATOM   6880 N N   . GLU B 1 357 ? 18.044  -46.357 -5.065  1.00 56.46  ? 358 GLU B N   1 
ATOM   6881 C CA  . GLU B 1 357 ? 17.848  -46.976 -6.364  1.00 52.33  ? 358 GLU B CA  1 
ATOM   6882 C C   . GLU B 1 357 ? 16.490  -47.660 -6.389  1.00 55.08  ? 358 GLU B C   1 
ATOM   6883 O O   . GLU B 1 357 ? 15.838  -47.740 -7.428  1.00 56.64  ? 358 GLU B O   1 
ATOM   6884 C CB  . GLU B 1 357 ? 18.969  -47.974 -6.667  1.00 64.63  ? 358 GLU B CB  1 
ATOM   6885 C CG  . GLU B 1 357 ? 20.347  -47.337 -6.848  1.00 69.87  ? 358 GLU B CG  1 
ATOM   6886 C CD  . GLU B 1 357 ? 21.422  -48.343 -7.257  1.00 75.88  ? 358 GLU B CD  1 
ATOM   6887 O OE1 . GLU B 1 357 ? 21.523  -49.413 -6.615  1.00 66.70  ? 358 GLU B OE1 1 
ATOM   6888 O OE2 . GLU B 1 357 ? 22.162  -48.060 -8.228  1.00 74.91  ? 358 GLU B OE2 1 
ATOM   6889 N N   . PHE B 1 358 ? 16.073  -48.147 -5.227  1.00 60.86  ? 359 PHE B N   1 
ATOM   6890 C CA  . PHE B 1 358 ? 14.759  -48.756 -5.058  1.00 54.78  ? 359 PHE B CA  1 
ATOM   6891 C C   . PHE B 1 358 ? 13.641  -47.747 -5.301  1.00 51.30  ? 359 PHE B C   1 
ATOM   6892 O O   . PHE B 1 358 ? 12.669  -48.046 -5.989  1.00 47.63  ? 359 PHE B O   1 
ATOM   6893 C CB  . PHE B 1 358 ? 14.642  -49.355 -3.655  1.00 57.02  ? 359 PHE B CB  1 
ATOM   6894 C CG  . PHE B 1 358 ? 13.256  -49.802 -3.296  1.00 53.15  ? 359 PHE B CG  1 
ATOM   6895 C CD1 . PHE B 1 358 ? 12.744  -50.978 -3.808  1.00 44.94  ? 359 PHE B CD1 1 
ATOM   6896 C CD2 . PHE B 1 358 ? 12.472  -49.049 -2.431  1.00 57.42  ? 359 PHE B CD2 1 
ATOM   6897 C CE1 . PHE B 1 358 ? 11.472  -51.395 -3.475  1.00 44.66  ? 359 PHE B CE1 1 
ATOM   6898 C CE2 . PHE B 1 358 ? 11.202  -49.458 -2.090  1.00 48.28  ? 359 PHE B CE2 1 
ATOM   6899 C CZ  . PHE B 1 358 ? 10.701  -50.637 -2.612  1.00 52.80  ? 359 PHE B CZ  1 
ATOM   6900 N N   . LEU B 1 359 ? 13.785  -46.552 -4.732  1.00 58.81  ? 360 LEU B N   1 
ATOM   6901 C CA  . LEU B 1 359 ? 12.790  -45.493 -4.898  1.00 55.42  ? 360 LEU B CA  1 
ATOM   6902 C C   . LEU B 1 359 ? 12.717  -45.069 -6.352  1.00 59.91  ? 360 LEU B C   1 
ATOM   6903 O O   . LEU B 1 359 ? 11.633  -44.826 -6.878  1.00 65.02  ? 360 LEU B O   1 
ATOM   6904 C CB  . LEU B 1 359 ? 13.111  -44.289 -4.002  1.00 53.39  ? 360 LEU B CB  1 
ATOM   6905 C CG  . LEU B 1 359 ? 13.133  -44.588 -2.493  1.00 67.68  ? 360 LEU B CG  1 
ATOM   6906 C CD1 . LEU B 1 359 ? 13.429  -43.351 -1.650  1.00 60.35  ? 360 LEU B CD1 1 
ATOM   6907 C CD2 . LEU B 1 359 ? 11.821  -45.220 -2.059  1.00 63.67  ? 360 LEU B CD2 1 
ATOM   6908 N N   . ALA B 1 360 ? 13.880  -44.996 -6.995  1.00 61.74  ? 361 ALA B N   1 
ATOM   6909 C CA  . ALA B 1 360 ? 13.968  -44.640 -8.406  1.00 54.14  ? 361 ALA B CA  1 
ATOM   6910 C C   . ALA B 1 360 ? 13.391  -45.743 -9.286  1.00 60.72  ? 361 ALA B C   1 
ATOM   6911 O O   . ALA B 1 360 ? 12.774  -45.473 -10.320 1.00 66.07  ? 361 ALA B O   1 
ATOM   6912 C CB  . ALA B 1 360 ? 15.409  -44.359 -8.791  1.00 50.99  ? 361 ALA B CB  1 
ATOM   6913 N N   . GLY B 1 361 ? 13.603  -46.987 -8.869  1.00 57.26  ? 362 GLY B N   1 
ATOM   6914 C CA  . GLY B 1 361 ? 13.095  -48.133 -9.599  1.00 57.19  ? 362 GLY B CA  1 
ATOM   6915 C C   . GLY B 1 361 ? 11.581  -48.178 -9.614  1.00 56.01  ? 362 GLY B C   1 
ATOM   6916 O O   . GLY B 1 361 ? 10.967  -48.522 -10.624 1.00 50.32  ? 362 GLY B O   1 
ATOM   6917 N N   . VAL B 1 362 ? 10.979  -47.819 -8.486  1.00 53.19  ? 363 VAL B N   1 
ATOM   6918 C CA  . VAL B 1 362 ? 9.532   -47.812 -8.371  1.00 51.37  ? 363 VAL B CA  1 
ATOM   6919 C C   . VAL B 1 362 ? 8.925   -46.864 -9.406  1.00 52.01  ? 363 VAL B C   1 
ATOM   6920 O O   . VAL B 1 362 ? 7.961   -47.235 -10.081 1.00 53.21  ? 363 VAL B O   1 
ATOM   6921 C CB  . VAL B 1 362 ? 9.088   -47.436 -6.939  1.00 56.05  ? 363 VAL B CB  1 
ATOM   6922 C CG1 . VAL B 1 362 ? 7.604   -47.126 -6.881  1.00 44.22  ? 363 VAL B CG1 1 
ATOM   6923 C CG2 . VAL B 1 362 ? 9.428   -48.569 -5.977  1.00 50.69  ? 363 VAL B CG2 1 
ATOM   6924 N N   . ARG B 1 363 ? 9.507   -45.674 -9.564  1.00 49.49  ? 364 ARG B N   1 
ATOM   6925 C CA  . ARG B 1 363 ? 9.028   -44.710 -10.570 1.00 62.46  ? 364 ARG B CA  1 
ATOM   6926 C C   . ARG B 1 363 ? 9.078   -45.273 -11.997 1.00 59.71  ? 364 ARG B C   1 
ATOM   6927 O O   . ARG B 1 363 ? 8.174   -45.037 -12.802 1.00 57.72  ? 364 ARG B O   1 
ATOM   6928 C CB  . ARG B 1 363 ? 9.831   -43.402 -10.522 1.00 57.81  ? 364 ARG B CB  1 
ATOM   6929 C CG  . ARG B 1 363 ? 9.736   -42.611 -9.218  1.00 54.60  ? 364 ARG B CG  1 
ATOM   6930 C CD  . ARG B 1 363 ? 8.339   -42.637 -8.619  1.00 64.96  ? 364 ARG B CD  1 
ATOM   6931 N NE  . ARG B 1 363 ? 7.333   -41.930 -9.415  1.00 75.39  ? 364 ARG B NE  1 
ATOM   6932 C CZ  . ARG B 1 363 ? 6.877   -40.710 -9.137  1.00 85.09  ? 364 ARG B CZ  1 
ATOM   6933 N NH1 . ARG B 1 363 ? 7.347   -40.043 -8.085  1.00 75.17  ? 364 ARG B NH1 1 
ATOM   6934 N NH2 . ARG B 1 363 ? 5.950   -40.153 -9.909  1.00 78.95  ? 364 ARG B NH2 1 
ATOM   6935 N N   . VAL B 1 364 ? 10.132  -46.020 -12.305 1.00 55.54  ? 365 VAL B N   1 
ATOM   6936 C CA  . VAL B 1 364 ? 10.277  -46.613 -13.628 1.00 54.51  ? 365 VAL B CA  1 
ATOM   6937 C C   . VAL B 1 364 ? 9.273   -47.741 -13.862 1.00 60.98  ? 365 VAL B C   1 
ATOM   6938 O O   . VAL B 1 364 ? 8.581   -47.768 -14.884 1.00 68.79  ? 365 VAL B O   1 
ATOM   6939 C CB  . VAL B 1 364 ? 11.701  -47.160 -13.835 1.00 67.98  ? 365 VAL B CB  1 
ATOM   6940 C CG1 . VAL B 1 364 ? 11.832  -47.823 -15.206 1.00 60.49  ? 365 VAL B CG1 1 
ATOM   6941 C CG2 . VAL B 1 364 ? 12.726  -46.048 -13.652 1.00 59.69  ? 365 VAL B CG2 1 
ATOM   6942 N N   . GLY B 1 365 ? 9.203   -48.665 -12.905 1.00 59.56  ? 366 GLY B N   1 
ATOM   6943 C CA  . GLY B 1 365 ? 8.365   -49.848 -13.012 1.00 56.93  ? 366 GLY B CA  1 
ATOM   6944 C C   . GLY B 1 365 ? 6.883   -49.594 -12.802 1.00 56.39  ? 366 GLY B C   1 
ATOM   6945 O O   . GLY B 1 365 ? 6.043   -50.366 -13.270 1.00 56.72  ? 366 GLY B O   1 
ATOM   6946 N N   . VAL B 1 366 ? 6.556   -48.524 -12.086 1.00 46.59  ? 367 VAL B N   1 
ATOM   6947 C CA  . VAL B 1 366 ? 5.176   -48.060 -12.034 1.00 48.11  ? 367 VAL B CA  1 
ATOM   6948 C C   . VAL B 1 366 ? 5.105   -46.662 -12.634 1.00 55.15  ? 367 VAL B C   1 
ATOM   6949 O O   . VAL B 1 366 ? 5.013   -45.668 -11.908 1.00 60.75  ? 367 VAL B O   1 
ATOM   6950 C CB  . VAL B 1 366 ? 4.613   -48.044 -10.605 1.00 45.26  ? 367 VAL B CB  1 
ATOM   6951 C CG1 . VAL B 1 366 ? 3.100   -48.030 -10.649 1.00 40.53  ? 367 VAL B CG1 1 
ATOM   6952 C CG2 . VAL B 1 366 ? 5.105   -49.255 -9.824  1.00 43.13  ? 367 VAL B CG2 1 
ATOM   6953 N N   . PRO B 1 367 ? 5.150   -46.578 -13.973 1.00 65.54  ? 368 PRO B N   1 
ATOM   6954 C CA  . PRO B 1 367 ? 5.273   -45.286 -14.650 1.00 65.26  ? 368 PRO B CA  1 
ATOM   6955 C C   . PRO B 1 367 ? 3.967   -44.496 -14.683 1.00 62.41  ? 368 PRO B C   1 
ATOM   6956 O O   . PRO B 1 367 ? 2.875   -45.082 -14.651 1.00 58.60  ? 368 PRO B O   1 
ATOM   6957 C CB  . PRO B 1 367 ? 5.711   -45.679 -16.057 1.00 63.80  ? 368 PRO B CB  1 
ATOM   6958 C CG  . PRO B 1 367 ? 5.079   -47.010 -16.270 1.00 61.27  ? 368 PRO B CG  1 
ATOM   6959 C CD  . PRO B 1 367 ? 5.050   -47.694 -14.933 1.00 59.31  ? 368 PRO B CD  1 
ATOM   6960 N N   . GLN B 1 368 ? 4.108   -43.172 -14.732 1.00 72.28  ? 369 GLN B N   1 
ATOM   6961 C CA  . GLN B 1 368 ? 2.984   -42.231 -14.807 1.00 85.33  ? 369 GLN B CA  1 
ATOM   6962 C C   . GLN B 1 368 ? 1.928   -42.447 -13.717 1.00 80.78  ? 369 GLN B C   1 
ATOM   6963 O O   . GLN B 1 368 ? 0.756   -42.703 -14.010 1.00 75.09  ? 369 GLN B O   1 
ATOM   6964 C CB  . GLN B 1 368 ? 2.317   -42.297 -16.189 1.00 85.44  ? 369 GLN B CB  1 
ATOM   6965 C CG  . GLN B 1 368 ? 3.263   -42.031 -17.350 1.00 81.72  ? 369 GLN B CG  1 
ATOM   6966 C CD  . GLN B 1 368 ? 3.761   -40.602 -17.395 1.00 87.36  ? 369 GLN B CD  1 
ATOM   6967 O OE1 . GLN B 1 368 ? 2.967   -39.656 -17.440 1.00 89.05  ? 369 GLN B OE1 1 
ATOM   6968 N NE2 . GLN B 1 368 ? 5.084   -40.435 -17.389 1.00 74.90  ? 369 GLN B NE2 1 
ATOM   6969 N N   . VAL B 1 369 ? 2.357   -42.351 -12.462 1.00 77.70  ? 370 VAL B N   1 
ATOM   6970 C CA  . VAL B 1 369 ? 1.437   -42.279 -11.337 1.00 71.73  ? 370 VAL B CA  1 
ATOM   6971 C C   . VAL B 1 369 ? 1.847   -41.093 -10.460 1.00 65.25  ? 370 VAL B C   1 
ATOM   6972 O O   . VAL B 1 369 ? 3.007   -40.665 -10.490 1.00 58.08  ? 370 VAL B O   1 
ATOM   6973 C CB  . VAL B 1 369 ? 1.422   -43.589 -10.518 1.00 64.27  ? 370 VAL B CB  1 
ATOM   6974 C CG1 . VAL B 1 369 ? 0.878   -44.727 -11.356 1.00 55.81  ? 370 VAL B CG1 1 
ATOM   6975 C CG2 . VAL B 1 369 ? 2.816   -43.921 -10.012 1.00 63.56  ? 370 VAL B CG2 1 
ATOM   6976 N N   . SER B 1 370 ? 0.902   -40.552 -9.696  1.00 58.42  ? 371 SER B N   1 
ATOM   6977 C CA  . SER B 1 370 ? 1.198   -39.423 -8.815  1.00 53.03  ? 371 SER B CA  1 
ATOM   6978 C C   . SER B 1 370 ? 2.219   -39.785 -7.741  1.00 61.96  ? 371 SER B C   1 
ATOM   6979 O O   . SER B 1 370 ? 2.393   -40.960 -7.407  1.00 64.63  ? 371 SER B O   1 
ATOM   6980 C CB  . SER B 1 370 ? -0.079  -38.914 -8.155  1.00 58.66  ? 371 SER B CB  1 
ATOM   6981 O OG  . SER B 1 370 ? -0.698  -39.929 -7.390  1.00 55.09  ? 371 SER B OG  1 
ATOM   6982 N N   . ASP B 1 371 ? 2.889   -38.771 -7.198  1.00 66.27  ? 372 ASP B N   1 
ATOM   6983 C CA  . ASP B 1 371 ? 3.859   -38.983 -6.126  1.00 61.42  ? 372 ASP B CA  1 
ATOM   6984 C C   . ASP B 1 371 ? 3.200   -39.658 -4.924  1.00 63.26  ? 372 ASP B C   1 
ATOM   6985 O O   . ASP B 1 371 ? 3.813   -40.482 -4.243  1.00 52.82  ? 372 ASP B O   1 
ATOM   6986 C CB  . ASP B 1 371 ? 4.493   -37.660 -5.711  1.00 61.72  ? 372 ASP B CB  1 
ATOM   6987 C CG  . ASP B 1 371 ? 5.222   -36.984 -6.853  1.00 80.58  ? 372 ASP B CG  1 
ATOM   6988 O OD1 . ASP B 1 371 ? 5.862   -37.702 -7.656  1.00 76.85  ? 372 ASP B OD1 1 
ATOM   6989 O OD2 . ASP B 1 371 ? 5.147   -35.738 -6.953  1.00 85.31  ? 372 ASP B OD2 1 
ATOM   6990 N N   . LEU B 1 372 ? 1.942   -39.307 -4.681  1.00 62.67  ? 373 LEU B N   1 
ATOM   6991 C CA  . LEU B 1 372 ? 1.155   -39.956 -3.647  1.00 56.93  ? 373 LEU B CA  1 
ATOM   6992 C C   . LEU B 1 372 ? 1.085   -41.460 -3.906  1.00 60.42  ? 373 LEU B C   1 
ATOM   6993 O O   . LEU B 1 372 ? 1.273   -42.264 -2.993  1.00 62.98  ? 373 LEU B O   1 
ATOM   6994 C CB  . LEU B 1 372 ? -0.249  -39.348 -3.582  1.00 50.08  ? 373 LEU B CB  1 
ATOM   6995 C CG  . LEU B 1 372 ? -1.192  -39.866 -2.495  1.00 57.02  ? 373 LEU B CG  1 
ATOM   6996 C CD1 . LEU B 1 372 ? -0.536  -39.834 -1.111  1.00 51.13  ? 373 LEU B CD1 1 
ATOM   6997 C CD2 . LEU B 1 372 ? -2.484  -39.062 -2.500  1.00 60.22  ? 373 LEU B CD2 1 
ATOM   6998 N N   . ALA B 1 373 ? 0.838   -41.841 -5.155  1.00 59.67  ? 374 ALA B N   1 
ATOM   6999 C CA  . ALA B 1 373 ? 0.728   -43.254 -5.492  1.00 47.83  ? 374 ALA B CA  1 
ATOM   7000 C C   . ALA B 1 373 ? 2.077   -43.952 -5.351  1.00 48.97  ? 374 ALA B C   1 
ATOM   7001 O O   . ALA B 1 373 ? 2.152   -45.065 -4.831  1.00 43.77  ? 374 ALA B O   1 
ATOM   7002 C CB  . ALA B 1 373 ? 0.184   -43.426 -6.889  1.00 49.98  ? 374 ALA B CB  1 
ATOM   7003 N N   . ALA B 1 374 ? 3.137   -43.293 -5.811  1.00 45.51  ? 375 ALA B N   1 
ATOM   7004 C CA  . ALA B 1 374 ? 4.483   -43.845 -5.708  1.00 44.43  ? 375 ALA B CA  1 
ATOM   7005 C C   . ALA B 1 374 ? 4.872   -44.046 -4.250  1.00 51.67  ? 375 ALA B C   1 
ATOM   7006 O O   . ALA B 1 374 ? 5.499   -45.048 -3.903  1.00 49.16  ? 375 ALA B O   1 
ATOM   7007 C CB  . ALA B 1 374 ? 5.480   -42.949 -6.406  1.00 47.82  ? 375 ALA B CB  1 
ATOM   7008 N N   . GLU B 1 375 ? 4.484   -43.093 -3.401  1.00 60.20  ? 376 GLU B N   1 
ATOM   7009 C CA  . GLU B 1 375 ? 4.679   -43.204 -1.956  1.00 50.12  ? 376 GLU B CA  1 
ATOM   7010 C C   . GLU B 1 375 ? 3.974   -44.428 -1.407  1.00 44.26  ? 376 GLU B C   1 
ATOM   7011 O O   . GLU B 1 375 ? 4.555   -45.211 -0.662  1.00 48.87  ? 376 GLU B O   1 
ATOM   7012 C CB  . GLU B 1 375 ? 4.163   -41.956 -1.230  1.00 65.26  ? 376 GLU B CB  1 
ATOM   7013 C CG  . GLU B 1 375 ? 5.005   -40.693 -1.393  1.00 82.69  ? 376 GLU B CG  1 
ATOM   7014 C CD  . GLU B 1 375 ? 6.258   -40.674 -0.523  1.00 102.40 ? 376 GLU B CD  1 
ATOM   7015 O OE1 . GLU B 1 375 ? 6.670   -39.559 -0.128  1.00 104.05 ? 376 GLU B OE1 1 
ATOM   7016 O OE2 . GLU B 1 375 ? 6.835   -41.757 -0.243  1.00 91.33  ? 376 GLU B OE2 1 
ATOM   7017 N N   . ALA B 1 376 ? 2.708   -44.573 -1.776  1.00 41.97  ? 377 ALA B N   1 
ATOM   7018 C CA  . ALA B 1 376 ? 1.899   -45.692 -1.318  1.00 49.35  ? 377 ALA B CA  1 
ATOM   7019 C C   . ALA B 1 376 ? 2.553   -47.034 -1.640  1.00 48.37  ? 377 ALA B C   1 
ATOM   7020 O O   . ALA B 1 376 ? 2.507   -47.969 -0.832  1.00 47.57  ? 377 ALA B O   1 
ATOM   7021 C CB  . ALA B 1 376 ? 0.510   -45.615 -1.934  1.00 45.84  ? 377 ALA B CB  1 
ATOM   7022 N N   . VAL B 1 377 ? 3.169   -47.119 -2.816  1.00 47.01  ? 378 VAL B N   1 
ATOM   7023 C CA  . VAL B 1 377 ? 3.825   -48.347 -3.244  1.00 45.92  ? 378 VAL B CA  1 
ATOM   7024 C C   . VAL B 1 377 ? 5.054   -48.613 -2.385  1.00 45.99  ? 378 VAL B C   1 
ATOM   7025 O O   . VAL B 1 377 ? 5.237   -49.731 -1.881  1.00 43.24  ? 378 VAL B O   1 
ATOM   7026 C CB  . VAL B 1 377 ? 4.219   -48.292 -4.728  1.00 44.71  ? 378 VAL B CB  1 
ATOM   7027 C CG1 . VAL B 1 377 ? 5.072   -49.499 -5.098  1.00 35.84  ? 378 VAL B CG1 1 
ATOM   7028 C CG2 . VAL B 1 377 ? 2.974   -48.238 -5.588  1.00 35.86  ? 378 VAL B CG2 1 
ATOM   7029 N N   . VAL B 1 378 ? 5.875   -47.584 -2.197  1.00 37.38  ? 379 VAL B N   1 
ATOM   7030 C CA  . VAL B 1 378 ? 7.054   -47.709 -1.346  1.00 45.44  ? 379 VAL B CA  1 
ATOM   7031 C C   . VAL B 1 378 ? 6.696   -48.189 0.071   1.00 47.17  ? 379 VAL B C   1 
ATOM   7032 O O   . VAL B 1 378 ? 7.402   -49.017 0.647   1.00 47.19  ? 379 VAL B O   1 
ATOM   7033 C CB  . VAL B 1 378 ? 7.817   -46.379 -1.243  1.00 46.01  ? 379 VAL B CB  1 
ATOM   7034 C CG1 . VAL B 1 378 ? 8.958   -46.514 -0.246  1.00 50.13  ? 379 VAL B CG1 1 
ATOM   7035 C CG2 . VAL B 1 378 ? 8.349   -45.963 -2.602  1.00 45.96  ? 379 VAL B CG2 1 
ATOM   7036 N N   . LEU B 1 379 ? 5.595   -47.676 0.616   1.00 47.33  ? 380 LEU B N   1 
ATOM   7037 C CA  . LEU B 1 379 ? 5.114   -48.080 1.937   1.00 46.75  ? 380 LEU B CA  1 
ATOM   7038 C C   . LEU B 1 379 ? 4.807   -49.569 2.009   1.00 44.37  ? 380 LEU B C   1 
ATOM   7039 O O   . LEU B 1 379 ? 5.278   -50.262 2.912   1.00 47.05  ? 380 LEU B O   1 
ATOM   7040 C CB  . LEU B 1 379 ? 3.846   -47.294 2.333   1.00 57.55  ? 380 LEU B CB  1 
ATOM   7041 C CG  . LEU B 1 379 ? 2.950   -47.933 3.424   1.00 59.38  ? 380 LEU B CG  1 
ATOM   7042 C CD1 . LEU B 1 379 ? 3.397   -47.593 4.843   1.00 41.13  ? 380 LEU B CD1 1 
ATOM   7043 C CD2 . LEU B 1 379 ? 1.463   -47.616 3.234   1.00 50.79  ? 380 LEU B CD2 1 
ATOM   7044 N N   A HIS B 1 380 ? 4.018   -50.059 1.058   0.44 43.16  ? 381 HIS B N   1 
ATOM   7045 N N   B HIS B 1 380 ? 4.015   -50.053 1.056   0.56 46.71  ? 381 HIS B N   1 
ATOM   7046 C CA  A HIS B 1 380 ? 3.542   -51.437 1.099   0.44 41.09  ? 381 HIS B CA  1 
ATOM   7047 C CA  B HIS B 1 380 ? 3.541   -51.431 1.076   0.56 41.48  ? 381 HIS B CA  1 
ATOM   7048 C C   A HIS B 1 380 ? 4.644   -52.460 0.824   0.44 44.80  ? 381 HIS B C   1 
ATOM   7049 C C   B HIS B 1 380 ? 4.682   -52.432 0.900   0.56 43.33  ? 381 HIS B C   1 
ATOM   7050 O O   A HIS B 1 380 ? 4.517   -53.627 1.200   0.44 43.45  ? 381 HIS B O   1 
ATOM   7051 O O   B HIS B 1 380 ? 4.622   -53.548 1.421   0.56 43.36  ? 381 HIS B O   1 
ATOM   7052 C CB  A HIS B 1 380 ? 2.389   -51.630 0.106   0.44 40.42  ? 381 HIS B CB  1 
ATOM   7053 C CB  B HIS B 1 380 ? 2.480   -51.646 -0.011  0.56 40.33  ? 381 HIS B CB  1 
ATOM   7054 C CG  A HIS B 1 380 ? 1.048   -51.255 0.659   0.44 43.73  ? 381 HIS B CG  1 
ATOM   7055 C CG  B HIS B 1 380 ? 1.821   -52.991 0.043   0.56 38.24  ? 381 HIS B CG  1 
ATOM   7056 N ND1 A HIS B 1 380 ? 0.626   -49.948 0.773   0.44 44.59  ? 381 HIS B ND1 1 
ATOM   7057 N ND1 B HIS B 1 380 ? 0.651   -53.221 0.734   0.56 37.05  ? 381 HIS B ND1 1 
ATOM   7058 C CD2 A HIS B 1 380 ? 0.040   -52.020 1.142   0.44 42.18  ? 381 HIS B CD2 1 
ATOM   7059 C CD2 B HIS B 1 380 ? 2.178   -54.179 -0.501  0.56 37.89  ? 381 HIS B CD2 1 
ATOM   7060 C CE1 A HIS B 1 380 ? -0.586  -49.923 1.299   0.44 41.54  ? 381 HIS B CE1 1 
ATOM   7061 C CE1 B HIS B 1 380 ? 0.314   -54.493 0.614   0.56 39.51  ? 381 HIS B CE1 1 
ATOM   7062 N NE2 A HIS B 1 380 ? -0.965  -51.167 1.532   0.44 44.17  ? 381 HIS B NE2 1 
ATOM   7063 N NE2 B HIS B 1 380 ? 1.223   -55.096 -0.132  0.56 41.02  ? 381 HIS B NE2 1 
ATOM   7064 N N   . TYR B 1 381 ? 5.727   -52.030 0.180   1.00 41.33  ? 382 TYR B N   1 
ATOM   7065 C CA  . TYR B 1 381 ? 6.804   -52.957 -0.162  1.00 41.05  ? 382 TYR B CA  1 
ATOM   7066 C C   . TYR B 1 381 ? 8.072   -52.801 0.669   1.00 43.86  ? 382 TYR B C   1 
ATOM   7067 O O   . TYR B 1 381 ? 9.009   -53.592 0.544   1.00 43.45  ? 382 TYR B O   1 
ATOM   7068 C CB  . TYR B 1 381 ? 7.131   -52.839 -1.653  1.00 37.72  ? 382 TYR B CB  1 
ATOM   7069 C CG  . TYR B 1 381 ? 6.096   -53.535 -2.494  1.00 34.78  ? 382 TYR B CG  1 
ATOM   7070 C CD1 . TYR B 1 381 ? 6.249   -54.865 -2.850  1.00 33.88  ? 382 TYR B CD1 1 
ATOM   7071 C CD2 . TYR B 1 381 ? 4.936   -52.878 -2.887  1.00 43.41  ? 382 TYR B CD2 1 
ATOM   7072 C CE1 . TYR B 1 381 ? 5.291   -55.518 -3.609  1.00 40.49  ? 382 TYR B CE1 1 
ATOM   7073 C CE2 . TYR B 1 381 ? 3.968   -53.521 -3.649  1.00 43.12  ? 382 TYR B CE2 1 
ATOM   7074 C CZ  . TYR B 1 381 ? 4.155   -54.839 -4.008  1.00 39.11  ? 382 TYR B CZ  1 
ATOM   7075 O OH  . TYR B 1 381 ? 3.206   -55.483 -4.756  1.00 35.34  ? 382 TYR B OH  1 
ATOM   7076 N N   . THR B 1 382 ? 8.100   -51.802 1.535   1.00 42.17  ? 383 THR B N   1 
ATOM   7077 C CA  . THR B 1 382 ? 9.217   -51.672 2.454   1.00 40.12  ? 383 THR B CA  1 
ATOM   7078 C C   . THR B 1 382 ? 9.008   -52.549 3.675   1.00 36.19  ? 383 THR B C   1 
ATOM   7079 O O   . THR B 1 382 ? 7.912   -52.580 4.227   1.00 42.46  ? 383 THR B O   1 
ATOM   7080 C CB  . THR B 1 382 ? 9.399   -50.231 2.902   1.00 41.47  ? 383 THR B CB  1 
ATOM   7081 O OG1 . THR B 1 382 ? 9.794   -49.435 1.779   1.00 43.63  ? 383 THR B OG1 1 
ATOM   7082 C CG2 . THR B 1 382 ? 10.452  -50.143 3.980   1.00 40.09  ? 383 THR B CG2 1 
ATOM   7083 N N   . ASP B 1 383 ? 10.039  -53.295 4.064   1.00 37.90  ? 384 ASP B N   1 
ATOM   7084 C CA  . ASP B 1 383 ? 10.071  -53.939 5.376   1.00 46.33  ? 384 ASP B CA  1 
ATOM   7085 C C   . ASP B 1 383 ? 10.677  -52.935 6.353   1.00 52.30  ? 384 ASP B C   1 
ATOM   7086 O O   . ASP B 1 383 ? 11.882  -52.684 6.325   1.00 48.20  ? 384 ASP B O   1 
ATOM   7087 C CB  . ASP B 1 383 ? 10.885  -55.235 5.345   1.00 42.73  ? 384 ASP B CB  1 
ATOM   7088 C CG  . ASP B 1 383 ? 10.916  -55.961 6.694   1.00 55.44  ? 384 ASP B CG  1 
ATOM   7089 O OD1 . ASP B 1 383 ? 10.638  -55.340 7.754   1.00 51.59  ? 384 ASP B OD1 1 
ATOM   7090 O OD2 . ASP B 1 383 ? 11.237  -57.172 6.690   1.00 56.40  ? 384 ASP B OD2 1 
ATOM   7091 N N   . TRP B 1 384 ? 9.848   -52.369 7.223   1.00 46.62  ? 385 TRP B N   1 
ATOM   7092 C CA  . TRP B 1 384 ? 10.292  -51.251 8.050   1.00 51.96  ? 385 TRP B CA  1 
ATOM   7093 C C   . TRP B 1 384 ? 11.193  -51.660 9.223   1.00 54.83  ? 385 TRP B C   1 
ATOM   7094 O O   . TRP B 1 384 ? 11.690  -50.802 9.950   1.00 57.36  ? 385 TRP B O   1 
ATOM   7095 C CB  . TRP B 1 384 ? 9.076   -50.472 8.540   1.00 44.15  ? 385 TRP B CB  1 
ATOM   7096 C CG  . TRP B 1 384 ? 8.413   -49.791 7.395   1.00 43.47  ? 385 TRP B CG  1 
ATOM   7097 C CD1 . TRP B 1 384 ? 7.282   -50.187 6.739   1.00 43.32  ? 385 TRP B CD1 1 
ATOM   7098 C CD2 . TRP B 1 384 ? 8.876   -48.617 6.724   1.00 46.47  ? 385 TRP B CD2 1 
ATOM   7099 N NE1 . TRP B 1 384 ? 6.996   -49.310 5.711   1.00 37.28  ? 385 TRP B NE1 1 
ATOM   7100 C CE2 . TRP B 1 384 ? 7.965   -48.340 5.680   1.00 45.54  ? 385 TRP B CE2 1 
ATOM   7101 C CE3 . TRP B 1 384 ? 9.968   -47.763 6.909   1.00 45.14  ? 385 TRP B CE3 1 
ATOM   7102 C CZ2 . TRP B 1 384 ? 8.113   -47.247 4.829   1.00 48.68  ? 385 TRP B CZ2 1 
ATOM   7103 C CZ3 . TRP B 1 384 ? 10.114  -46.680 6.066   1.00 44.38  ? 385 TRP B CZ3 1 
ATOM   7104 C CH2 . TRP B 1 384 ? 9.192   -46.431 5.038   1.00 48.65  ? 385 TRP B CH2 1 
ATOM   7105 N N   . LEU B 1 385 ? 11.427  -52.961 9.383   1.00 55.22  ? 386 LEU B N   1 
ATOM   7106 C CA  . LEU B 1 385 ? 12.422  -53.454 10.332  1.00 51.25  ? 386 LEU B CA  1 
ATOM   7107 C C   . LEU B 1 385 ? 13.777  -53.614 9.653   1.00 56.68  ? 386 LEU B C   1 
ATOM   7108 O O   . LEU B 1 385 ? 14.813  -53.676 10.321  1.00 59.83  ? 386 LEU B O   1 
ATOM   7109 C CB  . LEU B 1 385 ? 11.982  -54.785 10.940  1.00 52.57  ? 386 LEU B CB  1 
ATOM   7110 C CG  . LEU B 1 385 ? 10.921  -54.672 12.034  1.00 50.54  ? 386 LEU B CG  1 
ATOM   7111 C CD1 . LEU B 1 385 ? 10.486  -56.052 12.526  1.00 44.93  ? 386 LEU B CD1 1 
ATOM   7112 C CD2 . LEU B 1 385 ? 11.453  -53.816 13.175  1.00 47.04  ? 386 LEU B CD2 1 
ATOM   7113 N N   . HIS B 1 386 ? 13.751  -53.696 8.322   1.00 51.47  ? 387 HIS B N   1 
ATOM   7114 C CA  . HIS B 1 386 ? 14.962  -53.787 7.501   1.00 47.00  ? 387 HIS B CA  1 
ATOM   7115 C C   . HIS B 1 386 ? 14.837  -52.923 6.248   1.00 50.31  ? 387 HIS B C   1 
ATOM   7116 O O   . HIS B 1 386 ? 14.864  -53.442 5.133   1.00 51.21  ? 387 HIS B O   1 
ATOM   7117 C CB  . HIS B 1 386 ? 15.238  -55.232 7.084   1.00 45.95  ? 387 HIS B CB  1 
ATOM   7118 C CG  . HIS B 1 386 ? 15.185  -56.211 8.211   1.00 48.26  ? 387 HIS B CG  1 
ATOM   7119 N ND1 . HIS B 1 386 ? 16.305  -56.586 8.921   1.00 48.28  ? 387 HIS B ND1 1 
ATOM   7120 C CD2 . HIS B 1 386 ? 14.150  -56.899 8.747   1.00 49.32  ? 387 HIS B CD2 1 
ATOM   7121 C CE1 . HIS B 1 386 ? 15.958  -57.457 9.852   1.00 56.38  ? 387 HIS B CE1 1 
ATOM   7122 N NE2 . HIS B 1 386 ? 14.657  -57.665 9.767   1.00 51.57  ? 387 HIS B NE2 1 
ATOM   7123 N N   . PRO B 1 387 ? 14.707  -51.603 6.420   1.00 49.93  ? 388 PRO B N   1 
ATOM   7124 C CA  . PRO B 1 387 ? 14.350  -50.751 5.280   1.00 53.49  ? 388 PRO B CA  1 
ATOM   7125 C C   . PRO B 1 387 ? 15.426  -50.602 4.202   1.00 48.84  ? 388 PRO B C   1 
ATOM   7126 O O   . PRO B 1 387 ? 15.113  -50.085 3.132   1.00 48.34  ? 388 PRO B O   1 
ATOM   7127 C CB  . PRO B 1 387 ? 14.068  -49.393 5.937   1.00 49.12  ? 388 PRO B CB  1 
ATOM   7128 C CG  . PRO B 1 387 ? 14.854  -49.415 7.187   1.00 44.42  ? 388 PRO B CG  1 
ATOM   7129 C CD  . PRO B 1 387 ? 14.826  -50.829 7.670   1.00 46.23  ? 388 PRO B CD  1 
ATOM   7130 N N   . GLU B 1 388 ? 16.656  -51.036 4.460   1.00 51.70  ? 389 GLU B N   1 
ATOM   7131 C CA  . GLU B 1 388 ? 17.744  -50.756 3.524   1.00 53.25  ? 389 GLU B CA  1 
ATOM   7132 C C   . GLU B 1 388 ? 18.569  -51.979 3.132   1.00 51.53  ? 389 GLU B C   1 
ATOM   7133 O O   . GLU B 1 388 ? 19.646  -51.841 2.547   1.00 45.09  ? 389 GLU B O   1 
ATOM   7134 C CB  . GLU B 1 388 ? 18.673  -49.690 4.108   1.00 56.42  ? 389 GLU B CB  1 
ATOM   7135 C CG  . GLU B 1 388 ? 17.958  -48.411 4.514   1.00 65.34  ? 389 GLU B CG  1 
ATOM   7136 C CD  . GLU B 1 388 ? 18.887  -47.219 4.574   1.00 83.68  ? 389 GLU B CD  1 
ATOM   7137 O OE1 . GLU B 1 388 ? 19.269  -46.718 3.492   1.00 85.15  ? 389 GLU B OE1 1 
ATOM   7138 O OE2 . GLU B 1 388 ? 19.235  -46.787 5.699   1.00 86.97  ? 389 GLU B OE2 1 
ATOM   7139 N N   . ASP B 1 389 ? 18.063  -53.167 3.455   1.00 47.27  ? 390 ASP B N   1 
ATOM   7140 C CA  . ASP B 1 389 ? 18.723  -54.412 3.071   1.00 51.65  ? 390 ASP B CA  1 
ATOM   7141 C C   . ASP B 1 389 ? 18.646  -54.587 1.563   1.00 54.05  ? 390 ASP B C   1 
ATOM   7142 O O   . ASP B 1 389 ? 17.570  -54.838 1.030   1.00 53.62  ? 390 ASP B O   1 
ATOM   7143 C CB  . ASP B 1 389 ? 18.085  -55.610 3.785   1.00 49.70  ? 390 ASP B CB  1 
ATOM   7144 C CG  . ASP B 1 389 ? 18.716  -56.947 3.395   1.00 59.00  ? 390 ASP B CG  1 
ATOM   7145 O OD1 . ASP B 1 389 ? 19.782  -56.962 2.739   1.00 68.40  ? 390 ASP B OD1 1 
ATOM   7146 O OD2 . ASP B 1 389 ? 18.144  -57.997 3.764   1.00 62.98  ? 390 ASP B OD2 1 
ATOM   7147 N N   . PRO B 1 390 ? 19.798  -54.471 0.879   1.00 58.16  ? 391 PRO B N   1 
ATOM   7148 C CA  . PRO B 1 390 ? 19.889  -54.494 -0.587  1.00 58.62  ? 391 PRO B CA  1 
ATOM   7149 C C   . PRO B 1 390 ? 19.274  -55.738 -1.235  1.00 55.97  ? 391 PRO B C   1 
ATOM   7150 O O   . PRO B 1 390 ? 18.655  -55.607 -2.289  1.00 60.87  ? 391 PRO B O   1 
ATOM   7151 C CB  . PRO B 1 390 ? 21.397  -54.448 -0.841  1.00 57.42  ? 391 PRO B CB  1 
ATOM   7152 C CG  . PRO B 1 390 ? 21.964  -53.840 0.389   1.00 55.13  ? 391 PRO B CG  1 
ATOM   7153 C CD  . PRO B 1 390 ? 21.129  -54.374 1.498   1.00 52.22  ? 391 PRO B CD  1 
ATOM   7154 N N   . ALA B 1 391 ? 19.431  -56.912 -0.631  1.00 53.92  ? 392 ALA B N   1 
ATOM   7155 C CA  . ALA B 1 391 ? 18.820  -58.119 -1.190  1.00 59.78  ? 392 ALA B CA  1 
ATOM   7156 C C   . ALA B 1 391 ? 17.294  -58.036 -1.123  1.00 54.53  ? 392 ALA B C   1 
ATOM   7157 O O   . ALA B 1 391 ? 16.604  -58.370 -2.085  1.00 48.02  ? 392 ALA B O   1 
ATOM   7158 C CB  . ALA B 1 391 ? 19.319  -59.367 -0.464  1.00 45.91  ? 392 ALA B CB  1 
ATOM   7159 N N   . ARG B 1 392 ? 16.782  -57.592 0.023   1.00 55.53  ? 393 ARG B N   1 
ATOM   7160 C CA  . ARG B 1 392 ? 15.347  -57.459 0.234   1.00 46.53  ? 393 ARG B CA  1 
ATOM   7161 C C   . ARG B 1 392 ? 14.762  -56.399 -0.693  1.00 44.73  ? 393 ARG B C   1 
ATOM   7162 O O   . ARG B 1 392 ? 13.633  -56.534 -1.163  1.00 44.44  ? 393 ARG B O   1 
ATOM   7163 C CB  . ARG B 1 392 ? 15.038  -57.104 1.695   1.00 44.71  ? 393 ARG B CB  1 
ATOM   7164 C CG  . ARG B 1 392 ? 15.010  -58.271 2.674   1.00 44.31  ? 393 ARG B CG  1 
ATOM   7165 C CD  . ARG B 1 392 ? 14.492  -57.791 4.027   1.00 57.06  ? 393 ARG B CD  1 
ATOM   7166 N NE  . ARG B 1 392 ? 14.540  -58.794 5.092   1.00 56.71  ? 393 ARG B NE  1 
ATOM   7167 C CZ  . ARG B 1 392 ? 15.593  -59.002 5.881   1.00 56.65  ? 393 ARG B CZ  1 
ATOM   7168 N NH1 . ARG B 1 392 ? 16.701  -58.289 5.716   1.00 56.89  ? 393 ARG B NH1 1 
ATOM   7169 N NH2 . ARG B 1 392 ? 15.542  -59.925 6.836   1.00 56.09  ? 393 ARG B NH2 1 
ATOM   7170 N N   . LEU B 1 393 ? 15.534  -55.345 -0.941  1.00 41.11  ? 394 LEU B N   1 
ATOM   7171 C CA  . LEU B 1 393 ? 15.113  -54.266 -1.822  1.00 42.07  ? 394 LEU B CA  1 
ATOM   7172 C C   . LEU B 1 393 ? 15.013  -54.721 -3.277  1.00 55.49  ? 394 LEU B C   1 
ATOM   7173 O O   . LEU B 1 393 ? 14.089  -54.338 -4.003  1.00 47.75  ? 394 LEU B O   1 
ATOM   7174 C CB  . LEU B 1 393 ? 16.082  -53.101 -1.715  1.00 43.54  ? 394 LEU B CB  1 
ATOM   7175 C CG  . LEU B 1 393 ? 16.010  -52.278 -0.435  1.00 49.72  ? 394 LEU B CG  1 
ATOM   7176 C CD1 . LEU B 1 393 ? 17.224  -51.363 -0.357  1.00 49.92  ? 394 LEU B CD1 1 
ATOM   7177 C CD2 . LEU B 1 393 ? 14.717  -51.482 -0.390  1.00 41.17  ? 394 LEU B CD2 1 
ATOM   7178 N N   . ARG B 1 394 ? 15.980  -55.532 -3.694  1.00 56.60  ? 395 ARG B N   1 
ATOM   7179 C CA  . ARG B 1 394 ? 15.970  -56.145 -5.013  1.00 43.78  ? 395 ARG B CA  1 
ATOM   7180 C C   . ARG B 1 394 ? 14.731  -57.031 -5.186  1.00 52.83  ? 395 ARG B C   1 
ATOM   7181 O O   . ARG B 1 394 ? 13.990  -56.892 -6.163  1.00 47.19  ? 395 ARG B O   1 
ATOM   7182 C CB  . ARG B 1 394 ? 17.250  -56.959 -5.231  1.00 52.17  ? 395 ARG B CB  1 
ATOM   7183 C CG  . ARG B 1 394 ? 17.388  -57.570 -6.624  1.00 59.25  ? 395 ARG B CG  1 
ATOM   7184 C CD  . ARG B 1 394 ? 18.470  -58.639 -6.670  1.00 51.83  ? 395 ARG B CD  1 
ATOM   7185 N NE  . ARG B 1 394 ? 18.180  -59.749 -5.767  1.00 52.98  ? 395 ARG B NE  1 
ATOM   7186 C CZ  . ARG B 1 394 ? 19.087  -60.622 -5.342  1.00 60.39  ? 395 ARG B CZ  1 
ATOM   7187 N NH1 . ARG B 1 394 ? 20.348  -60.514 -5.742  1.00 55.37  ? 395 ARG B NH1 1 
ATOM   7188 N NH2 . ARG B 1 394 ? 18.739  -61.601 -4.513  1.00 56.74  ? 395 ARG B NH2 1 
ATOM   7189 N N   . GLU B 1 395 ? 14.508  -57.933 -4.233  1.00 42.95  ? 396 GLU B N   1 
ATOM   7190 C CA  . GLU B 1 395 ? 13.314  -58.777 -4.238  1.00 54.64  ? 396 GLU B CA  1 
ATOM   7191 C C   . GLU B 1 395 ? 12.027  -57.944 -4.286  1.00 51.14  ? 396 GLU B C   1 
ATOM   7192 O O   . GLU B 1 395 ? 11.071  -58.284 -4.992  1.00 47.61  ? 396 GLU B O   1 
ATOM   7193 C CB  . GLU B 1 395 ? 13.291  -59.691 -3.006  1.00 51.90  ? 396 GLU B CB  1 
ATOM   7194 C CG  . GLU B 1 395 ? 13.099  -61.167 -3.321  1.00 69.56  ? 396 GLU B CG  1 
ATOM   7195 C CD  . GLU B 1 395 ? 14.344  -61.799 -3.943  1.00 96.36  ? 396 GLU B CD  1 
ATOM   7196 O OE1 . GLU B 1 395 ? 14.557  -61.637 -5.172  1.00 88.01  ? 396 GLU B OE1 1 
ATOM   7197 O OE2 . GLU B 1 395 ? 15.113  -62.453 -3.197  1.00 86.42  ? 396 GLU B OE2 1 
ATOM   7198 N N   . ALA B 1 396 ? 12.014  -56.850 -3.531  1.00 47.52  ? 397 ALA B N   1 
ATOM   7199 C CA  . ALA B 1 396 ? 10.832  -56.012 -3.433  1.00 43.64  ? 397 ALA B CA  1 
ATOM   7200 C C   . ALA B 1 396 ? 10.560  -55.273 -4.749  1.00 50.06  ? 397 ALA B C   1 
ATOM   7201 O O   . ALA B 1 396 ? 9.410   -55.180 -5.183  1.00 45.16  ? 397 ALA B O   1 
ATOM   7202 C CB  . ALA B 1 396 ? 10.979  -55.035 -2.291  1.00 39.18  ? 397 ALA B CB  1 
ATOM   7203 N N   . LEU B 1 397 ? 11.605  -54.760 -5.395  1.00 43.55  ? 398 LEU B N   1 
ATOM   7204 C CA  . LEU B 1 397 ? 11.408  -54.078 -6.671  1.00 45.12  ? 398 LEU B CA  1 
ATOM   7205 C C   . LEU B 1 397 ? 10.912  -55.060 -7.721  1.00 44.02  ? 398 LEU B C   1 
ATOM   7206 O O   . LEU B 1 397 ? 10.116  -54.708 -8.591  1.00 42.53  ? 398 LEU B O   1 
ATOM   7207 C CB  . LEU B 1 397 ? 12.691  -53.404 -7.158  1.00 45.29  ? 398 LEU B CB  1 
ATOM   7208 C CG  . LEU B 1 397 ? 12.470  -52.482 -8.361  1.00 37.42  ? 398 LEU B CG  1 
ATOM   7209 C CD1 . LEU B 1 397 ? 11.394  -51.476 -8.041  1.00 37.35  ? 398 LEU B CD1 1 
ATOM   7210 C CD2 . LEU B 1 397 ? 13.750  -51.775 -8.772  1.00 45.50  ? 398 LEU B CD2 1 
ATOM   7211 N N   . SER B 1 398 ? 11.389  -56.294 -7.632  1.00 47.02  ? 399 SER B N   1 
ATOM   7212 C CA  . SER B 1 398 ? 10.957  -57.331 -8.547  1.00 35.42  ? 399 SER B CA  1 
ATOM   7213 C C   . SER B 1 398 ? 9.484   -57.602 -8.308  1.00 42.29  ? 399 SER B C   1 
ATOM   7214 O O   . SER B 1 398 ? 8.706   -57.731 -9.257  1.00 40.38  ? 399 SER B O   1 
ATOM   7215 C CB  . SER B 1 398 ? 11.790  -58.596 -8.366  1.00 38.04  ? 399 SER B CB  1 
ATOM   7216 O OG  . SER B 1 398 ? 11.354  -59.621 -9.235  1.00 40.40  ? 399 SER B OG  1 
ATOM   7217 N N   . ASP B 1 399 ? 9.099   -57.659 -7.035  1.00 44.05  ? 400 ASP B N   1 
ATOM   7218 C CA  . ASP B 1 399 ? 7.702   -57.879 -6.674  1.00 45.47  ? 400 ASP B CA  1 
ATOM   7219 C C   . ASP B 1 399 ? 6.817   -56.707 -7.092  1.00 43.20  ? 400 ASP B C   1 
ATOM   7220 O O   . ASP B 1 399 ? 5.701   -56.910 -7.553  1.00 36.96  ? 400 ASP B O   1 
ATOM   7221 C CB  . ASP B 1 399 ? 7.571   -58.137 -5.176  1.00 44.82  ? 400 ASP B CB  1 
ATOM   7222 C CG  . ASP B 1 399 ? 8.051   -59.522 -4.788  1.00 59.97  ? 400 ASP B CG  1 
ATOM   7223 O OD1 . ASP B 1 399 ? 8.158   -60.368 -5.705  1.00 60.68  ? 400 ASP B OD1 1 
ATOM   7224 O OD2 . ASP B 1 399 ? 8.312   -59.770 -3.582  1.00 55.99  ? 400 ASP B OD2 1 
ATOM   7225 N N   . VAL B 1 400 ? 7.323   -55.484 -6.951  1.00 41.25  ? 401 VAL B N   1 
ATOM   7226 C CA  . VAL B 1 400 ? 6.566   -54.310 -7.361  1.00 35.61  ? 401 VAL B CA  1 
ATOM   7227 C C   . VAL B 1 400 ? 6.183   -54.422 -8.834  1.00 42.21  ? 401 VAL B C   1 
ATOM   7228 O O   . VAL B 1 400 ? 4.999   -54.442 -9.184  1.00 38.26  ? 401 VAL B O   1 
ATOM   7229 C CB  . VAL B 1 400 ? 7.357   -53.010 -7.132  1.00 38.24  ? 401 VAL B CB  1 
ATOM   7230 C CG1 . VAL B 1 400 ? 6.709   -51.853 -7.887  1.00 36.41  ? 401 VAL B CG1 1 
ATOM   7231 C CG2 . VAL B 1 400 ? 7.461   -52.698 -5.643  1.00 39.09  ? 401 VAL B CG2 1 
ATOM   7232 N N   . VAL B 1 401 ? 7.194   -54.531 -9.687  1.00 38.92  ? 402 VAL B N   1 
ATOM   7233 C CA  . VAL B 1 401 ? 6.982   -54.599 -11.121 1.00 33.87  ? 402 VAL B CA  1 
ATOM   7234 C C   . VAL B 1 401 ? 6.126   -55.798 -11.511 1.00 40.29  ? 402 VAL B C   1 
ATOM   7235 O O   . VAL B 1 401 ? 5.137   -55.657 -12.239 1.00 35.89  ? 402 VAL B O   1 
ATOM   7236 C CB  . VAL B 1 401 ? 8.316   -54.654 -11.851 1.00 39.09  ? 402 VAL B CB  1 
ATOM   7237 C CG1 . VAL B 1 401 ? 8.108   -54.909 -13.335 1.00 36.01  ? 402 VAL B CG1 1 
ATOM   7238 C CG2 . VAL B 1 401 ? 9.067   -53.354 -11.604 1.00 37.14  ? 402 VAL B CG2 1 
ATOM   7239 N N   . GLY B 1 402 ? 6.489   -56.970 -10.999 1.00 35.02  ? 403 GLY B N   1 
ATOM   7240 C CA  . GLY B 1 402 ? 5.751   -58.183 -11.295 1.00 33.93  ? 403 GLY B CA  1 
ATOM   7241 C C   . GLY B 1 402 ? 4.305   -58.180 -10.835 1.00 38.46  ? 403 GLY B C   1 
ATOM   7242 O O   . GLY B 1 402 ? 3.420   -58.614 -11.577 1.00 39.83  ? 403 GLY B O   1 
ATOM   7243 N N   . ASP B 1 403 ? 4.055   -57.698 -9.620  1.00 36.15  ? 404 ASP B N   1 
ATOM   7244 C CA  . ASP B 1 403 ? 2.696   -57.700 -9.083  1.00 37.70  ? 404 ASP B CA  1 
ATOM   7245 C C   . ASP B 1 403 ? 1.806   -56.725 -9.842  1.00 34.78  ? 404 ASP B C   1 
ATOM   7246 O O   . ASP B 1 403 ? 0.662   -57.046 -10.178 1.00 34.03  ? 404 ASP B O   1 
ATOM   7247 C CB  . ASP B 1 403 ? 2.694   -57.366 -7.583  1.00 37.08  ? 404 ASP B CB  1 
ATOM   7248 C CG  . ASP B 1 403 ? 3.416   -58.420 -6.746  1.00 43.47  ? 404 ASP B CG  1 
ATOM   7249 O OD1 . ASP B 1 403 ? 3.798   -59.477 -7.304  1.00 48.40  ? 404 ASP B OD1 1 
ATOM   7250 O OD2 . ASP B 1 403 ? 3.608   -58.187 -5.534  1.00 39.54  ? 404 ASP B OD2 1 
ATOM   7251 N N   . HIS B 1 404 ? 2.346   -55.541 -10.111 1.00 31.31  ? 405 HIS B N   1 
ATOM   7252 C CA  . HIS B 1 404 ? 1.642   -54.501 -10.856 1.00 34.56  ? 405 HIS B CA  1 
ATOM   7253 C C   . HIS B 1 404 ? 1.304   -54.903 -12.306 1.00 35.34  ? 405 HIS B C   1 
ATOM   7254 O O   . HIS B 1 404 ? 0.207   -54.644 -12.800 1.00 31.38  ? 405 HIS B O   1 
ATOM   7255 C CB  . HIS B 1 404 ? 2.487   -53.221 -10.849 1.00 29.39  ? 405 HIS B CB  1 
ATOM   7256 C CG  . HIS B 1 404 ? 1.880   -52.080 -11.606 1.00 38.46  ? 405 HIS B CG  1 
ATOM   7257 N ND1 . HIS B 1 404 ? 0.539   -51.761 -11.532 1.00 40.57  ? 405 HIS B ND1 1 
ATOM   7258 C CD2 . HIS B 1 404 ? 2.438   -51.173 -12.443 1.00 38.30  ? 405 HIS B CD2 1 
ATOM   7259 C CE1 . HIS B 1 404 ? 0.297   -50.710 -12.298 1.00 35.24  ? 405 HIS B CE1 1 
ATOM   7260 N NE2 . HIS B 1 404 ? 1.432   -50.334 -12.861 1.00 40.53  ? 405 HIS B NE2 1 
ATOM   7261 N N   . ASN B 1 405 ? 2.243   -55.543 -12.987 1.00 34.36  ? 406 ASN B N   1 
ATOM   7262 C CA  . ASN B 1 405 ? 2.075   -55.760 -14.415 1.00 36.01  ? 406 ASN B CA  1 
ATOM   7263 C C   . ASN B 1 405 ? 1.494   -57.115 -14.796 1.00 35.57  ? 406 ASN B C   1 
ATOM   7264 O O   . ASN B 1 405 ? 0.844   -57.244 -15.827 1.00 35.92  ? 406 ASN B O   1 
ATOM   7265 C CB  . ASN B 1 405 ? 3.410   -55.544 -15.111 1.00 30.17  ? 406 ASN B CB  1 
ATOM   7266 C CG  . ASN B 1 405 ? 3.817   -54.082 -15.115 1.00 42.29  ? 406 ASN B CG  1 
ATOM   7267 O OD1 . ASN B 1 405 ? 3.292   -53.288 -15.895 1.00 46.84  ? 406 ASN B OD1 1 
ATOM   7268 N ND2 . ASN B 1 405 ? 4.743   -53.714 -14.234 1.00 38.26  ? 406 ASN B ND2 1 
ATOM   7269 N N   . VAL B 1 406 ? 1.694   -58.121 -13.960 1.00 34.67  ? 407 VAL B N   1 
ATOM   7270 C CA  . VAL B 1 406 ? 1.248   -59.456 -14.318 1.00 33.38  ? 407 VAL B CA  1 
ATOM   7271 C C   . VAL B 1 406 ? 0.345   -60.086 -13.262 1.00 31.88  ? 407 VAL B C   1 
ATOM   7272 O O   . VAL B 1 406 ? -0.840  -60.331 -13.517 1.00 32.35  ? 407 VAL B O   1 
ATOM   7273 C CB  . VAL B 1 406 ? 2.450   -60.391 -14.569 1.00 35.38  ? 407 VAL B CB  1 
ATOM   7274 C CG1 . VAL B 1 406 ? 1.971   -61.741 -15.048 1.00 29.68  ? 407 VAL B CG1 1 
ATOM   7275 C CG2 . VAL B 1 406 ? 3.389   -59.780 -15.579 1.00 30.07  ? 407 VAL B CG2 1 
ATOM   7276 N N   . VAL B 1 407 ? 0.899   -60.352 -12.084 1.00 30.54  ? 408 VAL B N   1 
ATOM   7277 C CA  . VAL B 1 407 ? 0.200   -61.184 -11.099 1.00 33.45  ? 408 VAL B CA  1 
ATOM   7278 C C   . VAL B 1 407 ? -1.156  -60.618 -10.709 1.00 28.79  ? 408 VAL B C   1 
ATOM   7279 O O   . VAL B 1 407 ? -2.166  -61.302 -10.817 1.00 32.67  ? 408 VAL B O   1 
ATOM   7280 C CB  . VAL B 1 407 ? 1.038   -61.389 -9.822  1.00 33.36  ? 408 VAL B CB  1 
ATOM   7281 C CG1 . VAL B 1 407 ? 0.352   -62.365 -8.903  1.00 25.16  ? 408 VAL B CG1 1 
ATOM   7282 C CG2 . VAL B 1 407 ? 2.420   -61.907 -10.186 1.00 35.98  ? 408 VAL B CG2 1 
ATOM   7283 N N   . CYS B 1 408 ? -1.197  -59.361 -10.295 1.00 28.24  ? 409 CYS B N   1 
ATOM   7284 C CA  . CYS B 1 408 ? -2.460  -58.811 -9.831  1.00 31.39  ? 409 CYS B CA  1 
ATOM   7285 C C   . CYS B 1 408 ? -3.497  -58.627 -10.959 1.00 35.35  ? 409 CYS B C   1 
ATOM   7286 O O   . CYS B 1 408 ? -4.674  -58.925 -10.747 1.00 33.91  ? 409 CYS B O   1 
ATOM   7287 C CB  . CYS B 1 408 ? -2.199  -57.511 -9.056  1.00 33.16  ? 409 CYS B CB  1 
ATOM   7288 S SG  . CYS B 1 408 ? -1.200  -57.846 -7.544  1.00 37.95  ? 409 CYS B SG  1 
ATOM   7289 N N   . PRO B 1 409 ? -3.079  -58.179 -12.166 1.00 36.57  ? 410 PRO B N   1 
ATOM   7290 C CA  . PRO B 1 409 ? -4.050  -58.284 -13.270 1.00 33.11  ? 410 PRO B CA  1 
ATOM   7291 C C   . PRO B 1 409 ? -4.595  -59.707 -13.488 1.00 36.32  ? 410 PRO B C   1 
ATOM   7292 O O   . PRO B 1 409 ? -5.814  -59.859 -13.662 1.00 33.02  ? 410 PRO B O   1 
ATOM   7293 C CB  . PRO B 1 409 ? -3.248  -57.819 -14.487 1.00 23.38  ? 410 PRO B CB  1 
ATOM   7294 C CG  . PRO B 1 409 ? -2.270  -56.855 -13.926 1.00 29.98  ? 410 PRO B CG  1 
ATOM   7295 C CD  . PRO B 1 409 ? -1.890  -57.401 -12.562 1.00 32.16  ? 410 PRO B CD  1 
ATOM   7296 N N   . VAL B 1 410 ? -3.730  -60.725 -13.466 1.00 26.07  ? 411 VAL B N   1 
ATOM   7297 C CA  . VAL B 1 410 ? -4.203  -62.098 -13.645 1.00 33.05  ? 411 VAL B CA  1 
ATOM   7298 C C   . VAL B 1 410 ? -5.162  -62.500 -12.512 1.00 35.06  ? 411 VAL B C   1 
ATOM   7299 O O   . VAL B 1 410 ? -6.210  -63.103 -12.766 1.00 32.39  ? 411 VAL B O   1 
ATOM   7300 C CB  . VAL B 1 410 ? -3.034  -63.108 -13.721 1.00 32.16  ? 411 VAL B CB  1 
ATOM   7301 C CG1 . VAL B 1 410 ? -3.554  -64.533 -13.780 1.00 22.47  ? 411 VAL B CG1 1 
ATOM   7302 C CG2 . VAL B 1 410 ? -2.166  -62.821 -14.930 1.00 31.17  ? 411 VAL B CG2 1 
ATOM   7303 N N   . ALA B 1 411 ? -4.816  -62.142 -11.277 1.00 27.74  ? 412 ALA B N   1 
ATOM   7304 C CA  . ALA B 1 411 ? -5.676  -62.414 -10.116 1.00 31.67  ? 412 ALA B CA  1 
ATOM   7305 C C   . ALA B 1 411 ? -7.039  -61.734 -10.210 1.00 33.47  ? 412 ALA B C   1 
ATOM   7306 O O   . ALA B 1 411 ? -8.072  -62.362 -9.945  1.00 34.61  ? 412 ALA B O   1 
ATOM   7307 C CB  . ALA B 1 411 ? -4.991  -61.989 -8.835  1.00 29.51  ? 412 ALA B CB  1 
ATOM   7308 N N   . GLN B 1 412 ? -7.049  -60.454 -10.566 1.00 28.88  ? 413 GLN B N   1 
ATOM   7309 C CA  . GLN B 1 412 ? -8.313  -59.756 -10.720 1.00 33.83  ? 413 GLN B CA  1 
ATOM   7310 C C   . GLN B 1 412 ? -9.200  -60.458 -11.741 1.00 42.66  ? 413 GLN B C   1 
ATOM   7311 O O   . GLN B 1 412 ? -10.388 -60.673 -11.496 1.00 45.26  ? 413 GLN B O   1 
ATOM   7312 C CB  . GLN B 1 412 ? -8.094  -58.311 -11.136 1.00 35.95  ? 413 GLN B CB  1 
ATOM   7313 C CG  . GLN B 1 412 ? -9.390  -57.565 -11.351 1.00 42.51  ? 413 GLN B CG  1 
ATOM   7314 C CD  . GLN B 1 412 ? -9.184  -56.073 -11.405 1.00 60.10  ? 413 GLN B CD  1 
ATOM   7315 O OE1 . GLN B 1 412 ? -8.708  -55.537 -12.405 1.00 69.07  ? 413 GLN B OE1 1 
ATOM   7316 N NE2 . GLN B 1 412 ? -9.529  -55.389 -10.319 1.00 63.57  ? 413 GLN B NE2 1 
ATOM   7317 N N   . LEU B 1 413 ? -8.605  -60.823 -12.875 1.00 40.32  ? 414 LEU B N   1 
ATOM   7318 C CA  . LEU B 1 413 ? -9.307  -61.533 -13.935 1.00 35.13  ? 414 LEU B CA  1 
ATOM   7319 C C   . LEU B 1 413 ? -9.902  -62.850 -13.447 1.00 39.93  ? 414 LEU B C   1 
ATOM   7320 O O   . LEU B 1 413 ? -11.091 -63.112 -13.632 1.00 34.17  ? 414 LEU B O   1 
ATOM   7321 C CB  . LEU B 1 413 ? -8.365  -61.810 -15.098 1.00 38.07  ? 414 LEU B CB  1 
ATOM   7322 C CG  . LEU B 1 413 ? -9.014  -62.540 -16.272 1.00 35.21  ? 414 LEU B CG  1 
ATOM   7323 C CD1 . LEU B 1 413 ? -9.835  -61.570 -17.061 1.00 38.50  ? 414 LEU B CD1 1 
ATOM   7324 C CD2 . LEU B 1 413 ? -7.971  -63.171 -17.147 1.00 34.11  ? 414 LEU B CD2 1 
ATOM   7325 N N   . ALA B 1 414 ? -9.062  -63.675 -12.830 1.00 37.70  ? 415 ALA B N   1 
ATOM   7326 C CA  . ALA B 1 414 ? -9.489  -64.967 -12.315 1.00 36.92  ? 415 ALA B CA  1 
ATOM   7327 C C   . ALA B 1 414 ? -10.686 -64.830 -11.386 1.00 45.88  ? 415 ALA B C   1 
ATOM   7328 O O   . ALA B 1 414 ? -11.703 -65.496 -11.578 1.00 46.84  ? 415 ALA B O   1 
ATOM   7329 C CB  . ALA B 1 414 ? -8.343  -65.651 -11.599 1.00 34.07  ? 415 ALA B CB  1 
ATOM   7330 N N   . GLY B 1 415 ? -10.568 -63.950 -10.395 1.00 43.85  ? 416 GLY B N   1 
ATOM   7331 C CA  . GLY B 1 415 ? -11.617 -63.771 -9.406  1.00 39.53  ? 416 GLY B CA  1 
ATOM   7332 C C   . GLY B 1 415 ? -12.930 -63.284 -9.991  1.00 41.96  ? 416 GLY B C   1 
ATOM   7333 O O   . GLY B 1 415 ? -14.008 -63.777 -9.651  1.00 45.43  ? 416 GLY B O   1 
ATOM   7334 N N   . ARG B 1 416 ? -12.842 -62.305 -10.878 1.00 39.36  ? 417 ARG B N   1 
ATOM   7335 C CA  . ARG B 1 416 ? -14.036 -61.768 -11.502 1.00 39.59  ? 417 ARG B CA  1 
ATOM   7336 C C   . ARG B 1 416 ? -14.700 -62.753 -12.471 1.00 48.82  ? 417 ARG B C   1 
ATOM   7337 O O   . ARG B 1 416 ? -15.924 -62.754 -12.609 1.00 54.46  ? 417 ARG B O   1 
ATOM   7338 C CB  . ARG B 1 416 ? -13.705 -60.466 -12.217 1.00 43.19  ? 417 ARG B CB  1 
ATOM   7339 C CG  . ARG B 1 416 ? -13.537 -59.285 -11.290 1.00 41.55  ? 417 ARG B CG  1 
ATOM   7340 C CD  . ARG B 1 416 ? -14.616 -59.309 -10.237 1.00 50.52  ? 417 ARG B CD  1 
ATOM   7341 N NE  . ARG B 1 416 ? -14.942 -57.981 -9.735  1.00 57.78  ? 417 ARG B NE  1 
ATOM   7342 C CZ  . ARG B 1 416 ? -16.055 -57.321 -10.039 1.00 67.59  ? 417 ARG B CZ  1 
ATOM   7343 N NH1 . ARG B 1 416 ? -16.955 -57.873 -10.848 1.00 65.42  ? 417 ARG B NH1 1 
ATOM   7344 N NH2 . ARG B 1 416 ? -16.269 -56.109 -9.534  1.00 62.44  ? 417 ARG B NH2 1 
ATOM   7345 N N   . LEU B 1 417 ? -13.912 -63.592 -13.136 1.00 43.91  ? 418 LEU B N   1 
ATOM   7346 C CA  . LEU B 1 417 ? -14.493 -64.577 -14.048 1.00 43.21  ? 418 LEU B CA  1 
ATOM   7347 C C   . LEU B 1 417 ? -15.165 -65.684 -13.250 1.00 47.22  ? 418 LEU B C   1 
ATOM   7348 O O   . LEU B 1 417 ? -16.225 -66.187 -13.629 1.00 48.35  ? 418 LEU B O   1 
ATOM   7349 C CB  . LEU B 1 417 ? -13.436 -65.184 -14.992 1.00 42.27  ? 418 LEU B CB  1 
ATOM   7350 C CG  . LEU B 1 417 ? -12.792 -64.333 -16.098 1.00 45.05  ? 418 LEU B CG  1 
ATOM   7351 C CD1 . LEU B 1 417 ? -11.935 -65.197 -17.010 1.00 42.40  ? 418 LEU B CD1 1 
ATOM   7352 C CD2 . LEU B 1 417 ? -13.817 -63.578 -16.902 1.00 34.38  ? 418 LEU B CD2 1 
ATOM   7353 N N   . ALA B 1 418 ? -14.539 -66.066 -12.142 1.00 44.52  ? 419 ALA B N   1 
ATOM   7354 C CA  . ALA B 1 418 ? -15.064 -67.143 -11.321 1.00 42.31  ? 419 ALA B CA  1 
ATOM   7355 C C   . ALA B 1 418 ? -16.379 -66.713 -10.664 1.00 50.06  ? 419 ALA B C   1 
ATOM   7356 O O   . ALA B 1 418 ? -17.365 -67.455 -10.672 1.00 46.98  ? 419 ALA B O   1 
ATOM   7357 C CB  . ALA B 1 418 ? -14.040 -67.563 -10.282 1.00 36.65  ? 419 ALA B CB  1 
ATOM   7358 N N   . ALA B 1 419 ? -16.390 -65.496 -10.128 1.00 50.69  ? 420 ALA B N   1 
ATOM   7359 C CA  . ALA B 1 419 ? -17.579 -64.922 -9.509  1.00 48.34  ? 420 ALA B CA  1 
ATOM   7360 C C   . ALA B 1 419 ? -18.744 -64.796 -10.484 1.00 48.12  ? 420 ALA B C   1 
ATOM   7361 O O   . ALA B 1 419 ? -19.911 -64.880 -10.097 1.00 53.75  ? 420 ALA B O   1 
ATOM   7362 C CB  . ALA B 1 419 ? -17.250 -63.559 -8.922  1.00 41.07  ? 420 ALA B CB  1 
ATOM   7363 N N   . GLN B 1 420 ? -18.430 -64.595 -11.755 1.00 47.94  ? 421 GLN B N   1 
ATOM   7364 C CA  . GLN B 1 420 ? -19.472 -64.275 -12.713 1.00 46.60  ? 421 GLN B CA  1 
ATOM   7365 C C   . GLN B 1 420 ? -19.774 -65.402 -13.679 1.00 45.22  ? 421 GLN B C   1 
ATOM   7366 O O   . GLN B 1 420 ? -20.366 -65.177 -14.731 1.00 45.19  ? 421 GLN B O   1 
ATOM   7367 C CB  . GLN B 1 420 ? -19.099 -63.009 -13.458 1.00 41.06  ? 421 GLN B CB  1 
ATOM   7368 C CG  . GLN B 1 420 ? -19.264 -61.821 -12.565 1.00 49.20  ? 421 GLN B CG  1 
ATOM   7369 C CD  . GLN B 1 420 ? -18.464 -60.642 -13.008 1.00 58.05  ? 421 GLN B CD  1 
ATOM   7370 O OE1 . GLN B 1 420 ? -17.770 -60.016 -12.207 1.00 61.58  ? 421 GLN B OE1 1 
ATOM   7371 N NE2 . GLN B 1 420 ? -18.557 -60.314 -14.290 1.00 63.86  ? 421 GLN B NE2 1 
ATOM   7372 N N   . GLY B 1 421 ? -19.393 -66.618 -13.301 1.00 45.58  ? 422 GLY B N   1 
ATOM   7373 C CA  . GLY B 1 421 ? -19.867 -67.794 -14.009 1.00 52.18  ? 422 GLY B CA  1 
ATOM   7374 C C   . GLY B 1 421 ? -18.826 -68.778 -14.493 1.00 52.65  ? 422 GLY B C   1 
ATOM   7375 O O   . GLY B 1 421 ? -19.104 -69.969 -14.609 1.00 54.06  ? 422 GLY B O   1 
ATOM   7376 N N   . ALA B 1 422 ? -17.622 -68.292 -14.770 1.00 49.08  ? 423 ALA B N   1 
ATOM   7377 C CA  . ALA B 1 422 ? -16.641 -69.108 -15.470 1.00 48.84  ? 423 ALA B CA  1 
ATOM   7378 C C   . ALA B 1 422 ? -15.970 -70.122 -14.555 1.00 48.87  ? 423 ALA B C   1 
ATOM   7379 O O   . ALA B 1 422 ? -15.772 -69.859 -13.373 1.00 49.26  ? 423 ALA B O   1 
ATOM   7380 C CB  . ALA B 1 422 ? -15.600 -68.221 -16.121 1.00 48.85  ? 423 ALA B CB  1 
ATOM   7381 N N   . ARG B 1 423 ? -15.633 -71.288 -15.099 1.00 37.62  ? 424 ARG B N   1 
ATOM   7382 C CA  . ARG B 1 423 ? -14.848 -72.235 -14.335 1.00 41.36  ? 424 ARG B CA  1 
ATOM   7383 C C   . ARG B 1 423 ? -13.385 -71.906 -14.573 1.00 49.10  ? 424 ARG B C   1 
ATOM   7384 O O   . ARG B 1 423 ? -12.911 -71.909 -15.705 1.00 42.60  ? 424 ARG B O   1 
ATOM   7385 C CB  . ARG B 1 423 ? -15.163 -73.684 -14.711 1.00 43.36  ? 424 ARG B CB  1 
ATOM   7386 C CG  . ARG B 1 423 ? -14.623 -74.687 -13.678 1.00 55.88  ? 424 ARG B CG  1 
ATOM   7387 C CD  . ARG B 1 423 ? -15.241 -76.075 -13.825 1.00 78.09  ? 424 ARG B CD  1 
ATOM   7388 N NE  . ARG B 1 423 ? -14.877 -76.709 -15.094 1.00 88.17  ? 424 ARG B NE  1 
ATOM   7389 C CZ  . ARG B 1 423 ? -15.503 -77.762 -15.617 1.00 90.39  ? 424 ARG B CZ  1 
ATOM   7390 N NH1 . ARG B 1 423 ? -16.535 -78.302 -14.979 1.00 99.88  ? 424 ARG B NH1 1 
ATOM   7391 N NH2 . ARG B 1 423 ? -15.107 -78.269 -16.782 1.00 71.86  ? 424 ARG B NH2 1 
ATOM   7392 N N   . VAL B 1 424 ? -12.677 -71.594 -13.497 1.00 43.71  ? 425 VAL B N   1 
ATOM   7393 C CA  . VAL B 1 424 ? -11.314 -71.110 -13.604 1.00 36.67  ? 425 VAL B CA  1 
ATOM   7394 C C   . VAL B 1 424 ? -10.339 -72.068 -12.936 1.00 39.34  ? 425 VAL B C   1 
ATOM   7395 O O   . VAL B 1 424 ? -10.602 -72.561 -11.848 1.00 36.47  ? 425 VAL B O   1 
ATOM   7396 C CB  . VAL B 1 424 ? -11.177 -69.723 -12.973 1.00 32.67  ? 425 VAL B CB  1 
ATOM   7397 C CG1 . VAL B 1 424 ? -9.772  -69.200 -13.154 1.00 38.27  ? 425 VAL B CG1 1 
ATOM   7398 C CG2 . VAL B 1 424 ? -12.188 -68.772 -13.582 1.00 33.75  ? 425 VAL B CG2 1 
ATOM   7399 N N   . TYR B 1 425 ? -9.229  -72.348 -13.608 1.00 33.04  ? 426 TYR B N   1 
ATOM   7400 C CA  . TYR B 1 425 ? -8.148  -73.121 -13.019 1.00 34.95  ? 426 TYR B CA  1 
ATOM   7401 C C   . TYR B 1 425 ? -6.904  -72.242 -13.010 1.00 40.82  ? 426 TYR B C   1 
ATOM   7402 O O   . TYR B 1 425 ? -6.674  -71.482 -13.944 1.00 46.36  ? 426 TYR B O   1 
ATOM   7403 C CB  . TYR B 1 425 ? -7.918  -74.424 -13.784 1.00 37.93  ? 426 TYR B CB  1 
ATOM   7404 C CG  . TYR B 1 425 ? -9.094  -75.371 -13.703 1.00 44.41  ? 426 TYR B CG  1 
ATOM   7405 C CD1 . TYR B 1 425 ? -9.188  -76.305 -12.672 1.00 43.98  ? 426 TYR B CD1 1 
ATOM   7406 C CD2 . TYR B 1 425 ? -10.121 -75.323 -14.645 1.00 37.66  ? 426 TYR B CD2 1 
ATOM   7407 C CE1 . TYR B 1 425 ? -10.270 -77.173 -12.582 1.00 39.15  ? 426 TYR B CE1 1 
ATOM   7408 C CE2 . TYR B 1 425 ? -11.211 -76.183 -14.562 1.00 46.45  ? 426 TYR B CE2 1 
ATOM   7409 C CZ  . TYR B 1 425 ? -11.279 -77.107 -13.526 1.00 49.26  ? 426 TYR B CZ  1 
ATOM   7410 O OH  . TYR B 1 425 ? -12.351 -77.967 -13.425 1.00 44.02  ? 426 TYR B OH  1 
ATOM   7411 N N   . ALA B 1 426 ? -6.122  -72.315 -11.938 1.00 43.48  ? 427 ALA B N   1 
ATOM   7412 C CA  . ALA B 1 426 ? -5.020  -71.378 -11.757 1.00 30.96  ? 427 ALA B CA  1 
ATOM   7413 C C   . ALA B 1 426 ? -3.743  -72.062 -11.280 1.00 37.94  ? 427 ALA B C   1 
ATOM   7414 O O   . ALA B 1 426 ? -3.793  -72.984 -10.458 1.00 38.47  ? 427 ALA B O   1 
ATOM   7415 C CB  . ALA B 1 426 ? -5.425  -70.297 -10.790 1.00 30.93  ? 427 ALA B CB  1 
ATOM   7416 N N   . TYR B 1 427 ? -2.604  -71.605 -11.791 1.00 26.74  ? 428 TYR B N   1 
ATOM   7417 C CA  . TYR B 1 427 ? -1.322  -72.212 -11.450 1.00 30.98  ? 428 TYR B CA  1 
ATOM   7418 C C   . TYR B 1 427 ? -0.261  -71.162 -11.149 1.00 34.70  ? 428 TYR B C   1 
ATOM   7419 O O   . TYR B 1 427 ? -0.352  -70.024 -11.618 1.00 33.73  ? 428 TYR B O   1 
ATOM   7420 C CB  . TYR B 1 427 ? -0.828  -73.125 -12.599 1.00 36.27  ? 428 TYR B CB  1 
ATOM   7421 C CG  . TYR B 1 427 ? -0.446  -72.377 -13.868 1.00 30.70  ? 428 TYR B CG  1 
ATOM   7422 C CD1 . TYR B 1 427 ? 0.846   -71.896 -14.054 1.00 26.89  ? 428 TYR B CD1 1 
ATOM   7423 C CD2 . TYR B 1 427 ? -1.383  -72.138 -14.869 1.00 33.09  ? 428 TYR B CD2 1 
ATOM   7424 C CE1 . TYR B 1 427 ? 1.194   -71.194 -15.193 1.00 34.76  ? 428 TYR B CE1 1 
ATOM   7425 C CE2 . TYR B 1 427 ? -1.043  -71.440 -16.021 1.00 34.42  ? 428 TYR B CE2 1 
ATOM   7426 C CZ  . TYR B 1 427 ? 0.247   -70.966 -16.178 1.00 37.97  ? 428 TYR B CZ  1 
ATOM   7427 O OH  . TYR B 1 427 ? 0.598   -70.268 -17.317 1.00 35.51  ? 428 TYR B OH  1 
ATOM   7428 N N   . VAL B 1 428 ? 0.751   -71.555 -10.382 1.00 28.69  ? 429 VAL B N   1 
ATOM   7429 C CA  . VAL B 1 428 ? 2.005   -70.812 -10.345 1.00 31.33  ? 429 VAL B CA  1 
ATOM   7430 C C   . VAL B 1 428 ? 3.100   -71.759 -10.826 1.00 40.79  ? 429 VAL B C   1 
ATOM   7431 O O   . VAL B 1 428 ? 3.256   -72.866 -10.304 1.00 41.54  ? 429 VAL B O   1 
ATOM   7432 C CB  . VAL B 1 428 ? 2.348   -70.261 -8.931  1.00 36.72  ? 429 VAL B CB  1 
ATOM   7433 C CG1 . VAL B 1 428 ? 3.721   -69.613 -8.924  1.00 31.87  ? 429 VAL B CG1 1 
ATOM   7434 C CG2 . VAL B 1 428 ? 1.315   -69.258 -8.489  1.00 42.66  ? 429 VAL B CG2 1 
ATOM   7435 N N   . PHE B 1 429 ? 3.842   -71.339 -11.841 1.00 34.46  ? 430 PHE B N   1 
ATOM   7436 C CA  . PHE B 1 429 ? 4.880   -72.187 -12.402 1.00 40.00  ? 430 PHE B CA  1 
ATOM   7437 C C   . PHE B 1 429 ? 6.183   -71.957 -11.637 1.00 41.05  ? 430 PHE B C   1 
ATOM   7438 O O   . PHE B 1 429 ? 6.767   -70.878 -11.717 1.00 39.90  ? 430 PHE B O   1 
ATOM   7439 C CB  . PHE B 1 429 ? 5.039   -71.897 -13.898 1.00 34.92  ? 430 PHE B CB  1 
ATOM   7440 C CG  . PHE B 1 429 ? 6.095   -72.718 -14.568 1.00 43.74  ? 430 PHE B CG  1 
ATOM   7441 C CD1 . PHE B 1 429 ? 5.777   -73.955 -15.121 1.00 40.27  ? 430 PHE B CD1 1 
ATOM   7442 C CD2 . PHE B 1 429 ? 7.404   -72.252 -14.659 1.00 37.97  ? 430 PHE B CD2 1 
ATOM   7443 C CE1 . PHE B 1 429 ? 6.743   -74.717 -15.744 1.00 34.89  ? 430 PHE B CE1 1 
ATOM   7444 C CE2 . PHE B 1 429 ? 8.377   -73.008 -15.278 1.00 38.76  ? 430 PHE B CE2 1 
ATOM   7445 C CZ  . PHE B 1 429 ? 8.049   -74.245 -15.825 1.00 42.61  ? 430 PHE B CZ  1 
ATOM   7446 N N   . GLU B 1 430 ? 6.640   -72.962 -10.894 1.00 41.44  ? 431 GLU B N   1 
ATOM   7447 C CA  . GLU B 1 430 ? 7.735   -72.744 -9.950  1.00 37.15  ? 431 GLU B CA  1 
ATOM   7448 C C   . GLU B 1 430 ? 9.069   -73.394 -10.317 1.00 46.93  ? 431 GLU B C   1 
ATOM   7449 O O   . GLU B 1 430 ? 9.997   -73.376 -9.514  1.00 46.00  ? 431 GLU B O   1 
ATOM   7450 C CB  . GLU B 1 430 ? 7.323   -73.229 -8.562  1.00 42.10  ? 431 GLU B CB  1 
ATOM   7451 C CG  . GLU B 1 430 ? 6.253   -72.389 -7.881  1.00 46.88  ? 431 GLU B CG  1 
ATOM   7452 C CD  . GLU B 1 430 ? 6.083   -72.745 -6.408  1.00 70.28  ? 431 GLU B CD  1 
ATOM   7453 O OE1 . GLU B 1 430 ? 6.157   -73.951 -6.077  1.00 73.57  ? 431 GLU B OE1 1 
ATOM   7454 O OE2 . GLU B 1 430 ? 5.892   -71.822 -5.580  1.00 75.53  ? 431 GLU B OE2 1 
ATOM   7455 N N   . HIS B 1 431 ? 9.190   -73.962 -11.512 1.00 47.80  ? 432 HIS B N   1 
ATOM   7456 C CA  . HIS B 1 431 ? 10.430  -74.660 -11.844 1.00 38.00  ? 432 HIS B CA  1 
ATOM   7457 C C   . HIS B 1 431 ? 11.392  -73.836 -12.691 1.00 41.65  ? 432 HIS B C   1 
ATOM   7458 O O   . HIS B 1 431 ? 11.054  -73.361 -13.773 1.00 45.29  ? 432 HIS B O   1 
ATOM   7459 C CB  . HIS B 1 431 ? 10.151  -75.984 -12.569 1.00 42.91  ? 432 HIS B CB  1 
ATOM   7460 C CG  . HIS B 1 431 ? 11.395  -76.658 -13.067 1.00 55.08  ? 432 HIS B CG  1 
ATOM   7461 N ND1 . HIS B 1 431 ? 12.232  -77.382 -12.242 1.00 51.38  ? 432 HIS B ND1 1 
ATOM   7462 C CD2 . HIS B 1 431 ? 11.967  -76.680 -14.295 1.00 48.89  ? 432 HIS B CD2 1 
ATOM   7463 C CE1 . HIS B 1 431 ? 13.256  -77.835 -12.944 1.00 46.38  ? 432 HIS B CE1 1 
ATOM   7464 N NE2 . HIS B 1 431 ? 13.120  -77.422 -14.193 1.00 54.12  ? 432 HIS B NE2 1 
ATOM   7465 N N   . ARG B 1 432 ? 12.612  -73.697 -12.202 1.00 41.83  ? 433 ARG B N   1 
ATOM   7466 C CA  . ARG B 1 432 ? 13.641  -73.026 -12.969 1.00 45.67  ? 433 ARG B CA  1 
ATOM   7467 C C   . ARG B 1 432 ? 14.336  -74.017 -13.886 1.00 44.53  ? 433 ARG B C   1 
ATOM   7468 O O   . ARG B 1 432 ? 14.875  -75.021 -13.429 1.00 50.44  ? 433 ARG B O   1 
ATOM   7469 C CB  . ARG B 1 432 ? 14.653  -72.355 -12.043 1.00 40.91  ? 433 ARG B CB  1 
ATOM   7470 C CG  . ARG B 1 432 ? 15.814  -71.751 -12.779 1.00 43.66  ? 433 ARG B CG  1 
ATOM   7471 C CD  . ARG B 1 432 ? 16.680  -70.948 -11.861 1.00 39.27  ? 433 ARG B CD  1 
ATOM   7472 N NE  . ARG B 1 432 ? 17.940  -70.635 -12.516 1.00 44.11  ? 433 ARG B NE  1 
ATOM   7473 C CZ  . ARG B 1 432 ? 18.284  -69.423 -12.927 1.00 52.72  ? 433 ARG B CZ  1 
ATOM   7474 N NH1 . ARG B 1 432 ? 17.456  -68.403 -12.736 1.00 53.43  ? 433 ARG B NH1 1 
ATOM   7475 N NH2 . ARG B 1 432 ? 19.461  -69.232 -13.515 1.00 44.70  ? 433 ARG B NH2 1 
ATOM   7476 N N   . ALA B 1 433 ? 14.315  -73.733 -15.183 1.00 54.78  ? 434 ALA B N   1 
ATOM   7477 C CA  . ALA B 1 433 ? 14.915  -74.619 -16.177 1.00 52.75  ? 434 ALA B CA  1 
ATOM   7478 C C   . ALA B 1 433 ? 16.414  -74.810 -15.942 1.00 52.75  ? 434 ALA B C   1 
ATOM   7479 O O   . ALA B 1 433 ? 17.116  -73.880 -15.552 1.00 62.11  ? 434 ALA B O   1 
ATOM   7480 C CB  . ALA B 1 433 ? 14.660  -74.080 -17.577 1.00 49.35  ? 434 ALA B CB  1 
ATOM   7481 N N   . SER B 1 434 ? 16.895  -76.026 -16.177 1.00 60.71  ? 435 SER B N   1 
ATOM   7482 C CA  . SER B 1 434 ? 18.310  -76.346 -16.000 1.00 52.16  ? 435 SER B CA  1 
ATOM   7483 C C   . SER B 1 434 ? 19.154  -75.672 -17.068 1.00 53.75  ? 435 SER B C   1 
ATOM   7484 O O   . SER B 1 434 ? 20.356  -75.494 -16.892 1.00 51.34  ? 435 SER B O   1 
ATOM   7485 C CB  . SER B 1 434 ? 18.538  -77.863 -16.043 1.00 55.59  ? 435 SER B CB  1 
ATOM   7486 O OG  . SER B 1 434 ? 18.266  -78.400 -17.337 1.00 55.76  ? 435 SER B OG  1 
ATOM   7487 N N   . THR B 1 435 ? 18.516  -75.298 -18.176 1.00 51.35  ? 436 THR B N   1 
ATOM   7488 C CA  . THR B 1 435 ? 19.230  -74.749 -19.324 1.00 55.48  ? 436 THR B CA  1 
ATOM   7489 C C   . THR B 1 435 ? 19.224  -73.226 -19.285 1.00 54.82  ? 436 THR B C   1 
ATOM   7490 O O   . THR B 1 435 ? 19.799  -72.559 -20.156 1.00 49.14  ? 436 THR B O   1 
ATOM   7491 C CB  . THR B 1 435 ? 18.614  -75.244 -20.656 1.00 57.75  ? 436 THR B CB  1 
ATOM   7492 O OG1 . THR B 1 435 ? 17.230  -74.872 -20.725 1.00 60.92  ? 436 THR B OG1 1 
ATOM   7493 C CG2 . THR B 1 435 ? 18.720  -76.760 -20.758 1.00 53.05  ? 436 THR B CG2 1 
ATOM   7494 N N   . LEU B 1 436 ? 18.580  -72.688 -18.253 1.00 52.41  ? 437 LEU B N   1 
ATOM   7495 C CA  . LEU B 1 436 ? 18.362  -71.253 -18.134 1.00 55.83  ? 437 LEU B CA  1 
ATOM   7496 C C   . LEU B 1 436 ? 19.683  -70.493 -18.048 1.00 52.01  ? 437 LEU B C   1 
ATOM   7497 O O   . LEU B 1 436 ? 20.575  -70.869 -17.287 1.00 57.19  ? 437 LEU B O   1 
ATOM   7498 C CB  . LEU B 1 436 ? 17.485  -70.964 -16.916 1.00 55.21  ? 437 LEU B CB  1 
ATOM   7499 C CG  . LEU B 1 436 ? 16.721  -69.639 -16.867 1.00 54.95  ? 437 LEU B CG  1 
ATOM   7500 C CD1 . LEU B 1 436 ? 15.911  -69.450 -18.114 1.00 55.42  ? 437 LEU B CD1 1 
ATOM   7501 C CD2 . LEU B 1 436 ? 15.807  -69.622 -15.665 1.00 57.65  ? 437 LEU B CD2 1 
ATOM   7502 N N   . SER B 1 437 ? 19.810  -69.427 -18.832 1.00 48.01  ? 438 SER B N   1 
ATOM   7503 C CA  . SER B 1 437 ? 21.073  -68.698 -18.915 1.00 52.55  ? 438 SER B CA  1 
ATOM   7504 C C   . SER B 1 437 ? 21.054  -67.360 -18.158 1.00 59.16  ? 438 SER B C   1 
ATOM   7505 O O   . SER B 1 437 ? 22.103  -66.735 -17.966 1.00 63.11  ? 438 SER B O   1 
ATOM   7506 C CB  . SER B 1 437 ? 21.452  -68.475 -20.389 1.00 57.49  ? 438 SER B CB  1 
ATOM   7507 O OG  . SER B 1 437 ? 20.329  -68.101 -21.174 1.00 60.01  ? 438 SER B OG  1 
ATOM   7508 N N   . TRP B 1 438 ? 19.870  -66.925 -17.729 1.00 57.50  ? 439 TRP B N   1 
ATOM   7509 C CA  . TRP B 1 438 ? 19.756  -65.751 -16.861 1.00 50.94  ? 439 TRP B CA  1 
ATOM   7510 C C   . TRP B 1 438 ? 20.295  -66.100 -15.475 1.00 53.10  ? 439 TRP B C   1 
ATOM   7511 O O   . TRP B 1 438 ? 20.216  -67.258 -15.055 1.00 53.52  ? 439 TRP B O   1 
ATOM   7512 C CB  . TRP B 1 438 ? 18.305  -65.264 -16.782 1.00 43.99  ? 439 TRP B CB  1 
ATOM   7513 C CG  . TRP B 1 438 ? 17.785  -64.723 -18.090 1.00 51.43  ? 439 TRP B CG  1 
ATOM   7514 C CD1 . TRP B 1 438 ? 17.009  -65.385 -18.999 1.00 47.39  ? 439 TRP B CD1 1 
ATOM   7515 C CD2 . TRP B 1 438 ? 18.009  -63.413 -18.635 1.00 47.19  ? 439 TRP B CD2 1 
ATOM   7516 N NE1 . TRP B 1 438 ? 16.736  -64.573 -20.076 1.00 44.22  ? 439 TRP B NE1 1 
ATOM   7517 C CE2 . TRP B 1 438 ? 17.338  -63.357 -19.880 1.00 52.61  ? 439 TRP B CE2 1 
ATOM   7518 C CE3 . TRP B 1 438 ? 18.710  -62.284 -18.195 1.00 47.01  ? 439 TRP B CE3 1 
ATOM   7519 C CZ2 . TRP B 1 438 ? 17.347  -62.215 -20.691 1.00 48.17  ? 439 TRP B CZ2 1 
ATOM   7520 C CZ3 . TRP B 1 438 ? 18.719  -61.144 -19.003 1.00 55.01  ? 439 TRP B CZ3 1 
ATOM   7521 C CH2 . TRP B 1 438 ? 18.039  -61.122 -20.235 1.00 56.30  ? 439 TRP B CH2 1 
ATOM   7522 N N   . PRO B 1 439 ? 20.860  -65.105 -14.766 1.00 56.73  ? 440 PRO B N   1 
ATOM   7523 C CA  . PRO B 1 439 ? 21.458  -65.304 -13.432 1.00 47.43  ? 440 PRO B CA  1 
ATOM   7524 C C   . PRO B 1 439 ? 20.512  -65.938 -12.410 1.00 50.66  ? 440 PRO B C   1 
ATOM   7525 O O   . PRO B 1 439 ? 19.291  -65.870 -12.546 1.00 50.87  ? 440 PRO B O   1 
ATOM   7526 C CB  . PRO B 1 439 ? 21.840  -63.883 -12.999 1.00 47.51  ? 440 PRO B CB  1 
ATOM   7527 C CG  . PRO B 1 439 ? 21.056  -62.970 -13.903 1.00 61.12  ? 440 PRO B CG  1 
ATOM   7528 C CD  . PRO B 1 439 ? 20.948  -63.702 -15.202 1.00 52.62  ? 440 PRO B CD  1 
ATOM   7529 N N   . LEU B 1 440 ? 21.083  -66.548 -11.378 1.00 56.15  ? 441 LEU B N   1 
ATOM   7530 C CA  . LEU B 1 440 ? 20.291  -67.321 -10.426 1.00 51.37  ? 441 LEU B CA  1 
ATOM   7531 C C   . LEU B 1 440 ? 19.321  -66.466 -9.592  1.00 51.85  ? 441 LEU B C   1 
ATOM   7532 O O   . LEU B 1 440 ? 18.332  -66.988 -9.065  1.00 52.87  ? 441 LEU B O   1 
ATOM   7533 C CB  . LEU B 1 440 ? 21.226  -68.111 -9.503  1.00 54.50  ? 441 LEU B CB  1 
ATOM   7534 C CG  . LEU B 1 440 ? 20.622  -69.155 -8.561  1.00 60.71  ? 441 LEU B CG  1 
ATOM   7535 C CD1 . LEU B 1 440 ? 20.025  -70.326 -9.333  1.00 55.81  ? 441 LEU B CD1 1 
ATOM   7536 C CD2 . LEU B 1 440 ? 21.667  -69.634 -7.565  1.00 65.69  ? 441 LEU B CD2 1 
ATOM   7537 N N   . TRP B 1 441 ? 19.589  -65.164 -9.477  1.00 54.01  ? 442 TRP B N   1 
ATOM   7538 C CA  . TRP B 1 441 ? 18.746  -64.297 -8.643  1.00 57.31  ? 442 TRP B CA  1 
ATOM   7539 C C   . TRP B 1 441 ? 17.411  -63.965 -9.311  1.00 59.14  ? 442 TRP B C   1 
ATOM   7540 O O   . TRP B 1 441 ? 16.482  -63.502 -8.649  1.00 57.55  ? 442 TRP B O   1 
ATOM   7541 C CB  . TRP B 1 441 ? 19.478  -62.992 -8.261  1.00 51.45  ? 442 TRP B CB  1 
ATOM   7542 C CG  . TRP B 1 441 ? 19.869  -62.083 -9.400  1.00 51.39  ? 442 TRP B CG  1 
ATOM   7543 C CD1 . TRP B 1 441 ? 21.100  -61.989 -9.983  1.00 59.36  ? 442 TRP B CD1 1 
ATOM   7544 C CD2 . TRP B 1 441 ? 19.035  -61.126 -10.073 1.00 53.11  ? 442 TRP B CD2 1 
ATOM   7545 N NE1 . TRP B 1 441 ? 21.083  -61.044 -10.986 1.00 57.78  ? 442 TRP B NE1 1 
ATOM   7546 C CE2 . TRP B 1 441 ? 19.828  -60.502 -11.065 1.00 56.77  ? 442 TRP B CE2 1 
ATOM   7547 C CE3 . TRP B 1 441 ? 17.695  -60.743 -9.942  1.00 48.44  ? 442 TRP B CE3 1 
ATOM   7548 C CZ2 . TRP B 1 441 ? 19.327  -59.517 -11.919 1.00 53.96  ? 442 TRP B CZ2 1 
ATOM   7549 C CZ3 . TRP B 1 441 ? 17.195  -59.765 -10.794 1.00 51.52  ? 442 TRP B CZ3 1 
ATOM   7550 C CH2 . TRP B 1 441 ? 18.012  -59.163 -11.771 1.00 54.18  ? 442 TRP B CH2 1 
ATOM   7551 N N   . MET B 1 442 ? 17.305  -64.212 -10.612 1.00 51.70  ? 443 MET B N   1 
ATOM   7552 C CA  . MET B 1 442 ? 16.062  -63.937 -11.316 1.00 43.04  ? 443 MET B CA  1 
ATOM   7553 C C   . MET B 1 442 ? 15.016  -65.024 -11.072 1.00 52.06  ? 443 MET B C   1 
ATOM   7554 O O   . MET B 1 442 ? 13.871  -64.892 -11.509 1.00 51.42  ? 443 MET B O   1 
ATOM   7555 C CB  . MET B 1 442 ? 16.309  -63.790 -12.815 1.00 45.76  ? 443 MET B CB  1 
ATOM   7556 C CG  . MET B 1 442 ? 17.171  -62.610 -13.201 1.00 43.61  ? 443 MET B CG  1 
ATOM   7557 S SD  . MET B 1 442 ? 16.968  -62.210 -14.952 1.00 52.65  ? 443 MET B SD  1 
ATOM   7558 C CE  . MET B 1 442 ? 18.099  -60.841 -15.101 1.00 52.29  ? 443 MET B CE  1 
ATOM   7559 N N   . GLY B 1 443 ? 15.405  -66.089 -10.376 1.00 40.34  ? 444 GLY B N   1 
ATOM   7560 C CA  . GLY B 1 443 ? 14.505  -67.200 -10.110 1.00 39.85  ? 444 GLY B CA  1 
ATOM   7561 C C   . GLY B 1 443 ? 13.911  -67.833 -11.364 1.00 49.78  ? 444 GLY B C   1 
ATOM   7562 O O   . GLY B 1 443 ? 14.621  -68.202 -12.302 1.00 42.36  ? 444 GLY B O   1 
ATOM   7563 N N   . VAL B 1 444 ? 12.592  -67.966 -11.372 1.00 45.43  ? 445 VAL B N   1 
ATOM   7564 C CA  . VAL B 1 444 ? 11.869  -68.395 -12.555 1.00 39.06  ? 445 VAL B CA  1 
ATOM   7565 C C   . VAL B 1 444 ? 11.300  -67.170 -13.257 1.00 40.57  ? 445 VAL B C   1 
ATOM   7566 O O   . VAL B 1 444 ? 10.283  -66.638 -12.832 1.00 38.35  ? 445 VAL B O   1 
ATOM   7567 C CB  . VAL B 1 444 ? 10.728  -69.363 -12.203 1.00 50.98  ? 445 VAL B CB  1 
ATOM   7568 C CG1 . VAL B 1 444 ? 10.045  -69.866 -13.481 1.00 46.22  ? 445 VAL B CG1 1 
ATOM   7569 C CG2 . VAL B 1 444 ? 11.254  -70.526 -11.353 1.00 43.17  ? 445 VAL B CG2 1 
ATOM   7570 N N   . PRO B 1 445 ? 11.958  -66.717 -14.337 1.00 43.88  ? 446 PRO B N   1 
ATOM   7571 C CA  . PRO B 1 445 ? 11.574  -65.456 -14.983 1.00 46.53  ? 446 PRO B CA  1 
ATOM   7572 C C   . PRO B 1 445 ? 10.388  -65.580 -15.931 1.00 44.30  ? 446 PRO B C   1 
ATOM   7573 O O   . PRO B 1 445 ? 9.941   -66.674 -16.275 1.00 46.15  ? 446 PRO B O   1 
ATOM   7574 C CB  . PRO B 1 445 ? 12.837  -65.053 -15.768 1.00 39.52  ? 446 PRO B CB  1 
ATOM   7575 C CG  . PRO B 1 445 ? 13.899  -66.059 -15.382 1.00 45.47  ? 446 PRO B CG  1 
ATOM   7576 C CD  . PRO B 1 445 ? 13.165  -67.285 -14.948 1.00 39.99  ? 446 PRO B CD  1 
ATOM   7577 N N   . HIS B 1 446 ? 9.895   -64.424 -16.347 1.00 42.72  ? 447 HIS B N   1 
ATOM   7578 C CA  . HIS B 1 446 ? 8.770   -64.319 -17.258 1.00 41.15  ? 447 HIS B CA  1 
ATOM   7579 C C   . HIS B 1 446 ? 9.045   -65.024 -18.598 1.00 44.50  ? 447 HIS B C   1 
ATOM   7580 O O   . HIS B 1 446 ? 10.066  -64.793 -19.268 1.00 40.69  ? 447 HIS B O   1 
ATOM   7581 C CB  . HIS B 1 446 ? 8.448   -62.838 -17.470 1.00 45.74  ? 447 HIS B CB  1 
ATOM   7582 C CG  . HIS B 1 446 ? 7.353   -62.582 -18.452 1.00 45.96  ? 447 HIS B CG  1 
ATOM   7583 N ND1 . HIS B 1 446 ? 6.018   -62.642 -18.111 1.00 52.63  ? 447 HIS B ND1 1 
ATOM   7584 C CD2 . HIS B 1 446 ? 7.395   -62.250 -19.763 1.00 44.42  ? 447 HIS B CD2 1 
ATOM   7585 C CE1 . HIS B 1 446 ? 5.283   -62.367 -19.173 1.00 45.89  ? 447 HIS B CE1 1 
ATOM   7586 N NE2 . HIS B 1 446 ? 6.093   -62.127 -20.189 1.00 61.22  ? 447 HIS B NE2 1 
ATOM   7587 N N   . GLY B 1 447 ? 8.125   -65.902 -18.976 1.00 42.91  ? 448 GLY B N   1 
ATOM   7588 C CA  . GLY B 1 447 ? 8.208   -66.580 -20.252 1.00 40.12  ? 448 GLY B CA  1 
ATOM   7589 C C   . GLY B 1 447 ? 8.899   -67.929 -20.261 1.00 43.53  ? 448 GLY B C   1 
ATOM   7590 O O   . GLY B 1 447 ? 8.998   -68.545 -21.311 1.00 41.77  ? 448 GLY B O   1 
ATOM   7591 N N   . TYR B 1 448 ? 9.365   -68.409 -19.111 1.00 45.36  ? 449 TYR B N   1 
ATOM   7592 C CA  . TYR B 1 448 ? 10.157  -69.632 -19.121 1.00 42.14  ? 449 TYR B CA  1 
ATOM   7593 C C   . TYR B 1 448 ? 9.381   -70.861 -18.669 1.00 41.50  ? 449 TYR B C   1 
ATOM   7594 O O   . TYR B 1 448 ? 9.960   -71.886 -18.322 1.00 52.36  ? 449 TYR B O   1 
ATOM   7595 C CB  . TYR B 1 448 ? 11.434  -69.431 -18.303 1.00 40.39  ? 449 TYR B CB  1 
ATOM   7596 C CG  . TYR B 1 448 ? 12.400  -68.622 -19.118 1.00 44.62  ? 449 TYR B CG  1 
ATOM   7597 C CD1 . TYR B 1 448 ? 13.198  -69.231 -20.074 1.00 43.84  ? 449 TYR B CD1 1 
ATOM   7598 C CD2 . TYR B 1 448 ? 12.445  -67.237 -19.010 1.00 46.37  ? 449 TYR B CD2 1 
ATOM   7599 C CE1 . TYR B 1 448 ? 14.061  -68.489 -20.863 1.00 47.40  ? 449 TYR B CE1 1 
ATOM   7600 C CE2 . TYR B 1 448 ? 13.303  -66.485 -19.796 1.00 47.89  ? 449 TYR B CE2 1 
ATOM   7601 C CZ  . TYR B 1 448 ? 14.107  -67.118 -20.724 1.00 48.94  ? 449 TYR B CZ  1 
ATOM   7602 O OH  . TYR B 1 448 ? 14.960  -66.380 -21.517 1.00 49.29  ? 449 TYR B OH  1 
ATOM   7603 N N   . GLU B 1 449 ? 8.064   -70.760 -18.727 1.00 34.31  ? 450 GLU B N   1 
ATOM   7604 C CA  . GLU B 1 449 ? 7.214   -71.932 -18.644 1.00 34.79  ? 450 GLU B CA  1 
ATOM   7605 C C   . GLU B 1 449 ? 6.828   -72.388 -20.054 1.00 40.58  ? 450 GLU B C   1 
ATOM   7606 O O   . GLU B 1 449 ? 6.351   -73.504 -20.243 1.00 42.31  ? 450 GLU B O   1 
ATOM   7607 C CB  . GLU B 1 449 ? 5.959   -71.629 -17.815 1.00 32.91  ? 450 GLU B CB  1 
ATOM   7608 C CG  . GLU B 1 449 ? 4.800   -70.939 -18.562 1.00 39.70  ? 450 GLU B CG  1 
ATOM   7609 C CD  . GLU B 1 449 ? 5.084   -69.491 -19.028 1.00 50.05  ? 450 GLU B CD  1 
ATOM   7610 O OE1 . GLU B 1 449 ? 6.258   -69.045 -19.041 1.00 39.69  ? 450 GLU B OE1 1 
ATOM   7611 O OE2 . GLU B 1 449 ? 4.105   -68.798 -19.402 1.00 45.49  ? 450 GLU B OE2 1 
ATOM   7612 N N   . ILE B 1 450 ? 7.029   -71.522 -21.045 1.00 43.77  ? 451 ILE B N   1 
ATOM   7613 C CA  . ILE B 1 450 ? 6.517   -71.788 -22.389 1.00 39.96  ? 451 ILE B CA  1 
ATOM   7614 C C   . ILE B 1 450 ? 7.153   -73.037 -22.986 1.00 38.57  ? 451 ILE B C   1 
ATOM   7615 O O   . ILE B 1 450 ? 6.453   -73.924 -23.483 1.00 33.25  ? 451 ILE B O   1 
ATOM   7616 C CB  . ILE B 1 450 ? 6.754   -70.603 -23.331 1.00 40.53  ? 451 ILE B CB  1 
ATOM   7617 C CG1 . ILE B 1 450 ? 6.047   -69.356 -22.800 1.00 43.13  ? 451 ILE B CG1 1 
ATOM   7618 C CG2 . ILE B 1 450 ? 6.276   -70.931 -24.731 1.00 30.98  ? 451 ILE B CG2 1 
ATOM   7619 C CD1 . ILE B 1 450 ? 6.291   -68.117 -23.643 1.00 33.74  ? 451 ILE B CD1 1 
ATOM   7620 N N   . GLU B 1 451 ? 8.478   -73.111 -22.899 1.00 39.23  ? 452 GLU B N   1 
ATOM   7621 C CA  . GLU B 1 451 ? 9.221   -74.244 -23.427 1.00 40.94  ? 452 GLU B CA  1 
ATOM   7622 C C   . GLU B 1 451 ? 8.759   -75.586 -22.837 1.00 40.91  ? 452 GLU B C   1 
ATOM   7623 O O   . GLU B 1 451 ? 8.791   -76.612 -23.515 1.00 40.21  ? 452 GLU B O   1 
ATOM   7624 C CB  . GLU B 1 451 ? 10.719  -74.037 -23.201 1.00 38.44  ? 452 GLU B CB  1 
ATOM   7625 C CG  . GLU B 1 451 ? 11.139  -73.701 -21.782 1.00 44.67  ? 452 GLU B CG  1 
ATOM   7626 C CD  . GLU B 1 451 ? 12.562  -73.128 -21.721 1.00 63.42  ? 452 GLU B CD  1 
ATOM   7627 O OE1 . GLU B 1 451 ? 13.318  -73.489 -20.789 1.00 58.05  ? 452 GLU B OE1 1 
ATOM   7628 O OE2 . GLU B 1 451 ? 12.928  -72.315 -22.606 1.00 59.94  ? 452 GLU B OE2 1 
ATOM   7629 N N   . PHE B 1 452 ? 8.289   -75.577 -21.597 1.00 37.38  ? 453 PHE B N   1 
ATOM   7630 C CA  . PHE B 1 452 ? 7.764   -76.804 -21.009 1.00 38.35  ? 453 PHE B CA  1 
ATOM   7631 C C   . PHE B 1 452 ? 6.360   -77.140 -21.510 1.00 40.19  ? 453 PHE B C   1 
ATOM   7632 O O   . PHE B 1 452 ? 6.027   -78.313 -21.669 1.00 45.36  ? 453 PHE B O   1 
ATOM   7633 C CB  . PHE B 1 452 ? 7.793   -76.715 -19.479 1.00 32.95  ? 453 PHE B CB  1 
ATOM   7634 C CG  . PHE B 1 452 ? 9.179   -76.770 -18.918 1.00 37.87  ? 453 PHE B CG  1 
ATOM   7635 C CD1 . PHE B 1 452 ? 9.904   -75.604 -18.707 1.00 41.22  ? 453 PHE B CD1 1 
ATOM   7636 C CD2 . PHE B 1 452 ? 9.781   -77.986 -18.651 1.00 33.79  ? 453 PHE B CD2 1 
ATOM   7637 C CE1 . PHE B 1 452 ? 11.204  -75.648 -18.214 1.00 38.68  ? 453 PHE B CE1 1 
ATOM   7638 C CE2 . PHE B 1 452 ? 11.073  -78.041 -18.158 1.00 43.64  ? 453 PHE B CE2 1 
ATOM   7639 C CZ  . PHE B 1 452 ? 11.789  -76.866 -17.937 1.00 44.53  ? 453 PHE B CZ  1 
ATOM   7640 N N   . ILE B 1 453 ? 5.539   -76.125 -21.766 1.00 40.47  ? 454 ILE B N   1 
ATOM   7641 C CA  . ILE B 1 453 ? 4.191   -76.360 -22.280 1.00 35.38  ? 454 ILE B CA  1 
ATOM   7642 C C   . ILE B 1 453 ? 4.250   -76.921 -23.699 1.00 44.25  ? 454 ILE B C   1 
ATOM   7643 O O   . ILE B 1 453 ? 3.478   -77.809 -24.057 1.00 38.22  ? 454 ILE B O   1 
ATOM   7644 C CB  . ILE B 1 453 ? 3.353   -75.078 -22.283 1.00 44.29  ? 454 ILE B CB  1 
ATOM   7645 C CG1 . ILE B 1 453 ? 3.186   -74.548 -20.860 1.00 43.08  ? 454 ILE B CG1 1 
ATOM   7646 C CG2 . ILE B 1 453 ? 1.989   -75.340 -22.892 1.00 42.39  ? 454 ILE B CG2 1 
ATOM   7647 C CD1 . ILE B 1 453 ? 2.459   -75.508 -19.958 1.00 44.84  ? 454 ILE B CD1 1 
ATOM   7648 N N   . PHE B 1 454 ? 5.186   -76.401 -24.492 1.00 41.71  ? 455 PHE B N   1 
ATOM   7649 C CA  . PHE B 1 454 ? 5.384   -76.844 -25.865 1.00 32.42  ? 455 PHE B CA  1 
ATOM   7650 C C   . PHE B 1 454 ? 6.234   -78.113 -25.951 1.00 41.28  ? 455 PHE B C   1 
ATOM   7651 O O   . PHE B 1 454 ? 6.477   -78.627 -27.039 1.00 44.11  ? 455 PHE B O   1 
ATOM   7652 C CB  . PHE B 1 454 ? 6.020   -75.721 -26.697 1.00 36.54  ? 455 PHE B CB  1 
ATOM   7653 C CG  . PHE B 1 454 ? 5.016   -74.765 -27.283 1.00 36.03  ? 455 PHE B CG  1 
ATOM   7654 C CD1 . PHE B 1 454 ? 4.631   -73.624 -26.589 1.00 40.81  ? 455 PHE B CD1 1 
ATOM   7655 C CD2 . PHE B 1 454 ? 4.434   -75.021 -28.512 1.00 29.29  ? 455 PHE B CD2 1 
ATOM   7656 C CE1 . PHE B 1 454 ? 3.688   -72.749 -27.115 1.00 36.21  ? 455 PHE B CE1 1 
ATOM   7657 C CE2 . PHE B 1 454 ? 3.492   -74.155 -29.041 1.00 36.98  ? 455 PHE B CE2 1 
ATOM   7658 C CZ  . PHE B 1 454 ? 3.113   -73.014 -28.338 1.00 32.61  ? 455 PHE B CZ  1 
ATOM   7659 N N   . GLY B 1 455 ? 6.682   -78.618 -24.806 1.00 43.24  ? 456 GLY B N   1 
ATOM   7660 C CA  . GLY B 1 455 ? 7.403   -79.880 -24.753 1.00 40.26  ? 456 GLY B CA  1 
ATOM   7661 C C   . GLY B 1 455 ? 8.817   -79.864 -25.323 1.00 46.49  ? 456 GLY B C   1 
ATOM   7662 O O   . GLY B 1 455 ? 9.415   -80.913 -25.555 1.00 46.22  ? 456 GLY B O   1 
ATOM   7663 N N   . ILE B 1 456 ? 9.362   -78.672 -25.534 1.00 41.60  ? 457 ILE B N   1 
ATOM   7664 C CA  . ILE B 1 456 ? 10.703  -78.521 -26.090 1.00 43.39  ? 457 ILE B CA  1 
ATOM   7665 C C   . ILE B 1 456 ? 11.789  -79.405 -25.432 1.00 48.54  ? 457 ILE B C   1 
ATOM   7666 O O   . ILE B 1 456 ? 12.720  -79.821 -26.117 1.00 51.42  ? 457 ILE B O   1 
ATOM   7667 C CB  . ILE B 1 456 ? 11.149  -77.035 -26.029 1.00 44.40  ? 457 ILE B CB  1 
ATOM   7668 C CG1 . ILE B 1 456 ? 10.076  -76.143 -26.647 1.00 43.79  ? 457 ILE B CG1 1 
ATOM   7669 C CG2 . ILE B 1 456 ? 12.450  -76.818 -26.757 1.00 38.38  ? 457 ILE B CG2 1 
ATOM   7670 C CD1 . ILE B 1 456 ? 9.652   -76.563 -28.025 1.00 36.37  ? 457 ILE B CD1 1 
ATOM   7671 N N   . PRO B 1 457 ? 11.689  -79.703 -24.115 1.00 52.05  ? 458 PRO B N   1 
ATOM   7672 C CA  . PRO B 1 457 ? 12.698  -80.633 -23.582 1.00 51.25  ? 458 PRO B CA  1 
ATOM   7673 C C   . PRO B 1 457 ? 12.777  -82.011 -24.271 1.00 51.80  ? 458 PRO B C   1 
ATOM   7674 O O   . PRO B 1 457 ? 13.802  -82.681 -24.155 1.00 49.42  ? 458 PRO B O   1 
ATOM   7675 C CB  . PRO B 1 457 ? 12.265  -80.802 -22.121 1.00 46.98  ? 458 PRO B CB  1 
ATOM   7676 C CG  . PRO B 1 457 ? 11.650  -79.517 -21.780 1.00 40.99  ? 458 PRO B CG  1 
ATOM   7677 C CD  . PRO B 1 457 ? 10.944  -79.049 -23.020 1.00 48.38  ? 458 PRO B CD  1 
ATOM   7678 N N   . LEU B 1 458 ? 11.723  -82.421 -24.968 1.00 46.87  ? 459 LEU B N   1 
ATOM   7679 C CA  . LEU B 1 458 ? 11.731  -83.692 -25.681 1.00 41.02  ? 459 LEU B CA  1 
ATOM   7680 C C   . LEU B 1 458 ? 12.659  -83.678 -26.900 1.00 49.15  ? 459 LEU B C   1 
ATOM   7681 O O   . LEU B 1 458 ? 12.937  -84.718 -27.488 1.00 56.81  ? 459 LEU B O   1 
ATOM   7682 C CB  . LEU B 1 458 ? 10.316  -84.061 -26.115 1.00 37.38  ? 459 LEU B CB  1 
ATOM   7683 C CG  . LEU B 1 458 ? 9.348   -84.321 -24.971 1.00 37.45  ? 459 LEU B CG  1 
ATOM   7684 C CD1 . LEU B 1 458 ? 8.048   -84.946 -25.486 1.00 37.61  ? 459 LEU B CD1 1 
ATOM   7685 C CD2 . LEU B 1 458 ? 10.006  -85.199 -23.936 1.00 36.84  ? 459 LEU B CD2 1 
ATOM   7686 N N   . ASP B 1 459 ? 13.125  -82.498 -27.278 1.00 45.58  ? 460 ASP B N   1 
ATOM   7687 C CA  . ASP B 1 459 ? 14.084  -82.356 -28.364 1.00 55.92  ? 460 ASP B CA  1 
ATOM   7688 C C   . ASP B 1 459 ? 15.476  -82.739 -27.852 1.00 63.86  ? 460 ASP B C   1 
ATOM   7689 O O   . ASP B 1 459 ? 16.089  -81.998 -27.078 1.00 63.17  ? 460 ASP B O   1 
ATOM   7690 C CB  . ASP B 1 459 ? 14.050  -80.917 -28.902 1.00 57.40  ? 460 ASP B CB  1 
ATOM   7691 C CG  . ASP B 1 459 ? 15.029  -80.669 -30.041 1.00 64.38  ? 460 ASP B CG  1 
ATOM   7692 O OD1 . ASP B 1 459 ? 15.832  -81.565 -30.383 1.00 76.44  ? 460 ASP B OD1 1 
ATOM   7693 O OD2 . ASP B 1 459 ? 14.999  -79.544 -30.588 1.00 60.01  ? 460 ASP B OD2 1 
ATOM   7694 N N   . PRO B 1 460 ? 15.986  -83.897 -28.300 1.00 71.81  ? 461 PRO B N   1 
ATOM   7695 C CA  . PRO B 1 460 ? 17.265  -84.456 -27.833 1.00 67.86  ? 461 PRO B CA  1 
ATOM   7696 C C   . PRO B 1 460 ? 18.443  -83.499 -27.989 1.00 74.99  ? 461 PRO B C   1 
ATOM   7697 O O   . PRO B 1 460 ? 19.354  -83.518 -27.155 1.00 72.11  ? 461 PRO B O   1 
ATOM   7698 C CB  . PRO B 1 460 ? 17.459  -85.682 -28.726 1.00 58.90  ? 461 PRO B CB  1 
ATOM   7699 C CG  . PRO B 1 460 ? 16.607  -85.417 -29.932 1.00 72.65  ? 461 PRO B CG  1 
ATOM   7700 C CD  . PRO B 1 460 ? 15.420  -84.671 -29.418 1.00 64.75  ? 461 PRO B CD  1 
ATOM   7701 N N   . SER B 1 461 ? 18.408  -82.668 -29.030 1.00 70.74  ? 462 SER B N   1 
ATOM   7702 C CA  . SER B 1 461 ? 19.508  -81.757 -29.344 1.00 63.99  ? 462 SER B CA  1 
ATOM   7703 C C   . SER B 1 461 ? 19.676  -80.688 -28.278 1.00 64.37  ? 462 SER B C   1 
ATOM   7704 O O   . SER B 1 461 ? 20.704  -80.015 -28.213 1.00 71.29  ? 462 SER B O   1 
ATOM   7705 C CB  . SER B 1 461 ? 19.284  -81.098 -30.702 1.00 72.17  ? 462 SER B CB  1 
ATOM   7706 O OG  . SER B 1 461 ? 18.155  -80.244 -30.660 1.00 79.83  ? 462 SER B OG  1 
ATOM   7707 N N   . ARG B 1 462 ? 18.650  -80.521 -27.454 1.00 70.37  ? 463 ARG B N   1 
ATOM   7708 C CA  . ARG B 1 462 ? 18.735  -79.636 -26.300 1.00 72.59  ? 463 ARG B CA  1 
ATOM   7709 C C   . ARG B 1 462 ? 19.016  -80.479 -25.061 1.00 81.22  ? 463 ARG B C   1 
ATOM   7710 O O   . ARG B 1 462 ? 18.652  -81.656 -25.000 1.00 80.06  ? 463 ARG B O   1 
ATOM   7711 C CB  . ARG B 1 462 ? 17.455  -78.817 -26.158 1.00 61.13  ? 463 ARG B CB  1 
ATOM   7712 C CG  . ARG B 1 462 ? 17.347  -77.781 -27.252 1.00 62.11  ? 463 ARG B CG  1 
ATOM   7713 C CD  . ARG B 1 462 ? 15.921  -77.424 -27.607 1.00 59.89  ? 463 ARG B CD  1 
ATOM   7714 N NE  . ARG B 1 462 ? 15.881  -76.637 -28.838 1.00 71.88  ? 463 ARG B NE  1 
ATOM   7715 C CZ  . ARG B 1 462 ? 16.290  -75.373 -28.931 1.00 80.79  ? 463 ARG B CZ  1 
ATOM   7716 N NH1 . ARG B 1 462 ? 16.765  -74.747 -27.859 1.00 68.21  ? 463 ARG B NH1 1 
ATOM   7717 N NH2 . ARG B 1 462 ? 16.229  -74.733 -30.096 1.00 68.30  ? 463 ARG B NH2 1 
ATOM   7718 N N   . ASN B 1 463 ? 19.684  -79.892 -24.079 1.00 66.94  ? 464 ASN B N   1 
ATOM   7719 C CA  . ASN B 1 463 ? 20.259  -80.712 -23.031 1.00 61.15  ? 464 ASN B CA  1 
ATOM   7720 C C   . ASN B 1 463 ? 19.479  -80.613 -21.719 1.00 56.58  ? 464 ASN B C   1 
ATOM   7721 O O   . ASN B 1 463 ? 20.027  -80.270 -20.677 1.00 63.69  ? 464 ASN B O   1 
ATOM   7722 C CB  . ASN B 1 463 ? 21.736  -80.336 -22.859 1.00 63.74  ? 464 ASN B CB  1 
ATOM   7723 C CG  . ASN B 1 463 ? 22.531  -80.476 -24.174 1.00 78.22  ? 464 ASN B CG  1 
ATOM   7724 O OD1 . ASN B 1 463 ? 23.174  -79.528 -24.646 1.00 71.87  ? 464 ASN B OD1 1 
ATOM   7725 N ND2 . ASN B 1 463 ? 22.471  -81.665 -24.772 1.00 72.84  ? 464 ASN B ND2 1 
ATOM   7726 N N   . TYR B 1 464 ? 18.189  -80.927 -21.782 1.00 50.33  ? 465 TYR B N   1 
ATOM   7727 C CA  . TYR B 1 464 ? 17.358  -80.969 -20.587 1.00 50.70  ? 465 TYR B CA  1 
ATOM   7728 C C   . TYR B 1 464 ? 17.559  -82.288 -19.835 1.00 56.77  ? 465 TYR B C   1 
ATOM   7729 O O   . TYR B 1 464 ? 18.037  -83.265 -20.406 1.00 68.72  ? 465 TYR B O   1 
ATOM   7730 C CB  . TYR B 1 464 ? 15.876  -80.794 -20.940 1.00 45.05  ? 465 TYR B CB  1 
ATOM   7731 C CG  . TYR B 1 464 ? 15.475  -79.393 -21.365 1.00 56.95  ? 465 TYR B CG  1 
ATOM   7732 C CD1 . TYR B 1 464 ? 15.625  -78.977 -22.685 1.00 56.58  ? 465 TYR B CD1 1 
ATOM   7733 C CD2 . TYR B 1 464 ? 14.921  -78.496 -20.454 1.00 54.20  ? 465 TYR B CD2 1 
ATOM   7734 C CE1 . TYR B 1 464 ? 15.252  -77.708 -23.086 1.00 53.18  ? 465 TYR B CE1 1 
ATOM   7735 C CE2 . TYR B 1 464 ? 14.545  -77.218 -20.845 1.00 51.35  ? 465 TYR B CE2 1 
ATOM   7736 C CZ  . TYR B 1 464 ? 14.713  -76.830 -22.165 1.00 57.89  ? 465 TYR B CZ  1 
ATOM   7737 O OH  . TYR B 1 464 ? 14.344  -75.567 -22.573 1.00 52.21  ? 465 TYR B OH  1 
ATOM   7738 N N   . THR B 1 465 ? 17.186  -82.307 -18.559 1.00 49.85  ? 466 THR B N   1 
ATOM   7739 C CA  . THR B 1 465 ? 17.291  -83.509 -17.746 1.00 51.03  ? 466 THR B CA  1 
ATOM   7740 C C   . THR B 1 465 ? 16.117  -84.427 -18.020 1.00 49.70  ? 466 THR B C   1 
ATOM   7741 O O   . THR B 1 465 ? 15.089  -84.003 -18.540 1.00 51.56  ? 466 THR B O   1 
ATOM   7742 C CB  . THR B 1 465 ? 17.331  -83.202 -16.218 1.00 50.03  ? 466 THR B CB  1 
ATOM   7743 O OG1 . THR B 1 465 ? 16.032  -82.794 -15.767 1.00 48.71  ? 466 THR B OG1 1 
ATOM   7744 C CG2 . THR B 1 465 ? 18.364  -82.143 -15.885 1.00 41.83  ? 466 THR B CG2 1 
ATOM   7745 N N   . ALA B 1 466 ? 16.270  -85.691 -17.653 1.00 50.00  ? 467 ALA B N   1 
ATOM   7746 C CA  . ALA B 1 466 ? 15.198  -86.649 -17.828 1.00 40.83  ? 467 ALA B CA  1 
ATOM   7747 C C   . ALA B 1 466 ? 13.982  -86.284 -16.974 1.00 51.30  ? 467 ALA B C   1 
ATOM   7748 O O   . ALA B 1 466 ? 12.846  -86.583 -17.349 1.00 48.08  ? 467 ALA B O   1 
ATOM   7749 C CB  . ALA B 1 466 ? 15.687  -88.038 -17.496 1.00 45.68  ? 467 ALA B CB  1 
ATOM   7750 N N   . GLU B 1 467 ? 14.214  -85.636 -15.831 1.00 51.19  ? 468 GLU B N   1 
ATOM   7751 C CA  . GLU B 1 467 ? 13.105  -85.242 -14.963 1.00 55.61  ? 468 GLU B CA  1 
ATOM   7752 C C   . GLU B 1 467 ? 12.301  -84.125 -15.622 1.00 55.12  ? 468 GLU B C   1 
ATOM   7753 O O   . GLU B 1 467 ? 11.064  -84.115 -15.586 1.00 40.94  ? 468 GLU B O   1 
ATOM   7754 C CB  . GLU B 1 467 ? 13.606  -84.796 -13.589 1.00 61.97  ? 468 GLU B CB  1 
ATOM   7755 C CG  . GLU B 1 467 ? 13.790  -85.928 -12.582 1.00 75.45  ? 468 GLU B CG  1 
ATOM   7756 C CD  . GLU B 1 467 ? 14.179  -85.423 -11.191 1.00 98.01  ? 468 GLU B CD  1 
ATOM   7757 O OE1 . GLU B 1 467 ? 13.948  -84.226 -10.901 1.00 83.71  ? 468 GLU B OE1 1 
ATOM   7758 O OE2 . GLU B 1 467 ? 14.720  -86.221 -10.389 1.00 106.14 ? 468 GLU B OE2 1 
ATOM   7759 N N   . GLU B 1 468 ? 13.015  -83.192 -16.239 1.00 50.61  ? 469 GLU B N   1 
ATOM   7760 C CA  . GLU B 1 468 ? 12.370  -82.107 -16.960 1.00 48.69  ? 469 GLU B CA  1 
ATOM   7761 C C   . GLU B 1 468 ? 11.512  -82.631 -18.117 1.00 49.72  ? 469 GLU B C   1 
ATOM   7762 O O   . GLU B 1 468 ? 10.454  -82.065 -18.403 1.00 46.46  ? 469 GLU B O   1 
ATOM   7763 C CB  . GLU B 1 468 ? 13.418  -81.107 -17.455 1.00 42.04  ? 469 GLU B CB  1 
ATOM   7764 C CG  . GLU B 1 468 ? 13.876  -80.167 -16.356 1.00 41.19  ? 469 GLU B CG  1 
ATOM   7765 C CD  . GLU B 1 468 ? 15.076  -79.320 -16.737 1.00 51.97  ? 469 GLU B CD  1 
ATOM   7766 O OE1 . GLU B 1 468 ? 15.911  -79.784 -17.542 1.00 45.47  ? 469 GLU B OE1 1 
ATOM   7767 O OE2 . GLU B 1 468 ? 15.183  -78.184 -16.222 1.00 46.92  ? 469 GLU B OE2 1 
ATOM   7768 N N   . LYS B 1 469 ? 11.947  -83.721 -18.755 1.00 43.34  ? 470 LYS B N   1 
ATOM   7769 C CA  . LYS B 1 469 ? 11.156  -84.350 -19.820 1.00 38.34  ? 470 LYS B CA  1 
ATOM   7770 C C   . LYS B 1 469 ? 9.865   -84.935 -19.268 1.00 40.09  ? 470 LYS B C   1 
ATOM   7771 O O   . LYS B 1 469 ? 8.807   -84.795 -19.877 1.00 44.04  ? 470 LYS B O   1 
ATOM   7772 C CB  . LYS B 1 469 ? 11.963  -85.434 -20.535 1.00 39.04  ? 470 LYS B CB  1 
ATOM   7773 C CG  . LYS B 1 469 ? 13.107  -84.880 -21.366 1.00 40.31  ? 470 LYS B CG  1 
ATOM   7774 C CD  . LYS B 1 469 ? 14.062  -85.943 -21.831 1.00 37.27  ? 470 LYS B CD  1 
ATOM   7775 C CE  . LYS B 1 469 ? 15.334  -85.290 -22.306 1.00 42.60  ? 470 LYS B CE  1 
ATOM   7776 N NZ  . LYS B 1 469 ? 16.283  -86.239 -22.917 1.00 43.31  ? 470 LYS B NZ  1 
ATOM   7777 N N   . ILE B 1 470 ? 9.955   -85.582 -18.110 1.00 41.97  ? 471 ILE B N   1 
ATOM   7778 C CA  . ILE B 1 470 ? 8.775   -86.093 -17.422 1.00 47.98  ? 471 ILE B CA  1 
ATOM   7779 C C   . ILE B 1 470 ? 7.824   -84.938 -17.113 1.00 46.94  ? 471 ILE B C   1 
ATOM   7780 O O   . ILE B 1 470 ? 6.602   -85.051 -17.271 1.00 42.19  ? 471 ILE B O   1 
ATOM   7781 C CB  . ILE B 1 470 ? 9.144   -86.825 -16.086 1.00 57.43  ? 471 ILE B CB  1 
ATOM   7782 C CG1 . ILE B 1 470 ? 10.193  -87.926 -16.306 1.00 42.55  ? 471 ILE B CG1 1 
ATOM   7783 C CG2 . ILE B 1 470 ? 7.896   -87.376 -15.396 1.00 40.69  ? 471 ILE B CG2 1 
ATOM   7784 C CD1 . ILE B 1 470 ? 9.767   -88.995 -17.283 1.00 68.53  ? 471 ILE B CD1 1 
ATOM   7785 N N   . PHE B 1 471 ? 8.410   -83.824 -16.677 1.00 44.60  ? 472 PHE B N   1 
ATOM   7786 C CA  . PHE B 1 471 ? 7.660   -82.659 -16.218 1.00 41.56  ? 472 PHE B CA  1 
ATOM   7787 C C   . PHE B 1 471 ? 6.937   -82.000 -17.381 1.00 43.17  ? 472 PHE B C   1 
ATOM   7788 O O   . PHE B 1 471 ? 5.748   -81.670 -17.280 1.00 38.32  ? 472 PHE B O   1 
ATOM   7789 C CB  . PHE B 1 471 ? 8.607   -81.664 -15.524 1.00 49.87  ? 472 PHE B CB  1 
ATOM   7790 C CG  . PHE B 1 471 ? 7.938   -80.399 -15.055 1.00 44.15  ? 472 PHE B CG  1 
ATOM   7791 C CD1 . PHE B 1 471 ? 6.771   -80.444 -14.308 1.00 44.67  ? 472 PHE B CD1 1 
ATOM   7792 C CD2 . PHE B 1 471 ? 8.491   -79.162 -15.346 1.00 45.17  ? 472 PHE B CD2 1 
ATOM   7793 C CE1 . PHE B 1 471 ? 6.158   -79.284 -13.876 1.00 38.99  ? 472 PHE B CE1 1 
ATOM   7794 C CE2 . PHE B 1 471 ? 7.886   -77.999 -14.908 1.00 46.97  ? 472 PHE B CE2 1 
ATOM   7795 C CZ  . PHE B 1 471 ? 6.718   -78.063 -14.173 1.00 43.03  ? 472 PHE B CZ  1 
ATOM   7796 N N   . ALA B 1 472 ? 7.663   -81.826 -18.486 1.00 37.65  ? 473 ALA B N   1 
ATOM   7797 C CA  . ALA B 1 472 ? 7.081   -81.319 -19.721 1.00 34.87  ? 473 ALA B CA  1 
ATOM   7798 C C   . ALA B 1 472 ? 5.887   -82.161 -20.154 1.00 41.44  ? 473 ALA B C   1 
ATOM   7799 O O   . ALA B 1 472 ? 4.853   -81.632 -20.573 1.00 39.09  ? 473 ALA B O   1 
ATOM   7800 C CB  . ALA B 1 472 ? 8.122   -81.279 -20.815 1.00 36.14  ? 473 ALA B CB  1 
ATOM   7801 N N   . GLN B 1 473 ? 6.021   -83.478 -20.048 1.00 44.36  ? 474 GLN B N   1 
ATOM   7802 C CA  . GLN B 1 473 ? 4.927   -84.349 -20.454 1.00 44.21  ? 474 GLN B CA  1 
ATOM   7803 C C   . GLN B 1 473 ? 3.722   -84.181 -19.528 1.00 41.05  ? 474 GLN B C   1 
ATOM   7804 O O   . GLN B 1 473 ? 2.574   -84.248 -19.977 1.00 38.67  ? 474 GLN B O   1 
ATOM   7805 C CB  . GLN B 1 473 ? 5.397   -85.796 -20.505 1.00 37.63  ? 474 GLN B CB  1 
ATOM   7806 C CG  . GLN B 1 473 ? 6.464   -86.029 -21.574 1.00 51.01  ? 474 GLN B CG  1 
ATOM   7807 C CD  . GLN B 1 473 ? 6.846   -87.493 -21.744 1.00 49.44  ? 474 GLN B CD  1 
ATOM   7808 O OE1 . GLN B 1 473 ? 7.302   -88.140 -20.803 1.00 59.35  ? 474 GLN B OE1 1 
ATOM   7809 N NE2 . GLN B 1 473 ? 6.656   -88.018 -22.952 1.00 58.29  ? 474 GLN B NE2 1 
ATOM   7810 N N   . ARG B 1 474 ? 3.976   -83.928 -18.246 1.00 42.01  ? 475 ARG B N   1 
ATOM   7811 C CA  . ARG B 1 474 ? 2.882   -83.665 -17.315 1.00 40.83  ? 475 ARG B CA  1 
ATOM   7812 C C   . ARG B 1 474 ? 2.089   -82.434 -17.733 1.00 45.57  ? 475 ARG B C   1 
ATOM   7813 O O   . ARG B 1 474 ? 0.854   -82.468 -17.777 1.00 37.56  ? 475 ARG B O   1 
ATOM   7814 C CB  . ARG B 1 474 ? 3.404   -83.480 -15.898 1.00 36.24  ? 475 ARG B CB  1 
ATOM   7815 C CG  . ARG B 1 474 ? 3.339   -84.727 -15.058 1.00 55.26  ? 475 ARG B CG  1 
ATOM   7816 C CD  . ARG B 1 474 ? 3.901   -84.480 -13.676 1.00 51.09  ? 475 ARG B CD  1 
ATOM   7817 N NE  . ARG B 1 474 ? 3.041   -83.575 -12.926 1.00 49.65  ? 475 ARG B NE  1 
ATOM   7818 C CZ  . ARG B 1 474 ? 3.486   -82.619 -12.121 1.00 52.26  ? 475 ARG B CZ  1 
ATOM   7819 N NH1 . ARG B 1 474 ? 4.798   -82.432 -11.959 1.00 41.59  ? 475 ARG B NH1 1 
ATOM   7820 N NH2 . ARG B 1 474 ? 2.613   -81.849 -11.481 1.00 48.22  ? 475 ARG B NH2 1 
ATOM   7821 N N   . LEU B 1 475 ? 2.808   -81.356 -18.048 1.00 35.82  ? 476 LEU B N   1 
ATOM   7822 C CA  . LEU B 1 475 ? 2.177   -80.086 -18.385 1.00 37.94  ? 476 LEU B CA  1 
ATOM   7823 C C   . LEU B 1 475 ? 1.383   -80.181 -19.679 1.00 39.04  ? 476 LEU B C   1 
ATOM   7824 O O   . LEU B 1 475 ? 0.232   -79.751 -19.731 1.00 41.74  ? 476 LEU B O   1 
ATOM   7825 C CB  . LEU B 1 475 ? 3.225   -78.980 -18.493 1.00 40.30  ? 476 LEU B CB  1 
ATOM   7826 C CG  . LEU B 1 475 ? 4.002   -78.723 -17.204 1.00 42.13  ? 476 LEU B CG  1 
ATOM   7827 C CD1 . LEU B 1 475 ? 5.094   -77.696 -17.431 1.00 44.82  ? 476 LEU B CD1 1 
ATOM   7828 C CD2 . LEU B 1 475 ? 3.054   -78.269 -16.123 1.00 35.04  ? 476 LEU B CD2 1 
ATOM   7829 N N   . MET B 1 476 ? 1.999   -80.744 -20.717 1.00 38.01  ? 477 MET B N   1 
ATOM   7830 C CA  . MET B 1 476 ? 1.316   -80.978 -21.983 1.00 36.35  ? 477 MET B CA  1 
ATOM   7831 C C   . MET B 1 476 ? -0.001  -81.731 -21.762 1.00 41.54  ? 477 MET B C   1 
ATOM   7832 O O   . MET B 1 476 ? -1.032  -81.409 -22.362 1.00 32.83  ? 477 MET B O   1 
ATOM   7833 C CB  . MET B 1 476 ? 2.227   -81.748 -22.939 1.00 38.70  ? 477 MET B CB  1 
ATOM   7834 C CG  . MET B 1 476 ? 3.486   -80.980 -23.354 1.00 48.17  ? 477 MET B CG  1 
ATOM   7835 S SD  . MET B 1 476 ? 4.320   -81.664 -24.812 1.00 46.69  ? 477 MET B SD  1 
ATOM   7836 C CE  . MET B 1 476 ? 5.078   -83.130 -24.120 1.00 37.80  ? 477 MET B CE  1 
ATOM   7837 N N   . ARG B 1 477 ? 0.040   -82.716 -20.870 1.00 35.72  ? 478 ARG B N   1 
ATOM   7838 C CA  . ARG B 1 477 ? -1.145  -83.467 -20.509 1.00 37.35  ? 478 ARG B CA  1 
ATOM   7839 C C   . ARG B 1 477 ? -2.231  -82.548 -19.921 1.00 45.48  ? 478 ARG B C   1 
ATOM   7840 O O   . ARG B 1 477 ? -3.372  -82.568 -20.386 1.00 42.31  ? 478 ARG B O   1 
ATOM   7841 C CB  . ARG B 1 477 ? -0.767  -84.583 -19.538 1.00 39.45  ? 478 ARG B CB  1 
ATOM   7842 C CG  . ARG B 1 477 ? -1.938  -85.437 -19.068 1.00 51.11  ? 478 ARG B CG  1 
ATOM   7843 C CD  . ARG B 1 477 ? -2.742  -86.022 -20.233 1.00 64.68  ? 478 ARG B CD  1 
ATOM   7844 N NE  . ARG B 1 477 ? -1.904  -86.771 -21.169 1.00 68.48  ? 478 ARG B NE  1 
ATOM   7845 C CZ  . ARG B 1 477 ? -1.520  -88.033 -20.996 1.00 64.72  ? 478 ARG B CZ  1 
ATOM   7846 N NH1 . ARG B 1 477 ? -1.895  -88.703 -19.916 1.00 64.77  ? 478 ARG B NH1 1 
ATOM   7847 N NH2 . ARG B 1 477 ? -0.755  -88.623 -21.905 1.00 66.15  ? 478 ARG B NH2 1 
ATOM   7848 N N   . TYR B 1 478 ? -1.866  -81.731 -18.927 1.00 39.65  ? 479 TYR B N   1 
ATOM   7849 C CA  . TYR B 1 478 ? -2.783  -80.757 -18.333 1.00 32.96  ? 479 TYR B CA  1 
ATOM   7850 C C   . TYR B 1 478 ? -3.423  -79.836 -19.374 1.00 42.86  ? 479 TYR B C   1 
ATOM   7851 O O   . TYR B 1 478 ? -4.656  -79.735 -19.457 1.00 41.20  ? 479 TYR B O   1 
ATOM   7852 C CB  . TYR B 1 478 ? -2.063  -79.884 -17.298 1.00 40.13  ? 479 TYR B CB  1 
ATOM   7853 C CG  . TYR B 1 478 ? -1.631  -80.571 -16.023 1.00 42.76  ? 479 TYR B CG  1 
ATOM   7854 C CD1 . TYR B 1 478 ? -2.500  -81.385 -15.311 1.00 33.54  ? 479 TYR B CD1 1 
ATOM   7855 C CD2 . TYR B 1 478 ? -0.343  -80.385 -15.522 1.00 44.64  ? 479 TYR B CD2 1 
ATOM   7856 C CE1 . TYR B 1 478 ? -2.091  -82.010 -14.132 1.00 35.93  ? 479 TYR B CE1 1 
ATOM   7857 C CE2 . TYR B 1 478 ? 0.076   -81.008 -14.356 1.00 43.73  ? 479 TYR B CE2 1 
ATOM   7858 C CZ  . TYR B 1 478 ? -0.800  -81.819 -13.663 1.00 44.92  ? 479 TYR B CZ  1 
ATOM   7859 O OH  . TYR B 1 478 ? -0.371  -82.431 -12.503 1.00 45.59  ? 479 TYR B OH  1 
ATOM   7860 N N   . TRP B 1 479 ? -2.581  -79.135 -20.134 1.00 31.04  ? 480 TRP B N   1 
ATOM   7861 C CA  . TRP B 1 479 ? -3.059  -78.214 -21.160 1.00 38.99  ? 480 TRP B CA  1 
ATOM   7862 C C   . TRP B 1 479 ? -3.970  -78.924 -22.157 1.00 42.24  ? 480 TRP B C   1 
ATOM   7863 O O   . TRP B 1 479 ? -5.035  -78.416 -22.500 1.00 40.94  ? 480 TRP B O   1 
ATOM   7864 C CB  . TRP B 1 479 ? -1.885  -77.564 -21.894 1.00 39.53  ? 480 TRP B CB  1 
ATOM   7865 C CG  . TRP B 1 479 ? -1.504  -76.186 -21.395 1.00 39.64  ? 480 TRP B CG  1 
ATOM   7866 C CD1 . TRP B 1 479 ? -1.507  -75.023 -22.116 1.00 40.76  ? 480 TRP B CD1 1 
ATOM   7867 C CD2 . TRP B 1 479 ? -1.065  -75.835 -20.076 1.00 41.47  ? 480 TRP B CD2 1 
ATOM   7868 N NE1 . TRP B 1 479 ? -1.098  -73.973 -21.331 1.00 34.05  ? 480 TRP B NE1 1 
ATOM   7869 C CE2 . TRP B 1 479 ? -0.818  -74.442 -20.073 1.00 42.68  ? 480 TRP B CE2 1 
ATOM   7870 C CE3 . TRP B 1 479 ? -0.859  -76.559 -18.893 1.00 41.55  ? 480 TRP B CE3 1 
ATOM   7871 C CZ2 . TRP B 1 479 ? -0.377  -73.759 -18.934 1.00 40.44  ? 480 TRP B CZ2 1 
ATOM   7872 C CZ3 . TRP B 1 479 ? -0.414  -75.881 -17.764 1.00 42.79  ? 480 TRP B CZ3 1 
ATOM   7873 C CH2 . TRP B 1 479 ? -0.178  -74.492 -17.794 1.00 39.44  ? 480 TRP B CH2 1 
ATOM   7874 N N   . ALA B 1 480 ? -3.561  -80.109 -22.602 1.00 42.62  ? 481 ALA B N   1 
ATOM   7875 C CA  . ALA B 1 480 ? -4.339  -80.854 -23.585 1.00 39.13  ? 481 ALA B CA  1 
ATOM   7876 C C   . ALA B 1 480 ? -5.641  -81.373 -22.988 1.00 48.00  ? 481 ALA B C   1 
ATOM   7877 O O   . ALA B 1 480 ? -6.687  -81.359 -23.655 1.00 44.30  ? 481 ALA B O   1 
ATOM   7878 C CB  . ALA B 1 480 ? -3.526  -81.994 -24.142 1.00 37.04  ? 481 ALA B CB  1 
ATOM   7879 N N   . ASN B 1 481 ? -5.567  -81.844 -21.741 1.00 44.14  ? 482 ASN B N   1 
ATOM   7880 C CA  . ASN B 1 481 ? -6.764  -82.216 -20.990 1.00 45.29  ? 482 ASN B CA  1 
ATOM   7881 C C   . ASN B 1 481 ? -7.729  -81.039 -20.890 1.00 44.55  ? 482 ASN B C   1 
ATOM   7882 O O   . ASN B 1 481 ? -8.934  -81.196 -21.098 1.00 44.29  ? 482 ASN B O   1 
ATOM   7883 C CB  . ASN B 1 481 ? -6.411  -82.714 -19.579 1.00 47.48  ? 482 ASN B CB  1 
ATOM   7884 C CG  . ASN B 1 481 ? -5.952  -84.160 -19.565 1.00 49.38  ? 482 ASN B CG  1 
ATOM   7885 O OD1 . ASN B 1 481 ? -6.198  -84.912 -20.505 1.00 63.96  ? 482 ASN B OD1 1 
ATOM   7886 N ND2 . ASN B 1 481 ? -5.284  -84.554 -18.497 1.00 49.57  ? 482 ASN B ND2 1 
ATOM   7887 N N   . PHE B 1 482 ? -7.201  -79.859 -20.575 1.00 42.87  ? 483 PHE B N   1 
ATOM   7888 C CA  . PHE B 1 482 ? -8.050  -78.688 -20.472 1.00 37.79  ? 483 PHE B CA  1 
ATOM   7889 C C   . PHE B 1 482 ? -8.683  -78.397 -21.824 1.00 39.90  ? 483 PHE B C   1 
ATOM   7890 O O   . PHE B 1 482 ? -9.881  -78.124 -21.912 1.00 41.20  ? 483 PHE B O   1 
ATOM   7891 C CB  . PHE B 1 482 ? -7.274  -77.472 -19.969 1.00 39.52  ? 483 PHE B CB  1 
ATOM   7892 C CG  . PHE B 1 482 ? -8.084  -76.213 -19.974 1.00 34.58  ? 483 PHE B CG  1 
ATOM   7893 C CD1 . PHE B 1 482 ? -9.042  -75.993 -19.004 1.00 35.31  ? 483 PHE B CD1 1 
ATOM   7894 C CD2 . PHE B 1 482 ? -7.911  -75.266 -20.969 1.00 33.35  ? 483 PHE B CD2 1 
ATOM   7895 C CE1 . PHE B 1 482 ? -9.813  -74.855 -19.016 1.00 34.48  ? 483 PHE B CE1 1 
ATOM   7896 C CE2 . PHE B 1 482 ? -8.675  -74.120 -20.986 1.00 36.76  ? 483 PHE B CE2 1 
ATOM   7897 C CZ  . PHE B 1 482 ? -9.631  -73.913 -20.001 1.00 37.59  ? 483 PHE B CZ  1 
ATOM   7898 N N   . ALA B 1 483 ? -7.877  -78.479 -22.878 1.00 36.68  ? 484 ALA B N   1 
ATOM   7899 C CA  . ALA B 1 483 ? -8.364  -78.283 -24.238 1.00 36.83  ? 484 ALA B CA  1 
ATOM   7900 C C   . ALA B 1 483 ? -9.518  -79.239 -24.575 1.00 44.50  ? 484 ALA B C   1 
ATOM   7901 O O   . ALA B 1 483 ? -10.580 -78.801 -25.012 1.00 46.99  ? 484 ALA B O   1 
ATOM   7902 C CB  . ALA B 1 483 ? -7.223  -78.453 -25.226 1.00 39.33  ? 484 ALA B CB  1 
ATOM   7903 N N   . ARG B 1 484 ? -9.311  -80.538 -24.354 1.00 41.91  ? 485 ARG B N   1 
ATOM   7904 C CA  . ARG B 1 484 ? -10.342 -81.549 -24.620 1.00 43.68  ? 485 ARG B CA  1 
ATOM   7905 C C   . ARG B 1 484 ? -11.608 -81.401 -23.777 1.00 47.90  ? 485 ARG B C   1 
ATOM   7906 O O   . ARG B 1 484 ? -12.718 -81.385 -24.311 1.00 50.65  ? 485 ARG B O   1 
ATOM   7907 C CB  . ARG B 1 484 ? -9.773  -82.953 -24.406 1.00 37.22  ? 485 ARG B CB  1 
ATOM   7908 C CG  . ARG B 1 484 ? -8.802  -83.390 -25.490 1.00 39.17  ? 485 ARG B CG  1 
ATOM   7909 C CD  . ARG B 1 484 ? -8.333  -84.810 -25.287 1.00 34.66  ? 485 ARG B CD  1 
ATOM   7910 N NE  . ARG B 1 484 ? -7.396  -84.911 -24.177 1.00 44.39  ? 485 ARG B NE  1 
ATOM   7911 C CZ  . ARG B 1 484 ? -6.074  -84.890 -24.315 1.00 41.57  ? 485 ARG B CZ  1 
ATOM   7912 N NH1 . ARG B 1 484 ? -5.529  -84.778 -25.518 1.00 43.47  ? 485 ARG B NH1 1 
ATOM   7913 N NH2 . ARG B 1 484 ? -5.294  -84.985 -23.250 1.00 49.42  ? 485 ARG B NH2 1 
ATOM   7914 N N   . THR B 1 485 ? -11.441 -81.286 -22.462 1.00 50.80  ? 486 THR B N   1 
ATOM   7915 C CA  . THR B 1 485 ? -12.567 -81.428 -21.539 1.00 49.91  ? 486 THR B CA  1 
ATOM   7916 C C   . THR B 1 485 ? -12.965 -80.167 -20.776 1.00 50.78  ? 486 THR B C   1 
ATOM   7917 O O   . THR B 1 485 ? -14.033 -80.129 -20.171 1.00 52.16  ? 486 THR B O   1 
ATOM   7918 C CB  . THR B 1 485 ? -12.275 -82.505 -20.492 1.00 46.82  ? 486 THR B CB  1 
ATOM   7919 O OG1 . THR B 1 485 ? -11.364 -81.980 -19.518 1.00 48.67  ? 486 THR B OG1 1 
ATOM   7920 C CG2 . THR B 1 485 ? -11.678 -83.746 -21.141 1.00 40.78  ? 486 THR B CG2 1 
ATOM   7921 N N   . GLY B 1 486 ? -12.106 -79.151 -20.782 1.00 51.12  ? 487 GLY B N   1 
ATOM   7922 C CA  . GLY B 1 486 ? -12.371 -77.932 -20.031 1.00 43.98  ? 487 GLY B CA  1 
ATOM   7923 C C   . GLY B 1 486 ? -11.945 -78.064 -18.586 1.00 42.52  ? 487 GLY B C   1 
ATOM   7924 O O   . GLY B 1 486 ? -12.293 -77.243 -17.746 1.00 49.46  ? 487 GLY B O   1 
ATOM   7925 N N   . ASP B 1 487 ? -11.169 -79.107 -18.316 1.00 43.85  ? 488 ASP B N   1 
ATOM   7926 C CA  . ASP B 1 487 ? -10.754 -79.475 -16.974 1.00 46.79  ? 488 ASP B CA  1 
ATOM   7927 C C   . ASP B 1 487 ? -9.395  -80.142 -17.121 1.00 48.93  ? 488 ASP B C   1 
ATOM   7928 O O   . ASP B 1 487 ? -9.288  -81.189 -17.758 1.00 51.95  ? 488 ASP B O   1 
ATOM   7929 C CB  . ASP B 1 487 ? -11.799 -80.412 -16.334 1.00 57.75  ? 488 ASP B CB  1 
ATOM   7930 C CG  . ASP B 1 487 ? -11.401 -80.936 -14.948 1.00 54.79  ? 488 ASP B CG  1 
ATOM   7931 O OD1 . ASP B 1 487 ? -10.206 -80.936 -14.587 1.00 54.49  ? 488 ASP B OD1 1 
ATOM   7932 O OD2 . ASP B 1 487 ? -12.313 -81.378 -14.212 1.00 61.89  ? 488 ASP B OD2 1 
ATOM   7933 N N   . PRO B 1 488 ? -8.350  -79.543 -16.531 1.00 49.36  ? 489 PRO B N   1 
ATOM   7934 C CA  . PRO B 1 488 ? -6.980  -80.051 -16.700 1.00 46.85  ? 489 PRO B CA  1 
ATOM   7935 C C   . PRO B 1 488 ? -6.735  -81.368 -15.969 1.00 50.34  ? 489 PRO B C   1 
ATOM   7936 O O   . PRO B 1 488 ? -5.647  -81.933 -16.079 1.00 48.75  ? 489 PRO B O   1 
ATOM   7937 C CB  . PRO B 1 488 ? -6.113  -78.932 -16.108 1.00 39.75  ? 489 PRO B CB  1 
ATOM   7938 C CG  . PRO B 1 488 ? -7.000  -78.277 -15.101 1.00 41.50  ? 489 PRO B CG  1 
ATOM   7939 C CD  . PRO B 1 488 ? -8.399  -78.345 -15.673 1.00 43.48  ? 489 PRO B CD  1 
ATOM   7940 N N   . ASN B 1 489 ? -7.731  -81.851 -15.235 1.00 57.35  ? 490 ASN B N   1 
ATOM   7941 C CA  . ASN B 1 489 ? -7.543  -83.043 -14.418 1.00 64.34  ? 490 ASN B CA  1 
ATOM   7942 C C   . ASN B 1 489 ? -7.670  -84.342 -15.180 1.00 68.00  ? 490 ASN B C   1 
ATOM   7943 O O   . ASN B 1 489 ? -8.517  -84.481 -16.068 1.00 61.24  ? 490 ASN B O   1 
ATOM   7944 C CB  . ASN B 1 489 ? -8.524  -83.059 -13.257 1.00 56.17  ? 490 ASN B CB  1 
ATOM   7945 C CG  . ASN B 1 489 ? -8.025  -82.273 -12.091 1.00 58.57  ? 490 ASN B CG  1 
ATOM   7946 O OD1 . ASN B 1 489 ? -6.999  -82.615 -11.501 1.00 59.81  ? 490 ASN B OD1 1 
ATOM   7947 N ND2 . ASN B 1 489 ? -8.732  -81.200 -11.749 1.00 58.12  ? 490 ASN B ND2 1 
ATOM   7948 N N   . GLU B 1 490 ? -6.815  -85.287 -14.793 1.00 82.35  ? 491 GLU B N   1 
ATOM   7949 C CA  . GLU B 1 490 ? -6.765  -86.624 -15.375 1.00 100.17 ? 491 GLU B CA  1 
ATOM   7950 C C   . GLU B 1 490 ? -8.112  -87.349 -15.311 1.00 110.16 ? 491 GLU B C   1 
ATOM   7951 O O   . GLU B 1 490 ? -8.576  -87.722 -14.222 1.00 102.04 ? 491 GLU B O   1 
ATOM   7952 C CB  . GLU B 1 490 ? -5.691  -87.457 -14.667 1.00 98.84  ? 491 GLU B CB  1 
ATOM   7953 C CG  . GLU B 1 490 ? -4.261  -86.953 -14.854 1.00 98.05  ? 491 GLU B CG  1 
ATOM   7954 C CD  . GLU B 1 490 ? -3.630  -87.420 -16.164 1.00 99.94  ? 491 GLU B CD  1 
ATOM   7955 O OE1 . GLU B 1 490 ? -4.349  -87.512 -17.189 1.00 78.31  ? 491 GLU B OE1 1 
ATOM   7956 O OE2 . GLU B 1 490 ? -2.409  -87.701 -16.163 1.00 94.22  ? 491 GLU B OE2 1 
ATOM   7957 N N   . PRO B 1 491 ? -8.744  -87.549 -16.484 1.00 104.54 ? 492 PRO B N   1 
ATOM   7958 C CA  . PRO B 1 491 ? -10.027 -88.250 -16.540 1.00 100.80 ? 492 PRO B CA  1 
ATOM   7959 C C   . PRO B 1 491 ? -9.892  -89.664 -15.982 1.00 126.42 ? 492 PRO B C   1 
ATOM   7960 O O   . PRO B 1 491 ? -9.118  -90.454 -16.533 1.00 135.45 ? 492 PRO B O   1 
ATOM   7961 C CB  . PRO B 1 491 ? -10.354 -88.272 -18.039 1.00 93.30  ? 492 PRO B CB  1 
ATOM   7962 C CG  . PRO B 1 491 ? -9.515  -87.191 -18.638 1.00 78.20  ? 492 PRO B CG  1 
ATOM   7963 C CD  . PRO B 1 491 ? -8.265  -87.178 -17.828 1.00 84.88  ? 492 PRO B CD  1 
ATOM   7964 N N   . ARG B 1 492 ? -10.606 -89.948 -14.892 1.00 123.15 ? 493 ARG B N   1 
ATOM   7965 C CA  . ARG B 1 492 ? -10.655 -91.276 -14.262 1.00 126.63 ? 493 ARG B CA  1 
ATOM   7966 C C   . ARG B 1 492 ? -9.333  -91.699 -13.586 1.00 127.15 ? 493 ARG B C   1 
ATOM   7967 O O   . ARG B 1 492 ? -9.123  -92.884 -13.313 1.00 127.45 ? 493 ARG B O   1 
ATOM   7968 C CB  . ARG B 1 492 ? -11.093 -92.340 -15.288 1.00 124.20 ? 493 ARG B CB  1 
ATOM   7969 C CG  . ARG B 1 492 ? -11.780 -93.569 -14.685 1.00 128.42 ? 493 ARG B CG  1 
ATOM   7970 C CD  . ARG B 1 492 ? -12.542 -94.381 -15.730 1.00 128.04 ? 493 ARG B CD  1 
ATOM   7971 N NE  . ARG B 1 492 ? -11.684 -94.903 -16.793 1.00 131.43 ? 493 ARG B NE  1 
ATOM   7972 C CZ  . ARG B 1 492 ? -11.004 -96.046 -16.720 1.00 131.31 ? 493 ARG B CZ  1 
ATOM   7973 N NH1 . ARG B 1 492 ? -11.066 -96.791 -15.621 1.00 122.79 ? 493 ARG B NH1 1 
ATOM   7974 N NH2 . ARG B 1 492 ? -10.255 -96.440 -17.744 1.00 126.07 ? 493 ARG B NH2 1 
ATOM   7975 N N   . ASP B 1 493 ? -8.448  -90.741 -13.305 1.00 115.79 ? 494 ASP B N   1 
ATOM   7976 C CA  . ASP B 1 493 ? -7.318  -91.020 -12.416 1.00 119.43 ? 494 ASP B CA  1 
ATOM   7977 C C   . ASP B 1 493 ? -7.646  -90.460 -11.033 1.00 119.00 ? 494 ASP B C   1 
ATOM   7978 O O   . ASP B 1 493 ? -7.782  -89.245 -10.870 1.00 116.60 ? 494 ASP B O   1 
ATOM   7979 C CB  . ASP B 1 493 ? -6.012  -90.425 -12.951 1.00 111.22 ? 494 ASP B CB  1 
ATOM   7980 C CG  . ASP B 1 493 ? -4.771  -90.976 -12.239 1.00 112.44 ? 494 ASP B CG  1 
ATOM   7981 O OD1 . ASP B 1 493 ? -4.887  -91.480 -11.096 1.00 104.52 ? 494 ASP B OD1 1 
ATOM   7982 O OD2 . ASP B 1 493 ? -3.670  -90.898 -12.827 1.00 105.80 ? 494 ASP B OD2 1 
ATOM   7983 N N   . PRO B 1 494 ? -7.788  -91.354 -10.036 1.00 120.46 ? 495 PRO B N   1 
ATOM   7984 C CA  . PRO B 1 494 ? -8.217  -90.995 -8.677  1.00 117.10 ? 495 PRO B CA  1 
ATOM   7985 C C   . PRO B 1 494 ? -7.070  -90.689 -7.697  1.00 113.91 ? 495 PRO B C   1 
ATOM   7986 O O   . PRO B 1 494 ? -7.155  -89.691 -6.976  1.00 103.01 ? 495 PRO B O   1 
ATOM   7987 C CB  . PRO B 1 494 ? -8.998  -92.242 -8.220  1.00 107.43 ? 495 PRO B CB  1 
ATOM   7988 C CG  . PRO B 1 494 ? -8.777  -93.309 -9.315  1.00 111.57 ? 495 PRO B CG  1 
ATOM   7989 C CD  . PRO B 1 494 ? -7.676  -92.812 -10.195 1.00 107.97 ? 495 PRO B CD  1 
ATOM   7990 N N   . LYS B 1 495 ? -6.030  -91.525 -7.673  1.00 109.69 ? 496 LYS B N   1 
ATOM   7991 C CA  . LYS B 1 495 ? -4.930  -91.371 -6.716  1.00 107.19 ? 496 LYS B CA  1 
ATOM   7992 C C   . LYS B 1 495 ? -3.990  -90.221 -7.073  1.00 112.32 ? 496 LYS B C   1 
ATOM   7993 O O   . LYS B 1 495 ? -3.169  -89.806 -6.246  1.00 111.04 ? 496 LYS B O   1 
ATOM   7994 C CB  . LYS B 1 495 ? -4.127  -92.671 -6.602  1.00 114.56 ? 496 LYS B CB  1 
ATOM   7995 C CG  . LYS B 1 495 ? -4.713  -93.686 -5.626  1.00 108.81 ? 496 LYS B CG  1 
ATOM   7996 C CD  . LYS B 1 495 ? -3.802  -94.898 -5.469  1.00 107.67 ? 496 LYS B CD  1 
ATOM   7997 C CE  . LYS B 1 495 ? -4.341  -95.879 -4.432  1.00 101.11 ? 496 LYS B CE  1 
ATOM   7998 N NZ  . LYS B 1 495 ? -3.398  -97.010 -4.208  1.00 82.55  ? 496 LYS B NZ  1 
ATOM   7999 N N   . ALA B 1 496 ? -4.111  -89.720 -8.303  1.00 116.03 ? 497 ALA B N   1 
ATOM   8000 C CA  . ALA B 1 496 ? -3.374  -88.533 -8.743  1.00 105.90 ? 497 ALA B CA  1 
ATOM   8001 C C   . ALA B 1 496 ? -3.957  -87.260 -8.112  1.00 98.09  ? 497 ALA B C   1 
ATOM   8002 O O   . ALA B 1 496 ? -5.174  -87.042 -8.166  1.00 87.60  ? 497 ALA B O   1 
ATOM   8003 C CB  . ALA B 1 496 ? -3.392  -88.431 -10.266 1.00 86.99  ? 497 ALA B CB  1 
ATOM   8004 N N   . PRO B 1 497 ? -3.086  -86.418 -7.517  1.00 89.13  ? 498 PRO B N   1 
ATOM   8005 C CA  . PRO B 1 497 ? -3.479  -85.182 -6.815  1.00 79.65  ? 498 PRO B CA  1 
ATOM   8006 C C   . PRO B 1 497 ? -4.366  -84.292 -7.683  1.00 77.19  ? 498 PRO B C   1 
ATOM   8007 O O   . PRO B 1 497 ? -4.057  -84.098 -8.862  1.00 81.40  ? 498 PRO B O   1 
ATOM   8008 C CB  . PRO B 1 497 ? -2.142  -84.494 -6.523  1.00 77.99  ? 498 PRO B CB  1 
ATOM   8009 C CG  . PRO B 1 497 ? -1.120  -85.587 -6.586  1.00 85.56  ? 498 PRO B CG  1 
ATOM   8010 C CD  . PRO B 1 497 ? -1.622  -86.576 -7.589  1.00 76.77  ? 498 PRO B CD  1 
ATOM   8011 N N   . GLN B 1 498 ? -5.451  -83.768 -7.123  1.00 65.41  ? 499 GLN B N   1 
ATOM   8012 C CA  . GLN B 1 498 ? -6.419  -83.031 -7.932  1.00 60.02  ? 499 GLN B CA  1 
ATOM   8013 C C   . GLN B 1 498 ? -6.182  -81.527 -7.947  1.00 56.17  ? 499 GLN B C   1 
ATOM   8014 O O   . GLN B 1 498 ? -5.774  -80.923 -6.962  1.00 62.02  ? 499 GLN B O   1 
ATOM   8015 C CB  . GLN B 1 498 ? -7.845  -83.314 -7.459  1.00 63.84  ? 499 GLN B CB  1 
ATOM   8016 C CG  . GLN B 1 498 ? -8.318  -84.741 -7.712  1.00 84.79  ? 499 GLN B CG  1 
ATOM   8017 C CD  . GLN B 1 498 ? -8.219  -85.155 -9.176  1.00 80.03  ? 499 GLN B CD  1 
ATOM   8018 O OE1 . GLN B 1 498 ? -9.050  -84.766 -10.005 1.00 67.69  ? 499 GLN B OE1 1 
ATOM   8019 N NE2 . GLN B 1 498 ? -7.201  -85.955 -9.499  1.00 69.79  ? 499 GLN B NE2 1 
ATOM   8020 N N   . TRP B 1 499 ? -6.453  -80.938 -9.100  1.00 61.82  ? 500 TRP B N   1 
ATOM   8021 C CA  . TRP B 1 499 ? -6.333  -79.510 -9.316  1.00 53.11  ? 500 TRP B CA  1 
ATOM   8022 C C   . TRP B 1 499 ? -7.728  -78.900 -9.193  1.00 51.87  ? 500 TRP B C   1 
ATOM   8023 O O   . TRP B 1 499 ? -8.568  -79.069 -10.083 1.00 51.64  ? 500 TRP B O   1 
ATOM   8024 C CB  . TRP B 1 499 ? -5.703  -79.263 -10.692 1.00 51.89  ? 500 TRP B CB  1 
ATOM   8025 C CG  . TRP B 1 499 ? -5.388  -77.840 -11.077 1.00 55.90  ? 500 TRP B CG  1 
ATOM   8026 C CD1 . TRP B 1 499 ? -5.846  -76.693 -10.492 1.00 55.92  ? 500 TRP B CD1 1 
ATOM   8027 C CD2 . TRP B 1 499 ? -4.549  -77.429 -12.160 1.00 51.96  ? 500 TRP B CD2 1 
ATOM   8028 N NE1 . TRP B 1 499 ? -5.337  -75.592 -11.146 1.00 53.62  ? 500 TRP B NE1 1 
ATOM   8029 C CE2 . TRP B 1 499 ? -4.538  -76.021 -12.175 1.00 47.97  ? 500 TRP B CE2 1 
ATOM   8030 C CE3 . TRP B 1 499 ? -3.803  -78.119 -13.120 1.00 36.85  ? 500 TRP B CE3 1 
ATOM   8031 C CZ2 . TRP B 1 499 ? -3.806  -75.293 -13.105 1.00 43.76  ? 500 TRP B CZ2 1 
ATOM   8032 C CZ3 . TRP B 1 499 ? -3.079  -77.397 -14.041 1.00 39.44  ? 500 TRP B CZ3 1 
ATOM   8033 C CH2 . TRP B 1 499 ? -3.082  -75.999 -14.029 1.00 43.74  ? 500 TRP B CH2 1 
ATOM   8034 N N   . PRO B 1 500 ? -7.992  -78.206 -8.075  1.00 49.18  ? 501 PRO B N   1 
ATOM   8035 C CA  . PRO B 1 500 ? -9.323  -77.644 -7.822  1.00 46.12  ? 501 PRO B CA  1 
ATOM   8036 C C   . PRO B 1 500 ? -9.544  -76.338 -8.563  1.00 40.63  ? 501 PRO B C   1 
ATOM   8037 O O   . PRO B 1 500 ? -8.577  -75.636 -8.855  1.00 42.71  ? 501 PRO B O   1 
ATOM   8038 C CB  . PRO B 1 500 ? -9.333  -77.414 -6.309  1.00 38.45  ? 501 PRO B CB  1 
ATOM   8039 C CG  . PRO B 1 500 ? -7.878  -77.332 -5.905  1.00 49.28  ? 501 PRO B CG  1 
ATOM   8040 C CD  . PRO B 1 500 ? -7.011  -77.777 -7.065  1.00 48.52  ? 501 PRO B CD  1 
ATOM   8041 N N   . PRO B 1 501 ? -10.799 -76.021 -8.885  1.00 36.90  ? 502 PRO B N   1 
ATOM   8042 C CA  . PRO B 1 501 ? -11.083 -74.724 -9.504  1.00 42.37  ? 502 PRO B CA  1 
ATOM   8043 C C   . PRO B 1 501 ? -10.703 -73.540 -8.602  1.00 47.15  ? 502 PRO B C   1 
ATOM   8044 O O   . PRO B 1 501 ? -10.723 -73.658 -7.376  1.00 50.48  ? 502 PRO B O   1 
ATOM   8045 C CB  . PRO B 1 501 ? -12.600 -74.771 -9.751  1.00 40.17  ? 502 PRO B CB  1 
ATOM   8046 C CG  . PRO B 1 501 ? -12.924 -76.227 -9.844  1.00 37.16  ? 502 PRO B CG  1 
ATOM   8047 C CD  . PRO B 1 501 ? -11.957 -76.935 -8.932  1.00 40.25  ? 502 PRO B CD  1 
ATOM   8048 N N   . TYR B 1 502 ? -10.334 -72.422 -9.226  1.00 48.85  ? 503 TYR B N   1 
ATOM   8049 C CA  . TYR B 1 502 ? -10.107 -71.161 -8.531  1.00 45.19  ? 503 TYR B CA  1 
ATOM   8050 C C   . TYR B 1 502 ? -11.431 -70.408 -8.362  1.00 42.34  ? 503 TYR B C   1 
ATOM   8051 O O   . TYR B 1 502 ? -12.150 -70.171 -9.335  1.00 48.37  ? 503 TYR B O   1 
ATOM   8052 C CB  . TYR B 1 502 ? -9.090  -70.300 -9.302  1.00 41.89  ? 503 TYR B CB  1 
ATOM   8053 C CG  . TYR B 1 502 ? -8.782  -68.950 -8.671  1.00 36.74  ? 503 TYR B CG  1 
ATOM   8054 C CD1 . TYR B 1 502 ? -9.607  -67.851 -8.898  1.00 33.47  ? 503 TYR B CD1 1 
ATOM   8055 C CD2 . TYR B 1 502 ? -7.661  -68.773 -7.863  1.00 32.71  ? 503 TYR B CD2 1 
ATOM   8056 C CE1 . TYR B 1 502 ? -9.341  -66.624 -8.332  1.00 34.58  ? 503 TYR B CE1 1 
ATOM   8057 C CE2 . TYR B 1 502 ? -7.378  -67.541 -7.295  1.00 38.38  ? 503 TYR B CE2 1 
ATOM   8058 C CZ  . TYR B 1 502 ? -8.228  -66.469 -7.530  1.00 42.05  ? 503 TYR B CZ  1 
ATOM   8059 O OH  . TYR B 1 502 ? -7.973  -65.231 -6.976  1.00 37.14  ? 503 TYR B OH  1 
ATOM   8060 N N   . THR B 1 503 ? -11.748 -70.029 -7.128  1.00 49.71  ? 504 THR B N   1 
ATOM   8061 C CA  . THR B 1 503 ? -12.935 -69.218 -6.838  1.00 51.34  ? 504 THR B CA  1 
ATOM   8062 C C   . THR B 1 503 ? -12.558 -67.975 -6.018  1.00 49.29  ? 504 THR B C   1 
ATOM   8063 O O   . THR B 1 503 ? -11.521 -67.966 -5.329  1.00 44.98  ? 504 THR B O   1 
ATOM   8064 C CB  . THR B 1 503 ? -13.992 -70.036 -6.083  1.00 55.34  ? 504 THR B CB  1 
ATOM   8065 O OG1 . THR B 1 503 ? -13.374 -70.681 -4.957  1.00 62.86  ? 504 THR B OG1 1 
ATOM   8066 C CG2 . THR B 1 503 ? -14.604 -71.096 -6.997  1.00 38.96  ? 504 THR B CG2 1 
ATOM   8067 N N   . ALA B 1 504 ? -13.394 -66.937 -6.095  1.00 45.76  ? 505 ALA B N   1 
ATOM   8068 C CA  . ALA B 1 504 ? -13.117 -65.643 -5.446  1.00 47.81  ? 505 ALA B CA  1 
ATOM   8069 C C   . ALA B 1 504 ? -12.839 -65.766 -3.940  1.00 52.47  ? 505 ALA B C   1 
ATOM   8070 O O   . ALA B 1 504 ? -11.991 -65.051 -3.399  1.00 45.77  ? 505 ALA B O   1 
ATOM   8071 C CB  . ALA B 1 504 ? -14.272 -64.674 -5.686  1.00 36.53  ? 505 ALA B CB  1 
ATOM   8072 N N   . GLY B 1 505 ? -13.541 -66.684 -3.278  1.00 48.66  ? 506 GLY B N   1 
ATOM   8073 C CA  . GLY B 1 505 ? -13.347 -66.931 -1.863  1.00 39.70  ? 506 GLY B CA  1 
ATOM   8074 C C   . GLY B 1 505 ? -12.130 -67.778 -1.544  1.00 47.93  ? 506 GLY B C   1 
ATOM   8075 O O   . GLY B 1 505 ? -11.138 -67.271 -1.025  1.00 52.75  ? 506 GLY B O   1 
ATOM   8076 N N   . ALA B 1 506 ? -12.197 -69.071 -1.849  1.00 52.63  ? 507 ALA B N   1 
ATOM   8077 C CA  . ALA B 1 506 ? -11.103 -69.987 -1.516  1.00 46.43  ? 507 ALA B CA  1 
ATOM   8078 C C   . ALA B 1 506 ? -9.781  -69.607 -2.197  1.00 50.33  ? 507 ALA B C   1 
ATOM   8079 O O   . ALA B 1 506 ? -8.713  -69.809 -1.612  1.00 44.20  ? 507 ALA B O   1 
ATOM   8080 C CB  . ALA B 1 506 ? -11.486 -71.422 -1.871  1.00 40.27  ? 507 ALA B CB  1 
ATOM   8081 N N   . GLN B 1 507 ? -9.864  -69.062 -3.419  1.00 48.56  ? 508 GLN B N   1 
ATOM   8082 C CA  . GLN B 1 507 ? -8.695  -68.589 -4.165  1.00 39.03  ? 508 GLN B CA  1 
ATOM   8083 C C   . GLN B 1 507 ? -7.614  -69.662 -4.307  1.00 41.90  ? 508 GLN B C   1 
ATOM   8084 O O   . GLN B 1 507 ? -6.421  -69.378 -4.160  1.00 44.34  ? 508 GLN B O   1 
ATOM   8085 C CB  . GLN B 1 507 ? -8.095  -67.346 -3.494  1.00 46.12  ? 508 GLN B CB  1 
ATOM   8086 C CG  . GLN B 1 507 ? -8.965  -66.100 -3.566  1.00 46.95  ? 508 GLN B CG  1 
ATOM   8087 C CD  . GLN B 1 507 ? -8.572  -65.046 -2.533  1.00 52.67  ? 508 GLN B CD  1 
ATOM   8088 O OE1 . GLN B 1 507 ? -7.518  -64.414 -2.628  1.00 48.60  ? 508 GLN B OE1 1 
ATOM   8089 N NE2 . GLN B 1 507 ? -9.425  -64.859 -1.536  1.00 61.12  ? 508 GLN B NE2 1 
ATOM   8090 N N   . GLN B 1 508 ? -8.030  -70.892 -4.592  1.00 40.96  ? 509 GLN B N   1 
ATOM   8091 C CA  . GLN B 1 508 ? -7.096  -72.012 -4.701  1.00 41.75  ? 509 GLN B CA  1 
ATOM   8092 C C   . GLN B 1 508 ? -6.386  -72.112 -6.055  1.00 44.94  ? 509 GLN B C   1 
ATOM   8093 O O   . GLN B 1 508 ? -6.985  -71.876 -7.107  1.00 43.71  ? 509 GLN B O   1 
ATOM   8094 C CB  . GLN B 1 508 ? -7.827  -73.317 -4.436  1.00 51.74  ? 509 GLN B CB  1 
ATOM   8095 C CG  . GLN B 1 508 ? -8.370  -73.449 -3.039  1.00 49.75  ? 509 GLN B CG  1 
ATOM   8096 C CD  . GLN B 1 508 ? -9.185  -74.707 -2.881  1.00 50.82  ? 509 GLN B CD  1 
ATOM   8097 O OE1 . GLN B 1 508 ? -10.361 -74.747 -3.265  1.00 46.30  ? 509 GLN B OE1 1 
ATOM   8098 N NE2 . GLN B 1 508 ? -8.564  -75.756 -2.329  1.00 38.75  ? 509 GLN B NE2 1 
ATOM   8099 N N   . TYR B 1 509 ? -5.108  -72.475 -6.015  1.00 32.71  ? 510 TYR B N   1 
ATOM   8100 C CA  . TYR B 1 509 ? -4.313  -72.655 -7.219  1.00 36.67  ? 510 TYR B CA  1 
ATOM   8101 C C   . TYR B 1 509 ? -3.281  -73.735 -6.936  1.00 45.93  ? 510 TYR B C   1 
ATOM   8102 O O   . TYR B 1 509 ? -3.009  -74.035 -5.773  1.00 44.35  ? 510 TYR B O   1 
ATOM   8103 C CB  . TYR B 1 509 ? -3.633  -71.348 -7.639  1.00 31.75  ? 510 TYR B CB  1 
ATOM   8104 C CG  . TYR B 1 509 ? -2.553  -70.884 -6.683  1.00 40.67  ? 510 TYR B CG  1 
ATOM   8105 C CD1 . TYR B 1 509 ? -2.860  -70.044 -5.613  1.00 38.55  ? 510 TYR B CD1 1 
ATOM   8106 C CD2 . TYR B 1 509 ? -1.227  -71.286 -6.848  1.00 35.48  ? 510 TYR B CD2 1 
ATOM   8107 C CE1 . TYR B 1 509 ? -1.876  -69.618 -4.730  1.00 38.83  ? 510 TYR B CE1 1 
ATOM   8108 C CE2 . TYR B 1 509 ? -0.240  -70.878 -5.964  1.00 37.34  ? 510 TYR B CE2 1 
ATOM   8109 C CZ  . TYR B 1 509 ? -0.569  -70.038 -4.910  1.00 44.33  ? 510 TYR B CZ  1 
ATOM   8110 O OH  . TYR B 1 509 ? 0.408   -69.619 -4.037  1.00 47.59  ? 510 TYR B OH  1 
ATOM   8111 N N   . VAL B 1 510 ? -2.700  -74.314 -7.983  1.00 36.49  ? 511 VAL B N   1 
ATOM   8112 C CA  . VAL B 1 510 ? -1.692  -75.347 -7.789  1.00 35.96  ? 511 VAL B CA  1 
ATOM   8113 C C   . VAL B 1 510 ? -0.324  -74.827 -8.173  1.00 36.09  ? 511 VAL B C   1 
ATOM   8114 O O   . VAL B 1 510 ? -0.205  -73.878 -8.942  1.00 40.97  ? 511 VAL B O   1 
ATOM   8115 C CB  . VAL B 1 510 ? -1.995  -76.629 -8.604  1.00 43.09  ? 511 VAL B CB  1 
ATOM   8116 C CG1 . VAL B 1 510 ? -3.352  -77.190 -8.225  1.00 42.95  ? 511 VAL B CG1 1 
ATOM   8117 C CG2 . VAL B 1 510 ? -1.934  -76.354 -10.091 1.00 34.88  ? 511 VAL B CG2 1 
ATOM   8118 N N   . SER B 1 511 ? 0.712   -75.437 -7.611  1.00 42.04  ? 512 SER B N   1 
ATOM   8119 C CA  . SER B 1 511 ? 2.072   -75.122 -8.009  1.00 47.73  ? 512 SER B CA  1 
ATOM   8120 C C   . SER B 1 511 ? 2.522   -76.170 -9.010  1.00 48.65  ? 512 SER B C   1 
ATOM   8121 O O   . SER B 1 511 ? 2.229   -77.356 -8.850  1.00 49.05  ? 512 SER B O   1 
ATOM   8122 C CB  . SER B 1 511 ? 3.014   -75.080 -6.804  1.00 48.30  ? 512 SER B CB  1 
ATOM   8123 O OG  . SER B 1 511 ? 3.240   -76.376 -6.284  1.00 63.61  ? 512 SER B OG  1 
ATOM   8124 N N   . LEU B 1 512 ? 3.206   -75.726 -10.058 1.00 44.52  ? 513 LEU B N   1 
ATOM   8125 C CA  . LEU B 1 512 ? 3.716   -76.633 -11.071 1.00 35.55  ? 513 LEU B CA  1 
ATOM   8126 C C   . LEU B 1 512 ? 5.237   -76.671 -11.022 1.00 44.10  ? 513 LEU B C   1 
ATOM   8127 O O   . LEU B 1 512 ? 5.898   -75.707 -11.413 1.00 40.51  ? 513 LEU B O   1 
ATOM   8128 C CB  . LEU B 1 512 ? 3.243   -76.209 -12.461 1.00 34.69  ? 513 LEU B CB  1 
ATOM   8129 C CG  . LEU B 1 512 ? 1.739   -76.081 -12.709 1.00 37.51  ? 513 LEU B CG  1 
ATOM   8130 C CD1 . LEU B 1 512 ? 1.492   -75.551 -14.102 1.00 29.86  ? 513 LEU B CD1 1 
ATOM   8131 C CD2 . LEU B 1 512 ? 1.029   -77.406 -12.516 1.00 32.27  ? 513 LEU B CD2 1 
ATOM   8132 N N   . ASP B 1 513 ? 5.793   -77.760 -10.499 1.00 43.09  ? 514 ASP B N   1 
ATOM   8133 C CA  . ASP B 1 513 ? 7.217   -78.045 -10.687 1.00 56.51  ? 514 ASP B CA  1 
ATOM   8134 C C   . ASP B 1 513 ? 7.423   -79.547 -10.607 1.00 50.71  ? 514 ASP B C   1 
ATOM   8135 O O   . ASP B 1 513 ? 6.458   -80.309 -10.728 1.00 50.65  ? 514 ASP B O   1 
ATOM   8136 C CB  . ASP B 1 513 ? 8.115   -77.299 -9.674  1.00 48.25  ? 514 ASP B CB  1 
ATOM   8137 C CG  . ASP B 1 513 ? 7.839   -77.678 -8.236  1.00 75.52  ? 514 ASP B CG  1 
ATOM   8138 O OD1 . ASP B 1 513 ? 6.708   -78.120 -7.930  1.00 80.10  ? 514 ASP B OD1 1 
ATOM   8139 O OD2 . ASP B 1 513 ? 8.760   -77.514 -7.402  1.00 85.66  ? 514 ASP B OD2 1 
ATOM   8140 N N   . LEU B 1 514 ? 8.671   -79.967 -10.416 1.00 53.04  ? 515 LEU B N   1 
ATOM   8141 C CA  . LEU B 1 514 ? 9.028   -81.386 -10.440 1.00 52.84  ? 515 LEU B CA  1 
ATOM   8142 C C   . LEU B 1 514 ? 8.232   -82.231 -9.440  1.00 53.22  ? 515 LEU B C   1 
ATOM   8143 O O   . LEU B 1 514 ? 7.835   -83.350 -9.766  1.00 59.68  ? 515 LEU B O   1 
ATOM   8144 C CB  . LEU B 1 514 ? 10.531  -81.551 -10.201 1.00 45.88  ? 515 LEU B CB  1 
ATOM   8145 C CG  . LEU B 1 514 ? 11.373  -80.740 -11.201 1.00 56.17  ? 515 LEU B CG  1 
ATOM   8146 C CD1 . LEU B 1 514 ? 12.871  -81.012 -11.070 1.00 55.24  ? 515 LEU B CD1 1 
ATOM   8147 C CD2 . LEU B 1 514 ? 10.906  -80.962 -12.641 1.00 45.93  ? 515 LEU B CD2 1 
ATOM   8148 N N   . ARG B 1 515 ? 7.978   -81.693 -8.246  1.00 55.13  ? 516 ARG B N   1 
ATOM   8149 C CA  . ARG B 1 515 ? 7.158   -82.374 -7.240  1.00 50.46  ? 516 ARG B CA  1 
ATOM   8150 C C   . ARG B 1 515 ? 5.708   -82.490 -7.714  1.00 47.05  ? 516 ARG B C   1 
ATOM   8151 O O   . ARG B 1 515 ? 5.315   -81.825 -8.662  1.00 57.58  ? 516 ARG B O   1 
ATOM   8152 C CB  . ARG B 1 515 ? 7.213   -81.624 -5.908  1.00 65.52  ? 516 ARG B CB  1 
ATOM   8153 C CG  . ARG B 1 515 ? 8.606   -81.440 -5.316  1.00 75.75  ? 516 ARG B CG  1 
ATOM   8154 C CD  . ARG B 1 515 ? 8.587   -80.365 -4.221  1.00 88.71  ? 516 ARG B CD  1 
ATOM   8155 N NE  . ARG B 1 515 ? 8.007   -79.113 -4.720  1.00 104.76 ? 516 ARG B NE  1 
ATOM   8156 C CZ  . ARG B 1 515 ? 6.817   -78.625 -4.365  1.00 102.57 ? 516 ARG B CZ  1 
ATOM   8157 N NH1 . ARG B 1 515 ? 6.058   -79.266 -3.478  1.00 93.19  ? 516 ARG B NH1 1 
ATOM   8158 N NH2 . ARG B 1 515 ? 6.388   -77.482 -4.893  1.00 84.09  ? 516 ARG B NH2 1 
ATOM   8159 N N   . PRO B 1 516 ? 4.904   -83.344 -7.065  1.00 55.70  ? 517 PRO B N   1 
ATOM   8160 C CA  . PRO B 1 516 ? 3.478   -83.401 -7.421  1.00 49.91  ? 517 PRO B CA  1 
ATOM   8161 C C   . PRO B 1 516 ? 2.708   -82.126 -7.061  1.00 58.63  ? 517 PRO B C   1 
ATOM   8162 O O   . PRO B 1 516 ? 3.225   -81.266 -6.337  1.00 56.48  ? 517 PRO B O   1 
ATOM   8163 C CB  . PRO B 1 516 ? 2.958   -84.585 -6.601  1.00 45.03  ? 517 PRO B CB  1 
ATOM   8164 C CG  . PRO B 1 516 ? 4.164   -85.410 -6.321  1.00 43.16  ? 517 PRO B CG  1 
ATOM   8165 C CD  . PRO B 1 516 ? 5.295   -84.451 -6.174  1.00 45.14  ? 517 PRO B CD  1 
ATOM   8166 N N   . LEU B 1 517 ? 1.477   -82.023 -7.556  1.00 54.92  ? 518 LEU B N   1 
ATOM   8167 C CA  . LEU B 1 517 ? 0.631   -80.856 -7.302  1.00 51.24  ? 518 LEU B CA  1 
ATOM   8168 C C   . LEU B 1 517 ? 0.459   -80.533 -5.827  1.00 54.32  ? 518 LEU B C   1 
ATOM   8169 O O   . LEU B 1 517 ? 0.037   -81.381 -5.038  1.00 59.28  ? 518 LEU B O   1 
ATOM   8170 C CB  . LEU B 1 517 ? -0.759  -81.050 -7.910  1.00 45.17  ? 518 LEU B CB  1 
ATOM   8171 C CG  . LEU B 1 517 ? -0.860  -81.000 -9.427  1.00 45.51  ? 518 LEU B CG  1 
ATOM   8172 C CD1 . LEU B 1 517 ? -2.303  -80.776 -9.826  1.00 51.06  ? 518 LEU B CD1 1 
ATOM   8173 C CD2 . LEU B 1 517 ? 0.034   -79.910 -9.979  1.00 50.56  ? 518 LEU B CD2 1 
ATOM   8174 N N   . GLU B 1 518 ? 0.770   -79.293 -5.469  1.00 58.79  ? 519 GLU B N   1 
ATOM   8175 C CA  . GLU B 1 518 ? 0.473   -78.778 -4.140  1.00 54.31  ? 519 GLU B CA  1 
ATOM   8176 C C   . GLU B 1 518 ? -0.607  -77.692 -4.273  1.00 48.31  ? 519 GLU B C   1 
ATOM   8177 O O   . GLU B 1 518 ? -0.460  -76.772 -5.070  1.00 50.21  ? 519 GLU B O   1 
ATOM   8178 C CB  . GLU B 1 518 ? 1.747   -78.244 -3.478  1.00 52.59  ? 519 GLU B CB  1 
ATOM   8179 C CG  . GLU B 1 518 ? 1.589   -77.845 -2.018  1.00 81.54  ? 519 GLU B CG  1 
ATOM   8180 C CD  . GLU B 1 518 ? 2.807   -77.085 -1.478  1.00 102.98 ? 519 GLU B CD  1 
ATOM   8181 O OE1 . GLU B 1 518 ? 3.929   -77.310 -1.998  1.00 93.32  ? 519 GLU B OE1 1 
ATOM   8182 O OE2 . GLU B 1 518 ? 2.637   -76.259 -0.544  1.00 81.22  ? 519 GLU B OE2 1 
ATOM   8183 N N   . VAL B 1 519 ? -1.707  -77.816 -3.532  1.00 44.96  ? 520 VAL B N   1 
ATOM   8184 C CA  . VAL B 1 519 ? -2.755  -76.797 -3.575  1.00 37.36  ? 520 VAL B CA  1 
ATOM   8185 C C   . VAL B 1 519 ? -2.470  -75.687 -2.568  1.00 42.82  ? 520 VAL B C   1 
ATOM   8186 O O   . VAL B 1 519 ? -2.121  -75.957 -1.420  1.00 48.73  ? 520 VAL B O   1 
ATOM   8187 C CB  . VAL B 1 519 ? -4.148  -77.386 -3.298  1.00 35.83  ? 520 VAL B CB  1 
ATOM   8188 C CG1 . VAL B 1 519 ? -5.219  -76.305 -3.414  1.00 35.64  ? 520 VAL B CG1 1 
ATOM   8189 C CG2 . VAL B 1 519 ? -4.450  -78.508 -4.260  1.00 36.32  ? 520 VAL B CG2 1 
ATOM   8190 N N   . ARG B 1 520 ? -2.602  -74.438 -3.012  1.00 47.71  ? 521 ARG B N   1 
ATOM   8191 C CA  . ARG B 1 520 ? -2.340  -73.280 -2.166  1.00 33.88  ? 521 ARG B CA  1 
ATOM   8192 C C   . ARG B 1 520 ? -3.454  -72.250 -2.297  1.00 45.80  ? 521 ARG B C   1 
ATOM   8193 O O   . ARG B 1 520 ? -4.291  -72.354 -3.196  1.00 47.61  ? 521 ARG B O   1 
ATOM   8194 C CB  . ARG B 1 520 ? -1.002  -72.657 -2.521  1.00 36.50  ? 521 ARG B CB  1 
ATOM   8195 C CG  . ARG B 1 520 ? 0.134   -73.647 -2.538  1.00 41.34  ? 521 ARG B CG  1 
ATOM   8196 C CD  . ARG B 1 520 ? 1.455   -72.947 -2.377  1.00 45.39  ? 521 ARG B CD  1 
ATOM   8197 N NE  . ARG B 1 520 ? 2.563   -73.865 -2.599  1.00 60.90  ? 521 ARG B NE  1 
ATOM   8198 C CZ  . ARG B 1 520 ? 3.623   -73.571 -3.342  1.00 67.91  ? 521 ARG B CZ  1 
ATOM   8199 N NH1 . ARG B 1 520 ? 3.709   -72.379 -3.924  1.00 55.66  ? 521 ARG B NH1 1 
ATOM   8200 N NH2 . ARG B 1 520 ? 4.596   -74.461 -3.497  1.00 64.72  ? 521 ARG B NH2 1 
ATOM   8201 N N   . ARG B 1 521 ? -3.474  -71.264 -1.396  1.00 42.07  ? 522 ARG B N   1 
ATOM   8202 C CA  . ARG B 1 521 ? -4.506  -70.227 -1.432  1.00 38.22  ? 522 ARG B CA  1 
ATOM   8203 C C   . ARG B 1 521 ? -3.937  -68.840 -1.677  1.00 41.72  ? 522 ARG B C   1 
ATOM   8204 O O   . ARG B 1 521 ? -2.876  -68.484 -1.149  1.00 41.97  ? 522 ARG B O   1 
ATOM   8205 C CB  . ARG B 1 521 ? -5.309  -70.199 -0.136  1.00 43.17  ? 522 ARG B CB  1 
ATOM   8206 C CG  . ARG B 1 521 ? -6.102  -71.445 0.140   1.00 45.83  ? 522 ARG B CG  1 
ATOM   8207 C CD  . ARG B 1 521 ? -7.048  -71.206 1.293   1.00 48.91  ? 522 ARG B CD  1 
ATOM   8208 N NE  . ARG B 1 521 ? -8.025  -70.176 0.956   1.00 51.80  ? 522 ARG B NE  1 
ATOM   8209 C CZ  . ARG B 1 521 ? -8.437  -69.229 1.793   1.00 52.59  ? 522 ARG B CZ  1 
ATOM   8210 N NH1 . ARG B 1 521 ? -7.953  -69.181 3.029   1.00 55.72  ? 522 ARG B NH1 1 
ATOM   8211 N NH2 . ARG B 1 521 ? -9.331  -68.329 1.389   1.00 53.61  ? 522 ARG B NH2 1 
ATOM   8212 N N   . GLY B 1 522 ? -4.664  -68.064 -2.478  1.00 43.23  ? 523 GLY B N   1 
ATOM   8213 C CA  . GLY B 1 522 ? -4.346  -66.670 -2.702  1.00 33.22  ? 523 GLY B CA  1 
ATOM   8214 C C   . GLY B 1 522 ? -3.170  -66.407 -3.614  1.00 39.83  ? 523 GLY B C   1 
ATOM   8215 O O   . GLY B 1 522 ? -2.032  -66.782 -3.332  1.00 44.33  ? 523 GLY B O   1 
ATOM   8216 N N   . LEU B 1 523 ? -3.454  -65.737 -4.720  1.00 40.27  ? 524 LEU B N   1 
ATOM   8217 C CA  . LEU B 1 523 ? -2.410  -65.283 -5.619  1.00 34.57  ? 524 LEU B CA  1 
ATOM   8218 C C   . LEU B 1 523 ? -1.875  -63.929 -5.168  1.00 42.76  ? 524 LEU B C   1 
ATOM   8219 O O   . LEU B 1 523 ? -2.323  -62.890 -5.658  1.00 41.79  ? 524 LEU B O   1 
ATOM   8220 C CB  . LEU B 1 523 ? -2.949  -65.201 -7.042  1.00 34.86  ? 524 LEU B CB  1 
ATOM   8221 C CG  . LEU B 1 523 ? -3.265  -66.559 -7.659  1.00 35.22  ? 524 LEU B CG  1 
ATOM   8222 C CD1 . LEU B 1 523 ? -4.074  -66.350 -8.924  1.00 41.25  ? 524 LEU B CD1 1 
ATOM   8223 C CD2 . LEU B 1 523 ? -1.974  -67.355 -7.934  1.00 30.03  ? 524 LEU B CD2 1 
ATOM   8224 N N   . ARG B 1 524 ? -0.917  -63.956 -4.240  1.00 43.95  ? 525 ARG B N   1 
ATOM   8225 C CA  . ARG B 1 524 ? -0.402  -62.751 -3.582  1.00 43.79  ? 525 ARG B CA  1 
ATOM   8226 C C   . ARG B 1 524 ? -1.544  -61.841 -3.147  1.00 45.32  ? 525 ARG B C   1 
ATOM   8227 O O   . ARG B 1 524 ? -1.603  -60.659 -3.519  1.00 39.38  ? 525 ARG B O   1 
ATOM   8228 C CB  . ARG B 1 524 ? 0.565   -62.007 -4.502  1.00 31.79  ? 525 ARG B CB  1 
ATOM   8229 C CG  . ARG B 1 524 ? 1.705   -62.873 -4.961  1.00 34.04  ? 525 ARG B CG  1 
ATOM   8230 C CD  . ARG B 1 524 ? 2.877   -62.067 -5.470  1.00 42.99  ? 525 ARG B CD  1 
ATOM   8231 N NE  . ARG B 1 524 ? 4.011   -62.943 -5.761  1.00 56.51  ? 525 ARG B NE  1 
ATOM   8232 C CZ  . ARG B 1 524 ? 5.247   -62.522 -6.026  1.00 57.93  ? 525 ARG B CZ  1 
ATOM   8233 N NH1 . ARG B 1 524 ? 5.524   -61.223 -6.051  1.00 61.32  ? 525 ARG B NH1 1 
ATOM   8234 N NH2 . ARG B 1 524 ? 6.210   -63.403 -6.273  1.00 59.04  ? 525 ARG B NH2 1 
ATOM   8235 N N   . ALA B 1 525 ? -2.450  -62.410 -2.360  1.00 40.73  ? 526 ALA B N   1 
ATOM   8236 C CA  . ALA B 1 525 ? -3.713  -61.755 -2.027  1.00 42.92  ? 526 ALA B CA  1 
ATOM   8237 C C   . ALA B 1 525 ? -3.532  -60.390 -1.359  1.00 44.08  ? 526 ALA B C   1 
ATOM   8238 O O   . ALA B 1 525 ? -4.179  -59.420 -1.764  1.00 46.33  ? 526 ALA B O   1 
ATOM   8239 C CB  . ALA B 1 525 ? -4.562  -62.670 -1.143  1.00 43.85  ? 526 ALA B CB  1 
ATOM   8240 N N   . GLN B 1 526 ? -2.658  -60.302 -0.356  1.00 42.28  ? 527 GLN B N   1 
ATOM   8241 C CA  . GLN B 1 526 ? -2.417  -59.025 0.324   1.00 43.70  ? 527 GLN B CA  1 
ATOM   8242 C C   . GLN B 1 526 ? -1.903  -57.954 -0.638  1.00 43.80  ? 527 GLN B C   1 
ATOM   8243 O O   . GLN B 1 526 ? -2.418  -56.837 -0.653  1.00 46.88  ? 527 GLN B O   1 
ATOM   8244 C CB  . GLN B 1 526 ? -1.427  -59.189 1.488   1.00 40.82  ? 527 GLN B CB  1 
ATOM   8245 C CG  . GLN B 1 526 ? -1.938  -60.028 2.631   1.00 35.01  ? 527 GLN B CG  1 
ATOM   8246 C CD  . GLN B 1 526 ? -3.265  -59.534 3.182   1.00 46.70  ? 527 GLN B CD  1 
ATOM   8247 O OE1 . GLN B 1 526 ? -4.209  -60.313 3.337   1.00 45.80  ? 527 GLN B OE1 1 
ATOM   8248 N NE2 . GLN B 1 526 ? -3.341  -58.238 3.496   1.00 48.07  ? 527 GLN B NE2 1 
ATOM   8249 N N   . ALA B 1 527 ? -0.893  -58.291 -1.438  1.00 45.39  ? 528 ALA B N   1 
ATOM   8250 C CA  . ALA B 1 527 ? -0.338  -57.343 -2.409  1.00 43.12  ? 528 ALA B CA  1 
ATOM   8251 C C   . ALA B 1 527 ? -1.371  -56.920 -3.440  1.00 40.45  ? 528 ALA B C   1 
ATOM   8252 O O   . ALA B 1 527 ? -1.442  -55.757 -3.826  1.00 43.40  ? 528 ALA B O   1 
ATOM   8253 C CB  . ALA B 1 527 ? 0.882   -57.938 -3.117  1.00 35.87  ? 528 ALA B CB  1 
ATOM   8254 N N   . CYS B 1 528 ? -2.179  -57.867 -3.892  1.00 37.57  ? 529 CYS B N   1 
ATOM   8255 C CA  . CYS B 1 528 ? -3.070  -57.579 -4.999  1.00 33.20  ? 529 CYS B CA  1 
ATOM   8256 C C   . CYS B 1 528 ? -4.306  -56.837 -4.525  1.00 42.93  ? 529 CYS B C   1 
ATOM   8257 O O   . CYS B 1 528 ? -4.907  -56.077 -5.292  1.00 38.81  ? 529 CYS B O   1 
ATOM   8258 C CB  . CYS B 1 528 ? -3.432  -58.871 -5.740  1.00 43.05  ? 529 CYS B CB  1 
ATOM   8259 S SG  . CYS B 1 528 ? -2.031  -59.521 -6.720  1.00 43.54  ? 529 CYS B SG  1 
ATOM   8260 N N   . ALA B 1 529 ? -4.672  -57.022 -3.257  1.00 43.17  ? 530 ALA B N   1 
ATOM   8261 C CA  . ALA B 1 529 ? -5.711  -56.179 -2.676  1.00 41.13  ? 530 ALA B CA  1 
ATOM   8262 C C   . ALA B 1 529 ? -5.300  -54.723 -2.827  1.00 43.62  ? 530 ALA B C   1 
ATOM   8263 O O   . ALA B 1 529 ? -6.100  -53.873 -3.234  1.00 36.71  ? 530 ALA B O   1 
ATOM   8264 C CB  . ALA B 1 529 ? -5.938  -56.512 -1.251  1.00 38.57  ? 530 ALA B CB  1 
ATOM   8265 N N   . PHE B 1 530 ? -4.033  -54.455 -2.535  1.00 31.74  ? 531 PHE B N   1 
ATOM   8266 C CA  . PHE B 1 530 ? -3.473  -53.134 -2.749  1.00 34.69  ? 531 PHE B CA  1 
ATOM   8267 C C   . PHE B 1 530 ? -3.610  -52.676 -4.209  1.00 44.25  ? 531 PHE B C   1 
ATOM   8268 O O   . PHE B 1 530 ? -4.152  -51.598 -4.468  1.00 43.03  ? 531 PHE B O   1 
ATOM   8269 C CB  . PHE B 1 530 ? -2.008  -53.103 -2.321  1.00 35.14  ? 531 PHE B CB  1 
ATOM   8270 C CG  . PHE B 1 530 ? -1.297  -51.842 -2.705  1.00 46.11  ? 531 PHE B CG  1 
ATOM   8271 C CD1 . PHE B 1 530 ? -1.374  -50.718 -1.899  1.00 44.88  ? 531 PHE B CD1 1 
ATOM   8272 C CD2 . PHE B 1 530 ? -0.558  -51.775 -3.880  1.00 43.55  ? 531 PHE B CD2 1 
ATOM   8273 C CE1 . PHE B 1 530 ? -0.725  -49.548 -2.252  1.00 40.41  ? 531 PHE B CE1 1 
ATOM   8274 C CE2 . PHE B 1 530 ? 0.091   -50.603 -4.242  1.00 46.25  ? 531 PHE B CE2 1 
ATOM   8275 C CZ  . PHE B 1 530 ? 0.008   -49.490 -3.422  1.00 48.91  ? 531 PHE B CZ  1 
ATOM   8276 N N   . TRP B 1 531 ? -3.131  -53.478 -5.161  1.00 39.64  ? 532 TRP B N   1 
ATOM   8277 C CA  . TRP B 1 531 ? -3.116  -53.032 -6.562  1.00 39.34  ? 532 TRP B CA  1 
ATOM   8278 C C   . TRP B 1 531 ? -4.511  -52.994 -7.199  1.00 41.00  ? 532 TRP B C   1 
ATOM   8279 O O   . TRP B 1 531 ? -4.786  -52.151 -8.057  1.00 35.81  ? 532 TRP B O   1 
ATOM   8280 C CB  . TRP B 1 531 ? -2.196  -53.913 -7.406  1.00 31.43  ? 532 TRP B CB  1 
ATOM   8281 C CG  . TRP B 1 531 ? -0.762  -53.769 -7.063  1.00 31.52  ? 532 TRP B CG  1 
ATOM   8282 C CD1 . TRP B 1 531 ? -0.011  -54.623 -6.314  1.00 31.72  ? 532 TRP B CD1 1 
ATOM   8283 C CD2 . TRP B 1 531 ? 0.105   -52.706 -7.451  1.00 31.63  ? 532 TRP B CD2 1 
ATOM   8284 N NE1 . TRP B 1 531 ? 1.274   -54.154 -6.209  1.00 31.49  ? 532 TRP B NE1 1 
ATOM   8285 C CE2 . TRP B 1 531 ? 1.372   -52.977 -6.900  1.00 30.81  ? 532 TRP B CE2 1 
ATOM   8286 C CE3 . TRP B 1 531 ? -0.064  -51.548 -8.210  1.00 31.09  ? 532 TRP B CE3 1 
ATOM   8287 C CZ2 . TRP B 1 531 ? 2.457   -52.135 -7.079  1.00 30.15  ? 532 TRP B CZ2 1 
ATOM   8288 C CZ3 . TRP B 1 531 ? 1.016   -50.714 -8.390  1.00 30.88  ? 532 TRP B CZ3 1 
ATOM   8289 C CH2 . TRP B 1 531 ? 2.259   -51.010 -7.828  1.00 32.77  ? 532 TRP B CH2 1 
ATOM   8290 N N   . ASN B 1 532 ? -5.392  -53.890 -6.767  1.00 35.07  ? 533 ASN B N   1 
ATOM   8291 C CA  . ASN B 1 532 ? -6.696  -54.023 -7.404  1.00 43.67  ? 533 ASN B CA  1 
ATOM   8292 C C   . ASN B 1 532 ? -7.839  -53.284 -6.700  1.00 45.12  ? 533 ASN B C   1 
ATOM   8293 O O   . ASN B 1 532 ? -8.764  -52.799 -7.345  1.00 44.23  ? 533 ASN B O   1 
ATOM   8294 C CB  . ASN B 1 532 ? -7.053  -55.506 -7.532  1.00 42.89  ? 533 ASN B CB  1 
ATOM   8295 C CG  . ASN B 1 532 ? -6.095  -56.255 -8.433  1.00 43.59  ? 533 ASN B CG  1 
ATOM   8296 O OD1 . ASN B 1 532 ? -5.546  -55.688 -9.381  1.00 45.90  ? 533 ASN B OD1 1 
ATOM   8297 N ND2 . ASN B 1 532 ? -5.883  -57.534 -8.139  1.00 41.08  ? 533 ASN B ND2 1 
ATOM   8298 N N   . ARG B 1 533 ? -7.788  -53.204 -5.379  1.00 46.66  ? 534 ARG B N   1 
ATOM   8299 C CA  . ARG B 1 533 ? -8.890  -52.602 -4.651  1.00 43.71  ? 534 ARG B CA  1 
ATOM   8300 C C   . ARG B 1 533 ? -8.608  -51.164 -4.208  1.00 56.36  ? 534 ARG B C   1 
ATOM   8301 O O   . ARG B 1 533 ? -9.484  -50.308 -4.304  1.00 53.40  ? 534 ARG B O   1 
ATOM   8302 C CB  . ARG B 1 533 ? -9.239  -53.467 -3.448  1.00 45.58  ? 534 ARG B CB  1 
ATOM   8303 C CG  . ARG B 1 533 ? -9.636  -54.870 -3.831  1.00 38.91  ? 534 ARG B CG  1 
ATOM   8304 C CD  . ARG B 1 533 ? -9.584  -55.814 -2.649  1.00 44.40  ? 534 ARG B CD  1 
ATOM   8305 N NE  . ARG B 1 533 ? -9.899  -57.178 -3.054  1.00 50.01  ? 534 ARG B NE  1 
ATOM   8306 C CZ  . ARG B 1 533 ? -11.137 -57.644 -3.189  1.00 61.87  ? 534 ARG B CZ  1 
ATOM   8307 N NH1 . ARG B 1 533 ? -12.171 -56.844 -2.946  1.00 44.94  ? 534 ARG B NH1 1 
ATOM   8308 N NH2 . ARG B 1 533 ? -11.339 -58.903 -3.570  1.00 49.10  ? 534 ARG B NH2 1 
ATOM   8309 N N   . PHE B 1 534 ? -7.396  -50.884 -3.737  1.00 53.41  ? 535 PHE B N   1 
ATOM   8310 C CA  . PHE B 1 534 ? -7.136  -49.566 -3.163  1.00 59.33  ? 535 PHE B CA  1 
ATOM   8311 C C   . PHE B 1 534 ? -6.503  -48.568 -4.128  1.00 52.68  ? 535 PHE B C   1 
ATOM   8312 O O   . PHE B 1 534 ? -6.989  -47.452 -4.271  1.00 56.03  ? 535 PHE B O   1 
ATOM   8313 C CB  . PHE B 1 534 ? -6.249  -49.675 -1.918  1.00 44.42  ? 535 PHE B CB  1 
ATOM   8314 C CG  . PHE B 1 534 ? -5.796  -48.339 -1.396  1.00 50.63  ? 535 PHE B CG  1 
ATOM   8315 C CD1 . PHE B 1 534 ? -6.711  -47.455 -0.828  1.00 60.15  ? 535 PHE B CD1 1 
ATOM   8316 C CD2 . PHE B 1 534 ? -4.466  -47.951 -1.490  1.00 62.51  ? 535 PHE B CD2 1 
ATOM   8317 C CE1 . PHE B 1 534 ? -6.306  -46.207 -0.350  1.00 53.40  ? 535 PHE B CE1 1 
ATOM   8318 C CE2 . PHE B 1 534 ? -4.048  -46.703 -1.013  1.00 66.42  ? 535 PHE B CE2 1 
ATOM   8319 C CZ  . PHE B 1 534 ? -4.972  -45.829 -0.445  1.00 58.68  ? 535 PHE B CZ  1 
ATOM   8320 N N   . LEU B 1 535 ? -5.411  -48.959 -4.769  1.00 53.02  ? 536 LEU B N   1 
ATOM   8321 C CA  . LEU B 1 535 ? -4.622  -48.013 -5.554  1.00 54.54  ? 536 LEU B CA  1 
ATOM   8322 C C   . LEU B 1 535 ? -5.381  -47.311 -6.692  1.00 60.49  ? 536 LEU B C   1 
ATOM   8323 O O   . LEU B 1 535 ? -5.028  -46.190 -7.057  1.00 62.20  ? 536 LEU B O   1 
ATOM   8324 C CB  . LEU B 1 535 ? -3.389  -48.710 -6.129  1.00 51.51  ? 536 LEU B CB  1 
ATOM   8325 C CG  . LEU B 1 535 ? -2.376  -47.739 -6.743  1.00 51.54  ? 536 LEU B CG  1 
ATOM   8326 C CD1 . LEU B 1 535 ? -1.563  -47.042 -5.660  1.00 55.57  ? 536 LEU B CD1 1 
ATOM   8327 C CD2 . LEU B 1 535 ? -1.477  -48.435 -7.725  1.00 44.75  ? 536 LEU B CD2 1 
ATOM   8328 N N   . PRO B 1 536 ? -6.408  -47.959 -7.274  1.00 69.27  ? 537 PRO B N   1 
ATOM   8329 C CA  . PRO B 1 536 ? -7.172  -47.155 -8.235  1.00 64.65  ? 537 PRO B CA  1 
ATOM   8330 C C   . PRO B 1 536 ? -7.986  -46.029 -7.577  1.00 72.74  ? 537 PRO B C   1 
ATOM   8331 O O   . PRO B 1 536 ? -8.029  -44.931 -8.141  1.00 74.21  ? 537 PRO B O   1 
ATOM   8332 C CB  . PRO B 1 536 ? -8.097  -48.185 -8.889  1.00 64.07  ? 537 PRO B CB  1 
ATOM   8333 C CG  . PRO B 1 536 ? -7.391  -49.483 -8.722  1.00 53.12  ? 537 PRO B CG  1 
ATOM   8334 C CD  . PRO B 1 536 ? -6.739  -49.393 -7.388  1.00 60.54  ? 537 PRO B CD  1 
ATOM   8335 N N   . LYS B 1 537 ? -8.599  -46.298 -6.417  1.00 68.35  ? 538 LYS B N   1 
ATOM   8336 C CA  . LYS B 1 537 ? -9.417  -45.315 -5.682  1.00 58.34  ? 538 LYS B CA  1 
ATOM   8337 C C   . LYS B 1 537 ? -8.643  -44.048 -5.361  1.00 61.43  ? 538 LYS B C   1 
ATOM   8338 O O   . LYS B 1 537 ? -9.209  -42.960 -5.235  1.00 67.48  ? 538 LYS B O   1 
ATOM   8339 C CB  . LYS B 1 537 ? -9.956  -45.922 -4.382  1.00 54.61  ? 538 LYS B CB  1 
ATOM   8340 C CG  . LYS B 1 537 ? -11.103 -46.894 -4.584  1.00 62.91  ? 538 LYS B CG  1 
ATOM   8341 C CD  . LYS B 1 537 ? -11.448 -47.657 -3.315  1.00 67.50  ? 538 LYS B CD  1 
ATOM   8342 C CE  . LYS B 1 537 ? -12.734 -48.469 -3.505  1.00 82.03  ? 538 LYS B CE  1 
ATOM   8343 N NZ  . LYS B 1 537 ? -12.707 -49.364 -4.705  1.00 76.94  ? 538 LYS B NZ  1 
ATOM   8344 N N   . LEU B 1 538 ? -7.335  -44.214 -5.237  1.00 63.77  ? 539 LEU B N   1 
ATOM   8345 C CA  . LEU B 1 538 ? -6.437  -43.140 -4.875  1.00 62.13  ? 539 LEU B CA  1 
ATOM   8346 C C   . LEU B 1 538 ? -6.091  -42.297 -6.086  1.00 67.23  ? 539 LEU B C   1 
ATOM   8347 O O   . LEU B 1 538 ? -5.825  -41.106 -5.962  1.00 87.56  ? 539 LEU B O   1 
ATOM   8348 C CB  . LEU B 1 538 ? -5.177  -43.723 -4.234  1.00 60.80  ? 539 LEU B CB  1 
ATOM   8349 C CG  . LEU B 1 538 ? -3.965  -42.846 -3.959  1.00 56.65  ? 539 LEU B CG  1 
ATOM   8350 C CD1 . LEU B 1 538 ? -3.213  -43.438 -2.801  1.00 60.63  ? 539 LEU B CD1 1 
ATOM   8351 C CD2 . LEU B 1 538 ? -3.068  -42.788 -5.185  1.00 71.44  ? 539 LEU B CD2 1 
ATOM   8352 N N   . LEU B 1 539 ? -6.075  -42.920 -7.258  1.00 78.00  ? 540 LEU B N   1 
ATOM   8353 C CA  . LEU B 1 539 ? -5.783  -42.195 -8.493  1.00 88.10  ? 540 LEU B CA  1 
ATOM   8354 C C   . LEU B 1 539 ? -6.948  -41.274 -8.898  1.00 95.13  ? 540 LEU B C   1 
ATOM   8355 O O   . LEU B 1 539 ? -6.734  -40.220 -9.511  1.00 87.53  ? 540 LEU B O   1 
ATOM   8356 C CB  . LEU B 1 539 ? -5.444  -43.178 -9.621  1.00 80.17  ? 540 LEU B CB  1 
ATOM   8357 C CG  . LEU B 1 539 ? -4.056  -43.824 -9.502  1.00 83.13  ? 540 LEU B CG  1 
ATOM   8358 C CD1 . LEU B 1 539 ? -3.799  -44.821 -10.624 1.00 59.84  ? 540 LEU B CD1 1 
ATOM   8359 C CD2 . LEU B 1 539 ? -2.955  -42.760 -9.459  1.00 75.48  ? 540 LEU B CD2 1 
ATOM   8360 N N   . SER B 1 540 ? -8.171  -41.667 -8.538  1.00 84.97  ? 541 SER B N   1 
ATOM   8361 C CA  . SER B 1 540 ? -9.358  -40.835 -8.749  1.00 86.54  ? 541 SER B CA  1 
ATOM   8362 C C   . SER B 1 540 ? -9.317  -39.527 -7.936  1.00 102.63 ? 541 SER B C   1 
ATOM   8363 O O   . SER B 1 540 ? -9.222  -38.434 -8.506  1.00 98.12  ? 541 SER B O   1 
ATOM   8364 C CB  . SER B 1 540 ? -10.615 -41.625 -8.394  1.00 77.31  ? 541 SER B CB  1 
ATOM   8365 O OG  . SER B 1 540 ? -10.538 -42.933 -8.927  1.00 80.18  ? 541 SER B OG  1 
ATOM   8366 N N   . ALA B 1 541 ? -9.395  -39.646 -6.610  1.00 104.21 ? 542 ALA B N   1 
ATOM   8367 C CA  . ALA B 1 541 ? -9.319  -38.488 -5.714  1.00 94.77  ? 542 ALA B CA  1 
ATOM   8368 C C   . ALA B 1 541 ? -7.868  -38.101 -5.412  1.00 90.77  ? 542 ALA B C   1 
ATOM   8369 O O   . ALA B 1 541 ? -7.062  -37.893 -6.323  1.00 88.68  ? 542 ALA B O   1 
ATOM   8370 C CB  . ALA B 1 541 ? -10.073 -38.770 -4.413  1.00 80.61  ? 542 ALA B CB  1 
HETATM 8371 C C1  . NAG C 2 .   ? -22.788 -59.120 22.078  1.00 73.47  ? 1   NAG C C1  1 
HETATM 8372 C C2  . NAG C 2 .   ? -23.650 -59.545 20.883  1.00 83.56  ? 1   NAG C C2  1 
HETATM 8373 C C3  . NAG C 2 .   ? -24.017 -58.333 20.026  1.00 79.80  ? 1   NAG C C3  1 
HETATM 8374 C C4  . NAG C 2 .   ? -24.612 -57.224 20.883  1.00 82.16  ? 1   NAG C C4  1 
HETATM 8375 C C5  . NAG C 2 .   ? -23.680 -56.913 22.052  1.00 76.72  ? 1   NAG C C5  1 
HETATM 8376 C C6  . NAG C 2 .   ? -24.238 -55.887 23.013  1.00 79.32  ? 1   NAG C C6  1 
HETATM 8377 C C7  . NAG C 2 .   ? -23.533 -61.705 19.716  1.00 87.69  ? 1   NAG C C7  1 
HETATM 8378 C C8  . NAG C 2 .   ? -24.943 -61.932 20.185  1.00 74.96  ? 1   NAG C C8  1 
HETATM 8379 N N2  . NAG C 2 .   ? -22.969 -60.549 20.081  1.00 82.60  ? 1   NAG C N2  1 
HETATM 8380 O O3  . NAG C 2 .   ? -24.953 -58.731 19.030  1.00 84.35  ? 1   NAG C O3  1 
HETATM 8381 O O4  . NAG C 2 .   ? -24.807 -56.061 20.084  1.00 88.15  ? 1   NAG C O4  1 
HETATM 8382 O O5  . NAG C 2 .   ? -23.457 -58.107 22.812  1.00 69.87  ? 1   NAG C O5  1 
HETATM 8383 O O6  . NAG C 2 .   ? -25.607 -56.146 23.297  1.00 96.72  ? 1   NAG C O6  1 
HETATM 8384 O O7  . NAG C 2 .   ? -22.931 -62.532 19.040  1.00 96.84  ? 1   NAG C O7  1 
HETATM 8385 C C1  . NAG C 2 .   ? -26.180 -55.607 20.178  1.00 102.45 ? 2   NAG C C1  1 
HETATM 8386 C C2  . NAG C 2 .   ? -26.207 -54.118 19.816  1.00 104.58 ? 2   NAG C C2  1 
HETATM 8387 C C3  . NAG C 2 .   ? -27.638 -53.578 19.888  1.00 105.78 ? 2   NAG C C3  1 
HETATM 8388 C C4  . NAG C 2 .   ? -28.590 -54.452 19.074  1.00 117.40 ? 2   NAG C C4  1 
HETATM 8389 C C5  . NAG C 2 .   ? -28.439 -55.926 19.459  1.00 110.62 ? 2   NAG C C5  1 
HETATM 8390 C C6  . NAG C 2 .   ? -29.260 -56.859 18.596  1.00 96.51  ? 2   NAG C C6  1 
HETATM 8391 C C7  . NAG C 2 .   ? -24.138 -52.880 20.297  1.00 90.75  ? 2   NAG C C7  1 
HETATM 8392 C C8  . NAG C 2 .   ? -23.354 -52.135 21.336  1.00 84.33  ? 2   NAG C C8  1 
HETATM 8393 N N2  . NAG C 2 .   ? -25.324 -53.361 20.690  1.00 99.07  ? 2   NAG C N2  1 
HETATM 8394 O O3  . NAG C 2 .   ? -27.668 -52.243 19.390  1.00 93.11  ? 2   NAG C O3  1 
HETATM 8395 O O4  . NAG C 2 .   ? -29.935 -54.031 19.283  1.00 106.19 ? 2   NAG C O4  1 
HETATM 8396 O O5  . NAG C 2 .   ? -27.069 -56.330 19.312  1.00 110.94 ? 2   NAG C O5  1 
HETATM 8397 O O6  . NAG C 2 .   ? -30.597 -56.404 18.451  1.00 99.45  ? 2   NAG C O6  1 
HETATM 8398 O O7  . NAG C 2 .   ? -23.720 -53.035 19.151  1.00 82.95  ? 2   NAG C O7  1 
HETATM 8399 C C1  . FUC C 2 .   ? -25.875 -56.093 24.722  1.00 96.00  ? 3   FUC C C1  1 
HETATM 8400 C C2  . FUC C 2 .   ? -27.419 -56.209 24.906  1.00 101.36 ? 3   FUC C C2  1 
HETATM 8401 C C3  . FUC C 2 .   ? -27.899 -57.647 24.620  1.00 90.98  ? 3   FUC C C3  1 
HETATM 8402 C C4  . FUC C 2 .   ? -27.140 -58.647 25.505  1.00 95.46  ? 3   FUC C C4  1 
HETATM 8403 C C5  . FUC C 2 .   ? -25.626 -58.496 25.276  1.00 91.04  ? 3   FUC C C5  1 
HETATM 8404 C C6  . FUC C 2 .   ? -24.780 -59.379 26.200  1.00 73.45  ? 3   FUC C C6  1 
HETATM 8405 O O2  . FUC C 2 .   ? -28.141 -55.255 24.113  1.00 101.98 ? 3   FUC C O2  1 
HETATM 8406 O O3  . FUC C 2 .   ? -29.282 -57.769 24.917  1.00 89.92  ? 3   FUC C O3  1 
HETATM 8407 O O4  . FUC C 2 .   ? -27.451 -58.415 26.878  1.00 98.34  ? 3   FUC C O4  1 
HETATM 8408 O O5  . FUC C 2 .   ? -25.181 -57.112 25.466  1.00 86.29  ? 3   FUC C O5  1 
HETATM 8409 C C1  . NAG D 2 .   ? 25.781  -54.141 -11.448 1.00 80.96  ? 1   NAG D C1  1 
HETATM 8410 C C2  . NAG D 2 .   ? 26.517  -53.032 -10.706 1.00 85.26  ? 1   NAG D C2  1 
HETATM 8411 C C3  . NAG D 2 .   ? 25.869  -51.687 -11.004 1.00 83.17  ? 1   NAG D C3  1 
HETATM 8412 C C4  . NAG D 2 .   ? 25.861  -51.437 -12.507 1.00 88.33  ? 1   NAG D C4  1 
HETATM 8413 C C5  . NAG D 2 .   ? 25.175  -52.605 -13.227 1.00 85.24  ? 1   NAG D C5  1 
HETATM 8414 C C6  . NAG D 2 .   ? 25.268  -52.527 -14.738 1.00 94.63  ? 1   NAG D C6  1 
HETATM 8415 C C7  . NAG D 2 .   ? 27.672  -53.624 -8.620  1.00 96.85  ? 1   NAG D C7  1 
HETATM 8416 C C8  . NAG D 2 .   ? 28.921  -53.735 -9.455  1.00 86.10  ? 1   NAG D C8  1 
HETATM 8417 N N2  . NAG D 2 .   ? 26.554  -53.282 -9.274  1.00 88.16  ? 1   NAG D N2  1 
HETATM 8418 O O3  . NAG D 2 .   ? 26.572  -50.650 -10.330 1.00 91.53  ? 1   NAG D O3  1 
HETATM 8419 O O4  . NAG D 2 .   ? 25.185  -50.212 -12.773 1.00 97.30  ? 1   NAG D O4  1 
HETATM 8420 O O5  . NAG D 2 .   ? 25.779  -53.857 -12.851 1.00 82.69  ? 1   NAG D O5  1 
HETATM 8421 O O6  . NAG D 2 .   ? 26.530  -52.030 -15.163 1.00 100.84 ? 1   NAG D O6  1 
HETATM 8422 O O7  . NAG D 2 .   ? 27.678  -53.835 -7.411  1.00 90.99  ? 1   NAG D O7  1 
HETATM 8423 C C1  . NAG D 2 .   ? 25.932  -49.319 -13.652 1.00 106.29 ? 2   NAG D C1  1 
HETATM 8424 C C2  . NAG D 2 .   ? 24.964  -48.251 -14.203 1.00 103.47 ? 2   NAG D C2  1 
HETATM 8425 C C3  . NAG D 2 .   ? 25.709  -47.258 -15.108 1.00 111.80 ? 2   NAG D C3  1 
HETATM 8426 C C4  . NAG D 2 .   ? 26.957  -46.712 -14.419 1.00 115.80 ? 2   NAG D C4  1 
HETATM 8427 C C5  . NAG D 2 .   ? 27.827  -47.861 -13.916 1.00 114.24 ? 2   NAG D C5  1 
HETATM 8428 C C6  . NAG D 2 .   ? 29.061  -47.396 -13.170 1.00 107.90 ? 2   NAG D C6  1 
HETATM 8429 C C7  . NAG D 2 .   ? 22.640  -49.042 -14.428 1.00 95.62  ? 2   NAG D C7  1 
HETATM 8430 C C8  . NAG D 2 .   ? 21.647  -49.721 -15.329 1.00 74.55  ? 2   NAG D C8  1 
HETATM 8431 N N2  . NAG D 2 .   ? 23.869  -48.879 -14.931 1.00 100.18 ? 2   NAG D N2  1 
HETATM 8432 O O3  . NAG D 2 .   ? 24.834  -46.186 -15.449 1.00 101.55 ? 2   NAG D O3  1 
HETATM 8433 O O4  . NAG D 2 .   ? 27.711  -45.902 -15.320 1.00 98.40  ? 2   NAG D O4  1 
HETATM 8434 O O5  . NAG D 2 .   ? 27.065  -48.673 -13.013 1.00 118.06 ? 2   NAG D O5  1 
HETATM 8435 O O6  . NAG D 2 .   ? 28.885  -47.463 -11.760 1.00 104.44 ? 2   NAG D O6  1 
HETATM 8436 O O7  . NAG D 2 .   ? 22.337  -48.657 -13.300 1.00 89.37  ? 2   NAG D O7  1 
HETATM 8437 C C1  . FUC D 2 .   ? 27.109  -52.783 -16.253 1.00 93.40  ? 3   FUC D C1  1 
HETATM 8438 C C2  . FUC D 2 .   ? 28.547  -52.209 -16.512 1.00 104.34 ? 3   FUC D C2  1 
HETATM 8439 C C3  . FUC D 2 .   ? 29.551  -52.647 -15.398 1.00 101.91 ? 3   FUC D C3  1 
HETATM 8440 C C4  . FUC D 2 .   ? 29.519  -54.173 -15.208 1.00 102.13 ? 3   FUC D C4  1 
HETATM 8441 C C5  . FUC D 2 .   ? 28.073  -54.614 -14.929 1.00 98.27  ? 3   FUC D C5  1 
HETATM 8442 C C6  . FUC D 2 .   ? 27.912  -56.117 -14.757 1.00 90.23  ? 3   FUC D C6  1 
HETATM 8443 O O2  . FUC D 2 .   ? 28.547  -50.787 -16.681 1.00 93.12  ? 3   FUC D O2  1 
HETATM 8444 O O3  . FUC D 2 .   ? 30.897  -52.271 -15.720 1.00 93.43  ? 3   FUC D O3  1 
HETATM 8445 O O4  . FUC D 2 .   ? 30.016  -54.831 -16.371 1.00 112.40 ? 3   FUC D O4  1 
HETATM 8446 O O5  . FUC D 2 .   ? 27.145  -54.183 -15.987 1.00 96.32  ? 3   FUC D O5  1 
HETATM 8447 C C12 A EFS E 3 .   ? -6.667  -42.299 24.929  0.80 53.58  ? 604 EFS A C12 1 
HETATM 8448 C C11 A EFS E 3 .   ? -7.854  -41.763 25.759  0.80 51.14  ? 604 EFS A C11 1 
HETATM 8449 O O2  A EFS E 3 .   ? -7.422  -41.086 26.803  0.80 43.73  ? 604 EFS A O2  1 
HETATM 8450 P P   A EFS E 3 .   ? -6.799  -41.970 28.259  0.80 47.86  ? 604 EFS A P   1 
HETATM 8451 O O4  A EFS E 3 .   ? -7.827  -43.069 28.457  0.80 51.46  ? 604 EFS A O4  1 
HETATM 8452 O O1  A EFS E 3 .   ? -6.808  -40.872 29.309  0.80 42.69  ? 604 EFS A O1  1 
HETATM 8453 C C1  B DEP F 4 .   ? -7.785  -42.256 25.787  0.20 51.81  ? 605 DEP A C1  1 
HETATM 8454 C C2  B DEP F 4 .   ? -6.518  -42.608 25.025  0.20 52.66  ? 605 DEP A C2  1 
HETATM 8455 C C3  B DEP F 4 .   ? -8.874  -43.214 29.350  0.20 45.93  ? 605 DEP A C3  1 
HETATM 8456 C C4  B DEP F 4 .   ? -9.940  -44.099 28.744  0.20 48.46  ? 605 DEP A C4  1 
HETATM 8457 O O1  B DEP F 4 .   ? -7.440  -41.423 26.857  0.20 44.56  ? 605 DEP A O1  1 
HETATM 8458 O O2  B DEP F 4 .   ? -7.759  -43.246 28.494  0.20 51.30  ? 605 DEP A O2  1 
HETATM 8459 O O3  B DEP F 4 .   ? -6.811  -40.987 29.335  0.20 42.63  ? 605 DEP A O3  1 
HETATM 8460 P P   B DEP F 4 .   ? -6.808  -41.984 28.241  0.20 49.01  ? 605 DEP A P   1 
HETATM 8461 C C1  . EDO G 5 .   ? -9.292  -58.905 9.566   1.00 49.06  ? 606 EDO A C1  1 
HETATM 8462 O O1  . EDO G 5 .   ? -7.894  -59.176 9.690   1.00 46.21  ? 606 EDO A O1  1 
HETATM 8463 C C2  . EDO G 5 .   ? -9.963  -60.073 8.856   1.00 51.71  ? 606 EDO A C2  1 
HETATM 8464 O O2  . EDO G 5 .   ? -9.701  -59.961 7.454   1.00 44.94  ? 606 EDO A O2  1 
HETATM 8465 C C1  . EDO H 5 .   ? 9.154   -47.751 12.050  0.99 56.08  ? 607 EDO A C1  1 
HETATM 8466 O O1  . EDO H 5 .   ? 10.177  -46.831 11.639  0.99 62.90  ? 607 EDO A O1  1 
HETATM 8467 C C2  . EDO H 5 .   ? 7.940   -47.632 11.128  0.99 55.15  ? 607 EDO A C2  1 
HETATM 8468 O O2  . EDO H 5 .   ? 7.485   -46.272 11.061  0.99 55.46  ? 607 EDO A O2  1 
HETATM 8469 C C1  . NAG I 6 .   ? -7.946  -35.311 -46.874 1.00 91.44  ? 604 NAG B C1  1 
HETATM 8470 C C2  . NAG I 6 .   ? -9.468  -35.079 -46.787 1.00 84.09  ? 604 NAG B C2  1 
HETATM 8471 C C3  . NAG I 6 .   ? -10.193 -35.781 -47.949 1.00 88.68  ? 604 NAG B C3  1 
HETATM 8472 C C4  . NAG I 6 .   ? -9.545  -35.475 -49.298 1.00 95.41  ? 604 NAG B C4  1 
HETATM 8473 C C5  . NAG I 6 .   ? -8.053  -35.774 -49.225 1.00 95.19  ? 604 NAG B C5  1 
HETATM 8474 C C6  . NAG I 6 .   ? -7.287  -35.492 -50.504 1.00 91.32  ? 604 NAG B C6  1 
HETATM 8475 C C7  . NAG I 6 .   ? -10.872 -34.913 -44.766 1.00 109.03 ? 604 NAG B C7  1 
HETATM 8476 C C8  . NAG I 6 .   ? -11.275 -35.586 -43.485 1.00 88.24  ? 604 NAG B C8  1 
HETATM 8477 N N2  . NAG I 6 .   ? -9.975  -35.567 -45.514 1.00 100.72 ? 604 NAG B N2  1 
HETATM 8478 O O3  . NAG I 6 .   ? -11.561 -35.386 -47.968 1.00 83.37  ? 604 NAG B O3  1 
HETATM 8479 O O4  . NAG I 6 .   ? -10.149 -36.268 -50.316 1.00 80.30  ? 604 NAG B O4  1 
HETATM 8480 O O5  . NAG I 6 .   ? -7.473  -34.964 -48.195 1.00 102.45 ? 604 NAG B O5  1 
HETATM 8481 O O6  . NAG I 6 .   ? -7.900  -34.497 -51.316 1.00 93.22  ? 604 NAG B O6  1 
HETATM 8482 O O7  . NAG I 6 .   ? -11.332 -33.824 -45.103 1.00 101.53 ? 604 NAG B O7  1 
HETATM 8483 C C12 A EFS J 3 .   ? 4.121   -57.793 -19.891 0.80 54.68  ? 605 EFS B C12 1 
HETATM 8484 C C11 A EFS J 3 .   ? 5.143   -57.483 -20.989 0.80 49.74  ? 605 EFS B C11 1 
HETATM 8485 O O2  A EFS J 3 .   ? 4.688   -57.922 -22.138 0.80 49.32  ? 605 EFS B O2  1 
HETATM 8486 P P   A EFS J 3 .   ? 4.972   -59.648 -22.648 0.80 43.66  ? 605 EFS B P   1 
HETATM 8487 O O4  A EFS J 3 .   ? 6.465   -59.817 -22.424 0.80 45.21  ? 605 EFS B O4  1 
HETATM 8488 O O1  A EFS J 3 .   ? 4.498   -59.609 -24.091 0.80 42.61  ? 605 EFS B O1  1 
HETATM 8489 C C1  B DEP K 4 .   ? 5.264   -57.683 -20.891 0.20 49.66  ? 606 DEP B C1  1 
HETATM 8490 C C2  B DEP K 4 .   ? 4.191   -58.017 -19.870 0.20 53.69  ? 606 DEP B C2  1 
HETATM 8491 C C3  B DEP K 4 .   ? 7.565   -59.878 -23.243 0.20 43.46  ? 606 DEP B C3  1 
HETATM 8492 C C4  B DEP K 4 .   ? 8.656   -58.971 -22.711 0.20 45.28  ? 606 DEP B C4  1 
HETATM 8493 O O1  B DEP K 4 .   ? 4.824   -58.124 -22.143 0.20 48.40  ? 606 DEP B O1  1 
HETATM 8494 O O2  B DEP K 4 .   ? 6.528   -59.907 -22.289 0.20 45.11  ? 606 DEP B O2  1 
HETATM 8495 O O3  B DEP K 4 .   ? 4.651   -59.837 -24.078 0.20 42.89  ? 606 DEP B O3  1 
HETATM 8496 P P   B DEP K 4 .   ? 4.985   -59.657 -22.648 0.20 42.35  ? 606 DEP B P   1 
HETATM 8497 C C1  . EDO L 5 .   ? 13.126  -53.467 2.145   1.00 43.70  ? 607 EDO B C1  1 
HETATM 8498 O O1  . EDO L 5 .   ? 12.364  -52.823 3.171   1.00 45.05  ? 607 EDO B O1  1 
HETATM 8499 C C2  . EDO L 5 .   ? 12.173  -54.089 1.133   1.00 45.18  ? 607 EDO B C2  1 
HETATM 8500 O O2  . EDO L 5 .   ? 11.486  -55.201 1.727   1.00 48.21  ? 607 EDO B O2  1 
HETATM 8501 C C1  . EDO M 5 .   ? -7.742  -60.903 -2.491  1.00 46.83  ? 608 EDO B C1  1 
HETATM 8502 O O1  . EDO M 5 .   ? -8.977  -61.240 -3.139  1.00 43.31  ? 608 EDO B O1  1 
HETATM 8503 C C2  . EDO M 5 .   ? -7.005  -59.786 -3.234  1.00 40.49  ? 608 EDO B C2  1 
HETATM 8504 O O2  . EDO M 5 .   ? -7.898  -58.724 -3.610  1.00 44.27  ? 608 EDO B O2  1 
HETATM 8505 N N   . NO3 N 7 .   ? -8.915  -39.377 -30.989 0.55 46.73  ? 609 NO3 B N   1 
HETATM 8506 O O1  . NO3 N 7 .   ? -9.942  -40.052 -30.688 0.55 45.21  ? 609 NO3 B O1  1 
HETATM 8507 O O2  . NO3 N 7 .   ? -8.326  -38.675 -30.112 0.55 39.52  ? 609 NO3 B O2  1 
HETATM 8508 O O3  . NO3 N 7 .   ? -8.479  -39.411 -32.178 0.55 46.61  ? 609 NO3 B O3  1 
HETATM 8509 O O   . HOH O 8 .   ? -1.134  -23.615 22.991  0.82 41.09  ? 701 HOH A O   1 
HETATM 8510 O O   . HOH O 8 .   ? -6.289  -34.366 61.915  1.00 53.06  ? 702 HOH A O   1 
HETATM 8511 O O   . HOH O 8 .   ? 0.665   -45.530 62.544  1.00 51.95  ? 703 HOH A O   1 
HETATM 8512 O O   . HOH O 8 .   ? 11.772  -44.781 57.208  1.00 48.21  ? 704 HOH A O   1 
HETATM 8513 O O   . HOH O 8 .   ? -10.489 -27.242 23.776  1.00 34.72  ? 705 HOH A O   1 
HETATM 8514 O O   . HOH O 8 .   ? -0.572  -21.505 58.743  0.99 45.05  ? 706 HOH A O   1 
HETATM 8515 O O   . HOH O 8 .   ? -7.410  -24.996 46.269  1.00 38.74  ? 707 HOH A O   1 
HETATM 8516 O O   . HOH O 8 .   ? 6.095   -57.842 21.648  1.00 50.68  ? 708 HOH A O   1 
HETATM 8517 O O   . HOH O 8 .   ? -8.218  -44.082 47.717  0.88 35.10  ? 709 HOH A O   1 
HETATM 8518 O O   . HOH O 8 .   ? 11.083  -46.535 53.364  1.00 45.59  ? 710 HOH A O   1 
HETATM 8519 O O   . HOH O 8 .   ? 2.024   -48.330 29.751  1.00 34.19  ? 711 HOH A O   1 
HETATM 8520 O O   . HOH O 8 .   ? -3.197  -43.282 50.319  1.00 40.15  ? 712 HOH A O   1 
HETATM 8521 O O   . HOH O 8 .   ? -2.725  -21.566 25.787  1.00 48.67  ? 713 HOH A O   1 
HETATM 8522 O O   . HOH O 8 .   ? -11.753 -41.996 33.352  1.00 40.16  ? 714 HOH A O   1 
HETATM 8523 O O   . HOH O 8 .   ? 10.652  -28.149 19.557  1.00 45.04  ? 715 HOH A O   1 
HETATM 8524 O O   . HOH O 8 .   ? -7.757  -41.156 36.290  0.89 29.22  ? 716 HOH A O   1 
HETATM 8525 O O   . HOH O 8 .   ? -10.418 -61.939 -0.601  1.00 42.36  ? 717 HOH A O   1 
HETATM 8526 O O   . HOH O 8 .   ? 0.678   -41.303 15.080  1.00 43.00  ? 718 HOH A O   1 
HETATM 8527 O O   . HOH O 8 .   ? 10.457  -52.294 44.367  0.92 34.95  ? 719 HOH A O   1 
HETATM 8528 O O   . HOH O 8 .   ? -6.554  -34.535 47.116  1.00 34.16  ? 720 HOH A O   1 
HETATM 8529 O O   . HOH O 8 .   ? 8.626   -29.592 39.989  0.96 39.49  ? 721 HOH A O   1 
HETATM 8530 O O   . HOH O 8 .   ? -2.499  -36.499 39.104  0.92 23.26  ? 722 HOH A O   1 
HETATM 8531 O O   . HOH O 8 .   ? 11.789  -33.619 56.349  1.00 60.52  ? 723 HOH A O   1 
HETATM 8532 O O   . HOH O 8 .   ? -13.096 -25.070 23.503  1.00 33.83  ? 724 HOH A O   1 
HETATM 8533 O O   . HOH O 8 .   ? -13.563 -24.612 37.790  0.93 40.20  ? 725 HOH A O   1 
HETATM 8534 O O   . HOH O 8 .   ? -2.525  -40.190 43.355  0.94 23.81  ? 726 HOH A O   1 
HETATM 8535 O O   . HOH O 8 .   ? -9.760  -21.200 29.244  1.00 36.33  ? 727 HOH A O   1 
HETATM 8536 O O   . HOH O 8 .   ? -12.559 -27.649 22.002  0.99 39.85  ? 728 HOH A O   1 
HETATM 8537 O O   . HOH O 8 .   ? -15.277 -45.662 34.232  1.00 48.70  ? 729 HOH A O   1 
HETATM 8538 O O   . HOH O 8 .   ? -13.016 -45.169 41.950  0.97 38.01  ? 730 HOH A O   1 
HETATM 8539 O O   . HOH O 8 .   ? -10.406 -37.851 24.356  1.00 39.66  ? 731 HOH A O   1 
HETATM 8540 O O   . HOH O 8 .   ? 12.150  -36.685 59.468  1.00 54.11  ? 732 HOH A O   1 
HETATM 8541 O O   . HOH O 8 .   ? -7.443  -20.025 40.553  0.97 38.30  ? 733 HOH A O   1 
HETATM 8542 O O   . HOH O 8 .   ? -8.855  -39.908 52.308  1.00 51.64  ? 734 HOH A O   1 
HETATM 8543 O O   . HOH O 8 .   ? -3.905  -56.081 20.539  1.00 39.93  ? 735 HOH A O   1 
HETATM 8544 O O   . HOH O 8 .   ? -21.823 -13.554 21.255  1.00 54.17  ? 736 HOH A O   1 
HETATM 8545 O O   . HOH O 8 .   ? -9.983  -36.172 44.348  1.00 39.12  ? 737 HOH A O   1 
HETATM 8546 O O   . HOH O 8 .   ? -7.869  -25.863 25.915  1.00 37.08  ? 738 HOH A O   1 
HETATM 8547 O O   . HOH O 8 .   ? 5.122   -25.914 11.363  1.00 48.80  ? 739 HOH A O   1 
HETATM 8548 O O   . HOH O 8 .   ? -9.287  -47.292 41.677  1.00 38.99  ? 740 HOH A O   1 
HETATM 8549 O O   . HOH O 8 .   ? -1.288  -54.331 10.201  1.00 40.95  ? 741 HOH A O   1 
HETATM 8550 O O   . HOH O 8 .   ? -9.676  -25.584 44.666  1.00 37.64  ? 742 HOH A O   1 
HETATM 8551 O O   . HOH O 8 .   ? -12.744 -23.662 35.106  0.97 31.99  ? 743 HOH A O   1 
HETATM 8552 O O   . HOH O 8 .   ? -11.924 -18.048 44.104  1.00 50.75  ? 744 HOH A O   1 
HETATM 8553 O O   . HOH O 8 .   ? -7.850  -36.803 31.872  1.00 26.94  ? 745 HOH A O   1 
HETATM 8554 O O   . HOH O 8 .   ? -10.168 -34.517 39.383  1.00 37.00  ? 746 HOH A O   1 
HETATM 8555 O O   . HOH O 8 .   ? -9.015  -40.480 17.311  0.94 45.18  ? 747 HOH A O   1 
HETATM 8556 O O   . HOH O 8 .   ? -7.347  -55.682 38.263  1.00 47.32  ? 748 HOH A O   1 
HETATM 8557 O O   . HOH O 8 .   ? 11.478  -27.239 47.401  1.00 36.14  ? 749 HOH A O   1 
HETATM 8558 O O   . HOH O 8 .   ? -12.982 -30.427 35.943  1.00 38.46  ? 750 HOH A O   1 
HETATM 8559 O O   . HOH O 8 .   ? 9.640   -58.910 32.057  1.00 39.81  ? 751 HOH A O   1 
HETATM 8560 O O   . HOH O 8 .   ? 5.202   -27.156 60.905  1.00 39.10  ? 752 HOH A O   1 
HETATM 8561 O O   . HOH O 8 .   ? -3.697  -20.317 28.634  1.00 51.12  ? 753 HOH A O   1 
HETATM 8562 O O   . HOH O 8 .   ? -4.223  -50.740 36.724  0.89 34.30  ? 754 HOH A O   1 
HETATM 8563 O O   . HOH O 8 .   ? -20.152 -50.371 21.809  1.00 58.02  ? 755 HOH A O   1 
HETATM 8564 O O   . HOH O 8 .   ? 5.866   -24.545 22.911  1.00 45.10  ? 756 HOH A O   1 
HETATM 8565 O O   . HOH O 8 .   ? -13.805 -17.126 42.869  0.98 52.59  ? 757 HOH A O   1 
HETATM 8566 O O   . HOH O 8 .   ? 17.294  -57.420 19.220  1.00 53.98  ? 758 HOH A O   1 
HETATM 8567 O O   . HOH O 8 .   ? -18.578 -41.835 40.885  1.00 31.50  ? 759 HOH A O   1 
HETATM 8568 O O   . HOH O 8 .   ? -18.277 -21.422 38.820  1.00 51.50  ? 760 HOH A O   1 
HETATM 8569 O O   . HOH O 8 .   ? 17.229  -49.940 20.027  1.00 40.53  ? 761 HOH A O   1 
HETATM 8570 O O   . HOH O 8 .   ? -13.483 -29.029 48.090  1.00 30.52  ? 762 HOH A O   1 
HETATM 8571 O O   . HOH O 8 .   ? -13.672 -65.052 5.794   1.00 43.72  ? 763 HOH A O   1 
HETATM 8572 O O   . HOH O 8 .   ? -13.918 -25.570 12.693  1.00 48.25  ? 764 HOH A O   1 
HETATM 8573 O O   . HOH O 8 .   ? 4.165   -22.060 46.947  1.00 48.72  ? 765 HOH A O   1 
HETATM 8574 O O   . HOH O 8 .   ? -18.386 -26.825 42.986  1.00 39.89  ? 766 HOH A O   1 
HETATM 8575 O O   . HOH O 8 .   ? -5.466  -57.784 18.540  1.00 49.21  ? 767 HOH A O   1 
HETATM 8576 O O   . HOH O 8 .   ? -14.048 -54.133 2.181   1.00 39.12  ? 768 HOH A O   1 
HETATM 8577 O O   . HOH O 8 .   ? -11.545 -24.107 49.862  1.00 41.39  ? 769 HOH A O   1 
HETATM 8578 O O   . HOH O 8 .   ? -6.550  -15.119 31.187  1.00 48.52  ? 770 HOH A O   1 
HETATM 8579 O O   . HOH O 8 .   ? -7.947  -29.344 52.687  0.97 38.51  ? 771 HOH A O   1 
HETATM 8580 O O   . HOH O 8 .   ? -8.951  -23.805 48.668  1.00 44.33  ? 772 HOH A O   1 
HETATM 8581 O O   . HOH O 8 .   ? 2.614   -22.832 49.564  1.00 44.08  ? 773 HOH A O   1 
HETATM 8582 O O   . HOH O 8 .   ? -21.352 -35.784 36.907  1.00 33.20  ? 774 HOH A O   1 
HETATM 8583 O O   . HOH O 8 .   ? 13.646  -31.448 38.502  1.00 36.96  ? 775 HOH A O   1 
HETATM 8584 O O   . HOH O 8 .   ? -7.331  -22.729 13.494  1.00 39.03  ? 776 HOH A O   1 
HETATM 8585 O O   . HOH O 8 .   ? -10.173 -18.329 17.418  1.00 61.17  ? 777 HOH A O   1 
HETATM 8586 O O   . HOH O 8 .   ? 15.687  -49.023 46.357  1.00 47.81  ? 778 HOH A O   1 
HETATM 8587 O O   . HOH O 8 .   ? 8.320   -28.052 58.166  1.00 50.30  ? 779 HOH A O   1 
HETATM 8588 O O   . HOH O 8 .   ? -5.326  -62.379 10.113  1.00 53.58  ? 780 HOH A O   1 
HETATM 8589 O O   . HOH O 8 .   ? -12.487 -12.788 32.729  1.00 53.27  ? 781 HOH A O   1 
HETATM 8590 O O   . HOH O 8 .   ? -23.210 -27.930 39.878  1.00 45.92  ? 782 HOH A O   1 
HETATM 8591 O O   . HOH O 8 .   ? 8.925   -45.358 54.940  1.00 41.06  ? 783 HOH A O   1 
HETATM 8592 O O   . HOH O 8 .   ? -9.390  -43.549 50.303  1.00 42.66  ? 784 HOH A O   1 
HETATM 8593 O O   . HOH O 8 .   ? -5.099  -53.322 20.335  0.94 44.31  ? 785 HOH A O   1 
HETATM 8594 O O   . HOH O 8 .   ? -10.923 -45.832 43.246  1.00 37.93  ? 786 HOH A O   1 
HETATM 8595 O O   . HOH O 8 .   ? -10.837 -33.946 19.764  1.00 36.03  ? 787 HOH A O   1 
HETATM 8596 O O   . HOH O 8 .   ? -9.505  -33.218 18.176  1.00 36.53  ? 788 HOH A O   1 
HETATM 8597 O O   . HOH O 8 .   ? 18.008  -43.241 17.422  1.00 45.98  ? 789 HOH A O   1 
HETATM 8598 O O   . HOH O 8 .   ? 7.370   -54.631 14.584  1.00 48.63  ? 790 HOH A O   1 
HETATM 8599 O O   . HOH O 8 .   ? 8.629   -41.962 5.277   1.00 51.34  ? 791 HOH A O   1 
HETATM 8600 O O   . HOH O 8 .   ? 19.581  -46.267 15.349  1.00 44.37  ? 792 HOH A O   1 
HETATM 8601 O O   . HOH O 8 .   ? 9.783   -52.953 50.881  1.00 42.20  ? 793 HOH A O   1 
HETATM 8602 O O   . HOH O 8 .   ? -6.239  -16.008 37.374  1.00 57.92  ? 794 HOH A O   1 
HETATM 8603 O O   . HOH O 8 .   ? -15.389 -40.690 35.329  1.00 47.52  ? 795 HOH A O   1 
HETATM 8604 O O   . HOH O 8 .   ? -5.368  -43.398 51.119  1.00 55.99  ? 796 HOH A O   1 
HETATM 8605 O O   . HOH O 8 .   ? 11.932  -59.200 17.892  1.00 43.35  ? 797 HOH A O   1 
HETATM 8606 O O   . HOH O 8 .   ? 17.238  -30.880 16.198  1.00 50.01  ? 798 HOH A O   1 
HETATM 8607 O O   . HOH O 8 .   ? -16.738 -59.473 32.254  1.00 48.62  ? 799 HOH A O   1 
HETATM 8608 O O   . HOH O 8 .   ? -10.405 -54.850 37.454  1.00 45.18  ? 800 HOH A O   1 
HETATM 8609 O O   . HOH O 8 .   ? -1.710  -42.078 14.366  1.00 35.69  ? 801 HOH A O   1 
HETATM 8610 O O   . HOH O 8 .   ? -7.442  -40.936 54.694  1.00 46.29  ? 802 HOH A O   1 
HETATM 8611 O O   . HOH O 8 .   ? -6.453  -60.187 12.796  1.00 49.94  ? 803 HOH A O   1 
HETATM 8612 O O   . HOH O 8 .   ? -10.078 -41.979 35.599  0.98 37.37  ? 804 HOH A O   1 
HETATM 8613 O O   . HOH O 8 .   ? -15.078 -43.007 30.216  1.00 50.77  ? 805 HOH A O   1 
HETATM 8614 O O   . HOH O 8 .   ? 8.700   -29.295 12.203  1.00 48.29  ? 806 HOH A O   1 
HETATM 8615 O O   . HOH O 8 .   ? 10.749  -26.178 50.778  1.00 40.43  ? 807 HOH A O   1 
HETATM 8616 O O   . HOH O 8 .   ? 8.758   -24.633 51.519  1.00 36.57  ? 808 HOH A O   1 
HETATM 8617 O O   . HOH O 8 .   ? 13.647  -31.101 55.172  1.00 44.65  ? 809 HOH A O   1 
HETATM 8618 O O   . HOH O 8 .   ? -7.333  -22.672 53.091  1.00 43.58  ? 810 HOH A O   1 
HETATM 8619 O O   . HOH O 8 .   ? -14.798 -12.428 19.640  1.00 53.40  ? 811 HOH A O   1 
HETATM 8620 O O   . HOH O 8 .   ? 9.776   -27.579 22.356  1.00 50.48  ? 812 HOH A O   1 
HETATM 8621 O O   . HOH O 8 .   ? 3.384   -22.022 43.729  1.00 39.35  ? 813 HOH A O   1 
HETATM 8622 O O   . HOH O 8 .   ? -13.135 -27.380 38.458  1.00 41.00  ? 814 HOH A O   1 
HETATM 8623 O O   . HOH O 8 .   ? -22.272 -20.881 39.229  1.00 39.36  ? 815 HOH A O   1 
HETATM 8624 O O   . HOH O 8 .   ? -12.919 -62.339 33.967  1.00 49.82  ? 816 HOH A O   1 
HETATM 8625 O O   . HOH O 8 .   ? -9.754  -51.244 0.238   1.00 45.74  ? 817 HOH A O   1 
HETATM 8626 O O   . HOH O 8 .   ? 7.755   -27.996 60.984  1.00 47.59  ? 818 HOH A O   1 
HETATM 8627 O O   . HOH O 8 .   ? 17.390  -28.525 16.951  1.00 53.88  ? 819 HOH A O   1 
HETATM 8628 O O   . HOH O 8 .   ? -7.339  -44.212 32.382  1.00 43.97  ? 820 HOH A O   1 
HETATM 8629 O O   . HOH O 8 .   ? 3.268   -54.646 12.674  1.00 39.93  ? 821 HOH A O   1 
HETATM 8630 O O   . HOH O 8 .   ? 0.395   -22.393 15.234  1.00 40.58  ? 822 HOH A O   1 
HETATM 8631 O O   . HOH O 8 .   ? 13.539  -28.462 22.564  1.00 48.53  ? 823 HOH A O   1 
HETATM 8632 O O   . HOH O 8 .   ? -4.450  -29.756 15.811  1.00 50.12  ? 824 HOH A O   1 
HETATM 8633 O O   . HOH O 8 .   ? -0.827  -20.496 16.300  1.00 46.77  ? 825 HOH A O   1 
HETATM 8634 O O   . HOH O 8 .   ? 8.027   -43.299 13.422  1.00 41.29  ? 826 HOH A O   1 
HETATM 8635 O O   . HOH O 8 .   ? 14.854  -28.864 37.586  1.00 38.05  ? 827 HOH A O   1 
HETATM 8636 O O   . HOH O 8 .   ? 11.616  -29.276 11.642  1.00 53.12  ? 828 HOH A O   1 
HETATM 8637 O O   . HOH O 8 .   ? -13.529 -49.434 43.057  1.00 46.71  ? 829 HOH A O   1 
HETATM 8638 O O   . HOH O 8 .   ? -3.519  -27.558 14.979  1.00 55.75  ? 830 HOH A O   1 
HETATM 8639 O O   . HOH O 8 .   ? -12.565 -64.417 36.035  1.00 45.47  ? 831 HOH A O   1 
HETATM 8640 O O   . HOH O 8 .   ? -19.601 -41.335 26.883  1.00 44.27  ? 832 HOH A O   1 
HETATM 8641 O O   . HOH P 8 .   ? -4.933  -37.388 -7.028  1.00 66.78  ? 701 HOH B O   1 
HETATM 8642 O O   . HOH P 8 .   ? -10.391 -84.300 -17.388 1.00 65.54  ? 702 HOH B O   1 
HETATM 8643 O O   . HOH P 8 .   ? -9.833  -32.067 -44.876 1.00 70.51  ? 703 HOH B O   1 
HETATM 8644 O O   . HOH P 8 .   ? 16.192  -82.195 -24.015 1.00 49.15  ? 704 HOH B O   1 
HETATM 8645 O O   . HOH P 8 .   ? -5.347  -75.280 -59.115 1.00 45.39  ? 705 HOH B O   1 
HETATM 8646 O O   . HOH P 8 .   ? -0.473  -67.956 -1.487  1.00 36.85  ? 706 HOH B O   1 
HETATM 8647 O O   . HOH P 8 .   ? -1.326  -44.889 -32.263 1.00 42.33  ? 707 HOH B O   1 
HETATM 8648 O O   . HOH P 8 .   ? 1.868   -85.478 -22.780 1.00 40.78  ? 708 HOH B O   1 
HETATM 8649 O O   . HOH P 8 .   ? -18.491 -69.410 -44.637 1.00 57.65  ? 709 HOH B O   1 
HETATM 8650 O O   . HOH P 8 .   ? 5.551   -66.282 -18.513 1.00 37.92  ? 710 HOH B O   1 
HETATM 8651 O O   . HOH P 8 .   ? -5.616  -52.785 -20.074 0.85 33.66  ? 711 HOH B O   1 
HETATM 8652 O O   . HOH P 8 .   ? 4.859   -78.718 -29.098 0.99 41.88  ? 712 HOH B O   1 
HETATM 8653 O O   . HOH P 8 .   ? -0.059  -63.187 -46.546 1.00 31.62  ? 713 HOH B O   1 
HETATM 8654 O O   . HOH P 8 .   ? 2.979   -69.779 -4.228  1.00 48.71  ? 714 HOH B O   1 
HETATM 8655 O O   . HOH P 8 .   ? 4.016   -71.694 -33.319 1.00 34.93  ? 715 HOH B O   1 
HETATM 8656 O O   . HOH P 8 .   ? -4.121  -36.013 -37.911 1.00 45.90  ? 716 HOH B O   1 
HETATM 8657 O O   . HOH P 8 .   ? 15.660  -74.320 -24.459 1.00 55.71  ? 717 HOH B O   1 
HETATM 8658 O O   . HOH P 8 .   ? 11.970  -72.361 -16.016 0.90 39.23  ? 718 HOH B O   1 
HETATM 8659 O O   . HOH P 8 .   ? 7.283   -63.985 -28.922 1.00 30.11  ? 719 HOH B O   1 
HETATM 8660 O O   . HOH P 8 .   ? 10.131  -70.660 -22.404 0.85 38.84  ? 720 HOH B O   1 
HETATM 8661 O O   . HOH P 8 .   ? -13.631 -57.962 -37.283 1.00 51.47  ? 721 HOH B O   1 
HETATM 8662 O O   . HOH P 8 .   ? 1.463   -61.294 -45.760 0.95 33.97  ? 722 HOH B O   1 
HETATM 8663 O O   . HOH P 8 .   ? 2.650   -68.625 -16.977 1.00 34.69  ? 723 HOH B O   1 
HETATM 8664 O O   . HOH P 8 .   ? 15.982  -53.312 -34.347 1.00 54.73  ? 724 HOH B O   1 
HETATM 8665 O O   . HOH P 8 .   ? 3.167   -56.904 -0.295  1.00 49.33  ? 725 HOH B O   1 
HETATM 8666 O O   . HOH P 8 .   ? -5.612  -74.541 -55.674 0.97 43.12  ? 726 HOH B O   1 
HETATM 8667 O O   . HOH P 8 .   ? 10.529  -62.336 -14.756 1.00 43.38  ? 727 HOH B O   1 
HETATM 8668 O O   . HOH P 8 .   ? -8.642  -36.095 -41.599 1.00 52.87  ? 728 HOH B O   1 
HETATM 8669 O O   . HOH P 8 .   ? -1.873  -47.516 -30.011 1.00 39.84  ? 729 HOH B O   1 
HETATM 8670 O O   . HOH P 8 .   ? 4.476   -50.473 -46.980 1.00 45.70  ? 730 HOH B O   1 
HETATM 8671 O O   . HOH P 8 .   ? 7.684   -77.251 -36.566 1.00 40.75  ? 731 HOH B O   1 
HETATM 8672 O O   . HOH P 8 .   ? 1.117   -66.926 -32.473 1.00 32.18  ? 732 HOH B O   1 
HETATM 8673 O O   . HOH P 8 .   ? -13.933 -71.451 -11.076 1.00 45.37  ? 733 HOH B O   1 
HETATM 8674 O O   . HOH P 8 .   ? -12.748 -54.229 -2.398  1.00 48.33  ? 734 HOH B O   1 
HETATM 8675 O O   . HOH P 8 .   ? -0.185  -89.930 -31.842 1.00 57.58  ? 735 HOH B O   1 
HETATM 8676 O O   . HOH P 8 .   ? 4.363   -70.359 -47.899 1.00 34.05  ? 736 HOH B O   1 
HETATM 8677 O O   . HOH P 8 .   ? -6.083  -64.654 -4.993  1.00 33.78  ? 737 HOH B O   1 
HETATM 8678 O O   . HOH P 8 .   ? 8.584   -55.635 -46.196 1.00 38.21  ? 738 HOH B O   1 
HETATM 8679 O O   . HOH P 8 .   ? 8.197   -52.810 -46.496 1.00 41.46  ? 739 HOH B O   1 
HETATM 8680 O O   . HOH P 8 .   ? 15.439  -58.927 -41.482 1.00 45.56  ? 740 HOH B O   1 
HETATM 8681 O O   . HOH P 8 .   ? 4.195   -53.134 -23.376 1.00 40.68  ? 741 HOH B O   1 
HETATM 8682 O O   . HOH P 8 .   ? -12.381 -79.835 -11.331 0.94 46.45  ? 742 HOH B O   1 
HETATM 8683 O O   . HOH P 8 .   ? 3.501   -59.075 -29.021 0.99 25.20  ? 743 HOH B O   1 
HETATM 8684 O O   . HOH P 8 .   ? 7.734   -66.024 -38.780 1.00 36.17  ? 744 HOH B O   1 
HETATM 8685 O O   . HOH P 8 .   ? 2.428   -53.812 -42.626 1.00 41.14  ? 745 HOH B O   1 
HETATM 8686 O O   . HOH P 8 .   ? -4.982  -62.015 -5.276  1.00 38.47  ? 746 HOH B O   1 
HETATM 8687 O O   . HOH P 8 .   ? 15.200  -66.792 -31.878 0.98 37.81  ? 747 HOH B O   1 
HETATM 8688 O O   . HOH P 8 .   ? 9.438   -42.799 0.172   1.00 54.17  ? 748 HOH B O   1 
HETATM 8689 O O   . HOH P 8 .   ? -10.667 -71.863 -4.992  1.00 48.53  ? 749 HOH B O   1 
HETATM 8690 O O   . HOH P 8 .   ? 14.966  -60.581 -26.500 1.00 52.80  ? 750 HOH B O   1 
HETATM 8691 O O   . HOH P 8 .   ? 4.643   -69.051 -41.196 1.00 42.26  ? 751 HOH B O   1 
HETATM 8692 O O   . HOH P 8 .   ? -4.498  -56.949 -45.924 1.00 46.24  ? 752 HOH B O   1 
HETATM 8693 O O   . HOH P 8 .   ? -16.033 -67.392 -7.142  1.00 46.73  ? 753 HOH B O   1 
HETATM 8694 O O   . HOH P 8 .   ? -11.026 -66.672 -43.604 1.00 46.12  ? 754 HOH B O   1 
HETATM 8695 O O   . HOH P 8 .   ? 14.009  -69.228 -32.074 0.83 39.57  ? 755 HOH B O   1 
HETATM 8696 O O   . HOH P 8 .   ? 9.625   -62.540 -28.788 1.00 37.25  ? 756 HOH B O   1 
HETATM 8697 O O   . HOH P 8 .   ? -8.610  -70.385 -47.305 1.00 46.21  ? 757 HOH B O   1 
HETATM 8698 O O   . HOH P 8 .   ? -5.646  -81.497 -51.727 0.97 41.26  ? 758 HOH B O   1 
HETATM 8699 O O   . HOH P 8 .   ? 2.875   -50.458 -16.731 1.00 46.74  ? 759 HOH B O   1 
HETATM 8700 O O   . HOH P 8 .   ? 4.243   -60.034 -3.368  1.00 37.65  ? 760 HOH B O   1 
HETATM 8701 O O   . HOH P 8 .   ? -10.374 -49.280 -42.231 1.00 48.76  ? 761 HOH B O   1 
HETATM 8702 O O   . HOH P 8 .   ? -13.436 -76.197 -40.103 1.00 47.46  ? 762 HOH B O   1 
HETATM 8703 O O   . HOH P 8 .   ? 23.864  -53.066 -8.110  1.00 61.51  ? 763 HOH B O   1 
HETATM 8704 O O   . HOH P 8 .   ? 11.402  -44.100 2.069   1.00 48.11  ? 764 HOH B O   1 
HETATM 8705 O O   . HOH P 8 .   ? 16.665  -85.927 -14.203 1.00 47.85  ? 765 HOH B O   1 
HETATM 8706 O O   . HOH P 8 .   ? 5.954   -85.638 -28.491 1.00 50.91  ? 766 HOH B O   1 
HETATM 8707 O O   . HOH P 8 .   ? 6.912   -70.473 -46.585 1.00 36.08  ? 767 HOH B O   1 
HETATM 8708 O O   . HOH P 8 .   ? 17.903  -52.077 6.962   1.00 46.24  ? 768 HOH B O   1 
HETATM 8709 O O   . HOH P 8 .   ? 17.776  -69.586 -21.688 1.00 53.00  ? 769 HOH B O   1 
HETATM 8710 O O   . HOH P 8 .   ? 10.113  -50.719 -46.445 1.00 43.16  ? 770 HOH B O   1 
HETATM 8711 O O   . HOH P 8 .   ? -7.241  -59.687 -6.382  1.00 41.18  ? 771 HOH B O   1 
HETATM 8712 O O   . HOH P 8 .   ? 5.843   -60.840 -9.052  1.00 44.56  ? 772 HOH B O   1 
HETATM 8713 O O   . HOH P 8 .   ? -4.150  -44.234 -21.950 1.00 40.53  ? 773 HOH B O   1 
HETATM 8714 O O   . HOH P 8 .   ? -6.318  -68.983 -46.940 1.00 42.11  ? 774 HOH B O   1 
HETATM 8715 O O   . HOH P 8 .   ? 24.539  -51.879 -2.787  1.00 53.17  ? 775 HOH B O   1 
HETATM 8716 O O   . HOH P 8 .   ? 7.452   -84.177 -12.664 1.00 52.14  ? 776 HOH B O   1 
HETATM 8717 O O   . HOH P 8 .   ? -17.316 -60.240 -8.978  1.00 44.04  ? 777 HOH B O   1 
HETATM 8718 O O   . HOH P 8 .   ? 16.625  -86.683 -43.527 1.00 49.81  ? 778 HOH B O   1 
HETATM 8719 O O   . HOH P 8 .   ? 8.603   -60.922 -9.036  1.00 45.73  ? 779 HOH B O   1 
HETATM 8720 O O   . HOH P 8 .   ? 9.642   -76.552 -37.380 1.00 48.89  ? 780 HOH B O   1 
HETATM 8721 O O   . HOH P 8 .   ? 0.103   -71.110 -56.573 1.00 38.31  ? 781 HOH B O   1 
HETATM 8722 O O   . HOH P 8 .   ? -18.034 -58.909 -24.228 1.00 52.43  ? 782 HOH B O   1 
HETATM 8723 O O   . HOH P 8 .   ? -1.554  -65.158 -0.684  1.00 40.73  ? 783 HOH B O   1 
HETATM 8724 O O   . HOH P 8 .   ? 0.475   -63.956 -49.296 1.00 39.66  ? 784 HOH B O   1 
HETATM 8725 O O   . HOH P 8 .   ? 12.798  -50.979 -44.613 1.00 41.81  ? 785 HOH B O   1 
HETATM 8726 O O   . HOH P 8 .   ? 0.968   -60.946 -0.807  1.00 37.69  ? 786 HOH B O   1 
HETATM 8727 O O   . HOH P 8 .   ? -17.176 -46.033 -31.643 1.00 42.00  ? 787 HOH B O   1 
HETATM 8728 O O   . HOH P 8 .   ? 0.627   -47.996 -22.575 1.00 43.92  ? 788 HOH B O   1 
HETATM 8729 O O   . HOH P 8 .   ? -0.739  -62.961 0.543   1.00 51.55  ? 789 HOH B O   1 
HETATM 8730 O O   . HOH P 8 .   ? -17.065 -72.078 -30.966 1.00 44.78  ? 790 HOH B O   1 
HETATM 8731 O O   . HOH P 8 .   ? 5.994   -44.571 2.580   1.00 40.53  ? 791 HOH B O   1 
HETATM 8732 O O   . HOH P 8 .   ? 7.196   -48.360 -48.715 1.00 49.10  ? 792 HOH B O   1 
HETATM 8733 O O   . HOH P 8 .   ? 7.743   -62.915 -24.370 1.00 40.80  ? 793 HOH B O   1 
HETATM 8734 O O   . HOH P 8 .   ? 2.543   -66.335 -6.480  1.00 40.01  ? 794 HOH B O   1 
HETATM 8735 O O   . HOH P 8 .   ? -15.098 -45.789 -26.014 1.00 42.79  ? 795 HOH B O   1 
HETATM 8736 O O   . HOH P 8 .   ? -9.885  -59.544 -7.673  1.00 39.65  ? 796 HOH B O   1 
HETATM 8737 O O   . HOH P 8 .   ? -18.358 -45.545 -29.476 1.00 48.51  ? 797 HOH B O   1 
HETATM 8738 O O   . HOH P 8 .   ? 5.261   -58.293 -0.464  1.00 69.60  ? 798 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   2   ?   ?   ?   A . n 
A 1 2   ARG 2   3   ?   ?   ?   A . n 
A 1 3   GLU 3   4   4   GLU GLU A . n 
A 1 4   ASP 4   5   5   ASP ASP A . n 
A 1 5   ALA 5   6   6   ALA ALA A . n 
A 1 6   GLU 6   7   7   GLU GLU A . n 
A 1 7   LEU 7   8   8   LEU LEU A . n 
A 1 8   LEU 8   9   9   LEU LEU A . n 
A 1 9   VAL 9   10  10  VAL VAL A . n 
A 1 10  THR 10  11  11  THR THR A . n 
A 1 11  VAL 11  12  12  VAL VAL A . n 
A 1 12  ARG 12  13  13  ARG ARG A . n 
A 1 13  GLY 13  14  14  GLY GLY A . n 
A 1 14  GLY 14  15  15  GLY GLY A . n 
A 1 15  ARG 15  16  16  ARG ARG A . n 
A 1 16  LEU 16  17  17  LEU LEU A . n 
A 1 17  ARG 17  18  18  ARG ARG A . n 
A 1 18  GLY 18  19  19  GLY GLY A . n 
A 1 19  ILE 19  20  20  ILE ILE A . n 
A 1 20  ARG 20  21  21  ARG ARG A . n 
A 1 21  LEU 21  22  22  LEU LEU A . n 
A 1 22  LYS 22  23  23  LYS LYS A . n 
A 1 23  THR 23  24  24  THR THR A . n 
A 1 24  PRO 24  25  25  PRO PRO A . n 
A 1 25  GLY 25  26  26  GLY GLY A . n 
A 1 26  GLY 26  27  27  GLY GLY A . n 
A 1 27  PRO 27  28  28  PRO PRO A . n 
A 1 28  VAL 28  29  29  VAL VAL A . n 
A 1 29  SER 29  30  30  SER SER A . n 
A 1 30  ALA 30  31  31  ALA ALA A . n 
A 1 31  PHE 31  32  32  PHE PHE A . n 
A 1 32  LEU 32  33  33  LEU LEU A . n 
A 1 33  GLY 33  34  34  GLY GLY A . n 
A 1 34  ILE 34  35  35  ILE ILE A . n 
A 1 35  PRO 35  36  36  PRO PRO A . n 
A 1 36  PHE 36  37  37  PHE PHE A . n 
A 1 37  ALA 37  38  38  ALA ALA A . n 
A 1 38  GLU 38  39  39  GLU GLU A . n 
A 1 39  PRO 39  40  40  PRO PRO A . n 
A 1 40  PRO 40  41  41  PRO PRO A . n 
A 1 41  MET 41  42  42  MET MET A . n 
A 1 42  GLY 42  43  43  GLY GLY A . n 
A 1 43  PRO 43  44  44  PRO PRO A . n 
A 1 44  ARG 44  45  45  ARG ARG A . n 
A 1 45  ARG 45  46  46  ARG ARG A . n 
A 1 46  PHE 46  47  47  PHE PHE A . n 
A 1 47  LEU 47  48  48  LEU LEU A . n 
A 1 48  PRO 48  49  49  PRO PRO A . n 
A 1 49  PRO 49  50  50  PRO PRO A . n 
A 1 50  GLU 50  51  51  GLU GLU A . n 
A 1 51  PRO 51  52  52  PRO PRO A . n 
A 1 52  LYS 52  53  53  LYS LYS A . n 
A 1 53  GLN 53  54  54  GLN GLN A . n 
A 1 54  PRO 54  55  55  PRO PRO A . n 
A 1 55  TRP 55  56  56  TRP TRP A . n 
A 1 56  SER 56  57  57  SER SER A . n 
A 1 57  GLY 57  58  58  GLY GLY A . n 
A 1 58  VAL 58  59  59  VAL VAL A . n 
A 1 59  VAL 59  60  60  VAL VAL A . n 
A 1 60  ASP 60  61  61  ASP ASP A . n 
A 1 61  ALA 61  62  62  ALA ALA A . n 
A 1 62  THR 62  63  63  THR THR A . n 
A 1 63  THR 63  64  64  THR THR A . n 
A 1 64  PHE 64  65  65  PHE PHE A . n 
A 1 65  GLN 65  66  66  GLN GLN A . n 
A 1 66  SER 66  67  67  SER SER A . n 
A 1 67  VAL 67  68  68  VAL VAL A . n 
A 1 68  CYS 68  69  69  CYS CYS A . n 
A 1 69  TYR 69  70  70  TYR TYR A . n 
A 1 70  GLN 70  71  71  GLN GLN A . n 
A 1 71  TYR 71  72  72  TYR TYR A . n 
A 1 72  VAL 72  73  73  VAL VAL A . n 
A 1 73  ASP 73  74  74  ASP ASP A . n 
A 1 74  THR 74  75  75  THR THR A . n 
A 1 75  LEU 75  76  76  LEU LEU A . n 
A 1 76  TYR 76  77  77  TYR TYR A . n 
A 1 77  PRO 77  78  78  PRO PRO A . n 
A 1 78  GLY 78  79  79  GLY GLY A . n 
A 1 79  PHE 79  80  80  PHE PHE A . n 
A 1 80  GLU 80  81  81  GLU GLU A . n 
A 1 81  GLY 81  82  82  GLY GLY A . n 
A 1 82  THR 82  83  83  THR THR A . n 
A 1 83  GLU 83  84  84  GLU GLU A . n 
A 1 84  MET 84  85  85  MET MET A . n 
A 1 85  TRP 85  86  86  TRP TRP A . n 
A 1 86  ASN 86  87  87  ASN ASN A . n 
A 1 87  PRO 87  88  88  PRO PRO A . n 
A 1 88  ASN 88  89  89  ASN ASN A . n 
A 1 89  ARG 89  90  90  ARG ARG A . n 
A 1 90  GLU 90  91  91  GLU GLU A . n 
A 1 91  LEU 91  92  92  LEU LEU A . n 
A 1 92  SER 92  93  93  SER SER A . n 
A 1 93  GLU 93  94  94  GLU GLU A . n 
A 1 94  ASP 94  95  95  ASP ASP A . n 
A 1 95  CYS 95  96  96  CYS CYS A . n 
A 1 96  LEU 96  97  97  LEU LEU A . n 
A 1 97  TYR 97  98  98  TYR TYR A . n 
A 1 98  LEU 98  99  99  LEU LEU A . n 
A 1 99  ASN 99  100 100 ASN ASN A . n 
A 1 100 VAL 100 101 101 VAL VAL A . n 
A 1 101 TRP 101 102 102 TRP TRP A . n 
A 1 102 THR 102 103 103 THR THR A . n 
A 1 103 PRO 103 104 104 PRO PRO A . n 
A 1 104 TYR 104 105 105 TYR TYR A . n 
A 1 105 PRO 105 106 106 PRO PRO A . n 
A 1 106 ARG 106 107 107 ARG ARG A . n 
A 1 107 PRO 107 108 108 PRO PRO A . n 
A 1 108 THR 108 109 109 THR THR A . n 
A 1 109 SER 109 110 110 SER SER A . n 
A 1 110 PRO 110 111 111 PRO PRO A . n 
A 1 111 THR 111 112 112 THR THR A . n 
A 1 112 PRO 112 113 113 PRO PRO A . n 
A 1 113 VAL 113 114 114 VAL VAL A . n 
A 1 114 LEU 114 115 115 LEU LEU A . n 
A 1 115 VAL 115 116 116 VAL VAL A . n 
A 1 116 TRP 116 117 117 TRP TRP A . n 
A 1 117 ILE 117 118 118 ILE ILE A . n 
A 1 118 TYR 118 119 119 TYR TYR A . n 
A 1 119 GLY 119 120 120 GLY GLY A . n 
A 1 120 GLY 120 121 121 GLY GLY A . n 
A 1 121 GLY 121 122 122 GLY GLY A . n 
A 1 122 PHE 122 123 123 PHE PHE A . n 
A 1 123 TYR 123 124 124 TYR TYR A . n 
A 1 124 SER 124 125 125 SER SER A . n 
A 1 125 GLY 125 126 126 GLY GLY A . n 
A 1 126 ALA 126 127 127 ALA ALA A . n 
A 1 127 SER 127 128 128 SER SER A . n 
A 1 128 SER 128 129 129 SER SER A . n 
A 1 129 LEU 129 130 130 LEU LEU A . n 
A 1 130 ASP 130 131 131 ASP ASP A . n 
A 1 131 VAL 131 132 132 VAL VAL A . n 
A 1 132 TYR 132 133 133 TYR TYR A . n 
A 1 133 ASP 133 134 134 ASP ASP A . n 
A 1 134 GLY 134 135 135 GLY GLY A . n 
A 1 135 ARG 135 136 136 ARG ARG A . n 
A 1 136 PHE 136 137 137 PHE PHE A . n 
A 1 137 LEU 137 138 138 LEU LEU A . n 
A 1 138 VAL 138 139 139 VAL VAL A . n 
A 1 139 GLN 139 140 140 GLN GLN A . n 
A 1 140 ALA 140 141 141 ALA ALA A . n 
A 1 141 GLU 141 142 142 GLU GLU A . n 
A 1 142 ARG 142 143 143 ARG ARG A . n 
A 1 143 THR 143 144 144 THR THR A . n 
A 1 144 VAL 144 145 145 VAL VAL A . n 
A 1 145 LEU 145 146 146 LEU LEU A . n 
A 1 146 VAL 146 147 147 VAL VAL A . n 
A 1 147 SER 147 148 148 SER SER A . n 
A 1 148 MET 148 149 149 MET MET A . n 
A 1 149 ASN 149 150 150 ASN ASN A . n 
A 1 150 TYR 150 151 151 TYR TYR A . n 
A 1 151 ARG 151 152 152 ARG ARG A . n 
A 1 152 VAL 152 153 153 VAL VAL A . n 
A 1 153 GLY 153 154 154 GLY GLY A . n 
A 1 154 ALA 154 155 155 ALA ALA A . n 
A 1 155 PHE 155 156 156 PHE PHE A . n 
A 1 156 GLY 156 157 157 GLY GLY A . n 
A 1 157 PHE 157 158 158 PHE PHE A . n 
A 1 158 LEU 158 159 159 LEU LEU A . n 
A 1 159 ALA 159 160 160 ALA ALA A . n 
A 1 160 LEU 160 161 161 LEU LEU A . n 
A 1 161 PRO 161 162 162 PRO PRO A . n 
A 1 162 GLY 162 163 163 GLY GLY A . n 
A 1 163 SER 163 164 164 SER SER A . n 
A 1 164 ARG 164 165 165 ARG ARG A . n 
A 1 165 GLU 165 166 166 GLU GLU A . n 
A 1 166 ALA 166 167 167 ALA ALA A . n 
A 1 167 PRO 167 168 168 PRO PRO A . n 
A 1 168 GLY 168 169 169 GLY GLY A . n 
A 1 169 ASN 169 170 170 ASN ASN A . n 
A 1 170 VAL 170 171 171 VAL VAL A . n 
A 1 171 GLY 171 172 172 GLY GLY A . n 
A 1 172 LEU 172 173 173 LEU LEU A . n 
A 1 173 LEU 173 174 174 LEU LEU A . n 
A 1 174 ASP 174 175 175 ASP ASP A . n 
A 1 175 GLN 175 176 176 GLN GLN A . n 
A 1 176 ARG 176 177 177 ARG ARG A . n 
A 1 177 LEU 177 178 178 LEU LEU A . n 
A 1 178 ALA 178 179 179 ALA ALA A . n 
A 1 179 LEU 179 180 180 LEU LEU A . n 
A 1 180 GLN 180 181 181 GLN GLN A . n 
A 1 181 TRP 181 182 182 TRP TRP A . n 
A 1 182 VAL 182 183 183 VAL VAL A . n 
A 1 183 GLN 183 184 184 GLN GLN A . n 
A 1 184 GLU 184 185 185 GLU GLU A . n 
A 1 185 ASN 185 186 186 ASN ASN A . n 
A 1 186 VAL 186 187 187 VAL VAL A . n 
A 1 187 ALA 187 188 188 ALA ALA A . n 
A 1 188 ALA 188 189 189 ALA ALA A . n 
A 1 189 PHE 189 190 190 PHE PHE A . n 
A 1 190 GLY 190 191 191 GLY GLY A . n 
A 1 191 GLY 191 192 192 GLY GLY A . n 
A 1 192 ASP 192 193 193 ASP ASP A . n 
A 1 193 PRO 193 194 194 PRO PRO A . n 
A 1 194 THR 194 195 195 THR THR A . n 
A 1 195 SER 195 196 196 SER SER A . n 
A 1 196 VAL 196 197 197 VAL VAL A . n 
A 1 197 THR 197 198 198 THR THR A . n 
A 1 198 LEU 198 199 199 LEU LEU A . n 
A 1 199 PHE 199 200 200 PHE PHE A . n 
A 1 200 GLY 200 201 201 GLY GLY A . n 
A 1 201 GLU 201 202 202 GLU GLU A . n 
A 1 202 SER 202 203 203 SER SER A . n 
A 1 203 ALA 203 204 204 ALA ALA A . n 
A 1 204 GLY 204 205 205 GLY GLY A . n 
A 1 205 ALA 205 206 206 ALA ALA A . n 
A 1 206 ALA 206 207 207 ALA ALA A . n 
A 1 207 SER 207 208 208 SER SER A . n 
A 1 208 VAL 208 209 209 VAL VAL A . n 
A 1 209 GLY 209 210 210 GLY GLY A . n 
A 1 210 MET 210 211 211 MET MET A . n 
A 1 211 HIS 211 212 212 HIS HIS A . n 
A 1 212 LEU 212 213 213 LEU LEU A . n 
A 1 213 LEU 213 214 214 LEU LEU A . n 
A 1 214 SER 214 215 215 SER SER A . n 
A 1 215 PRO 215 216 216 PRO PRO A . n 
A 1 216 PRO 216 217 217 PRO PRO A . n 
A 1 217 SER 217 218 218 SER SER A . n 
A 1 218 ARG 218 219 219 ARG ARG A . n 
A 1 219 GLY 219 220 220 GLY GLY A . n 
A 1 220 LEU 220 221 221 LEU LEU A . n 
A 1 221 PHE 221 222 222 PHE PHE A . n 
A 1 222 HIS 222 223 223 HIS HIS A . n 
A 1 223 ARG 223 224 224 ARG ARG A . n 
A 1 224 ALA 224 225 225 ALA ALA A . n 
A 1 225 VAL 225 226 226 VAL VAL A . n 
A 1 226 LEU 226 227 227 LEU LEU A . n 
A 1 227 GLN 227 228 228 GLN GLN A . n 
A 1 228 SER 228 229 229 SER SER A . n 
A 1 229 GLY 229 230 230 GLY GLY A . n 
A 1 230 ALA 230 231 231 ALA ALA A . n 
A 1 231 PRO 231 232 232 PRO PRO A . n 
A 1 232 ASN 232 233 233 ASN ASN A . n 
A 1 233 GLY 233 234 234 GLY GLY A . n 
A 1 234 PRO 234 235 235 PRO PRO A . n 
A 1 235 TRP 235 236 236 TRP TRP A . n 
A 1 236 ALA 236 237 237 ALA ALA A . n 
A 1 237 THR 237 238 238 THR THR A . n 
A 1 238 VAL 238 239 239 VAL VAL A . n 
A 1 239 GLY 239 240 240 GLY GLY A . n 
A 1 240 MET 240 241 241 MET MET A . n 
A 1 241 GLY 241 242 242 GLY GLY A . n 
A 1 242 GLU 242 243 243 GLU GLU A . n 
A 1 243 ALA 243 244 244 ALA ALA A . n 
A 1 244 ARG 244 245 245 ARG ARG A . n 
A 1 245 ARG 245 246 246 ARG ARG A . n 
A 1 246 ARG 246 247 247 ARG ARG A . n 
A 1 247 ALA 247 248 248 ALA ALA A . n 
A 1 248 THR 248 249 249 THR THR A . n 
A 1 249 GLN 249 250 250 GLN GLN A . n 
A 1 250 LEU 250 251 251 LEU LEU A . n 
A 1 251 ALA 251 252 252 ALA ALA A . n 
A 1 252 HIS 252 253 253 HIS HIS A . n 
A 1 253 LEU 253 254 254 LEU LEU A . n 
A 1 254 VAL 254 255 255 VAL VAL A . n 
A 1 255 GLY 255 256 256 GLY GLY A . n 
A 1 256 CYS 256 257 257 CYS CYS A . n 
A 1 257 PRO 257 258 258 PRO PRO A . n 
A 1 258 PRO 258 259 ?   ?   ?   A . n 
A 1 259 GLY 259 260 ?   ?   ?   A . n 
A 1 260 GLY 260 261 ?   ?   ?   A . n 
A 1 261 THR 261 262 ?   ?   ?   A . n 
A 1 262 GLY 262 263 ?   ?   ?   A . n 
A 1 263 GLY 263 264 ?   ?   ?   A . n 
A 1 264 ASN 264 265 265 ASN ASN A . n 
A 1 265 ASP 265 266 266 ASP ASP A . n 
A 1 266 THR 266 267 267 THR THR A . n 
A 1 267 GLU 267 268 268 GLU GLU A . n 
A 1 268 LEU 268 269 269 LEU LEU A . n 
A 1 269 VAL 269 270 270 VAL VAL A . n 
A 1 270 ALA 270 271 271 ALA ALA A . n 
A 1 271 CYS 271 272 272 CYS CYS A . n 
A 1 272 LEU 272 273 273 LEU LEU A . n 
A 1 273 ARG 273 274 274 ARG ARG A . n 
A 1 274 THR 274 275 275 THR THR A . n 
A 1 275 ARG 275 276 276 ARG ARG A . n 
A 1 276 PRO 276 277 277 PRO PRO A . n 
A 1 277 ALA 277 278 278 ALA ALA A . n 
A 1 278 GLN 278 279 279 GLN GLN A . n 
A 1 279 VAL 279 280 280 VAL VAL A . n 
A 1 280 LEU 280 281 281 LEU LEU A . n 
A 1 281 VAL 281 282 282 VAL VAL A . n 
A 1 282 ASN 282 283 283 ASN ASN A . n 
A 1 283 HIS 283 284 284 HIS HIS A . n 
A 1 284 GLU 284 285 285 GLU GLU A . n 
A 1 285 TRP 285 286 286 TRP TRP A . n 
A 1 286 HIS 286 287 287 HIS HIS A . n 
A 1 287 VAL 287 288 288 VAL VAL A . n 
A 1 288 LEU 288 289 289 LEU LEU A . n 
A 1 289 PRO 289 290 290 PRO PRO A . n 
A 1 290 GLN 290 291 291 GLN GLN A . n 
A 1 291 GLU 291 292 292 GLU GLU A . n 
A 1 292 SER 292 293 293 SER SER A . n 
A 1 293 VAL 293 294 294 VAL VAL A . n 
A 1 294 PHE 294 295 295 PHE PHE A . n 
A 1 295 ARG 295 296 296 ARG ARG A . n 
A 1 296 PHE 296 297 297 PHE PHE A . n 
A 1 297 SER 297 298 298 SER SER A . n 
A 1 298 PHE 298 299 299 PHE PHE A . n 
A 1 299 VAL 299 300 300 VAL VAL A . n 
A 1 300 PRO 300 301 301 PRO PRO A . n 
A 1 301 VAL 301 302 302 VAL VAL A . n 
A 1 302 VAL 302 303 303 VAL VAL A . n 
A 1 303 ASP 303 304 304 ASP ASP A . n 
A 1 304 GLY 304 305 305 GLY GLY A . n 
A 1 305 ASP 305 306 306 ASP ASP A . n 
A 1 306 PHE 306 307 307 PHE PHE A . n 
A 1 307 LEU 307 308 308 LEU LEU A . n 
A 1 308 SER 308 309 309 SER SER A . n 
A 1 309 ASP 309 310 310 ASP ASP A . n 
A 1 310 THR 310 311 311 THR THR A . n 
A 1 311 PRO 311 312 312 PRO PRO A . n 
A 1 312 GLU 312 313 313 GLU GLU A . n 
A 1 313 ALA 313 314 314 ALA ALA A . n 
A 1 314 LEU 314 315 315 LEU LEU A . n 
A 1 315 ILE 315 316 316 ILE ILE A . n 
A 1 316 ASN 316 317 317 ASN ASN A . n 
A 1 317 ALA 317 318 318 ALA ALA A . n 
A 1 318 GLY 318 319 319 GLY GLY A . n 
A 1 319 ASP 319 320 320 ASP ASP A . n 
A 1 320 PHE 320 321 321 PHE PHE A . n 
A 1 321 HIS 321 322 322 HIS HIS A . n 
A 1 322 GLY 322 323 323 GLY GLY A . n 
A 1 323 LEU 323 324 324 LEU LEU A . n 
A 1 324 GLN 324 325 325 GLN GLN A . n 
A 1 325 VAL 325 326 326 VAL VAL A . n 
A 1 326 LEU 326 327 327 LEU LEU A . n 
A 1 327 VAL 327 328 328 VAL VAL A . n 
A 1 328 GLY 328 329 329 GLY GLY A . n 
A 1 329 VAL 329 330 330 VAL VAL A . n 
A 1 330 VAL 330 331 331 VAL VAL A . n 
A 1 331 LYS 331 332 332 LYS LYS A . n 
A 1 332 ASP 332 333 333 ASP ASP A . n 
A 1 333 GLU 333 334 334 GLU GLU A . n 
A 1 334 GLY 334 335 335 GLY GLY A . n 
A 1 335 SER 335 336 336 SER SER A . n 
A 1 336 TYR 336 337 337 TYR TYR A . n 
A 1 337 PHE 337 338 338 PHE PHE A . n 
A 1 338 LEU 338 339 339 LEU LEU A . n 
A 1 339 VAL 339 340 340 VAL VAL A . n 
A 1 340 TYR 340 341 341 TYR TYR A . n 
A 1 341 GLY 341 342 342 GLY GLY A . n 
A 1 342 ALA 342 343 343 ALA ALA A . n 
A 1 343 PRO 343 344 344 PRO PRO A . n 
A 1 344 GLY 344 345 345 GLY GLY A . n 
A 1 345 PHE 345 346 346 PHE PHE A . n 
A 1 346 SER 346 347 347 SER SER A . n 
A 1 347 LYS 347 348 348 LYS LYS A . n 
A 1 348 ASP 348 349 349 ASP ASP A . n 
A 1 349 ASN 349 350 350 ASN ASN A . n 
A 1 350 GLU 350 351 351 GLU GLU A . n 
A 1 351 SER 351 352 352 SER SER A . n 
A 1 352 LEU 352 353 353 LEU LEU A . n 
A 1 353 ILE 353 354 354 ILE ILE A . n 
A 1 354 SER 354 355 355 SER SER A . n 
A 1 355 ARG 355 356 356 ARG ARG A . n 
A 1 356 ALA 356 357 357 ALA ALA A . n 
A 1 357 GLU 357 358 358 GLU GLU A . n 
A 1 358 PHE 358 359 359 PHE PHE A . n 
A 1 359 LEU 359 360 360 LEU LEU A . n 
A 1 360 ALA 360 361 361 ALA ALA A . n 
A 1 361 GLY 361 362 362 GLY GLY A . n 
A 1 362 VAL 362 363 363 VAL VAL A . n 
A 1 363 ARG 363 364 364 ARG ARG A . n 
A 1 364 VAL 364 365 365 VAL VAL A . n 
A 1 365 GLY 365 366 366 GLY GLY A . n 
A 1 366 VAL 366 367 367 VAL VAL A . n 
A 1 367 PRO 367 368 368 PRO PRO A . n 
A 1 368 GLN 368 369 369 GLN GLN A . n 
A 1 369 VAL 369 370 370 VAL VAL A . n 
A 1 370 SER 370 371 371 SER SER A . n 
A 1 371 ASP 371 372 372 ASP ASP A . n 
A 1 372 LEU 372 373 373 LEU LEU A . n 
A 1 373 ALA 373 374 374 ALA ALA A . n 
A 1 374 ALA 374 375 375 ALA ALA A . n 
A 1 375 GLU 375 376 376 GLU GLU A . n 
A 1 376 ALA 376 377 377 ALA ALA A . n 
A 1 377 VAL 377 378 378 VAL VAL A . n 
A 1 378 VAL 378 379 379 VAL VAL A . n 
A 1 379 LEU 379 380 380 LEU LEU A . n 
A 1 380 HIS 380 381 381 HIS HIS A . n 
A 1 381 TYR 381 382 382 TYR TYR A . n 
A 1 382 THR 382 383 383 THR THR A . n 
A 1 383 ASP 383 384 384 ASP ASP A . n 
A 1 384 TRP 384 385 385 TRP TRP A . n 
A 1 385 LEU 385 386 386 LEU LEU A . n 
A 1 386 HIS 386 387 387 HIS HIS A . n 
A 1 387 PRO 387 388 388 PRO PRO A . n 
A 1 388 GLU 388 389 389 GLU GLU A . n 
A 1 389 ASP 389 390 390 ASP ASP A . n 
A 1 390 PRO 390 391 391 PRO PRO A . n 
A 1 391 ALA 391 392 392 ALA ALA A . n 
A 1 392 ARG 392 393 393 ARG ARG A . n 
A 1 393 LEU 393 394 394 LEU LEU A . n 
A 1 394 ARG 394 395 395 ARG ARG A . n 
A 1 395 GLU 395 396 396 GLU GLU A . n 
A 1 396 ALA 396 397 397 ALA ALA A . n 
A 1 397 LEU 397 398 398 LEU LEU A . n 
A 1 398 SER 398 399 399 SER SER A . n 
A 1 399 ASP 399 400 400 ASP ASP A . n 
A 1 400 VAL 400 401 401 VAL VAL A . n 
A 1 401 VAL 401 402 402 VAL VAL A . n 
A 1 402 GLY 402 403 403 GLY GLY A . n 
A 1 403 ASP 403 404 404 ASP ASP A . n 
A 1 404 HIS 404 405 405 HIS HIS A . n 
A 1 405 ASN 405 406 406 ASN ASN A . n 
A 1 406 VAL 406 407 407 VAL VAL A . n 
A 1 407 VAL 407 408 408 VAL VAL A . n 
A 1 408 CYS 408 409 409 CYS CYS A . n 
A 1 409 PRO 409 410 410 PRO PRO A . n 
A 1 410 VAL 410 411 411 VAL VAL A . n 
A 1 411 ALA 411 412 412 ALA ALA A . n 
A 1 412 GLN 412 413 413 GLN GLN A . n 
A 1 413 LEU 413 414 414 LEU LEU A . n 
A 1 414 ALA 414 415 415 ALA ALA A . n 
A 1 415 GLY 415 416 416 GLY GLY A . n 
A 1 416 ARG 416 417 417 ARG ARG A . n 
A 1 417 LEU 417 418 418 LEU LEU A . n 
A 1 418 ALA 418 419 419 ALA ALA A . n 
A 1 419 ALA 419 420 420 ALA ALA A . n 
A 1 420 GLN 420 421 421 GLN GLN A . n 
A 1 421 GLY 421 422 422 GLY GLY A . n 
A 1 422 ALA 422 423 423 ALA ALA A . n 
A 1 423 ARG 423 424 424 ARG ARG A . n 
A 1 424 VAL 424 425 425 VAL VAL A . n 
A 1 425 TYR 425 426 426 TYR TYR A . n 
A 1 426 ALA 426 427 427 ALA ALA A . n 
A 1 427 TYR 427 428 428 TYR TYR A . n 
A 1 428 VAL 428 429 429 VAL VAL A . n 
A 1 429 PHE 429 430 430 PHE PHE A . n 
A 1 430 GLU 430 431 431 GLU GLU A . n 
A 1 431 HIS 431 432 432 HIS HIS A . n 
A 1 432 ARG 432 433 433 ARG ARG A . n 
A 1 433 ALA 433 434 434 ALA ALA A . n 
A 1 434 SER 434 435 435 SER SER A . n 
A 1 435 THR 435 436 436 THR THR A . n 
A 1 436 LEU 436 437 437 LEU LEU A . n 
A 1 437 SER 437 438 438 SER SER A . n 
A 1 438 TRP 438 439 439 TRP TRP A . n 
A 1 439 PRO 439 440 440 PRO PRO A . n 
A 1 440 LEU 440 441 441 LEU LEU A . n 
A 1 441 TRP 441 442 442 TRP TRP A . n 
A 1 442 MET 442 443 443 MET MET A . n 
A 1 443 GLY 443 444 444 GLY GLY A . n 
A 1 444 VAL 444 445 445 VAL VAL A . n 
A 1 445 PRO 445 446 446 PRO PRO A . n 
A 1 446 HIS 446 447 447 HIS HIS A . n 
A 1 447 GLY 447 448 448 GLY GLY A . n 
A 1 448 TYR 448 449 449 TYR TYR A . n 
A 1 449 GLU 449 450 450 GLU GLU A . n 
A 1 450 ILE 450 451 451 ILE ILE A . n 
A 1 451 GLU 451 452 452 GLU GLU A . n 
A 1 452 PHE 452 453 453 PHE PHE A . n 
A 1 453 ILE 453 454 454 ILE ILE A . n 
A 1 454 PHE 454 455 455 PHE PHE A . n 
A 1 455 GLY 455 456 456 GLY GLY A . n 
A 1 456 ILE 456 457 457 ILE ILE A . n 
A 1 457 PRO 457 458 458 PRO PRO A . n 
A 1 458 LEU 458 459 459 LEU LEU A . n 
A 1 459 ASP 459 460 460 ASP ASP A . n 
A 1 460 PRO 460 461 461 PRO PRO A . n 
A 1 461 SER 461 462 462 SER SER A . n 
A 1 462 ARG 462 463 463 ARG ARG A . n 
A 1 463 ASN 463 464 464 ASN ASN A . n 
A 1 464 TYR 464 465 465 TYR TYR A . n 
A 1 465 THR 465 466 466 THR THR A . n 
A 1 466 ALA 466 467 467 ALA ALA A . n 
A 1 467 GLU 467 468 468 GLU GLU A . n 
A 1 468 GLU 468 469 469 GLU GLU A . n 
A 1 469 LYS 469 470 470 LYS LYS A . n 
A 1 470 ILE 470 471 471 ILE ILE A . n 
A 1 471 PHE 471 472 472 PHE PHE A . n 
A 1 472 ALA 472 473 473 ALA ALA A . n 
A 1 473 GLN 473 474 474 GLN GLN A . n 
A 1 474 ARG 474 475 475 ARG ARG A . n 
A 1 475 LEU 475 476 476 LEU LEU A . n 
A 1 476 MET 476 477 477 MET MET A . n 
A 1 477 ARG 477 478 478 ARG ARG A . n 
A 1 478 TYR 478 479 479 TYR TYR A . n 
A 1 479 TRP 479 480 480 TRP TRP A . n 
A 1 480 ALA 480 481 481 ALA ALA A . n 
A 1 481 ASN 481 482 482 ASN ASN A . n 
A 1 482 PHE 482 483 483 PHE PHE A . n 
A 1 483 ALA 483 484 484 ALA ALA A . n 
A 1 484 ARG 484 485 485 ARG ARG A . n 
A 1 485 THR 485 486 486 THR THR A . n 
A 1 486 GLY 486 487 487 GLY GLY A . n 
A 1 487 ASP 487 488 488 ASP ASP A . n 
A 1 488 PRO 488 489 489 PRO PRO A . n 
A 1 489 ASN 489 490 490 ASN ASN A . n 
A 1 490 GLU 490 491 491 GLU GLU A . n 
A 1 491 PRO 491 492 492 PRO PRO A . n 
A 1 492 ARG 492 493 493 ARG ARG A . n 
A 1 493 ASP 493 494 494 ASP ASP A . n 
A 1 494 PRO 494 495 495 PRO PRO A . n 
A 1 495 LYS 495 496 496 LYS LYS A . n 
A 1 496 ALA 496 497 497 ALA ALA A . n 
A 1 497 PRO 497 498 498 PRO PRO A . n 
A 1 498 GLN 498 499 499 GLN GLN A . n 
A 1 499 TRP 499 500 500 TRP TRP A . n 
A 1 500 PRO 500 501 501 PRO PRO A . n 
A 1 501 PRO 501 502 502 PRO PRO A . n 
A 1 502 TYR 502 503 503 TYR TYR A . n 
A 1 503 THR 503 504 504 THR THR A . n 
A 1 504 ALA 504 505 505 ALA ALA A . n 
A 1 505 GLY 505 506 506 GLY GLY A . n 
A 1 506 ALA 506 507 507 ALA ALA A . n 
A 1 507 GLN 507 508 508 GLN GLN A . n 
A 1 508 GLN 508 509 509 GLN GLN A . n 
A 1 509 TYR 509 510 510 TYR TYR A . n 
A 1 510 VAL 510 511 511 VAL VAL A . n 
A 1 511 SER 511 512 512 SER SER A . n 
A 1 512 LEU 512 513 513 LEU LEU A . n 
A 1 513 ASP 513 514 514 ASP ASP A . n 
A 1 514 LEU 514 515 515 LEU LEU A . n 
A 1 515 ARG 515 516 516 ARG ARG A . n 
A 1 516 PRO 516 517 517 PRO PRO A . n 
A 1 517 LEU 517 518 518 LEU LEU A . n 
A 1 518 GLU 518 519 519 GLU GLU A . n 
A 1 519 VAL 519 520 520 VAL VAL A . n 
A 1 520 ARG 520 521 521 ARG ARG A . n 
A 1 521 ARG 521 522 522 ARG ARG A . n 
A 1 522 GLY 522 523 523 GLY GLY A . n 
A 1 523 LEU 523 524 524 LEU LEU A . n 
A 1 524 ARG 524 525 525 ARG ARG A . n 
A 1 525 ALA 525 526 526 ALA ALA A . n 
A 1 526 GLN 526 527 527 GLN GLN A . n 
A 1 527 ALA 527 528 528 ALA ALA A . n 
A 1 528 CYS 528 529 529 CYS CYS A . n 
A 1 529 ALA 529 530 530 ALA ALA A . n 
A 1 530 PHE 530 531 531 PHE PHE A . n 
A 1 531 TRP 531 532 532 TRP TRP A . n 
A 1 532 ASN 532 533 533 ASN ASN A . n 
A 1 533 ARG 533 534 534 ARG ARG A . n 
A 1 534 PHE 534 535 535 PHE PHE A . n 
A 1 535 LEU 535 536 536 LEU LEU A . n 
A 1 536 PRO 536 537 537 PRO PRO A . n 
A 1 537 LYS 537 538 538 LYS LYS A . n 
A 1 538 LEU 538 539 539 LEU LEU A . n 
A 1 539 LEU 539 540 540 LEU LEU A . n 
A 1 540 SER 540 541 541 SER SER A . n 
A 1 541 ALA 541 542 542 ALA ALA A . n 
A 1 542 THR 542 543 ?   ?   ?   A . n 
B 1 1   GLY 1   2   ?   ?   ?   B . n 
B 1 2   ARG 2   3   ?   ?   ?   B . n 
B 1 3   GLU 3   4   4   GLU GLU B . n 
B 1 4   ASP 4   5   5   ASP ASP B . n 
B 1 5   ALA 5   6   6   ALA ALA B . n 
B 1 6   GLU 6   7   7   GLU GLU B . n 
B 1 7   LEU 7   8   8   LEU LEU B . n 
B 1 8   LEU 8   9   9   LEU LEU B . n 
B 1 9   VAL 9   10  10  VAL VAL B . n 
B 1 10  THR 10  11  11  THR THR B . n 
B 1 11  VAL 11  12  12  VAL VAL B . n 
B 1 12  ARG 12  13  13  ARG ARG B . n 
B 1 13  GLY 13  14  14  GLY GLY B . n 
B 1 14  GLY 14  15  15  GLY GLY B . n 
B 1 15  ARG 15  16  16  ARG ARG B . n 
B 1 16  LEU 16  17  17  LEU LEU B . n 
B 1 17  ARG 17  18  18  ARG ARG B . n 
B 1 18  GLY 18  19  19  GLY GLY B . n 
B 1 19  ILE 19  20  20  ILE ILE B . n 
B 1 20  ARG 20  21  21  ARG ARG B . n 
B 1 21  LEU 21  22  22  LEU LEU B . n 
B 1 22  LYS 22  23  23  LYS LYS B . n 
B 1 23  THR 23  24  24  THR THR B . n 
B 1 24  PRO 24  25  25  PRO PRO B . n 
B 1 25  GLY 25  26  26  GLY GLY B . n 
B 1 26  GLY 26  27  27  GLY GLY B . n 
B 1 27  PRO 27  28  28  PRO PRO B . n 
B 1 28  VAL 28  29  29  VAL VAL B . n 
B 1 29  SER 29  30  30  SER SER B . n 
B 1 30  ALA 30  31  31  ALA ALA B . n 
B 1 31  PHE 31  32  32  PHE PHE B . n 
B 1 32  LEU 32  33  33  LEU LEU B . n 
B 1 33  GLY 33  34  34  GLY GLY B . n 
B 1 34  ILE 34  35  35  ILE ILE B . n 
B 1 35  PRO 35  36  36  PRO PRO B . n 
B 1 36  PHE 36  37  37  PHE PHE B . n 
B 1 37  ALA 37  38  38  ALA ALA B . n 
B 1 38  GLU 38  39  39  GLU GLU B . n 
B 1 39  PRO 39  40  40  PRO PRO B . n 
B 1 40  PRO 40  41  41  PRO PRO B . n 
B 1 41  MET 41  42  42  MET MET B . n 
B 1 42  GLY 42  43  43  GLY GLY B . n 
B 1 43  PRO 43  44  44  PRO PRO B . n 
B 1 44  ARG 44  45  45  ARG ARG B . n 
B 1 45  ARG 45  46  46  ARG ARG B . n 
B 1 46  PHE 46  47  47  PHE PHE B . n 
B 1 47  LEU 47  48  48  LEU LEU B . n 
B 1 48  PRO 48  49  49  PRO PRO B . n 
B 1 49  PRO 49  50  50  PRO PRO B . n 
B 1 50  GLU 50  51  51  GLU GLU B . n 
B 1 51  PRO 51  52  52  PRO PRO B . n 
B 1 52  LYS 52  53  53  LYS LYS B . n 
B 1 53  GLN 53  54  54  GLN GLN B . n 
B 1 54  PRO 54  55  55  PRO PRO B . n 
B 1 55  TRP 55  56  56  TRP TRP B . n 
B 1 56  SER 56  57  57  SER SER B . n 
B 1 57  GLY 57  58  58  GLY GLY B . n 
B 1 58  VAL 58  59  59  VAL VAL B . n 
B 1 59  VAL 59  60  60  VAL VAL B . n 
B 1 60  ASP 60  61  61  ASP ASP B . n 
B 1 61  ALA 61  62  62  ALA ALA B . n 
B 1 62  THR 62  63  63  THR THR B . n 
B 1 63  THR 63  64  64  THR THR B . n 
B 1 64  PHE 64  65  65  PHE PHE B . n 
B 1 65  GLN 65  66  66  GLN GLN B . n 
B 1 66  SER 66  67  67  SER SER B . n 
B 1 67  VAL 67  68  68  VAL VAL B . n 
B 1 68  CYS 68  69  69  CYS CYS B . n 
B 1 69  TYR 69  70  70  TYR TYR B . n 
B 1 70  GLN 70  71  71  GLN GLN B . n 
B 1 71  TYR 71  72  72  TYR TYR B . n 
B 1 72  VAL 72  73  73  VAL VAL B . n 
B 1 73  ASP 73  74  74  ASP ASP B . n 
B 1 74  THR 74  75  75  THR THR B . n 
B 1 75  LEU 75  76  76  LEU LEU B . n 
B 1 76  TYR 76  77  77  TYR TYR B . n 
B 1 77  PRO 77  78  78  PRO PRO B . n 
B 1 78  GLY 78  79  79  GLY GLY B . n 
B 1 79  PHE 79  80  80  PHE PHE B . n 
B 1 80  GLU 80  81  81  GLU GLU B . n 
B 1 81  GLY 81  82  82  GLY GLY B . n 
B 1 82  THR 82  83  83  THR THR B . n 
B 1 83  GLU 83  84  84  GLU GLU B . n 
B 1 84  MET 84  85  85  MET MET B . n 
B 1 85  TRP 85  86  86  TRP TRP B . n 
B 1 86  ASN 86  87  87  ASN ASN B . n 
B 1 87  PRO 87  88  88  PRO PRO B . n 
B 1 88  ASN 88  89  89  ASN ASN B . n 
B 1 89  ARG 89  90  90  ARG ARG B . n 
B 1 90  GLU 90  91  91  GLU GLU B . n 
B 1 91  LEU 91  92  92  LEU LEU B . n 
B 1 92  SER 92  93  93  SER SER B . n 
B 1 93  GLU 93  94  94  GLU GLU B . n 
B 1 94  ASP 94  95  95  ASP ASP B . n 
B 1 95  CYS 95  96  96  CYS CYS B . n 
B 1 96  LEU 96  97  97  LEU LEU B . n 
B 1 97  TYR 97  98  98  TYR TYR B . n 
B 1 98  LEU 98  99  99  LEU LEU B . n 
B 1 99  ASN 99  100 100 ASN ASN B . n 
B 1 100 VAL 100 101 101 VAL VAL B . n 
B 1 101 TRP 101 102 102 TRP TRP B . n 
B 1 102 THR 102 103 103 THR THR B . n 
B 1 103 PRO 103 104 104 PRO PRO B . n 
B 1 104 TYR 104 105 105 TYR TYR B . n 
B 1 105 PRO 105 106 106 PRO PRO B . n 
B 1 106 ARG 106 107 107 ARG ARG B . n 
B 1 107 PRO 107 108 108 PRO PRO B . n 
B 1 108 THR 108 109 109 THR THR B . n 
B 1 109 SER 109 110 110 SER SER B . n 
B 1 110 PRO 110 111 111 PRO PRO B . n 
B 1 111 THR 111 112 112 THR THR B . n 
B 1 112 PRO 112 113 113 PRO PRO B . n 
B 1 113 VAL 113 114 114 VAL VAL B . n 
B 1 114 LEU 114 115 115 LEU LEU B . n 
B 1 115 VAL 115 116 116 VAL VAL B . n 
B 1 116 TRP 116 117 117 TRP TRP B . n 
B 1 117 ILE 117 118 118 ILE ILE B . n 
B 1 118 TYR 118 119 119 TYR TYR B . n 
B 1 119 GLY 119 120 120 GLY GLY B . n 
B 1 120 GLY 120 121 121 GLY GLY B . n 
B 1 121 GLY 121 122 122 GLY GLY B . n 
B 1 122 PHE 122 123 123 PHE PHE B . n 
B 1 123 TYR 123 124 124 TYR TYR B . n 
B 1 124 SER 124 125 125 SER SER B . n 
B 1 125 GLY 125 126 126 GLY GLY B . n 
B 1 126 ALA 126 127 127 ALA ALA B . n 
B 1 127 SER 127 128 128 SER SER B . n 
B 1 128 SER 128 129 129 SER SER B . n 
B 1 129 LEU 129 130 130 LEU LEU B . n 
B 1 130 ASP 130 131 131 ASP ASP B . n 
B 1 131 VAL 131 132 132 VAL VAL B . n 
B 1 132 TYR 132 133 133 TYR TYR B . n 
B 1 133 ASP 133 134 134 ASP ASP B . n 
B 1 134 GLY 134 135 135 GLY GLY B . n 
B 1 135 ARG 135 136 136 ARG ARG B . n 
B 1 136 PHE 136 137 137 PHE PHE B . n 
B 1 137 LEU 137 138 138 LEU LEU B . n 
B 1 138 VAL 138 139 139 VAL VAL B . n 
B 1 139 GLN 139 140 140 GLN GLN B . n 
B 1 140 ALA 140 141 141 ALA ALA B . n 
B 1 141 GLU 141 142 142 GLU GLU B . n 
B 1 142 ARG 142 143 143 ARG ARG B . n 
B 1 143 THR 143 144 144 THR THR B . n 
B 1 144 VAL 144 145 145 VAL VAL B . n 
B 1 145 LEU 145 146 146 LEU LEU B . n 
B 1 146 VAL 146 147 147 VAL VAL B . n 
B 1 147 SER 147 148 148 SER SER B . n 
B 1 148 MET 148 149 149 MET MET B . n 
B 1 149 ASN 149 150 150 ASN ASN B . n 
B 1 150 TYR 150 151 151 TYR TYR B . n 
B 1 151 ARG 151 152 152 ARG ARG B . n 
B 1 152 VAL 152 153 153 VAL VAL B . n 
B 1 153 GLY 153 154 154 GLY GLY B . n 
B 1 154 ALA 154 155 155 ALA ALA B . n 
B 1 155 PHE 155 156 156 PHE PHE B . n 
B 1 156 GLY 156 157 157 GLY GLY B . n 
B 1 157 PHE 157 158 158 PHE PHE B . n 
B 1 158 LEU 158 159 159 LEU LEU B . n 
B 1 159 ALA 159 160 160 ALA ALA B . n 
B 1 160 LEU 160 161 161 LEU LEU B . n 
B 1 161 PRO 161 162 162 PRO PRO B . n 
B 1 162 GLY 162 163 163 GLY GLY B . n 
B 1 163 SER 163 164 164 SER SER B . n 
B 1 164 ARG 164 165 165 ARG ARG B . n 
B 1 165 GLU 165 166 166 GLU GLU B . n 
B 1 166 ALA 166 167 167 ALA ALA B . n 
B 1 167 PRO 167 168 168 PRO PRO B . n 
B 1 168 GLY 168 169 169 GLY GLY B . n 
B 1 169 ASN 169 170 170 ASN ASN B . n 
B 1 170 VAL 170 171 171 VAL VAL B . n 
B 1 171 GLY 171 172 172 GLY GLY B . n 
B 1 172 LEU 172 173 173 LEU LEU B . n 
B 1 173 LEU 173 174 174 LEU LEU B . n 
B 1 174 ASP 174 175 175 ASP ASP B . n 
B 1 175 GLN 175 176 176 GLN GLN B . n 
B 1 176 ARG 176 177 177 ARG ARG B . n 
B 1 177 LEU 177 178 178 LEU LEU B . n 
B 1 178 ALA 178 179 179 ALA ALA B . n 
B 1 179 LEU 179 180 180 LEU LEU B . n 
B 1 180 GLN 180 181 181 GLN GLN B . n 
B 1 181 TRP 181 182 182 TRP TRP B . n 
B 1 182 VAL 182 183 183 VAL VAL B . n 
B 1 183 GLN 183 184 184 GLN GLN B . n 
B 1 184 GLU 184 185 185 GLU GLU B . n 
B 1 185 ASN 185 186 186 ASN ASN B . n 
B 1 186 VAL 186 187 187 VAL VAL B . n 
B 1 187 ALA 187 188 188 ALA ALA B . n 
B 1 188 ALA 188 189 189 ALA ALA B . n 
B 1 189 PHE 189 190 190 PHE PHE B . n 
B 1 190 GLY 190 191 191 GLY GLY B . n 
B 1 191 GLY 191 192 192 GLY GLY B . n 
B 1 192 ASP 192 193 193 ASP ASP B . n 
B 1 193 PRO 193 194 194 PRO PRO B . n 
B 1 194 THR 194 195 195 THR THR B . n 
B 1 195 SER 195 196 196 SER SER B . n 
B 1 196 VAL 196 197 197 VAL VAL B . n 
B 1 197 THR 197 198 198 THR THR B . n 
B 1 198 LEU 198 199 199 LEU LEU B . n 
B 1 199 PHE 199 200 200 PHE PHE B . n 
B 1 200 GLY 200 201 201 GLY GLY B . n 
B 1 201 GLU 201 202 202 GLU GLU B . n 
B 1 202 SER 202 203 203 SER SER B . n 
B 1 203 ALA 203 204 204 ALA ALA B . n 
B 1 204 GLY 204 205 205 GLY GLY B . n 
B 1 205 ALA 205 206 206 ALA ALA B . n 
B 1 206 ALA 206 207 207 ALA ALA B . n 
B 1 207 SER 207 208 208 SER SER B . n 
B 1 208 VAL 208 209 209 VAL VAL B . n 
B 1 209 GLY 209 210 210 GLY GLY B . n 
B 1 210 MET 210 211 211 MET MET B . n 
B 1 211 HIS 211 212 212 HIS HIS B . n 
B 1 212 LEU 212 213 213 LEU LEU B . n 
B 1 213 LEU 213 214 214 LEU LEU B . n 
B 1 214 SER 214 215 215 SER SER B . n 
B 1 215 PRO 215 216 216 PRO PRO B . n 
B 1 216 PRO 216 217 217 PRO PRO B . n 
B 1 217 SER 217 218 218 SER SER B . n 
B 1 218 ARG 218 219 219 ARG ARG B . n 
B 1 219 GLY 219 220 220 GLY GLY B . n 
B 1 220 LEU 220 221 221 LEU LEU B . n 
B 1 221 PHE 221 222 222 PHE PHE B . n 
B 1 222 HIS 222 223 223 HIS HIS B . n 
B 1 223 ARG 223 224 224 ARG ARG B . n 
B 1 224 ALA 224 225 225 ALA ALA B . n 
B 1 225 VAL 225 226 226 VAL VAL B . n 
B 1 226 LEU 226 227 227 LEU LEU B . n 
B 1 227 GLN 227 228 228 GLN GLN B . n 
B 1 228 SER 228 229 229 SER SER B . n 
B 1 229 GLY 229 230 230 GLY GLY B . n 
B 1 230 ALA 230 231 231 ALA ALA B . n 
B 1 231 PRO 231 232 232 PRO PRO B . n 
B 1 232 ASN 232 233 233 ASN ASN B . n 
B 1 233 GLY 233 234 234 GLY GLY B . n 
B 1 234 PRO 234 235 235 PRO PRO B . n 
B 1 235 TRP 235 236 236 TRP TRP B . n 
B 1 236 ALA 236 237 237 ALA ALA B . n 
B 1 237 THR 237 238 238 THR THR B . n 
B 1 238 VAL 238 239 239 VAL VAL B . n 
B 1 239 GLY 239 240 240 GLY GLY B . n 
B 1 240 MET 240 241 241 MET MET B . n 
B 1 241 GLY 241 242 242 GLY GLY B . n 
B 1 242 GLU 242 243 243 GLU GLU B . n 
B 1 243 ALA 243 244 244 ALA ALA B . n 
B 1 244 ARG 244 245 245 ARG ARG B . n 
B 1 245 ARG 245 246 246 ARG ARG B . n 
B 1 246 ARG 246 247 247 ARG ARG B . n 
B 1 247 ALA 247 248 248 ALA ALA B . n 
B 1 248 THR 248 249 249 THR THR B . n 
B 1 249 GLN 249 250 250 GLN GLN B . n 
B 1 250 LEU 250 251 251 LEU LEU B . n 
B 1 251 ALA 251 252 252 ALA ALA B . n 
B 1 252 HIS 252 253 253 HIS HIS B . n 
B 1 253 LEU 253 254 254 LEU LEU B . n 
B 1 254 VAL 254 255 255 VAL VAL B . n 
B 1 255 GLY 255 256 256 GLY GLY B . n 
B 1 256 CYS 256 257 257 CYS CYS B . n 
B 1 257 PRO 257 258 258 PRO PRO B . n 
B 1 258 PRO 258 259 259 PRO PRO B . n 
B 1 259 GLY 259 260 ?   ?   ?   B . n 
B 1 260 GLY 260 261 ?   ?   ?   B . n 
B 1 261 THR 261 262 262 THR THR B . n 
B 1 262 GLY 262 263 263 GLY GLY B . n 
B 1 263 GLY 263 264 264 GLY GLY B . n 
B 1 264 ASN 264 265 265 ASN ASN B . n 
B 1 265 ASP 265 266 266 ASP ASP B . n 
B 1 266 THR 266 267 267 THR THR B . n 
B 1 267 GLU 267 268 268 GLU GLU B . n 
B 1 268 LEU 268 269 269 LEU LEU B . n 
B 1 269 VAL 269 270 270 VAL VAL B . n 
B 1 270 ALA 270 271 271 ALA ALA B . n 
B 1 271 CYS 271 272 272 CYS CYS B . n 
B 1 272 LEU 272 273 273 LEU LEU B . n 
B 1 273 ARG 273 274 274 ARG ARG B . n 
B 1 274 THR 274 275 275 THR THR B . n 
B 1 275 ARG 275 276 276 ARG ARG B . n 
B 1 276 PRO 276 277 277 PRO PRO B . n 
B 1 277 ALA 277 278 278 ALA ALA B . n 
B 1 278 GLN 278 279 279 GLN GLN B . n 
B 1 279 VAL 279 280 280 VAL VAL B . n 
B 1 280 LEU 280 281 281 LEU LEU B . n 
B 1 281 VAL 281 282 282 VAL VAL B . n 
B 1 282 ASN 282 283 283 ASN ASN B . n 
B 1 283 HIS 283 284 284 HIS HIS B . n 
B 1 284 GLU 284 285 285 GLU GLU B . n 
B 1 285 TRP 285 286 286 TRP TRP B . n 
B 1 286 HIS 286 287 287 HIS HIS B . n 
B 1 287 VAL 287 288 288 VAL VAL B . n 
B 1 288 LEU 288 289 289 LEU LEU B . n 
B 1 289 PRO 289 290 290 PRO PRO B . n 
B 1 290 GLN 290 291 291 GLN GLN B . n 
B 1 291 GLU 291 292 292 GLU GLU B . n 
B 1 292 SER 292 293 293 SER SER B . n 
B 1 293 VAL 293 294 294 VAL VAL B . n 
B 1 294 PHE 294 295 295 PHE PHE B . n 
B 1 295 ARG 295 296 296 ARG ARG B . n 
B 1 296 PHE 296 297 297 PHE PHE B . n 
B 1 297 SER 297 298 298 SER SER B . n 
B 1 298 PHE 298 299 299 PHE PHE B . n 
B 1 299 VAL 299 300 300 VAL VAL B . n 
B 1 300 PRO 300 301 301 PRO PRO B . n 
B 1 301 VAL 301 302 302 VAL VAL B . n 
B 1 302 VAL 302 303 303 VAL VAL B . n 
B 1 303 ASP 303 304 304 ASP ASP B . n 
B 1 304 GLY 304 305 305 GLY GLY B . n 
B 1 305 ASP 305 306 306 ASP ASP B . n 
B 1 306 PHE 306 307 307 PHE PHE B . n 
B 1 307 LEU 307 308 308 LEU LEU B . n 
B 1 308 SER 308 309 309 SER SER B . n 
B 1 309 ASP 309 310 310 ASP ASP B . n 
B 1 310 THR 310 311 311 THR THR B . n 
B 1 311 PRO 311 312 312 PRO PRO B . n 
B 1 312 GLU 312 313 313 GLU GLU B . n 
B 1 313 ALA 313 314 314 ALA ALA B . n 
B 1 314 LEU 314 315 315 LEU LEU B . n 
B 1 315 ILE 315 316 316 ILE ILE B . n 
B 1 316 ASN 316 317 317 ASN ASN B . n 
B 1 317 ALA 317 318 318 ALA ALA B . n 
B 1 318 GLY 318 319 319 GLY GLY B . n 
B 1 319 ASP 319 320 320 ASP ASP B . n 
B 1 320 PHE 320 321 321 PHE PHE B . n 
B 1 321 HIS 321 322 322 HIS HIS B . n 
B 1 322 GLY 322 323 323 GLY GLY B . n 
B 1 323 LEU 323 324 324 LEU LEU B . n 
B 1 324 GLN 324 325 325 GLN GLN B . n 
B 1 325 VAL 325 326 326 VAL VAL B . n 
B 1 326 LEU 326 327 327 LEU LEU B . n 
B 1 327 VAL 327 328 328 VAL VAL B . n 
B 1 328 GLY 328 329 329 GLY GLY B . n 
B 1 329 VAL 329 330 330 VAL VAL B . n 
B 1 330 VAL 330 331 331 VAL VAL B . n 
B 1 331 LYS 331 332 332 LYS LYS B . n 
B 1 332 ASP 332 333 333 ASP ASP B . n 
B 1 333 GLU 333 334 334 GLU GLU B . n 
B 1 334 GLY 334 335 335 GLY GLY B . n 
B 1 335 SER 335 336 336 SER SER B . n 
B 1 336 TYR 336 337 337 TYR TYR B . n 
B 1 337 PHE 337 338 338 PHE PHE B . n 
B 1 338 LEU 338 339 339 LEU LEU B . n 
B 1 339 VAL 339 340 340 VAL VAL B . n 
B 1 340 TYR 340 341 341 TYR TYR B . n 
B 1 341 GLY 341 342 342 GLY GLY B . n 
B 1 342 ALA 342 343 343 ALA ALA B . n 
B 1 343 PRO 343 344 344 PRO PRO B . n 
B 1 344 GLY 344 345 345 GLY GLY B . n 
B 1 345 PHE 345 346 346 PHE PHE B . n 
B 1 346 SER 346 347 347 SER SER B . n 
B 1 347 LYS 347 348 348 LYS LYS B . n 
B 1 348 ASP 348 349 349 ASP ASP B . n 
B 1 349 ASN 349 350 350 ASN ASN B . n 
B 1 350 GLU 350 351 351 GLU GLU B . n 
B 1 351 SER 351 352 352 SER SER B . n 
B 1 352 LEU 352 353 353 LEU LEU B . n 
B 1 353 ILE 353 354 354 ILE ILE B . n 
B 1 354 SER 354 355 355 SER SER B . n 
B 1 355 ARG 355 356 356 ARG ARG B . n 
B 1 356 ALA 356 357 357 ALA ALA B . n 
B 1 357 GLU 357 358 358 GLU GLU B . n 
B 1 358 PHE 358 359 359 PHE PHE B . n 
B 1 359 LEU 359 360 360 LEU LEU B . n 
B 1 360 ALA 360 361 361 ALA ALA B . n 
B 1 361 GLY 361 362 362 GLY GLY B . n 
B 1 362 VAL 362 363 363 VAL VAL B . n 
B 1 363 ARG 363 364 364 ARG ARG B . n 
B 1 364 VAL 364 365 365 VAL VAL B . n 
B 1 365 GLY 365 366 366 GLY GLY B . n 
B 1 366 VAL 366 367 367 VAL VAL B . n 
B 1 367 PRO 367 368 368 PRO PRO B . n 
B 1 368 GLN 368 369 369 GLN GLN B . n 
B 1 369 VAL 369 370 370 VAL VAL B . n 
B 1 370 SER 370 371 371 SER SER B . n 
B 1 371 ASP 371 372 372 ASP ASP B . n 
B 1 372 LEU 372 373 373 LEU LEU B . n 
B 1 373 ALA 373 374 374 ALA ALA B . n 
B 1 374 ALA 374 375 375 ALA ALA B . n 
B 1 375 GLU 375 376 376 GLU GLU B . n 
B 1 376 ALA 376 377 377 ALA ALA B . n 
B 1 377 VAL 377 378 378 VAL VAL B . n 
B 1 378 VAL 378 379 379 VAL VAL B . n 
B 1 379 LEU 379 380 380 LEU LEU B . n 
B 1 380 HIS 380 381 381 HIS HIS B . n 
B 1 381 TYR 381 382 382 TYR TYR B . n 
B 1 382 THR 382 383 383 THR THR B . n 
B 1 383 ASP 383 384 384 ASP ASP B . n 
B 1 384 TRP 384 385 385 TRP TRP B . n 
B 1 385 LEU 385 386 386 LEU LEU B . n 
B 1 386 HIS 386 387 387 HIS HIS B . n 
B 1 387 PRO 387 388 388 PRO PRO B . n 
B 1 388 GLU 388 389 389 GLU GLU B . n 
B 1 389 ASP 389 390 390 ASP ASP B . n 
B 1 390 PRO 390 391 391 PRO PRO B . n 
B 1 391 ALA 391 392 392 ALA ALA B . n 
B 1 392 ARG 392 393 393 ARG ARG B . n 
B 1 393 LEU 393 394 394 LEU LEU B . n 
B 1 394 ARG 394 395 395 ARG ARG B . n 
B 1 395 GLU 395 396 396 GLU GLU B . n 
B 1 396 ALA 396 397 397 ALA ALA B . n 
B 1 397 LEU 397 398 398 LEU LEU B . n 
B 1 398 SER 398 399 399 SER SER B . n 
B 1 399 ASP 399 400 400 ASP ASP B . n 
B 1 400 VAL 400 401 401 VAL VAL B . n 
B 1 401 VAL 401 402 402 VAL VAL B . n 
B 1 402 GLY 402 403 403 GLY GLY B . n 
B 1 403 ASP 403 404 404 ASP ASP B . n 
B 1 404 HIS 404 405 405 HIS HIS B . n 
B 1 405 ASN 405 406 406 ASN ASN B . n 
B 1 406 VAL 406 407 407 VAL VAL B . n 
B 1 407 VAL 407 408 408 VAL VAL B . n 
B 1 408 CYS 408 409 409 CYS CYS B . n 
B 1 409 PRO 409 410 410 PRO PRO B . n 
B 1 410 VAL 410 411 411 VAL VAL B . n 
B 1 411 ALA 411 412 412 ALA ALA B . n 
B 1 412 GLN 412 413 413 GLN GLN B . n 
B 1 413 LEU 413 414 414 LEU LEU B . n 
B 1 414 ALA 414 415 415 ALA ALA B . n 
B 1 415 GLY 415 416 416 GLY GLY B . n 
B 1 416 ARG 416 417 417 ARG ARG B . n 
B 1 417 LEU 417 418 418 LEU LEU B . n 
B 1 418 ALA 418 419 419 ALA ALA B . n 
B 1 419 ALA 419 420 420 ALA ALA B . n 
B 1 420 GLN 420 421 421 GLN GLN B . n 
B 1 421 GLY 421 422 422 GLY GLY B . n 
B 1 422 ALA 422 423 423 ALA ALA B . n 
B 1 423 ARG 423 424 424 ARG ARG B . n 
B 1 424 VAL 424 425 425 VAL VAL B . n 
B 1 425 TYR 425 426 426 TYR TYR B . n 
B 1 426 ALA 426 427 427 ALA ALA B . n 
B 1 427 TYR 427 428 428 TYR TYR B . n 
B 1 428 VAL 428 429 429 VAL VAL B . n 
B 1 429 PHE 429 430 430 PHE PHE B . n 
B 1 430 GLU 430 431 431 GLU GLU B . n 
B 1 431 HIS 431 432 432 HIS HIS B . n 
B 1 432 ARG 432 433 433 ARG ARG B . n 
B 1 433 ALA 433 434 434 ALA ALA B . n 
B 1 434 SER 434 435 435 SER SER B . n 
B 1 435 THR 435 436 436 THR THR B . n 
B 1 436 LEU 436 437 437 LEU LEU B . n 
B 1 437 SER 437 438 438 SER SER B . n 
B 1 438 TRP 438 439 439 TRP TRP B . n 
B 1 439 PRO 439 440 440 PRO PRO B . n 
B 1 440 LEU 440 441 441 LEU LEU B . n 
B 1 441 TRP 441 442 442 TRP TRP B . n 
B 1 442 MET 442 443 443 MET MET B . n 
B 1 443 GLY 443 444 444 GLY GLY B . n 
B 1 444 VAL 444 445 445 VAL VAL B . n 
B 1 445 PRO 445 446 446 PRO PRO B . n 
B 1 446 HIS 446 447 447 HIS HIS B . n 
B 1 447 GLY 447 448 448 GLY GLY B . n 
B 1 448 TYR 448 449 449 TYR TYR B . n 
B 1 449 GLU 449 450 450 GLU GLU B . n 
B 1 450 ILE 450 451 451 ILE ILE B . n 
B 1 451 GLU 451 452 452 GLU GLU B . n 
B 1 452 PHE 452 453 453 PHE PHE B . n 
B 1 453 ILE 453 454 454 ILE ILE B . n 
B 1 454 PHE 454 455 455 PHE PHE B . n 
B 1 455 GLY 455 456 456 GLY GLY B . n 
B 1 456 ILE 456 457 457 ILE ILE B . n 
B 1 457 PRO 457 458 458 PRO PRO B . n 
B 1 458 LEU 458 459 459 LEU LEU B . n 
B 1 459 ASP 459 460 460 ASP ASP B . n 
B 1 460 PRO 460 461 461 PRO PRO B . n 
B 1 461 SER 461 462 462 SER SER B . n 
B 1 462 ARG 462 463 463 ARG ARG B . n 
B 1 463 ASN 463 464 464 ASN ASN B . n 
B 1 464 TYR 464 465 465 TYR TYR B . n 
B 1 465 THR 465 466 466 THR THR B . n 
B 1 466 ALA 466 467 467 ALA ALA B . n 
B 1 467 GLU 467 468 468 GLU GLU B . n 
B 1 468 GLU 468 469 469 GLU GLU B . n 
B 1 469 LYS 469 470 470 LYS LYS B . n 
B 1 470 ILE 470 471 471 ILE ILE B . n 
B 1 471 PHE 471 472 472 PHE PHE B . n 
B 1 472 ALA 472 473 473 ALA ALA B . n 
B 1 473 GLN 473 474 474 GLN GLN B . n 
B 1 474 ARG 474 475 475 ARG ARG B . n 
B 1 475 LEU 475 476 476 LEU LEU B . n 
B 1 476 MET 476 477 477 MET MET B . n 
B 1 477 ARG 477 478 478 ARG ARG B . n 
B 1 478 TYR 478 479 479 TYR TYR B . n 
B 1 479 TRP 479 480 480 TRP TRP B . n 
B 1 480 ALA 480 481 481 ALA ALA B . n 
B 1 481 ASN 481 482 482 ASN ASN B . n 
B 1 482 PHE 482 483 483 PHE PHE B . n 
B 1 483 ALA 483 484 484 ALA ALA B . n 
B 1 484 ARG 484 485 485 ARG ARG B . n 
B 1 485 THR 485 486 486 THR THR B . n 
B 1 486 GLY 486 487 487 GLY GLY B . n 
B 1 487 ASP 487 488 488 ASP ASP B . n 
B 1 488 PRO 488 489 489 PRO PRO B . n 
B 1 489 ASN 489 490 490 ASN ASN B . n 
B 1 490 GLU 490 491 491 GLU GLU B . n 
B 1 491 PRO 491 492 492 PRO PRO B . n 
B 1 492 ARG 492 493 493 ARG ARG B . n 
B 1 493 ASP 493 494 494 ASP ASP B . n 
B 1 494 PRO 494 495 495 PRO PRO B . n 
B 1 495 LYS 495 496 496 LYS LYS B . n 
B 1 496 ALA 496 497 497 ALA ALA B . n 
B 1 497 PRO 497 498 498 PRO PRO B . n 
B 1 498 GLN 498 499 499 GLN GLN B . n 
B 1 499 TRP 499 500 500 TRP TRP B . n 
B 1 500 PRO 500 501 501 PRO PRO B . n 
B 1 501 PRO 501 502 502 PRO PRO B . n 
B 1 502 TYR 502 503 503 TYR TYR B . n 
B 1 503 THR 503 504 504 THR THR B . n 
B 1 504 ALA 504 505 505 ALA ALA B . n 
B 1 505 GLY 505 506 506 GLY GLY B . n 
B 1 506 ALA 506 507 507 ALA ALA B . n 
B 1 507 GLN 507 508 508 GLN GLN B . n 
B 1 508 GLN 508 509 509 GLN GLN B . n 
B 1 509 TYR 509 510 510 TYR TYR B . n 
B 1 510 VAL 510 511 511 VAL VAL B . n 
B 1 511 SER 511 512 512 SER SER B . n 
B 1 512 LEU 512 513 513 LEU LEU B . n 
B 1 513 ASP 513 514 514 ASP ASP B . n 
B 1 514 LEU 514 515 515 LEU LEU B . n 
B 1 515 ARG 515 516 516 ARG ARG B . n 
B 1 516 PRO 516 517 517 PRO PRO B . n 
B 1 517 LEU 517 518 518 LEU LEU B . n 
B 1 518 GLU 518 519 519 GLU GLU B . n 
B 1 519 VAL 519 520 520 VAL VAL B . n 
B 1 520 ARG 520 521 521 ARG ARG B . n 
B 1 521 ARG 521 522 522 ARG ARG B . n 
B 1 522 GLY 522 523 523 GLY GLY B . n 
B 1 523 LEU 523 524 524 LEU LEU B . n 
B 1 524 ARG 524 525 525 ARG ARG B . n 
B 1 525 ALA 525 526 526 ALA ALA B . n 
B 1 526 GLN 526 527 527 GLN GLN B . n 
B 1 527 ALA 527 528 528 ALA ALA B . n 
B 1 528 CYS 528 529 529 CYS CYS B . n 
B 1 529 ALA 529 530 530 ALA ALA B . n 
B 1 530 PHE 530 531 531 PHE PHE B . n 
B 1 531 TRP 531 532 532 TRP TRP B . n 
B 1 532 ASN 532 533 533 ASN ASN B . n 
B 1 533 ARG 533 534 534 ARG ARG B . n 
B 1 534 PHE 534 535 535 PHE PHE B . n 
B 1 535 LEU 535 536 536 LEU LEU B . n 
B 1 536 PRO 536 537 537 PRO PRO B . n 
B 1 537 LYS 537 538 538 LYS LYS B . n 
B 1 538 LEU 538 539 539 LEU LEU B . n 
B 1 539 LEU 539 540 540 LEU LEU B . n 
B 1 540 SER 540 541 541 SER SER B . n 
B 1 541 ALA 541 542 542 ALA ALA B . n 
B 1 542 THR 542 543 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 EFS 1   604 1001 EFS MEP A . 
F 4 DEP 1   605 1002 DEP DEP A . 
G 5 EDO 1   606 1    EDO EDO A . 
H 5 EDO 1   607 2    EDO EDO A . 
I 6 NAG 1   604 604  NAG NAG B . 
J 3 EFS 1   605 1001 EFS MEP B . 
K 4 DEP 1   606 1002 DEP DEP B . 
L 5 EDO 1   607 3    EDO EDO B . 
M 5 EDO 1   608 4    EDO EDO B . 
N 7 NO3 1   609 5    NO3 NO3 B . 
O 8 HOH 1   701 39   HOH HOH A . 
O 8 HOH 2   702 216  HOH HOH A . 
O 8 HOH 3   703 136  HOH HOH A . 
O 8 HOH 4   704 229  HOH HOH A . 
O 8 HOH 5   705 32   HOH HOH A . 
O 8 HOH 6   706 116  HOH HOH A . 
O 8 HOH 7   707 57   HOH HOH A . 
O 8 HOH 8   708 214  HOH HOH A . 
O 8 HOH 9   709 221  HOH HOH A . 
O 8 HOH 10  710 45   HOH HOH A . 
O 8 HOH 11  711 15   HOH HOH A . 
O 8 HOH 12  712 170  HOH HOH A . 
O 8 HOH 13  713 16   HOH HOH A . 
O 8 HOH 14  714 94   HOH HOH A . 
O 8 HOH 15  715 132  HOH HOH A . 
O 8 HOH 16  716 8    HOH HOH A . 
O 8 HOH 17  717 126  HOH HOH A . 
O 8 HOH 18  718 195  HOH HOH A . 
O 8 HOH 19  719 36   HOH HOH A . 
O 8 HOH 20  720 20   HOH HOH A . 
O 8 HOH 21  721 29   HOH HOH A . 
O 8 HOH 22  722 5    HOH HOH A . 
O 8 HOH 23  723 135  HOH HOH A . 
O 8 HOH 24  724 4    HOH HOH A . 
O 8 HOH 25  725 71   HOH HOH A . 
O 8 HOH 26  726 1    HOH HOH A . 
O 8 HOH 27  727 34   HOH HOH A . 
O 8 HOH 28  728 131  HOH HOH A . 
O 8 HOH 29  729 27   HOH HOH A . 
O 8 HOH 30  730 66   HOH HOH A . 
O 8 HOH 31  731 145  HOH HOH A . 
O 8 HOH 32  732 129  HOH HOH A . 
O 8 HOH 33  733 30   HOH HOH A . 
O 8 HOH 34  734 96   HOH HOH A . 
O 8 HOH 35  735 143  HOH HOH A . 
O 8 HOH 36  736 150  HOH HOH A . 
O 8 HOH 37  737 48   HOH HOH A . 
O 8 HOH 38  738 6    HOH HOH A . 
O 8 HOH 39  739 125  HOH HOH A . 
O 8 HOH 40  740 38   HOH HOH A . 
O 8 HOH 41  741 167  HOH HOH A . 
O 8 HOH 42  742 14   HOH HOH A . 
O 8 HOH 43  743 18   HOH HOH A . 
O 8 HOH 44  744 79   HOH HOH A . 
O 8 HOH 45  745 11   HOH HOH A . 
O 8 HOH 46  746 52   HOH HOH A . 
O 8 HOH 47  747 119  HOH HOH A . 
O 8 HOH 48  748 169  HOH HOH A . 
O 8 HOH 49  749 163  HOH HOH A . 
O 8 HOH 50  750 9    HOH HOH A . 
O 8 HOH 51  751 56   HOH HOH A . 
O 8 HOH 52  752 111  HOH HOH A . 
O 8 HOH 53  753 109  HOH HOH A . 
O 8 HOH 54  754 28   HOH HOH A . 
O 8 HOH 55  755 171  HOH HOH A . 
O 8 HOH 56  756 106  HOH HOH A . 
O 8 HOH 57  757 180  HOH HOH A . 
O 8 HOH 58  758 188  HOH HOH A . 
O 8 HOH 59  759 91   HOH HOH A . 
O 8 HOH 60  760 104  HOH HOH A . 
O 8 HOH 61  761 3    HOH HOH A . 
O 8 HOH 62  762 164  HOH HOH A . 
O 8 HOH 63  763 50   HOH HOH A . 
O 8 HOH 64  764 218  HOH HOH A . 
O 8 HOH 65  765 141  HOH HOH A . 
O 8 HOH 66  766 86   HOH HOH A . 
O 8 HOH 67  767 107  HOH HOH A . 
O 8 HOH 68  768 179  HOH HOH A . 
O 8 HOH 69  769 90   HOH HOH A . 
O 8 HOH 70  770 72   HOH HOH A . 
O 8 HOH 71  771 117  HOH HOH A . 
O 8 HOH 72  772 98   HOH HOH A . 
O 8 HOH 73  773 59   HOH HOH A . 
O 8 HOH 74  774 177  HOH HOH A . 
O 8 HOH 75  775 232  HOH HOH A . 
O 8 HOH 76  776 137  HOH HOH A . 
O 8 HOH 77  777 172  HOH HOH A . 
O 8 HOH 78  778 93   HOH HOH A . 
O 8 HOH 79  779 110  HOH HOH A . 
O 8 HOH 80  780 222  HOH HOH A . 
O 8 HOH 81  781 160  HOH HOH A . 
O 8 HOH 82  782 108  HOH HOH A . 
O 8 HOH 83  783 25   HOH HOH A . 
O 8 HOH 84  784 178  HOH HOH A . 
O 8 HOH 85  785 40   HOH HOH A . 
O 8 HOH 86  786 81   HOH HOH A . 
O 8 HOH 87  787 144  HOH HOH A . 
O 8 HOH 88  788 165  HOH HOH A . 
O 8 HOH 89  789 42   HOH HOH A . 
O 8 HOH 90  790 85   HOH HOH A . 
O 8 HOH 91  791 197  HOH HOH A . 
O 8 HOH 92  792 193  HOH HOH A . 
O 8 HOH 93  793 130  HOH HOH A . 
O 8 HOH 94  794 134  HOH HOH A . 
O 8 HOH 95  795 37   HOH HOH A . 
O 8 HOH 96  796 181  HOH HOH A . 
O 8 HOH 97  797 185  HOH HOH A . 
O 8 HOH 98  798 120  HOH HOH A . 
O 8 HOH 99  799 82   HOH HOH A . 
O 8 HOH 100 800 80   HOH HOH A . 
O 8 HOH 101 801 87   HOH HOH A . 
O 8 HOH 102 802 176  HOH HOH A . 
O 8 HOH 103 803 128  HOH HOH A . 
O 8 HOH 104 804 35   HOH HOH A . 
O 8 HOH 105 805 226  HOH HOH A . 
O 8 HOH 106 806 118  HOH HOH A . 
O 8 HOH 107 807 76   HOH HOH A . 
O 8 HOH 108 808 88   HOH HOH A . 
O 8 HOH 109 809 161  HOH HOH A . 
O 8 HOH 110 810 230  HOH HOH A . 
O 8 HOH 111 811 138  HOH HOH A . 
O 8 HOH 112 812 184  HOH HOH A . 
O 8 HOH 113 813 228  HOH HOH A . 
O 8 HOH 114 814 208  HOH HOH A . 
O 8 HOH 115 815 194  HOH HOH A . 
O 8 HOH 116 816 159  HOH HOH A . 
O 8 HOH 117 817 231  HOH HOH A . 
O 8 HOH 118 818 148  HOH HOH A . 
O 8 HOH 119 819 149  HOH HOH A . 
O 8 HOH 120 820 223  HOH HOH A . 
O 8 HOH 121 821 225  HOH HOH A . 
O 8 HOH 122 822 174  HOH HOH A . 
O 8 HOH 123 823 227  HOH HOH A . 
O 8 HOH 124 824 158  HOH HOH A . 
O 8 HOH 125 825 182  HOH HOH A . 
O 8 HOH 126 826 209  HOH HOH A . 
O 8 HOH 127 827 233  HOH HOH A . 
O 8 HOH 128 828 187  HOH HOH A . 
O 8 HOH 129 829 211  HOH HOH A . 
O 8 HOH 130 830 127  HOH HOH A . 
O 8 HOH 131 831 189  HOH HOH A . 
O 8 HOH 132 832 236  HOH HOH A . 
P 8 HOH 1   701 156  HOH HOH B . 
P 8 HOH 2   702 220  HOH HOH B . 
P 8 HOH 3   703 186  HOH HOH B . 
P 8 HOH 4   704 67   HOH HOH B . 
P 8 HOH 5   705 152  HOH HOH B . 
P 8 HOH 6   706 51   HOH HOH B . 
P 8 HOH 7   707 12   HOH HOH B . 
P 8 HOH 8   708 83   HOH HOH B . 
P 8 HOH 9   709 153  HOH HOH B . 
P 8 HOH 10  710 162  HOH HOH B . 
P 8 HOH 11  711 202  HOH HOH B . 
P 8 HOH 12  712 10   HOH HOH B . 
P 8 HOH 13  713 58   HOH HOH B . 
P 8 HOH 14  714 151  HOH HOH B . 
P 8 HOH 15  715 190  HOH HOH B . 
P 8 HOH 16  716 166  HOH HOH B . 
P 8 HOH 17  717 154  HOH HOH B . 
P 8 HOH 18  718 105  HOH HOH B . 
P 8 HOH 19  719 22   HOH HOH B . 
P 8 HOH 20  720 201  HOH HOH B . 
P 8 HOH 21  721 175  HOH HOH B . 
P 8 HOH 22  722 21   HOH HOH B . 
P 8 HOH 23  723 24   HOH HOH B . 
P 8 HOH 24  724 60   HOH HOH B . 
P 8 HOH 25  725 206  HOH HOH B . 
P 8 HOH 26  726 78   HOH HOH B . 
P 8 HOH 27  727 13   HOH HOH B . 
P 8 HOH 28  728 147  HOH HOH B . 
P 8 HOH 29  729 41   HOH HOH B . 
P 8 HOH 30  730 47   HOH HOH B . 
P 8 HOH 31  731 7    HOH HOH B . 
P 8 HOH 32  732 2    HOH HOH B . 
P 8 HOH 33  733 49   HOH HOH B . 
P 8 HOH 34  734 213  HOH HOH B . 
P 8 HOH 35  735 224  HOH HOH B . 
P 8 HOH 36  736 33   HOH HOH B . 
P 8 HOH 37  737 44   HOH HOH B . 
P 8 HOH 38  738 204  HOH HOH B . 
P 8 HOH 39  739 101  HOH HOH B . 
P 8 HOH 40  740 63   HOH HOH B . 
P 8 HOH 41  741 219  HOH HOH B . 
P 8 HOH 42  742 124  HOH HOH B . 
P 8 HOH 43  743 19   HOH HOH B . 
P 8 HOH 44  744 53   HOH HOH B . 
P 8 HOH 45  745 65   HOH HOH B . 
P 8 HOH 46  746 26   HOH HOH B . 
P 8 HOH 47  747 99   HOH HOH B . 
P 8 HOH 48  748 199  HOH HOH B . 
P 8 HOH 49  749 46   HOH HOH B . 
P 8 HOH 50  750 61   HOH HOH B . 
P 8 HOH 51  751 17   HOH HOH B . 
P 8 HOH 52  752 69   HOH HOH B . 
P 8 HOH 53  753 173  HOH HOH B . 
P 8 HOH 54  754 133  HOH HOH B . 
P 8 HOH 55  755 43   HOH HOH B . 
P 8 HOH 56  756 192  HOH HOH B . 
P 8 HOH 57  757 210  HOH HOH B . 
P 8 HOH 58  758 84   HOH HOH B . 
P 8 HOH 59  759 74   HOH HOH B . 
P 8 HOH 60  760 234  HOH HOH B . 
P 8 HOH 61  761 112  HOH HOH B . 
P 8 HOH 62  762 31   HOH HOH B . 
P 8 HOH 63  763 115  HOH HOH B . 
P 8 HOH 64  764 198  HOH HOH B . 
P 8 HOH 65  765 62   HOH HOH B . 
P 8 HOH 66  766 122  HOH HOH B . 
P 8 HOH 67  767 23   HOH HOH B . 
P 8 HOH 68  768 217  HOH HOH B . 
P 8 HOH 69  769 89   HOH HOH B . 
P 8 HOH 70  770 73   HOH HOH B . 
P 8 HOH 71  771 100  HOH HOH B . 
P 8 HOH 72  772 102  HOH HOH B . 
P 8 HOH 73  773 68   HOH HOH B . 
P 8 HOH 74  774 75   HOH HOH B . 
P 8 HOH 75  775 157  HOH HOH B . 
P 8 HOH 76  776 103  HOH HOH B . 
P 8 HOH 77  777 203  HOH HOH B . 
P 8 HOH 78  778 155  HOH HOH B . 
P 8 HOH 79  779 95   HOH HOH B . 
P 8 HOH 80  780 114  HOH HOH B . 
P 8 HOH 81  781 142  HOH HOH B . 
P 8 HOH 82  782 139  HOH HOH B . 
P 8 HOH 83  783 92   HOH HOH B . 
P 8 HOH 84  784 64   HOH HOH B . 
P 8 HOH 85  785 205  HOH HOH B . 
P 8 HOH 86  786 55   HOH HOH B . 
P 8 HOH 87  787 70   HOH HOH B . 
P 8 HOH 88  788 200  HOH HOH B . 
P 8 HOH 89  789 140  HOH HOH B . 
P 8 HOH 90  790 121  HOH HOH B . 
P 8 HOH 91  791 196  HOH HOH B . 
P 8 HOH 92  792 235  HOH HOH B . 
P 8 HOH 93  793 191  HOH HOH B . 
P 8 HOH 94  794 212  HOH HOH B . 
P 8 HOH 95  795 237  HOH HOH B . 
P 8 HOH 96  796 97   HOH HOH B . 
P 8 HOH 97  797 183  HOH HOH B . 
P 8 HOH 98  798 207  HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6370  ? 
1 MORE         42    ? 
1 'SSA (A^2)'  38510 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-06-22 
2 'Structure model' 1 1 2016-08-24 
3 'Structure model' 1 2 2017-11-22 
4 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Database references'    
3 3 'Structure model' 'Derived calculations'   
4 3 'Structure model' 'Refinement description' 
5 4 'Structure model' 'Atomic model'           
6 4 'Structure model' 'Data collection'        
7 4 'Structure model' 'Derived calculations'   
8 4 'Structure model' 'Structure summary'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  3 'Structure model' citation                      
2  3 'Structure model' pdbx_struct_oper_list         
3  3 'Structure model' software                      
4  4 'Structure model' atom_site                     
5  4 'Structure model' chem_comp                     
6  4 'Structure model' entity                        
7  4 'Structure model' pdbx_branch_scheme            
8  4 'Structure model' pdbx_chem_comp_identifier     
9  4 'Structure model' pdbx_entity_branch            
10 4 'Structure model' pdbx_entity_branch_descriptor 
11 4 'Structure model' pdbx_entity_branch_link       
12 4 'Structure model' pdbx_entity_branch_list       
13 4 'Structure model' pdbx_entity_nonpoly           
14 4 'Structure model' pdbx_nonpoly_scheme           
15 4 'Structure model' pdbx_struct_assembly_gen      
16 4 'Structure model' struct_asym                   
17 4 'Structure model' struct_conn                   
18 4 'Structure model' struct_site                   
19 4 'Structure model' struct_site_gen               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  3 'Structure model' '_citation.journal_id_CSD'                  
2  3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
3  3 'Structure model' '_software.classification'                  
4  4 'Structure model' '_atom_site.B_iso_or_equiv'                 
5  4 'Structure model' '_atom_site.Cartn_x'                        
6  4 'Structure model' '_atom_site.Cartn_y'                        
7  4 'Structure model' '_atom_site.Cartn_z'                        
8  4 'Structure model' '_atom_site.auth_asym_id'                   
9  4 'Structure model' '_atom_site.auth_atom_id'                   
10 4 'Structure model' '_atom_site.auth_comp_id'                   
11 4 'Structure model' '_atom_site.auth_seq_id'                    
12 4 'Structure model' '_atom_site.label_alt_id'                   
13 4 'Structure model' '_atom_site.label_asym_id'                  
14 4 'Structure model' '_atom_site.label_atom_id'                  
15 4 'Structure model' '_atom_site.label_comp_id'                  
16 4 'Structure model' '_atom_site.label_entity_id'                
17 4 'Structure model' '_atom_site.occupancy'                      
18 4 'Structure model' '_atom_site.type_symbol'                    
19 4 'Structure model' '_chem_comp.name'                           
20 4 'Structure model' '_chem_comp.type'                           
21 4 'Structure model' '_entity.formula_weight'                    
22 4 'Structure model' '_entity.pdbx_description'                  
23 4 'Structure model' '_entity.pdbx_number_of_molecules'          
24 4 'Structure model' '_entity.src_method'                        
25 4 'Structure model' '_entity.type'                              
26 4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list'    
27 4 'Structure model' '_struct_conn.pdbx_role'                    
28 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id'           
29 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'            
30 4 'Structure model' '_struct_conn.ptnr1_label_asym_id'          
31 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id'           
32 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'            
33 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'          
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data collection' ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .    1 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? SCALEPACK   ? ? ? .    2 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? .    3 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 4 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .    5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   NH1 
_pdbx_validate_close_contact.auth_asym_id_1   B 
_pdbx_validate_close_contact.auth_comp_id_1   ARG 
_pdbx_validate_close_contact.auth_seq_id_1    45 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   OE2 
_pdbx_validate_close_contact.auth_asym_id_2   B 
_pdbx_validate_close_contact.auth_comp_id_2   GLU 
_pdbx_validate_close_contact.auth_seq_id_2    51 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.18 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             C 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             GLU 
_pdbx_validate_rmsd_angle.auth_seq_id_1              491 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             N 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_2              492 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_3              492 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                128.31 
_pdbx_validate_rmsd_angle.angle_target_value         119.30 
_pdbx_validate_rmsd_angle.angle_deviation            9.01 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.50 
_pdbx_validate_rmsd_angle.linker_flag                Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 47  ? ? 70.68   -2.25   
2  1 ALA A 62  ? ? -117.08 51.08   
3  1 PHE A 158 ? ? -141.13 10.78   
4  1 ALA A 167 ? ? -154.06 82.30   
5  1 SER A 203 ? ? 56.01   -114.58 
6  1 GLN A 291 ? ? -105.91 67.31   
7  1 ARG A 296 ? ? -153.31 66.28   
8  1 ASP A 306 ? ? -87.97  -86.96  
9  1 HIS A 387 ? ? -144.12 55.16   
10 1 VAL A 407 ? ? -125.49 -64.87  
11 1 GLU A 491 ? ? -55.13  104.98  
12 1 ASP A 494 ? ? -160.24 99.76   
13 1 ASP A 514 ? ? -159.77 -153.57 
14 1 SER A 541 ? ? -72.42  -96.21  
15 1 PHE B 47  ? ? 73.13   -7.86   
16 1 ALA B 167 ? ? -155.81 64.77   
17 1 SER B 203 ? ? 58.24   -121.46 
18 1 ARG B 296 ? ? -153.75 71.80   
19 1 ASP B 306 ? ? -83.83  -85.11  
20 1 TYR B 341 ? ? -103.70 54.19   
21 1 VAL B 367 ? ? -117.36 76.87   
22 1 VAL B 407 ? ? -125.83 -65.71  
23 1 ASN B 464 ? ? -105.97 56.95   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 2   ? A GLY 1   
2  1 Y 1 A ARG 3   ? A ARG 2   
3  1 Y 1 A PRO 259 ? A PRO 258 
4  1 Y 1 A GLY 260 ? A GLY 259 
5  1 Y 1 A GLY 261 ? A GLY 260 
6  1 Y 1 A THR 262 ? A THR 261 
7  1 Y 1 A GLY 263 ? A GLY 262 
8  1 Y 1 A GLY 264 ? A GLY 263 
9  1 Y 1 A THR 543 ? A THR 542 
10 1 Y 1 B GLY 2   ? B GLY 1   
11 1 Y 1 B ARG 3   ? B ARG 2   
12 1 Y 1 B GLY 260 ? B GLY 259 
13 1 Y 1 B GLY 261 ? B GLY 260 
14 1 Y 1 B THR 543 ? B THR 542 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
C 2 NAG 1 C NAG 1 A NAG 601 n 
C 2 NAG 2 C NAG 2 A NAG 603 n 
C 2 FUC 3 C FUC 3 A FUC 602 n 
D 2 NAG 1 D NAG 1 B NAG 601 n 
D 2 NAG 2 D NAG 2 B NAG 603 n 
D 2 FUC 3 D FUC 3 B FUC 602 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
FUC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 LFucpa                         
FUC 'COMMON NAME'                         GMML     1.0 a-L-fucopyranose               
FUC 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-L-Fucp                       
FUC 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Fuc                            
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
_pdbx_entity_branch.entity_id   2 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 'DGlcpNAcb1-4[LFucpa1-6]DGlcpNAcb1-'                                         'Glycam Condensed Sequence' GMML       1.0   
2 2 'WURCS=2.0/2,3,2/[a2122h-1b_1-5_2*NCC/3=O][a1221m-1a_1-5]/1-1-2/a4-b1_a6-c1' WURCS                       PDB2Glycan 1.1.0 
3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}[(6+1)][a-L-Fucp]{}}}'        LINUCS                      PDB-CARE   ?     
# 
loop_
_pdbx_entity_branch_link.link_id 
_pdbx_entity_branch_link.entity_id 
_pdbx_entity_branch_link.entity_branch_list_num_1 
_pdbx_entity_branch_link.comp_id_1 
_pdbx_entity_branch_link.atom_id_1 
_pdbx_entity_branch_link.leaving_atom_id_1 
_pdbx_entity_branch_link.entity_branch_list_num_2 
_pdbx_entity_branch_link.comp_id_2 
_pdbx_entity_branch_link.atom_id_2 
_pdbx_entity_branch_link.leaving_atom_id_2 
_pdbx_entity_branch_link.value_order 
_pdbx_entity_branch_link.details 
1 2 2 NAG C1 O1 1 NAG O4 HO4 sing ? 
2 2 3 FUC C1 O1 1 NAG O6 HO6 sing ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 NAG 1 n 
2 NAG 2 n 
2 FUC 3 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'ETHYL DIHYDROGEN PHOSPHATE'             EFS 
4 'DIETHYL PHOSPHONATE'                    DEP 
5 1,2-ETHANEDIOL                           EDO 
6 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 
7 'NITRATE ION'                            NO3 
8 water                                    HOH 
#