data_5HF9
# 
_entry.id   5HF9 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5HF9         
WWPDB D_1000216490 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 5HF5 PDB . 
unspecified 5HF6 PDB . 
unspecified 5HF8 PDB . 
unspecified 5HFA PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5HF9 
_pdbx_database_status.recvd_initial_deposition_date   2016-01-06 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Franklin, M.F.' 1 
'Rudolph, M.J.'  2 
'Ginter, C.'     3 
'Cassidy, M.S.'  4 
'Cheung, J.'     5 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Proteins 
_citation.journal_id_ASTM           PSFGEY 
_citation.journal_id_CSD            0867 
_citation.journal_id_ISSN           1097-0134 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            84 
_citation.language                  ? 
_citation.page_first                1246 
_citation.page_last                 1256 
_citation.title                     
'Structures of paraoxon-inhibited human acetylcholinesterase reveal perturbations of the acyl loop and the dimer interface.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1002/prot.25073 
_citation.pdbx_database_id_PubMed   27191504 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Franklin, M.C.' 1 ? 
primary 'Rudolph, M.J.'  2 ? 
primary 'Ginter, C.'     3 ? 
primary 'Cassidy, M.S.'  4 ? 
primary 'Cheung, J.'     5 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5HF9 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     105.931 
_cell.length_a_esd                 ? 
_cell.length_b                     105.931 
_cell.length_b_esd                 ? 
_cell.length_c                     324.415 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        12 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5HF9 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Acetylcholinesterase 59447.105 2   3.1.1.7 none 'catalytic domain, UNP residues 33 to 574' ? 
2 branched    man 
'2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose' 570.542   2 
?       ?    ?                                          ? 
3 non-polymer syn 'DIETHYL PHOSPHONATE' 138.102   2   ?       ?    ?                                          ? 
4 non-polymer syn 1,2-ETHANEDIOL 62.068    4   ?       ?    ?                                          ? 
5 non-polymer syn '4-(AMINOCARBONYL)-1-[({2-[(E)-(HYDROXYIMINO)METHYL]PYRIDINIUM-1-YL}METHOXY)METHYL]PYRIDINIUM' 288.302   2   ? ? 
?                                          ? 
6 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   1   ?       ?    ?                                          ? 
7 non-polymer syn 3,6,9,12,15,18,21-HEPTAOXATRICOSANE-1,23-DIOL 370.436   1   ?       ?    ? ? 
8 non-polymer syn 'NITRATE ION' 62.005    1   ?       ?    ?                                          ? 
9 water       nat water 18.015    590 ?       ?    ?                                          ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        AChE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFE
GTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLAL
PGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGM
GEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDF
HGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDV
VGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWA
NFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFE
GTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLAL
PGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGM
GEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDF
HGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDV
VGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWA
NFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ARG n 
1 3   GLU n 
1 4   ASP n 
1 5   ALA n 
1 6   GLU n 
1 7   LEU n 
1 8   LEU n 
1 9   VAL n 
1 10  THR n 
1 11  VAL n 
1 12  ARG n 
1 13  GLY n 
1 14  GLY n 
1 15  ARG n 
1 16  LEU n 
1 17  ARG n 
1 18  GLY n 
1 19  ILE n 
1 20  ARG n 
1 21  LEU n 
1 22  LYS n 
1 23  THR n 
1 24  PRO n 
1 25  GLY n 
1 26  GLY n 
1 27  PRO n 
1 28  VAL n 
1 29  SER n 
1 30  ALA n 
1 31  PHE n 
1 32  LEU n 
1 33  GLY n 
1 34  ILE n 
1 35  PRO n 
1 36  PHE n 
1 37  ALA n 
1 38  GLU n 
1 39  PRO n 
1 40  PRO n 
1 41  MET n 
1 42  GLY n 
1 43  PRO n 
1 44  ARG n 
1 45  ARG n 
1 46  PHE n 
1 47  LEU n 
1 48  PRO n 
1 49  PRO n 
1 50  GLU n 
1 51  PRO n 
1 52  LYS n 
1 53  GLN n 
1 54  PRO n 
1 55  TRP n 
1 56  SER n 
1 57  GLY n 
1 58  VAL n 
1 59  VAL n 
1 60  ASP n 
1 61  ALA n 
1 62  THR n 
1 63  THR n 
1 64  PHE n 
1 65  GLN n 
1 66  SER n 
1 67  VAL n 
1 68  CYS n 
1 69  TYR n 
1 70  GLN n 
1 71  TYR n 
1 72  VAL n 
1 73  ASP n 
1 74  THR n 
1 75  LEU n 
1 76  TYR n 
1 77  PRO n 
1 78  GLY n 
1 79  PHE n 
1 80  GLU n 
1 81  GLY n 
1 82  THR n 
1 83  GLU n 
1 84  MET n 
1 85  TRP n 
1 86  ASN n 
1 87  PRO n 
1 88  ASN n 
1 89  ARG n 
1 90  GLU n 
1 91  LEU n 
1 92  SER n 
1 93  GLU n 
1 94  ASP n 
1 95  CYS n 
1 96  LEU n 
1 97  TYR n 
1 98  LEU n 
1 99  ASN n 
1 100 VAL n 
1 101 TRP n 
1 102 THR n 
1 103 PRO n 
1 104 TYR n 
1 105 PRO n 
1 106 ARG n 
1 107 PRO n 
1 108 THR n 
1 109 SER n 
1 110 PRO n 
1 111 THR n 
1 112 PRO n 
1 113 VAL n 
1 114 LEU n 
1 115 VAL n 
1 116 TRP n 
1 117 ILE n 
1 118 TYR n 
1 119 GLY n 
1 120 GLY n 
1 121 GLY n 
1 122 PHE n 
1 123 TYR n 
1 124 SER n 
1 125 GLY n 
1 126 ALA n 
1 127 SER n 
1 128 SER n 
1 129 LEU n 
1 130 ASP n 
1 131 VAL n 
1 132 TYR n 
1 133 ASP n 
1 134 GLY n 
1 135 ARG n 
1 136 PHE n 
1 137 LEU n 
1 138 VAL n 
1 139 GLN n 
1 140 ALA n 
1 141 GLU n 
1 142 ARG n 
1 143 THR n 
1 144 VAL n 
1 145 LEU n 
1 146 VAL n 
1 147 SER n 
1 148 MET n 
1 149 ASN n 
1 150 TYR n 
1 151 ARG n 
1 152 VAL n 
1 153 GLY n 
1 154 ALA n 
1 155 PHE n 
1 156 GLY n 
1 157 PHE n 
1 158 LEU n 
1 159 ALA n 
1 160 LEU n 
1 161 PRO n 
1 162 GLY n 
1 163 SER n 
1 164 ARG n 
1 165 GLU n 
1 166 ALA n 
1 167 PRO n 
1 168 GLY n 
1 169 ASN n 
1 170 VAL n 
1 171 GLY n 
1 172 LEU n 
1 173 LEU n 
1 174 ASP n 
1 175 GLN n 
1 176 ARG n 
1 177 LEU n 
1 178 ALA n 
1 179 LEU n 
1 180 GLN n 
1 181 TRP n 
1 182 VAL n 
1 183 GLN n 
1 184 GLU n 
1 185 ASN n 
1 186 VAL n 
1 187 ALA n 
1 188 ALA n 
1 189 PHE n 
1 190 GLY n 
1 191 GLY n 
1 192 ASP n 
1 193 PRO n 
1 194 THR n 
1 195 SER n 
1 196 VAL n 
1 197 THR n 
1 198 LEU n 
1 199 PHE n 
1 200 GLY n 
1 201 GLU n 
1 202 SER n 
1 203 ALA n 
1 204 GLY n 
1 205 ALA n 
1 206 ALA n 
1 207 SER n 
1 208 VAL n 
1 209 GLY n 
1 210 MET n 
1 211 HIS n 
1 212 LEU n 
1 213 LEU n 
1 214 SER n 
1 215 PRO n 
1 216 PRO n 
1 217 SER n 
1 218 ARG n 
1 219 GLY n 
1 220 LEU n 
1 221 PHE n 
1 222 HIS n 
1 223 ARG n 
1 224 ALA n 
1 225 VAL n 
1 226 LEU n 
1 227 GLN n 
1 228 SER n 
1 229 GLY n 
1 230 ALA n 
1 231 PRO n 
1 232 ASN n 
1 233 GLY n 
1 234 PRO n 
1 235 TRP n 
1 236 ALA n 
1 237 THR n 
1 238 VAL n 
1 239 GLY n 
1 240 MET n 
1 241 GLY n 
1 242 GLU n 
1 243 ALA n 
1 244 ARG n 
1 245 ARG n 
1 246 ARG n 
1 247 ALA n 
1 248 THR n 
1 249 GLN n 
1 250 LEU n 
1 251 ALA n 
1 252 HIS n 
1 253 LEU n 
1 254 VAL n 
1 255 GLY n 
1 256 CYS n 
1 257 PRO n 
1 258 PRO n 
1 259 GLY n 
1 260 GLY n 
1 261 THR n 
1 262 GLY n 
1 263 GLY n 
1 264 ASN n 
1 265 ASP n 
1 266 THR n 
1 267 GLU n 
1 268 LEU n 
1 269 VAL n 
1 270 ALA n 
1 271 CYS n 
1 272 LEU n 
1 273 ARG n 
1 274 THR n 
1 275 ARG n 
1 276 PRO n 
1 277 ALA n 
1 278 GLN n 
1 279 VAL n 
1 280 LEU n 
1 281 VAL n 
1 282 ASN n 
1 283 HIS n 
1 284 GLU n 
1 285 TRP n 
1 286 HIS n 
1 287 VAL n 
1 288 LEU n 
1 289 PRO n 
1 290 GLN n 
1 291 GLU n 
1 292 SER n 
1 293 VAL n 
1 294 PHE n 
1 295 ARG n 
1 296 PHE n 
1 297 SER n 
1 298 PHE n 
1 299 VAL n 
1 300 PRO n 
1 301 VAL n 
1 302 VAL n 
1 303 ASP n 
1 304 GLY n 
1 305 ASP n 
1 306 PHE n 
1 307 LEU n 
1 308 SER n 
1 309 ASP n 
1 310 THR n 
1 311 PRO n 
1 312 GLU n 
1 313 ALA n 
1 314 LEU n 
1 315 ILE n 
1 316 ASN n 
1 317 ALA n 
1 318 GLY n 
1 319 ASP n 
1 320 PHE n 
1 321 HIS n 
1 322 GLY n 
1 323 LEU n 
1 324 GLN n 
1 325 VAL n 
1 326 LEU n 
1 327 VAL n 
1 328 GLY n 
1 329 VAL n 
1 330 VAL n 
1 331 LYS n 
1 332 ASP n 
1 333 GLU n 
1 334 GLY n 
1 335 SER n 
1 336 TYR n 
1 337 PHE n 
1 338 LEU n 
1 339 VAL n 
1 340 TYR n 
1 341 GLY n 
1 342 ALA n 
1 343 PRO n 
1 344 GLY n 
1 345 PHE n 
1 346 SER n 
1 347 LYS n 
1 348 ASP n 
1 349 ASN n 
1 350 GLU n 
1 351 SER n 
1 352 LEU n 
1 353 ILE n 
1 354 SER n 
1 355 ARG n 
1 356 ALA n 
1 357 GLU n 
1 358 PHE n 
1 359 LEU n 
1 360 ALA n 
1 361 GLY n 
1 362 VAL n 
1 363 ARG n 
1 364 VAL n 
1 365 GLY n 
1 366 VAL n 
1 367 PRO n 
1 368 GLN n 
1 369 VAL n 
1 370 SER n 
1 371 ASP n 
1 372 LEU n 
1 373 ALA n 
1 374 ALA n 
1 375 GLU n 
1 376 ALA n 
1 377 VAL n 
1 378 VAL n 
1 379 LEU n 
1 380 HIS n 
1 381 TYR n 
1 382 THR n 
1 383 ASP n 
1 384 TRP n 
1 385 LEU n 
1 386 HIS n 
1 387 PRO n 
1 388 GLU n 
1 389 ASP n 
1 390 PRO n 
1 391 ALA n 
1 392 ARG n 
1 393 LEU n 
1 394 ARG n 
1 395 GLU n 
1 396 ALA n 
1 397 LEU n 
1 398 SER n 
1 399 ASP n 
1 400 VAL n 
1 401 VAL n 
1 402 GLY n 
1 403 ASP n 
1 404 HIS n 
1 405 ASN n 
1 406 VAL n 
1 407 VAL n 
1 408 CYS n 
1 409 PRO n 
1 410 VAL n 
1 411 ALA n 
1 412 GLN n 
1 413 LEU n 
1 414 ALA n 
1 415 GLY n 
1 416 ARG n 
1 417 LEU n 
1 418 ALA n 
1 419 ALA n 
1 420 GLN n 
1 421 GLY n 
1 422 ALA n 
1 423 ARG n 
1 424 VAL n 
1 425 TYR n 
1 426 ALA n 
1 427 TYR n 
1 428 VAL n 
1 429 PHE n 
1 430 GLU n 
1 431 HIS n 
1 432 ARG n 
1 433 ALA n 
1 434 SER n 
1 435 THR n 
1 436 LEU n 
1 437 SER n 
1 438 TRP n 
1 439 PRO n 
1 440 LEU n 
1 441 TRP n 
1 442 MET n 
1 443 GLY n 
1 444 VAL n 
1 445 PRO n 
1 446 HIS n 
1 447 GLY n 
1 448 TYR n 
1 449 GLU n 
1 450 ILE n 
1 451 GLU n 
1 452 PHE n 
1 453 ILE n 
1 454 PHE n 
1 455 GLY n 
1 456 ILE n 
1 457 PRO n 
1 458 LEU n 
1 459 ASP n 
1 460 PRO n 
1 461 SER n 
1 462 ARG n 
1 463 ASN n 
1 464 TYR n 
1 465 THR n 
1 466 ALA n 
1 467 GLU n 
1 468 GLU n 
1 469 LYS n 
1 470 ILE n 
1 471 PHE n 
1 472 ALA n 
1 473 GLN n 
1 474 ARG n 
1 475 LEU n 
1 476 MET n 
1 477 ARG n 
1 478 TYR n 
1 479 TRP n 
1 480 ALA n 
1 481 ASN n 
1 482 PHE n 
1 483 ALA n 
1 484 ARG n 
1 485 THR n 
1 486 GLY n 
1 487 ASP n 
1 488 PRO n 
1 489 ASN n 
1 490 GLU n 
1 491 PRO n 
1 492 ARG n 
1 493 ASP n 
1 494 PRO n 
1 495 LYS n 
1 496 ALA n 
1 497 PRO n 
1 498 GLN n 
1 499 TRP n 
1 500 PRO n 
1 501 PRO n 
1 502 TYR n 
1 503 THR n 
1 504 ALA n 
1 505 GLY n 
1 506 ALA n 
1 507 GLN n 
1 508 GLN n 
1 509 TYR n 
1 510 VAL n 
1 511 SER n 
1 512 LEU n 
1 513 ASP n 
1 514 LEU n 
1 515 ARG n 
1 516 PRO n 
1 517 LEU n 
1 518 GLU n 
1 519 VAL n 
1 520 ARG n 
1 521 ARG n 
1 522 GLY n 
1 523 LEU n 
1 524 ARG n 
1 525 ALA n 
1 526 GLN n 
1 527 ALA n 
1 528 CYS n 
1 529 ALA n 
1 530 PHE n 
1 531 TRP n 
1 532 ASN n 
1 533 ARG n 
1 534 PHE n 
1 535 LEU n 
1 536 PRO n 
1 537 LYS n 
1 538 LEU n 
1 539 LEU n 
1 540 SER n 
1 541 ALA n 
1 542 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   542 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ACHE 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_HUMAN 
_struct_ref.pdbx_db_accession          P22303 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFE
GTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLAL
PGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGM
GEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDF
HGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDV
VGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWA
NFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT
;
_struct_ref.pdbx_align_begin           33 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5HF9 A 1 ? 542 ? P22303 33 ? 574 ? 2 543 
2 1 5HF9 B 1 ? 542 ? P22303 33 ? 574 ? 2 543 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                                                                        
?                                                                                 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking'           y ARGININE                                                                                       
?                                                                                 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking'           y ASPARAGINE                                                                                     
?                                                                                 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                                                                                
?                                                                                 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking'           y CYSTEINE                                                                                       
?                                                                                 'C3 H7 N O2 S'    121.158 
DEP non-polymer                   . 'DIETHYL PHOSPHONATE'                                                                          
?                                                                                 'C4 H11 O3 P'     138.102 
EDO non-polymer                   . 1,2-ETHANEDIOL                                                                                 
'ETHYLENE GLYCOL'                                                                 'C2 H6 O2'        62.068  
FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose                                                                           
?                                                                                 'C6 H12 O5'       164.156 
GLN 'L-peptide linking'           y GLUTAMINE                                                                                      
?                                                                                 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                                                                                
?                                                                                 'C5 H9 N O4'      147.129 
GLY 'peptide linking'             y GLYCINE                                                                                        
?                                                                                 'C2 H5 N O2'      75.067  
HI6 non-polymer                   . '4-(AMINOCARBONYL)-1-[({2-[(E)-(HYDROXYIMINO)METHYL]PYRIDINIUM-1-YL}METHOXY)METHYL]PYRIDINIUM' 
'1-(2-HYDROXY-IMINOMETHYLPYRIDINIUM)-1-(4-CARBOXYAMINO)-PYRIDINIUM DIMETHYLETHER' 'C14 H16 N4 O3 2' 288.302 
HIS 'L-peptide linking'           y HISTIDINE                                                                                      
?                                                                                 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer                   . WATER                                                                                          
?                                                                                 'H2 O'            18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                                                                                     
?                                                                                 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking'           y LEUCINE                                                                                        
?                                                                                 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking'           y LYSINE                                                                                         
?                                                                                 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking'           y METHIONINE                                                                                     
?                                                                                 'C5 H11 N O2 S'   149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose                                                       
?                                                                                 'C8 H15 N O6'     221.208 
NO3 non-polymer                   . 'NITRATE ION'                                                                                  
?                                                                                 'N O3 -1'         62.005  
PE8 non-polymer                   . 3,6,9,12,15,18,21-HEPTAOXATRICOSANE-1,23-DIOL                                                  
?                                                                                 'C16 H34 O9'      370.436 
PHE 'L-peptide linking'           y PHENYLALANINE                                                                                  
?                                                                                 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking'           y PROLINE                                                                                        
?                                                                                 'C5 H9 N O2'      115.130 
SER 'L-peptide linking'           y SERINE                                                                                         
?                                                                                 'C3 H7 N O3'      105.093 
THR 'L-peptide linking'           y THREONINE                                                                                      
?                                                                                 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                                                                                     
?                                                                                 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking'           y TYROSINE                                                                                       
?                                                                                 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking'           y VALINE                                                                                         
?                                                                                 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5HF9 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            4.44 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         72.32 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '15 - 18% PEG3350, 0.2M potassium nitrate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-05-29 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.075 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'NSLS BEAMLINE X29A' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.075 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X29A 
_diffrn_source.pdbx_synchrotron_site       NSLS 
# 
_reflns.B_iso_Wilson_estimate            34.060 
_reflns.entry_id                         5HF9 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.200 
_reflns.d_resolution_low                 50.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       108212 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.600 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.800 
_reflns.pdbx_Rmerge_I_obs                0.130 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         16.488 
_reflns.pdbx_netI_over_sigmaI            5.200 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 1.050 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.135 
_reflns.pdbx_Rpim_I_all                  0.052 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         844881 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
2.200 2.240  ? ? ? ? ? 5344 ? 100.000 ? ? ? ? ?     ? ? ? ? ? ? ? ? 6.400 ? 0.557 ? ? ?     ?     0 1  1 0.673 ? 
2.240 2.280  ? ? ? ? ? 5066 ? 94.600  ? ? ? ? 0.675 ? ? ? ? ? ? ? ? 5.100 ? 1.145 ? ? 0.776 0.365 0 2  1 0.964 ? 
2.280 2.320  ? ? ? ? ? 5364 ? 100.000 ? ? ? ? ?     ? ? ? ? ? ? ? ? 8.400 ? 0.571 ? ? ?     0.418 0 3  1 0.772 ? 
2.320 2.370  ? ? ? ? ? 5351 ? 100.000 ? ? ? ? 0.947 ? ? ? ? ? ? ? ? 8.400 ? 0.563 ? ? ?     0.341 0 4  1 0.837 ? 
2.370 2.420  ? ? ? ? ? 5404 ? 100.000 ? ? ? ? 0.793 ? ? ? ? ? ? ? ? 8.300 ? 0.580 ? ? 0.845 0.287 0 5  1 0.861 ? 
2.420 2.480  ? ? ? ? ? 5348 ? 100.000 ? ? ? ? 0.635 ? ? ? ? ? ? ? ? 8.300 ? 0.582 ? ? 0.677 0.230 0 6  1 0.905 ? 
2.480 2.540  ? ? ? ? ? 5361 ? 100.000 ? ? ? ? 0.553 ? ? ? ? ? ? ? ? 8.200 ? 0.621 ? ? 0.589 0.200 0 7  1 0.925 ? 
2.540 2.610  ? ? ? ? ? 5365 ? 100.000 ? ? ? ? 0.427 ? ? ? ? ? ? ? ? 8.200 ? 0.621 ? ? 0.456 0.155 0 8  1 0.950 ? 
2.610 2.690  ? ? ? ? ? 5371 ? 99.900  ? ? ? ? 0.429 ? ? ? ? ? ? ? ? 7.700 ? 0.856 ? ? 0.461 0.165 0 9  1 0.942 ? 
2.690 2.770  ? ? ? ? ? 5425 ? 100.000 ? ? ? ? 0.341 ? ? ? ? ? ? ? ? 8.100 ? 0.725 ? ? 0.364 0.124 0 10 1 0.972 ? 
2.770 2.870  ? ? ? ? ? 5406 ? 100.000 ? ? ? ? 0.246 ? ? ? ? ? ? ? ? 8.200 ? 0.709 ? ? 0.262 0.089 0 11 1 0.981 ? 
2.870 2.990  ? ? ? ? ? 5374 ? 100.000 ? ? ? ? 0.202 ? ? ? ? ? ? ? ? 8.300 ? 0.784 ? ? 0.215 0.073 0 12 1 0.986 ? 
2.990 3.120  ? ? ? ? ? 5437 ? 100.000 ? ? ? ? 0.165 ? ? ? ? ? ? ? ? 8.200 ? 0.896 ? ? 0.176 0.060 0 13 1 0.991 ? 
3.120 3.290  ? ? ? ? ? 5392 ? 100.000 ? ? ? ? 0.142 ? ? ? ? ? ? ? ? 8.100 ? 1.029 ? ? 0.152 0.052 0 14 1 0.992 ? 
3.290 3.490  ? ? ? ? ? 5413 ? 99.900  ? ? ? ? 0.128 ? ? ? ? ? ? ? ? 7.600 ? 1.288 ? ? 0.138 0.050 0 15 1 0.991 ? 
3.490 3.760  ? ? ? ? ? 5459 ? 99.600  ? ? ? ? 0.104 ? ? ? ? ? ? ? ? 7.200 ? 1.472 ? ? 0.113 0.042 0 16 1 0.993 ? 
3.760 4.140  ? ? ? ? ? 5388 ? 98.700  ? ? ? ? 0.087 ? ? ? ? ? ? ? ? 6.900 ? 1.730 ? ? 0.095 0.037 0 17 1 0.993 ? 
4.140 4.740  ? ? ? ? ? 5514 ? 99.900  ? ? ? ? 0.076 ? ? ? ? ? ? ? ? 7.600 ? 1.983 ? ? 0.082 0.030 0 18 1 0.995 ? 
4.740 5.970  ? ? ? ? ? 5596 ? 100.000 ? ? ? ? 0.074 ? ? ? ? ? ? ? ? 8.400 ? 1.997 ? ? 0.080 0.028 0 19 1 0.996 ? 
5.970 50.000 ? ? ? ? ? 5834 ? 99.700  ? ? ? ? 0.064 ? ? ? ? ? ? ? ? 8.500 ? 2.265 ? ? 0.069 0.024 0 20 1 0.997 ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                103.010 
_refine.B_iso_mean                               48.1514 
_refine.B_iso_min                                26.440 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5HF9 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.2 
_refine.ls_d_res_low                             45.4180 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     106625 
_refine.ls_number_reflns_R_free                  5346 
_refine.ls_number_reflns_R_work                  101279 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    98.1800 
_refine.ls_percent_reflns_R_free                 5.0100 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2029 
_refine.ls_R_factor_R_free                       0.2403 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2009 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4EY4 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 28.1200 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.3200 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.2 
_refine_hist.d_res_low                        45.4180 
_refine_hist.pdbx_number_atoms_ligand         193 
_refine_hist.number_atoms_solvent             590 
_refine_hist.number_atoms_total               9051 
_refine_hist.pdbx_number_residues_total       1063 
_refine_hist.pdbx_B_iso_mean_ligand           70.17 
_refine_hist.pdbx_B_iso_mean_solvent          51.98 
_refine_hist.pdbx_number_atoms_protein        8268 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.010  ? 8816  ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.214  ? 12040 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.050  ? 1286  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.007  ? 1580  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 14.793 ? 3178  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.1967 2.2217  3455 . 181 3274 97.0000  . . . 0.4256 . 0.3800 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.2217 2.2478  3106 . 150 2956 86.0000  . . . 0.4702 . 0.4472 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.2478 2.2752  2483 . 129 2354 70.0000  . . . 0.5213 . 0.4917 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.2752 2.3040  3588 . 189 3399 100.0000 . . . 0.3460 . 0.3318 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.3040 2.3343  3523 . 166 3357 100.0000 . . . 0.3790 . 0.3201 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.3343 2.3663  3547 . 181 3366 100.0000 . . . 0.3670 . 0.2986 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.3663 2.4001  3581 . 188 3393 100.0000 . . . 0.3206 . 0.2818 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.4001 2.4359  3593 . 179 3414 100.0000 . . . 0.2707 . 0.2645 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.4359 2.4740  3562 . 174 3388 100.0000 . . . 0.3139 . 0.2622 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.4740 2.5145  3588 . 206 3382 100.0000 . . . 0.2725 . 0.2442 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.5145 2.5579  3540 . 176 3364 100.0000 . . . 0.2881 . 0.2398 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.5579 2.6044  3595 . 163 3432 100.0000 . . . 0.3296 . 0.2389 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.6044 2.6545  3630 . 206 3424 100.0000 . . . 0.2996 . 0.2550 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.6545 2.7087  3525 . 183 3342 98.0000  . . . 0.3984 . 0.3413 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.7087 2.7676  3590 . 168 3422 100.0000 . . . 0.2519 . 0.2101 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.7676 2.8319  3566 . 192 3374 100.0000 . . . 0.2475 . 0.1927 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.8319 2.9027  3594 . 174 3420 100.0000 . . . 0.2412 . 0.1923 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.9027 2.9812  3623 . 164 3459 100.0000 . . . 0.2576 . 0.1972 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.9812 3.0689  3602 . 184 3418 100.0000 . . . 0.2453 . 0.1877 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.0689 3.1679  3598 . 178 3420 100.0000 . . . 0.2504 . 0.1881 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.1679 3.2811  3625 . 170 3455 100.0000 . . . 0.2494 . 0.1965 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.2811 3.4125  3652 . 186 3466 100.0000 . . . 0.2263 . 0.1990 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.4125 3.5677  3554 . 191 3363 99.0000  . . . 0.2538 . 0.2300 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.5677 3.7557  3622 . 168 3454 99.0000  . . . 0.2464 . 0.2132 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.7557 3.9909  3562 . 180 3382 98.0000  . . . 0.2367 . 0.1914 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.9909 4.2988  3653 . 171 3482 100.0000 . . . 0.2110 . 0.1562 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 4.2988 4.7310  3679 . 190 3489 100.0000 . . . 0.1521 . 0.1306 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 4.7310 5.4147  3713 . 170 3543 100.0000 . . . 0.1621 . 0.1388 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 5.4147 6.8182  3750 . 209 3541 100.0000 . . . 0.1982 . 0.1636 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 6.8182 45.4274 3926 . 180 3746 100.0000 . . . 0.2017 . 0.1782 . . . . . . 30 . . . 
# 
_struct.entry_id                     5HF9 
_struct.title                        'Crystal structure of human acetylcholinesterase in complex with paraoxon and HI6' 
_struct.pdbx_descriptor              'Acetylcholinesterase (E.C.3.1.1.7)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5HF9 
_struct_keywords.text            'acetylcholinesterase, hydrolase' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
H N N 5 ? 
I N N 6 ? 
J N N 3 ? 
K N N 7 ? 
L N N 4 ? 
M N N 4 ? 
N N N 8 ? 
O N N 5 ? 
P N N 9 ? 
Q N N 9 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 4   ? GLU A 6   ? ASP A 5   GLU A 7   5 ? 3  
HELX_P HELX_P2  AA2 MET A 41  ? ARG A 45  ? MET A 42  ARG A 46  5 ? 5  
HELX_P HELX_P3  AA3 PHE A 79  ? MET A 84  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P4  AA4 LEU A 129 ? ASP A 133 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P5  AA5 GLY A 134 ? ARG A 142 ? GLY A 135 ARG A 143 1 ? 9  
HELX_P HELX_P6  AA6 VAL A 152 ? LEU A 158 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P7  AA7 ASN A 169 ? VAL A 186 ? ASN A 170 VAL A 187 1 ? 18 
HELX_P HELX_P8  AA8 ALA A 187 ? PHE A 189 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P9  AA9 SER A 202 ? LEU A 213 ? SER A 203 LEU A 214 1 ? 12 
HELX_P HELX_P10 AB1 SER A 214 ? GLY A 219 ? SER A 215 GLY A 220 1 ? 6  
HELX_P HELX_P11 AB2 MET A 240 ? VAL A 254 ? MET A 241 VAL A 255 1 ? 15 
HELX_P HELX_P12 AB3 ASP A 265 ? THR A 274 ? ASP A 266 THR A 275 1 ? 10 
HELX_P HELX_P13 AB4 PRO A 276 ? GLU A 284 ? PRO A 277 GLU A 285 1 ? 9  
HELX_P HELX_P14 AB5 TRP A 285 ? LEU A 288 ? TRP A 286 LEU A 289 5 ? 4  
HELX_P HELX_P15 AB6 THR A 310 ? GLY A 318 ? THR A 311 GLY A 319 1 ? 9  
HELX_P HELX_P16 AB7 GLY A 334 ? VAL A 339 ? GLY A 335 VAL A 340 1 ? 6  
HELX_P HELX_P17 AB8 SER A 354 ? VAL A 366 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P18 AB9 SER A 370 ? THR A 382 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P19 AC1 ASP A 389 ? VAL A 406 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P20 AC2 VAL A 406 ? GLN A 420 ? VAL A 407 GLN A 421 1 ? 15 
HELX_P HELX_P21 AC3 PRO A 439 ? GLY A 443 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P22 AC4 GLU A 449 ? PHE A 454 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P23 AC5 GLY A 455 ? ASP A 459 ? GLY A 456 ASP A 460 5 ? 5  
HELX_P HELX_P24 AC6 THR A 465 ? GLY A 486 ? THR A 466 GLY A 487 1 ? 22 
HELX_P HELX_P25 AC7 ARG A 524 ? ARG A 533 ? ARG A 525 ARG A 534 1 ? 10 
HELX_P HELX_P26 AC8 ARG A 533 ? ALA A 541 ? ARG A 534 ALA A 542 1 ? 9  
HELX_P HELX_P27 AC9 ASP B 4   ? GLU B 6   ? ASP B 5   GLU B 7   5 ? 3  
HELX_P HELX_P28 AD1 MET B 41  ? ARG B 45  ? MET B 42  ARG B 46  5 ? 5  
HELX_P HELX_P29 AD2 PHE B 79  ? MET B 84  ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P30 AD3 LEU B 129 ? ASP B 133 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P31 AD4 GLY B 134 ? ARG B 142 ? GLY B 135 ARG B 143 1 ? 9  
HELX_P HELX_P32 AD5 VAL B 152 ? LEU B 158 ? VAL B 153 LEU B 159 1 ? 7  
HELX_P HELX_P33 AD6 ASN B 169 ? VAL B 186 ? ASN B 170 VAL B 187 1 ? 18 
HELX_P HELX_P34 AD7 ALA B 187 ? PHE B 189 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P35 AD8 SER B 202 ? LEU B 213 ? SER B 203 LEU B 214 1 ? 12 
HELX_P HELX_P36 AD9 SER B 214 ? GLY B 219 ? SER B 215 GLY B 220 1 ? 6  
HELX_P HELX_P37 AE1 MET B 240 ? VAL B 254 ? MET B 241 VAL B 255 1 ? 15 
HELX_P HELX_P38 AE2 ASN B 264 ? THR B 274 ? ASN B 265 THR B 275 1 ? 11 
HELX_P HELX_P39 AE3 PRO B 276 ? GLU B 284 ? PRO B 277 GLU B 285 1 ? 9  
HELX_P HELX_P40 AE4 TRP B 285 ? LEU B 288 ? TRP B 286 LEU B 289 5 ? 4  
HELX_P HELX_P41 AE5 THR B 310 ? GLY B 318 ? THR B 311 GLY B 319 1 ? 9  
HELX_P HELX_P42 AE6 GLY B 334 ? VAL B 339 ? GLY B 335 VAL B 340 1 ? 6  
HELX_P HELX_P43 AE7 SER B 354 ? VAL B 366 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P44 AE8 SER B 370 ? THR B 382 ? SER B 371 THR B 383 1 ? 13 
HELX_P HELX_P45 AE9 ASP B 389 ? VAL B 406 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P46 AF1 VAL B 406 ? GLN B 420 ? VAL B 407 GLN B 421 1 ? 15 
HELX_P HELX_P47 AF2 PRO B 439 ? GLY B 443 ? PRO B 440 GLY B 444 5 ? 5  
HELX_P HELX_P48 AF3 GLU B 449 ? PHE B 454 ? GLU B 450 PHE B 455 1 ? 6  
HELX_P HELX_P49 AF4 GLY B 455 ? ASP B 459 ? GLY B 456 ASP B 460 5 ? 5  
HELX_P HELX_P50 AF5 THR B 465 ? GLY B 486 ? THR B 466 GLY B 487 1 ? 22 
HELX_P HELX_P51 AF6 ARG B 524 ? ARG B 533 ? ARG B 525 ARG B 534 1 ? 10 
HELX_P HELX_P52 AF7 PHE B 534 ? ALA B 541 ? PHE B 535 ALA B 542 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 68  SG  ? ? ? 1_555 A CYS 95  SG ? ? A CYS 69  A CYS 96  1_555 ? ? ? ? ? ? ? 2.058 ? ?               
disulf2 disulf ?    ? A CYS 256 SG  ? ? ? 1_555 A CYS 271 SG ? ? A CYS 257 A CYS 272 1_555 ? ? ? ? ? ? ? 2.068 ? ?               
disulf3 disulf ?    ? A CYS 408 SG  ? ? ? 1_555 A CYS 528 SG ? ? A CYS 409 A CYS 529 1_555 ? ? ? ? ? ? ? 2.047 ? ?               
disulf4 disulf ?    ? B CYS 68  SG  ? ? ? 1_555 B CYS 95  SG ? ? B CYS 69  B CYS 96  1_555 ? ? ? ? ? ? ? 2.079 ? ?               
disulf5 disulf ?    ? B CYS 256 SG  ? ? ? 1_555 B CYS 271 SG ? ? B CYS 257 B CYS 272 1_555 ? ? ? ? ? ? ? 2.075 ? ?               
disulf6 disulf ?    ? B CYS 408 SG  ? ? ? 1_555 B CYS 528 SG ? ? B CYS 409 B CYS 529 1_555 ? ? ? ? ? ? ? 2.022 ? ?               
covale1 covale one  ? A SER 202 OG  ? ? ? 1_555 E DEP .   P  A ? A SER 203 A DEP 604 1_555 ? ? ? ? ? ? ? 1.593 ? ?               
covale2 covale one  ? A ASN 349 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 350 C NAG 1   1_555 ? ? ? ? ? ? ? 1.448 ? N-Glycosylation 
covale3 covale one  ? B SER 202 OG  ? ? ? 1_555 J DEP .   P  A ? B SER 203 B DEP 605 1_555 ? ? ? ? ? ? ? 1.598 ? ?               
covale4 covale one  ? B ASN 264 ND2 ? ? ? 1_555 I NAG .   C1 ? ? B ASN 265 B NAG 604 1_555 ? ? ? ? ? ? ? 1.454 ? N-Glycosylation 
covale5 covale one  ? B ASN 349 ND2 ? ? ? 1_555 D NAG .   C1 ? ? B ASN 350 D NAG 1   1_555 ? ? ? ? ? ? ? 1.459 ? N-Glycosylation 
covale6 covale both ? C NAG .   O4  ? ? ? 1_555 C NAG .   C1 ? ? C NAG 1   C NAG 2   1_555 ? ? ? ? ? ? ? 1.446 ? ?               
covale7 covale one  ? C NAG .   O6  ? ? ? 1_555 C FUC .   C1 ? ? C NAG 1   C FUC 3   1_555 ? ? ? ? ? ? ? 1.452 ? ?               
covale8 covale both ? D NAG .   O4  ? ? ? 1_555 D NAG .   C1 ? ? D NAG 1   D NAG 2   1_555 ? ? ? ? ? ? ? 1.458 ? ?               
covale9 covale one  ? D NAG .   O6  ? ? ? 1_555 D FUC .   C1 ? ? D NAG 1   D FUC 3   1_555 ? ? ? ? ? ? ? 1.450 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 104 A . ? TYR 105 A PRO 105 A ? PRO 106 A 1 -3.09 
2 TYR 104 B . ? TYR 105 B PRO 105 B ? PRO 106 B 1 5.60  
3 CYS 256 B . ? CYS 257 B PRO 257 B ? PRO 258 B 1 -1.23 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3  ? 
AA2 ? 11 ? 
AA3 ? 2  ? 
AA4 ? 3  ? 
AA5 ? 11 ? 
AA6 ? 2  ? 
AA7 ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? parallel      
AA2 1  2  ? anti-parallel 
AA2 2  3  ? anti-parallel 
AA2 3  4  ? anti-parallel 
AA2 4  5  ? parallel      
AA2 5  6  ? parallel      
AA2 6  7  ? parallel      
AA2 7  8  ? parallel      
AA2 8  9  ? parallel      
AA2 9  10 ? parallel      
AA2 10 11 ? anti-parallel 
AA3 1  2  ? parallel      
AA4 1  2  ? anti-parallel 
AA4 2  3  ? parallel      
AA5 1  2  ? anti-parallel 
AA5 2  3  ? anti-parallel 
AA5 3  4  ? anti-parallel 
AA5 4  5  ? parallel      
AA5 5  6  ? parallel      
AA5 6  7  ? parallel      
AA5 7  8  ? parallel      
AA5 8  9  ? parallel      
AA5 9  10 ? parallel      
AA5 10 11 ? anti-parallel 
AA6 1  2  ? parallel      
AA7 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  LEU A 8   ? VAL A 11  ? LEU A 9   VAL A 12  
AA1 2  GLY A 14  ? ARG A 17  ? GLY A 15  ARG A 18  
AA1 3  VAL A 58  ? ASP A 60  ? VAL A 59  ASP A 61  
AA2 1  ILE A 19  ? LEU A 21  ? ILE A 20  LEU A 22  
AA2 2  VAL A 28  ? PRO A 35  ? VAL A 29  PRO A 36  
AA2 3  TYR A 97  ? PRO A 103 ? TYR A 98  PRO A 104 
AA2 4  VAL A 144 ? MET A 148 ? VAL A 145 MET A 149 
AA2 5  THR A 111 ? ILE A 117 ? THR A 112 ILE A 118 
AA2 6  GLY A 191 ? GLU A 201 ? GLY A 192 GLU A 202 
AA2 7  ARG A 223 ? GLN A 227 ? ARG A 224 GLN A 228 
AA2 8  GLN A 324 ? VAL A 330 ? GLN A 325 VAL A 331 
AA2 9  ARG A 423 ? PHE A 429 ? ARG A 424 PHE A 430 
AA2 10 GLN A 508 ? LEU A 512 ? GLN A 509 LEU A 513 
AA2 11 GLU A 518 ? ARG A 521 ? GLU A 519 ARG A 522 
AA3 1  VAL A 238 ? GLY A 239 ? VAL A 239 GLY A 240 
AA3 2  VAL A 301 ? VAL A 302 ? VAL A 302 VAL A 303 
AA4 1  LEU B 8   ? VAL B 11  ? LEU B 9   VAL B 12  
AA4 2  GLY B 14  ? ARG B 17  ? GLY B 15  ARG B 18  
AA4 3  VAL B 58  ? ASP B 60  ? VAL B 59  ASP B 61  
AA5 1  ILE B 19  ? LEU B 21  ? ILE B 20  LEU B 22  
AA5 2  VAL B 28  ? PRO B 35  ? VAL B 29  PRO B 36  
AA5 3  TYR B 97  ? PRO B 103 ? TYR B 98  PRO B 104 
AA5 4  VAL B 144 ? MET B 148 ? VAL B 145 MET B 149 
AA5 5  THR B 111 ? ILE B 117 ? THR B 112 ILE B 118 
AA5 6  GLY B 191 ? GLU B 201 ? GLY B 192 GLU B 202 
AA5 7  ARG B 223 ? GLN B 227 ? ARG B 224 GLN B 228 
AA5 8  GLN B 324 ? VAL B 330 ? GLN B 325 VAL B 331 
AA5 9  ARG B 423 ? PHE B 429 ? ARG B 424 PHE B 430 
AA5 10 GLN B 508 ? LEU B 512 ? GLN B 509 LEU B 513 
AA5 11 GLU B 518 ? ARG B 521 ? GLU B 519 ARG B 522 
AA6 1  VAL B 67  ? CYS B 68  ? VAL B 68  CYS B 69  
AA6 2  LEU B 91  ? SER B 92  ? LEU B 92  SER B 93  
AA7 1  VAL B 238 ? GLY B 239 ? VAL B 239 GLY B 240 
AA7 2  VAL B 301 ? VAL B 302 ? VAL B 302 VAL B 303 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  N VAL A 11  ? N VAL A 12  O GLY A 14  ? O GLY A 15  
AA1 2  3  N ARG A 15  ? N ARG A 16  O VAL A 59  ? O VAL A 60  
AA2 1  2  N LEU A 21  ? N LEU A 22  O VAL A 28  ? O VAL A 29  
AA2 2  3  N PHE A 31  ? N PHE A 32  O VAL A 100 ? O VAL A 101 
AA2 3  4  N ASN A 99  ? N ASN A 100 O SER A 147 ? O SER A 148 
AA2 4  5  O VAL A 146 ? O VAL A 147 N TRP A 116 ? N TRP A 117 
AA2 5  6  N VAL A 113 ? N VAL A 114 O SER A 195 ? O SER A 196 
AA2 6  7  N LEU A 198 ? N LEU A 199 O VAL A 225 ? O VAL A 226 
AA2 7  8  N LEU A 226 ? N LEU A 227 O LEU A 326 ? O LEU A 327 
AA2 8  9  N VAL A 329 ? N VAL A 330 O PHE A 429 ? O PHE A 430 
AA2 9  10 N VAL A 428 ? N VAL A 429 O LEU A 512 ? O LEU A 513 
AA2 10 11 N TYR A 509 ? N TYR A 510 O ARG A 520 ? O ARG A 521 
AA3 1  2  N VAL A 238 ? N VAL A 239 O VAL A 302 ? O VAL A 303 
AA4 1  2  N VAL B 9   ? N VAL B 10  O LEU B 16  ? O LEU B 17  
AA4 2  3  N ARG B 15  ? N ARG B 16  O VAL B 59  ? O VAL B 60  
AA5 1  2  N LEU B 21  ? N LEU B 22  O VAL B 28  ? O VAL B 29  
AA5 2  3  N PHE B 31  ? N PHE B 32  O VAL B 100 ? O VAL B 101 
AA5 3  4  N ASN B 99  ? N ASN B 100 O SER B 147 ? O SER B 148 
AA5 4  5  O VAL B 146 ? O VAL B 147 N TRP B 116 ? N TRP B 117 
AA5 5  6  N THR B 111 ? N THR B 112 O ASP B 192 ? O ASP B 193 
AA5 6  7  N LEU B 198 ? N LEU B 199 O VAL B 225 ? O VAL B 226 
AA5 7  8  N LEU B 226 ? N LEU B 227 O LEU B 326 ? O LEU B 327 
AA5 8  9  N VAL B 329 ? N VAL B 330 O PHE B 429 ? O PHE B 430 
AA5 9  10 N VAL B 428 ? N VAL B 429 O LEU B 512 ? O LEU B 513 
AA5 10 11 N TYR B 509 ? N TYR B 510 O ARG B 520 ? O ARG B 521 
AA6 1  2  N VAL B 67  ? N VAL B 68  O SER B 92  ? O SER B 93  
AA7 1  2  N VAL B 238 ? N VAL B 239 O VAL B 302 ? O VAL B 303 
# 
_atom_sites.entry_id                    5HF9 
_atom_sites.fract_transf_matrix[1][1]   0.009440 
_atom_sites.fract_transf_matrix[1][2]   0.005450 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010900 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003082 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 3   ? 2.378   -36.462 70.039  1.00 84.79  ? 4    GLU A N   1 
ATOM   2    C CA  . GLU A 1 3   ? 2.236   -35.796 68.746  1.00 84.89  ? 4    GLU A CA  1 
ATOM   3    C C   . GLU A 1 3   ? 3.407   -36.151 67.823  1.00 83.00  ? 4    GLU A C   1 
ATOM   4    O O   . GLU A 1 3   ? 4.571   -36.135 68.239  1.00 84.90  ? 4    GLU A O   1 
ATOM   5    C CB  . GLU A 1 3   ? 2.132   -34.276 68.932  1.00 82.55  ? 4    GLU A CB  1 
ATOM   6    C CG  . GLU A 1 3   ? 1.882   -33.483 67.641  1.00 85.51  ? 4    GLU A CG  1 
ATOM   7    C CD  . GLU A 1 3   ? 0.456   -33.625 67.102  1.00 85.64  ? 4    GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 3   ? -0.316  -34.452 67.641  1.00 91.87  ? 4    GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 3   ? 0.104   -32.901 66.139  1.00 78.53  ? 4    GLU A OE2 1 
ATOM   10   N N   . ASP A 1 4   ? 3.101   -36.485 66.574  1.00 69.10  ? 5    ASP A N   1 
ATOM   11   C CA  . ASP A 1 4   ? 4.139   -36.942 65.658  1.00 68.51  ? 5    ASP A CA  1 
ATOM   12   C C   . ASP A 1 4   ? 4.641   -35.808 64.772  1.00 64.97  ? 5    ASP A C   1 
ATOM   13   O O   . ASP A 1 4   ? 3.915   -35.338 63.904  1.00 62.71  ? 5    ASP A O   1 
ATOM   14   C CB  . ASP A 1 4   ? 3.616   -38.092 64.797  1.00 62.24  ? 5    ASP A CB  1 
ATOM   15   C CG  . ASP A 1 4   ? 4.733   -38.897 64.168  1.00 69.01  ? 5    ASP A CG  1 
ATOM   16   O OD1 . ASP A 1 4   ? 5.864   -38.357 64.052  1.00 68.54  ? 5    ASP A OD1 1 
ATOM   17   O OD2 . ASP A 1 4   ? 4.480   -40.070 63.790  1.00 67.82  ? 5    ASP A OD2 1 
ATOM   18   N N   . ALA A 1 5   ? 5.887   -35.384 64.983  1.00 65.14  ? 6    ALA A N   1 
ATOM   19   C CA  . ALA A 1 5   ? 6.449   -34.248 64.250  1.00 65.05  ? 6    ALA A CA  1 
ATOM   20   C C   . ALA A 1 5   ? 6.816   -34.615 62.812  1.00 62.02  ? 6    ALA A C   1 
ATOM   21   O O   . ALA A 1 5   ? 7.089   -33.734 61.997  1.00 64.28  ? 6    ALA A O   1 
ATOM   22   C CB  . ALA A 1 5   ? 7.670   -33.687 64.978  1.00 54.51  ? 6    ALA A CB  1 
ATOM   23   N N   . GLU A 1 6   ? 6.816   -35.909 62.497  1.00 63.42  ? 7    GLU A N   1 
ATOM   24   C CA  . GLU A 1 6   ? 7.032   -36.337 61.117  1.00 62.61  ? 7    GLU A CA  1 
ATOM   25   C C   . GLU A 1 6   ? 5.821   -36.021 60.219  1.00 60.24  ? 7    GLU A C   1 
ATOM   26   O O   . GLU A 1 6   ? 5.937   -35.953 58.990  1.00 61.06  ? 7    GLU A O   1 
ATOM   27   C CB  . GLU A 1 6   ? 7.341   -37.830 61.062  1.00 61.32  ? 7    GLU A CB  1 
ATOM   28   C CG  . GLU A 1 6   ? 8.701   -38.214 61.614  1.00 64.67  ? 7    GLU A CG  1 
ATOM   29   C CD  . GLU A 1 6   ? 9.866   -37.597 60.853  1.00 69.77  ? 7    GLU A CD  1 
ATOM   30   O OE1 . GLU A 1 6   ? 9.714   -37.268 59.654  1.00 73.25  ? 7    GLU A OE1 1 
ATOM   31   O OE2 . GLU A 1 6   ? 10.951  -37.449 61.458  1.00 76.49  ? 7    GLU A OE2 1 
ATOM   32   N N   . LEU A 1 7   ? 4.663   -35.834 60.834  1.00 53.59  ? 8    LEU A N   1 
ATOM   33   C CA  . LEU A 1 7   ? 3.453   -35.520 60.087  1.00 52.48  ? 8    LEU A CA  1 
ATOM   34   C C   . LEU A 1 7   ? 3.139   -34.025 60.087  1.00 51.52  ? 8    LEU A C   1 
ATOM   35   O O   . LEU A 1 7   ? 2.078   -33.606 59.614  1.00 49.11  ? 8    LEU A O   1 
ATOM   36   C CB  . LEU A 1 7   ? 2.268   -36.291 60.665  1.00 50.41  ? 8    LEU A CB  1 
ATOM   37   C CG  . LEU A 1 7   ? 2.472   -37.793 60.862  1.00 54.47  ? 8    LEU A CG  1 
ATOM   38   C CD1 . LEU A 1 7   ? 1.175   -38.415 61.389  1.00 51.36  ? 8    LEU A CD1 1 
ATOM   39   C CD2 . LEU A 1 7   ? 2.943   -38.486 59.572  1.00 49.08  ? 8    LEU A CD2 1 
ATOM   40   N N   . LEU A 1 8   ? 4.046   -33.222 60.637  1.00 49.13  ? 9    LEU A N   1 
ATOM   41   C CA  . LEU A 1 8   ? 3.871   -31.778 60.602  1.00 46.75  ? 9    LEU A CA  1 
ATOM   42   C C   . LEU A 1 8   ? 4.869   -31.208 59.612  1.00 47.11  ? 9    LEU A C   1 
ATOM   43   O O   . LEU A 1 8   ? 6.049   -31.556 59.635  1.00 48.10  ? 9    LEU A O   1 
ATOM   44   C CB  . LEU A 1 8   ? 4.040   -31.162 61.986  1.00 49.02  ? 9    LEU A CB  1 
ATOM   45   C CG  . LEU A 1 8   ? 2.999   -31.610 63.021  1.00 56.71  ? 9    LEU A CG  1 
ATOM   46   C CD1 . LEU A 1 8   ? 3.129   -30.812 64.332  1.00 61.22  ? 9    LEU A CD1 1 
ATOM   47   C CD2 . LEU A 1 8   ? 1.574   -31.510 62.477  1.00 44.57  ? 9    LEU A CD2 1 
ATOM   48   N N   . VAL A 1 9   ? 4.370   -30.381 58.703  1.00 43.69  ? 10   VAL A N   1 
ATOM   49   C CA  . VAL A 1 9   ? 5.172   -29.840 57.602  1.00 44.66  ? 10   VAL A CA  1 
ATOM   50   C C   . VAL A 1 9   ? 4.734   -28.417 57.343  1.00 42.16  ? 10   VAL A C   1 
ATOM   51   O O   . VAL A 1 9   ? 3.538   -28.129 57.334  1.00 47.10  ? 10   VAL A O   1 
ATOM   52   C CB  . VAL A 1 9   ? 5.007   -30.675 56.302  1.00 43.81  ? 10   VAL A CB  1 
ATOM   53   C CG1 . VAL A 1 9   ? 5.655   -29.987 55.105  1.00 49.56  ? 10   VAL A CG1 1 
ATOM   54   C CG2 . VAL A 1 9   ? 5.588   -32.063 56.476  1.00 48.68  ? 10   VAL A CG2 1 
ATOM   55   N N   . THR A 1 10  ? 5.687   -27.519 57.140  1.00 44.41  ? 11   THR A N   1 
ATOM   56   C CA  . THR A 1 10  ? 5.343   -26.154 56.768  1.00 45.92  ? 11   THR A CA  1 
ATOM   57   C C   . THR A 1 10  ? 5.768   -25.885 55.326  1.00 47.36  ? 11   THR A C   1 
ATOM   58   O O   . THR A 1 10  ? 6.931   -26.060 54.967  1.00 50.55  ? 11   THR A O   1 
ATOM   59   C CB  . THR A 1 10  ? 5.996   -25.121 57.741  1.00 51.76  ? 11   THR A CB  1 
ATOM   60   O OG1 . THR A 1 10  ? 5.360   -25.214 59.020  1.00 49.39  ? 11   THR A OG1 1 
ATOM   61   C CG2 . THR A 1 10  ? 5.835   -23.701 57.224  1.00 45.84  ? 11   THR A CG2 1 
ATOM   62   N N   . VAL A 1 11  ? 4.812   -25.497 54.488  1.00 42.81  ? 12   VAL A N   1 
ATOM   63   C CA  . VAL A 1 11  ? 5.122   -25.129 53.108  1.00 43.54  ? 12   VAL A CA  1 
ATOM   64   C C   . VAL A 1 11  ? 4.945   -23.622 53.017  1.00 45.97  ? 12   VAL A C   1 
ATOM   65   O O   . VAL A 1 11  ? 4.570   -22.999 53.998  1.00 49.21  ? 12   VAL A O   1 
ATOM   66   C CB  . VAL A 1 11  ? 4.218   -25.878 52.083  1.00 44.62  ? 12   VAL A CB  1 
ATOM   67   C CG1 . VAL A 1 11  ? 4.589   -27.360 52.052  1.00 39.61  ? 12   VAL A CG1 1 
ATOM   68   C CG2 . VAL A 1 11  ? 2.751   -25.727 52.447  1.00 40.14  ? 12   VAL A CG2 1 
ATOM   69   N N   . ARG A 1 12  ? 5.198   -23.029 51.862  1.00 47.01  ? 13   ARG A N   1 
ATOM   70   C CA  . ARG A 1 12  ? 5.197   -21.575 51.789  1.00 45.70  ? 13   ARG A CA  1 
ATOM   71   C C   . ARG A 1 12  ? 3.881   -20.961 52.242  1.00 48.99  ? 13   ARG A C   1 
ATOM   72   O O   . ARG A 1 12  ? 3.868   -19.887 52.832  1.00 49.59  ? 13   ARG A O   1 
ATOM   73   C CB  . ARG A 1 12  ? 5.528   -21.105 50.368  1.00 49.06  ? 13   ARG A CB  1 
ATOM   74   C CG  . ARG A 1 12  ? 6.978   -21.359 50.027  1.00 55.08  ? 13   ARG A CG  1 
ATOM   75   C CD  . ARG A 1 12  ? 7.485   -20.512 48.890  1.00 63.37  ? 13   ARG A CD  1 
ATOM   76   N NE  . ARG A 1 12  ? 8.804   -20.984 48.464  1.00 72.04  ? 13   ARG A NE  1 
ATOM   77   C CZ  . ARG A 1 12  ? 9.457   -20.534 47.396  1.00 73.58  ? 13   ARG A CZ  1 
ATOM   78   N NH1 . ARG A 1 12  ? 8.923   -19.582 46.639  1.00 72.21  ? 13   ARG A NH1 1 
ATOM   79   N NH2 . ARG A 1 12  ? 10.649  -21.035 47.086  1.00 77.46  ? 13   ARG A NH2 1 
ATOM   80   N N   . GLY A 1 13  ? 2.775   -21.646 51.984  1.00 48.07  ? 14   GLY A N   1 
ATOM   81   C CA  . GLY A 1 13  ? 1.477   -21.084 52.294  1.00 43.12  ? 14   GLY A CA  1 
ATOM   82   C C   . GLY A 1 13  ? 0.988   -21.322 53.709  1.00 46.16  ? 14   GLY A C   1 
ATOM   83   O O   . GLY A 1 13  ? -0.019  -20.741 54.117  1.00 43.95  ? 14   GLY A O   1 
ATOM   84   N N   . GLY A 1 14  ? 1.679   -22.183 54.452  1.00 44.05  ? 15   GLY A N   1 
ATOM   85   C CA  . GLY A 1 14  ? 1.206   -22.555 55.771  1.00 42.50  ? 15   GLY A CA  1 
ATOM   86   C C   . GLY A 1 14  ? 1.627   -23.928 56.262  1.00 44.04  ? 15   GLY A C   1 
ATOM   87   O O   . GLY A 1 14  ? 2.493   -24.594 55.681  1.00 43.58  ? 15   GLY A O   1 
ATOM   88   N N   . ARG A 1 15  ? 0.996   -24.329 57.358  1.00 45.71  ? 16   ARG A N   1 
ATOM   89   C CA  . ARG A 1 15  ? 1.285   -25.572 58.060  1.00 48.81  ? 16   ARG A CA  1 
ATOM   90   C C   . ARG A 1 15  ? 0.335   -26.704 57.625  1.00 47.46  ? 16   ARG A C   1 
ATOM   91   O O   . ARG A 1 15  ? -0.850  -26.475 57.351  1.00 42.34  ? 16   ARG A O   1 
ATOM   92   C CB  . ARG A 1 15  ? 1.193   -25.348 59.586  1.00 50.58  ? 16   ARG A CB  1 
ATOM   93   C CG  . ARG A 1 15  ? 2.442   -24.697 60.205  1.00 58.53  ? 16   ARG A CG  1 
ATOM   94   C CD  . ARG A 1 15  ? 2.264   -24.348 61.694  1.00 54.01  ? 16   ARG A CD  1 
ATOM   95   N NE  . ARG A 1 15  ? 1.213   -23.352 61.899  1.00 55.36  ? 16   ARG A NE  1 
ATOM   96   C CZ  . ARG A 1 15  ? 0.421   -23.306 62.969  1.00 59.03  ? 16   ARG A CZ  1 
ATOM   97   N NH1 . ARG A 1 15  ? 0.557   -24.202 63.936  1.00 54.01  ? 16   ARG A NH1 1 
ATOM   98   N NH2 . ARG A 1 15  ? -0.516  -22.372 63.070  1.00 63.67  ? 16   ARG A NH2 1 
ATOM   99   N N   . LEU A 1 16  ? 0.872   -27.923 57.588  1.00 46.74  ? 17   LEU A N   1 
ATOM   100  C CA  . LEU A 1 16  ? 0.117   -29.110 57.192  1.00 49.99  ? 17   LEU A CA  1 
ATOM   101  C C   . LEU A 1 16  ? 0.175   -30.205 58.257  1.00 43.23  ? 17   LEU A C   1 
ATOM   102  O O   . LEU A 1 16  ? 1.211   -30.423 58.889  1.00 45.40  ? 17   LEU A O   1 
ATOM   103  C CB  . LEU A 1 16  ? 0.653   -29.674 55.859  1.00 46.27  ? 17   LEU A CB  1 
ATOM   104  C CG  . LEU A 1 16  ? 0.680   -28.747 54.644  1.00 43.57  ? 17   LEU A CG  1 
ATOM   105  C CD1 . LEU A 1 16  ? 1.313   -29.439 53.443  1.00 40.36  ? 17   LEU A CD1 1 
ATOM   106  C CD2 . LEU A 1 16  ? -0.713  -28.255 54.314  1.00 43.79  ? 17   LEU A CD2 1 
ATOM   107  N N   . ARG A 1 17  ? -0.934  -30.912 58.434  1.00 42.14  ? 18   ARG A N   1 
ATOM   108  C CA  . ARG A 1 17  ? -0.928  -32.125 59.244  1.00 51.32  ? 18   ARG A CA  1 
ATOM   109  C C   . ARG A 1 17  ? -1.221  -33.349 58.372  1.00 44.66  ? 18   ARG A C   1 
ATOM   110  O O   . ARG A 1 17  ? -2.330  -33.512 57.868  1.00 47.76  ? 18   ARG A O   1 
ATOM   111  C CB  . ARG A 1 17  ? -1.946  -32.026 60.398  1.00 49.14  ? 18   ARG A CB  1 
ATOM   112  C CG  . ARG A 1 17  ? -2.006  -33.263 61.303  1.00 50.34  ? 18   ARG A CG  1 
ATOM   113  C CD  . ARG A 1 17  ? -2.968  -33.029 62.482  1.00 65.20  ? 18   ARG A CD  1 
ATOM   114  N NE  . ARG A 1 17  ? -4.053  -32.118 62.100  1.00 73.62  ? 18   ARG A NE  1 
ATOM   115  C CZ  . ARG A 1 17  ? -5.233  -32.503 61.607  1.00 75.11  ? 18   ARG A CZ  1 
ATOM   116  N NH1 . ARG A 1 17  ? -5.514  -33.799 61.454  1.00 66.29  ? 18   ARG A NH1 1 
ATOM   117  N NH2 . ARG A 1 17  ? -6.143  -31.586 61.279  1.00 66.07  ? 18   ARG A NH2 1 
ATOM   118  N N   . GLY A 1 18  ? -0.219  -34.205 58.200  1.00 46.97  ? 19   GLY A N   1 
ATOM   119  C CA  . GLY A 1 18  ? -0.371  -35.407 57.394  1.00 47.54  ? 19   GLY A CA  1 
ATOM   120  C C   . GLY A 1 18  ? -0.817  -36.623 58.192  1.00 51.03  ? 19   GLY A C   1 
ATOM   121  O O   . GLY A 1 18  ? -1.314  -36.491 59.303  1.00 49.81  ? 19   GLY A O   1 
ATOM   122  N N   . ILE A 1 19  ? -0.638  -37.810 57.617  1.00 46.74  ? 20   ILE A N   1 
ATOM   123  C CA  . ILE A 1 19  ? -1.087  -39.042 58.237  1.00 41.96  ? 20   ILE A CA  1 
ATOM   124  C C   . ILE A 1 19  ? -0.099  -40.149 57.912  1.00 46.23  ? 20   ILE A C   1 
ATOM   125  O O   . ILE A 1 19  ? 0.552   -40.131 56.868  1.00 44.35  ? 20   ILE A O   1 
ATOM   126  C CB  . ILE A 1 19  ? -2.509  -39.439 57.757  1.00 48.53  ? 20   ILE A CB  1 
ATOM   127  C CG1 . ILE A 1 19  ? -3.084  -40.596 58.578  1.00 46.96  ? 20   ILE A CG1 1 
ATOM   128  C CG2 . ILE A 1 19  ? -2.509  -39.827 56.280  1.00 42.20  ? 20   ILE A CG2 1 
ATOM   129  C CD1 . ILE A 1 19  ? -4.472  -41.015 58.097  1.00 47.11  ? 20   ILE A CD1 1 
ATOM   130  N N   . ARG A 1 20  ? 0.026   -41.107 58.821  1.00 46.09  ? 21   ARG A N   1 
ATOM   131  C CA  . ARG A 1 20  ? 0.925   -42.226 58.634  1.00 42.26  ? 21   ARG A CA  1 
ATOM   132  C C   . ARG A 1 20  ? 0.135   -43.388 58.031  1.00 47.51  ? 21   ARG A C   1 
ATOM   133  O O   . ARG A 1 20  ? -0.983  -43.672 58.461  1.00 49.87  ? 21   ARG A O   1 
ATOM   134  C CB  . ARG A 1 20  ? 1.566   -42.611 59.972  1.00 48.73  ? 21   ARG A CB  1 
ATOM   135  C CG  . ARG A 1 20  ? 2.605   -43.702 59.873  1.00 47.32  ? 21   ARG A CG  1 
ATOM   136  C CD  . ARG A 1 20  ? 3.452   -43.846 61.176  1.00 63.98  ? 21   ARG A CD  1 
ATOM   137  N NE  . ARG A 1 20  ? 2.757   -43.542 62.440  1.00 63.15  ? 21   ARG A NE  1 
ATOM   138  C CZ  . ARG A 1 20  ? 1.855   -44.325 63.039  1.00 57.99  ? 21   ARG A CZ  1 
ATOM   139  N NH1 . ARG A 1 20  ? 1.475   -45.488 62.503  1.00 54.63  ? 21   ARG A NH1 1 
ATOM   140  N NH2 . ARG A 1 20  ? 1.315   -43.924 64.181  1.00 51.97  ? 21   ARG A NH2 1 
ATOM   141  N N   . LEU A 1 21  ? 0.698   -44.033 57.017  1.00 42.49  ? 22   LEU A N   1 
ATOM   142  C CA  . LEU A 1 21  ? 0.009   -45.115 56.313  1.00 47.91  ? 22   LEU A CA  1 
ATOM   143  C C   . LEU A 1 21  ? 0.780   -46.391 56.550  1.00 48.14  ? 22   LEU A C   1 
ATOM   144  O O   . LEU A 1 21  ? 1.992   -46.340 56.734  1.00 47.75  ? 22   LEU A O   1 
ATOM   145  C CB  . LEU A 1 21  ? -0.090  -44.843 54.796  1.00 38.75  ? 22   LEU A CB  1 
ATOM   146  C CG  . LEU A 1 21  ? -0.925  -43.649 54.318  1.00 51.25  ? 22   LEU A CG  1 
ATOM   147  C CD1 . LEU A 1 21  ? -0.896  -43.518 52.785  1.00 46.89  ? 22   LEU A CD1 1 
ATOM   148  C CD2 . LEU A 1 21  ? -2.363  -43.733 54.817  1.00 44.10  ? 22   LEU A CD2 1 
ATOM   149  N N   . LYS A 1 22  ? 0.087   -47.530 56.529  1.00 44.96  ? 23   LYS A N   1 
ATOM   150  C CA  . LYS A 1 22  ? 0.739   -48.822 56.661  1.00 42.22  ? 23   LYS A CA  1 
ATOM   151  C C   . LYS A 1 22  ? 0.890   -49.521 55.309  1.00 41.29  ? 23   LYS A C   1 
ATOM   152  O O   . LYS A 1 22  ? 0.025   -49.414 54.443  1.00 40.25  ? 23   LYS A O   1 
ATOM   153  C CB  . LYS A 1 22  ? -0.048  -49.725 57.626  1.00 47.61  ? 23   LYS A CB  1 
ATOM   154  C CG  . LYS A 1 22  ? -0.318  -49.108 58.999  1.00 54.85  ? 23   LYS A CG  1 
ATOM   155  C CD  . LYS A 1 22  ? -0.905  -50.138 59.985  1.00 48.22  ? 23   LYS A CD  1 
ATOM   156  C CE  . LYS A 1 22  ? -2.350  -50.457 59.652  1.00 57.62  ? 23   LYS A CE  1 
ATOM   157  N NZ  . LYS A 1 22  ? -2.748  -51.846 60.089  1.00 61.76  ? 23   LYS A NZ  1 
ATOM   158  N N   . THR A 1 23  ? 2.006   -50.222 55.152  1.00 36.40  ? 24   THR A N   1 
ATOM   159  C CA  . THR A 1 23  ? 2.237   -51.157 54.069  1.00 46.37  ? 24   THR A CA  1 
ATOM   160  C C   . THR A 1 23  ? 2.847   -52.441 54.647  1.00 42.57  ? 24   THR A C   1 
ATOM   161  O O   . THR A 1 23  ? 3.394   -52.440 55.747  1.00 46.00  ? 24   THR A O   1 
ATOM   162  C CB  . THR A 1 23  ? 3.213   -50.580 52.969  1.00 40.11  ? 24   THR A CB  1 
ATOM   163  O OG1 . THR A 1 23  ? 4.563   -50.716 53.413  1.00 38.69  ? 24   THR A OG1 1 
ATOM   164  C CG2 . THR A 1 23  ? 2.928   -49.133 52.705  1.00 38.76  ? 24   THR A CG2 1 
ATOM   165  N N   . PRO A 1 24  ? 2.798   -53.532 53.887  1.00 44.98  ? 25   PRO A N   1 
ATOM   166  C CA  . PRO A 1 24  ? 3.473   -54.757 54.326  1.00 47.10  ? 25   PRO A CA  1 
ATOM   167  C C   . PRO A 1 24  ? 4.978   -54.580 54.504  1.00 46.86  ? 25   PRO A C   1 
ATOM   168  O O   . PRO A 1 24  ? 5.644   -55.467 55.045  1.00 49.42  ? 25   PRO A O   1 
ATOM   169  C CB  . PRO A 1 24  ? 3.178   -55.741 53.190  1.00 42.54  ? 25   PRO A CB  1 
ATOM   170  C CG  . PRO A 1 24  ? 1.930   -55.223 52.589  1.00 46.80  ? 25   PRO A CG  1 
ATOM   171  C CD  . PRO A 1 24  ? 2.011   -53.743 52.662  1.00 38.28  ? 25   PRO A CD  1 
ATOM   172  N N   . GLY A 1 25  ? 5.512   -53.454 54.048  1.00 42.83  ? 26   GLY A N   1 
ATOM   173  C CA  . GLY A 1 25  ? 6.931   -53.193 54.207  1.00 42.63  ? 26   GLY A CA  1 
ATOM   174  C C   . GLY A 1 25  ? 7.282   -52.161 55.261  1.00 43.84  ? 26   GLY A C   1 
ATOM   175  O O   . GLY A 1 25  ? 8.449   -51.781 55.378  1.00 48.59  ? 26   GLY A O   1 
ATOM   176  N N   . GLY A 1 26  ? 6.290   -51.714 56.038  1.00 36.69  ? 27   GLY A N   1 
ATOM   177  C CA  . GLY A 1 26  ? 6.506   -50.627 56.969  1.00 34.63  ? 27   GLY A CA  1 
ATOM   178  C C   . GLY A 1 26  ? 5.776   -49.343 56.585  1.00 42.72  ? 27   GLY A C   1 
ATOM   179  O O   . GLY A 1 26  ? 5.246   -49.223 55.479  1.00 45.91  ? 27   GLY A O   1 
ATOM   180  N N   . PRO A 1 27  ? 5.756   -48.363 57.500  1.00 43.15  ? 28   PRO A N   1 
ATOM   181  C CA  . PRO A 1 27  ? 5.003   -47.124 57.296  1.00 40.97  ? 28   PRO A CA  1 
ATOM   182  C C   . PRO A 1 27  ? 5.584   -46.152 56.261  1.00 41.54  ? 28   PRO A C   1 
ATOM   183  O O   . PRO A 1 27  ? 6.745   -46.201 55.844  1.00 37.86  ? 28   PRO A O   1 
ATOM   184  C CB  . PRO A 1 27  ? 5.043   -46.469 58.678  1.00 40.54  ? 28   PRO A CB  1 
ATOM   185  C CG  . PRO A 1 27  ? 6.327   -46.936 59.241  1.00 42.06  ? 28   PRO A CG  1 
ATOM   186  C CD  . PRO A 1 27  ? 6.494   -48.350 58.776  1.00 35.36  ? 28   PRO A CD  1 
ATOM   187  N N   . VAL A 1 28  ? 4.742   -45.188 55.933  1.00 39.74  ? 29   VAL A N   1 
ATOM   188  C CA  . VAL A 1 28  ? 5.002   -44.215 54.910  1.00 39.98  ? 29   VAL A CA  1 
ATOM   189  C C   . VAL A 1 28  ? 4.314   -42.959 55.417  1.00 38.83  ? 29   VAL A C   1 
ATOM   190  O O   . VAL A 1 28  ? 3.324   -43.064 56.141  1.00 39.25  ? 29   VAL A O   1 
ATOM   191  C CB  . VAL A 1 28  ? 4.450   -44.724 53.537  1.00 46.80  ? 29   VAL A CB  1 
ATOM   192  C CG1 . VAL A 1 28  ? 3.729   -43.625 52.759  1.00 46.80  ? 29   VAL A CG1 1 
ATOM   193  C CG2 . VAL A 1 28  ? 5.555   -45.383 52.732  1.00 35.98  ? 29   VAL A CG2 1 
ATOM   194  N N   . SER A 1 29  ? 4.845   -41.780 55.096  1.00 41.08  ? 30   SER A N   1 
ATOM   195  C CA  . SER A 1 29  ? 4.155   -40.531 55.432  1.00 40.73  ? 30   SER A CA  1 
ATOM   196  C C   . SER A 1 29  ? 3.360   -40.064 54.223  1.00 42.78  ? 30   SER A C   1 
ATOM   197  O O   . SER A 1 29  ? 3.859   -40.129 53.101  1.00 44.06  ? 30   SER A O   1 
ATOM   198  C CB  . SER A 1 29  ? 5.134   -39.431 55.842  1.00 41.02  ? 30   SER A CB  1 
ATOM   199  O OG  . SER A 1 29  ? 5.998   -39.842 56.891  1.00 50.74  ? 30   SER A OG  1 
ATOM   200  N N   . ALA A 1 30  ? 2.148   -39.569 54.448  1.00 41.63  ? 31   ALA A N   1 
ATOM   201  C CA  . ALA A 1 30  ? 1.323   -39.091 53.356  1.00 40.81  ? 31   ALA A CA  1 
ATOM   202  C C   . ALA A 1 30  ? 0.685   -37.761 53.694  1.00 42.20  ? 31   ALA A C   1 
ATOM   203  O O   . ALA A 1 30  ? 0.250   -37.542 54.815  1.00 39.25  ? 31   ALA A O   1 
ATOM   204  C CB  . ALA A 1 30  ? 0.246   -40.114 53.004  1.00 40.16  ? 31   ALA A CB  1 
ATOM   205  N N   . PHE A 1 31  ? 0.612   -36.886 52.690  1.00 39.19  ? 32   PHE A N   1 
ATOM   206  C CA  . PHE A 1 31  ? -0.016  -35.598 52.840  1.00 40.19  ? 32   PHE A CA  1 
ATOM   207  C C   . PHE A 1 31  ? -0.978  -35.431 51.671  1.00 34.76  ? 32   PHE A C   1 
ATOM   208  O O   . PHE A 1 31  ? -0.574  -35.196 50.539  1.00 43.01  ? 32   PHE A O   1 
ATOM   209  C CB  . PHE A 1 31  ? 1.024   -34.493 52.899  1.00 39.20  ? 32   PHE A CB  1 
ATOM   210  C CG  . PHE A 1 31  ? 1.968   -34.619 54.072  1.00 38.48  ? 32   PHE A CG  1 
ATOM   211  C CD1 . PHE A 1 31  ? 3.041   -35.486 54.024  1.00 39.74  ? 32   PHE A CD1 1 
ATOM   212  C CD2 . PHE A 1 31  ? 1.788   -33.860 55.208  1.00 39.64  ? 32   PHE A CD2 1 
ATOM   213  C CE1 . PHE A 1 31  ? 3.907   -35.605 55.087  1.00 42.22  ? 32   PHE A CE1 1 
ATOM   214  C CE2 . PHE A 1 31  ? 2.656   -33.983 56.280  1.00 46.90  ? 32   PHE A CE2 1 
ATOM   215  C CZ  . PHE A 1 31  ? 3.716   -34.858 56.210  1.00 40.28  ? 32   PHE A CZ  1 
ATOM   216  N N   . LEU A 1 32  ? -2.254  -35.606 51.989  1.00 33.30  ? 33   LEU A N   1 
ATOM   217  C CA  . LEU A 1 32  ? -3.335  -35.773 51.046  1.00 37.66  ? 33   LEU A CA  1 
ATOM   218  C C   . LEU A 1 32  ? -4.269  -34.592 51.154  1.00 39.07  ? 33   LEU A C   1 
ATOM   219  O O   . LEU A 1 32  ? -4.686  -34.234 52.263  1.00 37.47  ? 33   LEU A O   1 
ATOM   220  C CB  . LEU A 1 32  ? -4.101  -37.068 51.329  1.00 31.63  ? 33   LEU A CB  1 
ATOM   221  C CG  . LEU A 1 32  ? -3.219  -38.305 51.477  1.00 37.66  ? 33   LEU A CG  1 
ATOM   222  C CD1 . LEU A 1 32  ? -4.047  -39.517 51.903  1.00 34.04  ? 33   LEU A CD1 1 
ATOM   223  C CD2 . LEU A 1 32  ? -2.459  -38.608 50.160  1.00 36.76  ? 33   LEU A CD2 1 
ATOM   224  N N   . GLY A 1 33  ? -4.605  -33.997 50.009  1.00 34.37  ? 34   GLY A N   1 
ATOM   225  C CA  . GLY A 1 33  ? -5.551  -32.899 49.990  1.00 36.13  ? 34   GLY A CA  1 
ATOM   226  C C   . GLY A 1 33  ? -4.930  -31.546 50.300  1.00 40.59  ? 34   GLY A C   1 
ATOM   227  O O   . GLY A 1 33  ? -5.540  -30.728 50.977  1.00 40.09  ? 34   GLY A O   1 
ATOM   228  N N   . ILE A 1 34  ? -3.716  -31.316 49.801  1.00 42.20  ? 35   ILE A N   1 
ATOM   229  C CA  . ILE A 1 34  ? -3.027  -30.030 49.947  1.00 39.45  ? 35   ILE A CA  1 
ATOM   230  C C   . ILE A 1 34  ? -3.538  -29.035 48.908  1.00 36.81  ? 35   ILE A C   1 
ATOM   231  O O   . ILE A 1 34  ? -3.411  -29.280 47.708  1.00 35.99  ? 35   ILE A O   1 
ATOM   232  C CB  . ILE A 1 34  ? -1.509  -30.179 49.755  1.00 33.01  ? 35   ILE A CB  1 
ATOM   233  C CG1 . ILE A 1 34  ? -0.924  -31.178 50.749  1.00 37.59  ? 35   ILE A CG1 1 
ATOM   234  C CG2 . ILE A 1 34  ? -0.832  -28.836 49.852  1.00 37.78  ? 35   ILE A CG2 1 
ATOM   235  C CD1 . ILE A 1 34  ? 0.495   -31.582 50.407  1.00 36.08  ? 35   ILE A CD1 1 
ATOM   236  N N   . PRO A 1 35  ? -4.094  -27.902 49.358  1.00 39.82  ? 36   PRO A N   1 
ATOM   237  C CA  . PRO A 1 35  ? -4.564  -26.912 48.373  1.00 30.99  ? 36   PRO A CA  1 
ATOM   238  C C   . PRO A 1 35  ? -3.409  -26.263 47.596  1.00 37.69  ? 36   PRO A C   1 
ATOM   239  O O   . PRO A 1 35  ? -2.484  -25.771 48.244  1.00 38.88  ? 36   PRO A O   1 
ATOM   240  C CB  . PRO A 1 35  ? -5.315  -25.885 49.234  1.00 36.87  ? 36   PRO A CB  1 
ATOM   241  C CG  . PRO A 1 35  ? -4.727  -26.058 50.681  1.00 39.78  ? 36   PRO A CG  1 
ATOM   242  C CD  . PRO A 1 35  ? -4.382  -27.532 50.768  1.00 36.88  ? 36   PRO A CD  1 
ATOM   243  N N   . PHE A 1 36  ? -3.425  -26.283 46.249  1.00 33.84  ? 37   PHE A N   1 
ATOM   244  C CA  . PHE A 1 36  ? -2.332  -25.629 45.527  1.00 33.20  ? 37   PHE A CA  1 
ATOM   245  C C   . PHE A 1 36  ? -2.833  -24.500 44.645  1.00 38.51  ? 37   PHE A C   1 
ATOM   246  O O   . PHE A 1 36  ? -2.043  -23.729 44.082  1.00 40.78  ? 37   PHE A O   1 
ATOM   247  C CB  . PHE A 1 36  ? -1.489  -26.643 44.712  1.00 37.69  ? 37   PHE A CB  1 
ATOM   248  C CG  . PHE A 1 36  ? -2.150  -27.185 43.454  1.00 35.45  ? 37   PHE A CG  1 
ATOM   249  C CD1 . PHE A 1 36  ? -2.017  -26.525 42.237  1.00 37.66  ? 37   PHE A CD1 1 
ATOM   250  C CD2 . PHE A 1 36  ? -2.829  -28.389 43.481  1.00 34.65  ? 37   PHE A CD2 1 
ATOM   251  C CE1 . PHE A 1 36  ? -2.589  -27.033 41.076  1.00 40.40  ? 37   PHE A CE1 1 
ATOM   252  C CE2 . PHE A 1 36  ? -3.414  -28.913 42.317  1.00 37.24  ? 37   PHE A CE2 1 
ATOM   253  C CZ  . PHE A 1 36  ? -3.285  -28.237 41.117  1.00 38.09  ? 37   PHE A CZ  1 
ATOM   254  N N   . ALA A 1 37  ? -4.149  -24.360 44.561  1.00 38.03  ? 38   ALA A N   1 
ATOM   255  C CA  . ALA A 1 37  ? -4.727  -23.236 43.847  1.00 35.62  ? 38   ALA A CA  1 
ATOM   256  C C   . ALA A 1 37  ? -5.911  -22.652 44.613  1.00 41.47  ? 38   ALA A C   1 
ATOM   257  O O   . ALA A 1 37  ? -6.507  -23.318 45.462  1.00 38.55  ? 38   ALA A O   1 
ATOM   258  C CB  . ALA A 1 37  ? -5.172  -23.665 42.439  1.00 34.62  ? 38   ALA A CB  1 
ATOM   259  N N   . GLU A 1 38  ? -6.271  -21.412 44.300  1.00 40.05  ? 39   GLU A N   1 
ATOM   260  C CA  . GLU A 1 38  ? -7.583  -20.924 44.706  1.00 45.33  ? 39   GLU A CA  1 
ATOM   261  C C   . GLU A 1 38  ? -8.657  -21.735 43.970  1.00 48.23  ? 39   GLU A C   1 
ATOM   262  O O   . GLU A 1 38  ? -8.494  -22.077 42.800  1.00 38.43  ? 39   GLU A O   1 
ATOM   263  C CB  . GLU A 1 38  ? -7.726  -19.432 44.409  1.00 47.40  ? 39   GLU A CB  1 
ATOM   264  C CG  . GLU A 1 38  ? -6.845  -18.551 45.293  1.00 49.95  ? 39   GLU A CG  1 
ATOM   265  C CD  . GLU A 1 38  ? -7.341  -18.499 46.718  1.00 50.27  ? 39   GLU A CD  1 
ATOM   266  O OE1 . GLU A 1 38  ? -8.520  -18.128 46.912  1.00 63.44  ? 39   GLU A OE1 1 
ATOM   267  O OE2 . GLU A 1 38  ? -6.572  -18.844 47.642  1.00 52.94  ? 39   GLU A OE2 1 
ATOM   268  N N   . PRO A 1 39  ? -9.736  -22.090 44.671  1.00 50.17  ? 40   PRO A N   1 
ATOM   269  C CA  . PRO A 1 39  ? -10.855 -22.815 44.047  1.00 43.93  ? 40   PRO A CA  1 
ATOM   270  C C   . PRO A 1 39  ? -11.345 -22.141 42.771  1.00 48.18  ? 40   PRO A C   1 
ATOM   271  O O   . PRO A 1 39  ? -11.754 -20.972 42.798  1.00 47.18  ? 40   PRO A O   1 
ATOM   272  C CB  . PRO A 1 39  ? -11.935 -22.783 45.129  1.00 46.69  ? 40   PRO A CB  1 
ATOM   273  C CG  . PRO A 1 39  ? -11.142 -22.698 46.439  1.00 41.45  ? 40   PRO A CG  1 
ATOM   274  C CD  . PRO A 1 39  ? -9.948  -21.839 46.108  1.00 40.69  ? 40   PRO A CD  1 
ATOM   275  N N   . PRO A 1 40  ? -11.299 -22.867 41.647  1.00 47.60  ? 41   PRO A N   1 
ATOM   276  C CA  . PRO A 1 40  ? -11.695 -22.279 40.362  1.00 44.45  ? 41   PRO A CA  1 
ATOM   277  C C   . PRO A 1 40  ? -13.212 -22.259 40.173  1.00 47.64  ? 41   PRO A C   1 
ATOM   278  O O   . PRO A 1 40  ? -13.702 -22.901 39.247  1.00 45.52  ? 41   PRO A O   1 
ATOM   279  C CB  . PRO A 1 40  ? -11.037 -23.197 39.346  1.00 41.04  ? 41   PRO A CB  1 
ATOM   280  C CG  . PRO A 1 40  ? -10.975 -24.516 40.035  1.00 42.98  ? 41   PRO A CG  1 
ATOM   281  C CD  . PRO A 1 40  ? -10.813 -24.249 41.504  1.00 40.35  ? 41   PRO A CD  1 
ATOM   282  N N   . MET A 1 41  ? -13.926 -21.537 41.041  1.00 53.71  ? 42   MET A N   1 
ATOM   283  C CA  . MET A 1 41  ? -15.391 -21.506 41.023  1.00 51.04  ? 42   MET A CA  1 
ATOM   284  C C   . MET A 1 41  ? -15.965 -20.136 40.716  1.00 50.36  ? 42   MET A C   1 
ATOM   285  O O   . MET A 1 41  ? -15.277 -19.112 40.811  1.00 51.22  ? 42   MET A O   1 
ATOM   286  C CB  . MET A 1 41  ? -15.957 -21.954 42.366  1.00 54.60  ? 42   MET A CB  1 
ATOM   287  C CG  . MET A 1 41  ? -15.149 -23.004 43.054  1.00 51.32  ? 42   MET A CG  1 
ATOM   288  S SD  . MET A 1 41  ? -16.132 -23.632 44.412  1.00 75.10  ? 42   MET A SD  1 
ATOM   289  C CE  . MET A 1 41  ? -17.395 -24.558 43.534  1.00 47.66  ? 42   MET A CE  1 
ATOM   290  N N   . GLY A 1 42  ? -17.251 -20.127 40.386  1.00 48.74  ? 43   GLY A N   1 
ATOM   291  C CA  . GLY A 1 42  ? -17.941 -18.901 40.050  1.00 47.48  ? 43   GLY A CA  1 
ATOM   292  C C   . GLY A 1 42  ? -17.262 -18.146 38.933  1.00 50.25  ? 43   GLY A C   1 
ATOM   293  O O   . GLY A 1 42  ? -17.105 -18.663 37.814  1.00 48.01  ? 43   GLY A O   1 
ATOM   294  N N   . PRO A 1 43  ? -16.850 -16.908 39.228  1.00 51.80  ? 44   PRO A N   1 
ATOM   295  C CA  . PRO A 1 43  ? -16.202 -16.072 38.206  1.00 49.82  ? 44   PRO A CA  1 
ATOM   296  C C   . PRO A 1 43  ? -14.889 -16.686 37.710  1.00 52.17  ? 44   PRO A C   1 
ATOM   297  O O   . PRO A 1 43  ? -14.392 -16.270 36.654  1.00 49.77  ? 44   PRO A O   1 
ATOM   298  C CB  . PRO A 1 43  ? -15.962 -14.736 38.930  1.00 47.70  ? 44   PRO A CB  1 
ATOM   299  C CG  . PRO A 1 43  ? -16.092 -15.055 40.422  1.00 46.28  ? 44   PRO A CG  1 
ATOM   300  C CD  . PRO A 1 43  ? -17.072 -16.195 40.502  1.00 45.44  ? 44   PRO A CD  1 
ATOM   301  N N   . ARG A 1 44  ? -14.357 -17.674 38.436  1.00 47.89  ? 45   ARG A N   1 
ATOM   302  C CA  . ARG A 1 44  ? -13.078 -18.289 38.064  1.00 47.64  ? 45   ARG A CA  1 
ATOM   303  C C   . ARG A 1 44  ? -13.209 -19.561 37.232  1.00 50.47  ? 45   ARG A C   1 
ATOM   304  O O   . ARG A 1 44  ? -12.187 -20.135 36.837  1.00 44.05  ? 45   ARG A O   1 
ATOM   305  C CB  . ARG A 1 44  ? -12.246 -18.617 39.303  1.00 47.54  ? 45   ARG A CB  1 
ATOM   306  C CG  . ARG A 1 44  ? -11.680 -17.409 40.031  1.00 57.22  ? 45   ARG A CG  1 
ATOM   307  C CD  . ARG A 1 44  ? -10.682 -17.887 41.096  1.00 64.94  ? 45   ARG A CD  1 
ATOM   308  N NE  . ARG A 1 44  ? -10.634 -17.041 42.296  1.00 78.81  ? 45   ARG A NE  1 
ATOM   309  C CZ  . ARG A 1 44  ? -9.913  -15.926 42.400  1.00 78.39  ? 45   ARG A CZ  1 
ATOM   310  N NH1 . ARG A 1 44  ? -9.191  -15.511 41.366  1.00 82.19  ? 45   ARG A NH1 1 
ATOM   311  N NH2 . ARG A 1 44  ? -9.910  -15.228 43.531  1.00 75.63  ? 45   ARG A NH2 1 
ATOM   312  N N   . ARG A 1 45  ? -14.437 -20.024 36.991  1.00 46.73  ? 46   ARG A N   1 
ATOM   313  C CA  . ARG A 1 45  ? -14.648 -21.119 36.033  1.00 45.24  ? 46   ARG A CA  1 
ATOM   314  C C   . ARG A 1 45  ? -14.074 -20.757 34.670  1.00 45.86  ? 46   ARG A C   1 
ATOM   315  O O   . ARG A 1 45  ? -14.264 -19.634 34.192  1.00 47.83  ? 46   ARG A O   1 
ATOM   316  C CB  . ARG A 1 45  ? -16.129 -21.450 35.889  1.00 45.07  ? 46   ARG A CB  1 
ATOM   317  C CG  . ARG A 1 45  ? -16.423 -22.672 35.030  1.00 43.24  ? 46   ARG A CG  1 
ATOM   318  C CD  . ARG A 1 45  ? -17.917 -22.888 34.904  1.00 43.43  ? 46   ARG A CD  1 
ATOM   319  N NE  . ARG A 1 45  ? -18.486 -23.618 36.038  1.00 40.63  ? 46   ARG A NE  1 
ATOM   320  C CZ  . ARG A 1 45  ? -19.787 -23.816 36.217  1.00 42.01  ? 46   ARG A CZ  1 
ATOM   321  N NH1 . ARG A 1 45  ? -20.654 -23.328 35.348  1.00 49.10  ? 46   ARG A NH1 1 
ATOM   322  N NH2 . ARG A 1 45  ? -20.225 -24.497 37.263  1.00 41.47  ? 46   ARG A NH2 1 
ATOM   323  N N   . PHE A 1 46  ? -13.357 -21.713 34.080  1.00 40.74  ? 47   PHE A N   1 
ATOM   324  C CA  . PHE A 1 46  ? -12.732 -21.603 32.760  1.00 41.83  ? 47   PHE A CA  1 
ATOM   325  C C   . PHE A 1 46  ? -11.457 -20.750 32.753  1.00 45.59  ? 47   PHE A C   1 
ATOM   326  O O   . PHE A 1 46  ? -10.781 -20.647 31.724  1.00 48.29  ? 47   PHE A O   1 
ATOM   327  C CB  . PHE A 1 46  ? -13.705 -21.032 31.715  1.00 45.36  ? 47   PHE A CB  1 
ATOM   328  C CG  . PHE A 1 46  ? -14.976 -21.804 31.569  1.00 43.25  ? 47   PHE A CG  1 
ATOM   329  C CD1 . PHE A 1 46  ? -14.955 -23.177 31.378  1.00 40.37  ? 47   PHE A CD1 1 
ATOM   330  C CD2 . PHE A 1 46  ? -16.201 -21.147 31.616  1.00 42.83  ? 47   PHE A CD2 1 
ATOM   331  C CE1 . PHE A 1 46  ? -16.142 -23.886 31.226  1.00 41.75  ? 47   PHE A CE1 1 
ATOM   332  C CE2 . PHE A 1 46  ? -17.391 -21.839 31.472  1.00 43.27  ? 47   PHE A CE2 1 
ATOM   333  C CZ  . PHE A 1 46  ? -17.366 -23.215 31.271  1.00 43.49  ? 47   PHE A CZ  1 
ATOM   334  N N   . LEU A 1 47  ? -11.138 -20.135 33.884  1.00 40.97  ? 48   LEU A N   1 
ATOM   335  C CA  . LEU A 1 47  ? -9.952  -19.295 33.986  1.00 44.43  ? 48   LEU A CA  1 
ATOM   336  C C   . LEU A 1 47  ? -8.705  -20.059 34.456  1.00 48.35  ? 48   LEU A C   1 
ATOM   337  O O   . LEU A 1 47  ? -8.809  -21.094 35.137  1.00 45.55  ? 48   LEU A O   1 
ATOM   338  C CB  . LEU A 1 47  ? -10.225 -18.137 34.944  1.00 46.79  ? 48   LEU A CB  1 
ATOM   339  C CG  . LEU A 1 47  ? -11.227 -17.089 34.447  1.00 51.42  ? 48   LEU A CG  1 
ATOM   340  C CD1 . LEU A 1 47  ? -11.144 -15.878 35.357  1.00 53.40  ? 48   LEU A CD1 1 
ATOM   341  C CD2 . LEU A 1 47  ? -10.968 -16.696 33.002  1.00 46.61  ? 48   LEU A CD2 1 
ATOM   342  N N   . PRO A 1 48  ? -7.518  -19.555 34.086  1.00 46.56  ? 49   PRO A N   1 
ATOM   343  C CA  . PRO A 1 48  ? -6.249  -20.077 34.615  1.00 38.14  ? 49   PRO A CA  1 
ATOM   344  C C   . PRO A 1 48  ? -6.251  -20.186 36.128  1.00 41.69  ? 49   PRO A C   1 
ATOM   345  O O   . PRO A 1 48  ? -6.871  -19.369 36.782  1.00 41.45  ? 49   PRO A O   1 
ATOM   346  C CB  . PRO A 1 48  ? -5.231  -19.033 34.159  1.00 38.53  ? 49   PRO A CB  1 
ATOM   347  C CG  . PRO A 1 48  ? -5.818  -18.512 32.846  1.00 43.97  ? 49   PRO A CG  1 
ATOM   348  C CD  . PRO A 1 48  ? -7.312  -18.469 33.102  1.00 42.83  ? 49   PRO A CD  1 
ATOM   349  N N   . PRO A 1 49  ? -5.552  -21.180 36.684  1.00 40.78  ? 50   PRO A N   1 
ATOM   350  C CA  . PRO A 1 49  ? -5.515  -21.324 38.148  1.00 42.84  ? 50   PRO A CA  1 
ATOM   351  C C   . PRO A 1 49  ? -4.753  -20.178 38.824  1.00 46.12  ? 50   PRO A C   1 
ATOM   352  O O   . PRO A 1 49  ? -3.762  -19.696 38.292  1.00 46.99  ? 50   PRO A O   1 
ATOM   353  C CB  . PRO A 1 49  ? -4.784  -22.661 38.354  1.00 35.07  ? 50   PRO A CB  1 
ATOM   354  C CG  . PRO A 1 49  ? -3.867  -22.758 37.135  1.00 34.55  ? 50   PRO A CG  1 
ATOM   355  C CD  . PRO A 1 49  ? -4.663  -22.136 36.000  1.00 36.48  ? 50   PRO A CD  1 
ATOM   356  N N   . GLU A 1 50  ? -5.222  -19.738 39.982  1.00 46.97  ? 51   GLU A N   1 
ATOM   357  C CA  . GLU A 1 50  ? -4.467  -18.783 40.775  1.00 46.61  ? 51   GLU A CA  1 
ATOM   358  C C   . GLU A 1 50  ? -3.764  -19.524 41.875  1.00 45.61  ? 51   GLU A C   1 
ATOM   359  O O   . GLU A 1 50  ? -4.336  -20.439 42.449  1.00 45.44  ? 51   GLU A O   1 
ATOM   360  C CB  . GLU A 1 50  ? -5.380  -17.720 41.377  1.00 58.24  ? 51   GLU A CB  1 
ATOM   361  C CG  . GLU A 1 50  ? -6.024  -16.812 40.348  1.00 64.36  ? 51   GLU A CG  1 
ATOM   362  C CD  . GLU A 1 50  ? -6.206  -15.417 40.889  1.00 82.54  ? 51   GLU A CD  1 
ATOM   363  O OE1 . GLU A 1 50  ? -6.569  -15.299 42.085  1.00 89.19  ? 51   GLU A OE1 1 
ATOM   364  O OE2 . GLU A 1 50  ? -5.960  -14.445 40.133  1.00 92.82  ? 51   GLU A OE2 1 
ATOM   365  N N   . PRO A 1 51  ? -2.522  -19.139 42.175  1.00 44.47  ? 52   PRO A N   1 
ATOM   366  C CA  . PRO A 1 51  ? -1.817  -19.725 43.326  1.00 40.69  ? 52   PRO A CA  1 
ATOM   367  C C   . PRO A 1 51  ? -2.657  -19.623 44.597  1.00 42.92  ? 52   PRO A C   1 
ATOM   368  O O   . PRO A 1 51  ? -3.376  -18.643 44.799  1.00 43.13  ? 52   PRO A O   1 
ATOM   369  C CB  . PRO A 1 51  ? -0.542  -18.885 43.423  1.00 41.13  ? 52   PRO A CB  1 
ATOM   370  C CG  . PRO A 1 51  ? -0.342  -18.348 41.993  1.00 42.36  ? 52   PRO A CG  1 
ATOM   371  C CD  . PRO A 1 51  ? -1.727  -18.117 41.469  1.00 39.46  ? 52   PRO A CD  1 
ATOM   372  N N   . LYS A 1 52  ? -2.606  -20.656 45.426  1.00 43.42  ? 53   LYS A N   1 
ATOM   373  C CA  . LYS A 1 52  ? -3.380  -20.662 46.659  1.00 46.19  ? 53   LYS A CA  1 
ATOM   374  C C   . LYS A 1 52  ? -2.836  -19.601 47.624  1.00 47.42  ? 53   LYS A C   1 
ATOM   375  O O   . LYS A 1 52  ? -1.639  -19.563 47.889  1.00 45.34  ? 53   LYS A O   1 
ATOM   376  C CB  . LYS A 1 52  ? -3.340  -22.053 47.297  1.00 41.70  ? 53   LYS A CB  1 
ATOM   377  C CG  . LYS A 1 52  ? -3.899  -22.144 48.736  1.00 38.53  ? 53   LYS A CG  1 
ATOM   378  C CD  . LYS A 1 52  ? -5.426  -22.026 48.772  1.00 43.47  ? 53   LYS A CD  1 
ATOM   379  C CE  . LYS A 1 52  ? -5.981  -22.236 50.190  1.00 41.53  ? 53   LYS A CE  1 
ATOM   380  N NZ  . LYS A 1 52  ? -7.461  -22.058 50.200  1.00 41.92  ? 53   LYS A NZ  1 
ATOM   381  N N   . GLN A 1 53  ? -3.701  -18.727 48.124  1.00 47.66  ? 54   GLN A N   1 
ATOM   382  C CA  . GLN A 1 53  ? -3.289  -17.739 49.134  1.00 52.94  ? 54   GLN A CA  1 
ATOM   383  C C   . GLN A 1 53  ? -2.927  -18.409 50.469  1.00 48.82  ? 54   GLN A C   1 
ATOM   384  O O   . GLN A 1 53  ? -3.523  -19.414 50.841  1.00 45.28  ? 54   GLN A O   1 
ATOM   385  C CB  . GLN A 1 53  ? -4.393  -16.699 49.358  1.00 51.76  ? 54   GLN A CB  1 
ATOM   386  C CG  . GLN A 1 53  ? -4.579  -15.729 48.182  1.00 61.29  ? 54   GLN A CG  1 
ATOM   387  C CD  . GLN A 1 53  ? -3.366  -14.829 47.962  1.00 70.48  ? 54   GLN A CD  1 
ATOM   388  O OE1 . GLN A 1 53  ? -2.916  -14.148 48.889  1.00 74.13  ? 54   GLN A OE1 1 
ATOM   389  N NE2 . GLN A 1 53  ? -2.826  -14.827 46.733  1.00 64.75  ? 54   GLN A NE2 1 
ATOM   390  N N   . PRO A 1 54  ? -1.942  -17.851 51.188  1.00 46.85  ? 55   PRO A N   1 
ATOM   391  C CA  . PRO A 1 54  ? -1.548  -18.365 52.510  1.00 54.26  ? 55   PRO A CA  1 
ATOM   392  C C   . PRO A 1 54  ? -2.719  -18.464 53.477  1.00 47.19  ? 55   PRO A C   1 
ATOM   393  O O   . PRO A 1 54  ? -3.680  -17.688 53.392  1.00 48.55  ? 55   PRO A O   1 
ATOM   394  C CB  . PRO A 1 54  ? -0.524  -17.337 52.989  1.00 50.71  ? 55   PRO A CB  1 
ATOM   395  C CG  . PRO A 1 54  ? 0.079   -16.828 51.722  1.00 50.98  ? 55   PRO A CG  1 
ATOM   396  C CD  . PRO A 1 54  ? -1.072  -16.745 50.755  1.00 53.25  ? 55   PRO A CD  1 
ATOM   397  N N   . TRP A 1 55  ? -2.651  -19.454 54.356  1.00 48.97  ? 56   TRP A N   1 
ATOM   398  C CA  . TRP A 1 55  ? -3.696  -19.693 55.353  1.00 49.50  ? 56   TRP A CA  1 
ATOM   399  C C   . TRP A 1 55  ? -3.088  -19.654 56.751  1.00 50.01  ? 56   TRP A C   1 
ATOM   400  O O   . TRP A 1 55  ? -1.879  -19.843 56.913  1.00 50.73  ? 56   TRP A O   1 
ATOM   401  C CB  . TRP A 1 55  ? -4.382  -21.047 55.104  1.00 48.82  ? 56   TRP A CB  1 
ATOM   402  C CG  . TRP A 1 55  ? -3.394  -22.193 55.112  1.00 50.23  ? 56   TRP A CG  1 
ATOM   403  C CD1 . TRP A 1 55  ? -2.981  -22.911 56.199  1.00 43.45  ? 56   TRP A CD1 1 
ATOM   404  C CD2 . TRP A 1 55  ? -2.689  -22.730 53.984  1.00 44.13  ? 56   TRP A CD2 1 
ATOM   405  N NE1 . TRP A 1 55  ? -2.056  -23.853 55.824  1.00 46.17  ? 56   TRP A NE1 1 
ATOM   406  C CE2 . TRP A 1 55  ? -1.866  -23.772 54.465  1.00 49.21  ? 56   TRP A CE2 1 
ATOM   407  C CE3 . TRP A 1 55  ? -2.675  -22.434 52.617  1.00 44.28  ? 56   TRP A CE3 1 
ATOM   408  C CZ2 . TRP A 1 55  ? -1.038  -24.519 53.627  1.00 40.53  ? 56   TRP A CZ2 1 
ATOM   409  C CZ3 . TRP A 1 55  ? -1.848  -23.172 51.786  1.00 45.12  ? 56   TRP A CZ3 1 
ATOM   410  C CH2 . TRP A 1 55  ? -1.040  -24.199 52.294  1.00 46.73  ? 56   TRP A CH2 1 
ATOM   411  N N   . SER A 1 56  ? -3.908  -19.403 57.767  1.00 51.92  ? 57   SER A N   1 
ATOM   412  C CA  . SER A 1 56  ? -3.418  -19.517 59.139  1.00 57.29  ? 57   SER A CA  1 
ATOM   413  C C   . SER A 1 56  ? -3.910  -20.837 59.698  1.00 57.56  ? 57   SER A C   1 
ATOM   414  O O   . SER A 1 56  ? -4.787  -21.482 59.108  1.00 55.84  ? 57   SER A O   1 
ATOM   415  C CB  . SER A 1 56  ? -3.885  -18.350 60.010  1.00 58.60  ? 57   SER A CB  1 
ATOM   416  O OG  . SER A 1 56  ? -5.287  -18.395 60.181  1.00 61.05  ? 57   SER A OG  1 
ATOM   417  N N   . GLY A 1 57  ? -3.347  -21.256 60.822  1.00 52.78  ? 58   GLY A N   1 
ATOM   418  C CA  . GLY A 1 57  ? -3.715  -22.547 61.367  1.00 52.27  ? 58   GLY A CA  1 
ATOM   419  C C   . GLY A 1 57  ? -3.202  -23.710 60.527  1.00 56.65  ? 58   GLY A C   1 
ATOM   420  O O   . GLY A 1 57  ? -2.309  -23.564 59.673  1.00 52.48  ? 58   GLY A O   1 
ATOM   421  N N   . VAL A 1 58  ? -3.780  -24.880 60.758  1.00 51.73  ? 59   VAL A N   1 
ATOM   422  C CA  . VAL A 1 58  ? -3.247  -26.092 60.155  1.00 55.25  ? 59   VAL A CA  1 
ATOM   423  C C   . VAL A 1 58  ? -4.235  -26.713 59.149  1.00 52.34  ? 59   VAL A C   1 
ATOM   424  O O   . VAL A 1 58  ? -5.380  -27.032 59.501  1.00 56.56  ? 59   VAL A O   1 
ATOM   425  C CB  . VAL A 1 58  ? -2.870  -27.102 61.266  1.00 51.72  ? 59   VAL A CB  1 
ATOM   426  C CG1 . VAL A 1 58  ? -2.212  -28.338 60.680  1.00 50.37  ? 59   VAL A CG1 1 
ATOM   427  C CG2 . VAL A 1 58  ? -1.930  -26.426 62.289  1.00 44.44  ? 59   VAL A CG2 1 
ATOM   428  N N   . VAL A 1 59  ? -3.808  -26.849 57.891  1.00 57.23  ? 60   VAL A N   1 
ATOM   429  C CA  . VAL A 1 59  ? -4.623  -27.552 56.892  1.00 44.90  ? 60   VAL A CA  1 
ATOM   430  C C   . VAL A 1 59  ? -4.568  -29.037 57.232  1.00 47.23  ? 60   VAL A C   1 
ATOM   431  O O   . VAL A 1 59  ? -3.503  -29.593 57.483  1.00 49.58  ? 60   VAL A O   1 
ATOM   432  C CB  . VAL A 1 59  ? -4.149  -27.307 55.437  1.00 53.41  ? 60   VAL A CB  1 
ATOM   433  C CG1 . VAL A 1 59  ? -4.744  -28.362 54.464  1.00 43.02  ? 60   VAL A CG1 1 
ATOM   434  C CG2 . VAL A 1 59  ? -4.528  -25.908 54.971  1.00 50.43  ? 60   VAL A CG2 1 
ATOM   435  N N   . ASP A 1 60  ? -5.732  -29.662 57.291  1.00 50.27  ? 61   ASP A N   1 
ATOM   436  C CA  . ASP A 1 60  ? -5.823  -31.084 57.609  1.00 54.13  ? 61   ASP A CA  1 
ATOM   437  C C   . ASP A 1 60  ? -5.554  -31.887 56.333  1.00 49.45  ? 61   ASP A C   1 
ATOM   438  O O   . ASP A 1 60  ? -6.408  -31.938 55.461  1.00 53.98  ? 61   ASP A O   1 
ATOM   439  C CB  . ASP A 1 60  ? -7.211  -31.383 58.201  1.00 47.00  ? 61   ASP A CB  1 
ATOM   440  C CG  . ASP A 1 60  ? -7.597  -32.851 58.139  1.00 58.98  ? 61   ASP A CG  1 
ATOM   441  O OD1 . ASP A 1 60  ? -6.707  -33.733 58.154  1.00 62.83  ? 61   ASP A OD1 1 
ATOM   442  O OD2 . ASP A 1 60  ? -8.821  -33.125 58.090  1.00 65.29  ? 61   ASP A OD2 1 
ATOM   443  N N   . ALA A 1 61  ? -4.372  -32.489 56.206  1.00 42.51  ? 62   ALA A N   1 
ATOM   444  C CA  . ALA A 1 61  ? -4.056  -33.217 54.976  1.00 48.24  ? 62   ALA A CA  1 
ATOM   445  C C   . ALA A 1 61  ? -3.942  -34.720 55.214  1.00 42.47  ? 62   ALA A C   1 
ATOM   446  O O   . ALA A 1 61  ? -2.936  -35.340 54.859  1.00 40.07  ? 62   ALA A O   1 
ATOM   447  C CB  . ALA A 1 61  ? -2.764  -32.687 54.333  1.00 39.88  ? 62   ALA A CB  1 
ATOM   448  N N   . THR A 1 62  ? -5.006  -35.293 55.772  1.00 40.72  ? 63   THR A N   1 
ATOM   449  C CA  . THR A 1 62  ? -5.051  -36.695 56.185  1.00 44.53  ? 63   THR A CA  1 
ATOM   450  C C   . THR A 1 62  ? -5.935  -37.542 55.255  1.00 43.00  ? 63   THR A C   1 
ATOM   451  O O   . THR A 1 62  ? -5.976  -38.762 55.375  1.00 43.05  ? 63   THR A O   1 
ATOM   452  C CB  . THR A 1 62  ? -5.607  -36.826 57.611  1.00 44.23  ? 63   THR A CB  1 
ATOM   453  O OG1 . THR A 1 62  ? -6.915  -36.237 57.632  1.00 49.65  ? 63   THR A OG1 1 
ATOM   454  C CG2 . THR A 1 62  ? -4.710  -36.099 58.617  1.00 41.29  ? 63   THR A CG2 1 
ATOM   455  N N   . THR A 1 63  ? -6.651  -36.890 54.341  1.00 44.46  ? 64   THR A N   1 
ATOM   456  C CA  . THR A 1 63  ? -7.555  -37.609 53.442  1.00 42.84  ? 64   THR A CA  1 
ATOM   457  C C   . THR A 1 63  ? -7.651  -36.958 52.048  1.00 41.06  ? 64   THR A C   1 
ATOM   458  O O   . THR A 1 63  ? -7.417  -35.759 51.910  1.00 42.79  ? 64   THR A O   1 
ATOM   459  C CB  . THR A 1 63  ? -8.974  -37.717 54.080  1.00 46.48  ? 64   THR A CB  1 
ATOM   460  O OG1 . THR A 1 63  ? -9.825  -38.517 53.249  1.00 56.31  ? 64   THR A OG1 1 
ATOM   461  C CG2 . THR A 1 63  ? -9.599  -36.338 54.289  1.00 40.74  ? 64   THR A CG2 1 
ATOM   462  N N   . PHE A 1 64  ? -7.997  -37.741 51.016  1.00 37.53  ? 65   PHE A N   1 
ATOM   463  C CA  . PHE A 1 64  ? -8.109  -37.187 49.679  1.00 39.28  ? 65   PHE A CA  1 
ATOM   464  C C   . PHE A 1 64  ? -9.200  -36.124 49.599  1.00 43.24  ? 65   PHE A C   1 
ATOM   465  O O   . PHE A 1 64  ? -10.178 -36.152 50.347  1.00 41.43  ? 65   PHE A O   1 
ATOM   466  C CB  . PHE A 1 64  ? -8.387  -38.274 48.654  1.00 35.11  ? 65   PHE A CB  1 
ATOM   467  C CG  . PHE A 1 64  ? -7.211  -39.150 48.368  1.00 34.29  ? 65   PHE A CG  1 
ATOM   468  C CD1 . PHE A 1 64  ? -6.097  -38.644 47.712  1.00 36.80  ? 65   PHE A CD1 1 
ATOM   469  C CD2 . PHE A 1 64  ? -7.239  -40.498 48.704  1.00 31.89  ? 65   PHE A CD2 1 
ATOM   470  C CE1 . PHE A 1 64  ? -5.011  -39.467 47.410  1.00 38.42  ? 65   PHE A CE1 1 
ATOM   471  C CE2 . PHE A 1 64  ? -6.169  -41.331 48.418  1.00 32.64  ? 65   PHE A CE2 1 
ATOM   472  C CZ  . PHE A 1 64  ? -5.048  -40.815 47.765  1.00 41.88  ? 65   PHE A CZ  1 
ATOM   473  N N   . GLN A 1 65  ? -9.027  -35.188 48.675  1.00 36.53  ? 66   GLN A N   1 
ATOM   474  C CA  . GLN A 1 65  ? -10.004 -34.143 48.503  1.00 36.33  ? 66   GLN A CA  1 
ATOM   475  C C   . GLN A 1 65  ? -10.953 -34.487 47.366  1.00 39.69  ? 66   GLN A C   1 
ATOM   476  O O   . GLN A 1 65  ? -10.788 -35.507 46.700  1.00 42.66  ? 66   GLN A O   1 
ATOM   477  C CB  . GLN A 1 65  ? -9.301  -32.815 48.248  1.00 34.18  ? 66   GLN A CB  1 
ATOM   478  C CG  . GLN A 1 65  ? -9.041  -32.015 49.512  1.00 38.74  ? 66   GLN A CG  1 
ATOM   479  C CD  . GLN A 1 65  ? -10.305 -31.434 50.079  1.00 45.10  ? 66   GLN A CD  1 
ATOM   480  O OE1 . GLN A 1 65  ? -11.345 -31.399 49.412  1.00 47.32  ? 66   GLN A OE1 1 
ATOM   481  N NE2 . GLN A 1 65  ? -10.227 -30.952 51.310  1.00 45.75  ? 66   GLN A NE2 1 
ATOM   482  N N   . SER A 1 66  ? -11.921 -33.609 47.130  1.00 36.79  ? 67   SER A N   1 
ATOM   483  C CA  . SER A 1 66  ? -12.930 -33.819 46.094  1.00 35.30  ? 67   SER A CA  1 
ATOM   484  C C   . SER A 1 66  ? -12.373 -34.074 44.679  1.00 43.35  ? 67   SER A C   1 
ATOM   485  O O   . SER A 1 66  ? -11.273 -33.650 44.342  1.00 38.86  ? 67   SER A O   1 
ATOM   486  C CB  . SER A 1 66  ? -13.865 -32.607 46.068  1.00 37.35  ? 67   SER A CB  1 
ATOM   487  O OG  . SER A 1 66  ? -14.388 -32.344 47.376  1.00 50.16  ? 67   SER A OG  1 
ATOM   488  N N   . VAL A 1 67  ? -13.168 -34.759 43.860  1.00 42.10  ? 68   VAL A N   1 
ATOM   489  C CA  . VAL A 1 67  ? -12.834 -35.058 42.477  1.00 38.79  ? 68   VAL A CA  1 
ATOM   490  C C   . VAL A 1 67  ? -13.390 -33.962 41.573  1.00 39.79  ? 68   VAL A C   1 
ATOM   491  O O   . VAL A 1 67  ? -14.513 -33.522 41.781  1.00 41.66  ? 68   VAL A O   1 
ATOM   492  C CB  . VAL A 1 67  ? -13.409 -36.424 42.076  1.00 39.35  ? 68   VAL A CB  1 
ATOM   493  C CG1 . VAL A 1 67  ? -13.123 -36.739 40.614  1.00 30.88  ? 68   VAL A CG1 1 
ATOM   494  C CG2 . VAL A 1 67  ? -12.864 -37.517 43.022  1.00 34.66  ? 68   VAL A CG2 1 
ATOM   495  N N   . CYS A 1 68  ? -12.600 -33.493 40.611  1.00 33.12  ? 69   CYS A N   1 
ATOM   496  C CA  . CYS A 1 68  ? -13.050 -32.456 39.678  1.00 35.90  ? 69   CYS A CA  1 
ATOM   497  C C   . CYS A 1 68  ? -14.253 -32.980 38.919  1.00 39.96  ? 69   CYS A C   1 
ATOM   498  O O   . CYS A 1 68  ? -14.282 -34.162 38.560  1.00 34.34  ? 69   CYS A O   1 
ATOM   499  C CB  . CYS A 1 68  ? -11.939 -32.067 38.690  1.00 35.01  ? 69   CYS A CB  1 
ATOM   500  S SG  . CYS A 1 68  ? -10.455 -31.339 39.485  1.00 38.36  ? 69   CYS A SG  1 
ATOM   501  N N   . TYR A 1 69  ? -15.243 -32.113 38.699  1.00 39.76  ? 70   TYR A N   1 
ATOM   502  C CA  . TYR A 1 69  ? -16.476 -32.491 38.013  1.00 39.79  ? 70   TYR A CA  1 
ATOM   503  C C   . TYR A 1 69  ? -16.237 -33.212 36.700  1.00 41.75  ? 70   TYR A C   1 
ATOM   504  O O   . TYR A 1 69  ? -15.456 -32.756 35.870  1.00 40.25  ? 70   TYR A O   1 
ATOM   505  C CB  . TYR A 1 69  ? -17.339 -31.257 37.755  1.00 42.41  ? 70   TYR A CB  1 
ATOM   506  C CG  . TYR A 1 69  ? -18.539 -31.205 38.657  1.00 38.99  ? 70   TYR A CG  1 
ATOM   507  C CD1 . TYR A 1 69  ? -19.710 -31.879 38.328  1.00 43.07  ? 70   TYR A CD1 1 
ATOM   508  C CD2 . TYR A 1 69  ? -18.493 -30.507 39.852  1.00 44.26  ? 70   TYR A CD2 1 
ATOM   509  C CE1 . TYR A 1 69  ? -20.815 -31.846 39.173  1.00 44.18  ? 70   TYR A CE1 1 
ATOM   510  C CE2 . TYR A 1 69  ? -19.585 -30.467 40.705  1.00 42.34  ? 70   TYR A CE2 1 
ATOM   511  C CZ  . TYR A 1 69  ? -20.734 -31.140 40.358  1.00 43.30  ? 70   TYR A CZ  1 
ATOM   512  O OH  . TYR A 1 69  ? -21.816 -31.093 41.199  1.00 60.50  ? 70   TYR A OH  1 
ATOM   513  N N   . GLN A 1 70  ? -16.927 -34.327 36.507  1.00 40.73  ? 71   GLN A N   1 
ATOM   514  C CA  . GLN A 1 70  ? -16.697 -35.156 35.340  1.00 40.63  ? 71   GLN A CA  1 
ATOM   515  C C   . GLN A 1 70  ? -17.861 -36.122 35.125  1.00 42.01  ? 71   GLN A C   1 
ATOM   516  O O   . GLN A 1 70  ? -18.627 -36.397 36.042  1.00 45.63  ? 71   GLN A O   1 
ATOM   517  C CB  . GLN A 1 70  ? -15.390 -35.937 35.503  1.00 36.05  ? 71   GLN A CB  1 
ATOM   518  C CG  . GLN A 1 70  ? -15.401 -36.938 36.662  1.00 35.57  ? 71   GLN A CG  1 
ATOM   519  C CD  . GLN A 1 70  ? -14.022 -37.508 36.925  1.00 36.95  ? 71   GLN A CD  1 
ATOM   520  O OE1 . GLN A 1 70  ? -13.761 -38.689 36.660  1.00 35.81  ? 71   GLN A OE1 1 
ATOM   521  N NE2 . GLN A 1 70  ? -13.114 -36.664 37.437  1.00 35.71  ? 71   GLN A NE2 1 
ATOM   522  N N   . TYR A 1 71  ? -17.984 -36.626 33.904  1.00 43.58  ? 72   TYR A N   1 
ATOM   523  C CA  . TYR A 1 71  ? -18.909 -37.703 33.602  1.00 43.82  ? 72   TYR A CA  1 
ATOM   524  C C   . TYR A 1 71  ? -18.632 -38.940 34.474  1.00 43.56  ? 72   TYR A C   1 
ATOM   525  O O   . TYR A 1 71  ? -17.481 -39.217 34.812  1.00 43.25  ? 72   TYR A O   1 
ATOM   526  C CB  . TYR A 1 71  ? -18.801 -38.035 32.117  1.00 44.83  ? 72   TYR A CB  1 
ATOM   527  C CG  . TYR A 1 71  ? -19.630 -39.200 31.676  1.00 48.19  ? 72   TYR A CG  1 
ATOM   528  C CD1 . TYR A 1 71  ? -21.008 -39.066 31.483  1.00 52.32  ? 72   TYR A CD1 1 
ATOM   529  C CD2 . TYR A 1 71  ? -19.045 -40.433 31.424  1.00 43.58  ? 72   TYR A CD2 1 
ATOM   530  C CE1 . TYR A 1 71  ? -21.784 -40.139 31.062  1.00 49.88  ? 72   TYR A CE1 1 
ATOM   531  C CE2 . TYR A 1 71  ? -19.815 -41.517 31.007  1.00 48.78  ? 72   TYR A CE2 1 
ATOM   532  C CZ  . TYR A 1 71  ? -21.182 -41.359 30.830  1.00 51.62  ? 72   TYR A CZ  1 
ATOM   533  O OH  . TYR A 1 71  ? -21.954 -42.422 30.422  1.00 59.50  ? 72   TYR A OH  1 
ATOM   534  N N   . VAL A 1 72  ? -19.679 -39.661 34.879  1.00 46.89  ? 73   VAL A N   1 
ATOM   535  C CA  . VAL A 1 72  ? -19.485 -40.933 35.580  1.00 40.37  ? 73   VAL A CA  1 
ATOM   536  C C   . VAL A 1 72  ? -19.947 -42.075 34.670  1.00 45.42  ? 73   VAL A C   1 
ATOM   537  O O   . VAL A 1 72  ? -21.098 -42.118 34.242  1.00 48.29  ? 73   VAL A O   1 
ATOM   538  C CB  . VAL A 1 72  ? -20.238 -40.989 36.967  1.00 46.20  ? 73   VAL A CB  1 
ATOM   539  C CG1 . VAL A 1 72  ? -20.060 -42.350 37.643  1.00 38.26  ? 73   VAL A CG1 1 
ATOM   540  C CG2 . VAL A 1 72  ? -19.735 -39.911 37.908  1.00 33.30  ? 73   VAL A CG2 1 
ATOM   541  N N   . ASP A 1 73  ? -19.020 -42.978 34.360  1.00 50.31  ? 74   ASP A N   1 
ATOM   542  C CA  . ASP A 1 73  ? -19.267 -44.156 33.521  1.00 47.84  ? 74   ASP A CA  1 
ATOM   543  C C   . ASP A 1 73  ? -20.373 -45.060 34.054  1.00 46.14  ? 74   ASP A C   1 
ATOM   544  O O   . ASP A 1 73  ? -20.258 -45.570 35.165  1.00 51.40  ? 74   ASP A O   1 
ATOM   545  C CB  . ASP A 1 73  ? -17.976 -44.972 33.404  1.00 50.15  ? 74   ASP A CB  1 
ATOM   546  C CG  . ASP A 1 73  ? -18.006 -45.999 32.261  1.00 57.64  ? 74   ASP A CG  1 
ATOM   547  O OD1 . ASP A 1 73  ? -19.029 -46.126 31.543  1.00 59.25  ? 74   ASP A OD1 1 
ATOM   548  O OD2 . ASP A 1 73  ? -16.977 -46.693 32.088  1.00 63.60  ? 74   ASP A OD2 1 
ATOM   549  N N   . THR A 1 74  ? -21.418 -45.277 33.254  1.00 46.78  ? 75   THR A N   1 
ATOM   550  C CA  . THR A 1 74  ? -22.529 -46.157 33.644  1.00 57.40  ? 75   THR A CA  1 
ATOM   551  C C   . THR A 1 74  ? -22.745 -47.389 32.748  1.00 57.42  ? 75   THR A C   1 
ATOM   552  O O   . THR A 1 74  ? -23.827 -47.978 32.766  1.00 58.69  ? 75   THR A O   1 
ATOM   553  C CB  . THR A 1 74  ? -23.882 -45.394 33.673  1.00 54.64  ? 75   THR A CB  1 
ATOM   554  O OG1 . THR A 1 74  ? -24.085 -44.710 32.426  1.00 56.51  ? 75   THR A OG1 1 
ATOM   555  C CG2 . THR A 1 74  ? -23.926 -44.399 34.819  1.00 49.79  ? 75   THR A CG2 1 
ATOM   556  N N   . LEU A 1 75  ? -21.727 -47.793 31.993  1.00 55.93  ? 76   LEU A N   1 
ATOM   557  C CA  . LEU A 1 75  ? -21.899 -48.860 31.007  1.00 55.48  ? 76   LEU A CA  1 
ATOM   558  C C   . LEU A 1 75  ? -22.213 -50.193 31.663  1.00 57.57  ? 76   LEU A C   1 
ATOM   559  O O   . LEU A 1 75  ? -23.108 -50.921 31.209  1.00 61.08  ? 76   LEU A O   1 
ATOM   560  C CB  . LEU A 1 75  ? -20.655 -49.011 30.120  1.00 54.52  ? 76   LEU A CB  1 
ATOM   561  C CG  . LEU A 1 75  ? -20.890 -49.974 28.950  1.00 57.06  ? 76   LEU A CG  1 
ATOM   562  C CD1 . LEU A 1 75  ? -22.065 -49.498 28.117  1.00 48.91  ? 76   LEU A CD1 1 
ATOM   563  C CD2 . LEU A 1 75  ? -19.660 -50.138 28.087  1.00 55.61  ? 76   LEU A CD2 1 
ATOM   564  N N   . TYR A 1 76  ? -21.459 -50.522 32.711  1.00 46.16  ? 77   TYR A N   1 
ATOM   565  C CA  . TYR A 1 76  ? -21.688 -51.751 33.455  1.00 50.13  ? 77   TYR A CA  1 
ATOM   566  C C   . TYR A 1 76  ? -21.783 -51.425 34.954  1.00 48.33  ? 77   TYR A C   1 
ATOM   567  O O   . TYR A 1 76  ? -20.806 -51.552 35.694  1.00 48.38  ? 77   TYR A O   1 
ATOM   568  C CB  . TYR A 1 76  ? -20.575 -52.770 33.187  1.00 50.09  ? 77   TYR A CB  1 
ATOM   569  C CG  . TYR A 1 76  ? -20.377 -53.139 31.721  1.00 54.52  ? 77   TYR A CG  1 
ATOM   570  C CD1 . TYR A 1 76  ? -21.351 -53.843 31.016  1.00 58.22  ? 77   TYR A CD1 1 
ATOM   571  C CD2 . TYR A 1 76  ? -19.205 -52.798 31.049  1.00 53.49  ? 77   TYR A CD2 1 
ATOM   572  C CE1 . TYR A 1 76  ? -21.171 -54.178 29.668  1.00 57.45  ? 77   TYR A CE1 1 
ATOM   573  C CE2 . TYR A 1 76  ? -19.019 -53.119 29.704  1.00 54.19  ? 77   TYR A CE2 1 
ATOM   574  C CZ  . TYR A 1 76  ? -20.003 -53.811 29.022  1.00 57.91  ? 77   TYR A CZ  1 
ATOM   575  O OH  . TYR A 1 76  ? -19.820 -54.146 27.696  1.00 61.44  ? 77   TYR A OH  1 
ATOM   576  N N   . PRO A 1 77  ? -22.956 -50.971 35.396  1.00 50.29  ? 78   PRO A N   1 
ATOM   577  C CA  . PRO A 1 77  ? -23.134 -50.580 36.803  1.00 48.79  ? 78   PRO A CA  1 
ATOM   578  C C   . PRO A 1 77  ? -22.556 -51.602 37.770  1.00 47.48  ? 78   PRO A C   1 
ATOM   579  O O   . PRO A 1 77  ? -22.876 -52.775 37.656  1.00 55.91  ? 78   PRO A O   1 
ATOM   580  C CB  . PRO A 1 77  ? -24.648 -50.481 36.940  1.00 48.04  ? 78   PRO A CB  1 
ATOM   581  C CG  . PRO A 1 77  ? -25.087 -49.977 35.578  1.00 54.63  ? 78   PRO A CG  1 
ATOM   582  C CD  . PRO A 1 77  ? -24.152 -50.676 34.577  1.00 51.10  ? 78   PRO A CD  1 
ATOM   583  N N   . GLY A 1 78  ? -21.649 -51.163 38.641  1.00 46.86  ? 79   GLY A N   1 
ATOM   584  C CA  . GLY A 1 78  ? -21.085 -52.011 39.677  1.00 44.19  ? 79   GLY A CA  1 
ATOM   585  C C   . GLY A 1 78  ? -20.031 -53.013 39.243  1.00 39.24  ? 79   GLY A C   1 
ATOM   586  O O   . GLY A 1 78  ? -19.505 -53.764 40.039  1.00 49.97  ? 79   GLY A O   1 
ATOM   587  N N   . PHE A 1 79  ? -19.718 -53.029 37.964  1.00 55.19  ? 80   PHE A N   1 
ATOM   588  C CA  . PHE A 1 79  ? -18.621 -53.849 37.473  1.00 46.30  ? 80   PHE A CA  1 
ATOM   589  C C   . PHE A 1 79  ? -17.277 -53.271 37.957  1.00 44.17  ? 80   PHE A C   1 
ATOM   590  O O   . PHE A 1 79  ? -17.009 -52.081 37.783  1.00 44.53  ? 80   PHE A O   1 
ATOM   591  C CB  . PHE A 1 79  ? -18.707 -53.912 35.945  1.00 45.63  ? 80   PHE A CB  1 
ATOM   592  C CG  . PHE A 1 79  ? -17.617 -54.694 35.304  1.00 47.00  ? 80   PHE A CG  1 
ATOM   593  C CD1 . PHE A 1 79  ? -17.385 -56.008 35.671  1.00 42.41  ? 80   PHE A CD1 1 
ATOM   594  C CD2 . PHE A 1 79  ? -16.825 -54.119 34.322  1.00 40.74  ? 80   PHE A CD2 1 
ATOM   595  C CE1 . PHE A 1 79  ? -16.373 -56.736 35.067  1.00 44.35  ? 80   PHE A CE1 1 
ATOM   596  C CE2 . PHE A 1 79  ? -15.813 -54.833 33.724  1.00 38.53  ? 80   PHE A CE2 1 
ATOM   597  C CZ  . PHE A 1 79  ? -15.585 -56.145 34.096  1.00 42.74  ? 80   PHE A CZ  1 
ATOM   598  N N   . GLU A 1 80  ? -16.455 -54.116 38.570  1.00 39.26  ? 81   GLU A N   1 
ATOM   599  C CA  . GLU A 1 80  ? -15.117 -53.759 39.003  1.00 38.04  ? 81   GLU A CA  1 
ATOM   600  C C   . GLU A 1 80  ? -14.311 -53.026 37.912  1.00 50.96  ? 81   GLU A C   1 
ATOM   601  O O   . GLU A 1 80  ? -13.703 -51.971 38.163  1.00 45.54  ? 81   GLU A O   1 
ATOM   602  C CB  . GLU A 1 80  ? -14.384 -55.024 39.444  1.00 44.37  ? 81   GLU A CB  1 
ATOM   603  C CG  . GLU A 1 80  ? -13.414 -54.866 40.625  1.00 57.39  ? 81   GLU A CG  1 
ATOM   604  C CD  . GLU A 1 80  ? -12.095 -54.211 40.223  1.00 67.13  ? 81   GLU A CD  1 
ATOM   605  O OE1 . GLU A 1 80  ? -11.790 -54.180 38.998  1.00 71.19  ? 81   GLU A OE1 1 
ATOM   606  O OE2 . GLU A 1 80  ? -11.363 -53.724 41.124  1.00 65.25  ? 81   GLU A OE2 1 
ATOM   607  N N   . GLY A 1 81  ? -14.340 -53.563 36.692  1.00 47.96  ? 82   GLY A N   1 
ATOM   608  C CA  . GLY A 1 81  ? -13.451 -53.097 35.648  1.00 43.15  ? 82   GLY A CA  1 
ATOM   609  C C   . GLY A 1 81  ? -13.736 -51.687 35.182  1.00 43.04  ? 82   GLY A C   1 
ATOM   610  O O   . GLY A 1 81  ? -12.885 -51.063 34.568  1.00 45.54  ? 82   GLY A O   1 
ATOM   611  N N   . THR A 1 82  ? -14.942 -51.193 35.438  1.00 42.90  ? 83   THR A N   1 
ATOM   612  C CA  . THR A 1 82  ? -15.259 -49.814 35.097  1.00 43.82  ? 83   THR A CA  1 
ATOM   613  C C   . THR A 1 82  ? -15.309 -48.931 36.347  1.00 43.42  ? 83   THR A C   1 
ATOM   614  O O   . THR A 1 82  ? -14.898 -47.774 36.300  1.00 41.85  ? 83   THR A O   1 
ATOM   615  C CB  . THR A 1 82  ? -16.602 -49.685 34.355  1.00 44.88  ? 83   THR A CB  1 
ATOM   616  O OG1 . THR A 1 82  ? -17.607 -50.434 35.049  1.00 49.15  ? 83   THR A OG1 1 
ATOM   617  C CG2 . THR A 1 82  ? -16.493 -50.177 32.914  1.00 47.20  ? 83   THR A CG2 1 
ATOM   618  N N   . GLU A 1 83  ? -15.794 -49.479 37.462  1.00 41.65  ? 84   GLU A N   1 
ATOM   619  C CA  . GLU A 1 83  ? -15.931 -48.686 38.688  1.00 47.34  ? 84   GLU A CA  1 
ATOM   620  C C   . GLU A 1 83  ? -14.579 -48.269 39.271  1.00 40.60  ? 84   GLU A C   1 
ATOM   621  O O   . GLU A 1 83  ? -14.501 -47.272 39.981  1.00 40.09  ? 84   GLU A O   1 
ATOM   622  C CB  . GLU A 1 83  ? -16.734 -49.442 39.763  1.00 37.74  ? 84   GLU A CB  1 
ATOM   623  C CG  . GLU A 1 83  ? -18.192 -49.731 39.386  1.00 45.50  ? 84   GLU A CG  1 
ATOM   624  C CD  . GLU A 1 83  ? -19.045 -48.476 39.228  1.00 53.30  ? 84   GLU A CD  1 
ATOM   625  O OE1 . GLU A 1 83  ? -20.134 -48.579 38.603  1.00 56.16  ? 84   GLU A OE1 1 
ATOM   626  O OE2 . GLU A 1 83  ? -18.637 -47.392 39.729  1.00 50.97  ? 84   GLU A OE2 1 
ATOM   627  N N   . MET A 1 84  ? -13.522 -49.027 38.974  1.00 38.10  ? 85   MET A N   1 
ATOM   628  C CA  . MET A 1 84  ? -12.183 -48.685 39.466  1.00 40.79  ? 85   MET A CA  1 
ATOM   629  C C   . MET A 1 84  ? -11.657 -47.356 38.884  1.00 39.71  ? 85   MET A C   1 
ATOM   630  O O   . MET A 1 84  ? -10.662 -46.818 39.367  1.00 40.09  ? 85   MET A O   1 
ATOM   631  C CB  . MET A 1 84  ? -11.195 -49.806 39.154  1.00 36.85  ? 85   MET A CB  1 
ATOM   632  C CG  . MET A 1 84  ? -10.942 -50.004 37.670  1.00 44.05  ? 85   MET A CG  1 
ATOM   633  S SD  . MET A 1 84  ? -9.761  -51.324 37.323  1.00 48.72  ? 85   MET A SD  1 
ATOM   634  C CE  . MET A 1 84  ? -8.273  -50.650 38.075  1.00 38.47  ? 85   MET A CE  1 
ATOM   635  N N   . TRP A 1 85  ? -12.342 -46.820 37.877  1.00 36.38  ? 86   TRP A N   1 
ATOM   636  C CA  . TRP A 1 85  ? -11.914 -45.577 37.229  1.00 38.81  ? 86   TRP A CA  1 
ATOM   637  C C   . TRP A 1 85  ? -12.840 -44.436 37.588  1.00 35.27  ? 86   TRP A C   1 
ATOM   638  O O   . TRP A 1 85  ? -12.556 -43.287 37.299  1.00 35.72  ? 86   TRP A O   1 
ATOM   639  C CB  . TRP A 1 85  ? -11.856 -45.738 35.704  1.00 34.55  ? 86   TRP A CB  1 
ATOM   640  C CG  . TRP A 1 85  ? -11.010 -46.887 35.225  1.00 37.46  ? 86   TRP A CG  1 
ATOM   641  C CD1 . TRP A 1 85  ? -11.447 -48.000 34.571  1.00 39.84  ? 86   TRP A CD1 1 
ATOM   642  C CD2 . TRP A 1 85  ? -9.587  -47.037 35.357  1.00 39.50  ? 86   TRP A CD2 1 
ATOM   643  N NE1 . TRP A 1 85  ? -10.392 -48.830 34.275  1.00 40.34  ? 86   TRP A NE1 1 
ATOM   644  C CE2 . TRP A 1 85  ? -9.237  -48.265 34.747  1.00 44.17  ? 86   TRP A CE2 1 
ATOM   645  C CE3 . TRP A 1 85  ? -8.572  -46.243 35.899  1.00 35.44  ? 86   TRP A CE3 1 
ATOM   646  C CZ2 . TRP A 1 85  ? -7.911  -48.721 34.677  1.00 43.32  ? 86   TRP A CZ2 1 
ATOM   647  C CZ3 . TRP A 1 85  ? -7.249  -46.703 35.837  1.00 33.63  ? 86   TRP A CZ3 1 
ATOM   648  C CH2 . TRP A 1 85  ? -6.936  -47.930 35.243  1.00 35.37  ? 86   TRP A CH2 1 
ATOM   649  N N   . ASN A 1 86  ? -13.956 -44.759 38.222  1.00 37.38  ? 87   ASN A N   1 
ATOM   650  C CA  . ASN A 1 86  ? -14.953 -43.748 38.566  1.00 40.62  ? 87   ASN A CA  1 
ATOM   651  C C   . ASN A 1 86  ? -14.579 -42.954 39.806  1.00 35.44  ? 87   ASN A C   1 
ATOM   652  O O   . ASN A 1 86  ? -13.824 -43.446 40.653  1.00 35.77  ? 87   ASN A O   1 
ATOM   653  C CB  . ASN A 1 86  ? -16.316 -44.397 38.785  1.00 38.21  ? 87   ASN A CB  1 
ATOM   654  C CG  . ASN A 1 86  ? -17.050 -44.686 37.485  1.00 47.16  ? 87   ASN A CG  1 
ATOM   655  O OD1 . ASN A 1 86  ? -16.883 -43.992 36.464  1.00 41.22  ? 87   ASN A OD1 1 
ATOM   656  N ND2 . ASN A 1 86  ? -17.893 -45.711 37.527  1.00 45.99  ? 87   ASN A ND2 1 
ATOM   657  N N   . PRO A 1 87  ? -15.139 -41.739 39.938  1.00 32.11  ? 88   PRO A N   1 
ATOM   658  C CA  . PRO A 1 87  ? -14.862 -40.924 41.123  1.00 32.28  ? 88   PRO A CA  1 
ATOM   659  C C   . PRO A 1 87  ? -15.081 -41.720 42.406  1.00 41.24  ? 88   PRO A C   1 
ATOM   660  O O   . PRO A 1 87  ? -16.059 -42.450 42.516  1.00 38.89  ? 88   PRO A O   1 
ATOM   661  C CB  . PRO A 1 87  ? -15.866 -39.775 41.002  1.00 34.22  ? 88   PRO A CB  1 
ATOM   662  C CG  . PRO A 1 87  ? -16.026 -39.623 39.485  1.00 34.74  ? 88   PRO A CG  1 
ATOM   663  C CD  . PRO A 1 87  ? -16.035 -41.052 38.985  1.00 31.06  ? 88   PRO A CD  1 
ATOM   664  N N   . ASN A 1 88  ? -14.144 -41.628 43.346  1.00 37.14  ? 89   ASN A N   1 
ATOM   665  C CA  . ASN A 1 88  ? -14.320 -42.308 44.604  1.00 32.86  ? 89   ASN A CA  1 
ATOM   666  C C   . ASN A 1 88  ? -14.348 -41.261 45.700  1.00 37.28  ? 89   ASN A C   1 
ATOM   667  O O   . ASN A 1 88  ? -14.118 -41.559 46.846  1.00 39.04  ? 89   ASN A O   1 
ATOM   668  C CB  . ASN A 1 88  ? -13.216 -43.332 44.835  1.00 36.24  ? 89   ASN A CB  1 
ATOM   669  C CG  . ASN A 1 88  ? -11.851 -42.682 45.009  1.00 44.82  ? 89   ASN A CG  1 
ATOM   670  O OD1 . ASN A 1 88  ? -11.606 -41.572 44.518  1.00 42.00  ? 89   ASN A OD1 1 
ATOM   671  N ND2 . ASN A 1 88  ? -10.950 -43.377 45.693  1.00 40.15  ? 89   ASN A ND2 1 
ATOM   672  N N   . ARG A 1 89  ? -14.614 -40.019 45.316  1.00 40.29  ? 90   ARG A N   1 
ATOM   673  C CA  . ARG A 1 89  ? -14.915 -38.953 46.268  1.00 42.46  ? 90   ARG A CA  1 
ATOM   674  C C   . ARG A 1 89  ? -16.012 -38.120 45.641  1.00 43.07  ? 90   ARG A C   1 
ATOM   675  O O   . ARG A 1 89  ? -16.287 -38.259 44.441  1.00 43.54  ? 90   ARG A O   1 
ATOM   676  C CB  . ARG A 1 89  ? -13.688 -38.079 46.583  1.00 43.41  ? 90   ARG A CB  1 
ATOM   677  C CG  . ARG A 1 89  ? -12.577 -38.791 47.325  1.00 43.15  ? 90   ARG A CG  1 
ATOM   678  C CD  . ARG A 1 89  ? -13.055 -39.216 48.718  1.00 41.37  ? 90   ARG A CD  1 
ATOM   679  N NE  . ARG A 1 89  ? -11.967 -39.725 49.555  1.00 42.59  ? 90   ARG A NE  1 
ATOM   680  C CZ  . ARG A 1 89  ? -11.525 -40.979 49.542  1.00 44.32  ? 90   ARG A CZ  1 
ATOM   681  N NH1 . ARG A 1 89  ? -12.065 -41.871 48.717  1.00 44.65  ? 90   ARG A NH1 1 
ATOM   682  N NH2 . ARG A 1 89  ? -10.526 -41.338 50.340  1.00 35.46  ? 90   ARG A NH2 1 
ATOM   683  N N   . GLU A 1 90  ? -16.634 -37.251 46.425  1.00 41.60  ? 91   GLU A N   1 
ATOM   684  C CA  . GLU A 1 90  ? -17.712 -36.429 45.887  1.00 48.06  ? 91   GLU A CA  1 
ATOM   685  C C   . GLU A 1 90  ? -17.157 -35.454 44.850  1.00 41.39  ? 91   GLU A C   1 
ATOM   686  O O   . GLU A 1 90  ? -16.027 -34.973 44.985  1.00 42.18  ? 91   GLU A O   1 
ATOM   687  C CB  . GLU A 1 90  ? -18.448 -35.677 47.019  1.00 51.25  ? 91   GLU A CB  1 
ATOM   688  C CG  . GLU A 1 90  ? -17.753 -34.422 47.547  1.00 59.34  ? 91   GLU A CG  1 
ATOM   689  C CD  . GLU A 1 90  ? -18.690 -33.521 48.395  1.00 79.65  ? 91   GLU A CD  1 
ATOM   690  O OE1 . GLU A 1 90  ? -19.932 -33.737 48.375  1.00 69.81  ? 91   GLU A OE1 1 
ATOM   691  O OE2 . GLU A 1 90  ? -18.178 -32.596 49.081  1.00 86.15  ? 91   GLU A OE2 1 
ATOM   692  N N   . LEU A 1 91  ? -17.938 -35.204 43.801  1.00 43.93  ? 92   LEU A N   1 
ATOM   693  C CA  . LEU A 1 91  ? -17.569 -34.248 42.762  1.00 38.96  ? 92   LEU A CA  1 
ATOM   694  C C   . LEU A 1 91  ? -17.621 -32.825 43.272  1.00 41.65  ? 92   LEU A C   1 
ATOM   695  O O   . LEU A 1 91  ? -18.504 -32.464 44.053  1.00 44.53  ? 92   LEU A O   1 
ATOM   696  C CB  . LEU A 1 91  ? -18.500 -34.353 41.550  1.00 43.21  ? 92   LEU A CB  1 
ATOM   697  C CG  . LEU A 1 91  ? -18.656 -35.682 40.811  1.00 45.55  ? 92   LEU A CG  1 
ATOM   698  C CD1 . LEU A 1 91  ? -19.558 -35.463 39.609  1.00 38.73  ? 92   LEU A CD1 1 
ATOM   699  C CD2 . LEU A 1 91  ? -17.302 -36.251 40.404  1.00 37.14  ? 92   LEU A CD2 1 
ATOM   700  N N   . SER A 1 92  ? -16.706 -31.999 42.787  1.00 40.64  ? 93   SER A N   1 
ATOM   701  C CA  . SER A 1 92  ? -16.722 -30.584 43.108  1.00 39.54  ? 93   SER A CA  1 
ATOM   702  C C   . SER A 1 92  ? -15.779 -29.812 42.189  1.00 42.16  ? 93   SER A C   1 
ATOM   703  O O   . SER A 1 92  ? -14.729 -30.335 41.787  1.00 39.82  ? 93   SER A O   1 
ATOM   704  C CB  . SER A 1 92  ? -16.331 -30.369 44.583  1.00 37.15  ? 93   SER A CB  1 
ATOM   705  O OG  . SER A 1 92  ? -16.143 -28.988 44.842  1.00 37.81  ? 93   SER A OG  1 
ATOM   706  N N   . GLU A 1 93  ? -16.149 -28.572 41.857  1.00 40.40  ? 94   GLU A N   1 
ATOM   707  C CA  . GLU A 1 93  ? -15.248 -27.669 41.133  1.00 37.33  ? 94   GLU A CA  1 
ATOM   708  C C   . GLU A 1 93  ? -14.113 -27.169 42.036  1.00 41.59  ? 94   GLU A C   1 
ATOM   709  O O   . GLU A 1 93  ? -13.106 -26.657 41.554  1.00 40.99  ? 94   GLU A O   1 
ATOM   710  C CB  . GLU A 1 93  ? -16.020 -26.469 40.579  1.00 38.69  ? 94   GLU A CB  1 
ATOM   711  C CG  . GLU A 1 93  ? -16.920 -26.778 39.374  1.00 44.79  ? 94   GLU A CG  1 
ATOM   712  C CD  . GLU A 1 93  ? -17.602 -25.526 38.843  1.00 42.09  ? 94   GLU A CD  1 
ATOM   713  O OE1 . GLU A 1 93  ? -17.014 -24.836 38.000  1.00 40.79  ? 94   GLU A OE1 1 
ATOM   714  O OE2 . GLU A 1 93  ? -18.726 -25.215 39.289  1.00 48.97  ? 94   GLU A OE2 1 
ATOM   715  N N   . ASP A 1 94  ? -14.319 -27.274 43.346  1.00 34.20  ? 95   ASP A N   1 
ATOM   716  C CA  . ASP A 1 94  ? -13.290 -26.981 44.343  1.00 34.22  ? 95   ASP A CA  1 
ATOM   717  C C   . ASP A 1 94  ? -12.489 -28.260 44.483  1.00 36.66  ? 95   ASP A C   1 
ATOM   718  O O   . ASP A 1 94  ? -12.792 -29.091 45.354  1.00 39.00  ? 95   ASP A O   1 
ATOM   719  C CB  . ASP A 1 94  ? -13.941 -26.540 45.673  1.00 34.72  ? 95   ASP A CB  1 
ATOM   720  C CG  . ASP A 1 94  ? -12.931 -26.244 46.782  1.00 42.18  ? 95   ASP A CG  1 
ATOM   721  O OD1 . ASP A 1 94  ? -11.705 -26.268 46.551  1.00 42.31  ? 95   ASP A OD1 1 
ATOM   722  O OD2 . ASP A 1 94  ? -13.381 -25.970 47.912  1.00 45.69  ? 95   ASP A OD2 1 
ATOM   723  N N   . CYS A 1 95  ? -11.502 -28.443 43.601  1.00 34.72  ? 96   CYS A N   1 
ATOM   724  C CA  . CYS A 1 95  ? -10.836 -29.739 43.454  1.00 35.96  ? 96   CYS A CA  1 
ATOM   725  C C   . CYS A 1 95  ? -9.345  -29.655 43.182  1.00 34.03  ? 96   CYS A C   1 
ATOM   726  O O   . CYS A 1 95  ? -8.709  -30.671 42.891  1.00 33.04  ? 96   CYS A O   1 
ATOM   727  C CB  . CYS A 1 95  ? -11.477 -30.545 42.314  1.00 31.14  ? 96   CYS A CB  1 
ATOM   728  S SG  . CYS A 1 95  ? -11.228 -29.810 40.625  1.00 39.37  ? 96   CYS A SG  1 
ATOM   729  N N   . LEU A 1 96  ? -8.774  -28.466 43.266  1.00 31.98  ? 97   LEU A N   1 
ATOM   730  C CA  . LEU A 1 96  ? -7.360  -28.352 42.946  1.00 35.97  ? 97   LEU A CA  1 
ATOM   731  C C   . LEU A 1 96  ? -6.491  -28.597 44.186  1.00 35.62  ? 97   LEU A C   1 
ATOM   732  O O   . LEU A 1 96  ? -6.038  -27.669 44.879  1.00 33.11  ? 97   LEU A O   1 
ATOM   733  C CB  . LEU A 1 96  ? -7.070  -26.998 42.303  1.00 31.27  ? 97   LEU A CB  1 
ATOM   734  C CG  . LEU A 1 96  ? -7.738  -26.852 40.931  1.00 35.06  ? 97   LEU A CG  1 
ATOM   735  C CD1 . LEU A 1 96  ? -7.294  -25.553 40.249  1.00 35.85  ? 97   LEU A CD1 1 
ATOM   736  C CD2 . LEU A 1 96  ? -7.492  -28.076 40.004  1.00 31.51  ? 97   LEU A CD2 1 
ATOM   737  N N   . TYR A 1 97  ? -6.279  -29.878 44.450  1.00 33.75  ? 98   TYR A N   1 
ATOM   738  C CA  . TYR A 1 97  ? -5.478  -30.329 45.579  1.00 35.44  ? 98   TYR A CA  1 
ATOM   739  C C   . TYR A 1 97  ? -4.435  -31.289 45.041  1.00 35.97  ? 98   TYR A C   1 
ATOM   740  O O   . TYR A 1 97  ? -4.640  -31.893 43.983  1.00 32.62  ? 98   TYR A O   1 
ATOM   741  C CB  . TYR A 1 97  ? -6.360  -30.994 46.650  1.00 31.36  ? 98   TYR A CB  1 
ATOM   742  C CG  . TYR A 1 97  ? -7.391  -30.034 47.177  1.00 37.08  ? 98   TYR A CG  1 
ATOM   743  C CD1 . TYR A 1 97  ? -7.157  -29.286 48.332  1.00 39.12  ? 98   TYR A CD1 1 
ATOM   744  C CD2 . TYR A 1 97  ? -8.595  -29.848 46.501  1.00 37.24  ? 98   TYR A CD2 1 
ATOM   745  C CE1 . TYR A 1 97  ? -8.106  -28.380 48.806  1.00 34.95  ? 98   TYR A CE1 1 
ATOM   746  C CE2 . TYR A 1 97  ? -9.546  -28.963 46.962  1.00 35.30  ? 98   TYR A CE2 1 
ATOM   747  C CZ  . TYR A 1 97  ? -9.295  -28.225 48.110  1.00 40.95  ? 98   TYR A CZ  1 
ATOM   748  O OH  . TYR A 1 97  ? -10.252 -27.334 48.530  1.00 39.89  ? 98   TYR A OH  1 
ATOM   749  N N   . LEU A 1 98  ? -3.309  -31.416 45.738  1.00 32.96  ? 99   LEU A N   1 
ATOM   750  C CA  . LEU A 1 98  ? -2.338  -32.429 45.358  1.00 34.03  ? 99   LEU A CA  1 
ATOM   751  C C   . LEU A 1 98  ? -1.956  -33.254 46.593  1.00 32.64  ? 99   LEU A C   1 
ATOM   752  O O   . LEU A 1 98  ? -2.379  -32.956 47.719  1.00 39.92  ? 99   LEU A O   1 
ATOM   753  C CB  . LEU A 1 98  ? -1.107  -31.802 44.665  1.00 31.29  ? 99   LEU A CB  1 
ATOM   754  C CG  . LEU A 1 98  ? -0.383  -30.597 45.299  1.00 39.78  ? 99   LEU A CG  1 
ATOM   755  C CD1 . LEU A 1 98  ? 0.429   -30.993 46.550  1.00 34.30  ? 99   LEU A CD1 1 
ATOM   756  C CD2 . LEU A 1 98  ? 0.492   -29.837 44.285  1.00 33.98  ? 99   LEU A CD2 1 
ATOM   757  N N   . ASN A 1 99  ? -1.183  -34.311 46.353  1.00 34.78  ? 100  ASN A N   1 
ATOM   758  C CA  . ASN A 1 99  ? -0.847  -35.292 47.363  1.00 33.16  ? 100  ASN A CA  1 
ATOM   759  C C   . ASN A 1 99  ? 0.641   -35.562 47.360  1.00 35.39  ? 100  ASN A C   1 
ATOM   760  O O   . ASN A 1 99  ? 1.275   -35.517 46.311  1.00 39.61  ? 100  ASN A O   1 
ATOM   761  C CB  . ASN A 1 99  ? -1.616  -36.599 47.128  1.00 31.21  ? 100  ASN A CB  1 
ATOM   762  C CG  . ASN A 1 99  ? -3.039  -36.355 46.705  1.00 38.62  ? 100  ASN A CG  1 
ATOM   763  O OD1 . ASN A 1 99  ? -3.862  -35.873 47.496  1.00 36.73  ? 100  ASN A OD1 1 
ATOM   764  N ND2 . ASN A 1 99  ? -3.347  -36.681 45.430  1.00 36.76  ? 100  ASN A ND2 1 
ATOM   765  N N   . VAL A 1 100 ? 1.193   -35.813 48.541  1.00 37.39  ? 101  VAL A N   1 
ATOM   766  C CA  . VAL A 1 100 ? 2.604   -36.117 48.694  1.00 35.09  ? 101  VAL A CA  1 
ATOM   767  C C   . VAL A 1 100 ? 2.719   -37.336 49.603  1.00 39.04  ? 101  VAL A C   1 
ATOM   768  O O   . VAL A 1 100 ? 2.161   -37.338 50.699  1.00 36.19  ? 101  VAL A O   1 
ATOM   769  C CB  . VAL A 1 100 ? 3.392   -34.943 49.345  1.00 39.97  ? 101  VAL A CB  1 
ATOM   770  C CG1 . VAL A 1 100 ? 4.877   -35.292 49.442  1.00 39.18  ? 101  VAL A CG1 1 
ATOM   771  C CG2 . VAL A 1 100 ? 3.183   -33.628 48.595  1.00 37.85  ? 101  VAL A CG2 1 
ATOM   772  N N   . TRP A 1 101 ? 3.406   -38.369 49.135  1.00 37.78  ? 102  TRP A N   1 
ATOM   773  C CA  . TRP A 1 101 ? 3.820   -39.492 49.964  1.00 34.52  ? 102  TRP A CA  1 
ATOM   774  C C   . TRP A 1 101 ? 5.323   -39.444 50.036  1.00 36.80  ? 102  TRP A C   1 
ATOM   775  O O   . TRP A 1 101 ? 5.996   -39.138 49.042  1.00 39.34  ? 102  TRP A O   1 
ATOM   776  C CB  . TRP A 1 101 ? 3.416   -40.859 49.400  1.00 38.36  ? 102  TRP A CB  1 
ATOM   777  C CG  . TRP A 1 101 ? 1.967   -41.141 49.242  1.00 37.39  ? 102  TRP A CG  1 
ATOM   778  C CD1 . TRP A 1 101 ? 1.169   -41.886 50.071  1.00 39.74  ? 102  TRP A CD1 1 
ATOM   779  C CD2 . TRP A 1 101 ? 1.146   -40.740 48.153  1.00 36.29  ? 102  TRP A CD2 1 
ATOM   780  N NE1 . TRP A 1 101 ? -0.108  -41.939 49.572  1.00 39.96  ? 102  TRP A NE1 1 
ATOM   781  C CE2 . TRP A 1 101 ? -0.144  -41.247 48.389  1.00 38.13  ? 102  TRP A CE2 1 
ATOM   782  C CE3 . TRP A 1 101 ? 1.373   -39.990 47.002  1.00 36.09  ? 102  TRP A CE3 1 
ATOM   783  C CZ2 . TRP A 1 101 ? -1.197  -41.030 47.512  1.00 36.65  ? 102  TRP A CZ2 1 
ATOM   784  C CZ3 . TRP A 1 101 ? 0.313   -39.769 46.134  1.00 36.93  ? 102  TRP A CZ3 1 
ATOM   785  C CH2 . TRP A 1 101 ? -0.945  -40.280 46.398  1.00 39.59  ? 102  TRP A CH2 1 
ATOM   786  N N   . THR A 1 102 ? 5.842   -39.823 51.191  1.00 38.41  ? 103  THR A N   1 
ATOM   787  C CA  . THR A 1 102 ? 7.257   -39.729 51.477  1.00 40.47  ? 103  THR A CA  1 
ATOM   788  C C   . THR A 1 102 ? 7.602   -40.844 52.468  1.00 38.05  ? 103  THR A C   1 
ATOM   789  O O   . THR A 1 102 ? 6.715   -41.282 53.208  1.00 37.88  ? 103  THR A O   1 
ATOM   790  C CB  . THR A 1 102 ? 7.579   -38.337 52.044  1.00 45.10  ? 103  THR A CB  1 
ATOM   791  O OG1 . THR A 1 102 ? 8.714   -37.802 51.374  1.00 58.06  ? 103  THR A OG1 1 
ATOM   792  C CG2 . THR A 1 102 ? 7.840   -38.394 53.529  1.00 43.65  ? 103  THR A CG2 1 
ATOM   793  N N   . PRO A 1 103 ? 8.852   -41.346 52.443  1.00 35.48  ? 104  PRO A N   1 
ATOM   794  C CA  . PRO A 1 103 ? 9.322   -42.357 53.406  1.00 40.11  ? 104  PRO A CA  1 
ATOM   795  C C   . PRO A 1 103 ? 9.103   -41.927 54.862  1.00 44.86  ? 104  PRO A C   1 
ATOM   796  O O   . PRO A 1 103 ? 8.957   -40.738 55.151  1.00 43.58  ? 104  PRO A O   1 
ATOM   797  C CB  . PRO A 1 103 ? 10.817  -42.475 53.088  1.00 40.14  ? 104  PRO A CB  1 
ATOM   798  C CG  . PRO A 1 103 ? 10.893  -42.154 51.616  1.00 39.11  ? 104  PRO A CG  1 
ATOM   799  C CD  . PRO A 1 103 ? 9.871   -41.055 51.415  1.00 39.38  ? 104  PRO A CD  1 
ATOM   800  N N   . TYR A 1 104 ? 9.043   -42.898 55.764  1.00 46.24  ? 105  TYR A N   1 
ATOM   801  C CA  . TYR A 1 104 ? 8.873   -42.626 57.179  1.00 48.42  ? 105  TYR A CA  1 
ATOM   802  C C   . TYR A 1 104 ? 10.046  -43.232 57.948  1.00 52.09  ? 105  TYR A C   1 
ATOM   803  O O   . TYR A 1 104 ? 10.344  -44.421 57.792  1.00 50.13  ? 105  TYR A O   1 
ATOM   804  C CB  . TYR A 1 104 ? 7.552   -43.179 57.695  1.00 47.61  ? 105  TYR A CB  1 
ATOM   805  C CG  . TYR A 1 104 ? 7.245   -42.767 59.116  1.00 53.00  ? 105  TYR A CG  1 
ATOM   806  C CD1 . TYR A 1 104 ? 7.918   -43.337 60.197  1.00 54.98  ? 105  TYR A CD1 1 
ATOM   807  C CD2 . TYR A 1 104 ? 6.270   -41.812 59.381  1.00 54.99  ? 105  TYR A CD2 1 
ATOM   808  C CE1 . TYR A 1 104 ? 7.638   -42.949 61.504  1.00 48.79  ? 105  TYR A CE1 1 
ATOM   809  C CE2 . TYR A 1 104 ? 5.976   -41.428 60.676  1.00 59.37  ? 105  TYR A CE2 1 
ATOM   810  C CZ  . TYR A 1 104 ? 6.660   -41.997 61.735  1.00 61.82  ? 105  TYR A CZ  1 
ATOM   811  O OH  . TYR A 1 104 ? 6.354   -41.594 63.026  1.00 63.80  ? 105  TYR A OH  1 
ATOM   812  N N   . PRO A 1 105 ? 10.741  -42.405 58.750  1.00 54.00  ? 106  PRO A N   1 
ATOM   813  C CA  . PRO A 1 105 ? 10.475  -40.966 58.869  1.00 57.26  ? 106  PRO A CA  1 
ATOM   814  C C   . PRO A 1 105 ? 10.925  -40.222 57.608  1.00 50.11  ? 106  PRO A C   1 
ATOM   815  O O   . PRO A 1 105 ? 11.572  -40.859 56.768  1.00 44.44  ? 106  PRO A O   1 
ATOM   816  C CB  . PRO A 1 105 ? 11.317  -40.568 60.080  1.00 51.57  ? 106  PRO A CB  1 
ATOM   817  C CG  . PRO A 1 105 ? 12.501  -41.478 59.976  1.00 53.74  ? 106  PRO A CG  1 
ATOM   818  C CD  . PRO A 1 105 ? 11.982  -42.788 59.450  1.00 46.10  ? 106  PRO A CD  1 
ATOM   819  N N   . ARG A 1 106 ? 10.604  -38.932 57.476  1.00 54.01  ? 107  ARG A N   1 
ATOM   820  C CA  . ARG A 1 106 ? 10.926  -38.178 56.252  1.00 57.98  ? 107  ARG A CA  1 
ATOM   821  C C   . ARG A 1 106 ? 12.400  -38.246 55.931  1.00 55.23  ? 107  ARG A C   1 
ATOM   822  O O   . ARG A 1 106 ? 13.227  -38.280 56.841  1.00 59.87  ? 107  ARG A O   1 
ATOM   823  C CB  . ARG A 1 106 ? 10.492  -36.711 56.363  1.00 56.90  ? 107  ARG A CB  1 
ATOM   824  C CG  . ARG A 1 106 ? 8.978   -36.550 56.544  1.00 65.61  ? 107  ARG A CG  1 
ATOM   825  C CD  . ARG A 1 106 ? 8.470   -35.216 55.997  1.00 61.37  ? 107  ARG A CD  1 
ATOM   826  N NE  . ARG A 1 106 ? 9.165   -34.067 56.575  1.00 56.67  ? 107  ARG A NE  1 
ATOM   827  C CZ  . ARG A 1 106 ? 8.735   -33.407 57.647  1.00 66.39  ? 107  ARG A CZ  1 
ATOM   828  N NH1 . ARG A 1 106 ? 7.614   -33.790 58.250  1.00 59.54  ? 107  ARG A NH1 1 
ATOM   829  N NH2 . ARG A 1 106 ? 9.419   -32.367 58.115  1.00 68.92  ? 107  ARG A NH2 1 
ATOM   830  N N   . PRO A 1 107 ? 12.728  -38.301 54.630  1.00 52.30  ? 108  PRO A N   1 
ATOM   831  C CA  . PRO A 1 107 ? 14.129  -38.268 54.200  1.00 56.61  ? 108  PRO A CA  1 
ATOM   832  C C   . PRO A 1 107 ? 14.829  -37.023 54.753  1.00 60.55  ? 108  PRO A C   1 
ATOM   833  O O   . PRO A 1 107 ? 14.174  -35.975 54.864  1.00 58.85  ? 108  PRO A O   1 
ATOM   834  C CB  . PRO A 1 107 ? 14.038  -38.218 52.664  1.00 57.51  ? 108  PRO A CB  1 
ATOM   835  C CG  . PRO A 1 107 ? 12.701  -38.825 52.334  1.00 49.48  ? 108  PRO A CG  1 
ATOM   836  C CD  . PRO A 1 107 ? 11.793  -38.466 53.501  1.00 49.90  ? 108  PRO A CD  1 
ATOM   837  N N   . THR A 1 108 ? 16.109  -37.137 55.111  1.00 61.90  ? 109  THR A N   1 
ATOM   838  C CA  . THR A 1 108 ? 16.878  -35.973 55.568  1.00 66.15  ? 109  THR A CA  1 
ATOM   839  C C   . THR A 1 108 ? 17.932  -35.566 54.544  1.00 63.69  ? 109  THR A C   1 
ATOM   840  O O   . THR A 1 108 ? 18.636  -34.579 54.745  1.00 68.58  ? 109  THR A O   1 
ATOM   841  C CB  . THR A 1 108 ? 17.589  -36.212 56.931  1.00 66.37  ? 109  THR A CB  1 
ATOM   842  O OG1 . THR A 1 108 ? 18.464  -37.350 56.838  1.00 64.43  ? 109  THR A OG1 1 
ATOM   843  C CG2 . THR A 1 108 ? 16.569  -36.397 58.071  1.00 64.58  ? 109  THR A CG2 1 
ATOM   844  N N   . SER A 1 109 ? 18.057  -36.339 53.466  1.00 62.82  ? 110  SER A N   1 
ATOM   845  C CA  . SER A 1 109 ? 18.802  -35.896 52.278  1.00 61.54  ? 110  SER A CA  1 
ATOM   846  C C   . SER A 1 109 ? 17.838  -35.844 51.092  1.00 57.61  ? 110  SER A C   1 
ATOM   847  O O   . SER A 1 109 ? 16.847  -36.574 51.088  1.00 51.70  ? 110  SER A O   1 
ATOM   848  C CB  . SER A 1 109 ? 19.992  -36.824 51.983  1.00 58.05  ? 110  SER A CB  1 
ATOM   849  O OG  . SER A 1 109 ? 19.778  -38.121 52.518  1.00 68.52  ? 110  SER A OG  1 
ATOM   850  N N   . PRO A 1 110 ? 18.115  -34.980 50.093  1.00 59.93  ? 111  PRO A N   1 
ATOM   851  C CA  . PRO A 1 110 ? 17.279  -34.852 48.885  1.00 55.41  ? 111  PRO A CA  1 
ATOM   852  C C   . PRO A 1 110 ? 16.981  -36.183 48.202  1.00 55.09  ? 111  PRO A C   1 
ATOM   853  O O   . PRO A 1 110 ? 17.886  -36.919 47.804  1.00 61.71  ? 111  PRO A O   1 
ATOM   854  C CB  . PRO A 1 110 ? 18.118  -33.957 47.972  1.00 52.77  ? 111  PRO A CB  1 
ATOM   855  C CG  . PRO A 1 110 ? 18.906  -33.120 48.917  1.00 56.70  ? 111  PRO A CG  1 
ATOM   856  C CD  . PRO A 1 110 ? 19.222  -34.007 50.092  1.00 57.78  ? 111  PRO A CD  1 
ATOM   857  N N   . THR A 1 111 ? 15.692  -36.481 48.091  1.00 51.99  ? 112  THR A N   1 
ATOM   858  C CA  . THR A 1 111 ? 15.196  -37.714 47.499  1.00 50.85  ? 112  THR A CA  1 
ATOM   859  C C   . THR A 1 111 ? 14.555  -37.382 46.151  1.00 46.72  ? 112  THR A C   1 
ATOM   860  O O   . THR A 1 111 ? 13.837  -36.386 46.054  1.00 44.38  ? 112  THR A O   1 
ATOM   861  C CB  . THR A 1 111 ? 14.159  -38.379 48.427  1.00 51.18  ? 112  THR A CB  1 
ATOM   862  O OG1 . THR A 1 111 ? 14.717  -38.519 49.730  1.00 52.55  ? 112  THR A OG1 1 
ATOM   863  C CG2 . THR A 1 111 ? 13.759  -39.738 47.919  1.00 53.17  ? 112  THR A CG2 1 
ATOM   864  N N   . PRO A 1 112 ? 14.813  -38.196 45.108  1.00 50.33  ? 113  PRO A N   1 
ATOM   865  C CA  . PRO A 1 112 ? 14.204  -37.944 43.795  1.00 45.69  ? 113  PRO A CA  1 
ATOM   866  C C   . PRO A 1 112 ? 12.681  -38.017 43.822  1.00 42.07  ? 113  PRO A C   1 
ATOM   867  O O   . PRO A 1 112 ? 12.107  -38.810 44.569  1.00 38.40  ? 113  PRO A O   1 
ATOM   868  C CB  . PRO A 1 112 ? 14.781  -39.059 42.916  1.00 44.26  ? 113  PRO A CB  1 
ATOM   869  C CG  . PRO A 1 112 ? 15.208  -40.125 43.878  1.00 45.75  ? 113  PRO A CG  1 
ATOM   870  C CD  . PRO A 1 112 ? 15.701  -39.370 45.075  1.00 52.80  ? 113  PRO A CD  1 
ATOM   871  N N   . VAL A 1 113 ? 12.046  -37.188 42.996  1.00 43.61  ? 114  VAL A N   1 
ATOM   872  C CA  . VAL A 1 113 ? 10.601  -37.055 43.001  1.00 37.12  ? 114  VAL A CA  1 
ATOM   873  C C   . VAL A 1 113 ? 9.989   -37.647 41.729  1.00 41.93  ? 114  VAL A C   1 
ATOM   874  O O   . VAL A 1 113 ? 10.474  -37.413 40.609  1.00 39.68  ? 114  VAL A O   1 
ATOM   875  C CB  . VAL A 1 113 ? 10.197  -35.576 43.152  1.00 37.07  ? 114  VAL A CB  1 
ATOM   876  C CG1 . VAL A 1 113 ? 8.695   -35.428 43.243  1.00 32.76  ? 114  VAL A CG1 1 
ATOM   877  C CG2 . VAL A 1 113 ? 10.853  -34.979 44.396  1.00 39.35  ? 114  VAL A CG2 1 
ATOM   878  N N   . LEU A 1 114 ? 8.951   -38.458 41.935  1.00 43.25  ? 115  LEU A N   1 
ATOM   879  C CA  . LEU A 1 114 ? 8.041   -38.939 40.889  1.00 39.94  ? 115  LEU A CA  1 
ATOM   880  C C   . LEU A 1 114 ? 6.744   -38.141 40.979  1.00 31.43  ? 115  LEU A C   1 
ATOM   881  O O   . LEU A 1 114 ? 6.167   -38.009 42.064  1.00 39.81  ? 115  LEU A O   1 
ATOM   882  C CB  . LEU A 1 114 ? 7.758   -40.445 41.063  1.00 36.68  ? 115  LEU A CB  1 
ATOM   883  C CG  . LEU A 1 114 ? 8.857   -41.350 40.505  1.00 39.10  ? 115  LEU A CG  1 
ATOM   884  C CD1 . LEU A 1 114 ? 8.631   -42.792 40.871  1.00 40.46  ? 115  LEU A CD1 1 
ATOM   885  C CD2 . LEU A 1 114 ? 8.833   -41.213 38.991  1.00 33.81  ? 115  LEU A CD2 1 
ATOM   886  N N   . VAL A 1 115 ? 6.299   -37.588 39.863  1.00 35.45  ? 116  VAL A N   1 
ATOM   887  C CA  . VAL A 1 115 ? 5.046   -36.835 39.817  1.00 32.12  ? 116  VAL A CA  1 
ATOM   888  C C   . VAL A 1 115 ? 4.062   -37.507 38.847  1.00 35.86  ? 116  VAL A C   1 
ATOM   889  O O   . VAL A 1 115 ? 4.335   -37.597 37.669  1.00 34.76  ? 116  VAL A O   1 
ATOM   890  C CB  . VAL A 1 115 ? 5.296   -35.374 39.385  1.00 35.67  ? 116  VAL A CB  1 
ATOM   891  C CG1 . VAL A 1 115 ? 3.994   -34.610 39.281  1.00 30.96  ? 116  VAL A CG1 1 
ATOM   892  C CG2 . VAL A 1 115 ? 6.258   -34.688 40.363  1.00 32.00  ? 116  VAL A CG2 1 
ATOM   893  N N   . TRP A 1 116 ? 2.936   -37.992 39.365  1.00 35.64  ? 117  TRP A N   1 
ATOM   894  C CA  . TRP A 1 116 ? 1.960   -38.752 38.591  1.00 31.28  ? 117  TRP A CA  1 
ATOM   895  C C   . TRP A 1 116 ? 0.883   -37.856 37.978  1.00 35.06  ? 117  TRP A C   1 
ATOM   896  O O   . TRP A 1 116 ? 0.304   -37.039 38.681  1.00 36.55  ? 117  TRP A O   1 
ATOM   897  C CB  . TRP A 1 116 ? 1.299   -39.825 39.494  1.00 28.97  ? 117  TRP A CB  1 
ATOM   898  C CG  . TRP A 1 116 ? 0.188   -40.588 38.825  1.00 37.84  ? 117  TRP A CG  1 
ATOM   899  C CD1 . TRP A 1 116 ? -1.152  -40.517 39.115  1.00 36.16  ? 117  TRP A CD1 1 
ATOM   900  C CD2 . TRP A 1 116 ? 0.314   -41.521 37.730  1.00 29.83  ? 117  TRP A CD2 1 
ATOM   901  N NE1 . TRP A 1 116 ? -1.859  -41.344 38.257  1.00 34.73  ? 117  TRP A NE1 1 
ATOM   902  C CE2 . TRP A 1 116 ? -0.981  -41.992 37.428  1.00 31.07  ? 117  TRP A CE2 1 
ATOM   903  C CE3 . TRP A 1 116 ? 1.399   -42.031 37.015  1.00 30.88  ? 117  TRP A CE3 1 
ATOM   904  C CZ2 . TRP A 1 116 ? -1.229  -42.931 36.405  1.00 33.89  ? 117  TRP A CZ2 1 
ATOM   905  C CZ3 . TRP A 1 116 ? 1.153   -42.977 35.987  1.00 36.31  ? 117  TRP A CZ3 1 
ATOM   906  C CH2 . TRP A 1 116 ? -0.149  -43.405 35.699  1.00 31.24  ? 117  TRP A CH2 1 
ATOM   907  N N   . ILE A 1 117 ? 0.595   -38.017 36.683  1.00 35.35  ? 118  ILE A N   1 
ATOM   908  C CA  . ILE A 1 117 ? -0.554  -37.320 36.070  1.00 35.59  ? 118  ILE A CA  1 
ATOM   909  C C   . ILE A 1 117 ? -1.574  -38.336 35.540  1.00 34.78  ? 118  ILE A C   1 
ATOM   910  O O   . ILE A 1 117 ? -1.237  -39.168 34.709  1.00 33.04  ? 118  ILE A O   1 
ATOM   911  C CB  . ILE A 1 117 ? -0.119  -36.384 34.939  1.00 33.08  ? 118  ILE A CB  1 
ATOM   912  C CG1 . ILE A 1 117 ? 0.964   -35.407 35.443  1.00 30.88  ? 118  ILE A CG1 1 
ATOM   913  C CG2 . ILE A 1 117 ? -1.319  -35.637 34.383  1.00 29.73  ? 118  ILE A CG2 1 
ATOM   914  C CD1 . ILE A 1 117 ? 1.560   -34.514 34.368  1.00 31.71  ? 118  ILE A CD1 1 
ATOM   915  N N   . TYR A 1 118 ? -2.802  -38.312 36.056  1.00 35.11  ? 119  TYR A N   1 
ATOM   916  C CA  . TYR A 1 118 ? -3.746  -39.387 35.736  1.00 34.94  ? 119  TYR A CA  1 
ATOM   917  C C   . TYR A 1 118 ? -4.296  -39.196 34.336  1.00 36.98  ? 119  TYR A C   1 
ATOM   918  O O   . TYR A 1 118 ? -4.276  -38.073 33.823  1.00 35.42  ? 119  TYR A O   1 
ATOM   919  C CB  . TYR A 1 118 ? -4.900  -39.461 36.757  1.00 28.32  ? 119  TYR A CB  1 
ATOM   920  C CG  . TYR A 1 118 ? -5.695  -38.187 36.938  1.00 31.48  ? 119  TYR A CG  1 
ATOM   921  C CD1 . TYR A 1 118 ? -6.589  -37.714 35.950  1.00 37.73  ? 119  TYR A CD1 1 
ATOM   922  C CD2 . TYR A 1 118 ? -5.569  -37.456 38.106  1.00 31.27  ? 119  TYR A CD2 1 
ATOM   923  C CE1 . TYR A 1 118 ? -7.315  -36.520 36.152  1.00 34.95  ? 119  TYR A CE1 1 
ATOM   924  C CE2 . TYR A 1 118 ? -6.270  -36.290 38.310  1.00 32.79  ? 119  TYR A CE2 1 
ATOM   925  C CZ  . TYR A 1 118 ? -7.128  -35.816 37.362  1.00 33.25  ? 119  TYR A CZ  1 
ATOM   926  O OH  . TYR A 1 118 ? -7.800  -34.634 37.654  1.00 33.51  ? 119  TYR A OH  1 
ATOM   927  N N   . GLY A 1 119 ? -4.773  -40.283 33.723  1.00 38.29  ? 120  GLY A N   1 
ATOM   928  C CA  . GLY A 1 119 ? -5.485  -40.215 32.447  1.00 26.44  ? 120  GLY A CA  1 
ATOM   929  C C   . GLY A 1 119 ? -6.997  -40.231 32.660  1.00 29.80  ? 120  GLY A C   1 
ATOM   930  O O   . GLY A 1 119 ? -7.469  -40.079 33.803  1.00 40.34  ? 120  GLY A O   1 
ATOM   931  N N   . GLY A 1 120 ? -7.747  -40.450 31.583  1.00 35.18  ? 121  GLY A N   1 
ATOM   932  C CA  . GLY A 1 120 ? -9.203  -40.311 31.588  1.00 33.89  ? 121  GLY A CA  1 
ATOM   933  C C   . GLY A 1 120 ? -9.687  -39.458 30.409  1.00 31.71  ? 121  GLY A C   1 
ATOM   934  O O   . GLY A 1 120 ? -10.706 -38.767 30.516  1.00 36.44  ? 121  GLY A O   1 
ATOM   935  N N   . GLY A 1 121 ? -8.946  -39.481 29.301  1.00 33.63  ? 122  GLY A N   1 
ATOM   936  C CA  . GLY A 1 121 ? -9.327  -38.790 28.062  1.00 32.35  ? 122  GLY A CA  1 
ATOM   937  C C   . GLY A 1 121 ? -9.536  -37.284 28.163  1.00 37.53  ? 122  GLY A C   1 
ATOM   938  O O   . GLY A 1 121 ? -10.207 -36.683 27.310  1.00 36.57  ? 122  GLY A O   1 
ATOM   939  N N   . PHE A 1 122 ? -8.952  -36.676 29.204  1.00 33.46  ? 123  PHE A N   1 
ATOM   940  C CA  . PHE A 1 122 ? -9.120  -35.261 29.538  1.00 30.68  ? 123  PHE A CA  1 
ATOM   941  C C   . PHE A 1 122 ? -10.548 -34.951 29.966  1.00 35.46  ? 123  PHE A C   1 
ATOM   942  O O   . PHE A 1 122 ? -10.895 -33.781 30.144  1.00 36.16  ? 123  PHE A O   1 
ATOM   943  C CB  . PHE A 1 122 ? -8.716  -34.331 28.370  1.00 31.93  ? 123  PHE A CB  1 
ATOM   944  C CG  . PHE A 1 122 ? -7.229  -34.329 28.062  1.00 30.88  ? 123  PHE A CG  1 
ATOM   945  C CD1 . PHE A 1 122 ? -6.309  -33.820 28.981  1.00 32.36  ? 123  PHE A CD1 1 
ATOM   946  C CD2 . PHE A 1 122 ? -6.754  -34.839 26.860  1.00 34.05  ? 123  PHE A CD2 1 
ATOM   947  C CE1 . PHE A 1 122 ? -4.933  -33.829 28.703  1.00 35.81  ? 123  PHE A CE1 1 
ATOM   948  C CE2 . PHE A 1 122 ? -5.374  -34.842 26.562  1.00 36.15  ? 123  PHE A CE2 1 
ATOM   949  C CZ  . PHE A 1 122 ? -4.461  -34.343 27.483  1.00 32.78  ? 123  PHE A CZ  1 
ATOM   950  N N   . TYR A 1 123 ? -11.382 -35.979 30.142  1.00 36.08  ? 124  TYR A N   1 
ATOM   951  C CA  . TYR A 1 123 ? -12.760 -35.727 30.591  1.00 37.75  ? 124  TYR A CA  1 
ATOM   952  C C   . TYR A 1 123 ? -13.020 -36.354 31.975  1.00 34.22  ? 124  TYR A C   1 
ATOM   953  O O   . TYR A 1 123 ? -14.102 -36.208 32.528  1.00 38.02  ? 124  TYR A O   1 
ATOM   954  C CB  . TYR A 1 123 ? -13.796 -36.246 29.561  1.00 36.62  ? 124  TYR A CB  1 
ATOM   955  C CG  . TYR A 1 123 ? -13.877 -37.752 29.486  1.00 36.96  ? 124  TYR A CG  1 
ATOM   956  C CD1 . TYR A 1 123 ? -14.577 -38.481 30.446  1.00 41.71  ? 124  TYR A CD1 1 
ATOM   957  C CD2 . TYR A 1 123 ? -13.239 -38.448 28.467  1.00 38.19  ? 124  TYR A CD2 1 
ATOM   958  C CE1 . TYR A 1 123 ? -14.622 -39.858 30.404  1.00 42.44  ? 124  TYR A CE1 1 
ATOM   959  C CE2 . TYR A 1 123 ? -13.288 -39.827 28.402  1.00 42.47  ? 124  TYR A CE2 1 
ATOM   960  C CZ  . TYR A 1 123 ? -13.983 -40.527 29.376  1.00 46.86  ? 124  TYR A CZ  1 
ATOM   961  O OH  . TYR A 1 123 ? -14.031 -41.893 29.322  1.00 56.19  ? 124  TYR A OH  1 
ATOM   962  N N   . SER A 1 124 ? -12.040 -37.055 32.526  1.00 33.99  ? 125  SER A N   1 
ATOM   963  C CA  . SER A 1 124 ? -12.250 -37.753 33.792  1.00 34.02  ? 125  SER A CA  1 
ATOM   964  C C   . SER A 1 124 ? -10.943 -38.110 34.487  1.00 36.00  ? 125  SER A C   1 
ATOM   965  O O   . SER A 1 124 ? -9.859  -37.929 33.911  1.00 35.74  ? 125  SER A O   1 
ATOM   966  C CB  . SER A 1 124 ? -13.048 -39.032 33.558  1.00 35.48  ? 125  SER A CB  1 
ATOM   967  O OG  . SER A 1 124 ? -12.279 -39.965 32.798  1.00 34.59  ? 125  SER A OG  1 
ATOM   968  N N   . GLY A 1 125 ? -11.056 -38.684 35.691  1.00 30.91  ? 126  GLY A N   1 
ATOM   969  C CA  . GLY A 1 125 ? -9.894  -39.149 36.432  1.00 33.24  ? 126  GLY A CA  1 
ATOM   970  C C   . GLY A 1 125 ? -9.749  -38.432 37.757  1.00 32.32  ? 126  GLY A C   1 
ATOM   971  O O   . GLY A 1 125 ? -10.335 -37.370 37.961  1.00 30.96  ? 126  GLY A O   1 
ATOM   972  N N   . ALA A 1 126 ? -8.991  -39.023 38.669  1.00 33.37  ? 127  ALA A N   1 
ATOM   973  C CA  . ALA A 1 126 ? -8.715  -38.405 39.959  1.00 33.97  ? 127  ALA A CA  1 
ATOM   974  C C   . ALA A 1 126 ? -7.408  -38.928 40.464  1.00 34.90  ? 127  ALA A C   1 
ATOM   975  O O   . ALA A 1 126 ? -7.012  -40.045 40.121  1.00 34.92  ? 127  ALA A O   1 
ATOM   976  C CB  . ALA A 1 126 ? -9.830  -38.703 40.983  1.00 31.35  ? 127  ALA A CB  1 
ATOM   977  N N   . SER A 1 127 ? -6.752  -38.143 41.310  1.00 37.09  ? 128  SER A N   1 
ATOM   978  C CA  . SER A 1 127 ? -5.560  -38.619 41.990  1.00 34.56  ? 128  SER A CA  1 
ATOM   979  C C   . SER A 1 127 ? -5.896  -39.538 43.195  1.00 39.13  ? 128  SER A C   1 
ATOM   980  O O   . SER A 1 127 ? -5.008  -40.198 43.764  1.00 33.21  ? 128  SER A O   1 
ATOM   981  C CB  . SER A 1 127 ? -4.723  -37.416 42.430  1.00 34.16  ? 128  SER A CB  1 
ATOM   982  O OG  . SER A 1 127 ? -5.429  -36.637 43.379  1.00 38.50  ? 128  SER A OG  1 
ATOM   983  N N   . SER A 1 128 ? -7.173  -39.609 43.571  1.00 36.49  ? 129  SER A N   1 
ATOM   984  C CA  . SER A 1 128 ? -7.576  -40.421 44.731  1.00 34.93  ? 129  SER A CA  1 
ATOM   985  C C   . SER A 1 128 ? -7.920  -41.886 44.421  1.00 37.77  ? 129  SER A C   1 
ATOM   986  O O   . SER A 1 128 ? -8.192  -42.648 45.338  1.00 38.56  ? 129  SER A O   1 
ATOM   987  C CB  . SER A 1 128 ? -8.770  -39.784 45.414  1.00 33.36  ? 129  SER A CB  1 
ATOM   988  O OG  . SER A 1 128 ? -9.762  -39.414 44.467  1.00 30.93  ? 129  SER A OG  1 
ATOM   989  N N   . LEU A 1 129 ? -7.911  -42.295 43.150  1.00 41.15  ? 130  LEU A N   1 
ATOM   990  C CA  . LEU A 1 129 ? -8.258  -43.685 42.822  1.00 36.40  ? 130  LEU A CA  1 
ATOM   991  C C   . LEU A 1 129 ? -7.334  -44.668 43.540  1.00 39.18  ? 130  LEU A C   1 
ATOM   992  O O   . LEU A 1 129 ? -6.139  -44.412 43.662  1.00 41.11  ? 130  LEU A O   1 
ATOM   993  C CB  . LEU A 1 129 ? -8.201  -43.917 41.311  1.00 35.08  ? 130  LEU A CB  1 
ATOM   994  C CG  . LEU A 1 129 ? -9.136  -43.042 40.461  1.00 40.03  ? 130  LEU A CG  1 
ATOM   995  C CD1 . LEU A 1 129 ? -9.133  -43.540 39.032  1.00 32.21  ? 130  LEU A CD1 1 
ATOM   996  C CD2 . LEU A 1 129 ? -10.557 -42.998 41.041  1.00 37.26  ? 130  LEU A CD2 1 
ATOM   997  N N   . ASP A 1 130 ? -7.884  -45.785 44.013  1.00 40.57  ? 131  ASP A N   1 
ATOM   998  C CA  . ASP A 1 130 ? -7.095  -46.779 44.744  1.00 36.76  ? 131  ASP A CA  1 
ATOM   999  C C   . ASP A 1 130 ? -5.878  -47.223 43.953  1.00 42.82  ? 131  ASP A C   1 
ATOM   1000 O O   . ASP A 1 130 ? -4.813  -47.492 44.510  1.00 40.33  ? 131  ASP A O   1 
ATOM   1001 C CB  . ASP A 1 130 ? -7.926  -48.024 45.060  1.00 41.75  ? 131  ASP A CB  1 
ATOM   1002 C CG  . ASP A 1 130 ? -9.079  -47.746 45.982  1.00 48.14  ? 131  ASP A CG  1 
ATOM   1003 O OD1 . ASP A 1 130 ? -9.135  -46.637 46.569  1.00 43.87  ? 131  ASP A OD1 1 
ATOM   1004 O OD2 . ASP A 1 130 ? -9.921  -48.663 46.129  1.00 52.49  ? 131  ASP A OD2 1 
ATOM   1005 N N   . VAL A 1 131 ? -6.055  -47.327 42.645  1.00 34.50  ? 132  VAL A N   1 
ATOM   1006 C CA  . VAL A 1 131 ? -5.006  -47.840 41.792  1.00 44.35  ? 132  VAL A CA  1 
ATOM   1007 C C   . VAL A 1 131 ? -3.838  -46.838 41.639  1.00 39.01  ? 132  VAL A C   1 
ATOM   1008 O O   . VAL A 1 131 ? -2.804  -47.191 41.083  1.00 37.20  ? 132  VAL A O   1 
ATOM   1009 C CB  . VAL A 1 131 ? -5.598  -48.232 40.405  1.00 41.18  ? 132  VAL A CB  1 
ATOM   1010 C CG1 . VAL A 1 131 ? -5.816  -47.002 39.533  1.00 39.21  ? 132  VAL A CG1 1 
ATOM   1011 C CG2 . VAL A 1 131 ? -4.714  -49.244 39.705  1.00 44.20  ? 132  VAL A CG2 1 
ATOM   1012 N N   . TYR A 1 132 ? -3.989  -45.617 42.165  1.00 37.15  ? 133  TYR A N   1 
ATOM   1013 C CA  . TYR A 1 132 ? -2.931  -44.590 42.086  1.00 40.13  ? 133  TYR A CA  1 
ATOM   1014 C C   . TYR A 1 132 ? -2.281  -44.373 43.463  1.00 40.53  ? 133  TYR A C   1 
ATOM   1015 O O   . TYR A 1 132 ? -1.564  -43.384 43.689  1.00 36.09  ? 133  TYR A O   1 
ATOM   1016 C CB  . TYR A 1 132 ? -3.479  -43.241 41.567  1.00 35.38  ? 133  TYR A CB  1 
ATOM   1017 C CG  . TYR A 1 132 ? -4.096  -43.261 40.167  1.00 32.67  ? 133  TYR A CG  1 
ATOM   1018 C CD1 . TYR A 1 132 ? -3.732  -44.207 39.228  1.00 35.51  ? 133  TYR A CD1 1 
ATOM   1019 C CD2 . TYR A 1 132 ? -5.053  -42.314 39.796  1.00 28.39  ? 133  TYR A CD2 1 
ATOM   1020 C CE1 . TYR A 1 132 ? -4.299  -44.219 37.944  1.00 29.90  ? 133  TYR A CE1 1 
ATOM   1021 C CE2 . TYR A 1 132 ? -5.624  -42.316 38.527  1.00 39.12  ? 133  TYR A CE2 1 
ATOM   1022 C CZ  . TYR A 1 132 ? -5.242  -43.262 37.603  1.00 29.87  ? 133  TYR A CZ  1 
ATOM   1023 O OH  . TYR A 1 132 ? -5.833  -43.253 36.361  1.00 35.51  ? 133  TYR A OH  1 
ATOM   1024 N N   . ASP A 1 133 ? -2.573  -45.284 44.386  1.00 41.70  ? 134  ASP A N   1 
ATOM   1025 C CA  . ASP A 1 133 ? -2.098  -45.222 45.772  1.00 36.14  ? 134  ASP A CA  1 
ATOM   1026 C C   . ASP A 1 133 ? -0.569  -45.248 45.812  1.00 35.91  ? 134  ASP A C   1 
ATOM   1027 O O   . ASP A 1 133 ? 0.041   -46.258 45.457  1.00 33.75  ? 134  ASP A O   1 
ATOM   1028 C CB  . ASP A 1 133 ? -2.701  -46.405 46.543  1.00 39.41  ? 134  ASP A CB  1 
ATOM   1029 C CG  . ASP A 1 133 ? -2.336  -46.426 48.033  1.00 46.54  ? 134  ASP A CG  1 
ATOM   1030 O OD1 . ASP A 1 133 ? -1.632  -45.506 48.540  1.00 41.35  ? 134  ASP A OD1 1 
ATOM   1031 O OD2 . ASP A 1 133 ? -2.793  -47.392 48.702  1.00 48.83  ? 134  ASP A OD2 1 
ATOM   1032 N N   . GLY A 1 134 ? 0.049   -44.144 46.225  1.00 32.96  ? 135  GLY A N   1 
ATOM   1033 C CA  . GLY A 1 134 ? 1.505   -44.056 46.256  1.00 32.53  ? 135  GLY A CA  1 
ATOM   1034 C C   . GLY A 1 134 ? 2.318   -44.787 47.342  1.00 40.68  ? 135  GLY A C   1 
ATOM   1035 O O   . GLY A 1 134 ? 3.562   -44.797 47.289  1.00 37.01  ? 135  GLY A O   1 
ATOM   1036 N N   . ARG A 1 135 ? 1.655   -45.424 48.306  1.00 36.64  ? 136  ARG A N   1 
ATOM   1037 C CA  . ARG A 1 135 ? 2.369   -45.967 49.462  1.00 35.36  ? 136  ARG A CA  1 
ATOM   1038 C C   . ARG A 1 135 ? 3.384   -47.079 49.144  1.00 39.77  ? 136  ARG A C   1 
ATOM   1039 O O   . ARG A 1 135 ? 4.457   -47.114 49.753  1.00 41.36  ? 136  ARG A O   1 
ATOM   1040 C CB  . ARG A 1 135 ? 1.361   -46.474 50.505  1.00 39.33  ? 136  ARG A CB  1 
ATOM   1041 C CG  . ARG A 1 135 ? 0.694   -47.782 50.161  1.00 38.92  ? 136  ARG A CG  1 
ATOM   1042 C CD  . ARG A 1 135 ? -0.289  -48.184 51.244  1.00 37.19  ? 136  ARG A CD  1 
ATOM   1043 N NE  . ARG A 1 135 ? -1.465  -47.334 51.206  1.00 39.07  ? 136  ARG A NE  1 
ATOM   1044 C CZ  . ARG A 1 135 ? -2.339  -47.214 52.203  1.00 47.19  ? 136  ARG A CZ  1 
ATOM   1045 N NH1 . ARG A 1 135 ? -2.158  -47.876 53.354  1.00 39.45  ? 136  ARG A NH1 1 
ATOM   1046 N NH2 . ARG A 1 135 ? -3.388  -46.412 52.054  1.00 41.62  ? 136  ARG A NH2 1 
ATOM   1047 N N   . PHE A 1 136 ? 3.077   -47.971 48.202  1.00 35.31  ? 137  PHE A N   1 
ATOM   1048 C CA  . PHE A 1 136 ? 3.960   -49.106 47.934  1.00 32.81  ? 137  PHE A CA  1 
ATOM   1049 C C   . PHE A 1 136 ? 5.228   -48.698 47.205  1.00 40.96  ? 137  PHE A C   1 
ATOM   1050 O O   . PHE A 1 136 ? 6.307   -49.226 47.497  1.00 39.70  ? 137  PHE A O   1 
ATOM   1051 C CB  . PHE A 1 136 ? 3.223   -50.193 47.127  1.00 36.90  ? 137  PHE A CB  1 
ATOM   1052 C CG  . PHE A 1 136 ? 1.915   -50.575 47.731  1.00 42.27  ? 137  PHE A CG  1 
ATOM   1053 C CD1 . PHE A 1 136 ? 1.879   -51.333 48.908  1.00 38.17  ? 137  PHE A CD1 1 
ATOM   1054 C CD2 . PHE A 1 136 ? 0.721   -50.117 47.185  1.00 35.31  ? 137  PHE A CD2 1 
ATOM   1055 C CE1 . PHE A 1 136 ? 0.675   -51.658 49.504  1.00 37.12  ? 137  PHE A CE1 1 
ATOM   1056 C CE2 . PHE A 1 136 ? -0.499  -50.435 47.795  1.00 41.94  ? 137  PHE A CE2 1 
ATOM   1057 C CZ  . PHE A 1 136 ? -0.517  -51.205 48.960  1.00 36.94  ? 137  PHE A CZ  1 
ATOM   1058 N N   . LEU A 1 137 ? 5.095   -47.760 46.264  1.00 39.10  ? 138  LEU A N   1 
ATOM   1059 C CA  . LEU A 1 137 ? 6.232   -47.243 45.503  1.00 36.19  ? 138  LEU A CA  1 
ATOM   1060 C C   . LEU A 1 137 ? 7.176   -46.497 46.412  1.00 31.03  ? 138  LEU A C   1 
ATOM   1061 O O   . LEU A 1 137 ? 8.387   -46.651 46.330  1.00 36.01  ? 138  LEU A O   1 
ATOM   1062 C CB  . LEU A 1 137 ? 5.762   -46.295 44.367  1.00 31.86  ? 138  LEU A CB  1 
ATOM   1063 C CG  . LEU A 1 137 ? 6.208   -46.591 42.967  1.00 36.96  ? 138  LEU A CG  1 
ATOM   1064 C CD1 . LEU A 1 137 ? 5.796   -45.452 42.017  1.00 43.69  ? 138  LEU A CD1 1 
ATOM   1065 C CD2 . LEU A 1 137 ? 7.676   -46.827 42.918  1.00 38.41  ? 138  LEU A CD2 1 
ATOM   1066 N N   . VAL A 1 138 ? 6.620   -45.652 47.267  1.00 38.41  ? 139  VAL A N   1 
ATOM   1067 C CA  . VAL A 1 138 ? 7.447   -44.848 48.162  1.00 35.98  ? 139  VAL A CA  1 
ATOM   1068 C C   . VAL A 1 138 ? 8.184   -45.732 49.160  1.00 38.88  ? 139  VAL A C   1 
ATOM   1069 O O   . VAL A 1 138 ? 9.372   -45.539 49.401  1.00 42.62  ? 139  VAL A O   1 
ATOM   1070 C CB  . VAL A 1 138 ? 6.600   -43.789 48.888  1.00 37.47  ? 139  VAL A CB  1 
ATOM   1071 C CG1 . VAL A 1 138 ? 7.388   -43.099 49.964  1.00 40.59  ? 139  VAL A CG1 1 
ATOM   1072 C CG2 . VAL A 1 138 ? 6.132   -42.752 47.884  1.00 40.76  ? 139  VAL A CG2 1 
ATOM   1073 N N   . GLN A 1 139 ? 7.512   -46.730 49.717  1.00 40.64  ? 140  GLN A N   1 
ATOM   1074 C CA  . GLN A 1 139 ? 8.161   -47.567 50.718  1.00 35.99  ? 140  GLN A CA  1 
ATOM   1075 C C   . GLN A 1 139 ? 9.244   -48.435 50.069  1.00 43.88  ? 140  GLN A C   1 
ATOM   1076 O O   . GLN A 1 139 ? 10.336  -48.607 50.621  1.00 40.81  ? 140  GLN A O   1 
ATOM   1077 C CB  . GLN A 1 139 ? 7.135   -48.439 51.441  1.00 39.40  ? 140  GLN A CB  1 
ATOM   1078 C CG  . GLN A 1 139 ? 7.671   -49.115 52.696  1.00 37.97  ? 140  GLN A CG  1 
ATOM   1079 C CD  . GLN A 1 139 ? 8.471   -50.359 52.376  1.00 43.98  ? 140  GLN A CD  1 
ATOM   1080 O OE1 . GLN A 1 139 ? 8.081   -51.142 51.511  1.00 44.73  ? 140  GLN A OE1 1 
ATOM   1081 N NE2 . GLN A 1 139 ? 9.613   -50.539 53.054  1.00 41.90  ? 140  GLN A NE2 1 
ATOM   1082 N N   . ALA A 1 140 ? 8.953   -48.948 48.876  1.00 39.92  ? 141  ALA A N   1 
ATOM   1083 C CA  . ALA A 1 140 ? 9.836   -49.911 48.243  1.00 42.30  ? 141  ALA A CA  1 
ATOM   1084 C C   . ALA A 1 140 ? 11.044  -49.256 47.593  1.00 41.89  ? 141  ALA A C   1 
ATOM   1085 O O   . ALA A 1 140 ? 12.127  -49.838 47.542  1.00 43.02  ? 141  ALA A O   1 
ATOM   1086 C CB  . ALA A 1 140 ? 9.060   -50.735 47.198  1.00 38.97  ? 141  ALA A CB  1 
ATOM   1087 N N   . GLU A 1 141 ? 10.867  -48.059 47.060  1.00 39.60  ? 142  GLU A N   1 
ATOM   1088 C CA  . GLU A 1 141 ? 11.919  -47.506 46.218  1.00 39.24  ? 142  GLU A CA  1 
ATOM   1089 C C   . GLU A 1 141 ? 12.379  -46.174 46.754  1.00 43.13  ? 142  GLU A C   1 
ATOM   1090 O O   . GLU A 1 141 ? 13.278  -45.544 46.189  1.00 41.04  ? 142  GLU A O   1 
ATOM   1091 C CB  . GLU A 1 141 ? 11.442  -47.366 44.764  1.00 40.93  ? 142  GLU A CB  1 
ATOM   1092 C CG  . GLU A 1 141 ? 11.272  -48.699 44.037  1.00 37.20  ? 142  GLU A CG  1 
ATOM   1093 C CD  . GLU A 1 141 ? 12.572  -49.474 43.970  1.00 41.29  ? 142  GLU A CD  1 
ATOM   1094 O OE1 . GLU A 1 141 ? 13.652  -48.830 43.895  1.00 43.71  ? 142  GLU A OE1 1 
ATOM   1095 O OE2 . GLU A 1 141 ? 12.524  -50.725 43.992  1.00 43.51  ? 142  GLU A OE2 1 
ATOM   1096 N N   . ARG A 1 142 ? 11.736  -45.752 47.842  1.00 41.29  ? 143  ARG A N   1 
ATOM   1097 C CA  . ARG A 1 142 ? 12.196  -44.627 48.636  1.00 43.53  ? 143  ARG A CA  1 
ATOM   1098 C C   . ARG A 1 142 ? 12.391  -43.366 47.818  1.00 40.13  ? 143  ARG A C   1 
ATOM   1099 O O   . ARG A 1 142 ? 13.395  -42.682 47.932  1.00 44.75  ? 143  ARG A O   1 
ATOM   1100 C CB  . ARG A 1 142 ? 13.475  -45.030 49.382  1.00 40.95  ? 143  ARG A CB  1 
ATOM   1101 C CG  . ARG A 1 142 ? 13.128  -46.056 50.471  1.00 42.81  ? 143  ARG A CG  1 
ATOM   1102 C CD  . ARG A 1 142 ? 14.275  -46.444 51.372  1.00 48.16  ? 143  ARG A CD  1 
ATOM   1103 N NE  . ARG A 1 142 ? 14.832  -45.314 52.110  1.00 49.32  ? 143  ARG A NE  1 
ATOM   1104 C CZ  . ARG A 1 142 ? 14.359  -44.835 53.255  1.00 55.91  ? 143  ARG A CZ  1 
ATOM   1105 N NH1 . ARG A 1 142 ? 13.276  -45.366 53.838  1.00 47.25  ? 143  ARG A NH1 1 
ATOM   1106 N NH2 . ARG A 1 142 ? 14.977  -43.805 53.813  1.00 56.26  ? 143  ARG A NH2 1 
ATOM   1107 N N   . THR A 1 143 ? 11.401  -43.078 46.991  1.00 45.71  ? 144  THR A N   1 
ATOM   1108 C CA  . THR A 1 143 ? 11.276  -41.808 46.283  1.00 45.13  ? 144  THR A CA  1 
ATOM   1109 C C   . THR A 1 143 ? 10.272  -40.961 47.039  1.00 38.52  ? 144  THR A C   1 
ATOM   1110 O O   . THR A 1 143 ? 9.590   -41.469 47.926  1.00 39.87  ? 144  THR A O   1 
ATOM   1111 C CB  . THR A 1 143 ? 10.743  -42.014 44.869  1.00 43.14  ? 144  THR A CB  1 
ATOM   1112 O OG1 . THR A 1 143 ? 9.634   -42.906 44.986  1.00 49.79  ? 144  THR A OG1 1 
ATOM   1113 C CG2 . THR A 1 143 ? 11.786  -42.653 43.957  1.00 38.24  ? 144  THR A CG2 1 
ATOM   1114 N N   . VAL A 1 144 ? 10.154  -39.691 46.674  1.00 36.91  ? 145  VAL A N   1 
ATOM   1115 C CA  . VAL A 1 144 ? 8.961   -38.932 47.001  1.00 35.93  ? 145  VAL A CA  1 
ATOM   1116 C C   . VAL A 1 144 ? 7.998   -39.020 45.807  1.00 36.17  ? 145  VAL A C   1 
ATOM   1117 O O   . VAL A 1 144 ? 8.432   -38.994 44.642  1.00 43.70  ? 145  VAL A O   1 
ATOM   1118 C CB  . VAL A 1 144 ? 9.288   -37.464 47.337  1.00 40.75  ? 145  VAL A CB  1 
ATOM   1119 C CG1 . VAL A 1 144 ? 8.005   -36.665 47.620  1.00 36.45  ? 145  VAL A CG1 1 
ATOM   1120 C CG2 . VAL A 1 144 ? 10.245  -37.398 48.550  1.00 38.98  ? 145  VAL A CG2 1 
ATOM   1121 N N   . LEU A 1 145 ? 6.706   -39.171 46.107  1.00 33.50  ? 146  LEU A N   1 
ATOM   1122 C CA  . LEU A 1 145 ? 5.664   -39.285 45.106  1.00 33.85  ? 146  LEU A CA  1 
ATOM   1123 C C   . LEU A 1 145 ? 4.653   -38.174 45.296  1.00 33.66  ? 146  LEU A C   1 
ATOM   1124 O O   . LEU A 1 145 ? 4.170   -37.962 46.398  1.00 38.72  ? 146  LEU A O   1 
ATOM   1125 C CB  . LEU A 1 145 ? 4.966   -40.639 45.185  1.00 33.48  ? 146  LEU A CB  1 
ATOM   1126 C CG  . LEU A 1 145 ? 4.446   -41.247 43.863  1.00 43.76  ? 146  LEU A CG  1 
ATOM   1127 C CD1 . LEU A 1 145 ? 3.664   -42.510 44.138  1.00 44.61  ? 146  LEU A CD1 1 
ATOM   1128 C CD2 . LEU A 1 145 ? 3.599   -40.311 43.061  1.00 39.72  ? 146  LEU A CD2 1 
ATOM   1129 N N   . VAL A 1 146 ? 4.350   -37.491 44.201  1.00 33.43  ? 147  VAL A N   1 
ATOM   1130 C CA  . VAL A 1 146 ? 3.355   -36.426 44.141  1.00 39.44  ? 147  VAL A CA  1 
ATOM   1131 C C   . VAL A 1 146 ? 2.340   -36.709 43.027  1.00 33.69  ? 147  VAL A C   1 
ATOM   1132 O O   . VAL A 1 146 ? 2.704   -37.254 41.981  1.00 35.15  ? 147  VAL A O   1 
ATOM   1133 C CB  . VAL A 1 146 ? 4.035   -35.050 43.903  1.00 39.17  ? 147  VAL A CB  1 
ATOM   1134 C CG1 . VAL A 1 146 ? 3.002   -33.930 43.778  1.00 34.03  ? 147  VAL A CG1 1 
ATOM   1135 C CG2 . VAL A 1 146 ? 5.044   -34.765 45.046  1.00 30.15  ? 147  VAL A CG2 1 
ATOM   1136 N N   . SER A 1 147 ? 1.068   -36.400 43.285  1.00 31.94  ? 148  SER A N   1 
ATOM   1137 C CA  . SER A 1 147 ? 0.013   -36.447 42.275  1.00 33.56  ? 148  SER A CA  1 
ATOM   1138 C C   . SER A 1 147 ? -0.956  -35.296 42.527  1.00 35.04  ? 148  SER A C   1 
ATOM   1139 O O   . SER A 1 147 ? -1.188  -34.917 43.681  1.00 39.45  ? 148  SER A O   1 
ATOM   1140 C CB  . SER A 1 147 ? -0.735  -37.794 42.279  1.00 30.64  ? 148  SER A CB  1 
ATOM   1141 O OG  . SER A 1 147 ? -1.440  -38.022 43.498  1.00 36.09  ? 148  SER A OG  1 
ATOM   1142 N N   . MET A 1 148 ? -1.508  -34.737 41.450  1.00 34.10  ? 149  MET A N   1 
ATOM   1143 C CA  . MET A 1 148 ? -2.419  -33.620 41.574  1.00 30.22  ? 149  MET A CA  1 
ATOM   1144 C C   . MET A 1 148 ? -3.736  -33.915 40.869  1.00 35.96  ? 149  MET A C   1 
ATOM   1145 O O   . MET A 1 148 ? -3.797  -34.762 39.966  1.00 28.61  ? 149  MET A O   1 
ATOM   1146 C CB  . MET A 1 148 ? -1.784  -32.349 40.996  1.00 30.92  ? 149  MET A CB  1 
ATOM   1147 C CG  . MET A 1 148 ? -1.973  -32.162 39.463  1.00 33.28  ? 149  MET A CG  1 
ATOM   1148 S SD  . MET A 1 148 ? -1.137  -33.445 38.497  1.00 37.37  ? 149  MET A SD  1 
ATOM   1149 C CE  . MET A 1 148 ? 0.582   -32.934 38.643  1.00 33.74  ? 149  MET A CE  1 
ATOM   1150 N N   . ASN A 1 149 ? -4.791  -33.229 41.296  1.00 32.85  ? 150  ASN A N   1 
ATOM   1151 C CA  . ASN A 1 149 ? -6.008  -33.187 40.514  1.00 36.43  ? 150  ASN A CA  1 
ATOM   1152 C C   . ASN A 1 149 ? -5.886  -32.023 39.544  1.00 37.67  ? 150  ASN A C   1 
ATOM   1153 O O   . ASN A 1 149 ? -5.277  -31.010 39.864  1.00 37.41  ? 150  ASN A O   1 
ATOM   1154 C CB  . ASN A 1 149 ? -7.248  -33.021 41.401  1.00 36.75  ? 150  ASN A CB  1 
ATOM   1155 C CG  . ASN A 1 149 ? -7.735  -34.341 42.001  1.00 39.81  ? 150  ASN A CG  1 
ATOM   1156 O OD1 . ASN A 1 149 ? -7.108  -35.393 41.825  1.00 37.40  ? 150  ASN A OD1 1 
ATOM   1157 N ND2 . ASN A 1 149 ? -8.866  -34.285 42.719  1.00 34.70  ? 150  ASN A ND2 1 
ATOM   1158 N N   . TYR A 1 150 ? -6.450  -32.158 38.351  1.00 34.65  ? 151  TYR A N   1 
ATOM   1159 C CA  . TYR A 1 150 ? -6.486  -31.045 37.428  1.00 34.39  ? 151  TYR A CA  1 
ATOM   1160 C C   . TYR A 1 150 ? -7.849  -31.054 36.787  1.00 34.10  ? 151  TYR A C   1 
ATOM   1161 O O   . TYR A 1 150 ? -8.458  -32.115 36.660  1.00 34.63  ? 151  TYR A O   1 
ATOM   1162 C CB  . TYR A 1 150 ? -5.373  -31.147 36.381  1.00 32.89  ? 151  TYR A CB  1 
ATOM   1163 C CG  . TYR A 1 150 ? -5.439  -32.377 35.508  1.00 32.13  ? 151  TYR A CG  1 
ATOM   1164 C CD1 . TYR A 1 150 ? -4.791  -33.563 35.871  1.00 33.21  ? 151  TYR A CD1 1 
ATOM   1165 C CD2 . TYR A 1 150 ? -6.153  -32.364 34.327  1.00 33.26  ? 151  TYR A CD2 1 
ATOM   1166 C CE1 . TYR A 1 150 ? -4.839  -34.701 35.050  1.00 27.88  ? 151  TYR A CE1 1 
ATOM   1167 C CE2 . TYR A 1 150 ? -6.221  -33.490 33.504  1.00 30.75  ? 151  TYR A CE2 1 
ATOM   1168 C CZ  . TYR A 1 150 ? -5.567  -34.655 33.876  1.00 34.62  ? 151  TYR A CZ  1 
ATOM   1169 O OH  . TYR A 1 150 ? -5.638  -35.755 33.041  1.00 29.49  ? 151  TYR A OH  1 
ATOM   1170 N N   . ARG A 1 151 ? -8.327  -29.886 36.380  1.00 33.65  ? 152  ARG A N   1 
ATOM   1171 C CA  . ARG A 1 151 ? -9.677  -29.787 35.821  1.00 35.94  ? 152  ARG A CA  1 
ATOM   1172 C C   . ARG A 1 151 ? -9.804  -30.511 34.493  1.00 33.80  ? 152  ARG A C   1 
ATOM   1173 O O   . ARG A 1 151 ? -8.894  -30.470 33.659  1.00 35.35  ? 152  ARG A O   1 
ATOM   1174 C CB  . ARG A 1 151 ? -10.073 -28.328 35.658  1.00 36.01  ? 152  ARG A CB  1 
ATOM   1175 C CG  . ARG A 1 151 ? -10.299 -27.597 37.002  1.00 32.08  ? 152  ARG A CG  1 
ATOM   1176 C CD  . ARG A 1 151 ? -10.475 -26.118 36.743  1.00 31.90  ? 152  ARG A CD  1 
ATOM   1177 N NE  . ARG A 1 151 ? -9.207  -25.404 36.598  1.00 35.50  ? 152  ARG A NE  1 
ATOM   1178 C CZ  . ARG A 1 151 ? -9.128  -24.133 36.211  1.00 35.23  ? 152  ARG A CZ  1 
ATOM   1179 N NH1 . ARG A 1 151 ? -10.238 -23.463 35.900  1.00 31.99  ? 152  ARG A NH1 1 
ATOM   1180 N NH2 . ARG A 1 151 ? -7.949  -23.533 36.135  1.00 34.05  ? 152  ARG A NH2 1 
ATOM   1181 N N   . VAL A 1 152 ? -10.938 -31.177 34.304  1.00 33.57  ? 153  VAL A N   1 
ATOM   1182 C CA  . VAL A 1 152 ? -11.168 -31.977 33.102  1.00 34.62  ? 153  VAL A CA  1 
ATOM   1183 C C   . VAL A 1 152 ? -12.480 -31.557 32.449  1.00 37.56  ? 153  VAL A C   1 
ATOM   1184 O O   . VAL A 1 152 ? -13.207 -30.738 33.006  1.00 36.12  ? 153  VAL A O   1 
ATOM   1185 C CB  . VAL A 1 152 ? -11.202 -33.475 33.430  1.00 35.15  ? 153  VAL A CB  1 
ATOM   1186 C CG1 . VAL A 1 152 ? -9.811  -33.952 33.829  1.00 32.50  ? 153  VAL A CG1 1 
ATOM   1187 C CG2 . VAL A 1 152 ? -12.231 -33.760 34.541  1.00 29.85  ? 153  VAL A CG2 1 
ATOM   1188 N N   . GLY A 1 153 ? -12.801 -32.134 31.293  1.00 35.11  ? 154  GLY A N   1 
ATOM   1189 C CA  . GLY A 1 153 ? -14.039 -31.788 30.607  1.00 32.75  ? 154  GLY A CA  1 
ATOM   1190 C C   . GLY A 1 153 ? -14.025 -30.328 30.181  1.00 40.20  ? 154  GLY A C   1 
ATOM   1191 O O   . GLY A 1 153 ? -12.960 -29.755 29.941  1.00 41.82  ? 154  GLY A O   1 
ATOM   1192 N N   . ALA A 1 154 ? -15.192 -29.701 30.107  1.00 40.70  ? 155  ALA A N   1 
ATOM   1193 C CA  . ALA A 1 154 ? -15.239 -28.279 29.759  1.00 43.41  ? 155  ALA A CA  1 
ATOM   1194 C C   . ALA A 1 154 ? -14.551 -27.390 30.828  1.00 42.37  ? 155  ALA A C   1 
ATOM   1195 O O   . ALA A 1 154 ? -13.961 -26.344 30.511  1.00 39.00  ? 155  ALA A O   1 
ATOM   1196 C CB  . ALA A 1 154 ? -16.678 -27.837 29.553  1.00 37.51  ? 155  ALA A CB  1 
ATOM   1197 N N   . PHE A 1 155 ? -14.620 -27.808 32.086  1.00 36.62  ? 156  PHE A N   1 
ATOM   1198 C CA  . PHE A 1 155 ? -13.989 -27.044 33.175  1.00 38.02  ? 156  PHE A CA  1 
ATOM   1199 C C   . PHE A 1 155 ? -12.487 -26.891 32.980  1.00 35.72  ? 156  PHE A C   1 
ATOM   1200 O O   . PHE A 1 155 ? -11.901 -25.915 33.432  1.00 40.08  ? 156  PHE A O   1 
ATOM   1201 C CB  . PHE A 1 155 ? -14.273 -27.706 34.516  1.00 35.66  ? 156  PHE A CB  1 
ATOM   1202 C CG  . PHE A 1 155 ? -15.686 -28.100 34.666  1.00 39.67  ? 156  PHE A CG  1 
ATOM   1203 C CD1 . PHE A 1 155 ? -16.614 -27.190 35.150  1.00 37.39  ? 156  PHE A CD1 1 
ATOM   1204 C CD2 . PHE A 1 155 ? -16.110 -29.362 34.255  1.00 36.40  ? 156  PHE A CD2 1 
ATOM   1205 C CE1 . PHE A 1 155 ? -17.946 -27.549 35.255  1.00 43.33  ? 156  PHE A CE1 1 
ATOM   1206 C CE2 . PHE A 1 155 ? -17.427 -29.729 34.363  1.00 38.49  ? 156  PHE A CE2 1 
ATOM   1207 C CZ  . PHE A 1 155 ? -18.353 -28.820 34.860  1.00 41.76  ? 156  PHE A CZ  1 
ATOM   1208 N N   . GLY A 1 156 ? -11.873 -27.844 32.289  1.00 35.38  ? 157  GLY A N   1 
ATOM   1209 C CA  . GLY A 1 156 ? -10.449 -27.801 32.075  1.00 33.38  ? 157  GLY A CA  1 
ATOM   1210 C C   . GLY A 1 156 ? -10.045 -27.381 30.681  1.00 36.63  ? 157  GLY A C   1 
ATOM   1211 O O   . GLY A 1 156 ? -8.926  -26.886 30.481  1.00 38.16  ? 157  GLY A O   1 
ATOM   1212 N N   . PHE A 1 157 ? -10.928 -27.581 29.703  1.00 38.09  ? 158  PHE A N   1 
ATOM   1213 C CA  . PHE A 1 157 ? -10.480 -27.482 28.320  1.00 40.88  ? 158  PHE A CA  1 
ATOM   1214 C C   . PHE A 1 157 ? -11.464 -26.828 27.358  1.00 41.54  ? 158  PHE A C   1 
ATOM   1215 O O   . PHE A 1 157 ? -11.214 -26.799 26.171  1.00 38.36  ? 158  PHE A O   1 
ATOM   1216 C CB  . PHE A 1 157 ? -10.082 -28.884 27.813  1.00 35.07  ? 158  PHE A CB  1 
ATOM   1217 C CG  . PHE A 1 157 ? -8.951  -29.485 28.598  1.00 36.02  ? 158  PHE A CG  1 
ATOM   1218 C CD1 . PHE A 1 157 ? -7.646  -29.086 28.365  1.00 34.48  ? 158  PHE A CD1 1 
ATOM   1219 C CD2 . PHE A 1 157 ? -9.196  -30.380 29.634  1.00 37.79  ? 158  PHE A CD2 1 
ATOM   1220 C CE1 . PHE A 1 157 ? -6.591  -29.600 29.120  1.00 38.01  ? 158  PHE A CE1 1 
ATOM   1221 C CE2 . PHE A 1 157 ? -8.142  -30.902 30.414  1.00 36.48  ? 158  PHE A CE2 1 
ATOM   1222 C CZ  . PHE A 1 157 ? -6.834  -30.514 30.152  1.00 30.51  ? 158  PHE A CZ  1 
ATOM   1223 N N   . LEU A 1 158 ? -12.558 -26.261 27.854  1.00 44.78  ? 159  LEU A N   1 
ATOM   1224 C CA  . LEU A 1 158 ? -13.425 -25.501 26.960  1.00 39.81  ? 159  LEU A CA  1 
ATOM   1225 C C   . LEU A 1 158 ? -12.677 -24.261 26.496  1.00 45.59  ? 159  LEU A C   1 
ATOM   1226 O O   . LEU A 1 158 ? -12.099 -23.547 27.316  1.00 46.77  ? 159  LEU A O   1 
ATOM   1227 C CB  . LEU A 1 158 ? -14.735 -25.112 27.643  1.00 45.27  ? 159  LEU A CB  1 
ATOM   1228 C CG  . LEU A 1 158 ? -15.666 -24.234 26.801  1.00 46.46  ? 159  LEU A CG  1 
ATOM   1229 C CD1 . LEU A 1 158 ? -17.095 -24.755 26.823  1.00 43.69  ? 159  LEU A CD1 1 
ATOM   1230 C CD2 . LEU A 1 158 ? -15.610 -22.794 27.299  1.00 45.60  ? 159  LEU A CD2 1 
ATOM   1231 N N   . ALA A 1 159 ? -12.681 -23.989 25.187  1.00 42.33  ? 160  ALA A N   1 
ATOM   1232 C CA  . ALA A 1 159 ? -11.916 -22.848 24.694  1.00 45.38  ? 160  ALA A CA  1 
ATOM   1233 C C   . ALA A 1 159 ? -12.681 -22.001 23.681  1.00 49.62  ? 160  ALA A C   1 
ATOM   1234 O O   . ALA A 1 159 ? -13.279 -22.511 22.727  1.00 46.53  ? 160  ALA A O   1 
ATOM   1235 C CB  . ALA A 1 159 ? -10.592 -23.323 24.086  1.00 38.02  ? 160  ALA A CB  1 
ATOM   1236 N N   . LEU A 1 160 ? -12.674 -20.700 23.915  1.00 50.19  ? 161  LEU A N   1 
ATOM   1237 C CA  . LEU A 1 160 ? -13.048 -19.734 22.896  1.00 48.96  ? 161  LEU A CA  1 
ATOM   1238 C C   . LEU A 1 160 ? -11.779 -18.963 22.556  1.00 49.94  ? 161  LEU A C   1 
ATOM   1239 O O   . LEU A 1 160 ? -11.482 -17.946 23.188  1.00 56.77  ? 161  LEU A O   1 
ATOM   1240 C CB  . LEU A 1 160 ? -14.153 -18.804 23.389  1.00 49.35  ? 161  LEU A CB  1 
ATOM   1241 C CG  . LEU A 1 160 ? -15.540 -19.420 23.577  1.00 53.09  ? 161  LEU A CG  1 
ATOM   1242 C CD1 . LEU A 1 160 ? -16.405 -18.443 24.351  1.00 57.97  ? 161  LEU A CD1 1 
ATOM   1243 C CD2 . LEU A 1 160 ? -16.201 -19.807 22.230  1.00 45.44  ? 161  LEU A CD2 1 
ATOM   1244 N N   . PRO A 1 161 ? -10.998 -19.480 21.593  1.00 51.67  ? 162  PRO A N   1 
ATOM   1245 C CA  . PRO A 1 161 ? -9.659  -18.948 21.291  1.00 54.46  ? 162  PRO A CA  1 
ATOM   1246 C C   . PRO A 1 161 ? -9.672  -17.435 21.084  1.00 53.52  ? 162  PRO A C   1 
ATOM   1247 O O   . PRO A 1 161 ? -10.554 -16.912 20.400  1.00 54.82  ? 162  PRO A O   1 
ATOM   1248 C CB  . PRO A 1 161 ? -9.282  -19.685 20.015  1.00 52.60  ? 162  PRO A CB  1 
ATOM   1249 C CG  . PRO A 1 161 ? -9.998  -20.988 20.147  1.00 50.25  ? 162  PRO A CG  1 
ATOM   1250 C CD  . PRO A 1 161 ? -11.322 -20.641 20.747  1.00 45.82  ? 162  PRO A CD  1 
ATOM   1251 N N   . GLY A 1 162 ? -8.731  -16.744 21.712  1.00 53.57  ? 163  GLY A N   1 
ATOM   1252 C CA  . GLY A 1 162 ? -8.732  -15.294 21.700  1.00 55.05  ? 163  GLY A CA  1 
ATOM   1253 C C   . GLY A 1 162 ? -9.254  -14.696 23.000  1.00 62.77  ? 163  GLY A C   1 
ATOM   1254 O O   . GLY A 1 162 ? -8.682  -13.734 23.517  1.00 62.49  ? 163  GLY A O   1 
ATOM   1255 N N   . SER A 1 163 ? -10.335 -15.256 23.537  1.00 55.39  ? 164  SER A N   1 
ATOM   1256 C CA  . SER A 1 163 ? -10.979 -14.658 24.705  1.00 57.85  ? 164  SER A CA  1 
ATOM   1257 C C   . SER A 1 163 ? -10.129 -14.735 25.969  1.00 61.44  ? 164  SER A C   1 
ATOM   1258 O O   . SER A 1 163 ? -9.348  -15.665 26.157  1.00 60.19  ? 164  SER A O   1 
ATOM   1259 C CB  . SER A 1 163 ? -12.318 -15.331 24.974  1.00 62.17  ? 164  SER A CB  1 
ATOM   1260 O OG  . SER A 1 163 ? -12.131 -16.671 25.401  1.00 60.78  ? 164  SER A OG  1 
ATOM   1261 N N   . ARG A 1 164 ? -10.289 -13.753 26.842  1.00 65.47  ? 165  ARG A N   1 
ATOM   1262 C CA  . ARG A 1 164 ? -9.707  -13.850 28.166  1.00 66.28  ? 165  ARG A CA  1 
ATOM   1263 C C   . ARG A 1 164 ? -10.554 -14.764 29.036  1.00 58.53  ? 165  ARG A C   1 
ATOM   1264 O O   . ARG A 1 164 ? -10.038 -15.386 29.945  1.00 65.70  ? 165  ARG A O   1 
ATOM   1265 C CB  . ARG A 1 164 ? -9.578  -12.467 28.813  1.00 75.61  ? 165  ARG A CB  1 
ATOM   1266 C CG  . ARG A 1 164 ? -8.443  -11.630 28.231  1.00 86.85  ? 165  ARG A CG  1 
ATOM   1267 C CD  . ARG A 1 164 ? -7.075  -12.296 28.473  1.00 92.06  ? 165  ARG A CD  1 
ATOM   1268 N NE  . ARG A 1 164 ? -6.150  -12.115 27.344  1.00 92.23  ? 165  ARG A NE  1 
ATOM   1269 C CZ  . ARG A 1 164 ? -4.847  -12.401 27.383  1.00 95.06  ? 165  ARG A CZ  1 
ATOM   1270 N NH1 . ARG A 1 164 ? -4.298  -12.877 28.500  1.00 96.59  ? 165  ARG A NH1 1 
ATOM   1271 N NH2 . ARG A 1 164 ? -4.089  -12.202 26.308  1.00 87.03  ? 165  ARG A NH2 1 
ATOM   1272 N N   . GLU A 1 165 ? -11.848 -14.854 28.735  1.00 62.03  ? 166  GLU A N   1 
ATOM   1273 C CA  . GLU A 1 165 ? -12.820 -15.520 29.610  1.00 60.13  ? 166  GLU A CA  1 
ATOM   1274 C C   . GLU A 1 165 ? -12.770 -17.045 29.544  1.00 56.45  ? 166  GLU A C   1 
ATOM   1275 O O   . GLU A 1 165 ? -13.064 -17.718 30.537  1.00 54.08  ? 166  GLU A O   1 
ATOM   1276 C CB  . GLU A 1 165 ? -14.241 -15.057 29.282  1.00 61.04  ? 166  GLU A CB  1 
ATOM   1277 C CG  . GLU A 1 165 ? -14.480 -13.557 29.465  1.00 67.90  ? 166  GLU A CG  1 
ATOM   1278 C CD  . GLU A 1 165 ? -14.196 -12.746 28.194  1.00 74.76  ? 166  GLU A CD  1 
ATOM   1279 O OE1 . GLU A 1 165 ? -13.479 -13.254 27.293  1.00 68.79  ? 166  GLU A OE1 1 
ATOM   1280 O OE2 . GLU A 1 165 ? -14.695 -11.596 28.097  1.00 78.29  ? 166  GLU A OE2 1 
ATOM   1281 N N   . ALA A 1 166 ? -12.428 -17.587 28.377  1.00 51.23  ? 167  ALA A N   1 
ATOM   1282 C CA  . ALA A 1 166 ? -12.160 -19.018 28.252  1.00 48.78  ? 167  ALA A CA  1 
ATOM   1283 C C   . ALA A 1 166 ? -11.030 -19.272 27.255  1.00 49.38  ? 167  ALA A C   1 
ATOM   1284 O O   . ALA A 1 166 ? -11.289 -19.601 26.090  1.00 48.88  ? 167  ALA A O   1 
ATOM   1285 C CB  . ALA A 1 166 ? -13.430 -19.767 27.844  1.00 46.73  ? 167  ALA A CB  1 
ATOM   1286 N N   . PRO A 1 167 ? -9.770  -19.111 27.710  1.00 49.22  ? 168  PRO A N   1 
ATOM   1287 C CA  . PRO A 1 167 ? -8.567  -19.193 26.861  1.00 45.44  ? 168  PRO A CA  1 
ATOM   1288 C C   . PRO A 1 167 ? -8.140  -20.611 26.451  1.00 53.86  ? 168  PRO A C   1 
ATOM   1289 O O   . PRO A 1 167 ? -7.323  -20.765 25.531  1.00 50.76  ? 168  PRO A O   1 
ATOM   1290 C CB  . PRO A 1 167 ? -7.479  -18.555 27.730  1.00 47.80  ? 168  PRO A CB  1 
ATOM   1291 C CG  . PRO A 1 167 ? -7.969  -18.732 29.139  1.00 48.56  ? 168  PRO A CG  1 
ATOM   1292 C CD  . PRO A 1 167 ? -9.458  -18.660 29.079  1.00 46.60  ? 168  PRO A CD  1 
ATOM   1293 N N   . GLY A 1 168 ? -8.670  -21.635 27.110  1.00 45.63  ? 169  GLY A N   1 
ATOM   1294 C CA  . GLY A 1 168 ? -8.263  -22.989 26.786  1.00 42.99  ? 169  GLY A CA  1 
ATOM   1295 C C   . GLY A 1 168 ? -7.108  -23.446 27.662  1.00 46.37  ? 169  GLY A C   1 
ATOM   1296 O O   . GLY A 1 168 ? -6.398  -22.626 28.267  1.00 39.88  ? 169  GLY A O   1 
ATOM   1297 N N   . ASN A 1 169 ? -6.972  -24.764 27.773  1.00 45.44  ? 170  ASN A N   1 
ATOM   1298 C CA  . ASN A 1 169 ? -5.804  -25.401 28.370  1.00 40.79  ? 170  ASN A CA  1 
ATOM   1299 C C   . ASN A 1 169 ? -5.584  -25.131 29.849  1.00 40.93  ? 170  ASN A C   1 
ATOM   1300 O O   . ASN A 1 169 ? -4.495  -25.374 30.355  1.00 39.51  ? 170  ASN A O   1 
ATOM   1301 C CB  . ASN A 1 169 ? -4.547  -24.982 27.580  1.00 44.63  ? 170  ASN A CB  1 
ATOM   1302 C CG  . ASN A 1 169 ? -4.578  -25.479 26.158  1.00 41.81  ? 170  ASN A CG  1 
ATOM   1303 O OD1 . ASN A 1 169 ? -5.192  -26.507 25.879  1.00 43.97  ? 170  ASN A OD1 1 
ATOM   1304 N ND2 . ASN A 1 169 ? -3.936  -24.756 25.246  1.00 46.32  ? 170  ASN A ND2 1 
ATOM   1305 N N   . VAL A 1 170 ? -6.614  -24.665 30.557  1.00 40.32  ? 171  VAL A N   1 
ATOM   1306 C CA  . VAL A 1 170 ? -6.428  -24.319 31.960  1.00 41.10  ? 171  VAL A CA  1 
ATOM   1307 C C   . VAL A 1 170 ? -6.153  -25.582 32.795  1.00 36.54  ? 171  VAL A C   1 
ATOM   1308 O O   . VAL A 1 170 ? -5.405  -25.543 33.789  1.00 35.00  ? 171  VAL A O   1 
ATOM   1309 C CB  . VAL A 1 170 ? -7.653  -23.510 32.520  1.00 45.86  ? 171  VAL A CB  1 
ATOM   1310 C CG1 . VAL A 1 170 ? -7.818  -22.206 31.725  1.00 40.41  ? 171  VAL A CG1 1 
ATOM   1311 C CG2 . VAL A 1 170 ? -8.947  -24.319 32.512  1.00 38.44  ? 171  VAL A CG2 1 
ATOM   1312 N N   . GLY A 1 171 ? -6.702  -26.710 32.358  1.00 35.81  ? 172  GLY A N   1 
ATOM   1313 C CA  . GLY A 1 171 ? -6.389  -27.983 32.987  1.00 34.78  ? 172  GLY A CA  1 
ATOM   1314 C C   . GLY A 1 171 ? -4.898  -28.284 32.892  1.00 36.95  ? 172  GLY A C   1 
ATOM   1315 O O   . GLY A 1 171 ? -4.314  -28.789 33.845  1.00 31.57  ? 172  GLY A O   1 
ATOM   1316 N N   . LEU A 1 172 ? -4.279  -27.982 31.741  1.00 34.89  ? 173  LEU A N   1 
ATOM   1317 C CA  . LEU A 1 172 ? -2.813  -28.087 31.609  1.00 32.69  ? 173  LEU A CA  1 
ATOM   1318 C C   . LEU A 1 172 ? -2.075  -27.104 32.550  1.00 37.45  ? 173  LEU A C   1 
ATOM   1319 O O   . LEU A 1 172 ? -1.056  -27.454 33.179  1.00 35.45  ? 173  LEU A O   1 
ATOM   1320 C CB  . LEU A 1 172 ? -2.386  -27.854 30.149  1.00 31.69  ? 173  LEU A CB  1 
ATOM   1321 C CG  . LEU A 1 172 ? -2.672  -28.991 29.158  1.00 32.37  ? 173  LEU A CG  1 
ATOM   1322 C CD1 . LEU A 1 172 ? -2.308  -28.610 27.703  1.00 30.54  ? 173  LEU A CD1 1 
ATOM   1323 C CD2 . LEU A 1 172 ? -1.934  -30.258 29.562  1.00 29.88  ? 173  LEU A CD2 1 
ATOM   1324 N N   . LEU A 1 173 ? -2.600  -25.885 32.666  1.00 33.64  ? 174  LEU A N   1 
ATOM   1325 C CA  . LEU A 1 173 ? -2.062  -24.922 33.610  1.00 34.78  ? 174  LEU A CA  1 
ATOM   1326 C C   . LEU A 1 173 ? -2.185  -25.409 35.060  1.00 37.21  ? 174  LEU A C   1 
ATOM   1327 O O   . LEU A 1 173 ? -1.290  -25.168 35.879  1.00 37.84  ? 174  LEU A O   1 
ATOM   1328 C CB  . LEU A 1 173 ? -2.748  -23.564 33.417  1.00 36.97  ? 174  LEU A CB  1 
ATOM   1329 C CG  . LEU A 1 173 ? -2.392  -22.870 32.071  1.00 42.51  ? 174  LEU A CG  1 
ATOM   1330 C CD1 . LEU A 1 173 ? -3.166  -21.552 31.856  1.00 34.47  ? 174  LEU A CD1 1 
ATOM   1331 C CD2 . LEU A 1 173 ? -0.884  -22.621 31.945  1.00 30.67  ? 174  LEU A CD2 1 
ATOM   1332 N N   . ASP A 1 174 ? -3.281  -26.104 35.376  1.00 36.54  ? 175  ASP A N   1 
ATOM   1333 C CA  . ASP A 1 174 ? -3.436  -26.708 36.699  1.00 33.09  ? 175  ASP A CA  1 
ATOM   1334 C C   . ASP A 1 174 ? -2.247  -27.610 36.975  1.00 36.19  ? 175  ASP A C   1 
ATOM   1335 O O   . ASP A 1 174 ? -1.650  -27.566 38.057  1.00 36.18  ? 175  ASP A O   1 
ATOM   1336 C CB  . ASP A 1 174 ? -4.730  -27.521 36.817  1.00 31.05  ? 175  ASP A CB  1 
ATOM   1337 C CG  . ASP A 1 174 ? -5.991  -26.658 36.730  1.00 35.82  ? 175  ASP A CG  1 
ATOM   1338 O OD1 . ASP A 1 174 ? -5.907  -25.424 36.923  1.00 36.46  ? 175  ASP A OD1 1 
ATOM   1339 O OD2 . ASP A 1 174 ? -7.077  -27.227 36.471  1.00 31.47  ? 175  ASP A OD2 1 
ATOM   1340 N N   . GLN A 1 175 ? -1.891  -28.433 35.994  1.00 33.12  ? 176  GLN A N   1 
ATOM   1341 C CA  . GLN A 1 175 ? -0.752  -29.336 36.172  1.00 36.97  ? 176  GLN A CA  1 
ATOM   1342 C C   . GLN A 1 175 ? 0.576   -28.577 36.351  1.00 36.69  ? 176  GLN A C   1 
ATOM   1343 O O   . GLN A 1 175 ? 1.395   -28.928 37.212  1.00 39.31  ? 176  GLN A O   1 
ATOM   1344 C CB  . GLN A 1 175 ? -0.640  -30.290 34.984  1.00 36.58  ? 176  GLN A CB  1 
ATOM   1345 C CG  . GLN A 1 175 ? -1.812  -31.224 34.803  1.00 31.81  ? 176  GLN A CG  1 
ATOM   1346 C CD  . GLN A 1 175 ? -1.729  -31.936 33.465  1.00 34.62  ? 176  GLN A CD  1 
ATOM   1347 O OE1 . GLN A 1 175 ? -0.700  -31.868 32.776  1.00 31.73  ? 176  GLN A OE1 1 
ATOM   1348 N NE2 . GLN A 1 175 ? -2.812  -32.598 33.077  1.00 32.41  ? 176  GLN A NE2 1 
ATOM   1349 N N   . ARG A 1 176 ? 0.772   -27.531 35.550  1.00 38.11  ? 177  ARG A N   1 
ATOM   1350 C CA  . ARG A 1 176 ? 1.991   -26.728 35.610  1.00 38.36  ? 177  ARG A CA  1 
ATOM   1351 C C   . ARG A 1 176 ? 2.118   -26.031 36.968  1.00 35.27  ? 177  ARG A C   1 
ATOM   1352 O O   . ARG A 1 176 ? 3.190   -26.036 37.583  1.00 32.95  ? 177  ARG A O   1 
ATOM   1353 C CB  . ARG A 1 176 ? 2.016   -25.692 34.466  1.00 35.63  ? 177  ARG A CB  1 
ATOM   1354 C CG  . ARG A 1 176 ? 3.213   -24.757 34.547  1.00 40.63  ? 177  ARG A CG  1 
ATOM   1355 C CD  . ARG A 1 176 ? 3.255   -23.742 33.434  1.00 35.10  ? 177  ARG A CD  1 
ATOM   1356 N NE  . ARG A 1 176 ? 3.499   -24.370 32.136  1.00 42.98  ? 177  ARG A NE  1 
ATOM   1357 C CZ  . ARG A 1 176 ? 3.264   -23.759 30.977  1.00 43.66  ? 177  ARG A CZ  1 
ATOM   1358 N NH1 . ARG A 1 176 ? 2.769   -22.528 30.976  1.00 44.30  ? 177  ARG A NH1 1 
ATOM   1359 N NH2 . ARG A 1 176 ? 3.510   -24.371 29.831  1.00 41.83  ? 177  ARG A NH2 1 
ATOM   1360 N N   . LEU A 1 177 ? 1.020   -25.450 37.443  1.00 33.41  ? 178  LEU A N   1 
ATOM   1361 C CA  . LEU A 1 177 ? 1.007   -24.835 38.771  1.00 37.82  ? 178  LEU A CA  1 
ATOM   1362 C C   . LEU A 1 177 ? 1.445   -25.863 39.815  1.00 39.56  ? 178  LEU A C   1 
ATOM   1363 O O   . LEU A 1 177 ? 2.250   -25.567 40.710  1.00 38.03  ? 178  LEU A O   1 
ATOM   1364 C CB  . LEU A 1 177 ? -0.377  -24.274 39.102  1.00 34.12  ? 178  LEU A CB  1 
ATOM   1365 C CG  . LEU A 1 177 ? -0.487  -23.489 40.412  1.00 43.00  ? 178  LEU A CG  1 
ATOM   1366 C CD1 . LEU A 1 177 ? 0.495   -22.336 40.428  1.00 36.08  ? 178  LEU A CD1 1 
ATOM   1367 C CD2 . LEU A 1 177 ? -1.912  -22.995 40.649  1.00 36.27  ? 178  LEU A CD2 1 
ATOM   1368 N N   . ALA A 1 178 ? 0.959   -27.090 39.675  1.00 37.88  ? 179  ALA A N   1 
ATOM   1369 C CA  . ALA A 1 178 ? 1.304   -28.134 40.644  1.00 38.15  ? 179  ALA A CA  1 
ATOM   1370 C C   . ALA A 1 178 ? 2.786   -28.458 40.545  1.00 32.77  ? 179  ALA A C   1 
ATOM   1371 O O   . ALA A 1 178 ? 3.417   -28.733 41.546  1.00 33.28  ? 179  ALA A O   1 
ATOM   1372 C CB  . ALA A 1 178 ? 0.443   -29.394 40.424  1.00 32.16  ? 179  ALA A CB  1 
ATOM   1373 N N   . LEU A 1 179 ? 3.343   -28.417 39.325  1.00 36.01  ? 180  LEU A N   1 
ATOM   1374 C CA  . LEU A 1 179 ? 4.782   -28.625 39.137  1.00 34.66  ? 180  LEU A CA  1 
ATOM   1375 C C   . LEU A 1 179 ? 5.622   -27.480 39.750  1.00 38.26  ? 180  LEU A C   1 
ATOM   1376 O O   . LEU A 1 179 ? 6.668   -27.726 40.362  1.00 38.58  ? 180  LEU A O   1 
ATOM   1377 C CB  . LEU A 1 179 ? 5.114   -28.797 37.651  1.00 38.29  ? 180  LEU A CB  1 
ATOM   1378 C CG  . LEU A 1 179 ? 4.501   -30.040 36.992  1.00 33.26  ? 180  LEU A CG  1 
ATOM   1379 C CD1 . LEU A 1 179 ? 4.850   -30.174 35.485  1.00 31.08  ? 180  LEU A CD1 1 
ATOM   1380 C CD2 . LEU A 1 179 ? 4.968   -31.254 37.797  1.00 31.69  ? 180  LEU A CD2 1 
ATOM   1381 N N   . GLN A 1 180 ? 5.155   -26.244 39.572  1.00 41.92  ? 181  GLN A N   1 
ATOM   1382 C CA  . GLN A 1 180 ? 5.727   -25.064 40.231  1.00 42.26  ? 181  GLN A CA  1 
ATOM   1383 C C   . GLN A 1 180 ? 5.699   -25.249 41.743  1.00 39.89  ? 181  GLN A C   1 
ATOM   1384 O O   . GLN A 1 180 ? 6.685   -24.997 42.441  1.00 42.32  ? 181  GLN A O   1 
ATOM   1385 C CB  . GLN A 1 180 ? 4.960   -23.784 39.824  1.00 40.94  ? 181  GLN A CB  1 
ATOM   1386 C CG  . GLN A 1 180 ? 5.442   -23.174 38.500  1.00 44.87  ? 181  GLN A CG  1 
ATOM   1387 C CD  . GLN A 1 180 ? 4.416   -22.252 37.812  1.00 55.17  ? 181  GLN A CD  1 
ATOM   1388 O OE1 . GLN A 1 180 ? 3.285   -22.088 38.276  1.00 56.22  ? 181  GLN A OE1 1 
ATOM   1389 N NE2 . GLN A 1 180 ? 4.819   -21.658 36.682  1.00 43.89  ? 181  GLN A NE2 1 
ATOM   1390 N N   . TRP A 1 181 ? 4.558   -25.717 42.239  1.00 42.87  ? 182  TRP A N   1 
ATOM   1391 C CA  . TRP A 1 181 ? 4.368   -25.961 43.674  1.00 35.75  ? 182  TRP A CA  1 
ATOM   1392 C C   . TRP A 1 181 ? 5.428   -26.916 44.187  1.00 37.08  ? 182  TRP A C   1 
ATOM   1393 O O   . TRP A 1 181 ? 5.970   -26.738 45.299  1.00 38.22  ? 182  TRP A O   1 
ATOM   1394 C CB  . TRP A 1 181 ? 2.970   -26.535 43.950  1.00 32.78  ? 182  TRP A CB  1 
ATOM   1395 C CG  . TRP A 1 181 ? 2.629   -26.667 45.431  1.00 32.73  ? 182  TRP A CG  1 
ATOM   1396 C CD1 . TRP A 1 181 ? 1.900   -25.786 46.183  1.00 30.52  ? 182  TRP A CD1 1 
ATOM   1397 C CD2 . TRP A 1 181 ? 3.004   -27.733 46.315  1.00 31.83  ? 182  TRP A CD2 1 
ATOM   1398 N NE1 . TRP A 1 181 ? 1.799   -26.235 47.480  1.00 33.82  ? 182  TRP A NE1 1 
ATOM   1399 C CE2 . TRP A 1 181 ? 2.463   -27.428 47.592  1.00 35.90  ? 182  TRP A CE2 1 
ATOM   1400 C CE3 . TRP A 1 181 ? 3.734   -28.917 46.157  1.00 29.75  ? 182  TRP A CE3 1 
ATOM   1401 C CZ2 . TRP A 1 181 ? 2.639   -28.263 48.703  1.00 31.22  ? 182  TRP A CZ2 1 
ATOM   1402 C CZ3 . TRP A 1 181 ? 3.902   -29.749 47.263  1.00 32.51  ? 182  TRP A CZ3 1 
ATOM   1403 C CH2 . TRP A 1 181 ? 3.355   -29.416 48.516  1.00 29.75  ? 182  TRP A CH2 1 
ATOM   1404 N N   . VAL A 1 182 ? 5.706   -27.936 43.375  1.00 34.26  ? 183  VAL A N   1 
ATOM   1405 C CA  . VAL A 1 182 ? 6.687   -28.955 43.728  1.00 36.86  ? 183  VAL A CA  1 
ATOM   1406 C C   . VAL A 1 182 ? 8.082   -28.336 43.774  1.00 39.70  ? 183  VAL A C   1 
ATOM   1407 O O   . VAL A 1 182 ? 8.852   -28.608 44.695  1.00 41.69  ? 183  VAL A O   1 
ATOM   1408 C CB  . VAL A 1 182 ? 6.654   -30.158 42.731  1.00 37.76  ? 183  VAL A CB  1 
ATOM   1409 C CG1 . VAL A 1 182 ? 7.894   -31.007 42.857  1.00 30.62  ? 183  VAL A CG1 1 
ATOM   1410 C CG2 . VAL A 1 182 ? 5.401   -31.010 42.962  1.00 34.30  ? 183  VAL A CG2 1 
ATOM   1411 N N   . GLN A 1 183 ? 8.403   -27.509 42.782  1.00 42.67  ? 184  GLN A N   1 
ATOM   1412 C CA  . GLN A 1 183 ? 9.684   -26.821 42.757  1.00 44.99  ? 184  GLN A CA  1 
ATOM   1413 C C   . GLN A 1 183 ? 9.850   -25.991 44.029  1.00 38.12  ? 184  GLN A C   1 
ATOM   1414 O O   . GLN A 1 183 ? 10.894  -26.039 44.664  1.00 46.41  ? 184  GLN A O   1 
ATOM   1415 C CB  . GLN A 1 183 ? 9.816   -25.943 41.497  1.00 38.75  ? 184  GLN A CB  1 
ATOM   1416 C CG  . GLN A 1 183 ? 10.225  -26.742 40.269  1.00 40.76  ? 184  GLN A CG  1 
ATOM   1417 C CD  . GLN A 1 183 ? 11.522  -27.465 40.511  1.00 46.47  ? 184  GLN A CD  1 
ATOM   1418 O OE1 . GLN A 1 183 ? 12.511  -26.853 40.918  1.00 57.36  ? 184  GLN A OE1 1 
ATOM   1419 N NE2 . GLN A 1 183 ? 11.527  -28.776 40.305  1.00 43.79  ? 184  GLN A NE2 1 
ATOM   1420 N N   . GLU A 1 184 ? 8.805   -25.285 44.440  1.00 42.57  ? 185  GLU A N   1 
ATOM   1421 C CA  . GLU A 1 184 ? 8.886   -24.465 45.656  1.00 43.50  ? 185  GLU A CA  1 
ATOM   1422 C C   . GLU A 1 184 ? 8.804   -25.221 46.994  1.00 52.84  ? 185  GLU A C   1 
ATOM   1423 O O   . GLU A 1 184 ? 9.377   -24.763 47.991  1.00 52.65  ? 185  GLU A O   1 
ATOM   1424 C CB  . GLU A 1 184 ? 7.806   -23.390 45.620  1.00 42.06  ? 185  GLU A CB  1 
ATOM   1425 C CG  . GLU A 1 184 ? 8.110   -22.322 44.545  1.00 57.57  ? 185  GLU A CG  1 
ATOM   1426 C CD  . GLU A 1 184 ? 6.976   -21.313 44.333  1.00 72.18  ? 185  GLU A CD  1 
ATOM   1427 O OE1 . GLU A 1 184 ? 6.846   -20.798 43.191  1.00 69.50  ? 185  GLU A OE1 1 
ATOM   1428 O OE2 . GLU A 1 184 ? 6.225   -21.025 45.302  1.00 73.32  ? 185  GLU A OE2 1 
ATOM   1429 N N   . ASN A 1 185 ? 8.121   -26.364 47.051  1.00 44.65  ? 186  ASN A N   1 
ATOM   1430 C CA  . ASN A 1 185 ? 7.825   -26.933 48.378  1.00 39.79  ? 186  ASN A CA  1 
ATOM   1431 C C   . ASN A 1 185 ? 8.257   -28.368 48.629  1.00 40.56  ? 186  ASN A C   1 
ATOM   1432 O O   . ASN A 1 185 ? 8.168   -28.837 49.762  1.00 44.12  ? 186  ASN A O   1 
ATOM   1433 C CB  . ASN A 1 185 ? 6.324   -26.845 48.665  1.00 32.64  ? 186  ASN A CB  1 
ATOM   1434 C CG  . ASN A 1 185 ? 5.808   -25.424 48.615  1.00 40.00  ? 186  ASN A CG  1 
ATOM   1435 O OD1 . ASN A 1 185 ? 6.111   -24.624 49.486  1.00 45.32  ? 186  ASN A OD1 1 
ATOM   1436 N ND2 . ASN A 1 185 ? 5.017   -25.103 47.591  1.00 43.15  ? 186  ASN A ND2 1 
ATOM   1437 N N   . VAL A 1 186 ? 8.719   -29.074 47.604  1.00 37.79  ? 187  VAL A N   1 
ATOM   1438 C CA  . VAL A 1 186 ? 8.937   -30.495 47.792  1.00 41.05  ? 187  VAL A CA  1 
ATOM   1439 C C   . VAL A 1 186 ? 10.082  -30.735 48.767  1.00 39.05  ? 187  VAL A C   1 
ATOM   1440 O O   . VAL A 1 186 ? 10.027  -31.697 49.526  1.00 41.91  ? 187  VAL A O   1 
ATOM   1441 C CB  . VAL A 1 186 ? 9.182   -31.252 46.437  1.00 36.96  ? 187  VAL A CB  1 
ATOM   1442 C CG1 . VAL A 1 186 ? 10.575  -30.997 45.871  1.00 35.18  ? 187  VAL A CG1 1 
ATOM   1443 C CG2 . VAL A 1 186 ? 8.937   -32.745 46.617  1.00 32.13  ? 187  VAL A CG2 1 
ATOM   1444 N N   . ALA A 1 187 ? 11.083  -29.848 48.787  1.00 43.27  ? 188  ALA A N   1 
ATOM   1445 C CA  . ALA A 1 187 ? 12.208  -29.963 49.736  1.00 46.43  ? 188  ALA A CA  1 
ATOM   1446 C C   . ALA A 1 187 ? 11.748  -30.092 51.186  1.00 44.01  ? 188  ALA A C   1 
ATOM   1447 O O   . ALA A 1 187 ? 12.388  -30.786 51.982  1.00 48.78  ? 188  ALA A O   1 
ATOM   1448 C CB  . ALA A 1 187 ? 13.149  -28.777 49.610  1.00 41.41  ? 188  ALA A CB  1 
ATOM   1449 N N   . ALA A 1 188 ? 10.635  -29.448 51.530  1.00 39.24  ? 189  ALA A N   1 
ATOM   1450 C CA  . ALA A 1 188 ? 10.130  -29.510 52.913  1.00 43.38  ? 189  ALA A CA  1 
ATOM   1451 C C   . ALA A 1 188 ? 9.650   -30.906 53.295  1.00 49.39  ? 189  ALA A C   1 
ATOM   1452 O O   . ALA A 1 188 ? 9.338   -31.155 54.465  1.00 47.26  ? 189  ALA A O   1 
ATOM   1453 C CB  . ALA A 1 188 ? 8.990   -28.495 53.120  1.00 42.15  ? 189  ALA A CB  1 
ATOM   1454 N N   . PHE A 1 189 ? 9.568   -31.801 52.306  1.00 48.07  ? 190  PHE A N   1 
ATOM   1455 C CA  . PHE A 1 189 ? 9.139   -33.186 52.522  1.00 45.32  ? 190  PHE A CA  1 
ATOM   1456 C C   . PHE A 1 189 ? 10.312  -34.158 52.404  1.00 46.30  ? 190  PHE A C   1 
ATOM   1457 O O   . PHE A 1 189 ? 10.143  -35.361 52.593  1.00 47.12  ? 190  PHE A O   1 
ATOM   1458 C CB  . PHE A 1 189 ? 8.042   -33.582 51.515  1.00 38.55  ? 190  PHE A CB  1 
ATOM   1459 C CG  . PHE A 1 189 ? 6.767   -32.778 51.649  1.00 39.06  ? 190  PHE A CG  1 
ATOM   1460 C CD1 . PHE A 1 189 ? 6.610   -31.590 50.964  1.00 36.63  ? 190  PHE A CD1 1 
ATOM   1461 C CD2 . PHE A 1 189 ? 5.739   -33.209 52.472  1.00 41.78  ? 190  PHE A CD2 1 
ATOM   1462 C CE1 . PHE A 1 189 ? 5.455   -30.852 51.076  1.00 37.37  ? 190  PHE A CE1 1 
ATOM   1463 C CE2 . PHE A 1 189 ? 4.570   -32.466 52.602  1.00 41.15  ? 190  PHE A CE2 1 
ATOM   1464 C CZ  . PHE A 1 189 ? 4.426   -31.292 51.891  1.00 40.51  ? 190  PHE A CZ  1 
ATOM   1465 N N   . GLY A 1 190 ? 11.496  -33.632 52.089  1.00 43.11  ? 191  GLY A N   1 
ATOM   1466 C CA  . GLY A 1 190 ? 12.659  -34.462 51.796  1.00 47.24  ? 191  GLY A CA  1 
ATOM   1467 C C   . GLY A 1 190 ? 12.893  -34.682 50.306  1.00 50.23  ? 191  GLY A C   1 
ATOM   1468 O O   . GLY A 1 190 ? 13.821  -35.384 49.887  1.00 48.50  ? 191  GLY A O   1 
ATOM   1469 N N   . GLY A 1 191 ? 12.050  -34.075 49.480  1.00 46.93  ? 192  GLY A N   1 
ATOM   1470 C CA  . GLY A 1 191 ? 12.208  -34.220 48.050  1.00 41.21  ? 192  GLY A CA  1 
ATOM   1471 C C   . GLY A 1 191 ? 13.271  -33.318 47.449  1.00 40.84  ? 192  GLY A C   1 
ATOM   1472 O O   . GLY A 1 191 ? 13.573  -32.264 47.978  1.00 48.32  ? 192  GLY A O   1 
ATOM   1473 N N   . ASP A 1 192 ? 13.827  -33.751 46.328  1.00 41.95  ? 193  ASP A N   1 
ATOM   1474 C CA  . ASP A 1 192 ? 14.839  -33.018 45.585  1.00 41.93  ? 193  ASP A CA  1 
ATOM   1475 C C   . ASP A 1 192 ? 14.251  -32.380 44.328  1.00 45.62  ? 193  ASP A C   1 
ATOM   1476 O O   . ASP A 1 192 ? 14.018  -33.065 43.335  1.00 41.67  ? 193  ASP A O   1 
ATOM   1477 C CB  . ASP A 1 192 ? 15.968  -33.972 45.206  1.00 44.09  ? 193  ASP A CB  1 
ATOM   1478 C CG  . ASP A 1 192 ? 17.088  -33.305 44.433  1.00 41.03  ? 193  ASP A CG  1 
ATOM   1479 O OD1 . ASP A 1 192 ? 17.058  -32.085 44.174  1.00 47.62  ? 193  ASP A OD1 1 
ATOM   1480 O OD2 . ASP A 1 192 ? 18.032  -34.030 44.088  1.00 52.37  ? 193  ASP A OD2 1 
ATOM   1481 N N   . PRO A 1 193 ? 14.049  -31.057 44.356  1.00 46.72  ? 194  PRO A N   1 
ATOM   1482 C CA  . PRO A 1 193 ? 13.440  -30.343 43.234  1.00 38.20  ? 194  PRO A CA  1 
ATOM   1483 C C   . PRO A 1 193 ? 14.298  -30.377 41.968  1.00 47.40  ? 194  PRO A C   1 
ATOM   1484 O O   . PRO A 1 193 ? 13.811  -29.976 40.902  1.00 42.25  ? 194  PRO A O   1 
ATOM   1485 C CB  . PRO A 1 193 ? 13.311  -28.907 43.764  1.00 42.38  ? 194  PRO A CB  1 
ATOM   1486 C CG  . PRO A 1 193 ? 14.371  -28.794 44.808  1.00 40.71  ? 194  PRO A CG  1 
ATOM   1487 C CD  . PRO A 1 193 ? 14.387  -30.152 45.470  1.00 43.03  ? 194  PRO A CD  1 
ATOM   1488 N N   . THR A 1 194 ? 15.541  -30.841 42.082  1.00 45.22  ? 195  THR A N   1 
ATOM   1489 C CA  . THR A 1 194 ? 16.446  -30.955 40.926  1.00 51.47  ? 195  THR A CA  1 
ATOM   1490 C C   . THR A 1 194 ? 16.405  -32.361 40.303  1.00 44.96  ? 195  THR A C   1 
ATOM   1491 O O   . THR A 1 194 ? 17.092  -32.625 39.328  1.00 47.33  ? 195  THR A O   1 
ATOM   1492 C CB  . THR A 1 194 ? 17.937  -30.627 41.305  1.00 49.49  ? 195  THR A CB  1 
ATOM   1493 O OG1 . THR A 1 194 ? 18.497  -31.711 42.067  1.00 43.43  ? 195  THR A OG1 1 
ATOM   1494 C CG2 . THR A 1 194 ? 18.035  -29.324 42.113  1.00 42.13  ? 195  THR A CG2 1 
ATOM   1495 N N   . SER A 1 195 ? 15.623  -33.264 40.881  1.00 41.36  ? 196  SER A N   1 
ATOM   1496 C CA  . SER A 1 195 ? 15.416  -34.586 40.291  1.00 47.36  ? 196  SER A CA  1 
ATOM   1497 C C   . SER A 1 195 ? 13.915  -34.912 40.261  1.00 47.93  ? 196  SER A C   1 
ATOM   1498 O O   . SER A 1 195 ? 13.390  -35.636 41.137  1.00 42.65  ? 196  SER A O   1 
ATOM   1499 C CB  . SER A 1 195 ? 16.175  -35.666 41.074  1.00 48.81  ? 196  SER A CB  1 
ATOM   1500 O OG  . SER A 1 195 ? 16.062  -36.932 40.425  1.00 54.50  ? 196  SER A OG  1 
ATOM   1501 N N   . VAL A 1 196 ? 13.214  -34.347 39.287  1.00 35.97  ? 197  VAL A N   1 
ATOM   1502 C CA  . VAL A 1 196 ? 11.782  -34.563 39.201  1.00 37.01  ? 197  VAL A CA  1 
ATOM   1503 C C   . VAL A 1 196 ? 11.424  -35.293 37.896  1.00 43.40  ? 197  VAL A C   1 
ATOM   1504 O O   . VAL A 1 196 ? 11.713  -34.795 36.791  1.00 36.18  ? 197  VAL A O   1 
ATOM   1505 C CB  . VAL A 1 196 ? 11.025  -33.243 39.296  1.00 40.62  ? 197  VAL A CB  1 
ATOM   1506 C CG1 . VAL A 1 196 ? 9.552   -33.451 38.959  1.00 36.93  ? 197  VAL A CG1 1 
ATOM   1507 C CG2 . VAL A 1 196 ? 11.196  -32.606 40.711  1.00 35.42  ? 197  VAL A CG2 1 
ATOM   1508 N N   . THR A 1 197 ? 10.840  -36.489 38.043  1.00 38.55  ? 198  THR A N   1 
ATOM   1509 C CA  . THR A 1 197 ? 10.424  -37.309 36.921  1.00 39.34  ? 198  THR A CA  1 
ATOM   1510 C C   . THR A 1 197 ? 8.904   -37.326 36.816  1.00 38.50  ? 198  THR A C   1 
ATOM   1511 O O   . THR A 1 197 ? 8.233   -37.659 37.786  1.00 38.36  ? 198  THR A O   1 
ATOM   1512 C CB  . THR A 1 197 ? 10.934  -38.760 37.036  1.00 37.92  ? 198  THR A CB  1 
ATOM   1513 O OG1 . THR A 1 197 ? 12.367  -38.762 37.150  1.00 34.58  ? 198  THR A OG1 1 
ATOM   1514 C CG2 . THR A 1 197 ? 10.527  -39.584 35.762  1.00 38.06  ? 198  THR A CG2 1 
ATOM   1515 N N   . LEU A 1 198 ? 8.386   -36.922 35.650  1.00 36.23  ? 199  LEU A N   1 
ATOM   1516 C CA  . LEU A 1 198 ? 6.954   -36.949 35.322  1.00 34.52  ? 199  LEU A CA  1 
ATOM   1517 C C   . LEU A 1 198 ? 6.557   -38.298 34.747  1.00 36.41  ? 199  LEU A C   1 
ATOM   1518 O O   . LEU A 1 198 ? 7.246   -38.819 33.864  1.00 33.65  ? 199  LEU A O   1 
ATOM   1519 C CB  . LEU A 1 198 ? 6.599   -35.884 34.285  1.00 33.17  ? 199  LEU A CB  1 
ATOM   1520 C CG  . LEU A 1 198 ? 6.653   -34.405 34.619  1.00 37.78  ? 199  LEU A CG  1 
ATOM   1521 C CD1 . LEU A 1 198 ? 5.992   -33.605 33.510  1.00 35.80  ? 199  LEU A CD1 1 
ATOM   1522 C CD2 . LEU A 1 198 ? 5.994   -34.101 35.974  1.00 39.26  ? 199  LEU A CD2 1 
ATOM   1523 N N   . PHE A 1 199 ? 5.470   -38.877 35.239  1.00 28.97  ? 200  PHE A N   1 
ATOM   1524 C CA  . PHE A 1 199 ? 4.939   -40.047 34.578  1.00 31.98  ? 200  PHE A CA  1 
ATOM   1525 C C   . PHE A 1 199 ? 3.427   -39.972 34.580  1.00 32.61  ? 200  PHE A C   1 
ATOM   1526 O O   . PHE A 1 199 ? 2.821   -39.349 35.442  1.00 34.43  ? 200  PHE A O   1 
ATOM   1527 C CB  . PHE A 1 199 ? 5.476   -41.369 35.178  1.00 30.16  ? 200  PHE A CB  1 
ATOM   1528 C CG  . PHE A 1 199 ? 5.024   -41.696 36.585  1.00 36.41  ? 200  PHE A CG  1 
ATOM   1529 C CD1 . PHE A 1 199 ? 5.066   -40.753 37.617  1.00 34.24  ? 200  PHE A CD1 1 
ATOM   1530 C CD2 . PHE A 1 199 ? 4.636   -43.000 36.890  1.00 34.85  ? 200  PHE A CD2 1 
ATOM   1531 C CE1 . PHE A 1 199 ? 4.689   -41.095 38.903  1.00 32.87  ? 200  PHE A CE1 1 
ATOM   1532 C CE2 . PHE A 1 199 ? 4.254   -43.362 38.198  1.00 37.09  ? 200  PHE A CE2 1 
ATOM   1533 C CZ  . PHE A 1 199 ? 4.288   -42.404 39.209  1.00 34.31  ? 200  PHE A CZ  1 
ATOM   1534 N N   . GLY A 1 200 ? 2.824   -40.577 33.568  1.00 33.15  ? 201  GLY A N   1 
ATOM   1535 C CA  . GLY A 1 200 ? 1.398   -40.437 33.345  1.00 35.71  ? 201  GLY A CA  1 
ATOM   1536 C C   . GLY A 1 200 ? 0.961   -41.483 32.344  1.00 32.15  ? 201  GLY A C   1 
ATOM   1537 O O   . GLY A 1 200 ? 1.782   -41.993 31.580  1.00 34.14  ? 201  GLY A O   1 
ATOM   1538 N N   . GLU A 1 201 ? -0.329  -41.814 32.351  1.00 35.03  ? 202  GLU A N   1 
ATOM   1539 C CA  . GLU A 1 201 ? -0.856  -42.829 31.453  1.00 36.75  ? 202  GLU A CA  1 
ATOM   1540 C C   . GLU A 1 201 ? -2.026  -42.274 30.620  1.00 34.40  ? 202  GLU A C   1 
ATOM   1541 O O   . GLU A 1 201 ? -2.822  -41.478 31.121  1.00 36.53  ? 202  GLU A O   1 
ATOM   1542 C CB  . GLU A 1 201 ? -1.259  -44.069 32.259  1.00 35.19  ? 202  GLU A CB  1 
ATOM   1543 C CG  . GLU A 1 201 ? -1.701  -45.277 31.402  1.00 35.31  ? 202  GLU A CG  1 
ATOM   1544 C CD  . GLU A 1 201 ? -3.206  -45.306 31.164  1.00 37.22  ? 202  GLU A CD  1 
ATOM   1545 O OE1 . GLU A 1 201 ? -3.923  -44.390 31.641  1.00 36.86  ? 202  GLU A OE1 1 
ATOM   1546 O OE2 . GLU A 1 201 ? -3.671  -46.255 30.501  1.00 42.41  ? 202  GLU A OE2 1 
ATOM   1547 N N   . SER A 1 202 ? -2.115  -42.691 29.354  1.00 37.10  ? 203  SER A N   1 
ATOM   1548 C CA  . SER A 1 202 ? -3.172  -42.240 28.426  1.00 36.93  ? 203  SER A CA  1 
ATOM   1549 C C   . SER A 1 202 ? -3.142  -40.704 28.272  1.00 33.31  ? 203  SER A C   1 
ATOM   1550 O O   . SER A 1 202 ? -2.118  -40.171 27.852  1.00 36.96  ? 203  SER A O   1 
ATOM   1551 C CB  . SER A 1 202 ? -4.560  -42.732 28.888  1.00 41.28  ? 203  SER A CB  1 
ATOM   1552 O OG  . SER A 1 202 ? -5.464  -42.813 27.764  1.00 40.65  ? 203  SER A OG  1 
ATOM   1553 N N   . ALA A 1 203 ? -4.234  -40.002 28.594  1.00 33.07  ? 204  ALA A N   1 
ATOM   1554 C CA  . ALA A 1 203 ? -4.247  -38.520 28.608  1.00 34.97  ? 204  ALA A CA  1 
ATOM   1555 C C   . ALA A 1 203 ? -3.215  -37.925 29.603  1.00 31.91  ? 204  ALA A C   1 
ATOM   1556 O O   . ALA A 1 203 ? -2.808  -36.768 29.480  1.00 28.07  ? 204  ALA A O   1 
ATOM   1557 C CB  . ALA A 1 203 ? -5.639  -37.996 28.945  1.00 29.72  ? 204  ALA A CB  1 
ATOM   1558 N N   . GLY A 1 204 ? -2.801  -38.723 30.575  1.00 31.00  ? 205  GLY A N   1 
ATOM   1559 C CA  . GLY A 1 204 ? -1.743  -38.338 31.497  1.00 32.63  ? 205  GLY A CA  1 
ATOM   1560 C C   . GLY A 1 204 ? -0.408  -38.417 30.772  1.00 32.39  ? 205  GLY A C   1 
ATOM   1561 O O   . GLY A 1 204 ? 0.461   -37.575 30.975  1.00 29.25  ? 205  GLY A O   1 
ATOM   1562 N N   . ALA A 1 205 ? -0.229  -39.430 29.924  1.00 30.04  ? 206  ALA A N   1 
ATOM   1563 C CA  . ALA A 1 205 ? 1.001   -39.493 29.140  1.00 33.04  ? 206  ALA A CA  1 
ATOM   1564 C C   . ALA A 1 205 ? 0.985   -38.364 28.065  1.00 35.10  ? 206  ALA A C   1 
ATOM   1565 O O   . ALA A 1 205 ? 1.983   -37.665 27.855  1.00 38.02  ? 206  ALA A O   1 
ATOM   1566 C CB  . ALA A 1 205 ? 1.166   -40.856 28.515  1.00 35.03  ? 206  ALA A CB  1 
ATOM   1567 N N   . ALA A 1 206 ? -0.151  -38.157 27.418  1.00 33.45  ? 207  ALA A N   1 
ATOM   1568 C CA  . ALA A 1 206 ? -0.293  -37.012 26.511  1.00 34.95  ? 207  ALA A CA  1 
ATOM   1569 C C   . ALA A 1 206 ? 0.086   -35.702 27.209  1.00 34.41  ? 207  ALA A C   1 
ATOM   1570 O O   . ALA A 1 206 ? 0.748   -34.848 26.635  1.00 34.75  ? 207  ALA A O   1 
ATOM   1571 C CB  . ALA A 1 206 ? -1.716  -36.925 25.984  1.00 33.32  ? 207  ALA A CB  1 
ATOM   1572 N N   . SER A 1 207 ? -0.327  -35.567 28.465  1.00 36.96  ? 208  SER A N   1 
ATOM   1573 C CA  . SER A 1 207 ? -0.053  -34.366 29.233  1.00 33.47  ? 208  SER A CA  1 
ATOM   1574 C C   . SER A 1 207 ? 1.437   -34.244 29.509  1.00 33.89  ? 208  SER A C   1 
ATOM   1575 O O   . SER A 1 207 ? 2.022   -33.170 29.355  1.00 35.21  ? 208  SER A O   1 
ATOM   1576 C CB  . SER A 1 207 ? -0.846  -34.375 30.534  1.00 30.63  ? 208  SER A CB  1 
ATOM   1577 O OG  . SER A 1 207 ? -2.225  -34.203 30.292  1.00 27.99  ? 208  SER A OG  1 
ATOM   1578 N N   . VAL A 1 208 ? 2.062   -35.351 29.892  1.00 30.61  ? 209  VAL A N   1 
ATOM   1579 C CA  . VAL A 1 208 ? 3.501   -35.330 30.080  1.00 31.82  ? 209  VAL A CA  1 
ATOM   1580 C C   . VAL A 1 208 ? 4.231   -34.826 28.806  1.00 33.83  ? 209  VAL A C   1 
ATOM   1581 O O   . VAL A 1 208 ? 5.061   -33.919 28.881  1.00 35.32  ? 209  VAL A O   1 
ATOM   1582 C CB  . VAL A 1 208 ? 4.022   -36.705 30.467  1.00 34.46  ? 209  VAL A CB  1 
ATOM   1583 C CG1 . VAL A 1 208 ? 5.549   -36.734 30.371  1.00 34.94  ? 209  VAL A CG1 1 
ATOM   1584 C CG2 . VAL A 1 208 ? 3.526   -37.089 31.875  1.00 34.00  ? 209  VAL A CG2 1 
ATOM   1585 N N   . GLY A 1 209 ? 3.903   -35.379 27.639  1.00 34.50  ? 210  GLY A N   1 
ATOM   1586 C CA  . GLY A 1 209 ? 4.539   -34.945 26.411  1.00 30.50  ? 210  GLY A CA  1 
ATOM   1587 C C   . GLY A 1 209 ? 4.269   -33.479 26.083  1.00 38.69  ? 210  GLY A C   1 
ATOM   1588 O O   . GLY A 1 209 ? 5.115   -32.781 25.522  1.00 39.64  ? 210  GLY A O   1 
ATOM   1589 N N   . MET A 1 210 ? 3.088   -32.988 26.438  1.00 40.97  ? 211  MET A N   1 
ATOM   1590 C CA  . MET A 1 210 ? 2.791   -31.592 26.182  1.00 36.70  ? 211  MET A CA  1 
ATOM   1591 C C   . MET A 1 210 ? 3.656   -30.698 27.054  1.00 39.86  ? 211  MET A C   1 
ATOM   1592 O O   . MET A 1 210 ? 4.077   -29.628 26.623  1.00 42.05  ? 211  MET A O   1 
ATOM   1593 C CB  . MET A 1 210 ? 1.308   -31.312 26.399  1.00 38.25  ? 211  MET A CB  1 
ATOM   1594 C CG  . MET A 1 210 ? 0.466   -31.741 25.168  1.00 39.37  ? 211  MET A CG  1 
ATOM   1595 S SD  . MET A 1 210 ? -1.291  -31.583 25.477  1.00 45.69  ? 211  MET A SD  1 
ATOM   1596 C CE  . MET A 1 210 ? -1.949  -32.919 24.440  1.00 36.28  ? 211  MET A CE  1 
ATOM   1597 N N   . HIS A 1 211 ? 3.958   -31.144 28.265  1.00 36.90  ? 212  HIS A N   1 
ATOM   1598 C CA  . HIS A 1 211 ? 4.840   -30.369 29.122  1.00 37.35  ? 212  HIS A CA  1 
ATOM   1599 C C   . HIS A 1 211 ? 6.251   -30.413 28.542  1.00 38.94  ? 212  HIS A C   1 
ATOM   1600 O O   . HIS A 1 211 ? 7.003   -29.465 28.687  1.00 39.54  ? 212  HIS A O   1 
ATOM   1601 C CB  . HIS A 1 211 ? 4.811   -30.886 30.570  1.00 33.37  ? 212  HIS A CB  1 
ATOM   1602 C CG  . HIS A 1 211 ? 3.539   -30.559 31.296  1.00 33.98  ? 212  HIS A CG  1 
ATOM   1603 N ND1 . HIS A 1 211 ? 3.143   -29.263 31.563  1.00 36.10  ? 212  HIS A ND1 1 
ATOM   1604 C CD2 . HIS A 1 211 ? 2.574   -31.359 31.812  1.00 32.74  ? 212  HIS A CD2 1 
ATOM   1605 C CE1 . HIS A 1 211 ? 1.990   -29.278 32.211  1.00 36.73  ? 212  HIS A CE1 1 
ATOM   1606 N NE2 . HIS A 1 211 ? 1.621   -30.539 32.374  1.00 35.17  ? 212  HIS A NE2 1 
ATOM   1607 N N   . LEU A 1 212 ? 6.590   -31.510 27.868  1.00 36.85  ? 213  LEU A N   1 
ATOM   1608 C CA  . LEU A 1 212 ? 7.876   -31.623 27.189  1.00 39.74  ? 213  LEU A CA  1 
ATOM   1609 C C   . LEU A 1 212 ? 8.007   -30.577 26.097  1.00 44.04  ? 213  LEU A C   1 
ATOM   1610 O O   . LEU A 1 212 ? 9.090   -30.018 25.916  1.00 43.91  ? 213  LEU A O   1 
ATOM   1611 C CB  . LEU A 1 212 ? 8.067   -33.012 26.561  1.00 37.33  ? 213  LEU A CB  1 
ATOM   1612 C CG  . LEU A 1 212 ? 8.630   -34.096 27.454  1.00 46.40  ? 213  LEU A CG  1 
ATOM   1613 C CD1 . LEU A 1 212 ? 8.655   -35.421 26.678  1.00 36.24  ? 213  LEU A CD1 1 
ATOM   1614 C CD2 . LEU A 1 212 ? 10.023  -33.679 27.948  1.00 48.95  ? 213  LEU A CD2 1 
ATOM   1615 N N   . LEU A 1 213 ? 6.902   -30.333 25.375  1.00 36.81  ? 214  LEU A N   1 
ATOM   1616 C CA  . LEU A 1 213 ? 6.902   -29.462 24.204  1.00 39.84  ? 214  LEU A CA  1 
ATOM   1617 C C   . LEU A 1 213 ? 6.545   -28.012 24.503  1.00 38.82  ? 214  LEU A C   1 
ATOM   1618 O O   . LEU A 1 213 ? 6.392   -27.197 23.590  1.00 47.40  ? 214  LEU A O   1 
ATOM   1619 C CB  . LEU A 1 213 ? 5.928   -30.010 23.145  1.00 36.47  ? 214  LEU A CB  1 
ATOM   1620 C CG  . LEU A 1 213 ? 6.169   -31.473 22.777  1.00 36.49  ? 214  LEU A CG  1 
ATOM   1621 C CD1 . LEU A 1 213 ? 5.051   -32.013 21.889  1.00 38.09  ? 214  LEU A CD1 1 
ATOM   1622 C CD2 . LEU A 1 213 ? 7.518   -31.650 22.117  1.00 38.41  ? 214  LEU A CD2 1 
ATOM   1623 N N   . SER A 1 214 ? 6.387   -27.682 25.771  1.00 42.45  ? 215  SER A N   1 
ATOM   1624 C CA  . SER A 1 214 ? 6.023   -26.324 26.137  1.00 40.32  ? 215  SER A CA  1 
ATOM   1625 C C   . SER A 1 214 ? 7.096   -25.763 27.076  1.00 42.41  ? 215  SER A C   1 
ATOM   1626 O O   . SER A 1 214 ? 7.194   -26.193 28.227  1.00 46.52  ? 215  SER A O   1 
ATOM   1627 C CB  . SER A 1 214 ? 4.627   -26.304 26.777  1.00 38.14  ? 215  SER A CB  1 
ATOM   1628 O OG  . SER A 1 214 ? 4.267   -25.002 27.209  1.00 41.19  ? 215  SER A OG  1 
ATOM   1629 N N   . PRO A 1 215 ? 7.906   -24.801 26.578  1.00 45.32  ? 216  PRO A N   1 
ATOM   1630 C CA  . PRO A 1 215 ? 9.072   -24.254 27.299  1.00 42.97  ? 216  PRO A CA  1 
ATOM   1631 C C   . PRO A 1 215 ? 8.817   -23.807 28.744  1.00 43.13  ? 216  PRO A C   1 
ATOM   1632 O O   . PRO A 1 215 ? 9.652   -24.104 29.591  1.00 43.73  ? 216  PRO A O   1 
ATOM   1633 C CB  . PRO A 1 215 ? 9.497   -23.066 26.419  1.00 48.40  ? 216  PRO A CB  1 
ATOM   1634 C CG  . PRO A 1 215 ? 9.106   -23.503 25.008  1.00 40.51  ? 216  PRO A CG  1 
ATOM   1635 C CD  . PRO A 1 215 ? 7.789   -24.235 25.215  1.00 46.34  ? 216  PRO A CD  1 
ATOM   1636 N N   . PRO A 1 216 ? 7.689   -23.138 29.040  1.00 41.86  ? 217  PRO A N   1 
ATOM   1637 C CA  . PRO A 1 216 ? 7.542   -22.786 30.464  1.00 35.15  ? 217  PRO A CA  1 
ATOM   1638 C C   . PRO A 1 216 ? 7.371   -23.994 31.431  1.00 47.95  ? 217  PRO A C   1 
ATOM   1639 O O   . PRO A 1 216 ? 7.581   -23.813 32.643  1.00 43.55  ? 217  PRO A O   1 
ATOM   1640 C CB  . PRO A 1 216 ? 6.275   -21.907 30.487  1.00 36.60  ? 217  PRO A CB  1 
ATOM   1641 C CG  . PRO A 1 216 ? 6.083   -21.440 29.028  1.00 37.40  ? 217  PRO A CG  1 
ATOM   1642 C CD  . PRO A 1 216 ? 6.611   -22.574 28.201  1.00 35.92  ? 217  PRO A CD  1 
ATOM   1643 N N   . SER A 1 217 ? 6.989   -25.176 30.938  1.00 39.01  ? 218  SER A N   1 
ATOM   1644 C CA  . SER A 1 217 ? 6.947   -26.373 31.806  1.00 39.27  ? 218  SER A CA  1 
ATOM   1645 C C   . SER A 1 217 ? 8.294   -27.060 31.876  1.00 42.03  ? 218  SER A C   1 
ATOM   1646 O O   . SER A 1 217 ? 8.573   -27.786 32.815  1.00 42.10  ? 218  SER A O   1 
ATOM   1647 C CB  . SER A 1 217 ? 5.911   -27.414 31.329  1.00 36.42  ? 218  SER A CB  1 
ATOM   1648 O OG  . SER A 1 217 ? 4.586   -26.903 31.288  1.00 39.79  ? 218  SER A OG  1 
ATOM   1649 N N   . ARG A 1 218 ? 9.120   -26.847 30.860  1.00 45.77  ? 219  ARG A N   1 
ATOM   1650 C CA  . ARG A 1 218 ? 10.257  -27.716 30.632  1.00 46.84  ? 219  ARG A CA  1 
ATOM   1651 C C   . ARG A 1 218 ? 11.289  -27.516 31.742  1.00 45.42  ? 219  ARG A C   1 
ATOM   1652 O O   . ARG A 1 218 ? 12.011  -28.443 32.121  1.00 48.60  ? 219  ARG A O   1 
ATOM   1653 C CB  . ARG A 1 218 ? 10.826  -27.452 29.231  1.00 49.78  ? 219  ARG A CB  1 
ATOM   1654 C CG  . ARG A 1 218 ? 11.887  -28.413 28.740  1.00 50.45  ? 219  ARG A CG  1 
ATOM   1655 C CD  . ARG A 1 218 ? 11.427  -29.854 28.740  1.00 50.41  ? 219  ARG A CD  1 
ATOM   1656 N NE  . ARG A 1 218 ? 12.570  -30.768 28.642  1.00 59.90  ? 219  ARG A NE  1 
ATOM   1657 C CZ  . ARG A 1 218 ? 13.233  -31.292 29.683  1.00 59.03  ? 219  ARG A CZ  1 
ATOM   1658 N NH1 . ARG A 1 218 ? 12.881  -31.023 30.948  1.00 41.26  ? 219  ARG A NH1 1 
ATOM   1659 N NH2 . ARG A 1 218 ? 14.255  -32.106 29.454  1.00 54.38  ? 219  ARG A NH2 1 
ATOM   1660 N N   . GLY A 1 219 ? 11.319  -26.320 32.312  1.00 44.93  ? 220  GLY A N   1 
ATOM   1661 C CA  . GLY A 1 219 ? 12.203  -26.068 33.432  1.00 39.35  ? 220  GLY A CA  1 
ATOM   1662 C C   . GLY A 1 219 ? 11.745  -26.691 34.735  1.00 46.76  ? 220  GLY A C   1 
ATOM   1663 O O   . GLY A 1 219 ? 12.481  -26.646 35.705  1.00 50.38  ? 220  GLY A O   1 
ATOM   1664 N N   . LEU A 1 220 ? 10.546  -27.280 34.767  1.00 43.75  ? 221  LEU A N   1 
ATOM   1665 C CA  . LEU A 1 220 ? 9.977   -27.780 36.019  1.00 39.51  ? 221  LEU A CA  1 
ATOM   1666 C C   . LEU A 1 220 ? 10.187  -29.275 36.248  1.00 43.62  ? 221  LEU A C   1 
ATOM   1667 O O   . LEU A 1 220 ? 9.705   -29.823 37.241  1.00 41.73  ? 221  LEU A O   1 
ATOM   1668 C CB  . LEU A 1 220 ? 8.475   -27.472 36.075  1.00 42.28  ? 221  LEU A CB  1 
ATOM   1669 C CG  . LEU A 1 220 ? 8.114   -25.999 35.839  1.00 47.77  ? 221  LEU A CG  1 
ATOM   1670 C CD1 . LEU A 1 220 ? 6.602   -25.757 35.890  1.00 40.40  ? 221  LEU A CD1 1 
ATOM   1671 C CD2 . LEU A 1 220 ? 8.852   -25.125 36.856  1.00 33.72  ? 221  LEU A CD2 1 
ATOM   1672 N N   . PHE A 1 221 ? 10.882  -29.949 35.334  1.00 37.34  ? 222  PHE A N   1 
ATOM   1673 C CA  . PHE A 1 221 ? 11.169  -31.368 35.535  1.00 37.87  ? 222  PHE A CA  1 
ATOM   1674 C C   . PHE A 1 221 ? 12.362  -31.763 34.679  1.00 36.90  ? 222  PHE A C   1 
ATOM   1675 O O   . PHE A 1 221 ? 12.864  -30.963 33.900  1.00 41.72  ? 222  PHE A O   1 
ATOM   1676 C CB  . PHE A 1 221 ? 9.939   -32.252 35.221  1.00 39.98  ? 222  PHE A CB  1 
ATOM   1677 C CG  . PHE A 1 221 ? 9.507   -32.222 33.777  1.00 39.54  ? 222  PHE A CG  1 
ATOM   1678 C CD1 . PHE A 1 221 ? 8.788   -31.152 33.275  1.00 43.10  ? 222  PHE A CD1 1 
ATOM   1679 C CD2 . PHE A 1 221 ? 9.812   -33.284 32.922  1.00 41.72  ? 222  PHE A CD2 1 
ATOM   1680 C CE1 . PHE A 1 221 ? 8.390   -31.121 31.933  1.00 38.05  ? 222  PHE A CE1 1 
ATOM   1681 C CE2 . PHE A 1 221 ? 9.417   -33.272 31.590  1.00 38.96  ? 222  PHE A CE2 1 
ATOM   1682 C CZ  . PHE A 1 221 ? 8.709   -32.184 31.087  1.00 40.69  ? 222  PHE A CZ  1 
ATOM   1683 N N   . HIS A 1 222 ? 12.801  -33.001 34.831  1.00 34.98  ? 223  HIS A N   1 
ATOM   1684 C CA  . HIS A 1 222 ? 14.067  -33.434 34.279  1.00 40.07  ? 223  HIS A CA  1 
ATOM   1685 C C   . HIS A 1 222 ? 13.949  -34.707 33.456  1.00 38.51  ? 223  HIS A C   1 
ATOM   1686 O O   . HIS A 1 222 ? 14.697  -34.881 32.507  1.00 47.45  ? 223  HIS A O   1 
ATOM   1687 C CB  . HIS A 1 222 ? 15.084  -33.612 35.421  1.00 39.46  ? 223  HIS A CB  1 
ATOM   1688 C CG  . HIS A 1 222 ? 15.146  -32.421 36.328  1.00 52.52  ? 223  HIS A CG  1 
ATOM   1689 N ND1 . HIS A 1 222 ? 14.349  -32.293 37.449  1.00 41.75  ? 223  HIS A ND1 1 
ATOM   1690 C CD2 . HIS A 1 222 ? 15.845  -31.263 36.230  1.00 50.08  ? 223  HIS A CD2 1 
ATOM   1691 C CE1 . HIS A 1 222 ? 14.577  -31.122 38.015  1.00 45.77  ? 223  HIS A CE1 1 
ATOM   1692 N NE2 . HIS A 1 222 ? 15.480  -30.476 37.294  1.00 50.76  ? 223  HIS A NE2 1 
ATOM   1693 N N   . ARG A 1 223 ? 13.025  -35.596 33.801  1.00 39.62  ? 224  ARG A N   1 
ATOM   1694 C CA  . ARG A 1 223 ? 12.820  -36.813 33.000  1.00 40.07  ? 224  ARG A CA  1 
ATOM   1695 C C   . ARG A 1 223 ? 11.336  -37.057 32.809  1.00 35.52  ? 224  ARG A C   1 
ATOM   1696 O O   . ARG A 1 223 ? 10.512  -36.392 33.437  1.00 35.90  ? 224  ARG A O   1 
ATOM   1697 C CB  . ARG A 1 223 ? 13.460  -38.025 33.661  1.00 38.95  ? 224  ARG A CB  1 
ATOM   1698 C CG  . ARG A 1 223 ? 14.953  -37.953 33.764  1.00 46.64  ? 224  ARG A CG  1 
ATOM   1699 C CD  . ARG A 1 223 ? 15.462  -38.985 34.768  1.00 47.17  ? 224  ARG A CD  1 
ATOM   1700 N NE  . ARG A 1 223 ? 16.751  -38.596 35.327  1.00 55.46  ? 224  ARG A NE  1 
ATOM   1701 C CZ  . ARG A 1 223 ? 16.902  -37.800 36.385  1.00 63.15  ? 224  ARG A CZ  1 
ATOM   1702 N NH1 . ARG A 1 223 ? 15.842  -37.298 37.021  1.00 57.84  ? 224  ARG A NH1 1 
ATOM   1703 N NH2 . ARG A 1 223 ? 18.124  -37.506 36.816  1.00 77.08  ? 224  ARG A NH2 1 
ATOM   1704 N N   . ALA A 1 224 ? 10.999  -38.036 31.981  1.00 34.50  ? 225  ALA A N   1 
ATOM   1705 C CA  . ALA A 1 224 ? 9.618   -38.207 31.539  1.00 39.04  ? 225  ALA A CA  1 
ATOM   1706 C C   . ALA A 1 224 ? 9.276   -39.651 31.207  1.00 38.28  ? 225  ALA A C   1 
ATOM   1707 O O   . ALA A 1 224 ? 10.037  -40.357 30.524  1.00 35.94  ? 225  ALA A O   1 
ATOM   1708 C CB  . ALA A 1 224 ? 9.340   -37.330 30.338  1.00 35.20  ? 225  ALA A CB  1 
ATOM   1709 N N   . VAL A 1 225 ? 8.106   -40.072 31.686  1.00 35.29  ? 226  VAL A N   1 
ATOM   1710 C CA  . VAL A 1 225 ? 7.593   -41.400 31.409  1.00 31.32  ? 226  VAL A CA  1 
ATOM   1711 C C   . VAL A 1 225 ? 6.220   -41.298 30.786  1.00 37.87  ? 226  VAL A C   1 
ATOM   1712 O O   . VAL A 1 225 ? 5.333   -40.626 31.338  1.00 33.71  ? 226  VAL A O   1 
ATOM   1713 C CB  . VAL A 1 225 ? 7.532   -42.233 32.665  1.00 31.84  ? 226  VAL A CB  1 
ATOM   1714 C CG1 . VAL A 1 225 ? 6.981   -43.597 32.358  1.00 32.60  ? 226  VAL A CG1 1 
ATOM   1715 C CG2 . VAL A 1 225 ? 8.919   -42.323 33.285  1.00 30.35  ? 226  VAL A CG2 1 
ATOM   1716 N N   . LEU A 1 226 ? 6.067   -41.946 29.627  1.00 32.23  ? 227  LEU A N   1 
ATOM   1717 C CA  . LEU A 1 226 ? 4.833   -41.900 28.852  1.00 32.97  ? 227  LEU A CA  1 
ATOM   1718 C C   . LEU A 1 226 ? 4.250   -43.293 28.645  1.00 34.60  ? 227  LEU A C   1 
ATOM   1719 O O   . LEU A 1 226 ? 4.674   -44.032 27.743  1.00 35.56  ? 227  LEU A O   1 
ATOM   1720 C CB  . LEU A 1 226 ? 5.070   -41.239 27.483  1.00 34.31  ? 227  LEU A CB  1 
ATOM   1721 C CG  . LEU A 1 226 ? 5.275   -39.728 27.560  1.00 38.11  ? 227  LEU A CG  1 
ATOM   1722 C CD1 . LEU A 1 226 ? 6.742   -39.400 27.614  1.00 34.48  ? 227  LEU A CD1 1 
ATOM   1723 C CD2 . LEU A 1 226 ? 4.611   -39.048 26.382  1.00 33.09  ? 227  LEU A CD2 1 
ATOM   1724 N N   . GLN A 1 227 ? 3.261   -43.641 29.461  1.00 33.57  ? 228  GLN A N   1 
ATOM   1725 C CA  . GLN A 1 227 ? 2.588   -44.929 29.339  1.00 35.49  ? 228  GLN A CA  1 
ATOM   1726 C C   . GLN A 1 227 ? 1.295   -44.859 28.511  1.00 36.15  ? 228  GLN A C   1 
ATOM   1727 O O   . GLN A 1 227 ? 0.318   -44.196 28.918  1.00 36.97  ? 228  GLN A O   1 
ATOM   1728 C CB  . GLN A 1 227 ? 2.267   -45.472 30.727  1.00 31.32  ? 228  GLN A CB  1 
ATOM   1729 C CG  . GLN A 1 227 ? 3.459   -45.428 31.695  1.00 36.75  ? 228  GLN A CG  1 
ATOM   1730 C CD  . GLN A 1 227 ? 3.040   -45.663 33.125  1.00 40.40  ? 228  GLN A CD  1 
ATOM   1731 O OE1 . GLN A 1 227 ? 3.773   -45.333 34.071  1.00 37.88  ? 228  GLN A OE1 1 
ATOM   1732 N NE2 . GLN A 1 227 ? 1.830   -46.212 33.302  1.00 35.10  ? 228  GLN A NE2 1 
ATOM   1733 N N   . SER A 1 228 ? 1.289   -45.558 27.371  1.00 34.62  ? 229  SER A N   1 
ATOM   1734 C CA  . SER A 1 228 ? 0.091   -45.710 26.515  1.00 32.97  ? 229  SER A CA  1 
ATOM   1735 C C   . SER A 1 228 ? -0.581  -44.414 26.136  1.00 28.91  ? 229  SER A C   1 
ATOM   1736 O O   . SER A 1 228 ? -1.812  -44.300 26.227  1.00 30.73  ? 229  SER A O   1 
ATOM   1737 C CB  . SER A 1 228 ? -0.986  -46.591 27.188  1.00 32.16  ? 229  SER A CB  1 
ATOM   1738 O OG  . SER A 1 228 ? -0.454  -47.818 27.639  1.00 36.92  ? 229  SER A OG  1 
ATOM   1739 N N   . GLY A 1 229 ? 0.202   -43.435 25.710  1.00 27.47  ? 230  GLY A N   1 
ATOM   1740 C CA  . GLY A 1 229 ? -0.370  -42.179 25.257  1.00 27.56  ? 230  GLY A CA  1 
ATOM   1741 C C   . GLY A 1 229 ? 0.742   -41.250 24.811  1.00 34.76  ? 230  GLY A C   1 
ATOM   1742 O O   . GLY A 1 229 ? 1.903   -41.484 25.130  1.00 35.90  ? 230  GLY A O   1 
ATOM   1743 N N   . ALA A 1 230 ? 0.384   -40.183 24.111  1.00 28.81  ? 231  ALA A N   1 
ATOM   1744 C CA  . ALA A 1 230 ? 1.355   -39.345 23.409  1.00 37.48  ? 231  ALA A CA  1 
ATOM   1745 C C   . ALA A 1 230 ? 0.699   -38.012 23.024  1.00 38.02  ? 231  ALA A C   1 
ATOM   1746 O O   . ALA A 1 230 ? -0.494  -37.968 22.695  1.00 37.96  ? 231  ALA A O   1 
ATOM   1747 C CB  . ALA A 1 230 ? 1.904   -40.081 22.139  1.00 31.79  ? 231  ALA A CB  1 
ATOM   1748 N N   . PRO A 1 231 ? 1.458   -36.916 23.072  1.00 35.00  ? 232  PRO A N   1 
ATOM   1749 C CA  . PRO A 1 231 ? 0.780   -35.650 22.773  1.00 37.91  ? 232  PRO A CA  1 
ATOM   1750 C C   . PRO A 1 231 ? 0.330   -35.554 21.302  1.00 38.90  ? 232  PRO A C   1 
ATOM   1751 O O   . PRO A 1 231 ? -0.549  -34.739 21.001  1.00 38.75  ? 232  PRO A O   1 
ATOM   1752 C CB  . PRO A 1 231 ? 1.848   -34.590 23.104  1.00 33.75  ? 232  PRO A CB  1 
ATOM   1753 C CG  . PRO A 1 231 ? 3.135   -35.301 22.976  1.00 37.10  ? 232  PRO A CG  1 
ATOM   1754 C CD  . PRO A 1 231 ? 2.862   -36.712 23.466  1.00 36.99  ? 232  PRO A CD  1 
ATOM   1755 N N   . ASN A 1 232 ? 0.902   -36.379 20.421  1.00 37.19  ? 233  ASN A N   1 
ATOM   1756 C CA  . ASN A 1 232 ? 0.549   -36.363 19.005  1.00 42.46  ? 233  ASN A CA  1 
ATOM   1757 C C   . ASN A 1 232 ? -0.594  -37.329 18.646  1.00 45.44  ? 233  ASN A C   1 
ATOM   1758 O O   . ASN A 1 232 ? -1.019  -37.425 17.475  1.00 40.20  ? 233  ASN A O   1 
ATOM   1759 C CB  . ASN A 1 232 ? 1.785   -36.674 18.135  1.00 43.80  ? 233  ASN A CB  1 
ATOM   1760 C CG  . ASN A 1 232 ? 2.584   -37.855 18.646  1.00 40.41  ? 233  ASN A CG  1 
ATOM   1761 O OD1 . ASN A 1 232 ? 2.905   -37.918 19.814  1.00 41.85  ? 233  ASN A OD1 1 
ATOM   1762 N ND2 . ASN A 1 232 ? 2.909   -38.790 17.770  1.00 42.53  ? 233  ASN A ND2 1 
ATOM   1763 N N   . GLY A 1 233 ? -1.104  -38.049 19.631  1.00 38.84  ? 234  GLY A N   1 
ATOM   1764 C CA  . GLY A 1 233 ? -2.283  -38.870 19.367  1.00 46.26  ? 234  GLY A CA  1 
ATOM   1765 C C   . GLY A 1 233 ? -3.402  -38.015 18.785  1.00 48.12  ? 234  GLY A C   1 
ATOM   1766 O O   . GLY A 1 233 ? -3.578  -36.866 19.214  1.00 49.15  ? 234  GLY A O   1 
ATOM   1767 N N   . PRO A 1 234 ? -4.160  -38.556 17.808  1.00 45.17  ? 235  PRO A N   1 
ATOM   1768 C CA  . PRO A 1 234 ? -5.209  -37.818 17.089  1.00 39.47  ? 235  PRO A CA  1 
ATOM   1769 C C   . PRO A 1 234 ? -6.401  -37.418 17.976  1.00 44.86  ? 235  PRO A C   1 
ATOM   1770 O O   . PRO A 1 234 ? -7.266  -36.656 17.551  1.00 41.48  ? 235  PRO A O   1 
ATOM   1771 C CB  . PRO A 1 234 ? -5.666  -38.815 16.032  1.00 38.33  ? 235  PRO A CB  1 
ATOM   1772 C CG  . PRO A 1 234 ? -5.473  -40.141 16.682  1.00 42.70  ? 235  PRO A CG  1 
ATOM   1773 C CD  . PRO A 1 234 ? -4.208  -39.999 17.509  1.00 42.99  ? 235  PRO A CD  1 
ATOM   1774 N N   . TRP A 1 235 ? -6.459  -37.946 19.194  1.00 39.61  ? 236  TRP A N   1 
ATOM   1775 C CA  . TRP A 1 235 ? -7.496  -37.547 20.141  1.00 37.52  ? 236  TRP A CA  1 
ATOM   1776 C C   . TRP A 1 235 ? -7.025  -36.463 21.112  1.00 40.37  ? 236  TRP A C   1 
ATOM   1777 O O   . TRP A 1 235 ? -7.842  -35.870 21.814  1.00 41.20  ? 236  TRP A O   1 
ATOM   1778 C CB  . TRP A 1 235 ? -7.953  -38.764 20.937  1.00 42.88  ? 236  TRP A CB  1 
ATOM   1779 C CG  . TRP A 1 235 ? -6.763  -39.512 21.513  1.00 40.21  ? 236  TRP A CG  1 
ATOM   1780 C CD1 . TRP A 1 235 ? -6.062  -40.532 20.911  1.00 42.12  ? 236  TRP A CD1 1 
ATOM   1781 C CD2 . TRP A 1 235 ? -6.110  -39.262 22.762  1.00 37.37  ? 236  TRP A CD2 1 
ATOM   1782 N NE1 . TRP A 1 235 ? -5.036  -40.943 21.719  1.00 39.99  ? 236  TRP A NE1 1 
ATOM   1783 C CE2 . TRP A 1 235 ? -5.038  -40.179 22.863  1.00 38.54  ? 236  TRP A CE2 1 
ATOM   1784 C CE3 . TRP A 1 235 ? -6.339  -38.367 23.815  1.00 40.77  ? 236  TRP A CE3 1 
ATOM   1785 C CZ2 . TRP A 1 235 ? -4.194  -40.228 23.979  1.00 38.41  ? 236  TRP A CZ2 1 
ATOM   1786 C CZ3 . TRP A 1 235 ? -5.503  -38.419 24.934  1.00 36.25  ? 236  TRP A CZ3 1 
ATOM   1787 C CH2 . TRP A 1 235 ? -4.439  -39.344 25.006  1.00 37.19  ? 236  TRP A CH2 1 
ATOM   1788 N N   . ALA A 1 236 ? -5.712  -36.232 21.193  1.00 39.70  ? 237  ALA A N   1 
ATOM   1789 C CA  . ALA A 1 236 ? -5.152  -35.459 22.318  1.00 37.74  ? 237  ALA A CA  1 
ATOM   1790 C C   . ALA A 1 236 ? -5.236  -33.950 22.129  1.00 40.72  ? 237  ALA A C   1 
ATOM   1791 O O   . ALA A 1 236 ? -5.158  -33.210 23.112  1.00 36.10  ? 237  ALA A O   1 
ATOM   1792 C CB  . ALA A 1 236 ? -3.696  -35.851 22.577  1.00 35.14  ? 237  ALA A CB  1 
ATOM   1793 N N   . THR A 1 237 ? -5.401  -33.481 20.887  1.00 38.87  ? 238  THR A N   1 
ATOM   1794 C CA  . THR A 1 237 ? -5.536  -32.042 20.674  1.00 40.31  ? 238  THR A CA  1 
ATOM   1795 C C   . THR A 1 237 ? -6.649  -31.679 19.690  1.00 40.85  ? 238  THR A C   1 
ATOM   1796 O O   . THR A 1 237 ? -7.169  -32.512 18.961  1.00 39.14  ? 238  THR A O   1 
ATOM   1797 C CB  . THR A 1 237 ? -4.211  -31.405 20.157  1.00 42.72  ? 238  THR A CB  1 
ATOM   1798 O OG1 . THR A 1 237 ? -3.850  -32.004 18.906  1.00 38.99  ? 238  THR A OG1 1 
ATOM   1799 C CG2 . THR A 1 237 ? -3.066  -31.600 21.165  1.00 41.15  ? 238  THR A CG2 1 
ATOM   1800 N N   . VAL A 1 238 ? -6.988  -30.400 19.662  1.00 42.50  ? 239  VAL A N   1 
ATOM   1801 C CA  . VAL A 1 238 ? -8.034  -29.921 18.795  1.00 42.04  ? 239  VAL A CA  1 
ATOM   1802 C C   . VAL A 1 238 ? -7.584  -28.566 18.249  1.00 42.51  ? 239  VAL A C   1 
ATOM   1803 O O   . VAL A 1 238 ? -6.840  -27.849 18.927  1.00 39.73  ? 239  VAL A O   1 
ATOM   1804 C CB  . VAL A 1 238 ? -9.384  -29.829 19.568  1.00 45.88  ? 239  VAL A CB  1 
ATOM   1805 C CG1 . VAL A 1 238 ? -9.403  -28.637 20.553  1.00 37.71  ? 239  VAL A CG1 1 
ATOM   1806 C CG2 . VAL A 1 238 ? -10.524 -29.749 18.627  1.00 43.02  ? 239  VAL A CG2 1 
ATOM   1807 N N   . GLY A 1 239 ? -7.973  -28.239 17.008  1.00 47.36  ? 240  GLY A N   1 
ATOM   1808 C CA  . GLY A 1 239 ? -7.629  -26.956 16.411  1.00 36.28  ? 240  GLY A CA  1 
ATOM   1809 C C   . GLY A 1 239 ? -8.510  -25.842 16.955  1.00 48.81  ? 240  GLY A C   1 
ATOM   1810 O O   . GLY A 1 239 ? -9.588  -26.105 17.516  1.00 44.45  ? 240  GLY A O   1 
ATOM   1811 N N   . MET A 1 240 ? -8.060  -24.598 16.797  1.00 48.23  ? 241  MET A N   1 
ATOM   1812 C CA  . MET A 1 240 ? -8.801  -23.442 17.311  1.00 50.58  ? 241  MET A CA  1 
ATOM   1813 C C   . MET A 1 240 ? -10.248 -23.390 16.797  1.00 54.71  ? 241  MET A C   1 
ATOM   1814 O O   . MET A 1 240 ? -11.194 -23.210 17.579  1.00 54.21  ? 241  MET A O   1 
ATOM   1815 C CB  . MET A 1 240 ? -8.074  -22.147 16.952  1.00 49.17  ? 241  MET A CB  1 
ATOM   1816 C CG  . MET A 1 240 ? -7.010  -21.729 17.968  1.00 53.53  ? 241  MET A CG  1 
ATOM   1817 S SD  . MET A 1 240 ? -5.939  -20.398 17.359  1.00 70.04  ? 241  MET A SD  1 
ATOM   1818 C CE  . MET A 1 240 ? -7.120  -19.055 17.112  1.00 61.21  ? 241  MET A CE  1 
ATOM   1819 N N   . GLY A 1 241 ? -10.412 -23.555 15.488  1.00 52.01  ? 242  GLY A N   1 
ATOM   1820 C CA  . GLY A 1 241 ? -11.728 -23.532 14.868  1.00 52.35  ? 242  GLY A CA  1 
ATOM   1821 C C   . GLY A 1 241 ? -12.680 -24.563 15.450  1.00 52.58  ? 242  GLY A C   1 
ATOM   1822 O O   . GLY A 1 241 ? -13.810 -24.236 15.834  1.00 49.28  ? 242  GLY A O   1 
ATOM   1823 N N   . GLU A 1 242 ? -12.224 -25.811 15.522  1.00 44.90  ? 243  GLU A N   1 
ATOM   1824 C CA  . GLU A 1 242 ? -13.044 -26.878 16.069  1.00 48.69  ? 243  GLU A CA  1 
ATOM   1825 C C   . GLU A 1 242 ? -13.322 -26.672 17.586  1.00 50.06  ? 243  GLU A C   1 
ATOM   1826 O O   . GLU A 1 242 ? -14.410 -26.988 18.072  1.00 49.15  ? 243  GLU A O   1 
ATOM   1827 C CB  . GLU A 1 242 ? -12.372 -28.232 15.785  1.00 47.09  ? 243  GLU A CB  1 
ATOM   1828 C CG  . GLU A 1 242 ? -13.078 -29.480 16.352  1.00 47.11  ? 243  GLU A CG  1 
ATOM   1829 C CD  . GLU A 1 242 ? -14.461 -29.723 15.773  1.00 51.56  ? 243  GLU A CD  1 
ATOM   1830 O OE1 . GLU A 1 242 ? -14.878 -28.974 14.859  1.00 56.24  ? 243  GLU A OE1 1 
ATOM   1831 O OE2 . GLU A 1 242 ? -15.145 -30.661 16.241  1.00 55.08  ? 243  GLU A OE2 1 
ATOM   1832 N N   . ALA A 1 243 ? -12.363 -26.120 18.326  1.00 52.84  ? 244  ALA A N   1 
ATOM   1833 C CA  . ALA A 1 243 ? -12.584 -25.817 19.750  1.00 52.01  ? 244  ALA A CA  1 
ATOM   1834 C C   . ALA A 1 243 ? -13.684 -24.765 19.920  1.00 52.84  ? 244  ALA A C   1 
ATOM   1835 O O   . ALA A 1 243 ? -14.529 -24.869 20.835  1.00 43.29  ? 244  ALA A O   1 
ATOM   1836 C CB  . ALA A 1 243 ? -11.290 -25.336 20.412  1.00 46.06  ? 244  ALA A CB  1 
ATOM   1837 N N   . ARG A 1 244 ? -13.658 -23.748 19.051  1.00 45.83  ? 245  ARG A N   1 
ATOM   1838 C CA  . ARG A 1 244 ? -14.701 -22.723 19.057  1.00 47.92  ? 245  ARG A CA  1 
ATOM   1839 C C   . ARG A 1 244 ? -16.072 -23.304 18.707  1.00 49.42  ? 245  ARG A C   1 
ATOM   1840 O O   . ARG A 1 244 ? -17.087 -22.955 19.314  1.00 49.56  ? 245  ARG A O   1 
ATOM   1841 C CB  . ARG A 1 244 ? -14.370 -21.591 18.097  1.00 50.57  ? 245  ARG A CB  1 
ATOM   1842 C CG  . ARG A 1 244 ? -15.406 -20.464 18.107  1.00 49.32  ? 245  ARG A CG  1 
ATOM   1843 C CD  . ARG A 1 244 ? -14.862 -19.204 17.442  1.00 47.57  ? 245  ARG A CD  1 
ATOM   1844 N NE  . ARG A 1 244 ? -13.960 -18.445 18.313  1.00 54.38  ? 245  ARG A NE  1 
ATOM   1845 C CZ  . ARG A 1 244 ? -14.371 -17.618 19.272  1.00 54.94  ? 245  ARG A CZ  1 
ATOM   1846 N NH1 . ARG A 1 244 ? -15.672 -17.470 19.493  1.00 55.30  ? 245  ARG A NH1 1 
ATOM   1847 N NH2 . ARG A 1 244 ? -13.485 -16.952 20.019  1.00 49.07  ? 245  ARG A NH2 1 
ATOM   1848 N N   . ARG A 1 245 ? -16.108 -24.203 17.743  1.00 47.28  ? 246  ARG A N   1 
ATOM   1849 C CA  . ARG A 1 245 ? -17.379 -24.815 17.390  1.00 52.66  ? 246  ARG A CA  1 
ATOM   1850 C C   . ARG A 1 245 ? -17.953 -25.642 18.534  1.00 48.25  ? 246  ARG A C   1 
ATOM   1851 O O   . ARG A 1 245 ? -19.158 -25.634 18.758  1.00 49.81  ? 246  ARG A O   1 
ATOM   1852 C CB  . ARG A 1 245 ? -17.248 -25.701 16.152  1.00 47.52  ? 246  ARG A CB  1 
ATOM   1853 C CG  . ARG A 1 245 ? -18.603 -26.065 15.564  1.00 52.87  ? 246  ARG A CG  1 
ATOM   1854 C CD  . ARG A 1 245 ? -18.567 -27.304 14.683  1.00 48.68  ? 246  ARG A CD  1 
ATOM   1855 N NE  . ARG A 1 245 ? -18.164 -28.523 15.384  1.00 56.74  ? 246  ARG A NE  1 
ATOM   1856 C CZ  . ARG A 1 245 ? -18.953 -29.242 16.185  1.00 63.39  ? 246  ARG A CZ  1 
ATOM   1857 N NH1 . ARG A 1 245 ? -20.205 -28.860 16.430  1.00 60.25  ? 246  ARG A NH1 1 
ATOM   1858 N NH2 . ARG A 1 245 ? -18.480 -30.347 16.759  1.00 60.95  ? 246  ARG A NH2 1 
ATOM   1859 N N   . ARG A 1 246 ? -17.101 -26.383 19.234  1.00 50.05  ? 247  ARG A N   1 
ATOM   1860 C CA  . ARG A 1 246 ? -17.584 -27.243 20.312  1.00 49.78  ? 247  ARG A CA  1 
ATOM   1861 C C   . ARG A 1 246 ? -18.009 -26.412 21.514  1.00 43.88  ? 247  ARG A C   1 
ATOM   1862 O O   . ARG A 1 246 ? -19.056 -26.661 22.089  1.00 46.94  ? 247  ARG A O   1 
ATOM   1863 C CB  . ARG A 1 246 ? -16.524 -28.270 20.714  1.00 50.89  ? 247  ARG A CB  1 
ATOM   1864 C CG  . ARG A 1 246 ? -16.157 -29.247 19.593  1.00 44.24  ? 247  ARG A CG  1 
ATOM   1865 C CD  . ARG A 1 246 ? -15.119 -30.233 20.076  1.00 46.41  ? 247  ARG A CD  1 
ATOM   1866 N NE  . ARG A 1 246 ? -14.596 -31.111 19.037  1.00 44.44  ? 247  ARG A NE  1 
ATOM   1867 C CZ  . ARG A 1 246 ? -13.794 -32.138 19.297  1.00 52.54  ? 247  ARG A CZ  1 
ATOM   1868 N NH1 . ARG A 1 246 ? -13.445 -32.399 20.564  1.00 40.16  ? 247  ARG A NH1 1 
ATOM   1869 N NH2 . ARG A 1 246 ? -13.341 -32.905 18.305  1.00 40.34  ? 247  ARG A NH2 1 
ATOM   1870 N N   . ALA A 1 247 ? -17.223 -25.405 21.875  1.00 41.65  ? 248  ALA A N   1 
ATOM   1871 C CA  . ALA A 1 247 ? -17.638 -24.501 22.944  1.00 42.55  ? 248  ALA A CA  1 
ATOM   1872 C C   . ALA A 1 247 ? -19.005 -23.913 22.628  1.00 50.55  ? 248  ALA A C   1 
ATOM   1873 O O   . ALA A 1 247 ? -19.902 -23.887 23.477  1.00 47.14  ? 248  ALA A O   1 
ATOM   1874 C CB  . ALA A 1 247 ? -16.618 -23.392 23.144  1.00 40.47  ? 248  ALA A CB  1 
ATOM   1875 N N   . THR A 1 248 ? -19.174 -23.496 21.372  1.00 50.60  ? 249  THR A N   1 
ATOM   1876 C CA  . THR A 1 248 ? -20.375 -22.796 20.967  1.00 43.23  ? 249  THR A CA  1 
ATOM   1877 C C   . THR A 1 248 ? -21.603 -23.706 21.003  1.00 48.50  ? 249  THR A C   1 
ATOM   1878 O O   . THR A 1 248 ? -22.680 -23.281 21.412  1.00 48.04  ? 249  THR A O   1 
ATOM   1879 C CB  . THR A 1 248 ? -20.181 -22.174 19.585  1.00 51.60  ? 249  THR A CB  1 
ATOM   1880 O OG1 . THR A 1 248 ? -19.224 -21.108 19.705  1.00 47.88  ? 249  THR A OG1 1 
ATOM   1881 C CG2 . THR A 1 248 ? -21.500 -21.628 19.036  1.00 45.64  ? 249  THR A CG2 1 
ATOM   1882 N N   A GLN A 1 249 ? -21.440 -24.961 20.607  0.48 47.39  ? 250  GLN A N   1 
ATOM   1883 N N   B GLN A 1 249 ? -21.429 -24.962 20.614  0.52 47.36  ? 250  GLN A N   1 
ATOM   1884 C CA  A GLN A 1 249 ? -22.554 -25.898 20.675  0.48 47.53  ? 250  GLN A CA  1 
ATOM   1885 C CA  B GLN A 1 249 ? -22.522 -25.925 20.664  0.52 47.54  ? 250  GLN A CA  1 
ATOM   1886 C C   A GLN A 1 249 ? -22.935 -26.247 22.123  0.48 48.55  ? 250  GLN A C   1 
ATOM   1887 C C   B GLN A 1 249 ? -22.920 -26.290 22.107  0.52 48.55  ? 250  GLN A C   1 
ATOM   1888 O O   A GLN A 1 249 ? -24.111 -26.467 22.424  0.48 47.25  ? 250  GLN A O   1 
ATOM   1889 O O   B GLN A 1 249 ? -24.089 -26.558 22.389  0.52 47.23  ? 250  GLN A O   1 
ATOM   1890 C CB  A GLN A 1 249 ? -22.239 -27.178 19.895  0.48 47.00  ? 250  GLN A CB  1 
ATOM   1891 C CB  B GLN A 1 249 ? -22.145 -27.188 19.880  0.52 47.02  ? 250  GLN A CB  1 
ATOM   1892 C CG  A GLN A 1 249 ? -23.418 -28.138 19.858  0.48 50.12  ? 250  GLN A CG  1 
ATOM   1893 C CG  B GLN A 1 249 ? -23.308 -28.142 19.645  0.52 50.20  ? 250  GLN A CG  1 
ATOM   1894 C CD  A GLN A 1 249 ? -23.200 -29.322 18.950  0.48 53.40  ? 250  GLN A CD  1 
ATOM   1895 C CD  B GLN A 1 249 ? -24.493 -27.466 18.977  0.52 50.83  ? 250  GLN A CD  1 
ATOM   1896 O OE1 A GLN A 1 249 ? -22.177 -29.426 18.270  0.48 54.42  ? 250  GLN A OE1 1 
ATOM   1897 O OE1 B GLN A 1 249 ? -24.328 -26.568 18.143  0.52 50.74  ? 250  GLN A OE1 1 
ATOM   1898 N NE2 A GLN A 1 249 ? -24.171 -30.230 18.933  0.48 52.29  ? 250  GLN A NE2 1 
ATOM   1899 N NE2 B GLN A 1 249 ? -25.697 -27.886 19.348  0.52 51.42  ? 250  GLN A NE2 1 
ATOM   1900 N N   . LEU A 1 250 ? -21.954 -26.304 23.019  1.00 45.07  ? 251  LEU A N   1 
ATOM   1901 C CA  . LEU A 1 250 ? -22.267 -26.582 24.415  1.00 49.99  ? 251  LEU A CA  1 
ATOM   1902 C C   . LEU A 1 250 ? -23.166 -25.455 24.920  1.00 48.16  ? 251  LEU A C   1 
ATOM   1903 O O   . LEU A 1 250 ? -24.192 -25.714 25.549  1.00 44.44  ? 251  LEU A O   1 
ATOM   1904 C CB  . LEU A 1 250 ? -21.011 -26.716 25.294  1.00 45.46  ? 251  LEU A CB  1 
ATOM   1905 C CG  . LEU A 1 250 ? -21.293 -27.083 26.763  1.00 45.98  ? 251  LEU A CG  1 
ATOM   1906 C CD1 . LEU A 1 250 ? -21.949 -28.447 26.893  1.00 40.13  ? 251  LEU A CD1 1 
ATOM   1907 C CD2 . LEU A 1 250 ? -20.036 -27.032 27.595  1.00 40.18  ? 251  LEU A CD2 1 
ATOM   1908 N N   . ALA A 1 251 ? -22.806 -24.213 24.605  1.00 44.04  ? 252  ALA A N   1 
ATOM   1909 C CA  . ALA A 1 251 ? -23.615 -23.092 25.051  1.00 51.27  ? 252  ALA A CA  1 
ATOM   1910 C C   . ALA A 1 251 ? -25.045 -23.254 24.550  1.00 54.49  ? 252  ALA A C   1 
ATOM   1911 O O   . ALA A 1 251 ? -25.987 -23.152 25.342  1.00 51.14  ? 252  ALA A O   1 
ATOM   1912 C CB  . ALA A 1 251 ? -23.028 -21.761 24.593  1.00 45.16  ? 252  ALA A CB  1 
ATOM   1913 N N   . HIS A 1 252 ? -25.204 -23.557 23.259  1.00 50.45  ? 253  HIS A N   1 
ATOM   1914 C CA  . HIS A 1 252 ? -26.543 -23.664 22.678  1.00 52.67  ? 253  HIS A CA  1 
ATOM   1915 C C   . HIS A 1 252 ? -27.322 -24.788 23.364  1.00 53.86  ? 253  HIS A C   1 
ATOM   1916 O O   . HIS A 1 252 ? -28.492 -24.617 23.719  1.00 54.35  ? 253  HIS A O   1 
ATOM   1917 C CB  . HIS A 1 252 ? -26.491 -23.899 21.155  1.00 53.45  ? 253  HIS A CB  1 
ATOM   1918 C CG  . HIS A 1 252 ? -27.820 -24.260 20.563  1.00 61.27  ? 253  HIS A CG  1 
ATOM   1919 N ND1 . HIS A 1 252 ? -28.168 -25.558 20.244  1.00 61.28  ? 253  HIS A ND1 1 
ATOM   1920 C CD2 . HIS A 1 252 ? -28.902 -23.497 20.268  1.00 58.95  ? 253  HIS A CD2 1 
ATOM   1921 C CE1 . HIS A 1 252 ? -29.403 -25.579 19.770  1.00 55.82  ? 253  HIS A CE1 1 
ATOM   1922 N NE2 . HIS A 1 252 ? -29.870 -24.341 19.772  1.00 67.28  ? 253  HIS A NE2 1 
ATOM   1923 N N   . LEU A 1 253 ? -26.657 -25.921 23.566  1.00 50.02  ? 254  LEU A N   1 
ATOM   1924 C CA  . LEU A 1 253 ? -27.265 -27.084 24.199  1.00 48.31  ? 254  LEU A CA  1 
ATOM   1925 C C   . LEU A 1 253 ? -27.736 -26.857 25.633  1.00 49.91  ? 254  LEU A C   1 
ATOM   1926 O O   . LEU A 1 253 ? -28.584 -27.596 26.115  1.00 52.79  ? 254  LEU A O   1 
ATOM   1927 C CB  . LEU A 1 253 ? -26.289 -28.259 24.202  1.00 53.59  ? 254  LEU A CB  1 
ATOM   1928 C CG  . LEU A 1 253 ? -26.018 -29.039 22.912  1.00 54.32  ? 254  LEU A CG  1 
ATOM   1929 C CD1 . LEU A 1 253 ? -25.004 -30.145 23.202  1.00 50.35  ? 254  LEU A CD1 1 
ATOM   1930 C CD2 . LEU A 1 253 ? -27.304 -29.635 22.381  1.00 51.36  ? 254  LEU A CD2 1 
ATOM   1931 N N   . VAL A 1 254 ? -27.181 -25.867 26.329  1.00 49.50  ? 255  VAL A N   1 
ATOM   1932 C CA  . VAL A 1 254 ? -27.555 -25.639 27.730  1.00 52.19  ? 255  VAL A CA  1 
ATOM   1933 C C   . VAL A 1 254 ? -28.286 -24.295 27.902  1.00 53.19  ? 255  VAL A C   1 
ATOM   1934 O O   . VAL A 1 254 ? -28.461 -23.797 29.033  1.00 47.44  ? 255  VAL A O   1 
ATOM   1935 C CB  . VAL A 1 254 ? -26.316 -25.711 28.687  1.00 46.70  ? 255  VAL A CB  1 
ATOM   1936 C CG1 . VAL A 1 254 ? -25.611 -27.038 28.516  1.00 44.88  ? 255  VAL A CG1 1 
ATOM   1937 C CG2 . VAL A 1 254 ? -25.353 -24.571 28.453  1.00 40.84  ? 255  VAL A CG2 1 
ATOM   1938 N N   . GLY A 1 255 ? -28.721 -23.738 26.769  1.00 46.93  ? 256  GLY A N   1 
ATOM   1939 C CA  . GLY A 1 255 ? -29.589 -22.573 26.735  1.00 46.75  ? 256  GLY A CA  1 
ATOM   1940 C C   . GLY A 1 255 ? -28.891 -21.239 26.870  1.00 52.07  ? 256  GLY A C   1 
ATOM   1941 O O   . GLY A 1 255 ? -29.448 -20.301 27.427  1.00 54.09  ? 256  GLY A O   1 
ATOM   1942 N N   . CYS A 1 256 ? -27.667 -21.152 26.363  1.00 55.22  ? 257  CYS A N   1 
ATOM   1943 C CA  . CYS A 1 256 ? -26.917 -19.901 26.364  1.00 58.16  ? 257  CYS A CA  1 
ATOM   1944 C C   . CYS A 1 256 ? -26.750 -19.420 24.943  1.00 58.79  ? 257  CYS A C   1 
ATOM   1945 O O   . CYS A 1 256 ? -26.630 -20.238 24.044  1.00 60.66  ? 257  CYS A O   1 
ATOM   1946 C CB  . CYS A 1 256 ? -25.550 -20.088 27.023  1.00 59.70  ? 257  CYS A CB  1 
ATOM   1947 S SG  . CYS A 1 256 ? -25.682 -20.569 28.732  1.00 63.35  ? 257  CYS A SG  1 
ATOM   1948 N N   . PRO A 1 257 ? -26.728 -18.091 24.741  1.00 67.97  ? 258  PRO A N   1 
ATOM   1949 C CA  . PRO A 1 257 ? -26.659 -17.460 23.411  1.00 71.57  ? 258  PRO A CA  1 
ATOM   1950 C C   . PRO A 1 257 ? -25.437 -17.881 22.567  1.00 74.68  ? 258  PRO A C   1 
ATOM   1951 O O   . PRO A 1 257 ? -25.370 -17.597 21.353  1.00 82.58  ? 258  PRO A O   1 
ATOM   1952 C CB  . PRO A 1 257 ? -26.593 -15.961 23.750  1.00 72.94  ? 258  PRO A CB  1 
ATOM   1953 C CG  . PRO A 1 257 ? -27.231 -15.852 25.121  1.00 68.90  ? 258  PRO A CG  1 
ATOM   1954 C CD  . PRO A 1 257 ? -26.770 -17.087 25.823  1.00 64.53  ? 258  PRO A CD  1 
ATOM   1955 N N   . ASN A 1 264 ? -20.776 -13.122 20.642  1.00 72.71  ? 265  ASN A N   1 
ATOM   1956 C CA  . ASN A 1 264 ? -19.864 -12.448 21.567  1.00 75.44  ? 265  ASN A CA  1 
ATOM   1957 C C   . ASN A 1 264 ? -19.419 -13.356 22.726  1.00 70.13  ? 265  ASN A C   1 
ATOM   1958 O O   . ASN A 1 264 ? -20.230 -13.776 23.550  1.00 69.43  ? 265  ASN A O   1 
ATOM   1959 C CB  . ASN A 1 264 ? -20.519 -11.172 22.106  1.00 77.49  ? 265  ASN A CB  1 
ATOM   1960 C CG  . ASN A 1 264 ? -19.679 -10.482 23.169  1.00 76.23  ? 265  ASN A CG  1 
ATOM   1961 O OD1 . ASN A 1 264 ? -19.746 -10.834 24.346  1.00 74.07  ? 265  ASN A OD1 1 
ATOM   1962 N ND2 . ASN A 1 264 ? -18.892 -9.489  22.761  1.00 80.47  ? 265  ASN A ND2 1 
ATOM   1963 N N   . ASP A 1 265 ? -18.122 -13.644 22.783  1.00 70.25  ? 266  ASP A N   1 
ATOM   1964 C CA  . ASP A 1 265 ? -17.569 -14.590 23.749  1.00 61.51  ? 266  ASP A CA  1 
ATOM   1965 C C   . ASP A 1 265 ? -17.823 -14.197 25.216  1.00 65.93  ? 266  ASP A C   1 
ATOM   1966 O O   . ASP A 1 265 ? -18.130 -15.057 26.053  1.00 57.27  ? 266  ASP A O   1 
ATOM   1967 C CB  . ASP A 1 265 ? -16.064 -14.761 23.512  1.00 57.53  ? 266  ASP A CB  1 
ATOM   1968 C CG  . ASP A 1 265 ? -15.740 -15.367 22.140  1.00 63.18  ? 266  ASP A CG  1 
ATOM   1969 O OD1 . ASP A 1 265 ? -16.644 -15.953 21.500  1.00 63.18  ? 266  ASP A OD1 1 
ATOM   1970 O OD2 . ASP A 1 265 ? -14.569 -15.265 21.704  1.00 57.64  ? 266  ASP A OD2 1 
ATOM   1971 N N   . THR A 1 266 ? -17.706 -12.910 25.524  1.00 63.54  ? 267  THR A N   1 
ATOM   1972 C CA  . THR A 1 266 ? -17.920 -12.429 26.889  1.00 61.74  ? 267  THR A CA  1 
ATOM   1973 C C   . THR A 1 266 ? -19.312 -12.783 27.426  1.00 66.41  ? 267  THR A C   1 
ATOM   1974 O O   . THR A 1 266 ? -19.446 -13.272 28.556  1.00 64.39  ? 267  THR A O   1 
ATOM   1975 C CB  . THR A 1 266 ? -17.707 -10.904 26.968  1.00 66.14  ? 267  THR A CB  1 
ATOM   1976 O OG1 . THR A 1 266 ? -16.354 -10.604 26.606  1.00 71.23  ? 267  THR A OG1 1 
ATOM   1977 C CG2 . THR A 1 266 ? -17.971 -10.377 28.374  1.00 65.47  ? 267  THR A CG2 1 
ATOM   1978 N N   . GLU A 1 267 ? -20.341 -12.550 26.613  1.00 67.75  ? 268  GLU A N   1 
ATOM   1979 C CA  . GLU A 1 267 ? -21.709 -12.903 26.983  1.00 64.29  ? 268  GLU A CA  1 
ATOM   1980 C C   . GLU A 1 267 ? -21.846 -14.428 27.090  1.00 61.97  ? 268  GLU A C   1 
ATOM   1981 O O   . GLU A 1 267 ? -22.506 -14.952 27.996  1.00 54.78  ? 268  GLU A O   1 
ATOM   1982 C CB  . GLU A 1 267 ? -22.714 -12.338 25.963  1.00 70.41  ? 268  GLU A CB  1 
ATOM   1983 C CG  . GLU A 1 267 ? -22.791 -10.789 25.904  1.00 84.85  ? 268  GLU A CG  1 
ATOM   1984 C CD  . GLU A 1 267 ? -23.290 -10.231 24.538  1.00 98.34  ? 268  GLU A CD  1 
ATOM   1985 O OE1 . GLU A 1 267 ? -23.514 -8.992  24.433  1.00 94.13  ? 268  GLU A OE1 1 
ATOM   1986 O OE2 . GLU A 1 267 ? -23.445 -11.020 23.567  1.00 91.24  ? 268  GLU A OE2 1 
ATOM   1987 N N   . LEU A 1 268 ? -21.206 -15.133 26.161  1.00 59.14  ? 269  LEU A N   1 
ATOM   1988 C CA  . LEU A 1 268 ? -21.340 -16.582 26.073  1.00 59.21  ? 269  LEU A CA  1 
ATOM   1989 C C   . LEU A 1 268 ? -20.774 -17.282 27.323  1.00 55.37  ? 269  LEU A C   1 
ATOM   1990 O O   . LEU A 1 268 ? -21.433 -18.128 27.911  1.00 54.39  ? 269  LEU A O   1 
ATOM   1991 C CB  . LEU A 1 268 ? -20.659 -17.087 24.792  1.00 59.26  ? 269  LEU A CB  1 
ATOM   1992 C CG  . LEU A 1 268 ? -20.942 -18.515 24.322  1.00 55.54  ? 269  LEU A CG  1 
ATOM   1993 C CD1 . LEU A 1 268 ? -20.826 -18.626 22.822  1.00 61.57  ? 269  LEU A CD1 1 
ATOM   1994 C CD2 . LEU A 1 268 ? -19.971 -19.468 24.969  1.00 59.52  ? 269  LEU A CD2 1 
ATOM   1995 N N   . VAL A 1 269 ? -19.567 -16.904 27.734  1.00 54.92  ? 270  VAL A N   1 
ATOM   1996 C CA  . VAL A 1 269 ? -18.918 -17.504 28.897  1.00 55.26  ? 270  VAL A CA  1 
ATOM   1997 C C   . VAL A 1 269 ? -19.638 -17.111 30.188  1.00 56.33  ? 270  VAL A C   1 
ATOM   1998 O O   . VAL A 1 269 ? -19.774 -17.915 31.116  1.00 49.78  ? 270  VAL A O   1 
ATOM   1999 C CB  . VAL A 1 269 ? -17.422 -17.096 28.983  1.00 56.43  ? 270  VAL A CB  1 
ATOM   2000 C CG1 . VAL A 1 269 ? -16.784 -17.603 30.261  1.00 52.74  ? 270  VAL A CG1 1 
ATOM   2001 C CG2 . VAL A 1 269 ? -16.664 -17.635 27.795  1.00 56.05  ? 270  VAL A CG2 1 
ATOM   2002 N N   . ALA A 1 270 ? -20.105 -15.872 30.245  1.00 56.00  ? 271  ALA A N   1 
ATOM   2003 C CA  . ALA A 1 270 ? -20.878 -15.438 31.396  1.00 55.63  ? 271  ALA A CA  1 
ATOM   2004 C C   . ALA A 1 270 ? -22.115 -16.329 31.622  1.00 50.08  ? 271  ALA A C   1 
ATOM   2005 O O   . ALA A 1 270 ? -22.349 -16.796 32.735  1.00 54.62  ? 271  ALA A O   1 
ATOM   2006 C CB  . ALA A 1 270 ? -21.281 -13.979 31.241  1.00 54.92  ? 271  ALA A CB  1 
ATOM   2007 N N   . CYS A 1 271 ? -22.899 -16.577 30.580  1.00 50.85  ? 272  CYS A N   1 
ATOM   2008 C CA  . CYS A 1 271 ? -24.067 -17.437 30.740  1.00 53.14  ? 272  CYS A CA  1 
ATOM   2009 C C   . CYS A 1 271 ? -23.665 -18.879 31.103  1.00 54.23  ? 272  CYS A C   1 
ATOM   2010 O O   . CYS A 1 271 ? -24.334 -19.527 31.909  1.00 52.03  ? 272  CYS A O   1 
ATOM   2011 C CB  . CYS A 1 271 ? -24.932 -17.425 29.472  1.00 59.14  ? 272  CYS A CB  1 
ATOM   2012 S SG  . CYS A 1 271 ? -26.233 -18.708 29.447  1.00 67.77  ? 272  CYS A SG  1 
ATOM   2013 N N   . LEU A 1 272 ? -22.577 -19.376 30.514  1.00 55.41  ? 273  LEU A N   1 
ATOM   2014 C CA  . LEU A 1 272 ? -22.041 -20.688 30.880  1.00 50.06  ? 273  LEU A CA  1 
ATOM   2015 C C   . LEU A 1 272 ? -21.688 -20.733 32.372  1.00 51.98  ? 273  LEU A C   1 
ATOM   2016 O O   . LEU A 1 272 ? -21.919 -21.743 33.056  1.00 49.22  ? 273  LEU A O   1 
ATOM   2017 C CB  . LEU A 1 272 ? -20.811 -21.027 30.023  1.00 53.08  ? 273  LEU A CB  1 
ATOM   2018 C CG  . LEU A 1 272 ? -20.974 -21.561 28.581  1.00 50.60  ? 273  LEU A CG  1 
ATOM   2019 C CD1 . LEU A 1 272 ? -19.628 -21.856 27.952  1.00 47.03  ? 273  LEU A CD1 1 
ATOM   2020 C CD2 . LEU A 1 272 ? -21.819 -22.824 28.515  1.00 48.30  ? 273  LEU A CD2 1 
ATOM   2021 N N   . ARG A 1 273 ? -21.164 -19.623 32.887  1.00 47.71  ? 274  ARG A N   1 
ATOM   2022 C CA  . ARG A 1 273 ? -20.774 -19.565 34.285  1.00 47.77  ? 274  ARG A CA  1 
ATOM   2023 C C   . ARG A 1 273 ? -21.978 -19.568 35.227  1.00 49.91  ? 274  ARG A C   1 
ATOM   2024 O O   . ARG A 1 273 ? -21.820 -19.853 36.401  1.00 42.49  ? 274  ARG A O   1 
ATOM   2025 C CB  . ARG A 1 273 ? -19.881 -18.340 34.562  1.00 50.14  ? 274  ARG A CB  1 
ATOM   2026 C CG  . ARG A 1 273 ? -18.413 -18.584 34.178  1.00 49.83  ? 274  ARG A CG  1 
ATOM   2027 C CD  . ARG A 1 273 ? -17.445 -17.620 34.817  1.00 45.86  ? 274  ARG A CD  1 
ATOM   2028 N NE  . ARG A 1 273 ? -17.155 -16.479 33.963  1.00 59.58  ? 274  ARG A NE  1 
ATOM   2029 C CZ  . ARG A 1 273 ? -16.001 -16.273 33.327  1.00 63.24  ? 274  ARG A CZ  1 
ATOM   2030 N NH1 . ARG A 1 273 ? -14.989 -17.132 33.428  1.00 56.57  ? 274  ARG A NH1 1 
ATOM   2031 N NH2 . ARG A 1 273 ? -15.857 -15.189 32.577  1.00 70.67  ? 274  ARG A NH2 1 
ATOM   2032 N N   . THR A 1 274 ? -23.178 -19.296 34.720  1.00 46.97  ? 275  THR A N   1 
ATOM   2033 C CA  . THR A 1 274 ? -24.356 -19.325 35.582  1.00 45.11  ? 275  THR A CA  1 
ATOM   2034 C C   . THR A 1 274 ? -24.936 -20.727 35.687  1.00 52.22  ? 275  THR A C   1 
ATOM   2035 O O   . THR A 1 274 ? -25.828 -20.959 36.487  1.00 53.80  ? 275  THR A O   1 
ATOM   2036 C CB  . THR A 1 274 ? -25.477 -18.388 35.088  1.00 51.21  ? 275  THR A CB  1 
ATOM   2037 O OG1 . THR A 1 274 ? -26.011 -18.883 33.852  1.00 56.58  ? 275  THR A OG1 1 
ATOM   2038 C CG2 . THR A 1 274 ? -24.964 -16.969 34.894  1.00 53.00  ? 275  THR A CG2 1 
ATOM   2039 N N   . ARG A 1 275 ? -24.435 -21.665 34.883  1.00 48.25  ? 276  ARG A N   1 
ATOM   2040 C CA  . ARG A 1 275 ? -25.002 -23.013 34.875  1.00 48.16  ? 276  ARG A CA  1 
ATOM   2041 C C   . ARG A 1 275 ? -24.358 -23.955 35.910  1.00 49.66  ? 276  ARG A C   1 
ATOM   2042 O O   . ARG A 1 275 ? -23.137 -23.928 36.125  1.00 47.42  ? 276  ARG A O   1 
ATOM   2043 C CB  . ARG A 1 275 ? -24.875 -23.626 33.477  1.00 49.62  ? 276  ARG A CB  1 
ATOM   2044 C CG  . ARG A 1 275 ? -25.593 -22.856 32.372  1.00 51.54  ? 276  ARG A CG  1 
ATOM   2045 C CD  . ARG A 1 275 ? -27.028 -23.300 32.294  1.00 49.74  ? 276  ARG A CD  1 
ATOM   2046 N NE  . ARG A 1 275 ? -27.814 -22.630 31.261  1.00 49.50  ? 276  ARG A NE  1 
ATOM   2047 C CZ  . ARG A 1 275 ? -28.406 -21.448 31.417  1.00 53.01  ? 276  ARG A CZ  1 
ATOM   2048 N NH1 . ARG A 1 275 ? -28.283 -20.779 32.560  1.00 48.66  ? 276  ARG A NH1 1 
ATOM   2049 N NH2 . ARG A 1 275 ? -29.123 -20.935 30.422  1.00 46.74  ? 276  ARG A NH2 1 
ATOM   2050 N N   . PRO A 1 276 ? -25.177 -24.803 36.553  1.00 47.94  ? 277  PRO A N   1 
ATOM   2051 C CA  . PRO A 1 276 ? -24.597 -25.807 37.452  1.00 47.12  ? 277  PRO A CA  1 
ATOM   2052 C C   . PRO A 1 276 ? -23.612 -26.697 36.702  1.00 48.82  ? 277  PRO A C   1 
ATOM   2053 O O   . PRO A 1 276 ? -23.825 -27.005 35.526  1.00 46.23  ? 277  PRO A O   1 
ATOM   2054 C CB  . PRO A 1 276 ? -25.810 -26.608 37.924  1.00 45.55  ? 277  PRO A CB  1 
ATOM   2055 C CG  . PRO A 1 276 ? -26.968 -25.657 37.775  1.00 49.84  ? 277  PRO A CG  1 
ATOM   2056 C CD  . PRO A 1 276 ? -26.651 -24.848 36.542  1.00 48.03  ? 277  PRO A CD  1 
ATOM   2057 N N   . ALA A 1 277 ? -22.547 -27.092 37.390  1.00 48.36  ? 278  ALA A N   1 
ATOM   2058 C CA  . ALA A 1 277 ? -21.508 -27.925 36.810  1.00 47.12  ? 278  ALA A CA  1 
ATOM   2059 C C   . ALA A 1 277 ? -22.081 -29.185 36.183  1.00 42.75  ? 278  ALA A C   1 
ATOM   2060 O O   . ALA A 1 277 ? -21.618 -29.623 35.132  1.00 43.70  ? 278  ALA A O   1 
ATOM   2061 C CB  . ALA A 1 277 ? -20.468 -28.294 37.881  1.00 40.82  ? 278  ALA A CB  1 
ATOM   2062 N N   . GLN A 1 278 ? -23.081 -29.769 36.841  1.00 48.50  ? 279  GLN A N   1 
ATOM   2063 C CA  . GLN A 1 278 ? -23.622 -31.057 36.425  1.00 43.34  ? 279  GLN A CA  1 
ATOM   2064 C C   . GLN A 1 278 ? -24.316 -30.934 35.061  1.00 47.36  ? 279  GLN A C   1 
ATOM   2065 O O   . GLN A 1 278 ? -24.293 -31.881 34.274  1.00 44.62  ? 279  GLN A O   1 
ATOM   2066 C CB  . GLN A 1 278 ? -24.580 -31.606 37.490  1.00 40.53  ? 279  GLN A CB  1 
ATOM   2067 C CG  . GLN A 1 278 ? -25.021 -33.041 37.263  1.00 41.34  ? 279  GLN A CG  1 
ATOM   2068 C CD  . GLN A 1 278 ? -23.845 -34.006 37.096  1.00 55.21  ? 279  GLN A CD  1 
ATOM   2069 O OE1 . GLN A 1 278 ? -23.015 -34.151 38.000  1.00 55.60  ? 279  GLN A OE1 1 
ATOM   2070 N NE2 . GLN A 1 278 ? -23.772 -34.669 35.933  1.00 51.31  ? 279  GLN A NE2 1 
ATOM   2071 N N   . VAL A 1 279 ? -24.900 -29.768 34.783  1.00 44.42  ? 280  VAL A N   1 
ATOM   2072 C CA  . VAL A 1 279 ? -25.564 -29.507 33.500  1.00 40.29  ? 280  VAL A CA  1 
ATOM   2073 C C   . VAL A 1 279 ? -24.584 -29.503 32.315  1.00 48.69  ? 280  VAL A C   1 
ATOM   2074 O O   . VAL A 1 279 ? -24.888 -30.016 31.227  1.00 43.86  ? 280  VAL A O   1 
ATOM   2075 C CB  . VAL A 1 279 ? -26.308 -28.138 33.516  1.00 47.39  ? 280  VAL A CB  1 
ATOM   2076 C CG1 . VAL A 1 279 ? -26.939 -27.848 32.155  1.00 43.72  ? 280  VAL A CG1 1 
ATOM   2077 C CG2 . VAL A 1 279 ? -27.358 -28.094 34.602  1.00 37.59  ? 280  VAL A CG2 1 
ATOM   2078 N N   . LEU A 1 280 ? -23.416 -28.907 32.518  1.00 48.43  ? 281  LEU A N   1 
ATOM   2079 C CA  . LEU A 1 280 ? -22.374 -28.924 31.497  1.00 42.38  ? 281  LEU A CA  1 
ATOM   2080 C C   . LEU A 1 280 ? -21.917 -30.358 31.258  1.00 45.87  ? 281  LEU A C   1 
ATOM   2081 O O   . LEU A 1 280 ? -21.800 -30.805 30.116  1.00 50.58  ? 281  LEU A O   1 
ATOM   2082 C CB  . LEU A 1 280 ? -21.191 -28.053 31.914  1.00 43.04  ? 281  LEU A CB  1 
ATOM   2083 C CG  . LEU A 1 280 ? -21.490 -26.567 32.088  1.00 45.00  ? 281  LEU A CG  1 
ATOM   2084 C CD1 . LEU A 1 280 ? -20.189 -25.785 32.118  1.00 43.12  ? 281  LEU A CD1 1 
ATOM   2085 C CD2 . LEU A 1 280 ? -22.403 -26.090 30.953  1.00 37.75  ? 281  LEU A CD2 1 
ATOM   2086 N N   . VAL A 1 281 ? -21.670 -31.083 32.338  1.00 42.42  ? 282  VAL A N   1 
ATOM   2087 C CA  . VAL A 1 281 ? -21.319 -32.489 32.215  1.00 46.44  ? 282  VAL A CA  1 
ATOM   2088 C C   . VAL A 1 281 ? -22.395 -33.279 31.448  1.00 49.42  ? 282  VAL A C   1 
ATOM   2089 O O   . VAL A 1 281 ? -22.070 -34.098 30.598  1.00 48.85  ? 282  VAL A O   1 
ATOM   2090 C CB  . VAL A 1 281 ? -21.100 -33.134 33.594  1.00 42.61  ? 282  VAL A CB  1 
ATOM   2091 C CG1 . VAL A 1 281 ? -20.908 -34.640 33.457  1.00 42.13  ? 282  VAL A CG1 1 
ATOM   2092 C CG2 . VAL A 1 281 ? -19.899 -32.508 34.279  1.00 38.62  ? 282  VAL A CG2 1 
ATOM   2093 N N   . ASN A 1 282 ? -23.669 -33.026 31.735  1.00 41.68  ? 283  ASN A N   1 
ATOM   2094 C CA  . ASN A 1 282 ? -24.735 -33.830 31.158  1.00 46.90  ? 283  ASN A CA  1 
ATOM   2095 C C   . ASN A 1 282 ? -24.768 -33.772 29.636  1.00 46.50  ? 283  ASN A C   1 
ATOM   2096 O O   . ASN A 1 282 ? -25.245 -34.697 28.993  1.00 48.83  ? 283  ASN A O   1 
ATOM   2097 C CB  . ASN A 1 282 ? -26.094 -33.387 31.694  1.00 54.31  ? 283  ASN A CB  1 
ATOM   2098 C CG  . ASN A 1 282 ? -26.340 -33.842 33.119  1.00 55.32  ? 283  ASN A CG  1 
ATOM   2099 O OD1 . ASN A 1 282 ? -25.574 -34.635 33.681  1.00 55.99  ? 283  ASN A OD1 1 
ATOM   2100 N ND2 . ASN A 1 282 ? -27.422 -33.344 33.712  1.00 51.90  ? 283  ASN A ND2 1 
ATOM   2101 N N   . HIS A 1 283 ? -24.250 -32.678 29.084  1.00 47.03  ? 284  HIS A N   1 
ATOM   2102 C CA  . HIS A 1 283 ? -24.356 -32.362 27.663  1.00 53.68  ? 284  HIS A CA  1 
ATOM   2103 C C   . HIS A 1 283 ? -23.046 -32.443 26.878  1.00 55.34  ? 284  HIS A C   1 
ATOM   2104 O O   . HIS A 1 283 ? -23.056 -32.294 25.659  1.00 52.32  ? 284  HIS A O   1 
ATOM   2105 C CB  . HIS A 1 283 ? -24.936 -30.951 27.496  1.00 51.18  ? 284  HIS A CB  1 
ATOM   2106 C CG  . HIS A 1 283 ? -26.378 -30.863 27.856  1.00 56.86  ? 284  HIS A CG  1 
ATOM   2107 N ND1 . HIS A 1 283 ? -27.364 -31.472 27.112  1.00 63.47  ? 284  HIS A ND1 1 
ATOM   2108 C CD2 . HIS A 1 283 ? -27.001 -30.274 28.901  1.00 54.42  ? 284  HIS A CD2 1 
ATOM   2109 C CE1 . HIS A 1 283 ? -28.536 -31.245 27.674  1.00 59.51  ? 284  HIS A CE1 1 
ATOM   2110 N NE2 . HIS A 1 283 ? -28.343 -30.520 28.761  1.00 62.07  ? 284  HIS A NE2 1 
ATOM   2111 N N   . GLU A 1 284 ? -21.933 -32.672 27.568  1.00 54.31  ? 285  GLU A N   1 
ATOM   2112 C CA  . GLU A 1 284 ? -20.619 -32.494 26.962  1.00 52.73  ? 285  GLU A CA  1 
ATOM   2113 C C   . GLU A 1 284 ? -20.380 -33.451 25.787  1.00 54.38  ? 285  GLU A C   1 
ATOM   2114 O O   . GLU A 1 284 ? -19.693 -33.103 24.825  1.00 56.28  ? 285  GLU A O   1 
ATOM   2115 C CB  . GLU A 1 284 ? -19.516 -32.655 28.022  1.00 55.31  ? 285  GLU A CB  1 
ATOM   2116 C CG  . GLU A 1 284 ? -18.780 -33.984 27.963  1.00 58.45  ? 285  GLU A CG  1 
ATOM   2117 C CD  . GLU A 1 284 ? -17.705 -34.135 29.028  1.00 64.47  ? 285  GLU A CD  1 
ATOM   2118 O OE1 . GLU A 1 284 ? -16.771 -33.290 29.075  1.00 61.64  ? 285  GLU A OE1 1 
ATOM   2119 O OE2 . GLU A 1 284 ? -17.795 -35.112 29.811  1.00 58.12  ? 285  GLU A OE2 1 
ATOM   2120 N N   . TRP A 1 285 ? -20.969 -34.633 25.832  1.00 54.18  ? 286  TRP A N   1 
ATOM   2121 C CA  . TRP A 1 285 ? -20.670 -35.599 24.799  1.00 60.59  ? 286  TRP A CA  1 
ATOM   2122 C C   . TRP A 1 285 ? -21.456 -35.332 23.527  1.00 62.84  ? 286  TRP A C   1 
ATOM   2123 O O   . TRP A 1 285 ? -21.051 -35.757 22.442  1.00 63.22  ? 286  TRP A O   1 
ATOM   2124 C CB  . TRP A 1 285 ? -20.922 -37.015 25.297  1.00 63.65  ? 286  TRP A CB  1 
ATOM   2125 C CG  . TRP A 1 285 ? -19.728 -37.916 25.063  1.00 72.76  ? 286  TRP A CG  1 
ATOM   2126 C CD1 . TRP A 1 285 ? -19.714 -39.099 24.360  1.00 73.33  ? 286  TRP A CD1 1 
ATOM   2127 C CD2 . TRP A 1 285 ? -18.367 -37.693 25.499  1.00 74.44  ? 286  TRP A CD2 1 
ATOM   2128 N NE1 . TRP A 1 285 ? -18.444 -39.627 24.349  1.00 78.46  ? 286  TRP A NE1 1 
ATOM   2129 C CE2 . TRP A 1 285 ? -17.598 -38.793 25.040  1.00 74.93  ? 286  TRP A CE2 1 
ATOM   2130 C CE3 . TRP A 1 285 ? -17.725 -36.674 26.237  1.00 69.99  ? 286  TRP A CE3 1 
ATOM   2131 C CZ2 . TRP A 1 285 ? -16.220 -38.911 25.299  1.00 64.79  ? 286  TRP A CZ2 1 
ATOM   2132 C CZ3 . TRP A 1 285 ? -16.350 -36.796 26.508  1.00 56.55  ? 286  TRP A CZ3 1 
ATOM   2133 C CH2 . TRP A 1 285 ? -15.618 -37.908 26.032  1.00 63.00  ? 286  TRP A CH2 1 
ATOM   2134 N N   . HIS A 1 286 ? -22.548 -34.585 23.647  1.00 57.36  ? 287  HIS A N   1 
ATOM   2135 C CA  . HIS A 1 286 ? -23.378 -34.299 22.485  1.00 63.42  ? 287  HIS A CA  1 
ATOM   2136 C C   . HIS A 1 286 ? -22.819 -33.181 21.604  1.00 59.67  ? 287  HIS A C   1 
ATOM   2137 O O   . HIS A 1 286 ? -23.548 -32.630 20.785  1.00 60.92  ? 287  HIS A O   1 
ATOM   2138 C CB  . HIS A 1 286 ? -24.800 -33.952 22.932  1.00 65.42  ? 287  HIS A CB  1 
ATOM   2139 C CG  . HIS A 1 286 ? -25.478 -35.062 23.674  1.00 78.90  ? 287  HIS A CG  1 
ATOM   2140 N ND1 . HIS A 1 286 ? -25.845 -34.960 25.001  1.00 73.42  ? 287  HIS A ND1 1 
ATOM   2141 C CD2 . HIS A 1 286 ? -25.828 -36.312 23.281  1.00 78.55  ? 287  HIS A CD2 1 
ATOM   2142 C CE1 . HIS A 1 286 ? -26.398 -36.095 25.391  1.00 78.48  ? 287  HIS A CE1 1 
ATOM   2143 N NE2 . HIS A 1 286 ? -26.403 -36.931 24.365  1.00 85.29  ? 287  HIS A NE2 1 
ATOM   2144 N N   . VAL A 1 287 ? -21.536 -32.853 21.763  1.00 56.06  ? 288  VAL A N   1 
ATOM   2145 C CA  . VAL A 1 287 ? -20.906 -31.809 20.948  1.00 52.87  ? 288  VAL A CA  1 
ATOM   2146 C C   . VAL A 1 287 ? -19.897 -32.399 19.953  1.00 57.66  ? 288  VAL A C   1 
ATOM   2147 O O   . VAL A 1 287 ? -19.374 -31.699 19.083  1.00 54.62  ? 288  VAL A O   1 
ATOM   2148 C CB  . VAL A 1 287 ? -20.207 -30.744 21.824  1.00 51.74  ? 288  VAL A CB  1 
ATOM   2149 C CG1 . VAL A 1 287 ? -21.015 -30.504 23.120  1.00 56.76  ? 288  VAL A CG1 1 
ATOM   2150 C CG2 . VAL A 1 287 ? -18.794 -31.153 22.158  1.00 46.79  ? 288  VAL A CG2 1 
ATOM   2151 N N   . LEU A 1 288 ? -19.638 -33.695 20.075  1.00 59.32  ? 289  LEU A N   1 
ATOM   2152 C CA  . LEU A 1 288 ? -18.775 -34.378 19.124  1.00 59.93  ? 289  LEU A CA  1 
ATOM   2153 C C   . LEU A 1 288 ? -19.486 -34.508 17.771  1.00 65.10  ? 289  LEU A C   1 
ATOM   2154 O O   . LEU A 1 288 ? -20.679 -34.828 17.722  1.00 60.66  ? 289  LEU A O   1 
ATOM   2155 C CB  . LEU A 1 288 ? -18.358 -35.757 19.654  1.00 57.78  ? 289  LEU A CB  1 
ATOM   2156 C CG  . LEU A 1 288 ? -17.294 -35.789 20.766  1.00 55.04  ? 289  LEU A CG  1 
ATOM   2157 C CD1 . LEU A 1 288 ? -16.902 -37.222 21.144  1.00 54.28  ? 289  LEU A CD1 1 
ATOM   2158 C CD2 . LEU A 1 288 ? -16.062 -34.963 20.382  1.00 48.65  ? 289  LEU A CD2 1 
ATOM   2159 N N   . PRO A 1 289 ? -18.741 -34.255 16.674  1.00 69.31  ? 290  PRO A N   1 
ATOM   2160 C CA  . PRO A 1 289 ? -19.195 -34.260 15.270  1.00 72.29  ? 290  PRO A CA  1 
ATOM   2161 C C   . PRO A 1 289 ? -19.795 -35.585 14.777  1.00 71.13  ? 290  PRO A C   1 
ATOM   2162 O O   . PRO A 1 289 ? -20.710 -35.542 13.955  1.00 75.34  ? 290  PRO A O   1 
ATOM   2163 C CB  . PRO A 1 289 ? -17.915 -33.929 14.488  1.00 66.50  ? 290  PRO A CB  1 
ATOM   2164 C CG  . PRO A 1 289 ? -16.773 -34.253 15.438  1.00 63.41  ? 290  PRO A CG  1 
ATOM   2165 C CD  . PRO A 1 289 ? -17.313 -33.896 16.781  1.00 67.29  ? 290  PRO A CD  1 
ATOM   2166 N N   . GLN A 1 290 ? -19.307 -36.731 15.244  1.00 68.42  ? 291  GLN A N   1 
ATOM   2167 C CA  . GLN A 1 290 ? -19.943 -37.998 14.869  1.00 73.16  ? 291  GLN A CA  1 
ATOM   2168 C C   . GLN A 1 290 ? -19.911 -39.034 15.996  1.00 71.11  ? 291  GLN A C   1 
ATOM   2169 O O   . GLN A 1 290 ? -19.269 -38.835 17.031  1.00 71.00  ? 291  GLN A O   1 
ATOM   2170 C CB  . GLN A 1 290 ? -19.294 -38.587 13.606  1.00 74.62  ? 291  GLN A CB  1 
ATOM   2171 C CG  . GLN A 1 290 ? -18.003 -39.388 13.848  1.00 77.60  ? 291  GLN A CG  1 
ATOM   2172 C CD  . GLN A 1 290 ? -17.697 -40.401 12.730  1.00 81.43  ? 291  GLN A CD  1 
ATOM   2173 O OE1 . GLN A 1 290 ? -17.342 -40.025 11.598  1.00 79.75  ? 291  GLN A OE1 1 
ATOM   2174 N NE2 . GLN A 1 290 ? -17.833 -41.692 13.050  1.00 67.19  ? 291  GLN A NE2 1 
ATOM   2175 N N   . GLU A 1 291 ? -20.632 -40.131 15.792  1.00 71.93  ? 292  GLU A N   1 
ATOM   2176 C CA  . GLU A 1 291 ? -20.599 -41.249 16.718  1.00 73.88  ? 292  GLU A CA  1 
ATOM   2177 C C   . GLU A 1 291 ? -19.188 -41.824 16.736  1.00 73.32  ? 292  GLU A C   1 
ATOM   2178 O O   . GLU A 1 291 ? -18.578 -42.007 15.685  1.00 70.27  ? 292  GLU A O   1 
ATOM   2179 C CB  . GLU A 1 291 ? -21.616 -42.319 16.313  1.00 78.51  ? 292  GLU A CB  1 
ATOM   2180 C CG  . GLU A 1 291 ? -21.480 -42.788 14.860  1.00 80.22  ? 292  GLU A CG  1 
ATOM   2181 C CD  . GLU A 1 291 ? -22.465 -43.897 14.489  1.00 92.35  ? 292  GLU A CD  1 
ATOM   2182 O OE1 . GLU A 1 291 ? -23.596 -43.571 14.059  1.00 101.38 ? 292  GLU A OE1 1 
ATOM   2183 O OE2 . GLU A 1 291 ? -22.108 -45.092 14.623  1.00 85.16  ? 292  GLU A OE2 1 
ATOM   2184 N N   . SER A 1 292 ? -18.655 -42.092 17.924  1.00 69.64  ? 293  SER A N   1 
ATOM   2185 C CA  . SER A 1 292 ? -17.317 -42.662 17.999  1.00 66.16  ? 293  SER A CA  1 
ATOM   2186 C C   . SER A 1 292 ? -16.980 -43.342 19.311  1.00 62.45  ? 293  SER A C   1 
ATOM   2187 O O   . SER A 1 292 ? -17.698 -43.238 20.305  1.00 68.44  ? 293  SER A O   1 
ATOM   2188 C CB  . SER A 1 292 ? -16.268 -41.578 17.735  1.00 64.98  ? 293  SER A CB  1 
ATOM   2189 O OG  . SER A 1 292 ? -16.251 -40.635 18.781  1.00 68.45  ? 293  SER A OG  1 
ATOM   2190 N N   . VAL A 1 293 ? -15.875 -44.072 19.278  1.00 64.27  ? 294  VAL A N   1 
ATOM   2191 C CA  . VAL A 1 293 ? -15.133 -44.396 20.482  1.00 64.43  ? 294  VAL A CA  1 
ATOM   2192 C C   . VAL A 1 293 ? -13.820 -43.621 20.370  1.00 64.73  ? 294  VAL A C   1 
ATOM   2193 O O   . VAL A 1 293 ? -13.434 -43.194 19.276  1.00 60.08  ? 294  VAL A O   1 
ATOM   2194 C CB  . VAL A 1 293 ? -14.877 -45.908 20.626  1.00 58.62  ? 294  VAL A CB  1 
ATOM   2195 C CG1 . VAL A 1 293 ? -16.203 -46.680 20.622  1.00 59.15  ? 294  VAL A CG1 1 
ATOM   2196 C CG2 . VAL A 1 293 ? -13.967 -46.405 19.515  1.00 52.74  ? 294  VAL A CG2 1 
ATOM   2197 N N   A PHE A 1 294 ? -13.165 -43.393 21.499  0.65 64.05  ? 295  PHE A N   1 
ATOM   2198 N N   B PHE A 1 294 ? -13.150 -43.431 21.504  0.35 63.98  ? 295  PHE A N   1 
ATOM   2199 C CA  A PHE A 1 294 ? -11.829 -42.811 21.472  0.65 60.63  ? 295  PHE A CA  1 
ATOM   2200 C CA  B PHE A 1 294 ? -11.828 -42.794 21.558  0.35 60.52  ? 295  PHE A CA  1 
ATOM   2201 C C   A PHE A 1 294 ? -11.748 -41.340 21.050  0.65 59.61  ? 295  PHE A C   1 
ATOM   2202 C C   B PHE A 1 294 ? -11.771 -41.361 21.012  0.35 59.56  ? 295  PHE A C   1 
ATOM   2203 O O   A PHE A 1 294 ? -10.711 -40.900 20.541  0.65 58.97  ? 295  PHE A O   1 
ATOM   2204 O O   B PHE A 1 294 ? -10.782 -40.973 20.384  0.35 58.75  ? 295  PHE A O   1 
ATOM   2205 C CB  A PHE A 1 294 ? -10.939 -43.638 20.542  0.65 56.56  ? 295  PHE A CB  1 
ATOM   2206 C CB  B PHE A 1 294 ? -10.800 -43.651 20.810  0.35 56.48  ? 295  PHE A CB  1 
ATOM   2207 C CG  A PHE A 1 294 ? -9.751  -44.161 21.213  0.65 54.10  ? 295  PHE A CG  1 
ATOM   2208 C CG  B PHE A 1 294 ? -9.513  -43.828 21.560  0.35 53.54  ? 295  PHE A CG  1 
ATOM   2209 C CD1 A PHE A 1 294 ? -8.904  -43.297 21.859  0.65 52.74  ? 295  PHE A CD1 1 
ATOM   2210 C CD1 B PHE A 1 294 ? -8.832  -42.729 22.077  0.35 51.88  ? 295  PHE A CD1 1 
ATOM   2211 C CD2 A PHE A 1 294 ? -9.507  -45.516 21.270  0.65 53.10  ? 295  PHE A CD2 1 
ATOM   2212 C CD2 B PHE A 1 294 ? -8.997  -45.094 21.778  0.35 51.90  ? 295  PHE A CD2 1 
ATOM   2213 C CE1 A PHE A 1 294 ? -7.814  -43.768 22.500  0.65 52.82  ? 295  PHE A CE1 1 
ATOM   2214 C CE1 B PHE A 1 294 ? -7.646  -42.890 22.784  0.35 48.95  ? 295  PHE A CE1 1 
ATOM   2215 C CE2 A PHE A 1 294 ? -8.400  -46.000 21.924  0.65 52.01  ? 295  PHE A CE2 1 
ATOM   2216 C CE2 B PHE A 1 294 ? -7.813  -45.267 22.479  0.35 51.42  ? 295  PHE A CE2 1 
ATOM   2217 C CZ  A PHE A 1 294 ? -7.552  -45.128 22.559  0.65 51.89  ? 295  PHE A CZ  1 
ATOM   2218 C CZ  B PHE A 1 294 ? -7.137  -44.163 22.993  0.35 50.68  ? 295  PHE A CZ  1 
ATOM   2219 N N   . ARG A 1 295 ? -12.826 -40.586 21.247  1.00 60.61  ? 296  ARG A N   1 
ATOM   2220 C CA  . ARG A 1 295 ? -12.808 -39.141 20.961  1.00 57.84  ? 296  ARG A CA  1 
ATOM   2221 C C   . ARG A 1 295 ? -13.496 -38.401 22.097  1.00 61.07  ? 296  ARG A C   1 
ATOM   2222 O O   . ARG A 1 295 ? -14.489 -38.874 22.659  1.00 59.37  ? 296  ARG A O   1 
ATOM   2223 C CB  . ARG A 1 295 ? -13.478 -38.798 19.631  1.00 53.01  ? 296  ARG A CB  1 
ATOM   2224 C CG  . ARG A 1 295 ? -12.634 -39.126 18.419  1.00 57.20  ? 296  ARG A CG  1 
ATOM   2225 C CD  . ARG A 1 295 ? -11.267 -38.423 18.416  1.00 54.80  ? 296  ARG A CD  1 
ATOM   2226 N NE  . ARG A 1 295 ? -10.558 -38.739 17.175  1.00 62.73  ? 296  ARG A NE  1 
ATOM   2227 C CZ  . ARG A 1 295 ? -9.825  -39.836 16.982  1.00 59.15  ? 296  ARG A CZ  1 
ATOM   2228 N NH1 . ARG A 1 295 ? -9.672  -40.722 17.968  1.00 47.36  ? 296  ARG A NH1 1 
ATOM   2229 N NH2 . ARG A 1 295 ? -9.243  -40.044 15.801  1.00 57.74  ? 296  ARG A NH2 1 
ATOM   2230 N N   . PHE A 1 296 ? -12.956 -37.240 22.437  1.00 58.67  ? 297  PHE A N   1 
ATOM   2231 C CA  . PHE A 1 296 ? -13.371 -36.558 23.643  1.00 48.71  ? 297  PHE A CA  1 
ATOM   2232 C C   . PHE A 1 296 ? -13.596 -35.088 23.370  1.00 47.31  ? 297  PHE A C   1 
ATOM   2233 O O   . PHE A 1 296 ? -12.758 -34.431 22.761  1.00 48.18  ? 297  PHE A O   1 
ATOM   2234 C CB  . PHE A 1 296 ? -12.314 -36.747 24.723  1.00 53.59  ? 297  PHE A CB  1 
ATOM   2235 C CG  . PHE A 1 296 ? -11.685 -38.103 24.713  1.00 51.10  ? 297  PHE A CG  1 
ATOM   2236 C CD1 . PHE A 1 296 ? -12.402 -39.213 25.125  1.00 51.93  ? 297  PHE A CD1 1 
ATOM   2237 C CD2 . PHE A 1 296 ? -10.382 -38.268 24.291  1.00 47.58  ? 297  PHE A CD2 1 
ATOM   2238 C CE1 . PHE A 1 296 ? -11.833 -40.466 25.111  1.00 50.88  ? 297  PHE A CE1 1 
ATOM   2239 C CE2 . PHE A 1 296 ? -9.802  -39.522 24.281  1.00 48.99  ? 297  PHE A CE2 1 
ATOM   2240 C CZ  . PHE A 1 296 ? -10.530 -40.619 24.685  1.00 51.25  ? 297  PHE A CZ  1 
ATOM   2241 N N   . SER A 1 297 ? -14.716 -34.568 23.855  1.00 48.32  ? 298  SER A N   1 
ATOM   2242 C CA  . SER A 1 297 ? -15.152 -33.218 23.510  1.00 41.18  ? 298  SER A CA  1 
ATOM   2243 C C   . SER A 1 297 ? -14.177 -32.083 23.821  1.00 40.08  ? 298  SER A C   1 
ATOM   2244 O O   . SER A 1 297 ? -13.884 -31.266 22.946  1.00 43.04  ? 298  SER A O   1 
ATOM   2245 C CB  . SER A 1 297 ? -16.488 -32.941 24.203  1.00 46.19  ? 298  SER A CB  1 
ATOM   2246 O OG  . SER A 1 297 ? -17.475 -33.869 23.769  1.00 54.67  ? 298  SER A OG  1 
ATOM   2247 N N   . PHE A 1 298 ? -13.696 -32.003 25.061  1.00 40.36  ? 299  PHE A N   1 
ATOM   2248 C CA  . PHE A 1 298 ? -12.843 -30.881 25.431  1.00 38.45  ? 299  PHE A CA  1 
ATOM   2249 C C   . PHE A 1 298 ? -11.419 -31.320 25.743  1.00 42.24  ? 299  PHE A C   1 
ATOM   2250 O O   . PHE A 1 298 ? -11.177 -32.027 26.710  1.00 31.63  ? 299  PHE A O   1 
ATOM   2251 C CB  . PHE A 1 298 ? -13.496 -30.118 26.569  1.00 31.91  ? 299  PHE A CB  1 
ATOM   2252 C CG  . PHE A 1 298 ? -14.840 -29.590 26.179  1.00 40.00  ? 299  PHE A CG  1 
ATOM   2253 C CD1 . PHE A 1 298 ? -14.936 -28.513 25.292  1.00 43.85  ? 299  PHE A CD1 1 
ATOM   2254 C CD2 . PHE A 1 298 ? -16.000 -30.233 26.578  1.00 37.84  ? 299  PHE A CD2 1 
ATOM   2255 C CE1 . PHE A 1 298 ? -16.170 -28.043 24.858  1.00 38.29  ? 299  PHE A CE1 1 
ATOM   2256 C CE2 . PHE A 1 298 ? -17.239 -29.768 26.166  1.00 36.17  ? 299  PHE A CE2 1 
ATOM   2257 C CZ  . PHE A 1 298 ? -17.325 -28.668 25.314  1.00 44.52  ? 299  PHE A CZ  1 
ATOM   2258 N N   . VAL A 1 299 ? -10.492 -30.947 24.847  1.00 38.83  ? 300  VAL A N   1 
ATOM   2259 C CA  . VAL A 1 299 ? -9.107  -31.397 24.940  1.00 35.01  ? 300  VAL A CA  1 
ATOM   2260 C C   . VAL A 1 299 ? -8.141  -30.209 24.752  1.00 39.96  ? 300  VAL A C   1 
ATOM   2261 O O   . VAL A 1 299 ? -8.584  -29.100 24.396  1.00 35.71  ? 300  VAL A O   1 
ATOM   2262 C CB  . VAL A 1 299 ? -8.818  -32.512 23.904  1.00 34.21  ? 300  VAL A CB  1 
ATOM   2263 C CG1 . VAL A 1 299 ? -9.680  -33.770 24.189  1.00 30.91  ? 300  VAL A CG1 1 
ATOM   2264 C CG2 . VAL A 1 299 ? -9.027  -31.994 22.452  1.00 37.01  ? 300  VAL A CG2 1 
ATOM   2265 N N   . PRO A 1 300 ? -6.835  -30.413 25.040  1.00 37.06  ? 301  PRO A N   1 
ATOM   2266 C CA  . PRO A 1 300 ? -5.867  -29.346 24.761  1.00 37.74  ? 301  PRO A CA  1 
ATOM   2267 C C   . PRO A 1 300 ? -6.024  -28.745 23.359  1.00 39.74  ? 301  PRO A C   1 
ATOM   2268 O O   . PRO A 1 300 ? -6.177  -29.477 22.382  1.00 37.54  ? 301  PRO A O   1 
ATOM   2269 C CB  . PRO A 1 300 ? -4.531  -30.065 24.920  1.00 34.08  ? 301  PRO A CB  1 
ATOM   2270 C CG  . PRO A 1 300 ? -4.828  -30.993 26.116  1.00 34.62  ? 301  PRO A CG  1 
ATOM   2271 C CD  . PRO A 1 300 ? -6.192  -31.538 25.756  1.00 34.26  ? 301  PRO A CD  1 
ATOM   2272 N N   . VAL A 1 301 ? -6.039  -27.419 23.274  1.00 37.50  ? 302  VAL A N   1 
ATOM   2273 C CA  . VAL A 1 301 ? -6.189  -26.758 21.979  1.00 42.30  ? 302  VAL A CA  1 
ATOM   2274 C C   . VAL A 1 301 ? -4.841  -26.190 21.506  1.00 39.56  ? 302  VAL A C   1 
ATOM   2275 O O   . VAL A 1 301 ? -4.097  -25.632 22.294  1.00 44.48  ? 302  VAL A O   1 
ATOM   2276 C CB  . VAL A 1 301 ? -7.244  -25.635 22.062  1.00 39.79  ? 302  VAL A CB  1 
ATOM   2277 C CG1 . VAL A 1 301 ? -6.950  -24.698 23.256  1.00 37.32  ? 302  VAL A CG1 1 
ATOM   2278 C CG2 . VAL A 1 301 ? -7.318  -24.863 20.758  1.00 42.16  ? 302  VAL A CG2 1 
ATOM   2279 N N   . VAL A 1 302 ? -4.508  -26.354 20.229  1.00 46.38  ? 303  VAL A N   1 
ATOM   2280 C CA  . VAL A 1 302 ? -3.304  -25.713 19.682  1.00 39.47  ? 303  VAL A CA  1 
ATOM   2281 C C   . VAL A 1 302 ? -3.619  -24.294 19.259  1.00 43.99  ? 303  VAL A C   1 
ATOM   2282 O O   . VAL A 1 302 ? -4.375  -24.074 18.315  1.00 52.89  ? 303  VAL A O   1 
ATOM   2283 C CB  . VAL A 1 302 ? -2.739  -26.465 18.492  1.00 46.21  ? 303  VAL A CB  1 
ATOM   2284 C CG1 . VAL A 1 302 ? -1.402  -25.881 18.113  1.00 49.71  ? 303  VAL A CG1 1 
ATOM   2285 C CG2 . VAL A 1 302 ? -2.588  -27.940 18.815  1.00 42.77  ? 303  VAL A CG2 1 
ATOM   2286 N N   . ASP A 1 303 ? -3.023  -23.327 19.944  1.00 51.89  ? 304  ASP A N   1 
ATOM   2287 C CA  . ASP A 1 303 ? -3.445  -21.937 19.801  1.00 56.13  ? 304  ASP A CA  1 
ATOM   2288 C C   . ASP A 1 303 ? -2.287  -20.935 19.836  1.00 56.26  ? 304  ASP A C   1 
ATOM   2289 O O   . ASP A 1 303 ? -2.512  -19.724 19.889  1.00 57.80  ? 304  ASP A O   1 
ATOM   2290 C CB  . ASP A 1 303 ? -4.448  -21.591 20.904  1.00 49.42  ? 304  ASP A CB  1 
ATOM   2291 C CG  . ASP A 1 303 ? -3.810  -21.515 22.283  1.00 57.54  ? 304  ASP A CG  1 
ATOM   2292 O OD1 . ASP A 1 303 ? -2.677  -22.027 22.486  1.00 57.04  ? 304  ASP A OD1 1 
ATOM   2293 O OD2 . ASP A 1 303 ? -4.466  -20.951 23.196  1.00 64.25  ? 304  ASP A OD2 1 
ATOM   2294 N N   . GLY A 1 304 ? -1.059  -21.443 19.843  1.00 47.69  ? 305  GLY A N   1 
ATOM   2295 C CA  . GLY A 1 304 ? 0.113   -20.592 19.858  1.00 50.79  ? 305  GLY A CA  1 
ATOM   2296 C C   . GLY A 1 304 ? 0.646   -20.264 21.240  1.00 55.38  ? 305  GLY A C   1 
ATOM   2297 O O   . GLY A 1 304 ? 1.805   -19.863 21.383  1.00 55.78  ? 305  GLY A O   1 
ATOM   2298 N N   . ASP A 1 305 ? -0.184  -20.440 22.266  1.00 52.33  ? 306  ASP A N   1 
ATOM   2299 C CA  . ASP A 1 305 ? 0.224   -20.091 23.627  1.00 50.89  ? 306  ASP A CA  1 
ATOM   2300 C C   . ASP A 1 305 ? 0.943   -21.287 24.294  1.00 51.10  ? 306  ASP A C   1 
ATOM   2301 O O   . ASP A 1 305 ? 2.157   -21.432 24.142  1.00 47.72  ? 306  ASP A O   1 
ATOM   2302 C CB  . ASP A 1 305 ? -0.995  -19.628 24.441  1.00 52.02  ? 306  ASP A CB  1 
ATOM   2303 C CG  . ASP A 1 305 ? -0.607  -18.842 25.699  1.00 62.14  ? 306  ASP A CG  1 
ATOM   2304 O OD1 . ASP A 1 305 ? 0.604   -18.783 26.032  1.00 63.87  ? 306  ASP A OD1 1 
ATOM   2305 O OD2 . ASP A 1 305 ? -1.522  -18.293 26.365  1.00 65.58  ? 306  ASP A OD2 1 
ATOM   2306 N N   . PHE A 1 306 ? 0.198   -22.152 24.988  1.00 45.06  ? 307  PHE A N   1 
ATOM   2307 C CA  . PHE A 1 306 ? 0.774   -23.353 25.607  1.00 45.01  ? 307  PHE A CA  1 
ATOM   2308 C C   . PHE A 1 306 ? 1.518   -24.210 24.595  1.00 45.48  ? 307  PHE A C   1 
ATOM   2309 O O   . PHE A 1 306 ? 2.650   -24.633 24.845  1.00 48.23  ? 307  PHE A O   1 
ATOM   2310 C CB  . PHE A 1 306 ? -0.303  -24.220 26.294  1.00 40.29  ? 307  PHE A CB  1 
ATOM   2311 C CG  . PHE A 1 306 ? 0.271   -25.244 27.265  1.00 42.65  ? 307  PHE A CG  1 
ATOM   2312 C CD1 . PHE A 1 306 ? 0.816   -26.446 26.805  1.00 41.27  ? 307  PHE A CD1 1 
ATOM   2313 C CD2 . PHE A 1 306 ? 0.272   -25.000 28.635  1.00 36.31  ? 307  PHE A CD2 1 
ATOM   2314 C CE1 . PHE A 1 306 ? 1.348   -27.380 27.708  1.00 43.05  ? 307  PHE A CE1 1 
ATOM   2315 C CE2 . PHE A 1 306 ? 0.793   -25.931 29.528  1.00 34.02  ? 307  PHE A CE2 1 
ATOM   2316 C CZ  . PHE A 1 306 ? 1.345   -27.114 29.063  1.00 32.87  ? 307  PHE A CZ  1 
ATOM   2317 N N   . LEU A 1 307 ? 0.857   -24.502 23.480  1.00 41.81  ? 308  LEU A N   1 
ATOM   2318 C CA  . LEU A 1 307 ? 1.483   -25.158 22.339  1.00 48.45  ? 308  LEU A CA  1 
ATOM   2319 C C   . LEU A 1 307 ? 1.655   -24.158 21.188  1.00 50.53  ? 308  LEU A C   1 
ATOM   2320 O O   . LEU A 1 307 ? 0.669   -23.688 20.634  1.00 48.73  ? 308  LEU A O   1 
ATOM   2321 C CB  . LEU A 1 307 ? 0.635   -26.341 21.884  1.00 47.42  ? 308  LEU A CB  1 
ATOM   2322 C CG  . LEU A 1 307 ? 0.432   -27.462 22.911  1.00 49.66  ? 308  LEU A CG  1 
ATOM   2323 C CD1 . LEU A 1 307 ? -0.608  -28.441 22.387  1.00 50.90  ? 308  LEU A CD1 1 
ATOM   2324 C CD2 . LEU A 1 307 ? 1.747   -28.182 23.195  1.00 39.20  ? 308  LEU A CD2 1 
ATOM   2325 N N   . SER A 1 308 ? 2.886   -23.804 20.837  1.00 51.76  ? 309  SER A N   1 
ATOM   2326 C CA  . SER A 1 308 ? 3.082   -22.795 19.786  1.00 55.91  ? 309  SER A CA  1 
ATOM   2327 C C   . SER A 1 308 ? 2.830   -23.382 18.396  1.00 53.33  ? 309  SER A C   1 
ATOM   2328 O O   . SER A 1 308 ? 2.498   -22.658 17.467  1.00 61.02  ? 309  SER A O   1 
ATOM   2329 C CB  . SER A 1 308 ? 4.481   -22.177 19.856  1.00 53.20  ? 309  SER A CB  1 
ATOM   2330 O OG  . SER A 1 308 ? 5.479   -23.175 19.771  1.00 57.47  ? 309  SER A OG  1 
ATOM   2331 N N   . ASP A 1 309 ? 2.952   -24.695 18.263  1.00 53.41  ? 310  ASP A N   1 
ATOM   2332 C CA  . ASP A 1 309 ? 2.561   -25.371 17.024  1.00 55.84  ? 310  ASP A CA  1 
ATOM   2333 C C   . ASP A 1 309 ? 1.836   -26.657 17.403  1.00 52.80  ? 310  ASP A C   1 
ATOM   2334 O O   . ASP A 1 309 ? 1.568   -26.873 18.578  1.00 46.53  ? 310  ASP A O   1 
ATOM   2335 C CB  . ASP A 1 309 ? 3.784   -25.666 16.148  1.00 56.70  ? 310  ASP A CB  1 
ATOM   2336 C CG  . ASP A 1 309 ? 3.487   -25.551 14.655  1.00 59.25  ? 310  ASP A CG  1 
ATOM   2337 O OD1 . ASP A 1 309 ? 2.507   -26.169 14.176  1.00 52.59  ? 310  ASP A OD1 1 
ATOM   2338 O OD2 . ASP A 1 309 ? 4.241   -24.827 13.964  1.00 63.95  ? 310  ASP A OD2 1 
ATOM   2339 N N   . THR A 1 310 ? 1.514   -27.505 16.428  1.00 50.64  ? 311  THR A N   1 
ATOM   2340 C CA  . THR A 1 310 ? 1.023   -28.844 16.753  1.00 49.79  ? 311  THR A CA  1 
ATOM   2341 C C   . THR A 1 310 ? 2.118   -29.692 17.425  1.00 52.85  ? 311  THR A C   1 
ATOM   2342 O O   . THR A 1 310 ? 3.313   -29.474 17.187  1.00 50.89  ? 311  THR A O   1 
ATOM   2343 C CB  . THR A 1 310 ? 0.534   -29.601 15.525  1.00 46.21  ? 311  THR A CB  1 
ATOM   2344 O OG1 . THR A 1 310 ? 1.671   -30.066 14.790  1.00 60.87  ? 311  THR A OG1 1 
ATOM   2345 C CG2 . THR A 1 310 ? -0.356  -28.715 14.645  1.00 48.23  ? 311  THR A CG2 1 
ATOM   2346 N N   . PRO A 1 311 ? 1.712   -30.659 18.272  1.00 50.05  ? 312  PRO A N   1 
ATOM   2347 C CA  . PRO A 1 311 ? 2.700   -31.509 18.935  1.00 48.02  ? 312  PRO A CA  1 
ATOM   2348 C C   . PRO A 1 311 ? 3.603   -32.204 17.924  1.00 47.39  ? 312  PRO A C   1 
ATOM   2349 O O   . PRO A 1 311 ? 4.790   -32.392 18.188  1.00 46.79  ? 312  PRO A O   1 
ATOM   2350 C CB  . PRO A 1 311 ? 1.829   -32.515 19.711  1.00 41.91  ? 312  PRO A CB  1 
ATOM   2351 C CG  . PRO A 1 311 ? 0.595   -31.735 20.027  1.00 43.22  ? 312  PRO A CG  1 
ATOM   2352 C CD  . PRO A 1 311 ? 0.344   -30.951 18.743  1.00 43.25  ? 312  PRO A CD  1 
ATOM   2353 N N   . GLU A 1 312 ? 3.036   -32.573 16.783  1.00 50.08  ? 313  GLU A N   1 
ATOM   2354 C CA  A GLU A 1 312 ? 3.793   -33.191 15.700  0.54 52.80  ? 313  GLU A CA  1 
ATOM   2355 C CA  B GLU A 1 312 ? 3.797   -33.196 15.702  0.46 52.57  ? 313  GLU A CA  1 
ATOM   2356 C C   . GLU A 1 312 ? 4.920   -32.298 15.185  1.00 52.36  ? 313  GLU A C   1 
ATOM   2357 O O   . GLU A 1 312 ? 6.083   -32.699 15.159  1.00 53.23  ? 313  GLU A O   1 
ATOM   2358 C CB  A GLU A 1 312 ? 2.863   -33.541 14.547  0.54 54.28  ? 313  GLU A CB  1 
ATOM   2359 C CB  B GLU A 1 312 ? 2.864   -33.571 14.554  0.46 54.56  ? 313  GLU A CB  1 
ATOM   2360 C CG  A GLU A 1 312 ? 3.604   -33.892 13.283  0.54 58.23  ? 313  GLU A CG  1 
ATOM   2361 C CG  B GLU A 1 312 ? 1.893   -34.683 14.899  0.46 55.38  ? 313  GLU A CG  1 
ATOM   2362 C CD  A GLU A 1 312 ? 2.709   -33.894 12.067  0.54 57.26  ? 313  GLU A CD  1 
ATOM   2363 C CD  B GLU A 1 312 ? 2.226   -35.988 14.199  0.46 57.47  ? 313  GLU A CD  1 
ATOM   2364 O OE1 A GLU A 1 312 ? 1.479   -34.052 12.227  0.54 59.73  ? 313  GLU A OE1 1 
ATOM   2365 O OE1 B GLU A 1 312 ? 3.261   -36.040 13.495  0.46 58.82  ? 313  GLU A OE1 1 
ATOM   2366 O OE2 A GLU A 1 312 ? 3.239   -33.723 10.954  0.54 57.93  ? 313  GLU A OE2 1 
ATOM   2367 O OE2 B GLU A 1 312 ? 1.447   -36.959 14.346  0.46 55.50  ? 313  GLU A OE2 1 
ATOM   2368 N N   . ALA A 1 313 ? 4.571   -31.086 14.765  1.00 50.38  ? 314  ALA A N   1 
ATOM   2369 C CA  . ALA A 1 313 ? 5.571   -30.139 14.288  1.00 46.44  ? 314  ALA A CA  1 
ATOM   2370 C C   . ALA A 1 313 ? 6.629   -29.890 15.360  1.00 54.14  ? 314  ALA A C   1 
ATOM   2371 O O   . ALA A 1 313 ? 7.822   -29.825 15.046  1.00 55.54  ? 314  ALA A O   1 
ATOM   2372 C CB  . ALA A 1 313 ? 4.925   -28.830 13.874  1.00 42.39  ? 314  ALA A CB  1 
ATOM   2373 N N   . LEU A 1 314 ? 6.189   -29.760 16.616  1.00 52.94  ? 315  LEU A N   1 
ATOM   2374 C CA  . LEU A 1 314 ? 7.096   -29.473 17.735  1.00 48.39  ? 315  LEU A CA  1 
ATOM   2375 C C   . LEU A 1 314 ? 8.050   -30.624 17.983  1.00 45.17  ? 315  LEU A C   1 
ATOM   2376 O O   . LEU A 1 314 ? 9.212   -30.414 18.311  1.00 52.13  ? 315  LEU A O   1 
ATOM   2377 C CB  . LEU A 1 314 ? 6.308   -29.166 19.020  1.00 50.50  ? 315  LEU A CB  1 
ATOM   2378 C CG  . LEU A 1 314 ? 5.560   -27.833 19.045  1.00 51.41  ? 315  LEU A CG  1 
ATOM   2379 C CD1 . LEU A 1 314 ? 4.687   -27.700 20.294  1.00 44.96  ? 315  LEU A CD1 1 
ATOM   2380 C CD2 . LEU A 1 314 ? 6.531   -26.665 18.934  1.00 51.18  ? 315  LEU A CD2 1 
ATOM   2381 N N   . ILE A 1 315 ? 7.560   -31.847 17.832  1.00 51.89  ? 316  ILE A N   1 
ATOM   2382 C CA  . ILE A 1 315 ? 8.407   -33.016 18.011  1.00 52.17  ? 316  ILE A CA  1 
ATOM   2383 C C   . ILE A 1 315 ? 9.479   -33.036 16.927  1.00 53.13  ? 316  ILE A C   1 
ATOM   2384 O O   . ILE A 1 315 ? 10.641  -33.318 17.202  1.00 58.17  ? 316  ILE A O   1 
ATOM   2385 C CB  . ILE A 1 315 ? 7.588   -34.325 17.978  1.00 48.83  ? 316  ILE A CB  1 
ATOM   2386 C CG1 . ILE A 1 315 ? 6.764   -34.465 19.245  1.00 46.43  ? 316  ILE A CG1 1 
ATOM   2387 C CG2 . ILE A 1 315 ? 8.491   -35.547 17.855  1.00 43.77  ? 316  ILE A CG2 1 
ATOM   2388 C CD1 . ILE A 1 315 ? 5.640   -35.464 19.089  1.00 44.64  ? 316  ILE A CD1 1 
ATOM   2389 N N   . ASN A 1 316 ? 9.094   -32.725 15.696  1.00 55.37  ? 317  ASN A N   1 
ATOM   2390 C CA  . ASN A 1 316 ? 10.047  -32.734 14.582  1.00 57.03  ? 317  ASN A CA  1 
ATOM   2391 C C   . ASN A 1 316 ? 11.132  -31.665 14.684  1.00 55.51  ? 317  ASN A C   1 
ATOM   2392 O O   . ASN A 1 316 ? 12.267  -31.893 14.285  1.00 62.27  ? 317  ASN A O   1 
ATOM   2393 C CB  . ASN A 1 316 ? 9.301   -32.583 13.271  1.00 53.79  ? 317  ASN A CB  1 
ATOM   2394 C CG  . ASN A 1 316 ? 8.408   -33.761 12.996  1.00 56.33  ? 317  ASN A CG  1 
ATOM   2395 O OD1 . ASN A 1 316 ? 8.531   -34.802 13.648  1.00 53.88  ? 317  ASN A OD1 1 
ATOM   2396 N ND2 . ASN A 1 316 ? 7.496   -33.612 12.036  1.00 55.62  ? 317  ASN A ND2 1 
ATOM   2397 N N   . ALA A 1 317 ? 10.793  -30.523 15.264  1.00 54.55  ? 318  ALA A N   1 
ATOM   2398 C CA  . ALA A 1 317 ? 11.711  -29.397 15.327  1.00 52.28  ? 318  ALA A CA  1 
ATOM   2399 C C   . ALA A 1 317 ? 12.666  -29.439 16.510  1.00 62.33  ? 318  ALA A C   1 
ATOM   2400 O O   . ALA A 1 317 ? 13.700  -28.772 16.479  1.00 70.19  ? 318  ALA A O   1 
ATOM   2401 C CB  . ALA A 1 317 ? 10.926  -28.099 15.363  1.00 57.14  ? 318  ALA A CB  1 
ATOM   2402 N N   . GLY A 1 318 ? 12.321  -30.207 17.544  1.00 57.37  ? 319  GLY A N   1 
ATOM   2403 C CA  . GLY A 1 318 ? 13.016  -30.147 18.819  1.00 49.10  ? 319  GLY A CA  1 
ATOM   2404 C C   . GLY A 1 318 ? 14.423  -30.717 18.868  1.00 53.51  ? 319  GLY A C   1 
ATOM   2405 O O   . GLY A 1 318 ? 14.749  -31.678 18.159  1.00 56.50  ? 319  GLY A O   1 
ATOM   2406 N N   . ASP A 1 319 ? 15.264  -30.107 19.703  1.00 52.74  ? 320  ASP A N   1 
ATOM   2407 C CA  . ASP A 1 319 ? 16.584  -30.657 20.024  1.00 56.95  ? 320  ASP A CA  1 
ATOM   2408 C C   . ASP A 1 319 ? 16.412  -31.376 21.353  1.00 55.10  ? 320  ASP A C   1 
ATOM   2409 O O   . ASP A 1 319 ? 16.202  -30.725 22.381  1.00 53.76  ? 320  ASP A O   1 
ATOM   2410 C CB  . ASP A 1 319 ? 17.656  -29.547 20.112  1.00 58.43  ? 320  ASP A CB  1 
ATOM   2411 C CG  . ASP A 1 319 ? 19.082  -30.083 20.421  1.00 64.46  ? 320  ASP A CG  1 
ATOM   2412 O OD1 . ASP A 1 319 ? 19.226  -31.244 20.873  1.00 59.73  ? 320  ASP A OD1 1 
ATOM   2413 O OD2 . ASP A 1 319 ? 20.076  -29.326 20.214  1.00 65.40  ? 320  ASP A OD2 1 
ATOM   2414 N N   . PHE A 1 320 ? 16.487  -32.705 21.349  1.00 51.40  ? 321  PHE A N   1 
ATOM   2415 C CA  . PHE A 1 320 ? 16.197  -33.432 22.586  1.00 55.24  ? 321  PHE A CA  1 
ATOM   2416 C C   . PHE A 1 320 ? 17.416  -34.070 23.229  1.00 55.24  ? 321  PHE A C   1 
ATOM   2417 O O   . PHE A 1 320 ? 17.287  -35.012 24.014  1.00 54.55  ? 321  PHE A O   1 
ATOM   2418 C CB  . PHE A 1 320 ? 15.120  -34.489 22.332  1.00 46.60  ? 321  PHE A CB  1 
ATOM   2419 C CG  . PHE A 1 320 ? 13.790  -33.895 22.014  1.00 48.15  ? 321  PHE A CG  1 
ATOM   2420 C CD1 . PHE A 1 320 ? 13.014  -33.332 23.023  1.00 44.53  ? 321  PHE A CD1 1 
ATOM   2421 C CD2 . PHE A 1 320 ? 13.335  -33.851 20.709  1.00 45.47  ? 321  PHE A CD2 1 
ATOM   2422 C CE1 . PHE A 1 320 ? 11.799  -32.757 22.732  1.00 44.49  ? 321  PHE A CE1 1 
ATOM   2423 C CE2 . PHE A 1 320 ? 12.112  -33.281 20.403  1.00 47.53  ? 321  PHE A CE2 1 
ATOM   2424 C CZ  . PHE A 1 320 ? 11.342  -32.734 21.412  1.00 48.38  ? 321  PHE A CZ  1 
ATOM   2425 N N   . HIS A 1 321 ? 18.598  -33.554 22.905  1.00 56.44  ? 322  HIS A N   1 
ATOM   2426 C CA  . HIS A 1 321 ? 19.809  -33.953 23.616  1.00 55.91  ? 322  HIS A CA  1 
ATOM   2427 C C   . HIS A 1 321 ? 19.635  -33.598 25.085  1.00 50.81  ? 322  HIS A C   1 
ATOM   2428 O O   . HIS A 1 321 ? 19.092  -32.543 25.410  1.00 55.86  ? 322  HIS A O   1 
ATOM   2429 C CB  . HIS A 1 321 ? 21.052  -33.282 23.015  1.00 50.99  ? 322  HIS A CB  1 
ATOM   2430 C CG  . HIS A 1 321 ? 21.483  -33.890 21.718  1.00 46.17  ? 322  HIS A CG  1 
ATOM   2431 N ND1 . HIS A 1 321 ? 20.993  -33.470 20.499  1.00 49.78  ? 322  HIS A ND1 1 
ATOM   2432 C CD2 . HIS A 1 321 ? 22.312  -34.930 21.453  1.00 50.34  ? 322  HIS A CD2 1 
ATOM   2433 C CE1 . HIS A 1 321 ? 21.524  -34.206 19.534  1.00 52.30  ? 322  HIS A CE1 1 
ATOM   2434 N NE2 . HIS A 1 321 ? 22.326  -35.101 20.086  1.00 56.20  ? 322  HIS A NE2 1 
ATOM   2435 N N   . GLY A 1 322 ? 20.049  -34.504 25.966  1.00 48.92  ? 323  GLY A N   1 
ATOM   2436 C CA  . GLY A 1 322 ? 19.856  -34.305 27.395  1.00 59.77  ? 323  GLY A CA  1 
ATOM   2437 C C   . GLY A 1 322 ? 18.580  -34.914 27.972  1.00 55.08  ? 323  GLY A C   1 
ATOM   2438 O O   . GLY A 1 322 ? 18.407  -34.996 29.187  1.00 57.22  ? 323  GLY A O   1 
ATOM   2439 N N   . LEU A 1 323 ? 17.681  -35.358 27.107  1.00 47.69  ? 324  LEU A N   1 
ATOM   2440 C CA  . LEU A 1 323 ? 16.437  -35.913 27.584  1.00 44.29  ? 324  LEU A CA  1 
ATOM   2441 C C   . LEU A 1 323 ? 16.490  -37.441 27.607  1.00 43.20  ? 324  LEU A C   1 
ATOM   2442 O O   . LEU A 1 323 ? 16.959  -38.074 26.653  1.00 46.61  ? 324  LEU A O   1 
ATOM   2443 C CB  . LEU A 1 323 ? 15.278  -35.426 26.718  1.00 49.65  ? 324  LEU A CB  1 
ATOM   2444 C CG  . LEU A 1 323 ? 13.871  -35.864 27.122  1.00 47.79  ? 324  LEU A CG  1 
ATOM   2445 C CD1 . LEU A 1 323 ? 13.517  -35.244 28.462  1.00 51.14  ? 324  LEU A CD1 1 
ATOM   2446 C CD2 . LEU A 1 323 ? 12.860  -35.490 26.041  1.00 47.16  ? 324  LEU A CD2 1 
ATOM   2447 N N   . GLN A 1 324 ? 16.048  -38.004 28.730  1.00 41.66  ? 325  GLN A N   1 
ATOM   2448 C CA  . GLN A 1 324 ? 15.776  -39.432 28.861  1.00 41.62  ? 325  GLN A CA  1 
ATOM   2449 C C   . GLN A 1 324 ? 14.282  -39.622 28.987  1.00 42.96  ? 325  GLN A C   1 
ATOM   2450 O O   . GLN A 1 324 ? 13.613  -38.924 29.774  1.00 38.68  ? 325  GLN A O   1 
ATOM   2451 C CB  . GLN A 1 324 ? 16.451  -40.059 30.090  1.00 43.58  ? 325  GLN A CB  1 
ATOM   2452 C CG  . GLN A 1 324 ? 17.970  -40.054 30.089  1.00 51.09  ? 325  GLN A CG  1 
ATOM   2453 C CD  . GLN A 1 324 ? 18.518  -38.761 30.619  1.00 49.86  ? 325  GLN A CD  1 
ATOM   2454 O OE1 . GLN A 1 324 ? 18.225  -38.367 31.745  1.00 50.13  ? 325  GLN A OE1 1 
ATOM   2455 N NE2 . GLN A 1 324 ? 19.294  -38.068 29.793  1.00 55.00  ? 325  GLN A NE2 1 
ATOM   2456 N N   . VAL A 1 325 ? 13.761  -40.576 28.228  1.00 36.93  ? 326  VAL A N   1 
ATOM   2457 C CA  . VAL A 1 325 ? 12.335  -40.830 28.215  1.00 37.71  ? 326  VAL A CA  1 
ATOM   2458 C C   . VAL A 1 325 ? 12.076  -42.329 28.282  1.00 40.25  ? 326  VAL A C   1 
ATOM   2459 O O   . VAL A 1 325 ? 12.777  -43.124 27.653  1.00 40.26  ? 326  VAL A O   1 
ATOM   2460 C CB  . VAL A 1 325 ? 11.659  -40.236 26.945  1.00 41.79  ? 326  VAL A CB  1 
ATOM   2461 C CG1 . VAL A 1 325 ? 10.191  -40.450 26.993  1.00 41.59  ? 326  VAL A CG1 1 
ATOM   2462 C CG2 . VAL A 1 325 ? 11.889  -38.765 26.883  1.00 46.19  ? 326  VAL A CG2 1 
ATOM   2463 N N   . LEU A 1 326 ? 11.077  -42.715 29.062  1.00 38.74  ? 327  LEU A N   1 
ATOM   2464 C CA  . LEU A 1 326 ? 10.615  -44.092 29.080  1.00 38.15  ? 327  LEU A CA  1 
ATOM   2465 C C   . LEU A 1 326 ? 9.205   -44.101 28.491  1.00 36.97  ? 327  LEU A C   1 
ATOM   2466 O O   . LEU A 1 326 ? 8.358   -43.300 28.886  1.00 38.79  ? 327  LEU A O   1 
ATOM   2467 C CB  . LEU A 1 326 ? 10.649  -44.642 30.505  1.00 33.29  ? 327  LEU A CB  1 
ATOM   2468 C CG  . LEU A 1 326 ? 10.157  -46.054 30.813  1.00 39.98  ? 327  LEU A CG  1 
ATOM   2469 C CD1 . LEU A 1 326 ? 11.120  -47.050 30.289  1.00 39.06  ? 327  LEU A CD1 1 
ATOM   2470 C CD2 . LEU A 1 326 ? 9.999   -46.228 32.337  1.00 34.86  ? 327  LEU A CD2 1 
ATOM   2471 N N   . VAL A 1 327 ? 8.945   -44.980 27.534  1.00 31.71  ? 328  VAL A N   1 
ATOM   2472 C CA  . VAL A 1 327 ? 7.627   -45.005 26.895  1.00 35.63  ? 328  VAL A CA  1 
ATOM   2473 C C   . VAL A 1 327 ? 7.205   -46.436 26.647  1.00 34.47  ? 328  VAL A C   1 
ATOM   2474 O O   . VAL A 1 327 ? 8.044   -47.330 26.520  1.00 33.86  ? 328  VAL A O   1 
ATOM   2475 C CB  . VAL A 1 327 ? 7.592   -44.253 25.517  1.00 34.33  ? 328  VAL A CB  1 
ATOM   2476 C CG1 . VAL A 1 327 ? 8.092   -42.846 25.636  1.00 28.13  ? 328  VAL A CG1 1 
ATOM   2477 C CG2 . VAL A 1 327 ? 8.393   -45.004 24.479  1.00 30.78  ? 328  VAL A CG2 1 
ATOM   2478 N N   . GLY A 1 328 ? 5.905   -46.668 26.566  1.00 31.33  ? 329  GLY A N   1 
ATOM   2479 C CA  . GLY A 1 328 ? 5.468   -48.007 26.253  1.00 34.38  ? 329  GLY A CA  1 
ATOM   2480 C C   . GLY A 1 328 ? 3.982   -48.171 26.122  1.00 35.22  ? 329  GLY A C   1 
ATOM   2481 O O   . GLY A 1 328 ? 3.225   -47.210 26.223  1.00 35.73  ? 329  GLY A O   1 
ATOM   2482 N N   . VAL A 1 329 ? 3.568   -49.413 25.883  1.00 35.21  ? 330  VAL A N   1 
ATOM   2483 C CA  . VAL A 1 329 ? 2.175   -49.710 25.614  1.00 35.48  ? 330  VAL A CA  1 
ATOM   2484 C C   . VAL A 1 329 ? 1.818   -51.037 26.280  1.00 37.00  ? 330  VAL A C   1 
ATOM   2485 O O   . VAL A 1 329 ? 2.704   -51.811 26.640  1.00 37.04  ? 330  VAL A O   1 
ATOM   2486 C CB  . VAL A 1 329 ? 1.888   -49.744 24.065  1.00 36.58  ? 330  VAL A CB  1 
ATOM   2487 C CG1 . VAL A 1 329 ? 2.132   -48.373 23.439  1.00 29.70  ? 330  VAL A CG1 1 
ATOM   2488 C CG2 . VAL A 1 329 ? 2.721   -50.806 23.334  1.00 29.53  ? 330  VAL A CG2 1 
ATOM   2489 N N   . VAL A 1 330 ? 0.525   -51.288 26.481  1.00 36.33  ? 331  VAL A N   1 
ATOM   2490 C CA  . VAL A 1 330 ? 0.065   -52.627 26.842  1.00 36.13  ? 331  VAL A CA  1 
ATOM   2491 C C   . VAL A 1 330 ? -0.126  -53.465 25.558  1.00 40.50  ? 331  VAL A C   1 
ATOM   2492 O O   . VAL A 1 330 ? -0.151  -52.928 24.455  1.00 38.10  ? 331  VAL A O   1 
ATOM   2493 C CB  . VAL A 1 330 ? -1.250  -52.593 27.649  1.00 35.60  ? 331  VAL A CB  1 
ATOM   2494 C CG1 . VAL A 1 330 ? -1.081  -51.736 28.905  1.00 35.60  ? 331  VAL A CG1 1 
ATOM   2495 C CG2 . VAL A 1 330 ? -2.407  -52.117 26.801  1.00 31.74  ? 331  VAL A CG2 1 
ATOM   2496 N N   . LYS A 1 331 ? -0.250  -54.780 25.712  1.00 43.06  ? 332  LYS A N   1 
ATOM   2497 C CA  . LYS A 1 331 ? -0.326  -55.701 24.581  1.00 44.35  ? 332  LYS A CA  1 
ATOM   2498 C C   . LYS A 1 331 ? -1.577  -55.492 23.735  1.00 42.46  ? 332  LYS A C   1 
ATOM   2499 O O   . LYS A 1 331 ? -1.527  -55.666 22.539  1.00 37.52  ? 332  LYS A O   1 
ATOM   2500 C CB  . LYS A 1 331 ? -0.276  -57.150 25.077  1.00 43.19  ? 332  LYS A CB  1 
ATOM   2501 C CG  . LYS A 1 331 ? -0.149  -58.201 23.992  1.00 42.80  ? 332  LYS A CG  1 
ATOM   2502 C CD  . LYS A 1 331 ? 0.005   -59.602 24.616  1.00 49.41  ? 332  LYS A CD  1 
ATOM   2503 C CE  . LYS A 1 331 ? 0.424   -60.665 23.574  1.00 57.36  ? 332  LYS A CE  1 
ATOM   2504 N NZ  . LYS A 1 331 ? -0.616  -60.918 22.512  1.00 51.71  ? 332  LYS A NZ  1 
ATOM   2505 N N   . ASP A 1 332 ? -2.701  -55.120 24.345  1.00 37.76  ? 333  ASP A N   1 
ATOM   2506 C CA  . ASP A 1 332 ? -3.923  -54.970 23.562  1.00 39.02  ? 333  ASP A CA  1 
ATOM   2507 C C   . ASP A 1 332 ? -4.612  -53.637 23.785  1.00 37.42  ? 333  ASP A C   1 
ATOM   2508 O O   . ASP A 1 332 ? -5.702  -53.582 24.344  1.00 42.57  ? 333  ASP A O   1 
ATOM   2509 C CB  . ASP A 1 332 ? -4.904  -56.117 23.861  1.00 36.72  ? 333  ASP A CB  1 
ATOM   2510 C CG  . ASP A 1 332 ? -4.320  -57.484 23.529  1.00 45.27  ? 333  ASP A CG  1 
ATOM   2511 O OD1 . ASP A 1 332 ? -4.292  -57.864 22.319  1.00 47.62  ? 333  ASP A OD1 1 
ATOM   2512 O OD2 . ASP A 1 332 ? -3.875  -58.178 24.477  1.00 42.94  ? 333  ASP A OD2 1 
ATOM   2513 N N   . GLU A 1 333 ? -3.994  -52.576 23.277  1.00 37.41  ? 334  GLU A N   1 
ATOM   2514 C CA  . GLU A 1 333 ? -4.438  -51.212 23.516  1.00 37.25  ? 334  GLU A CA  1 
ATOM   2515 C C   . GLU A 1 333 ? -5.873  -50.889 23.114  1.00 44.07  ? 334  GLU A C   1 
ATOM   2516 O O   . GLU A 1 333 ? -6.503  -50.015 23.718  1.00 44.21  ? 334  GLU A O   1 
ATOM   2517 C CB  . GLU A 1 333 ? -3.505  -50.235 22.795  1.00 33.75  ? 334  GLU A CB  1 
ATOM   2518 C CG  . GLU A 1 333 ? -2.104  -50.075 23.428  1.00 40.21  ? 334  GLU A CG  1 
ATOM   2519 C CD  . GLU A 1 333 ? -2.135  -49.291 24.762  1.00 44.38  ? 334  GLU A CD  1 
ATOM   2520 O OE1 . GLU A 1 333 ? -3.218  -48.748 25.110  1.00 42.35  ? 334  GLU A OE1 1 
ATOM   2521 O OE2 . GLU A 1 333 ? -1.077  -49.224 25.461  1.00 40.03  ? 334  GLU A OE2 1 
ATOM   2522 N N   . GLY A 1 334 ? -6.393  -51.562 22.092  1.00 40.31  ? 335  GLY A N   1 
ATOM   2523 C CA  . GLY A 1 334 ? -7.676  -51.171 21.541  1.00 38.20  ? 335  GLY A CA  1 
ATOM   2524 C C   . GLY A 1 334 ? -8.916  -51.858 22.099  1.00 38.90  ? 335  GLY A C   1 
ATOM   2525 O O   . GLY A 1 334 ? -10.028 -51.334 21.957  1.00 39.97  ? 335  GLY A O   1 
ATOM   2526 N N   . SER A 1 335 ? -8.740  -53.020 22.716  1.00 36.07  ? 336  SER A N   1 
ATOM   2527 C CA  . SER A 1 335 ? -9.885  -53.858 23.079  1.00 40.10  ? 336  SER A CA  1 
ATOM   2528 C C   . SER A 1 335 ? -10.878 -53.157 24.027  1.00 44.60  ? 336  SER A C   1 
ATOM   2529 O O   . SER A 1 335 ? -12.070 -53.088 23.726  1.00 42.35  ? 336  SER A O   1 
ATOM   2530 C CB  . SER A 1 335 ? -9.397  -55.171 23.689  1.00 41.08  ? 336  SER A CB  1 
ATOM   2531 O OG  . SER A 1 335 ? -8.718  -54.962 24.918  1.00 46.03  ? 336  SER A OG  1 
ATOM   2532 N N   . TYR A 1 336 ? -10.384 -52.624 25.146  1.00 42.94  ? 337  TYR A N   1 
ATOM   2533 C CA  . TYR A 1 336 ? -11.206 -51.862 26.112  1.00 44.40  ? 337  TYR A CA  1 
ATOM   2534 C C   . TYR A 1 336 ? -12.189 -50.878 25.473  1.00 43.17  ? 337  TYR A C   1 
ATOM   2535 O O   . TYR A 1 336 ? -13.345 -50.806 25.867  1.00 43.53  ? 337  TYR A O   1 
ATOM   2536 C CB  . TYR A 1 336 ? -10.288 -51.090 27.069  1.00 42.20  ? 337  TYR A CB  1 
ATOM   2537 C CG  . TYR A 1 336 ? -10.979 -50.257 28.131  1.00 44.25  ? 337  TYR A CG  1 
ATOM   2538 C CD1 . TYR A 1 336 ? -11.353 -50.822 29.349  1.00 57.52  ? 337  TYR A CD1 1 
ATOM   2539 C CD2 . TYR A 1 336 ? -11.204 -48.901 27.950  1.00 49.53  ? 337  TYR A CD2 1 
ATOM   2540 C CE1 . TYR A 1 336 ? -11.950 -50.058 30.362  1.00 56.56  ? 337  TYR A CE1 1 
ATOM   2541 C CE2 . TYR A 1 336 ? -11.817 -48.137 28.942  1.00 54.61  ? 337  TYR A CE2 1 
ATOM   2542 C CZ  . TYR A 1 336 ? -12.194 -48.723 30.145  1.00 62.00  ? 337  TYR A CZ  1 
ATOM   2543 O OH  . TYR A 1 336 ? -12.798 -47.991 31.149  1.00 65.31  ? 337  TYR A OH  1 
ATOM   2544 N N   . PHE A 1 337 ? -11.731 -50.128 24.476  1.00 42.93  ? 338  PHE A N   1 
ATOM   2545 C CA  . PHE A 1 337 ? -12.538 -49.053 23.897  1.00 41.62  ? 338  PHE A CA  1 
ATOM   2546 C C   . PHE A 1 337 ? -13.676 -49.582 23.036  1.00 46.52  ? 338  PHE A C   1 
ATOM   2547 O O   . PHE A 1 337 ? -14.664 -48.877 22.798  1.00 43.90  ? 338  PHE A O   1 
ATOM   2548 C CB  . PHE A 1 337 ? -11.648 -48.109 23.064  1.00 43.75  ? 338  PHE A CB  1 
ATOM   2549 C CG  . PHE A 1 337 ? -10.516 -47.515 23.851  1.00 45.22  ? 338  PHE A CG  1 
ATOM   2550 C CD1 . PHE A 1 337 ? -10.673 -46.288 24.497  1.00 46.39  ? 338  PHE A CD1 1 
ATOM   2551 C CD2 . PHE A 1 337 ? -9.314  -48.195 23.981  1.00 40.22  ? 338  PHE A CD2 1 
ATOM   2552 C CE1 . PHE A 1 337 ? -9.651  -45.739 25.244  1.00 47.12  ? 338  PHE A CE1 1 
ATOM   2553 C CE2 . PHE A 1 337 ? -8.267  -47.651 24.735  1.00 47.35  ? 338  PHE A CE2 1 
ATOM   2554 C CZ  . PHE A 1 337 ? -8.440  -46.423 25.383  1.00 44.04  ? 338  PHE A CZ  1 
ATOM   2555 N N   . LEU A 1 338 ? -13.547 -50.818 22.571  1.00 40.02  ? 339  LEU A N   1 
ATOM   2556 C CA  . LEU A 1 338 ? -14.502 -51.322 21.591  1.00 47.57  ? 339  LEU A CA  1 
ATOM   2557 C C   . LEU A 1 338 ? -15.897 -51.527 22.198  1.00 48.83  ? 339  LEU A C   1 
ATOM   2558 O O   . LEU A 1 338 ? -16.904 -51.376 21.493  1.00 47.01  ? 339  LEU A O   1 
ATOM   2559 C CB  . LEU A 1 338 ? -13.986 -52.621 20.964  1.00 41.95  ? 339  LEU A CB  1 
ATOM   2560 C CG  . LEU A 1 338 ? -12.770 -52.418 20.056  1.00 46.07  ? 339  LEU A CG  1 
ATOM   2561 C CD1 . LEU A 1 338 ? -12.243 -53.740 19.525  1.00 38.03  ? 339  LEU A CD1 1 
ATOM   2562 C CD2 . LEU A 1 338 ? -13.119 -51.469 18.928  1.00 38.99  ? 339  LEU A CD2 1 
ATOM   2563 N N   . VAL A 1 339 ? -15.967 -51.842 23.494  1.00 40.35  ? 340  VAL A N   1 
ATOM   2564 C CA  . VAL A 1 339 ? -17.273 -52.045 24.122  1.00 47.76  ? 340  VAL A CA  1 
ATOM   2565 C C   . VAL A 1 339 ? -18.043 -50.747 24.368  1.00 49.60  ? 340  VAL A C   1 
ATOM   2566 O O   . VAL A 1 339 ? -19.154 -50.775 24.867  1.00 54.75  ? 340  VAL A O   1 
ATOM   2567 C CB  . VAL A 1 339 ? -17.152 -52.801 25.451  1.00 52.27  ? 340  VAL A CB  1 
ATOM   2568 C CG1 . VAL A 1 339 ? -16.639 -54.208 25.197  1.00 47.73  ? 340  VAL A CG1 1 
ATOM   2569 C CG2 . VAL A 1 339 ? -16.247 -52.059 26.416  1.00 51.32  ? 340  VAL A CG2 1 
ATOM   2570 N N   . TYR A 1 340 ? -17.475 -49.613 23.987  1.00 52.71  ? 341  TYR A N   1 
ATOM   2571 C CA  . TYR A 1 340 ? -18.159 -48.339 24.184  1.00 51.69  ? 341  TYR A CA  1 
ATOM   2572 C C   . TYR A 1 340 ? -18.753 -47.783 22.903  1.00 54.49  ? 341  TYR A C   1 
ATOM   2573 O O   . TYR A 1 340 ? -18.903 -46.569 22.770  1.00 60.09  ? 341  TYR A O   1 
ATOM   2574 C CB  . TYR A 1 340 ? -17.208 -47.305 24.805  1.00 51.34  ? 341  TYR A CB  1 
ATOM   2575 C CG  . TYR A 1 340 ? -16.934 -47.577 26.264  1.00 52.21  ? 341  TYR A CG  1 
ATOM   2576 C CD1 . TYR A 1 340 ? -17.792 -47.099 27.253  1.00 54.08  ? 341  TYR A CD1 1 
ATOM   2577 C CD2 . TYR A 1 340 ? -15.852 -48.362 26.655  1.00 49.24  ? 341  TYR A CD2 1 
ATOM   2578 C CE1 . TYR A 1 340 ? -17.552 -47.358 28.603  1.00 54.77  ? 341  TYR A CE1 1 
ATOM   2579 C CE2 . TYR A 1 340 ? -15.617 -48.642 27.982  1.00 51.19  ? 341  TYR A CE2 1 
ATOM   2580 C CZ  . TYR A 1 340 ? -16.466 -48.129 28.956  1.00 56.61  ? 341  TYR A CZ  1 
ATOM   2581 O OH  . TYR A 1 340 ? -16.221 -48.402 30.277  1.00 56.04  ? 341  TYR A OH  1 
ATOM   2582 N N   . GLY A 1 341 ? -19.085 -48.662 21.959  1.00 62.28  ? 342  GLY A N   1 
ATOM   2583 C CA  . GLY A 1 341 ? -19.908 -48.259 20.828  1.00 51.80  ? 342  GLY A CA  1 
ATOM   2584 C C   . GLY A 1 341 ? -19.552 -48.798 19.458  1.00 59.90  ? 342  GLY A C   1 
ATOM   2585 O O   . GLY A 1 341 ? -20.054 -48.299 18.445  1.00 51.92  ? 342  GLY A O   1 
ATOM   2586 N N   . ALA A 1 342 ? -18.676 -49.798 19.416  1.00 57.33  ? 343  ALA A N   1 
ATOM   2587 C CA  . ALA A 1 342 ? -18.432 -50.525 18.184  1.00 49.60  ? 343  ALA A CA  1 
ATOM   2588 C C   . ALA A 1 342 ? -19.526 -51.581 18.043  1.00 55.34  ? 343  ALA A C   1 
ATOM   2589 O O   . ALA A 1 342 ? -19.750 -52.375 18.970  1.00 47.96  ? 343  ALA A O   1 
ATOM   2590 C CB  . ALA A 1 342 ? -17.059 -51.167 18.186  1.00 47.77  ? 343  ALA A CB  1 
ATOM   2591 N N   . PRO A 1 343 ? -20.220 -51.592 16.888  1.00 53.19  ? 344  PRO A N   1 
ATOM   2592 C CA  . PRO A 1 343 ? -21.310 -52.557 16.697  1.00 45.32  ? 344  PRO A CA  1 
ATOM   2593 C C   . PRO A 1 343 ? -20.847 -53.995 16.922  1.00 51.07  ? 344  PRO A C   1 
ATOM   2594 O O   . PRO A 1 343 ? -19.868 -54.443 16.317  1.00 50.10  ? 344  PRO A O   1 
ATOM   2595 C CB  . PRO A 1 343 ? -21.747 -52.321 15.249  1.00 49.44  ? 344  PRO A CB  1 
ATOM   2596 C CG  . PRO A 1 343 ? -20.675 -51.421 14.628  1.00 57.48  ? 344  PRO A CG  1 
ATOM   2597 C CD  . PRO A 1 343 ? -20.109 -50.639 15.770  1.00 49.66  ? 344  PRO A CD  1 
ATOM   2598 N N   . GLY A 1 344 ? -21.514 -54.687 17.846  1.00 49.65  ? 345  GLY A N   1 
ATOM   2599 C CA  . GLY A 1 344 ? -21.285 -56.108 18.034  1.00 46.12  ? 345  GLY A CA  1 
ATOM   2600 C C   . GLY A 1 344 ? -20.430 -56.466 19.230  1.00 49.42  ? 345  GLY A C   1 
ATOM   2601 O O   . GLY A 1 344 ? -20.221 -57.644 19.530  1.00 47.01  ? 345  GLY A O   1 
ATOM   2602 N N   . PHE A 1 345 ? -19.921 -55.458 19.925  1.00 51.54  ? 346  PHE A N   1 
ATOM   2603 C CA  . PHE A 1 345 ? -19.016 -55.728 21.034  1.00 49.68  ? 346  PHE A CA  1 
ATOM   2604 C C   . PHE A 1 345 ? -19.695 -55.698 22.399  1.00 48.11  ? 346  PHE A C   1 
ATOM   2605 O O   . PHE A 1 345 ? -20.536 -54.848 22.679  1.00 55.05  ? 346  PHE A O   1 
ATOM   2606 C CB  . PHE A 1 345 ? -17.849 -54.739 20.994  1.00 50.05  ? 346  PHE A CB  1 
ATOM   2607 C CG  . PHE A 1 345 ? -16.804 -55.105 19.991  1.00 51.30  ? 346  PHE A CG  1 
ATOM   2608 C CD1 . PHE A 1 345 ? -15.729 -55.913 20.357  1.00 47.45  ? 346  PHE A CD1 1 
ATOM   2609 C CD2 . PHE A 1 345 ? -16.917 -54.683 18.661  1.00 44.80  ? 346  PHE A CD2 1 
ATOM   2610 C CE1 . PHE A 1 345 ? -14.764 -56.278 19.410  1.00 49.12  ? 346  PHE A CE1 1 
ATOM   2611 C CE2 . PHE A 1 345 ? -15.962 -55.032 17.727  1.00 44.51  ? 346  PHE A CE2 1 
ATOM   2612 C CZ  . PHE A 1 345 ? -14.886 -55.831 18.097  1.00 44.87  ? 346  PHE A CZ  1 
ATOM   2613 N N   . SER A 1 346 ? -19.322 -56.648 23.241  1.00 55.69  ? 347  SER A N   1 
ATOM   2614 C CA  . SER A 1 346 ? -19.708 -56.624 24.646  1.00 53.56  ? 347  SER A CA  1 
ATOM   2615 C C   . SER A 1 346 ? -18.680 -57.387 25.471  1.00 49.40  ? 347  SER A C   1 
ATOM   2616 O O   . SER A 1 346 ? -18.040 -58.318 24.984  1.00 47.84  ? 347  SER A O   1 
ATOM   2617 C CB  . SER A 1 346 ? -21.111 -57.221 24.851  1.00 55.16  ? 347  SER A CB  1 
ATOM   2618 O OG  . SER A 1 346 ? -21.467 -57.264 26.237  1.00 57.97  ? 347  SER A OG  1 
ATOM   2619 N N   . LYS A 1 347 ? -18.531 -57.001 26.734  1.00 47.80  ? 348  LYS A N   1 
ATOM   2620 C CA  . LYS A 1 347 ? -17.664 -57.735 27.638  1.00 45.73  ? 348  LYS A CA  1 
ATOM   2621 C C   . LYS A 1 347 ? -18.287 -59.082 28.016  1.00 47.36  ? 348  LYS A C   1 
ATOM   2622 O O   . LYS A 1 347 ? -17.608 -59.983 28.509  1.00 45.49  ? 348  LYS A O   1 
ATOM   2623 C CB  . LYS A 1 347 ? -17.392 -56.907 28.909  1.00 50.28  ? 348  LYS A CB  1 
ATOM   2624 C CG  . LYS A 1 347 ? -18.538 -56.929 29.927  1.00 46.24  ? 348  LYS A CG  1 
ATOM   2625 C CD  . LYS A 1 347 ? -18.147 -56.269 31.258  1.00 51.84  ? 348  LYS A CD  1 
ATOM   2626 C CE  . LYS A 1 347 ? -19.087 -56.666 32.377  1.00 46.01  ? 348  LYS A CE  1 
ATOM   2627 N NZ  . LYS A 1 347 ? -18.746 -58.028 32.853  1.00 47.60  ? 348  LYS A NZ  1 
ATOM   2628 N N   . ASP A 1 348 ? -19.590 -59.205 27.801  1.00 52.40  ? 349  ASP A N   1 
ATOM   2629 C CA  . ASP A 1 348 ? -20.334 -60.379 28.268  1.00 54.98  ? 349  ASP A CA  1 
ATOM   2630 C C   . ASP A 1 348 ? -20.535 -61.470 27.214  1.00 58.96  ? 349  ASP A C   1 
ATOM   2631 O O   . ASP A 1 348 ? -21.126 -62.501 27.529  1.00 62.97  ? 349  ASP A O   1 
ATOM   2632 C CB  . ASP A 1 348 ? -21.708 -59.958 28.795  1.00 58.20  ? 349  ASP A CB  1 
ATOM   2633 C CG  . ASP A 1 348 ? -21.617 -59.109 30.041  1.00 60.51  ? 349  ASP A CG  1 
ATOM   2634 O OD1 . ASP A 1 348 ? -20.853 -59.498 30.966  1.00 48.53  ? 349  ASP A OD1 1 
ATOM   2635 O OD2 . ASP A 1 348 ? -22.297 -58.049 30.070  1.00 60.32  ? 349  ASP A OD2 1 
ATOM   2636 N N   . ASN A 1 349 ? -20.095 -61.239 25.972  1.00 55.24  ? 350  ASN A N   1 
ATOM   2637 C CA  . ASN A 1 349 ? -19.952 -62.350 25.019  1.00 53.74  ? 350  ASN A CA  1 
ATOM   2638 C C   . ASN A 1 349 ? -18.608 -62.287 24.302  1.00 53.45  ? 350  ASN A C   1 
ATOM   2639 O O   . ASN A 1 349 ? -17.764 -61.451 24.632  1.00 53.81  ? 350  ASN A O   1 
ATOM   2640 C CB  . ASN A 1 349 ? -21.124 -62.403 24.019  1.00 48.17  ? 350  ASN A CB  1 
ATOM   2641 C CG  . ASN A 1 349 ? -21.231 -61.178 23.104  1.00 59.55  ? 350  ASN A CG  1 
ATOM   2642 O OD1 . ASN A 1 349 ? -20.230 -60.584 22.679  1.00 60.99  ? 350  ASN A OD1 1 
ATOM   2643 N ND2 . ASN A 1 349 ? -22.479 -60.809 22.785  1.00 59.16  ? 350  ASN A ND2 1 
ATOM   2644 N N   . GLU A 1 350 ? -18.401 -63.190 23.351  1.00 51.28  ? 351  GLU A N   1 
ATOM   2645 C CA  . GLU A 1 350 ? -17.103 -63.336 22.697  1.00 50.45  ? 351  GLU A CA  1 
ATOM   2646 C C   . GLU A 1 350 ? -16.838 -62.229 21.681  1.00 47.56  ? 351  GLU A C   1 
ATOM   2647 O O   . GLU A 1 350 ? -15.743 -62.140 21.138  1.00 46.53  ? 351  GLU A O   1 
ATOM   2648 C CB  . GLU A 1 350 ? -16.997 -64.698 22.007  1.00 54.34  ? 351  GLU A CB  1 
ATOM   2649 C CG  . GLU A 1 350 ? -16.796 -65.876 22.939  1.00 57.06  ? 351  GLU A CG  1 
ATOM   2650 C CD  . GLU A 1 350 ? -15.486 -65.791 23.694  1.00 70.31  ? 351  GLU A CD  1 
ATOM   2651 O OE1 . GLU A 1 350 ? -14.415 -65.876 23.044  1.00 73.61  ? 351  GLU A OE1 1 
ATOM   2652 O OE2 . GLU A 1 350 ? -15.523 -65.629 24.939  1.00 74.12  ? 351  GLU A OE2 1 
ATOM   2653 N N   . SER A 1 351 ? -17.835 -61.390 21.440  1.00 43.16  ? 352  SER A N   1 
ATOM   2654 C CA  . SER A 1 351 ? -17.708 -60.301 20.475  1.00 47.23  ? 352  SER A CA  1 
ATOM   2655 C C   . SER A 1 351 ? -17.212 -60.774 19.097  1.00 54.65  ? 352  SER A C   1 
ATOM   2656 O O   . SER A 1 351 ? -16.405 -60.095 18.457  1.00 47.24  ? 352  SER A O   1 
ATOM   2657 C CB  . SER A 1 351 ? -16.770 -59.218 21.024  1.00 49.67  ? 352  SER A CB  1 
ATOM   2658 O OG  . SER A 1 351 ? -17.352 -58.538 22.123  1.00 46.10  ? 352  SER A OG  1 
ATOM   2659 N N   . LEU A 1 352 ? -17.693 -61.931 18.644  1.00 53.73  ? 353  LEU A N   1 
ATOM   2660 C CA  . LEU A 1 352 ? -17.310 -62.451 17.330  1.00 47.39  ? 353  LEU A CA  1 
ATOM   2661 C C   . LEU A 1 352 ? -18.126 -61.772 16.230  1.00 52.70  ? 353  LEU A C   1 
ATOM   2662 O O   . LEU A 1 352 ? -19.233 -62.200 15.926  1.00 57.91  ? 353  LEU A O   1 
ATOM   2663 C CB  . LEU A 1 352 ? -17.502 -63.962 17.290  1.00 44.25  ? 353  LEU A CB  1 
ATOM   2664 C CG  . LEU A 1 352 ? -16.596 -64.733 18.235  1.00 49.03  ? 353  LEU A CG  1 
ATOM   2665 C CD1 . LEU A 1 352 ? -17.094 -66.160 18.407  1.00 53.43  ? 353  LEU A CD1 1 
ATOM   2666 C CD2 . LEU A 1 352 ? -15.178 -64.724 17.704  1.00 48.84  ? 353  LEU A CD2 1 
ATOM   2667 N N   . ILE A 1 353 ? -17.564 -60.721 15.633  1.00 49.60  ? 354  ILE A N   1 
ATOM   2668 C CA  . ILE A 1 353 ? -18.304 -59.836 14.738  1.00 42.72  ? 354  ILE A CA  1 
ATOM   2669 C C   . ILE A 1 353 ? -18.308 -60.243 13.246  1.00 53.63  ? 354  ILE A C   1 
ATOM   2670 O O   . ILE A 1 353 ? -17.480 -61.026 12.764  1.00 47.27  ? 354  ILE A O   1 
ATOM   2671 C CB  . ILE A 1 353 ? -17.747 -58.390 14.825  1.00 47.23  ? 354  ILE A CB  1 
ATOM   2672 C CG1 . ILE A 1 353 ? -16.261 -58.370 14.456  1.00 42.87  ? 354  ILE A CG1 1 
ATOM   2673 C CG2 . ILE A 1 353 ? -17.947 -57.821 16.224  1.00 48.68  ? 354  ILE A CG2 1 
ATOM   2674 C CD1 . ILE A 1 353 ? -15.709 -56.991 14.167  1.00 42.24  ? 354  ILE A CD1 1 
ATOM   2675 N N   . SER A 1 354 ? -19.247 -59.664 12.520  1.00 48.13  ? 355  SER A N   1 
ATOM   2676 C CA  . SER A 1 354 ? -19.400 -59.902 11.109  1.00 50.03  ? 355  SER A CA  1 
ATOM   2677 C C   . SER A 1 354 ? -18.631 -58.843 10.324  1.00 55.95  ? 355  SER A C   1 
ATOM   2678 O O   . SER A 1 354 ? -18.419 -57.721 10.803  1.00 50.14  ? 355  SER A O   1 
ATOM   2679 C CB  . SER A 1 354 ? -20.880 -59.868 10.722  1.00 51.41  ? 355  SER A CB  1 
ATOM   2680 O OG  . SER A 1 354 ? -21.342 -58.524 10.675  1.00 51.64  ? 355  SER A OG  1 
ATOM   2681 N N   . ARG A 1 355 ? -18.235 -59.197 9.110   1.00 53.74  ? 356  ARG A N   1 
ATOM   2682 C CA  . ARG A 1 355 ? -17.497 -58.287 8.257   1.00 49.16  ? 356  ARG A CA  1 
ATOM   2683 C C   . ARG A 1 355 ? -18.184 -56.928 8.151   1.00 48.59  ? 356  ARG A C   1 
ATOM   2684 O O   . ARG A 1 355 ? -17.520 -55.894 8.176   1.00 52.62  ? 356  ARG A O   1 
ATOM   2685 C CB  . ARG A 1 355 ? -17.315 -58.901 6.872   1.00 49.80  ? 356  ARG A CB  1 
ATOM   2686 C CG  . ARG A 1 355 ? -16.781 -57.918 5.858   1.00 45.80  ? 356  ARG A CG  1 
ATOM   2687 C CD  . ARG A 1 355 ? -15.442 -58.387 5.400   1.00 48.85  ? 356  ARG A CD  1 
ATOM   2688 N NE  . ARG A 1 355 ? -14.732 -57.365 4.646   1.00 50.25  ? 356  ARG A NE  1 
ATOM   2689 C CZ  . ARG A 1 355 ? -13.439 -57.113 4.810   1.00 46.64  ? 356  ARG A CZ  1 
ATOM   2690 N NH1 . ARG A 1 355 ? -12.739 -57.821 5.699   1.00 42.58  ? 356  ARG A NH1 1 
ATOM   2691 N NH2 . ARG A 1 355 ? -12.853 -56.166 4.091   1.00 42.27  ? 356  ARG A NH2 1 
ATOM   2692 N N   . ALA A 1 356 ? -19.509 -56.919 8.060   1.00 48.08  ? 357  ALA A N   1 
ATOM   2693 C CA  . ALA A 1 356 ? -20.243 -55.656 7.985   1.00 51.33  ? 357  ALA A CA  1 
ATOM   2694 C C   . ALA A 1 356 ? -20.099 -54.852 9.294   1.00 52.77  ? 357  ALA A C   1 
ATOM   2695 O O   . ALA A 1 356 ? -20.023 -53.616 9.267   1.00 52.11  ? 357  ALA A O   1 
ATOM   2696 C CB  . ALA A 1 356 ? -21.720 -55.911 7.659   1.00 42.50  ? 357  ALA A CB  1 
ATOM   2697 N N   . GLU A 1 357 ? -20.061 -55.553 10.428  1.00 49.53  ? 358  GLU A N   1 
ATOM   2698 C CA  . GLU A 1 357 ? -19.842 -54.902 11.726  1.00 54.17  ? 358  GLU A CA  1 
ATOM   2699 C C   . GLU A 1 357 ? -18.418 -54.332 11.797  1.00 52.47  ? 358  GLU A C   1 
ATOM   2700 O O   . GLU A 1 357 ? -18.199 -53.209 12.247  1.00 50.67  ? 358  GLU A O   1 
ATOM   2701 C CB  . GLU A 1 357 ? -20.098 -55.886 12.885  1.00 51.18  ? 358  GLU A CB  1 
ATOM   2702 C CG  . GLU A 1 357 ? -21.596 -56.210 13.090  1.00 54.30  ? 358  GLU A CG  1 
ATOM   2703 C CD  . GLU A 1 357 ? -21.888 -57.270 14.169  1.00 49.90  ? 358  GLU A CD  1 
ATOM   2704 O OE1 . GLU A 1 357 ? -21.094 -58.217 14.345  1.00 45.56  ? 358  GLU A OE1 1 
ATOM   2705 O OE2 . GLU A 1 357 ? -22.943 -57.159 14.836  1.00 56.33  ? 358  GLU A OE2 1 
ATOM   2706 N N   . PHE A 1 358 ? -17.459 -55.114 11.316  1.00 54.51  ? 359  PHE A N   1 
ATOM   2707 C CA  . PHE A 1 358 ? -16.075 -54.674 11.219  1.00 50.63  ? 359  PHE A CA  1 
ATOM   2708 C C   . PHE A 1 358 ? -15.982 -53.378 10.397  1.00 50.67  ? 359  PHE A C   1 
ATOM   2709 O O   . PHE A 1 358 ? -15.372 -52.399 10.834  1.00 51.32  ? 359  PHE A O   1 
ATOM   2710 C CB  . PHE A 1 358 ? -15.220 -55.795 10.615  1.00 47.00  ? 359  PHE A CB  1 
ATOM   2711 C CG  . PHE A 1 358 ? -13.811 -55.392 10.298  1.00 48.48  ? 359  PHE A CG  1 
ATOM   2712 C CD1 . PHE A 1 358 ? -12.813 -55.521 11.246  1.00 45.73  ? 359  PHE A CD1 1 
ATOM   2713 C CD2 . PHE A 1 358 ? -13.482 -54.895 9.044   1.00 50.86  ? 359  PHE A CD2 1 
ATOM   2714 C CE1 . PHE A 1 358 ? -11.513 -55.156 10.958  1.00 46.05  ? 359  PHE A CE1 1 
ATOM   2715 C CE2 . PHE A 1 358 ? -12.177 -54.529 8.737   1.00 47.76  ? 359  PHE A CE2 1 
ATOM   2716 C CZ  . PHE A 1 358 ? -11.192 -54.656 9.695   1.00 49.88  ? 359  PHE A CZ  1 
ATOM   2717 N N   . LEU A 1 359 ? -16.620 -53.372 9.233   1.00 48.84  ? 360  LEU A N   1 
ATOM   2718 C CA  . LEU A 1 359 ? -16.639 -52.204 8.348   1.00 52.32  ? 360  LEU A CA  1 
ATOM   2719 C C   . LEU A 1 359 ? -17.211 -50.981 9.049   1.00 49.68  ? 360  LEU A C   1 
ATOM   2720 O O   . LEU A 1 359 ? -16.699 -49.872 8.901   1.00 52.60  ? 360  LEU A O   1 
ATOM   2721 C CB  . LEU A 1 359 ? -17.443 -52.507 7.066   1.00 40.18  ? 360  LEU A CB  1 
ATOM   2722 C CG  . LEU A 1 359 ? -16.834 -53.592 6.153   1.00 55.38  ? 360  LEU A CG  1 
ATOM   2723 C CD1 . LEU A 1 359 ? -17.488 -53.661 4.753   1.00 49.08  ? 360  LEU A CD1 1 
ATOM   2724 C CD2 . LEU A 1 359 ? -15.311 -53.454 6.022   1.00 45.13  ? 360  LEU A CD2 1 
ATOM   2725 N N   . ALA A 1 360 ? -18.288 -51.176 9.801   1.00 55.13  ? 361  ALA A N   1 
ATOM   2726 C CA  . ALA A 1 360 ? -18.899 -50.068 10.529  1.00 50.31  ? 361  ALA A CA  1 
ATOM   2727 C C   . ALA A 1 360 ? -18.036 -49.690 11.737  1.00 53.80  ? 361  ALA A C   1 
ATOM   2728 O O   . ALA A 1 360 ? -17.948 -48.517 12.111  1.00 51.79  ? 361  ALA A O   1 
ATOM   2729 C CB  . ALA A 1 360 ? -20.304 -50.429 10.963  1.00 48.27  ? 361  ALA A CB  1 
ATOM   2730 N N   . GLY A 1 361 ? -17.397 -50.693 12.337  1.00 49.62  ? 362  GLY A N   1 
ATOM   2731 C CA  . GLY A 1 361 ? -16.507 -50.470 13.462  1.00 46.72  ? 362  GLY A CA  1 
ATOM   2732 C C   . GLY A 1 361 ? -15.390 -49.520 13.091  1.00 50.10  ? 362  GLY A C   1 
ATOM   2733 O O   . GLY A 1 361 ? -15.044 -48.622 13.854  1.00 49.32  ? 362  GLY A O   1 
ATOM   2734 N N   . VAL A 1 362 ? -14.843 -49.708 11.895  1.00 48.51  ? 363  VAL A N   1 
ATOM   2735 C CA  . VAL A 1 362 ? -13.739 -48.900 11.422  1.00 45.16  ? 363  VAL A CA  1 
ATOM   2736 C C   . VAL A 1 362 ? -14.074 -47.395 11.338  1.00 47.54  ? 363  VAL A C   1 
ATOM   2737 O O   . VAL A 1 362 ? -13.227 -46.567 11.662  1.00 47.51  ? 363  VAL A O   1 
ATOM   2738 C CB  . VAL A 1 362 ? -13.260 -49.424 10.049  1.00 52.16  ? 363  VAL A CB  1 
ATOM   2739 C CG1 . VAL A 1 362 ? -12.424 -48.391 9.322   1.00 43.02  ? 363  VAL A CG1 1 
ATOM   2740 C CG2 . VAL A 1 362 ? -12.492 -50.730 10.228  1.00 43.45  ? 363  VAL A CG2 1 
ATOM   2741 N N   . ARG A 1 363 ? -15.285 -47.025 10.917  1.00 49.14  ? 364  ARG A N   1 
ATOM   2742 C CA  . ARG A 1 363 ? -15.617 -45.596 10.839  1.00 50.91  ? 364  ARG A CA  1 
ATOM   2743 C C   . ARG A 1 363 ? -15.819 -45.031 12.246  1.00 56.02  ? 364  ARG A C   1 
ATOM   2744 O O   . ARG A 1 363 ? -15.751 -43.820 12.449  1.00 54.70  ? 364  ARG A O   1 
ATOM   2745 C CB  . ARG A 1 363 ? -16.873 -45.315 10.004  1.00 50.41  ? 364  ARG A CB  1 
ATOM   2746 C CG  . ARG A 1 363 ? -16.902 -45.885 8.612   1.00 56.42  ? 364  ARG A CG  1 
ATOM   2747 C CD  . ARG A 1 363 ? -15.667 -45.539 7.798   1.00 54.43  ? 364  ARG A CD  1 
ATOM   2748 N NE  . ARG A 1 363 ? -15.483 -44.110 7.514   1.00 62.58  ? 364  ARG A NE  1 
ATOM   2749 C CZ  . ARG A 1 363 ? -15.795 -43.523 6.356   1.00 64.97  ? 364  ARG A CZ  1 
ATOM   2750 N NH1 . ARG A 1 363 ? -16.337 -44.238 5.369   1.00 61.74  ? 364  ARG A NH1 1 
ATOM   2751 N NH2 . ARG A 1 363 ? -15.559 -42.222 6.177   1.00 59.51  ? 364  ARG A NH2 1 
ATOM   2752 N N   . VAL A 1 364 ? -16.063 -45.917 13.211  1.00 57.75  ? 365  VAL A N   1 
ATOM   2753 C CA  . VAL A 1 364 ? -16.228 -45.527 14.612  1.00 54.16  ? 365  VAL A CA  1 
ATOM   2754 C C   . VAL A 1 364 ? -14.883 -45.379 15.340  1.00 56.33  ? 365  VAL A C   1 
ATOM   2755 O O   . VAL A 1 364 ? -14.698 -44.458 16.144  1.00 59.85  ? 365  VAL A O   1 
ATOM   2756 C CB  . VAL A 1 364 ? -17.114 -46.550 15.367  1.00 56.28  ? 365  VAL A CB  1 
ATOM   2757 C CG1 . VAL A 1 364 ? -17.062 -46.310 16.853  1.00 54.74  ? 365  VAL A CG1 1 
ATOM   2758 C CG2 . VAL A 1 364 ? -18.557 -46.474 14.859  1.00 56.20  ? 365  VAL A CG2 1 
ATOM   2759 N N   . GLY A 1 365 ? -13.946 -46.278 15.052  1.00 49.87  ? 366  GLY A N   1 
ATOM   2760 C CA  . GLY A 1 365 ? -12.633 -46.240 15.679  1.00 53.31  ? 366  GLY A CA  1 
ATOM   2761 C C   . GLY A 1 365 ? -11.630 -45.370 14.916  1.00 53.05  ? 366  GLY A C   1 
ATOM   2762 O O   . GLY A 1 365 ? -10.508 -45.148 15.357  1.00 55.85  ? 366  GLY A O   1 
ATOM   2763 N N   . VAL A 1 366 ? -12.028 -44.886 13.755  1.00 47.33  ? 367  VAL A N   1 
ATOM   2764 C CA  . VAL A 1 366 ? -11.196 -43.967 12.989  1.00 56.05  ? 367  VAL A CA  1 
ATOM   2765 C C   . VAL A 1 366 ? -12.103 -42.851 12.495  1.00 52.41  ? 367  VAL A C   1 
ATOM   2766 O O   . VAL A 1 366 ? -12.400 -42.766 11.304  1.00 54.68  ? 367  VAL A O   1 
ATOM   2767 C CB  . VAL A 1 366 ? -10.483 -44.653 11.778  1.00 43.79  ? 367  VAL A CB  1 
ATOM   2768 C CG1 . VAL A 1 366 ? -9.408  -43.754 11.213  1.00 46.88  ? 367  VAL A CG1 1 
ATOM   2769 C CG2 . VAL A 1 366 ? -9.857  -45.962 12.177  1.00 41.62  ? 367  VAL A CG2 1 
ATOM   2770 N N   . PRO A 1 367 ? -12.564 -41.998 13.417  1.00 55.33  ? 368  PRO A N   1 
ATOM   2771 C CA  . PRO A 1 367 ? -13.600 -41.014 13.090  1.00 55.42  ? 368  PRO A CA  1 
ATOM   2772 C C   . PRO A 1 367 ? -13.093 -39.837 12.267  1.00 57.99  ? 368  PRO A C   1 
ATOM   2773 O O   . PRO A 1 367 ? -11.919 -39.458 12.350  1.00 61.02  ? 368  PRO A O   1 
ATOM   2774 C CB  . PRO A 1 367 ? -14.077 -40.543 14.467  1.00 60.53  ? 368  PRO A CB  1 
ATOM   2775 C CG  . PRO A 1 367 ? -12.906 -40.726 15.340  1.00 51.90  ? 368  PRO A CG  1 
ATOM   2776 C CD  . PRO A 1 367 ? -12.163 -41.931 14.833  1.00 53.16  ? 368  PRO A CD  1 
ATOM   2777 N N   . GLN A 1 368 ? -13.998 -39.286 11.466  1.00 60.26  ? 369  GLN A N   1 
ATOM   2778 C CA  . GLN A 1 368 ? -13.769 -38.048 10.735  1.00 67.00  ? 369  GLN A CA  1 
ATOM   2779 C C   . GLN A 1 368 ? -12.631 -38.124 9.713   1.00 68.76  ? 369  GLN A C   1 
ATOM   2780 O O   . GLN A 1 368 ? -11.962 -37.122 9.454   1.00 67.12  ? 369  GLN A O   1 
ATOM   2781 C CB  . GLN A 1 368 ? -13.513 -36.899 11.725  1.00 70.82  ? 369  GLN A CB  1 
ATOM   2782 C CG  . GLN A 1 368 ? -14.695 -36.623 12.674  1.00 72.18  ? 369  GLN A CG  1 
ATOM   2783 C CD  . GLN A 1 368 ? -15.991 -36.281 11.932  1.00 76.11  ? 369  GLN A CD  1 
ATOM   2784 O OE1 . GLN A 1 368 ? -16.946 -37.067 11.915  1.00 73.38  ? 369  GLN A OE1 1 
ATOM   2785 N NE2 . GLN A 1 368 ? -16.027 -35.099 11.323  1.00 66.06  ? 369  GLN A NE2 1 
ATOM   2786 N N   . VAL A 1 369 ? -12.415 -39.300 9.127   1.00 62.30  ? 370  VAL A N   1 
ATOM   2787 C CA  . VAL A 1 369 ? -11.519 -39.394 7.975   1.00 63.10  ? 370  VAL A CA  1 
ATOM   2788 C C   . VAL A 1 369 ? -12.338 -39.681 6.724   1.00 60.27  ? 370  VAL A C   1 
ATOM   2789 O O   . VAL A 1 369 ? -13.491 -40.102 6.811   1.00 64.55  ? 370  VAL A O   1 
ATOM   2790 C CB  . VAL A 1 369 ? -10.447 -40.479 8.153   1.00 61.26  ? 370  VAL A CB  1 
ATOM   2791 C CG1 . VAL A 1 369 ? -9.687  -40.254 9.447   1.00 53.62  ? 370  VAL A CG1 1 
ATOM   2792 C CG2 . VAL A 1 369 ? -11.082 -41.867 8.125   1.00 54.03  ? 370  VAL A CG2 1 
ATOM   2793 N N   . SER A 1 370 ? -11.751 -39.452 5.557   1.00 58.29  ? 371  SER A N   1 
ATOM   2794 C CA  . SER A 1 370 ? -12.487 -39.648 4.309   1.00 56.71  ? 371  SER A CA  1 
ATOM   2795 C C   . SER A 1 370 ? -12.804 -41.127 4.043   1.00 60.61  ? 371  SER A C   1 
ATOM   2796 O O   . SER A 1 370 ? -12.195 -42.030 4.641   1.00 53.96  ? 371  SER A O   1 
ATOM   2797 C CB  . SER A 1 370 ? -11.697 -39.070 3.139   1.00 60.71  ? 371  SER A CB  1 
ATOM   2798 O OG  . SER A 1 370 ? -10.485 -39.783 2.938   1.00 63.27  ? 371  SER A OG  1 
ATOM   2799 N N   . ASP A 1 371 ? -13.769 -41.365 3.154   1.00 59.83  ? 372  ASP A N   1 
ATOM   2800 C CA  . ASP A 1 371 ? -14.071 -42.718 2.694   1.00 60.85  ? 372  ASP A CA  1 
ATOM   2801 C C   . ASP A 1 371 ? -12.807 -43.414 2.180   1.00 57.74  ? 372  ASP A C   1 
ATOM   2802 O O   . ASP A 1 371 ? -12.552 -44.584 2.484   1.00 49.51  ? 372  ASP A O   1 
ATOM   2803 C CB  . ASP A 1 371 ? -15.126 -42.694 1.580   1.00 64.10  ? 372  ASP A CB  1 
ATOM   2804 C CG  . ASP A 1 371 ? -16.534 -42.461 2.098   1.00 72.81  ? 372  ASP A CG  1 
ATOM   2805 O OD1 . ASP A 1 371 ? -16.802 -42.728 3.291   1.00 72.09  ? 372  ASP A OD1 1 
ATOM   2806 O OD2 . ASP A 1 371 ? -17.385 -42.017 1.292   1.00 84.47  ? 372  ASP A OD2 1 
ATOM   2807 N N   . LEU A 1 372 ? -12.024 -42.683 1.388   1.00 52.83  ? 373  LEU A N   1 
ATOM   2808 C CA  . LEU A 1 372 ? -10.826 -43.252 0.799   1.00 53.52  ? 373  LEU A CA  1 
ATOM   2809 C C   . LEU A 1 372 ? -9.860  -43.675 1.915   1.00 52.21  ? 373  LEU A C   1 
ATOM   2810 O O   . LEU A 1 372 ? -9.236  -44.734 1.845   1.00 51.20  ? 373  LEU A O   1 
ATOM   2811 C CB  . LEU A 1 372 ? -10.177 -42.256 -0.170  1.00 51.30  ? 373  LEU A CB  1 
ATOM   2812 C CG  . LEU A 1 372 ? -8.882  -42.753 -0.821  1.00 54.06  ? 373  LEU A CG  1 
ATOM   2813 C CD1 . LEU A 1 372 ? -9.155  -43.907 -1.774  1.00 50.65  ? 373  LEU A CD1 1 
ATOM   2814 C CD2 . LEU A 1 372 ? -8.135  -41.624 -1.501  1.00 51.49  ? 373  LEU A CD2 1 
ATOM   2815 N N   . ALA A 1 373 ? -9.779  -42.865 2.966   1.00 52.21  ? 374  ALA A N   1 
ATOM   2816 C CA  . ALA A 1 373 ? -8.928  -43.170 4.110   1.00 46.98  ? 374  ALA A CA  1 
ATOM   2817 C C   . ALA A 1 373 ? -9.398  -44.435 4.816   1.00 46.47  ? 374  ALA A C   1 
ATOM   2818 O O   . ALA A 1 373 ? -8.598  -45.305 5.184   1.00 45.12  ? 374  ALA A O   1 
ATOM   2819 C CB  . ALA A 1 373 ? -8.900  -41.990 5.074   1.00 45.79  ? 374  ALA A CB  1 
ATOM   2820 N N   . ALA A 1 374 ? -10.705 -44.545 5.004   1.00 48.09  ? 375  ALA A N   1 
ATOM   2821 C CA  . ALA A 1 374 ? -11.249 -45.711 5.679   1.00 44.63  ? 375  ALA A CA  1 
ATOM   2822 C C   . ALA A 1 374 ? -10.998 -46.983 4.856   1.00 53.03  ? 375  ALA A C   1 
ATOM   2823 O O   . ALA A 1 374 ? -10.659 -48.038 5.417   1.00 53.59  ? 375  ALA A O   1 
ATOM   2824 C CB  . ALA A 1 374 ? -12.714 -45.522 5.947   1.00 42.79  ? 375  ALA A CB  1 
ATOM   2825 N N   . GLU A 1 375 ? -11.155 -46.875 3.536   1.00 45.72  ? 376  GLU A N   1 
ATOM   2826 C CA  . GLU A 1 375 ? -10.854 -47.976 2.631   1.00 47.24  ? 376  GLU A CA  1 
ATOM   2827 C C   . GLU A 1 375 ? -9.430  -48.457 2.779   1.00 44.18  ? 376  GLU A C   1 
ATOM   2828 O O   . GLU A 1 375 ? -9.187  -49.661 2.886   1.00 47.07  ? 376  GLU A O   1 
ATOM   2829 C CB  . GLU A 1 375 ? -11.089 -47.574 1.162   1.00 58.44  ? 376  GLU A CB  1 
ATOM   2830 C CG  . GLU A 1 375 ? -12.542 -47.359 0.772   1.00 62.02  ? 376  GLU A CG  1 
ATOM   2831 C CD  . GLU A 1 375 ? -13.301 -48.646 0.520   1.00 70.45  ? 376  GLU A CD  1 
ATOM   2832 O OE1 . GLU A 1 375 ? -12.846 -49.733 0.950   1.00 72.98  ? 376  GLU A OE1 1 
ATOM   2833 O OE2 . GLU A 1 375 ? -14.366 -48.571 -0.126  1.00 85.13  ? 376  GLU A OE2 1 
ATOM   2834 N N   . ALA A 1 376 ? -8.485  -47.522 2.760   1.00 41.01  ? 377  ALA A N   1 
ATOM   2835 C CA  . ALA A 1 376 ? -7.079  -47.868 2.997   1.00 44.18  ? 377  ALA A CA  1 
ATOM   2836 C C   . ALA A 1 376 ? -6.885  -48.633 4.316   1.00 44.88  ? 377  ALA A C   1 
ATOM   2837 O O   . ALA A 1 376 ? -6.022  -49.529 4.412   1.00 46.96  ? 377  ALA A O   1 
ATOM   2838 C CB  . ALA A 1 376 ? -6.216  -46.616 2.989   1.00 43.08  ? 377  ALA A CB  1 
ATOM   2839 N N   . VAL A 1 377 ? -7.685  -48.294 5.328   1.00 41.33  ? 378  VAL A N   1 
ATOM   2840 C CA  . VAL A 1 377 ? -7.578  -48.974 6.614   1.00 43.01  ? 378  VAL A CA  1 
ATOM   2841 C C   . VAL A 1 377 ? -8.055  -50.418 6.484   1.00 37.42  ? 378  VAL A C   1 
ATOM   2842 O O   . VAL A 1 377 ? -7.362  -51.356 6.880   1.00 39.32  ? 378  VAL A O   1 
ATOM   2843 C CB  . VAL A 1 377 ? -8.381  -48.233 7.733   1.00 36.46  ? 378  VAL A CB  1 
ATOM   2844 C CG1 . VAL A 1 377 ? -8.410  -49.052 8.975   1.00 34.42  ? 378  VAL A CG1 1 
ATOM   2845 C CG2 . VAL A 1 377 ? -7.763  -46.869 8.016   1.00 35.76  ? 378  VAL A CG2 1 
ATOM   2846 N N   . VAL A 1 378 ? -9.231  -50.593 5.904   1.00 37.65  ? 379  VAL A N   1 
ATOM   2847 C CA  . VAL A 1 378 ? -9.782  -51.927 5.676   1.00 41.83  ? 379  VAL A CA  1 
ATOM   2848 C C   . VAL A 1 378 ? -8.861  -52.822 4.821   1.00 51.02  ? 379  VAL A C   1 
ATOM   2849 O O   . VAL A 1 378 ? -8.753  -54.038 5.052   1.00 47.42  ? 379  VAL A O   1 
ATOM   2850 C CB  . VAL A 1 378 ? -11.161 -51.828 5.011   1.00 49.87  ? 379  VAL A CB  1 
ATOM   2851 C CG1 . VAL A 1 378 ? -11.692 -53.207 4.711   1.00 53.89  ? 379  VAL A CG1 1 
ATOM   2852 C CG2 . VAL A 1 378 ? -12.132 -51.091 5.941   1.00 44.38  ? 379  VAL A CG2 1 
ATOM   2853 N N   . LEU A 1 379 ? -8.187  -52.213 3.846   1.00 44.03  ? 380  LEU A N   1 
ATOM   2854 C CA  . LEU A 1 379 ? -7.224  -52.927 3.023   1.00 46.45  ? 380  LEU A CA  1 
ATOM   2855 C C   . LEU A 1 379 ? -6.062  -53.476 3.823   1.00 47.76  ? 380  LEU A C   1 
ATOM   2856 O O   . LEU A 1 379 ? -5.705  -54.654 3.672   1.00 44.01  ? 380  LEU A O   1 
ATOM   2857 C CB  . LEU A 1 379 ? -6.661  -52.016 1.908   1.00 46.83  ? 380  LEU A CB  1 
ATOM   2858 C CG  . LEU A 1 379 ? -5.252  -52.367 1.393   1.00 48.44  ? 380  LEU A CG  1 
ATOM   2859 C CD1 . LEU A 1 379 ? -5.243  -53.626 0.470   1.00 39.07  ? 380  LEU A CD1 1 
ATOM   2860 C CD2 . LEU A 1 379 ? -4.574  -51.156 0.745   1.00 50.48  ? 380  LEU A CD2 1 
ATOM   2861 N N   A HIS A 1 380 ? -5.452  -52.614 4.636   0.54 44.25  ? 381  HIS A N   1 
ATOM   2862 N N   B HIS A 1 380 ? -5.464  -52.635 4.667   0.46 44.28  ? 381  HIS A N   1 
ATOM   2863 C CA  A HIS A 1 380 ? -4.286  -52.999 5.412   0.54 45.07  ? 381  HIS A CA  1 
ATOM   2864 C CA  B HIS A 1 380 ? -4.274  -53.040 5.405   0.46 45.25  ? 381  HIS A CA  1 
ATOM   2865 C C   A HIS A 1 380 ? -4.676  -54.078 6.429   0.54 45.68  ? 381  HIS A C   1 
ATOM   2866 C C   B HIS A 1 380 ? -4.591  -53.946 6.594   0.46 45.75  ? 381  HIS A C   1 
ATOM   2867 O O   A HIS A 1 380 ? -3.966  -55.073 6.589   0.54 47.34  ? 381  HIS A O   1 
ATOM   2868 O O   B HIS A 1 380 ? -3.719  -54.672 7.072   0.46 47.68  ? 381  HIS A O   1 
ATOM   2869 C CB  A HIS A 1 380 ? -3.671  -51.761 6.100   0.54 45.51  ? 381  HIS A CB  1 
ATOM   2870 C CB  B HIS A 1 380 ? -3.493  -51.810 5.884   0.46 45.51  ? 381  HIS A CB  1 
ATOM   2871 C CG  A HIS A 1 380 ? -2.425  -52.046 6.884   0.54 45.68  ? 381  HIS A CG  1 
ATOM   2872 C CG  B HIS A 1 380 ? -2.521  -51.288 4.876   0.46 47.17  ? 381  HIS A CG  1 
ATOM   2873 N ND1 A HIS A 1 380 ? -1.158  -51.815 6.388   0.54 44.53  ? 381  HIS A ND1 1 
ATOM   2874 N ND1 B HIS A 1 380 ? -2.889  -50.426 3.865   0.46 44.11  ? 381  HIS A ND1 1 
ATOM   2875 C CD2 A HIS A 1 380 ? -2.254  -52.533 8.138   0.54 45.64  ? 381  HIS A CD2 1 
ATOM   2876 C CD2 B HIS A 1 380 ? -1.196  -51.518 4.714   0.46 46.47  ? 381  HIS A CD2 1 
ATOM   2877 C CE1 A HIS A 1 380 ? -0.261  -52.158 7.299   0.54 41.79  ? 381  HIS A CE1 1 
ATOM   2878 C CE1 B HIS A 1 380 ? -1.832  -50.144 3.126   0.46 47.67  ? 381  HIS A CE1 1 
ATOM   2879 N NE2 A HIS A 1 380 ? -0.900  -52.602 8.368   0.54 43.69  ? 381  HIS A NE2 1 
ATOM   2880 N NE2 B HIS A 1 380 ? -0.792  -50.793 3.619   0.46 49.36  ? 381  HIS A NE2 1 
ATOM   2881 N N   . TYR A 1 381 ? -5.825  -53.906 7.082   1.00 46.14  ? 382  TYR A N   1 
ATOM   2882 C CA  . TYR A 1 381 ? -6.187  -54.762 8.216   1.00 42.86  ? 382  TYR A CA  1 
ATOM   2883 C C   . TYR A 1 381 ? -7.066  -55.961 7.861   1.00 42.64  ? 382  TYR A C   1 
ATOM   2884 O O   . TYR A 1 381 ? -7.401  -56.760 8.717   1.00 49.60  ? 382  TYR A O   1 
ATOM   2885 C CB  . TYR A 1 381 ? -6.862  -53.923 9.308   1.00 45.22  ? 382  TYR A CB  1 
ATOM   2886 C CG  . TYR A 1 381 ? -5.892  -53.057 10.087  1.00 41.77  ? 382  TYR A CG  1 
ATOM   2887 C CD1 . TYR A 1 381 ? -5.304  -53.520 11.258  1.00 43.83  ? 382  TYR A CD1 1 
ATOM   2888 C CD2 . TYR A 1 381 ? -5.557  -51.781 9.646   1.00 37.04  ? 382  TYR A CD2 1 
ATOM   2889 C CE1 . TYR A 1 381 ? -4.412  -52.729 11.985  1.00 39.64  ? 382  TYR A CE1 1 
ATOM   2890 C CE2 . TYR A 1 381 ? -4.655  -50.997 10.344  1.00 37.38  ? 382  TYR A CE2 1 
ATOM   2891 C CZ  . TYR A 1 381 ? -4.098  -51.475 11.529  1.00 39.54  ? 382  TYR A CZ  1 
ATOM   2892 O OH  . TYR A 1 381 ? -3.214  -50.701 12.245  1.00 39.20  ? 382  TYR A OH  1 
ATOM   2893 N N   . THR A 1 382 ? -7.418  -56.124 6.595   1.00 50.53  ? 383  THR A N   1 
ATOM   2894 C CA  . THR A 1 382 ? -8.104  -57.341 6.203   1.00 41.71  ? 383  THR A CA  1 
ATOM   2895 C C   . THR A 1 382 ? -7.089  -58.414 5.866   1.00 42.63  ? 383  THR A C   1 
ATOM   2896 O O   . THR A 1 382 ? -6.077  -58.121 5.235   1.00 40.36  ? 383  THR A O   1 
ATOM   2897 C CB  . THR A 1 382 ? -9.007  -57.088 5.016   1.00 44.50  ? 383  THR A CB  1 
ATOM   2898 O OG1 . THR A 1 382 ? -10.088 -56.246 5.431   1.00 42.15  ? 383  THR A OG1 1 
ATOM   2899 C CG2 . THR A 1 382 ? -9.555  -58.399 4.454   1.00 47.82  ? 383  THR A CG2 1 
ATOM   2900 N N   . ASP A 1 383 ? -7.328  -59.642 6.317   1.00 39.58  ? 384  ASP A N   1 
ATOM   2901 C CA  . ASP A 1 383 ? -6.596  -60.801 5.792   1.00 43.47  ? 384  ASP A CA  1 
ATOM   2902 C C   . ASP A 1 383 ? -7.391  -61.340 4.592   1.00 41.82  ? 384  ASP A C   1 
ATOM   2903 O O   . ASP A 1 383 ? -8.458  -61.931 4.753   1.00 38.51  ? 384  ASP A O   1 
ATOM   2904 C CB  . ASP A 1 383 ? -6.408  -61.878 6.873   1.00 39.46  ? 384  ASP A CB  1 
ATOM   2905 C CG  . ASP A 1 383 ? -5.754  -63.153 6.334   1.00 51.27  ? 384  ASP A CG  1 
ATOM   2906 O OD1 . ASP A 1 383 ? -5.837  -63.439 5.115   1.00 52.03  ? 384  ASP A OD1 1 
ATOM   2907 O OD2 . ASP A 1 383 ? -5.160  -63.899 7.139   1.00 53.15  ? 384  ASP A OD2 1 
ATOM   2908 N N   . TRP A 1 384 ? -6.883  -61.141 3.387   1.00 42.88  ? 385  TRP A N   1 
ATOM   2909 C CA  . TRP A 1 384 ? -7.715  -61.410 2.219   1.00 44.09  ? 385  TRP A CA  1 
ATOM   2910 C C   . TRP A 1 384 ? -7.834  -62.902 1.880   1.00 40.94  ? 385  TRP A C   1 
ATOM   2911 O O   . TRP A 1 384 ? -8.569  -63.271 0.967   1.00 44.38  ? 385  TRP A O   1 
ATOM   2912 C CB  . TRP A 1 384 ? -7.208  -60.593 1.035   1.00 43.92  ? 385  TRP A CB  1 
ATOM   2913 C CG  . TRP A 1 384 ? -7.440  -59.139 1.301   1.00 39.37  ? 385  TRP A CG  1 
ATOM   2914 C CD1 . TRP A 1 384 ? -6.539  -58.239 1.806   1.00 42.12  ? 385  TRP A CD1 1 
ATOM   2915 C CD2 . TRP A 1 384 ? -8.673  -58.438 1.162   1.00 34.24  ? 385  TRP A CD2 1 
ATOM   2916 N NE1 . TRP A 1 384 ? -7.133  -57.009 1.952   1.00 42.36  ? 385  TRP A NE1 1 
ATOM   2917 C CE2 . TRP A 1 384 ? -8.443  -57.104 1.555   1.00 40.73  ? 385  TRP A CE2 1 
ATOM   2918 C CE3 . TRP A 1 384 ? -9.953  -58.807 0.741   1.00 36.59  ? 385  TRP A CE3 1 
ATOM   2919 C CZ2 . TRP A 1 384 ? -9.444  -56.135 1.534   1.00 39.34  ? 385  TRP A CZ2 1 
ATOM   2920 C CZ3 . TRP A 1 384 ? -10.942 -57.845 0.703   1.00 38.22  ? 385  TRP A CZ3 1 
ATOM   2921 C CH2 . TRP A 1 384 ? -10.682 -56.522 1.097   1.00 40.43  ? 385  TRP A CH2 1 
ATOM   2922 N N   . LEU A 1 385 ? -7.153  -63.747 2.649   1.00 41.72  ? 386  LEU A N   1 
ATOM   2923 C CA  . LEU A 1 385 ? -7.435  -65.182 2.660   1.00 44.20  ? 386  LEU A CA  1 
ATOM   2924 C C   . LEU A 1 385 ? -8.566  -65.558 3.638   1.00 52.61  ? 386  LEU A C   1 
ATOM   2925 O O   . LEU A 1 385 ? -9.146  -66.645 3.540   1.00 52.35  ? 386  LEU A O   1 
ATOM   2926 C CB  . LEU A 1 385 ? -6.167  -65.965 3.002   1.00 42.38  ? 386  LEU A CB  1 
ATOM   2927 C CG  . LEU A 1 385 ? -5.138  -65.923 1.860   1.00 52.02  ? 386  LEU A CG  1 
ATOM   2928 C CD1 . LEU A 1 385 ? -3.874  -66.701 2.196   1.00 52.75  ? 386  LEU A CD1 1 
ATOM   2929 C CD2 . LEU A 1 385 ? -5.778  -66.472 0.616   1.00 41.48  ? 386  LEU A CD2 1 
ATOM   2930 N N   . HIS A 1 386 ? -8.861  -64.669 4.586   1.00 50.39  ? 387  HIS A N   1 
ATOM   2931 C CA  . HIS A 1 386 ? -9.904  -64.920 5.594   1.00 49.95  ? 387  HIS A CA  1 
ATOM   2932 C C   . HIS A 1 386 ? -10.661 -63.648 5.876   1.00 46.52  ? 387  HIS A C   1 
ATOM   2933 O O   . HIS A 1 386 ? -10.648 -63.142 6.999   1.00 55.68  ? 387  HIS A O   1 
ATOM   2934 C CB  . HIS A 1 386 ? -9.304  -65.453 6.901   1.00 42.36  ? 387  HIS A CB  1 
ATOM   2935 C CG  . HIS A 1 386 ? -8.420  -66.644 6.718   1.00 47.00  ? 387  HIS A CG  1 
ATOM   2936 N ND1 . HIS A 1 386 ? -8.899  -67.938 6.757   1.00 42.45  ? 387  HIS A ND1 1 
ATOM   2937 C CD2 . HIS A 1 386 ? -7.086  -66.740 6.495   1.00 46.68  ? 387  HIS A CD2 1 
ATOM   2938 C CE1 . HIS A 1 386 ? -7.894  -68.780 6.562   1.00 46.88  ? 387  HIS A CE1 1 
ATOM   2939 N NE2 . HIS A 1 386 ? -6.784  -68.079 6.400   1.00 45.96  ? 387  HIS A NE2 1 
ATOM   2940 N N   . PRO A 1 387 ? -11.321 -63.109 4.854   1.00 49.22  ? 388  PRO A N   1 
ATOM   2941 C CA  . PRO A 1 387 ? -11.860 -61.751 4.976   1.00 43.87  ? 388  PRO A CA  1 
ATOM   2942 C C   . PRO A 1 387 ? -13.042 -61.640 5.923   1.00 50.38  ? 388  PRO A C   1 
ATOM   2943 O O   . PRO A 1 387 ? -13.450 -60.517 6.259   1.00 48.88  ? 388  PRO A O   1 
ATOM   2944 C CB  . PRO A 1 387 ? -12.294 -61.422 3.539   1.00 45.55  ? 388  PRO A CB  1 
ATOM   2945 C CG  . PRO A 1 387 ? -12.539 -62.765 2.904   1.00 41.78  ? 388  PRO A CG  1 
ATOM   2946 C CD  . PRO A 1 387 ? -11.528 -63.680 3.508   1.00 45.64  ? 388  PRO A CD  1 
ATOM   2947 N N   . GLU A 1 388 ? -13.583 -62.777 6.351   1.00 50.01  ? 389  GLU A N   1 
ATOM   2948 C CA  . GLU A 1 388 ? -14.884 -62.774 7.019   1.00 51.09  ? 389  GLU A CA  1 
ATOM   2949 C C   . GLU A 1 388 ? -14.926 -63.570 8.304   1.00 49.71  ? 389  GLU A C   1 
ATOM   2950 O O   . GLU A 1 388 ? -15.995 -63.729 8.881   1.00 51.82  ? 389  GLU A O   1 
ATOM   2951 C CB  . GLU A 1 388 ? -15.960 -63.308 6.064   1.00 54.01  ? 389  GLU A CB  1 
ATOM   2952 C CG  . GLU A 1 388 ? -16.187 -62.404 4.861   1.00 52.81  ? 389  GLU A CG  1 
ATOM   2953 C CD  . GLU A 1 388 ? -17.600 -62.468 4.357   1.00 64.82  ? 389  GLU A CD  1 
ATOM   2954 O OE1 . GLU A 1 388 ? -18.358 -61.498 4.584   1.00 73.96  ? 389  GLU A OE1 1 
ATOM   2955 O OE2 . GLU A 1 388 ? -17.958 -63.490 3.734   1.00 78.53  ? 389  GLU A OE2 1 
ATOM   2956 N N   . ASP A 1 389 ? -13.773 -64.081 8.734   1.00 44.31  ? 390  ASP A N   1 
ATOM   2957 C CA  . ASP A 1 389 ? -13.662 -64.822 9.984   1.00 51.81  ? 390  ASP A CA  1 
ATOM   2958 C C   . ASP A 1 389 ? -13.835 -63.904 11.216  1.00 53.84  ? 390  ASP A C   1 
ATOM   2959 O O   . ASP A 1 389 ? -13.037 -62.997 11.438  1.00 49.90  ? 390  ASP A O   1 
ATOM   2960 C CB  . ASP A 1 389 ? -12.310 -65.540 10.040  1.00 51.22  ? 390  ASP A CB  1 
ATOM   2961 C CG  . ASP A 1 389 ? -12.113 -66.294 11.326  1.00 57.60  ? 390  ASP A CG  1 
ATOM   2962 O OD1 . ASP A 1 389 ? -13.127 -66.635 11.968  1.00 62.20  ? 390  ASP A OD1 1 
ATOM   2963 O OD2 . ASP A 1 389 ? -10.944 -66.553 11.704  1.00 64.33  ? 390  ASP A OD2 1 
ATOM   2964 N N   . PRO A 1 390 ? -14.898 -64.133 12.003  1.00 55.55  ? 391  PRO A N   1 
ATOM   2965 C CA  . PRO A 1 390 ? -15.254 -63.314 13.178  1.00 53.67  ? 391  PRO A CA  1 
ATOM   2966 C C   . PRO A 1 390 ? -14.109 -63.037 14.144  1.00 46.93  ? 391  PRO A C   1 
ATOM   2967 O O   . PRO A 1 390 ? -13.868 -61.875 14.448  1.00 47.23  ? 391  PRO A O   1 
ATOM   2968 C CB  . PRO A 1 390 ? -16.333 -64.149 13.856  1.00 49.69  ? 391  PRO A CB  1 
ATOM   2969 C CG  . PRO A 1 390 ? -17.047 -64.797 12.660  1.00 58.91  ? 391  PRO A CG  1 
ATOM   2970 C CD  . PRO A 1 390 ? -15.952 -65.113 11.669  1.00 51.69  ? 391  PRO A CD  1 
ATOM   2971 N N   . ALA A 1 391 ? -13.419 -64.072 14.607  1.00 44.30  ? 392  ALA A N   1 
ATOM   2972 C CA  . ALA A 1 391 ? -12.324 -63.891 15.552  1.00 46.61  ? 392  ALA A CA  1 
ATOM   2973 C C   . ALA A 1 391 ? -11.229 -62.958 15.016  1.00 49.00  ? 392  ALA A C   1 
ATOM   2974 O O   . ALA A 1 391 ? -10.753 -62.063 15.730  1.00 43.76  ? 392  ALA A O   1 
ATOM   2975 C CB  . ALA A 1 391 ? -11.732 -65.238 15.924  1.00 47.78  ? 392  ALA A CB  1 
ATOM   2976 N N   . ARG A 1 392 ? -10.844 -63.157 13.758  1.00 45.50  ? 393  ARG A N   1 
ATOM   2977 C CA  . ARG A 1 392 ? -9.808  -62.331 13.151  1.00 43.08  ? 393  ARG A CA  1 
ATOM   2978 C C   . ARG A 1 392 ? -10.288 -60.896 13.001  1.00 40.57  ? 393  ARG A C   1 
ATOM   2979 O O   . ARG A 1 392 ? -9.499  -59.958 13.092  1.00 41.10  ? 393  ARG A O   1 
ATOM   2980 C CB  . ARG A 1 392 ? -9.382  -62.897 11.789  1.00 46.58  ? 393  ARG A CB  1 
ATOM   2981 C CG  . ARG A 1 392 ? -8.438  -64.099 11.861  1.00 44.68  ? 393  ARG A CG  1 
ATOM   2982 C CD  . ARG A 1 392 ? -8.048  -64.512 10.425  1.00 48.83  ? 393  ARG A CD  1 
ATOM   2983 N NE  . ARG A 1 392 ? -7.057  -65.598 10.368  1.00 46.01  ? 393  ARG A NE  1 
ATOM   2984 C CZ  . ARG A 1 392 ? -7.367  -66.890 10.238  1.00 48.83  ? 393  ARG A CZ  1 
ATOM   2985 N NH1 . ARG A 1 392 ? -8.637  -67.275 10.165  1.00 50.58  ? 393  ARG A NH1 1 
ATOM   2986 N NH2 . ARG A 1 392 ? -6.401  -67.799 10.188  1.00 42.87  ? 393  ARG A NH2 1 
ATOM   2987 N N   . LEU A 1 393 ? -11.580 -60.731 12.763  1.00 35.75  ? 394  LEU A N   1 
ATOM   2988 C CA  . LEU A 1 393 ? -12.148 -59.405 12.597  1.00 40.29  ? 394  LEU A CA  1 
ATOM   2989 C C   . LEU A 1 393 ? -12.127 -58.629 13.923  1.00 42.66  ? 394  LEU A C   1 
ATOM   2990 O O   . LEU A 1 393 ? -11.839 -57.419 13.948  1.00 40.48  ? 394  LEU A O   1 
ATOM   2991 C CB  . LEU A 1 393 ? -13.577 -59.503 12.050  1.00 38.90  ? 394  LEU A CB  1 
ATOM   2992 C CG  . LEU A 1 393 ? -13.700 -59.985 10.592  1.00 52.88  ? 394  LEU A CG  1 
ATOM   2993 C CD1 . LEU A 1 393 ? -15.142 -60.429 10.218  1.00 44.90  ? 394  LEU A CD1 1 
ATOM   2994 C CD2 . LEU A 1 393 ? -13.212 -58.910 9.636   1.00 42.57  ? 394  LEU A CD2 1 
ATOM   2995 N N   . ARG A 1 394 ? -12.447 -59.336 15.013  1.00 39.10  ? 395  ARG A N   1 
ATOM   2996 C CA  . ARG A 1 394 ? -12.467 -58.755 16.340  1.00 43.52  ? 395  ARG A CA  1 
ATOM   2997 C C   . ARG A 1 394 ? -11.059 -58.284 16.698  1.00 41.86  ? 395  ARG A C   1 
ATOM   2998 O O   . ARG A 1 394 ? -10.875 -57.165 17.165  1.00 41.17  ? 395  ARG A O   1 
ATOM   2999 C CB  . ARG A 1 394 ? -12.984 -59.779 17.360  1.00 44.65  ? 395  ARG A CB  1 
ATOM   3000 C CG  . ARG A 1 394 ? -12.993 -59.328 18.813  1.00 43.52  ? 395  ARG A CG  1 
ATOM   3001 C CD  . ARG A 1 394 ? -13.238 -60.527 19.716  1.00 43.73  ? 395  ARG A CD  1 
ATOM   3002 N NE  . ARG A 1 394 ? -12.134 -61.478 19.661  1.00 47.48  ? 395  ARG A NE  1 
ATOM   3003 C CZ  . ARG A 1 394 ? -12.236 -62.767 19.968  1.00 53.00  ? 395  ARG A CZ  1 
ATOM   3004 N NH1 . ARG A 1 394 ? -13.407 -63.276 20.344  1.00 54.09  ? 395  ARG A NH1 1 
ATOM   3005 N NH2 . ARG A 1 394 ? -11.166 -63.551 19.899  1.00 46.51  ? 395  ARG A NH2 1 
ATOM   3006 N N   . GLU A 1 395 ? -10.077 -59.149 16.449  1.00 44.84  ? 396  GLU A N   1 
ATOM   3007 C CA  . GLU A 1 395 ? -8.674  -58.842 16.709  1.00 46.53  ? 396  GLU A CA  1 
ATOM   3008 C C   . GLU A 1 395 ? -8.201  -57.716 15.792  1.00 41.87  ? 396  GLU A C   1 
ATOM   3009 O O   . GLU A 1 395 ? -7.420  -56.873 16.207  1.00 45.05  ? 396  GLU A O   1 
ATOM   3010 C CB  . GLU A 1 395 ? -7.791  -60.087 16.522  1.00 35.66  ? 396  GLU A CB  1 
ATOM   3011 C CG  . GLU A 1 395 ? -7.432  -60.844 17.783  1.00 56.15  ? 396  GLU A CG  1 
ATOM   3012 C CD  . GLU A 1 395 ? -8.629  -61.183 18.681  1.00 63.33  ? 396  GLU A CD  1 
ATOM   3013 O OE1 . GLU A 1 395 ? -8.953  -60.368 19.600  1.00 63.16  ? 396  GLU A OE1 1 
ATOM   3014 O OE2 . GLU A 1 395 ? -9.220  -62.281 18.484  1.00 59.78  ? 396  GLU A OE2 1 
ATOM   3015 N N   . ALA A 1 396 ? -8.685  -57.679 14.556  1.00 43.34  ? 397  ALA A N   1 
ATOM   3016 C CA  . ALA A 1 396 ? -8.201  -56.670 13.602  1.00 42.04  ? 397  ALA A CA  1 
ATOM   3017 C C   . ALA A 1 396 ? -8.783  -55.297 13.916  1.00 39.32  ? 397  ALA A C   1 
ATOM   3018 O O   . ALA A 1 396 ? -8.121  -54.289 13.699  1.00 43.28  ? 397  ALA A O   1 
ATOM   3019 C CB  . ALA A 1 396 ? -8.517  -57.072 12.151  1.00 34.09  ? 397  ALA A CB  1 
ATOM   3020 N N   . LEU A 1 397 ? -10.007 -55.248 14.428  1.00 38.84  ? 398  LEU A N   1 
ATOM   3021 C CA  . LEU A 1 397 ? -10.596 -53.964 14.780  1.00 36.65  ? 398  LEU A CA  1 
ATOM   3022 C C   . LEU A 1 397 ? -9.930  -53.399 16.046  1.00 41.57  ? 398  LEU A C   1 
ATOM   3023 O O   . LEU A 1 397 ? -9.743  -52.183 16.199  1.00 36.04  ? 398  LEU A O   1 
ATOM   3024 C CB  . LEU A 1 397 ? -12.089 -54.102 14.993  1.00 37.18  ? 398  LEU A CB  1 
ATOM   3025 C CG  . LEU A 1 397 ? -12.721 -52.736 15.177  1.00 37.38  ? 398  LEU A CG  1 
ATOM   3026 C CD1 . LEU A 1 397 ? -12.516 -51.912 13.896  1.00 40.42  ? 398  LEU A CD1 1 
ATOM   3027 C CD2 . LEU A 1 397 ? -14.182 -52.867 15.523  1.00 40.24  ? 398  LEU A CD2 1 
ATOM   3028 N N   . SER A 1 398 ? -9.584  -54.306 16.948  1.00 38.24  ? 399  SER A N   1 
ATOM   3029 C CA  . SER A 1 398 ? -8.796  -53.986 18.116  1.00 43.68  ? 399  SER A CA  1 
ATOM   3030 C C   . SER A 1 398 ? -7.439  -53.402 17.717  1.00 40.51  ? 399  SER A C   1 
ATOM   3031 O O   . SER A 1 398 ? -7.029  -52.369 18.230  1.00 42.91  ? 399  SER A O   1 
ATOM   3032 C CB  . SER A 1 398 ? -8.618  -55.241 18.972  1.00 41.02  ? 399  SER A CB  1 
ATOM   3033 O OG  . SER A 1 398 ? -7.916  -54.937 20.152  1.00 44.13  ? 399  SER A OG  1 
ATOM   3034 N N   . ASP A 1 399 ? -6.743  -54.066 16.799  1.00 45.80  ? 400  ASP A N   1 
ATOM   3035 C CA  . ASP A 1 399 ? -5.532  -53.496 16.206  1.00 43.79  ? 400  ASP A CA  1 
ATOM   3036 C C   . ASP A 1 399 ? -5.773  -52.122 15.573  1.00 37.97  ? 400  ASP A C   1 
ATOM   3037 O O   . ASP A 1 399 ? -4.989  -51.199 15.773  1.00 34.13  ? 400  ASP A O   1 
ATOM   3038 C CB  . ASP A 1 399 ? -4.946  -54.444 15.159  1.00 44.05  ? 400  ASP A CB  1 
ATOM   3039 C CG  . ASP A 1 399 ? -4.349  -55.698 15.777  1.00 48.88  ? 400  ASP A CG  1 
ATOM   3040 O OD1 . ASP A 1 399 ? -3.966  -55.658 16.982  1.00 57.09  ? 400  ASP A OD1 1 
ATOM   3041 O OD2 . ASP A 1 399 ? -4.266  -56.728 15.063  1.00 52.63  ? 400  ASP A OD2 1 
ATOM   3042 N N   . VAL A 1 400 ? -6.861  -51.958 14.834  1.00 35.91  ? 401  VAL A N   1 
ATOM   3043 C CA  . VAL A 1 400 ? -7.093  -50.655 14.211  1.00 38.28  ? 401  VAL A CA  1 
ATOM   3044 C C   . VAL A 1 400 ? -7.159  -49.523 15.263  1.00 39.30  ? 401  VAL A C   1 
ATOM   3045 O O   . VAL A 1 400 ? -6.449  -48.510 15.161  1.00 34.15  ? 401  VAL A O   1 
ATOM   3046 C CB  . VAL A 1 400 ? -8.382  -50.647 13.369  1.00 36.37  ? 401  VAL A CB  1 
ATOM   3047 C CG1 . VAL A 1 400 ? -8.733  -49.226 12.970  1.00 30.41  ? 401  VAL A CG1 1 
ATOM   3048 C CG2 . VAL A 1 400 ? -8.220  -51.552 12.118  1.00 36.60  ? 401  VAL A CG2 1 
ATOM   3049 N N   . VAL A 1 401 ? -7.993  -49.719 16.279  1.00 36.31  ? 402  VAL A N   1 
ATOM   3050 C CA  . VAL A 1 401 ? -8.233  -48.705 17.286  1.00 34.40  ? 402  VAL A CA  1 
ATOM   3051 C C   . VAL A 1 401 ? -6.962  -48.441 18.117  1.00 37.79  ? 402  VAL A C   1 
ATOM   3052 O O   . VAL A 1 401 ? -6.528  -47.286 18.252  1.00 38.06  ? 402  VAL A O   1 
ATOM   3053 C CB  . VAL A 1 401 ? -9.435  -49.130 18.162  1.00 39.71  ? 402  VAL A CB  1 
ATOM   3054 C CG1 . VAL A 1 401 ? -9.628  -48.194 19.350  1.00 37.83  ? 402  VAL A CG1 1 
ATOM   3055 C CG2 . VAL A 1 401 ? -10.694 -49.165 17.288  1.00 38.03  ? 402  VAL A CG2 1 
ATOM   3056 N N   . GLY A 1 402 ? -6.361  -49.514 18.627  1.00 35.01  ? 403  GLY A N   1 
ATOM   3057 C CA  . GLY A 1 402 ? -5.100  -49.462 19.348  1.00 38.18  ? 403  GLY A CA  1 
ATOM   3058 C C   . GLY A 1 402 ? -3.956  -48.809 18.588  1.00 40.27  ? 403  GLY A C   1 
ATOM   3059 O O   . GLY A 1 402 ? -3.192  -48.032 19.173  1.00 34.99  ? 403  GLY A O   1 
ATOM   3060 N N   . ASP A 1 403 ? -3.845  -49.088 17.282  1.00 35.55  ? 404  ASP A N   1 
ATOM   3061 C CA  . ASP A 1 403 ? -2.685  -48.613 16.510  1.00 34.13  ? 404  ASP A CA  1 
ATOM   3062 C C   . ASP A 1 403 ? -2.850  -47.149 16.217  1.00 32.26  ? 404  ASP A C   1 
ATOM   3063 O O   . ASP A 1 403 ? -1.922  -46.357 16.407  1.00 34.81  ? 404  ASP A O   1 
ATOM   3064 C CB  . ASP A 1 403 ? -2.494  -49.405 15.195  1.00 31.65  ? 404  ASP A CB  1 
ATOM   3065 C CG  . ASP A 1 403 ? -2.146  -50.873 15.434  1.00 35.78  ? 404  ASP A CG  1 
ATOM   3066 O OD1 . ASP A 1 403 ? -1.729  -51.238 16.555  1.00 42.20  ? 404  ASP A OD1 1 
ATOM   3067 O OD2 . ASP A 1 403 ? -2.298  -51.677 14.502  1.00 43.35  ? 404  ASP A OD2 1 
ATOM   3068 N N   . HIS A 1 404 ? -4.039  -46.799 15.745  1.00 33.86  ? 405  HIS A N   1 
ATOM   3069 C CA  . HIS A 1 404 ? -4.373  -45.430 15.369  1.00 35.11  ? 405  HIS A CA  1 
ATOM   3070 C C   . HIS A 1 404 ? -4.228  -44.481 16.569  1.00 39.12  ? 405  HIS A C   1 
ATOM   3071 O O   . HIS A 1 404 ? -3.617  -43.411 16.480  1.00 37.51  ? 405  HIS A O   1 
ATOM   3072 C CB  . HIS A 1 404 ? -5.803  -45.376 14.837  1.00 33.38  ? 405  HIS A CB  1 
ATOM   3073 C CG  . HIS A 1 404 ? -6.277  -43.994 14.512  1.00 37.51  ? 405  HIS A CG  1 
ATOM   3074 N ND1 . HIS A 1 404 ? -5.549  -43.127 13.724  1.00 38.02  ? 405  HIS A ND1 1 
ATOM   3075 C CD2 . HIS A 1 404 ? -7.406  -43.331 14.863  1.00 36.22  ? 405  HIS A CD2 1 
ATOM   3076 C CE1 . HIS A 1 404 ? -6.208  -41.986 13.605  1.00 37.79  ? 405  HIS A CE1 1 
ATOM   3077 N NE2 . HIS A 1 404 ? -7.337  -42.084 14.288  1.00 42.96  ? 405  HIS A NE2 1 
ATOM   3078 N N   . ASN A 1 405 ? -4.789  -44.900 17.692  1.00 34.92  ? 406  ASN A N   1 
ATOM   3079 C CA  . ASN A 1 405 ? -4.876  -44.025 18.860  1.00 40.30  ? 406  ASN A CA  1 
ATOM   3080 C C   . ASN A 1 405 ? -3.706  -44.046 19.824  1.00 32.44  ? 406  ASN A C   1 
ATOM   3081 O O   . ASN A 1 405 ? -3.403  -43.013 20.402  1.00 37.95  ? 406  ASN A O   1 
ATOM   3082 C CB  . ASN A 1 405 ? -6.172  -44.330 19.608  1.00 34.85  ? 406  ASN A CB  1 
ATOM   3083 C CG  . ASN A 1 405 ? -7.385  -43.855 18.825  1.00 42.73  ? 406  ASN A CG  1 
ATOM   3084 O OD1 . ASN A 1 405 ? -7.636  -42.661 18.740  1.00 43.86  ? 406  ASN A OD1 1 
ATOM   3085 N ND2 . ASN A 1 405 ? -8.092  -44.781 18.189  1.00 43.17  ? 406  ASN A ND2 1 
ATOM   3086 N N   . VAL A 1 406 ? -3.026  -45.180 19.982  1.00 34.42  ? 407  VAL A N   1 
ATOM   3087 C CA  . VAL A 1 406 ? -1.992  -45.279 21.010  1.00 32.71  ? 407  VAL A CA  1 
ATOM   3088 C C   . VAL A 1 406 ? -0.618  -45.741 20.526  1.00 33.57  ? 407  VAL A C   1 
ATOM   3089 O O   . VAL A 1 406 ? 0.353   -45.003 20.614  1.00 36.24  ? 407  VAL A O   1 
ATOM   3090 C CB  . VAL A 1 406 ? -2.443  -46.224 22.143  1.00 35.78  ? 407  VAL A CB  1 
ATOM   3091 C CG1 . VAL A 1 406 ? -1.349  -46.311 23.242  1.00 33.99  ? 407  VAL A CG1 1 
ATOM   3092 C CG2 . VAL A 1 406 ? -3.733  -45.713 22.758  1.00 33.52  ? 407  VAL A CG2 1 
ATOM   3093 N N   . VAL A 1 407 ? -0.535  -46.956 20.003  1.00 33.54  ? 408  VAL A N   1 
ATOM   3094 C CA  . VAL A 1 407 ? 0.737   -47.538 19.607  1.00 34.64  ? 408  VAL A CA  1 
ATOM   3095 C C   . VAL A 1 407 ? 1.525   -46.717 18.568  1.00 37.56  ? 408  VAL A C   1 
ATOM   3096 O O   . VAL A 1 407 ? 2.732   -46.481 18.726  1.00 35.10  ? 408  VAL A O   1 
ATOM   3097 C CB  . VAL A 1 407 ? 0.523   -48.941 19.034  1.00 36.56  ? 408  VAL A CB  1 
ATOM   3098 C CG1 . VAL A 1 407 ? 1.847   -49.524 18.606  1.00 36.67  ? 408  VAL A CG1 1 
ATOM   3099 C CG2 . VAL A 1 407 ? -0.199  -49.849 20.067  1.00 31.39  ? 408  VAL A CG2 1 
ATOM   3100 N N   . CYS A 1 408 ? 0.864   -46.257 17.517  1.00 34.26  ? 409  CYS A N   1 
ATOM   3101 C CA  . CYS A 1 408 ? 1.625   -45.586 16.450  1.00 36.57  ? 409  CYS A CA  1 
ATOM   3102 C C   . CYS A 1 408 ? 1.961   -44.149 16.816  1.00 34.94  ? 409  CYS A C   1 
ATOM   3103 O O   . CYS A 1 408 ? 3.058   -43.690 16.495  1.00 37.12  ? 409  CYS A O   1 
ATOM   3104 C CB  . CYS A 1 408 ? 0.881   -45.663 15.110  1.00 38.33  ? 409  CYS A CB  1 
ATOM   3105 S SG  . CYS A 1 408 ? 0.779   -47.368 14.504  1.00 39.54  ? 409  CYS A SG  1 
ATOM   3106 N N   . PRO A 1 409 ? 1.052   -43.433 17.516  1.00 36.52  ? 410  PRO A N   1 
ATOM   3107 C CA  . PRO A 1 409 ? 1.551   -42.150 18.043  1.00 37.83  ? 410  PRO A CA  1 
ATOM   3108 C C   . PRO A 1 409 ? 2.739   -42.308 19.025  1.00 36.57  ? 410  PRO A C   1 
ATOM   3109 O O   . PRO A 1 409 ? 3.665   -41.489 18.966  1.00 34.81  ? 410  PRO A O   1 
ATOM   3110 C CB  . PRO A 1 409 ? 0.329   -41.559 18.748  1.00 32.56  ? 410  PRO A CB  1 
ATOM   3111 C CG  . PRO A 1 409 ? -0.832  -42.165 18.041  1.00 32.89  ? 410  PRO A CG  1 
ATOM   3112 C CD  . PRO A 1 409 ? -0.410  -43.562 17.680  1.00 31.37  ? 410  PRO A CD  1 
ATOM   3113 N N   . VAL A 1 410 ? 2.737   -43.342 19.870  1.00 34.66  ? 411  VAL A N   1 
ATOM   3114 C CA  . VAL A 1 410 ? 3.853   -43.549 20.801  1.00 37.59  ? 411  VAL A CA  1 
ATOM   3115 C C   . VAL A 1 410 ? 5.100   -43.944 20.007  1.00 38.82  ? 411  VAL A C   1 
ATOM   3116 O O   . VAL A 1 410 ? 6.207   -43.496 20.291  1.00 39.52  ? 411  VAL A O   1 
ATOM   3117 C CB  . VAL A 1 410 ? 3.528   -44.639 21.891  1.00 34.61  ? 411  VAL A CB  1 
ATOM   3118 C CG1 . VAL A 1 410 ? 4.801   -45.173 22.522  1.00 30.41  ? 411  VAL A CG1 1 
ATOM   3119 C CG2 . VAL A 1 410 ? 2.565   -44.095 22.955  1.00 27.52  ? 411  VAL A CG2 1 
ATOM   3120 N N   . ALA A 1 411 ? 4.925   -44.767 18.987  1.00 37.44  ? 412  ALA A N   1 
ATOM   3121 C CA  . ALA A 1 411 ? 6.061   -45.171 18.160  1.00 39.70  ? 412  ALA A CA  1 
ATOM   3122 C C   . ALA A 1 411 ? 6.695   -43.984 17.426  1.00 39.58  ? 412  ALA A C   1 
ATOM   3123 O O   . ALA A 1 411 ? 7.927   -43.857 17.358  1.00 43.29  ? 412  ALA A O   1 
ATOM   3124 C CB  . ALA A 1 411 ? 5.631   -46.240 17.163  1.00 37.89  ? 412  ALA A CB  1 
ATOM   3125 N N   . GLN A 1 412 ? 5.855   -43.116 16.878  1.00 37.26  ? 413  GLN A N   1 
ATOM   3126 C CA  . GLN A 1 412 ? 6.346   -41.917 16.217  1.00 35.51  ? 413  GLN A CA  1 
ATOM   3127 C C   . GLN A 1 412 ? 7.115   -41.025 17.175  1.00 40.71  ? 413  GLN A C   1 
ATOM   3128 O O   . GLN A 1 412 ? 8.169   -40.517 16.828  1.00 41.05  ? 413  GLN A O   1 
ATOM   3129 C CB  . GLN A 1 412 ? 5.186   -41.122 15.607  1.00 40.73  ? 413  GLN A CB  1 
ATOM   3130 C CG  . GLN A 1 412 ? 5.638   -40.012 14.675  1.00 42.53  ? 413  GLN A CG  1 
ATOM   3131 C CD  . GLN A 1 412 ? 4.500   -39.129 14.230  1.00 56.46  ? 413  GLN A CD  1 
ATOM   3132 O OE1 . GLN A 1 412 ? 3.772   -38.570 15.063  1.00 65.13  ? 413  GLN A OE1 1 
ATOM   3133 N NE2 . GLN A 1 412 ? 4.321   -39.002 12.911  1.00 62.96  ? 413  GLN A NE2 1 
ATOM   3134 N N   . LEU A 1 413 ? 6.567   -40.819 18.375  1.00 37.95  ? 414  LEU A N   1 
ATOM   3135 C CA  . LEU A 1 413 ? 7.229   -40.011 19.398  1.00 36.22  ? 414  LEU A CA  1 
ATOM   3136 C C   . LEU A 1 413 ? 8.608   -40.559 19.772  1.00 37.69  ? 414  LEU A C   1 
ATOM   3137 O O   . LEU A 1 413 ? 9.576   -39.811 19.913  1.00 38.60  ? 414  LEU A O   1 
ATOM   3138 C CB  . LEU A 1 413 ? 6.359   -39.931 20.662  1.00 39.87  ? 414  LEU A CB  1 
ATOM   3139 C CG  . LEU A 1 413 ? 6.959   -39.132 21.839  1.00 36.71  ? 414  LEU A CG  1 
ATOM   3140 C CD1 . LEU A 1 413 ? 6.931   -37.656 21.509  1.00 41.18  ? 414  LEU A CD1 1 
ATOM   3141 C CD2 . LEU A 1 413 ? 6.196   -39.361 23.057  1.00 35.18  ? 414  LEU A CD2 1 
ATOM   3142 N N   . ALA A 1 414 ? 8.684   -41.866 19.965  1.00 35.17  ? 415  ALA A N   1 
ATOM   3143 C CA  . ALA A 1 414 ? 9.920   -42.491 20.400  1.00 38.80  ? 415  ALA A CA  1 
ATOM   3144 C C   . ALA A 1 414 ? 11.007  -42.385 19.308  1.00 44.99  ? 415  ALA A C   1 
ATOM   3145 O O   . ALA A 1 414 ? 12.177  -42.097 19.590  1.00 43.82  ? 415  ALA A O   1 
ATOM   3146 C CB  . ALA A 1 414 ? 9.659   -43.960 20.774  1.00 35.68  ? 415  ALA A CB  1 
ATOM   3147 N N   . GLY A 1 415 ? 10.609  -42.604 18.063  1.00 40.00  ? 416  GLY A N   1 
ATOM   3148 C CA  . GLY A 1 415 ? 11.541  -42.539 16.951  1.00 38.68  ? 416  GLY A CA  1 
ATOM   3149 C C   . GLY A 1 415 ? 12.075  -41.145 16.712  1.00 41.58  ? 416  GLY A C   1 
ATOM   3150 O O   . GLY A 1 415 ? 13.268  -40.958 16.463  1.00 42.62  ? 416  GLY A O   1 
ATOM   3151 N N   . ARG A 1 416 ? 11.206  -40.148 16.789  1.00 38.51  ? 417  ARG A N   1 
ATOM   3152 C CA  . ARG A 1 416 ? 11.663  -38.793 16.524  1.00 40.80  ? 417  ARG A CA  1 
ATOM   3153 C C   . ARG A 1 416 ? 12.500  -38.250 17.694  1.00 46.76  ? 417  ARG A C   1 
ATOM   3154 O O   . ARG A 1 416 ? 13.443  -37.480 17.483  1.00 50.06  ? 417  ARG A O   1 
ATOM   3155 C CB  . ARG A 1 416 ? 10.479  -37.870 16.236  1.00 42.01  ? 417  ARG A CB  1 
ATOM   3156 C CG  . ARG A 1 416 ? 9.624   -38.257 15.006  1.00 51.28  ? 417  ARG A CG  1 
ATOM   3157 C CD  . ARG A 1 416 ? 10.380  -38.162 13.650  1.00 48.15  ? 417  ARG A CD  1 
ATOM   3158 N NE  . ARG A 1 416 ? 11.161  -36.936 13.553  1.00 55.88  ? 417  ARG A NE  1 
ATOM   3159 C CZ  . ARG A 1 416 ? 11.252  -36.163 12.473  1.00 66.55  ? 417  ARG A CZ  1 
ATOM   3160 N NH1 . ARG A 1 416 ? 10.589  -36.470 11.359  1.00 55.54  ? 417  ARG A NH1 1 
ATOM   3161 N NH2 . ARG A 1 416 ? 12.006  -35.066 12.514  1.00 65.76  ? 417  ARG A NH2 1 
ATOM   3162 N N   . LEU A 1 417 ? 12.173  -38.646 18.917  1.00 42.38  ? 418  LEU A N   1 
ATOM   3163 C CA  . LEU A 1 417 ? 12.963  -38.208 20.074  1.00 45.50  ? 418  LEU A CA  1 
ATOM   3164 C C   . LEU A 1 417 ? 14.348  -38.831 20.058  1.00 40.36  ? 418  LEU A C   1 
ATOM   3165 O O   . LEU A 1 417 ? 15.336  -38.156 20.331  1.00 47.02  ? 418  LEU A O   1 
ATOM   3166 C CB  . LEU A 1 417 ? 12.272  -38.550 21.406  1.00 35.24  ? 418  LEU A CB  1 
ATOM   3167 C CG  . LEU A 1 417 ? 10.986  -37.799 21.790  1.00 47.73  ? 418  LEU A CG  1 
ATOM   3168 C CD1 . LEU A 1 417 ? 10.566  -38.106 23.225  1.00 36.33  ? 418  LEU A CD1 1 
ATOM   3169 C CD2 . LEU A 1 417 ? 11.124  -36.316 21.614  1.00 44.64  ? 418  LEU A CD2 1 
ATOM   3170 N N   . ALA A 1 418 ? 14.418  -40.123 19.770  1.00 42.29  ? 419  ALA A N   1 
ATOM   3171 C CA  . ALA A 1 418 ? 15.696  -40.823 19.727  1.00 44.62  ? 419  ALA A CA  1 
ATOM   3172 C C   . ALA A 1 418 ? 16.570  -40.283 18.592  1.00 48.22  ? 419  ALA A C   1 
ATOM   3173 O O   . ALA A 1 418 ? 17.791  -40.160 18.733  1.00 53.05  ? 419  ALA A O   1 
ATOM   3174 C CB  . ALA A 1 418 ? 15.480  -42.325 19.567  1.00 38.34  ? 419  ALA A CB  1 
ATOM   3175 N N   . ALA A 1 419 ? 15.943  -39.936 17.479  1.00 49.12  ? 420  ALA A N   1 
ATOM   3176 C CA  . ALA A 1 419 ? 16.688  -39.477 16.306  1.00 48.52  ? 420  ALA A CA  1 
ATOM   3177 C C   . ALA A 1 419 ? 17.145  -38.041 16.483  1.00 55.87  ? 420  ALA A C   1 
ATOM   3178 O O   . ALA A 1 419 ? 18.036  -37.578 15.771  1.00 60.50  ? 420  ALA A O   1 
ATOM   3179 C CB  . ALA A 1 419 ? 15.847  -39.600 15.057  1.00 42.50  ? 420  ALA A CB  1 
ATOM   3180 N N   . GLN A 1 420 ? 16.527  -37.336 17.427  1.00 51.14  ? 421  GLN A N   1 
ATOM   3181 C CA  . GLN A 1 420 ? 16.854  -35.933 17.660  1.00 48.11  ? 421  GLN A CA  1 
ATOM   3182 C C   . GLN A 1 420 ? 17.504  -35.709 19.010  1.00 43.35  ? 421  GLN A C   1 
ATOM   3183 O O   . GLN A 1 420 ? 17.410  -34.617 19.585  1.00 47.20  ? 421  GLN A O   1 
ATOM   3184 C CB  . GLN A 1 420 ? 15.611  -35.068 17.526  1.00 50.42  ? 421  GLN A CB  1 
ATOM   3185 C CG  . GLN A 1 420 ? 15.254  -34.861 16.082  1.00 55.51  ? 421  GLN A CG  1 
ATOM   3186 C CD  . GLN A 1 420 ? 13.789  -34.607 15.866  1.00 56.05  ? 421  GLN A CD  1 
ATOM   3187 O OE1 . GLN A 1 420 ? 13.157  -35.246 15.018  1.00 58.51  ? 421  GLN A OE1 1 
ATOM   3188 N NE2 . GLN A 1 420 ? 13.235  -33.663 16.617  1.00 55.07  ? 421  GLN A NE2 1 
ATOM   3189 N N   . GLY A 1 421 ? 18.166  -36.746 19.513  1.00 44.14  ? 422  GLY A N   1 
ATOM   3190 C CA  . GLY A 1 421 ? 19.045  -36.588 20.657  1.00 48.14  ? 422  GLY A CA  1 
ATOM   3191 C C   . GLY A 1 421 ? 18.658  -37.214 21.979  1.00 50.70  ? 422  GLY A C   1 
ATOM   3192 O O   . GLY A 1 421 ? 19.489  -37.279 22.877  1.00 55.43  ? 422  GLY A O   1 
ATOM   3193 N N   . ALA A 1 422 ? 17.413  -37.661 22.128  1.00 53.24  ? 423  ALA A N   1 
ATOM   3194 C CA  . ALA A 1 422 ? 16.959  -38.173 23.426  1.00 44.06  ? 423  ALA A CA  1 
ATOM   3195 C C   . ALA A 1 422 ? 17.408  -39.615 23.626  1.00 40.29  ? 423  ALA A C   1 
ATOM   3196 O O   . ALA A 1 422 ? 17.632  -40.332 22.659  1.00 49.89  ? 423  ALA A O   1 
ATOM   3197 C CB  . ALA A 1 422 ? 15.443  -38.071 23.544  1.00 39.60  ? 423  ALA A CB  1 
ATOM   3198 N N   . ARG A 1 423 ? 17.557  -40.044 24.873  1.00 40.00  ? 424  ARG A N   1 
ATOM   3199 C CA  . ARG A 1 423 ? 17.742  -41.472 25.118  1.00 43.75  ? 424  ARG A CA  1 
ATOM   3200 C C   . ARG A 1 423 ? 16.396  -42.090 25.518  1.00 42.00  ? 424  ARG A C   1 
ATOM   3201 O O   . ARG A 1 423 ? 15.796  -41.695 26.525  1.00 43.88  ? 424  ARG A O   1 
ATOM   3202 C CB  . ARG A 1 423 ? 18.808  -41.729 26.204  1.00 45.16  ? 424  ARG A CB  1 
ATOM   3203 C CG  . ARG A 1 423 ? 19.294  -43.186 26.205  1.00 50.28  ? 424  ARG A CG  1 
ATOM   3204 C CD  . ARG A 1 423 ? 20.653  -43.357 26.863  1.00 57.46  ? 424  ARG A CD  1 
ATOM   3205 N NE  . ARG A 1 423 ? 20.516  -43.369 28.319  1.00 67.89  ? 424  ARG A NE  1 
ATOM   3206 C CZ  . ARG A 1 423 ? 20.922  -42.391 29.125  1.00 62.84  ? 424  ARG A CZ  1 
ATOM   3207 N NH1 . ARG A 1 423 ? 21.519  -41.305 28.624  1.00 53.73  ? 424  ARG A NH1 1 
ATOM   3208 N NH2 . ARG A 1 423 ? 20.731  -42.505 30.432  1.00 53.60  ? 424  ARG A NH2 1 
ATOM   3209 N N   . VAL A 1 424 ? 15.935  -43.066 24.736  1.00 42.02  ? 425  VAL A N   1 
ATOM   3210 C CA  . VAL A 1 424 ? 14.575  -43.574 24.862  1.00 34.81  ? 425  VAL A CA  1 
ATOM   3211 C C   . VAL A 1 424 ? 14.561  -45.046 25.259  1.00 39.98  ? 425  VAL A C   1 
ATOM   3212 O O   . VAL A 1 424 ? 15.320  -45.842 24.714  1.00 37.39  ? 425  VAL A O   1 
ATOM   3213 C CB  . VAL A 1 424 ? 13.797  -43.387 23.525  1.00 43.36  ? 425  VAL A CB  1 
ATOM   3214 C CG1 . VAL A 1 424 ? 12.346  -43.905 23.648  1.00 34.95  ? 425  VAL A CG1 1 
ATOM   3215 C CG2 . VAL A 1 424 ? 13.836  -41.928 23.077  1.00 29.97  ? 425  VAL A CG2 1 
ATOM   3216 N N   . TYR A 1 425 ? 13.727  -45.411 26.233  1.00 38.54  ? 426  TYR A N   1 
ATOM   3217 C CA  . TYR A 1 425 ? 13.492  -46.829 26.491  1.00 40.99  ? 426  TYR A CA  1 
ATOM   3218 C C   . TYR A 1 425 ? 12.024  -47.138 26.221  1.00 43.76  ? 426  TYR A C   1 
ATOM   3219 O O   . TYR A 1 425 ? 11.140  -46.391 26.672  1.00 42.34  ? 426  TYR A O   1 
ATOM   3220 C CB  . TYR A 1 425 ? 13.873  -47.221 27.927  1.00 39.15  ? 426  TYR A CB  1 
ATOM   3221 C CG  . TYR A 1 425 ? 15.306  -46.908 28.269  1.00 40.45  ? 426  TYR A CG  1 
ATOM   3222 C CD1 . TYR A 1 425 ? 16.295  -47.868 28.116  1.00 38.72  ? 426  TYR A CD1 1 
ATOM   3223 C CD2 . TYR A 1 425 ? 15.675  -45.635 28.724  1.00 37.96  ? 426  TYR A CD2 1 
ATOM   3224 C CE1 . TYR A 1 425 ? 17.627  -47.577 28.416  1.00 44.76  ? 426  TYR A CE1 1 
ATOM   3225 C CE2 . TYR A 1 425 ? 17.001  -45.327 29.021  1.00 38.02  ? 426  TYR A CE2 1 
ATOM   3226 C CZ  . TYR A 1 425 ? 17.972  -46.307 28.873  1.00 45.52  ? 426  TYR A CZ  1 
ATOM   3227 O OH  . TYR A 1 425 ? 19.288  -46.030 29.161  1.00 46.88  ? 426  TYR A OH  1 
ATOM   3228 N N   . ALA A 1 426 ? 11.783  -48.239 25.507  1.00 38.05  ? 427  ALA A N   1 
ATOM   3229 C CA  . ALA A 1 426 ? 10.438  -48.659 25.099  1.00 36.90  ? 427  ALA A CA  1 
ATOM   3230 C C   . ALA A 1 426 ? 10.062  -50.022 25.681  1.00 40.23  ? 427  ALA A C   1 
ATOM   3231 O O   . ALA A 1 426 ? 10.911  -50.917 25.789  1.00 41.93  ? 427  ALA A O   1 
ATOM   3232 C CB  . ALA A 1 426 ? 10.336  -48.695 23.577  1.00 37.46  ? 427  ALA A CB  1 
ATOM   3233 N N   . TYR A 1 427 ? 8.802   -50.179 26.083  1.00 39.95  ? 428  TYR A N   1 
ATOM   3234 C CA  . TYR A 1 427 ? 8.318   -51.474 26.566  1.00 38.72  ? 428  TYR A CA  1 
ATOM   3235 C C   . TYR A 1 427 ? 6.974   -51.821 25.920  1.00 35.91  ? 428  TYR A C   1 
ATOM   3236 O O   . TYR A 1 427 ? 6.226   -50.959 25.475  1.00 31.86  ? 428  TYR A O   1 
ATOM   3237 C CB  . TYR A 1 427 ? 8.189   -51.505 28.112  1.00 37.00  ? 428  TYR A CB  1 
ATOM   3238 C CG  . TYR A 1 427 ? 7.115   -50.571 28.650  1.00 35.89  ? 428  TYR A CG  1 
ATOM   3239 C CD1 . TYR A 1 427 ? 5.793   -50.994 28.784  1.00 35.57  ? 428  TYR A CD1 1 
ATOM   3240 C CD2 . TYR A 1 427 ? 7.419   -49.259 29.002  1.00 31.43  ? 428  TYR A CD2 1 
ATOM   3241 C CE1 . TYR A 1 427 ? 4.802   -50.138 29.273  1.00 30.95  ? 428  TYR A CE1 1 
ATOM   3242 C CE2 . TYR A 1 427 ? 6.443   -48.395 29.465  1.00 33.41  ? 428  TYR A CE2 1 
ATOM   3243 C CZ  . TYR A 1 427 ? 5.138   -48.838 29.596  1.00 32.17  ? 428  TYR A CZ  1 
ATOM   3244 O OH  . TYR A 1 427 ? 4.165   -47.970 30.014  1.00 32.60  ? 428  TYR A OH  1 
ATOM   3245 N N   . VAL A 1 428 ? 6.690   -53.108 25.871  1.00 39.33  ? 429  VAL A N   1 
ATOM   3246 C CA  . VAL A 1 428 ? 5.334   -53.579 25.711  1.00 39.16  ? 429  VAL A CA  1 
ATOM   3247 C C   . VAL A 1 428 ? 4.975   -54.384 26.962  1.00 35.11  ? 429  VAL A C   1 
ATOM   3248 O O   . VAL A 1 428 ? 5.698   -55.312 27.352  1.00 36.89  ? 429  VAL A O   1 
ATOM   3249 C CB  . VAL A 1 428 ? 5.179   -54.421 24.436  1.00 36.71  ? 429  VAL A CB  1 
ATOM   3250 C CG1 . VAL A 1 428 ? 3.800   -55.033 24.374  1.00 35.04  ? 429  VAL A CG1 1 
ATOM   3251 C CG2 . VAL A 1 428 ? 5.398   -53.530 23.226  1.00 42.82  ? 429  VAL A CG2 1 
ATOM   3252 N N   . PHE A 1 429 ? 3.879   -54.016 27.607  1.00 35.71  ? 430  PHE A N   1 
ATOM   3253 C CA  . PHE A 1 429 ? 3.472   -54.680 28.850  1.00 40.45  ? 430  PHE A CA  1 
ATOM   3254 C C   . PHE A 1 429 ? 2.530   -55.836 28.514  1.00 38.46  ? 430  PHE A C   1 
ATOM   3255 O O   . PHE A 1 429 ? 1.438   -55.633 27.978  1.00 38.26  ? 430  PHE A O   1 
ATOM   3256 C CB  . PHE A 1 429 ? 2.826   -53.675 29.812  1.00 32.24  ? 430  PHE A CB  1 
ATOM   3257 C CG  . PHE A 1 429 ? 2.302   -54.289 31.062  1.00 40.20  ? 430  PHE A CG  1 
ATOM   3258 C CD1 . PHE A 1 429 ? 1.013   -54.786 31.114  1.00 40.69  ? 430  PHE A CD1 1 
ATOM   3259 C CD2 . PHE A 1 429 ? 3.086   -54.343 32.209  1.00 45.58  ? 430  PHE A CD2 1 
ATOM   3260 C CE1 . PHE A 1 429 ? 0.522   -55.346 32.269  1.00 42.47  ? 430  PHE A CE1 1 
ATOM   3261 C CE2 . PHE A 1 429 ? 2.593   -54.902 33.385  1.00 43.15  ? 430  PHE A CE2 1 
ATOM   3262 C CZ  . PHE A 1 429 ? 1.319   -55.411 33.414  1.00 41.52  ? 430  PHE A CZ  1 
ATOM   3263 N N   . GLU A 1 430 ? 2.953   -57.055 28.829  1.00 42.29  ? 431  GLU A N   1 
ATOM   3264 C CA  . GLU A 1 430 ? 2.279   -58.226 28.260  1.00 48.35  ? 431  GLU A CA  1 
ATOM   3265 C C   . GLU A 1 430 ? 1.729   -59.186 29.297  1.00 44.29  ? 431  GLU A C   1 
ATOM   3266 O O   . GLU A 1 430 ? 1.494   -60.342 28.985  1.00 44.20  ? 431  GLU A O   1 
ATOM   3267 C CB  . GLU A 1 430 ? 3.229   -58.991 27.337  1.00 37.86  ? 431  GLU A CB  1 
ATOM   3268 C CG  . GLU A 1 430 ? 3.586   -58.222 26.079  1.00 47.24  ? 431  GLU A CG  1 
ATOM   3269 C CD  . GLU A 1 430 ? 4.298   -59.075 25.028  1.00 53.24  ? 431  GLU A CD  1 
ATOM   3270 O OE1 . GLU A 1 430 ? 4.182   -58.745 23.826  1.00 63.71  ? 431  GLU A OE1 1 
ATOM   3271 O OE2 . GLU A 1 430 ? 4.976   -60.068 25.392  1.00 53.90  ? 431  GLU A OE2 1 
ATOM   3272 N N   . HIS A 1 431 ? 1.518   -58.728 30.522  1.00 43.37  ? 432  HIS A N   1 
ATOM   3273 C CA  . HIS A 1 431 ? 1.012   -59.645 31.550  1.00 44.30  ? 432  HIS A CA  1 
ATOM   3274 C C   . HIS A 1 431 ? -0.437  -59.379 31.875  1.00 41.95  ? 432  HIS A C   1 
ATOM   3275 O O   . HIS A 1 431 ? -0.805  -58.272 32.249  1.00 39.19  ? 432  HIS A O   1 
ATOM   3276 C CB  . HIS A 1 431 ? 1.809   -59.576 32.842  1.00 45.01  ? 432  HIS A CB  1 
ATOM   3277 C CG  . HIS A 1 431 ? 1.213   -60.403 33.936  1.00 47.45  ? 432  HIS A CG  1 
ATOM   3278 N ND1 . HIS A 1 431 ? 1.276   -61.781 33.945  1.00 54.76  ? 432  HIS A ND1 1 
ATOM   3279 C CD2 . HIS A 1 431 ? 0.472   -60.056 35.018  1.00 43.50  ? 432  HIS A CD2 1 
ATOM   3280 C CE1 . HIS A 1 431 ? 0.647   -62.246 35.013  1.00 48.64  ? 432  HIS A CE1 1 
ATOM   3281 N NE2 . HIS A 1 431 ? 0.145   -61.219 35.676  1.00 46.62  ? 432  HIS A NE2 1 
ATOM   3282 N N   . ARG A 1 432 ? -1.259  -60.413 31.722  1.00 44.35  ? 433  ARG A N   1 
ATOM   3283 C CA  . ARG A 1 432 ? -2.654  -60.326 32.093  1.00 45.07  ? 433  ARG A CA  1 
ATOM   3284 C C   . ARG A 1 432 ? -2.806  -60.643 33.581  1.00 48.23  ? 433  ARG A C   1 
ATOM   3285 O O   . ARG A 1 432 ? -2.469  -61.743 34.022  1.00 44.72  ? 433  ARG A O   1 
ATOM   3286 C CB  . ARG A 1 432 ? -3.497  -61.278 31.234  1.00 44.70  ? 433  ARG A CB  1 
ATOM   3287 C CG  . ARG A 1 432 ? -4.975  -61.143 31.509  1.00 50.86  ? 433  ARG A CG  1 
ATOM   3288 C CD  . ARG A 1 432 ? -5.802  -62.045 30.630  1.00 49.12  ? 433  ARG A CD  1 
ATOM   3289 N NE  . ARG A 1 432 ? -7.139  -62.194 31.186  1.00 51.64  ? 433  ARG A NE  1 
ATOM   3290 C CZ  . ARG A 1 432 ? -8.211  -61.534 30.759  1.00 57.62  ? 433  ARG A CZ  1 
ATOM   3291 N NH1 . ARG A 1 432 ? -8.109  -60.666 29.742  1.00 39.08  ? 433  ARG A NH1 1 
ATOM   3292 N NH2 . ARG A 1 432 ? -9.387  -61.739 31.357  1.00 52.17  ? 433  ARG A NH2 1 
ATOM   3293 N N   . ALA A 1 433 ? -3.290  -59.669 34.346  1.00 42.01  ? 434  ALA A N   1 
ATOM   3294 C CA  . ALA A 1 433 ? -3.430  -59.828 35.786  1.00 46.40  ? 434  ALA A CA  1 
ATOM   3295 C C   . ALA A 1 433 ? -4.355  -60.990 36.103  1.00 49.40  ? 434  ALA A C   1 
ATOM   3296 O O   . ALA A 1 433 ? -5.450  -61.081 35.538  1.00 44.91  ? 434  ALA A O   1 
ATOM   3297 C CB  . ALA A 1 433 ? -3.958  -58.545 36.423  1.00 43.20  ? 434  ALA A CB  1 
ATOM   3298 N N   . SER A 1 434 ? -3.919  -61.856 37.022  1.00 45.81  ? 435  SER A N   1 
ATOM   3299 C CA  . SER A 1 434 ? -4.741  -62.972 37.500  1.00 45.58  ? 435  SER A CA  1 
ATOM   3300 C C   . SER A 1 434 ? -6.091  -62.493 38.032  1.00 47.60  ? 435  SER A C   1 
ATOM   3301 O O   . SER A 1 434 ? -7.057  -63.234 38.027  1.00 51.22  ? 435  SER A O   1 
ATOM   3302 C CB  . SER A 1 434 ? -4.007  -63.754 38.594  1.00 45.49  ? 435  SER A CB  1 
ATOM   3303 O OG  . SER A 1 434 ? -3.852  -62.958 39.759  1.00 47.96  ? 435  SER A OG  1 
ATOM   3304 N N   . THR A 1 435 ? -6.152  -61.242 38.467  1.00 47.67  ? 436  THR A N   1 
ATOM   3305 C CA  . THR A 1 435 ? -7.378  -60.666 39.017  1.00 47.93  ? 436  THR A CA  1 
ATOM   3306 C C   . THR A 1 435 ? -8.237  -59.924 37.994  1.00 48.32  ? 436  THR A C   1 
ATOM   3307 O O   . THR A 1 435 ? -9.238  -59.308 38.356  1.00 52.99  ? 436  THR A O   1 
ATOM   3308 C CB  . THR A 1 435 ? -7.042  -59.669 40.118  1.00 50.89  ? 436  THR A CB  1 
ATOM   3309 O OG1 . THR A 1 435 ? -6.204  -58.632 39.568  1.00 48.00  ? 436  THR A OG1 1 
ATOM   3310 C CG2 . THR A 1 435 ? -6.311  -60.374 41.269  1.00 47.39  ? 436  THR A CG2 1 
ATOM   3311 N N   . LEU A 1 436 ? -7.825  -59.935 36.734  1.00 43.07  ? 437  LEU A N   1 
ATOM   3312 C CA  . LEU A 1 436 ? -8.535  -59.161 35.706  1.00 48.24  ? 437  LEU A CA  1 
ATOM   3313 C C   . LEU A 1 436 ? -9.986  -59.598 35.486  1.00 43.80  ? 437  LEU A C   1 
ATOM   3314 O O   . LEU A 1 436 ? -10.269 -60.780 35.273  1.00 44.54  ? 437  LEU A O   1 
ATOM   3315 C CB  . LEU A 1 436 ? -7.786  -59.239 34.380  1.00 45.35  ? 437  LEU A CB  1 
ATOM   3316 C CG  . LEU A 1 436 ? -8.062  -58.095 33.410  1.00 46.41  ? 437  LEU A CG  1 
ATOM   3317 C CD1 . LEU A 1 436 ? -7.518  -56.832 34.020  1.00 41.48  ? 437  LEU A CD1 1 
ATOM   3318 C CD2 . LEU A 1 436 ? -7.419  -58.377 32.051  1.00 42.94  ? 437  LEU A CD2 1 
ATOM   3319 N N   . SER A 1 437 ? -10.895 -58.631 35.523  1.00 38.75  ? 438  SER A N   1 
ATOM   3320 C CA  . SER A 1 437 ? -12.315 -58.926 35.509  1.00 45.19  ? 438  SER A CA  1 
ATOM   3321 C C   . SER A 1 437 ? -12.967 -58.760 34.141  1.00 47.45  ? 438  SER A C   1 
ATOM   3322 O O   . SER A 1 437 ? -14.129 -59.135 33.978  1.00 48.80  ? 438  SER A O   1 
ATOM   3323 C CB  . SER A 1 437 ? -13.042 -58.044 36.524  1.00 47.74  ? 438  SER A CB  1 
ATOM   3324 O OG  . SER A 1 437 ? -12.857 -56.668 36.216  1.00 57.60  ? 438  SER A OG  1 
ATOM   3325 N N   . TRP A 1 438 ? -12.240 -58.168 33.183  1.00 45.23  ? 439  TRP A N   1 
ATOM   3326 C CA  . TRP A 1 438 ? -12.674 -58.132 31.785  1.00 45.78  ? 439  TRP A CA  1 
ATOM   3327 C C   . TRP A 1 438 ? -12.450 -59.509 31.155  1.00 44.68  ? 439  TRP A C   1 
ATOM   3328 O O   . TRP A 1 438 ? -11.593 -60.271 31.628  1.00 43.10  ? 439  TRP A O   1 
ATOM   3329 C CB  . TRP A 1 438 ? -11.917 -57.064 30.985  1.00 45.63  ? 439  TRP A CB  1 
ATOM   3330 C CG  . TRP A 1 438 ? -12.089 -55.658 31.482  1.00 44.24  ? 439  TRP A CG  1 
ATOM   3331 C CD1 . TRP A 1 438 ? -11.266 -54.986 32.347  1.00 42.76  ? 439  TRP A CD1 1 
ATOM   3332 C CD2 . TRP A 1 438 ? -13.127 -54.745 31.128  1.00 39.91  ? 439  TRP A CD2 1 
ATOM   3333 N NE1 . TRP A 1 438 ? -11.736 -53.717 32.556  1.00 42.54  ? 439  TRP A NE1 1 
ATOM   3334 C CE2 . TRP A 1 438 ? -12.875 -53.538 31.816  1.00 42.66  ? 439  TRP A CE2 1 
ATOM   3335 C CE3 . TRP A 1 438 ? -14.244 -54.824 30.295  1.00 42.48  ? 439  TRP A CE3 1 
ATOM   3336 C CZ2 . TRP A 1 438 ? -13.700 -52.419 31.696  1.00 39.91  ? 439  TRP A CZ2 1 
ATOM   3337 C CZ3 . TRP A 1 438 ? -15.063 -53.702 30.174  1.00 45.49  ? 439  TRP A CZ3 1 
ATOM   3338 C CH2 . TRP A 1 438 ? -14.785 -52.518 30.871  1.00 42.55  ? 439  TRP A CH2 1 
ATOM   3339 N N   . PRO A 1 439 ? -13.209 -59.830 30.088  1.00 40.80  ? 440  PRO A N   1 
ATOM   3340 C CA  . PRO A 1 439 ? -13.139 -61.152 29.457  1.00 44.84  ? 440  PRO A CA  1 
ATOM   3341 C C   . PRO A 1 439 ? -11.779 -61.477 28.834  1.00 53.61  ? 440  PRO A C   1 
ATOM   3342 O O   . PRO A 1 439 ? -10.991 -60.581 28.511  1.00 54.49  ? 440  PRO A O   1 
ATOM   3343 C CB  . PRO A 1 439 ? -14.221 -61.074 28.367  1.00 49.61  ? 440  PRO A CB  1 
ATOM   3344 C CG  . PRO A 1 439 ? -14.357 -59.626 28.074  1.00 46.17  ? 440  PRO A CG  1 
ATOM   3345 C CD  . PRO A 1 439 ? -14.206 -58.975 29.425  1.00 39.58  ? 440  PRO A CD  1 
ATOM   3346 N N   . LEU A 1 440 ? -11.533 -62.766 28.630  1.00 51.99  ? 441  LEU A N   1 
ATOM   3347 C CA  . LEU A 1 440 ? -10.284 -63.233 28.054  1.00 46.51  ? 441  LEU A CA  1 
ATOM   3348 C C   . LEU A 1 440 ? -9.940  -62.606 26.706  1.00 53.66  ? 441  LEU A C   1 
ATOM   3349 O O   . LEU A 1 440 ? -8.767  -62.345 26.448  1.00 56.36  ? 441  LEU A O   1 
ATOM   3350 C CB  . LEU A 1 440 ? -10.319 -64.749 27.901  1.00 53.30  ? 441  LEU A CB  1 
ATOM   3351 C CG  . LEU A 1 440 ? -8.941  -65.403 27.783  1.00 64.42  ? 441  LEU A CG  1 
ATOM   3352 C CD1 . LEU A 1 440 ? -8.111  -65.087 29.025  1.00 61.14  ? 441  LEU A CD1 1 
ATOM   3353 C CD2 . LEU A 1 440 ? -9.059  -66.922 27.577  1.00 55.79  ? 441  LEU A CD2 1 
ATOM   3354 N N   . TRP A 1 441 ? -10.946 -62.377 25.848  1.00 48.38  ? 442  TRP A N   1 
ATOM   3355 C CA  . TRP A 1 441 ? -10.677 -61.927 24.484  1.00 50.67  ? 442  TRP A CA  1 
ATOM   3356 C C   . TRP A 1 441 ? -10.063 -60.530 24.455  1.00 47.72  ? 442  TRP A C   1 
ATOM   3357 O O   . TRP A 1 441 ? -9.373  -60.170 23.503  1.00 55.76  ? 442  TRP A O   1 
ATOM   3358 C CB  . TRP A 1 441 ? -11.946 -61.968 23.605  1.00 48.06  ? 442  TRP A CB  1 
ATOM   3359 C CG  . TRP A 1 441 ? -13.047 -60.998 23.951  1.00 43.91  ? 442  TRP A CG  1 
ATOM   3360 C CD1 . TRP A 1 441 ? -14.177 -61.269 24.663  1.00 42.89  ? 442  TRP A CD1 1 
ATOM   3361 C CD2 . TRP A 1 441 ? -13.144 -59.622 23.552  1.00 43.29  ? 442  TRP A CD2 1 
ATOM   3362 N NE1 . TRP A 1 441 ? -14.964 -60.144 24.754  1.00 42.84  ? 442  TRP A NE1 1 
ATOM   3363 C CE2 . TRP A 1 441 ? -14.352 -59.116 24.090  1.00 39.10  ? 442  TRP A CE2 1 
ATOM   3364 C CE3 . TRP A 1 441 ? -12.322 -58.767 22.809  1.00 40.01  ? 442  TRP A CE3 1 
ATOM   3365 C CZ2 . TRP A 1 441 ? -14.763 -57.798 23.910  1.00 37.63  ? 442  TRP A CZ2 1 
ATOM   3366 C CZ3 . TRP A 1 441 ? -12.731 -57.451 22.626  1.00 40.09  ? 442  TRP A CZ3 1 
ATOM   3367 C CH2 . TRP A 1 441 ? -13.943 -56.977 23.184  1.00 47.17  ? 442  TRP A CH2 1 
ATOM   3368 N N   . MET A 1 442 ? -10.305 -59.751 25.498  1.00 47.14  ? 443  MET A N   1 
ATOM   3369 C CA  . MET A 1 442 ? -9.725  -58.419 25.607  1.00 50.75  ? 443  MET A CA  1 
ATOM   3370 C C   . MET A 1 442 ? -8.211  -58.422 25.844  1.00 47.85  ? 443  MET A C   1 
ATOM   3371 O O   . MET A 1 442 ? -7.559  -57.388 25.681  1.00 42.47  ? 443  MET A O   1 
ATOM   3372 C CB  . MET A 1 442 ? -10.411 -57.645 26.728  1.00 45.52  ? 443  MET A CB  1 
ATOM   3373 C CG  . MET A 1 442 ? -11.786 -57.174 26.342  1.00 51.15  ? 443  MET A CG  1 
ATOM   3374 S SD  . MET A 1 442 ? -12.304 -55.837 27.425  1.00 49.43  ? 443  MET A SD  1 
ATOM   3375 C CE  . MET A 1 442 ? -13.918 -55.509 26.775  1.00 48.43  ? 443  MET A CE  1 
ATOM   3376 N N   . GLY A 1 443 ? -7.667  -59.569 26.244  1.00 43.37  ? 444  GLY A N   1 
ATOM   3377 C CA  . GLY A 1 443 ? -6.232  -59.716 26.416  1.00 47.03  ? 444  GLY A CA  1 
ATOM   3378 C C   . GLY A 1 443 ? -5.680  -58.867 27.556  1.00 47.86  ? 444  GLY A C   1 
ATOM   3379 O O   . GLY A 1 443 ? -6.203  -58.908 28.670  1.00 45.95  ? 444  GLY A O   1 
ATOM   3380 N N   . VAL A 1 444 ? -4.613  -58.111 27.281  1.00 43.25  ? 445  VAL A N   1 
ATOM   3381 C CA  . VAL A 1 444 ? -4.070  -57.146 28.246  1.00 42.02  ? 445  VAL A CA  1 
ATOM   3382 C C   . VAL A 1 444 ? -4.576  -55.745 27.915  1.00 38.38  ? 445  VAL A C   1 
ATOM   3383 O O   . VAL A 1 444 ? -4.008  -55.065 27.069  1.00 40.36  ? 445  VAL A O   1 
ATOM   3384 C CB  . VAL A 1 444 ? -2.526  -57.155 28.235  1.00 44.42  ? 445  VAL A CB  1 
ATOM   3385 C CG1 . VAL A 1 444 ? -1.960  -56.318 29.380  1.00 43.89  ? 445  VAL A CG1 1 
ATOM   3386 C CG2 . VAL A 1 444 ? -2.009  -58.586 28.296  1.00 44.66  ? 445  VAL A CG2 1 
ATOM   3387 N N   . PRO A 1 445 ? -5.652  -55.299 28.572  1.00 37.96  ? 446  PRO A N   1 
ATOM   3388 C CA  . PRO A 1 445 ? -6.265  -54.066 28.071  1.00 41.80  ? 446  PRO A CA  1 
ATOM   3389 C C   . PRO A 1 445 ? -5.591  -52.798 28.561  1.00 41.99  ? 446  PRO A C   1 
ATOM   3390 O O   . PRO A 1 445 ? -4.724  -52.806 29.430  1.00 39.04  ? 446  PRO A O   1 
ATOM   3391 C CB  . PRO A 1 445 ? -7.701  -54.122 28.607  1.00 35.34  ? 446  PRO A CB  1 
ATOM   3392 C CG  . PRO A 1 445 ? -7.825  -55.459 29.307  1.00 43.42  ? 446  PRO A CG  1 
ATOM   3393 C CD  . PRO A 1 445 ? -6.435  -55.884 29.660  1.00 44.19  ? 446  PRO A CD  1 
ATOM   3394 N N   . HIS A 1 446 ? -6.021  -51.702 27.962  1.00 41.57  ? 447  HIS A N   1 
ATOM   3395 C CA  . HIS A 1 446 ? -5.541  -50.381 28.271  1.00 42.48  ? 447  HIS A CA  1 
ATOM   3396 C C   . HIS A 1 446 ? -5.699  -50.041 29.753  1.00 45.47  ? 447  HIS A C   1 
ATOM   3397 O O   . HIS A 1 446 ? -6.771  -50.201 30.345  1.00 44.80  ? 447  HIS A O   1 
ATOM   3398 C CB  . HIS A 1 446 ? -6.301  -49.402 27.400  1.00 40.46  ? 447  HIS A CB  1 
ATOM   3399 C CG  . HIS A 1 446 ? -5.920  -47.977 27.595  1.00 45.83  ? 447  HIS A CG  1 
ATOM   3400 N ND1 . HIS A 1 446 ? -4.806  -47.418 27.002  1.00 43.29  ? 447  HIS A ND1 1 
ATOM   3401 C CD2 . HIS A 1 446 ? -6.550  -46.972 28.247  1.00 36.52  ? 447  HIS A CD2 1 
ATOM   3402 C CE1 . HIS A 1 446 ? -4.754  -46.132 27.302  1.00 42.68  ? 447  HIS A CE1 1 
ATOM   3403 N NE2 . HIS A 1 446 ? -5.804  -45.834 28.049  1.00 44.61  ? 447  HIS A NE2 1 
ATOM   3404 N N   . GLY A 1 447 ? -4.611  -49.584 30.356  1.00 44.82  ? 448  GLY A N   1 
ATOM   3405 C CA  . GLY A 1 447 ? -4.659  -49.168 31.736  1.00 38.75  ? 448  GLY A CA  1 
ATOM   3406 C C   . GLY A 1 447 ? -4.335  -50.254 32.739  1.00 40.71  ? 448  GLY A C   1 
ATOM   3407 O O   . GLY A 1 447 ? -4.309  -49.956 33.909  1.00 40.18  ? 448  GLY A O   1 
ATOM   3408 N N   . TYR A 1 448 ? -4.050  -51.489 32.322  1.00 39.18  ? 449  TYR A N   1 
ATOM   3409 C CA  . TYR A 1 448 ? -3.861  -52.526 33.347  1.00 43.89  ? 449  TYR A CA  1 
ATOM   3410 C C   . TYR A 1 448 ? -2.406  -52.878 33.618  1.00 42.65  ? 449  TYR A C   1 
ATOM   3411 O O   . TYR A 1 448 ? -2.105  -53.901 34.249  1.00 45.21  ? 449  TYR A O   1 
ATOM   3412 C CB  . TYR A 1 448 ? -4.696  -53.772 33.010  1.00 39.81  ? 449  TYR A CB  1 
ATOM   3413 C CG  . TYR A 1 448 ? -6.122  -53.418 33.295  1.00 41.25  ? 449  TYR A CG  1 
ATOM   3414 C CD1 . TYR A 1 448 ? -6.665  -53.573 34.574  1.00 41.52  ? 449  TYR A CD1 1 
ATOM   3415 C CD2 . TYR A 1 448 ? -6.899  -52.814 32.318  1.00 41.66  ? 449  TYR A CD2 1 
ATOM   3416 C CE1 . TYR A 1 448 ? -7.966  -53.168 34.849  1.00 45.12  ? 449  TYR A CE1 1 
ATOM   3417 C CE2 . TYR A 1 448 ? -8.183  -52.414 32.577  1.00 45.98  ? 449  TYR A CE2 1 
ATOM   3418 C CZ  . TYR A 1 448 ? -8.720  -52.586 33.841  1.00 42.14  ? 449  TYR A CZ  1 
ATOM   3419 O OH  . TYR A 1 448 ? -10.014 -52.157 34.055  1.00 40.31  ? 449  TYR A OH  1 
ATOM   3420 N N   . GLU A 1 449 ? -1.508  -51.993 33.197  1.00 38.57  ? 450  GLU A N   1 
ATOM   3421 C CA  . GLU A 1 449 ? -0.148  -52.023 33.714  1.00 38.10  ? 450  GLU A CA  1 
ATOM   3422 C C   . GLU A 1 449 ? 0.007   -51.106 34.945  1.00 37.19  ? 450  GLU A C   1 
ATOM   3423 O O   . GLU A 1 449 ? 0.907   -51.316 35.752  1.00 39.69  ? 450  GLU A O   1 
ATOM   3424 C CB  . GLU A 1 449 ? 0.851   -51.621 32.629  1.00 29.59  ? 450  GLU A CB  1 
ATOM   3425 C CG  . GLU A 1 449 ? 1.159   -50.145 32.545  1.00 32.65  ? 450  GLU A CG  1 
ATOM   3426 C CD  . GLU A 1 449 ? 0.011   -49.300 32.008  1.00 37.51  ? 450  GLU A CD  1 
ATOM   3427 O OE1 . GLU A 1 449 ? -1.135  -49.779 31.902  1.00 36.95  ? 450  GLU A OE1 1 
ATOM   3428 O OE2 . GLU A 1 449 ? 0.263   -48.128 31.660  1.00 42.85  ? 450  GLU A OE2 1 
ATOM   3429 N N   . ILE A 1 450 ? -0.865  -50.103 35.094  1.00 38.08  ? 451  ILE A N   1 
ATOM   3430 C CA  . ILE A 1 450 ? -0.723  -49.129 36.193  1.00 41.75  ? 451  ILE A CA  1 
ATOM   3431 C C   . ILE A 1 450 ? -0.655  -49.782 37.584  1.00 40.96  ? 451  ILE A C   1 
ATOM   3432 O O   . ILE A 1 450 ? 0.246   -49.472 38.391  1.00 38.29  ? 451  ILE A O   1 
ATOM   3433 C CB  . ILE A 1 450 ? -1.878  -48.103 36.225  1.00 37.65  ? 451  ILE A CB  1 
ATOM   3434 C CG1 . ILE A 1 450 ? -1.923  -47.321 34.909  1.00 41.24  ? 451  ILE A CG1 1 
ATOM   3435 C CG2 . ILE A 1 450 ? -1.751  -47.169 37.481  1.00 33.01  ? 451  ILE A CG2 1 
ATOM   3436 C CD1 . ILE A 1 450 ? -3.084  -46.348 34.800  1.00 36.40  ? 451  ILE A CD1 1 
ATOM   3437 N N   . GLU A 1 451 ? -1.572  -50.706 37.854  1.00 38.07  ? 452  GLU A N   1 
ATOM   3438 C CA  . GLU A 1 451 ? -1.612  -51.321 39.186  1.00 40.31  ? 452  GLU A CA  1 
ATOM   3439 C C   . GLU A 1 451 ? -0.297  -52.037 39.508  1.00 35.71  ? 452  GLU A C   1 
ATOM   3440 O O   . GLU A 1 451 ? 0.079   -52.123 40.666  1.00 41.31  ? 452  GLU A O   1 
ATOM   3441 C CB  . GLU A 1 451 ? -2.808  -52.279 39.315  1.00 35.33  ? 452  GLU A CB  1 
ATOM   3442 C CG  . GLU A 1 451 ? -2.692  -53.546 38.475  1.00 41.58  ? 452  GLU A CG  1 
ATOM   3443 C CD  . GLU A 1 451 ? -4.054  -54.117 38.076  1.00 45.68  ? 452  GLU A CD  1 
ATOM   3444 O OE1 . GLU A 1 451 ? -4.196  -55.356 38.081  1.00 54.39  ? 452  GLU A OE1 1 
ATOM   3445 O OE2 . GLU A 1 451 ? -4.986  -53.339 37.760  1.00 45.23  ? 452  GLU A OE2 1 
ATOM   3446 N N   . PHE A 1 452 ? 0.419   -52.514 38.490  1.00 39.98  ? 453  PHE A N   1 
ATOM   3447 C CA  . PHE A 1 452 ? 1.733   -53.139 38.705  1.00 38.47  ? 453  PHE A CA  1 
ATOM   3448 C C   . PHE A 1 452 ? 2.835   -52.120 38.958  1.00 41.71  ? 453  PHE A C   1 
ATOM   3449 O O   . PHE A 1 452 ? 3.684   -52.336 39.830  1.00 42.00  ? 453  PHE A O   1 
ATOM   3450 C CB  . PHE A 1 452 ? 2.107   -54.060 37.521  1.00 37.34  ? 453  PHE A CB  1 
ATOM   3451 C CG  . PHE A 1 452 ? 1.342   -55.337 37.543  1.00 42.59  ? 453  PHE A CG  1 
ATOM   3452 C CD1 . PHE A 1 452 ? 0.064   -55.401 36.992  1.00 39.51  ? 453  PHE A CD1 1 
ATOM   3453 C CD2 . PHE A 1 452 ? 1.826   -56.438 38.230  1.00 38.21  ? 453  PHE A CD2 1 
ATOM   3454 C CE1 . PHE A 1 452 ? -0.698  -56.557 37.088  1.00 39.89  ? 453  PHE A CE1 1 
ATOM   3455 C CE2 . PHE A 1 452 ? 1.070   -57.590 38.307  1.00 45.49  ? 453  PHE A CE2 1 
ATOM   3456 C CZ  . PHE A 1 452 ? -0.198  -57.645 37.739  1.00 36.53  ? 453  PHE A CZ  1 
ATOM   3457 N N   . ILE A 1 453 ? 2.822   -51.017 38.213  1.00 40.31  ? 454  ILE A N   1 
ATOM   3458 C CA  . ILE A 1 453 ? 3.803   -49.959 38.412  1.00 36.76  ? 454  ILE A CA  1 
ATOM   3459 C C   . ILE A 1 453 ? 3.697   -49.390 39.831  1.00 37.66  ? 454  ILE A C   1 
ATOM   3460 O O   . ILE A 1 453 ? 4.701   -49.145 40.482  1.00 37.42  ? 454  ILE A O   1 
ATOM   3461 C CB  . ILE A 1 453 ? 3.627   -48.796 37.403  1.00 40.12  ? 454  ILE A CB  1 
ATOM   3462 C CG1 . ILE A 1 453 ? 3.607   -49.279 35.930  1.00 38.71  ? 454  ILE A CG1 1 
ATOM   3463 C CG2 . ILE A 1 453 ? 4.694   -47.744 37.637  1.00 34.54  ? 454  ILE A CG2 1 
ATOM   3464 C CD1 . ILE A 1 453 ? 4.696   -50.188 35.577  1.00 39.17  ? 454  ILE A CD1 1 
ATOM   3465 N N   . PHE A 1 454 ? 2.475   -49.192 40.312  1.00 38.63  ? 455  PHE A N   1 
ATOM   3466 C CA  . PHE A 1 454 ? 2.250   -48.714 41.682  1.00 35.29  ? 455  PHE A CA  1 
ATOM   3467 C C   . PHE A 1 454 ? 2.330   -49.826 42.736  1.00 43.82  ? 455  PHE A C   1 
ATOM   3468 O O   . PHE A 1 454 ? 2.142   -49.576 43.931  1.00 34.14  ? 455  PHE A O   1 
ATOM   3469 C CB  . PHE A 1 454 ? 0.893   -48.022 41.795  1.00 34.39  ? 455  PHE A CB  1 
ATOM   3470 C CG  . PHE A 1 454 ? 0.889   -46.604 41.296  1.00 37.46  ? 455  PHE A CG  1 
ATOM   3471 C CD1 . PHE A 1 454 ? 0.678   -46.321 39.949  1.00 36.18  ? 455  PHE A CD1 1 
ATOM   3472 C CD2 . PHE A 1 454 ? 1.096   -45.549 42.176  1.00 36.32  ? 455  PHE A CD2 1 
ATOM   3473 C CE1 . PHE A 1 454 ? 0.670   -45.018 39.486  1.00 36.81  ? 455  PHE A CE1 1 
ATOM   3474 C CE2 . PHE A 1 454 ? 1.092   -44.234 41.722  1.00 41.22  ? 455  PHE A CE2 1 
ATOM   3475 C CZ  . PHE A 1 454 ? 0.873   -43.963 40.373  1.00 35.31  ? 455  PHE A CZ  1 
ATOM   3476 N N   . GLY A 1 455 ? 2.610   -51.054 42.311  1.00 42.13  ? 456  GLY A N   1 
ATOM   3477 C CA  . GLY A 1 455 ? 2.849   -52.118 43.276  1.00 41.13  ? 456  GLY A CA  1 
ATOM   3478 C C   . GLY A 1 455 ? 1.626   -52.498 44.104  1.00 42.93  ? 456  GLY A C   1 
ATOM   3479 O O   . GLY A 1 455 ? 1.757   -53.015 45.217  1.00 41.05  ? 456  GLY A O   1 
ATOM   3480 N N   . ILE A 1 456 ? 0.437   -52.259 43.557  1.00 42.20  ? 457  ILE A N   1 
ATOM   3481 C CA  . ILE A 1 456 ? -0.804  -52.682 44.204  1.00 41.08  ? 457  ILE A CA  1 
ATOM   3482 C C   . ILE A 1 456 ? -0.853  -54.185 44.538  1.00 46.76  ? 457  ILE A C   1 
ATOM   3483 O O   . ILE A 1 456 ? -1.456  -54.573 45.529  1.00 49.42  ? 457  ILE A O   1 
ATOM   3484 C CB  . ILE A 1 456 ? -2.038  -52.347 43.346  1.00 46.33  ? 457  ILE A CB  1 
ATOM   3485 C CG1 . ILE A 1 456 ? -2.053  -50.861 42.950  1.00 40.41  ? 457  ILE A CG1 1 
ATOM   3486 C CG2 . ILE A 1 456 ? -3.310  -52.731 44.099  1.00 44.89  ? 457  ILE A CG2 1 
ATOM   3487 C CD1 . ILE A 1 456 ? -2.069  -49.891 44.132  1.00 37.36  ? 457  ILE A CD1 1 
ATOM   3488 N N   . PRO A 1 457 ? -0.222  -55.049 43.723  1.00 48.94  ? 458  PRO A N   1 
ATOM   3489 C CA  . PRO A 1 457 ? -0.265  -56.448 44.169  1.00 44.99  ? 458  PRO A CA  1 
ATOM   3490 C C   . PRO A 1 457 ? 0.307   -56.728 45.556  1.00 50.00  ? 458  PRO A C   1 
ATOM   3491 O O   . PRO A 1 457 ? -0.008  -57.780 46.098  1.00 54.52  ? 458  PRO A O   1 
ATOM   3492 C CB  . PRO A 1 457 ? 0.564   -57.162 43.104  1.00 48.01  ? 458  PRO A CB  1 
ATOM   3493 C CG  . PRO A 1 457 ? 0.238   -56.404 41.861  1.00 39.73  ? 458  PRO A CG  1 
ATOM   3494 C CD  . PRO A 1 457 ? 0.176   -54.958 42.303  1.00 45.21  ? 458  PRO A CD  1 
ATOM   3495 N N   . LEU A 1 458 ? 1.111   -55.826 46.115  1.00 50.68  ? 459  LEU A N   1 
ATOM   3496 C CA  . LEU A 1 458 ? 1.694   -56.042 47.441  1.00 48.80  ? 459  LEU A CA  1 
ATOM   3497 C C   . LEU A 1 458 ? 0.640   -55.919 48.550  1.00 48.62  ? 459  LEU A C   1 
ATOM   3498 O O   . LEU A 1 458 ? 0.862   -56.379 49.664  1.00 51.98  ? 459  LEU A O   1 
ATOM   3499 C CB  . LEU A 1 458 ? 2.845   -55.058 47.702  1.00 44.95  ? 459  LEU A CB  1 
ATOM   3500 C CG  . LEU A 1 458 ? 4.060   -55.174 46.776  1.00 49.41  ? 459  LEU A CG  1 
ATOM   3501 C CD1 . LEU A 1 458 ? 5.198   -54.294 47.288  1.00 52.04  ? 459  LEU A CD1 1 
ATOM   3502 C CD2 . LEU A 1 458 ? 4.503   -56.610 46.710  1.00 48.66  ? 459  LEU A CD2 1 
ATOM   3503 N N   . ASP A 1 459 ? -0.496  -55.299 48.245  1.00 46.14  ? 460  ASP A N   1 
ATOM   3504 C CA  . ASP A 1 459 ? -1.597  -55.219 49.204  1.00 48.47  ? 460  ASP A CA  1 
ATOM   3505 C C   . ASP A 1 459 ? -2.141  -56.622 49.499  1.00 57.39  ? 460  ASP A C   1 
ATOM   3506 O O   . ASP A 1 459 ? -2.699  -57.279 48.614  1.00 54.40  ? 460  ASP A O   1 
ATOM   3507 C CB  . ASP A 1 459 ? -2.716  -54.314 48.677  1.00 48.41  ? 460  ASP A CB  1 
ATOM   3508 C CG  . ASP A 1 459 ? -3.818  -54.080 49.714  1.00 54.77  ? 460  ASP A CG  1 
ATOM   3509 O OD1 . ASP A 1 459 ? -3.842  -54.795 50.737  1.00 61.97  ? 460  ASP A OD1 1 
ATOM   3510 O OD2 . ASP A 1 459 ? -4.674  -53.187 49.515  1.00 52.47  ? 460  ASP A OD2 1 
ATOM   3511 N N   . PRO A 1 460 ? -2.009  -57.077 50.762  1.00 66.35  ? 461  PRO A N   1 
ATOM   3512 C CA  . PRO A 1 460 ? -2.419  -58.453 51.094  1.00 64.12  ? 461  PRO A CA  1 
ATOM   3513 C C   . PRO A 1 460 ? -3.928  -58.661 50.935  1.00 59.17  ? 461  PRO A C   1 
ATOM   3514 O O   . PRO A 1 460 ? -4.351  -59.716 50.446  1.00 59.93  ? 461  PRO A O   1 
ATOM   3515 C CB  . PRO A 1 460 ? -1.988  -58.604 52.549  1.00 60.46  ? 461  PRO A CB  1 
ATOM   3516 C CG  . PRO A 1 460 ? -1.998  -57.201 53.084  1.00 62.83  ? 461  PRO A CG  1 
ATOM   3517 C CD  . PRO A 1 460 ? -1.550  -56.331 51.950  1.00 54.62  ? 461  PRO A CD  1 
ATOM   3518 N N   . SER A 1 461 ? -4.717  -57.651 51.293  1.00 50.04  ? 462  SER A N   1 
ATOM   3519 C CA  . SER A 1 461 ? -6.164  -57.715 51.113  1.00 56.36  ? 462  SER A CA  1 
ATOM   3520 C C   . SER A 1 461 ? -6.625  -57.942 49.666  1.00 61.95  ? 462  SER A C   1 
ATOM   3521 O O   . SER A 1 461 ? -7.814  -58.131 49.428  1.00 69.02  ? 462  SER A O   1 
ATOM   3522 C CB  . SER A 1 461 ? -6.809  -56.434 51.622  1.00 55.49  ? 462  SER A CB  1 
ATOM   3523 O OG  . SER A 1 461 ? -6.702  -55.426 50.646  1.00 54.43  ? 462  SER A OG  1 
ATOM   3524 N N   . ARG A 1 462 ? -5.709  -57.889 48.703  1.00 56.99  ? 463  ARG A N   1 
ATOM   3525 C CA  . ARG A 1 462 ? -6.050  -58.196 47.315  1.00 57.78  ? 463  ARG A CA  1 
ATOM   3526 C C   . ARG A 1 462 ? -5.457  -59.548 46.950  1.00 57.79  ? 463  ARG A C   1 
ATOM   3527 O O   . ARG A 1 462 ? -4.722  -60.137 47.751  1.00 60.31  ? 463  ARG A O   1 
ATOM   3528 C CB  . ARG A 1 462 ? -5.558  -57.099 46.375  1.00 57.48  ? 463  ARG A CB  1 
ATOM   3529 C CG  . ARG A 1 462 ? -6.259  -55.773 46.608  1.00 57.06  ? 463  ARG A CG  1 
ATOM   3530 C CD  . ARG A 1 462 ? -5.854  -54.750 45.576  1.00 57.52  ? 463  ARG A CD  1 
ATOM   3531 N NE  . ARG A 1 462 ? -6.253  -53.402 45.964  1.00 57.45  ? 463  ARG A NE  1 
ATOM   3532 C CZ  . ARG A 1 462 ? -7.354  -52.801 45.524  1.00 62.98  ? 463  ARG A CZ  1 
ATOM   3533 N NH1 . ARG A 1 462 ? -8.167  -53.437 44.687  1.00 66.75  ? 463  ARG A NH1 1 
ATOM   3534 N NH2 . ARG A 1 462 ? -7.648  -51.568 45.925  1.00 64.10  ? 463  ARG A NH2 1 
ATOM   3535 N N   . ASN A 1 463 ? -5.770  -60.057 45.763  1.00 54.13  ? 464  ASN A N   1 
ATOM   3536 C CA  . ASN A 1 463 ? -5.583  -61.498 45.530  1.00 57.54  ? 464  ASN A CA  1 
ATOM   3537 C C   . ASN A 1 463 ? -4.552  -61.890 44.474  1.00 56.42  ? 464  ASN A C   1 
ATOM   3538 O O   . ASN A 1 463 ? -4.700  -62.930 43.826  1.00 61.42  ? 464  ASN A O   1 
ATOM   3539 C CB  . ASN A 1 463 ? -6.939  -62.141 45.171  1.00 59.94  ? 464  ASN A CB  1 
ATOM   3540 C CG  . ASN A 1 463 ? -7.887  -62.218 46.372  1.00 67.87  ? 464  ASN A CG  1 
ATOM   3541 O OD1 . ASN A 1 463 ? -7.444  -62.495 47.495  1.00 62.24  ? 464  ASN A OD1 1 
ATOM   3542 N ND2 . ASN A 1 463 ? -9.184  -61.960 46.148  1.00 63.84  ? 464  ASN A ND2 1 
ATOM   3543 N N   . TYR A 1 464 ? -3.501  -61.090 44.317  1.00 42.23  ? 465  TYR A N   1 
ATOM   3544 C CA  . TYR A 1 464 ? -2.501  -61.382 43.304  1.00 50.75  ? 465  TYR A CA  1 
ATOM   3545 C C   . TYR A 1 464 ? -1.651  -62.579 43.741  1.00 50.08  ? 465  TYR A C   1 
ATOM   3546 O O   . TYR A 1 464 ? -1.588  -62.896 44.909  1.00 50.62  ? 465  TYR A O   1 
ATOM   3547 C CB  . TYR A 1 464 ? -1.628  -60.142 43.032  1.00 47.18  ? 465  TYR A CB  1 
ATOM   3548 C CG  . TYR A 1 464 ? -2.376  -58.986 42.384  1.00 49.50  ? 465  TYR A CG  1 
ATOM   3549 C CD1 . TYR A 1 464 ? -3.094  -58.082 43.162  1.00 44.61  ? 465  TYR A CD1 1 
ATOM   3550 C CD2 . TYR A 1 464 ? -2.369  -58.802 40.986  1.00 45.01  ? 465  TYR A CD2 1 
ATOM   3551 C CE1 . TYR A 1 464 ? -3.781  -57.029 42.591  1.00 45.86  ? 465  TYR A CE1 1 
ATOM   3552 C CE2 . TYR A 1 464 ? -3.065  -57.743 40.398  1.00 43.18  ? 465  TYR A CE2 1 
ATOM   3553 C CZ  . TYR A 1 464 ? -3.762  -56.856 41.212  1.00 47.05  ? 465  TYR A CZ  1 
ATOM   3554 O OH  . TYR A 1 464 ? -4.460  -55.795 40.668  1.00 46.46  ? 465  TYR A OH  1 
ATOM   3555 N N   . THR A 1 465 ? -1.012  -63.252 42.797  1.00 49.27  ? 466  THR A N   1 
ATOM   3556 C CA  . THR A 1 465 ? -0.159  -64.382 43.137  1.00 43.00  ? 466  THR A CA  1 
ATOM   3557 C C   . THR A 1 465 ? 1.176   -63.927 43.689  1.00 52.56  ? 466  THR A C   1 
ATOM   3558 O O   . THR A 1 465 ? 1.527   -62.748 43.611  1.00 54.26  ? 466  THR A O   1 
ATOM   3559 C CB  . THR A 1 465 ? 0.128   -65.275 41.922  1.00 48.67  ? 466  THR A CB  1 
ATOM   3560 O OG1 . THR A 1 465 ? 1.065   -64.620 41.055  1.00 49.31  ? 466  THR A OG1 1 
ATOM   3561 C CG2 . THR A 1 465 ? -1.161  -65.607 41.172  1.00 42.55  ? 466  THR A CG2 1 
ATOM   3562 N N   . ALA A 1 466 ? 1.931   -64.873 44.238  1.00 51.75  ? 467  ALA A N   1 
ATOM   3563 C CA  . ALA A 1 466 ? 3.269   -64.576 44.710  1.00 55.75  ? 467  ALA A CA  1 
ATOM   3564 C C   . ALA A 1 466 ? 4.141   -64.064 43.562  1.00 53.68  ? 467  ALA A C   1 
ATOM   3565 O O   . ALA A 1 466 ? 4.935   -63.149 43.760  1.00 50.01  ? 467  ALA A O   1 
ATOM   3566 C CB  . ALA A 1 466 ? 3.898   -65.811 45.359  1.00 54.28  ? 467  ALA A CB  1 
ATOM   3567 N N   . GLU A 1 467 ? 3.983   -64.641 42.366  1.00 51.56  ? 468  GLU A N   1 
ATOM   3568 C CA  . GLU A 1 467 ? 4.793   -64.240 41.210  1.00 55.92  ? 468  GLU A CA  1 
ATOM   3569 C C   . GLU A 1 467 ? 4.452   -62.854 40.700  1.00 51.98  ? 468  GLU A C   1 
ATOM   3570 O O   . GLU A 1 467 ? 5.318   -62.157 40.169  1.00 43.33  ? 468  GLU A O   1 
ATOM   3571 C CB  . GLU A 1 467 ? 4.638   -65.231 40.064  1.00 53.12  ? 468  GLU A CB  1 
ATOM   3572 C CG  . GLU A 1 467 ? 5.746   -66.254 39.989  1.00 67.41  ? 468  GLU A CG  1 
ATOM   3573 C CD  . GLU A 1 467 ? 5.261   -67.579 39.407  1.00 88.26  ? 468  GLU A CD  1 
ATOM   3574 O OE1 . GLU A 1 467 ? 5.074   -67.664 38.158  1.00 83.03  ? 468  GLU A OE1 1 
ATOM   3575 O OE2 . GLU A 1 467 ? 5.055   -68.528 40.211  1.00 86.72  ? 468  GLU A OE2 1 
ATOM   3576 N N   . GLU A 1 468 ? 3.189   -62.463 40.844  1.00 49.28  ? 469  GLU A N   1 
ATOM   3577 C CA  . GLU A 1 468 ? 2.769   -61.136 40.426  1.00 49.79  ? 469  GLU A CA  1 
ATOM   3578 C C   . GLU A 1 468 ? 3.366   -60.059 41.351  1.00 55.37  ? 469  GLU A C   1 
ATOM   3579 O O   . GLU A 1 468 ? 3.631   -58.930 40.907  1.00 49.16  ? 469  GLU A O   1 
ATOM   3580 C CB  . GLU A 1 468 ? 1.243   -61.055 40.374  1.00 47.80  ? 469  GLU A CB  1 
ATOM   3581 C CG  . GLU A 1 468 ? 0.683   -61.754 39.119  1.00 41.35  ? 469  GLU A CG  1 
ATOM   3582 C CD  . GLU A 1 468 ? -0.839  -61.764 39.030  1.00 48.20  ? 469  GLU A CD  1 
ATOM   3583 O OE1 . GLU A 1 468 ? -1.522  -61.999 40.055  1.00 46.64  ? 469  GLU A OE1 1 
ATOM   3584 O OE2 . GLU A 1 468 ? -1.362  -61.549 37.914  1.00 46.05  ? 469  GLU A OE2 1 
ATOM   3585 N N   . LYS A 1 469 ? 3.623   -60.421 42.611  1.00 46.10  ? 470  LYS A N   1 
ATOM   3586 C CA  . LYS A 1 469 ? 4.225   -59.495 43.574  1.00 44.04  ? 470  LYS A CA  1 
ATOM   3587 C C   . LYS A 1 469 ? 5.698   -59.275 43.261  1.00 46.83  ? 470  LYS A C   1 
ATOM   3588 O O   . LYS A 1 469 ? 6.213   -58.158 43.318  1.00 46.50  ? 470  LYS A O   1 
ATOM   3589 C CB  . LYS A 1 469 ? 4.062   -60.014 45.005  1.00 49.35  ? 470  LYS A CB  1 
ATOM   3590 C CG  . LYS A 1 469 ? 2.605   -60.191 45.420  1.00 56.10  ? 470  LYS A CG  1 
ATOM   3591 C CD  . LYS A 1 469 ? 2.477   -60.639 46.864  1.00 53.99  ? 470  LYS A CD  1 
ATOM   3592 C CE  . LYS A 1 469 ? 1.016   -60.728 47.292  1.00 50.21  ? 470  LYS A CE  1 
ATOM   3593 N NZ  . LYS A 1 469 ? 0.888   -60.930 48.774  1.00 57.83  ? 470  LYS A NZ  1 
ATOM   3594 N N   . ILE A 1 470 ? 6.380   -60.355 42.928  1.00 45.58  ? 471  ILE A N   1 
ATOM   3595 C CA  . ILE A 1 470 ? 7.762   -60.258 42.516  1.00 44.96  ? 471  ILE A CA  1 
ATOM   3596 C C   . ILE A 1 470 ? 7.865   -59.407 41.235  1.00 49.95  ? 471  ILE A C   1 
ATOM   3597 O O   . ILE A 1 470 ? 8.819   -58.638 41.053  1.00 43.70  ? 471  ILE A O   1 
ATOM   3598 C CB  . ILE A 1 470 ? 8.363   -61.669 42.316  1.00 49.21  ? 471  ILE A CB  1 
ATOM   3599 C CG1 . ILE A 1 470 ? 8.710   -62.260 43.694  1.00 46.66  ? 471  ILE A CG1 1 
ATOM   3600 C CG2 . ILE A 1 470 ? 9.591   -61.634 41.392  1.00 39.97  ? 471  ILE A CG2 1 
ATOM   3601 C CD1 . ILE A 1 470 ? 9.174   -63.680 43.635  1.00 44.49  ? 471  ILE A CD1 1 
ATOM   3602 N N   . PHE A 1 471 ? 6.849   -59.526 40.384  1.00 42.95  ? 472  PHE A N   1 
ATOM   3603 C CA  . PHE A 1 471 ? 6.765   -58.782 39.139  1.00 47.80  ? 472  PHE A CA  1 
ATOM   3604 C C   . PHE A 1 471 ? 6.563   -57.285 39.376  1.00 40.52  ? 472  PHE A C   1 
ATOM   3605 O O   . PHE A 1 471 ? 7.286   -56.449 38.828  1.00 40.34  ? 472  PHE A O   1 
ATOM   3606 C CB  . PHE A 1 471 ? 5.626   -59.348 38.301  1.00 45.51  ? 472  PHE A CB  1 
ATOM   3607 C CG  . PHE A 1 471 ? 5.446   -58.686 36.993  1.00 36.60  ? 472  PHE A CG  1 
ATOM   3608 C CD1 . PHE A 1 471 ? 6.541   -58.401 36.180  1.00 43.84  ? 472  PHE A CD1 1 
ATOM   3609 C CD2 . PHE A 1 471 ? 4.165   -58.408 36.523  1.00 39.35  ? 472  PHE A CD2 1 
ATOM   3610 C CE1 . PHE A 1 471 ? 6.366   -57.812 34.908  1.00 35.54  ? 472  PHE A CE1 1 
ATOM   3611 C CE2 . PHE A 1 471 ? 3.977   -57.815 35.239  1.00 35.52  ? 472  PHE A CE2 1 
ATOM   3612 C CZ  . PHE A 1 471 ? 5.087   -57.511 34.453  1.00 34.88  ? 472  PHE A CZ  1 
ATOM   3613 N N   . ALA A 1 472 ? 5.567   -56.960 40.183  1.00 38.54  ? 473  ALA A N   1 
ATOM   3614 C CA  . ALA A 1 472 ? 5.344   -55.583 40.596  1.00 44.56  ? 473  ALA A CA  1 
ATOM   3615 C C   . ALA A 1 472 ? 6.655   -54.959 41.088  1.00 45.16  ? 473  ALA A C   1 
ATOM   3616 O O   . ALA A 1 472 ? 7.006   -53.834 40.682  1.00 42.07  ? 473  ALA A O   1 
ATOM   3617 C CB  . ALA A 1 472 ? 4.264   -55.516 41.676  1.00 40.77  ? 473  ALA A CB  1 
ATOM   3618 N N   . GLN A 1 473 ? 7.402   -55.712 41.897  1.00 37.98  ? 474  GLN A N   1 
ATOM   3619 C CA  . GLN A 1 473 ? 8.621   -55.185 42.505  1.00 45.69  ? 474  GLN A CA  1 
ATOM   3620 C C   . GLN A 1 473 ? 9.678   -54.897 41.459  1.00 38.01  ? 474  GLN A C   1 
ATOM   3621 O O   . GLN A 1 473 ? 10.371  -53.891 41.559  1.00 39.43  ? 474  GLN A O   1 
ATOM   3622 C CB  . GLN A 1 473 ? 9.159   -56.145 43.586  1.00 42.12  ? 474  GLN A CB  1 
ATOM   3623 C CG  . GLN A 1 473 ? 8.240   -56.190 44.788  1.00 42.35  ? 474  GLN A CG  1 
ATOM   3624 C CD  . GLN A 1 473 ? 8.605   -57.270 45.801  1.00 54.18  ? 474  GLN A CD  1 
ATOM   3625 O OE1 . GLN A 1 473 ? 8.978   -58.391 45.449  1.00 55.87  ? 474  GLN A OE1 1 
ATOM   3626 N NE2 . GLN A 1 473 ? 8.480   -56.932 47.067  1.00 50.23  ? 474  GLN A NE2 1 
ATOM   3627 N N   . ARG A 1 474 ? 9.787   -55.766 40.453  1.00 43.12  ? 475  ARG A N   1 
ATOM   3628 C CA  . ARG A 1 474 ? 10.633  -55.502 39.285  1.00 43.86  ? 475  ARG A CA  1 
ATOM   3629 C C   . ARG A 1 474 ? 10.247  -54.210 38.557  1.00 37.83  ? 475  ARG A C   1 
ATOM   3630 O O   . ARG A 1 474 ? 11.101  -53.413 38.184  1.00 39.12  ? 475  ARG A O   1 
ATOM   3631 C CB  . ARG A 1 474 ? 10.560  -56.658 38.282  1.00 48.30  ? 475  ARG A CB  1 
ATOM   3632 C CG  . ARG A 1 474 ? 11.326  -57.911 38.652  1.00 47.84  ? 475  ARG A CG  1 
ATOM   3633 C CD  . ARG A 1 474 ? 11.156  -58.974 37.547  1.00 51.69  ? 475  ARG A CD  1 
ATOM   3634 N NE  . ARG A 1 474 ? 11.593  -58.461 36.245  1.00 48.95  ? 475  ARG A NE  1 
ATOM   3635 C CZ  . ARG A 1 474 ? 10.992  -58.736 35.088  1.00 48.19  ? 475  ARG A CZ  1 
ATOM   3636 N NH1 . ARG A 1 474 ? 9.926   -59.523 35.070  1.00 41.31  ? 475  ARG A NH1 1 
ATOM   3637 N NH2 . ARG A 1 474 ? 11.457  -58.217 33.953  1.00 44.24  ? 475  ARG A NH2 1 
ATOM   3638 N N   . LEU A 1 475 ? 8.955   -54.019 38.334  1.00 37.40  ? 476  LEU A N   1 
ATOM   3639 C CA  . LEU A 1 475 ? 8.506   -52.865 37.567  1.00 39.48  ? 476  LEU A CA  1 
ATOM   3640 C C   . LEU A 1 475 ? 8.810   -51.591 38.374  1.00 45.07  ? 476  LEU A C   1 
ATOM   3641 O O   . LEU A 1 475 ? 9.349   -50.604 37.844  1.00 38.81  ? 476  LEU A O   1 
ATOM   3642 C CB  . LEU A 1 475 ? 7.015   -52.986 37.234  1.00 35.90  ? 476  LEU A CB  1 
ATOM   3643 C CG  . LEU A 1 475 ? 6.681   -54.025 36.142  1.00 46.95  ? 476  LEU A CG  1 
ATOM   3644 C CD1 . LEU A 1 475 ? 5.271   -53.837 35.585  1.00 45.14  ? 476  LEU A CD1 1 
ATOM   3645 C CD2 . LEU A 1 475 ? 7.666   -53.968 34.994  1.00 36.54  ? 476  LEU A CD2 1 
ATOM   3646 N N   . MET A 1 476 ? 8.501   -51.643 39.668  1.00 37.12  ? 477  MET A N   1 
ATOM   3647 C CA  . MET A 1 476 ? 8.768   -50.520 40.555  1.00 39.69  ? 477  MET A CA  1 
ATOM   3648 C C   . MET A 1 476 ? 10.244  -50.163 40.567  1.00 37.20  ? 477  MET A C   1 
ATOM   3649 O O   . MET A 1 476 ? 10.595  -48.986 40.630  1.00 36.72  ? 477  MET A O   1 
ATOM   3650 C CB  . MET A 1 476 ? 8.284   -50.818 41.977  1.00 40.56  ? 477  MET A CB  1 
ATOM   3651 C CG  . MET A 1 476 ? 6.771   -50.794 42.144  1.00 38.99  ? 477  MET A CG  1 
ATOM   3652 S SD  . MET A 1 476 ? 6.294   -50.720 43.897  1.00 44.26  ? 477  MET A SD  1 
ATOM   3653 C CE  . MET A 1 476 ? 6.842   -52.334 44.427  1.00 38.01  ? 477  MET A CE  1 
ATOM   3654 N N   . ARG A 1 477 ? 11.101  -51.176 40.484  1.00 39.21  ? 478  ARG A N   1 
ATOM   3655 C CA  . ARG A 1 477 ? 12.553  -50.968 40.417  1.00 38.54  ? 478  ARG A CA  1 
ATOM   3656 C C   . ARG A 1 477 ? 12.981  -50.315 39.099  1.00 39.63  ? 478  ARG A C   1 
ATOM   3657 O O   . ARG A 1 477 ? 13.795  -49.370 39.115  1.00 35.95  ? 478  ARG A O   1 
ATOM   3658 C CB  . ARG A 1 477 ? 13.300  -52.307 40.618  1.00 39.71  ? 478  ARG A CB  1 
ATOM   3659 C CG  . ARG A 1 477 ? 14.826  -52.234 40.603  1.00 41.05  ? 478  ARG A CG  1 
ATOM   3660 C CD  . ARG A 1 477 ? 15.366  -51.250 41.647  1.00 44.62  ? 478  ARG A CD  1 
ATOM   3661 N NE  . ARG A 1 477 ? 14.916  -51.614 42.981  1.00 47.77  ? 478  ARG A NE  1 
ATOM   3662 C CZ  . ARG A 1 477 ? 15.493  -52.560 43.720  1.00 54.35  ? 478  ARG A CZ  1 
ATOM   3663 N NH1 . ARG A 1 477 ? 16.544  -53.230 43.246  1.00 42.31  ? 478  ARG A NH1 1 
ATOM   3664 N NH2 . ARG A 1 477 ? 15.020  -52.840 44.930  1.00 45.91  ? 478  ARG A NH2 1 
ATOM   3665 N N   . TYR A 1 478 ? 12.452  -50.805 37.966  1.00 38.52  ? 479  TYR A N   1 
ATOM   3666 C CA  . TYR A 1 478 ? 12.766  -50.198 36.659  1.00 36.98  ? 479  TYR A CA  1 
ATOM   3667 C C   . TYR A 1 478 ? 12.404  -48.711 36.660  1.00 37.88  ? 479  TYR A C   1 
ATOM   3668 O O   . TYR A 1 478 ? 13.234  -47.868 36.308  1.00 41.70  ? 479  TYR A O   1 
ATOM   3669 C CB  . TYR A 1 478 ? 12.016  -50.877 35.484  1.00 36.41  ? 479  TYR A CB  1 
ATOM   3670 C CG  . TYR A 1 478 ? 12.436  -52.289 35.149  1.00 36.34  ? 479  TYR A CG  1 
ATOM   3671 C CD1 . TYR A 1 478 ? 13.784  -52.643 35.019  1.00 34.03  ? 479  TYR A CD1 1 
ATOM   3672 C CD2 . TYR A 1 478 ? 11.474  -53.272 34.944  1.00 37.97  ? 479  TYR A CD2 1 
ATOM   3673 C CE1 . TYR A 1 478 ? 14.154  -53.946 34.700  1.00 32.58  ? 479  TYR A CE1 1 
ATOM   3674 C CE2 . TYR A 1 478 ? 11.827  -54.565 34.643  1.00 39.48  ? 479  TYR A CE2 1 
ATOM   3675 C CZ  . TYR A 1 478 ? 13.159  -54.900 34.517  1.00 41.17  ? 479  TYR A CZ  1 
ATOM   3676 O OH  . TYR A 1 478 ? 13.456  -56.208 34.222  1.00 46.31  ? 479  TYR A OH  1 
ATOM   3677 N N   . TRP A 1 479 ? 11.165  -48.408 37.063  1.00 36.12  ? 480  TRP A N   1 
ATOM   3678 C CA  . TRP A 1 479 ? 10.649  -47.039 37.071  1.00 37.56  ? 480  TRP A CA  1 
ATOM   3679 C C   . TRP A 1 479 ? 11.451  -46.110 38.001  1.00 36.96  ? 480  TRP A C   1 
ATOM   3680 O O   . TRP A 1 479 ? 11.760  -44.985 37.646  1.00 38.83  ? 480  TRP A O   1 
ATOM   3681 C CB  . TRP A 1 479 ? 9.171   -47.031 37.476  1.00 26.56  ? 480  TRP A CB  1 
ATOM   3682 C CG  . TRP A 1 479 ? 8.184   -46.911 36.304  1.00 35.65  ? 480  TRP A CG  1 
ATOM   3683 C CD1 . TRP A 1 479 ? 7.266   -45.904 36.094  1.00 34.07  ? 480  TRP A CD1 1 
ATOM   3684 C CD2 . TRP A 1 479 ? 8.004   -47.837 35.222  1.00 34.02  ? 480  TRP A CD2 1 
ATOM   3685 N NE1 . TRP A 1 479 ? 6.552   -46.140 34.952  1.00 36.55  ? 480  TRP A NE1 1 
ATOM   3686 C CE2 . TRP A 1 479 ? 6.976   -47.322 34.397  1.00 37.15  ? 480  TRP A CE2 1 
ATOM   3687 C CE3 . TRP A 1 479 ? 8.605   -49.050 34.873  1.00 35.48  ? 480  TRP A CE3 1 
ATOM   3688 C CZ2 . TRP A 1 479 ? 6.546   -47.977 33.239  1.00 31.96  ? 480  TRP A CZ2 1 
ATOM   3689 C CZ3 . TRP A 1 479 ? 8.176   -49.701 33.731  1.00 39.34  ? 480  TRP A CZ3 1 
ATOM   3690 C CH2 . TRP A 1 479 ? 7.160   -49.158 32.918  1.00 37.02  ? 480  TRP A CH2 1 
ATOM   3691 N N   . ALA A 1 480 ? 11.791  -46.584 39.190  1.00 39.40  ? 481  ALA A N   1 
ATOM   3692 C CA  . ALA A 1 480 ? 12.526  -45.760 40.146  1.00 37.94  ? 481  ALA A CA  1 
ATOM   3693 C C   . ALA A 1 480 ? 14.000  -45.633 39.727  1.00 40.71  ? 481  ALA A C   1 
ATOM   3694 O O   . ALA A 1 480 ? 14.620  -44.585 39.932  1.00 37.76  ? 481  ALA A O   1 
ATOM   3695 C CB  . ALA A 1 480 ? 12.403  -46.341 41.541  1.00 36.06  ? 481  ALA A CB  1 
ATOM   3696 N N   . ASN A 1 481 ? 14.550  -46.688 39.123  1.00 36.72  ? 482  ASN A N   1 
ATOM   3697 C CA  . ASN A 1 481 ? 15.882  -46.589 38.536  1.00 40.80  ? 482  ASN A CA  1 
ATOM   3698 C C   . ASN A 1 481 ? 15.908  -45.475 37.516  1.00 43.36  ? 482  ASN A C   1 
ATOM   3699 O O   . ASN A 1 481 ? 16.848  -44.669 37.484  1.00 37.79  ? 482  ASN A O   1 
ATOM   3700 C CB  . ASN A 1 481 ? 16.312  -47.903 37.870  1.00 37.68  ? 482  ASN A CB  1 
ATOM   3701 C CG  . ASN A 1 481 ? 16.864  -48.906 38.877  1.00 45.71  ? 482  ASN A CG  1 
ATOM   3702 O OD1 . ASN A 1 481 ? 16.972  -48.598 40.071  1.00 43.16  ? 482  ASN A OD1 1 
ATOM   3703 N ND2 . ASN A 1 481 ? 17.206  -50.108 38.407  1.00 44.30  ? 482  ASN A ND2 1 
ATOM   3704 N N   . PHE A 1 482 ? 14.862  -45.437 36.685  1.00 40.19  ? 483  PHE A N   1 
ATOM   3705 C CA  . PHE A 1 482 ? 14.808  -44.482 35.598  1.00 37.61  ? 483  PHE A CA  1 
ATOM   3706 C C   . PHE A 1 482 ? 14.712  -43.078 36.182  1.00 38.84  ? 483  PHE A C   1 
ATOM   3707 O O   . PHE A 1 482 ? 15.379  -42.151 35.712  1.00 40.66  ? 483  PHE A O   1 
ATOM   3708 C CB  . PHE A 1 482 ? 13.623  -44.756 34.647  1.00 36.16  ? 483  PHE A CB  1 
ATOM   3709 C CG  . PHE A 1 482 ? 13.465  -43.694 33.576  1.00 38.67  ? 483  PHE A CG  1 
ATOM   3710 C CD1 . PHE A 1 482 ? 14.318  -43.667 32.470  1.00 36.69  ? 483  PHE A CD1 1 
ATOM   3711 C CD2 . PHE A 1 482 ? 12.499  -42.710 33.690  1.00 32.28  ? 483  PHE A CD2 1 
ATOM   3712 C CE1 . PHE A 1 482 ? 14.199  -42.686 31.502  1.00 35.53  ? 483  PHE A CE1 1 
ATOM   3713 C CE2 . PHE A 1 482 ? 12.372  -41.726 32.705  1.00 35.19  ? 483  PHE A CE2 1 
ATOM   3714 C CZ  . PHE A 1 482 ? 13.227  -41.712 31.626  1.00 31.32  ? 483  PHE A CZ  1 
ATOM   3715 N N   . ALA A 1 483 ? 13.869  -42.915 37.195  1.00 34.74  ? 484  ALA A N   1 
ATOM   3716 C CA  . ALA A 1 483 ? 13.729  -41.623 37.864  1.00 39.73  ? 484  ALA A CA  1 
ATOM   3717 C C   . ALA A 1 483 ? 15.051  -41.136 38.503  1.00 42.76  ? 484  ALA A C   1 
ATOM   3718 O O   . ALA A 1 483 ? 15.356  -39.956 38.475  1.00 49.29  ? 484  ALA A O   1 
ATOM   3719 C CB  . ALA A 1 483 ? 12.628  -41.698 38.927  1.00 34.55  ? 484  ALA A CB  1 
ATOM   3720 N N   . ARG A 1 484 ? 15.822  -42.050 39.077  1.00 38.48  ? 485  ARG A N   1 
ATOM   3721 C CA  . ARG A 1 484 ? 17.079  -41.699 39.728  1.00 39.88  ? 485  ARG A CA  1 
ATOM   3722 C C   . ARG A 1 484 ? 18.201  -41.403 38.724  1.00 47.32  ? 485  ARG A C   1 
ATOM   3723 O O   . ARG A 1 484 ? 18.957  -40.457 38.921  1.00 47.13  ? 485  ARG A O   1 
ATOM   3724 C CB  . ARG A 1 484 ? 17.514  -42.829 40.668  1.00 37.05  ? 485  ARG A CB  1 
ATOM   3725 C CG  . ARG A 1 484 ? 16.710  -42.882 41.986  1.00 42.88  ? 485  ARG A CG  1 
ATOM   3726 C CD  . ARG A 1 484 ? 17.238  -43.945 42.961  1.00 35.45  ? 485  ARG A CD  1 
ATOM   3727 N NE  . ARG A 1 484 ? 17.032  -45.304 42.454  1.00 41.10  ? 485  ARG A NE  1 
ATOM   3728 C CZ  . ARG A 1 484 ? 16.064  -46.118 42.847  1.00 35.87  ? 485  ARG A CZ  1 
ATOM   3729 N NH1 . ARG A 1 484 ? 15.200  -45.723 43.763  1.00 36.62  ? 485  ARG A NH1 1 
ATOM   3730 N NH2 . ARG A 1 484 ? 15.957  -47.328 42.318  1.00 40.54  ? 485  ARG A NH2 1 
ATOM   3731 N N   . THR A 1 485 ? 18.300  -42.200 37.653  1.00 38.93  ? 486  THR A N   1 
ATOM   3732 C CA  . THR A 1 485 ? 19.462  -42.150 36.759  1.00 43.87  ? 486  THR A CA  1 
ATOM   3733 C C   . THR A 1 485 ? 19.175  -41.932 35.268  1.00 42.78  ? 486  THR A C   1 
ATOM   3734 O O   . THR A 1 485 ? 20.107  -41.741 34.498  1.00 47.32  ? 486  THR A O   1 
ATOM   3735 C CB  . THR A 1 485 ? 20.286  -43.448 36.831  1.00 40.27  ? 486  THR A CB  1 
ATOM   3736 O OG1 . THR A 1 485 ? 19.528  -44.513 36.246  1.00 43.31  ? 486  THR A OG1 1 
ATOM   3737 C CG2 . THR A 1 485 ? 20.657  -43.805 38.277  1.00 38.89  ? 486  THR A CG2 1 
ATOM   3738 N N   . GLY A 1 486 ? 17.917  -41.972 34.847  1.00 43.79  ? 487  GLY A N   1 
ATOM   3739 C CA  . GLY A 1 486 ? 17.607  -41.882 33.420  1.00 40.30  ? 487  GLY A CA  1 
ATOM   3740 C C   . GLY A 1 486 ? 17.834  -43.214 32.717  1.00 41.07  ? 487  GLY A C   1 
ATOM   3741 O O   . GLY A 1 486 ? 17.916  -43.301 31.508  1.00 47.01  ? 487  GLY A O   1 
ATOM   3742 N N   . ASP A 1 487 ? 17.926  -44.277 33.495  1.00 48.77  ? 488  ASP A N   1 
ATOM   3743 C CA  . ASP A 1 487 ? 18.247  -45.586 32.944  1.00 45.24  ? 488  ASP A CA  1 
ATOM   3744 C C   . ASP A 1 487 ? 17.579  -46.647 33.846  1.00 40.36  ? 488  ASP A C   1 
ATOM   3745 O O   . ASP A 1 487 ? 17.958  -46.796 34.995  1.00 44.10  ? 488  ASP A O   1 
ATOM   3746 C CB  . ASP A 1 487 ? 19.773  -45.715 32.874  1.00 40.90  ? 488  ASP A CB  1 
ATOM   3747 C CG  . ASP A 1 487 ? 20.251  -47.048 32.341  1.00 44.73  ? 488  ASP A CG  1 
ATOM   3748 O OD1 . ASP A 1 487 ? 19.461  -48.007 32.267  1.00 46.47  ? 488  ASP A OD1 1 
ATOM   3749 O OD2 . ASP A 1 487 ? 21.457  -47.137 32.014  1.00 48.82  ? 488  ASP A OD2 1 
ATOM   3750 N N   . PRO A 1 488 ? 16.580  -47.379 33.319  1.00 42.70  ? 489  PRO A N   1 
ATOM   3751 C CA  . PRO A 1 488 ? 15.835  -48.336 34.151  1.00 41.52  ? 489  PRO A CA  1 
ATOM   3752 C C   . PRO A 1 488 ? 16.662  -49.558 34.533  1.00 46.01  ? 489  PRO A C   1 
ATOM   3753 O O   . PRO A 1 488 ? 16.294  -50.246 35.486  1.00 47.67  ? 489  PRO A O   1 
ATOM   3754 C CB  . PRO A 1 488 ? 14.678  -48.761 33.246  1.00 41.58  ? 489  PRO A CB  1 
ATOM   3755 C CG  . PRO A 1 488 ? 15.294  -48.723 31.869  1.00 37.03  ? 489  PRO A CG  1 
ATOM   3756 C CD  . PRO A 1 488 ? 16.187  -47.475 31.899  1.00 40.03  ? 489  PRO A CD  1 
ATOM   3757 N N   . ASN A 1 489 ? 17.742  -49.830 33.795  1.00 43.60  ? 490  ASN A N   1 
ATOM   3758 C CA  . ASN A 1 489 ? 18.513  -51.055 33.991  1.00 47.51  ? 490  ASN A CA  1 
ATOM   3759 C C   . ASN A 1 489 ? 19.088  -51.268 35.403  1.00 56.27  ? 490  ASN A C   1 
ATOM   3760 O O   . ASN A 1 489 ? 19.602  -50.351 36.045  1.00 52.47  ? 490  ASN A O   1 
ATOM   3761 C CB  . ASN A 1 489 ? 19.663  -51.117 32.987  1.00 45.64  ? 490  ASN A CB  1 
ATOM   3762 C CG  . ASN A 1 489 ? 19.193  -51.455 31.593  1.00 46.62  ? 490  ASN A CG  1 
ATOM   3763 O OD1 . ASN A 1 489 ? 18.953  -52.620 31.282  1.00 48.59  ? 490  ASN A OD1 1 
ATOM   3764 N ND2 . ASN A 1 489 ? 19.052  -50.436 30.744  1.00 38.21  ? 490  ASN A ND2 1 
ATOM   3765 N N   . GLU A 1 490 ? 18.987  -52.511 35.857  1.00 62.65  ? 491  GLU A N   1 
ATOM   3766 C CA  . GLU A 1 490 ? 19.654  -53.009 37.058  1.00 67.60  ? 491  GLU A CA  1 
ATOM   3767 C C   . GLU A 1 490 ? 21.074  -53.472 36.634  1.00 68.74  ? 491  GLU A C   1 
ATOM   3768 O O   . GLU A 1 490 ? 21.275  -53.761 35.448  1.00 66.14  ? 491  GLU A O   1 
ATOM   3769 C CB  . GLU A 1 490 ? 18.804  -54.146 37.650  1.00 63.55  ? 491  GLU A CB  1 
ATOM   3770 C CG  . GLU A 1 490 ? 19.073  -54.550 39.082  1.00 80.01  ? 491  GLU A CG  1 
ATOM   3771 C CD  . GLU A 1 490 ? 18.431  -53.631 40.106  1.00 67.20  ? 491  GLU A CD  1 
ATOM   3772 O OE1 . GLU A 1 490 ? 18.484  -52.393 39.948  1.00 65.02  ? 491  GLU A OE1 1 
ATOM   3773 O OE2 . GLU A 1 490 ? 17.880  -54.163 41.086  1.00 72.46  ? 491  GLU A OE2 1 
ATOM   3774 N N   . PRO A 1 491 ? 22.060  -53.524 37.570  1.00 73.15  ? 492  PRO A N   1 
ATOM   3775 C CA  . PRO A 1 491 ? 23.413  -54.002 37.203  1.00 73.29  ? 492  PRO A CA  1 
ATOM   3776 C C   . PRO A 1 491 ? 23.456  -55.326 36.407  1.00 75.79  ? 492  PRO A C   1 
ATOM   3777 O O   . PRO A 1 491 ? 22.597  -56.194 36.594  1.00 75.92  ? 492  PRO A O   1 
ATOM   3778 C CB  . PRO A 1 491 ? 24.099  -54.187 38.568  1.00 73.12  ? 492  PRO A CB  1 
ATOM   3779 C CG  . PRO A 1 491 ? 23.460  -53.159 39.452  1.00 70.28  ? 492  PRO A CG  1 
ATOM   3780 C CD  . PRO A 1 491 ? 22.013  -53.053 38.975  1.00 76.06  ? 492  PRO A CD  1 
ATOM   3781 N N   . ARG A 1 492 ? 24.455  -55.469 35.536  1.00 77.61  ? 493  ARG A N   1 
ATOM   3782 C CA  . ARG A 1 492 ? 24.586  -56.653 34.673  1.00 83.00  ? 493  ARG A CA  1 
ATOM   3783 C C   . ARG A 1 492 ? 24.587  -57.961 35.478  1.00 85.06  ? 493  ARG A C   1 
ATOM   3784 O O   . ARG A 1 492 ? 25.297  -58.090 36.483  1.00 80.39  ? 493  ARG A O   1 
ATOM   3785 C CB  . ARG A 1 492 ? 25.861  -56.562 33.822  1.00 79.82  ? 493  ARG A CB  1 
ATOM   3786 C CG  . ARG A 1 492 ? 26.006  -55.250 33.039  1.00 78.97  ? 493  ARG A CG  1 
ATOM   3787 C CD  . ARG A 1 492 ? 25.775  -55.447 31.544  1.00 82.37  ? 493  ARG A CD  1 
ATOM   3788 N NE  . ARG A 1 492 ? 26.961  -55.940 30.846  1.00 88.15  ? 493  ARG A NE  1 
ATOM   3789 C CZ  . ARG A 1 492 ? 26.987  -56.312 29.565  1.00 93.81  ? 493  ARG A CZ  1 
ATOM   3790 N NH1 . ARG A 1 492 ? 25.882  -56.262 28.826  1.00 90.52  ? 493  ARG A NH1 1 
ATOM   3791 N NH2 . ARG A 1 492 ? 28.122  -56.744 29.021  1.00 93.68  ? 493  ARG A NH2 1 
ATOM   3792 N N   . ASP A 1 493 ? 23.785  -58.922 35.024  1.00 84.83  ? 494  ASP A N   1 
ATOM   3793 C CA  . ASP A 1 493 ? 23.608  -60.187 35.729  1.00 87.24  ? 494  ASP A CA  1 
ATOM   3794 C C   . ASP A 1 493 ? 24.457  -61.298 35.108  1.00 92.70  ? 494  ASP A C   1 
ATOM   3795 O O   . ASP A 1 493 ? 23.963  -62.107 34.317  1.00 93.63  ? 494  ASP A O   1 
ATOM   3796 C CB  . ASP A 1 493 ? 22.127  -60.590 35.731  1.00 89.69  ? 494  ASP A CB  1 
ATOM   3797 C CG  . ASP A 1 493 ? 21.713  -61.331 37.008  1.00 101.65 ? 494  ASP A CG  1 
ATOM   3798 O OD1 . ASP A 1 493 ? 22.309  -61.076 38.087  1.00 96.20  ? 494  ASP A OD1 1 
ATOM   3799 O OD2 . ASP A 1 493 ? 20.775  -62.162 36.930  1.00 100.19 ? 494  ASP A OD2 1 
ATOM   3800 N N   . PRO A 1 497 ? 19.560  -59.770 32.145  1.00 70.63  ? 498  PRO A N   1 
ATOM   3801 C CA  . PRO A 1 497 ? 19.513  -59.332 30.737  1.00 69.94  ? 498  PRO A CA  1 
ATOM   3802 C C   . PRO A 1 497 ? 19.096  -57.858 30.616  1.00 64.82  ? 498  PRO A C   1 
ATOM   3803 O O   . PRO A 1 497 ? 18.223  -57.391 31.358  1.00 68.63  ? 498  PRO A O   1 
ATOM   3804 C CB  . PRO A 1 497 ? 18.474  -60.265 30.095  1.00 69.09  ? 498  PRO A CB  1 
ATOM   3805 C CG  . PRO A 1 497 ? 17.698  -60.839 31.248  1.00 71.85  ? 498  PRO A CG  1 
ATOM   3806 C CD  . PRO A 1 497 ? 18.643  -60.890 32.415  1.00 72.36  ? 498  PRO A CD  1 
ATOM   3807 N N   . GLN A 1 498 ? 19.731  -57.140 29.696  1.00 50.85  ? 499  GLN A N   1 
ATOM   3808 C CA  . GLN A 1 498 ? 19.673  -55.684 29.689  1.00 50.85  ? 499  GLN A CA  1 
ATOM   3809 C C   . GLN A 1 498 ? 18.636  -55.078 28.739  1.00 56.27  ? 499  GLN A C   1 
ATOM   3810 O O   . GLN A 1 498 ? 18.343  -55.615 27.659  1.00 49.09  ? 499  GLN A O   1 
ATOM   3811 C CB  . GLN A 1 498 ? 21.052  -55.114 29.342  1.00 53.02  ? 499  GLN A CB  1 
ATOM   3812 C CG  . GLN A 1 498 ? 22.121  -55.423 30.367  1.00 58.41  ? 499  GLN A CG  1 
ATOM   3813 C CD  . GLN A 1 498 ? 21.985  -54.596 31.644  1.00 61.01  ? 499  GLN A CD  1 
ATOM   3814 O OE1 . GLN A 1 498 ? 22.191  -53.374 31.632  1.00 57.90  ? 499  GLN A OE1 1 
ATOM   3815 N NE2 . GLN A 1 498 ? 21.648  -55.258 32.751  1.00 58.14  ? 499  GLN A NE2 1 
ATOM   3816 N N   . TRP A 1 499 ? 18.123  -53.927 29.164  1.00 50.93  ? 500  TRP A N   1 
ATOM   3817 C CA  . TRP A 1 499 ? 17.113  -53.167 28.455  1.00 40.98  ? 500  TRP A CA  1 
ATOM   3818 C C   . TRP A 1 499 ? 17.791  -52.108 27.594  1.00 42.95  ? 500  TRP A C   1 
ATOM   3819 O O   . TRP A 1 499 ? 18.203  -51.066 28.100  1.00 43.54  ? 500  TRP A O   1 
ATOM   3820 C CB  . TRP A 1 499 ? 16.150  -52.540 29.477  1.00 40.13  ? 500  TRP A CB  1 
ATOM   3821 C CG  . TRP A 1 499 ? 14.928  -51.823 28.944  1.00 39.33  ? 500  TRP A CG  1 
ATOM   3822 C CD1 . TRP A 1 499 ? 14.699  -51.373 27.655  1.00 38.28  ? 500  TRP A CD1 1 
ATOM   3823 C CD2 . TRP A 1 499 ? 13.760  -51.478 29.703  1.00 40.85  ? 500  TRP A CD2 1 
ATOM   3824 N NE1 . TRP A 1 499 ? 13.451  -50.778 27.579  1.00 37.30  ? 500  TRP A NE1 1 
ATOM   3825 C CE2 . TRP A 1 499 ? 12.867  -50.814 28.825  1.00 37.30  ? 500  TRP A CE2 1 
ATOM   3826 C CE3 . TRP A 1 499 ? 13.383  -51.664 31.048  1.00 40.64  ? 500  TRP A CE3 1 
ATOM   3827 C CZ2 . TRP A 1 499 ? 11.620  -50.351 29.244  1.00 36.07  ? 500  TRP A CZ2 1 
ATOM   3828 C CZ3 . TRP A 1 499 ? 12.150  -51.194 31.463  1.00 39.42  ? 500  TRP A CZ3 1 
ATOM   3829 C CH2 . TRP A 1 499 ? 11.275  -50.553 30.557  1.00 41.80  ? 500  TRP A CH2 1 
ATOM   3830 N N   . PRO A 1 500 ? 17.911  -52.363 26.276  1.00 41.40  ? 501  PRO A N   1 
ATOM   3831 C CA  . PRO A 1 500 ? 18.649  -51.412 25.445  1.00 39.76  ? 501  PRO A CA  1 
ATOM   3832 C C   . PRO A 1 500 ? 17.804  -50.204 25.095  1.00 37.89  ? 501  PRO A C   1 
ATOM   3833 O O   . PRO A 1 500 ? 16.588  -50.299 25.038  1.00 41.07  ? 501  PRO A O   1 
ATOM   3834 C CB  . PRO A 1 500 ? 18.976  -52.235 24.179  1.00 41.07  ? 501  PRO A CB  1 
ATOM   3835 C CG  . PRO A 1 500 ? 17.836  -53.139 24.049  1.00 39.10  ? 501  PRO A CG  1 
ATOM   3836 C CD  . PRO A 1 500 ? 17.397  -53.495 25.479  1.00 37.32  ? 501  PRO A CD  1 
ATOM   3837 N N   . PRO A 1 501 ? 18.446  -49.069 24.851  1.00 38.02  ? 502  PRO A N   1 
ATOM   3838 C CA  . PRO A 1 501 ? 17.760  -47.893 24.302  1.00 41.85  ? 502  PRO A CA  1 
ATOM   3839 C C   . PRO A 1 501 ? 17.007  -48.173 22.990  1.00 42.18  ? 502  PRO A C   1 
ATOM   3840 O O   . PRO A 1 501 ? 17.423  -49.014 22.173  1.00 42.70  ? 502  PRO A O   1 
ATOM   3841 C CB  . PRO A 1 501 ? 18.909  -46.908 24.056  1.00 44.81  ? 502  PRO A CB  1 
ATOM   3842 C CG  . PRO A 1 501 ? 19.938  -47.297 25.061  1.00 43.22  ? 502  PRO A CG  1 
ATOM   3843 C CD  . PRO A 1 501 ? 19.854  -48.799 25.176  1.00 39.05  ? 502  PRO A CD  1 
ATOM   3844 N N   . TYR A 1 502 ? 15.897  -47.462 22.797  1.00 42.50  ? 503  TYR A N   1 
ATOM   3845 C CA  . TYR A 1 502 ? 15.131  -47.510 21.553  1.00 40.69  ? 503  TYR A CA  1 
ATOM   3846 C C   . TYR A 1 502 ? 15.712  -46.534 20.539  1.00 41.83  ? 503  TYR A C   1 
ATOM   3847 O O   . TYR A 1 502 ? 15.958  -45.371 20.866  1.00 40.71  ? 503  TYR A O   1 
ATOM   3848 C CB  . TYR A 1 502 ? 13.646  -47.173 21.808  1.00 40.46  ? 503  TYR A CB  1 
ATOM   3849 C CG  . TYR A 1 502 ? 12.758  -47.220 20.559  1.00 41.74  ? 503  TYR A CG  1 
ATOM   3850 C CD1 . TYR A 1 502 ? 12.631  -46.115 19.717  1.00 41.81  ? 503  TYR A CD1 1 
ATOM   3851 C CD2 . TYR A 1 502 ? 12.045  -48.368 20.236  1.00 37.51  ? 503  TYR A CD2 1 
ATOM   3852 C CE1 . TYR A 1 502 ? 11.829  -46.161 18.588  1.00 40.69  ? 503  TYR A CE1 1 
ATOM   3853 C CE2 . TYR A 1 502 ? 11.231  -48.419 19.140  1.00 42.11  ? 503  TYR A CE2 1 
ATOM   3854 C CZ  . TYR A 1 502 ? 11.135  -47.315 18.304  1.00 41.31  ? 503  TYR A CZ  1 
ATOM   3855 O OH  . TYR A 1 502 ? 10.326  -47.382 17.192  1.00 42.30  ? 503  TYR A OH  1 
ATOM   3856 N N   . THR A 1 503 ? 15.909  -46.986 19.306  1.00 40.43  ? 504  THR A N   1 
ATOM   3857 C CA  . THR A 1 503 ? 16.407  -46.101 18.246  1.00 45.17  ? 504  THR A CA  1 
ATOM   3858 C C   . THR A 1 503 ? 15.558  -46.204 16.971  1.00 45.45  ? 504  THR A C   1 
ATOM   3859 O O   . THR A 1 503 ? 14.900  -47.227 16.738  1.00 46.26  ? 504  THR A O   1 
ATOM   3860 C CB  . THR A 1 503 ? 17.882  -46.404 17.902  1.00 42.46  ? 504  THR A CB  1 
ATOM   3861 O OG1 . THR A 1 503 ? 18.043  -47.803 17.641  1.00 43.74  ? 504  THR A OG1 1 
ATOM   3862 C CG2 . THR A 1 503 ? 18.781  -46.023 19.057  1.00 39.61  ? 504  THR A CG2 1 
ATOM   3863 N N   . ALA A 1 504 ? 15.568  -45.160 16.142  1.00 46.51  ? 505  ALA A N   1 
ATOM   3864 C CA  . ALA A 1 504 ? 14.692  -45.141 14.952  1.00 51.39  ? 505  ALA A CA  1 
ATOM   3865 C C   . ALA A 1 504 ? 15.002  -46.287 13.987  1.00 45.19  ? 505  ALA A C   1 
ATOM   3866 O O   . ALA A 1 504 ? 14.115  -46.784 13.278  1.00 45.82  ? 505  ALA A O   1 
ATOM   3867 C CB  . ALA A 1 504 ? 14.793  -43.802 14.224  1.00 46.50  ? 505  ALA A CB  1 
ATOM   3868 N N   . GLY A 1 505 ? 16.257  -46.719 13.980  1.00 44.90  ? 506  GLY A N   1 
ATOM   3869 C CA  . GLY A 1 505 ? 16.666  -47.828 13.136  1.00 40.99  ? 506  GLY A CA  1 
ATOM   3870 C C   . GLY A 1 505 ? 16.394  -49.189 13.739  1.00 42.63  ? 506  GLY A C   1 
ATOM   3871 O O   . GLY A 1 505 ? 15.570  -49.950 13.233  1.00 44.30  ? 506  GLY A O   1 
ATOM   3872 N N   . ALA A 1 506 ? 17.065  -49.515 14.838  1.00 47.40  ? 507  ALA A N   1 
ATOM   3873 C CA  . ALA A 1 506 ? 16.939  -50.876 15.349  1.00 41.68  ? 507  ALA A CA  1 
ATOM   3874 C C   . ALA A 1 506 ? 15.567  -51.086 15.994  1.00 43.64  ? 507  ALA A C   1 
ATOM   3875 O O   . ALA A 1 506 ? 15.073  -52.216 16.039  1.00 45.49  ? 507  ALA A O   1 
ATOM   3876 C CB  . ALA A 1 506 ? 18.061  -51.191 16.316  1.00 37.31  ? 507  ALA A CB  1 
ATOM   3877 N N   . GLN A 1 507 ? 14.955  -49.998 16.467  1.00 41.65  ? 508  GLN A N   1 
ATOM   3878 C CA  . GLN A 1 507 ? 13.606  -50.041 17.045  1.00 40.27  ? 508  GLN A CA  1 
ATOM   3879 C C   . GLN A 1 507 ? 13.432  -51.078 18.167  1.00 45.42  ? 508  GLN A C   1 
ATOM   3880 O O   . GLN A 1 507 ? 12.404  -51.753 18.239  1.00 49.15  ? 508  GLN A O   1 
ATOM   3881 C CB  . GLN A 1 507 ? 12.577  -50.311 15.945  1.00 43.66  ? 508  GLN A CB  1 
ATOM   3882 C CG  . GLN A 1 507 ? 12.565  -49.271 14.821  1.00 43.28  ? 508  GLN A CG  1 
ATOM   3883 C CD  . GLN A 1 507 ? 11.722  -49.716 13.620  1.00 51.53  ? 508  GLN A CD  1 
ATOM   3884 O OE1 . GLN A 1 507 ? 10.504  -49.887 13.728  1.00 47.31  ? 508  GLN A OE1 1 
ATOM   3885 N NE2 . GLN A 1 507 ? 12.374  -49.919 12.474  1.00 46.41  ? 508  GLN A NE2 1 
ATOM   3886 N N   . GLN A 1 508 ? 14.414  -51.206 19.052  1.00 40.81  ? 509  GLN A N   1 
ATOM   3887 C CA  . GLN A 1 508 ? 14.326  -52.234 20.095  1.00 45.82  ? 509  GLN A CA  1 
ATOM   3888 C C   . GLN A 1 508 ? 13.515  -51.812 21.326  1.00 39.82  ? 509  GLN A C   1 
ATOM   3889 O O   . GLN A 1 508 ? 13.552  -50.658 21.757  1.00 37.11  ? 509  GLN A O   1 
ATOM   3890 C CB  . GLN A 1 508 ? 15.720  -52.659 20.537  1.00 38.69  ? 509  GLN A CB  1 
ATOM   3891 C CG  . GLN A 1 508 ? 16.446  -53.492 19.505  1.00 46.82  ? 509  GLN A CG  1 
ATOM   3892 C CD  . GLN A 1 508 ? 17.862  -53.802 19.929  1.00 48.19  ? 509  GLN A CD  1 
ATOM   3893 O OE1 . GLN A 1 508 ? 18.642  -52.896 20.237  1.00 46.90  ? 509  GLN A OE1 1 
ATOM   3894 N NE2 . GLN A 1 508 ? 18.197  -55.085 19.972  1.00 49.36  ? 509  GLN A NE2 1 
ATOM   3895 N N   . TYR A 1 509 ? 12.779  -52.772 21.870  1.00 38.61  ? 510  TYR A N   1 
ATOM   3896 C CA  . TYR A 1 509 ? 11.983  -52.575 23.070  1.00 40.60  ? 510  TYR A CA  1 
ATOM   3897 C C   . TYR A 1 509 ? 12.000  -53.887 23.844  1.00 42.04  ? 510  TYR A C   1 
ATOM   3898 O O   . TYR A 1 509 ? 12.475  -54.900 23.313  1.00 41.67  ? 510  TYR A O   1 
ATOM   3899 C CB  . TYR A 1 509 ? 10.560  -52.171 22.713  1.00 37.70  ? 510  TYR A CB  1 
ATOM   3900 C CG  . TYR A 1 509 ? 9.762   -53.258 22.031  1.00 40.24  ? 510  TYR A CG  1 
ATOM   3901 C CD1 . TYR A 1 509 ? 9.787   -53.413 20.632  1.00 42.90  ? 510  TYR A CD1 1 
ATOM   3902 C CD2 . TYR A 1 509 ? 8.959   -54.111 22.769  1.00 35.14  ? 510  TYR A CD2 1 
ATOM   3903 C CE1 . TYR A 1 509 ? 9.037   -54.415 20.004  1.00 39.19  ? 510  TYR A CE1 1 
ATOM   3904 C CE2 . TYR A 1 509 ? 8.218   -55.107 22.158  1.00 41.52  ? 510  TYR A CE2 1 
ATOM   3905 C CZ  . TYR A 1 509 ? 8.251   -55.250 20.779  1.00 43.94  ? 510  TYR A CZ  1 
ATOM   3906 O OH  . TYR A 1 509 ? 7.501   -56.240 20.206  1.00 48.99  ? 510  TYR A OH  1 
ATOM   3907 N N   . VAL A 1 510 ? 11.490  -53.884 25.080  1.00 39.10  ? 511  VAL A N   1 
ATOM   3908 C CA  . VAL A 1 510 ? 11.409  -55.121 25.863  1.00 36.45  ? 511  VAL A CA  1 
ATOM   3909 C C   . VAL A 1 510 ? 9.993   -55.479 26.245  1.00 39.77  ? 511  VAL A C   1 
ATOM   3910 O O   . VAL A 1 510 ? 9.111   -54.615 26.383  1.00 44.96  ? 511  VAL A O   1 
ATOM   3911 C CB  . VAL A 1 510 ? 12.222  -55.066 27.158  1.00 38.30  ? 511  VAL A CB  1 
ATOM   3912 C CG1 . VAL A 1 510 ? 13.684  -54.919 26.864  1.00 40.25  ? 511  VAL A CG1 1 
ATOM   3913 C CG2 . VAL A 1 510 ? 11.709  -53.944 28.066  1.00 40.64  ? 511  VAL A CG2 1 
ATOM   3914 N N   . SER A 1 511 ? 9.788   -56.772 26.434  1.00 38.73  ? 512  SER A N   1 
ATOM   3915 C CA  . SER A 1 511 ? 8.508   -57.286 26.872  1.00 41.50  ? 512  SER A CA  1 
ATOM   3916 C C   . SER A 1 511 ? 8.509   -57.299 28.390  1.00 41.00  ? 512  SER A C   1 
ATOM   3917 O O   . SER A 1 511 ? 9.468   -57.738 29.014  1.00 43.70  ? 512  SER A O   1 
ATOM   3918 C CB  . SER A 1 511 ? 8.263   -58.692 26.305  1.00 43.31  ? 512  SER A CB  1 
ATOM   3919 O OG  . SER A 1 511 ? 9.190   -59.617 26.845  1.00 47.75  ? 512  SER A OG  1 
ATOM   3920 N N   . LEU A 1 512 ? 7.456   -56.780 28.988  1.00 43.16  ? 513  LEU A N   1 
ATOM   3921 C CA  . LEU A 1 512 ? 7.340   -56.804 30.431  1.00 42.48  ? 513  LEU A CA  1 
ATOM   3922 C C   . LEU A 1 512 ? 6.276   -57.827 30.794  1.00 39.60  ? 513  LEU A C   1 
ATOM   3923 O O   . LEU A 1 512 ? 5.109   -57.638 30.468  1.00 41.73  ? 513  LEU A O   1 
ATOM   3924 C CB  . LEU A 1 512 ? 6.994   -55.415 30.987  1.00 41.20  ? 513  LEU A CB  1 
ATOM   3925 C CG  . LEU A 1 512 ? 7.996   -54.268 30.792  1.00 45.11  ? 513  LEU A CG  1 
ATOM   3926 C CD1 . LEU A 1 512 ? 7.461   -52.954 31.444  1.00 40.89  ? 513  LEU A CD1 1 
ATOM   3927 C CD2 . LEU A 1 512 ? 9.359   -54.625 31.395  1.00 44.22  ? 513  LEU A CD2 1 
ATOM   3928 N N   . ASP A 1 513 ? 6.692   -58.927 31.422  1.00 44.44  ? 514  ASP A N   1 
ATOM   3929 C CA  . ASP A 1 513 ? 5.770   -59.971 31.899  1.00 41.56  ? 514  ASP A CA  1 
ATOM   3930 C C   . ASP A 1 513 ? 6.519   -60.826 32.925  1.00 42.80  ? 514  ASP A C   1 
ATOM   3931 O O   . ASP A 1 513 ? 7.611   -60.451 33.339  1.00 45.02  ? 514  ASP A O   1 
ATOM   3932 C CB  . ASP A 1 513 ? 5.216   -60.831 30.735  1.00 43.29  ? 514  ASP A CB  1 
ATOM   3933 C CG  . ASP A 1 513 ? 6.301   -61.554 29.938  1.00 50.05  ? 514  ASP A CG  1 
ATOM   3934 O OD1 . ASP A 1 513 ? 7.478   -61.632 30.377  1.00 49.00  ? 514  ASP A OD1 1 
ATOM   3935 O OD2 . ASP A 1 513 ? 5.968   -62.064 28.842  1.00 60.99  ? 514  ASP A OD2 1 
ATOM   3936 N N   . LEU A 1 514 ? 5.962   -61.971 33.312  1.00 42.14  ? 515  LEU A N   1 
ATOM   3937 C CA  . LEU A 1 514 ? 6.547   -62.781 34.388  1.00 41.19  ? 515  LEU A CA  1 
ATOM   3938 C C   . LEU A 1 514 ? 7.911   -63.346 34.040  1.00 48.04  ? 515  LEU A C   1 
ATOM   3939 O O   . LEU A 1 514 ? 8.713   -63.636 34.934  1.00 58.10  ? 515  LEU A O   1 
ATOM   3940 C CB  . LEU A 1 514 ? 5.619   -63.923 34.758  1.00 37.37  ? 515  LEU A CB  1 
ATOM   3941 C CG  . LEU A 1 514 ? 4.268   -63.492 35.308  1.00 43.95  ? 515  LEU A CG  1 
ATOM   3942 C CD1 . LEU A 1 514 ? 3.530   -64.726 35.822  1.00 46.25  ? 515  LEU A CD1 1 
ATOM   3943 C CD2 . LEU A 1 514 ? 4.447   -62.456 36.446  1.00 43.16  ? 515  LEU A CD2 1 
ATOM   3944 N N   . ARG A 1 515 ? 8.174   -63.493 32.744  1.00 45.78  ? 516  ARG A N   1 
ATOM   3945 C CA  . ARG A 1 515 ? 9.465   -63.970 32.256  1.00 51.33  ? 516  ARG A CA  1 
ATOM   3946 C C   . ARG A 1 515 ? 10.515  -62.861 32.323  1.00 49.64  ? 516  ARG A C   1 
ATOM   3947 O O   . ARG A 1 515 ? 10.171  -61.688 32.355  1.00 49.43  ? 516  ARG A O   1 
ATOM   3948 C CB  . ARG A 1 515 ? 9.341   -64.472 30.813  1.00 48.55  ? 516  ARG A CB  1 
ATOM   3949 C CG  . ARG A 1 515 ? 8.304   -65.552 30.585  1.00 50.63  ? 516  ARG A CG  1 
ATOM   3950 C CD  . ARG A 1 515 ? 8.192   -65.850 29.079  1.00 58.36  ? 516  ARG A CD  1 
ATOM   3951 N NE  . ARG A 1 515 ? 7.808   -64.659 28.308  1.00 67.05  ? 516  ARG A NE  1 
ATOM   3952 C CZ  . ARG A 1 515 ? 8.543   -64.072 27.354  1.00 66.75  ? 516  ARG A CZ  1 
ATOM   3953 N NH1 . ARG A 1 515 ? 9.734   -64.553 27.008  1.00 70.92  ? 516  ARG A NH1 1 
ATOM   3954 N NH2 . ARG A 1 515 ? 8.079   -62.994 26.731  1.00 60.96  ? 516  ARG A NH2 1 
ATOM   3955 N N   . PRO A 1 516 ? 11.805  -63.226 32.327  1.00 51.80  ? 517  PRO A N   1 
ATOM   3956 C CA  . PRO A 1 516 ? 12.832  -62.182 32.200  1.00 50.53  ? 517  PRO A CA  1 
ATOM   3957 C C   . PRO A 1 516 ? 12.660  -61.345 30.924  1.00 54.44  ? 517  PRO A C   1 
ATOM   3958 O O   . PRO A 1 516 ? 12.048  -61.803 29.939  1.00 48.65  ? 517  PRO A O   1 
ATOM   3959 C CB  . PRO A 1 516 ? 14.151  -62.975 32.135  1.00 54.34  ? 517  PRO A CB  1 
ATOM   3960 C CG  . PRO A 1 516 ? 13.827  -64.322 32.727  1.00 57.75  ? 517  PRO A CG  1 
ATOM   3961 C CD  . PRO A 1 516 ? 12.381  -64.582 32.400  1.00 51.41  ? 517  PRO A CD  1 
ATOM   3962 N N   . LEU A 1 517 ? 13.210  -60.134 30.958  1.00 47.07  ? 518  LEU A N   1 
ATOM   3963 C CA  . LEU A 1 517 ? 13.186  -59.233 29.827  1.00 46.13  ? 518  LEU A CA  1 
ATOM   3964 C C   . LEU A 1 517 ? 13.588  -59.949 28.541  1.00 51.30  ? 518  LEU A C   1 
ATOM   3965 O O   . LEU A 1 517 ? 14.582  -60.676 28.494  1.00 53.48  ? 518  LEU A O   1 
ATOM   3966 C CB  . LEU A 1 517 ? 14.117  -58.047 30.059  1.00 43.99  ? 518  LEU A CB  1 
ATOM   3967 C CG  . LEU A 1 517 ? 13.804  -56.955 31.082  1.00 49.41  ? 518  LEU A CG  1 
ATOM   3968 C CD1 . LEU A 1 517 ? 14.817  -55.842 30.932  1.00 41.57  ? 518  LEU A CD1 1 
ATOM   3969 C CD2 . LEU A 1 517 ? 12.383  -56.410 30.928  1.00 47.30  ? 518  LEU A CD2 1 
ATOM   3970 N N   . GLU A 1 518 ? 12.789  -59.751 27.507  1.00 50.31  ? 519  GLU A N   1 
ATOM   3971 C CA  . GLU A 1 518 ? 13.091  -60.270 26.183  1.00 49.60  ? 519  GLU A CA  1 
ATOM   3972 C C   . GLU A 1 518 ? 13.159  -59.064 25.262  1.00 48.99  ? 519  GLU A C   1 
ATOM   3973 O O   . GLU A 1 518 ? 12.286  -58.200 25.317  1.00 48.13  ? 519  GLU A O   1 
ATOM   3974 C CB  . GLU A 1 518 ? 12.019  -61.275 25.735  1.00 54.64  ? 519  GLU A CB  1 
ATOM   3975 C CG  . GLU A 1 518 ? 12.045  -61.657 24.249  1.00 58.95  ? 519  GLU A CG  1 
ATOM   3976 C CD  . GLU A 1 518 ? 10.886  -62.588 23.865  1.00 67.38  ? 519  GLU A CD  1 
ATOM   3977 O OE1 . GLU A 1 518 ? 10.446  -62.560 22.688  1.00 71.83  ? 519  GLU A OE1 1 
ATOM   3978 O OE2 . GLU A 1 518 ? 10.414  -63.348 24.742  1.00 66.64  ? 519  GLU A OE2 1 
ATOM   3979 N N   . VAL A 1 519 ? 14.211  -58.983 24.453  1.00 49.04  ? 520  VAL A N   1 
ATOM   3980 C CA  . VAL A 1 519 ? 14.390  -57.872 23.528  1.00 43.13  ? 520  VAL A CA  1 
ATOM   3981 C C   . VAL A 1 519 ? 13.748  -58.177 22.163  1.00 50.21  ? 520  VAL A C   1 
ATOM   3982 O O   . VAL A 1 519 ? 13.922  -59.262 21.618  1.00 46.95  ? 520  VAL A O   1 
ATOM   3983 C CB  . VAL A 1 519 ? 15.889  -57.554 23.335  1.00 48.00  ? 520  VAL A CB  1 
ATOM   3984 C CG1 . VAL A 1 519 ? 16.088  -56.464 22.283  1.00 42.03  ? 520  VAL A CG1 1 
ATOM   3985 C CG2 . VAL A 1 519 ? 16.528  -57.143 24.673  1.00 44.14  ? 520  VAL A CG2 1 
ATOM   3986 N N   . ARG A 1 520 ? 12.996  -57.218 21.628  1.00 47.20  ? 521  ARG A N   1 
ATOM   3987 C CA  . ARG A 1 520 ? 12.320  -57.379 20.352  1.00 45.83  ? 521  ARG A CA  1 
ATOM   3988 C C   . ARG A 1 520 ? 12.463  -56.114 19.526  1.00 49.49  ? 521  ARG A C   1 
ATOM   3989 O O   . ARG A 1 520 ? 12.905  -55.079 20.050  1.00 47.94  ? 521  ARG A O   1 
ATOM   3990 C CB  . ARG A 1 520 ? 10.849  -57.698 20.556  1.00 45.40  ? 521  ARG A CB  1 
ATOM   3991 C CG  . ARG A 1 520 ? 10.605  -58.924 21.373  1.00 49.71  ? 521  ARG A CG  1 
ATOM   3992 C CD  . ARG A 1 520 ? 9.133   -59.157 21.526  1.00 52.36  ? 521  ARG A CD  1 
ATOM   3993 N NE  . ARG A 1 520 ? 8.892   -60.252 22.449  1.00 53.29  ? 521  ARG A NE  1 
ATOM   3994 C CZ  . ARG A 1 520 ? 7.757   -60.427 23.106  1.00 55.26  ? 521  ARG A CZ  1 
ATOM   3995 N NH1 . ARG A 1 520 ? 6.759   -59.562 22.935  1.00 47.83  ? 521  ARG A NH1 1 
ATOM   3996 N NH2 . ARG A 1 520 ? 7.630   -61.456 23.940  1.00 57.52  ? 521  ARG A NH2 1 
ATOM   3997 N N   . ARG A 1 521 ? 12.085  -56.210 18.247  1.00 46.55  ? 522  ARG A N   1 
ATOM   3998 C CA  . ARG A 1 521 ? 12.205  -55.113 17.275  1.00 47.28  ? 522  ARG A CA  1 
ATOM   3999 C C   . ARG A 1 521 ? 10.856  -54.668 16.724  1.00 46.65  ? 522  ARG A C   1 
ATOM   4000 O O   . ARG A 1 521 ? 10.046  -55.481 16.273  1.00 46.90  ? 522  ARG A O   1 
ATOM   4001 C CB  . ARG A 1 521 ? 13.093  -55.511 16.088  1.00 48.13  ? 522  ARG A CB  1 
ATOM   4002 C CG  . ARG A 1 521 ? 14.549  -55.783 16.405  1.00 49.53  ? 522  ARG A CG  1 
ATOM   4003 C CD  . ARG A 1 521 ? 15.419  -55.764 15.136  1.00 45.83  ? 522  ARG A CD  1 
ATOM   4004 N NE  . ARG A 1 521 ? 15.450  -54.443 14.497  1.00 47.28  ? 522  ARG A NE  1 
ATOM   4005 C CZ  . ARG A 1 521 ? 15.219  -54.232 13.200  1.00 51.94  ? 522  ARG A CZ  1 
ATOM   4006 N NH1 . ARG A 1 521 ? 14.956  -55.262 12.404  1.00 49.28  ? 522  ARG A NH1 1 
ATOM   4007 N NH2 . ARG A 1 521 ? 15.263  -52.996 12.700  1.00 40.33  ? 522  ARG A NH2 1 
ATOM   4008 N N   . GLY A 1 522 ? 10.617  -53.367 16.743  1.00 49.48  ? 523  GLY A N   1 
ATOM   4009 C CA  . GLY A 1 522 ? 9.457   -52.819 16.069  1.00 47.74  ? 523  GLY A CA  1 
ATOM   4010 C C   . GLY A 1 522 ? 8.204   -52.749 16.914  1.00 47.08  ? 523  GLY A C   1 
ATOM   4011 O O   . GLY A 1 522 ? 7.649   -53.767 17.308  1.00 44.60  ? 523  GLY A O   1 
ATOM   4012 N N   . LEU A 1 523 ? 7.761   -51.529 17.193  1.00 41.43  ? 524  LEU A N   1 
ATOM   4013 C CA  . LEU A 1 523 ? 6.443   -51.303 17.762  1.00 42.41  ? 524  LEU A CA  1 
ATOM   4014 C C   . LEU A 1 523 ? 5.430   -51.340 16.644  1.00 42.68  ? 524  LEU A C   1 
ATOM   4015 O O   . LEU A 1 523 ? 5.055   -50.283 16.142  1.00 42.68  ? 524  LEU A O   1 
ATOM   4016 C CB  . LEU A 1 523 ? 6.373   -49.949 18.477  1.00 38.31  ? 524  LEU A CB  1 
ATOM   4017 C CG  . LEU A 1 523 ? 7.247   -49.786 19.719  1.00 39.87  ? 524  LEU A CG  1 
ATOM   4018 C CD1 . LEU A 1 523 ? 7.224   -48.346 20.234  1.00 34.14  ? 524  LEU A CD1 1 
ATOM   4019 C CD2 . LEU A 1 523 ? 6.797   -50.780 20.762  1.00 37.01  ? 524  LEU A CD2 1 
ATOM   4020 N N   . ARG A 1 524 ? 5.011   -52.538 16.244  1.00 45.99  ? 525  ARG A N   1 
ATOM   4021 C CA  A ARG A 1 524 ? 4.079   -52.680 15.131  0.54 42.25  ? 525  ARG A CA  1 
ATOM   4022 C CA  B ARG A 1 524 ? 4.100   -52.712 15.120  0.46 41.37  ? 525  ARG A CA  1 
ATOM   4023 C C   . ARG A 1 524 ? 4.534   -51.840 13.931  1.00 44.05  ? 525  ARG A C   1 
ATOM   4024 O O   . ARG A 1 524 ? 3.772   -51.006 13.420  1.00 42.17  ? 525  ARG A O   1 
ATOM   4025 C CB  A ARG A 1 524 ? 2.670   -52.263 15.558  0.54 42.26  ? 525  ARG A CB  1 
ATOM   4026 C CB  B ARG A 1 524 ? 2.670   -52.402 15.563  0.46 42.27  ? 525  ARG A CB  1 
ATOM   4027 C CG  A ARG A 1 524 ? 2.147   -52.963 16.813  0.54 42.48  ? 525  ARG A CG  1 
ATOM   4028 C CG  B ARG A 1 524 ? 2.251   -53.210 16.801  0.46 42.31  ? 525  ARG A CG  1 
ATOM   4029 C CD  A ARG A 1 524 ? 1.181   -54.096 16.465  0.54 43.31  ? 525  ARG A CD  1 
ATOM   4030 C CD  B ARG A 1 524 ? 0.733   -53.211 17.027  0.46 39.88  ? 525  ARG A CD  1 
ATOM   4031 N NE  A ARG A 1 524 ? 0.172   -53.712 15.473  0.54 41.96  ? 525  ARG A NE  1 
ATOM   4032 N NE  B ARG A 1 524 ? 0.336   -54.238 17.986  0.46 41.34  ? 525  ARG A NE  1 
ATOM   4033 C CZ  A ARG A 1 524 ? -0.467  -54.582 14.693  0.54 41.37  ? 525  ARG A CZ  1 
ATOM   4034 C CZ  B ARG A 1 524 ? -0.921  -54.545 18.293  0.46 40.96  ? 525  ARG A CZ  1 
ATOM   4035 N NH1 A ARG A 1 524 ? -0.200  -55.874 14.799  0.54 43.17  ? 525  ARG A NH1 1 
ATOM   4036 N NH1 B ARG A 1 524 ? -1.928  -53.904 17.719  0.46 42.13  ? 525  ARG A NH1 1 
ATOM   4037 N NH2 A ARG A 1 524 ? -1.363  -54.168 13.812  0.54 34.44  ? 525  ARG A NH2 1 
ATOM   4038 N NH2 B ARG A 1 524 ? -1.169  -55.494 19.183  0.46 41.59  ? 525  ARG A NH2 1 
ATOM   4039 N N   . ALA A 1 525 ? 5.781   -52.046 13.502  1.00 42.48  ? 526  ALA A N   1 
ATOM   4040 C CA  . ALA A 1 525 ? 6.406   -51.248 12.443  1.00 43.20  ? 526  ALA A CA  1 
ATOM   4041 C C   . ALA A 1 525 ? 5.626   -51.226 11.134  1.00 44.07  ? 526  ALA A C   1 
ATOM   4042 O O   . ALA A 1 525 ? 5.494   -50.163 10.530  1.00 39.87  ? 526  ALA A O   1 
ATOM   4043 C CB  . ALA A 1 525 ? 7.831   -51.740 12.173  1.00 41.30  ? 526  ALA A CB  1 
ATOM   4044 N N   . GLN A 1 526 ? 5.118   -52.379 10.694  1.00 42.28  ? 527  GLN A N   1 
ATOM   4045 C CA  . GLN A 1 526 ? 4.388   -52.427 9.435   1.00 44.24  ? 527  GLN A CA  1 
ATOM   4046 C C   . GLN A 1 526 ? 3.120   -51.610 9.538   1.00 39.74  ? 527  GLN A C   1 
ATOM   4047 O O   . GLN A 1 526 ? 2.868   -50.733 8.719   1.00 47.09  ? 527  GLN A O   1 
ATOM   4048 C CB  . GLN A 1 526 ? 4.056   -53.867 9.032   1.00 44.76  ? 527  GLN A CB  1 
ATOM   4049 C CG  . GLN A 1 526 ? 5.264   -54.718 8.699   1.00 47.95  ? 527  GLN A CG  1 
ATOM   4050 C CD  . GLN A 1 526 ? 6.091   -54.151 7.563   1.00 47.00  ? 527  GLN A CD  1 
ATOM   4051 O OE1 . GLN A 1 526 ? 7.293   -53.957 7.703   1.00 55.39  ? 527  GLN A OE1 1 
ATOM   4052 N NE2 . GLN A 1 526 ? 5.455   -53.890 6.431   1.00 47.29  ? 527  GLN A NE2 1 
ATOM   4053 N N   . ALA A 1 527 ? 2.326   -51.888 10.558  1.00 41.41  ? 528  ALA A N   1 
ATOM   4054 C CA  . ALA A 1 527 ? 1.100   -51.128 10.801  1.00 40.01  ? 528  ALA A CA  1 
ATOM   4055 C C   . ALA A 1 527 ? 1.378   -49.644 10.989  1.00 37.22  ? 528  ALA A C   1 
ATOM   4056 O O   . ALA A 1 527 ? 0.624   -48.809 10.533  1.00 43.28  ? 528  ALA A O   1 
ATOM   4057 C CB  . ALA A 1 527 ? 0.345   -51.699 12.057  1.00 42.34  ? 528  ALA A CB  1 
ATOM   4058 N N   . CYS A 1 528 ? 2.450   -49.289 11.676  1.00 37.77  ? 529  CYS A N   1 
ATOM   4059 C CA  . CYS A 1 528 ? 2.616   -47.877 11.977  1.00 39.06  ? 529  CYS A CA  1 
ATOM   4060 C C   . CYS A 1 528 ? 3.157   -47.076 10.795  1.00 41.25  ? 529  CYS A C   1 
ATOM   4061 O O   . CYS A 1 528 ? 2.905   -45.855 10.699  1.00 38.22  ? 529  CYS A O   1 
ATOM   4062 C CB  . CYS A 1 528 ? 3.487   -47.711 13.229  1.00 42.13  ? 529  CYS A CB  1 
ATOM   4063 S SG  . CYS A 1 528 ? 2.588   -48.295 14.746  1.00 42.33  ? 529  CYS A SG  1 
ATOM   4064 N N   . ALA A 1 529 ? 3.851   -47.742 9.870   1.00 39.50  ? 530  ALA A N   1 
ATOM   4065 C CA  . ALA A 1 529 ? 4.218   -47.070 8.613   1.00 43.48  ? 530  ALA A CA  1 
ATOM   4066 C C   . ALA A 1 529 ? 2.948   -46.576 7.961   1.00 40.96  ? 530  ALA A C   1 
ATOM   4067 O O   . ALA A 1 529 ? 2.914   -45.461 7.444   1.00 42.98  ? 530  ALA A O   1 
ATOM   4068 C CB  . ALA A 1 529 ? 4.986   -47.981 7.679   1.00 37.83  ? 530  ALA A CB  1 
ATOM   4069 N N   . PHE A 1 530 ? 1.879   -47.366 8.053   1.00 38.27  ? 531  PHE A N   1 
ATOM   4070 C CA  . PHE A 1 530 ? 0.636   -46.963 7.414   1.00 44.92  ? 531  PHE A CA  1 
ATOM   4071 C C   . PHE A 1 530 ? 0.121   -45.638 7.998   1.00 46.50  ? 531  PHE A C   1 
ATOM   4072 O O   . PHE A 1 530 ? -0.077  -44.651 7.270   1.00 47.16  ? 531  PHE A O   1 
ATOM   4073 C CB  . PHE A 1 530 ? -0.429  -48.060 7.545   1.00 46.67  ? 531  PHE A CB  1 
ATOM   4074 C CG  . PHE A 1 530 ? -1.817  -47.580 7.228   1.00 44.91  ? 531  PHE A CG  1 
ATOM   4075 C CD1 . PHE A 1 530 ? -2.182  -47.294 5.926   1.00 46.99  ? 531  PHE A CD1 1 
ATOM   4076 C CD2 . PHE A 1 530 ? -2.732  -47.364 8.242   1.00 40.11  ? 531  PHE A CD2 1 
ATOM   4077 C CE1 . PHE A 1 530 ? -3.456  -46.825 5.622   1.00 51.29  ? 531  PHE A CE1 1 
ATOM   4078 C CE2 . PHE A 1 530 ? -4.002  -46.888 7.965   1.00 46.97  ? 531  PHE A CE2 1 
ATOM   4079 C CZ  . PHE A 1 530 ? -4.377  -46.631 6.642   1.00 48.67  ? 531  PHE A CZ  1 
ATOM   4080 N N   . TRP A 1 531 ? -0.067  -45.626 9.314   1.00 40.84  ? 532  TRP A N   1 
ATOM   4081 C CA  . TRP A 1 531 ? -0.588  -44.467 10.044  1.00 43.40  ? 532  TRP A CA  1 
ATOM   4082 C C   . TRP A 1 531 ? 0.380   -43.300 10.099  1.00 41.01  ? 532  TRP A C   1 
ATOM   4083 O O   . TRP A 1 531 ? -0.036  -42.145 10.041  1.00 48.74  ? 532  TRP A O   1 
ATOM   4084 C CB  . TRP A 1 531 ? -0.960  -44.864 11.480  1.00 36.35  ? 532  TRP A CB  1 
ATOM   4085 C CG  . TRP A 1 531 ? -1.992  -45.970 11.560  1.00 35.83  ? 532  TRP A CG  1 
ATOM   4086 C CD1 . TRP A 1 531 ? -1.770  -47.310 11.789  1.00 38.83  ? 532  TRP A CD1 1 
ATOM   4087 C CD2 . TRP A 1 531 ? -3.399  -45.818 11.418  1.00 34.43  ? 532  TRP A CD2 1 
ATOM   4088 N NE1 . TRP A 1 531 ? -2.968  -48.000 11.795  1.00 33.21  ? 532  TRP A NE1 1 
ATOM   4089 C CE2 . TRP A 1 531 ? -3.981  -47.102 11.575  1.00 36.04  ? 532  TRP A CE2 1 
ATOM   4090 C CE3 . TRP A 1 531 ? -4.232  -44.719 11.162  1.00 35.38  ? 532  TRP A CE3 1 
ATOM   4091 C CZ2 . TRP A 1 531 ? -5.357  -47.309 11.492  1.00 38.95  ? 532  TRP A CZ2 1 
ATOM   4092 C CZ3 . TRP A 1 531 ? -5.598  -44.925 11.083  1.00 35.87  ? 532  TRP A CZ3 1 
ATOM   4093 C CH2 . TRP A 1 531 ? -6.147  -46.212 11.245  1.00 39.19  ? 532  TRP A CH2 1 
ATOM   4094 N N   . ASN A 1 532 ? 1.666   -43.587 10.235  1.00 36.66  ? 533  ASN A N   1 
ATOM   4095 C CA  . ASN A 1 532 ? 2.617   -42.507 10.436  1.00 46.59  ? 533  ASN A CA  1 
ATOM   4096 C C   . ASN A 1 532 ? 3.198   -42.012 9.104   1.00 46.12  ? 533  ASN A C   1 
ATOM   4097 O O   . ASN A 1 532 ? 3.501   -40.834 8.964   1.00 50.22  ? 533  ASN A O   1 
ATOM   4098 C CB  . ASN A 1 532 ? 3.734   -42.937 11.401  1.00 36.45  ? 533  ASN A CB  1 
ATOM   4099 C CG  . ASN A 1 532 ? 3.217   -43.153 12.850  1.00 40.51  ? 533  ASN A CG  1 
ATOM   4100 O OD1 . ASN A 1 532 ? 2.163   -42.652 13.223  1.00 43.20  ? 533  ASN A OD1 1 
ATOM   4101 N ND2 . ASN A 1 532 ? 3.970   -43.894 13.652  1.00 33.70  ? 533  ASN A ND2 1 
ATOM   4102 N N   . ARG A 1 533 ? 3.317   -42.880 8.108   1.00 43.93  ? 534  ARG A N   1 
ATOM   4103 C CA  . ARG A 1 533 ? 3.949   -42.444 6.863   1.00 51.12  ? 534  ARG A CA  1 
ATOM   4104 C C   . ARG A 1 533 ? 2.964   -42.210 5.722   1.00 50.70  ? 534  ARG A C   1 
ATOM   4105 O O   . ARG A 1 533 ? 2.983   -41.153 5.105   1.00 51.51  ? 534  ARG A O   1 
ATOM   4106 C CB  . ARG A 1 533 ? 5.023   -43.445 6.439   1.00 47.96  ? 534  ARG A CB  1 
ATOM   4107 C CG  . ARG A 1 533 ? 6.235   -43.426 7.374   1.00 43.35  ? 534  ARG A CG  1 
ATOM   4108 C CD  . ARG A 1 533 ? 7.166   -44.591 7.090   1.00 47.23  ? 534  ARG A CD  1 
ATOM   4109 N NE  . ARG A 1 533 ? 8.082   -44.851 8.208   1.00 55.25  ? 534  ARG A NE  1 
ATOM   4110 C CZ  . ARG A 1 533 ? 9.275   -44.275 8.360   1.00 55.76  ? 534  ARG A CZ  1 
ATOM   4111 N NH1 . ARG A 1 533 ? 9.714   -43.382 7.466   1.00 54.18  ? 534  ARG A NH1 1 
ATOM   4112 N NH2 . ARG A 1 533 ? 10.034  -44.596 9.407   1.00 55.78  ? 534  ARG A NH2 1 
ATOM   4113 N N   . PHE A 1 534 ? 2.089   -43.172 5.449   1.00 52.97  ? 535  PHE A N   1 
ATOM   4114 C CA  . PHE A 1 534 ? 1.200   -43.046 4.294   1.00 48.64  ? 535  PHE A CA  1 
ATOM   4115 C C   . PHE A 1 534 ? -0.026  -42.160 4.518   1.00 53.33  ? 535  PHE A C   1 
ATOM   4116 O O   . PHE A 1 534 ? -0.263  -41.223 3.759   1.00 52.78  ? 535  PHE A O   1 
ATOM   4117 C CB  . PHE A 1 534 ? 0.717   -44.414 3.817   1.00 45.91  ? 535  PHE A CB  1 
ATOM   4118 C CG  . PHE A 1 534 ? -0.225  -44.321 2.650   1.00 54.64  ? 535  PHE A CG  1 
ATOM   4119 C CD1 . PHE A 1 534 ? 0.219   -43.842 1.428   1.00 48.88  ? 535  PHE A CD1 1 
ATOM   4120 C CD2 . PHE A 1 534 ? -1.560  -44.662 2.780   1.00 49.98  ? 535  PHE A CD2 1 
ATOM   4121 C CE1 . PHE A 1 534 ? -0.654  -43.720 0.344   1.00 49.55  ? 535  PHE A CE1 1 
ATOM   4122 C CE2 . PHE A 1 534 ? -2.433  -44.543 1.702   1.00 51.81  ? 535  PHE A CE2 1 
ATOM   4123 C CZ  . PHE A 1 534 ? -1.983  -44.068 0.486   1.00 44.99  ? 535  PHE A CZ  1 
ATOM   4124 N N   . LEU A 1 535 ? -0.807  -42.453 5.554   1.00 51.75  ? 536  LEU A N   1 
ATOM   4125 C CA  . LEU A 1 535 ? -2.086  -41.765 5.746   1.00 51.93  ? 536  LEU A CA  1 
ATOM   4126 C C   . LEU A 1 535 ? -2.044  -40.219 5.815   1.00 58.10  ? 536  LEU A C   1 
ATOM   4127 O O   . LEU A 1 535 ? -2.980  -39.562 5.357   1.00 63.60  ? 536  LEU A O   1 
ATOM   4128 C CB  . LEU A 1 535 ? -2.771  -42.302 6.993   1.00 52.79  ? 536  LEU A CB  1 
ATOM   4129 C CG  . LEU A 1 535 ? -4.287  -42.303 6.850   1.00 58.76  ? 536  LEU A CG  1 
ATOM   4130 C CD1 . LEU A 1 535 ? -4.697  -43.201 5.685   1.00 52.62  ? 536  LEU A CD1 1 
ATOM   4131 C CD2 . LEU A 1 535 ? -4.907  -42.788 8.123   1.00 48.04  ? 536  LEU A CD2 1 
ATOM   4132 N N   . PRO A 1 536 ? -0.982  -39.625 6.386   1.00 55.46  ? 537  PRO A N   1 
ATOM   4133 C CA  . PRO A 1 536 ? -0.951  -38.160 6.268   1.00 60.53  ? 537  PRO A CA  1 
ATOM   4134 C C   . PRO A 1 536 ? -0.827  -37.672 4.811   1.00 63.85  ? 537  PRO A C   1 
ATOM   4135 O O   . PRO A 1 536 ? -1.455  -36.670 4.451   1.00 60.23  ? 537  PRO A O   1 
ATOM   4136 C CB  . PRO A 1 536 ? 0.295   -37.768 7.075   1.00 54.10  ? 537  PRO A CB  1 
ATOM   4137 C CG  . PRO A 1 536 ? 0.496   -38.894 8.031   1.00 55.10  ? 537  PRO A CG  1 
ATOM   4138 C CD  . PRO A 1 536 ? 0.084   -40.123 7.273   1.00 57.00  ? 537  PRO A CD  1 
ATOM   4139 N N   . LYS A 1 537 ? -0.027  -38.365 3.999   1.00 60.88  ? 538  LYS A N   1 
ATOM   4140 C CA  . LYS A 1 537 ? 0.164   -37.990 2.593   1.00 60.44  ? 538  LYS A CA  1 
ATOM   4141 C C   . LYS A 1 537 ? -1.173  -37.952 1.862   1.00 63.54  ? 538  LYS A C   1 
ATOM   4142 O O   . LYS A 1 537 ? -1.421  -37.072 1.040   1.00 63.56  ? 538  LYS A O   1 
ATOM   4143 C CB  . LYS A 1 537 ? 1.112   -38.962 1.896   1.00 56.60  ? 538  LYS A CB  1 
ATOM   4144 C CG  . LYS A 1 537 ? 2.564   -38.817 2.299   1.00 55.70  ? 538  LYS A CG  1 
ATOM   4145 C CD  . LYS A 1 537 ? 3.429   -39.782 1.513   1.00 61.54  ? 538  LYS A CD  1 
ATOM   4146 C CE  . LYS A 1 537 ? 4.897   -39.361 1.541   1.00 72.28  ? 538  LYS A CE  1 
ATOM   4147 N NZ  . LYS A 1 537 ? 5.474   -39.346 2.911   1.00 65.91  ? 538  LYS A NZ  1 
ATOM   4148 N N   . LEU A 1 538 ? -2.031  -38.904 2.218   1.00 63.73  ? 539  LEU A N   1 
ATOM   4149 C CA  . LEU A 1 538 ? -3.327  -39.113 1.595   1.00 64.29  ? 539  LEU A CA  1 
ATOM   4150 C C   . LEU A 1 538 ? -4.282  -37.968 1.883   1.00 66.74  ? 539  LEU A C   1 
ATOM   4151 O O   . LEU A 1 538 ? -4.853  -37.374 0.962   1.00 73.62  ? 539  LEU A O   1 
ATOM   4152 C CB  . LEU A 1 538 ? -3.911  -40.441 2.082   1.00 60.12  ? 539  LEU A CB  1 
ATOM   4153 C CG  . LEU A 1 538 ? -5.305  -40.902 1.665   1.00 64.35  ? 539  LEU A CG  1 
ATOM   4154 C CD1 . LEU A 1 538 ? -5.343  -42.415 1.686   1.00 62.56  ? 539  LEU A CD1 1 
ATOM   4155 C CD2 . LEU A 1 538 ? -6.384  -40.348 2.583   1.00 61.02  ? 539  LEU A CD2 1 
ATOM   4156 N N   . LEU A 1 539 ? -4.465  -37.677 3.166   1.00 70.76  ? 540  LEU A N   1 
ATOM   4157 C CA  . LEU A 1 539 ? -5.356  -36.602 3.611   1.00 77.39  ? 540  LEU A CA  1 
ATOM   4158 C C   . LEU A 1 539 ? -4.944  -35.237 3.027   1.00 75.02  ? 540  LEU A C   1 
ATOM   4159 O O   . LEU A 1 539 ? -5.806  -34.461 2.604   1.00 78.34  ? 540  LEU A O   1 
ATOM   4160 C CB  . LEU A 1 539 ? -5.402  -36.550 5.150   1.00 73.23  ? 540  LEU A CB  1 
ATOM   4161 C CG  . LEU A 1 539 ? -5.867  -37.856 5.832   1.00 75.98  ? 540  LEU A CG  1 
ATOM   4162 C CD1 . LEU A 1 539 ? -5.520  -37.877 7.328   1.00 73.98  ? 540  LEU A CD1 1 
ATOM   4163 C CD2 . LEU A 1 539 ? -7.369  -38.154 5.627   1.00 64.44  ? 540  LEU A CD2 1 
ATOM   4164 N N   . SER A 1 540 ? -3.638  -34.958 2.990   1.00 73.72  ? 541  SER A N   1 
ATOM   4165 C CA  . SER A 1 540 ? -3.110  -33.758 2.330   1.00 69.95  ? 541  SER A CA  1 
ATOM   4166 C C   . SER A 1 540 ? -3.563  -33.677 0.882   1.00 84.66  ? 541  SER A C   1 
ATOM   4167 O O   . SER A 1 540 ? -4.448  -32.886 0.537   1.00 90.42  ? 541  SER A O   1 
ATOM   4168 C CB  . SER A 1 540 ? -1.582  -33.733 2.381   1.00 66.82  ? 541  SER A CB  1 
ATOM   4169 O OG  . SER A 1 540 ? -1.124  -33.326 3.658   1.00 90.75  ? 541  SER A OG  1 
ATOM   4170 N N   . ALA A 1 541 ? -2.943  -34.511 0.045   1.00 84.56  ? 542  ALA A N   1 
ATOM   4171 C CA  . ALA A 1 541 ? -3.272  -34.614 -1.372  1.00 84.78  ? 542  ALA A CA  1 
ATOM   4172 C C   . ALA A 1 541 ? -4.608  -35.330 -1.584  1.00 83.72  ? 542  ALA A C   1 
ATOM   4173 O O   . ALA A 1 541 ? -5.642  -34.935 -1.032  1.00 82.76  ? 542  ALA A O   1 
ATOM   4174 C CB  . ALA A 1 541 ? -2.149  -35.341 -2.121  1.00 82.27  ? 542  ALA A CB  1 
ATOM   4175 N N   . GLU B 1 3   ? 3.936   -89.259 -54.878 1.00 80.28  ? 4    GLU B N   1 
ATOM   4176 C CA  . GLU B 1 3   ? 3.435   -88.370 -53.828 1.00 88.62  ? 4    GLU B CA  1 
ATOM   4177 C C   . GLU B 1 3   ? 2.803   -89.166 -52.664 1.00 86.84  ? 4    GLU B C   1 
ATOM   4178 O O   . GLU B 1 3   ? 2.274   -90.267 -52.869 1.00 89.45  ? 4    GLU B O   1 
ATOM   4179 C CB  . GLU B 1 3   ? 2.431   -87.366 -54.424 1.00 82.96  ? 4    GLU B CB  1 
ATOM   4180 C CG  . GLU B 1 3   ? 2.172   -86.133 -53.541 1.00 86.86  ? 4    GLU B CG  1 
ATOM   4181 C CD  . GLU B 1 3   ? 2.456   -84.786 -54.235 1.00 79.11  ? 4    GLU B CD  1 
ATOM   4182 O OE1 . GLU B 1 3   ? 3.229   -83.985 -53.657 1.00 76.71  ? 4    GLU B OE1 1 
ATOM   4183 O OE2 . GLU B 1 3   ? 1.898   -84.514 -55.326 1.00 69.91  ? 4    GLU B OE2 1 
ATOM   4184 N N   . ASP B 1 4   ? 2.883   -88.622 -51.446 1.00 83.80  ? 5    ASP B N   1 
ATOM   4185 C CA  . ASP B 1 4   ? 2.344   -89.295 -50.254 1.00 76.76  ? 5    ASP B CA  1 
ATOM   4186 C C   . ASP B 1 4   ? 1.007   -88.694 -49.839 1.00 71.20  ? 5    ASP B C   1 
ATOM   4187 O O   . ASP B 1 4   ? 0.895   -87.494 -49.582 1.00 63.31  ? 5    ASP B O   1 
ATOM   4188 C CB  . ASP B 1 4   ? 3.340   -89.233 -49.086 1.00 72.60  ? 5    ASP B CB  1 
ATOM   4189 C CG  . ASP B 1 4   ? 2.750   -89.748 -47.757 1.00 75.08  ? 5    ASP B CG  1 
ATOM   4190 O OD1 . ASP B 1 4   ? 1.720   -90.456 -47.761 1.00 79.48  ? 5    ASP B OD1 1 
ATOM   4191 O OD2 . ASP B 1 4   ? 3.333   -89.450 -46.690 1.00 70.29  ? 5    ASP B OD2 1 
ATOM   4192 N N   . ALA B 1 5   ? 0.005   -89.560 -49.745 1.00 72.57  ? 6    ALA B N   1 
ATOM   4193 C CA  . ALA B 1 5   ? -1.371  -89.161 -49.474 1.00 72.06  ? 6    ALA B CA  1 
ATOM   4194 C C   . ALA B 1 5   ? -1.562  -88.371 -48.171 1.00 67.87  ? 6    ALA B C   1 
ATOM   4195 O O   . ALA B 1 5   ? -2.387  -87.453 -48.129 1.00 67.38  ? 6    ALA B O   1 
ATOM   4196 C CB  . ALA B 1 5   ? -2.269  -90.400 -49.464 1.00 71.65  ? 6    ALA B CB  1 
ATOM   4197 N N   . GLU B 1 6   ? -0.818  -88.726 -47.120 1.00 65.99  ? 7    GLU B N   1 
ATOM   4198 C CA  . GLU B 1 6   ? -1.001  -88.098 -45.807 1.00 65.94  ? 7    GLU B CA  1 
ATOM   4199 C C   . GLU B 1 6   ? -0.608  -86.621 -45.812 1.00 62.58  ? 7    GLU B C   1 
ATOM   4200 O O   . GLU B 1 6   ? -1.110  -85.841 -44.996 1.00 59.90  ? 7    GLU B O   1 
ATOM   4201 C CB  . GLU B 1 6   ? -0.199  -88.832 -44.722 1.00 68.91  ? 7    GLU B CB  1 
ATOM   4202 C CG  . GLU B 1 6   ? -0.793  -90.179 -44.265 1.00 77.08  ? 7    GLU B CG  1 
ATOM   4203 C CD  . GLU B 1 6   ? -2.159  -90.048 -43.580 1.00 85.59  ? 7    GLU B CD  1 
ATOM   4204 O OE1 . GLU B 1 6   ? -2.473  -88.958 -43.044 1.00 82.57  ? 7    GLU B OE1 1 
ATOM   4205 O OE2 . GLU B 1 6   ? -2.923  -91.043 -43.575 1.00 88.12  ? 7    GLU B OE2 1 
ATOM   4206 N N   . LEU B 1 7   ? 0.276   -86.239 -46.734 1.00 54.78  ? 8    LEU B N   1 
ATOM   4207 C CA  . LEU B 1 7   ? 0.771   -84.867 -46.805 1.00 48.01  ? 8    LEU B CA  1 
ATOM   4208 C C   . LEU B 1 7   ? 0.038   -84.010 -47.818 1.00 51.69  ? 8    LEU B C   1 
ATOM   4209 O O   . LEU B 1 7   ? 0.486   -82.902 -48.131 1.00 51.08  ? 8    LEU B O   1 
ATOM   4210 C CB  . LEU B 1 7   ? 2.255   -84.856 -47.136 1.00 49.34  ? 8    LEU B CB  1 
ATOM   4211 C CG  . LEU B 1 7   ? 3.134   -85.691 -46.212 1.00 57.47  ? 8    LEU B CG  1 
ATOM   4212 C CD1 . LEU B 1 7   ? 4.589   -85.588 -46.653 1.00 51.79  ? 8    LEU B CD1 1 
ATOM   4213 C CD2 . LEU B 1 7   ? 2.952   -85.266 -44.748 1.00 53.49  ? 8    LEU B CD2 1 
ATOM   4214 N N   . LEU B 1 8   ? -1.076  -84.521 -48.341 1.00 50.75  ? 9    LEU B N   1 
ATOM   4215 C CA  . LEU B 1 8   ? -1.905  -83.759 -49.267 1.00 45.23  ? 9    LEU B CA  1 
ATOM   4216 C C   . LEU B 1 8   ? -3.252  -83.444 -48.634 1.00 47.04  ? 9    LEU B C   1 
ATOM   4217 O O   . LEU B 1 8   ? -3.957  -84.335 -48.160 1.00 48.21  ? 9    LEU B O   1 
ATOM   4218 C CB  . LEU B 1 8   ? -2.107  -84.520 -50.592 1.00 45.21  ? 9    LEU B CB  1 
ATOM   4219 C CG  . LEU B 1 8   ? -0.873  -84.752 -51.462 1.00 54.08  ? 9    LEU B CG  1 
ATOM   4220 C CD1 . LEU B 1 8   ? -1.281  -85.306 -52.815 1.00 64.24  ? 9    LEU B CD1 1 
ATOM   4221 C CD2 . LEU B 1 8   ? -0.038  -83.474 -51.652 1.00 53.84  ? 9    LEU B CD2 1 
ATOM   4222 N N   . VAL B 1 9   ? -3.613  -82.170 -48.628 1.00 44.97  ? 10   VAL B N   1 
ATOM   4223 C CA  . VAL B 1 9   ? -4.878  -81.761 -48.039 1.00 47.08  ? 10   VAL B CA  1 
ATOM   4224 C C   . VAL B 1 9   ? -5.494  -80.689 -48.911 1.00 44.56  ? 10   VAL B C   1 
ATOM   4225 O O   . VAL B 1 9   ? -4.792  -79.862 -49.490 1.00 43.19  ? 10   VAL B O   1 
ATOM   4226 C CB  . VAL B 1 9   ? -4.695  -81.235 -46.564 1.00 50.18  ? 10   VAL B CB  1 
ATOM   4227 C CG1 . VAL B 1 9   ? -5.993  -80.655 -45.987 1.00 46.28  ? 10   VAL B CG1 1 
ATOM   4228 C CG2 . VAL B 1 9   ? -4.226  -82.348 -45.667 1.00 48.07  ? 10   VAL B CG2 1 
ATOM   4229 N N   . THR B 1 10  ? -6.813  -80.713 -49.004 1.00 41.39  ? 11   THR B N   1 
ATOM   4230 C CA  . THR B 1 10  ? -7.531  -79.671 -49.698 1.00 46.79  ? 11   THR B CA  1 
ATOM   4231 C C   . THR B 1 10  ? -8.307  -78.822 -48.716 1.00 48.71  ? 11   THR B C   1 
ATOM   4232 O O   . THR B 1 10  ? -9.106  -79.328 -47.928 1.00 46.87  ? 11   THR B O   1 
ATOM   4233 C CB  . THR B 1 10  ? -8.496  -80.268 -50.766 1.00 50.93  ? 11   THR B CB  1 
ATOM   4234 O OG1 . THR B 1 10  ? -7.713  -80.861 -51.804 1.00 45.75  ? 11   THR B OG1 1 
ATOM   4235 C CG2 . THR B 1 10  ? -9.374  -79.192 -51.381 1.00 44.40  ? 11   THR B CG2 1 
ATOM   4236 N N   . VAL B 1 11  ? -8.081  -77.520 -48.765 1.00 48.43  ? 12   VAL B N   1 
ATOM   4237 C CA  . VAL B 1 11  ? -8.822  -76.616 -47.894 1.00 47.92  ? 12   VAL B CA  1 
ATOM   4238 C C   . VAL B 1 11  ? -9.564  -75.708 -48.828 1.00 48.55  ? 12   VAL B C   1 
ATOM   4239 O O   . VAL B 1 11  ? -9.315  -75.763 -50.019 1.00 54.71  ? 12   VAL B O   1 
ATOM   4240 C CB  . VAL B 1 11  ? -7.899  -75.836 -46.965 1.00 46.86  ? 12   VAL B CB  1 
ATOM   4241 C CG1 . VAL B 1 11  ? -7.074  -76.808 -46.131 1.00 38.78  ? 12   VAL B CG1 1 
ATOM   4242 C CG2 . VAL B 1 11  ? -6.985  -74.935 -47.777 1.00 46.55  ? 12   VAL B CG2 1 
ATOM   4243 N N   . ARG B 1 12  ? -10.458 -74.874 -48.318 1.00 48.99  ? 13   ARG B N   1 
ATOM   4244 C CA  . ARG B 1 12  ? -11.354 -74.125 -49.196 1.00 47.91  ? 13   ARG B CA  1 
ATOM   4245 C C   . ARG B 1 12  ? -10.664 -73.251 -50.245 1.00 53.51  ? 13   ARG B C   1 
ATOM   4246 O O   . ARG B 1 12  ? -11.286 -72.862 -51.236 1.00 53.43  ? 13   ARG B O   1 
ATOM   4247 C CB  . ARG B 1 12  ? -12.298 -73.260 -48.359 1.00 50.98  ? 13   ARG B CB  1 
ATOM   4248 C CG  . ARG B 1 12  ? -13.359 -74.100 -47.652 1.00 61.36  ? 13   ARG B CG  1 
ATOM   4249 C CD  . ARG B 1 12  ? -14.535 -73.275 -47.144 1.00 71.44  ? 13   ARG B CD  1 
ATOM   4250 N NE  . ARG B 1 12  ? -15.253 -74.015 -46.104 1.00 75.79  ? 13   ARG B NE  1 
ATOM   4251 C CZ  . ARG B 1 12  ? -16.214 -73.507 -45.336 1.00 76.26  ? 13   ARG B CZ  1 
ATOM   4252 N NH1 . ARG B 1 12  ? -16.594 -72.242 -45.486 1.00 78.25  ? 13   ARG B NH1 1 
ATOM   4253 N NH2 . ARG B 1 12  ? -16.798 -74.267 -44.416 1.00 76.57  ? 13   ARG B NH2 1 
ATOM   4254 N N   . GLY B 1 13  ? -9.388  -72.944 -50.045 1.00 49.46  ? 14   GLY B N   1 
ATOM   4255 C CA  . GLY B 1 13  ? -8.713  -72.031 -50.951 1.00 47.52  ? 14   GLY B CA  1 
ATOM   4256 C C   . GLY B 1 13  ? -8.002  -72.720 -52.103 1.00 46.55  ? 14   GLY B C   1 
ATOM   4257 O O   . GLY B 1 13  ? -7.627  -72.085 -53.083 1.00 45.17  ? 14   GLY B O   1 
ATOM   4258 N N   . GLY B 1 14  ? -7.804  -74.025 -51.969 1.00 47.04  ? 15   GLY B N   1 
ATOM   4259 C CA  . GLY B 1 14  ? -6.987  -74.764 -52.899 1.00 44.95  ? 15   GLY B CA  1 
ATOM   4260 C C   . GLY B 1 14  ? -6.317  -75.932 -52.211 1.00 45.58  ? 15   GLY B C   1 
ATOM   4261 O O   . GLY B 1 14  ? -6.682  -76.315 -51.109 1.00 50.05  ? 15   GLY B O   1 
ATOM   4262 N N   . ARG B 1 15  ? -5.310  -76.479 -52.870 1.00 46.16  ? 16   ARG B N   1 
ATOM   4263 C CA  . ARG B 1 15  ? -4.633  -77.677 -52.416 1.00 47.45  ? 16   ARG B CA  1 
ATOM   4264 C C   . ARG B 1 15  ? -3.322  -77.329 -51.714 1.00 48.12  ? 16   ARG B C   1 
ATOM   4265 O O   . ARG B 1 15  ? -2.655  -76.353 -52.088 1.00 41.64  ? 16   ARG B O   1 
ATOM   4266 C CB  . ARG B 1 15  ? -4.376  -78.602 -53.610 1.00 51.95  ? 16   ARG B CB  1 
ATOM   4267 C CG  . ARG B 1 15  ? -5.652  -79.225 -54.180 1.00 55.09  ? 16   ARG B CG  1 
ATOM   4268 C CD  . ARG B 1 15  ? -5.340  -80.237 -55.277 1.00 50.18  ? 16   ARG B CD  1 
ATOM   4269 N NE  . ARG B 1 15  ? -5.073  -79.533 -56.527 1.00 66.69  ? 16   ARG B NE  1 
ATOM   4270 C CZ  . ARG B 1 15  ? -4.155  -79.898 -57.418 1.00 65.76  ? 16   ARG B CZ  1 
ATOM   4271 N NH1 . ARG B 1 15  ? -3.405  -80.978 -57.204 1.00 66.45  ? 16   ARG B NH1 1 
ATOM   4272 N NH2 . ARG B 1 15  ? -3.986  -79.171 -58.521 1.00 60.16  ? 16   ARG B NH2 1 
ATOM   4273 N N   . LEU B 1 16  ? -2.980  -78.127 -50.700 1.00 42.87  ? 17   LEU B N   1 
ATOM   4274 C CA  . LEU B 1 16  ? -1.765  -77.949 -49.902 1.00 45.24  ? 17   LEU B CA  1 
ATOM   4275 C C   . LEU B 1 16  ? -0.914  -79.201 -49.892 1.00 40.69  ? 17   LEU B C   1 
ATOM   4276 O O   . LEU B 1 16  ? -1.434  -80.315 -49.923 1.00 43.47  ? 17   LEU B O   1 
ATOM   4277 C CB  . LEU B 1 16  ? -2.106  -77.589 -48.439 1.00 48.03  ? 17   LEU B CB  1 
ATOM   4278 C CG  . LEU B 1 16  ? -2.863  -76.289 -48.196 1.00 44.47  ? 17   LEU B CG  1 
ATOM   4279 C CD1 . LEU B 1 16  ? -3.357  -76.269 -46.763 1.00 44.62  ? 17   LEU B CD1 1 
ATOM   4280 C CD2 . LEU B 1 16  ? -1.943  -75.114 -48.478 1.00 41.24  ? 17   LEU B CD2 1 
ATOM   4281 N N   . ARG B 1 17  ? 0.394   -79.005 -49.792 1.00 37.35  ? 18   ARG B N   1 
ATOM   4282 C CA  . ARG B 1 17  ? 1.338   -80.089 -49.625 1.00 42.14  ? 18   ARG B CA  1 
ATOM   4283 C C   . ARG B 1 17  ? 2.143   -79.791 -48.367 1.00 42.26  ? 18   ARG B C   1 
ATOM   4284 O O   . ARG B 1 17  ? 2.601   -78.666 -48.179 1.00 41.89  ? 18   ARG B O   1 
ATOM   4285 C CB  . ARG B 1 17  ? 2.256   -80.201 -50.848 1.00 40.92  ? 18   ARG B CB  1 
ATOM   4286 C CG  . ARG B 1 17  ? 3.331   -81.273 -50.757 1.00 42.77  ? 18   ARG B CG  1 
ATOM   4287 C CD  . ARG B 1 17  ? 4.209   -81.286 -52.036 1.00 54.64  ? 18   ARG B CD  1 
ATOM   4288 N NE  . ARG B 1 17  ? 3.414   -81.539 -53.248 1.00 47.34  ? 18   ARG B NE  1 
ATOM   4289 C CZ  . ARG B 1 17  ? 3.195   -80.662 -54.239 1.00 52.92  ? 18   ARG B CZ  1 
ATOM   4290 N NH1 . ARG B 1 17  ? 3.728   -79.442 -54.230 1.00 51.05  ? 18   ARG B NH1 1 
ATOM   4291 N NH2 . ARG B 1 17  ? 2.448   -81.019 -55.273 1.00 60.71  ? 18   ARG B NH2 1 
ATOM   4292 N N   . GLY B 1 18  ? 2.321   -80.785 -47.508 1.00 43.75  ? 19   GLY B N   1 
ATOM   4293 C CA  . GLY B 1 18  ? 3.038   -80.578 -46.266 1.00 40.03  ? 19   GLY B CA  1 
ATOM   4294 C C   . GLY B 1 18  ? 4.261   -81.458 -46.145 1.00 46.43  ? 19   GLY B C   1 
ATOM   4295 O O   . GLY B 1 18  ? 4.786   -81.985 -47.132 1.00 48.78  ? 19   GLY B O   1 
ATOM   4296 N N   . ILE B 1 19  ? 4.713   -81.625 -44.915 1.00 42.90  ? 20   ILE B N   1 
ATOM   4297 C CA  . ILE B 1 19  ? 5.955   -82.308 -44.672 1.00 45.52  ? 20   ILE B CA  1 
ATOM   4298 C C   . ILE B 1 19  ? 5.786   -83.292 -43.499 1.00 55.03  ? 20   ILE B C   1 
ATOM   4299 O O   . ILE B 1 19  ? 4.931   -83.107 -42.625 1.00 49.55  ? 20   ILE B O   1 
ATOM   4300 C CB  . ILE B 1 19  ? 7.081   -81.273 -44.408 1.00 52.04  ? 20   ILE B CB  1 
ATOM   4301 C CG1 . ILE B 1 19  ? 8.461   -81.921 -44.512 1.00 58.18  ? 20   ILE B CG1 1 
ATOM   4302 C CG2 . ILE B 1 19  ? 6.905   -80.569 -43.048 1.00 48.64  ? 20   ILE B CG2 1 
ATOM   4303 C CD1 . ILE B 1 19  ? 9.612   -80.947 -44.220 1.00 56.54  ? 20   ILE B CD1 1 
ATOM   4304 N N   . ARG B 1 20  ? 6.566   -84.364 -43.507 1.00 54.01  ? 21   ARG B N   1 
ATOM   4305 C CA  . ARG B 1 20  ? 6.522   -85.330 -42.422 1.00 55.22  ? 21   ARG B CA  1 
ATOM   4306 C C   . ARG B 1 20  ? 7.655   -85.063 -41.427 1.00 53.24  ? 21   ARG B C   1 
ATOM   4307 O O   . ARG B 1 20  ? 8.818   -85.069 -41.796 1.00 55.86  ? 21   ARG B O   1 
ATOM   4308 C CB  . ARG B 1 20  ? 6.602   -86.749 -42.969 1.00 54.56  ? 21   ARG B CB  1 
ATOM   4309 C CG  . ARG B 1 20  ? 6.916   -87.802 -41.921 1.00 61.05  ? 21   ARG B CG  1 
ATOM   4310 C CD  . ARG B 1 20  ? 6.952   -89.195 -42.559 1.00 68.11  ? 21   ARG B CD  1 
ATOM   4311 N NE  . ARG B 1 20  ? 7.136   -90.236 -41.550 1.00 76.99  ? 21   ARG B NE  1 
ATOM   4312 C CZ  . ARG B 1 20  ? 7.077   -91.546 -41.778 1.00 73.77  ? 21   ARG B CZ  1 
ATOM   4313 N NH1 . ARG B 1 20  ? 6.836   -92.012 -43.002 1.00 75.78  ? 21   ARG B NH1 1 
ATOM   4314 N NH2 . ARG B 1 20  ? 7.259   -92.393 -40.769 1.00 65.01  ? 21   ARG B NH2 1 
ATOM   4315 N N   . LEU B 1 21  ? 7.296   -84.806 -40.173 1.00 54.09  ? 22   LEU B N   1 
ATOM   4316 C CA  . LEU B 1 21  ? 8.273   -84.490 -39.130 1.00 56.04  ? 22   LEU B CA  1 
ATOM   4317 C C   . LEU B 1 21  ? 8.607   -85.709 -38.302 1.00 53.10  ? 22   LEU B C   1 
ATOM   4318 O O   . LEU B 1 21  ? 7.709   -86.469 -37.936 1.00 57.31  ? 22   LEU B O   1 
ATOM   4319 C CB  . LEU B 1 21  ? 7.748   -83.396 -38.197 1.00 51.03  ? 22   LEU B CB  1 
ATOM   4320 C CG  . LEU B 1 21  ? 7.493   -82.024 -38.810 1.00 50.79  ? 22   LEU B CG  1 
ATOM   4321 C CD1 . LEU B 1 21  ? 7.026   -81.059 -37.709 1.00 54.47  ? 22   LEU B CD1 1 
ATOM   4322 C CD2 . LEU B 1 21  ? 8.753   -81.521 -39.479 1.00 45.03  ? 22   LEU B CD2 1 
ATOM   4323 N N   . LYS B 1 22  ? 9.893   -85.888 -38.003 1.00 53.61  ? 23   LYS B N   1 
ATOM   4324 C CA  . LYS B 1 22  ? 10.328  -86.920 -37.065 1.00 54.71  ? 23   LYS B CA  1 
ATOM   4325 C C   . LYS B 1 22  ? 10.273  -86.409 -35.636 1.00 55.72  ? 23   LYS B C   1 
ATOM   4326 O O   . LYS B 1 22  ? 10.706  -85.295 -35.354 1.00 60.60  ? 23   LYS B O   1 
ATOM   4327 C CB  . LYS B 1 22  ? 11.748  -87.395 -37.394 1.00 50.30  ? 23   LYS B CB  1 
ATOM   4328 C CG  . LYS B 1 22  ? 11.841  -88.114 -38.726 1.00 59.71  ? 23   LYS B CG  1 
ATOM   4329 C CD  . LYS B 1 22  ? 13.172  -88.832 -38.932 1.00 67.29  ? 23   LYS B CD  1 
ATOM   4330 C CE  . LYS B 1 22  ? 13.326  -89.213 -40.404 1.00 71.49  ? 23   LYS B CE  1 
ATOM   4331 N NZ  . LYS B 1 22  ? 14.401  -90.222 -40.651 1.00 78.01  ? 23   LYS B NZ  1 
ATOM   4332 N N   . THR B 1 23  ? 9.716   -87.216 -34.741 1.00 56.82  ? 24   THR B N   1 
ATOM   4333 C CA  . THR B 1 23  ? 9.805   -86.956 -33.303 1.00 64.73  ? 24   THR B CA  1 
ATOM   4334 C C   . THR B 1 23  ? 10.323  -88.207 -32.609 1.00 61.33  ? 24   THR B C   1 
ATOM   4335 O O   . THR B 1 23  ? 10.249  -89.299 -33.173 1.00 61.98  ? 24   THR B O   1 
ATOM   4336 C CB  . THR B 1 23  ? 8.446   -86.565 -32.671 1.00 57.14  ? 24   THR B CB  1 
ATOM   4337 O OG1 . THR B 1 23  ? 7.690   -87.750 -32.388 1.00 57.97  ? 24   THR B OG1 1 
ATOM   4338 C CG2 . THR B 1 23  ? 7.662   -85.639 -33.595 1.00 57.01  ? 24   THR B CG2 1 
ATOM   4339 N N   . PRO B 1 24  ? 10.875  -88.046 -31.397 1.00 61.06  ? 25   PRO B N   1 
ATOM   4340 C CA  . PRO B 1 24  ? 11.255  -89.194 -30.565 1.00 63.95  ? 25   PRO B CA  1 
ATOM   4341 C C   . PRO B 1 24  ? 10.182  -90.279 -30.519 1.00 61.98  ? 25   PRO B C   1 
ATOM   4342 O O   . PRO B 1 24  ? 10.520  -91.451 -30.660 1.00 72.26  ? 25   PRO B O   1 
ATOM   4343 C CB  . PRO B 1 24  ? 11.460  -88.563 -29.194 1.00 59.75  ? 25   PRO B CB  1 
ATOM   4344 C CG  . PRO B 1 24  ? 12.017  -87.211 -29.524 1.00 59.02  ? 25   PRO B CG  1 
ATOM   4345 C CD  . PRO B 1 24  ? 11.365  -86.779 -30.822 1.00 59.56  ? 25   PRO B CD  1 
ATOM   4346 N N   . GLY B 1 25  ? 8.920   -89.901 -30.374 1.00 57.81  ? 26   GLY B N   1 
ATOM   4347 C CA  . GLY B 1 25  ? 7.864   -90.884 -30.262 1.00 59.56  ? 26   GLY B CA  1 
ATOM   4348 C C   . GLY B 1 25  ? 7.226   -91.298 -31.576 1.00 63.11  ? 26   GLY B C   1 
ATOM   4349 O O   . GLY B 1 25  ? 6.270   -92.064 -31.570 1.00 68.43  ? 26   GLY B O   1 
ATOM   4350 N N   . GLY B 1 26  ? 7.726   -90.803 -32.704 1.00 59.60  ? 27   GLY B N   1 
ATOM   4351 C CA  . GLY B 1 26  ? 7.112   -91.143 -33.986 1.00 59.80  ? 27   GLY B CA  1 
ATOM   4352 C C   . GLY B 1 26  ? 6.803   -89.964 -34.905 1.00 65.17  ? 27   GLY B C   1 
ATOM   4353 O O   . GLY B 1 26  ? 7.014   -88.810 -34.534 1.00 66.11  ? 27   GLY B O   1 
ATOM   4354 N N   . PRO B 1 27  ? 6.289   -90.246 -36.114 1.00 60.98  ? 28   PRO B N   1 
ATOM   4355 C CA  . PRO B 1 27  ? 6.035   -89.217 -37.132 1.00 57.80  ? 28   PRO B CA  1 
ATOM   4356 C C   . PRO B 1 27  ? 4.796   -88.346 -36.907 1.00 55.83  ? 28   PRO B C   1 
ATOM   4357 O O   . PRO B 1 27  ? 3.776   -88.790 -36.378 1.00 53.28  ? 28   PRO B O   1 
ATOM   4358 C CB  . PRO B 1 27  ? 5.857   -90.040 -38.411 1.00 58.14  ? 28   PRO B CB  1 
ATOM   4359 C CG  . PRO B 1 27  ? 5.323   -91.345 -37.935 1.00 61.74  ? 28   PRO B CG  1 
ATOM   4360 C CD  . PRO B 1 27  ? 5.981   -91.601 -36.609 1.00 56.76  ? 28   PRO B CD  1 
ATOM   4361 N N   . VAL B 1 28  ? 4.900   -87.103 -37.363 1.00 51.45  ? 29   VAL B N   1 
ATOM   4362 C CA  . VAL B 1 28  ? 3.820   -86.138 -37.309 1.00 47.52  ? 29   VAL B CA  1 
ATOM   4363 C C   . VAL B 1 28  ? 3.667   -85.496 -38.690 1.00 50.73  ? 29   VAL B C   1 
ATOM   4364 O O   . VAL B 1 28  ? 4.649   -85.393 -39.438 1.00 52.81  ? 29   VAL B O   1 
ATOM   4365 C CB  . VAL B 1 28  ? 4.116   -85.073 -36.212 1.00 51.66  ? 29   VAL B CB  1 
ATOM   4366 C CG1 . VAL B 1 28  ? 3.152   -83.921 -36.274 1.00 49.39  ? 29   VAL B CG1 1 
ATOM   4367 C CG2 . VAL B 1 28  ? 4.085   -85.714 -34.844 1.00 48.04  ? 29   VAL B CG2 1 
ATOM   4368 N N   . SER B 1 29  ? 2.453   -85.095 -39.062 1.00 47.27  ? 30   SER B N   1 
ATOM   4369 C CA  . SER B 1 29  ? 2.281   -84.313 -40.296 1.00 48.24  ? 30   SER B CA  1 
ATOM   4370 C C   . SER B 1 29  ? 2.215   -82.826 -39.978 1.00 48.44  ? 30   SER B C   1 
ATOM   4371 O O   . SER B 1 29  ? 1.395   -82.408 -39.164 1.00 51.36  ? 30   SER B O   1 
ATOM   4372 C CB  . SER B 1 29  ? 1.003   -84.709 -41.062 1.00 48.90  ? 30   SER B CB  1 
ATOM   4373 O OG  . SER B 1 29  ? 0.976   -86.083 -41.408 1.00 54.85  ? 30   SER B OG  1 
ATOM   4374 N N   . ALA B 1 30  ? 3.057   -82.027 -40.628 1.00 46.84  ? 31   ALA B N   1 
ATOM   4375 C CA  . ALA B 1 30  ? 3.016   -80.576 -40.464 1.00 44.16  ? 31   ALA B CA  1 
ATOM   4376 C C   . ALA B 1 30  ? 2.752   -79.848 -41.782 1.00 41.84  ? 31   ALA B C   1 
ATOM   4377 O O   . ALA B 1 30  ? 3.349   -80.142 -42.806 1.00 44.35  ? 31   ALA B O   1 
ATOM   4378 C CB  . ALA B 1 30  ? 4.327   -80.066 -39.836 1.00 38.46  ? 31   ALA B CB  1 
ATOM   4379 N N   . PHE B 1 31  ? 1.858   -78.878 -41.715 1.00 41.97  ? 32   PHE B N   1 
ATOM   4380 C CA  . PHE B 1 31  ? 1.606   -77.949 -42.787 1.00 40.42  ? 32   PHE B CA  1 
ATOM   4381 C C   . PHE B 1 31  ? 1.968   -76.545 -42.306 1.00 41.23  ? 32   PHE B C   1 
ATOM   4382 O O   . PHE B 1 31  ? 1.167   -75.878 -41.638 1.00 41.58  ? 32   PHE B O   1 
ATOM   4383 C CB  . PHE B 1 31  ? 0.142   -78.032 -43.218 1.00 41.10  ? 32   PHE B CB  1 
ATOM   4384 C CG  . PHE B 1 31  ? -0.268  -79.407 -43.660 1.00 49.22  ? 32   PHE B CG  1 
ATOM   4385 C CD1 . PHE B 1 31  ? -0.610  -80.384 -42.725 1.00 47.70  ? 32   PHE B CD1 1 
ATOM   4386 C CD2 . PHE B 1 31  ? -0.291  -79.737 -45.011 1.00 49.38  ? 32   PHE B CD2 1 
ATOM   4387 C CE1 . PHE B 1 31  ? -0.978  -81.667 -43.136 1.00 48.66  ? 32   PHE B CE1 1 
ATOM   4388 C CE2 . PHE B 1 31  ? -0.652  -81.018 -45.431 1.00 51.04  ? 32   PHE B CE2 1 
ATOM   4389 C CZ  . PHE B 1 31  ? -0.998  -81.983 -44.489 1.00 48.68  ? 32   PHE B CZ  1 
ATOM   4390 N N   . LEU B 1 32  ? 3.186   -76.123 -42.630 1.00 36.00  ? 33   LEU B N   1 
ATOM   4391 C CA  . LEU B 1 32  ? 3.756   -74.881 -42.133 1.00 35.43  ? 33   LEU B CA  1 
ATOM   4392 C C   . LEU B 1 32  ? 3.694   -73.819 -43.198 1.00 39.60  ? 33   LEU B C   1 
ATOM   4393 O O   . LEU B 1 32  ? 3.974   -74.094 -44.353 1.00 40.41  ? 33   LEU B O   1 
ATOM   4394 C CB  . LEU B 1 32  ? 5.206   -75.099 -41.711 1.00 37.06  ? 33   LEU B CB  1 
ATOM   4395 C CG  . LEU B 1 32  ? 5.474   -76.335 -40.853 1.00 37.39  ? 33   LEU B CG  1 
ATOM   4396 C CD1 . LEU B 1 32  ? 6.948   -76.389 -40.466 1.00 32.46  ? 33   LEU B CD1 1 
ATOM   4397 C CD2 . LEU B 1 32  ? 4.580   -76.340 -39.599 1.00 38.73  ? 33   LEU B CD2 1 
ATOM   4398 N N   . GLY B 1 33  ? 3.342   -72.602 -42.821 1.00 40.01  ? 34   GLY B N   1 
ATOM   4399 C CA  . GLY B 1 33  ? 3.321   -71.515 -43.778 1.00 32.94  ? 34   GLY B CA  1 
ATOM   4400 C C   . GLY B 1 33  ? 2.165   -71.571 -44.759 1.00 40.78  ? 34   GLY B C   1 
ATOM   4401 O O   . GLY B 1 33  ? 2.352   -71.454 -45.982 1.00 42.87  ? 34   GLY B O   1 
ATOM   4402 N N   . ILE B 1 34  ? 0.962   -71.728 -44.225 1.00 38.35  ? 35   ILE B N   1 
ATOM   4403 C CA  . ILE B 1 34  ? -0.261  -71.643 -45.016 1.00 34.42  ? 35   ILE B CA  1 
ATOM   4404 C C   . ILE B 1 34  ? -0.793  -70.214 -45.056 1.00 36.63  ? 35   ILE B C   1 
ATOM   4405 O O   . ILE B 1 34  ? -1.045  -69.633 -44.005 1.00 41.35  ? 35   ILE B O   1 
ATOM   4406 C CB  . ILE B 1 34  ? -1.349  -72.552 -44.426 1.00 36.03  ? 35   ILE B CB  1 
ATOM   4407 C CG1 . ILE B 1 34  ? -0.860  -73.990 -44.341 1.00 35.05  ? 35   ILE B CG1 1 
ATOM   4408 C CG2 . ILE B 1 34  ? -2.622  -72.420 -45.194 1.00 36.38  ? 35   ILE B CG2 1 
ATOM   4409 C CD1 . ILE B 1 34  ? -1.657  -74.826 -43.363 1.00 36.93  ? 35   ILE B CD1 1 
ATOM   4410 N N   . PRO B 1 35  ? -0.967  -69.632 -46.260 1.00 40.07  ? 36   PRO B N   1 
ATOM   4411 C CA  . PRO B 1 35  ? -1.505  -68.268 -46.328 1.00 32.70  ? 36   PRO B CA  1 
ATOM   4412 C C   . PRO B 1 35  ? -2.958  -68.242 -45.863 1.00 38.36  ? 36   PRO B C   1 
ATOM   4413 O O   . PRO B 1 35  ? -3.706  -69.132 -46.246 1.00 39.64  ? 36   PRO B O   1 
ATOM   4414 C CB  . PRO B 1 35  ? -1.385  -67.910 -47.829 1.00 40.53  ? 36   PRO B CB  1 
ATOM   4415 C CG  . PRO B 1 35  ? -1.397  -69.243 -48.545 1.00 36.73  ? 36   PRO B CG  1 
ATOM   4416 C CD  . PRO B 1 35  ? -0.685  -70.197 -47.600 1.00 36.98  ? 36   PRO B CD  1 
ATOM   4417 N N   . PHE B 1 36  ? -3.346  -67.294 -45.011 1.00 41.06  ? 37   PHE B N   1 
ATOM   4418 C CA  . PHE B 1 36  ? -4.747  -67.234 -44.581 1.00 35.12  ? 37   PHE B CA  1 
ATOM   4419 C C   . PHE B 1 36  ? -5.279  -65.834 -44.834 1.00 39.03  ? 37   PHE B C   1 
ATOM   4420 O O   . PHE B 1 36  ? -6.455  -65.562 -44.659 1.00 42.33  ? 37   PHE B O   1 
ATOM   4421 C CB  . PHE B 1 36  ? -4.908  -67.649 -43.109 1.00 35.93  ? 37   PHE B CB  1 
ATOM   4422 C CG  . PHE B 1 36  ? -4.346  -66.659 -42.102 1.00 35.13  ? 37   PHE B CG  1 
ATOM   4423 C CD1 . PHE B 1 36  ? -5.116  -65.585 -41.650 1.00 34.61  ? 37   PHE B CD1 1 
ATOM   4424 C CD2 . PHE B 1 36  ? -3.064  -66.838 -41.568 1.00 35.09  ? 37   PHE B CD2 1 
ATOM   4425 C CE1 . PHE B 1 36  ? -4.608  -64.677 -40.709 1.00 42.66  ? 37   PHE B CE1 1 
ATOM   4426 C CE2 . PHE B 1 36  ? -2.538  -65.946 -40.616 1.00 38.26  ? 37   PHE B CE2 1 
ATOM   4427 C CZ  . PHE B 1 36  ? -3.317  -64.864 -40.168 1.00 41.40  ? 37   PHE B CZ  1 
ATOM   4428 N N   . ALA B 1 37  ? -4.390  -64.962 -45.296 1.00 39.16  ? 38   ALA B N   1 
ATOM   4429 C CA  . ALA B 1 37  ? -4.755  -63.601 -45.646 1.00 38.34  ? 38   ALA B CA  1 
ATOM   4430 C C   . ALA B 1 37  ? -3.939  -63.113 -46.850 1.00 42.87  ? 38   ALA B C   1 
ATOM   4431 O O   . ALA B 1 37  ? -2.827  -63.597 -47.094 1.00 39.46  ? 38   ALA B O   1 
ATOM   4432 C CB  . ALA B 1 37  ? -4.544  -62.677 -44.453 1.00 33.22  ? 38   ALA B CB  1 
ATOM   4433 N N   . GLU B 1 38  ? -4.497  -62.171 -47.607 1.00 42.98  ? 39   GLU B N   1 
ATOM   4434 C CA  . GLU B 1 38  ? -3.725  -61.476 -48.631 1.00 44.25  ? 39   GLU B CA  1 
ATOM   4435 C C   . GLU B 1 38  ? -2.633  -60.704 -47.913 1.00 41.60  ? 39   GLU B C   1 
ATOM   4436 O O   . GLU B 1 38  ? -2.860  -60.172 -46.829 1.00 47.04  ? 39   GLU B O   1 
ATOM   4437 C CB  . GLU B 1 38  ? -4.603  -60.539 -49.477 1.00 44.99  ? 39   GLU B CB  1 
ATOM   4438 C CG  . GLU B 1 38  ? -5.671  -61.267 -50.301 1.00 47.53  ? 39   GLU B CG  1 
ATOM   4439 C CD  . GLU B 1 38  ? -5.075  -62.148 -51.402 1.00 53.50  ? 39   GLU B CD  1 
ATOM   4440 O OE1 . GLU B 1 38  ? -4.155  -61.672 -52.109 1.00 51.71  ? 39   GLU B OE1 1 
ATOM   4441 O OE2 . GLU B 1 38  ? -5.521  -63.319 -51.558 1.00 51.94  ? 39   GLU B OE2 1 
ATOM   4442 N N   . PRO B 1 39  ? -1.430  -60.680 -48.493 1.00 46.58  ? 40   PRO B N   1 
ATOM   4443 C CA  . PRO B 1 39  ? -0.335  -59.958 -47.837 1.00 39.50  ? 40   PRO B CA  1 
ATOM   4444 C C   . PRO B 1 39  ? -0.712  -58.497 -47.543 1.00 47.39  ? 40   PRO B C   1 
ATOM   4445 O O   . PRO B 1 39  ? -1.039  -57.734 -48.447 1.00 45.95  ? 40   PRO B O   1 
ATOM   4446 C CB  . PRO B 1 39  ? 0.817   -60.084 -48.856 1.00 40.58  ? 40   PRO B CB  1 
ATOM   4447 C CG  . PRO B 1 39  ? 0.540   -61.403 -49.556 1.00 36.64  ? 40   PRO B CG  1 
ATOM   4448 C CD  . PRO B 1 39  ? -0.975  -61.453 -49.673 1.00 43.82  ? 40   PRO B CD  1 
ATOM   4449 N N   . PRO B 1 40  ? -0.707  -58.114 -46.256 1.00 48.18  ? 41   PRO B N   1 
ATOM   4450 C CA  . PRO B 1 40  ? -1.103  -56.746 -45.901 1.00 46.46  ? 41   PRO B CA  1 
ATOM   4451 C C   . PRO B 1 40  ? -0.007  -55.746 -46.262 1.00 49.03  ? 41   PRO B C   1 
ATOM   4452 O O   . PRO B 1 40  ? 0.593   -55.134 -45.369 1.00 56.16  ? 41   PRO B O   1 
ATOM   4453 C CB  . PRO B 1 40  ? -1.329  -56.826 -44.391 1.00 43.45  ? 41   PRO B CB  1 
ATOM   4454 C CG  . PRO B 1 40  ? -0.406  -57.913 -43.943 1.00 42.79  ? 41   PRO B CG  1 
ATOM   4455 C CD  . PRO B 1 40  ? -0.307  -58.910 -45.086 1.00 38.66  ? 41   PRO B CD  1 
ATOM   4456 N N   . MET B 1 41  ? 0.211   -55.600 -47.569 1.00 48.63  ? 42   MET B N   1 
ATOM   4457 C CA  . MET B 1 41  ? 1.302   -54.847 -48.188 1.00 55.37  ? 42   MET B CA  1 
ATOM   4458 C C   . MET B 1 41  ? 0.835   -53.534 -48.798 1.00 51.74  ? 42   MET B C   1 
ATOM   4459 O O   . MET B 1 41  ? -0.304  -53.448 -49.261 1.00 47.36  ? 42   MET B O   1 
ATOM   4460 C CB  . MET B 1 41  ? 1.931   -55.658 -49.337 1.00 59.25  ? 42   MET B CB  1 
ATOM   4461 C CG  . MET B 1 41  ? 2.536   -56.971 -48.964 1.00 57.15  ? 42   MET B CG  1 
ATOM   4462 S SD  . MET B 1 41  ? 4.214   -56.629 -48.504 1.00 70.08  ? 42   MET B SD  1 
ATOM   4463 C CE  . MET B 1 41  ? 4.812   -55.837 -50.011 1.00 70.02  ? 42   MET B CE  1 
ATOM   4464 N N   . GLY B 1 42  ? 1.735   -52.553 -48.869 1.00 45.27  ? 43   GLY B N   1 
ATOM   4465 C CA  . GLY B 1 42  ? 1.488   -51.340 -49.632 1.00 50.22  ? 43   GLY B CA  1 
ATOM   4466 C C   . GLY B 1 42  ? 0.223   -50.622 -49.197 1.00 54.83  ? 43   GLY B C   1 
ATOM   4467 O O   . GLY B 1 42  ? 0.158   -50.118 -48.073 1.00 48.77  ? 43   GLY B O   1 
ATOM   4468 N N   . PRO B 1 43  ? -0.789  -50.576 -50.086 1.00 53.53  ? 44   PRO B N   1 
ATOM   4469 C CA  . PRO B 1 43  ? -2.094  -49.994 -49.738 1.00 54.18  ? 44   PRO B CA  1 
ATOM   4470 C C   . PRO B 1 43  ? -2.776  -50.686 -48.550 1.00 49.72  ? 44   PRO B C   1 
ATOM   4471 O O   . PRO B 1 43  ? -3.613  -50.067 -47.903 1.00 48.33  ? 44   PRO B O   1 
ATOM   4472 C CB  . PRO B 1 43  ? -2.931  -50.189 -51.031 1.00 46.28  ? 44   PRO B CB  1 
ATOM   4473 C CG  . PRO B 1 43  ? -2.179  -51.206 -51.852 1.00 41.72  ? 44   PRO B CG  1 
ATOM   4474 C CD  . PRO B 1 43  ? -0.736  -51.006 -51.501 1.00 50.91  ? 44   PRO B CD  1 
ATOM   4475 N N   . ARG B 1 44  ? -2.443  -51.948 -48.296 1.00 46.74  ? 45   ARG B N   1 
ATOM   4476 C CA  . ARG B 1 44  ? -3.125  -52.737 -47.274 1.00 47.62  ? 45   ARG B CA  1 
ATOM   4477 C C   . ARG B 1 44  ? -2.480  -52.653 -45.874 1.00 49.77  ? 45   ARG B C   1 
ATOM   4478 O O   . ARG B 1 44  ? -2.975  -53.273 -44.923 1.00 46.26  ? 45   ARG B O   1 
ATOM   4479 C CB  . ARG B 1 44  ? -3.198  -54.198 -47.702 1.00 46.69  ? 45   ARG B CB  1 
ATOM   4480 C CG  . ARG B 1 44  ? -4.087  -54.466 -48.922 1.00 49.74  ? 45   ARG B CG  1 
ATOM   4481 C CD  . ARG B 1 44  ? -4.224  -55.962 -49.084 1.00 50.13  ? 45   ARG B CD  1 
ATOM   4482 N NE  . ARG B 1 44  ? -4.538  -56.378 -50.446 1.00 69.86  ? 45   ARG B NE  1 
ATOM   4483 C CZ  . ARG B 1 44  ? -5.772  -56.607 -50.879 1.00 70.80  ? 45   ARG B CZ  1 
ATOM   4484 N NH1 . ARG B 1 44  ? -6.794  -56.442 -50.052 1.00 64.50  ? 45   ARG B NH1 1 
ATOM   4485 N NH2 . ARG B 1 44  ? -5.987  -56.995 -52.129 1.00 67.24  ? 45   ARG B NH2 1 
ATOM   4486 N N   . ARG B 1 45  ? -1.393  -51.891 -45.750 1.00 45.46  ? 46   ARG B N   1 
ATOM   4487 C CA  . ARG B 1 45  ? -0.792  -51.622 -44.444 1.00 47.16  ? 46   ARG B CA  1 
ATOM   4488 C C   . ARG B 1 45  ? -1.777  -50.854 -43.524 1.00 44.80  ? 46   ARG B C   1 
ATOM   4489 O O   . ARG B 1 45  ? -2.414  -49.886 -43.949 1.00 45.14  ? 46   ARG B O   1 
ATOM   4490 C CB  . ARG B 1 45  ? 0.523   -50.842 -44.612 1.00 41.84  ? 46   ARG B CB  1 
ATOM   4491 C CG  . ARG B 1 45  ? 1.237   -50.555 -43.279 1.00 41.19  ? 46   ARG B CG  1 
ATOM   4492 C CD  . ARG B 1 45  ? 2.414   -49.596 -43.423 1.00 43.35  ? 46   ARG B CD  1 
ATOM   4493 N NE  . ARG B 1 45  ? 3.605   -50.249 -43.953 1.00 41.26  ? 46   ARG B NE  1 
ATOM   4494 C CZ  . ARG B 1 45  ? 4.749   -49.621 -44.220 1.00 45.76  ? 46   ARG B CZ  1 
ATOM   4495 N NH1 . ARG B 1 45  ? 4.875   -48.318 -44.011 1.00 38.81  ? 46   ARG B NH1 1 
ATOM   4496 N NH2 . ARG B 1 45  ? 5.777   -50.302 -44.697 1.00 43.01  ? 46   ARG B NH2 1 
ATOM   4497 N N   . PHE B 1 46  ? -1.892  -51.313 -42.277 1.00 45.96  ? 47   PHE B N   1 
ATOM   4498 C CA  . PHE B 1 46  ? -2.815  -50.777 -41.253 1.00 35.17  ? 47   PHE B CA  1 
ATOM   4499 C C   . PHE B 1 46  ? -4.276  -51.152 -41.493 1.00 43.08  ? 47   PHE B C   1 
ATOM   4500 O O   . PHE B 1 46  ? -5.134  -50.785 -40.695 1.00 41.10  ? 47   PHE B O   1 
ATOM   4501 C CB  . PHE B 1 46  ? -2.734  -49.258 -41.133 1.00 35.12  ? 47   PHE B CB  1 
ATOM   4502 C CG  . PHE B 1 46  ? -1.335  -48.712 -40.999 1.00 38.64  ? 47   PHE B CG  1 
ATOM   4503 C CD1 . PHE B 1 46  ? -0.513  -49.105 -39.957 1.00 36.35  ? 47   PHE B CD1 1 
ATOM   4504 C CD2 . PHE B 1 46  ? -0.858  -47.769 -41.905 1.00 41.32  ? 47   PHE B CD2 1 
ATOM   4505 C CE1 . PHE B 1 46  ? 0.762   -48.585 -39.826 1.00 39.13  ? 47   PHE B CE1 1 
ATOM   4506 C CE2 . PHE B 1 46  ? 0.425   -47.241 -41.779 1.00 38.33  ? 47   PHE B CE2 1 
ATOM   4507 C CZ  . PHE B 1 46  ? 1.228   -47.643 -40.744 1.00 40.84  ? 47   PHE B CZ  1 
ATOM   4508 N N   . LEU B 1 47  ? -4.577  -51.882 -42.569 1.00 39.37  ? 48   LEU B N   1 
ATOM   4509 C CA  . LEU B 1 47  ? -5.966  -52.271 -42.817 1.00 40.45  ? 48   LEU B CA  1 
ATOM   4510 C C   . LEU B 1 47  ? -6.294  -53.632 -42.223 1.00 39.64  ? 48   LEU B C   1 
ATOM   4511 O O   . LEU B 1 47  ? -5.403  -54.441 -42.008 1.00 42.37  ? 48   LEU B O   1 
ATOM   4512 C CB  . LEU B 1 47  ? -6.269  -52.309 -44.324 1.00 44.87  ? 48   LEU B CB  1 
ATOM   4513 C CG  . LEU B 1 47  ? -6.433  -51.010 -45.118 1.00 51.32  ? 48   LEU B CG  1 
ATOM   4514 C CD1 . LEU B 1 47  ? -6.940  -51.297 -46.535 1.00 40.01  ? 48   LEU B CD1 1 
ATOM   4515 C CD2 . LEU B 1 47  ? -7.384  -50.068 -44.388 1.00 47.31  ? 48   LEU B CD2 1 
ATOM   4516 N N   . PRO B 1 48  ? -7.585  -53.907 -41.990 1.00 36.97  ? 49   PRO B N   1 
ATOM   4517 C CA  . PRO B 1 48  ? -8.007  -55.255 -41.619 1.00 37.90  ? 49   PRO B CA  1 
ATOM   4518 C C   . PRO B 1 48  ? -7.533  -56.292 -42.631 1.00 43.80  ? 49   PRO B C   1 
ATOM   4519 O O   . PRO B 1 48  ? -7.408  -55.984 -43.794 1.00 40.52  ? 49   PRO B O   1 
ATOM   4520 C CB  . PRO B 1 48  ? -9.532  -55.149 -41.617 1.00 38.99  ? 49   PRO B CB  1 
ATOM   4521 C CG  . PRO B 1 48  ? -9.787  -53.738 -41.210 1.00 41.08  ? 49   PRO B CG  1 
ATOM   4522 C CD  . PRO B 1 48  ? -8.708  -52.956 -41.944 1.00 40.12  ? 49   PRO B CD  1 
ATOM   4523 N N   . PRO B 1 49  ? -7.254  -57.519 -42.180 1.00 49.32  ? 50   PRO B N   1 
ATOM   4524 C CA  . PRO B 1 49  ? -6.776  -58.541 -43.112 1.00 36.94  ? 50   PRO B CA  1 
ATOM   4525 C C   . PRO B 1 49  ? -7.881  -58.929 -44.091 1.00 46.19  ? 50   PRO B C   1 
ATOM   4526 O O   . PRO B 1 49  ? -9.054  -58.987 -43.681 1.00 42.79  ? 50   PRO B O   1 
ATOM   4527 C CB  . PRO B 1 49  ? -6.420  -59.710 -42.197 1.00 39.29  ? 50   PRO B CB  1 
ATOM   4528 C CG  . PRO B 1 49  ? -7.415  -59.581 -41.039 1.00 36.99  ? 50   PRO B CG  1 
ATOM   4529 C CD  . PRO B 1 49  ? -7.524  -58.062 -40.837 1.00 34.42  ? 50   PRO B CD  1 
ATOM   4530 N N   . GLU B 1 50  ? -7.519  -59.158 -45.357 1.00 39.94  ? 51   GLU B N   1 
ATOM   4531 C CA  . GLU B 1 50  ? -8.457  -59.692 -46.337 1.00 43.04  ? 51   GLU B CA  1 
ATOM   4532 C C   . GLU B 1 50  ? -8.277  -61.198 -46.387 1.00 40.44  ? 51   GLU B C   1 
ATOM   4533 O O   . GLU B 1 50  ? -7.157  -61.685 -46.321 1.00 42.26  ? 51   GLU B O   1 
ATOM   4534 C CB  . GLU B 1 50  ? -8.207  -59.098 -47.718 1.00 51.14  ? 51   GLU B CB  1 
ATOM   4535 C CG  . GLU B 1 50  ? -9.079  -57.942 -48.112 1.00 64.21  ? 51   GLU B CG  1 
ATOM   4536 C CD  . GLU B 1 50  ? -9.238  -57.863 -49.644 1.00 88.03  ? 51   GLU B CD  1 
ATOM   4537 O OE1 . GLU B 1 50  ? -9.060  -58.908 -50.333 1.00 82.58  ? 51   GLU B OE1 1 
ATOM   4538 O OE2 . GLU B 1 50  ? -9.516  -56.753 -50.166 1.00 95.57  ? 51   GLU B OE2 1 
ATOM   4539 N N   . PRO B 1 51  ? -9.370  -61.948 -46.491 1.00 38.67  ? 52   PRO B N   1 
ATOM   4540 C CA  . PRO B 1 51  ? -9.197  -63.395 -46.656 1.00 43.67  ? 52   PRO B CA  1 
ATOM   4541 C C   . PRO B 1 51  ? -8.381  -63.742 -47.919 1.00 40.75  ? 52   PRO B C   1 
ATOM   4542 O O   . PRO B 1 51  ? -8.528  -63.096 -48.958 1.00 51.45  ? 52   PRO B O   1 
ATOM   4543 C CB  . PRO B 1 51  ? -10.636 -63.904 -46.759 1.00 43.87  ? 52   PRO B CB  1 
ATOM   4544 C CG  . PRO B 1 51  ? -11.438 -62.874 -46.001 1.00 43.63  ? 52   PRO B CG  1 
ATOM   4545 C CD  . PRO B 1 51  ? -10.781 -61.563 -46.322 1.00 40.15  ? 52   PRO B CD  1 
ATOM   4546 N N   . LYS B 1 52  ? -7.503  -64.733 -47.798 1.00 44.28  ? 53   LYS B N   1 
ATOM   4547 C CA  . LYS B 1 52  ? -6.673  -65.196 -48.900 1.00 48.01  ? 53   LYS B CA  1 
ATOM   4548 C C   . LYS B 1 52  ? -7.541  -65.694 -50.082 1.00 45.42  ? 53   LYS B C   1 
ATOM   4549 O O   . LYS B 1 52  ? -8.411  -66.549 -49.916 1.00 46.38  ? 53   LYS B O   1 
ATOM   4550 C CB  . LYS B 1 52  ? -5.730  -66.301 -48.402 1.00 44.29  ? 53   LYS B CB  1 
ATOM   4551 C CG  . LYS B 1 52  ? -4.873  -66.982 -49.501 1.00 41.84  ? 53   LYS B CG  1 
ATOM   4552 C CD  . LYS B 1 52  ? -3.762  -66.058 -49.957 1.00 46.28  ? 53   LYS B CD  1 
ATOM   4553 C CE  . LYS B 1 52  ? -2.913  -66.692 -51.052 1.00 47.12  ? 53   LYS B CE  1 
ATOM   4554 N NZ  . LYS B 1 52  ? -1.872  -65.734 -51.536 1.00 52.60  ? 53   LYS B NZ  1 
ATOM   4555 N N   . GLN B 1 53  ? -7.332  -65.119 -51.259 1.00 48.39  ? 54   GLN B N   1 
ATOM   4556 C CA  . GLN B 1 53  ? -8.057  -65.546 -52.467 1.00 51.51  ? 54   GLN B CA  1 
ATOM   4557 C C   . GLN B 1 53  ? -7.697  -66.990 -52.842 1.00 47.44  ? 54   GLN B C   1 
ATOM   4558 O O   . GLN B 1 53  ? -6.539  -67.401 -52.724 1.00 48.45  ? 54   GLN B O   1 
ATOM   4559 C CB  . GLN B 1 53  ? -7.750  -64.599 -53.638 1.00 50.46  ? 54   GLN B CB  1 
ATOM   4560 C CG  . GLN B 1 53  ? -8.411  -63.214 -53.531 1.00 55.28  ? 54   GLN B CG  1 
ATOM   4561 C CD  . GLN B 1 53  ? -9.923  -63.276 -53.770 1.00 79.80  ? 54   GLN B CD  1 
ATOM   4562 O OE1 . GLN B 1 53  ? -10.711 -63.333 -52.818 1.00 70.38  ? 54   GLN B OE1 1 
ATOM   4563 N NE2 . GLN B 1 53  ? -10.332 -63.283 -55.054 1.00 86.06  ? 54   GLN B NE2 1 
ATOM   4564 N N   . PRO B 1 54  ? -8.684  -67.767 -53.302 1.00 48.83  ? 55   PRO B N   1 
ATOM   4565 C CA  . PRO B 1 54  ? -8.389  -69.134 -53.770 1.00 50.45  ? 55   PRO B CA  1 
ATOM   4566 C C   . PRO B 1 54  ? -7.276  -69.196 -54.844 1.00 47.62  ? 55   PRO B C   1 
ATOM   4567 O O   . PRO B 1 54  ? -7.047  -68.237 -55.584 1.00 41.99  ? 55   PRO B O   1 
ATOM   4568 C CB  . PRO B 1 54  ? -9.732  -69.604 -54.338 1.00 54.62  ? 55   PRO B CB  1 
ATOM   4569 C CG  . PRO B 1 54  ? -10.773 -68.725 -53.640 1.00 51.64  ? 55   PRO B CG  1 
ATOM   4570 C CD  . PRO B 1 54  ? -10.102 -67.402 -53.470 1.00 50.85  ? 55   PRO B CD  1 
ATOM   4571 N N   . TRP B 1 55  ? -6.581  -70.328 -54.888 1.00 49.39  ? 56   TRP B N   1 
ATOM   4572 C CA  . TRP B 1 55  ? -5.423  -70.528 -55.757 1.00 45.95  ? 56   TRP B CA  1 
ATOM   4573 C C   . TRP B 1 55  ? -5.525  -71.857 -56.502 1.00 48.67  ? 56   TRP B C   1 
ATOM   4574 O O   . TRP B 1 55  ? -6.157  -72.800 -56.015 1.00 47.22  ? 56   TRP B O   1 
ATOM   4575 C CB  . TRP B 1 55  ? -4.120  -70.492 -54.942 1.00 47.04  ? 56   TRP B CB  1 
ATOM   4576 C CG  . TRP B 1 55  ? -3.996  -71.605 -53.911 1.00 50.12  ? 56   TRP B CG  1 
ATOM   4577 C CD1 . TRP B 1 55  ? -3.514  -72.869 -54.119 1.00 46.13  ? 56   TRP B CD1 1 
ATOM   4578 C CD2 . TRP B 1 55  ? -4.362  -71.541 -52.523 1.00 45.98  ? 56   TRP B CD2 1 
ATOM   4579 N NE1 . TRP B 1 55  ? -3.559  -73.593 -52.952 1.00 46.10  ? 56   TRP B NE1 1 
ATOM   4580 C CE2 . TRP B 1 55  ? -4.076  -72.802 -51.957 1.00 50.02  ? 56   TRP B CE2 1 
ATOM   4581 C CE3 . TRP B 1 55  ? -4.900  -70.536 -51.701 1.00 49.65  ? 56   TRP B CE3 1 
ATOM   4582 C CZ2 . TRP B 1 55  ? -4.306  -73.090 -50.594 1.00 46.55  ? 56   TRP B CZ2 1 
ATOM   4583 C CZ3 . TRP B 1 55  ? -5.140  -70.827 -50.340 1.00 45.77  ? 56   TRP B CZ3 1 
ATOM   4584 C CH2 . TRP B 1 55  ? -4.842  -72.094 -49.813 1.00 47.08  ? 56   TRP B CH2 1 
ATOM   4585 N N   . SER B 1 56  ? -4.902  -71.945 -57.676 1.00 48.69  ? 57   SER B N   1 
ATOM   4586 C CA  . SER B 1 56  ? -4.896  -73.211 -58.418 1.00 52.90  ? 57   SER B CA  1 
ATOM   4587 C C   . SER B 1 56  ? -3.570  -73.914 -58.172 1.00 51.71  ? 57   SER B C   1 
ATOM   4588 O O   . SER B 1 56  ? -2.631  -73.310 -57.660 1.00 52.28  ? 57   SER B O   1 
ATOM   4589 C CB  . SER B 1 56  ? -5.137  -72.988 -59.922 1.00 55.32  ? 57   SER B CB  1 
ATOM   4590 O OG  . SER B 1 56  ? -4.029  -72.362 -60.562 1.00 58.71  ? 57   SER B OG  1 
ATOM   4591 N N   . GLY B 1 57  ? -3.491  -75.192 -58.511 1.00 51.51  ? 58   GLY B N   1 
ATOM   4592 C CA  . GLY B 1 57  ? -2.290  -75.945 -58.201 1.00 49.23  ? 58   GLY B CA  1 
ATOM   4593 C C   . GLY B 1 57  ? -2.078  -76.097 -56.698 1.00 51.59  ? 58   GLY B C   1 
ATOM   4594 O O   . GLY B 1 57  ? -2.981  -75.858 -55.894 1.00 49.05  ? 58   GLY B O   1 
ATOM   4595 N N   . VAL B 1 58  ? -0.875  -76.504 -56.317 1.00 48.19  ? 59   VAL B N   1 
ATOM   4596 C CA  . VAL B 1 58  ? -0.611  -76.917 -54.951 1.00 47.16  ? 59   VAL B CA  1 
ATOM   4597 C C   . VAL B 1 58  ? 0.366   -75.976 -54.254 1.00 49.01  ? 59   VAL B C   1 
ATOM   4598 O O   . VAL B 1 58  ? 1.478   -75.750 -54.741 1.00 45.31  ? 59   VAL B O   1 
ATOM   4599 C CB  . VAL B 1 58  ? -0.041  -78.344 -54.925 1.00 49.96  ? 59   VAL B CB  1 
ATOM   4600 C CG1 . VAL B 1 58  ? 0.025   -78.882 -53.496 1.00 46.63  ? 59   VAL B CG1 1 
ATOM   4601 C CG2 . VAL B 1 58  ? -0.866  -79.257 -55.831 1.00 44.91  ? 59   VAL B CG2 1 
ATOM   4602 N N   . VAL B 1 59  ? -0.048  -75.428 -53.113 1.00 50.50  ? 60   VAL B N   1 
ATOM   4603 C CA  . VAL B 1 59  ? 0.854   -74.630 -52.274 1.00 41.77  ? 60   VAL B CA  1 
ATOM   4604 C C   . VAL B 1 59  ? 1.699   -75.518 -51.372 1.00 41.82  ? 60   VAL B C   1 
ATOM   4605 O O   . VAL B 1 59  ? 1.165   -76.353 -50.625 1.00 45.61  ? 60   VAL B O   1 
ATOM   4606 C CB  . VAL B 1 59  ? 0.073   -73.601 -51.406 1.00 43.72  ? 60   VAL B CB  1 
ATOM   4607 C CG1 . VAL B 1 59  ? 0.971   -73.022 -50.276 1.00 40.28  ? 60   VAL B CG1 1 
ATOM   4608 C CG2 . VAL B 1 59  ? -0.468  -72.502 -52.276 1.00 37.19  ? 60   VAL B CG2 1 
ATOM   4609 N N   . ASP B 1 60  ? 3.015   -75.347 -51.433 1.00 37.64  ? 61   ASP B N   1 
ATOM   4610 C CA  . ASP B 1 60  ? 3.888   -76.063 -50.500 1.00 41.96  ? 61   ASP B CA  1 
ATOM   4611 C C   . ASP B 1 60  ? 3.860   -75.422 -49.108 1.00 41.62  ? 61   ASP B C   1 
ATOM   4612 O O   . ASP B 1 60  ? 4.331   -74.299 -48.921 1.00 40.34  ? 61   ASP B O   1 
ATOM   4613 C CB  . ASP B 1 60  ? 5.326   -76.109 -51.008 1.00 39.61  ? 61   ASP B CB  1 
ATOM   4614 C CG  . ASP B 1 60  ? 5.498   -77.074 -52.156 1.00 46.90  ? 61   ASP B CG  1 
ATOM   4615 O OD1 . ASP B 1 60  ? 5.070   -78.238 -52.017 1.00 53.81  ? 61   ASP B OD1 1 
ATOM   4616 O OD2 . ASP B 1 60  ? 6.049   -76.670 -53.205 1.00 56.91  ? 61   ASP B OD2 1 
ATOM   4617 N N   . ALA B 1 61  ? 3.301   -76.141 -48.140 1.00 40.72  ? 62   ALA B N   1 
ATOM   4618 C CA  . ALA B 1 61  ? 3.311   -75.697 -46.746 1.00 40.34  ? 62   ALA B CA  1 
ATOM   4619 C C   . ALA B 1 61  ? 4.356   -76.493 -45.996 1.00 39.50  ? 62   ALA B C   1 
ATOM   4620 O O   . ALA B 1 61  ? 4.029   -77.356 -45.175 1.00 36.23  ? 62   ALA B O   1 
ATOM   4621 C CB  . ALA B 1 61  ? 1.943   -75.872 -46.097 1.00 40.06  ? 62   ALA B CB  1 
ATOM   4622 N N   . THR B 1 62  ? 5.617   -76.217 -46.291 1.00 37.71  ? 63   THR B N   1 
ATOM   4623 C CA  . THR B 1 62  ? 6.685   -77.122 -45.898 1.00 37.23  ? 63   THR B CA  1 
ATOM   4624 C C   . THR B 1 62  ? 7.753   -76.479 -45.021 1.00 35.09  ? 63   THR B C   1 
ATOM   4625 O O   . THR B 1 62  ? 8.729   -77.131 -44.645 1.00 38.29  ? 63   THR B O   1 
ATOM   4626 C CB  . THR B 1 62  ? 7.372   -77.678 -47.159 1.00 38.73  ? 63   THR B CB  1 
ATOM   4627 O OG1 . THR B 1 62  ? 7.863   -76.567 -47.896 1.00 36.40  ? 63   THR B OG1 1 
ATOM   4628 C CG2 . THR B 1 62  ? 6.387   -78.452 -48.009 1.00 35.36  ? 63   THR B CG2 1 
ATOM   4629 N N   . THR B 1 63  ? 7.608   -75.188 -44.746 1.00 36.96  ? 64   THR B N   1 
ATOM   4630 C CA  . THR B 1 63  ? 8.498   -74.496 -43.800 1.00 36.44  ? 64   THR B CA  1 
ATOM   4631 C C   . THR B 1 63  ? 7.796   -73.233 -43.319 1.00 35.96  ? 64   THR B C   1 
ATOM   4632 O O   . THR B 1 63  ? 6.840   -72.779 -43.964 1.00 35.95  ? 64   THR B O   1 
ATOM   4633 C CB  . THR B 1 63  ? 9.866   -74.147 -44.421 1.00 35.84  ? 64   THR B CB  1 
ATOM   4634 O OG1 . THR B 1 63  ? 10.811  -73.923 -43.375 1.00 42.74  ? 64   THR B OG1 1 
ATOM   4635 C CG2 . THR B 1 63  ? 9.795   -72.905 -45.276 1.00 36.38  ? 64   THR B CG2 1 
ATOM   4636 N N   . PHE B 1 64  ? 8.221   -72.713 -42.171 1.00 32.80  ? 65   PHE B N   1 
ATOM   4637 C CA  . PHE B 1 64  ? 7.649   -71.492 -41.615 1.00 35.09  ? 65   PHE B CA  1 
ATOM   4638 C C   . PHE B 1 64  ? 7.864   -70.309 -42.541 1.00 37.48  ? 65   PHE B C   1 
ATOM   4639 O O   . PHE B 1 64  ? 8.938   -70.161 -43.125 1.00 33.94  ? 65   PHE B O   1 
ATOM   4640 C CB  . PHE B 1 64  ? 8.273   -71.159 -40.254 1.00 34.70  ? 65   PHE B CB  1 
ATOM   4641 C CG  . PHE B 1 64  ? 7.876   -72.098 -39.145 1.00 32.77  ? 65   PHE B CG  1 
ATOM   4642 C CD1 . PHE B 1 64  ? 6.577   -72.125 -38.678 1.00 30.18  ? 65   PHE B CD1 1 
ATOM   4643 C CD2 . PHE B 1 64  ? 8.817   -72.938 -38.560 1.00 36.01  ? 65   PHE B CD2 1 
ATOM   4644 C CE1 . PHE B 1 64  ? 6.210   -72.988 -37.650 1.00 39.54  ? 65   PHE B CE1 1 
ATOM   4645 C CE2 . PHE B 1 64  ? 8.465   -73.803 -37.534 1.00 38.28  ? 65   PHE B CE2 1 
ATOM   4646 C CZ  . PHE B 1 64  ? 7.158   -73.821 -37.071 1.00 36.45  ? 65   PHE B CZ  1 
ATOM   4647 N N   . GLN B 1 65  ? 6.867   -69.433 -42.623 1.00 40.24  ? 66   GLN B N   1 
ATOM   4648 C CA  . GLN B 1 65  ? 7.007   -68.218 -43.412 1.00 40.15  ? 66   GLN B CA  1 
ATOM   4649 C C   . GLN B 1 65  ? 7.633   -67.112 -42.576 1.00 36.41  ? 66   GLN B C   1 
ATOM   4650 O O   . GLN B 1 65  ? 7.981   -67.331 -41.414 1.00 36.21  ? 66   GLN B O   1 
ATOM   4651 C CB  . GLN B 1 65  ? 5.652   -67.769 -43.977 1.00 36.07  ? 66   GLN B CB  1 
ATOM   4652 C CG  . GLN B 1 65  ? 5.478   -68.109 -45.404 1.00 42.11  ? 66   GLN B CG  1 
ATOM   4653 C CD  . GLN B 1 65  ? 6.160   -67.106 -46.319 1.00 42.92  ? 66   GLN B CD  1 
ATOM   4654 O OE1 . GLN B 1 65  ? 6.884   -66.209 -45.869 1.00 45.10  ? 66   GLN B OE1 1 
ATOM   4655 N NE2 . GLN B 1 65  ? 5.912   -67.235 -47.601 1.00 35.57  ? 66   GLN B NE2 1 
ATOM   4656 N N   . SER B 1 66  ? 7.757   -65.930 -43.179 1.00 30.95  ? 67   SER B N   1 
ATOM   4657 C CA  . SER B 1 66  ? 8.493   -64.828 -42.582 1.00 39.51  ? 67   SER B CA  1 
ATOM   4658 C C   . SER B 1 66  ? 7.877   -64.321 -41.258 1.00 40.77  ? 67   SER B C   1 
ATOM   4659 O O   . SER B 1 66  ? 6.670   -64.403 -41.043 1.00 36.83  ? 67   SER B O   1 
ATOM   4660 C CB  . SER B 1 66  ? 8.585   -63.660 -43.580 1.00 39.32  ? 67   SER B CB  1 
ATOM   4661 O OG  . SER B 1 66  ? 8.968   -64.102 -44.875 1.00 39.22  ? 67   SER B OG  1 
ATOM   4662 N N   . VAL B 1 67  ? 8.726   -63.783 -40.392 1.00 35.64  ? 68   VAL B N   1 
ATOM   4663 C CA  . VAL B 1 67  ? 8.278   -63.067 -39.213 1.00 37.45  ? 68   VAL B CA  1 
ATOM   4664 C C   . VAL B 1 67  ? 7.695   -61.679 -39.546 1.00 39.09  ? 68   VAL B C   1 
ATOM   4665 O O   . VAL B 1 67  ? 8.261   -60.930 -40.345 1.00 39.81  ? 68   VAL B O   1 
ATOM   4666 C CB  . VAL B 1 67  ? 9.446   -62.931 -38.230 1.00 38.31  ? 68   VAL B CB  1 
ATOM   4667 C CG1 . VAL B 1 67  ? 9.045   -62.125 -36.998 1.00 39.98  ? 68   VAL B CG1 1 
ATOM   4668 C CG2 . VAL B 1 67  ? 9.921   -64.304 -37.835 1.00 34.44  ? 68   VAL B CG2 1 
ATOM   4669 N N   . CYS B 1 68  ? 6.557   -61.337 -38.948 1.00 39.87  ? 69   CYS B N   1 
ATOM   4670 C CA  . CYS B 1 68  ? 5.999   -59.985 -39.093 1.00 40.47  ? 69   CYS B CA  1 
ATOM   4671 C C   . CYS B 1 68  ? 7.021   -58.953 -38.640 1.00 40.30  ? 69   CYS B C   1 
ATOM   4672 O O   . CYS B 1 68  ? 7.699   -59.170 -37.636 1.00 38.39  ? 69   CYS B O   1 
ATOM   4673 C CB  . CYS B 1 68  ? 4.706   -59.842 -38.281 1.00 36.34  ? 69   CYS B CB  1 
ATOM   4674 S SG  . CYS B 1 68  ? 3.303   -60.861 -38.906 1.00 43.31  ? 69   CYS B SG  1 
ATOM   4675 N N   . TYR B 1 69  ? 7.141   -57.845 -39.371 1.00 37.92  ? 70   TYR B N   1 
ATOM   4676 C CA  . TYR B 1 69  ? 8.125   -56.805 -39.032 1.00 39.98  ? 70   TYR B CA  1 
ATOM   4677 C C   . TYR B 1 69  ? 8.088   -56.384 -37.558 1.00 37.96  ? 70   TYR B C   1 
ATOM   4678 O O   . TYR B 1 69  ? 7.028   -56.103 -37.004 1.00 32.88  ? 70   TYR B O   1 
ATOM   4679 C CB  . TYR B 1 69  ? 7.926   -55.570 -39.911 1.00 42.94  ? 70   TYR B CB  1 
ATOM   4680 C CG  . TYR B 1 69  ? 9.008   -55.409 -40.947 1.00 38.83  ? 70   TYR B CG  1 
ATOM   4681 C CD1 . TYR B 1 69  ? 10.208  -54.794 -40.637 1.00 36.56  ? 70   TYR B CD1 1 
ATOM   4682 C CD2 . TYR B 1 69  ? 8.819   -55.878 -42.244 1.00 50.29  ? 70   TYR B CD2 1 
ATOM   4683 C CE1 . TYR B 1 69  ? 11.204  -54.654 -41.586 1.00 44.45  ? 70   TYR B CE1 1 
ATOM   4684 C CE2 . TYR B 1 69  ? 9.800   -55.739 -43.198 1.00 52.32  ? 70   TYR B CE2 1 
ATOM   4685 C CZ  . TYR B 1 69  ? 10.997  -55.129 -42.863 1.00 48.53  ? 70   TYR B CZ  1 
ATOM   4686 O OH  . TYR B 1 69  ? 11.971  -54.998 -43.840 1.00 64.31  ? 70   TYR B OH  1 
ATOM   4687 N N   . GLN B 1 70  ? 9.251   -56.353 -36.922 1.00 39.83  ? 71   GLN B N   1 
ATOM   4688 C CA  . GLN B 1 70  ? 9.297   -56.050 -35.507 1.00 36.29  ? 71   GLN B CA  1 
ATOM   4689 C C   . GLN B 1 70  ? 10.686  -55.656 -35.055 1.00 43.89  ? 71   GLN B C   1 
ATOM   4690 O O   . GLN B 1 70  ? 11.683  -55.992 -35.696 1.00 42.26  ? 71   GLN B O   1 
ATOM   4691 C CB  . GLN B 1 70  ? 8.822   -57.252 -34.690 1.00 42.43  ? 71   GLN B CB  1 
ATOM   4692 C CG  . GLN B 1 70  ? 9.607   -58.546 -34.945 1.00 37.89  ? 71   GLN B CG  1 
ATOM   4693 C CD  . GLN B 1 70  ? 8.934   -59.751 -34.323 1.00 37.64  ? 71   GLN B CD  1 
ATOM   4694 O OE1 . GLN B 1 70  ? 9.382   -60.281 -33.278 1.00 35.83  ? 71   GLN B OE1 1 
ATOM   4695 N NE2 . GLN B 1 70  ? 7.843   -60.196 -34.949 1.00 28.56  ? 71   GLN B NE2 1 
ATOM   4696 N N   . TYR B 1 71  ? 10.732  -54.942 -33.937 1.00 40.24  ? 72   TYR B N   1 
ATOM   4697 C CA  . TYR B 1 71  ? 11.991  -54.630 -33.284 1.00 43.56  ? 72   TYR B CA  1 
ATOM   4698 C C   . TYR B 1 71  ? 12.724  -55.919 -32.879 1.00 46.79  ? 72   TYR B C   1 
ATOM   4699 O O   . TYR B 1 71  ? 12.100  -56.913 -32.499 1.00 44.61  ? 72   TYR B O   1 
ATOM   4700 C CB  . TYR B 1 71  ? 11.728  -53.740 -32.066 1.00 45.49  ? 72   TYR B CB  1 
ATOM   4701 C CG  . TYR B 1 71  ? 12.920  -53.539 -31.162 1.00 51.65  ? 72   TYR B CG  1 
ATOM   4702 C CD1 . TYR B 1 71  ? 13.843  -52.523 -31.410 1.00 48.95  ? 72   TYR B CD1 1 
ATOM   4703 C CD2 . TYR B 1 71  ? 13.125  -54.368 -30.059 1.00 44.19  ? 72   TYR B CD2 1 
ATOM   4704 C CE1 . TYR B 1 71  ? 14.939  -52.339 -30.584 1.00 54.11  ? 72   TYR B CE1 1 
ATOM   4705 C CE2 . TYR B 1 71  ? 14.218  -54.193 -29.229 1.00 49.19  ? 72   TYR B CE2 1 
ATOM   4706 C CZ  . TYR B 1 71  ? 15.119  -53.175 -29.491 1.00 53.57  ? 72   TYR B CZ  1 
ATOM   4707 O OH  . TYR B 1 71  ? 16.211  -53.002 -28.671 1.00 58.12  ? 72   TYR B OH  1 
ATOM   4708 N N   . VAL B 1 72  ? 14.048  -55.898 -32.969 1.00 47.49  ? 73   VAL B N   1 
ATOM   4709 C CA  . VAL B 1 72  ? 14.867  -57.038 -32.579 1.00 41.39  ? 73   VAL B CA  1 
ATOM   4710 C C   . VAL B 1 72  ? 15.691  -56.665 -31.364 1.00 45.85  ? 73   VAL B C   1 
ATOM   4711 O O   . VAL B 1 72  ? 16.497  -55.743 -31.432 1.00 43.82  ? 73   VAL B O   1 
ATOM   4712 C CB  . VAL B 1 72  ? 15.811  -57.487 -33.711 1.00 43.45  ? 73   VAL B CB  1 
ATOM   4713 C CG1 . VAL B 1 72  ? 16.758  -58.574 -33.207 1.00 45.26  ? 73   VAL B CG1 1 
ATOM   4714 C CG2 . VAL B 1 72  ? 15.013  -57.945 -34.925 1.00 41.13  ? 73   VAL B CG2 1 
ATOM   4715 N N   . ASP B 1 73  ? 15.476  -57.376 -30.255 1.00 46.40  ? 74   ASP B N   1 
ATOM   4716 C CA  . ASP B 1 73  ? 16.207  -57.134 -29.012 1.00 51.47  ? 74   ASP B CA  1 
ATOM   4717 C C   . ASP B 1 73  ? 17.723  -57.232 -29.156 1.00 51.59  ? 74   ASP B C   1 
ATOM   4718 O O   . ASP B 1 73  ? 18.245  -58.248 -29.603 1.00 49.26  ? 74   ASP B O   1 
ATOM   4719 C CB  . ASP B 1 73  ? 15.753  -58.116 -27.931 1.00 53.04  ? 74   ASP B CB  1 
ATOM   4720 C CG  . ASP B 1 73  ? 16.435  -57.864 -26.602 1.00 54.64  ? 74   ASP B CG  1 
ATOM   4721 O OD1 . ASP B 1 73  ? 16.959  -56.753 -26.398 1.00 58.42  ? 74   ASP B OD1 1 
ATOM   4722 O OD2 . ASP B 1 73  ? 16.448  -58.771 -25.745 1.00 62.79  ? 74   ASP B OD2 1 
ATOM   4723 N N   . THR B 1 74  ? 18.429  -56.194 -28.717 1.00 54.51  ? 75   THR B N   1 
ATOM   4724 C CA  . THR B 1 74  ? 19.889  -56.183 -28.800 1.00 55.39  ? 75   THR B CA  1 
ATOM   4725 C C   . THR B 1 74  ? 20.615  -56.098 -27.453 1.00 54.21  ? 75   THR B C   1 
ATOM   4726 O O   . THR B 1 74  ? 21.840  -56.034 -27.425 1.00 58.81  ? 75   THR B O   1 
ATOM   4727 C CB  . THR B 1 74  ? 20.367  -55.009 -29.670 1.00 56.93  ? 75   THR B CB  1 
ATOM   4728 O OG1 . THR B 1 74  ? 19.765  -53.794 -29.199 1.00 58.09  ? 75   THR B OG1 1 
ATOM   4729 C CG2 . THR B 1 74  ? 19.978  -55.243 -31.112 1.00 52.29  ? 75   THR B CG2 1 
ATOM   4730 N N   . LEU B 1 75  ? 19.865  -56.125 -26.350 1.00 56.15  ? 76   LEU B N   1 
ATOM   4731 C CA  . LEU B 1 75  ? 20.426  -55.994 -25.000 1.00 53.64  ? 76   LEU B CA  1 
ATOM   4732 C C   . LEU B 1 75  ? 21.604  -56.925 -24.698 1.00 55.24  ? 76   LEU B C   1 
ATOM   4733 O O   . LEU B 1 75  ? 22.673  -56.460 -24.299 1.00 59.92  ? 76   LEU B O   1 
ATOM   4734 C CB  . LEU B 1 75  ? 19.332  -56.223 -23.941 1.00 58.10  ? 76   LEU B CB  1 
ATOM   4735 C CG  . LEU B 1 75  ? 19.667  -55.767 -22.507 1.00 57.59  ? 76   LEU B CG  1 
ATOM   4736 C CD1 . LEU B 1 75  ? 19.968  -54.270 -22.467 1.00 53.91  ? 76   LEU B CD1 1 
ATOM   4737 C CD2 . LEU B 1 75  ? 18.555  -56.100 -21.508 1.00 57.67  ? 76   LEU B CD2 1 
ATOM   4738 N N   . TYR B 1 76  ? 21.415  -58.232 -24.843 1.00 51.78  ? 77   TYR B N   1 
ATOM   4739 C CA  . TYR B 1 76  ? 22.539  -59.153 -24.651 1.00 52.04  ? 77   TYR B CA  1 
ATOM   4740 C C   . TYR B 1 76  ? 22.772  -60.000 -25.905 1.00 54.28  ? 77   TYR B C   1 
ATOM   4741 O O   . TYR B 1 76  ? 22.277  -61.121 -26.002 1.00 56.19  ? 77   TYR B O   1 
ATOM   4742 C CB  . TYR B 1 76  ? 22.304  -60.066 -23.446 1.00 53.32  ? 77   TYR B CB  1 
ATOM   4743 C CG  . TYR B 1 76  ? 22.046  -59.364 -22.119 1.00 54.85  ? 77   TYR B CG  1 
ATOM   4744 C CD1 . TYR B 1 76  ? 23.083  -58.761 -21.401 1.00 53.88  ? 77   TYR B CD1 1 
ATOM   4745 C CD2 . TYR B 1 76  ? 20.768  -59.341 -21.562 1.00 54.10  ? 77   TYR B CD2 1 
ATOM   4746 C CE1 . TYR B 1 76  ? 22.844  -58.136 -20.161 1.00 59.05  ? 77   TYR B CE1 1 
ATOM   4747 C CE2 . TYR B 1 76  ? 20.517  -58.716 -20.325 1.00 59.68  ? 77   TYR B CE2 1 
ATOM   4748 C CZ  . TYR B 1 76  ? 21.552  -58.118 -19.628 1.00 55.46  ? 77   TYR B CZ  1 
ATOM   4749 O OH  . TYR B 1 76  ? 21.283  -57.506 -18.413 1.00 57.48  ? 77   TYR B OH  1 
ATOM   4750 N N   . PRO B 1 77  ? 23.530  -59.466 -26.875 1.00 58.78  ? 78   PRO B N   1 
ATOM   4751 C CA  . PRO B 1 77  ? 23.614  -60.123 -28.187 1.00 57.69  ? 78   PRO B CA  1 
ATOM   4752 C C   . PRO B 1 77  ? 24.310  -61.491 -28.106 1.00 58.76  ? 78   PRO B C   1 
ATOM   4753 O O   . PRO B 1 77  ? 25.318  -61.645 -27.406 1.00 55.39  ? 78   PRO B O   1 
ATOM   4754 C CB  . PRO B 1 77  ? 24.415  -59.121 -29.028 1.00 59.28  ? 78   PRO B CB  1 
ATOM   4755 C CG  . PRO B 1 77  ? 25.219  -58.355 -28.051 1.00 61.58  ? 78   PRO B CG  1 
ATOM   4756 C CD  . PRO B 1 77  ? 24.404  -58.281 -26.785 1.00 58.72  ? 78   PRO B CD  1 
ATOM   4757 N N   . GLY B 1 78  ? 23.745  -62.482 -28.789 1.00 54.31  ? 79   GLY B N   1 
ATOM   4758 C CA  . GLY B 1 78  ? 24.281  -63.830 -28.749 1.00 49.76  ? 79   GLY B CA  1 
ATOM   4759 C C   . GLY B 1 78  ? 23.869  -64.623 -27.520 1.00 53.43  ? 79   GLY B C   1 
ATOM   4760 O O   . GLY B 1 78  ? 24.073  -65.838 -27.465 1.00 50.57  ? 79   GLY B O   1 
ATOM   4761 N N   . PHE B 1 79  ? 23.284  -63.945 -26.531 1.00 54.72  ? 80   PHE B N   1 
ATOM   4762 C CA  . PHE B 1 79  ? 22.831  -64.621 -25.316 1.00 47.88  ? 80   PHE B CA  1 
ATOM   4763 C C   . PHE B 1 79  ? 21.577  -65.443 -25.615 1.00 48.86  ? 80   PHE B C   1 
ATOM   4764 O O   . PHE B 1 79  ? 20.645  -64.965 -26.261 1.00 49.74  ? 80   PHE B O   1 
ATOM   4765 C CB  . PHE B 1 79  ? 22.579  -63.605 -24.201 1.00 46.32  ? 80   PHE B CB  1 
ATOM   4766 C CG  . PHE B 1 79  ? 22.023  -64.204 -22.930 1.00 48.00  ? 80   PHE B CG  1 
ATOM   4767 C CD1 . PHE B 1 79  ? 22.740  -65.151 -22.213 1.00 47.22  ? 80   PHE B CD1 1 
ATOM   4768 C CD2 . PHE B 1 79  ? 20.798  -63.771 -22.424 1.00 50.60  ? 80   PHE B CD2 1 
ATOM   4769 C CE1 . PHE B 1 79  ? 22.226  -65.699 -21.035 1.00 47.87  ? 80   PHE B CE1 1 
ATOM   4770 C CE2 . PHE B 1 79  ? 20.281  -64.296 -21.240 1.00 47.39  ? 80   PHE B CE2 1 
ATOM   4771 C CZ  . PHE B 1 79  ? 21.000  -65.263 -20.541 1.00 50.47  ? 80   PHE B CZ  1 
ATOM   4772 N N   . GLU B 1 80  ? 21.565  -66.682 -25.142 1.00 48.09  ? 81   GLU B N   1 
ATOM   4773 C CA  . GLU B 1 80  ? 20.458  -67.590 -25.387 1.00 56.43  ? 81   GLU B CA  1 
ATOM   4774 C C   . GLU B 1 80  ? 19.116  -67.063 -24.852 1.00 55.56  ? 81   GLU B C   1 
ATOM   4775 O O   . GLU B 1 80  ? 18.086  -67.139 -25.535 1.00 51.71  ? 81   GLU B O   1 
ATOM   4776 C CB  . GLU B 1 80  ? 20.755  -68.961 -24.765 1.00 56.00  ? 81   GLU B CB  1 
ATOM   4777 C CG  . GLU B 1 80  ? 20.214  -70.119 -25.607 1.00 72.27  ? 81   GLU B CG  1 
ATOM   4778 C CD  . GLU B 1 80  ? 19.229  -70.997 -24.848 1.00 81.35  ? 81   GLU B CD  1 
ATOM   4779 O OE1 . GLU B 1 80  ? 19.559  -71.418 -23.712 1.00 82.11  ? 81   GLU B OE1 1 
ATOM   4780 O OE2 . GLU B 1 80  ? 18.126  -71.266 -25.391 1.00 82.67  ? 81   GLU B OE2 1 
ATOM   4781 N N   . GLY B 1 81  ? 19.138  -66.531 -23.638 1.00 48.37  ? 82   GLY B N   1 
ATOM   4782 C CA  . GLY B 1 81  ? 17.919  -66.119 -22.959 1.00 47.99  ? 82   GLY B CA  1 
ATOM   4783 C C   . GLY B 1 81  ? 17.154  -65.032 -23.689 1.00 47.59  ? 82   GLY B C   1 
ATOM   4784 O O   . GLY B 1 81  ? 15.936  -64.912 -23.547 1.00 48.49  ? 82   GLY B O   1 
ATOM   4785 N N   . THR B 1 82  ? 17.863  -64.223 -24.466 1.00 46.30  ? 83   THR B N   1 
ATOM   4786 C CA  . THR B 1 82  ? 17.190  -63.227 -25.272 1.00 45.61  ? 83   THR B CA  1 
ATOM   4787 C C   . THR B 1 82  ? 16.972  -63.736 -26.703 1.00 47.30  ? 83   THR B C   1 
ATOM   4788 O O   . THR B 1 82  ? 15.892  -63.530 -27.257 1.00 47.81  ? 83   THR B O   1 
ATOM   4789 C CB  . THR B 1 82  ? 17.966  -61.910 -25.295 1.00 47.13  ? 83   THR B CB  1 
ATOM   4790 O OG1 . THR B 1 82  ? 19.351  -62.194 -25.437 1.00 49.05  ? 83   THR B OG1 1 
ATOM   4791 C CG2 . THR B 1 82  ? 17.771  -61.152 -23.988 1.00 49.02  ? 83   THR B CG2 1 
ATOM   4792 N N   . GLU B 1 83  ? 17.964  -64.425 -27.280 1.00 46.55  ? 84   GLU B N   1 
ATOM   4793 C CA  . GLU B 1 83  ? 17.909  -64.819 -28.707 1.00 47.58  ? 84   GLU B CA  1 
ATOM   4794 C C   . GLU B 1 83  ? 16.783  -65.816 -28.994 1.00 45.83  ? 84   GLU B C   1 
ATOM   4795 O O   . GLU B 1 83  ? 16.162  -65.784 -30.068 1.00 44.99  ? 84   GLU B O   1 
ATOM   4796 C CB  . GLU B 1 83  ? 19.251  -65.420 -29.193 1.00 45.63  ? 84   GLU B CB  1 
ATOM   4797 C CG  . GLU B 1 83  ? 20.476  -64.463 -29.221 1.00 45.81  ? 84   GLU B CG  1 
ATOM   4798 C CD  . GLU B 1 83  ? 20.248  -63.142 -29.981 1.00 54.63  ? 84   GLU B CD  1 
ATOM   4799 O OE1 . GLU B 1 83  ? 19.266  -63.029 -30.759 1.00 58.01  ? 84   GLU B OE1 1 
ATOM   4800 O OE2 . GLU B 1 83  ? 21.072  -62.205 -29.809 1.00 55.72  ? 84   GLU B OE2 1 
ATOM   4801 N N   . MET B 1 84  ? 16.500  -66.688 -28.029 1.00 40.98  ? 85   MET B N   1 
ATOM   4802 C CA  . MET B 1 84  ? 15.397  -67.629 -28.183 1.00 42.87  ? 85   MET B CA  1 
ATOM   4803 C C   . MET B 1 84  ? 14.058  -66.958 -28.539 1.00 45.78  ? 85   MET B C   1 
ATOM   4804 O O   . MET B 1 84  ? 13.157  -67.624 -29.079 1.00 48.36  ? 85   MET B O   1 
ATOM   4805 C CB  . MET B 1 84  ? 15.226  -68.454 -26.921 1.00 45.85  ? 85   MET B CB  1 
ATOM   4806 C CG  . MET B 1 84  ? 14.857  -67.645 -25.684 1.00 45.40  ? 85   MET B CG  1 
ATOM   4807 S SD  . MET B 1 84  ? 14.639  -68.809 -24.344 1.00 50.55  ? 85   MET B SD  1 
ATOM   4808 C CE  . MET B 1 84  ? 13.073  -69.560 -24.814 1.00 43.33  ? 85   MET B CE  1 
ATOM   4809 N N   . TRP B 1 85  ? 13.941  -65.651 -28.276 1.00 41.25  ? 86   TRP B N   1 
ATOM   4810 C CA  . TRP B 1 85  ? 12.698  -64.917 -28.523 1.00 41.32  ? 86   TRP B CA  1 
ATOM   4811 C C   . TRP B 1 85  ? 12.730  -64.066 -29.802 1.00 42.12  ? 86   TRP B C   1 
ATOM   4812 O O   . TRP B 1 85  ? 11.686  -63.615 -30.283 1.00 38.05  ? 86   TRP B O   1 
ATOM   4813 C CB  . TRP B 1 85  ? 12.373  -64.017 -27.323 1.00 39.74  ? 86   TRP B CB  1 
ATOM   4814 C CG  . TRP B 1 85  ? 12.267  -64.756 -25.989 1.00 46.39  ? 86   TRP B CG  1 
ATOM   4815 C CD1 . TRP B 1 85  ? 13.116  -64.653 -24.924 1.00 39.84  ? 86   TRP B CD1 1 
ATOM   4816 C CD2 . TRP B 1 85  ? 11.254  -65.692 -25.600 1.00 43.09  ? 86   TRP B CD2 1 
ATOM   4817 N NE1 . TRP B 1 85  ? 12.701  -65.462 -23.907 1.00 46.60  ? 86   TRP B NE1 1 
ATOM   4818 C CE2 . TRP B 1 85  ? 11.556  -66.107 -24.287 1.00 42.75  ? 86   TRP B CE2 1 
ATOM   4819 C CE3 . TRP B 1 85  ? 10.117  -66.213 -26.232 1.00 41.98  ? 86   TRP B CE3 1 
ATOM   4820 C CZ2 . TRP B 1 85  ? 10.775  -67.032 -23.593 1.00 41.75  ? 86   TRP B CZ2 1 
ATOM   4821 C CZ3 . TRP B 1 85  ? 9.331   -67.126 -25.539 1.00 47.44  ? 86   TRP B CZ3 1 
ATOM   4822 C CH2 . TRP B 1 85  ? 9.666   -67.528 -24.232 1.00 40.52  ? 86   TRP B CH2 1 
ATOM   4823 N N   . ASN B 1 86  ? 13.927  -63.830 -30.330 1.00 41.48  ? 87   ASN B N   1 
ATOM   4824 C CA  . ASN B 1 86  ? 14.113  -63.037 -31.551 1.00 41.38  ? 87   ASN B CA  1 
ATOM   4825 C C   . ASN B 1 86  ? 13.696  -63.768 -32.828 1.00 40.56  ? 87   ASN B C   1 
ATOM   4826 O O   . ASN B 1 86  ? 13.674  -64.993 -32.854 1.00 40.46  ? 87   ASN B O   1 
ATOM   4827 C CB  . ASN B 1 86  ? 15.579  -62.607 -31.676 1.00 46.69  ? 87   ASN B CB  1 
ATOM   4828 C CG  . ASN B 1 86  ? 15.916  -61.414 -30.793 1.00 47.68  ? 87   ASN B CG  1 
ATOM   4829 O OD1 . ASN B 1 86  ? 15.060  -60.581 -30.497 1.00 52.58  ? 87   ASN B OD1 1 
ATOM   4830 N ND2 . ASN B 1 86  ? 17.169  -61.328 -30.378 1.00 46.40  ? 87   ASN B ND2 1 
ATOM   4831 N N   . PRO B 1 87  ? 13.359  -63.012 -33.893 1.00 42.66  ? 88   PRO B N   1 
ATOM   4832 C CA  . PRO B 1 87  ? 12.922  -63.626 -35.159 1.00 39.82  ? 88   PRO B CA  1 
ATOM   4833 C C   . PRO B 1 87  ? 13.908  -64.656 -35.682 1.00 40.70  ? 88   PRO B C   1 
ATOM   4834 O O   . PRO B 1 87  ? 15.113  -64.414 -35.684 1.00 42.92  ? 88   PRO B O   1 
ATOM   4835 C CB  . PRO B 1 87  ? 12.841  -62.437 -36.119 1.00 35.98  ? 88   PRO B CB  1 
ATOM   4836 C CG  . PRO B 1 87  ? 12.561  -61.280 -35.253 1.00 39.85  ? 88   PRO B CG  1 
ATOM   4837 C CD  . PRO B 1 87  ? 13.309  -61.540 -33.957 1.00 32.24  ? 88   PRO B CD  1 
ATOM   4838 N N   . ASN B 1 88  ? 13.403  -65.799 -36.115 1.00 44.39  ? 89   ASN B N   1 
ATOM   4839 C CA  . ASN B 1 88  ? 14.254  -66.824 -36.710 1.00 44.55  ? 89   ASN B CA  1 
ATOM   4840 C C   . ASN B 1 88  ? 13.876  -67.085 -38.159 1.00 42.88  ? 89   ASN B C   1 
ATOM   4841 O O   . ASN B 1 88  ? 14.175  -68.151 -38.723 1.00 48.25  ? 89   ASN B O   1 
ATOM   4842 C CB  . ASN B 1 88  ? 14.167  -68.108 -35.891 1.00 43.99  ? 89   ASN B CB  1 
ATOM   4843 C CG  . ASN B 1 88  ? 12.772  -68.702 -35.901 1.00 44.24  ? 89   ASN B CG  1 
ATOM   4844 O OD1 . ASN B 1 88  ? 11.787  -68.030 -36.238 1.00 43.36  ? 89   ASN B OD1 1 
ATOM   4845 N ND2 . ASN B 1 88  ? 12.678  -69.968 -35.526 1.00 49.14  ? 89   ASN B ND2 1 
ATOM   4846 N N   . ARG B 1 89  ? 13.181  -66.114 -38.745 1.00 41.70  ? 90   ARG B N   1 
ATOM   4847 C CA  . ARG B 1 89  ? 12.946  -66.053 -40.196 1.00 43.70  ? 90   ARG B CA  1 
ATOM   4848 C C   . ARG B 1 89  ? 13.170  -64.610 -40.585 1.00 44.57  ? 90   ARG B C   1 
ATOM   4849 O O   . ARG B 1 89  ? 13.238  -63.754 -39.704 1.00 43.57  ? 90   ARG B O   1 
ATOM   4850 C CB  . ARG B 1 89  ? 11.527  -66.472 -40.584 1.00 44.81  ? 90   ARG B CB  1 
ATOM   4851 C CG  . ARG B 1 89  ? 11.269  -67.942 -40.590 1.00 46.85  ? 90   ARG B CG  1 
ATOM   4852 C CD  . ARG B 1 89  ? 12.088  -68.633 -41.661 1.00 45.51  ? 90   ARG B CD  1 
ATOM   4853 N NE  . ARG B 1 89  ? 11.703  -70.029 -41.756 1.00 44.82  ? 90   ARG B NE  1 
ATOM   4854 C CZ  . ARG B 1 89  ? 12.142  -70.961 -40.929 1.00 44.79  ? 90   ARG B CZ  1 
ATOM   4855 N NH1 . ARG B 1 89  ? 13.000  -70.630 -39.982 1.00 44.01  ? 90   ARG B NH1 1 
ATOM   4856 N NH2 . ARG B 1 89  ? 11.729  -72.217 -41.057 1.00 54.41  ? 90   ARG B NH2 1 
ATOM   4857 N N   . GLU B 1 90  ? 13.284  -64.328 -41.883 1.00 48.55  ? 91   GLU B N   1 
ATOM   4858 C CA  . GLU B 1 90  ? 13.449  -62.948 -42.324 1.00 50.75  ? 91   GLU B CA  1 
ATOM   4859 C C   . GLU B 1 90  ? 12.202  -62.144 -41.924 1.00 45.84  ? 91   GLU B C   1 
ATOM   4860 O O   . GLU B 1 90  ? 11.108  -62.704 -41.821 1.00 42.31  ? 91   GLU B O   1 
ATOM   4861 C CB  . GLU B 1 90  ? 13.691  -62.873 -43.839 1.00 45.41  ? 91   GLU B CB  1 
ATOM   4862 C CG  . GLU B 1 90  ? 12.452  -62.531 -44.632 1.00 51.94  ? 91   GLU B CG  1 
ATOM   4863 C CD  . GLU B 1 90  ? 12.649  -62.591 -46.137 1.00 69.14  ? 91   GLU B CD  1 
ATOM   4864 O OE1 . GLU B 1 90  ? 13.559  -63.331 -46.605 1.00 77.10  ? 91   GLU B OE1 1 
ATOM   4865 O OE2 . GLU B 1 90  ? 11.879  -61.898 -46.850 1.00 60.78  ? 91   GLU B OE2 1 
ATOM   4866 N N   . LEU B 1 91  ? 12.388  -60.849 -41.668 1.00 41.71  ? 92   LEU B N   1 
ATOM   4867 C CA  . LEU B 1 91  ? 11.274  -59.928 -41.461 1.00 43.98  ? 92   LEU B CA  1 
ATOM   4868 C C   . LEU B 1 91  ? 10.580  -59.537 -42.774 1.00 45.98  ? 92   LEU B C   1 
ATOM   4869 O O   . LEU B 1 91  ? 11.226  -59.223 -43.760 1.00 46.16  ? 92   LEU B O   1 
ATOM   4870 C CB  . LEU B 1 91  ? 11.753  -58.663 -40.762 1.00 40.42  ? 92   LEU B CB  1 
ATOM   4871 C CG  . LEU B 1 91  ? 12.517  -58.839 -39.459 1.00 49.49  ? 92   LEU B CG  1 
ATOM   4872 C CD1 . LEU B 1 91  ? 12.921  -57.476 -38.921 1.00 45.83  ? 92   LEU B CD1 1 
ATOM   4873 C CD2 . LEU B 1 91  ? 11.642  -59.598 -38.470 1.00 38.71  ? 92   LEU B CD2 1 
ATOM   4874 N N   . SER B 1 92  ? 9.257   -59.520 -42.758 1.00 46.11  ? 93   SER B N   1 
ATOM   4875 C CA  . SER B 1 92  ? 8.486   -59.092 -43.905 1.00 44.72  ? 93   SER B CA  1 
ATOM   4876 C C   . SER B 1 92  ? 7.095   -58.624 -43.465 1.00 44.76  ? 93   SER B C   1 
ATOM   4877 O O   . SER B 1 92  ? 6.568   -59.107 -42.462 1.00 42.07  ? 93   SER B O   1 
ATOM   4878 C CB  . SER B 1 92  ? 8.368   -60.232 -44.912 1.00 40.34  ? 93   SER B CB  1 
ATOM   4879 O OG  . SER B 1 92  ? 7.468   -59.876 -45.939 1.00 37.76  ? 93   SER B OG  1 
ATOM   4880 N N   . GLU B 1 93  ? 6.493   -57.698 -44.214 1.00 44.76  ? 94   GLU B N   1 
ATOM   4881 C CA  . GLU B 1 93  ? 5.085   -57.356 -44.000 1.00 41.04  ? 94   GLU B CA  1 
ATOM   4882 C C   . GLU B 1 93  ? 4.187   -58.432 -44.589 1.00 41.65  ? 94   GLU B C   1 
ATOM   4883 O O   . GLU B 1 93  ? 2.994   -58.501 -44.294 1.00 38.58  ? 94   GLU B O   1 
ATOM   4884 C CB  . GLU B 1 93  ? 4.741   -56.018 -44.621 1.00 42.84  ? 94   GLU B CB  1 
ATOM   4885 C CG  . GLU B 1 93  ? 5.245   -54.825 -43.855 1.00 43.44  ? 94   GLU B CG  1 
ATOM   4886 C CD  . GLU B 1 93  ? 4.715   -53.535 -44.443 1.00 48.88  ? 94   GLU B CD  1 
ATOM   4887 O OE1 . GLU B 1 93  ? 3.628   -53.086 -44.019 1.00 44.90  ? 94   GLU B OE1 1 
ATOM   4888 O OE2 . GLU B 1 93  ? 5.381   -52.981 -45.348 1.00 50.33  ? 94   GLU B OE2 1 
ATOM   4889 N N   . ASP B 1 94  ? 4.777   -59.256 -45.443 1.00 38.15  ? 95   ASP B N   1 
ATOM   4890 C CA  . ASP B 1 94  ? 4.116   -60.441 -45.976 1.00 43.31  ? 95   ASP B CA  1 
ATOM   4891 C C   . ASP B 1 94  ? 4.289   -61.606 -44.971 1.00 40.90  ? 95   ASP B C   1 
ATOM   4892 O O   . ASP B 1 94  ? 5.195   -62.431 -45.111 1.00 36.51  ? 95   ASP B O   1 
ATOM   4893 C CB  . ASP B 1 94  ? 4.703   -60.769 -47.355 1.00 41.39  ? 95   ASP B CB  1 
ATOM   4894 C CG  . ASP B 1 94  ? 4.087   -62.006 -47.994 1.00 43.74  ? 95   ASP B CG  1 
ATOM   4895 O OD1 . ASP B 1 94  ? 3.109   -62.557 -47.458 1.00 42.82  ? 95   ASP B OD1 1 
ATOM   4896 O OD2 . ASP B 1 94  ? 4.582   -62.419 -49.062 1.00 53.43  ? 95   ASP B OD2 1 
ATOM   4897 N N   . CYS B 1 95  ? 3.424   -61.669 -43.955 1.00 42.27  ? 96   CYS B N   1 
ATOM   4898 C CA  . CYS B 1 95  ? 3.668   -62.581 -42.817 1.00 36.25  ? 96   CYS B CA  1 
ATOM   4899 C C   . CYS B 1 95  ? 2.436   -63.277 -42.305 1.00 34.94  ? 96   CYS B C   1 
ATOM   4900 O O   . CYS B 1 95  ? 2.474   -63.962 -41.271 1.00 38.98  ? 96   CYS B O   1 
ATOM   4901 C CB  . CYS B 1 95  ? 4.307   -61.822 -41.665 1.00 32.28  ? 96   CYS B CB  1 
ATOM   4902 S SG  . CYS B 1 95  ? 3.244   -60.528 -40.957 1.00 38.89  ? 96   CYS B SG  1 
ATOM   4903 N N   . LEU B 1 96  ? 1.332   -63.113 -43.014 1.00 34.13  ? 97   LEU B N   1 
ATOM   4904 C CA  . LEU B 1 96  ? 0.088   -63.646 -42.489 1.00 33.22  ? 97   LEU B CA  1 
ATOM   4905 C C   . LEU B 1 96  ? -0.145  -65.091 -42.938 1.00 37.56  ? 97   LEU B C   1 
ATOM   4906 O O   . LEU B 1 96  ? -0.993  -65.369 -43.795 1.00 33.70  ? 97   LEU B O   1 
ATOM   4907 C CB  . LEU B 1 96  ? -1.074  -62.731 -42.876 1.00 33.66  ? 97   LEU B CB  1 
ATOM   4908 C CG  . LEU B 1 96  ? -1.128  -61.393 -42.115 1.00 35.51  ? 97   LEU B CG  1 
ATOM   4909 C CD1 . LEU B 1 96  ? -2.449  -60.687 -42.346 1.00 41.04  ? 97   LEU B CD1 1 
ATOM   4910 C CD2 . LEU B 1 96  ? -0.939  -61.570 -40.595 1.00 36.21  ? 97   LEU B CD2 1 
ATOM   4911 N N   . TYR B 1 97  ? 0.595   -65.999 -42.297 1.00 36.64  ? 98   TYR B N   1 
ATOM   4912 C CA  . TYR B 1 97  ? 0.535   -67.439 -42.543 1.00 33.11  ? 98   TYR B CA  1 
ATOM   4913 C C   . TYR B 1 97  ? 0.265   -68.175 -41.227 1.00 39.72  ? 98   TYR B C   1 
ATOM   4914 O O   . TYR B 1 97  ? 0.632   -67.673 -40.170 1.00 37.44  ? 98   TYR B O   1 
ATOM   4915 C CB  . TYR B 1 97  ? 1.852   -67.931 -43.170 1.00 34.99  ? 98   TYR B CB  1 
ATOM   4916 C CG  . TYR B 1 97  ? 2.173   -67.209 -44.466 1.00 38.98  ? 98   TYR B CG  1 
ATOM   4917 C CD1 . TYR B 1 97  ? 2.743   -65.940 -44.450 1.00 37.90  ? 98   TYR B CD1 1 
ATOM   4918 C CD2 . TYR B 1 97  ? 1.854   -67.775 -45.707 1.00 40.39  ? 98   TYR B CD2 1 
ATOM   4919 C CE1 . TYR B 1 97  ? 3.003   -65.257 -45.610 1.00 40.13  ? 98   TYR B CE1 1 
ATOM   4920 C CE2 . TYR B 1 97  ? 2.126   -67.095 -46.902 1.00 37.13  ? 98   TYR B CE2 1 
ATOM   4921 C CZ  . TYR B 1 97  ? 2.702   -65.837 -46.841 1.00 43.90  ? 98   TYR B CZ  1 
ATOM   4922 O OH  . TYR B 1 97  ? 2.964   -65.126 -47.993 1.00 39.69  ? 98   TYR B OH  1 
ATOM   4923 N N   . LEU B 1 98  ? -0.359  -69.356 -41.280 1.00 34.02  ? 99   LEU B N   1 
ATOM   4924 C CA  . LEU B 1 98  ? -0.508  -70.168 -40.080 1.00 38.09  ? 99   LEU B CA  1 
ATOM   4925 C C   . LEU B 1 98  ? 0.037   -71.585 -40.272 1.00 37.72  ? 99   LEU B C   1 
ATOM   4926 O O   . LEU B 1 98  ? 0.445   -71.977 -41.371 1.00 40.59  ? 99   LEU B O   1 
ATOM   4927 C CB  . LEU B 1 98  ? -1.987  -70.210 -39.623 1.00 34.68  ? 99   LEU B CB  1 
ATOM   4928 C CG  . LEU B 1 98  ? -3.059  -70.632 -40.635 1.00 33.91  ? 99   LEU B CG  1 
ATOM   4929 C CD1 . LEU B 1 98  ? -3.108  -72.141 -40.829 1.00 30.68  ? 99   LEU B CD1 1 
ATOM   4930 C CD2 . LEU B 1 98  ? -4.432  -70.079 -40.301 1.00 32.01  ? 99   LEU B CD2 1 
ATOM   4931 N N   . ASN B 1 99  ? 0.036   -72.345 -39.185 1.00 34.92  ? 100  ASN B N   1 
ATOM   4932 C CA  . ASN B 1 99  ? 0.665   -73.653 -39.162 1.00 38.39  ? 100  ASN B CA  1 
ATOM   4933 C C   . ASN B 1 99  ? -0.289  -74.666 -38.574 1.00 35.80  ? 100  ASN B C   1 
ATOM   4934 O O   . ASN B 1 99  ? -1.057  -74.338 -37.688 1.00 38.17  ? 100  ASN B O   1 
ATOM   4935 C CB  . ASN B 1 99  ? 1.973   -73.604 -38.370 1.00 33.26  ? 100  ASN B CB  1 
ATOM   4936 C CG  . ASN B 1 99  ? 2.826   -72.392 -38.747 1.00 39.61  ? 100  ASN B CG  1 
ATOM   4937 O OD1 . ASN B 1 99  ? 3.294   -72.290 -39.874 1.00 44.96  ? 100  ASN B OD1 1 
ATOM   4938 N ND2 . ASN B 1 99  ? 2.991   -71.456 -37.823 1.00 37.87  ? 100  ASN B ND2 1 
ATOM   4939 N N   . VAL B 1 100 ? -0.278  -75.877 -39.114 1.00 37.31  ? 101  VAL B N   1 
ATOM   4940 C CA  . VAL B 1 100 ? -1.114  -76.956 -38.602 1.00 36.37  ? 101  VAL B CA  1 
ATOM   4941 C C   . VAL B 1 100 ? -0.239  -78.168 -38.426 1.00 43.79  ? 101  VAL B C   1 
ATOM   4942 O O   . VAL B 1 100 ? 0.439   -78.591 -39.371 1.00 43.15  ? 101  VAL B O   1 
ATOM   4943 C CB  . VAL B 1 100 ? -2.290  -77.323 -39.544 1.00 36.91  ? 101  VAL B CB  1 
ATOM   4944 C CG1 . VAL B 1 100 ? -3.041  -78.549 -39.016 1.00 36.64  ? 101  VAL B CG1 1 
ATOM   4945 C CG2 . VAL B 1 100 ? -3.240  -76.154 -39.720 1.00 35.22  ? 101  VAL B CG2 1 
ATOM   4946 N N   . TRP B 1 101 ? -0.225  -78.708 -37.213 1.00 39.53  ? 102  TRP B N   1 
ATOM   4947 C CA  . TRP B 1 101 ? 0.379   -80.004 -36.981 1.00 41.48  ? 102  TRP B CA  1 
ATOM   4948 C C   . TRP B 1 101 ? -0.721  -81.011 -36.684 1.00 46.17  ? 102  TRP B C   1 
ATOM   4949 O O   . TRP B 1 101 ? -1.697  -80.681 -35.999 1.00 44.23  ? 102  TRP B O   1 
ATOM   4950 C CB  . TRP B 1 101 ? 1.344   -79.974 -35.826 1.00 41.96  ? 102  TRP B CB  1 
ATOM   4951 C CG  . TRP B 1 101 ? 2.595   -79.186 -35.968 1.00 39.91  ? 102  TRP B CG  1 
ATOM   4952 C CD1 . TRP B 1 101 ? 3.825   -79.671 -36.285 1.00 39.20  ? 102  TRP B CD1 1 
ATOM   4953 C CD2 . TRP B 1 101 ? 2.768   -77.786 -35.699 1.00 39.40  ? 102  TRP B CD2 1 
ATOM   4954 N NE1 . TRP B 1 101 ? 4.760   -78.659 -36.239 1.00 44.25  ? 102  TRP B NE1 1 
ATOM   4955 C CE2 . TRP B 1 101 ? 4.135   -77.493 -35.880 1.00 39.96  ? 102  TRP B CE2 1 
ATOM   4956 C CE3 . TRP B 1 101 ? 1.901   -76.754 -35.318 1.00 38.52  ? 102  TRP B CE3 1 
ATOM   4957 C CZ2 . TRP B 1 101 ? 4.657   -76.209 -35.699 1.00 37.13  ? 102  TRP B CZ2 1 
ATOM   4958 C CZ3 . TRP B 1 101 ? 2.422   -75.481 -35.136 1.00 34.40  ? 102  TRP B CZ3 1 
ATOM   4959 C CH2 . TRP B 1 101 ? 3.786   -75.222 -35.322 1.00 33.13  ? 102  TRP B CH2 1 
ATOM   4960 N N   . THR B 1 102 ? -0.569  -82.233 -37.190 1.00 45.17  ? 103  THR B N   1 
ATOM   4961 C CA  . THR B 1 102 ? -1.592  -83.251 -37.001 1.00 40.03  ? 103  THR B CA  1 
ATOM   4962 C C   . THR B 1 102 ? -0.911  -84.620 -36.870 1.00 44.03  ? 103  THR B C   1 
ATOM   4963 O O   . THR B 1 102 ? 0.249   -84.774 -37.263 1.00 46.14  ? 103  THR B O   1 
ATOM   4964 C CB  . THR B 1 102 ? -2.632  -83.199 -38.143 1.00 45.75  ? 103  THR B CB  1 
ATOM   4965 O OG1 . THR B 1 102 ? -3.792  -83.963 -37.788 1.00 54.13  ? 103  THR B OG1 1 
ATOM   4966 C CG2 . THR B 1 102 ? -2.059  -83.716 -39.456 1.00 46.63  ? 103  THR B CG2 1 
ATOM   4967 N N   . PRO B 1 103 ? -1.580  -85.592 -36.229 1.00 47.81  ? 104  PRO B N   1 
ATOM   4968 C CA  . PRO B 1 103 ? -0.933  -86.914 -36.111 1.00 51.42  ? 104  PRO B CA  1 
ATOM   4969 C C   . PRO B 1 103 ? -0.755  -87.643 -37.456 1.00 53.12  ? 104  PRO B C   1 
ATOM   4970 O O   . PRO B 1 103 ? -1.486  -87.380 -38.420 1.00 53.54  ? 104  PRO B O   1 
ATOM   4971 C CB  . PRO B 1 103 ? -1.888  -87.693 -35.194 1.00 54.45  ? 104  PRO B CB  1 
ATOM   4972 C CG  . PRO B 1 103 ? -2.594  -86.637 -34.392 1.00 48.78  ? 104  PRO B CG  1 
ATOM   4973 C CD  . PRO B 1 103 ? -2.738  -85.452 -35.321 1.00 48.34  ? 104  PRO B CD  1 
ATOM   4974 N N   . TYR B 1 104 ? 0.224   -88.544 -37.512 1.00 56.48  ? 105  TYR B N   1 
ATOM   4975 C CA  . TYR B 1 104 ? 0.514   -89.349 -38.712 1.00 63.74  ? 105  TYR B CA  1 
ATOM   4976 C C   . TYR B 1 104 ? 0.363   -90.837 -38.402 1.00 67.10  ? 105  TYR B C   1 
ATOM   4977 O O   . TYR B 1 104 ? 1.167   -91.398 -37.667 1.00 70.52  ? 105  TYR B O   1 
ATOM   4978 C CB  . TYR B 1 104 ? 1.931   -89.066 -39.216 1.00 62.57  ? 105  TYR B CB  1 
ATOM   4979 C CG  . TYR B 1 104 ? 2.297   -89.608 -40.588 1.00 67.64  ? 105  TYR B CG  1 
ATOM   4980 C CD1 . TYR B 1 104 ? 2.472   -90.976 -40.805 1.00 74.29  ? 105  TYR B CD1 1 
ATOM   4981 C CD2 . TYR B 1 104 ? 2.538   -88.739 -41.655 1.00 73.94  ? 105  TYR B CD2 1 
ATOM   4982 C CE1 . TYR B 1 104 ? 2.838   -91.468 -42.059 1.00 72.09  ? 105  TYR B CE1 1 
ATOM   4983 C CE2 . TYR B 1 104 ? 2.902   -89.218 -42.919 1.00 72.44  ? 105  TYR B CE2 1 
ATOM   4984 C CZ  . TYR B 1 104 ? 3.053   -90.581 -43.113 1.00 78.27  ? 105  TYR B CZ  1 
ATOM   4985 O OH  . TYR B 1 104 ? 3.412   -91.052 -44.360 1.00 78.42  ? 105  TYR B OH  1 
ATOM   4986 N N   . PRO B 1 105 ? -0.643  -91.491 -38.991 1.00 63.95  ? 106  PRO B N   1 
ATOM   4987 C CA  . PRO B 1 105 ? -1.552  -90.944 -39.999 1.00 72.85  ? 106  PRO B CA  1 
ATOM   4988 C C   . PRO B 1 105 ? -2.669  -90.068 -39.435 1.00 65.40  ? 106  PRO B C   1 
ATOM   4989 O O   . PRO B 1 105 ? -3.021  -90.166 -38.260 1.00 66.44  ? 106  PRO B O   1 
ATOM   4990 C CB  . PRO B 1 105 ? -2.139  -92.203 -40.654 1.00 73.15  ? 106  PRO B CB  1 
ATOM   4991 C CG  . PRO B 1 105 ? -2.088  -93.228 -39.591 1.00 66.56  ? 106  PRO B CG  1 
ATOM   4992 C CD  . PRO B 1 105 ? -0.870  -92.929 -38.761 1.00 68.63  ? 106  PRO B CD  1 
ATOM   4993 N N   . ARG B 1 106 ? -3.205  -89.227 -40.314 1.00 67.81  ? 107  ARG B N   1 
ATOM   4994 C CA  . ARG B 1 106 ? -4.293  -88.304 -40.019 1.00 65.42  ? 107  ARG B CA  1 
ATOM   4995 C C   . ARG B 1 106 ? -5.417  -88.981 -39.247 1.00 66.47  ? 107  ARG B C   1 
ATOM   4996 O O   . ARG B 1 106 ? -5.812  -90.096 -39.581 1.00 69.64  ? 107  ARG B O   1 
ATOM   4997 C CB  . ARG B 1 106 ? -4.816  -87.712 -41.328 1.00 58.20  ? 107  ARG B CB  1 
ATOM   4998 C CG  . ARG B 1 106 ? -5.575  -86.429 -41.185 1.00 59.75  ? 107  ARG B CG  1 
ATOM   4999 C CD  . ARG B 1 106 ? -5.969  -85.872 -42.549 1.00 60.85  ? 107  ARG B CD  1 
ATOM   5000 N NE  . ARG B 1 106 ? -4.828  -85.794 -43.465 1.00 68.87  ? 107  ARG B NE  1 
ATOM   5001 C CZ  . ARG B 1 106 ? -4.939  -85.605 -44.782 1.00 66.62  ? 107  ARG B CZ  1 
ATOM   5002 N NH1 . ARG B 1 106 ? -6.141  -85.465 -45.338 1.00 57.42  ? 107  ARG B NH1 1 
ATOM   5003 N NH2 . ARG B 1 106 ? -3.850  -85.556 -45.546 1.00 57.57  ? 107  ARG B NH2 1 
ATOM   5004 N N   . PRO B 1 107 ? -5.907  -88.324 -38.178 1.00 74.58  ? 108  PRO B N   1 
ATOM   5005 C CA  . PRO B 1 107 ? -6.961  -88.874 -37.314 1.00 68.71  ? 108  PRO B CA  1 
ATOM   5006 C C   . PRO B 1 107 ? -8.138  -89.440 -38.093 1.00 67.36  ? 108  PRO B C   1 
ATOM   5007 O O   . PRO B 1 107 ? -8.545  -88.859 -39.102 1.00 66.97  ? 108  PRO B O   1 
ATOM   5008 C CB  . PRO B 1 107 ? -7.399  -87.662 -36.490 1.00 63.63  ? 108  PRO B CB  1 
ATOM   5009 C CG  . PRO B 1 107 ? -6.144  -86.855 -36.357 1.00 63.34  ? 108  PRO B CG  1 
ATOM   5010 C CD  . PRO B 1 107 ? -5.388  -87.043 -37.658 1.00 64.60  ? 108  PRO B CD  1 
ATOM   5011 N N   . THR B 1 108 ? -8.673  -90.564 -37.626 1.00 67.00  ? 109  THR B N   1 
ATOM   5012 C CA  . THR B 1 108 ? -9.840  -91.167 -38.257 1.00 71.81  ? 109  THR B CA  1 
ATOM   5013 C C   . THR B 1 108 ? -11.120 -90.428 -37.872 1.00 69.95  ? 109  THR B C   1 
ATOM   5014 O O   . THR B 1 108 ? -11.978 -90.166 -38.718 1.00 69.07  ? 109  THR B O   1 
ATOM   5015 C CB  . THR B 1 108 ? -9.960  -92.646 -37.877 1.00 75.57  ? 109  THR B CB  1 
ATOM   5016 O OG1 . THR B 1 108 ? -9.876  -92.775 -36.453 1.00 76.32  ? 109  THR B OG1 1 
ATOM   5017 C CG2 . THR B 1 108 ? -8.820  -93.441 -38.513 1.00 71.74  ? 109  THR B CG2 1 
ATOM   5018 N N   . SER B 1 109 ? -11.216 -90.068 -36.594 1.00 66.33  ? 110  SER B N   1 
ATOM   5019 C CA  . SER B 1 109 ? -12.372 -89.369 -36.036 1.00 63.26  ? 110  SER B CA  1 
ATOM   5020 C C   . SER B 1 109 ? -11.969 -87.974 -35.553 1.00 64.91  ? 110  SER B C   1 
ATOM   5021 O O   . SER B 1 109 ? -10.807 -87.771 -35.201 1.00 66.25  ? 110  SER B O   1 
ATOM   5022 C CB  . SER B 1 109 ? -12.946 -90.194 -34.888 1.00 66.23  ? 110  SER B CB  1 
ATOM   5023 O OG  . SER B 1 109 ? -11.887 -90.797 -34.170 1.00 59.35  ? 110  SER B OG  1 
ATOM   5024 N N   . PRO B 1 110 ? -12.920 -87.013 -35.521 1.00 63.31  ? 111  PRO B N   1 
ATOM   5025 C CA  . PRO B 1 110 ? -12.602 -85.614 -35.182 1.00 63.84  ? 111  PRO B CA  1 
ATOM   5026 C C   . PRO B 1 110 ? -11.852 -85.449 -33.852 1.00 64.03  ? 111  PRO B C   1 
ATOM   5027 O O   . PRO B 1 110 ? -12.211 -86.037 -32.827 1.00 66.38  ? 111  PRO B O   1 
ATOM   5028 C CB  . PRO B 1 110 ? -13.983 -84.942 -35.117 1.00 63.61  ? 111  PRO B CB  1 
ATOM   5029 C CG  . PRO B 1 110 ? -14.842 -85.761 -36.015 1.00 60.88  ? 111  PRO B CG  1 
ATOM   5030 C CD  . PRO B 1 110 ? -14.360 -87.185 -35.792 1.00 67.05  ? 111  PRO B CD  1 
ATOM   5031 N N   . THR B 1 111 ? -10.801 -84.636 -33.901 1.00 62.10  ? 112  THR B N   1 
ATOM   5032 C CA  . THR B 1 111 ? -9.816  -84.521 -32.839 1.00 61.91  ? 112  THR B CA  1 
ATOM   5033 C C   . THR B 1 111 ? -9.815  -83.090 -32.297 1.00 55.79  ? 112  THR B C   1 
ATOM   5034 O O   . THR B 1 111 ? -9.988  -82.137 -33.062 1.00 52.71  ? 112  THR B O   1 
ATOM   5035 C CB  . THR B 1 111 ? -8.411  -84.913 -33.356 1.00 57.57  ? 112  THR B CB  1 
ATOM   5036 O OG1 . THR B 1 111 ? -8.450  -86.254 -33.846 1.00 67.35  ? 112  THR B OG1 1 
ATOM   5037 C CG2 . THR B 1 111 ? -7.390  -84.859 -32.260 1.00 50.19  ? 112  THR B CG2 1 
ATOM   5038 N N   . PRO B 1 112 ? -9.672  -82.939 -30.970 1.00 56.04  ? 113  PRO B N   1 
ATOM   5039 C CA  . PRO B 1 112 ? -9.652  -81.606 -30.367 1.00 52.44  ? 113  PRO B CA  1 
ATOM   5040 C C   . PRO B 1 112 ? -8.503  -80.746 -30.882 1.00 46.67  ? 113  PRO B C   1 
ATOM   5041 O O   . PRO B 1 112 ? -7.385  -81.251 -31.100 1.00 43.33  ? 113  PRO B O   1 
ATOM   5042 C CB  . PRO B 1 112 ? -9.489  -81.911 -28.879 1.00 49.14  ? 113  PRO B CB  1 
ATOM   5043 C CG  . PRO B 1 112 ? -10.167 -83.213 -28.717 1.00 54.75  ? 113  PRO B CG  1 
ATOM   5044 C CD  . PRO B 1 112 ? -9.782  -83.986 -29.937 1.00 57.87  ? 113  PRO B CD  1 
ATOM   5045 N N   . VAL B 1 113 ? -8.785  -79.458 -31.064 1.00 41.61  ? 114  VAL B N   1 
ATOM   5046 C CA  . VAL B 1 113 ? -7.780  -78.527 -31.574 1.00 44.89  ? 114  VAL B CA  1 
ATOM   5047 C C   . VAL B 1 113 ? -7.265  -77.559 -30.499 1.00 44.77  ? 114  VAL B C   1 
ATOM   5048 O O   . VAL B 1 113 ? -8.039  -76.908 -29.784 1.00 44.13  ? 114  VAL B O   1 
ATOM   5049 C CB  . VAL B 1 113 ? -8.334  -77.725 -32.770 1.00 46.53  ? 114  VAL B CB  1 
ATOM   5050 C CG1 . VAL B 1 113 ? -7.250  -76.843 -33.391 1.00 38.04  ? 114  VAL B CG1 1 
ATOM   5051 C CG2 . VAL B 1 113 ? -8.881  -78.687 -33.821 1.00 39.12  ? 114  VAL B CG2 1 
ATOM   5052 N N   . LEU B 1 114 ? -5.945  -77.501 -30.367 1.00 42.50  ? 115  LEU B N   1 
ATOM   5053 C CA  . LEU B 1 114 ? -5.291  -76.432 -29.612 1.00 45.04  ? 115  LEU B CA  1 
ATOM   5054 C C   . LEU B 1 114 ? -4.763  -75.361 -30.582 1.00 40.22  ? 115  LEU B C   1 
ATOM   5055 O O   . LEU B 1 114 ? -4.016  -75.686 -31.505 1.00 39.58  ? 115  LEU B O   1 
ATOM   5056 C CB  . LEU B 1 114 ? -4.151  -76.994 -28.765 1.00 36.45  ? 115  LEU B CB  1 
ATOM   5057 C CG  . LEU B 1 114 ? -4.510  -77.707 -27.477 1.00 40.78  ? 115  LEU B CG  1 
ATOM   5058 C CD1 . LEU B 1 114 ? -3.317  -78.513 -27.001 1.00 45.08  ? 115  LEU B CD1 1 
ATOM   5059 C CD2 . LEU B 1 114 ? -4.836  -76.662 -26.457 1.00 34.71  ? 115  LEU B CD2 1 
ATOM   5060 N N   . VAL B 1 115 ? -5.142  -74.102 -30.361 1.00 41.27  ? 116  VAL B N   1 
ATOM   5061 C CA  . VAL B 1 115 ? -4.663  -72.961 -31.157 1.00 35.08  ? 116  VAL B CA  1 
ATOM   5062 C C   . VAL B 1 115 ? -3.765  -72.022 -30.327 1.00 41.19  ? 116  VAL B C   1 
ATOM   5063 O O   . VAL B 1 115 ? -4.178  -71.519 -29.263 1.00 39.48  ? 116  VAL B O   1 
ATOM   5064 C CB  . VAL B 1 115 ? -5.843  -72.172 -31.729 1.00 37.40  ? 116  VAL B CB  1 
ATOM   5065 C CG1 . VAL B 1 115 ? -5.368  -70.971 -32.566 1.00 36.46  ? 116  VAL B CG1 1 
ATOM   5066 C CG2 . VAL B 1 115 ? -6.717  -73.094 -32.548 1.00 32.56  ? 116  VAL B CG2 1 
ATOM   5067 N N   . TRP B 1 116 ? -2.536  -71.797 -30.797 1.00 32.15  ? 117  TRP B N   1 
ATOM   5068 C CA  . TRP B 1 116 ? -1.540  -71.092 -29.987 1.00 39.21  ? 117  TRP B CA  1 
ATOM   5069 C C   . TRP B 1 116 ? -1.359  -69.659 -30.409 1.00 38.57  ? 117  TRP B C   1 
ATOM   5070 O O   . TRP B 1 116 ? -1.197  -69.404 -31.582 1.00 42.71  ? 117  TRP B O   1 
ATOM   5071 C CB  . TRP B 1 116 ? -0.187  -71.800 -30.047 1.00 38.72  ? 117  TRP B CB  1 
ATOM   5072 C CG  . TRP B 1 116 ? 0.937   -70.987 -29.438 1.00 38.01  ? 117  TRP B CG  1 
ATOM   5073 C CD1 . TRP B 1 116 ? 1.938   -70.308 -30.113 1.00 39.24  ? 117  TRP B CD1 1 
ATOM   5074 C CD2 . TRP B 1 116 ? 1.176   -70.762 -28.043 1.00 35.47  ? 117  TRP B CD2 1 
ATOM   5075 N NE1 . TRP B 1 116 ? 2.777   -69.683 -29.211 1.00 38.12  ? 117  TRP B NE1 1 
ATOM   5076 C CE2 . TRP B 1 116 ? 2.333   -69.951 -27.940 1.00 36.61  ? 117  TRP B CE2 1 
ATOM   5077 C CE3 . TRP B 1 116 ? 0.524   -71.172 -26.863 1.00 32.70  ? 117  TRP B CE3 1 
ATOM   5078 C CZ2 . TRP B 1 116 ? 2.847   -69.542 -26.705 1.00 36.69  ? 117  TRP B CZ2 1 
ATOM   5079 C CZ3 . TRP B 1 116 ? 1.030   -70.772 -25.659 1.00 35.37  ? 117  TRP B CZ3 1 
ATOM   5080 C CH2 . TRP B 1 116 ? 2.177   -69.959 -25.581 1.00 38.25  ? 117  TRP B CH2 1 
ATOM   5081 N N   . ILE B 1 117 ? -1.346  -68.726 -29.451 1.00 38.04  ? 118  ILE B N   1 
ATOM   5082 C CA  . ILE B 1 117 ? -1.141  -67.319 -29.779 1.00 40.50  ? 118  ILE B CA  1 
ATOM   5083 C C   . ILE B 1 117 ? 0.066   -66.785 -29.035 1.00 38.19  ? 118  ILE B C   1 
ATOM   5084 O O   . ILE B 1 117 ? 0.004   -66.632 -27.832 1.00 38.86  ? 118  ILE B O   1 
ATOM   5085 C CB  . ILE B 1 117 ? -2.370  -66.444 -29.429 1.00 40.30  ? 118  ILE B CB  1 
ATOM   5086 C CG1 . ILE B 1 117 ? -3.602  -66.888 -30.209 1.00 37.79  ? 118  ILE B CG1 1 
ATOM   5087 C CG2 . ILE B 1 117 ? -2.116  -64.987 -29.769 1.00 33.34  ? 118  ILE B CG2 1 
ATOM   5088 C CD1 . ILE B 1 117 ? -4.787  -66.063 -29.855 1.00 33.07  ? 118  ILE B CD1 1 
ATOM   5089 N N   . TYR B 1 118 ? 1.159   -66.480 -29.744 1.00 39.32  ? 119  TYR B N   1 
ATOM   5090 C CA  . TYR B 1 118 ? 2.387   -66.068 -29.072 1.00 31.85  ? 119  TYR B CA  1 
ATOM   5091 C C   . TYR B 1 118 ? 2.277   -64.710 -28.419 1.00 34.89  ? 119  TYR B C   1 
ATOM   5092 O O   . TYR B 1 118 ? 1.420   -63.897 -28.773 1.00 36.28  ? 119  TYR B O   1 
ATOM   5093 C CB  . TYR B 1 118 ? 3.569   -66.035 -30.029 1.00 37.88  ? 119  TYR B CB  1 
ATOM   5094 C CG  . TYR B 1 118 ? 3.395   -65.146 -31.251 1.00 33.39  ? 119  TYR B CG  1 
ATOM   5095 C CD1 . TYR B 1 118 ? 3.472   -63.746 -31.171 1.00 30.71  ? 119  TYR B CD1 1 
ATOM   5096 C CD2 . TYR B 1 118 ? 3.206   -65.721 -32.514 1.00 36.05  ? 119  TYR B CD2 1 
ATOM   5097 C CE1 . TYR B 1 118 ? 3.322   -62.949 -32.339 1.00 31.00  ? 119  TYR B CE1 1 
ATOM   5098 C CE2 . TYR B 1 118 ? 3.060   -64.939 -33.668 1.00 31.97  ? 119  TYR B CE2 1 
ATOM   5099 C CZ  . TYR B 1 118 ? 3.121   -63.564 -33.580 1.00 35.03  ? 119  TYR B CZ  1 
ATOM   5100 O OH  . TYR B 1 118 ? 2.976   -62.831 -34.761 1.00 31.71  ? 119  TYR B OH  1 
ATOM   5101 N N   . GLY B 1 119 ? 3.192   -64.466 -27.489 1.00 34.27  ? 120  GLY B N   1 
ATOM   5102 C CA  . GLY B 1 119 ? 3.284   -63.187 -26.825 1.00 38.71  ? 120  GLY B CA  1 
ATOM   5103 C C   . GLY B 1 119 ? 4.469   -62.421 -27.367 1.00 40.93  ? 120  GLY B C   1 
ATOM   5104 O O   . GLY B 1 119 ? 5.069   -62.813 -28.376 1.00 39.05  ? 120  GLY B O   1 
ATOM   5105 N N   . GLY B 1 120 ? 4.826   -61.335 -26.691 1.00 39.22  ? 121  GLY B N   1 
ATOM   5106 C CA  . GLY B 1 120 ? 5.841   -60.449 -27.215 1.00 35.28  ? 121  GLY B CA  1 
ATOM   5107 C C   . GLY B 1 120 ? 5.430   -58.996 -27.104 1.00 38.97  ? 121  GLY B C   1 
ATOM   5108 O O   . GLY B 1 120 ? 5.870   -58.185 -27.909 1.00 37.91  ? 121  GLY B O   1 
ATOM   5109 N N   . GLY B 1 121 ? 4.612   -58.667 -26.096 1.00 38.48  ? 122  GLY B N   1 
ATOM   5110 C CA  . GLY B 1 121 ? 4.217   -57.291 -25.828 1.00 35.42  ? 122  GLY B CA  1 
ATOM   5111 C C   . GLY B 1 121 ? 3.441   -56.577 -26.927 1.00 38.41  ? 122  GLY B C   1 
ATOM   5112 O O   . GLY B 1 121 ? 3.355   -55.343 -26.931 1.00 36.69  ? 122  GLY B O   1 
ATOM   5113 N N   . PHE B 1 122 ? 2.885   -57.360 -27.859 1.00 33.39  ? 123  PHE B N   1 
ATOM   5114 C CA  . PHE B 1 122 ? 2.204   -56.855 -29.049 1.00 37.11  ? 123  PHE B CA  1 
ATOM   5115 C C   . PHE B 1 122 ? 3.158   -56.123 -29.990 1.00 35.74  ? 123  PHE B C   1 
ATOM   5116 O O   . PHE B 1 122 ? 2.721   -55.565 -30.995 1.00 37.86  ? 123  PHE B O   1 
ATOM   5117 C CB  . PHE B 1 122 ? 1.033   -55.928 -28.680 1.00 38.28  ? 123  PHE B CB  1 
ATOM   5118 C CG  . PHE B 1 122 ? -0.132  -56.634 -28.045 1.00 33.03  ? 123  PHE B CG  1 
ATOM   5119 C CD1 . PHE B 1 122 ? -0.926  -57.492 -28.781 1.00 33.81  ? 123  PHE B CD1 1 
ATOM   5120 C CD2 . PHE B 1 122 ? -0.453  -56.405 -26.711 1.00 36.06  ? 123  PHE B CD2 1 
ATOM   5121 C CE1 . PHE B 1 122 ? -2.007  -58.153 -28.192 1.00 35.21  ? 123  PHE B CE1 1 
ATOM   5122 C CE2 . PHE B 1 122 ? -1.553  -57.032 -26.119 1.00 33.63  ? 123  PHE B CE2 1 
ATOM   5123 C CZ  . PHE B 1 122 ? -2.322  -57.917 -26.853 1.00 34.69  ? 123  PHE B CZ  1 
ATOM   5124 N N   . TYR B 1 123 ? 4.457   -56.131 -29.689 1.00 36.48  ? 124  TYR B N   1 
ATOM   5125 C CA  . TYR B 1 123 ? 5.427   -55.508 -30.601 1.00 42.57  ? 124  TYR B CA  1 
ATOM   5126 C C   . TYR B 1 123 ? 6.385   -56.532 -31.243 1.00 37.62  ? 124  TYR B C   1 
ATOM   5127 O O   . TYR B 1 123 ? 7.205   -56.168 -32.077 1.00 35.39  ? 124  TYR B O   1 
ATOM   5128 C CB  . TYR B 1 123 ? 6.250   -54.431 -29.874 1.00 41.10  ? 124  TYR B CB  1 
ATOM   5129 C CG  . TYR B 1 123 ? 7.189   -55.003 -28.821 1.00 43.39  ? 124  TYR B CG  1 
ATOM   5130 C CD1 . TYR B 1 123 ? 8.431   -55.539 -29.168 1.00 42.17  ? 124  TYR B CD1 1 
ATOM   5131 C CD2 . TYR B 1 123 ? 6.846   -54.975 -27.490 1.00 45.92  ? 124  TYR B CD2 1 
ATOM   5132 C CE1 . TYR B 1 123 ? 9.282   -56.052 -28.221 1.00 44.25  ? 124  TYR B CE1 1 
ATOM   5133 C CE2 . TYR B 1 123 ? 7.692   -55.492 -26.524 1.00 49.97  ? 124  TYR B CE2 1 
ATOM   5134 C CZ  . TYR B 1 123 ? 8.904   -56.030 -26.900 1.00 47.04  ? 124  TYR B CZ  1 
ATOM   5135 O OH  . TYR B 1 123 ? 9.728   -56.534 -25.932 1.00 54.47  ? 124  TYR B OH  1 
ATOM   5136 N N   . SER B 1 124 ? 6.306   -57.791 -30.818 1.00 35.83  ? 125  SER B N   1 
ATOM   5137 C CA  . SER B 1 124 ? 7.229   -58.816 -31.304 1.00 38.22  ? 125  SER B CA  1 
ATOM   5138 C C   . SER B 1 124 ? 6.640   -60.211 -31.181 1.00 37.50  ? 125  SER B C   1 
ATOM   5139 O O   . SER B 1 124 ? 5.554   -60.387 -30.611 1.00 33.45  ? 125  SER B O   1 
ATOM   5140 C CB  . SER B 1 124 ? 8.546   -58.776 -30.522 1.00 38.74  ? 125  SER B CB  1 
ATOM   5141 O OG  . SER B 1 124 ? 8.310   -58.994 -29.143 1.00 37.25  ? 125  SER B OG  1 
ATOM   5142 N N   . GLY B 1 125 ? 7.379   -61.191 -31.697 1.00 32.82  ? 126  GLY B N   1 
ATOM   5143 C CA  . GLY B 1 125 ? 7.040   -62.592 -31.542 1.00 33.22  ? 126  GLY B CA  1 
ATOM   5144 C C   . GLY B 1 125 ? 6.740   -63.266 -32.877 1.00 35.12  ? 126  GLY B C   1 
ATOM   5145 O O   . GLY B 1 125 ? 6.555   -62.591 -33.902 1.00 34.06  ? 126  GLY B O   1 
ATOM   5146 N N   . ALA B 1 126 ? 6.689   -64.594 -32.883 1.00 29.52  ? 127  ALA B N   1 
ATOM   5147 C CA  . ALA B 1 126 ? 6.434   -65.320 -34.144 1.00 39.44  ? 127  ALA B CA  1 
ATOM   5148 C C   . ALA B 1 126 ? 6.059   -66.740 -33.841 1.00 38.57  ? 127  ALA B C   1 
ATOM   5149 O O   . ALA B 1 126 ? 6.518   -67.295 -32.833 1.00 34.82  ? 127  ALA B O   1 
ATOM   5150 C CB  . ALA B 1 126 ? 7.653   -65.290 -35.066 1.00 29.91  ? 127  ALA B CB  1 
ATOM   5151 N N   . SER B 1 127 ? 5.269   -67.354 -34.720 1.00 33.11  ? 128  SER B N   1 
ATOM   5152 C CA  . SER B 1 127 ? 4.867   -68.735 -34.478 1.00 37.95  ? 128  SER B CA  1 
ATOM   5153 C C   . SER B 1 127 ? 5.981   -69.726 -34.817 1.00 42.85  ? 128  SER B C   1 
ATOM   5154 O O   . SER B 1 127 ? 5.861   -70.923 -34.523 1.00 38.89  ? 128  SER B O   1 
ATOM   5155 C CB  . SER B 1 127 ? 3.610   -69.087 -35.268 1.00 40.51  ? 128  SER B CB  1 
ATOM   5156 O OG  . SER B 1 127 ? 3.836   -68.963 -36.654 1.00 38.66  ? 128  SER B OG  1 
ATOM   5157 N N   . SER B 1 128 ? 7.062   -69.230 -35.422 1.00 38.64  ? 129  SER B N   1 
ATOM   5158 C CA  . SER B 1 128 ? 8.144   -70.098 -35.881 1.00 38.19  ? 129  SER B CA  1 
ATOM   5159 C C   . SER B 1 128 ? 9.240   -70.317 -34.828 1.00 38.89  ? 129  SER B C   1 
ATOM   5160 O O   . SER B 1 128 ? 10.151  -71.112 -35.047 1.00 36.24  ? 129  SER B O   1 
ATOM   5161 C CB  . SER B 1 128 ? 8.763   -69.525 -37.155 1.00 33.71  ? 129  SER B CB  1 
ATOM   5162 O OG  . SER B 1 128 ? 9.232   -68.219 -36.899 1.00 38.09  ? 129  SER B OG  1 
ATOM   5163 N N   . LEU B 1 129 ? 9.168   -69.628 -33.689 1.00 35.70  ? 130  LEU B N   1 
ATOM   5164 C CA  . LEU B 1 129 ? 10.173  -69.845 -32.649 1.00 38.97  ? 130  LEU B CA  1 
ATOM   5165 C C   . LEU B 1 129 ? 10.287  -71.330 -32.277 1.00 40.05  ? 130  LEU B C   1 
ATOM   5166 O O   . LEU B 1 129 ? 9.285   -72.016 -32.187 1.00 39.68  ? 130  LEU B O   1 
ATOM   5167 C CB  . LEU B 1 129 ? 9.843   -69.029 -31.404 1.00 40.71  ? 130  LEU B CB  1 
ATOM   5168 C CG  . LEU B 1 129 ? 9.810   -67.515 -31.606 1.00 41.43  ? 130  LEU B CG  1 
ATOM   5169 C CD1 . LEU B 1 129 ? 9.773   -66.839 -30.256 1.00 39.22  ? 130  LEU B CD1 1 
ATOM   5170 C CD2 . LEU B 1 129 ? 11.006  -67.042 -32.467 1.00 41.61  ? 130  LEU B CD2 1 
ATOM   5171 N N   . ASP B 1 130 ? 11.509  -71.818 -32.089 1.00 43.07  ? 131  ASP B N   1 
ATOM   5172 C CA  . ASP B 1 130 ? 11.752  -73.208 -31.685 1.00 41.21  ? 131  ASP B CA  1 
ATOM   5173 C C   . ASP B 1 130 ? 10.921  -73.619 -30.471 1.00 43.87  ? 131  ASP B C   1 
ATOM   5174 O O   . ASP B 1 130 ? 10.385  -74.723 -30.400 1.00 44.89  ? 131  ASP B O   1 
ATOM   5175 C CB  . ASP B 1 130 ? 13.231  -73.425 -31.351 1.00 45.41  ? 131  ASP B CB  1 
ATOM   5176 C CG  . ASP B 1 130 ? 14.142  -73.271 -32.555 1.00 50.58  ? 131  ASP B CG  1 
ATOM   5177 O OD1 . ASP B 1 130 ? 13.647  -73.194 -33.698 1.00 48.41  ? 131  ASP B OD1 1 
ATOM   5178 O OD2 . ASP B 1 130 ? 15.373  -73.226 -32.347 1.00 58.14  ? 131  ASP B OD2 1 
ATOM   5179 N N   . VAL B 1 131 ? 10.804  -72.718 -29.514 1.00 37.34  ? 132  VAL B N   1 
ATOM   5180 C CA  . VAL B 1 131 ? 10.099  -73.055 -28.297 1.00 46.35  ? 132  VAL B CA  1 
ATOM   5181 C C   . VAL B 1 131 ? 8.578   -73.245 -28.514 1.00 41.00  ? 132  VAL B C   1 
ATOM   5182 O O   . VAL B 1 131 ? 7.891   -73.739 -27.620 1.00 46.55  ? 132  VAL B O   1 
ATOM   5183 C CB  . VAL B 1 131 ? 10.401  -71.979 -27.203 1.00 46.73  ? 132  VAL B CB  1 
ATOM   5184 C CG1 . VAL B 1 131 ? 9.654   -70.669 -27.474 1.00 45.60  ? 132  VAL B CG1 1 
ATOM   5185 C CG2 . VAL B 1 131 ? 10.092  -72.510 -25.873 1.00 48.85  ? 132  VAL B CG2 1 
ATOM   5186 N N   . TYR B 1 132 ? 8.055   -72.888 -29.692 1.00 43.81  ? 133  TYR B N   1 
ATOM   5187 C CA  . TYR B 1 132 ? 6.621   -73.094 -30.013 1.00 41.50  ? 133  TYR B CA  1 
ATOM   5188 C C   . TYR B 1 132 ? 6.428   -74.265 -30.978 1.00 40.13  ? 133  TYR B C   1 
ATOM   5189 O O   . TYR B 1 132 ? 5.355   -74.425 -31.555 1.00 40.89  ? 133  TYR B O   1 
ATOM   5190 C CB  . TYR B 1 132 ? 5.978   -71.834 -30.630 1.00 38.43  ? 133  TYR B CB  1 
ATOM   5191 C CG  . TYR B 1 132 ? 6.144   -70.538 -29.849 1.00 41.81  ? 133  TYR B CG  1 
ATOM   5192 C CD1 . TYR B 1 132 ? 6.156   -70.534 -28.468 1.00 40.76  ? 133  TYR B CD1 1 
ATOM   5193 C CD2 . TYR B 1 132 ? 6.306   -69.316 -30.506 1.00 39.33  ? 133  TYR B CD2 1 
ATOM   5194 C CE1 . TYR B 1 132 ? 6.300   -69.356 -27.754 1.00 43.03  ? 133  TYR B CE1 1 
ATOM   5195 C CE2 . TYR B 1 132 ? 6.458   -68.135 -29.805 1.00 33.72  ? 133  TYR B CE2 1 
ATOM   5196 C CZ  . TYR B 1 132 ? 6.455   -68.160 -28.422 1.00 40.66  ? 133  TYR B CZ  1 
ATOM   5197 O OH  . TYR B 1 132 ? 6.601   -66.998 -27.679 1.00 36.13  ? 133  TYR B OH  1 
ATOM   5198 N N   . ASP B 1 133 ? 7.481   -75.056 -31.172 1.00 39.08  ? 134  ASP B N   1 
ATOM   5199 C CA  . ASP B 1 133 ? 7.425   -76.243 -32.023 1.00 41.39  ? 134  ASP B CA  1 
ATOM   5200 C C   . ASP B 1 133 ? 6.298   -77.166 -31.585 1.00 43.33  ? 134  ASP B C   1 
ATOM   5201 O O   . ASP B 1 133 ? 6.350   -77.752 -30.500 1.00 41.62  ? 134  ASP B O   1 
ATOM   5202 C CB  . ASP B 1 133 ? 8.771   -76.994 -31.982 1.00 43.32  ? 134  ASP B CB  1 
ATOM   5203 C CG  . ASP B 1 133 ? 8.878   -78.096 -33.045 1.00 52.92  ? 134  ASP B CG  1 
ATOM   5204 O OD1 . ASP B 1 133 ? 7.843   -78.476 -33.649 1.00 47.55  ? 134  ASP B OD1 1 
ATOM   5205 O OD2 . ASP B 1 133 ? 10.016  -78.578 -33.273 1.00 49.52  ? 134  ASP B OD2 1 
ATOM   5206 N N   . GLY B 1 134 ? 5.294   -77.326 -32.438 1.00 44.66  ? 135  GLY B N   1 
ATOM   5207 C CA  . GLY B 1 134 ? 4.136   -78.118 -32.074 1.00 40.48  ? 135  GLY B CA  1 
ATOM   5208 C C   . GLY B 1 134 ? 4.265   -79.629 -32.201 1.00 44.35  ? 135  GLY B C   1 
ATOM   5209 O O   . GLY B 1 134 ? 3.338   -80.349 -31.817 1.00 43.41  ? 135  GLY B O   1 
ATOM   5210 N N   . ARG B 1 135 ? 5.391   -80.124 -32.720 1.00 44.15  ? 136  ARG B N   1 
ATOM   5211 C CA  . ARG B 1 135 ? 5.474   -81.550 -33.074 1.00 46.28  ? 136  ARG B CA  1 
ATOM   5212 C C   . ARG B 1 135 ? 5.362   -82.490 -31.850 1.00 50.35  ? 136  ARG B C   1 
ATOM   5213 O O   . ARG B 1 135 ? 4.810   -83.589 -31.969 1.00 51.76  ? 136  ARG B O   1 
ATOM   5214 C CB  . ARG B 1 135 ? 6.768   -81.844 -33.857 1.00 43.37  ? 136  ARG B CB  1 
ATOM   5215 C CG  . ARG B 1 135 ? 8.041   -82.008 -33.013 1.00 47.87  ? 136  ARG B CG  1 
ATOM   5216 C CD  . ARG B 1 135 ? 9.257   -82.274 -33.902 1.00 48.46  ? 136  ARG B CD  1 
ATOM   5217 N NE  . ARG B 1 135 ? 9.664   -81.074 -34.641 1.00 52.64  ? 136  ARG B NE  1 
ATOM   5218 C CZ  . ARG B 1 135 ? 10.498  -81.049 -35.686 1.00 54.13  ? 136  ARG B CZ  1 
ATOM   5219 N NH1 . ARG B 1 135 ? 11.037  -82.167 -36.161 1.00 47.66  ? 136  ARG B NH1 1 
ATOM   5220 N NH2 . ARG B 1 135 ? 10.797  -79.890 -36.264 1.00 44.52  ? 136  ARG B NH2 1 
ATOM   5221 N N   . PHE B 1 136 ? 5.834   -82.055 -30.680 1.00 43.20  ? 137  PHE B N   1 
ATOM   5222 C CA  . PHE B 1 136 ? 5.827   -82.925 -29.491 1.00 49.92  ? 137  PHE B CA  1 
ATOM   5223 C C   . PHE B 1 136 ? 4.458   -83.050 -28.849 1.00 46.38  ? 137  PHE B C   1 
ATOM   5224 O O   . PHE B 1 136 ? 4.051   -84.146 -28.462 1.00 49.98  ? 137  PHE B O   1 
ATOM   5225 C CB  . PHE B 1 136 ? 6.816   -82.432 -28.454 1.00 39.27  ? 137  PHE B CB  1 
ATOM   5226 C CG  . PHE B 1 136 ? 8.177   -82.204 -29.001 1.00 39.53  ? 137  PHE B CG  1 
ATOM   5227 C CD1 . PHE B 1 136 ? 9.037   -83.264 -29.204 1.00 42.28  ? 137  PHE B CD1 1 
ATOM   5228 C CD2 . PHE B 1 136 ? 8.594   -80.934 -29.334 1.00 42.99  ? 137  PHE B CD2 1 
ATOM   5229 C CE1 . PHE B 1 136 ? 10.301  -83.063 -29.719 1.00 49.31  ? 137  PHE B CE1 1 
ATOM   5230 C CE2 . PHE B 1 136 ? 9.857   -80.723 -29.863 1.00 48.05  ? 137  PHE B CE2 1 
ATOM   5231 C CZ  . PHE B 1 136 ? 10.714  -81.792 -30.052 1.00 49.99  ? 137  PHE B CZ  1 
ATOM   5232 N N   . LEU B 1 137 ? 3.739   -81.944 -28.746 1.00 43.82  ? 138  LEU B N   1 
ATOM   5233 C CA  . LEU B 1 137 ? 2.381   -81.995 -28.208 1.00 48.32  ? 138  LEU B CA  1 
ATOM   5234 C C   . LEU B 1 137 ? 1.489   -82.904 -29.046 1.00 50.72  ? 138  LEU B C   1 
ATOM   5235 O O   . LEU B 1 137 ? 0.725   -83.716 -28.513 1.00 50.31  ? 138  LEU B O   1 
ATOM   5236 C CB  . LEU B 1 137 ? 1.776   -80.599 -28.156 1.00 44.49  ? 138  LEU B CB  1 
ATOM   5237 C CG  . LEU B 1 137 ? 1.491   -79.941 -26.829 1.00 45.58  ? 138  LEU B CG  1 
ATOM   5238 C CD1 . LEU B 1 137 ? 0.900   -78.554 -27.106 1.00 42.76  ? 138  LEU B CD1 1 
ATOM   5239 C CD2 . LEU B 1 137 ? 0.537   -80.792 -26.025 1.00 47.10  ? 138  LEU B CD2 1 
ATOM   5240 N N   . VAL B 1 138 ? 1.580   -82.751 -30.367 1.00 48.14  ? 139  VAL B N   1 
ATOM   5241 C CA  . VAL B 1 138 ? 0.724   -83.508 -31.280 1.00 47.01  ? 139  VAL B CA  1 
ATOM   5242 C C   . VAL B 1 138 ? 1.044   -84.996 -31.201 1.00 45.38  ? 139  VAL B C   1 
ATOM   5243 O O   . VAL B 1 138 ? 0.148   -85.829 -31.177 1.00 49.77  ? 139  VAL B O   1 
ATOM   5244 C CB  . VAL B 1 138 ? 0.865   -83.003 -32.733 1.00 45.91  ? 139  VAL B CB  1 
ATOM   5245 C CG1 . VAL B 1 138 ? 0.201   -83.969 -33.735 1.00 40.64  ? 139  VAL B CG1 1 
ATOM   5246 C CG2 . VAL B 1 138 ? 0.269   -81.598 -32.849 1.00 39.86  ? 139  VAL B CG2 1 
ATOM   5247 N N   . GLN B 1 139 ? 2.323   -85.328 -31.118 1.00 48.84  ? 140  GLN B N   1 
ATOM   5248 C CA  . GLN B 1 139 ? 2.723   -86.727 -31.047 1.00 51.12  ? 140  GLN B CA  1 
ATOM   5249 C C   . GLN B 1 139 ? 2.284   -87.361 -29.727 1.00 54.34  ? 140  GLN B C   1 
ATOM   5250 O O   . GLN B 1 139 ? 1.715   -88.456 -29.708 1.00 49.96  ? 140  GLN B O   1 
ATOM   5251 C CB  . GLN B 1 139 ? 4.242   -86.857 -31.217 1.00 50.81  ? 140  GLN B CB  1 
ATOM   5252 C CG  . GLN B 1 139 ? 4.711   -88.241 -31.667 1.00 58.46  ? 140  GLN B CG  1 
ATOM   5253 C CD  . GLN B 1 139 ? 4.617   -89.291 -30.569 1.00 63.16  ? 140  GLN B CD  1 
ATOM   5254 O OE1 . GLN B 1 139 ? 5.229   -89.151 -29.507 1.00 63.25  ? 140  GLN B OE1 1 
ATOM   5255 N NE2 . GLN B 1 139 ? 3.840   -90.344 -30.820 1.00 58.12  ? 140  GLN B NE2 1 
ATOM   5256 N N   . ALA B 1 140 ? 2.565   -86.668 -28.624 1.00 52.00  ? 141  ALA B N   1 
ATOM   5257 C CA  . ALA B 1 140 ? 2.297   -87.203 -27.299 1.00 52.13  ? 141  ALA B CA  1 
ATOM   5258 C C   . ALA B 1 140 ? 0.807   -87.287 -26.970 1.00 48.75  ? 141  ALA B C   1 
ATOM   5259 O O   . ALA B 1 140 ? 0.370   -88.229 -26.320 1.00 49.84  ? 141  ALA B O   1 
ATOM   5260 C CB  . ALA B 1 140 ? 3.016   -86.364 -26.238 1.00 46.44  ? 141  ALA B CB  1 
ATOM   5261 N N   . GLU B 1 141 ? 0.026   -86.309 -27.404 1.00 45.05  ? 142  GLU B N   1 
ATOM   5262 C CA  . GLU B 1 141 ? -1.340  -86.202 -26.910 1.00 46.91  ? 142  GLU B CA  1 
ATOM   5263 C C   . GLU B 1 141 ? -2.381  -86.357 -27.997 1.00 49.98  ? 142  GLU B C   1 
ATOM   5264 O O   . GLU B 1 141 ? -3.579  -86.346 -27.714 1.00 51.14  ? 142  GLU B O   1 
ATOM   5265 C CB  . GLU B 1 141 ? -1.535  -84.859 -26.198 1.00 44.93  ? 142  GLU B CB  1 
ATOM   5266 C CG  . GLU B 1 141 ? -0.836  -84.788 -24.842 1.00 47.12  ? 142  GLU B CG  1 
ATOM   5267 C CD  . GLU B 1 141 ? -1.291  -85.889 -23.893 1.00 46.66  ? 142  GLU B CD  1 
ATOM   5268 O OE1 . GLU B 1 141 ? -2.508  -86.181 -23.833 1.00 45.07  ? 142  GLU B OE1 1 
ATOM   5269 O OE2 . GLU B 1 141 ? -0.425  -86.465 -23.202 1.00 51.03  ? 142  GLU B OE2 1 
ATOM   5270 N N   . ARG B 1 142 ? -1.915  -86.485 -29.238 1.00 52.98  ? 143  ARG B N   1 
ATOM   5271 C CA  . ARG B 1 142 ? -2.791  -86.695 -30.384 1.00 52.63  ? 143  ARG B CA  1 
ATOM   5272 C C   . ARG B 1 142 ? -3.896  -85.644 -30.468 1.00 46.57  ? 143  ARG B C   1 
ATOM   5273 O O   . ARG B 1 142 ? -5.050  -85.959 -30.680 1.00 54.07  ? 143  ARG B O   1 
ATOM   5274 C CB  . ARG B 1 142 ? -3.393  -88.107 -30.343 1.00 55.46  ? 143  ARG B CB  1 
ATOM   5275 C CG  . ARG B 1 142 ? -2.366  -89.213 -30.601 1.00 61.66  ? 143  ARG B CG  1 
ATOM   5276 C CD  . ARG B 1 142 ? -3.023  -90.576 -30.844 1.00 76.77  ? 143  ARG B CD  1 
ATOM   5277 N NE  . ARG B 1 142 ? -3.895  -90.552 -32.021 1.00 82.85  ? 143  ARG B NE  1 
ATOM   5278 C CZ  . ARG B 1 142 ? -3.459  -90.619 -33.279 1.00 78.86  ? 143  ARG B CZ  1 
ATOM   5279 N NH1 . ARG B 1 142 ? -2.156  -90.726 -33.524 1.00 77.74  ? 143  ARG B NH1 1 
ATOM   5280 N NH2 . ARG B 1 142 ? -4.323  -90.571 -34.294 1.00 75.39  ? 143  ARG B NH2 1 
ATOM   5281 N N   . THR B 1 143 ? -3.534  -84.389 -30.286 1.00 50.73  ? 144  THR B N   1 
ATOM   5282 C CA  . THR B 1 143 ? -4.422  -83.282 -30.615 1.00 47.86  ? 144  THR B CA  1 
ATOM   5283 C C   . THR B 1 143 ? -3.991  -82.749 -31.968 1.00 43.42  ? 144  THR B C   1 
ATOM   5284 O O   . THR B 1 143 ? -2.978  -83.179 -32.509 1.00 43.01  ? 144  THR B O   1 
ATOM   5285 C CB  . THR B 1 143 ? -4.318  -82.168 -29.591 1.00 48.19  ? 144  THR B CB  1 
ATOM   5286 O OG1 . THR B 1 143 ? -2.927  -81.891 -29.397 1.00 50.20  ? 144  THR B OG1 1 
ATOM   5287 C CG2 . THR B 1 143 ? -4.906  -82.604 -28.254 1.00 50.51  ? 144  THR B CG2 1 
ATOM   5288 N N   . VAL B 1 144 ? -4.753  -81.811 -32.508 1.00 49.54  ? 145  VAL B N   1 
ATOM   5289 C CA  . VAL B 1 144 ? -4.305  -81.032 -33.653 1.00 41.74  ? 145  VAL B CA  1 
ATOM   5290 C C   . VAL B 1 144 ? -3.867  -79.674 -33.136 1.00 45.51  ? 145  VAL B C   1 
ATOM   5291 O O   . VAL B 1 144 ? -4.607  -79.034 -32.372 1.00 49.56  ? 145  VAL B O   1 
ATOM   5292 C CB  . VAL B 1 144 ? -5.403  -80.840 -34.719 1.00 42.32  ? 145  VAL B CB  1 
ATOM   5293 C CG1 . VAL B 1 144 ? -4.899  -79.912 -35.835 1.00 36.57  ? 145  VAL B CG1 1 
ATOM   5294 C CG2 . VAL B 1 144 ? -5.840  -82.174 -35.298 1.00 45.99  ? 145  VAL B CG2 1 
ATOM   5295 N N   . LEU B 1 145 ? -2.666  -79.241 -33.515 1.00 40.64  ? 146  LEU B N   1 
ATOM   5296 C CA  . LEU B 1 145 ? -2.182  -77.934 -33.089 1.00 39.20  ? 146  LEU B CA  1 
ATOM   5297 C C   . LEU B 1 145 ? -2.107  -76.932 -34.233 1.00 42.49  ? 146  LEU B C   1 
ATOM   5298 O O   . LEU B 1 145 ? -1.549  -77.233 -35.289 1.00 45.71  ? 146  LEU B O   1 
ATOM   5299 C CB  . LEU B 1 145 ? -0.812  -78.060 -32.447 1.00 40.19  ? 146  LEU B CB  1 
ATOM   5300 C CG  . LEU B 1 145 ? -0.403  -76.807 -31.664 1.00 46.52  ? 146  LEU B CG  1 
ATOM   5301 C CD1 . LEU B 1 145 ? -0.635  -77.014 -30.198 1.00 46.50  ? 146  LEU B CD1 1 
ATOM   5302 C CD2 . LEU B 1 145 ? 1.055   -76.518 -31.904 1.00 53.11  ? 146  LEU B CD2 1 
ATOM   5303 N N   . VAL B 1 146 ? -2.679  -75.751 -34.014 1.00 33.86  ? 147  VAL B N   1 
ATOM   5304 C CA  . VAL B 1 146 ? -2.607  -74.650 -34.954 1.00 34.06  ? 147  VAL B CA  1 
ATOM   5305 C C   . VAL B 1 146 ? -1.935  -73.435 -34.299 1.00 42.41  ? 147  VAL B C   1 
ATOM   5306 O O   . VAL B 1 146 ? -2.196  -73.131 -33.136 1.00 44.23  ? 147  VAL B O   1 
ATOM   5307 C CB  . VAL B 1 146 ? -4.016  -74.268 -35.459 1.00 40.62  ? 147  VAL B CB  1 
ATOM   5308 C CG1 . VAL B 1 146 ? -3.947  -73.161 -36.503 1.00 33.80  ? 147  VAL B CG1 1 
ATOM   5309 C CG2 . VAL B 1 146 ? -4.719  -75.486 -36.036 1.00 35.83  ? 147  VAL B CG2 1 
ATOM   5310 N N   . SER B 1 147 ? -1.057  -72.751 -35.026 1.00 43.27  ? 148  SER B N   1 
ATOM   5311 C CA  . SER B 1 147 ? -0.542  -71.442 -34.576 1.00 40.98  ? 148  SER B CA  1 
ATOM   5312 C C   . SER B 1 147 ? -0.507  -70.495 -35.768 1.00 37.53  ? 148  SER B C   1 
ATOM   5313 O O   . SER B 1 147 ? -0.367  -70.937 -36.906 1.00 43.09  ? 148  SER B O   1 
ATOM   5314 C CB  . SER B 1 147 ? 0.845   -71.554 -33.930 1.00 34.24  ? 148  SER B CB  1 
ATOM   5315 O OG  . SER B 1 147 ? 1.835   -71.973 -34.858 1.00 41.31  ? 148  SER B OG  1 
ATOM   5316 N N   . MET B 1 148 ? -0.663  -69.200 -35.508 1.00 34.31  ? 149  MET B N   1 
ATOM   5317 C CA  . MET B 1 148 ? -0.723  -68.213 -36.568 1.00 38.91  ? 149  MET B CA  1 
ATOM   5318 C C   . MET B 1 148 ? 0.250   -67.090 -36.315 1.00 40.13  ? 149  MET B C   1 
ATOM   5319 O O   . MET B 1 148 ? 0.675   -66.874 -35.190 1.00 38.63  ? 149  MET B O   1 
ATOM   5320 C CB  . MET B 1 148 ? -2.139  -67.646 -36.716 1.00 36.03  ? 149  MET B CB  1 
ATOM   5321 C CG  . MET B 1 148 ? -2.422  -66.409 -35.902 1.00 37.95  ? 149  MET B CG  1 
ATOM   5322 S SD  . MET B 1 148 ? -2.540  -66.755 -34.117 1.00 39.50  ? 149  MET B SD  1 
ATOM   5323 C CE  . MET B 1 148 ? -3.775  -68.063 -34.081 1.00 31.01  ? 149  MET B CE  1 
ATOM   5324 N N   . ASN B 1 149 ? 0.642   -66.398 -37.382 1.00 42.95  ? 150  ASN B N   1 
ATOM   5325 C CA  . ASN B 1 149 ? 1.317   -65.126 -37.225 1.00 37.23  ? 150  ASN B CA  1 
ATOM   5326 C C   . ASN B 1 149 ? 0.267   -64.030 -37.287 1.00 41.93  ? 150  ASN B C   1 
ATOM   5327 O O   . ASN B 1 149 ? -0.734  -64.167 -37.994 1.00 39.21  ? 150  ASN B O   1 
ATOM   5328 C CB  . ASN B 1 149 ? 2.375   -64.912 -38.292 1.00 35.29  ? 150  ASN B CB  1 
ATOM   5329 C CG  . ASN B 1 149 ? 3.725   -65.526 -37.937 1.00 38.78  ? 150  ASN B CG  1 
ATOM   5330 O OD1 . ASN B 1 149 ? 3.874   -66.249 -36.948 1.00 39.44  ? 150  ASN B OD1 1 
ATOM   5331 N ND2 . ASN B 1 149 ? 4.722   -65.241 -38.764 1.00 42.38  ? 150  ASN B ND2 1 
ATOM   5332 N N   . TYR B 1 150 ? 0.491   -62.949 -36.543 1.00 37.54  ? 151  TYR B N   1 
ATOM   5333 C CA  . TYR B 1 150 ? -0.375  -61.793 -36.592 1.00 32.93  ? 151  TYR B CA  1 
ATOM   5334 C C   . TYR B 1 150 ? 0.505   -60.567 -36.515 1.00 31.31  ? 151  TYR B C   1 
ATOM   5335 O O   . TYR B 1 150 ? 1.543   -60.598 -35.870 1.00 34.03  ? 151  TYR B O   1 
ATOM   5336 C CB  . TYR B 1 150 ? -1.394  -61.821 -35.433 1.00 35.15  ? 151  TYR B CB  1 
ATOM   5337 C CG  . TYR B 1 150 ? -0.781  -61.773 -34.048 1.00 31.04  ? 151  TYR B CG  1 
ATOM   5338 C CD1 . TYR B 1 150 ? -0.484  -60.555 -33.435 1.00 36.54  ? 151  TYR B CD1 1 
ATOM   5339 C CD2 . TYR B 1 150 ? -0.507  -62.938 -33.346 1.00 30.75  ? 151  TYR B CD2 1 
ATOM   5340 C CE1 . TYR B 1 150 ? 0.074   -60.495 -32.157 1.00 30.42  ? 151  TYR B CE1 1 
ATOM   5341 C CE2 . TYR B 1 150 ? 0.055   -62.893 -32.072 1.00 31.88  ? 151  TYR B CE2 1 
ATOM   5342 C CZ  . TYR B 1 150 ? 0.335   -61.666 -31.475 1.00 35.97  ? 151  TYR B CZ  1 
ATOM   5343 O OH  . TYR B 1 150 ? 0.902   -61.612 -30.209 1.00 30.27  ? 151  TYR B OH  1 
ATOM   5344 N N   . ARG B 1 151 ? 0.074   -59.469 -37.120 1.00 30.68  ? 152  ARG B N   1 
ATOM   5345 C CA  . ARG B 1 151 ? 0.907   -58.267 -37.162 1.00 29.98  ? 152  ARG B CA  1 
ATOM   5346 C C   . ARG B 1 151 ? 1.121   -57.683 -35.765 1.00 34.67  ? 152  ARG B C   1 
ATOM   5347 O O   . ARG B 1 151 ? 0.246   -57.769 -34.911 1.00 33.41  ? 152  ARG B O   1 
ATOM   5348 C CB  . ARG B 1 151 ? 0.283   -57.226 -38.099 1.00 34.65  ? 152  ARG B CB  1 
ATOM   5349 C CG  . ARG B 1 151 ? 0.382   -57.592 -39.616 1.00 31.44  ? 152  ARG B CG  1 
ATOM   5350 C CD  . ARG B 1 151 ? -0.491  -56.658 -40.457 1.00 33.41  ? 152  ARG B CD  1 
ATOM   5351 N NE  . ARG B 1 151 ? -1.876  -57.115 -40.507 1.00 36.52  ? 152  ARG B NE  1 
ATOM   5352 C CZ  . ARG B 1 151 ? -2.886  -56.406 -41.006 1.00 36.78  ? 152  ARG B CZ  1 
ATOM   5353 N NH1 . ARG B 1 151 ? -2.663  -55.195 -41.494 1.00 38.09  ? 152  ARG B NH1 1 
ATOM   5354 N NH2 . ARG B 1 151 ? -4.119  -56.910 -41.018 1.00 36.19  ? 152  ARG B NH2 1 
ATOM   5355 N N   . VAL B 1 152 ? 2.299   -57.094 -35.554 1.00 32.28  ? 153  VAL B N   1 
ATOM   5356 C CA  . VAL B 1 152 ? 2.669   -56.537 -34.281 1.00 32.70  ? 153  VAL B CA  1 
ATOM   5357 C C   . VAL B 1 152 ? 3.186   -55.113 -34.488 1.00 34.68  ? 153  VAL B C   1 
ATOM   5358 O O   . VAL B 1 152 ? 3.320   -54.665 -35.636 1.00 37.36  ? 153  VAL B O   1 
ATOM   5359 C CB  . VAL B 1 152 ? 3.736   -57.405 -33.562 1.00 32.14  ? 153  VAL B CB  1 
ATOM   5360 C CG1 . VAL B 1 152 ? 3.137   -58.700 -33.145 1.00 30.27  ? 153  VAL B CG1 1 
ATOM   5361 C CG2 . VAL B 1 152 ? 4.955   -57.649 -34.472 1.00 32.50  ? 153  VAL B CG2 1 
ATOM   5362 N N   . GLY B 1 153 ? 3.435   -54.409 -33.379 1.00 33.31  ? 154  GLY B N   1 
ATOM   5363 C CA  . GLY B 1 153 ? 3.846   -53.010 -33.395 1.00 36.63  ? 154  GLY B CA  1 
ATOM   5364 C C   . GLY B 1 153 ? 2.869   -52.122 -34.158 1.00 42.07  ? 154  GLY B C   1 
ATOM   5365 O O   . GLY B 1 153 ? 1.666   -52.380 -34.187 1.00 43.67  ? 154  GLY B O   1 
ATOM   5366 N N   . ALA B 1 154 ? 3.379   -51.087 -34.811 1.00 41.49  ? 155  ALA B N   1 
ATOM   5367 C CA  . ALA B 1 154 ? 2.511   -50.194 -35.566 1.00 40.01  ? 155  ALA B CA  1 
ATOM   5368 C C   . ALA B 1 154 ? 1.720   -50.947 -36.642 1.00 41.28  ? 155  ALA B C   1 
ATOM   5369 O O   . ALA B 1 154 ? 0.554   -50.650 -36.888 1.00 44.83  ? 155  ALA B O   1 
ATOM   5370 C CB  . ALA B 1 154 ? 3.335   -49.044 -36.184 1.00 34.14  ? 155  ALA B CB  1 
ATOM   5371 N N   . PHE B 1 155 ? 2.338   -51.940 -37.277 1.00 38.67  ? 156  PHE B N   1 
ATOM   5372 C CA  . PHE B 1 155 ? 1.650   -52.679 -38.333 1.00 36.79  ? 156  PHE B CA  1 
ATOM   5373 C C   . PHE B 1 155 ? 0.392   -53.375 -37.849 1.00 35.84  ? 156  PHE B C   1 
ATOM   5374 O O   . PHE B 1 155 ? -0.567  -53.551 -38.602 1.00 40.14  ? 156  PHE B O   1 
ATOM   5375 C CB  . PHE B 1 155 ? 2.619   -53.685 -38.956 1.00 37.76  ? 156  PHE B CB  1 
ATOM   5376 C CG  . PHE B 1 155 ? 3.925   -53.069 -39.321 1.00 42.01  ? 156  PHE B CG  1 
ATOM   5377 C CD1 . PHE B 1 155 ? 4.057   -52.357 -40.508 1.00 35.90  ? 156  PHE B CD1 1 
ATOM   5378 C CD2 . PHE B 1 155 ? 5.002   -53.131 -38.452 1.00 37.82  ? 156  PHE B CD2 1 
ATOM   5379 C CE1 . PHE B 1 155 ? 5.249   -51.759 -40.835 1.00 40.02  ? 156  PHE B CE1 1 
ATOM   5380 C CE2 . PHE B 1 155 ? 6.197   -52.521 -38.771 1.00 41.49  ? 156  PHE B CE2 1 
ATOM   5381 C CZ  . PHE B 1 155 ? 6.321   -51.834 -39.971 1.00 42.07  ? 156  PHE B CZ  1 
ATOM   5382 N N   . GLY B 1 156 ? 0.380   -53.765 -36.582 1.00 38.64  ? 157  GLY B N   1 
ATOM   5383 C CA  . GLY B 1 156 ? -0.763  -54.465 -36.044 1.00 35.57  ? 157  GLY B CA  1 
ATOM   5384 C C   . GLY B 1 156 ? -1.701  -53.574 -35.263 1.00 37.44  ? 157  GLY B C   1 
ATOM   5385 O O   . GLY B 1 156 ? -2.909  -53.869 -35.169 1.00 33.42  ? 157  GLY B O   1 
ATOM   5386 N N   . PHE B 1 157 ? -1.172  -52.482 -34.707 1.00 36.73  ? 158  PHE B N   1 
ATOM   5387 C CA  . PHE B 1 157 ? -1.932  -51.793 -33.651 1.00 39.34  ? 158  PHE B CA  1 
ATOM   5388 C C   . PHE B 1 157 ? -1.858  -50.286 -33.671 1.00 44.47  ? 158  PHE B C   1 
ATOM   5389 O O   . PHE B 1 157 ? -2.422  -49.632 -32.795 1.00 39.89  ? 158  PHE B O   1 
ATOM   5390 C CB  . PHE B 1 157 ? -1.496  -52.315 -32.274 1.00 38.35  ? 158  PHE B CB  1 
ATOM   5391 C CG  . PHE B 1 157 ? -1.791  -53.770 -32.101 1.00 37.48  ? 158  PHE B CG  1 
ATOM   5392 C CD1 . PHE B 1 157 ? -3.088  -54.200 -31.837 1.00 33.90  ? 158  PHE B CD1 1 
ATOM   5393 C CD2 . PHE B 1 157 ? -0.798  -54.714 -32.293 1.00 30.09  ? 158  PHE B CD2 1 
ATOM   5394 C CE1 . PHE B 1 157 ? -3.367  -55.551 -31.727 1.00 34.77  ? 158  PHE B CE1 1 
ATOM   5395 C CE2 . PHE B 1 157 ? -1.067  -56.066 -32.178 1.00 32.27  ? 158  PHE B CE2 1 
ATOM   5396 C CZ  . PHE B 1 157 ? -2.342  -56.492 -31.897 1.00 29.86  ? 158  PHE B CZ  1 
ATOM   5397 N N   . LEU B 1 158 ? -1.210  -49.713 -34.679 1.00 43.00  ? 159  LEU B N   1 
ATOM   5398 C CA  . LEU B 1 158 ? -1.339  -48.273 -34.816 1.00 46.87  ? 159  LEU B CA  1 
ATOM   5399 C C   . LEU B 1 158 ? -2.807  -47.977 -35.094 1.00 45.08  ? 159  LEU B C   1 
ATOM   5400 O O   . LEU B 1 158 ? -3.437  -48.640 -35.911 1.00 40.45  ? 159  LEU B O   1 
ATOM   5401 C CB  . LEU B 1 158 ? -0.438  -47.716 -35.909 1.00 38.68  ? 159  LEU B CB  1 
ATOM   5402 C CG  . LEU B 1 158 ? -0.511  -46.203 -36.080 1.00 40.09  ? 159  LEU B CG  1 
ATOM   5403 C CD1 . LEU B 1 158 ? 0.838   -45.656 -36.511 1.00 42.01  ? 159  LEU B CD1 1 
ATOM   5404 C CD2 . LEU B 1 158 ? -1.593  -45.804 -37.076 1.00 43.75  ? 159  LEU B CD2 1 
ATOM   5405 N N   . ALA B 1 159 ? -3.357  -47.005 -34.374 1.00 43.44  ? 160  ALA B N   1 
ATOM   5406 C CA  . ALA B 1 159 ? -4.771  -46.666 -34.485 1.00 42.55  ? 160  ALA B CA  1 
ATOM   5407 C C   . ALA B 1 159 ? -4.980  -45.161 -34.557 1.00 45.42  ? 160  ALA B C   1 
ATOM   5408 O O   . ALA B 1 159 ? -4.463  -44.408 -33.716 1.00 43.66  ? 160  ALA B O   1 
ATOM   5409 C CB  . ALA B 1 159 ? -5.553  -47.245 -33.293 1.00 40.61  ? 160  ALA B CB  1 
ATOM   5410 N N   . LEU B 1 160 ? -5.720  -44.720 -35.573 1.00 45.63  ? 161  LEU B N   1 
ATOM   5411 C CA  . LEU B 1 160 ? -6.326  -43.385 -35.555 1.00 45.59  ? 161  LEU B CA  1 
ATOM   5412 C C   . LEU B 1 160 ? -7.827  -43.603 -35.452 1.00 45.04  ? 161  LEU B C   1 
ATOM   5413 O O   . LEU B 1 160 ? -8.496  -43.718 -36.468 1.00 42.77  ? 161  LEU B O   1 
ATOM   5414 C CB  . LEU B 1 160 ? -5.964  -42.576 -36.797 1.00 41.76  ? 161  LEU B CB  1 
ATOM   5415 C CG  . LEU B 1 160 ? -4.469  -42.332 -37.010 1.00 42.43  ? 161  LEU B CG  1 
ATOM   5416 C CD1 . LEU B 1 160 ? -4.212  -41.938 -38.458 1.00 50.67  ? 161  LEU B CD1 1 
ATOM   5417 C CD2 . LEU B 1 160 ? -3.929  -41.265 -36.082 1.00 41.18  ? 161  LEU B CD2 1 
ATOM   5418 N N   . PRO B 1 161 ? -8.355  -43.701 -34.212 1.00 42.78  ? 162  PRO B N   1 
ATOM   5419 C CA  . PRO B 1 161 ? -9.740  -44.134 -33.983 1.00 41.41  ? 162  PRO B CA  1 
ATOM   5420 C C   . PRO B 1 161 ? -10.769 -43.382 -34.849 1.00 50.04  ? 162  PRO B C   1 
ATOM   5421 O O   . PRO B 1 161 ? -10.670 -42.158 -35.009 1.00 50.69  ? 162  PRO B O   1 
ATOM   5422 C CB  . PRO B 1 161 ? -9.943  -43.849 -32.490 1.00 52.37  ? 162  PRO B CB  1 
ATOM   5423 C CG  . PRO B 1 161 ? -8.579  -44.059 -31.904 1.00 44.42  ? 162  PRO B CG  1 
ATOM   5424 C CD  . PRO B 1 161 ? -7.610  -43.538 -32.951 1.00 39.92  ? 162  PRO B CD  1 
ATOM   5425 N N   . GLY B 1 162 ? -11.707 -44.124 -35.435 1.00 49.95  ? 163  GLY B N   1 
ATOM   5426 C CA  . GLY B 1 162 ? -12.725 -43.549 -36.302 1.00 47.75  ? 163  GLY B CA  1 
ATOM   5427 C C   . GLY B 1 162 ? -12.360 -43.530 -37.781 1.00 58.00  ? 163  GLY B C   1 
ATOM   5428 O O   . GLY B 1 162 ? -13.240 -43.539 -38.644 1.00 65.39  ? 163  GLY B O   1 
ATOM   5429 N N   . SER B 1 163 ? -11.066 -43.500 -38.082 1.00 53.55  ? 164  SER B N   1 
ATOM   5430 C CA  . SER B 1 163 ? -10.612 -43.456 -39.468 1.00 54.93  ? 164  SER B CA  1 
ATOM   5431 C C   . SER B 1 163 ? -10.817 -44.793 -40.151 1.00 54.80  ? 164  SER B C   1 
ATOM   5432 O O   . SER B 1 163 ? -10.843 -45.834 -39.497 1.00 53.72  ? 164  SER B O   1 
ATOM   5433 C CB  . SER B 1 163 ? -9.141  -43.081 -39.544 1.00 49.99  ? 164  SER B CB  1 
ATOM   5434 O OG  . SER B 1 163 ? -8.358  -44.203 -39.188 1.00 50.71  ? 164  SER B OG  1 
ATOM   5435 N N   . ARG B 1 164 ? -10.947 -44.769 -41.472 1.00 59.61  ? 165  ARG B N   1 
ATOM   5436 C CA  . ARG B 1 164 ? -11.065 -46.010 -42.244 1.00 59.73  ? 165  ARG B CA  1 
ATOM   5437 C C   . ARG B 1 164 ? -9.696  -46.614 -42.543 1.00 48.72  ? 165  ARG B C   1 
ATOM   5438 O O   . ARG B 1 164 ? -9.539  -47.831 -42.626 1.00 52.71  ? 165  ARG B O   1 
ATOM   5439 C CB  . ARG B 1 164 ? -11.816 -45.763 -43.560 1.00 66.88  ? 165  ARG B CB  1 
ATOM   5440 C CG  . ARG B 1 164 ? -13.305 -46.067 -43.485 1.00 79.80  ? 165  ARG B CG  1 
ATOM   5441 C CD  . ARG B 1 164 ? -13.568 -47.402 -42.783 1.00 81.02  ? 165  ARG B CD  1 
ATOM   5442 N NE  . ARG B 1 164 ? -14.991 -47.732 -42.761 1.00 94.83  ? 165  ARG B NE  1 
ATOM   5443 C CZ  . ARG B 1 164 ? -15.491 -48.859 -42.263 1.00 99.12  ? 165  ARG B CZ  1 
ATOM   5444 N NH1 . ARG B 1 164 ? -14.678 -49.774 -41.740 1.00 95.23  ? 165  ARG B NH1 1 
ATOM   5445 N NH2 . ARG B 1 164 ? -16.805 -49.073 -42.289 1.00 97.72  ? 165  ARG B NH2 1 
ATOM   5446 N N   . GLU B 1 165 ? -8.712  -45.744 -42.697 1.00 48.56  ? 166  GLU B N   1 
ATOM   5447 C CA  . GLU B 1 165 ? -7.399  -46.134 -43.170 1.00 46.88  ? 166  GLU B CA  1 
ATOM   5448 C C   . GLU B 1 165 ? -6.488  -46.689 -42.076 1.00 51.21  ? 166  GLU B C   1 
ATOM   5449 O O   . GLU B 1 165 ? -5.478  -47.316 -42.383 1.00 42.08  ? 166  GLU B O   1 
ATOM   5450 C CB  . GLU B 1 165 ? -6.736  -44.941 -43.847 1.00 48.23  ? 166  GLU B CB  1 
ATOM   5451 C CG  . GLU B 1 165 ? -7.614  -44.332 -44.926 1.00 62.17  ? 166  GLU B CG  1 
ATOM   5452 C CD  . GLU B 1 165 ? -8.093  -45.372 -45.948 1.00 71.47  ? 166  GLU B CD  1 
ATOM   5453 O OE1 . GLU B 1 165 ? -7.277  -46.245 -46.368 1.00 59.84  ? 166  GLU B OE1 1 
ATOM   5454 O OE2 . GLU B 1 165 ? -9.294  -45.315 -46.323 1.00 75.33  ? 166  GLU B OE2 1 
ATOM   5455 N N   . ALA B 1 166 ? -6.834  -46.466 -40.806 1.00 44.34  ? 167  ALA B N   1 
ATOM   5456 C CA  . ALA B 1 166 ? -6.088  -47.102 -39.714 1.00 47.45  ? 167  ALA B CA  1 
ATOM   5457 C C   . ALA B 1 166 ? -6.951  -47.259 -38.482 1.00 44.13  ? 167  ALA B C   1 
ATOM   5458 O O   . ALA B 1 166 ? -6.787  -46.513 -37.534 1.00 40.17  ? 167  ALA B O   1 
ATOM   5459 C CB  . ALA B 1 166 ? -4.822  -46.295 -39.375 1.00 46.65  ? 167  ALA B CB  1 
ATOM   5460 N N   . PRO B 1 167 ? -7.876  -48.229 -38.503 1.00 46.69  ? 168  PRO B N   1 
ATOM   5461 C CA  . PRO B 1 167 ? -8.889  -48.369 -37.449 1.00 40.26  ? 168  PRO B CA  1 
ATOM   5462 C C   . PRO B 1 167 ? -8.336  -48.945 -36.153 1.00 44.70  ? 168  PRO B C   1 
ATOM   5463 O O   . PRO B 1 167 ? -8.933  -48.774 -35.104 1.00 49.44  ? 168  PRO B O   1 
ATOM   5464 C CB  . PRO B 1 167 ? -9.913  -49.326 -38.075 1.00 42.43  ? 168  PRO B CB  1 
ATOM   5465 C CG  . PRO B 1 167 ? -9.130  -50.113 -39.084 1.00 35.39  ? 168  PRO B CG  1 
ATOM   5466 C CD  . PRO B 1 167 ? -8.116  -49.151 -39.628 1.00 42.12  ? 168  PRO B CD  1 
ATOM   5467 N N   . GLY B 1 168 ? -7.204  -49.623 -36.235 1.00 43.72  ? 169  GLY B N   1 
ATOM   5468 C CA  . GLY B 1 168 ? -6.594  -50.215 -35.068 1.00 40.04  ? 169  GLY B CA  1 
ATOM   5469 C C   . GLY B 1 168 ? -7.095  -51.627 -34.855 1.00 43.25  ? 169  GLY B C   1 
ATOM   5470 O O   . GLY B 1 168 ? -8.049  -52.070 -35.503 1.00 41.19  ? 169  GLY B O   1 
ATOM   5471 N N   . ASN B 1 169 ? -6.424  -52.325 -33.942 1.00 41.14  ? 170  ASN B N   1 
ATOM   5472 C CA  . ASN B 1 169 ? -6.725  -53.696 -33.600 1.00 37.35  ? 170  ASN B CA  1 
ATOM   5473 C C   . ASN B 1 169 ? -6.602  -54.685 -34.774 1.00 39.48  ? 170  ASN B C   1 
ATOM   5474 O O   . ASN B 1 169 ? -7.147  -55.796 -34.698 1.00 39.16  ? 170  ASN B O   1 
ATOM   5475 C CB  . ASN B 1 169 ? -8.136  -53.776 -32.970 1.00 37.41  ? 170  ASN B CB  1 
ATOM   5476 C CG  . ASN B 1 169 ? -8.207  -53.081 -31.594 1.00 43.78  ? 170  ASN B CG  1 
ATOM   5477 O OD1 . ASN B 1 169 ? -7.186  -52.888 -30.933 1.00 43.50  ? 170  ASN B OD1 1 
ATOM   5478 N ND2 . ASN B 1 169 ? -9.410  -52.697 -31.171 1.00 36.54  ? 170  ASN B ND2 1 
ATOM   5479 N N   . VAL B 1 170 ? -5.874  -54.341 -35.845 1.00 40.28  ? 171  VAL B N   1 
ATOM   5480 C CA  . VAL B 1 170 ? -5.885  -55.264 -36.986 1.00 35.99  ? 171  VAL B CA  1 
ATOM   5481 C C   . VAL B 1 170 ? -5.088  -56.553 -36.701 1.00 37.53  ? 171  VAL B C   1 
ATOM   5482 O O   . VAL B 1 170 ? -5.420  -57.611 -37.249 1.00 37.49  ? 171  VAL B O   1 
ATOM   5483 C CB  . VAL B 1 170 ? -5.397  -54.592 -38.308 1.00 41.90  ? 171  VAL B CB  1 
ATOM   5484 C CG1 . VAL B 1 170 ? -6.355  -53.461 -38.687 1.00 38.93  ? 171  VAL B CG1 1 
ATOM   5485 C CG2 . VAL B 1 170 ? -3.942  -54.099 -38.224 1.00 36.17  ? 171  VAL B CG2 1 
ATOM   5486 N N   . GLY B 1 171 ? -4.096  -56.494 -35.808 1.00 35.61  ? 172  GLY B N   1 
ATOM   5487 C CA  . GLY B 1 171 ? -3.394  -57.702 -35.392 1.00 28.61  ? 172  GLY B CA  1 
ATOM   5488 C C   . GLY B 1 171 ? -4.309  -58.667 -34.633 1.00 37.59  ? 172  GLY B C   1 
ATOM   5489 O O   . GLY B 1 171 ? -4.122  -59.901 -34.685 1.00 32.45  ? 172  GLY B O   1 
ATOM   5490 N N   . LEU B 1 172 ? -5.293  -58.121 -33.918 1.00 31.04  ? 173  LEU B N   1 
ATOM   5491 C CA  . LEU B 1 172 ? -6.340  -58.968 -33.323 1.00 36.30  ? 173  LEU B CA  1 
ATOM   5492 C C   . LEU B 1 172 ? -7.258  -59.551 -34.402 1.00 36.67  ? 173  LEU B C   1 
ATOM   5493 O O   . LEU B 1 172 ? -7.687  -60.716 -34.320 1.00 37.07  ? 173  LEU B O   1 
ATOM   5494 C CB  . LEU B 1 172 ? -7.170  -58.183 -32.300 1.00 35.10  ? 173  LEU B CB  1 
ATOM   5495 C CG  . LEU B 1 172 ? -6.567  -57.915 -30.904 1.00 39.87  ? 173  LEU B CG  1 
ATOM   5496 C CD1 . LEU B 1 172 ? -7.509  -57.034 -30.053 1.00 34.32  ? 173  LEU B CD1 1 
ATOM   5497 C CD2 . LEU B 1 172 ? -6.233  -59.219 -30.149 1.00 34.70  ? 173  LEU B CD2 1 
ATOM   5498 N N   . LEU B 1 173 ? -7.579  -58.743 -35.411 1.00 30.87  ? 174  LEU B N   1 
ATOM   5499 C CA  . LEU B 1 173 ? -8.385  -59.235 -36.519 1.00 37.31  ? 174  LEU B CA  1 
ATOM   5500 C C   . LEU B 1 173 ? -7.648  -60.330 -37.309 1.00 34.46  ? 174  LEU B C   1 
ATOM   5501 O O   . LEU B 1 173 ? -8.282  -61.280 -37.777 1.00 37.50  ? 174  LEU B O   1 
ATOM   5502 C CB  . LEU B 1 173 ? -8.796  -58.085 -37.453 1.00 37.53  ? 174  LEU B CB  1 
ATOM   5503 C CG  . LEU B 1 173 ? -9.790  -57.097 -36.812 1.00 41.74  ? 174  LEU B CG  1 
ATOM   5504 C CD1 . LEU B 1 173 ? -10.145 -55.951 -37.769 1.00 37.34  ? 174  LEU B CD1 1 
ATOM   5505 C CD2 . LEU B 1 173 ? -11.056 -57.795 -36.299 1.00 37.20  ? 174  LEU B CD2 1 
ATOM   5506 N N   . ASP B 1 174 ? -6.329  -60.204 -37.442 1.00 35.02  ? 175  ASP B N   1 
ATOM   5507 C CA  . ASP B 1 174 ? -5.494  -61.265 -38.043 1.00 39.36  ? 175  ASP B CA  1 
ATOM   5508 C C   . ASP B 1 174 ? -5.726  -62.584 -37.308 1.00 36.83  ? 175  ASP B C   1 
ATOM   5509 O O   . ASP B 1 174 ? -5.934  -63.640 -37.912 1.00 41.03  ? 175  ASP B O   1 
ATOM   5510 C CB  . ASP B 1 174 ? -3.992  -60.923 -37.975 1.00 33.66  ? 175  ASP B CB  1 
ATOM   5511 C CG  . ASP B 1 174 ? -3.615  -59.736 -38.830 1.00 35.28  ? 175  ASP B CG  1 
ATOM   5512 O OD1 . ASP B 1 174 ? -4.400  -59.385 -39.739 1.00 40.15  ? 175  ASP B OD1 1 
ATOM   5513 O OD2 . ASP B 1 174 ? -2.529  -59.152 -38.597 1.00 32.66  ? 175  ASP B OD2 1 
ATOM   5514 N N   . GLN B 1 175 ? -5.677  -62.504 -35.990 1.00 36.25  ? 176  GLN B N   1 
ATOM   5515 C CA  . GLN B 1 175 ? -5.923  -63.661 -35.143 1.00 39.22  ? 176  GLN B CA  1 
ATOM   5516 C C   . GLN B 1 175 ? -7.319  -64.207 -35.349 1.00 35.23  ? 176  GLN B C   1 
ATOM   5517 O O   . GLN B 1 175 ? -7.483  -65.404 -35.552 1.00 38.28  ? 176  GLN B O   1 
ATOM   5518 C CB  . GLN B 1 175 ? -5.719  -63.300 -33.693 1.00 35.24  ? 176  GLN B CB  1 
ATOM   5519 C CG  . GLN B 1 175 ? -4.294  -62.921 -33.324 1.00 36.80  ? 176  GLN B CG  1 
ATOM   5520 C CD  . GLN B 1 175 ? -4.265  -62.425 -31.890 1.00 36.25  ? 176  GLN B CD  1 
ATOM   5521 O OE1 . GLN B 1 175 ? -5.242  -62.610 -31.171 1.00 40.30  ? 176  GLN B OE1 1 
ATOM   5522 N NE2 . GLN B 1 175 ? -3.181  -61.765 -31.483 1.00 30.50  ? 176  GLN B NE2 1 
ATOM   5523 N N   . ARG B 1 176 ? -8.321  -63.329 -35.347 1.00 36.40  ? 177  ARG B N   1 
ATOM   5524 C CA  . ARG B 1 176 ? -9.692  -63.773 -35.606 1.00 35.68  ? 177  ARG B CA  1 
ATOM   5525 C C   . ARG B 1 176 ? -9.813  -64.474 -36.949 1.00 36.73  ? 177  ARG B C   1 
ATOM   5526 O O   . ARG B 1 176 ? -10.441 -65.540 -37.033 1.00 37.06  ? 177  ARG B O   1 
ATOM   5527 C CB  . ARG B 1 176 ? -10.691 -62.619 -35.567 1.00 35.36  ? 177  ARG B CB  1 
ATOM   5528 C CG  . ARG B 1 176 ? -12.128 -63.122 -35.807 1.00 45.16  ? 177  ARG B CG  1 
ATOM   5529 C CD  . ARG B 1 176 ? -13.141 -62.002 -35.752 1.00 45.82  ? 177  ARG B CD  1 
ATOM   5530 N NE  . ARG B 1 176 ? -13.287 -61.457 -34.398 1.00 50.19  ? 177  ARG B NE  1 
ATOM   5531 C CZ  . ARG B 1 176 ? -13.789 -60.252 -34.145 1.00 46.31  ? 177  ARG B CZ  1 
ATOM   5532 N NH1 . ARG B 1 176 ? -14.176 -59.479 -35.150 1.00 46.35  ? 177  ARG B NH1 1 
ATOM   5533 N NH2 . ARG B 1 176 ? -13.905 -59.825 -32.901 1.00 48.15  ? 177  ARG B NH2 1 
ATOM   5534 N N   . LEU B 1 177 ? -9.221  -63.884 -37.996 1.00 38.31  ? 178  LEU B N   1 
ATOM   5535 C CA  . LEU B 1 177 ? -9.290  -64.493 -39.330 1.00 35.59  ? 178  LEU B CA  1 
ATOM   5536 C C   . LEU B 1 177 ? -8.722  -65.905 -39.252 1.00 37.73  ? 178  LEU B C   1 
ATOM   5537 O O   . LEU B 1 177 ? -9.345  -66.858 -39.727 1.00 40.10  ? 178  LEU B O   1 
ATOM   5538 C CB  . LEU B 1 177 ? -8.551  -63.648 -40.378 1.00 39.18  ? 178  LEU B CB  1 
ATOM   5539 C CG  . LEU B 1 177 ? -8.661  -64.076 -41.849 1.00 42.30  ? 178  LEU B CG  1 
ATOM   5540 C CD1 . LEU B 1 177 ? -10.100 -64.330 -42.261 1.00 42.03  ? 178  LEU B CD1 1 
ATOM   5541 C CD2 . LEU B 1 177 ? -8.083  -63.040 -42.768 1.00 35.48  ? 178  LEU B CD2 1 
ATOM   5542 N N   . ALA B 1 178 ? -7.570  -66.055 -38.602 1.00 34.81  ? 179  ALA B N   1 
ATOM   5543 C CA  . ALA B 1 178 ? -7.021  -67.398 -38.424 1.00 35.14  ? 179  ALA B CA  1 
ATOM   5544 C C   . ALA B 1 178 ? -8.015  -68.312 -37.702 1.00 38.10  ? 179  ALA B C   1 
ATOM   5545 O O   . ALA B 1 178 ? -8.189  -69.474 -38.107 1.00 37.64  ? 179  ALA B O   1 
ATOM   5546 C CB  . ALA B 1 178 ? -5.708  -67.351 -37.680 1.00 31.58  ? 179  ALA B CB  1 
ATOM   5547 N N   . LEU B 1 179 ? -8.685  -67.806 -36.655 1.00 36.60  ? 180  LEU B N   1 
ATOM   5548 C CA  . LEU B 1 179 ? -9.672  -68.638 -35.947 1.00 40.16  ? 180  LEU B CA  1 
ATOM   5549 C C   . LEU B 1 179 ? -10.837 -69.039 -36.861 1.00 37.14  ? 180  LEU B C   1 
ATOM   5550 O O   . LEU B 1 179 ? -11.325 -70.171 -36.790 1.00 37.85  ? 180  LEU B O   1 
ATOM   5551 C CB  . LEU B 1 179 ? -10.218 -67.919 -34.697 1.00 36.80  ? 180  LEU B CB  1 
ATOM   5552 C CG  . LEU B 1 179 ? -9.187  -67.689 -33.610 1.00 29.59  ? 180  LEU B CG  1 
ATOM   5553 C CD1 . LEU B 1 179 ? -9.803  -67.009 -32.387 1.00 36.48  ? 180  LEU B CD1 1 
ATOM   5554 C CD2 . LEU B 1 179 ? -8.565  -69.035 -33.252 1.00 31.11  ? 180  LEU B CD2 1 
ATOM   5555 N N   . GLN B 1 180 ? -11.284 -68.102 -37.697 1.00 39.27  ? 181  GLN B N   1 
ATOM   5556 C CA  . GLN B 1 180 ? -12.280 -68.384 -38.744 1.00 43.21  ? 181  GLN B CA  1 
ATOM   5557 C C   . GLN B 1 180 ? -11.778 -69.427 -39.733 1.00 44.41  ? 181  GLN B C   1 
ATOM   5558 O O   . GLN B 1 180 ? -12.530 -70.314 -40.150 1.00 49.65  ? 181  GLN B O   1 
ATOM   5559 C CB  . GLN B 1 180 ? -12.671 -67.099 -39.482 1.00 41.15  ? 181  GLN B CB  1 
ATOM   5560 C CG  . GLN B 1 180 ? -13.594 -66.208 -38.649 1.00 43.36  ? 181  GLN B CG  1 
ATOM   5561 C CD  . GLN B 1 180 ? -13.694 -64.769 -39.161 1.00 55.59  ? 181  GLN B CD  1 
ATOM   5562 O OE1 . GLN B 1 180 ? -13.012 -64.375 -40.125 1.00 55.56  ? 181  GLN B OE1 1 
ATOM   5563 N NE2 . GLN B 1 180 ? -14.552 -63.975 -38.510 1.00 47.88  ? 181  GLN B NE2 1 
ATOM   5564 N N   . TRP B 1 181 ? -10.501 -69.332 -40.090 1.00 41.74  ? 182  TRP B N   1 
ATOM   5565 C CA  . TRP B 1 181 ? -9.873  -70.334 -40.944 1.00 40.56  ? 182  TRP B CA  1 
ATOM   5566 C C   . TRP B 1 181 ? -9.954  -71.736 -40.330 1.00 44.69  ? 182  TRP B C   1 
ATOM   5567 O O   . TRP B 1 181 ? -10.209 -72.718 -41.041 1.00 42.15  ? 182  TRP B O   1 
ATOM   5568 C CB  . TRP B 1 181 ? -8.414  -69.961 -41.203 1.00 38.12  ? 182  TRP B CB  1 
ATOM   5569 C CG  . TRP B 1 181 ? -7.789  -70.753 -42.279 1.00 41.54  ? 182  TRP B CG  1 
ATOM   5570 C CD1 . TRP B 1 181 ? -7.683  -70.402 -43.619 1.00 40.75  ? 182  TRP B CD1 1 
ATOM   5571 C CD2 . TRP B 1 181 ? -7.167  -72.034 -42.146 1.00 38.95  ? 182  TRP B CD2 1 
ATOM   5572 N NE1 . TRP B 1 181 ? -7.023  -71.394 -44.311 1.00 38.80  ? 182  TRP B NE1 1 
ATOM   5573 C CE2 . TRP B 1 181 ? -6.703  -72.410 -43.442 1.00 38.29  ? 182  TRP B CE2 1 
ATOM   5574 C CE3 . TRP B 1 181 ? -6.943  -72.900 -41.061 1.00 37.32  ? 182  TRP B CE3 1 
ATOM   5575 C CZ2 . TRP B 1 181 ? -6.041  -73.616 -43.677 1.00 35.45  ? 182  TRP B CZ2 1 
ATOM   5576 C CZ3 . TRP B 1 181 ? -6.289  -74.095 -41.296 1.00 39.17  ? 182  TRP B CZ3 1 
ATOM   5577 C CH2 . TRP B 1 181 ? -5.844  -74.448 -42.597 1.00 40.19  ? 182  TRP B CH2 1 
ATOM   5578 N N   . VAL B 1 182 ? -9.745  -71.821 -39.010 1.00 42.29  ? 183  VAL B N   1 
ATOM   5579 C CA  . VAL B 1 182 ? -9.757  -73.108 -38.300 1.00 39.62  ? 183  VAL B CA  1 
ATOM   5580 C C   . VAL B 1 182 ? -11.147 -73.727 -38.350 1.00 41.92  ? 183  VAL B C   1 
ATOM   5581 O O   . VAL B 1 182 ? -11.310 -74.933 -38.609 1.00 44.81  ? 183  VAL B O   1 
ATOM   5582 C CB  . VAL B 1 182 ? -9.309  -72.958 -36.820 1.00 43.13  ? 183  VAL B CB  1 
ATOM   5583 C CG1 . VAL B 1 182 ? -9.598  -74.233 -36.041 1.00 41.63  ? 183  VAL B CG1 1 
ATOM   5584 C CG2 . VAL B 1 182 ? -7.844  -72.622 -36.745 1.00 35.77  ? 183  VAL B CG2 1 
ATOM   5585 N N   . GLN B 1 183 ? -12.144 -72.884 -38.127 1.00 40.68  ? 184  GLN B N   1 
ATOM   5586 C CA  . GLN B 1 183 ? -13.528 -73.323 -38.184 1.00 49.11  ? 184  GLN B CA  1 
ATOM   5587 C C   . GLN B 1 183 ? -13.819 -73.973 -39.537 1.00 47.27  ? 184  GLN B C   1 
ATOM   5588 O O   . GLN B 1 183 ? -14.281 -75.118 -39.606 1.00 47.65  ? 184  GLN B O   1 
ATOM   5589 C CB  . GLN B 1 183 ? -14.476 -72.146 -37.940 1.00 39.40  ? 184  GLN B CB  1 
ATOM   5590 C CG  . GLN B 1 183 ? -14.703 -71.835 -36.475 1.00 48.84  ? 184  GLN B CG  1 
ATOM   5591 C CD  . GLN B 1 183 ? -15.167 -73.048 -35.707 1.00 50.83  ? 184  GLN B CD  1 
ATOM   5592 O OE1 . GLN B 1 183 ? -16.246 -73.583 -35.967 1.00 54.89  ? 184  GLN B OE1 1 
ATOM   5593 N NE2 . GLN B 1 183 ? -14.338 -73.516 -34.782 1.00 39.26  ? 184  GLN B NE2 1 
ATOM   5594 N N   . GLU B 1 184 ? -13.510 -73.249 -40.609 1.00 50.34  ? 185  GLU B N   1 
ATOM   5595 C CA  . GLU B 1 184 ? -13.838 -73.693 -41.951 1.00 47.61  ? 185  GLU B CA  1 
ATOM   5596 C C   . GLU B 1 184 ? -12.955 -74.820 -42.501 1.00 49.55  ? 185  GLU B C   1 
ATOM   5597 O O   . GLU B 1 184 ? -13.339 -75.476 -43.474 1.00 53.67  ? 185  GLU B O   1 
ATOM   5598 C CB  . GLU B 1 184 ? -13.783 -72.503 -42.897 1.00 56.62  ? 185  GLU B CB  1 
ATOM   5599 C CG  . GLU B 1 184 ? -14.697 -71.362 -42.483 1.00 59.25  ? 185  GLU B CG  1 
ATOM   5600 C CD  . GLU B 1 184 ? -14.748 -70.254 -43.529 1.00 75.00  ? 185  GLU B CD  1 
ATOM   5601 O OE1 . GLU B 1 184 ? -14.018 -70.377 -44.542 1.00 78.91  ? 185  GLU B OE1 1 
ATOM   5602 O OE2 . GLU B 1 184 ? -15.510 -69.268 -43.343 1.00 72.84  ? 185  GLU B OE2 1 
ATOM   5603 N N   . ASN B 1 185 ? -11.788 -75.065 -41.897 1.00 42.60  ? 186  ASN B N   1 
ATOM   5604 C CA  . ASN B 1 185 ? -10.819 -75.967 -42.524 1.00 38.72  ? 186  ASN B CA  1 
ATOM   5605 C C   . ASN B 1 185 ? -10.171 -77.052 -41.669 1.00 48.09  ? 186  ASN B C   1 
ATOM   5606 O O   . ASN B 1 185 ? -9.543  -77.966 -42.222 1.00 46.79  ? 186  ASN B O   1 
ATOM   5607 C CB  . ASN B 1 185 ? -9.693  -75.140 -43.156 1.00 42.89  ? 186  ASN B CB  1 
ATOM   5608 C CG  . ASN B 1 185 ? -10.171 -74.296 -44.333 1.00 49.30  ? 186  ASN B CG  1 
ATOM   5609 O OD1 . ASN B 1 185 ? -10.638 -74.833 -45.350 1.00 53.29  ? 186  ASN B OD1 1 
ATOM   5610 N ND2 . ASN B 1 185 ? -10.055 -72.977 -44.205 1.00 43.43  ? 186  ASN B ND2 1 
ATOM   5611 N N   . VAL B 1 186 ? -10.285 -76.971 -40.341 1.00 45.91  ? 187  VAL B N   1 
ATOM   5612 C CA  . VAL B 1 186 ? -9.484  -77.853 -39.500 1.00 42.31  ? 187  VAL B CA  1 
ATOM   5613 C C   . VAL B 1 186 ? -9.948  -79.296 -39.665 1.00 44.20  ? 187  VAL B C   1 
ATOM   5614 O O   . VAL B 1 186 ? -9.175  -80.238 -39.429 1.00 43.23  ? 187  VAL B O   1 
ATOM   5615 C CB  . VAL B 1 186 ? -9.531  -77.438 -37.986 1.00 43.64  ? 187  VAL B CB  1 
ATOM   5616 C CG1 . VAL B 1 186 ? -10.764 -78.005 -37.296 1.00 45.28  ? 187  VAL B CG1 1 
ATOM   5617 C CG2 . VAL B 1 186 ? -8.264  -77.875 -37.258 1.00 35.34  ? 187  VAL B CG2 1 
ATOM   5618 N N   . ALA B 1 187 ? -11.208 -79.471 -40.071 1.00 46.47  ? 188  ALA B N   1 
ATOM   5619 C CA  . ALA B 1 187 ? -11.774 -80.819 -40.212 1.00 50.43  ? 188  ALA B CA  1 
ATOM   5620 C C   . ALA B 1 187 ? -11.042 -81.576 -41.316 1.00 50.14  ? 188  ALA B C   1 
ATOM   5621 O O   . ALA B 1 187 ? -10.863 -82.796 -41.221 1.00 50.85  ? 188  ALA B O   1 
ATOM   5622 C CB  . ALA B 1 187 ? -13.271 -80.763 -40.495 1.00 45.99  ? 188  ALA B CB  1 
ATOM   5623 N N   . ALA B 1 188 ? -10.580 -80.846 -42.336 1.00 48.52  ? 189  ALA B N   1 
ATOM   5624 C CA  . ALA B 1 188 ? -9.811  -81.463 -43.426 1.00 48.98  ? 189  ALA B CA  1 
ATOM   5625 C C   . ALA B 1 188 ? -8.500  -82.038 -42.924 1.00 47.05  ? 189  ALA B C   1 
ATOM   5626 O O   . ALA B 1 188 ? -7.878  -82.823 -43.624 1.00 50.65  ? 189  ALA B O   1 
ATOM   5627 C CB  . ALA B 1 188 ? -9.546  -80.459 -44.563 1.00 40.44  ? 189  ALA B CB  1 
ATOM   5628 N N   . PHE B 1 189 ? -8.072  -81.651 -41.717 1.00 48.92  ? 190  PHE B N   1 
ATOM   5629 C CA  . PHE B 1 189 ? -6.848  -82.211 -41.133 1.00 45.96  ? 190  PHE B CA  1 
ATOM   5630 C C   . PHE B 1 189 ? -7.205  -83.250 -40.079 1.00 47.97  ? 190  PHE B C   1 
ATOM   5631 O O   . PHE B 1 189 ? -6.325  -83.838 -39.447 1.00 50.01  ? 190  PHE B O   1 
ATOM   5632 C CB  . PHE B 1 189 ? -5.954  -81.111 -40.535 1.00 45.25  ? 190  PHE B CB  1 
ATOM   5633 C CG  . PHE B 1 189 ? -5.531  -80.057 -41.540 1.00 42.89  ? 190  PHE B CG  1 
ATOM   5634 C CD1 . PHE B 1 189 ? -6.381  -79.009 -41.864 1.00 40.48  ? 190  PHE B CD1 1 
ATOM   5635 C CD2 . PHE B 1 189 ? -4.290  -80.129 -42.168 1.00 45.56  ? 190  PHE B CD2 1 
ATOM   5636 C CE1 . PHE B 1 189 ? -6.013  -78.044 -42.786 1.00 42.20  ? 190  PHE B CE1 1 
ATOM   5637 C CE2 . PHE B 1 189 ? -3.911  -79.177 -43.105 1.00 46.69  ? 190  PHE B CE2 1 
ATOM   5638 C CZ  . PHE B 1 189 ? -4.771  -78.126 -43.415 1.00 41.41  ? 190  PHE B CZ  1 
ATOM   5639 N N   . GLY B 1 190 ? -8.501  -83.495 -39.913 1.00 48.77  ? 191  GLY B N   1 
ATOM   5640 C CA  . GLY B 1 190 ? -8.966  -84.455 -38.927 1.00 51.17  ? 191  GLY B CA  1 
ATOM   5641 C C   . GLY B 1 190 ? -9.248  -83.823 -37.570 1.00 57.12  ? 191  GLY B C   1 
ATOM   5642 O O   . GLY B 1 190 ? -9.494  -84.525 -36.583 1.00 57.64  ? 191  GLY B O   1 
ATOM   5643 N N   . GLY B 1 191 ? -9.214  -82.494 -37.521 1.00 49.32  ? 192  GLY B N   1 
ATOM   5644 C CA  . GLY B 1 191 ? -9.518  -81.767 -36.303 1.00 47.52  ? 192  GLY B CA  1 
ATOM   5645 C C   . GLY B 1 191 ? -11.008 -81.519 -36.107 1.00 55.11  ? 192  GLY B C   1 
ATOM   5646 O O   . GLY B 1 191 ? -11.790 -81.570 -37.056 1.00 56.29  ? 192  GLY B O   1 
ATOM   5647 N N   . ASP B 1 192 ? -11.398 -81.239 -34.863 1.00 57.29  ? 193  ASP B N   1 
ATOM   5648 C CA  . ASP B 1 192 ? -12.789 -80.981 -34.530 1.00 48.50  ? 193  ASP B CA  1 
ATOM   5649 C C   . ASP B 1 192 ? -13.060 -79.499 -34.378 1.00 46.33  ? 193  ASP B C   1 
ATOM   5650 O O   . ASP B 1 192 ? -12.642 -78.891 -33.422 1.00 53.82  ? 193  ASP B O   1 
ATOM   5651 C CB  . ASP B 1 192 ? -13.159 -81.707 -33.241 1.00 52.70  ? 193  ASP B CB  1 
ATOM   5652 C CG  . ASP B 1 192 ? -14.646 -81.686 -32.962 1.00 54.21  ? 193  ASP B CG  1 
ATOM   5653 O OD1 . ASP B 1 192 ? -15.376 -80.819 -33.518 1.00 50.39  ? 193  ASP B OD1 1 
ATOM   5654 O OD2 . ASP B 1 192 ? -15.083 -82.553 -32.175 1.00 56.37  ? 193  ASP B OD2 1 
ATOM   5655 N N   . PRO B 1 193 ? -13.784 -78.910 -35.326 1.00 55.50  ? 194  PRO B N   1 
ATOM   5656 C CA  . PRO B 1 193 ? -14.089 -77.485 -35.158 1.00 52.97  ? 194  PRO B CA  1 
ATOM   5657 C C   . PRO B 1 193 ? -15.058 -77.190 -34.013 1.00 48.65  ? 194  PRO B C   1 
ATOM   5658 O O   . PRO B 1 193 ? -15.295 -76.016 -33.740 1.00 45.98  ? 194  PRO B O   1 
ATOM   5659 C CB  . PRO B 1 193 ? -14.722 -77.098 -36.510 1.00 46.47  ? 194  PRO B CB  1 
ATOM   5660 C CG  . PRO B 1 193 ? -15.230 -78.394 -37.074 1.00 46.21  ? 194  PRO B CG  1 
ATOM   5661 C CD  . PRO B 1 193 ? -14.251 -79.440 -36.622 1.00 47.44  ? 194  PRO B CD  1 
ATOM   5662 N N   . THR B 1 194 ? -15.638 -78.213 -33.390 1.00 46.47  ? 195  THR B N   1 
ATOM   5663 C CA  . THR B 1 194 ? -16.521 -77.973 -32.244 1.00 52.72  ? 195  THR B CA  1 
ATOM   5664 C C   . THR B 1 194 ? -15.771 -78.131 -30.921 1.00 52.87  ? 195  THR B C   1 
ATOM   5665 O O   . THR B 1 194 ? -16.377 -78.011 -29.852 1.00 59.80  ? 195  THR B O   1 
ATOM   5666 C CB  . THR B 1 194 ? -17.754 -78.924 -32.205 1.00 45.49  ? 195  THR B CB  1 
ATOM   5667 O OG1 . THR B 1 194 ? -17.312 -80.287 -32.154 1.00 53.00  ? 195  THR B OG1 1 
ATOM   5668 C CG2 . THR B 1 194 ? -18.659 -78.714 -33.405 1.00 52.27  ? 195  THR B CG2 1 
ATOM   5669 N N   . SER B 1 195 ? -14.465 -78.405 -30.994 1.00 51.56  ? 196  SER B N   1 
ATOM   5670 C CA  . SER B 1 195 ? -13.620 -78.513 -29.790 1.00 52.17  ? 196  SER B CA  1 
ATOM   5671 C C   . SER B 1 195 ? -12.287 -77.757 -29.946 1.00 47.42  ? 196  SER B C   1 
ATOM   5672 O O   . SER B 1 195 ? -11.213 -78.361 -30.081 1.00 43.10  ? 196  SER B O   1 
ATOM   5673 C CB  . SER B 1 195 ? -13.359 -79.981 -29.463 1.00 50.40  ? 196  SER B CB  1 
ATOM   5674 O OG  . SER B 1 195 ? -12.584 -80.124 -28.287 1.00 51.27  ? 196  SER B OG  1 
ATOM   5675 N N   . VAL B 1 196 ? -12.360 -76.432 -29.915 1.00 42.63  ? 197  VAL B N   1 
ATOM   5676 C CA  . VAL B 1 196 ? -11.177 -75.619 -30.108 1.00 46.71  ? 197  VAL B CA  1 
ATOM   5677 C C   . VAL B 1 196 ? -10.771 -74.822 -28.871 1.00 42.31  ? 197  VAL B C   1 
ATOM   5678 O O   . VAL B 1 196 ? -11.543 -73.997 -28.364 1.00 42.59  ? 197  VAL B O   1 
ATOM   5679 C CB  . VAL B 1 196 ? -11.374 -74.646 -31.288 1.00 44.47  ? 197  VAL B CB  1 
ATOM   5680 C CG1 . VAL B 1 196 ? -10.266 -73.605 -31.298 1.00 39.22  ? 197  VAL B CG1 1 
ATOM   5681 C CG2 . VAL B 1 196 ? -11.402 -75.426 -32.599 1.00 45.50  ? 197  VAL B CG2 1 
ATOM   5682 N N   . THR B 1 197 ? -9.540  -75.056 -28.421 1.00 43.21  ? 198  THR B N   1 
ATOM   5683 C CA  . THR B 1 197 ? -8.982  -74.436 -27.206 1.00 40.14  ? 198  THR B CA  1 
ATOM   5684 C C   . THR B 1 197 ? -7.875  -73.419 -27.536 1.00 42.71  ? 198  THR B C   1 
ATOM   5685 O O   . THR B 1 197 ? -6.846  -73.789 -28.111 1.00 42.64  ? 198  THR B O   1 
ATOM   5686 C CB  . THR B 1 197 ? -8.422  -75.514 -26.282 1.00 40.75  ? 198  THR B CB  1 
ATOM   5687 O OG1 . THR B 1 197 ? -9.459  -76.453 -25.972 1.00 44.39  ? 198  THR B OG1 1 
ATOM   5688 C CG2 . THR B 1 197 ? -7.834  -74.916 -24.947 1.00 41.14  ? 198  THR B CG2 1 
ATOM   5689 N N   . LEU B 1 198 ? -8.091  -72.141 -27.222 1.00 40.54  ? 199  LEU B N   1 
ATOM   5690 C CA  . LEU B 1 198 ? -7.038  -71.145 -27.423 1.00 38.56  ? 199  LEU B CA  1 
ATOM   5691 C C   . LEU B 1 198 ? -6.105  -71.151 -26.240 1.00 42.43  ? 199  LEU B C   1 
ATOM   5692 O O   . LEU B 1 198 ? -6.557  -71.171 -25.089 1.00 46.69  ? 199  LEU B O   1 
ATOM   5693 C CB  . LEU B 1 198 ? -7.605  -69.740 -27.587 1.00 42.17  ? 199  LEU B CB  1 
ATOM   5694 C CG  . LEU B 1 198 ? -8.698  -69.441 -28.600 1.00 41.99  ? 199  LEU B CG  1 
ATOM   5695 C CD1 . LEU B 1 198 ? -8.929  -67.937 -28.640 1.00 39.49  ? 199  LEU B CD1 1 
ATOM   5696 C CD2 . LEU B 1 198 ? -8.315  -69.945 -29.976 1.00 45.50  ? 199  LEU B CD2 1 
ATOM   5697 N N   . PHE B 1 199 ? -4.806  -71.162 -26.498 1.00 36.72  ? 200  PHE B N   1 
ATOM   5698 C CA  . PHE B 1 199 ? -3.869  -70.879 -25.432 1.00 36.86  ? 200  PHE B CA  1 
ATOM   5699 C C   . PHE B 1 199 ? -2.815  -69.908 -25.927 1.00 35.52  ? 200  PHE B C   1 
ATOM   5700 O O   . PHE B 1 199 ? -2.414  -69.939 -27.068 1.00 41.35  ? 200  PHE B O   1 
ATOM   5701 C CB  . PHE B 1 199 ? -3.250  -72.167 -24.811 1.00 35.20  ? 200  PHE B CB  1 
ATOM   5702 C CG  . PHE B 1 199 ? -2.404  -73.021 -25.746 1.00 40.75  ? 200  PHE B CG  1 
ATOM   5703 C CD1 . PHE B 1 199 ? -2.802  -73.299 -27.052 1.00 36.32  ? 200  PHE B CD1 1 
ATOM   5704 C CD2 . PHE B 1 199 ? -1.214  -73.601 -25.272 1.00 38.24  ? 200  PHE B CD2 1 
ATOM   5705 C CE1 . PHE B 1 199 ? -2.017  -74.107 -27.891 1.00 33.10  ? 200  PHE B CE1 1 
ATOM   5706 C CE2 . PHE B 1 199 ? -0.418  -74.411 -26.107 1.00 42.76  ? 200  PHE B CE2 1 
ATOM   5707 C CZ  . PHE B 1 199 ? -0.829  -74.668 -27.421 1.00 38.53  ? 200  PHE B CZ  1 
ATOM   5708 N N   . GLY B 1 200 ? -2.388  -69.020 -25.040 1.00 44.25  ? 201  GLY B N   1 
ATOM   5709 C CA  . GLY B 1 200 ? -1.335  -68.081 -25.344 1.00 40.39  ? 201  GLY B CA  1 
ATOM   5710 C C   . GLY B 1 200 ? -0.644  -67.678 -24.048 1.00 37.04  ? 201  GLY B C   1 
ATOM   5711 O O   . GLY B 1 200 ? -1.119  -67.958 -22.975 1.00 39.03  ? 201  GLY B O   1 
ATOM   5712 N N   . GLU B 1 201 ? 0.481   -67.002 -24.172 1.00 33.71  ? 202  GLU B N   1 
ATOM   5713 C CA  . GLU B 1 201 ? 1.297   -66.629 -23.057 1.00 36.39  ? 202  GLU B CA  1 
ATOM   5714 C C   . GLU B 1 201 ? 1.562   -65.128 -23.188 1.00 39.90  ? 202  GLU B C   1 
ATOM   5715 O O   . GLU B 1 201 ? 1.725   -64.629 -24.299 1.00 36.16  ? 202  GLU B O   1 
ATOM   5716 C CB  . GLU B 1 201 ? 2.585   -67.457 -23.034 1.00 38.47  ? 202  GLU B CB  1 
ATOM   5717 C CG  . GLU B 1 201 ? 3.494   -67.189 -21.843 1.00 35.04  ? 202  GLU B CG  1 
ATOM   5718 C CD  . GLU B 1 201 ? 4.470   -66.046 -22.106 1.00 42.01  ? 202  GLU B CD  1 
ATOM   5719 O OE1 . GLU B 1 201 ? 4.583   -65.583 -23.269 1.00 43.90  ? 202  GLU B OE1 1 
ATOM   5720 O OE2 . GLU B 1 201 ? 5.120   -65.586 -21.139 1.00 48.04  ? 202  GLU B OE2 1 
ATOM   5721 N N   . SER B 1 202 ? 1.546   -64.409 -22.059 1.00 40.43  ? 203  SER B N   1 
ATOM   5722 C CA  . SER B 1 202 ? 1.815   -62.969 -22.049 1.00 37.47  ? 203  SER B CA  1 
ATOM   5723 C C   . SER B 1 202 ? 0.827   -62.185 -22.931 1.00 37.67  ? 203  SER B C   1 
ATOM   5724 O O   . SER B 1 202 ? -0.388  -62.283 -22.741 1.00 30.92  ? 203  SER B O   1 
ATOM   5725 C CB  . SER B 1 202 ? 3.248   -62.706 -22.501 1.00 41.16  ? 203  SER B CB  1 
ATOM   5726 O OG  . SER B 1 202 ? 3.791   -61.539 -21.900 1.00 40.67  ? 203  SER B OG  1 
ATOM   5727 N N   . ALA B 1 203 ? 1.330   -61.402 -23.890 1.00 36.64  ? 204  ALA B N   1 
ATOM   5728 C CA  . ALA B 1 203 ? 0.409   -60.688 -24.783 1.00 35.15  ? 204  ALA B CA  1 
ATOM   5729 C C   . ALA B 1 203 ? -0.498  -61.668 -25.540 1.00 33.14  ? 204  ALA B C   1 
ATOM   5730 O O   . ALA B 1 203 ? -1.604  -61.306 -25.924 1.00 37.58  ? 204  ALA B O   1 
ATOM   5731 C CB  . ALA B 1 203 ? 1.149   -59.803 -25.731 1.00 33.47  ? 204  ALA B CB  1 
ATOM   5732 N N   . GLY B 1 204 ? -0.068  -62.916 -25.710 1.00 38.26  ? 205  GLY B N   1 
ATOM   5733 C CA  . GLY B 1 204 ? -0.935  -63.926 -26.318 1.00 35.77  ? 205  GLY B CA  1 
ATOM   5734 C C   . GLY B 1 204 ? -2.126  -64.295 -25.423 1.00 41.19  ? 205  GLY B C   1 
ATOM   5735 O O   . GLY B 1 204 ? -3.231  -64.579 -25.897 1.00 38.46  ? 205  GLY B O   1 
ATOM   5736 N N   . ALA B 1 205 ? -1.875  -64.306 -24.121 1.00 31.32  ? 206  ALA B N   1 
ATOM   5737 C CA  . ALA B 1 205 ? -2.900  -64.556 -23.108 1.00 41.54  ? 206  ALA B CA  1 
ATOM   5738 C C   . ALA B 1 205 ? -3.862  -63.381 -22.985 1.00 38.65  ? 206  ALA B C   1 
ATOM   5739 O O   . ALA B 1 205 ? -5.070  -63.574 -22.919 1.00 40.51  ? 206  ALA B O   1 
ATOM   5740 C CB  . ALA B 1 205 ? -2.248  -64.847 -21.733 1.00 30.96  ? 206  ALA B CB  1 
ATOM   5741 N N   . ALA B 1 206 ? -3.324  -62.167 -22.939 1.00 34.91  ? 207  ALA B N   1 
ATOM   5742 C CA  . ALA B 1 206 ? -4.159  -60.986 -23.098 1.00 35.88  ? 207  ALA B CA  1 
ATOM   5743 C C   . ALA B 1 206 ? -5.010  -61.098 -24.385 1.00 38.92  ? 207  ALA B C   1 
ATOM   5744 O O   . ALA B 1 206 ? -6.212  -60.797 -24.367 1.00 38.37  ? 207  ALA B O   1 
ATOM   5745 C CB  . ALA B 1 206 ? -3.292  -59.725 -23.122 1.00 32.85  ? 207  ALA B CB  1 
ATOM   5746 N N   . SER B 1 207 ? -4.412  -61.543 -25.493 1.00 34.63  ? 208  SER B N   1 
ATOM   5747 C CA  . SER B 1 207 ? -5.165  -61.675 -26.767 1.00 34.43  ? 208  SER B CA  1 
ATOM   5748 C C   . SER B 1 207 ? -6.290  -62.710 -26.666 1.00 32.69  ? 208  SER B C   1 
ATOM   5749 O O   . SER B 1 207 ? -7.409  -62.456 -27.079 1.00 34.21  ? 208  SER B O   1 
ATOM   5750 C CB  . SER B 1 207 ? -4.234  -62.059 -27.932 1.00 36.64  ? 208  SER B CB  1 
ATOM   5751 O OG  . SER B 1 207 ? -3.298  -61.033 -28.198 1.00 35.76  ? 208  SER B OG  1 
ATOM   5752 N N   . VAL B 1 208 ? -5.977  -63.881 -26.131 1.00 33.96  ? 209  VAL B N   1 
ATOM   5753 C CA  . VAL B 1 208 ? -6.994  -64.878 -25.783 1.00 38.47  ? 209  VAL B CA  1 
ATOM   5754 C C   . VAL B 1 208 ? -8.156  -64.294 -24.976 1.00 39.59  ? 209  VAL B C   1 
ATOM   5755 O O   . VAL B 1 208 ? -9.321  -64.545 -25.283 1.00 39.61  ? 209  VAL B O   1 
ATOM   5756 C CB  . VAL B 1 208 ? -6.389  -66.036 -24.960 1.00 38.88  ? 209  VAL B CB  1 
ATOM   5757 C CG1 . VAL B 1 208 ? -7.504  -66.923 -24.412 1.00 41.58  ? 209  VAL B CG1 1 
ATOM   5758 C CG2 . VAL B 1 208 ? -5.429  -66.854 -25.821 1.00 41.13  ? 209  VAL B CG2 1 
ATOM   5759 N N   . GLY B 1 209 ? -7.837  -63.511 -23.945 1.00 38.12  ? 210  GLY B N   1 
ATOM   5760 C CA  . GLY B 1 209 ? -8.862  -62.901 -23.110 1.00 33.94  ? 210  GLY B CA  1 
ATOM   5761 C C   . GLY B 1 209 ? -9.717  -61.911 -23.887 1.00 42.55  ? 210  GLY B C   1 
ATOM   5762 O O   . GLY B 1 209 ? -10.917 -61.770 -23.632 1.00 38.45  ? 210  GLY B O   1 
ATOM   5763 N N   . MET B 1 210 ? -9.119  -61.236 -24.866 1.00 39.22  ? 211  MET B N   1 
ATOM   5764 C CA  . MET B 1 210 ? -9.894  -60.283 -25.641 1.00 39.57  ? 211  MET B CA  1 
ATOM   5765 C C   . MET B 1 210 ? -10.838 -60.994 -26.610 1.00 41.49  ? 211  MET B C   1 
ATOM   5766 O O   . MET B 1 210 ? -11.941 -60.513 -26.869 1.00 40.81  ? 211  MET B O   1 
ATOM   5767 C CB  . MET B 1 210 ? -8.972  -59.320 -26.373 1.00 39.88  ? 211  MET B CB  1 
ATOM   5768 C CG  . MET B 1 210 ? -8.340  -58.330 -25.432 1.00 37.18  ? 211  MET B CG  1 
ATOM   5769 S SD  . MET B 1 210 ? -7.077  -57.374 -26.240 1.00 51.89  ? 211  MET B SD  1 
ATOM   5770 C CE  . MET B 1 210 ? -6.101  -56.839 -24.826 1.00 42.67  ? 211  MET B CE  1 
ATOM   5771 N N   . HIS B 1 211 ? -10.431 -62.152 -27.114 1.00 38.75  ? 212  HIS B N   1 
ATOM   5772 C CA  . HIS B 1 211 ? -11.338 -62.956 -27.919 1.00 38.16  ? 212  HIS B CA  1 
ATOM   5773 C C   . HIS B 1 211 ? -12.529 -63.442 -27.077 1.00 47.63  ? 212  HIS B C   1 
ATOM   5774 O O   . HIS B 1 211 ? -13.656 -63.494 -27.581 1.00 43.62  ? 212  HIS B O   1 
ATOM   5775 C CB  . HIS B 1 211 ? -10.594 -64.133 -28.554 1.00 37.80  ? 212  HIS B CB  1 
ATOM   5776 C CG  . HIS B 1 211 ? -9.629  -63.714 -29.619 1.00 45.86  ? 212  HIS B CG  1 
ATOM   5777 N ND1 . HIS B 1 211 ? -10.025 -63.040 -30.755 1.00 44.21  ? 212  HIS B ND1 1 
ATOM   5778 C CD2 . HIS B 1 211 ? -8.282  -63.823 -29.700 1.00 36.03  ? 212  HIS B CD2 1 
ATOM   5779 C CE1 . HIS B 1 211 ? -8.969  -62.773 -31.500 1.00 38.28  ? 212  HIS B CE1 1 
ATOM   5780 N NE2 . HIS B 1 211 ? -7.898  -63.231 -30.879 1.00 44.09  ? 212  HIS B NE2 1 
ATOM   5781 N N   . LEU B 1 212 ? -12.286 -63.791 -25.807 1.00 38.26  ? 213  LEU B N   1 
ATOM   5782 C CA  . LEU B 1 212 ? -13.383 -64.080 -24.874 1.00 44.41  ? 213  LEU B CA  1 
ATOM   5783 C C   . LEU B 1 212 ? -14.406 -62.947 -24.826 1.00 40.90  ? 213  LEU B C   1 
ATOM   5784 O O   . LEU B 1 212 ? -15.603 -63.200 -24.817 1.00 45.12  ? 213  LEU B O   1 
ATOM   5785 C CB  . LEU B 1 212 ? -12.860 -64.327 -23.450 1.00 43.21  ? 213  LEU B CB  1 
ATOM   5786 C CG  . LEU B 1 212 ? -12.247 -65.712 -23.238 1.00 48.22  ? 213  LEU B CG  1 
ATOM   5787 C CD1 . LEU B 1 212 ? -11.591 -65.780 -21.861 1.00 41.84  ? 213  LEU B CD1 1 
ATOM   5788 C CD2 . LEU B 1 212 ? -13.298 -66.798 -23.397 1.00 43.73  ? 213  LEU B CD2 1 
ATOM   5789 N N   . LEU B 1 213 ? -13.930 -61.706 -24.806 1.00 37.00  ? 214  LEU B N   1 
ATOM   5790 C CA  . LEU B 1 213 ? -14.797 -60.565 -24.509 1.00 36.37  ? 214  LEU B CA  1 
ATOM   5791 C C   . LEU B 1 213 ? -15.289 -59.844 -25.739 1.00 39.69  ? 214  LEU B C   1 
ATOM   5792 O O   . LEU B 1 213 ? -15.864 -58.772 -25.632 1.00 43.65  ? 214  LEU B O   1 
ATOM   5793 C CB  . LEU B 1 213 ? -14.062 -59.566 -23.615 1.00 38.34  ? 214  LEU B CB  1 
ATOM   5794 C CG  . LEU B 1 213 ? -13.433 -60.191 -22.375 1.00 38.70  ? 214  LEU B CG  1 
ATOM   5795 C CD1 . LEU B 1 213 ? -12.461 -59.220 -21.695 1.00 37.02  ? 214  LEU B CD1 1 
ATOM   5796 C CD2 . LEU B 1 213 ? -14.526 -60.674 -21.424 1.00 39.70  ? 214  LEU B CD2 1 
ATOM   5797 N N   . SER B 1 214 ? -15.038 -60.407 -26.916 1.00 47.04  ? 215  SER B N   1 
ATOM   5798 C CA  . SER B 1 214 ? -15.525 -59.810 -28.164 1.00 46.21  ? 215  SER B CA  1 
ATOM   5799 C C   . SER B 1 214 ? -16.442 -60.831 -28.816 1.00 44.69  ? 215  SER B C   1 
ATOM   5800 O O   . SER B 1 214 ? -15.979 -61.881 -29.259 1.00 48.84  ? 215  SER B O   1 
ATOM   5801 C CB  . SER B 1 214 ? -14.371 -59.422 -29.097 1.00 48.50  ? 215  SER B CB  1 
ATOM   5802 O OG  . SER B 1 214 ? -14.839 -58.907 -30.348 1.00 47.91  ? 215  SER B OG  1 
ATOM   5803 N N   . PRO B 1 215 ? -17.754 -60.546 -28.829 1.00 47.35  ? 216  PRO B N   1 
ATOM   5804 C CA  . PRO B 1 215 ? -18.761 -61.512 -29.286 1.00 51.44  ? 216  PRO B CA  1 
ATOM   5805 C C   . PRO B 1 215 ? -18.430 -62.205 -30.635 1.00 42.73  ? 216  PRO B C   1 
ATOM   5806 O O   . PRO B 1 215 ? -18.532 -63.429 -30.684 1.00 44.14  ? 216  PRO B O   1 
ATOM   5807 C CB  . PRO B 1 215 ? -20.026 -60.653 -29.366 1.00 51.68  ? 216  PRO B CB  1 
ATOM   5808 C CG  . PRO B 1 215 ? -19.843 -59.682 -28.208 1.00 41.96  ? 216  PRO B CG  1 
ATOM   5809 C CD  . PRO B 1 215 ? -18.378 -59.315 -28.304 1.00 52.52  ? 216  PRO B CD  1 
ATOM   5810 N N   . PRO B 1 216 ? -17.977 -61.467 -31.669 1.00 46.22  ? 217  PRO B N   1 
ATOM   5811 C CA  . PRO B 1 216 ? -17.675 -62.231 -32.892 1.00 44.26  ? 217  PRO B CA  1 
ATOM   5812 C C   . PRO B 1 216 ? -16.524 -63.246 -32.755 1.00 49.46  ? 217  PRO B C   1 
ATOM   5813 O O   . PRO B 1 216 ? -16.597 -64.266 -33.433 1.00 51.81  ? 217  PRO B O   1 
ATOM   5814 C CB  . PRO B 1 216 ? -17.326 -61.145 -33.909 1.00 41.40  ? 217  PRO B CB  1 
ATOM   5815 C CG  . PRO B 1 216 ? -17.984 -59.910 -33.388 1.00 44.09  ? 217  PRO B CG  1 
ATOM   5816 C CD  . PRO B 1 216 ? -17.844 -60.015 -31.894 1.00 42.84  ? 217  PRO B CD  1 
ATOM   5817 N N   . SER B 1 217 ? -15.517 -63.014 -31.908 1.00 47.88  ? 218  SER B N   1 
ATOM   5818 C CA  . SER B 1 217 ? -14.486 -64.041 -31.669 1.00 43.64  ? 218  SER B CA  1 
ATOM   5819 C C   . SER B 1 217 ? -15.034 -65.227 -30.889 1.00 49.39  ? 218  SER B C   1 
ATOM   5820 O O   . SER B 1 217 ? -14.644 -66.391 -31.111 1.00 46.20  ? 218  SER B O   1 
ATOM   5821 C CB  . SER B 1 217 ? -13.283 -63.475 -30.893 1.00 42.54  ? 218  SER B CB  1 
ATOM   5822 O OG  . SER B 1 217 ? -12.628 -62.424 -31.598 1.00 47.50  ? 218  SER B OG  1 
ATOM   5823 N N   . ARG B 1 218 ? -15.936 -64.917 -29.960 1.00 50.98  ? 219  ARG B N   1 
ATOM   5824 C CA  . ARG B 1 218 ? -16.294 -65.833 -28.875 1.00 51.35  ? 219  ARG B CA  1 
ATOM   5825 C C   . ARG B 1 218 ? -16.927 -67.096 -29.452 1.00 45.67  ? 219  ARG B C   1 
ATOM   5826 O O   . ARG B 1 218 ? -16.686 -68.216 -28.973 1.00 48.40  ? 219  ARG B O   1 
ATOM   5827 C CB  . ARG B 1 218 ? -17.222 -65.118 -27.861 1.00 45.42  ? 219  ARG B CB  1 
ATOM   5828 C CG  . ARG B 1 218 ? -17.659 -65.974 -26.688 1.00 50.93  ? 219  ARG B CG  1 
ATOM   5829 C CD  . ARG B 1 218 ? -16.487 -66.492 -25.852 1.00 49.88  ? 219  ARG B CD  1 
ATOM   5830 N NE  . ARG B 1 218 ? -16.935 -67.511 -24.899 1.00 54.58  ? 219  ARG B NE  1 
ATOM   5831 C CZ  . ARG B 1 218 ? -16.987 -68.817 -25.164 1.00 58.33  ? 219  ARG B CZ  1 
ATOM   5832 N NH1 . ARG B 1 218 ? -16.610 -69.266 -26.364 1.00 45.76  ? 219  ARG B NH1 1 
ATOM   5833 N NH2 . ARG B 1 218 ? -17.416 -69.676 -24.237 1.00 42.75  ? 219  ARG B NH2 1 
ATOM   5834 N N   . GLY B 1 219 ? -17.696 -66.922 -30.513 1.00 42.75  ? 220  GLY B N   1 
ATOM   5835 C CA  . GLY B 1 219 ? -18.194 -68.062 -31.268 1.00 44.33  ? 220  GLY B CA  1 
ATOM   5836 C C   . GLY B 1 219 ? -17.197 -69.016 -31.937 1.00 49.05  ? 220  GLY B C   1 
ATOM   5837 O O   . GLY B 1 219 ? -17.609 -70.088 -32.380 1.00 50.54  ? 220  GLY B O   1 
ATOM   5838 N N   . LEU B 1 220 ? -15.902 -68.683 -31.983 1.00 43.16  ? 221  LEU B N   1 
ATOM   5839 C CA  . LEU B 1 220 ? -14.925 -69.512 -32.712 1.00 38.86  ? 221  LEU B CA  1 
ATOM   5840 C C   . LEU B 1 220 ? -14.130 -70.521 -31.851 1.00 49.91  ? 221  LEU B C   1 
ATOM   5841 O O   . LEU B 1 220 ? -13.270 -71.264 -32.361 1.00 42.08  ? 221  LEU B O   1 
ATOM   5842 C CB  . LEU B 1 220 ? -13.944 -68.595 -33.454 1.00 35.61  ? 221  LEU B CB  1 
ATOM   5843 C CG  . LEU B 1 220 ? -14.675 -67.556 -34.322 1.00 47.13  ? 221  LEU B CG  1 
ATOM   5844 C CD1 . LEU B 1 220 ? -13.759 -66.447 -34.847 1.00 44.95  ? 221  LEU B CD1 1 
ATOM   5845 C CD2 . LEU B 1 220 ? -15.374 -68.258 -35.483 1.00 42.32  ? 221  LEU B CD2 1 
ATOM   5846 N N   . PHE B 1 221 ? -14.396 -70.554 -30.549 1.00 38.44  ? 222  PHE B N   1 
ATOM   5847 C CA  . PHE B 1 221 ? -13.705 -71.498 -29.690 1.00 40.52  ? 222  PHE B CA  1 
ATOM   5848 C C   . PHE B 1 221 ? -14.539 -71.791 -28.440 1.00 47.26  ? 222  PHE B C   1 
ATOM   5849 O O   . PHE B 1 221 ? -15.569 -71.149 -28.198 1.00 44.08  ? 222  PHE B O   1 
ATOM   5850 C CB  . PHE B 1 221 ? -12.308 -70.967 -29.304 1.00 41.21  ? 222  PHE B CB  1 
ATOM   5851 C CG  . PHE B 1 221 ? -12.334 -69.658 -28.568 1.00 41.25  ? 222  PHE B CG  1 
ATOM   5852 C CD1 . PHE B 1 221 ? -12.653 -68.476 -29.226 1.00 40.35  ? 222  PHE B CD1 1 
ATOM   5853 C CD2 . PHE B 1 221 ? -12.061 -69.611 -27.199 1.00 44.94  ? 222  PHE B CD2 1 
ATOM   5854 C CE1 . PHE B 1 221 ? -12.701 -67.257 -28.534 1.00 41.56  ? 222  PHE B CE1 1 
ATOM   5855 C CE2 . PHE B 1 221 ? -12.090 -68.393 -26.505 1.00 40.22  ? 222  PHE B CE2 1 
ATOM   5856 C CZ  . PHE B 1 221 ? -12.413 -67.220 -27.177 1.00 40.01  ? 222  PHE B CZ  1 
ATOM   5857 N N   . HIS B 1 222 ? -14.066 -72.740 -27.641 1.00 46.43  ? 223  HIS B N   1 
ATOM   5858 C CA  . HIS B 1 222 ? -14.868 -73.320 -26.570 1.00 51.43  ? 223  HIS B CA  1 
ATOM   5859 C C   . HIS B 1 222 ? -14.187 -73.226 -25.211 1.00 44.96  ? 223  HIS B C   1 
ATOM   5860 O O   . HIS B 1 222 ? -14.850 -73.083 -24.203 1.00 53.57  ? 223  HIS B O   1 
ATOM   5861 C CB  . HIS B 1 222 ? -15.191 -74.771 -26.925 1.00 44.25  ? 223  HIS B CB  1 
ATOM   5862 C CG  . HIS B 1 222 ? -15.787 -74.909 -28.295 1.00 58.45  ? 223  HIS B CG  1 
ATOM   5863 N ND1 . HIS B 1 222 ? -15.020 -75.065 -29.432 1.00 48.48  ? 223  HIS B ND1 1 
ATOM   5864 C CD2 . HIS B 1 222 ? -17.072 -74.844 -28.716 1.00 55.19  ? 223  HIS B CD2 1 
ATOM   5865 C CE1 . HIS B 1 222 ? -15.809 -75.116 -30.487 1.00 49.34  ? 223  HIS B CE1 1 
ATOM   5866 N NE2 . HIS B 1 222 ? -17.060 -74.995 -30.081 1.00 52.51  ? 223  HIS B NE2 1 
ATOM   5867 N N   . ARG B 1 223 ? -12.864 -73.312 -25.196 1.00 46.53  ? 224  ARG B N   1 
ATOM   5868 C CA  . ARG B 1 223 ? -12.093 -73.151 -23.972 1.00 46.44  ? 224  ARG B CA  1 
ATOM   5869 C C   . ARG B 1 223 ? -10.909 -72.220 -24.182 1.00 46.84  ? 224  ARG B C   1 
ATOM   5870 O O   . ARG B 1 223 ? -10.542 -71.889 -25.325 1.00 46.08  ? 224  ARG B O   1 
ATOM   5871 C CB  . ARG B 1 223 ? -11.578 -74.491 -23.463 1.00 49.88  ? 224  ARG B CB  1 
ATOM   5872 C CG  . ARG B 1 223 ? -12.616 -75.537 -23.392 1.00 51.99  ? 224  ARG B CG  1 
ATOM   5873 C CD  . ARG B 1 223 ? -12.005 -76.888 -23.233 1.00 51.77  ? 224  ARG B CD  1 
ATOM   5874 N NE  . ARG B 1 223 ? -13.082 -77.853 -23.126 1.00 59.31  ? 224  ARG B NE  1 
ATOM   5875 C CZ  . ARG B 1 223 ? -13.642 -78.464 -24.155 1.00 58.27  ? 224  ARG B CZ  1 
ATOM   5876 N NH1 . ARG B 1 223 ? -13.194 -78.245 -25.386 1.00 59.37  ? 224  ARG B NH1 1 
ATOM   5877 N NH2 . ARG B 1 223 ? -14.630 -79.322 -23.944 1.00 72.72  ? 224  ARG B NH2 1 
ATOM   5878 N N   . ALA B 1 224 ? -10.301 -71.836 -23.064 1.00 43.73  ? 225  ALA B N   1 
ATOM   5879 C CA  . ALA B 1 224 ? -9.278  -70.815 -23.048 1.00 41.85  ? 225  ALA B CA  1 
ATOM   5880 C C   . ALA B 1 224 ? -8.231  -71.104 -21.983 1.00 44.01  ? 225  ALA B C   1 
ATOM   5881 O O   . ALA B 1 224 ? -8.550  -71.546 -20.877 1.00 49.47  ? 225  ALA B O   1 
ATOM   5882 C CB  . ALA B 1 224 ? -9.908  -69.461 -22.827 1.00 40.12  ? 225  ALA B CB  1 
ATOM   5883 N N   . VAL B 1 225 ? -6.980  -70.851 -22.338 1.00 40.43  ? 226  VAL B N   1 
ATOM   5884 C CA  . VAL B 1 225 ? -5.843  -70.990 -21.447 1.00 36.26  ? 226  VAL B CA  1 
ATOM   5885 C C   . VAL B 1 225 ? -5.071  -69.682 -21.499 1.00 41.54  ? 226  VAL B C   1 
ATOM   5886 O O   . VAL B 1 225 ? -4.631  -69.274 -22.581 1.00 46.28  ? 226  VAL B O   1 
ATOM   5887 C CB  . VAL B 1 225 ? -4.926  -72.159 -21.863 1.00 34.47  ? 226  VAL B CB  1 
ATOM   5888 C CG1 . VAL B 1 225 ? -3.685  -72.229 -21.022 1.00 35.23  ? 226  VAL B CG1 1 
ATOM   5889 C CG2 . VAL B 1 225 ? -5.661  -73.451 -21.862 1.00 34.13  ? 226  VAL B CG2 1 
ATOM   5890 N N   . LEU B 1 226 ? -4.944  -69.013 -20.352 1.00 40.58  ? 227  LEU B N   1 
ATOM   5891 C CA  . LEU B 1 226 ? -4.203  -67.752 -20.239 1.00 36.80  ? 227  LEU B CA  1 
ATOM   5892 C C   . LEU B 1 226 ? -2.998  -67.968 -19.355 1.00 36.91  ? 227  LEU B C   1 
ATOM   5893 O O   . LEU B 1 226 ? -3.138  -68.230 -18.172 1.00 41.94  ? 227  LEU B O   1 
ATOM   5894 C CB  . LEU B 1 226 ? -5.079  -66.634 -19.666 1.00 29.95  ? 227  LEU B CB  1 
ATOM   5895 C CG  . LEU B 1 226 ? -6.187  -66.127 -20.597 1.00 39.75  ? 227  LEU B CG  1 
ATOM   5896 C CD1 . LEU B 1 226 ? -7.375  -67.063 -20.664 1.00 42.35  ? 227  LEU B CD1 1 
ATOM   5897 C CD2 . LEU B 1 226 ? -6.629  -64.726 -20.193 1.00 37.04  ? 227  LEU B CD2 1 
ATOM   5898 N N   . GLN B 1 227 ? -1.813  -67.902 -19.944 1.00 43.72  ? 228  GLN B N   1 
ATOM   5899 C CA  . GLN B 1 227 ? -0.560  -68.112 -19.223 1.00 36.09  ? 228  GLN B CA  1 
ATOM   5900 C C   . GLN B 1 227 ? 0.110   -66.770 -19.002 1.00 37.09  ? 228  GLN B C   1 
ATOM   5901 O O   . GLN B 1 227 ? 0.445   -66.092 -19.972 1.00 41.54  ? 228  GLN B O   1 
ATOM   5902 C CB  . GLN B 1 227 ? 0.360   -69.065 -20.023 1.00 38.02  ? 228  GLN B CB  1 
ATOM   5903 C CG  . GLN B 1 227 ? -0.407  -70.309 -20.518 1.00 40.15  ? 228  GLN B CG  1 
ATOM   5904 C CD  . GLN B 1 227 ? 0.428   -71.298 -21.325 1.00 42.89  ? 228  GLN B CD  1 
ATOM   5905 O OE1 . GLN B 1 227 ? -0.116  -72.241 -21.918 1.00 39.50  ? 228  GLN B OE1 1 
ATOM   5906 N NE2 . GLN B 1 227 ? 1.741   -71.103 -21.345 1.00 39.45  ? 228  GLN B NE2 1 
ATOM   5907 N N   . SER B 1 228 ? 0.282   -66.367 -17.744 1.00 39.60  ? 229  SER B N   1 
ATOM   5908 C CA  . SER B 1 228 ? 1.036   -65.148 -17.435 1.00 34.58  ? 229  SER B CA  1 
ATOM   5909 C C   . SER B 1 228 ? 0.606   -63.901 -18.217 1.00 37.28  ? 229  SER B C   1 
ATOM   5910 O O   . SER B 1 228 ? 1.470   -63.158 -18.695 1.00 36.40  ? 229  SER B O   1 
ATOM   5911 C CB  . SER B 1 228 ? 2.531   -65.373 -17.710 1.00 36.28  ? 229  SER B CB  1 
ATOM   5912 O OG  . SER B 1 228 ? 3.030   -66.489 -17.011 1.00 37.16  ? 229  SER B OG  1 
ATOM   5913 N N   . GLY B 1 229 ? -0.696  -63.676 -18.371 1.00 34.15  ? 230  GLY B N   1 
ATOM   5914 C CA  . GLY B 1 229 ? -1.168  -62.542 -19.155 1.00 32.52  ? 230  GLY B CA  1 
ATOM   5915 C C   . GLY B 1 229 ? -2.684  -62.474 -19.089 1.00 32.87  ? 230  GLY B C   1 
ATOM   5916 O O   . GLY B 1 229 ? -3.336  -63.485 -18.941 1.00 33.74  ? 230  GLY B O   1 
ATOM   5917 N N   . ALA B 1 230 ? -3.237  -61.279 -19.239 1.00 30.49  ? 231  ALA B N   1 
ATOM   5918 C CA  . ALA B 1 230 ? -4.649  -61.041 -19.010 1.00 34.90  ? 231  ALA B CA  1 
ATOM   5919 C C   . ALA B 1 230 ? -5.030  -59.783 -19.764 1.00 35.31  ? 231  ALA B C   1 
ATOM   5920 O O   . ALA B 1 230 ? -4.229  -58.861 -19.869 1.00 34.57  ? 231  ALA B O   1 
ATOM   5921 C CB  . ALA B 1 230 ? -4.951  -60.895 -17.457 1.00 33.13  ? 231  ALA B CB  1 
ATOM   5922 N N   . PRO B 1 231 ? -6.242  -59.747 -20.335 1.00 41.35  ? 232  PRO B N   1 
ATOM   5923 C CA  . PRO B 1 231 ? -6.603  -58.598 -21.169 1.00 34.22  ? 232  PRO B CA  1 
ATOM   5924 C C   . PRO B 1 231 ? -6.814  -57.346 -20.306 1.00 41.35  ? 232  PRO B C   1 
ATOM   5925 O O   . PRO B 1 231 ? -6.781  -56.238 -20.843 1.00 39.63  ? 232  PRO B O   1 
ATOM   5926 C CB  . PRO B 1 231 ? -7.901  -59.055 -21.828 1.00 35.50  ? 232  PRO B CB  1 
ATOM   5927 C CG  . PRO B 1 231 ? -8.524  -59.944 -20.736 1.00 37.04  ? 232  PRO B CG  1 
ATOM   5928 C CD  . PRO B 1 231 ? -7.351  -60.714 -20.218 1.00 37.56  ? 232  PRO B CD  1 
ATOM   5929 N N   . ASN B 1 232 ? -7.019  -57.527 -18.994 1.00 39.99  ? 233  ASN B N   1 
ATOM   5930 C CA  . ASN B 1 232 ? -7.118  -56.402 -18.060 1.00 40.19  ? 233  ASN B CA  1 
ATOM   5931 C C   . ASN B 1 232 ? -5.777  -55.893 -17.511 1.00 42.48  ? 233  ASN B C   1 
ATOM   5932 O O   . ASN B 1 232 ? -5.744  -54.968 -16.713 1.00 43.15  ? 233  ASN B O   1 
ATOM   5933 C CB  . ASN B 1 232 ? -8.036  -56.762 -16.888 1.00 40.97  ? 233  ASN B CB  1 
ATOM   5934 C CG  . ASN B 1 232 ? -7.783  -58.159 -16.347 1.00 45.16  ? 233  ASN B CG  1 
ATOM   5935 O OD1 . ASN B 1 232 ? -7.678  -59.118 -17.122 1.00 38.59  ? 233  ASN B OD1 1 
ATOM   5936 N ND2 . ASN B 1 232 ? -7.692  -58.292 -15.001 1.00 33.01  ? 233  ASN B ND2 1 
ATOM   5937 N N   . GLY B 1 233 ? -4.663  -56.471 -17.940 1.00 43.61  ? 234  GLY B N   1 
ATOM   5938 C CA  . GLY B 1 233 ? -3.371  -55.906 -17.575 1.00 47.96  ? 234  GLY B CA  1 
ATOM   5939 C C   . GLY B 1 233 ? -3.175  -54.468 -18.057 1.00 50.32  ? 234  GLY B C   1 
ATOM   5940 O O   . GLY B 1 233 ? -3.509  -54.155 -19.210 1.00 47.73  ? 234  GLY B O   1 
ATOM   5941 N N   . PRO B 1 234 ? -2.601  -53.595 -17.201 1.00 40.89  ? 235  PRO B N   1 
ATOM   5942 C CA  . PRO B 1 234 ? -2.399  -52.157 -17.482 1.00 40.16  ? 235  PRO B CA  1 
ATOM   5943 C C   . PRO B 1 234 ? -1.590  -51.834 -18.777 1.00 42.51  ? 235  PRO B C   1 
ATOM   5944 O O   . PRO B 1 234 ? -1.600  -50.698 -19.256 1.00 42.07  ? 235  PRO B O   1 
ATOM   5945 C CB  . PRO B 1 234 ? -1.620  -51.674 -16.258 1.00 37.67  ? 235  PRO B CB  1 
ATOM   5946 C CG  . PRO B 1 234 ? -0.853  -52.889 -15.827 1.00 41.69  ? 235  PRO B CG  1 
ATOM   5947 C CD  . PRO B 1 234 ? -1.761  -54.062 -16.083 1.00 35.94  ? 235  PRO B CD  1 
ATOM   5948 N N   . TRP B 1 235 ? -0.891  -52.820 -19.315 1.00 37.10  ? 236  TRP B N   1 
ATOM   5949 C CA  . TRP B 1 235 ? -0.057  -52.640 -20.505 1.00 41.23  ? 236  TRP B CA  1 
ATOM   5950 C C   . TRP B 1 235 ? -0.795  -53.105 -21.762 1.00 38.50  ? 236  TRP B C   1 
ATOM   5951 O O   . TRP B 1 235 ? -0.339  -52.888 -22.889 1.00 41.37  ? 236  TRP B O   1 
ATOM   5952 C CB  . TRP B 1 235 ? 1.240   -53.432 -20.348 1.00 35.75  ? 236  TRP B CB  1 
ATOM   5953 C CG  . TRP B 1 235 ? 0.953   -54.822 -19.888 1.00 38.92  ? 236  TRP B CG  1 
ATOM   5954 C CD1 . TRP B 1 235 ? 0.949   -55.271 -18.594 1.00 45.87  ? 236  TRP B CD1 1 
ATOM   5955 C CD2 . TRP B 1 235 ? 0.578   -55.945 -20.695 1.00 35.99  ? 236  TRP B CD2 1 
ATOM   5956 N NE1 . TRP B 1 235 ? 0.625   -56.604 -18.550 1.00 40.00  ? 236  TRP B NE1 1 
ATOM   5957 C CE2 . TRP B 1 235 ? 0.384   -57.043 -19.823 1.00 39.42  ? 236  TRP B CE2 1 
ATOM   5958 C CE3 . TRP B 1 235 ? 0.425   -56.142 -22.068 1.00 41.47  ? 236  TRP B CE3 1 
ATOM   5959 C CZ2 . TRP B 1 235 ? 0.031   -58.311 -20.281 1.00 37.61  ? 236  TRP B CZ2 1 
ATOM   5960 C CZ3 . TRP B 1 235 ? 0.060   -57.397 -22.525 1.00 36.78  ? 236  TRP B CZ3 1 
ATOM   5961 C CH2 . TRP B 1 235 ? -0.132  -58.467 -21.633 1.00 42.41  ? 236  TRP B CH2 1 
ATOM   5962 N N   . ALA B 1 236 ? -1.929  -53.760 -21.555 1.00 36.83  ? 237  ALA B N   1 
ATOM   5963 C CA  . ALA B 1 236 ? -2.536  -54.571 -22.589 1.00 40.17  ? 237  ALA B CA  1 
ATOM   5964 C C   . ALA B 1 236 ? -3.482  -53.784 -23.506 1.00 43.34  ? 237  ALA B C   1 
ATOM   5965 O O   . ALA B 1 236 ? -3.712  -54.181 -24.656 1.00 38.58  ? 237  ALA B O   1 
ATOM   5966 C CB  . ALA B 1 236 ? -3.260  -55.752 -21.955 1.00 36.13  ? 237  ALA B CB  1 
ATOM   5967 N N   . THR B 1 237 ? -4.025  -52.666 -23.030 1.00 38.84  ? 238  THR B N   1 
ATOM   5968 C CA  . THR B 1 237 ? -4.877  -51.860 -23.899 1.00 40.98  ? 238  THR B CA  1 
ATOM   5969 C C   . THR B 1 237 ? -4.581  -50.398 -23.712 1.00 42.41  ? 238  THR B C   1 
ATOM   5970 O O   . THR B 1 237 ? -3.908  -50.020 -22.766 1.00 36.21  ? 238  THR B O   1 
ATOM   5971 C CB  . THR B 1 237 ? -6.369  -52.079 -23.642 1.00 39.80  ? 238  THR B CB  1 
ATOM   5972 O OG1 . THR B 1 237 ? -6.639  -51.762 -22.285 1.00 45.52  ? 238  THR B OG1 1 
ATOM   5973 C CG2 . THR B 1 237 ? -6.787  -53.519 -23.913 1.00 41.83  ? 238  THR B CG2 1 
ATOM   5974 N N   . VAL B 1 238 ? -5.066  -49.580 -24.644 1.00 43.37  ? 239  VAL B N   1 
ATOM   5975 C CA  . VAL B 1 238 ? -4.871  -48.142 -24.581 1.00 38.71  ? 239  VAL B CA  1 
ATOM   5976 C C   . VAL B 1 238 ? -6.209  -47.488 -24.926 1.00 41.80  ? 239  VAL B C   1 
ATOM   5977 O O   . VAL B 1 238 ? -7.051  -48.132 -25.554 1.00 37.41  ? 239  VAL B O   1 
ATOM   5978 C CB  . VAL B 1 238 ? -3.752  -47.697 -25.520 1.00 40.96  ? 239  VAL B CB  1 
ATOM   5979 C CG1 . VAL B 1 238 ? -4.201  -47.762 -26.994 1.00 37.57  ? 239  VAL B CG1 1 
ATOM   5980 C CG2 . VAL B 1 238 ? -3.278  -46.326 -25.175 1.00 47.64  ? 239  VAL B CG2 1 
ATOM   5981 N N   . GLY B 1 239 ? -6.459  -46.268 -24.444 1.00 44.30  ? 240  GLY B N   1 
ATOM   5982 C CA  . GLY B 1 239 ? -7.680  -45.548 -24.797 1.00 42.38  ? 240  GLY B CA  1 
ATOM   5983 C C   . GLY B 1 239 ? -7.553  -44.875 -26.169 1.00 43.13  ? 240  GLY B C   1 
ATOM   5984 O O   . GLY B 1 239 ? -6.445  -44.794 -26.728 1.00 44.92  ? 240  GLY B O   1 
ATOM   5985 N N   . MET B 1 240 ? -8.665  -44.388 -26.720 1.00 49.27  ? 241  MET B N   1 
ATOM   5986 C CA  . MET B 1 240 ? -8.664  -43.846 -28.096 1.00 44.35  ? 241  MET B CA  1 
ATOM   5987 C C   . MET B 1 240 ? -7.761  -42.645 -28.229 1.00 44.93  ? 241  MET B C   1 
ATOM   5988 O O   . MET B 1 240 ? -6.974  -42.559 -29.167 1.00 42.87  ? 241  MET B O   1 
ATOM   5989 C CB  . MET B 1 240 ? -10.070 -43.467 -28.542 1.00 42.54  ? 241  MET B CB  1 
ATOM   5990 C CG  . MET B 1 240 ? -10.933 -44.665 -28.805 1.00 49.13  ? 241  MET B CG  1 
ATOM   5991 S SD  . MET B 1 240 ? -12.606 -44.230 -29.287 1.00 62.06  ? 241  MET B SD  1 
ATOM   5992 C CE  . MET B 1 240 ? -13.470 -44.499 -27.756 1.00 57.38  ? 241  MET B CE  1 
ATOM   5993 N N   . GLY B 1 241 ? -7.855  -41.729 -27.271 1.00 45.28  ? 242  GLY B N   1 
ATOM   5994 C CA  . GLY B 1 241 ? -7.100  -40.493 -27.352 1.00 41.65  ? 242  GLY B CA  1 
ATOM   5995 C C   . GLY B 1 241 ? -5.603  -40.719 -27.284 1.00 48.43  ? 242  GLY B C   1 
ATOM   5996 O O   . GLY B 1 241 ? -4.819  -40.053 -27.980 1.00 46.79  ? 242  GLY B O   1 
ATOM   5997 N N   . GLU B 1 242 ? -5.190  -41.660 -26.442 1.00 45.73  ? 243  GLU B N   1 
ATOM   5998 C CA  . GLU B 1 242 ? -3.768  -41.925 -26.297 1.00 47.61  ? 243  GLU B CA  1 
ATOM   5999 C C   . GLU B 1 242 ? -3.244  -42.673 -27.539 1.00 42.84  ? 243  GLU B C   1 
ATOM   6000 O O   . GLU B 1 242 ? -2.111  -42.453 -27.953 1.00 41.95  ? 243  GLU B O   1 
ATOM   6001 C CB  . GLU B 1 242 ? -3.498  -42.716 -25.012 1.00 44.27  ? 243  GLU B CB  1 
ATOM   6002 C CG  . GLU B 1 242 ? -2.026  -43.130 -24.755 1.00 48.17  ? 243  GLU B CG  1 
ATOM   6003 C CD  . GLU B 1 242 ? -1.069  -41.971 -24.501 1.00 45.65  ? 243  GLU B CD  1 
ATOM   6004 O OE1 . GLU B 1 242 ? -1.527  -40.815 -24.349 1.00 51.67  ? 243  GLU B OE1 1 
ATOM   6005 O OE2 . GLU B 1 242 ? 0.157   -42.219 -24.462 1.00 45.93  ? 243  GLU B OE2 1 
ATOM   6006 N N   . ALA B 1 243 ? -4.062  -43.562 -28.099 1.00 38.63  ? 244  ALA B N   1 
ATOM   6007 C CA  . ALA B 1 243 ? -3.703  -44.279 -29.331 1.00 44.90  ? 244  ALA B CA  1 
ATOM   6008 C C   . ALA B 1 243 ? -3.416  -43.271 -30.412 1.00 43.35  ? 244  ALA B C   1 
ATOM   6009 O O   . ALA B 1 243 ? -2.372  -43.321 -31.056 1.00 42.78  ? 244  ALA B O   1 
ATOM   6010 C CB  . ALA B 1 243 ? -4.818  -45.221 -29.792 1.00 45.00  ? 244  ALA B CB  1 
ATOM   6011 N N   . ARG B 1 244 ? -4.353  -42.340 -30.581 1.00 43.04  ? 245  ARG B N   1 
ATOM   6012 C CA  . ARG B 1 244 ? -4.220  -41.296 -31.582 1.00 44.98  ? 245  ARG B CA  1 
ATOM   6013 C C   . ARG B 1 244 ? -2.983  -40.457 -31.330 1.00 46.49  ? 245  ARG B C   1 
ATOM   6014 O O   . ARG B 1 244 ? -2.300  -40.067 -32.264 1.00 46.85  ? 245  ARG B O   1 
ATOM   6015 C CB  . ARG B 1 244 ? -5.467  -40.401 -31.615 1.00 44.27  ? 245  ARG B CB  1 
ATOM   6016 C CG  . ARG B 1 244 ? -5.327  -39.196 -32.534 1.00 41.10  ? 245  ARG B CG  1 
ATOM   6017 C CD  . ARG B 1 244 ? -6.662  -38.522 -32.810 1.00 44.32  ? 245  ARG B CD  1 
ATOM   6018 N NE  . ARG B 1 244 ? -7.599  -39.344 -33.569 1.00 42.66  ? 245  ARG B NE  1 
ATOM   6019 C CZ  . ARG B 1 244 ? -7.640  -39.409 -34.907 1.00 47.26  ? 245  ARG B CZ  1 
ATOM   6020 N NH1 . ARG B 1 244 ? -6.771  -38.719 -35.638 1.00 40.94  ? 245  ARG B NH1 1 
ATOM   6021 N NH2 . ARG B 1 244 ? -8.549  -40.171 -35.518 1.00 41.31  ? 245  ARG B NH2 1 
ATOM   6022 N N   . ARG B 1 245 ? -2.697  -40.173 -30.066 1.00 47.64  ? 246  ARG B N   1 
ATOM   6023 C CA  . ARG B 1 245 ? -1.555  -39.333 -29.749 1.00 50.24  ? 246  ARG B CA  1 
ATOM   6024 C C   . ARG B 1 245 ? -0.254  -40.008 -30.158 1.00 49.86  ? 246  ARG B C   1 
ATOM   6025 O O   . ARG B 1 245 ? 0.634   -39.377 -30.744 1.00 50.20  ? 246  ARG B O   1 
ATOM   6026 C CB  . ARG B 1 245 ? -1.509  -39.003 -28.261 1.00 45.81  ? 246  ARG B CB  1 
ATOM   6027 C CG  . ARG B 1 245 ? -0.476  -37.948 -27.956 1.00 45.91  ? 246  ARG B CG  1 
ATOM   6028 C CD  . ARG B 1 245 ? -0.129  -37.903 -26.472 1.00 53.87  ? 246  ARG B CD  1 
ATOM   6029 N NE  . ARG B 1 245 ? 0.420   -39.165 -25.987 1.00 53.20  ? 246  ARG B NE  1 
ATOM   6030 C CZ  . ARG B 1 245 ? 1.684   -39.550 -26.155 1.00 56.16  ? 246  ARG B CZ  1 
ATOM   6031 N NH1 . ARG B 1 245 ? 2.541   -38.775 -26.825 1.00 54.16  ? 246  ARG B NH1 1 
ATOM   6032 N NH2 . ARG B 1 245 ? 2.085   -40.720 -25.662 1.00 50.92  ? 246  ARG B NH2 1 
ATOM   6033 N N   . ARG B 1 246 ? -0.151  -41.289 -29.820 1.00 48.12  ? 247  ARG B N   1 
ATOM   6034 C CA  . ARG B 1 246 ? 0.988   -42.124 -30.193 1.00 47.53  ? 247  ARG B CA  1 
ATOM   6035 C C   . ARG B 1 246 ? 1.148   -42.270 -31.707 1.00 47.51  ? 247  ARG B C   1 
ATOM   6036 O O   . ARG B 1 246 ? 2.251   -42.121 -32.251 1.00 49.30  ? 247  ARG B O   1 
ATOM   6037 C CB  . ARG B 1 246 ? 0.839   -43.499 -29.552 1.00 44.60  ? 247  ARG B CB  1 
ATOM   6038 C CG  . ARG B 1 246 ? 1.044   -43.467 -28.063 1.00 43.31  ? 247  ARG B CG  1 
ATOM   6039 C CD  . ARG B 1 246 ? 0.894   -44.829 -27.411 1.00 47.38  ? 247  ARG B CD  1 
ATOM   6040 N NE  . ARG B 1 246 ? 0.852   -44.701 -25.953 1.00 45.51  ? 247  ARG B NE  1 
ATOM   6041 C CZ  . ARG B 1 246 ? 0.870   -45.721 -25.105 1.00 47.20  ? 247  ARG B CZ  1 
ATOM   6042 N NH1 . ARG B 1 246 ? 0.947   -46.969 -25.550 1.00 44.44  ? 247  ARG B NH1 1 
ATOM   6043 N NH2 . ARG B 1 246 ? 0.824   -45.491 -23.801 1.00 46.45  ? 247  ARG B NH2 1 
ATOM   6044 N N   . ALA B 1 247 ? 0.040   -42.562 -32.383 1.00 45.01  ? 248  ALA B N   1 
ATOM   6045 C CA  . ALA B 1 247 ? 0.046   -42.726 -33.821 1.00 43.54  ? 248  ALA B CA  1 
ATOM   6046 C C   . ALA B 1 247 ? 0.491   -41.418 -34.454 1.00 52.02  ? 248  ALA B C   1 
ATOM   6047 O O   . ALA B 1 247 ? 1.306   -41.388 -35.385 1.00 46.07  ? 248  ALA B O   1 
ATOM   6048 C CB  . ALA B 1 247 ? -1.328  -43.129 -34.321 1.00 39.78  ? 248  ALA B CB  1 
ATOM   6049 N N   . THR B 1 248 ? -0.027  -40.326 -33.913 1.00 46.20  ? 249  THR B N   1 
ATOM   6050 C CA  . THR B 1 248 ? 0.257   -39.022 -34.468 1.00 49.39  ? 249  THR B CA  1 
ATOM   6051 C C   . THR B 1 248 ? 1.718   -38.653 -34.258 1.00 51.11  ? 249  THR B C   1 
ATOM   6052 O O   . THR B 1 248 ? 2.362   -38.126 -35.177 1.00 53.39  ? 249  THR B O   1 
ATOM   6053 C CB  . THR B 1 248 ? -0.670  -37.958 -33.874 1.00 52.71  ? 249  THR B CB  1 
ATOM   6054 O OG1 . THR B 1 248 ? -2.028  -38.292 -34.202 1.00 49.32  ? 249  THR B OG1 1 
ATOM   6055 C CG2 . THR B 1 248 ? -0.348  -36.590 -34.443 1.00 54.61  ? 249  THR B CG2 1 
ATOM   6056 N N   A GLN B 1 249 ? 2.239   -38.934 -33.063 0.54 48.26  ? 250  GLN B N   1 
ATOM   6057 N N   B GLN B 1 249 ? 2.258   -38.958 -33.083 0.46 48.28  ? 250  GLN B N   1 
ATOM   6058 C CA  A GLN B 1 249 ? 3.646   -38.680 -32.763 0.54 48.56  ? 250  GLN B CA  1 
ATOM   6059 C CA  B GLN B 1 249 ? 3.655   -38.643 -32.802 0.46 48.53  ? 250  GLN B CA  1 
ATOM   6060 C C   A GLN B 1 249 ? 4.557   -39.520 -33.660 0.54 49.64  ? 250  GLN B C   1 
ATOM   6061 C C   B GLN B 1 249 ? 4.614   -39.555 -33.579 0.46 49.64  ? 250  GLN B C   1 
ATOM   6062 O O   A GLN B 1 249 ? 5.583   -39.034 -34.137 0.54 52.39  ? 250  GLN B O   1 
ATOM   6063 O O   B GLN B 1 249 ? 5.731   -39.154 -33.896 0.46 52.29  ? 250  GLN B O   1 
ATOM   6064 C CB  A GLN B 1 249 ? 3.967   -38.957 -31.282 0.54 50.27  ? 250  GLN B CB  1 
ATOM   6065 C CB  B GLN B 1 249 ? 3.932   -38.722 -31.296 0.46 50.40  ? 250  GLN B CB  1 
ATOM   6066 C CG  A GLN B 1 249 ? 5.471   -39.092 -31.023 0.54 51.64  ? 250  GLN B CG  1 
ATOM   6067 C CG  B GLN B 1 249 ? 5.363   -38.358 -30.879 0.46 52.42  ? 250  GLN B CG  1 
ATOM   6068 C CD  A GLN B 1 249 ? 5.909   -38.770 -29.597 0.54 55.03  ? 250  GLN B CD  1 
ATOM   6069 C CD  B GLN B 1 249 ? 5.772   -36.915 -31.203 0.46 53.42  ? 250  GLN B CD  1 
ATOM   6070 O OE1 A GLN B 1 249 ? 5.192   -39.027 -28.624 0.54 55.37  ? 250  GLN B OE1 1 
ATOM   6071 O OE1 B GLN B 1 249 ? 4.979   -36.110 -31.705 0.46 51.42  ? 250  GLN B OE1 1 
ATOM   6072 N NE2 A GLN B 1 249 ? 7.110   -38.214 -29.472 0.54 51.59  ? 250  GLN B NE2 1 
ATOM   6073 N NE2 B GLN B 1 249 ? 7.028   -36.590 -30.910 0.46 54.12  ? 250  GLN B NE2 1 
ATOM   6074 N N   . LEU B 1 250 ? 4.183   -40.773 -33.893 1.00 44.97  ? 251  LEU B N   1 
ATOM   6075 C CA  . LEU B 1 250 ? 4.984   -41.641 -34.760 1.00 50.83  ? 251  LEU B CA  1 
ATOM   6076 C C   . LEU B 1 250 ? 5.088   -41.027 -36.157 1.00 48.63  ? 251  LEU B C   1 
ATOM   6077 O O   . LEU B 1 250 ? 6.175   -40.871 -36.697 1.00 46.80  ? 251  LEU B O   1 
ATOM   6078 C CB  . LEU B 1 250 ? 4.392   -43.049 -34.861 1.00 46.27  ? 251  LEU B CB  1 
ATOM   6079 C CG  . LEU B 1 250 ? 5.108   -43.981 -35.844 1.00 47.63  ? 251  LEU B CG  1 
ATOM   6080 C CD1 . LEU B 1 250 ? 6.558   -44.194 -35.455 1.00 44.99  ? 251  LEU B CD1 1 
ATOM   6081 C CD2 . LEU B 1 250 ? 4.398   -45.306 -35.947 1.00 47.95  ? 251  LEU B CD2 1 
ATOM   6082 N N   . ALA B 1 251 ? 3.942   -40.659 -36.717 1.00 51.79  ? 252  ALA B N   1 
ATOM   6083 C CA  . ALA B 1 251 ? 3.889   -40.059 -38.044 1.00 56.79  ? 252  ALA B CA  1 
ATOM   6084 C C   . ALA B 1 251 ? 4.770   -38.818 -38.094 1.00 56.90  ? 252  ALA B C   1 
ATOM   6085 O O   . ALA B 1 251 ? 5.546   -38.650 -39.033 1.00 60.88  ? 252  ALA B O   1 
ATOM   6086 C CB  . ALA B 1 251 ? 2.447   -39.727 -38.429 1.00 53.29  ? 252  ALA B CB  1 
ATOM   6087 N N   . HIS B 1 252 ? 4.670   -37.973 -37.071 1.00 53.23  ? 253  HIS B N   1 
ATOM   6088 C CA  . HIS B 1 252 ? 5.503   -36.777 -36.968 1.00 51.27  ? 253  HIS B CA  1 
ATOM   6089 C C   . HIS B 1 252 ? 7.000   -37.104 -36.979 1.00 56.38  ? 253  HIS B C   1 
ATOM   6090 O O   . HIS B 1 252 ? 7.790   -36.453 -37.665 1.00 57.80  ? 253  HIS B O   1 
ATOM   6091 C CB  . HIS B 1 252 ? 5.148   -36.005 -35.688 1.00 59.98  ? 253  HIS B CB  1 
ATOM   6092 C CG  . HIS B 1 252 ? 5.998   -34.791 -35.453 1.00 66.03  ? 253  HIS B CG  1 
ATOM   6093 N ND1 . HIS B 1 252 ? 5.899   -33.647 -36.220 1.00 68.49  ? 253  HIS B ND1 1 
ATOM   6094 C CD2 . HIS B 1 252 ? 6.972   -34.546 -34.542 1.00 60.66  ? 253  HIS B CD2 1 
ATOM   6095 C CE1 . HIS B 1 252 ? 6.766   -32.748 -35.786 1.00 61.98  ? 253  HIS B CE1 1 
ATOM   6096 N NE2 . HIS B 1 252 ? 7.433   -33.270 -34.770 1.00 61.96  ? 253  HIS B NE2 1 
ATOM   6097 N N   . LEU B 1 253 ? 7.384   -38.114 -36.204 1.00 57.17  ? 254  LEU B N   1 
ATOM   6098 C CA  . LEU B 1 253 ? 8.787   -38.479 -36.049 1.00 57.53  ? 254  LEU B CA  1 
ATOM   6099 C C   . LEU B 1 253 ? 9.428   -39.036 -37.325 1.00 58.53  ? 254  LEU B C   1 
ATOM   6100 O O   . LEU B 1 253 ? 10.658  -39.095 -37.416 1.00 54.20  ? 254  LEU B O   1 
ATOM   6101 C CB  . LEU B 1 253 ? 8.946   -39.504 -34.924 1.00 54.94  ? 254  LEU B CB  1 
ATOM   6102 C CG  . LEU B 1 253 ? 8.887   -38.962 -33.495 1.00 56.89  ? 254  LEU B CG  1 
ATOM   6103 C CD1 . LEU B 1 253 ? 9.221   -40.071 -32.534 1.00 53.84  ? 254  LEU B CD1 1 
ATOM   6104 C CD2 . LEU B 1 253 ? 9.848   -37.811 -33.333 1.00 55.46  ? 254  LEU B CD2 1 
ATOM   6105 N N   . VAL B 1 254 ? 8.604   -39.462 -38.284 1.00 51.96  ? 255  VAL B N   1 
ATOM   6106 C CA  . VAL B 1 254 ? 9.105   -39.957 -39.564 1.00 55.47  ? 255  VAL B CA  1 
ATOM   6107 C C   . VAL B 1 254 ? 8.705   -39.029 -40.715 1.00 60.92  ? 255  VAL B C   1 
ATOM   6108 O O   . VAL B 1 254 ? 8.741   -39.424 -41.881 1.00 59.65  ? 255  VAL B O   1 
ATOM   6109 C CB  . VAL B 1 254 ? 8.591   -41.377 -39.874 1.00 53.74  ? 255  VAL B CB  1 
ATOM   6110 C CG1 . VAL B 1 254 ? 9.105   -42.384 -38.829 1.00 49.11  ? 255  VAL B CG1 1 
ATOM   6111 C CG2 . VAL B 1 254 ? 7.063   -41.388 -39.975 1.00 48.55  ? 255  VAL B CG2 1 
ATOM   6112 N N   . GLY B 1 255 ? 8.293   -37.811 -40.371 1.00 61.24  ? 256  GLY B N   1 
ATOM   6113 C CA  . GLY B 1 255 ? 8.009   -36.772 -41.346 1.00 60.21  ? 256  GLY B CA  1 
ATOM   6114 C C   . GLY B 1 255 ? 6.595   -36.701 -41.892 1.00 65.27  ? 256  GLY B C   1 
ATOM   6115 O O   . GLY B 1 255 ? 6.380   -36.209 -42.990 1.00 71.64  ? 256  GLY B O   1 
ATOM   6116 N N   . CYS B 1 256 ? 5.616   -37.172 -41.137 1.00 63.06  ? 257  CYS B N   1 
ATOM   6117 C CA  . CYS B 1 256 ? 4.250   -37.199 -41.650 1.00 61.59  ? 257  CYS B CA  1 
ATOM   6118 C C   . CYS B 1 256 ? 3.289   -36.446 -40.742 1.00 70.06  ? 257  CYS B C   1 
ATOM   6119 O O   . CYS B 1 256 ? 3.115   -36.829 -39.601 1.00 69.58  ? 257  CYS B O   1 
ATOM   6120 C CB  . CYS B 1 256 ? 3.772   -38.637 -41.809 1.00 56.42  ? 257  CYS B CB  1 
ATOM   6121 S SG  . CYS B 1 256 ? 4.716   -39.612 -42.990 1.00 66.37  ? 257  CYS B SG  1 
ATOM   6122 N N   . PRO B 1 257 ? 2.643   -35.381 -41.250 1.00 80.58  ? 258  PRO B N   1 
ATOM   6123 C CA  . PRO B 1 257 ? 2.800   -34.856 -42.609 1.00 78.33  ? 258  PRO B CA  1 
ATOM   6124 C C   . PRO B 1 257 ? 3.989   -33.907 -42.670 1.00 79.22  ? 258  PRO B C   1 
ATOM   6125 O O   . PRO B 1 257 ? 4.512   -33.550 -41.602 1.00 72.28  ? 258  PRO B O   1 
ATOM   6126 C CB  . PRO B 1 257 ? 1.483   -34.117 -42.844 1.00 75.61  ? 258  PRO B CB  1 
ATOM   6127 C CG  . PRO B 1 257 ? 1.139   -33.585 -41.479 1.00 72.45  ? 258  PRO B CG  1 
ATOM   6128 C CD  . PRO B 1 257 ? 1.619   -34.630 -40.492 1.00 75.66  ? 258  PRO B CD  1 
ATOM   6129 N N   . PRO B 1 258 ? 4.419   -33.521 -43.889 1.00 79.16  ? 259  PRO B N   1 
ATOM   6130 C CA  . PRO B 1 258 ? 5.476   -32.509 -44.046 1.00 79.85  ? 259  PRO B CA  1 
ATOM   6131 C C   . PRO B 1 258 ? 4.952   -31.078 -43.879 1.00 76.27  ? 259  PRO B C   1 
ATOM   6132 O O   . PRO B 1 258 ? 5.550   -30.304 -43.120 1.00 74.51  ? 259  PRO B O   1 
ATOM   6133 C CB  . PRO B 1 258 ? 5.982   -32.748 -45.475 1.00 80.61  ? 259  PRO B CB  1 
ATOM   6134 C CG  . PRO B 1 258 ? 4.799   -33.315 -46.202 1.00 79.37  ? 259  PRO B CG  1 
ATOM   6135 C CD  . PRO B 1 258 ? 4.049   -34.146 -45.176 1.00 81.33  ? 259  PRO B CD  1 
ATOM   6136 N N   . THR B 1 261 ? 1.943   -32.098 -38.122 1.00 81.44  ? 262  THR B N   1 
ATOM   6137 C CA  . THR B 1 261 ? 1.311   -33.058 -37.207 1.00 81.73  ? 262  THR B CA  1 
ATOM   6138 C C   . THR B 1 261 ? -0.203  -33.116 -37.401 1.00 75.91  ? 262  THR B C   1 
ATOM   6139 O O   . THR B 1 261 ? -0.860  -32.089 -37.615 1.00 77.92  ? 262  THR B O   1 
ATOM   6140 C CB  . THR B 1 261 ? 1.590   -32.731 -35.707 1.00 78.02  ? 262  THR B CB  1 
ATOM   6141 O OG1 . THR B 1 261 ? 1.085   -31.429 -35.390 1.00 85.05  ? 262  THR B OG1 1 
ATOM   6142 C CG2 . THR B 1 261 ? 3.067   -32.772 -35.398 1.00 70.69  ? 262  THR B CG2 1 
ATOM   6143 N N   . GLY B 1 262 ? -0.755  -34.321 -37.303 1.00 73.38  ? 263  GLY B N   1 
ATOM   6144 C CA  . GLY B 1 262 ? -2.181  -34.516 -37.481 1.00 72.52  ? 263  GLY B CA  1 
ATOM   6145 C C   . GLY B 1 262 ? -2.643  -34.089 -38.860 1.00 71.41  ? 263  GLY B C   1 
ATOM   6146 O O   . GLY B 1 262 ? -1.925  -34.279 -39.848 1.00 74.04  ? 263  GLY B O   1 
ATOM   6147 N N   . GLY B 1 263 ? -3.835  -33.492 -38.922 1.00 72.04  ? 264  GLY B N   1 
ATOM   6148 C CA  . GLY B 1 263 ? -4.461  -33.110 -40.186 1.00 69.66  ? 264  GLY B CA  1 
ATOM   6149 C C   . GLY B 1 263 ? -5.471  -34.165 -40.622 1.00 69.70  ? 264  GLY B C   1 
ATOM   6150 O O   . GLY B 1 263 ? -5.957  -34.934 -39.783 1.00 65.83  ? 264  GLY B O   1 
ATOM   6151 N N   . ASN B 1 264 ? -5.790  -34.198 -41.919 1.00 65.78  ? 265  ASN B N   1 
ATOM   6152 C CA  . ASN B 1 264 ? -6.642  -35.248 -42.502 1.00 64.58  ? 265  ASN B CA  1 
ATOM   6153 C C   . ASN B 1 264 ? -6.046  -36.615 -42.164 1.00 56.68  ? 265  ASN B C   1 
ATOM   6154 O O   . ASN B 1 264 ? -4.839  -36.828 -42.347 1.00 52.81  ? 265  ASN B O   1 
ATOM   6155 C CB  . ASN B 1 264 ? -6.768  -35.030 -44.037 1.00 64.31  ? 265  ASN B CB  1 
ATOM   6156 C CG  . ASN B 1 264 ? -7.710  -36.039 -44.753 1.00 68.59  ? 265  ASN B CG  1 
ATOM   6157 O OD1 . ASN B 1 264 ? -7.840  -37.203 -44.362 1.00 64.38  ? 265  ASN B OD1 1 
ATOM   6158 N ND2 . ASN B 1 264 ? -8.363  -35.566 -45.831 1.00 80.84  ? 265  ASN B ND2 1 
ATOM   6159 N N   . ASP B 1 265 ? -6.869  -37.536 -41.662 1.00 48.45  ? 266  ASP B N   1 
ATOM   6160 C CA  . ASP B 1 265 ? -6.352  -38.863 -41.340 1.00 51.09  ? 266  ASP B CA  1 
ATOM   6161 C C   . ASP B 1 265 ? -5.890  -39.626 -42.590 1.00 57.66  ? 266  ASP B C   1 
ATOM   6162 O O   . ASP B 1 265 ? -4.852  -40.299 -42.566 1.00 53.55  ? 266  ASP B O   1 
ATOM   6163 C CB  . ASP B 1 265 ? -7.390  -39.683 -40.573 1.00 47.44  ? 266  ASP B CB  1 
ATOM   6164 C CG  . ASP B 1 265 ? -7.306  -39.463 -39.050 1.00 52.55  ? 266  ASP B CG  1 
ATOM   6165 O OD1 . ASP B 1 265 ? -6.298  -38.894 -38.573 1.00 49.14  ? 266  ASP B OD1 1 
ATOM   6166 O OD2 . ASP B 1 265 ? -8.251  -39.849 -38.334 1.00 48.14  ? 266  ASP B OD2 1 
ATOM   6167 N N   . THR B 1 266 ? -6.648  -39.506 -43.680 1.00 59.30  ? 267  THR B N   1 
ATOM   6168 C CA  . THR B 1 266 ? -6.343  -40.222 -44.914 1.00 58.40  ? 267  THR B CA  1 
ATOM   6169 C C   . THR B 1 266 ? -4.975  -39.817 -45.482 1.00 58.90  ? 267  THR B C   1 
ATOM   6170 O O   . THR B 1 266 ? -4.215  -40.667 -45.957 1.00 60.53  ? 267  THR B O   1 
ATOM   6171 C CB  . THR B 1 266 ? -7.439  -39.990 -45.984 1.00 57.85  ? 267  THR B CB  1 
ATOM   6172 O OG1 . THR B 1 266 ? -8.667  -40.588 -45.553 1.00 58.36  ? 267  THR B OG1 1 
ATOM   6173 C CG2 . THR B 1 266 ? -7.038  -40.613 -47.308 1.00 58.22  ? 267  THR B CG2 1 
ATOM   6174 N N   . GLU B 1 267 ? -4.659  -38.528 -45.424 1.00 55.27  ? 268  GLU B N   1 
ATOM   6175 C CA  . GLU B 1 267 ? -3.379  -38.051 -45.933 1.00 54.74  ? 268  GLU B CA  1 
ATOM   6176 C C   . GLU B 1 267 ? -2.219  -38.509 -45.059 1.00 58.17  ? 268  GLU B C   1 
ATOM   6177 O O   . GLU B 1 267 ? -1.114  -38.773 -45.558 1.00 54.39  ? 268  GLU B O   1 
ATOM   6178 C CB  . GLU B 1 267 ? -3.376  -36.525 -46.039 1.00 59.44  ? 268  GLU B CB  1 
ATOM   6179 C CG  . GLU B 1 267 ? -4.128  -35.988 -47.268 1.00 76.46  ? 268  GLU B CG  1 
ATOM   6180 C CD  . GLU B 1 267 ? -4.203  -34.464 -47.301 1.00 87.01  ? 268  GLU B CD  1 
ATOM   6181 O OE1 . GLU B 1 267 ? -3.858  -33.822 -46.280 1.00 95.20  ? 268  GLU B OE1 1 
ATOM   6182 O OE2 . GLU B 1 267 ? -4.608  -33.905 -48.347 1.00 96.07  ? 268  GLU B OE2 1 
ATOM   6183 N N   . LEU B 1 268 ? -2.474  -38.589 -43.754 1.00 56.25  ? 269  LEU B N   1 
ATOM   6184 C CA  . LEU B 1 268 ? -1.441  -38.944 -42.791 1.00 52.13  ? 269  LEU B CA  1 
ATOM   6185 C C   . LEU B 1 268 ? -1.076  -40.408 -42.930 1.00 48.24  ? 269  LEU B C   1 
ATOM   6186 O O   . LEU B 1 268 ? 0.093   -40.765 -42.928 1.00 49.54  ? 269  LEU B O   1 
ATOM   6187 C CB  . LEU B 1 268 ? -1.898  -38.643 -41.367 1.00 51.86  ? 269  LEU B CB  1 
ATOM   6188 C CG  . LEU B 1 268 ? -0.802  -38.828 -40.316 1.00 54.71  ? 269  LEU B CG  1 
ATOM   6189 C CD1 . LEU B 1 268 ? -0.484  -37.534 -39.604 1.00 61.00  ? 269  LEU B CD1 1 
ATOM   6190 C CD2 . LEU B 1 268 ? -1.230  -39.878 -39.342 1.00 53.61  ? 269  LEU B CD2 1 
ATOM   6191 N N   . VAL B 1 269 ? -2.083  -41.250 -43.082 1.00 47.67  ? 270  VAL B N   1 
ATOM   6192 C CA  . VAL B 1 269 ? -1.846  -42.677 -43.204 1.00 52.17  ? 270  VAL B CA  1 
ATOM   6193 C C   . VAL B 1 269 ? -1.185  -42.974 -44.547 1.00 55.76  ? 270  VAL B C   1 
ATOM   6194 O O   . VAL B 1 269 ? -0.268  -43.798 -44.629 1.00 53.57  ? 270  VAL B O   1 
ATOM   6195 C CB  . VAL B 1 269 ? -3.155  -43.480 -43.053 1.00 52.61  ? 270  VAL B CB  1 
ATOM   6196 C CG1 . VAL B 1 269 ? -2.928  -44.952 -43.335 1.00 49.46  ? 270  VAL B CG1 1 
ATOM   6197 C CG2 . VAL B 1 269 ? -3.720  -43.285 -41.649 1.00 45.81  ? 270  VAL B CG2 1 
ATOM   6198 N N   . ALA B 1 270 ? -1.630  -42.293 -45.597 1.00 55.09  ? 271  ALA B N   1 
ATOM   6199 C CA  . ALA B 1 270 ? -1.026  -42.502 -46.907 1.00 50.32  ? 271  ALA B CA  1 
ATOM   6200 C C   . ALA B 1 270 ? 0.446   -42.134 -46.834 1.00 44.24  ? 271  ALA B C   1 
ATOM   6201 O O   . ALA B 1 270 ? 1.281   -42.877 -47.302 1.00 51.45  ? 271  ALA B O   1 
ATOM   6202 C CB  . ALA B 1 270 ? -1.739  -41.707 -47.964 1.00 51.29  ? 271  ALA B CB  1 
ATOM   6203 N N   . CYS B 1 271 ? 0.772   -41.022 -46.197 1.00 45.26  ? 272  CYS B N   1 
ATOM   6204 C CA  . CYS B 1 271 ? 2.173   -40.695 -45.982 1.00 50.12  ? 272  CYS B CA  1 
ATOM   6205 C C   . CYS B 1 271 ? 2.880   -41.769 -45.107 1.00 60.47  ? 272  CYS B C   1 
ATOM   6206 O O   . CYS B 1 271 ? 4.041   -42.110 -45.373 1.00 55.87  ? 272  CYS B O   1 
ATOM   6207 C CB  . CYS B 1 271 ? 2.300   -39.296 -45.361 1.00 50.71  ? 272  CYS B CB  1 
ATOM   6208 S SG  . CYS B 1 271 ? 3.969   -38.851 -44.770 1.00 70.42  ? 272  CYS B SG  1 
ATOM   6209 N N   . LEU B 1 272 ? 2.196   -42.313 -44.089 1.00 50.32  ? 273  LEU B N   1 
ATOM   6210 C CA  . LEU B 1 272 ? 2.790   -43.393 -43.284 1.00 51.09  ? 273  LEU B CA  1 
ATOM   6211 C C   . LEU B 1 272 ? 3.120   -44.627 -44.132 1.00 52.46  ? 273  LEU B C   1 
ATOM   6212 O O   . LEU B 1 272 ? 4.151   -45.272 -43.933 1.00 46.82  ? 273  LEU B O   1 
ATOM   6213 C CB  . LEU B 1 272 ? 1.868   -43.814 -42.134 1.00 48.61  ? 273  LEU B CB  1 
ATOM   6214 C CG  . LEU B 1 272 ? 1.901   -42.982 -40.848 1.00 52.97  ? 273  LEU B CG  1 
ATOM   6215 C CD1 . LEU B 1 272 ? 0.921   -43.555 -39.813 1.00 51.90  ? 273  LEU B CD1 1 
ATOM   6216 C CD2 . LEU B 1 272 ? 3.301   -42.897 -40.262 1.00 47.51  ? 273  LEU B CD2 1 
ATOM   6217 N N   . ARG B 1 273 ? 2.231   -44.939 -45.070 1.00 47.43  ? 274  ARG B N   1 
ATOM   6218 C CA  . ARG B 1 273 ? 2.343   -46.123 -45.908 1.00 54.90  ? 274  ARG B CA  1 
ATOM   6219 C C   . ARG B 1 273 ? 3.503   -46.034 -46.899 1.00 58.74  ? 274  ARG B C   1 
ATOM   6220 O O   . ARG B 1 273 ? 3.880   -47.047 -47.474 1.00 52.53  ? 274  ARG B O   1 
ATOM   6221 C CB  . ARG B 1 273 ? 1.028   -46.379 -46.673 1.00 50.99  ? 274  ARG B CB  1 
ATOM   6222 C CG  . ARG B 1 273 ? -0.093  -46.969 -45.785 1.00 53.34  ? 274  ARG B CG  1 
ATOM   6223 C CD  . ARG B 1 273 ? -1.187  -47.666 -46.590 1.00 47.66  ? 274  ARG B CD  1 
ATOM   6224 N NE  . ARG B 1 273 ? -2.324  -46.795 -46.831 1.00 59.26  ? 274  ARG B NE  1 
ATOM   6225 C CZ  . ARG B 1 273 ? -3.529  -46.923 -46.270 1.00 63.21  ? 274  ARG B CZ  1 
ATOM   6226 N NH1 . ARG B 1 273 ? -3.805  -47.914 -45.418 1.00 50.41  ? 274  ARG B NH1 1 
ATOM   6227 N NH2 . ARG B 1 273 ? -4.477  -46.047 -46.582 1.00 64.40  ? 274  ARG B NH2 1 
ATOM   6228 N N   . THR B 1 274 ? 4.078   -44.846 -47.089 1.00 51.65  ? 275  THR B N   1 
ATOM   6229 C CA  . THR B 1 274 ? 5.171   -44.705 -48.049 1.00 58.53  ? 275  THR B CA  1 
ATOM   6230 C C   . THR B 1 274 ? 6.497   -44.925 -47.365 1.00 55.70  ? 275  THR B C   1 
ATOM   6231 O O   . THR B 1 274 ? 7.542   -44.973 -48.007 1.00 58.50  ? 275  THR B O   1 
ATOM   6232 C CB  . THR B 1 274 ? 5.210   -43.312 -48.740 1.00 52.91  ? 275  THR B CB  1 
ATOM   6233 O OG1 . THR B 1 274 ? 5.708   -42.323 -47.820 1.00 54.36  ? 275  THR B OG1 1 
ATOM   6234 C CG2 . THR B 1 274 ? 3.833   -42.922 -49.262 1.00 44.88  ? 275  THR B CG2 1 
ATOM   6235 N N   . ARG B 1 275 ? 6.460   -45.028 -46.050 1.00 53.59  ? 276  ARG B N   1 
ATOM   6236 C CA  . ARG B 1 275 ? 7.687   -45.227 -45.297 1.00 55.96  ? 276  ARG B CA  1 
ATOM   6237 C C   . ARG B 1 275 ? 8.071   -46.706 -45.276 1.00 53.15  ? 276  ARG B C   1 
ATOM   6238 O O   . ARG B 1 275 ? 7.206   -47.573 -45.182 1.00 54.15  ? 276  ARG B O   1 
ATOM   6239 C CB  . ARG B 1 275 ? 7.527   -44.691 -43.877 1.00 55.77  ? 276  ARG B CB  1 
ATOM   6240 C CG  . ARG B 1 275 ? 7.279   -43.190 -43.820 1.00 60.53  ? 276  ARG B CG  1 
ATOM   6241 C CD  . ARG B 1 275 ? 8.541   -42.416 -44.182 1.00 55.12  ? 276  ARG B CD  1 
ATOM   6242 N NE  . ARG B 1 275 ? 8.315   -40.977 -44.128 1.00 62.62  ? 276  ARG B NE  1 
ATOM   6243 C CZ  . ARG B 1 275 ? 7.748   -40.269 -45.105 1.00 67.03  ? 276  ARG B CZ  1 
ATOM   6244 N NH1 . ARG B 1 275 ? 7.336   -40.868 -46.223 1.00 59.68  ? 276  ARG B NH1 1 
ATOM   6245 N NH2 . ARG B 1 275 ? 7.594   -38.959 -44.963 1.00 63.85  ? 276  ARG B NH2 1 
ATOM   6246 N N   . PRO B 1 276 ? 9.372   -46.997 -45.390 1.00 54.38  ? 277  PRO B N   1 
ATOM   6247 C CA  . PRO B 1 276 ? 9.822   -48.387 -45.266 1.00 52.05  ? 277  PRO B CA  1 
ATOM   6248 C C   . PRO B 1 276 ? 9.468   -48.939 -43.881 1.00 46.28  ? 277  PRO B C   1 
ATOM   6249 O O   . PRO B 1 276 ? 9.558   -48.193 -42.910 1.00 46.40  ? 277  PRO B O   1 
ATOM   6250 C CB  . PRO B 1 276 ? 11.339  -48.286 -45.450 1.00 53.87  ? 277  PRO B CB  1 
ATOM   6251 C CG  . PRO B 1 276 ? 11.553  -46.998 -46.212 1.00 54.23  ? 277  PRO B CG  1 
ATOM   6252 C CD  . PRO B 1 276 ? 10.477  -46.074 -45.701 1.00 54.77  ? 277  PRO B CD  1 
ATOM   6253 N N   . ALA B 1 277 ? 9.071   -50.205 -43.801 1.00 46.71  ? 278  ALA B N   1 
ATOM   6254 C CA  . ALA B 1 277 ? 8.771   -50.846 -42.519 1.00 45.11  ? 278  ALA B CA  1 
ATOM   6255 C C   . ALA B 1 277 ? 9.855   -50.585 -41.479 1.00 47.89  ? 278  ALA B C   1 
ATOM   6256 O O   . ALA B 1 277 ? 9.557   -50.194 -40.343 1.00 49.40  ? 278  ALA B O   1 
ATOM   6257 C CB  . ALA B 1 277 ? 8.576   -52.319 -42.706 1.00 41.27  ? 278  ALA B CB  1 
ATOM   6258 N N   . GLN B 1 278 ? 11.115  -50.758 -41.861 1.00 48.94  ? 279  GLN B N   1 
ATOM   6259 C CA  . GLN B 1 278 ? 12.184  -50.651 -40.871 1.00 44.90  ? 279  GLN B CA  1 
ATOM   6260 C C   . GLN B 1 278 ? 12.267  -49.268 -40.230 1.00 51.24  ? 279  GLN B C   1 
ATOM   6261 O O   . GLN B 1 278 ? 12.775  -49.121 -39.104 1.00 51.22  ? 279  GLN B O   1 
ATOM   6262 C CB  . GLN B 1 278 ? 13.532  -51.013 -41.488 1.00 44.27  ? 279  GLN B CB  1 
ATOM   6263 C CG  . GLN B 1 278 ? 14.607  -51.287 -40.433 1.00 46.84  ? 279  GLN B CG  1 
ATOM   6264 C CD  . GLN B 1 278 ? 14.217  -52.443 -39.522 1.00 48.86  ? 279  GLN B CD  1 
ATOM   6265 O OE1 . GLN B 1 278 ? 13.829  -53.510 -40.008 1.00 53.10  ? 279  GLN B OE1 1 
ATOM   6266 N NE2 . GLN B 1 278 ? 14.282  -52.228 -38.203 1.00 42.87  ? 279  GLN B NE2 1 
ATOM   6267 N N   . VAL B 1 279 ? 11.765  -48.255 -40.936 1.00 50.58  ? 280  VAL B N   1 
ATOM   6268 C CA  . VAL B 1 279 ? 11.820  -46.879 -40.432 1.00 51.22  ? 280  VAL B CA  1 
ATOM   6269 C C   . VAL B 1 279 ? 10.798  -46.688 -39.303 1.00 47.46  ? 280  VAL B C   1 
ATOM   6270 O O   . VAL B 1 279 ? 11.107  -46.084 -38.264 1.00 46.13  ? 280  VAL B O   1 
ATOM   6271 C CB  . VAL B 1 279 ? 11.582  -45.850 -41.578 1.00 51.35  ? 280  VAL B CB  1 
ATOM   6272 C CG1 . VAL B 1 279 ? 11.231  -44.482 -41.030 1.00 42.33  ? 280  VAL B CG1 1 
ATOM   6273 C CG2 . VAL B 1 279 ? 12.828  -45.767 -42.479 1.00 49.21  ? 280  VAL B CG2 1 
ATOM   6274 N N   . LEU B 1 280 ? 9.594   -47.220 -39.522 1.00 45.11  ? 281  LEU B N   1 
ATOM   6275 C CA  . LEU B 1 280 ? 8.549   -47.230 -38.518 1.00 42.55  ? 281  LEU B CA  1 
ATOM   6276 C C   . LEU B 1 280 ? 9.053   -47.935 -37.259 1.00 51.75  ? 281  LEU B C   1 
ATOM   6277 O O   . LEU B 1 280 ? 9.000   -47.367 -36.162 1.00 53.17  ? 281  LEU B O   1 
ATOM   6278 C CB  . LEU B 1 280 ? 7.283   -47.908 -39.055 1.00 40.39  ? 281  LEU B CB  1 
ATOM   6279 C CG  . LEU B 1 280 ? 6.647   -47.175 -40.238 1.00 49.25  ? 281  LEU B CG  1 
ATOM   6280 C CD1 . LEU B 1 280 ? 5.378   -47.857 -40.728 1.00 39.48  ? 281  LEU B CD1 1 
ATOM   6281 C CD2 . LEU B 1 280 ? 6.357   -45.734 -39.853 1.00 49.72  ? 281  LEU B CD2 1 
ATOM   6282 N N   . VAL B 1 281 ? 9.562   -49.155 -37.420 1.00 49.76  ? 282  VAL B N   1 
ATOM   6283 C CA  . VAL B 1 281 ? 10.099  -49.923 -36.299 1.00 49.28  ? 282  VAL B CA  1 
ATOM   6284 C C   . VAL B 1 281 ? 11.147  -49.149 -35.511 1.00 51.42  ? 282  VAL B C   1 
ATOM   6285 O O   . VAL B 1 281 ? 11.117  -49.128 -34.279 1.00 53.84  ? 282  VAL B O   1 
ATOM   6286 C CB  . VAL B 1 281 ? 10.706  -51.245 -36.783 1.00 46.31  ? 282  VAL B CB  1 
ATOM   6287 C CG1 . VAL B 1 281 ? 11.545  -51.877 -35.703 1.00 45.61  ? 282  VAL B CG1 1 
ATOM   6288 C CG2 . VAL B 1 281 ? 9.597   -52.176 -37.193 1.00 46.30  ? 282  VAL B CG2 1 
ATOM   6289 N N   . ASN B 1 282 ? 12.046  -48.474 -36.217 1.00 50.62  ? 283  ASN B N   1 
ATOM   6290 C CA  . ASN B 1 282 ? 13.124  -47.753 -35.550 1.00 52.11  ? 283  ASN B CA  1 
ATOM   6291 C C   . ASN B 1 282 ? 12.655  -46.603 -34.686 1.00 50.64  ? 283  ASN B C   1 
ATOM   6292 O O   . ASN B 1 282 ? 13.377  -46.168 -33.789 1.00 54.11  ? 283  ASN B O   1 
ATOM   6293 C CB  . ASN B 1 282 ? 14.135  -47.233 -36.571 1.00 54.59  ? 283  ASN B CB  1 
ATOM   6294 C CG  . ASN B 1 282 ? 14.910  -48.353 -37.224 1.00 57.57  ? 283  ASN B CG  1 
ATOM   6295 O OD1 . ASN B 1 282 ? 14.863  -49.500 -36.762 1.00 53.59  ? 283  ASN B OD1 1 
ATOM   6296 N ND2 . ASN B 1 282 ? 15.625  -48.037 -38.304 1.00 59.09  ? 283  ASN B ND2 1 
ATOM   6297 N N   . HIS B 1 283 ? 11.444  -46.119 -34.937 1.00 49.52  ? 284  HIS B N   1 
ATOM   6298 C CA  . HIS B 1 283 ? 10.964  -44.954 -34.213 1.00 51.79  ? 284  HIS B CA  1 
ATOM   6299 C C   . HIS B 1 283 ? 9.870   -45.279 -33.207 1.00 55.17  ? 284  HIS B C   1 
ATOM   6300 O O   . HIS B 1 283 ? 9.465   -44.417 -32.418 1.00 52.21  ? 284  HIS B O   1 
ATOM   6301 C CB  . HIS B 1 283 ? 10.467  -43.902 -35.201 1.00 46.44  ? 284  HIS B CB  1 
ATOM   6302 C CG  . HIS B 1 283 ? 11.573  -43.199 -35.927 1.00 57.40  ? 284  HIS B CG  1 
ATOM   6303 N ND1 . HIS B 1 283 ? 11.875  -43.442 -37.252 1.00 55.49  ? 284  HIS B ND1 1 
ATOM   6304 C CD2 . HIS B 1 283 ? 12.463  -42.271 -35.502 1.00 54.97  ? 284  HIS B CD2 1 
ATOM   6305 C CE1 . HIS B 1 283 ? 12.898  -42.687 -37.611 1.00 57.38  ? 284  HIS B CE1 1 
ATOM   6306 N NE2 . HIS B 1 283 ? 13.271  -41.965 -36.568 1.00 49.93  ? 284  HIS B NE2 1 
ATOM   6307 N N   . GLU B 1 284 ? 9.401   -46.521 -33.211 1.00 51.08  ? 285  GLU B N   1 
ATOM   6308 C CA  . GLU B 1 284 ? 8.190   -46.827 -32.474 1.00 55.67  ? 285  GLU B CA  1 
ATOM   6309 C C   . GLU B 1 284 ? 8.346   -46.648 -30.947 1.00 58.85  ? 285  GLU B C   1 
ATOM   6310 O O   . GLU B 1 284 ? 7.384   -46.307 -30.266 1.00 54.25  ? 285  GLU B O   1 
ATOM   6311 C CB  . GLU B 1 284 ? 7.714   -48.238 -32.822 1.00 54.41  ? 285  GLU B CB  1 
ATOM   6312 C CG  . GLU B 1 284 ? 7.908   -49.268 -31.717 1.00 61.17  ? 285  GLU B CG  1 
ATOM   6313 C CD  . GLU B 1 284 ? 7.445   -50.653 -32.141 1.00 63.06  ? 285  GLU B CD  1 
ATOM   6314 O OE1 . GLU B 1 284 ? 6.464   -50.736 -32.924 1.00 68.32  ? 285  GLU B OE1 1 
ATOM   6315 O OE2 . GLU B 1 284 ? 8.075   -51.641 -31.710 1.00 53.91  ? 285  GLU B OE2 1 
ATOM   6316 N N   . TRP B 1 285 ? 9.542   -46.816 -30.397 1.00 55.66  ? 286  TRP B N   1 
ATOM   6317 C CA  . TRP B 1 285 ? 9.640   -46.703 -28.943 1.00 60.64  ? 286  TRP B CA  1 
ATOM   6318 C C   . TRP B 1 285 ? 9.757   -45.271 -28.450 1.00 59.45  ? 286  TRP B C   1 
ATOM   6319 O O   . TRP B 1 285 ? 9.591   -45.026 -27.264 1.00 60.24  ? 286  TRP B O   1 
ATOM   6320 C CB  . TRP B 1 285 ? 10.811  -47.512 -28.398 1.00 60.13  ? 286  TRP B CB  1 
ATOM   6321 C CG  . TRP B 1 285 ? 10.398  -48.436 -27.274 1.00 63.82  ? 286  TRP B CG  1 
ATOM   6322 C CD1 . TRP B 1 285 ? 10.913  -48.471 -25.998 1.00 65.73  ? 286  TRP B CD1 1 
ATOM   6323 C CD2 . TRP B 1 285 ? 9.371   -49.445 -27.320 1.00 64.11  ? 286  TRP B CD2 1 
ATOM   6324 N NE1 . TRP B 1 285 ? 10.283  -49.446 -25.258 1.00 63.55  ? 286  TRP B NE1 1 
ATOM   6325 C CE2 . TRP B 1 285 ? 9.335   -50.061 -26.039 1.00 64.57  ? 286  TRP B CE2 1 
ATOM   6326 C CE3 . TRP B 1 285 ? 8.474   -49.883 -28.316 1.00 59.80  ? 286  TRP B CE3 1 
ATOM   6327 C CZ2 . TRP B 1 285 ? 8.447   -51.105 -25.731 1.00 55.46  ? 286  TRP B CZ2 1 
ATOM   6328 C CZ3 . TRP B 1 285 ? 7.593   -50.917 -28.014 1.00 57.84  ? 286  TRP B CZ3 1 
ATOM   6329 C CH2 . TRP B 1 285 ? 7.584   -51.516 -26.721 1.00 60.08  ? 286  TRP B CH2 1 
ATOM   6330 N N   . HIS B 1 286 ? 10.000  -44.326 -29.359 1.00 60.71  ? 287  HIS B N   1 
ATOM   6331 C CA  . HIS B 1 286 ? 10.084  -42.916 -28.982 1.00 59.03  ? 287  HIS B CA  1 
ATOM   6332 C C   . HIS B 1 286 ? 8.726   -42.263 -28.700 1.00 61.45  ? 287  HIS B C   1 
ATOM   6333 O O   . HIS B 1 286 ? 8.667   -41.109 -28.272 1.00 64.12  ? 287  HIS B O   1 
ATOM   6334 C CB  . HIS B 1 286 ? 10.826  -42.135 -30.064 1.00 60.51  ? 287  HIS B CB  1 
ATOM   6335 C CG  . HIS B 1 286 ? 12.237  -42.595 -30.259 1.00 69.23  ? 287  HIS B CG  1 
ATOM   6336 N ND1 . HIS B 1 286 ? 12.915  -42.448 -31.449 1.00 73.20  ? 287  HIS B ND1 1 
ATOM   6337 C CD2 . HIS B 1 286 ? 13.094  -43.216 -29.412 1.00 69.92  ? 287  HIS B CD2 1 
ATOM   6338 C CE1 . HIS B 1 286 ? 14.131  -42.955 -31.325 1.00 75.14  ? 287  HIS B CE1 1 
ATOM   6339 N NE2 . HIS B 1 286 ? 14.266  -43.425 -30.098 1.00 69.86  ? 287  HIS B NE2 1 
ATOM   6340 N N   . VAL B 1 287 ? 7.636   -42.997 -28.899 1.00 56.98  ? 288  VAL B N   1 
ATOM   6341 C CA  . VAL B 1 287 ? 6.321   -42.416 -28.671 1.00 58.65  ? 288  VAL B CA  1 
ATOM   6342 C C   . VAL B 1 287 ? 5.741   -42.702 -27.277 1.00 60.87  ? 288  VAL B C   1 
ATOM   6343 O O   . VAL B 1 287 ? 4.662   -42.216 -26.955 1.00 63.81  ? 288  VAL B O   1 
ATOM   6344 C CB  . VAL B 1 287 ? 5.299   -42.884 -29.758 1.00 55.89  ? 288  VAL B CB  1 
ATOM   6345 C CG1 . VAL B 1 287 ? 5.902   -42.732 -31.153 1.00 53.71  ? 288  VAL B CG1 1 
ATOM   6346 C CG2 . VAL B 1 287 ? 4.841   -44.318 -29.518 1.00 50.04  ? 288  VAL B CG2 1 
ATOM   6347 N N   . LEU B 1 288 ? 6.438   -43.457 -26.433 1.00 64.12  ? 289  LEU B N   1 
ATOM   6348 C CA  . LEU B 1 288 ? 5.913   -43.696 -25.086 1.00 60.72  ? 289  LEU B CA  1 
ATOM   6349 C C   . LEU B 1 288 ? 5.990   -42.424 -24.240 1.00 68.89  ? 289  LEU B C   1 
ATOM   6350 O O   . LEU B 1 288 ? 6.930   -41.635 -24.395 1.00 66.38  ? 289  LEU B O   1 
ATOM   6351 C CB  . LEU B 1 288 ? 6.660   -44.839 -24.393 1.00 57.83  ? 289  LEU B CB  1 
ATOM   6352 C CG  . LEU B 1 288 ? 6.243   -46.241 -24.856 1.00 64.72  ? 289  LEU B CG  1 
ATOM   6353 C CD1 . LEU B 1 288 ? 6.909   -47.346 -24.037 1.00 55.00  ? 289  LEU B CD1 1 
ATOM   6354 C CD2 . LEU B 1 288 ? 4.728   -46.386 -24.850 1.00 53.49  ? 289  LEU B CD2 1 
ATOM   6355 N N   . PRO B 1 289 ? 4.992   -42.222 -23.346 1.00 73.81  ? 290  PRO B N   1 
ATOM   6356 C CA  . PRO B 1 289 ? 4.886   -41.050 -22.457 1.00 75.00  ? 290  PRO B CA  1 
ATOM   6357 C C   . PRO B 1 289 ? 6.045   -40.923 -21.460 1.00 76.51  ? 290  PRO B C   1 
ATOM   6358 O O   . PRO B 1 289 ? 6.645   -39.847 -21.370 1.00 80.75  ? 290  PRO B O   1 
ATOM   6359 C CB  . PRO B 1 289 ? 3.550   -41.277 -21.722 1.00 74.36  ? 290  PRO B CB  1 
ATOM   6360 C CG  . PRO B 1 289 ? 3.258   -42.740 -21.858 1.00 66.72  ? 290  PRO B CG  1 
ATOM   6361 C CD  . PRO B 1 289 ? 3.826   -43.120 -23.202 1.00 67.19  ? 290  PRO B CD  1 
ATOM   6362 N N   . GLN B 1 290 ? 6.353   -41.986 -20.720 1.00 72.19  ? 291  GLN B N   1 
ATOM   6363 C CA  . GLN B 1 290 ? 7.545   -41.972 -19.871 1.00 76.15  ? 291  GLN B CA  1 
ATOM   6364 C C   . GLN B 1 290 ? 8.434   -43.168 -20.194 1.00 75.78  ? 291  GLN B C   1 
ATOM   6365 O O   . GLN B 1 290 ? 8.033   -44.083 -20.931 1.00 70.70  ? 291  GLN B O   1 
ATOM   6366 C CB  . GLN B 1 290 ? 7.181   -41.967 -18.374 1.00 73.53  ? 291  GLN B CB  1 
ATOM   6367 C CG  . GLN B 1 290 ? 6.918   -43.347 -17.759 1.00 72.40  ? 291  GLN B CG  1 
ATOM   6368 C CD  . GLN B 1 290 ? 6.965   -43.341 -16.210 1.00 78.62  ? 291  GLN B CD  1 
ATOM   6369 O OE1 . GLN B 1 290 ? 5.989   -42.956 -15.537 1.00 77.68  ? 291  GLN B OE1 1 
ATOM   6370 N NE2 . GLN B 1 290 ? 8.104   -43.771 -15.646 1.00 64.95  ? 291  GLN B NE2 1 
ATOM   6371 N N   . GLU B 1 291 ? 9.653   -43.152 -19.661 1.00 69.24  ? 292  GLU B N   1 
ATOM   6372 C CA  . GLU B 1 291 ? 10.520  -44.302 -19.810 1.00 67.94  ? 292  GLU B CA  1 
ATOM   6373 C C   . GLU B 1 291 ? 10.086  -45.344 -18.793 1.00 72.35  ? 292  GLU B C   1 
ATOM   6374 O O   . GLU B 1 291 ? 9.777   -45.036 -17.632 1.00 60.64  ? 292  GLU B O   1 
ATOM   6375 C CB  . GLU B 1 291 ? 11.991  -43.929 -19.641 1.00 75.09  ? 292  GLU B CB  1 
ATOM   6376 C CG  . GLU B 1 291 ? 12.834  -44.236 -20.882 1.00 76.53  ? 292  GLU B CG  1 
ATOM   6377 C CD  . GLU B 1 291 ? 13.712  -43.065 -21.285 1.00 86.80  ? 292  GLU B CD  1 
ATOM   6378 O OE1 . GLU B 1 291 ? 13.532  -41.970 -20.706 1.00 97.28  ? 292  GLU B OE1 1 
ATOM   6379 O OE2 . GLU B 1 291 ? 14.582  -43.232 -22.171 1.00 90.08  ? 292  GLU B OE2 1 
ATOM   6380 N N   . SER B 1 292 ? 10.029  -46.581 -19.256 1.00 70.60  ? 293  SER B N   1 
ATOM   6381 C CA  . SER B 1 292 ? 9.512   -47.662 -18.447 1.00 63.40  ? 293  SER B CA  1 
ATOM   6382 C C   . SER B 1 292 ? 10.001  -49.016 -18.929 1.00 63.71  ? 293  SER B C   1 
ATOM   6383 O O   . SER B 1 292 ? 10.480  -49.175 -20.052 1.00 77.45  ? 293  SER B O   1 
ATOM   6384 C CB  . SER B 1 292 ? 7.986   -47.638 -18.451 1.00 62.84  ? 293  SER B CB  1 
ATOM   6385 O OG  . SER B 1 292 ? 7.469   -47.661 -19.769 1.00 63.36  ? 293  SER B OG  1 
ATOM   6386 N N   . VAL B 1 293 ? 9.916   -49.987 -18.037 1.00 69.15  ? 294  VAL B N   1 
ATOM   6387 C CA  . VAL B 1 293 ? 9.864   -51.370 -18.445 1.00 67.33  ? 294  VAL B CA  1 
ATOM   6388 C C   . VAL B 1 293 ? 8.370   -51.708 -18.457 1.00 68.63  ? 294  VAL B C   1 
ATOM   6389 O O   . VAL B 1 293 ? 7.562   -51.028 -17.796 1.00 63.83  ? 294  VAL B O   1 
ATOM   6390 C CB  . VAL B 1 293 ? 10.639  -52.292 -17.491 1.00 61.78  ? 294  VAL B CB  1 
ATOM   6391 C CG1 . VAL B 1 293 ? 12.020  -51.726 -17.222 1.00 58.37  ? 294  VAL B CG1 1 
ATOM   6392 C CG2 . VAL B 1 293 ? 9.880   -52.464 -16.192 1.00 53.19  ? 294  VAL B CG2 1 
ATOM   6393 N N   A PHE B 1 294 ? 7.994   -52.721 -19.229 0.80 61.63  ? 295  PHE B N   1 
ATOM   6394 N N   B PHE B 1 294 ? 8.007   -52.722 -19.236 0.20 61.58  ? 295  PHE B N   1 
ATOM   6395 C CA  A PHE B 1 294 ? 6.618   -53.199 -19.210 0.80 59.39  ? 295  PHE B CA  1 
ATOM   6396 C CA  B PHE B 1 294 ? 6.640   -53.244 -19.280 0.20 59.30  ? 295  PHE B CA  1 
ATOM   6397 C C   A PHE B 1 294 ? 5.551   -52.260 -19.777 0.80 59.34  ? 295  PHE B C   1 
ATOM   6398 C C   B PHE B 1 294 ? 5.574   -52.259 -19.768 0.20 59.18  ? 295  PHE B C   1 
ATOM   6399 O O   A PHE B 1 294 ? 4.399   -52.287 -19.317 0.80 58.85  ? 295  PHE B O   1 
ATOM   6400 O O   B PHE B 1 294 ? 4.454   -52.251 -19.252 0.20 58.66  ? 295  PHE B O   1 
ATOM   6401 C CB  A PHE B 1 294 ? 6.223   -53.558 -17.776 0.80 57.99  ? 295  PHE B CB  1 
ATOM   6402 C CB  B PHE B 1 294 ? 6.236   -53.766 -17.900 0.20 57.64  ? 295  PHE B CB  1 
ATOM   6403 C CG  A PHE B 1 294 ? 5.779   -54.944 -17.652 0.80 55.02  ? 295  PHE B CG  1 
ATOM   6404 C CG  B PHE B 1 294 ? 5.599   -55.116 -17.943 0.20 54.90  ? 295  PHE B CG  1 
ATOM   6405 C CD1 A PHE B 1 294 ? 4.843   -55.432 -18.547 0.80 55.34  ? 295  PHE B CD1 1 
ATOM   6406 C CD1 B PHE B 1 294 ? 4.585   -55.390 -18.852 0.20 53.89  ? 295  PHE B CD1 1 
ATOM   6407 C CD2 A PHE B 1 294 ? 6.348   -55.797 -16.727 0.80 54.05  ? 295  PHE B CD2 1 
ATOM   6408 C CD2 B PHE B 1 294 ? 6.037   -56.125 -17.105 0.20 53.60  ? 295  PHE B CD2 1 
ATOM   6409 C CE1 A PHE B 1 294 ? 4.429   -56.728 -18.480 0.80 54.83  ? 295  PHE B CE1 1 
ATOM   6410 C CE1 B PHE B 1 294 ? 4.001   -56.644 -18.908 0.20 51.61  ? 295  PHE B CE1 1 
ATOM   6411 C CE2 A PHE B 1 294 ? 5.937   -57.115 -16.652 0.80 55.18  ? 295  PHE B CE2 1 
ATOM   6412 C CE2 B PHE B 1 294 ? 5.460   -57.379 -17.152 0.20 52.53  ? 295  PHE B CE2 1 
ATOM   6413 C CZ  A PHE B 1 294 ? 4.982   -57.590 -17.540 0.80 52.82  ? 295  PHE B CZ  1 
ATOM   6414 C CZ  B PHE B 1 294 ? 4.442   -57.643 -18.055 0.20 51.70  ? 295  PHE B CZ  1 
ATOM   6415 N N   . ARG B 1 295 ? 5.918   -51.440 -20.756 1.00 53.62  ? 296  ARG B N   1 
ATOM   6416 C CA  . ARG B 1 295 ? 4.930   -50.627 -21.464 1.00 54.20  ? 296  ARG B CA  1 
ATOM   6417 C C   . ARG B 1 295 ? 5.300   -50.600 -22.941 1.00 60.11  ? 296  ARG B C   1 
ATOM   6418 O O   . ARG B 1 295 ? 6.472   -50.450 -23.292 1.00 56.37  ? 296  ARG B O   1 
ATOM   6419 C CB  . ARG B 1 295 ? 4.841   -49.208 -20.919 1.00 56.24  ? 296  ARG B CB  1 
ATOM   6420 C CG  . ARG B 1 295 ? 4.095   -49.103 -19.585 1.00 62.38  ? 296  ARG B CG  1 
ATOM   6421 C CD  . ARG B 1 295 ? 2.632   -49.611 -19.625 1.00 52.69  ? 296  ARG B CD  1 
ATOM   6422 N NE  . ARG B 1 295 ? 1.975   -49.379 -18.334 1.00 62.40  ? 296  ARG B NE  1 
ATOM   6423 C CZ  . ARG B 1 295 ? 2.103   -50.150 -17.243 1.00 57.93  ? 296  ARG B CZ  1 
ATOM   6424 N NH1 . ARG B 1 295 ? 2.855   -51.249 -17.256 1.00 49.48  ? 296  ARG B NH1 1 
ATOM   6425 N NH2 . ARG B 1 295 ? 1.470   -49.814 -16.123 1.00 58.67  ? 296  ARG B NH2 1 
ATOM   6426 N N   . PHE B 1 296 ? 4.299   -50.758 -23.799 1.00 50.54  ? 297  PHE B N   1 
ATOM   6427 C CA  . PHE B 1 296 ? 4.537   -50.951 -25.213 1.00 49.23  ? 297  PHE B CA  1 
ATOM   6428 C C   . PHE B 1 296 ? 3.724   -49.960 -26.037 1.00 50.14  ? 297  PHE B C   1 
ATOM   6429 O O   . PHE B 1 296 ? 2.560   -49.675 -25.736 1.00 51.07  ? 297  PHE B O   1 
ATOM   6430 C CB  . PHE B 1 296 ? 4.197   -52.377 -25.589 1.00 48.18  ? 297  PHE B CB  1 
ATOM   6431 C CG  . PHE B 1 296 ? 4.512   -53.383 -24.509 1.00 50.79  ? 297  PHE B CG  1 
ATOM   6432 C CD1 . PHE B 1 296 ? 5.821   -53.712 -24.208 1.00 49.60  ? 297  PHE B CD1 1 
ATOM   6433 C CD2 . PHE B 1 296 ? 3.499   -54.030 -23.828 1.00 46.53  ? 297  PHE B CD2 1 
ATOM   6434 C CE1 . PHE B 1 296 ? 6.114   -54.649 -23.225 1.00 52.90  ? 297  PHE B CE1 1 
ATOM   6435 C CE2 . PHE B 1 296 ? 3.795   -54.978 -22.837 1.00 46.65  ? 297  PHE B CE2 1 
ATOM   6436 C CZ  . PHE B 1 296 ? 5.102   -55.279 -22.541 1.00 46.65  ? 297  PHE B CZ  1 
ATOM   6437 N N   . SER B 1 297 ? 4.345   -49.440 -27.080 1.00 45.56  ? 298  SER B N   1 
ATOM   6438 C CA  . SER B 1 297 ? 3.790   -48.331 -27.846 1.00 51.31  ? 298  SER B CA  1 
ATOM   6439 C C   . SER B 1 297 ? 2.442   -48.592 -28.517 1.00 42.51  ? 298  SER B C   1 
ATOM   6440 O O   . SER B 1 297 ? 1.533   -47.785 -28.423 1.00 46.94  ? 298  SER B O   1 
ATOM   6441 C CB  . SER B 1 297 ? 4.803   -47.903 -28.910 1.00 44.27  ? 298  SER B CB  1 
ATOM   6442 O OG  . SER B 1 297 ? 5.869   -47.202 -28.312 1.00 50.65  ? 298  SER B OG  1 
ATOM   6443 N N   . PHE B 1 298 ? 2.311   -49.704 -29.207 1.00 39.21  ? 299  PHE B N   1 
ATOM   6444 C CA  . PHE B 1 298 ? 1.100   -49.933 -29.952 1.00 36.68  ? 299  PHE B CA  1 
ATOM   6445 C C   . PHE B 1 298 ? 0.478   -51.227 -29.509 1.00 39.26  ? 299  PHE B C   1 
ATOM   6446 O O   . PHE B 1 298 ? 1.021   -52.302 -29.739 1.00 33.77  ? 299  PHE B O   1 
ATOM   6447 C CB  . PHE B 1 298 ? 1.389   -49.939 -31.466 1.00 44.66  ? 299  PHE B CB  1 
ATOM   6448 C CG  . PHE B 1 298 ? 1.889   -48.613 -31.976 1.00 45.17  ? 299  PHE B CG  1 
ATOM   6449 C CD1 . PHE B 1 298 ? 1.009   -47.555 -32.153 1.00 40.05  ? 299  PHE B CD1 1 
ATOM   6450 C CD2 . PHE B 1 298 ? 3.239   -48.405 -32.217 1.00 42.34  ? 299  PHE B CD2 1 
ATOM   6451 C CE1 . PHE B 1 298 ? 1.458   -46.324 -32.600 1.00 42.09  ? 299  PHE B CE1 1 
ATOM   6452 C CE2 . PHE B 1 298 ? 3.693   -47.175 -32.655 1.00 44.90  ? 299  PHE B CE2 1 
ATOM   6453 C CZ  . PHE B 1 298 ? 2.800   -46.135 -32.848 1.00 44.40  ? 299  PHE B CZ  1 
ATOM   6454 N N   . VAL B 1 299 ? -0.675  -51.108 -28.861 1.00 38.42  ? 300  VAL B N   1 
ATOM   6455 C CA  . VAL B 1 299 ? -1.338  -52.240 -28.245 1.00 33.01  ? 300  VAL B CA  1 
ATOM   6456 C C   . VAL B 1 299 ? -2.822  -52.110 -28.596 1.00 36.39  ? 300  VAL B C   1 
ATOM   6457 O O   . VAL B 1 299 ? -3.221  -51.090 -29.164 1.00 35.22  ? 300  VAL B O   1 
ATOM   6458 C CB  . VAL B 1 299 ? -1.086  -52.253 -26.716 1.00 40.21  ? 300  VAL B CB  1 
ATOM   6459 C CG1 . VAL B 1 299 ? 0.421   -52.135 -26.427 1.00 34.34  ? 300  VAL B CG1 1 
ATOM   6460 C CG2 . VAL B 1 299 ? -1.890  -51.143 -26.027 1.00 35.88  ? 300  VAL B CG2 1 
ATOM   6461 N N   . PRO B 1 300 ? -3.635  -53.141 -28.308 1.00 33.98  ? 301  PRO B N   1 
ATOM   6462 C CA  . PRO B 1 300 ? -5.069  -52.999 -28.580 1.00 41.02  ? 301  PRO B CA  1 
ATOM   6463 C C   . PRO B 1 300 ? -5.676  -51.714 -28.000 1.00 42.34  ? 301  PRO B C   1 
ATOM   6464 O O   . PRO B 1 300 ? -5.249  -51.234 -26.943 1.00 40.62  ? 301  PRO B O   1 
ATOM   6465 C CB  . PRO B 1 300 ? -5.660  -54.242 -27.906 1.00 36.11  ? 301  PRO B CB  1 
ATOM   6466 C CG  . PRO B 1 300 ? -4.611  -55.253 -28.146 1.00 35.69  ? 301  PRO B CG  1 
ATOM   6467 C CD  . PRO B 1 300 ? -3.317  -54.519 -27.890 1.00 32.70  ? 301  PRO B CD  1 
ATOM   6468 N N   . VAL B 1 301 ? -6.637  -51.148 -28.723 1.00 39.16  ? 302  VAL B N   1 
ATOM   6469 C CA  . VAL B 1 301 ? -7.270  -49.905 -28.322 1.00 35.97  ? 302  VAL B CA  1 
ATOM   6470 C C   . VAL B 1 301 ? -8.730  -50.180 -27.973 1.00 39.37  ? 302  VAL B C   1 
ATOM   6471 O O   . VAL B 1 301 ? -9.396  -51.002 -28.602 1.00 40.96  ? 302  VAL B O   1 
ATOM   6472 C CB  . VAL B 1 301 ? -7.155  -48.835 -29.452 1.00 46.38  ? 302  VAL B CB  1 
ATOM   6473 C CG1 . VAL B 1 301 ? -7.756  -49.361 -30.758 1.00 33.52  ? 302  VAL B CG1 1 
ATOM   6474 C CG2 . VAL B 1 301 ? -7.791  -47.516 -29.033 1.00 41.76  ? 302  VAL B CG2 1 
ATOM   6475 N N   . VAL B 1 302 ? -9.220  -49.520 -26.931 1.00 44.34  ? 303  VAL B N   1 
ATOM   6476 C CA  . VAL B 1 302 ? -10.619 -49.668 -26.551 1.00 46.21  ? 303  VAL B CA  1 
ATOM   6477 C C   . VAL B 1 302 ? -11.417 -48.604 -27.294 1.00 47.27  ? 303  VAL B C   1 
ATOM   6478 O O   . VAL B 1 302 ? -11.285 -47.421 -26.996 1.00 45.93  ? 303  VAL B O   1 
ATOM   6479 C CB  . VAL B 1 302 ? -10.827 -49.512 -25.032 1.00 47.18  ? 303  VAL B CB  1 
ATOM   6480 C CG1 . VAL B 1 302 ? -12.300 -49.630 -24.699 1.00 40.04  ? 303  VAL B CG1 1 
ATOM   6481 C CG2 . VAL B 1 302 ? -9.988  -50.542 -24.271 1.00 42.43  ? 303  VAL B CG2 1 
ATOM   6482 N N   . ASP B 1 303 ? -12.240 -49.013 -28.250 1.00 46.97  ? 304  ASP B N   1 
ATOM   6483 C CA  . ASP B 1 303 ? -12.852 -48.026 -29.144 1.00 57.47  ? 304  ASP B CA  1 
ATOM   6484 C C   . ASP B 1 303 ? -14.309 -48.318 -29.497 1.00 51.43  ? 304  ASP B C   1 
ATOM   6485 O O   . ASP B 1 303 ? -14.894 -47.648 -30.333 1.00 54.41  ? 304  ASP B O   1 
ATOM   6486 C CB  . ASP B 1 303 ? -12.033 -47.923 -30.424 1.00 52.08  ? 304  ASP B CB  1 
ATOM   6487 C CG  . ASP B 1 303 ? -12.145 -49.165 -31.272 1.00 55.35  ? 304  ASP B CG  1 
ATOM   6488 O OD1 . ASP B 1 303 ? -12.567 -50.231 -30.739 1.00 51.39  ? 304  ASP B OD1 1 
ATOM   6489 O OD2 . ASP B 1 303 ? -11.814 -49.069 -32.470 1.00 55.93  ? 304  ASP B OD2 1 
ATOM   6490 N N   . GLY B 1 304 ? -14.881 -49.329 -28.862 1.00 49.34  ? 305  GLY B N   1 
ATOM   6491 C CA  . GLY B 1 304 ? -16.295 -49.586 -29.003 1.00 54.44  ? 305  GLY B CA  1 
ATOM   6492 C C   . GLY B 1 304 ? -16.569 -50.633 -30.053 1.00 55.90  ? 305  GLY B C   1 
ATOM   6493 O O   . GLY B 1 304 ? -17.703 -51.085 -30.209 1.00 59.76  ? 305  GLY B O   1 
ATOM   6494 N N   . ASP B 1 305 ? -15.522 -51.032 -30.765 1.00 49.33  ? 306  ASP B N   1 
ATOM   6495 C CA  . ASP B 1 305 ? -15.679 -51.964 -31.873 1.00 52.28  ? 306  ASP B CA  1 
ATOM   6496 C C   . ASP B 1 305 ? -15.262 -53.380 -31.438 1.00 51.89  ? 306  ASP B C   1 
ATOM   6497 O O   . ASP B 1 305 ? -16.095 -54.134 -30.922 1.00 48.76  ? 306  ASP B O   1 
ATOM   6498 C CB  . ASP B 1 305 ? -14.869 -51.470 -33.074 1.00 51.47  ? 306  ASP B CB  1 
ATOM   6499 C CG  . ASP B 1 305 ? -15.130 -52.267 -34.342 1.00 55.85  ? 306  ASP B CG  1 
ATOM   6500 O OD1 . ASP B 1 305 ? -15.801 -53.318 -34.286 1.00 58.39  ? 306  ASP B OD1 1 
ATOM   6501 O OD2 . ASP B 1 305 ? -14.637 -51.832 -35.402 1.00 53.65  ? 306  ASP B OD2 1 
ATOM   6502 N N   . PHE B 1 306 ? -13.994 -53.745 -31.643 1.00 48.64  ? 307  PHE B N   1 
ATOM   6503 C CA  . PHE B 1 306 ? -13.524 -55.057 -31.211 1.00 44.72  ? 307  PHE B CA  1 
ATOM   6504 C C   . PHE B 1 306 ? -13.852 -55.233 -29.724 1.00 45.48  ? 307  PHE B C   1 
ATOM   6505 O O   . PHE B 1 306 ? -14.357 -56.274 -29.302 1.00 46.09  ? 307  PHE B O   1 
ATOM   6506 C CB  . PHE B 1 306 ? -12.021 -55.223 -31.459 1.00 40.46  ? 307  PHE B CB  1 
ATOM   6507 C CG  . PHE B 1 306 ? -11.558 -56.650 -31.363 1.00 44.29  ? 307  PHE B CG  1 
ATOM   6508 C CD1 . PHE B 1 306 ? -11.364 -57.251 -30.122 1.00 40.78  ? 307  PHE B CD1 1 
ATOM   6509 C CD2 . PHE B 1 306 ? -11.344 -57.399 -32.507 1.00 38.04  ? 307  PHE B CD2 1 
ATOM   6510 C CE1 . PHE B 1 306 ? -10.964 -58.574 -30.023 1.00 42.26  ? 307  PHE B CE1 1 
ATOM   6511 C CE2 . PHE B 1 306 ? -10.935 -58.723 -32.416 1.00 45.70  ? 307  PHE B CE2 1 
ATOM   6512 C CZ  . PHE B 1 306 ? -10.748 -59.318 -31.162 1.00 42.27  ? 307  PHE B CZ  1 
ATOM   6513 N N   . LEU B 1 307 ? -13.557 -54.184 -28.955 1.00 46.94  ? 308  LEU B N   1 
ATOM   6514 C CA  . LEU B 1 307 ? -13.874 -54.074 -27.535 1.00 50.84  ? 308  LEU B CA  1 
ATOM   6515 C C   . LEU B 1 307 ? -14.890 -52.961 -27.282 1.00 51.46  ? 308  LEU B C   1 
ATOM   6516 O O   . LEU B 1 307 ? -14.567 -51.782 -27.440 1.00 50.47  ? 308  LEU B O   1 
ATOM   6517 C CB  . LEU B 1 307 ? -12.609 -53.784 -26.724 1.00 50.37  ? 308  LEU B CB  1 
ATOM   6518 C CG  . LEU B 1 307 ? -11.529 -54.858 -26.696 1.00 52.39  ? 308  LEU B CG  1 
ATOM   6519 C CD1 . LEU B 1 307 ? -10.278 -54.267 -26.088 1.00 48.77  ? 308  LEU B CD1 1 
ATOM   6520 C CD2 . LEU B 1 307 ? -12.005 -56.081 -25.912 1.00 43.28  ? 308  LEU B CD2 1 
ATOM   6521 N N   . SER B 1 308 ? -16.098 -53.327 -26.860 1.00 54.51  ? 309  SER B N   1 
ATOM   6522 C CA  . SER B 1 308 ? -17.186 -52.352 -26.664 1.00 59.70  ? 309  SER B CA  1 
ATOM   6523 C C   . SER B 1 308 ? -17.019 -51.521 -25.387 1.00 59.82  ? 309  SER B C   1 
ATOM   6524 O O   . SER B 1 308 ? -17.669 -50.493 -25.212 1.00 67.60  ? 309  SER B O   1 
ATOM   6525 C CB  . SER B 1 308 ? -18.540 -53.064 -26.639 1.00 56.46  ? 309  SER B CB  1 
ATOM   6526 O OG  . SER B 1 308 ? -18.591 -54.048 -25.617 1.00 58.76  ? 309  SER B OG  1 
ATOM   6527 N N   . ASP B 1 309 ? -16.139 -51.984 -24.509 1.00 56.13  ? 310  ASP B N   1 
ATOM   6528 C CA  . ASP B 1 309 ? -15.816 -51.307 -23.258 1.00 56.60  ? 310  ASP B CA  1 
ATOM   6529 C C   . ASP B 1 309 ? -14.458 -51.840 -22.802 1.00 54.60  ? 310  ASP B C   1 
ATOM   6530 O O   . ASP B 1 309 ? -13.931 -52.770 -23.406 1.00 54.82  ? 310  ASP B O   1 
ATOM   6531 C CB  . ASP B 1 309 ? -16.893 -51.572 -22.194 1.00 61.31  ? 310  ASP B CB  1 
ATOM   6532 C CG  . ASP B 1 309 ? -16.960 -50.485 -21.132 1.00 57.66  ? 310  ASP B CG  1 
ATOM   6533 O OD1 . ASP B 1 309 ? -15.919 -49.876 -20.805 1.00 58.84  ? 310  ASP B OD1 1 
ATOM   6534 O OD2 . ASP B 1 309 ? -18.075 -50.244 -20.617 1.00 72.60  ? 310  ASP B OD2 1 
ATOM   6535 N N   . THR B 1 310 ? -13.906 -51.278 -21.733 1.00 53.52  ? 311  THR B N   1 
ATOM   6536 C CA  . THR B 1 310 ? -12.655 -51.773 -21.187 1.00 50.70  ? 311  THR B CA  1 
ATOM   6537 C C   . THR B 1 310 ? -12.774 -53.232 -20.778 1.00 52.05  ? 311  THR B C   1 
ATOM   6538 O O   . THR B 1 310 ? -13.854 -53.700 -20.408 1.00 46.49  ? 311  THR B O   1 
ATOM   6539 C CB  . THR B 1 310 ? -12.207 -50.979 -19.951 1.00 48.96  ? 311  THR B CB  1 
ATOM   6540 O OG1 . THR B 1 310 ? -12.976 -51.413 -18.834 1.00 50.52  ? 311  THR B OG1 1 
ATOM   6541 C CG2 . THR B 1 310 ? -12.377 -49.478 -20.160 1.00 48.01  ? 311  THR B CG2 1 
ATOM   6542 N N   . PRO B 1 311 ? -11.657 -53.961 -20.849 1.00 49.72  ? 312  PRO B N   1 
ATOM   6543 C CA  . PRO B 1 311 ? -11.658 -55.354 -20.409 1.00 49.11  ? 312  PRO B CA  1 
ATOM   6544 C C   . PRO B 1 311 ? -12.180 -55.518 -18.969 1.00 52.22  ? 312  PRO B C   1 
ATOM   6545 O O   . PRO B 1 311 ? -12.943 -56.448 -18.711 1.00 51.92  ? 312  PRO B O   1 
ATOM   6546 C CB  . PRO B 1 311 ? -10.184 -55.748 -20.524 1.00 43.63  ? 312  PRO B CB  1 
ATOM   6547 C CG  . PRO B 1 311 ? -9.668  -54.881 -21.658 1.00 45.04  ? 312  PRO B CG  1 
ATOM   6548 C CD  . PRO B 1 311 ? -10.407 -53.585 -21.541 1.00 46.79  ? 312  PRO B CD  1 
ATOM   6549 N N   . GLU B 1 312 ? -11.777 -54.635 -18.056 1.00 49.05  ? 313  GLU B N   1 
ATOM   6550 C CA  . GLU B 1 312 ? -12.297 -54.677 -16.698 1.00 59.53  ? 313  GLU B CA  1 
ATOM   6551 C C   . GLU B 1 312 ? -13.830 -54.691 -16.700 1.00 59.09  ? 313  GLU B C   1 
ATOM   6552 O O   . GLU B 1 312 ? -14.451 -55.623 -16.169 1.00 51.83  ? 313  GLU B O   1 
ATOM   6553 C CB  . GLU B 1 312 ? -11.785 -53.499 -15.879 1.00 58.48  ? 313  GLU B CB  1 
ATOM   6554 C CG  . GLU B 1 312 ? -12.189 -53.599 -14.417 1.00 71.37  ? 313  GLU B CG  1 
ATOM   6555 C CD  . GLU B 1 312 ? -12.368 -52.242 -13.731 1.00 82.88  ? 313  GLU B CD  1 
ATOM   6556 O OE1 . GLU B 1 312 ? -12.698 -51.248 -14.424 1.00 80.29  ? 313  GLU B OE1 1 
ATOM   6557 O OE2 . GLU B 1 312 ? -12.183 -52.180 -12.489 1.00 87.57  ? 313  GLU B OE2 1 
ATOM   6558 N N   . ALA B 1 313 ? -14.426 -53.674 -17.322 1.00 48.56  ? 314  ALA B N   1 
ATOM   6559 C CA  . ALA B 1 313 ? -15.872 -53.571 -17.389 1.00 46.98  ? 314  ALA B CA  1 
ATOM   6560 C C   . ALA B 1 313 ? -16.517 -54.811 -18.009 1.00 54.03  ? 314  ALA B C   1 
ATOM   6561 O O   . ALA B 1 313 ? -17.513 -55.325 -17.499 1.00 53.39  ? 314  ALA B O   1 
ATOM   6562 C CB  . ALA B 1 313 ? -16.273 -52.330 -18.174 1.00 52.36  ? 314  ALA B CB  1 
ATOM   6563 N N   . LEU B 1 314 ? -15.955 -55.285 -19.118 1.00 54.84  ? 315  LEU B N   1 
ATOM   6564 C CA  . LEU B 1 314 ? -16.526 -56.432 -19.825 1.00 47.93  ? 315  LEU B CA  1 
ATOM   6565 C C   . LEU B 1 314 ? -16.455 -57.692 -18.978 1.00 51.42  ? 315  LEU B C   1 
ATOM   6566 O O   . LEU B 1 314 ? -17.369 -58.508 -18.983 1.00 50.31  ? 315  LEU B O   1 
ATOM   6567 C CB  . LEU B 1 314 ? -15.797 -56.665 -21.146 1.00 49.19  ? 315  LEU B CB  1 
ATOM   6568 C CG  . LEU B 1 314 ? -15.991 -55.618 -22.238 1.00 54.60  ? 315  LEU B CG  1 
ATOM   6569 C CD1 . LEU B 1 314 ? -15.044 -55.890 -23.406 1.00 49.22  ? 315  LEU B CD1 1 
ATOM   6570 C CD2 . LEU B 1 314 ? -17.442 -55.587 -22.709 1.00 52.51  ? 315  LEU B CD2 1 
ATOM   6571 N N   . ILE B 1 315 ? -15.347 -57.850 -18.265 1.00 44.41  ? 316  ILE B N   1 
ATOM   6572 C CA  . ILE B 1 315 ? -15.174 -58.981 -17.384 1.00 51.86  ? 316  ILE B CA  1 
ATOM   6573 C C   . ILE B 1 315 ? -16.228 -58.898 -16.269 1.00 58.48  ? 316  ILE B C   1 
ATOM   6574 O O   . ILE B 1 315 ? -16.933 -59.869 -15.987 1.00 54.40  ? 316  ILE B O   1 
ATOM   6575 C CB  . ILE B 1 315 ? -13.755 -59.008 -16.786 1.00 52.32  ? 316  ILE B CB  1 
ATOM   6576 C CG1 . ILE B 1 315 ? -12.735 -59.468 -17.822 1.00 50.18  ? 316  ILE B CG1 1 
ATOM   6577 C CG2 . ILE B 1 315 ? -13.679 -59.944 -15.610 1.00 52.96  ? 316  ILE B CG2 1 
ATOM   6578 C CD1 . ILE B 1 315 ? -11.286 -59.241 -17.392 1.00 48.01  ? 316  ILE B CD1 1 
ATOM   6579 N N   . ASN B 1 316 ? -16.353 -57.722 -15.660 1.00 55.61  ? 317  ASN B N   1 
ATOM   6580 C CA  . ASN B 1 316 ? -17.301 -57.537 -14.562 1.00 61.66  ? 317  ASN B CA  1 
ATOM   6581 C C   . ASN B 1 316 ? -18.745 -57.783 -14.977 1.00 61.81  ? 317  ASN B C   1 
ATOM   6582 O O   . ASN B 1 316 ? -19.534 -58.324 -14.204 1.00 61.00  ? 317  ASN B O   1 
ATOM   6583 C CB  . ASN B 1 316 ? -17.158 -56.138 -13.973 1.00 55.19  ? 317  ASN B CB  1 
ATOM   6584 C CG  . ASN B 1 316 ? -15.851 -55.969 -13.216 1.00 58.32  ? 317  ASN B CG  1 
ATOM   6585 O OD1 . ASN B 1 316 ? -15.161 -56.949 -12.937 1.00 59.08  ? 317  ASN B OD1 1 
ATOM   6586 N ND2 . ASN B 1 316 ? -15.502 -54.728 -12.888 1.00 60.72  ? 317  ASN B ND2 1 
ATOM   6587 N N   . ALA B 1 317 ? -19.067 -57.440 -16.221 1.00 64.86  ? 318  ALA B N   1 
ATOM   6588 C CA  . ALA B 1 317 ? -20.447 -57.426 -16.679 1.00 58.23  ? 318  ALA B CA  1 
ATOM   6589 C C   . ALA B 1 317 ? -20.891 -58.714 -17.345 1.00 61.38  ? 318  ALA B C   1 
ATOM   6590 O O   . ALA B 1 317 ? -22.045 -58.829 -17.750 1.00 66.41  ? 318  ALA B O   1 
ATOM   6591 C CB  . ALA B 1 317 ? -20.659 -56.271 -17.634 1.00 57.92  ? 318  ALA B CB  1 
ATOM   6592 N N   . GLY B 1 318 ? -19.995 -59.686 -17.453 1.00 60.33  ? 319  GLY B N   1 
ATOM   6593 C CA  . GLY B 1 318 ? -20.258 -60.818 -18.317 1.00 56.47  ? 319  GLY B CA  1 
ATOM   6594 C C   . GLY B 1 318 ? -20.867 -62.053 -17.689 1.00 57.83  ? 319  GLY B C   1 
ATOM   6595 O O   . GLY B 1 318 ? -20.694 -62.326 -16.501 1.00 59.11  ? 319  GLY B O   1 
ATOM   6596 N N   . ASP B 1 319 ? -21.578 -62.813 -18.515 1.00 59.24  ? 320  ASP B N   1 
ATOM   6597 C CA  . ASP B 1 319 ? -22.022 -64.146 -18.144 1.00 58.27  ? 320  ASP B CA  1 
ATOM   6598 C C   . ASP B 1 319 ? -21.071 -65.147 -18.786 1.00 59.95  ? 320  ASP B C   1 
ATOM   6599 O O   . ASP B 1 319 ? -20.861 -65.133 -20.002 1.00 63.57  ? 320  ASP B O   1 
ATOM   6600 C CB  . ASP B 1 319 ? -23.461 -64.398 -18.594 1.00 59.51  ? 320  ASP B CB  1 
ATOM   6601 C CG  . ASP B 1 319 ? -24.008 -65.738 -18.110 1.00 66.03  ? 320  ASP B CG  1 
ATOM   6602 O OD1 . ASP B 1 319 ? -23.275 -66.518 -17.455 1.00 63.51  ? 320  ASP B OD1 1 
ATOM   6603 O OD2 . ASP B 1 319 ? -25.191 -66.018 -18.396 1.00 77.07  ? 320  ASP B OD2 1 
ATOM   6604 N N   . PHE B 1 320 ? -20.499 -66.012 -17.958 1.00 60.61  ? 321  PHE B N   1 
ATOM   6605 C CA  . PHE B 1 320 ? -19.457 -66.916 -18.399 1.00 51.52  ? 321  PHE B CA  1 
ATOM   6606 C C   . PHE B 1 320 ? -19.828 -68.360 -18.128 1.00 54.86  ? 321  PHE B C   1 
ATOM   6607 O O   . PHE B 1 320 ? -18.956 -69.224 -18.037 1.00 59.30  ? 321  PHE B O   1 
ATOM   6608 C CB  . PHE B 1 320 ? -18.129 -66.559 -17.713 1.00 55.46  ? 321  PHE B CB  1 
ATOM   6609 C CG  . PHE B 1 320 ? -17.586 -65.213 -18.118 1.00 56.48  ? 321  PHE B CG  1 
ATOM   6610 C CD1 . PHE B 1 320 ? -17.072 -65.012 -19.408 1.00 51.77  ? 321  PHE B CD1 1 
ATOM   6611 C CD2 . PHE B 1 320 ? -17.611 -64.144 -17.232 1.00 52.69  ? 321  PHE B CD2 1 
ATOM   6612 C CE1 . PHE B 1 320 ? -16.580 -63.778 -19.793 1.00 48.06  ? 321  PHE B CE1 1 
ATOM   6613 C CE2 . PHE B 1 320 ? -17.117 -62.895 -17.612 1.00 53.06  ? 321  PHE B CE2 1 
ATOM   6614 C CZ  . PHE B 1 320 ? -16.604 -62.710 -18.892 1.00 52.60  ? 321  PHE B CZ  1 
ATOM   6615 N N   . HIS B 1 321 ? -21.124 -68.630 -18.004 1.00 60.53  ? 322  HIS B N   1 
ATOM   6616 C CA  . HIS B 1 321 ? -21.574 -70.006 -17.815 1.00 61.91  ? 322  HIS B CA  1 
ATOM   6617 C C   . HIS B 1 321 ? -21.279 -70.798 -19.085 1.00 55.51  ? 322  HIS B C   1 
ATOM   6618 O O   . HIS B 1 321 ? -21.385 -70.266 -20.200 1.00 54.00  ? 322  HIS B O   1 
ATOM   6619 C CB  . HIS B 1 321 ? -23.068 -70.064 -17.461 1.00 59.72  ? 322  HIS B CB  1 
ATOM   6620 C CG  . HIS B 1 321 ? -23.366 -69.702 -16.040 1.00 61.82  ? 322  HIS B CG  1 
ATOM   6621 N ND1 . HIS B 1 321 ? -23.824 -68.455 -15.671 1.00 67.81  ? 322  HIS B ND1 1 
ATOM   6622 C CD2 . HIS B 1 321 ? -23.246 -70.414 -14.893 1.00 57.58  ? 322  HIS B CD2 1 
ATOM   6623 C CE1 . HIS B 1 321 ? -23.988 -68.418 -14.359 1.00 59.11  ? 322  HIS B CE1 1 
ATOM   6624 N NE2 . HIS B 1 321 ? -23.643 -69.593 -13.863 1.00 56.86  ? 322  HIS B NE2 1 
ATOM   6625 N N   . GLY B 1 322 ? -20.895 -72.062 -18.916 1.00 60.15  ? 323  GLY B N   1 
ATOM   6626 C CA  . GLY B 1 322 ? -20.508 -72.904 -20.045 1.00 58.80  ? 323  GLY B CA  1 
ATOM   6627 C C   . GLY B 1 322 ? -19.063 -72.727 -20.512 1.00 62.47  ? 323  GLY B C   1 
ATOM   6628 O O   . GLY B 1 322 ? -18.681 -73.204 -21.587 1.00 58.05  ? 323  GLY B O   1 
ATOM   6629 N N   . LEU B 1 323 ? -18.254 -72.039 -19.703 1.00 61.13  ? 324  LEU B N   1 
ATOM   6630 C CA  . LEU B 1 323 ? -16.871 -71.762 -20.069 1.00 55.38  ? 324  LEU B CA  1 
ATOM   6631 C C   . LEU B 1 323 ? -15.909 -72.440 -19.111 1.00 54.43  ? 324  LEU B C   1 
ATOM   6632 O O   . LEU B 1 323 ? -16.114 -72.425 -17.888 1.00 52.50  ? 324  LEU B O   1 
ATOM   6633 C CB  . LEU B 1 323 ? -16.610 -70.259 -20.096 1.00 50.88  ? 324  LEU B CB  1 
ATOM   6634 C CG  . LEU B 1 323 ? -15.170 -69.855 -20.409 1.00 53.07  ? 324  LEU B CG  1 
ATOM   6635 C CD1 . LEU B 1 323 ? -14.813 -70.216 -21.858 1.00 50.21  ? 324  LEU B CD1 1 
ATOM   6636 C CD2 . LEU B 1 323 ? -14.952 -68.374 -20.144 1.00 43.55  ? 324  LEU B CD2 1 
ATOM   6637 N N   . GLN B 1 324 ? -14.868 -73.058 -19.665 1.00 49.89  ? 325  GLN B N   1 
ATOM   6638 C CA  . GLN B 1 324 ? -13.791 -73.582 -18.837 1.00 47.09  ? 325  GLN B CA  1 
ATOM   6639 C C   . GLN B 1 324 ? -12.535 -72.795 -19.177 1.00 49.84  ? 325  GLN B C   1 
ATOM   6640 O O   . GLN B 1 324 ? -12.261 -72.511 -20.352 1.00 52.34  ? 325  GLN B O   1 
ATOM   6641 C CB  . GLN B 1 324 ? -13.574 -75.085 -19.050 1.00 49.30  ? 325  GLN B CB  1 
ATOM   6642 C CG  . GLN B 1 324 ? -14.805 -75.964 -18.810 1.00 50.96  ? 325  GLN B CG  1 
ATOM   6643 C CD  . GLN B 1 324 ? -15.645 -76.130 -20.066 1.00 62.23  ? 325  GLN B CD  1 
ATOM   6644 O OE1 . GLN B 1 324 ? -15.115 -76.193 -21.187 1.00 58.74  ? 325  GLN B OE1 1 
ATOM   6645 N NE2 . GLN B 1 324 ? -16.963 -76.174 -19.891 1.00 63.47  ? 325  GLN B NE2 1 
ATOM   6646 N N   . VAL B 1 325 ? -11.791 -72.413 -18.146 1.00 43.59  ? 326  VAL B N   1 
ATOM   6647 C CA  . VAL B 1 325 ? -10.587 -71.631 -18.326 1.00 44.92  ? 326  VAL B CA  1 
ATOM   6648 C C   . VAL B 1 325 ? -9.466  -72.141 -17.430 1.00 44.34  ? 326  VAL B C   1 
ATOM   6649 O O   . VAL B 1 325 ? -9.691  -72.519 -16.287 1.00 43.36  ? 326  VAL B O   1 
ATOM   6650 C CB  . VAL B 1 325 ? -10.836 -70.149 -18.032 1.00 49.69  ? 326  VAL B CB  1 
ATOM   6651 C CG1 . VAL B 1 325 ? -9.554  -69.376 -18.164 1.00 53.19  ? 326  VAL B CG1 1 
ATOM   6652 C CG2 . VAL B 1 325 ? -11.862 -69.586 -18.992 1.00 47.12  ? 326  VAL B CG2 1 
ATOM   6653 N N   . LEU B 1 326 ? -8.261  -72.182 -17.977 1.00 41.91  ? 327  LEU B N   1 
ATOM   6654 C CA  . LEU B 1 326 ? -7.075  -72.527 -17.223 1.00 34.36  ? 327  LEU B CA  1 
ATOM   6655 C C   . LEU B 1 326 ? -6.187  -71.292 -17.265 1.00 40.71  ? 327  LEU B C   1 
ATOM   6656 O O   . LEU B 1 326 ? -5.983  -70.700 -18.337 1.00 42.14  ? 327  LEU B O   1 
ATOM   6657 C CB  . LEU B 1 326 ? -6.398  -73.759 -17.809 1.00 38.96  ? 327  LEU B CB  1 
ATOM   6658 C CG  . LEU B 1 326 ? -4.944  -74.105 -17.482 1.00 43.30  ? 327  LEU B CG  1 
ATOM   6659 C CD1 . LEU B 1 326 ? -4.763  -74.498 -16.042 1.00 38.54  ? 327  LEU B CD1 1 
ATOM   6660 C CD2 . LEU B 1 326 ? -4.496  -75.241 -18.361 1.00 38.29  ? 327  LEU B CD2 1 
ATOM   6661 N N   . VAL B 1 327 ? -5.734  -70.847 -16.094 1.00 37.16  ? 328  VAL B N   1 
ATOM   6662 C CA  . VAL B 1 327 ? -4.888  -69.651 -15.991 1.00 38.09  ? 328  VAL B CA  1 
ATOM   6663 C C   . VAL B 1 327 ? -3.760  -69.910 -15.033 1.00 37.18  ? 328  VAL B C   1 
ATOM   6664 O O   . VAL B 1 327 ? -3.867  -70.771 -14.144 1.00 39.83  ? 328  VAL B O   1 
ATOM   6665 C CB  . VAL B 1 327 ? -5.665  -68.409 -15.509 1.00 39.58  ? 328  VAL B CB  1 
ATOM   6666 C CG1 . VAL B 1 327 ? -6.798  -68.088 -16.479 1.00 30.96  ? 328  VAL B CG1 1 
ATOM   6667 C CG2 . VAL B 1 327 ? -6.207  -68.631 -14.072 1.00 36.30  ? 328  VAL B CG2 1 
ATOM   6668 N N   . GLY B 1 328 ? -2.666  -69.179 -15.204 1.00 38.79  ? 329  GLY B N   1 
ATOM   6669 C CA  . GLY B 1 328 ? -1.556  -69.315 -14.279 1.00 34.09  ? 329  GLY B CA  1 
ATOM   6670 C C   . GLY B 1 328 ? -0.465  -68.302 -14.507 1.00 37.68  ? 329  GLY B C   1 
ATOM   6671 O O   . GLY B 1 328 ? -0.553  -67.453 -15.406 1.00 38.38  ? 329  GLY B O   1 
ATOM   6672 N N   . VAL B 1 329 ? 0.568   -68.406 -13.677 1.00 37.53  ? 330  VAL B N   1 
ATOM   6673 C CA  . VAL B 1 329 ? 1.715   -67.520 -13.715 1.00 32.18  ? 330  VAL B CA  1 
ATOM   6674 C C   . VAL B 1 329 ? 2.938   -68.345 -13.392 1.00 35.22  ? 330  VAL B C   1 
ATOM   6675 O O   . VAL B 1 329 ? 2.811   -69.460 -12.874 1.00 35.81  ? 330  VAL B O   1 
ATOM   6676 C CB  . VAL B 1 329 ? 1.591   -66.374 -12.681 1.00 38.97  ? 330  VAL B CB  1 
ATOM   6677 C CG1 . VAL B 1 329 ? 0.362   -65.514 -12.970 1.00 30.46  ? 330  VAL B CG1 1 
ATOM   6678 C CG2 . VAL B 1 329 ? 1.564   -66.953 -11.240 1.00 33.99  ? 330  VAL B CG2 1 
ATOM   6679 N N   . VAL B 1 330 ? 4.118   -67.804 -13.686 1.00 34.88  ? 331  VAL B N   1 
ATOM   6680 C CA  . VAL B 1 330 ? 5.357   -68.370 -13.172 1.00 34.63  ? 331  VAL B CA  1 
ATOM   6681 C C   . VAL B 1 330 ? 5.649   -67.770 -11.783 1.00 41.28  ? 331  VAL B C   1 
ATOM   6682 O O   . VAL B 1 330 ? 5.034   -66.782 -11.365 1.00 36.36  ? 331  VAL B O   1 
ATOM   6683 C CB  . VAL B 1 330 ? 6.561   -68.106 -14.123 1.00 39.80  ? 331  VAL B CB  1 
ATOM   6684 C CG1 . VAL B 1 330 ? 6.363   -68.814 -15.430 1.00 34.38  ? 331  VAL B CG1 1 
ATOM   6685 C CG2 . VAL B 1 330 ? 6.770   -66.614 -14.337 1.00 34.66  ? 331  VAL B CG2 1 
ATOM   6686 N N   . LYS B 1 331 ? 6.591   -68.387 -11.087 1.00 41.12  ? 332  LYS B N   1 
ATOM   6687 C CA  . LYS B 1 331 ? 6.959   -68.013 -9.754  1.00 37.97  ? 332  LYS B CA  1 
ATOM   6688 C C   . LYS B 1 331 ? 7.548   -66.610 -9.655  1.00 40.87  ? 332  LYS B C   1 
ATOM   6689 O O   . LYS B 1 331 ? 7.270   -65.899 -8.690  1.00 42.68  ? 332  LYS B O   1 
ATOM   6690 C CB  . LYS B 1 331 ? 7.952   -69.034 -9.186  1.00 45.42  ? 332  LYS B CB  1 
ATOM   6691 C CG  . LYS B 1 331 ? 8.267   -68.845 -7.670  1.00 37.45  ? 332  LYS B CG  1 
ATOM   6692 C CD  . LYS B 1 331 ? 9.061   -70.044 -7.117  1.00 51.18  ? 332  LYS B CD  1 
ATOM   6693 C CE  . LYS B 1 331 ? 9.674   -69.769 -5.724  1.00 46.51  ? 332  LYS B CE  1 
ATOM   6694 N NZ  . LYS B 1 331 ? 8.763   -68.922 -4.919  1.00 56.88  ? 332  LYS B NZ  1 
ATOM   6695 N N   . ASP B 1 332 ? 8.350   -66.206 -10.640 1.00 43.24  ? 333  ASP B N   1 
ATOM   6696 C CA  . ASP B 1 332 ? 8.985   -64.883 -10.596 1.00 37.28  ? 333  ASP B CA  1 
ATOM   6697 C C   . ASP B 1 332 ? 8.684   -64.031 -11.848 1.00 43.01  ? 333  ASP B C   1 
ATOM   6698 O O   . ASP B 1 332 ? 9.545   -63.811 -12.708 1.00 42.68  ? 333  ASP B O   1 
ATOM   6699 C CB  . ASP B 1 332 ? 10.491  -65.053 -10.394 1.00 40.39  ? 333  ASP B CB  1 
ATOM   6700 C CG  . ASP B 1 332 ? 10.821  -65.855 -9.125  1.00 45.93  ? 333  ASP B CG  1 
ATOM   6701 O OD1 . ASP B 1 332 ? 10.814  -65.261 -8.031  1.00 47.49  ? 333  ASP B OD1 1 
ATOM   6702 O OD2 . ASP B 1 332 ? 11.079  -67.078 -9.219  1.00 47.05  ? 333  ASP B OD2 1 
ATOM   6703 N N   . GLU B 1 333 ? 7.449   -63.547 -11.937 1.00 42.11  ? 334  GLU B N   1 
ATOM   6704 C CA  . GLU B 1 333 ? 6.991   -62.858 -13.130 1.00 36.88  ? 334  GLU B CA  1 
ATOM   6705 C C   . GLU B 1 333 ? 7.793   -61.600 -13.422 1.00 44.53  ? 334  GLU B C   1 
ATOM   6706 O O   . GLU B 1 333 ? 8.015   -61.265 -14.591 1.00 41.50  ? 334  GLU B O   1 
ATOM   6707 C CB  . GLU B 1 333 ? 5.508   -62.511 -13.009 1.00 33.82  ? 334  GLU B CB  1 
ATOM   6708 C CG  . GLU B 1 333 ? 4.577   -63.699 -13.140 1.00 37.62  ? 334  GLU B CG  1 
ATOM   6709 C CD  . GLU B 1 333 ? 4.457   -64.202 -14.592 1.00 43.77  ? 334  GLU B CD  1 
ATOM   6710 O OE1 . GLU B 1 333 ? 5.089   -63.597 -15.496 1.00 43.36  ? 334  GLU B OE1 1 
ATOM   6711 O OE2 . GLU B 1 333 ? 3.726   -65.200 -14.831 1.00 38.01  ? 334  GLU B OE2 1 
ATOM   6712 N N   . GLY B 1 334 ? 8.253   -60.907 -12.376 1.00 43.92  ? 335  GLY B N   1 
ATOM   6713 C CA  . GLY B 1 334 ? 8.837   -59.588 -12.593 1.00 40.80  ? 335  GLY B CA  1 
ATOM   6714 C C   . GLY B 1 334 ? 10.308  -59.478 -12.944 1.00 38.42  ? 335  GLY B C   1 
ATOM   6715 O O   . GLY B 1 334 ? 10.720  -58.519 -13.590 1.00 34.51  ? 335  GLY B O   1 
ATOM   6716 N N   . SER B 1 335 ? 11.102  -60.440 -12.473 1.00 41.30  ? 336  SER B N   1 
ATOM   6717 C CA  . SER B 1 335 ? 12.559  -60.407 -12.576 1.00 42.75  ? 336  SER B CA  1 
ATOM   6718 C C   . SER B 1 335 ? 13.088  -60.143 -14.000 1.00 46.61  ? 336  SER B C   1 
ATOM   6719 O O   . SER B 1 335 ? 13.993  -59.331 -14.197 1.00 42.85  ? 336  SER B O   1 
ATOM   6720 C CB  . SER B 1 335 ? 13.128  -61.725 -12.057 1.00 49.31  ? 336  SER B CB  1 
ATOM   6721 O OG  . SER B 1 335 ? 12.708  -62.805 -12.892 1.00 53.63  ? 336  SER B OG  1 
ATOM   6722 N N   . TYR B 1 336 ? 12.510  -60.824 -14.984 1.00 45.64  ? 337  TYR B N   1 
ATOM   6723 C CA  . TYR B 1 336 ? 12.946  -60.704 -16.364 1.00 43.07  ? 337  TYR B CA  1 
ATOM   6724 C C   . TYR B 1 336 ? 12.853  -59.260 -16.847 1.00 48.49  ? 337  TYR B C   1 
ATOM   6725 O O   . TYR B 1 336 ? 13.691  -58.789 -17.612 1.00 51.29  ? 337  TYR B O   1 
ATOM   6726 C CB  . TYR B 1 336 ? 12.100  -61.636 -17.254 1.00 50.53  ? 337  TYR B CB  1 
ATOM   6727 C CG  . TYR B 1 336 ? 12.254  -61.449 -18.742 1.00 45.17  ? 337  TYR B CG  1 
ATOM   6728 C CD1 . TYR B 1 336 ? 13.248  -62.120 -19.455 1.00 53.85  ? 337  TYR B CD1 1 
ATOM   6729 C CD2 . TYR B 1 336 ? 11.394  -60.614 -19.450 1.00 56.01  ? 337  TYR B CD2 1 
ATOM   6730 C CE1 . TYR B 1 336 ? 13.387  -61.947 -20.856 1.00 55.13  ? 337  TYR B CE1 1 
ATOM   6731 C CE2 . TYR B 1 336 ? 11.528  -60.436 -20.840 1.00 51.03  ? 337  TYR B CE2 1 
ATOM   6732 C CZ  . TYR B 1 336 ? 12.526  -61.099 -21.531 1.00 55.23  ? 337  TYR B CZ  1 
ATOM   6733 O OH  . TYR B 1 336 ? 12.645  -60.928 -22.908 1.00 75.86  ? 337  TYR B OH  1 
ATOM   6734 N N   . PHE B 1 337 ? 11.832  -58.549 -16.389 1.00 45.09  ? 338  PHE B N   1 
ATOM   6735 C CA  . PHE B 1 337 ? 11.576  -57.214 -16.902 1.00 42.50  ? 338  PHE B CA  1 
ATOM   6736 C C   . PHE B 1 337 ? 12.525  -56.167 -16.342 1.00 46.76  ? 338  PHE B C   1 
ATOM   6737 O O   . PHE B 1 337 ? 12.753  -55.142 -16.991 1.00 48.47  ? 338  PHE B O   1 
ATOM   6738 C CB  . PHE B 1 337 ? 10.118  -56.841 -16.636 1.00 45.88  ? 338  PHE B CB  1 
ATOM   6739 C CG  . PHE B 1 337 ? 9.164   -57.726 -17.359 1.00 45.72  ? 338  PHE B CG  1 
ATOM   6740 C CD1 . PHE B 1 337 ? 8.864   -57.491 -18.688 1.00 50.79  ? 338  PHE B CD1 1 
ATOM   6741 C CD2 . PHE B 1 337 ? 8.640   -58.849 -16.743 1.00 49.08  ? 338  PHE B CD2 1 
ATOM   6742 C CE1 . PHE B 1 337 ? 8.005   -58.334 -19.399 1.00 50.02  ? 338  PHE B CE1 1 
ATOM   6743 C CE2 . PHE B 1 337 ? 7.783   -59.700 -17.437 1.00 49.11  ? 338  PHE B CE2 1 
ATOM   6744 C CZ  . PHE B 1 337 ? 7.467   -59.433 -18.774 1.00 47.63  ? 338  PHE B CZ  1 
ATOM   6745 N N   . LEU B 1 338 ? 13.127  -56.459 -15.185 1.00 41.73  ? 339  LEU B N   1 
ATOM   6746 C CA  . LEU B 1 338 ? 13.949  -55.479 -14.460 1.00 48.55  ? 339  LEU B CA  1 
ATOM   6747 C C   . LEU B 1 338 ? 15.282  -55.163 -15.147 1.00 49.21  ? 339  LEU B C   1 
ATOM   6748 O O   . LEU B 1 338 ? 15.806  -54.057 -15.010 1.00 44.23  ? 339  LEU B O   1 
ATOM   6749 C CB  . LEU B 1 338 ? 14.208  -55.962 -13.020 1.00 42.91  ? 339  LEU B CB  1 
ATOM   6750 C CG  . LEU B 1 338 ? 12.899  -56.064 -12.236 1.00 47.54  ? 339  LEU B CG  1 
ATOM   6751 C CD1 . LEU B 1 338 ? 13.110  -56.575 -10.817 1.00 40.73  ? 339  LEU B CD1 1 
ATOM   6752 C CD2 . LEU B 1 338 ? 12.146  -54.727 -12.248 1.00 42.07  ? 339  LEU B CD2 1 
ATOM   6753 N N   . VAL B 1 339 ? 15.823  -56.115 -15.900 1.00 48.60  ? 340  VAL B N   1 
ATOM   6754 C CA  . VAL B 1 339 ? 17.107  -55.878 -16.550 1.00 51.78  ? 340  VAL B CA  1 
ATOM   6755 C C   . VAL B 1 339 ? 16.958  -55.038 -17.813 1.00 49.76  ? 340  VAL B C   1 
ATOM   6756 O O   . VAL B 1 339 ? 17.934  -54.692 -18.460 1.00 53.19  ? 340  VAL B O   1 
ATOM   6757 C CB  . VAL B 1 339 ? 17.809  -57.183 -16.887 1.00 52.07  ? 340  VAL B CB  1 
ATOM   6758 C CG1 . VAL B 1 339 ? 18.069  -57.951 -15.606 1.00 53.02  ? 340  VAL B CG1 1 
ATOM   6759 C CG2 . VAL B 1 339 ? 16.969  -58.004 -17.856 1.00 53.49  ? 340  VAL B CG2 1 
ATOM   6760 N N   . TYR B 1 340 ? 15.733  -54.678 -18.147 1.00 51.60  ? 341  TYR B N   1 
ATOM   6761 C CA  . TYR B 1 340 ? 15.524  -53.778 -19.265 1.00 51.32  ? 341  TYR B CA  1 
ATOM   6762 C C   . TYR B 1 340 ? 15.315  -52.322 -18.830 1.00 54.07  ? 341  TYR B C   1 
ATOM   6763 O O   . TYR B 1 340 ? 14.539  -51.601 -19.445 1.00 54.57  ? 341  TYR B O   1 
ATOM   6764 C CB  . TYR B 1 340 ? 14.335  -54.257 -20.102 1.00 53.05  ? 341  TYR B CB  1 
ATOM   6765 C CG  . TYR B 1 340 ? 14.660  -55.468 -20.933 1.00 50.49  ? 341  TYR B CG  1 
ATOM   6766 C CD1 . TYR B 1 340 ? 14.577  -56.745 -20.396 1.00 48.07  ? 341  TYR B CD1 1 
ATOM   6767 C CD2 . TYR B 1 340 ? 15.074  -55.335 -22.260 1.00 53.51  ? 341  TYR B CD2 1 
ATOM   6768 C CE1 . TYR B 1 340 ? 14.891  -57.864 -21.160 1.00 54.58  ? 341  TYR B CE1 1 
ATOM   6769 C CE2 . TYR B 1 340 ? 15.386  -56.445 -23.028 1.00 47.99  ? 341  TYR B CE2 1 
ATOM   6770 C CZ  . TYR B 1 340 ? 15.295  -57.703 -22.472 1.00 51.76  ? 341  TYR B CZ  1 
ATOM   6771 O OH  . TYR B 1 340 ? 15.604  -58.805 -23.228 1.00 55.67  ? 341  TYR B OH  1 
ATOM   6772 N N   . GLY B 1 341 ? 15.988  -51.870 -17.777 1.00 58.29  ? 342  GLY B N   1 
ATOM   6773 C CA  . GLY B 1 341 ? 15.941  -50.446 -17.483 1.00 53.06  ? 342  GLY B CA  1 
ATOM   6774 C C   . GLY B 1 341 ? 15.867  -50.000 -16.043 1.00 58.36  ? 342  GLY B C   1 
ATOM   6775 O O   . GLY B 1 341 ? 16.192  -48.853 -15.736 1.00 62.15  ? 342  GLY B O   1 
ATOM   6776 N N   . ALA B 1 342 ? 15.421  -50.885 -15.158 1.00 56.66  ? 343  ALA B N   1 
ATOM   6777 C CA  . ALA B 1 342 ? 15.404  -50.563 -13.744 1.00 55.85  ? 343  ALA B CA  1 
ATOM   6778 C C   . ALA B 1 342 ? 16.845  -50.336 -13.273 1.00 54.43  ? 343  ALA B C   1 
ATOM   6779 O O   . ALA B 1 342 ? 17.718  -51.183 -13.495 1.00 47.32  ? 343  ALA B O   1 
ATOM   6780 C CB  . ALA B 1 342 ? 14.715  -51.675 -12.930 1.00 53.25  ? 343  ALA B CB  1 
ATOM   6781 N N   . PRO B 1 343 ? 17.097  -49.175 -12.640 1.00 56.74  ? 344  PRO B N   1 
ATOM   6782 C CA  . PRO B 1 343 ? 18.443  -48.820 -12.181 1.00 51.51  ? 344  PRO B CA  1 
ATOM   6783 C C   . PRO B 1 343 ? 19.025  -49.863 -11.245 1.00 54.37  ? 344  PRO B C   1 
ATOM   6784 O O   . PRO B 1 343 ? 18.343  -50.337 -10.329 1.00 52.33  ? 344  PRO B O   1 
ATOM   6785 C CB  . PRO B 1 343 ? 18.240  -47.473 -11.473 1.00 49.49  ? 344  PRO B CB  1 
ATOM   6786 C CG  . PRO B 1 343 ? 16.779  -47.271 -11.359 1.00 50.96  ? 344  PRO B CG  1 
ATOM   6787 C CD  . PRO B 1 343 ? 16.140  -48.072 -12.446 1.00 55.29  ? 344  PRO B CD  1 
ATOM   6788 N N   . GLY B 1 344 ? 20.272  -50.245 -11.515 1.00 55.19  ? 345  GLY B N   1 
ATOM   6789 C CA  . GLY B 1 344 ? 20.966  -51.234 -10.708 1.00 54.45  ? 345  GLY B CA  1 
ATOM   6790 C C   . GLY B 1 344 ? 20.802  -52.695 -11.109 1.00 49.76  ? 345  GLY B C   1 
ATOM   6791 O O   . GLY B 1 344 ? 21.436  -53.568 -10.526 1.00 52.00  ? 345  GLY B O   1 
ATOM   6792 N N   . PHE B 1 345 ? 19.956  -52.972 -12.095 1.00 49.68  ? 346  PHE B N   1 
ATOM   6793 C CA  . PHE B 1 345 ? 19.685  -54.354 -12.498 1.00 48.99  ? 346  PHE B CA  1 
ATOM   6794 C C   . PHE B 1 345 ? 20.479  -54.802 -13.719 1.00 52.29  ? 346  PHE B C   1 
ATOM   6795 O O   . PHE B 1 345 ? 20.566  -54.089 -14.710 1.00 59.35  ? 346  PHE B O   1 
ATOM   6796 C CB  . PHE B 1 345 ? 18.190  -54.539 -12.775 1.00 48.08  ? 346  PHE B CB  1 
ATOM   6797 C CG  . PHE B 1 345 ? 17.370  -54.701 -11.529 1.00 49.09  ? 346  PHE B CG  1 
ATOM   6798 C CD1 . PHE B 1 345 ? 16.847  -53.597 -10.886 1.00 43.98  ? 346  PHE B CD1 1 
ATOM   6799 C CD2 . PHE B 1 345 ? 17.151  -55.959 -10.988 1.00 43.37  ? 346  PHE B CD2 1 
ATOM   6800 C CE1 . PHE B 1 345 ? 16.104  -53.740 -9.731  1.00 45.52  ? 346  PHE B CE1 1 
ATOM   6801 C CE2 . PHE B 1 345 ? 16.408  -56.111 -9.838  1.00 46.55  ? 346  PHE B CE2 1 
ATOM   6802 C CZ  . PHE B 1 345 ? 15.885  -54.997 -9.202  1.00 46.27  ? 346  PHE B CZ  1 
ATOM   6803 N N   . SER B 1 346 ? 21.023  -56.010 -13.634 1.00 55.89  ? 347  SER B N   1 
ATOM   6804 C CA  . SER B 1 346 ? 21.748  -56.636 -14.732 1.00 48.67  ? 347  SER B CA  1 
ATOM   6805 C C   . SER B 1 346 ? 21.676  -58.152 -14.602 1.00 52.39  ? 347  SER B C   1 
ATOM   6806 O O   . SER B 1 346 ? 21.696  -58.678 -13.497 1.00 53.41  ? 347  SER B O   1 
ATOM   6807 C CB  . SER B 1 346 ? 23.208  -56.185 -14.743 1.00 50.84  ? 347  SER B CB  1 
ATOM   6808 O OG  . SER B 1 346 ? 23.979  -57.027 -15.572 1.00 63.16  ? 347  SER B OG  1 
ATOM   6809 N N   . LYS B 1 347 ? 21.608  -58.874 -15.713 1.00 51.14  ? 348  LYS B N   1 
ATOM   6810 C CA  . LYS B 1 347 ? 21.701  -60.327 -15.606 1.00 51.85  ? 348  LYS B CA  1 
ATOM   6811 C C   . LYS B 1 347 ? 23.102  -60.760 -15.140 1.00 51.67  ? 348  LYS B C   1 
ATOM   6812 O O   . LYS B 1 347 ? 23.291  -61.881 -14.678 1.00 51.34  ? 348  LYS B O   1 
ATOM   6813 C CB  . LYS B 1 347 ? 21.367  -60.997 -16.940 1.00 52.98  ? 348  LYS B CB  1 
ATOM   6814 C CG  . LYS B 1 347 ? 22.499  -60.986 -17.940 1.00 48.03  ? 348  LYS B CG  1 
ATOM   6815 C CD  . LYS B 1 347 ? 22.121  -61.759 -19.206 1.00 52.95  ? 348  LYS B CD  1 
ATOM   6816 C CE  . LYS B 1 347 ? 23.364  -62.138 -20.038 1.00 51.79  ? 348  LYS B CE  1 
ATOM   6817 N NZ  . LYS B 1 347 ? 24.152  -63.226 -19.353 1.00 52.85  ? 348  LYS B NZ  1 
ATOM   6818 N N   . ASP B 1 348 ? 24.080  -59.866 -15.250 1.00 46.85  ? 349  ASP B N   1 
ATOM   6819 C CA  . ASP B 1 348 ? 25.465  -60.274 -15.062 1.00 55.15  ? 349  ASP B CA  1 
ATOM   6820 C C   . ASP B 1 348 ? 26.036  -59.958 -13.672 1.00 61.71  ? 349  ASP B C   1 
ATOM   6821 O O   . ASP B 1 348 ? 27.224  -60.181 -13.429 1.00 63.61  ? 349  ASP B O   1 
ATOM   6822 C CB  . ASP B 1 348 ? 26.340  -59.649 -16.162 1.00 64.10  ? 349  ASP B CB  1 
ATOM   6823 C CG  . ASP B 1 348 ? 26.117  -60.308 -17.533 1.00 55.86  ? 349  ASP B CG  1 
ATOM   6824 O OD1 . ASP B 1 348 ? 26.006  -61.552 -17.579 1.00 54.13  ? 349  ASP B OD1 1 
ATOM   6825 O OD2 . ASP B 1 348 ? 26.040  -59.586 -18.556 1.00 57.58  ? 349  ASP B OD2 1 
ATOM   6826 N N   . ASN B 1 349 ? 25.193  -59.463 -12.764 1.00 54.81  ? 350  ASN B N   1 
ATOM   6827 C CA  . ASN B 1 349 ? 25.555  -59.387 -11.352 1.00 57.87  ? 350  ASN B CA  1 
ATOM   6828 C C   . ASN B 1 349 ? 24.333  -59.686 -10.477 1.00 61.42  ? 350  ASN B C   1 
ATOM   6829 O O   . ASN B 1 349 ? 23.296  -60.154 -10.967 1.00 57.82  ? 350  ASN B O   1 
ATOM   6830 C CB  . ASN B 1 349 ? 26.202  -58.024 -10.990 1.00 57.92  ? 350  ASN B CB  1 
ATOM   6831 C CG  . ASN B 1 349 ? 25.299  -56.800 -11.253 1.00 62.16  ? 350  ASN B CG  1 
ATOM   6832 O OD1 . ASN B 1 349 ? 24.074  -56.877 -11.175 1.00 64.93  ? 350  ASN B OD1 1 
ATOM   6833 N ND2 . ASN B 1 349 ? 25.933  -55.652 -11.561 1.00 64.94  ? 350  ASN B ND2 1 
ATOM   6834 N N   . GLU B 1 350 ? 24.460  -59.437 -9.182  1.00 51.19  ? 351  GLU B N   1 
ATOM   6835 C CA  . GLU B 1 350 ? 23.451  -59.893 -8.239  1.00 53.98  ? 351  GLU B CA  1 
ATOM   6836 C C   . GLU B 1 350 ? 22.288  -58.907 -8.139  1.00 51.74  ? 351  GLU B C   1 
ATOM   6837 O O   . GLU B 1 350 ? 21.259  -59.212 -7.537  1.00 51.88  ? 351  GLU B O   1 
ATOM   6838 C CB  . GLU B 1 350 ? 24.085  -60.141 -6.862  1.00 51.79  ? 351  GLU B CB  1 
ATOM   6839 C CG  . GLU B 1 350 ? 24.826  -61.480 -6.766  1.00 55.72  ? 351  GLU B CG  1 
ATOM   6840 C CD  . GLU B 1 350 ? 23.964  -62.683 -7.187  1.00 67.23  ? 351  GLU B CD  1 
ATOM   6841 O OE1 . GLU B 1 350 ? 24.231  -63.270 -8.262  1.00 71.15  ? 351  GLU B OE1 1 
ATOM   6842 O OE2 . GLU B 1 350 ? 23.025  -63.056 -6.442  1.00 75.27  ? 351  GLU B OE2 1 
ATOM   6843 N N   . SER B 1 351 ? 22.451  -57.739 -8.751  1.00 47.89  ? 352  SER B N   1 
ATOM   6844 C CA  . SER B 1 351 ? 21.402  -56.733 -8.778  1.00 53.40  ? 352  SER B CA  1 
ATOM   6845 C C   . SER B 1 351 ? 20.928  -56.385 -7.355  1.00 50.18  ? 352  SER B C   1 
ATOM   6846 O O   . SER B 1 351 ? 19.738  -56.148 -7.110  1.00 47.59  ? 352  SER B O   1 
ATOM   6847 C CB  . SER B 1 351 ? 20.235  -57.208 -9.653  1.00 44.79  ? 352  SER B CB  1 
ATOM   6848 O OG  . SER B 1 351 ? 20.681  -57.390 -10.982 1.00 51.81  ? 352  SER B OG  1 
ATOM   6849 N N   . LEU B 1 352 ? 21.877  -56.356 -6.427  1.00 53.47  ? 353  LEU B N   1 
ATOM   6850 C CA  . LEU B 1 352 ? 21.613  -55.946 -5.047  1.00 52.02  ? 353  LEU B CA  1 
ATOM   6851 C C   . LEU B 1 352 ? 21.448  -54.429 -4.959  1.00 49.02  ? 353  LEU B C   1 
ATOM   6852 O O   . LEU B 1 352 ? 22.394  -53.716 -4.663  1.00 57.73  ? 353  LEU B O   1 
ATOM   6853 C CB  . LEU B 1 352 ? 22.739  -56.417 -4.138  1.00 42.63  ? 353  LEU B CB  1 
ATOM   6854 C CG  . LEU B 1 352 ? 22.900  -57.933 -4.127  1.00 47.12  ? 353  LEU B CG  1 
ATOM   6855 C CD1 . LEU B 1 352 ? 24.207  -58.330 -3.442  1.00 47.64  ? 353  LEU B CD1 1 
ATOM   6856 C CD2 . LEU B 1 352 ? 21.712  -58.613 -3.456  1.00 48.16  ? 353  LEU B CD2 1 
ATOM   6857 N N   . ILE B 1 353 ? 20.242  -53.942 -5.215  1.00 44.70  ? 354  ILE B N   1 
ATOM   6858 C CA  . ILE B 1 353 ? 20.029  -52.514 -5.365  1.00 46.76  ? 354  ILE B CA  1 
ATOM   6859 C C   . ILE B 1 353 ? 19.898  -51.765 -4.029  1.00 46.13  ? 354  ILE B C   1 
ATOM   6860 O O   . ILE B 1 353 ? 19.647  -52.354 -2.980  1.00 45.07  ? 354  ILE B O   1 
ATOM   6861 C CB  . ILE B 1 353 ? 18.770  -52.239 -6.217  1.00 48.18  ? 354  ILE B CB  1 
ATOM   6862 C CG1 . ILE B 1 353 ? 17.532  -52.822 -5.524  1.00 43.77  ? 354  ILE B CG1 1 
ATOM   6863 C CG2 . ILE B 1 353 ? 18.948  -52.825 -7.642  1.00 47.34  ? 354  ILE B CG2 1 
ATOM   6864 C CD1 . ILE B 1 353 ? 16.209  -52.464 -6.199  1.00 42.57  ? 354  ILE B CD1 1 
ATOM   6865 N N   . SER B 1 354 ? 20.062  -50.452 -4.107  1.00 49.74  ? 355  SER B N   1 
ATOM   6866 C CA  . SER B 1 354 ? 19.916  -49.557 -2.974  1.00 52.86  ? 355  SER B CA  1 
ATOM   6867 C C   . SER B 1 354 ? 18.481  -49.057 -2.834  1.00 54.13  ? 355  SER B C   1 
ATOM   6868 O O   . SER B 1 354 ? 17.639  -49.232 -3.726  1.00 47.81  ? 355  SER B O   1 
ATOM   6869 C CB  . SER B 1 354 ? 20.851  -48.352 -3.127  1.00 48.28  ? 355  SER B CB  1 
ATOM   6870 O OG  . SER B 1 354 ? 20.375  -47.476 -4.154  1.00 50.94  ? 355  SER B OG  1 
ATOM   6871 N N   . ARG B 1 355 ? 18.227  -48.388 -1.723  1.00 46.64  ? 356  ARG B N   1 
ATOM   6872 C CA  . ARG B 1 355 ? 16.915  -47.868 -1.454  1.00 49.78  ? 356  ARG B CA  1 
ATOM   6873 C C   . ARG B 1 355 ? 16.562  -46.802 -2.463  1.00 44.13  ? 356  ARG B C   1 
ATOM   6874 O O   . ARG B 1 355 ? 15.453  -46.773 -2.983  1.00 48.48  ? 356  ARG B O   1 
ATOM   6875 C CB  . ARG B 1 355 ? 16.845  -47.311 -0.037  1.00 50.44  ? 356  ARG B CB  1 
ATOM   6876 C CG  . ARG B 1 355 ? 15.515  -46.718 0.287   1.00 49.78  ? 356  ARG B CG  1 
ATOM   6877 C CD  . ARG B 1 355 ? 14.624  -47.743 0.908   1.00 53.55  ? 356  ARG B CD  1 
ATOM   6878 N NE  . ARG B 1 355 ? 13.362  -47.152 1.345   1.00 55.29  ? 356  ARG B NE  1 
ATOM   6879 C CZ  . ARG B 1 355 ? 12.231  -47.834 1.457   1.00 46.92  ? 356  ARG B CZ  1 
ATOM   6880 N NH1 . ARG B 1 355 ? 12.210  -49.130 1.170   1.00 50.83  ? 356  ARG B NH1 1 
ATOM   6881 N NH2 . ARG B 1 355 ? 11.125  -47.220 1.830   1.00 47.40  ? 356  ARG B NH2 1 
ATOM   6882 N N   . ALA B 1 356 ? 17.502  -45.921 -2.756  1.00 48.36  ? 357  ALA B N   1 
ATOM   6883 C CA  . ALA B 1 356 ? 17.257  -44.925 -3.795  1.00 48.07  ? 357  ALA B CA  1 
ATOM   6884 C C   . ALA B 1 356 ? 16.936  -45.594 -5.139  1.00 49.70  ? 357  ALA B C   1 
ATOM   6885 O O   . ALA B 1 356 ? 16.088  -45.107 -5.898  1.00 47.82  ? 357  ALA B O   1 
ATOM   6886 C CB  . ALA B 1 356 ? 18.448  -44.002 -3.928  1.00 44.89  ? 357  ALA B CB  1 
ATOM   6887 N N   . GLU B 1 357 ? 17.594  -46.717 -5.426  1.00 46.85  ? 358  GLU B N   1 
ATOM   6888 C CA  . GLU B 1 357 ? 17.406  -47.386 -6.718  1.00 49.99  ? 358  GLU B CA  1 
ATOM   6889 C C   . GLU B 1 357 ? 16.055  -48.114 -6.761  1.00 49.91  ? 358  GLU B C   1 
ATOM   6890 O O   . GLU B 1 357 ? 15.425  -48.226 -7.822  1.00 49.48  ? 358  GLU B O   1 
ATOM   6891 C CB  . GLU B 1 357 ? 18.561  -48.363 -6.995  1.00 52.42  ? 358  GLU B CB  1 
ATOM   6892 C CG  . GLU B 1 357 ? 19.883  -47.686 -7.404  1.00 52.98  ? 358  GLU B CG  1 
ATOM   6893 C CD  . GLU B 1 357 ? 21.014  -48.689 -7.688  1.00 58.06  ? 358  GLU B CD  1 
ATOM   6894 O OE1 . GLU B 1 357 ? 21.126  -49.703 -6.957  1.00 53.45  ? 358  GLU B OE1 1 
ATOM   6895 O OE2 . GLU B 1 357 ? 21.790  -48.468 -8.655  1.00 61.21  ? 358  GLU B OE2 1 
ATOM   6896 N N   . PHE B 1 358 ? 15.608  -48.576 -5.594  1.00 47.49  ? 359  PHE B N   1 
ATOM   6897 C CA  . PHE B 1 358 ? 14.316  -49.229 -5.448  1.00 44.13  ? 359  PHE B CA  1 
ATOM   6898 C C   . PHE B 1 358 ? 13.186  -48.264 -5.722  1.00 46.20  ? 359  PHE B C   1 
ATOM   6899 O O   . PHE B 1 358 ? 12.275  -48.571 -6.499  1.00 43.20  ? 359  PHE B O   1 
ATOM   6900 C CB  . PHE B 1 358 ? 14.171  -49.822 -4.048  1.00 41.15  ? 359  PHE B CB  1 
ATOM   6901 C CG  . PHE B 1 358 ? 12.763  -50.258 -3.699  1.00 45.93  ? 359  PHE B CG  1 
ATOM   6902 C CD1 . PHE B 1 358 ? 12.270  -51.485 -4.132  1.00 43.23  ? 359  PHE B CD1 1 
ATOM   6903 C CD2 . PHE B 1 358 ? 11.949  -49.456 -2.906  1.00 41.56  ? 359  PHE B CD2 1 
ATOM   6904 C CE1 . PHE B 1 358 ? 10.976  -51.890 -3.804  1.00 43.79  ? 359  PHE B CE1 1 
ATOM   6905 C CE2 . PHE B 1 358 ? 10.660  -49.855 -2.565  1.00 43.21  ? 359  PHE B CE2 1 
ATOM   6906 C CZ  . PHE B 1 358 ? 10.172  -51.070 -3.017  1.00 45.92  ? 359  PHE B CZ  1 
ATOM   6907 N N   . LEU B 1 359 ? 13.248  -47.103 -5.076  1.00 45.57  ? 360  LEU B N   1 
ATOM   6908 C CA  . LEU B 1 359 ? 12.249  -46.056 -5.260  1.00 49.73  ? 360  LEU B CA  1 
ATOM   6909 C C   . LEU B 1 359 ? 12.203  -45.631 -6.716  1.00 48.15  ? 360  LEU B C   1 
ATOM   6910 O O   . LEU B 1 359 ? 11.140  -45.398 -7.275  1.00 55.30  ? 360  LEU B O   1 
ATOM   6911 C CB  . LEU B 1 359 ? 12.545  -44.846 -4.366  1.00 51.53  ? 360  LEU B CB  1 
ATOM   6912 C CG  . LEU B 1 359 ? 12.630  -45.135 -2.857  1.00 50.16  ? 360  LEU B CG  1 
ATOM   6913 C CD1 . LEU B 1 359 ? 13.071  -43.904 -2.051  1.00 49.62  ? 360  LEU B CD1 1 
ATOM   6914 C CD2 . LEU B 1 359 ? 11.310  -45.690 -2.316  1.00 50.62  ? 360  LEU B CD2 1 
ATOM   6915 N N   . ALA B 1 360 ? 13.364  -45.556 -7.341  1.00 48.73  ? 361  ALA B N   1 
ATOM   6916 C CA  . ALA B 1 360 ? 13.429  -45.082 -8.702  1.00 48.71  ? 361  ALA B CA  1 
ATOM   6917 C C   . ALA B 1 360 ? 12.853  -46.146 -9.627  1.00 54.05  ? 361  ALA B C   1 
ATOM   6918 O O   . ALA B 1 360 ? 12.262  -45.834 -10.655 1.00 53.73  ? 361  ALA B O   1 
ATOM   6919 C CB  . ALA B 1 360 ? 14.859  -44.739 -9.077  1.00 50.92  ? 361  ALA B CB  1 
ATOM   6920 N N   . GLY B 1 361 ? 13.032  -47.405 -9.240  1.00 53.62  ? 362  GLY B N   1 
ATOM   6921 C CA  . GLY B 1 361 ? 12.494  -48.529 -9.981  1.00 45.36  ? 362  GLY B CA  1 
ATOM   6922 C C   . GLY B 1 361 ? 10.977  -48.617 -9.944  1.00 46.21  ? 362  GLY B C   1 
ATOM   6923 O O   . GLY B 1 361 ? 10.367  -49.062 -10.913 1.00 48.15  ? 362  GLY B O   1 
ATOM   6924 N N   . VAL B 1 362 ? 10.372  -48.196 -8.839  1.00 43.74  ? 363  VAL B N   1 
ATOM   6925 C CA  . VAL B 1 362 ? 8.926   -48.252 -8.692  1.00 46.11  ? 363  VAL B CA  1 
ATOM   6926 C C   . VAL B 1 362 ? 8.257   -47.342 -9.729  1.00 45.55  ? 363  VAL B C   1 
ATOM   6927 O O   . VAL B 1 362 ? 7.176   -47.661 -10.241 1.00 50.30  ? 363  VAL B O   1 
ATOM   6928 C CB  . VAL B 1 362 ? 8.497   -47.882 -7.212  1.00 47.25  ? 363  VAL B CB  1 
ATOM   6929 C CG1 . VAL B 1 362 ? 7.009   -47.669 -7.084  1.00 43.22  ? 363  VAL B CG1 1 
ATOM   6930 C CG2 . VAL B 1 362 ? 8.898   -48.979 -6.249  1.00 36.95  ? 363  VAL B CG2 1 
ATOM   6931 N N   . ARG B 1 363 ? 8.915   -46.240 -10.089 1.00 47.80  ? 364  ARG B N   1 
ATOM   6932 C CA  . ARG B 1 363 ? 8.364   -45.334 -11.106 1.00 52.35  ? 364  ARG B CA  1 
ATOM   6933 C C   . ARG B 1 363 ? 8.518   -45.915 -12.512 1.00 54.09  ? 364  ARG B C   1 
ATOM   6934 O O   . ARG B 1 363 ? 7.699   -45.662 -13.396 1.00 48.73  ? 364  ARG B O   1 
ATOM   6935 C CB  . ARG B 1 363 ? 9.033   -43.950 -11.067 1.00 53.92  ? 364  ARG B CB  1 
ATOM   6936 C CG  . ARG B 1 363 ? 8.996   -43.221 -9.725  1.00 59.53  ? 364  ARG B CG  1 
ATOM   6937 C CD  . ARG B 1 363 ? 7.627   -43.283 -9.039  1.00 61.73  ? 364  ARG B CD  1 
ATOM   6938 N NE  . ARG B 1 363 ? 6.569   -42.552 -9.745  1.00 64.48  ? 364  ARG B NE  1 
ATOM   6939 C CZ  . ARG B 1 363 ? 6.082   -41.377 -9.353  1.00 66.10  ? 364  ARG B CZ  1 
ATOM   6940 N NH1 . ARG B 1 363 ? 6.568   -40.790 -8.265  1.00 70.01  ? 364  ARG B NH1 1 
ATOM   6941 N NH2 . ARG B 1 363 ? 5.108   -40.792 -10.038 1.00 63.98  ? 364  ARG B NH2 1 
ATOM   6942 N N   . VAL B 1 364 ? 9.584   -46.675 -12.725 1.00 52.57  ? 365  VAL B N   1 
ATOM   6943 C CA  . VAL B 1 364 ? 9.822   -47.279 -14.029 1.00 52.89  ? 365  VAL B CA  1 
ATOM   6944 C C   . VAL B 1 364 ? 8.907   -48.483 -14.246 1.00 53.80  ? 365  VAL B C   1 
ATOM   6945 O O   . VAL B 1 364 ? 8.373   -48.675 -15.338 1.00 53.89  ? 365  VAL B O   1 
ATOM   6946 C CB  . VAL B 1 364 ? 11.291  -47.705 -14.186 1.00 55.79  ? 365  VAL B CB  1 
ATOM   6947 C CG1 . VAL B 1 364 ? 11.450  -48.650 -15.358 1.00 58.61  ? 365  VAL B CG1 1 
ATOM   6948 C CG2 . VAL B 1 364 ? 12.162  -46.486 -14.360 1.00 52.71  ? 365  VAL B CG2 1 
ATOM   6949 N N   . GLY B 1 365 ? 8.703   -49.273 -13.193 1.00 49.33  ? 366  GLY B N   1 
ATOM   6950 C CA  . GLY B 1 365 ? 7.875   -50.462 -13.285 1.00 50.65  ? 366  GLY B CA  1 
ATOM   6951 C C   . GLY B 1 365 ? 6.386   -50.222 -13.070 1.00 50.08  ? 366  GLY B C   1 
ATOM   6952 O O   . GLY B 1 365 ? 5.546   -51.043 -13.471 1.00 50.98  ? 366  GLY B O   1 
ATOM   6953 N N   . VAL B 1 366 ? 6.052   -49.111 -12.423 1.00 49.87  ? 367  VAL B N   1 
ATOM   6954 C CA  . VAL B 1 366 ? 4.660   -48.681 -12.328 1.00 50.38  ? 367  VAL B CA  1 
ATOM   6955 C C   . VAL B 1 366 ? 4.526   -47.282 -12.919 1.00 53.26  ? 367  VAL B C   1 
ATOM   6956 O O   . VAL B 1 366 ? 4.288   -46.305 -12.190 1.00 47.54  ? 367  VAL B O   1 
ATOM   6957 C CB  . VAL B 1 366 ? 4.130   -48.662 -10.879 1.00 44.11  ? 367  VAL B CB  1 
ATOM   6958 C CG1 . VAL B 1 366 ? 2.607   -48.607 -10.889 1.00 37.53  ? 367  VAL B CG1 1 
ATOM   6959 C CG2 . VAL B 1 366 ? 4.614   -49.873 -10.119 1.00 39.90  ? 367  VAL B CG2 1 
ATOM   6960 N N   . PRO B 1 367 ? 4.657   -47.186 -14.251 1.00 52.57  ? 368  PRO B N   1 
ATOM   6961 C CA  . PRO B 1 367 ? 4.686   -45.894 -14.932 1.00 52.52  ? 368  PRO B CA  1 
ATOM   6962 C C   . PRO B 1 367 ? 3.317   -45.221 -14.947 1.00 55.15  ? 368  PRO B C   1 
ATOM   6963 O O   . PRO B 1 367 ? 2.284   -45.902 -14.882 1.00 51.17  ? 368  PRO B O   1 
ATOM   6964 C CB  . PRO B 1 367 ? 5.132   -46.268 -16.335 1.00 56.40  ? 368  PRO B CB  1 
ATOM   6965 C CG  . PRO B 1 367 ? 4.560   -47.629 -16.518 1.00 52.42  ? 368  PRO B CG  1 
ATOM   6966 C CD  . PRO B 1 367 ? 4.644   -48.307 -15.207 1.00 52.24  ? 368  PRO B CD  1 
ATOM   6967 N N   . GLN B 1 368 ? 3.333   -43.891 -14.989 1.00 54.29  ? 369  GLN B N   1 
ATOM   6968 C CA  . GLN B 1 368 ? 2.125   -43.080 -15.144 1.00 63.92  ? 369  GLN B CA  1 
ATOM   6969 C C   . GLN B 1 368 ? 1.096   -43.216 -14.011 1.00 59.02  ? 369  GLN B C   1 
ATOM   6970 O O   . GLN B 1 368 ? -0.107  -43.323 -14.261 1.00 60.75  ? 369  GLN B O   1 
ATOM   6971 C CB  . GLN B 1 368 ? 1.451   -43.404 -16.482 1.00 59.04  ? 369  GLN B CB  1 
ATOM   6972 C CG  . GLN B 1 368 ? 2.322   -43.116 -17.711 1.00 74.70  ? 369  GLN B CG  1 
ATOM   6973 C CD  . GLN B 1 368 ? 2.722   -41.648 -17.832 1.00 77.43  ? 369  GLN B CD  1 
ATOM   6974 O OE1 . GLN B 1 368 ? 1.906   -40.797 -18.203 1.00 79.96  ? 369  GLN B OE1 1 
ATOM   6975 N NE2 . GLN B 1 368 ? 3.988   -41.350 -17.535 1.00 73.74  ? 369  GLN B NE2 1 
ATOM   6976 N N   . VAL B 1 369 ? 1.559   -43.205 -12.769 1.00 59.28  ? 370  VAL B N   1 
ATOM   6977 C CA  . VAL B 1 369 ? 0.640   -43.077 -11.640 1.00 52.61  ? 370  VAL B CA  1 
ATOM   6978 C C   . VAL B 1 369 ? 1.074   -41.869 -10.827 1.00 52.68  ? 370  VAL B C   1 
ATOM   6979 O O   . VAL B 1 369 ? 2.228   -41.449 -10.919 1.00 57.75  ? 370  VAL B O   1 
ATOM   6980 C CB  . VAL B 1 369 ? 0.600   -44.345 -10.773 1.00 55.47  ? 370  VAL B CB  1 
ATOM   6981 C CG1 . VAL B 1 369 ? 0.157   -45.535 -11.609 1.00 48.73  ? 370  VAL B CG1 1 
ATOM   6982 C CG2 . VAL B 1 369 ? 1.951   -44.613 -10.128 1.00 52.02  ? 370  VAL B CG2 1 
ATOM   6983 N N   . SER B 1 370 ? 0.159   -41.290 -10.053 1.00 60.20  ? 371  SER B N   1 
ATOM   6984 C CA  . SER B 1 370 ? 0.490   -40.117 -9.232  1.00 61.95  ? 371  SER B CA  1 
ATOM   6985 C C   . SER B 1 370 ? 1.564   -40.442 -8.186  1.00 58.51  ? 371  SER B C   1 
ATOM   6986 O O   . SER B 1 370 ? 1.806   -41.611 -7.882  1.00 57.31  ? 371  SER B O   1 
ATOM   6987 C CB  . SER B 1 370 ? -0.767  -39.582 -8.537  1.00 61.53  ? 371  SER B CB  1 
ATOM   6988 O OG  . SER B 1 370 ? -1.165  -40.437 -7.468  1.00 61.46  ? 371  SER B OG  1 
ATOM   6989 N N   . ASP B 1 371 ? 2.195   -39.413 -7.627  1.00 58.59  ? 372  ASP B N   1 
ATOM   6990 C CA  . ASP B 1 371 ? 3.136   -39.613 -6.515  1.00 60.78  ? 372  ASP B CA  1 
ATOM   6991 C C   . ASP B 1 371 ? 2.468   -40.293 -5.319  1.00 57.46  ? 372  ASP B C   1 
ATOM   6992 O O   . ASP B 1 371 ? 3.077   -41.129 -4.637  1.00 54.64  ? 372  ASP B O   1 
ATOM   6993 C CB  . ASP B 1 371 ? 3.739   -38.285 -6.062  1.00 64.29  ? 372  ASP B CB  1 
ATOM   6994 C CG  . ASP B 1 371 ? 4.509   -37.582 -7.163  1.00 72.92  ? 372  ASP B CG  1 
ATOM   6995 O OD1 . ASP B 1 371 ? 4.866   -38.239 -8.178  1.00 73.24  ? 372  ASP B OD1 1 
ATOM   6996 O OD2 . ASP B 1 371 ? 4.756   -36.363 -7.012  1.00 78.81  ? 372  ASP B OD2 1 
ATOM   6997 N N   . LEU B 1 372 ? 1.218   -39.916 -5.064  1.00 53.06  ? 373  LEU B N   1 
ATOM   6998 C CA  . LEU B 1 372 ? 0.459   -40.504 -3.974  1.00 55.95  ? 373  LEU B CA  1 
ATOM   6999 C C   . LEU B 1 372 ? 0.372   -42.020 -4.172  1.00 58.80  ? 373  LEU B C   1 
ATOM   7000 O O   . LEU B 1 372 ? 0.566   -42.789 -3.221  1.00 52.24  ? 373  LEU B O   1 
ATOM   7001 C CB  . LEU B 1 372 ? -0.936  -39.880 -3.880  1.00 47.43  ? 373  LEU B CB  1 
ATOM   7002 C CG  . LEU B 1 372 ? -1.853  -40.368 -2.753  1.00 55.15  ? 373  LEU B CG  1 
ATOM   7003 C CD1 . LEU B 1 372 ? -1.232  -40.152 -1.386  1.00 55.49  ? 373  LEU B CD1 1 
ATOM   7004 C CD2 . LEU B 1 372 ? -3.186  -39.664 -2.846  1.00 58.33  ? 373  LEU B CD2 1 
ATOM   7005 N N   . ALA B 1 373 ? 0.118   -42.444 -5.413  1.00 55.19  ? 374  ALA B N   1 
ATOM   7006 C CA  . ALA B 1 373 ? -0.007  -43.871 -5.725  1.00 50.80  ? 374  ALA B CA  1 
ATOM   7007 C C   . ALA B 1 373 ? 1.333   -44.595 -5.599  1.00 44.84  ? 374  ALA B C   1 
ATOM   7008 O O   . ALA B 1 373 ? 1.397   -45.695 -5.052  1.00 46.13  ? 374  ALA B O   1 
ATOM   7009 C CB  . ALA B 1 373 ? -0.592  -44.066 -7.117  1.00 52.47  ? 374  ALA B CB  1 
ATOM   7010 N N   . ALA B 1 374 ? 2.399   -43.978 -6.098  1.00 45.21  ? 375  ALA B N   1 
ATOM   7011 C CA  . ALA B 1 374 ? 3.743   -44.515 -5.916  1.00 45.97  ? 375  ALA B CA  1 
ATOM   7012 C C   . ALA B 1 374 ? 4.078   -44.659 -4.414  1.00 51.75  ? 375  ALA B C   1 
ATOM   7013 O O   . ALA B 1 374 ? 4.597   -45.699 -3.970  1.00 48.33  ? 375  ALA B O   1 
ATOM   7014 C CB  . ALA B 1 374 ? 4.739   -43.640 -6.586  1.00 45.04  ? 375  ALA B CB  1 
ATOM   7015 N N   . GLU B 1 375 ? 3.763   -43.620 -3.643  1.00 51.36  ? 376  GLU B N   1 
ATOM   7016 C CA  . GLU B 1 375 ? 3.961   -43.651 -2.200  1.00 50.41  ? 376  GLU B CA  1 
ATOM   7017 C C   . GLU B 1 375 ? 3.275   -44.866 -1.621  1.00 49.60  ? 376  GLU B C   1 
ATOM   7018 O O   . GLU B 1 375 ? 3.865   -45.588 -0.813  1.00 51.85  ? 376  GLU B O   1 
ATOM   7019 C CB  . GLU B 1 375 ? 3.430   -42.381 -1.529  1.00 60.80  ? 376  GLU B CB  1 
ATOM   7020 C CG  . GLU B 1 375 ? 4.261   -41.133 -1.786  1.00 65.19  ? 376  GLU B CG  1 
ATOM   7021 C CD  . GLU B 1 375 ? 5.731   -41.333 -1.457  1.00 77.12  ? 376  GLU B CD  1 
ATOM   7022 O OE1 . GLU B 1 375 ? 6.036   -42.035 -0.455  1.00 68.22  ? 376  GLU B OE1 1 
ATOM   7023 O OE2 . GLU B 1 375 ? 6.581   -40.795 -2.216  1.00 85.41  ? 376  GLU B OE2 1 
ATOM   7024 N N   . ALA B 1 376 ? 2.047   -45.114 -2.067  1.00 42.73  ? 377  ALA B N   1 
ATOM   7025 C CA  . ALA B 1 376 ? 1.308   -46.274 -1.586  1.00 43.47  ? 377  ALA B CA  1 
ATOM   7026 C C   . ALA B 1 376 ? 1.982   -47.588 -1.978  1.00 45.74  ? 377  ALA B C   1 
ATOM   7027 O O   . ALA B 1 376 ? 1.955   -48.544 -1.194  1.00 49.44  ? 377  ALA B O   1 
ATOM   7028 C CB  . ALA B 1 376 ? -0.115  -46.238 -2.086  1.00 42.46  ? 377  ALA B CB  1 
ATOM   7029 N N   . VAL B 1 377 ? 2.597   -47.649 -3.167  1.00 44.82  ? 378  VAL B N   1 
ATOM   7030 C CA  . VAL B 1 377 ? 3.300   -48.873 -3.560  1.00 43.44  ? 378  VAL B CA  1 
ATOM   7031 C C   . VAL B 1 377 ? 4.496   -49.116 -2.636  1.00 45.25  ? 378  VAL B C   1 
ATOM   7032 O O   . VAL B 1 377 ? 4.711   -50.229 -2.139  1.00 38.39  ? 378  VAL B O   1 
ATOM   7033 C CB  . VAL B 1 377 ? 3.783   -48.838 -5.038  1.00 41.81  ? 378  VAL B CB  1 
ATOM   7034 C CG1 . VAL B 1 377 ? 4.656   -50.051 -5.335  1.00 33.65  ? 378  VAL B CG1 1 
ATOM   7035 C CG2 . VAL B 1 377 ? 2.601   -48.781 -5.982  1.00 33.85  ? 378  VAL B CG2 1 
ATOM   7036 N N   . VAL B 1 378 ? 5.271   -48.066 -2.402  1.00 49.55  ? 379  VAL B N   1 
ATOM   7037 C CA  . VAL B 1 378 ? 6.405   -48.158 -1.497  1.00 50.23  ? 379  VAL B CA  1 
ATOM   7038 C C   . VAL B 1 378 ? 5.988   -48.578 -0.080  1.00 48.43  ? 379  VAL B C   1 
ATOM   7039 O O   . VAL B 1 378 ? 6.665   -49.376 0.556   1.00 47.82  ? 379  VAL B O   1 
ATOM   7040 C CB  . VAL B 1 378 ? 7.152   -46.839 -1.463  1.00 51.51  ? 379  VAL B CB  1 
ATOM   7041 C CG1 . VAL B 1 378 ? 8.329   -46.941 -0.527  1.00 51.52  ? 379  VAL B CG1 1 
ATOM   7042 C CG2 . VAL B 1 378 ? 7.612   -46.486 -2.890  1.00 46.12  ? 379  VAL B CG2 1 
ATOM   7043 N N   . LEU B 1 379 ? 4.848   -48.085 0.390   1.00 54.35  ? 380  LEU B N   1 
ATOM   7044 C CA  . LEU B 1 379 ? 4.313   -48.479 1.703   1.00 47.12  ? 380  LEU B CA  1 
ATOM   7045 C C   . LEU B 1 379 ? 4.073   -49.976 1.812   1.00 52.12  ? 380  LEU B C   1 
ATOM   7046 O O   . LEU B 1 379 ? 4.445   -50.624 2.809   1.00 46.19  ? 380  LEU B O   1 
ATOM   7047 C CB  . LEU B 1 379 ? 2.978   -47.775 2.003   1.00 42.88  ? 380  LEU B CB  1 
ATOM   7048 C CG  . LEU B 1 379 ? 2.185   -48.396 3.175   1.00 52.12  ? 380  LEU B CG  1 
ATOM   7049 C CD1 . LEU B 1 379 ? 2.893   -48.186 4.539   1.00 40.30  ? 380  LEU B CD1 1 
ATOM   7050 C CD2 . LEU B 1 379 ? 0.750   -47.888 3.244   1.00 46.96  ? 380  LEU B CD2 1 
ATOM   7051 N N   A HIS B 1 380 ? 3.440   -50.545 0.793   0.47 44.74  ? 381  HIS B N   1 
ATOM   7052 N N   B HIS B 1 380 ? 3.414   -50.515 0.789   0.53 44.98  ? 381  HIS B N   1 
ATOM   7053 C CA  A HIS B 1 380 ? 3.042   -51.938 0.890   0.47 45.77  ? 381  HIS B CA  1 
ATOM   7054 C CA  B HIS B 1 380 ? 3.022   -51.911 0.799   0.53 44.51  ? 381  HIS B CA  1 
ATOM   7055 C C   A HIS B 1 380 ? 4.180   -52.902 0.548   0.47 44.93  ? 381  HIS B C   1 
ATOM   7056 C C   B HIS B 1 380 ? 4.242   -52.828 0.669   0.53 44.89  ? 381  HIS B C   1 
ATOM   7057 O O   A HIS B 1 380 ? 4.137   -54.067 0.953   0.47 45.46  ? 381  HIS B O   1 
ATOM   7058 O O   B HIS B 1 380 ? 4.309   -53.876 1.322   0.53 45.10  ? 381  HIS B O   1 
ATOM   7059 C CB  A HIS B 1 380 ? 1.807   -52.197 0.014   0.47 46.11  ? 381  HIS B CB  1 
ATOM   7060 C CB  B HIS B 1 380 ? 2.011   -52.203 -0.323  0.53 45.36  ? 381  HIS B CB  1 
ATOM   7061 C CG  A HIS B 1 380 ? 0.524   -51.787 0.670   0.47 49.89  ? 381  HIS B CG  1 
ATOM   7062 C CG  B HIS B 1 380 ? 1.466   -53.595 -0.278  0.53 46.29  ? 381  HIS B CG  1 
ATOM   7063 N ND1 A HIS B 1 380 ? -0.136  -50.618 0.356   0.47 50.03  ? 381  HIS B ND1 1 
ATOM   7064 N ND1 B HIS B 1 380 ? 0.216   -53.894 0.223   0.53 48.94  ? 381  HIS B ND1 1 
ATOM   7065 C CD2 A HIS B 1 380 ? -0.192  -52.370 1.662   0.47 48.07  ? 381  HIS B CD2 1 
ATOM   7066 C CD2 B HIS B 1 380 ? 2.025   -54.778 -0.630  0.53 43.10  ? 381  HIS B CD2 1 
ATOM   7067 C CE1 A HIS B 1 380 ? -1.215  -50.510 1.112   0.47 49.55  ? 381  HIS B CE1 1 
ATOM   7068 C CE1 B HIS B 1 380 ? 0.026   -55.201 0.167   0.53 50.04  ? 381  HIS B CE1 1 
ATOM   7069 N NE2 A HIS B 1 380 ? -1.274  -51.560 1.912   0.47 48.05  ? 381  HIS B NE2 1 
ATOM   7070 N NE2 B HIS B 1 380 ? 1.109   -55.761 -0.346  0.53 45.77  ? 381  HIS B NE2 1 
ATOM   7071 N N   . TYR B 1 381 ? 5.209   -52.432 -0.158  1.00 39.51  ? 382  TYR B N   1 
ATOM   7072 C CA  . TYR B 1 381 ? 6.307   -53.331 -0.500  1.00 40.05  ? 382  TYR B CA  1 
ATOM   7073 C C   . TYR B 1 381 ? 7.589   -53.132 0.320   1.00 43.68  ? 382  TYR B C   1 
ATOM   7074 O O   . TYR B 1 381 ? 8.520   -53.934 0.223   1.00 43.54  ? 382  TYR B O   1 
ATOM   7075 C CB  . TYR B 1 381 ? 6.606   -53.250 -2.009  1.00 40.89  ? 382  TYR B CB  1 
ATOM   7076 C CG  . TYR B 1 381 ? 5.543   -53.965 -2.819  1.00 40.66  ? 382  TYR B CG  1 
ATOM   7077 C CD1 . TYR B 1 381 ? 4.365   -53.313 -3.188  1.00 37.43  ? 382  TYR B CD1 1 
ATOM   7078 C CD2 . TYR B 1 381 ? 5.696   -55.301 -3.182  1.00 39.45  ? 382  TYR B CD2 1 
ATOM   7079 C CE1 . TYR B 1 381 ? 3.383   -53.963 -3.901  1.00 34.63  ? 382  TYR B CE1 1 
ATOM   7080 C CE2 . TYR B 1 381 ? 4.708   -55.964 -3.907  1.00 33.67  ? 382  TYR B CE2 1 
ATOM   7081 C CZ  . TYR B 1 381 ? 3.566   -55.286 -4.263  1.00 34.63  ? 382  TYR B CZ  1 
ATOM   7082 O OH  . TYR B 1 381 ? 2.586   -55.927 -4.962  1.00 37.77  ? 382  TYR B OH  1 
ATOM   7083 N N   . THR B 1 382 ? 7.643   -52.107 1.162   1.00 42.31  ? 383  THR B N   1 
ATOM   7084 C CA  . THR B 1 382 ? 8.784   -51.975 2.063   1.00 43.75  ? 383  THR B CA  1 
ATOM   7085 C C   . THR B 1 382 ? 8.599   -52.831 3.319   1.00 45.63  ? 383  THR B C   1 
ATOM   7086 O O   . THR B 1 382 ? 7.521   -52.838 3.915   1.00 43.72  ? 383  THR B O   1 
ATOM   7087 C CB  . THR B 1 382 ? 8.995   -50.515 2.463   1.00 48.59  ? 383  THR B CB  1 
ATOM   7088 O OG1 . THR B 1 382 ? 9.363   -49.771 1.296   1.00 43.01  ? 383  THR B OG1 1 
ATOM   7089 C CG2 . THR B 1 382 ? 10.086  -50.374 3.571   1.00 40.77  ? 383  THR B CG2 1 
ATOM   7090 N N   . ASP B 1 383 ? 9.626   -53.582 3.701   1.00 43.15  ? 384  ASP B N   1 
ATOM   7091 C CA  . ASP B 1 383 ? 9.640   -54.197 5.033   1.00 44.13  ? 384  ASP B CA  1 
ATOM   7092 C C   . ASP B 1 383 ? 10.213  -53.166 5.992   1.00 43.17  ? 384  ASP B C   1 
ATOM   7093 O O   . ASP B 1 383 ? 11.397  -52.853 5.912   1.00 45.20  ? 384  ASP B O   1 
ATOM   7094 C CB  . ASP B 1 383 ? 10.484  -55.473 5.051   1.00 43.91  ? 384  ASP B CB  1 
ATOM   7095 C CG  . ASP B 1 383 ? 10.565  -56.126 6.446   1.00 50.43  ? 384  ASP B CG  1 
ATOM   7096 O OD1 . ASP B 1 383 ? 10.302  -55.466 7.483   1.00 49.12  ? 384  ASP B OD1 1 
ATOM   7097 O OD2 . ASP B 1 383 ? 10.928  -57.320 6.504   1.00 49.62  ? 384  ASP B OD2 1 
ATOM   7098 N N   . TRP B 1 384 ? 9.397   -52.645 6.902   1.00 44.38  ? 385  TRP B N   1 
ATOM   7099 C CA  . TRP B 1 384 ? 9.829   -51.503 7.712   1.00 48.02  ? 385  TRP B CA  1 
ATOM   7100 C C   . TRP B 1 384 ? 10.769  -51.858 8.882   1.00 46.44  ? 385  TRP B C   1 
ATOM   7101 O O   . TRP B 1 384 ? 11.295  -50.961 9.552   1.00 46.15  ? 385  TRP B O   1 
ATOM   7102 C CB  . TRP B 1 384 ? 8.599   -50.741 8.199   1.00 44.32  ? 385  TRP B CB  1 
ATOM   7103 C CG  . TRP B 1 384 ? 7.916   -50.122 7.018   1.00 43.69  ? 385  TRP B CG  1 
ATOM   7104 C CD1 . TRP B 1 384 ? 6.814   -50.597 6.362   1.00 43.72  ? 385  TRP B CD1 1 
ATOM   7105 C CD2 . TRP B 1 384 ? 8.329   -48.950 6.310   1.00 41.26  ? 385  TRP B CD2 1 
ATOM   7106 N NE1 . TRP B 1 384 ? 6.500   -49.782 5.302   1.00 43.48  ? 385  TRP B NE1 1 
ATOM   7107 C CE2 . TRP B 1 384 ? 7.415   -48.762 5.244   1.00 46.93  ? 385  TRP B CE2 1 
ATOM   7108 C CE3 . TRP B 1 384 ? 9.381   -48.039 6.470   1.00 41.94  ? 385  TRP B CE3 1 
ATOM   7109 C CZ2 . TRP B 1 384 ? 7.522   -47.695 4.338   1.00 42.56  ? 385  TRP B CZ2 1 
ATOM   7110 C CZ3 . TRP B 1 384 ? 9.483   -46.978 5.582   1.00 45.04  ? 385  TRP B CZ3 1 
ATOM   7111 C CH2 . TRP B 1 384 ? 8.553   -46.815 4.525   1.00 46.16  ? 385  TRP B CH2 1 
ATOM   7112 N N   . LEU B 1 385 ? 11.005  -53.151 9.096   1.00 48.53  ? 386  LEU B N   1 
ATOM   7113 C CA  . LEU B 1 385 ? 12.054  -53.621 10.010  1.00 44.28  ? 386  LEU B CA  1 
ATOM   7114 C C   . LEU B 1 385 ? 13.386  -53.787 9.285   1.00 52.39  ? 386  LEU B C   1 
ATOM   7115 O O   . LEU B 1 385 ? 14.419  -54.024 9.911   1.00 49.53  ? 386  LEU B O   1 
ATOM   7116 C CB  . LEU B 1 385 ? 11.664  -54.952 10.646  1.00 45.18  ? 386  LEU B CB  1 
ATOM   7117 C CG  . LEU B 1 385 ? 10.586  -54.901 11.723  1.00 56.35  ? 386  LEU B CG  1 
ATOM   7118 C CD1 . LEU B 1 385 ? 10.192  -56.318 12.167  1.00 49.28  ? 386  LEU B CD1 1 
ATOM   7119 C CD2 . LEU B 1 385 ? 11.089  -54.061 12.899  1.00 45.34  ? 386  LEU B CD2 1 
ATOM   7120 N N   . HIS B 1 386 ? 13.339  -53.715 7.954   1.00 47.93  ? 387  HIS B N   1 
ATOM   7121 C CA  . HIS B 1 386 ? 14.530  -53.854 7.126   1.00 47.48  ? 387  HIS B CA  1 
ATOM   7122 C C   . HIS B 1 386 ? 14.432  -52.985 5.884   1.00 54.19  ? 387  HIS B C   1 
ATOM   7123 O O   . HIS B 1 386 ? 14.530  -53.502 4.780   1.00 42.19  ? 387  HIS B O   1 
ATOM   7124 C CB  . HIS B 1 386 ? 14.730  -55.295 6.660   1.00 48.08  ? 387  HIS B CB  1 
ATOM   7125 C CG  . HIS B 1 386 ? 14.833  -56.304 7.760   1.00 50.06  ? 387  HIS B CG  1 
ATOM   7126 N ND1 . HIS B 1 386 ? 16.005  -56.544 8.442   1.00 47.67  ? 387  HIS B ND1 1 
ATOM   7127 C CD2 . HIS B 1 386 ? 13.924  -57.178 8.253   1.00 50.50  ? 387  HIS B CD2 1 
ATOM   7128 C CE1 . HIS B 1 386 ? 15.807  -57.502 9.329   1.00 47.35  ? 387  HIS B CE1 1 
ATOM   7129 N NE2 . HIS B 1 386 ? 14.550  -57.900 9.237   1.00 49.75  ? 387  HIS B NE2 1 
ATOM   7130 N N   . PRO B 1 387 ? 14.244  -51.669 6.057   1.00 54.56  ? 388  PRO B N   1 
ATOM   7131 C CA  . PRO B 1 387 ? 13.921  -50.837 4.891   1.00 44.74  ? 388  PRO B CA  1 
ATOM   7132 C C   . PRO B 1 387 ? 15.029  -50.715 3.842   1.00 52.84  ? 388  PRO B C   1 
ATOM   7133 O O   . PRO B 1 387 ? 14.785  -50.150 2.772   1.00 48.44  ? 388  PRO B O   1 
ATOM   7134 C CB  . PRO B 1 387 ? 13.644  -49.460 5.507   1.00 45.12  ? 388  PRO B CB  1 
ATOM   7135 C CG  . PRO B 1 387 ? 14.394  -49.468 6.831   1.00 50.66  ? 388  PRO B CG  1 
ATOM   7136 C CD  . PRO B 1 387 ? 14.326  -50.894 7.312   1.00 45.88  ? 388  PRO B CD  1 
ATOM   7137 N N   . GLU B 1 388 ? 16.223  -51.217 4.128   1.00 50.06  ? 389  GLU B N   1 
ATOM   7138 C CA  . GLU B 1 388 ? 17.348  -50.927 3.245   1.00 52.59  ? 389  GLU B CA  1 
ATOM   7139 C C   . GLU B 1 388 ? 18.150  -52.154 2.833   1.00 42.85  ? 389  GLU B C   1 
ATOM   7140 O O   . GLU B 1 388 ? 19.168  -52.032 2.169   1.00 48.96  ? 389  GLU B O   1 
ATOM   7141 C CB  . GLU B 1 388 ? 18.267  -49.910 3.915   1.00 56.35  ? 389  GLU B CB  1 
ATOM   7142 C CG  . GLU B 1 388 ? 17.531  -48.656 4.340   1.00 64.31  ? 389  GLU B CG  1 
ATOM   7143 C CD  . GLU B 1 388 ? 18.370  -47.412 4.209   1.00 69.98  ? 389  GLU B CD  1 
ATOM   7144 O OE1 . GLU B 1 388 ? 18.349  -46.796 3.118   1.00 67.87  ? 389  GLU B OE1 1 
ATOM   7145 O OE2 . GLU B 1 388 ? 19.045  -47.055 5.199   1.00 82.04  ? 389  GLU B OE2 1 
ATOM   7146 N N   . ASP B 1 389 ? 17.692  -53.333 3.233   1.00 45.61  ? 390  ASP B N   1 
ATOM   7147 C CA  . ASP B 1 389 ? 18.353  -54.566 2.847   1.00 50.64  ? 390  ASP B CA  1 
ATOM   7148 C C   . ASP B 1 389 ? 18.256  -54.777 1.320   1.00 54.15  ? 390  ASP B C   1 
ATOM   7149 O O   . ASP B 1 389 ? 17.172  -55.008 0.785   1.00 50.42  ? 390  ASP B O   1 
ATOM   7150 C CB  . ASP B 1 389 ? 17.740  -55.746 3.598   1.00 48.79  ? 390  ASP B CB  1 
ATOM   7151 C CG  . ASP B 1 389 ? 18.343  -57.066 3.178   1.00 57.08  ? 390  ASP B CG  1 
ATOM   7152 O OD1 . ASP B 1 389 ? 19.524  -57.063 2.769   1.00 66.96  ? 390  ASP B OD1 1 
ATOM   7153 O OD2 . ASP B 1 389 ? 17.649  -58.103 3.243   1.00 61.56  ? 390  ASP B OD2 1 
ATOM   7154 N N   . PRO B 1 390 ? 19.400  -54.696 0.621   1.00 50.55  ? 391  PRO B N   1 
ATOM   7155 C CA  . PRO B 1 390 ? 19.479  -54.790 -0.842  1.00 45.68  ? 391  PRO B CA  1 
ATOM   7156 C C   . PRO B 1 390 ? 18.771  -56.010 -1.449  1.00 50.56  ? 391  PRO B C   1 
ATOM   7157 O O   . PRO B 1 390 ? 17.996  -55.858 -2.414  1.00 47.16  ? 391  PRO B O   1 
ATOM   7158 C CB  . PRO B 1 390 ? 20.986  -54.870 -1.105  1.00 45.60  ? 391  PRO B CB  1 
ATOM   7159 C CG  . PRO B 1 390 ? 21.612  -54.179 0.092   1.00 47.04  ? 391  PRO B CG  1 
ATOM   7160 C CD  . PRO B 1 390 ? 20.731  -54.562 1.247   1.00 49.62  ? 391  PRO B CD  1 
ATOM   7161 N N   . ALA B 1 391 ? 19.048  -57.193 -0.915  1.00 44.18  ? 392  ALA B N   1 
ATOM   7162 C CA  . ALA B 1 391 ? 18.416  -58.429 -1.389  1.00 49.71  ? 392  ALA B CA  1 
ATOM   7163 C C   . ALA B 1 391 ? 16.903  -58.349 -1.298  1.00 50.65  ? 392  ALA B C   1 
ATOM   7164 O O   . ALA B 1 391 ? 16.196  -58.711 -2.234  1.00 44.75  ? 392  ALA B O   1 
ATOM   7165 C CB  . ALA B 1 391 ? 18.919  -59.628 -0.592  1.00 47.84  ? 392  ALA B CB  1 
ATOM   7166 N N   . ARG B 1 392 ? 16.409  -57.879 -0.154  1.00 45.15  ? 393  ARG B N   1 
ATOM   7167 C CA  . ARG B 1 392 ? 14.974  -57.708 0.032   1.00 48.02  ? 393  ARG B CA  1 
ATOM   7168 C C   . ARG B 1 392 ? 14.392  -56.696 -0.953  1.00 42.93  ? 393  ARG B C   1 
ATOM   7169 O O   . ARG B 1 392 ? 13.295  -56.891 -1.468  1.00 39.81  ? 393  ARG B O   1 
ATOM   7170 C CB  . ARG B 1 392 ? 14.662  -57.287 1.472   1.00 48.30  ? 393  ARG B CB  1 
ATOM   7171 C CG  . ARG B 1 392 ? 14.596  -58.439 2.459   1.00 44.70  ? 393  ARG B CG  1 
ATOM   7172 C CD  . ARG B 1 392 ? 14.317  -57.872 3.820   1.00 53.69  ? 393  ARG B CD  1 
ATOM   7173 N NE  . ARG B 1 392 ? 14.161  -58.862 4.878   1.00 52.06  ? 393  ARG B NE  1 
ATOM   7174 C CZ  . ARG B 1 392 ? 15.144  -59.259 5.676   1.00 50.90  ? 393  ARG B CZ  1 
ATOM   7175 N NH1 . ARG B 1 392 ? 16.368  -58.778 5.504   1.00 52.79  ? 393  ARG B NH1 1 
ATOM   7176 N NH2 . ARG B 1 392 ? 14.903  -60.145 6.633   1.00 53.00  ? 393  ARG B NH2 1 
ATOM   7177 N N   . LEU B 1 393 ? 15.142  -55.632 -1.221  1.00 42.57  ? 394  LEU B N   1 
ATOM   7178 C CA  . LEU B 1 393 ? 14.704  -54.604 -2.149  1.00 40.88  ? 394  LEU B CA  1 
ATOM   7179 C C   . LEU B 1 393 ? 14.603  -55.127 -3.584  1.00 45.32  ? 394  LEU B C   1 
ATOM   7180 O O   . LEU B 1 393 ? 13.662  -54.795 -4.303  1.00 42.41  ? 394  LEU B O   1 
ATOM   7181 C CB  . LEU B 1 393 ? 15.651  -53.415 -2.074  1.00 42.71  ? 394  LEU B CB  1 
ATOM   7182 C CG  . LEU B 1 393 ? 15.569  -52.664 -0.734  1.00 48.20  ? 394  LEU B CG  1 
ATOM   7183 C CD1 . LEU B 1 393 ? 16.711  -51.682 -0.585  1.00 47.01  ? 394  LEU B CD1 1 
ATOM   7184 C CD2 . LEU B 1 393 ? 14.246  -51.937 -0.648  1.00 40.83  ? 394  LEU B CD2 1 
ATOM   7185 N N   . ARG B 1 394 ? 15.569  -55.949 -3.988  1.00 47.48  ? 395  ARG B N   1 
ATOM   7186 C CA  . ARG B 1 394 ? 15.572  -56.592 -5.301  1.00 43.65  ? 395  ARG B CA  1 
ATOM   7187 C C   . ARG B 1 394 ? 14.315  -57.423 -5.475  1.00 44.56  ? 395  ARG B C   1 
ATOM   7188 O O   . ARG B 1 394 ? 13.589  -57.292 -6.477  1.00 39.37  ? 395  ARG B O   1 
ATOM   7189 C CB  . ARG B 1 394 ? 16.811  -57.484 -5.469  1.00 46.18  ? 395  ARG B CB  1 
ATOM   7190 C CG  . ARG B 1 394 ? 16.955  -58.154 -6.861  1.00 45.98  ? 395  ARG B CG  1 
ATOM   7191 C CD  . ARG B 1 394 ? 18.072  -59.193 -6.854  1.00 42.91  ? 395  ARG B CD  1 
ATOM   7192 N NE  . ARG B 1 394 ? 17.849  -60.268 -5.885  1.00 48.73  ? 395  ARG B NE  1 
ATOM   7193 C CZ  . ARG B 1 394 ? 18.820  -60.988 -5.324  1.00 49.33  ? 395  ARG B CZ  1 
ATOM   7194 N NH1 . ARG B 1 394 ? 20.090  -60.756 -5.628  1.00 46.87  ? 395  ARG B NH1 1 
ATOM   7195 N NH2 . ARG B 1 394 ? 18.526  -61.946 -4.456  1.00 49.24  ? 395  ARG B NH2 1 
ATOM   7196 N N   . GLU B 1 395 ? 14.065  -58.257 -4.466  1.00 43.77  ? 396  GLU B N   1 
ATOM   7197 C CA  . GLU B 1 395 ? 12.929  -59.169 -4.432  1.00 45.65  ? 396  GLU B CA  1 
ATOM   7198 C C   . GLU B 1 395 ? 11.609  -58.410 -4.451  1.00 45.34  ? 396  GLU B C   1 
ATOM   7199 O O   . GLU B 1 395 ? 10.675  -58.784 -5.167  1.00 48.02  ? 396  GLU B O   1 
ATOM   7200 C CB  . GLU B 1 395 ? 13.009  -60.065 -3.190  1.00 46.07  ? 396  GLU B CB  1 
ATOM   7201 C CG  . GLU B 1 395 ? 13.268  -61.552 -3.442  1.00 54.07  ? 396  GLU B CG  1 
ATOM   7202 C CD  . GLU B 1 395 ? 14.721  -61.886 -3.858  1.00 66.06  ? 396  GLU B CD  1 
ATOM   7203 O OE1 . GLU B 1 395 ? 15.083  -61.656 -5.044  1.00 63.91  ? 396  GLU B OE1 1 
ATOM   7204 O OE2 . GLU B 1 395 ? 15.491  -62.407 -3.004  1.00 68.97  ? 396  GLU B OE2 1 
ATOM   7205 N N   . ALA B 1 396 ? 11.535  -57.333 -3.674  1.00 43.23  ? 397  ALA B N   1 
ATOM   7206 C CA  . ALA B 1 396 ? 10.310  -56.542 -3.611  1.00 41.41  ? 397  ALA B CA  1 
ATOM   7207 C C   . ALA B 1 396 ? 10.043  -55.814 -4.942  1.00 41.97  ? 397  ALA B C   1 
ATOM   7208 O O   . ALA B 1 396 ? 8.893   -55.660 -5.338  1.00 42.19  ? 397  ALA B O   1 
ATOM   7209 C CB  . ALA B 1 396 ? 10.375  -55.541 -2.457  1.00 42.88  ? 397  ALA B CB  1 
ATOM   7210 N N   . LEU B 1 397 ? 11.084  -55.351 -5.629  1.00 35.68  ? 398  LEU B N   1 
ATOM   7211 C CA  . LEU B 1 397 ? 10.835  -54.620 -6.864  1.00 38.78  ? 398  LEU B CA  1 
ATOM   7212 C C   . LEU B 1 397 ? 10.341  -55.608 -7.923  1.00 36.97  ? 398  LEU B C   1 
ATOM   7213 O O   . LEU B 1 397 ? 9.434   -55.312 -8.665  1.00 38.29  ? 398  LEU B O   1 
ATOM   7214 C CB  . LEU B 1 397 ? 12.071  -53.879 -7.363  1.00 44.54  ? 398  LEU B CB  1 
ATOM   7215 C CG  . LEU B 1 397 ? 11.687  -53.010 -8.564  1.00 40.56  ? 398  LEU B CG  1 
ATOM   7216 C CD1 . LEU B 1 397 ? 10.646  -51.994 -8.118  1.00 40.60  ? 398  LEU B CD1 1 
ATOM   7217 C CD2 . LEU B 1 397 ? 12.890  -52.314 -9.162  1.00 41.52  ? 398  LEU B CD2 1 
ATOM   7218 N N   . SER B 1 398 ? 10.912  -56.802 -7.925  1.00 38.30  ? 399  SER B N   1 
ATOM   7219 C CA  . SER B 1 398 ? 10.405  -57.889 -8.733  1.00 36.63  ? 399  SER B CA  1 
ATOM   7220 C C   . SER B 1 398 ? 8.952   -58.239 -8.441  1.00 39.00  ? 399  SER B C   1 
ATOM   7221 O O   . SER B 1 398 ? 8.210   -58.574 -9.353  1.00 45.71  ? 399  SER B O   1 
ATOM   7222 C CB  . SER B 1 398 ? 11.265  -59.133 -8.553  1.00 37.68  ? 399  SER B CB  1 
ATOM   7223 O OG  . SER B 1 398 ? 10.762  -60.175 -9.383  1.00 45.74  ? 399  SER B OG  1 
ATOM   7224 N N   . ASP B 1 399 ? 8.560   -58.198 -7.175  1.00 43.43  ? 400  ASP B N   1 
ATOM   7225 C CA  . ASP B 1 399 ? 7.179   -58.441 -6.788  1.00 39.86  ? 400  ASP B CA  1 
ATOM   7226 C C   . ASP B 1 399 ? 6.275   -57.321 -7.267  1.00 40.91  ? 400  ASP B C   1 
ATOM   7227 O O   . ASP B 1 399 ? 5.240   -57.595 -7.878  1.00 41.64  ? 400  ASP B O   1 
ATOM   7228 C CB  . ASP B 1 399 ? 7.056   -58.602 -5.264  1.00 40.01  ? 400  ASP B CB  1 
ATOM   7229 C CG  . ASP B 1 399 ? 7.509   -59.984 -4.791  1.00 47.62  ? 400  ASP B CG  1 
ATOM   7230 O OD1 . ASP B 1 399 ? 7.395   -60.945 -5.597  1.00 49.89  ? 400  ASP B OD1 1 
ATOM   7231 O OD2 . ASP B 1 399 ? 7.985   -60.106 -3.629  1.00 45.68  ? 400  ASP B OD2 1 
ATOM   7232 N N   . VAL B 1 400 ? 6.662   -56.069 -7.000  1.00 36.70  ? 401  VAL B N   1 
ATOM   7233 C CA  . VAL B 1 400 ? 5.936   -54.920 -7.535  1.00 35.93  ? 401  VAL B CA  1 
ATOM   7234 C C   . VAL B 1 400 ? 5.625   -55.076 -9.032  1.00 39.03  ? 401  VAL B C   1 
ATOM   7235 O O   . VAL B 1 400 ? 4.451   -55.016 -9.446  1.00 34.80  ? 401  VAL B O   1 
ATOM   7236 C CB  . VAL B 1 400 ? 6.727   -53.599 -7.367  1.00 41.64  ? 401  VAL B CB  1 
ATOM   7237 C CG1 . VAL B 1 400 ? 6.111   -52.471 -8.248  1.00 31.08  ? 401  VAL B CG1 1 
ATOM   7238 C CG2 . VAL B 1 400 ? 6.792   -53.188 -5.911  1.00 31.88  ? 401  VAL B CG2 1 
ATOM   7239 N N   . VAL B 1 401 ? 6.674   -55.261 -9.837  1.00 37.46  ? 402  VAL B N   1 
ATOM   7240 C CA  . VAL B 1 401 ? 6.514   -55.313 -11.292 1.00 40.36  ? 402  VAL B CA  1 
ATOM   7241 C C   . VAL B 1 401 ? 5.691   -56.540 -11.671 1.00 38.29  ? 402  VAL B C   1 
ATOM   7242 O O   . VAL B 1 401 ? 4.728   -56.443 -12.436 1.00 39.00  ? 402  VAL B O   1 
ATOM   7243 C CB  . VAL B 1 401 ? 7.870   -55.340 -12.011 1.00 43.46  ? 402  VAL B CB  1 
ATOM   7244 C CG1 . VAL B 1 401 ? 7.678   -55.570 -13.490 1.00 40.78  ? 402  VAL B CG1 1 
ATOM   7245 C CG2 . VAL B 1 401 ? 8.613   -54.041 -11.775 1.00 39.30  ? 402  VAL B CG2 1 
ATOM   7246 N N   . GLY B 1 402 ? 6.048   -57.683 -11.089 1.00 36.19  ? 403  GLY B N   1 
ATOM   7247 C CA  . GLY B 1 402 ? 5.303   -58.911 -11.291 1.00 32.13  ? 403  GLY B CA  1 
ATOM   7248 C C   . GLY B 1 402 ? 3.827   -58.810 -10.945 1.00 40.27  ? 403  GLY B C   1 
ATOM   7249 O O   . GLY B 1 402 ? 2.979   -59.235 -11.742 1.00 40.70  ? 403  GLY B O   1 
ATOM   7250 N N   . ASP B 1 403 ? 3.514   -58.276 -9.757  1.00 40.27  ? 404  ASP B N   1 
ATOM   7251 C CA  . ASP B 1 403 ? 2.123   -58.204 -9.285  1.00 40.03  ? 404  ASP B CA  1 
ATOM   7252 C C   . ASP B 1 403 ? 1.281   -57.249 -10.138 1.00 39.55  ? 404  ASP B C   1 
ATOM   7253 O O   . ASP B 1 403 ? 0.193   -57.606 -10.590 1.00 40.04  ? 404  ASP B O   1 
ATOM   7254 C CB  . ASP B 1 403 ? 2.063   -57.776 -7.802  1.00 34.30  ? 404  ASP B CB  1 
ATOM   7255 C CG  . ASP B 1 403 ? 2.735   -58.786 -6.862  1.00 40.83  ? 404  ASP B CG  1 
ATOM   7256 O OD1 . ASP B 1 403 ? 2.984   -59.948 -7.274  1.00 43.76  ? 404  ASP B OD1 1 
ATOM   7257 O OD2 . ASP B 1 403 ? 3.043   -58.415 -5.712  1.00 42.10  ? 404  ASP B OD2 1 
ATOM   7258 N N   . HIS B 1 404 ? 1.789   -56.033 -10.341 1.00 38.03  ? 405  HIS B N   1 
ATOM   7259 C CA  . HIS B 1 404 ? 1.105   -55.004 -11.130 1.00 34.97  ? 405  HIS B CA  1 
ATOM   7260 C C   . HIS B 1 404 ? 0.793   -55.466 -12.552 1.00 39.21  ? 405  HIS B C   1 
ATOM   7261 O O   . HIS B 1 404 ? -0.320  -55.306 -13.040 1.00 40.46  ? 405  HIS B O   1 
ATOM   7262 C CB  . HIS B 1 404 ? 1.964   -53.739 -11.158 1.00 33.05  ? 405  HIS B CB  1 
ATOM   7263 C CG  . HIS B 1 404 ? 1.365   -52.605 -11.927 1.00 35.56  ? 405  HIS B CG  1 
ATOM   7264 N ND1 . HIS B 1 404 ? 0.056   -52.204 -11.771 1.00 36.25  ? 405  HIS B ND1 1 
ATOM   7265 C CD2 . HIS B 1 404 ? 1.895   -51.800 -12.882 1.00 40.89  ? 405  HIS B CD2 1 
ATOM   7266 C CE1 . HIS B 1 404 ? -0.192  -51.189 -12.580 1.00 35.10  ? 405  HIS B CE1 1 
ATOM   7267 N NE2 . HIS B 1 404 ? 0.905   -50.929 -13.273 1.00 41.68  ? 405  HIS B NE2 1 
ATOM   7268 N N   . ASN B 1 405 ? 1.764   -56.060 -13.224 1.00 37.34  ? 406  ASN B N   1 
ATOM   7269 C CA  . ASN B 1 405 ? 1.581   -56.341 -14.646 1.00 41.12  ? 406  ASN B CA  1 
ATOM   7270 C C   . ASN B 1 405 ? 1.010   -57.713 -15.001 1.00 39.96  ? 406  ASN B C   1 
ATOM   7271 O O   . ASN B 1 405 ? 0.403   -57.859 -16.051 1.00 38.78  ? 406  ASN B O   1 
ATOM   7272 C CB  . ASN B 1 405 ? 2.904   -56.143 -15.364 1.00 39.24  ? 406  ASN B CB  1 
ATOM   7273 C CG  . ASN B 1 405 ? 3.345   -54.700 -15.347 1.00 48.29  ? 406  ASN B CG  1 
ATOM   7274 O OD1 . ASN B 1 405 ? 2.794   -53.877 -16.078 1.00 48.66  ? 406  ASN B OD1 1 
ATOM   7275 N ND2 . ASN B 1 405 ? 4.334   -54.376 -14.510 1.00 42.29  ? 406  ASN B ND2 1 
ATOM   7276 N N   . VAL B 1 406 ? 1.197   -58.717 -14.143 1.00 38.15  ? 407  VAL B N   1 
ATOM   7277 C CA  . VAL B 1 406 ? 0.770   -60.055 -14.506 1.00 35.99  ? 407  VAL B CA  1 
ATOM   7278 C C   . VAL B 1 406 ? -0.119  -60.719 -13.461 1.00 41.87  ? 407  VAL B C   1 
ATOM   7279 O O   . VAL B 1 406 ? -1.271  -61.029 -13.753 1.00 40.98  ? 407  VAL B O   1 
ATOM   7280 C CB  . VAL B 1 406 ? 1.971   -60.985 -14.760 1.00 37.11  ? 407  VAL B CB  1 
ATOM   7281 C CG1 . VAL B 1 406 ? 1.480   -62.367 -15.193 1.00 34.98  ? 407  VAL B CG1 1 
ATOM   7282 C CG2 . VAL B 1 406 ? 2.918   -60.392 -15.784 1.00 34.56  ? 407  VAL B CG2 1 
ATOM   7283 N N   . VAL B 1 407 ? 0.405   -60.929 -12.249 1.00 41.72  ? 408  VAL B N   1 
ATOM   7284 C CA  . VAL B 1 407 ? -0.273  -61.772 -11.269 1.00 39.30  ? 408  VAL B CA  1 
ATOM   7285 C C   . VAL B 1 407 ? -1.626  -61.200 -10.849 1.00 41.64  ? 408  VAL B C   1 
ATOM   7286 O O   . VAL B 1 407 ? -2.634  -61.903 -10.932 1.00 45.18  ? 408  VAL B O   1 
ATOM   7287 C CB  . VAL B 1 407 ? 0.580   -62.021 -9.987  1.00 41.98  ? 408  VAL B CB  1 
ATOM   7288 C CG1 . VAL B 1 407 ? -0.095  -63.076 -9.112  1.00 34.08  ? 408  VAL B CG1 1 
ATOM   7289 C CG2 . VAL B 1 407 ? 1.982   -62.495 -10.341 1.00 37.87  ? 408  VAL B CG2 1 
ATOM   7290 N N   . CYS B 1 408 ? -1.687  -59.937 -10.439 1.00 34.31  ? 409  CYS B N   1 
ATOM   7291 C CA  . CYS B 1 408 ? -2.978  -59.413 -9.982  1.00 32.14  ? 409  CYS B CA  1 
ATOM   7292 C C   . CYS B 1 408 ? -4.022  -59.227 -11.125 1.00 37.28  ? 409  CYS B C   1 
ATOM   7293 O O   . CYS B 1 408 ? -5.199  -59.530 -10.935 1.00 38.90  ? 409  CYS B O   1 
ATOM   7294 C CB  . CYS B 1 408 ? -2.741  -58.119 -9.191  1.00 34.72  ? 409  CYS B CB  1 
ATOM   7295 S SG  . CYS B 1 408 ? -1.590  -58.429 -7.797  1.00 39.83  ? 409  CYS B SG  1 
ATOM   7296 N N   . PRO B 1 409 ? -3.597  -58.811 -12.334 1.00 39.03  ? 410  PRO B N   1 
ATOM   7297 C CA  . PRO B 1 409 ? -4.567  -58.898 -13.445 1.00 39.54  ? 410  PRO B CA  1 
ATOM   7298 C C   . PRO B 1 409 ? -5.142  -60.305 -13.715 1.00 36.99  ? 410  PRO B C   1 
ATOM   7299 O O   . PRO B 1 409 ? -6.350  -60.409 -13.939 1.00 35.62  ? 410  PRO B O   1 
ATOM   7300 C CB  . PRO B 1 409 ? -3.746  -58.410 -14.641 1.00 39.59  ? 410  PRO B CB  1 
ATOM   7301 C CG  . PRO B 1 409 ? -2.758  -57.453 -14.035 1.00 30.91  ? 410  PRO B CG  1 
ATOM   7302 C CD  . PRO B 1 409 ? -2.355  -58.139 -12.765 1.00 38.60  ? 410  PRO B CD  1 
ATOM   7303 N N   . VAL B 1 410 ? -4.303  -61.342 -13.713 1.00 36.72  ? 411  VAL B N   1 
ATOM   7304 C CA  . VAL B 1 410 ? -4.747  -62.734 -13.849 1.00 33.80  ? 411  VAL B CA  1 
ATOM   7305 C C   . VAL B 1 410 ? -5.625  -63.125 -12.635 1.00 39.72  ? 411  VAL B C   1 
ATOM   7306 O O   . VAL B 1 410 ? -6.722  -63.659 -12.789 1.00 40.49  ? 411  VAL B O   1 
ATOM   7307 C CB  . VAL B 1 410 ? -3.519  -63.702 -13.944 1.00 36.53  ? 411  VAL B CB  1 
ATOM   7308 C CG1 . VAL B 1 410 ? -3.933  -65.158 -13.921 1.00 30.48  ? 411  VAL B CG1 1 
ATOM   7309 C CG2 . VAL B 1 410 ? -2.653  -63.378 -15.138 1.00 34.74  ? 411  VAL B CG2 1 
ATOM   7310 N N   . ALA B 1 411 ? -5.159  -62.840 -11.422 1.00 35.75  ? 412  ALA B N   1 
ATOM   7311 C CA  . ALA B 1 411 ? -5.979  -63.113 -10.216 1.00 38.14  ? 412  ALA B CA  1 
ATOM   7312 C C   . ALA B 1 411 ? -7.373  -62.490 -10.319 1.00 36.58  ? 412  ALA B C   1 
ATOM   7313 O O   . ALA B 1 411 ? -8.377  -63.146 -10.025 1.00 37.98  ? 412  ALA B O   1 
ATOM   7314 C CB  . ALA B 1 411 ? -5.274  -62.617 -8.941  1.00 38.21  ? 412  ALA B CB  1 
ATOM   7315 N N   . GLN B 1 412 ? -7.436  -61.242 -10.763 1.00 35.73  ? 413  GLN B N   1 
ATOM   7316 C CA  . GLN B 1 412 ? -8.718  -60.577 -10.919 1.00 38.14  ? 413  GLN B CA  1 
ATOM   7317 C C   . GLN B 1 412 ? -9.601  -61.232 -11.970 1.00 43.63  ? 413  GLN B C   1 
ATOM   7318 O O   . GLN B 1 412 ? -10.827 -61.333 -11.791 1.00 39.01  ? 413  GLN B O   1 
ATOM   7319 C CB  . GLN B 1 412 ? -8.539  -59.108 -11.297 1.00 38.22  ? 413  GLN B CB  1 
ATOM   7320 C CG  . GLN B 1 412 ? -9.893  -58.435 -11.506 1.00 41.69  ? 413  GLN B CG  1 
ATOM   7321 C CD  . GLN B 1 412 ? -9.868  -56.928 -11.303 1.00 63.00  ? 413  GLN B CD  1 
ATOM   7322 O OE1 . GLN B 1 412 ? -9.425  -56.179 -12.184 1.00 61.60  ? 413  GLN B OE1 1 
ATOM   7323 N NE2 . GLN B 1 412 ? -10.358 -56.471 -10.137 1.00 61.95  ? 413  GLN B NE2 1 
ATOM   7324 N N   . LEU B 1 413 ? -8.981  -61.631 -13.085 1.00 43.41  ? 414  LEU B N   1 
ATOM   7325 C CA  . LEU B 1 413 ? -9.705  -62.295 -14.168 1.00 39.20  ? 414  LEU B CA  1 
ATOM   7326 C C   . LEU B 1 413 ? -10.247 -63.598 -13.651 1.00 34.10  ? 414  LEU B C   1 
ATOM   7327 O O   . LEU B 1 413 ? -11.402 -63.912 -13.863 1.00 38.73  ? 414  LEU B O   1 
ATOM   7328 C CB  . LEU B 1 413 ? -8.801  -62.553 -15.385 1.00 36.73  ? 414  LEU B CB  1 
ATOM   7329 C CG  . LEU B 1 413 ? -9.439  -63.364 -16.516 1.00 34.60  ? 414  LEU B CG  1 
ATOM   7330 C CD1 . LEU B 1 413 ? -10.737 -62.724 -16.923 1.00 39.38  ? 414  LEU B CD1 1 
ATOM   7331 C CD2 . LEU B 1 413 ? -8.508  -63.320 -17.683 1.00 32.81  ? 414  LEU B CD2 1 
ATOM   7332 N N   . ALA B 1 414 ? -9.397  -64.347 -12.959 1.00 35.45  ? 415  ALA B N   1 
ATOM   7333 C CA  . ALA B 1 414 ? -9.758  -65.674 -12.467 1.00 34.60  ? 415  ALA B CA  1 
ATOM   7334 C C   . ALA B 1 414 ? -10.965 -65.613 -11.536 1.00 43.92  ? 415  ALA B C   1 
ATOM   7335 O O   . ALA B 1 414 ? -11.933 -66.384 -11.683 1.00 40.32  ? 415  ALA B O   1 
ATOM   7336 C CB  . ALA B 1 414 ? -8.578  -66.300 -11.758 1.00 30.76  ? 415  ALA B CB  1 
ATOM   7337 N N   . GLY B 1 415 ? -10.900 -64.684 -10.585 1.00 44.28  ? 416  GLY B N   1 
ATOM   7338 C CA  . GLY B 1 415 ? -11.945 -64.506 -9.587  1.00 41.16  ? 416  GLY B CA  1 
ATOM   7339 C C   . GLY B 1 415 ? -13.285 -64.067 -10.149 1.00 44.94  ? 416  GLY B C   1 
ATOM   7340 O O   . GLY B 1 415 ? -14.311 -64.658 -9.818  1.00 50.85  ? 416  GLY B O   1 
ATOM   7341 N N   . ARG B 1 416 ? -13.298 -63.050 -11.003 1.00 44.42  ? 417  ARG B N   1 
ATOM   7342 C CA  . ARG B 1 416 ? -14.560 -62.645 -11.612 1.00 48.94  ? 417  ARG B CA  1 
ATOM   7343 C C   . ARG B 1 416 ? -15.163 -63.761 -12.476 1.00 51.61  ? 417  ARG B C   1 
ATOM   7344 O O   . ARG B 1 416 ? -16.379 -63.936 -12.482 1.00 51.72  ? 417  ARG B O   1 
ATOM   7345 C CB  . ARG B 1 416 ? -14.391 -61.375 -12.455 1.00 45.49  ? 417  ARG B CB  1 
ATOM   7346 C CG  . ARG B 1 416 ? -13.926 -60.155 -11.673 1.00 49.31  ? 417  ARG B CG  1 
ATOM   7347 C CD  . ARG B 1 416 ? -14.764 -59.934 -10.392 1.00 57.48  ? 417  ARG B CD  1 
ATOM   7348 N NE  . ARG B 1 416 ? -16.158 -59.593 -10.679 1.00 58.70  ? 417  ARG B NE  1 
ATOM   7349 C CZ  . ARG B 1 416 ? -16.712 -58.402 -10.448 1.00 58.93  ? 417  ARG B CZ  1 
ATOM   7350 N NH1 . ARG B 1 416 ? -15.994 -57.430 -9.912  1.00 58.20  ? 417  ARG B NH1 1 
ATOM   7351 N NH2 . ARG B 1 416 ? -17.987 -58.183 -10.758 1.00 56.24  ? 417  ARG B NH2 1 
ATOM   7352 N N   . LEU B 1 417 ? -14.323 -64.510 -13.197 1.00 48.94  ? 418  LEU B N   1 
ATOM   7353 C CA  . LEU B 1 417 ? -14.820 -65.558 -14.101 1.00 48.49  ? 418  LEU B CA  1 
ATOM   7354 C C   . LEU B 1 417 ? -15.460 -66.676 -13.298 1.00 50.95  ? 418  LEU B C   1 
ATOM   7355 O O   . LEU B 1 417 ? -16.521 -67.196 -13.679 1.00 49.82  ? 418  LEU B O   1 
ATOM   7356 C CB  . LEU B 1 417 ? -13.697 -66.143 -14.987 1.00 41.30  ? 418  LEU B CB  1 
ATOM   7357 C CG  . LEU B 1 417 ? -13.150 -65.330 -16.178 1.00 51.10  ? 418  LEU B CG  1 
ATOM   7358 C CD1 . LEU B 1 417 ? -12.311 -66.185 -17.091 1.00 37.83  ? 418  LEU B CD1 1 
ATOM   7359 C CD2 . LEU B 1 417 ? -14.249 -64.679 -16.969 1.00 49.24  ? 418  LEU B CD2 1 
ATOM   7360 N N   . ALA B 1 418 ? -14.780 -67.076 -12.220 1.00 45.76  ? 419  ALA B N   1 
ATOM   7361 C CA  . ALA B 1 418 ? -15.316 -68.081 -11.300 1.00 54.10  ? 419  ALA B CA  1 
ATOM   7362 C C   . ALA B 1 418 ? -16.686 -67.634 -10.809 1.00 54.85  ? 419  ALA B C   1 
ATOM   7363 O O   . ALA B 1 418 ? -17.686 -68.333 -11.004 1.00 56.97  ? 419  ALA B O   1 
ATOM   7364 C CB  . ALA B 1 418 ? -14.367 -68.313 -10.104 1.00 44.94  ? 419  ALA B CB  1 
ATOM   7365 N N   . ALA B 1 419 ? -16.719 -66.439 -10.222 1.00 54.56  ? 420  ALA B N   1 
ATOM   7366 C CA  . ALA B 1 419 ? -17.926 -65.881 -9.612  1.00 52.25  ? 420  ALA B CA  1 
ATOM   7367 C C   . ALA B 1 419 ? -19.093 -65.780 -10.589 1.00 53.95  ? 420  ALA B C   1 
ATOM   7368 O O   . ALA B 1 419 ? -20.253 -65.847 -10.183 1.00 59.16  ? 420  ALA B O   1 
ATOM   7369 C CB  . ALA B 1 419 ? -17.623 -64.495 -9.016  1.00 43.49  ? 420  ALA B CB  1 
ATOM   7370 N N   . GLN B 1 420 ? -18.795 -65.626 -11.876 1.00 58.20  ? 421  GLN B N   1 
ATOM   7371 C CA  . GLN B 1 420 ? -19.847 -65.329 -12.854 1.00 50.13  ? 421  GLN B CA  1 
ATOM   7372 C C   . GLN B 1 420 ? -20.105 -66.451 -13.836 1.00 50.86  ? 421  GLN B C   1 
ATOM   7373 O O   . GLN B 1 420 ? -20.593 -66.224 -14.946 1.00 57.19  ? 421  GLN B O   1 
ATOM   7374 C CB  . GLN B 1 420 ? -19.515 -64.042 -13.594 1.00 47.99  ? 421  GLN B CB  1 
ATOM   7375 C CG  . GLN B 1 420 ? -19.624 -62.815 -12.683 1.00 53.67  ? 421  GLN B CG  1 
ATOM   7376 C CD  . GLN B 1 420 ? -18.710 -61.691 -13.114 1.00 60.42  ? 421  GLN B CD  1 
ATOM   7377 O OE1 . GLN B 1 420 ? -18.159 -60.965 -12.284 1.00 56.67  ? 421  GLN B OE1 1 
ATOM   7378 N NE2 . GLN B 1 420 ? -18.538 -61.542 -14.422 1.00 55.73  ? 421  GLN B NE2 1 
ATOM   7379 N N   . GLY B 1 421 ? -19.800 -67.672 -13.426 1.00 49.57  ? 422  GLY B N   1 
ATOM   7380 C CA  . GLY B 1 421 ? -20.272 -68.813 -14.180 1.00 51.51  ? 422  GLY B CA  1 
ATOM   7381 C C   . GLY B 1 421 ? -19.249 -69.847 -14.602 1.00 60.69  ? 422  GLY B C   1 
ATOM   7382 O O   . GLY B 1 421 ? -19.595 -71.020 -14.779 1.00 59.52  ? 422  GLY B O   1 
ATOM   7383 N N   . ALA B 1 422 ? -17.994 -69.440 -14.765 1.00 57.09  ? 423  ALA B N   1 
ATOM   7384 C CA  . ALA B 1 422 ? -17.034 -70.307 -15.446 1.00 50.91  ? 423  ALA B CA  1 
ATOM   7385 C C   . ALA B 1 422 ? -16.343 -71.271 -14.490 1.00 51.91  ? 423  ALA B C   1 
ATOM   7386 O O   . ALA B 1 422 ? -16.202 -70.983 -13.298 1.00 54.89  ? 423  ALA B O   1 
ATOM   7387 C CB  . ALA B 1 422 ? -16.005 -69.468 -16.180 1.00 49.12  ? 423  ALA B CB  1 
ATOM   7388 N N   . ARG B 1 423 ? -15.930 -72.424 -15.010 1.00 47.26  ? 424  ARG B N   1 
ATOM   7389 C CA  . ARG B 1 423 ? -15.055 -73.315 -14.256 1.00 48.05  ? 424  ARG B CA  1 
ATOM   7390 C C   . ARG B 1 423 ? -13.605 -72.892 -14.508 1.00 50.85  ? 424  ARG B C   1 
ATOM   7391 O O   . ARG B 1 423 ? -13.150 -72.869 -15.647 1.00 50.04  ? 424  ARG B O   1 
ATOM   7392 C CB  . ARG B 1 423 ? -15.275 -74.779 -14.651 1.00 46.33  ? 424  ARG B CB  1 
ATOM   7393 C CG  . ARG B 1 423 ? -14.610 -75.779 -13.691 1.00 60.87  ? 424  ARG B CG  1 
ATOM   7394 C CD  . ARG B 1 423 ? -15.187 -77.198 -13.831 1.00 73.16  ? 424  ARG B CD  1 
ATOM   7395 N NE  . ARG B 1 423 ? -14.910 -77.781 -15.152 1.00 76.20  ? 424  ARG B NE  1 
ATOM   7396 C CZ  . ARG B 1 423 ? -15.749 -78.565 -15.830 1.00 76.15  ? 424  ARG B CZ  1 
ATOM   7397 N NH1 . ARG B 1 423 ? -16.939 -78.866 -15.320 1.00 85.83  ? 424  ARG B NH1 1 
ATOM   7398 N NH2 . ARG B 1 423 ? -15.403 -79.050 -17.022 1.00 70.82  ? 424  ARG B NH2 1 
ATOM   7399 N N   . VAL B 1 424 ? -12.895 -72.539 -13.446 1.00 47.95  ? 425  VAL B N   1 
ATOM   7400 C CA  . VAL B 1 424 ? -11.548 -72.003 -13.557 1.00 44.80  ? 425  VAL B CA  1 
ATOM   7401 C C   . VAL B 1 424 ? -10.557 -72.913 -12.862 1.00 41.03  ? 425  VAL B C   1 
ATOM   7402 O O   . VAL B 1 424 ? -10.819 -73.387 -11.771 1.00 51.74  ? 425  VAL B O   1 
ATOM   7403 C CB  . VAL B 1 424 ? -11.450 -70.592 -12.940 1.00 40.44  ? 425  VAL B CB  1 
ATOM   7404 C CG1 . VAL B 1 424 ? -10.036 -70.048 -13.052 1.00 35.79  ? 425  VAL B CG1 1 
ATOM   7405 C CG2 . VAL B 1 424 ? -12.453 -69.646 -13.582 1.00 40.34  ? 425  VAL B CG2 1 
ATOM   7406 N N   . TYR B 1 425 ? -9.433  -73.173 -13.507 1.00 42.90  ? 426  TYR B N   1 
ATOM   7407 C CA  . TYR B 1 425 ? -8.318  -73.889 -12.901 1.00 37.16  ? 426  TYR B CA  1 
ATOM   7408 C C   . TYR B 1 425 ? -7.087  -72.977 -12.934 1.00 37.81  ? 426  TYR B C   1 
ATOM   7409 O O   . TYR B 1 425 ? -6.837  -72.308 -13.938 1.00 45.58  ? 426  TYR B O   1 
ATOM   7410 C CB  . TYR B 1 425 ? -8.045  -75.200 -13.644 1.00 40.85  ? 426  TYR B CB  1 
ATOM   7411 C CG  . TYR B 1 425 ? -9.185  -76.186 -13.577 1.00 46.82  ? 426  TYR B CG  1 
ATOM   7412 C CD1 . TYR B 1 425 ? -9.295  -77.071 -12.502 1.00 45.63  ? 426  TYR B CD1 1 
ATOM   7413 C CD2 . TYR B 1 425 ? -10.146 -76.250 -14.592 1.00 44.44  ? 426  TYR B CD2 1 
ATOM   7414 C CE1 . TYR B 1 425 ? -10.329 -77.990 -12.426 1.00 43.71  ? 426  TYR B CE1 1 
ATOM   7415 C CE2 . TYR B 1 425 ? -11.201 -77.172 -14.525 1.00 47.77  ? 426  TYR B CE2 1 
ATOM   7416 C CZ  . TYR B 1 425 ? -11.281 -78.038 -13.428 1.00 52.32  ? 426  TYR B CZ  1 
ATOM   7417 O OH  . TYR B 1 425 ? -12.299 -78.961 -13.319 1.00 50.38  ? 426  TYR B OH  1 
ATOM   7418 N N   . ALA B 1 426 ? -6.308  -72.978 -11.865 1.00 36.99  ? 427  ALA B N   1 
ATOM   7419 C CA  . ALA B 1 426 ? -5.226  -72.023 -11.710 1.00 33.76  ? 427  ALA B CA  1 
ATOM   7420 C C   . ALA B 1 426 ? -3.943  -72.725 -11.276 1.00 38.34  ? 427  ALA B C   1 
ATOM   7421 O O   . ALA B 1 426 ? -3.982  -73.694 -10.509 1.00 41.10  ? 427  ALA B O   1 
ATOM   7422 C CB  . ALA B 1 426 ? -5.620  -70.937 -10.701 1.00 36.15  ? 427  ALA B CB  1 
ATOM   7423 N N   . TYR B 1 427 ? -2.810  -72.255 -11.787 1.00 37.19  ? 428  TYR B N   1 
ATOM   7424 C CA  . TYR B 1 427 ? -1.524  -72.857 -11.461 1.00 34.61  ? 428  TYR B CA  1 
ATOM   7425 C C   . TYR B 1 427 ? -0.475  -71.792 -11.165 1.00 39.29  ? 428  TYR B C   1 
ATOM   7426 O O   . TYR B 1 427 ? -0.616  -70.631 -11.577 1.00 36.49  ? 428  TYR B O   1 
ATOM   7427 C CB  . TYR B 1 427 ? -1.018  -73.755 -12.617 1.00 42.28  ? 428  TYR B CB  1 
ATOM   7428 C CG  . TYR B 1 427 ? -0.645  -72.972 -13.881 1.00 38.30  ? 428  TYR B CG  1 
ATOM   7429 C CD1 . TYR B 1 427 ? 0.605   -72.388 -14.013 1.00 37.04  ? 428  TYR B CD1 1 
ATOM   7430 C CD2 . TYR B 1 427 ? -1.548  -72.826 -14.926 1.00 38.08  ? 428  TYR B CD2 1 
ATOM   7431 C CE1 . TYR B 1 427 ? 0.956   -71.663 -15.155 1.00 36.20  ? 428  TYR B CE1 1 
ATOM   7432 C CE2 . TYR B 1 427 ? -1.210  -72.102 -16.085 1.00 41.50  ? 428  TYR B CE2 1 
ATOM   7433 C CZ  . TYR B 1 427 ? 0.048   -71.526 -16.180 1.00 36.74  ? 428  TYR B CZ  1 
ATOM   7434 O OH  . TYR B 1 427 ? 0.393   -70.783 -17.276 1.00 36.95  ? 428  TYR B OH  1 
ATOM   7435 N N   . VAL B 1 428 ? 0.591   -72.202 -10.479 1.00 33.72  ? 429  VAL B N   1 
ATOM   7436 C CA  . VAL B 1 428 ? 1.820   -71.431 -10.476 1.00 34.62  ? 429  VAL B CA  1 
ATOM   7437 C C   . VAL B 1 428 ? 2.926   -72.376 -10.917 1.00 38.90  ? 429  VAL B C   1 
ATOM   7438 O O   . VAL B 1 428 ? 3.096   -73.453 -10.345 1.00 40.12  ? 429  VAL B O   1 
ATOM   7439 C CB  . VAL B 1 428 ? 2.136   -70.812 -9.093  1.00 45.97  ? 429  VAL B CB  1 
ATOM   7440 C CG1 . VAL B 1 428 ? 3.425   -70.014 -9.164  1.00 41.63  ? 429  VAL B CG1 1 
ATOM   7441 C CG2 . VAL B 1 428 ? 0.991   -69.920 -8.642  1.00 41.61  ? 429  VAL B CG2 1 
ATOM   7442 N N   . PHE B 1 429 ? 3.646   -71.993 -11.968 1.00 40.57  ? 430  PHE B N   1 
ATOM   7443 C CA  . PHE B 1 429 ? 4.725   -72.820 -12.509 1.00 38.53  ? 430  PHE B CA  1 
ATOM   7444 C C   . PHE B 1 429 ? 6.018   -72.517 -11.744 1.00 38.97  ? 430  PHE B C   1 
ATOM   7445 O O   . PHE B 1 429 ? 6.474   -71.377 -11.750 1.00 41.31  ? 430  PHE B O   1 
ATOM   7446 C CB  . PHE B 1 429 ? 4.894   -72.568 -14.032 1.00 39.63  ? 430  PHE B CB  1 
ATOM   7447 C CG  . PHE B 1 429 ? 6.014   -73.340 -14.628 1.00 36.17  ? 430  PHE B CG  1 
ATOM   7448 C CD1 . PHE B 1 429 ? 5.811   -74.639 -15.070 1.00 36.94  ? 430  PHE B CD1 1 
ATOM   7449 C CD2 . PHE B 1 429 ? 7.285   -72.795 -14.701 1.00 34.30  ? 430  PHE B CD2 1 
ATOM   7450 C CE1 . PHE B 1 429 ? 6.859   -75.381 -15.605 1.00 41.65  ? 430  PHE B CE1 1 
ATOM   7451 C CE2 . PHE B 1 429 ? 8.333   -73.523 -15.223 1.00 40.31  ? 430  PHE B CE2 1 
ATOM   7452 C CZ  . PHE B 1 429 ? 8.119   -74.827 -15.674 1.00 42.91  ? 430  PHE B CZ  1 
ATOM   7453 N N   . GLU B 1 430 ? 6.608   -73.520 -11.091 1.00 39.25  ? 431  GLU B N   1 
ATOM   7454 C CA  . GLU B 1 430 ? 7.656   -73.252 -10.084 1.00 40.28  ? 431  GLU B CA  1 
ATOM   7455 C C   . GLU B 1 430 ? 8.960   -73.969 -10.335 1.00 44.99  ? 431  GLU B C   1 
ATOM   7456 O O   . GLU B 1 430 ? 9.828   -73.993 -9.453  1.00 45.89  ? 431  GLU B O   1 
ATOM   7457 C CB  . GLU B 1 430 ? 7.174   -73.624 -8.662  1.00 43.24  ? 431  GLU B CB  1 
ATOM   7458 C CG  . GLU B 1 430 ? 6.057   -72.731 -8.149  1.00 48.40  ? 431  GLU B CG  1 
ATOM   7459 C CD  . GLU B 1 430 ? 5.817   -72.833 -6.640  1.00 48.97  ? 431  GLU B CD  1 
ATOM   7460 O OE1 . GLU B 1 430 ? 6.169   -73.865 -6.026  1.00 58.53  ? 431  GLU B OE1 1 
ATOM   7461 O OE2 . GLU B 1 430 ? 5.271   -71.864 -6.067  1.00 54.05  ? 431  GLU B OE2 1 
ATOM   7462 N N   . HIS B 1 431 ? 9.114   -74.560 -11.521 1.00 43.42  ? 432  HIS B N   1 
ATOM   7463 C CA  . HIS B 1 431 ? 10.348  -75.284 -11.801 1.00 39.95  ? 432  HIS B CA  1 
ATOM   7464 C C   . HIS B 1 431 ? 11.358  -74.432 -12.561 1.00 48.78  ? 432  HIS B C   1 
ATOM   7465 O O   . HIS B 1 431 ? 11.041  -73.839 -13.596 1.00 49.60  ? 432  HIS B O   1 
ATOM   7466 C CB  . HIS B 1 431 ? 10.063  -76.569 -12.589 1.00 42.63  ? 432  HIS B CB  1 
ATOM   7467 C CG  . HIS B 1 431 ? 11.303  -77.258 -13.071 1.00 51.31  ? 432  HIS B CG  1 
ATOM   7468 N ND1 . HIS B 1 431 ? 12.106  -78.007 -12.241 1.00 45.66  ? 432  HIS B ND1 1 
ATOM   7469 C CD2 . HIS B 1 431 ? 11.892  -77.287 -14.292 1.00 48.97  ? 432  HIS B CD2 1 
ATOM   7470 C CE1 . HIS B 1 431 ? 13.132  -78.477 -12.929 1.00 50.88  ? 432  HIS B CE1 1 
ATOM   7471 N NE2 . HIS B 1 431 ? 13.027  -78.055 -14.176 1.00 46.56  ? 432  HIS B NE2 1 
ATOM   7472 N N   . ARG B 1 432 ? 12.586  -74.398 -12.057 1.00 43.17  ? 433  ARG B N   1 
ATOM   7473 C CA  . ARG B 1 432 ? 13.655  -73.690 -12.732 1.00 46.58  ? 433  ARG B CA  1 
ATOM   7474 C C   . ARG B 1 432 ? 14.446  -74.667 -13.601 1.00 50.84  ? 433  ARG B C   1 
ATOM   7475 O O   . ARG B 1 432 ? 15.172  -75.526 -13.086 1.00 55.69  ? 433  ARG B O   1 
ATOM   7476 C CB  . ARG B 1 432 ? 14.576  -72.992 -11.725 1.00 46.68  ? 433  ARG B CB  1 
ATOM   7477 C CG  . ARG B 1 432 ? 15.647  -72.170 -12.410 1.00 50.95  ? 433  ARG B CG  1 
ATOM   7478 C CD  . ARG B 1 432 ? 16.572  -71.506 -11.428 1.00 48.88  ? 433  ARG B CD  1 
ATOM   7479 N NE  . ARG B 1 432 ? 17.807  -71.094 -12.086 1.00 49.20  ? 433  ARG B NE  1 
ATOM   7480 C CZ  . ARG B 1 432 ? 18.023  -69.886 -12.598 1.00 53.43  ? 433  ARG B CZ  1 
ATOM   7481 N NH1 . ARG B 1 432 ? 17.088  -68.941 -12.522 1.00 52.31  ? 433  ARG B NH1 1 
ATOM   7482 N NH2 . ARG B 1 432 ? 19.184  -69.617 -13.183 1.00 52.27  ? 433  ARG B NH2 1 
ATOM   7483 N N   . ALA B 1 433 ? 14.288  -74.540 -14.915 1.00 53.78  ? 434  ALA B N   1 
ATOM   7484 C CA  . ALA B 1 433 ? 14.886  -75.476 -15.865 1.00 55.84  ? 434  ALA B CA  1 
ATOM   7485 C C   . ALA B 1 433 ? 16.400  -75.592 -15.684 1.00 60.03  ? 434  ALA B C   1 
ATOM   7486 O O   . ALA B 1 433 ? 17.103  -74.585 -15.538 1.00 59.07  ? 434  ALA B O   1 
ATOM   7487 C CB  . ALA B 1 433 ? 14.553  -75.064 -17.294 1.00 48.27  ? 434  ALA B CB  1 
ATOM   7488 N N   . SER B 1 434 ? 16.888  -76.830 -15.698 1.00 56.39  ? 435  SER B N   1 
ATOM   7489 C CA  . SER B 1 434 ? 18.316  -77.108 -15.587 1.00 52.22  ? 435  SER B CA  1 
ATOM   7490 C C   . SER B 1 434 ? 19.127  -76.403 -16.684 1.00 54.28  ? 435  SER B C   1 
ATOM   7491 O O   . SER B 1 434 ? 20.330  -76.207 -16.541 1.00 49.31  ? 435  SER B O   1 
ATOM   7492 C CB  . SER B 1 434 ? 18.556  -78.622 -15.646 1.00 58.18  ? 435  SER B CB  1 
ATOM   7493 O OG  . SER B 1 434 ? 18.117  -79.162 -16.892 1.00 57.75  ? 435  SER B OG  1 
ATOM   7494 N N   . THR B 1 435 ? 18.463  -76.010 -17.770 1.00 53.40  ? 436  THR B N   1 
ATOM   7495 C CA  . THR B 1 435 ? 19.153  -75.403 -18.910 1.00 54.62  ? 436  THR B CA  1 
ATOM   7496 C C   . THR B 1 435 ? 19.066  -73.882 -18.903 1.00 48.72  ? 436  THR B C   1 
ATOM   7497 O O   . THR B 1 435 ? 19.691  -73.218 -19.713 1.00 49.40  ? 436  THR B O   1 
ATOM   7498 C CB  . THR B 1 435 ? 18.582  -75.929 -20.234 1.00 54.47  ? 436  THR B CB  1 
ATOM   7499 O OG1 . THR B 1 435 ? 17.161  -75.759 -20.230 1.00 57.64  ? 436  THR B OG1 1 
ATOM   7500 C CG2 . THR B 1 435 ? 18.880  -77.400 -20.369 1.00 56.67  ? 436  THR B CG2 1 
ATOM   7501 N N   . LEU B 1 436 ? 18.311  -73.340 -17.957 1.00 55.22  ? 437  LEU B N   1 
ATOM   7502 C CA  . LEU B 1 436 ? 18.070  -71.904 -17.881 1.00 54.60  ? 437  LEU B CA  1 
ATOM   7503 C C   . LEU B 1 436 ? 19.370  -71.092 -17.889 1.00 53.67  ? 437  LEU B C   1 
ATOM   7504 O O   . LEU B 1 436 ? 20.243  -71.300 -17.049 1.00 50.45  ? 437  LEU B O   1 
ATOM   7505 C CB  . LEU B 1 436 ? 17.249  -71.579 -16.622 1.00 50.54  ? 437  LEU B CB  1 
ATOM   7506 C CG  . LEU B 1 436 ? 16.535  -70.225 -16.628 1.00 52.53  ? 437  LEU B CG  1 
ATOM   7507 C CD1 . LEU B 1 436 ? 15.594  -70.135 -17.818 1.00 45.63  ? 437  LEU B CD1 1 
ATOM   7508 C CD2 . LEU B 1 436 ? 15.776  -69.996 -15.330 1.00 53.69  ? 437  LEU B CD2 1 
ATOM   7509 N N   . SER B 1 437 ? 19.484  -70.156 -18.827 1.00 49.73  ? 438  SER B N   1 
ATOM   7510 C CA  . SER B 1 437 ? 20.718  -69.392 -18.987 1.00 48.36  ? 438  SER B CA  1 
ATOM   7511 C C   . SER B 1 437 ? 20.717  -68.044 -18.242 1.00 55.25  ? 438  SER B C   1 
ATOM   7512 O O   . SER B 1 437 ? 21.750  -67.365 -18.185 1.00 58.45  ? 438  SER B O   1 
ATOM   7513 C CB  . SER B 1 437 ? 20.997  -69.180 -20.484 1.00 58.59  ? 438  SER B CB  1 
ATOM   7514 O OG  . SER B 1 437 ? 19.829  -68.758 -21.170 1.00 56.87  ? 438  SER B OG  1 
ATOM   7515 N N   . TRP B 1 438 ? 19.571  -67.665 -17.667 1.00 53.93  ? 439  TRP B N   1 
ATOM   7516 C CA  . TRP B 1 438 ? 19.482  -66.477 -16.802 1.00 50.14  ? 439  TRP B CA  1 
ATOM   7517 C C   . TRP B 1 438 ? 20.033  -66.782 -15.402 1.00 51.87  ? 439  TRP B C   1 
ATOM   7518 O O   . TRP B 1 438 ? 20.009  -67.933 -14.977 1.00 51.70  ? 439  TRP B O   1 
ATOM   7519 C CB  . TRP B 1 438 ? 18.029  -65.993 -16.692 1.00 45.70  ? 439  TRP B CB  1 
ATOM   7520 C CG  . TRP B 1 438 ? 17.422  -65.544 -17.965 1.00 47.96  ? 439  TRP B CG  1 
ATOM   7521 C CD1 . TRP B 1 438 ? 16.599  -66.271 -18.783 1.00 44.42  ? 439  TRP B CD1 1 
ATOM   7522 C CD2 . TRP B 1 438 ? 17.567  -64.259 -18.578 1.00 41.53  ? 439  TRP B CD2 1 
ATOM   7523 N NE1 . TRP B 1 438 ? 16.225  -65.517 -19.864 1.00 45.47  ? 439  TRP B NE1 1 
ATOM   7524 C CE2 . TRP B 1 438 ? 16.806  -64.280 -19.771 1.00 42.12  ? 439  TRP B CE2 1 
ATOM   7525 C CE3 . TRP B 1 438 ? 18.271  -63.099 -18.241 1.00 41.85  ? 439  TRP B CE3 1 
ATOM   7526 C CZ2 . TRP B 1 438 ? 16.726  -63.184 -20.630 1.00 42.28  ? 439  TRP B CZ2 1 
ATOM   7527 C CZ3 . TRP B 1 438 ? 18.197  -62.008 -19.089 1.00 41.48  ? 439  TRP B CZ3 1 
ATOM   7528 C CH2 . TRP B 1 438 ? 17.422  -62.055 -20.273 1.00 49.01  ? 439  TRP B CH2 1 
ATOM   7529 N N   . PRO B 1 439 ? 20.514  -65.749 -14.676 1.00 51.97  ? 440  PRO B N   1 
ATOM   7530 C CA  . PRO B 1 439 ? 21.090  -65.912 -13.327 1.00 52.45  ? 440  PRO B CA  1 
ATOM   7531 C C   . PRO B 1 439 ? 20.117  -66.470 -12.279 1.00 53.78  ? 440  PRO B C   1 
ATOM   7532 O O   . PRO B 1 439 ? 18.893  -66.363 -12.399 1.00 49.28  ? 440  PRO B O   1 
ATOM   7533 C CB  . PRO B 1 439 ? 21.506  -64.489 -12.946 1.00 55.13  ? 440  PRO B CB  1 
ATOM   7534 C CG  . PRO B 1 439 ? 20.673  -63.594 -13.816 1.00 54.16  ? 440  PRO B CG  1 
ATOM   7535 C CD  . PRO B 1 439 ? 20.549  -64.342 -15.114 1.00 55.56  ? 440  PRO B CD  1 
ATOM   7536 N N   . LEU B 1 440 ? 20.679  -67.066 -11.242 1.00 51.19  ? 441  LEU B N   1 
ATOM   7537 C CA  . LEU B 1 440 ? 19.878  -67.700 -10.216 1.00 51.51  ? 441  LEU B CA  1 
ATOM   7538 C C   . LEU B 1 440 ? 18.907  -66.731 -9.515  1.00 51.43  ? 441  LEU B C   1 
ATOM   7539 O O   . LEU B 1 440 ? 17.810  -67.135 -9.135  1.00 52.24  ? 441  LEU B O   1 
ATOM   7540 C CB  . LEU B 1 440 ? 20.789  -68.348 -9.181  1.00 58.45  ? 441  LEU B CB  1 
ATOM   7541 C CG  . LEU B 1 440 ? 20.218  -69.501 -8.346  1.00 59.41  ? 441  LEU B CG  1 
ATOM   7542 C CD1 . LEU B 1 440 ? 20.291  -70.804 -9.112  1.00 58.01  ? 441  LEU B CD1 1 
ATOM   7543 C CD2 . LEU B 1 440 ? 20.979  -69.626 -7.030  1.00 62.77  ? 441  LEU B CD2 1 
ATOM   7544 N N   . TRP B 1 441 ? 19.290  -65.466 -9.344  1.00 46.63  ? 442  TRP B N   1 
ATOM   7545 C CA  . TRP B 1 441 ? 18.426  -64.533 -8.606  1.00 49.56  ? 442  TRP B CA  1 
ATOM   7546 C C   . TRP B 1 441 ? 17.094  -64.284 -9.323  1.00 51.52  ? 442  TRP B C   1 
ATOM   7547 O O   . TRP B 1 441 ? 16.090  -64.010 -8.667  1.00 54.75  ? 442  TRP B O   1 
ATOM   7548 C CB  . TRP B 1 441 ? 19.133  -63.185 -8.328  1.00 47.78  ? 442  TRP B CB  1 
ATOM   7549 C CG  . TRP B 1 441 ? 19.442  -62.299 -9.533  1.00 47.50  ? 442  TRP B CG  1 
ATOM   7550 C CD1 . TRP B 1 441 ? 20.630  -62.214 -10.195 1.00 51.61  ? 442  TRP B CD1 1 
ATOM   7551 C CD2 . TRP B 1 441 ? 18.562  -61.361 -10.179 1.00 50.74  ? 442  TRP B CD2 1 
ATOM   7552 N NE1 . TRP B 1 441 ? 20.547  -61.296 -11.217 1.00 50.74  ? 442  TRP B NE1 1 
ATOM   7553 C CE2 . TRP B 1 441 ? 19.287  -60.766 -11.235 1.00 44.55  ? 442  TRP B CE2 1 
ATOM   7554 C CE3 . TRP B 1 441 ? 17.236  -60.971 -9.971  1.00 49.04  ? 442  TRP B CE3 1 
ATOM   7555 C CZ2 . TRP B 1 441 ? 18.735  -59.803 -12.075 1.00 45.55  ? 442  TRP B CZ2 1 
ATOM   7556 C CZ3 . TRP B 1 441 ? 16.682  -60.017 -10.817 1.00 49.12  ? 442  TRP B CZ3 1 
ATOM   7557 C CH2 . TRP B 1 441 ? 17.433  -59.444 -11.857 1.00 47.51  ? 442  TRP B CH2 1 
ATOM   7558 N N   . MET B 1 442 ? 17.072  -64.394 -10.655 1.00 50.23  ? 443  MET B N   1 
ATOM   7559 C CA  . MET B 1 442 ? 15.815  -64.238 -11.393 1.00 47.27  ? 443  MET B CA  1 
ATOM   7560 C C   . MET B 1 442 ? 14.802  -65.370 -11.120 1.00 47.02  ? 443  MET B C   1 
ATOM   7561 O O   . MET B 1 442 ? 13.624  -65.240 -11.459 1.00 47.97  ? 443  MET B O   1 
ATOM   7562 C CB  . MET B 1 442 ? 16.079  -64.146 -12.892 1.00 50.70  ? 443  MET B CB  1 
ATOM   7563 C CG  . MET B 1 442 ? 16.813  -62.894 -13.321 1.00 48.74  ? 443  MET B CG  1 
ATOM   7564 S SD  . MET B 1 442 ? 16.710  -62.616 -15.105 1.00 55.68  ? 443  MET B SD  1 
ATOM   7565 C CE  . MET B 1 442 ? 17.987  -61.393 -15.228 1.00 55.77  ? 443  MET B CE  1 
ATOM   7566 N N   . GLY B 1 443 ? 15.249  -66.463 -10.502 1.00 46.53  ? 444  GLY B N   1 
ATOM   7567 C CA  . GLY B 1 443 ? 14.369  -67.576 -10.164 1.00 41.53  ? 444  GLY B CA  1 
ATOM   7568 C C   . GLY B 1 443 ? 13.722  -68.219 -11.389 1.00 48.65  ? 444  GLY B C   1 
ATOM   7569 O O   . GLY B 1 443 ? 14.403  -68.621 -12.328 1.00 44.29  ? 444  GLY B O   1 
ATOM   7570 N N   . VAL B 1 444 ? 12.397  -68.324 -11.370 1.00 45.01  ? 445  VAL B N   1 
ATOM   7571 C CA  . VAL B 1 444 ? 11.645  -68.853 -12.497 1.00 41.18  ? 445  VAL B CA  1 
ATOM   7572 C C   . VAL B 1 444 ? 10.974  -67.719 -13.262 1.00 40.58  ? 445  VAL B C   1 
ATOM   7573 O O   . VAL B 1 444 ? 9.877   -67.324 -12.906 1.00 41.31  ? 445  VAL B O   1 
ATOM   7574 C CB  . VAL B 1 444 ? 10.578  -69.844 -12.026 1.00 47.08  ? 445  VAL B CB  1 
ATOM   7575 C CG1 . VAL B 1 444 ? 9.988   -70.613 -13.191 1.00 42.90  ? 445  VAL B CG1 1 
ATOM   7576 C CG2 . VAL B 1 444 ? 11.161  -70.795 -10.966 1.00 43.92  ? 445  VAL B CG2 1 
ATOM   7577 N N   . PRO B 1 445 ? 11.627  -67.207 -14.332 1.00 42.50  ? 446  PRO B N   1 
ATOM   7578 C CA  . PRO B 1 445 ? 11.168  -65.976 -14.989 1.00 43.40  ? 446  PRO B CA  1 
ATOM   7579 C C   . PRO B 1 445 ? 10.031  -66.155 -15.967 1.00 37.76  ? 446  PRO B C   1 
ATOM   7580 O O   . PRO B 1 445 ? 9.733   -67.254 -16.428 1.00 38.49  ? 446  PRO B O   1 
ATOM   7581 C CB  . PRO B 1 445 ? 12.415  -65.475 -15.743 1.00 38.47  ? 446  PRO B CB  1 
ATOM   7582 C CG  . PRO B 1 445 ? 13.518  -66.421 -15.382 1.00 43.74  ? 446  PRO B CG  1 
ATOM   7583 C CD  . PRO B 1 445 ? 12.875  -67.692 -14.934 1.00 37.56  ? 446  PRO B CD  1 
ATOM   7584 N N   . HIS B 1 446 ? 9.405   -65.032 -16.271 1.00 40.17  ? 447  HIS B N   1 
ATOM   7585 C CA  . HIS B 1 446 ? 8.385   -64.923 -17.311 1.00 43.21  ? 447  HIS B CA  1 
ATOM   7586 C C   . HIS B 1 446 ? 8.732   -65.690 -18.582 1.00 40.40  ? 447  HIS B C   1 
ATOM   7587 O O   . HIS B 1 446 ? 9.814   -65.508 -19.130 1.00 42.11  ? 447  HIS B O   1 
ATOM   7588 C CB  . HIS B 1 446 ? 8.197   -63.451 -17.643 1.00 39.04  ? 447  HIS B CB  1 
ATOM   7589 C CG  . HIS B 1 446 ? 7.072   -63.180 -18.580 1.00 42.32  ? 447  HIS B CG  1 
ATOM   7590 N ND1 . HIS B 1 446 ? 5.758   -63.138 -18.164 1.00 35.01  ? 447  HIS B ND1 1 
ATOM   7591 C CD2 . HIS B 1 446 ? 7.064   -62.900 -19.909 1.00 34.26  ? 447  HIS B CD2 1 
ATOM   7592 C CE1 . HIS B 1 446 ? 4.983   -62.852 -19.196 1.00 39.21  ? 447  HIS B CE1 1 
ATOM   7593 N NE2 . HIS B 1 446 ? 5.752   -62.708 -20.267 1.00 40.65  ? 447  HIS B NE2 1 
ATOM   7594 N N   . GLY B 1 447 ? 7.818   -66.560 -19.020 1.00 43.65  ? 448  GLY B N   1 
ATOM   7595 C CA  . GLY B 1 447 ? 7.944   -67.290 -20.268 1.00 36.33  ? 448  GLY B CA  1 
ATOM   7596 C C   . GLY B 1 447 ? 8.619   -68.653 -20.246 1.00 41.46  ? 448  GLY B C   1 
ATOM   7597 O O   . GLY B 1 447 ? 8.643   -69.355 -21.258 1.00 44.69  ? 448  GLY B O   1 
ATOM   7598 N N   . TYR B 1 448 ? 9.182   -69.050 -19.116 1.00 45.44  ? 449  TYR B N   1 
ATOM   7599 C CA  . TYR B 1 448 ? 9.991   -70.257 -19.102 1.00 39.75  ? 449  TYR B CA  1 
ATOM   7600 C C   . TYR B 1 448 ? 9.191   -71.487 -18.699 1.00 41.05  ? 449  TYR B C   1 
ATOM   7601 O O   . TYR B 1 448 ? 9.739   -72.563 -18.570 1.00 41.67  ? 449  TYR B O   1 
ATOM   7602 C CB  . TYR B 1 448 ? 11.231  -70.029 -18.229 1.00 41.31  ? 449  TYR B CB  1 
ATOM   7603 C CG  . TYR B 1 448 ? 12.179  -69.209 -19.058 1.00 43.75  ? 449  TYR B CG  1 
ATOM   7604 C CD1 . TYR B 1 448 ? 12.982  -69.819 -20.022 1.00 46.83  ? 449  TYR B CD1 1 
ATOM   7605 C CD2 . TYR B 1 448 ? 12.186  -67.819 -18.984 1.00 42.22  ? 449  TYR B CD2 1 
ATOM   7606 C CE1 . TYR B 1 448 ? 13.805  -69.078 -20.842 1.00 45.87  ? 449  TYR B CE1 1 
ATOM   7607 C CE2 . TYR B 1 448 ? 13.015  -67.067 -19.803 1.00 43.40  ? 449  TYR B CE2 1 
ATOM   7608 C CZ  . TYR B 1 448 ? 13.819  -67.701 -20.735 1.00 50.51  ? 449  TYR B CZ  1 
ATOM   7609 O OH  . TYR B 1 448 ? 14.639  -66.959 -21.579 1.00 51.39  ? 449  TYR B OH  1 
ATOM   7610 N N   . GLU B 1 449 ? 7.875   -71.345 -18.585 1.00 42.51  ? 450  GLU B N   1 
ATOM   7611 C CA  . GLU B 1 449 ? 7.019   -72.530 -18.508 1.00 43.27  ? 450  GLU B CA  1 
ATOM   7612 C C   . GLU B 1 449 ? 6.681   -73.036 -19.920 1.00 39.94  ? 450  GLU B C   1 
ATOM   7613 O O   . GLU B 1 449 ? 6.339   -74.212 -20.103 1.00 39.27  ? 450  GLU B O   1 
ATOM   7614 C CB  . GLU B 1 449 ? 5.728   -72.236 -17.748 1.00 34.69  ? 450  GLU B CB  1 
ATOM   7615 C CG  . GLU B 1 449 ? 4.587   -71.729 -18.633 1.00 42.94  ? 450  GLU B CG  1 
ATOM   7616 C CD  . GLU B 1 449 ? 4.716   -70.261 -19.055 1.00 45.93  ? 450  GLU B CD  1 
ATOM   7617 O OE1 . GLU B 1 449 ? 5.840   -69.698 -18.971 1.00 44.16  ? 450  GLU B OE1 1 
ATOM   7618 O OE2 . GLU B 1 449 ? 3.673   -69.669 -19.462 1.00 41.72  ? 450  GLU B OE2 1 
ATOM   7619 N N   . ILE B 1 450 ? 6.784   -72.160 -20.922 1.00 41.42  ? 451  ILE B N   1 
ATOM   7620 C CA  . ILE B 1 450 ? 6.289   -72.482 -22.269 1.00 36.58  ? 451  ILE B CA  1 
ATOM   7621 C C   . ILE B 1 450 ? 6.936   -73.740 -22.846 1.00 38.30  ? 451  ILE B C   1 
ATOM   7622 O O   . ILE B 1 450 ? 6.258   -74.647 -23.343 1.00 35.75  ? 451  ILE B O   1 
ATOM   7623 C CB  . ILE B 1 450 ? 6.526   -71.325 -23.246 1.00 40.95  ? 451  ILE B CB  1 
ATOM   7624 C CG1 . ILE B 1 450 ? 5.696   -70.108 -22.856 1.00 37.46  ? 451  ILE B CG1 1 
ATOM   7625 C CG2 . ILE B 1 450 ? 6.185   -71.751 -24.653 1.00 34.15  ? 451  ILE B CG2 1 
ATOM   7626 C CD1 . ILE B 1 450 ? 6.012   -68.889 -23.703 1.00 34.16  ? 451  ILE B CD1 1 
ATOM   7627 N N   . GLU B 1 451 ? 8.253   -73.799 -22.747 1.00 36.71  ? 452  GLU B N   1 
ATOM   7628 C CA  . GLU B 1 451 ? 9.003   -74.897 -23.330 1.00 40.95  ? 452  GLU B CA  1 
ATOM   7629 C C   . GLU B 1 451 ? 8.616   -76.261 -22.735 1.00 43.81  ? 452  GLU B C   1 
ATOM   7630 O O   . GLU B 1 451 ? 8.769   -77.288 -23.399 1.00 39.27  ? 452  GLU B O   1 
ATOM   7631 C CB  . GLU B 1 451 ? 10.510  -74.634 -23.166 1.00 47.22  ? 452  GLU B CB  1 
ATOM   7632 C CG  . GLU B 1 451 ? 10.977  -74.450 -21.702 1.00 43.67  ? 452  GLU B CG  1 
ATOM   7633 C CD  . GLU B 1 451 ? 12.318  -73.687 -21.580 1.00 52.10  ? 452  GLU B CD  1 
ATOM   7634 O OE1 . GLU B 1 451 ? 13.261  -74.213 -20.938 1.00 47.11  ? 452  GLU B OE1 1 
ATOM   7635 O OE2 . GLU B 1 451 ? 12.427  -72.553 -22.118 1.00 50.50  ? 452  GLU B OE2 1 
ATOM   7636 N N   . PHE B 1 452 ? 8.099   -76.278 -21.503 1.00 38.37  ? 453  PHE B N   1 
ATOM   7637 C CA  . PHE B 1 452 ? 7.629   -77.529 -20.908 1.00 38.13  ? 453  PHE B CA  1 
ATOM   7638 C C   . PHE B 1 452 ? 6.262   -77.890 -21.465 1.00 40.66  ? 453  PHE B C   1 
ATOM   7639 O O   . PHE B 1 452 ? 6.010   -79.060 -21.781 1.00 44.24  ? 453  PHE B O   1 
ATOM   7640 C CB  . PHE B 1 452 ? 7.607   -77.444 -19.366 1.00 38.75  ? 453  PHE B CB  1 
ATOM   7641 C CG  . PHE B 1 452 ? 8.980   -77.588 -18.758 1.00 44.75  ? 453  PHE B CG  1 
ATOM   7642 C CD1 . PHE B 1 452 ? 9.456   -78.834 -18.372 1.00 43.70  ? 453  PHE B CD1 1 
ATOM   7643 C CD2 . PHE B 1 452 ? 9.819   -76.491 -18.635 1.00 42.35  ? 453  PHE B CD2 1 
ATOM   7644 C CE1 . PHE B 1 452 ? 10.734  -78.983 -17.854 1.00 43.64  ? 453  PHE B CE1 1 
ATOM   7645 C CE2 . PHE B 1 452 ? 11.097  -76.627 -18.108 1.00 48.63  ? 453  PHE B CE2 1 
ATOM   7646 C CZ  . PHE B 1 452 ? 11.562  -77.880 -17.719 1.00 44.36  ? 453  PHE B CZ  1 
ATOM   7647 N N   . ILE B 1 453 ? 5.394   -76.889 -21.604 1.00 36.50  ? 454  ILE B N   1 
ATOM   7648 C CA  . ILE B 1 453 ? 4.059   -77.082 -22.186 1.00 39.49  ? 454  ILE B CA  1 
ATOM   7649 C C   . ILE B 1 453 ? 4.176   -77.693 -23.588 1.00 42.86  ? 454  ILE B C   1 
ATOM   7650 O O   . ILE B 1 453 ? 3.396   -78.571 -23.966 1.00 41.51  ? 454  ILE B O   1 
ATOM   7651 C CB  . ILE B 1 453 ? 3.253   -75.723 -22.265 1.00 39.01  ? 454  ILE B CB  1 
ATOM   7652 C CG1 . ILE B 1 453 ? 3.196   -75.002 -20.887 1.00 37.69  ? 454  ILE B CG1 1 
ATOM   7653 C CG2 . ILE B 1 453 ? 1.849   -75.943 -22.808 1.00 35.85  ? 454  ILE B CG2 1 
ATOM   7654 C CD1 . ILE B 1 453 ? 2.589   -75.815 -19.838 1.00 40.47  ? 454  ILE B CD1 1 
ATOM   7655 N N   . PHE B 1 454 ? 5.165   -77.243 -24.357 1.00 41.21  ? 455  PHE B N   1 
ATOM   7656 C CA  . PHE B 1 454 ? 5.305   -77.719 -25.725 1.00 44.47  ? 455  PHE B CA  1 
ATOM   7657 C C   . PHE B 1 454 ? 6.154   -78.985 -25.790 1.00 47.21  ? 455  PHE B C   1 
ATOM   7658 O O   . PHE B 1 454 ? 6.403   -79.532 -26.869 1.00 44.86  ? 455  PHE B O   1 
ATOM   7659 C CB  . PHE B 1 454 ? 5.903   -76.624 -26.617 1.00 43.13  ? 455  PHE B CB  1 
ATOM   7660 C CG  . PHE B 1 454 ? 4.883   -75.676 -27.160 1.00 43.31  ? 455  PHE B CG  1 
ATOM   7661 C CD1 . PHE B 1 454 ? 4.471   -74.582 -26.428 1.00 40.00  ? 455  PHE B CD1 1 
ATOM   7662 C CD2 . PHE B 1 454 ? 4.319   -75.889 -28.408 1.00 43.00  ? 455  PHE B CD2 1 
ATOM   7663 C CE1 . PHE B 1 454 ? 3.514   -73.712 -26.949 1.00 43.23  ? 455  PHE B CE1 1 
ATOM   7664 C CE2 . PHE B 1 454 ? 3.371   -75.027 -28.921 1.00 36.42  ? 455  PHE B CE2 1 
ATOM   7665 C CZ  . PHE B 1 454 ? 2.969   -73.944 -28.203 1.00 37.69  ? 455  PHE B CZ  1 
ATOM   7666 N N   . GLY B 1 455 ? 6.604   -79.440 -24.628 1.00 42.96  ? 456  GLY B N   1 
ATOM   7667 C CA  . GLY B 1 455 ? 7.315   -80.701 -24.538 1.00 43.33  ? 456  GLY B CA  1 
ATOM   7668 C C   . GLY B 1 455 ? 8.717   -80.639 -25.117 1.00 46.26  ? 456  GLY B C   1 
ATOM   7669 O O   . GLY B 1 455 ? 9.285   -81.674 -25.501 1.00 47.42  ? 456  GLY B O   1 
ATOM   7670 N N   . ILE B 1 456 ? 9.291   -79.438 -25.163 1.00 38.57  ? 457  ILE B N   1 
ATOM   7671 C CA  . ILE B 1 456 ? 10.598  -79.257 -25.778 1.00 46.13  ? 457  ILE B CA  1 
ATOM   7672 C C   . ILE B 1 456 ? 11.716  -80.107 -25.132 1.00 48.12  ? 457  ILE B C   1 
ATOM   7673 O O   . ILE B 1 456 ? 12.674  -80.468 -25.815 1.00 53.36  ? 457  ILE B O   1 
ATOM   7674 C CB  . ILE B 1 456 ? 11.012  -77.774 -25.774 1.00 48.39  ? 457  ILE B CB  1 
ATOM   7675 C CG1 . ILE B 1 456 ? 9.932   -76.912 -26.454 1.00 44.42  ? 457  ILE B CG1 1 
ATOM   7676 C CG2 . ILE B 1 456 ? 12.306  -77.585 -26.546 1.00 47.42  ? 457  ILE B CG2 1 
ATOM   7677 C CD1 . ILE B 1 456 ? 9.792   -77.192 -27.936 1.00 44.69  ? 457  ILE B CD1 1 
ATOM   7678 N N   . PRO B 1 457 ? 11.609  -80.442 -23.835 1.00 44.70  ? 458  PRO B N   1 
ATOM   7679 C CA  . PRO B 1 457 ? 12.676  -81.317 -23.325 1.00 48.06  ? 458  PRO B CA  1 
ATOM   7680 C C   . PRO B 1 457 ? 12.785  -82.689 -23.984 1.00 45.01  ? 458  PRO B C   1 
ATOM   7681 O O   . PRO B 1 457 ? 13.820  -83.331 -23.815 1.00 44.68  ? 458  PRO B O   1 
ATOM   7682 C CB  . PRO B 1 457 ? 12.304  -81.483 -21.846 1.00 41.46  ? 458  PRO B CB  1 
ATOM   7683 C CG  . PRO B 1 457 ? 11.636  -80.247 -21.510 1.00 46.90  ? 458  PRO B CG  1 
ATOM   7684 C CD  . PRO B 1 457 ? 10.849  -79.842 -22.719 1.00 43.71  ? 458  PRO B CD  1 
ATOM   7685 N N   . LEU B 1 458 ? 11.754  -83.126 -24.703 1.00 47.24  ? 459  LEU B N   1 
ATOM   7686 C CA  . LEU B 1 458 ? 11.801  -84.401 -25.413 1.00 42.68  ? 459  LEU B CA  1 
ATOM   7687 C C   . LEU B 1 458 ? 12.717  -84.352 -26.632 1.00 51.26  ? 459  LEU B C   1 
ATOM   7688 O O   . LEU B 1 458 ? 13.033  -85.384 -27.229 1.00 48.98  ? 459  LEU B O   1 
ATOM   7689 C CB  . LEU B 1 458 ? 10.398  -84.828 -25.836 1.00 44.45  ? 459  LEU B CB  1 
ATOM   7690 C CG  . LEU B 1 458 ? 9.477   -85.132 -24.661 1.00 46.23  ? 459  LEU B CG  1 
ATOM   7691 C CD1 . LEU B 1 458 ? 8.173   -85.720 -25.140 1.00 48.89  ? 459  LEU B CD1 1 
ATOM   7692 C CD2 . LEU B 1 458 ? 10.184  -86.071 -23.698 1.00 47.35  ? 459  LEU B CD2 1 
ATOM   7693 N N   . ASP B 1 459 ? 13.140  -83.147 -26.992 1.00 49.18  ? 460  ASP B N   1 
ATOM   7694 C CA  . ASP B 1 459 ? 14.001  -82.943 -28.140 1.00 55.65  ? 460  ASP B CA  1 
ATOM   7695 C C   . ASP B 1 459 ? 15.413  -83.432 -27.816 1.00 59.57  ? 460  ASP B C   1 
ATOM   7696 O O   . ASP B 1 459 ? 16.130  -82.829 -27.001 1.00 56.52  ? 460  ASP B O   1 
ATOM   7697 C CB  . ASP B 1 459 ? 13.990  -81.463 -28.527 1.00 60.76  ? 460  ASP B CB  1 
ATOM   7698 C CG  . ASP B 1 459 ? 14.798  -81.156 -29.772 1.00 60.42  ? 460  ASP B CG  1 
ATOM   7699 O OD1 . ASP B 1 459 ? 15.780  -81.865 -30.079 1.00 55.97  ? 460  ASP B OD1 1 
ATOM   7700 O OD2 . ASP B 1 459 ? 14.456  -80.150 -30.425 1.00 67.79  ? 460  ASP B OD2 1 
ATOM   7701 N N   . PRO B 1 460 ? 15.831  -84.507 -28.495 1.00 57.16  ? 461  PRO B N   1 
ATOM   7702 C CA  . PRO B 1 460 ? 17.099  -85.179 -28.184 1.00 62.22  ? 461  PRO B CA  1 
ATOM   7703 C C   . PRO B 1 460 ? 18.336  -84.285 -28.362 1.00 63.23  ? 461  PRO B C   1 
ATOM   7704 O O   . PRO B 1 460 ? 19.368  -84.593 -27.771 1.00 70.35  ? 461  PRO B O   1 
ATOM   7705 C CB  . PRO B 1 460 ? 17.121  -86.355 -29.163 1.00 58.61  ? 461  PRO B CB  1 
ATOM   7706 C CG  . PRO B 1 460 ? 16.240  -85.922 -30.308 1.00 65.85  ? 461  PRO B CG  1 
ATOM   7707 C CD  . PRO B 1 460 ? 15.171  -85.060 -29.691 1.00 62.81  ? 461  PRO B CD  1 
ATOM   7708 N N   . SER B 1 461 ? 18.242  -83.202 -29.131 1.00 60.90  ? 462  SER B N   1 
ATOM   7709 C CA  . SER B 1 461 ? 19.381  -82.295 -29.277 1.00 56.95  ? 462  SER B CA  1 
ATOM   7710 C C   . SER B 1 461 ? 19.573  -81.428 -28.035 1.00 61.39  ? 462  SER B C   1 
ATOM   7711 O O   . SER B 1 461 ? 20.612  -80.788 -27.855 1.00 62.40  ? 462  SER B O   1 
ATOM   7712 C CB  . SER B 1 461 ? 19.203  -81.404 -30.499 1.00 59.34  ? 462  SER B CB  1 
ATOM   7713 O OG  . SER B 1 461 ? 18.228  -80.407 -30.239 1.00 66.37  ? 462  SER B OG  1 
ATOM   7714 N N   . ARG B 1 462 ? 18.562  -81.398 -27.173 1.00 62.16  ? 463  ARG B N   1 
ATOM   7715 C CA  . ARG B 1 462 ? 18.644  -80.595 -25.964 1.00 63.59  ? 463  ARG B CA  1 
ATOM   7716 C C   . ARG B 1 462 ? 19.032  -81.472 -24.773 1.00 62.43  ? 463  ARG B C   1 
ATOM   7717 O O   . ARG B 1 462 ? 18.891  -82.702 -24.815 1.00 63.07  ? 463  ARG B O   1 
ATOM   7718 C CB  . ARG B 1 462 ? 17.323  -79.864 -25.735 1.00 61.16  ? 463  ARG B CB  1 
ATOM   7719 C CG  . ARG B 1 462 ? 17.002  -78.949 -26.915 1.00 60.60  ? 463  ARG B CG  1 
ATOM   7720 C CD  . ARG B 1 462 ? 15.748  -78.144 -26.719 1.00 58.70  ? 463  ARG B CD  1 
ATOM   7721 N NE  . ARG B 1 462 ? 15.438  -77.349 -27.903 1.00 69.02  ? 463  ARG B NE  1 
ATOM   7722 C CZ  . ARG B 1 462 ? 15.949  -76.146 -28.154 1.00 74.74  ? 463  ARG B CZ  1 
ATOM   7723 N NH1 . ARG B 1 462 ? 16.804  -75.596 -27.296 1.00 73.29  ? 463  ARG B NH1 1 
ATOM   7724 N NH2 . ARG B 1 462 ? 15.611  -75.496 -29.265 1.00 64.79  ? 463  ARG B NH2 1 
ATOM   7725 N N   . ASN B 1 463 ? 19.554  -80.845 -23.728 1.00 54.92  ? 464  ASN B N   1 
ATOM   7726 C CA  . ASN B 1 463 ? 20.149  -81.599 -22.631 1.00 57.54  ? 464  ASN B CA  1 
ATOM   7727 C C   . ASN B 1 463 ? 19.355  -81.497 -21.336 1.00 52.10  ? 464  ASN B C   1 
ATOM   7728 O O   . ASN B 1 463 ? 19.911  -81.174 -20.296 1.00 60.77  ? 464  ASN B O   1 
ATOM   7729 C CB  . ASN B 1 463 ? 21.591  -81.132 -22.419 1.00 59.80  ? 464  ASN B CB  1 
ATOM   7730 C CG  . ASN B 1 463 ? 22.405  -81.155 -23.716 1.00 66.79  ? 464  ASN B CG  1 
ATOM   7731 O OD1 . ASN B 1 463 ? 22.696  -82.223 -24.253 1.00 66.63  ? 464  ASN B OD1 1 
ATOM   7732 N ND2 . ASN B 1 463 ? 22.762  -79.976 -24.226 1.00 71.63  ? 464  ASN B ND2 1 
ATOM   7733 N N   . TYR B 1 464 ? 18.051  -81.768 -21.402 1.00 47.08  ? 465  TYR B N   1 
ATOM   7734 C CA  . TYR B 1 464 ? 17.223  -81.768 -20.202 1.00 53.55  ? 465  TYR B CA  1 
ATOM   7735 C C   . TYR B 1 464 ? 17.408  -83.067 -19.404 1.00 53.27  ? 465  TYR B C   1 
ATOM   7736 O O   . TYR B 1 464 ? 17.823  -84.089 -19.948 1.00 50.70  ? 465  TYR B O   1 
ATOM   7737 C CB  . TYR B 1 464 ? 15.746  -81.584 -20.557 1.00 45.64  ? 465  TYR B CB  1 
ATOM   7738 C CG  . TYR B 1 464 ? 15.374  -80.179 -20.996 1.00 55.14  ? 465  TYR B CG  1 
ATOM   7739 C CD1 . TYR B 1 464 ? 15.500  -79.787 -22.328 1.00 46.00  ? 465  TYR B CD1 1 
ATOM   7740 C CD2 . TYR B 1 464 ? 14.880  -79.250 -20.083 1.00 48.48  ? 465  TYR B CD2 1 
ATOM   7741 C CE1 . TYR B 1 464 ? 15.159  -78.516 -22.739 1.00 50.04  ? 465  TYR B CE1 1 
ATOM   7742 C CE2 . TYR B 1 464 ? 14.532  -77.971 -20.481 1.00 48.85  ? 465  TYR B CE2 1 
ATOM   7743 C CZ  . TYR B 1 464 ? 14.669  -77.607 -21.811 1.00 54.48  ? 465  TYR B CZ  1 
ATOM   7744 O OH  . TYR B 1 464 ? 14.331  -76.335 -22.223 1.00 48.87  ? 465  TYR B OH  1 
ATOM   7745 N N   . THR B 1 465 ? 17.093  -83.037 -18.118 1.00 47.71  ? 466  THR B N   1 
ATOM   7746 C CA  . THR B 1 465 ? 17.180  -84.253 -17.319 1.00 48.08  ? 466  THR B CA  1 
ATOM   7747 C C   . THR B 1 465 ? 16.016  -85.175 -17.650 1.00 49.09  ? 466  THR B C   1 
ATOM   7748 O O   . THR B 1 465 ? 15.041  -84.768 -18.303 1.00 47.57  ? 466  THR B O   1 
ATOM   7749 C CB  . THR B 1 465 ? 17.158  -83.967 -15.812 1.00 48.85  ? 466  THR B CB  1 
ATOM   7750 O OG1 . THR B 1 465 ? 15.849  -83.507 -15.449 1.00 52.92  ? 466  THR B OG1 1 
ATOM   7751 C CG2 . THR B 1 465 ? 18.214  -82.930 -15.444 1.00 43.28  ? 466  THR B CG2 1 
ATOM   7752 N N   . ALA B 1 466 ? 16.117  -86.417 -17.188 1.00 46.81  ? 467  ALA B N   1 
ATOM   7753 C CA  . ALA B 1 466 ? 15.057  -87.389 -17.403 1.00 50.17  ? 467  ALA B CA  1 
ATOM   7754 C C   . ALA B 1 466 ? 13.789  -87.000 -16.646 1.00 49.58  ? 467  ALA B C   1 
ATOM   7755 O O   . ALA B 1 466 ? 12.674  -87.294 -17.086 1.00 48.65  ? 467  ALA B O   1 
ATOM   7756 C CB  . ALA B 1 466 ? 15.523  -88.766 -16.986 1.00 48.30  ? 467  ALA B CB  1 
ATOM   7757 N N   . GLU B 1 467 ? 13.970  -86.341 -15.503 1.00 49.88  ? 468  GLU B N   1 
ATOM   7758 C CA  . GLU B 1 467 ? 12.850  -85.932 -14.664 1.00 51.95  ? 468  GLU B CA  1 
ATOM   7759 C C   . GLU B 1 467 ? 12.096  -84.809 -15.337 1.00 46.58  ? 468  GLU B C   1 
ATOM   7760 O O   . GLU B 1 467 ? 10.869  -84.761 -15.323 1.00 45.04  ? 468  GLU B O   1 
ATOM   7761 C CB  . GLU B 1 467 ? 13.340  -85.477 -13.292 1.00 56.18  ? 468  GLU B CB  1 
ATOM   7762 C CG  . GLU B 1 467 ? 13.960  -86.566 -12.452 1.00 65.92  ? 468  GLU B CG  1 
ATOM   7763 C CD  . GLU B 1 467 ? 14.482  -86.029 -11.134 1.00 81.56  ? 468  GLU B CD  1 
ATOM   7764 O OE1 . GLU B 1 467 ? 14.490  -84.786 -10.964 1.00 78.09  ? 468  GLU B OE1 1 
ATOM   7765 O OE2 . GLU B 1 467 ? 14.881  -86.842 -10.267 1.00 96.88  ? 468  GLU B OE2 1 
ATOM   7766 N N   . GLU B 1 468 ? 12.851  -83.893 -15.932 1.00 45.77  ? 469  GLU B N   1 
ATOM   7767 C CA  . GLU B 1 468 ? 12.249  -82.836 -16.723 1.00 42.16  ? 469  GLU B CA  1 
ATOM   7768 C C   . GLU B 1 468 ? 11.472  -83.389 -17.938 1.00 46.66  ? 469  GLU B C   1 
ATOM   7769 O O   . GLU B 1 468 ? 10.426  -82.830 -18.298 1.00 45.36  ? 469  GLU B O   1 
ATOM   7770 C CB  . GLU B 1 468 ? 13.324  -81.854 -17.155 1.00 47.36  ? 469  GLU B CB  1 
ATOM   7771 C CG  . GLU B 1 468 ? 13.851  -81.015 -16.006 1.00 45.44  ? 469  GLU B CG  1 
ATOM   7772 C CD  . GLU B 1 468 ? 15.015  -80.127 -16.407 1.00 48.52  ? 469  GLU B CD  1 
ATOM   7773 O OE1 . GLU B 1 468 ? 15.966  -80.630 -17.056 1.00 46.98  ? 469  GLU B OE1 1 
ATOM   7774 O OE2 . GLU B 1 468 ? 14.988  -78.927 -16.048 1.00 52.62  ? 469  GLU B OE2 1 
ATOM   7775 N N   . LYS B 1 469 ? 11.943  -84.485 -18.553 1.00 39.67  ? 470  LYS B N   1 
ATOM   7776 C CA  . LYS B 1 469 ? 11.157  -85.111 -19.631 1.00 43.87  ? 470  LYS B CA  1 
ATOM   7777 C C   . LYS B 1 469 ? 9.842   -85.668 -19.086 1.00 42.51  ? 470  LYS B C   1 
ATOM   7778 O O   . LYS B 1 469 ? 8.783   -85.489 -19.682 1.00 43.57  ? 470  LYS B O   1 
ATOM   7779 C CB  . LYS B 1 469 ? 11.972  -86.207 -20.341 1.00 47.23  ? 470  LYS B CB  1 
ATOM   7780 C CG  . LYS B 1 469 ? 13.158  -85.633 -21.145 1.00 42.06  ? 470  LYS B CG  1 
ATOM   7781 C CD  . LYS B 1 469 ? 14.199  -86.661 -21.565 1.00 39.66  ? 470  LYS B CD  1 
ATOM   7782 C CE  . LYS B 1 469 ? 15.457  -85.934 -22.005 1.00 46.88  ? 470  LYS B CE  1 
ATOM   7783 N NZ  . LYS B 1 469 ? 16.574  -86.824 -22.432 1.00 48.61  ? 470  LYS B NZ  1 
ATOM   7784 N N   . ILE B 1 470 ? 9.908   -86.320 -17.926 1.00 47.66  ? 471  ILE B N   1 
ATOM   7785 C CA  . ILE B 1 470 ? 8.702   -86.788 -17.239 1.00 46.64  ? 471  ILE B CA  1 
ATOM   7786 C C   . ILE B 1 470 ? 7.782   -85.608 -16.880 1.00 41.76  ? 471  ILE B C   1 
ATOM   7787 O O   . ILE B 1 470 ? 6.563   -85.667 -17.055 1.00 44.93  ? 471  ILE B O   1 
ATOM   7788 C CB  . ILE B 1 470 ? 9.044   -87.582 -15.930 1.00 45.55  ? 471  ILE B CB  1 
ATOM   7789 C CG1 . ILE B 1 470 ? 9.927   -88.789 -16.218 1.00 40.91  ? 471  ILE B CG1 1 
ATOM   7790 C CG2 . ILE B 1 470 ? 7.775   -88.041 -15.233 1.00 39.63  ? 471  ILE B CG2 1 
ATOM   7791 C CD1 . ILE B 1 470 ? 9.215   -89.871 -17.028 1.00 50.23  ? 471  ILE B CD1 1 
ATOM   7792 N N   . PHE B 1 471 ? 8.373   -84.534 -16.373 1.00 39.26  ? 472  PHE B N   1 
ATOM   7793 C CA  . PHE B 1 471 ? 7.587   -83.382 -15.941 1.00 44.04  ? 472  PHE B CA  1 
ATOM   7794 C C   . PHE B 1 471 ? 6.864   -82.737 -17.118 1.00 40.82  ? 472  PHE B C   1 
ATOM   7795 O O   . PHE B 1 471 ? 5.660   -82.465 -17.053 1.00 45.30  ? 472  PHE B O   1 
ATOM   7796 C CB  . PHE B 1 471 ? 8.495   -82.371 -15.232 1.00 51.10  ? 472  PHE B CB  1 
ATOM   7797 C CG  . PHE B 1 471 ? 7.805   -81.087 -14.836 1.00 45.67  ? 472  PHE B CG  1 
ATOM   7798 C CD1 . PHE B 1 471 ? 6.586   -81.111 -14.168 1.00 36.73  ? 472  PHE B CD1 1 
ATOM   7799 C CD2 . PHE B 1 471 ? 8.401   -79.858 -15.106 1.00 40.74  ? 472  PHE B CD2 1 
ATOM   7800 C CE1 . PHE B 1 471 ? 5.966   -79.931 -13.787 1.00 40.39  ? 472  PHE B CE1 1 
ATOM   7801 C CE2 . PHE B 1 471 ? 7.782   -78.668 -14.742 1.00 42.79  ? 472  PHE B CE2 1 
ATOM   7802 C CZ  . PHE B 1 471 ? 6.565   -78.704 -14.070 1.00 42.41  ? 472  PHE B CZ  1 
ATOM   7803 N N   . ALA B 1 472 ? 7.594   -82.533 -18.210 1.00 41.27  ? 473  ALA B N   1 
ATOM   7804 C CA  . ALA B 1 472 ? 7.010   -82.019 -19.454 1.00 42.99  ? 473  ALA B CA  1 
ATOM   7805 C C   . ALA B 1 472 ? 5.871   -82.884 -20.000 1.00 42.93  ? 473  ALA B C   1 
ATOM   7806 O O   . ALA B 1 472 ? 4.891   -82.362 -20.553 1.00 41.13  ? 473  ALA B O   1 
ATOM   7807 C CB  . ALA B 1 472 ? 8.104   -81.868 -20.516 1.00 42.67  ? 473  ALA B CB  1 
ATOM   7808 N N   . GLN B 1 473 ? 5.996   -84.204 -19.862 1.00 43.09  ? 474  GLN B N   1 
ATOM   7809 C CA  . GLN B 1 473 ? 4.920   -85.093 -20.316 1.00 48.87  ? 474  GLN B CA  1 
ATOM   7810 C C   . GLN B 1 473 ? 3.681   -84.932 -19.426 1.00 42.30  ? 474  GLN B C   1 
ATOM   7811 O O   . GLN B 1 473 ? 2.547   -85.004 -19.902 1.00 45.36  ? 474  GLN B O   1 
ATOM   7812 C CB  . GLN B 1 473 ? 5.390   -86.559 -20.339 1.00 52.42  ? 474  GLN B CB  1 
ATOM   7813 C CG  . GLN B 1 473 ? 6.212   -86.954 -21.571 1.00 48.54  ? 474  GLN B CG  1 
ATOM   7814 C CD  . GLN B 1 473 ? 6.968   -88.280 -21.392 1.00 56.11  ? 474  GLN B CD  1 
ATOM   7815 O OE1 . GLN B 1 473 ? 7.086   -88.793 -20.288 1.00 65.85  ? 474  GLN B OE1 1 
ATOM   7816 N NE2 . GLN B 1 473 ? 7.487   -88.818 -22.478 1.00 61.67  ? 474  GLN B NE2 1 
ATOM   7817 N N   . ARG B 1 474 ? 3.905   -84.693 -18.141 1.00 41.74  ? 475  ARG B N   1 
ATOM   7818 C CA  . ARG B 1 474 ? 2.804   -84.400 -17.205 1.00 44.54  ? 475  ARG B CA  1 
ATOM   7819 C C   . ARG B 1 474 ? 2.066   -83.148 -17.631 1.00 38.62  ? 475  ARG B C   1 
ATOM   7820 O O   . ARG B 1 474 ? 0.836   -83.147 -17.760 1.00 40.02  ? 475  ARG B O   1 
ATOM   7821 C CB  . ARG B 1 474 ? 3.316   -84.222 -15.774 1.00 42.78  ? 475  ARG B CB  1 
ATOM   7822 C CG  . ARG B 1 474 ? 3.552   -85.499 -14.994 1.00 54.78  ? 475  ARG B CG  1 
ATOM   7823 C CD  . ARG B 1 474 ? 4.032   -85.198 -13.548 1.00 51.35  ? 475  ARG B CD  1 
ATOM   7824 N NE  . ARG B 1 474 ? 3.139   -84.254 -12.882 1.00 48.76  ? 475  ARG B NE  1 
ATOM   7825 C CZ  . ARG B 1 474 ? 3.530   -83.283 -12.052 1.00 47.19  ? 475  ARG B CZ  1 
ATOM   7826 N NH1 . ARG B 1 474 ? 4.825   -83.104 -11.755 1.00 39.70  ? 475  ARG B NH1 1 
ATOM   7827 N NH2 . ARG B 1 474 ? 2.611   -82.485 -11.518 1.00 38.47  ? 475  ARG B NH2 1 
ATOM   7828 N N   . LEU B 1 475 ? 2.823   -82.087 -17.880 1.00 40.58  ? 476  LEU B N   1 
ATOM   7829 C CA  . LEU B 1 475 ? 2.215   -80.813 -18.280 1.00 41.72  ? 476  LEU B CA  1 
ATOM   7830 C C   . LEU B 1 475 ? 1.431   -80.947 -19.571 1.00 40.89  ? 476  LEU B C   1 
ATOM   7831 O O   . LEU B 1 475 ? 0.273   -80.516 -19.638 1.00 41.47  ? 476  LEU B O   1 
ATOM   7832 C CB  . LEU B 1 475 ? 3.276   -79.714 -18.405 1.00 37.95  ? 476  LEU B CB  1 
ATOM   7833 C CG  . LEU B 1 475 ? 3.812   -79.327 -17.021 1.00 42.95  ? 476  LEU B CG  1 
ATOM   7834 C CD1 . LEU B 1 475 ? 4.621   -78.063 -17.064 1.00 45.77  ? 476  LEU B CD1 1 
ATOM   7835 C CD2 . LEU B 1 475 ? 2.654   -79.152 -16.065 1.00 38.43  ? 476  LEU B CD2 1 
ATOM   7836 N N   . MET B 1 476 ? 2.044   -81.569 -20.579 1.00 40.32  ? 477  MET B N   1 
ATOM   7837 C CA  . MET B 1 476 ? 1.363   -81.799 -21.841 1.00 40.17  ? 477  MET B CA  1 
ATOM   7838 C C   . MET B 1 476 ? 0.042   -82.535 -21.616 1.00 38.70  ? 477  MET B C   1 
ATOM   7839 O O   . MET B 1 476 ? -0.986  -82.186 -22.212 1.00 42.99  ? 477  MET B O   1 
ATOM   7840 C CB  . MET B 1 476 ? 2.267   -82.577 -22.804 1.00 43.09  ? 477  MET B CB  1 
ATOM   7841 C CG  . MET B 1 476 ? 3.393   -81.736 -23.430 1.00 46.42  ? 477  MET B CG  1 
ATOM   7842 S SD  . MET B 1 476 ? 4.105   -82.554 -24.899 1.00 50.03  ? 477  MET B SD  1 
ATOM   7843 C CE  . MET B 1 476 ? 5.088   -83.812 -24.045 1.00 45.71  ? 477  MET B CE  1 
ATOM   7844 N N   . ARG B 1 477 ? 0.072   -83.525 -20.723 1.00 43.89  ? 478  ARG B N   1 
ATOM   7845 C CA  . ARG B 1 477 ? -1.125  -84.288 -20.357 1.00 43.80  ? 478  ARG B CA  1 
ATOM   7846 C C   . ARG B 1 477 ? -2.225  -83.389 -19.757 1.00 44.51  ? 478  ARG B C   1 
ATOM   7847 O O   . ARG B 1 477 ? -3.386  -83.482 -20.169 1.00 48.21  ? 478  ARG B O   1 
ATOM   7848 C CB  . ARG B 1 477 ? -0.757  -85.427 -19.386 1.00 40.68  ? 478  ARG B CB  1 
ATOM   7849 C CG  . ARG B 1 477 ? -1.961  -86.233 -18.904 1.00 41.75  ? 478  ARG B CG  1 
ATOM   7850 C CD  . ARG B 1 477 ? -2.817  -86.706 -20.077 1.00 53.10  ? 478  ARG B CD  1 
ATOM   7851 N NE  . ARG B 1 477 ? -2.022  -87.569 -20.943 1.00 54.91  ? 478  ARG B NE  1 
ATOM   7852 C CZ  . ARG B 1 477 ? -1.852  -88.871 -20.736 1.00 59.52  ? 478  ARG B CZ  1 
ATOM   7853 N NH1 . ARG B 1 477 ? -2.457  -89.452 -19.708 1.00 66.25  ? 478  ARG B NH1 1 
ATOM   7854 N NH2 . ARG B 1 477 ? -1.088  -89.589 -21.552 1.00 60.82  ? 478  ARG B NH2 1 
ATOM   7855 N N   . TYR B 1 478 ? -1.866  -82.504 -18.822 1.00 39.43  ? 479  TYR B N   1 
ATOM   7856 C CA  . TYR B 1 478 ? -2.843  -81.555 -18.246 1.00 40.92  ? 479  TYR B CA  1 
ATOM   7857 C C   . TYR B 1 478 ? -3.514  -80.646 -19.273 1.00 42.75  ? 479  TYR B C   1 
ATOM   7858 O O   . TYR B 1 478 ? -4.749  -80.490 -19.299 1.00 42.22  ? 479  TYR B O   1 
ATOM   7859 C CB  . TYR B 1 478 ? -2.172  -80.648 -17.208 1.00 44.58  ? 479  TYR B CB  1 
ATOM   7860 C CG  . TYR B 1 478 ? -1.671  -81.317 -15.950 1.00 40.26  ? 479  TYR B CG  1 
ATOM   7861 C CD1 . TYR B 1 478 ? -2.394  -82.316 -15.306 1.00 46.97  ? 479  TYR B CD1 1 
ATOM   7862 C CD2 . TYR B 1 478 ? -0.475  -80.926 -15.397 1.00 45.99  ? 479  TYR B CD2 1 
ATOM   7863 C CE1 . TYR B 1 478 ? -1.902  -82.914 -14.111 1.00 41.81  ? 479  TYR B CE1 1 
ATOM   7864 C CE2 . TYR B 1 478 ? 0.017   -81.504 -14.227 1.00 45.00  ? 479  TYR B CE2 1 
ATOM   7865 C CZ  . TYR B 1 478 ? -0.690  -82.495 -13.597 1.00 44.36  ? 479  TYR B CZ  1 
ATOM   7866 O OH  . TYR B 1 478 ? -0.140  -83.022 -12.443 1.00 45.88  ? 479  TYR B OH  1 
ATOM   7867 N N   . TRP B 1 479 ? -2.686  -80.016 -20.106 1.00 42.45  ? 480  TRP B N   1 
ATOM   7868 C CA  . TRP B 1 479 ? -3.189  -79.103 -21.124 1.00 41.80  ? 480  TRP B CA  1 
ATOM   7869 C C   . TRP B 1 479 ? -4.094  -79.849 -22.106 1.00 43.32  ? 480  TRP B C   1 
ATOM   7870 O O   . TRP B 1 479 ? -5.175  -79.365 -22.451 1.00 41.42  ? 480  TRP B O   1 
ATOM   7871 C CB  . TRP B 1 479 ? -2.028  -78.436 -21.868 1.00 38.03  ? 480  TRP B CB  1 
ATOM   7872 C CG  . TRP B 1 479 ? -1.661  -77.052 -21.389 1.00 38.16  ? 480  TRP B CG  1 
ATOM   7873 C CD1 . TRP B 1 479 ? -1.685  -75.891 -22.124 1.00 40.30  ? 480  TRP B CD1 1 
ATOM   7874 C CD2 . TRP B 1 479 ? -1.199  -76.681 -20.076 1.00 43.78  ? 480  TRP B CD2 1 
ATOM   7875 N NE1 . TRP B 1 479 ? -1.279  -74.820 -21.342 1.00 44.09  ? 480  TRP B NE1 1 
ATOM   7876 C CE2 . TRP B 1 479 ? -0.969  -75.281 -20.087 1.00 39.39  ? 480  TRP B CE2 1 
ATOM   7877 C CE3 . TRP B 1 479 ? -0.966  -77.394 -18.887 1.00 33.51  ? 480  TRP B CE3 1 
ATOM   7878 C CZ2 . TRP B 1 479 ? -0.526  -74.584 -18.950 1.00 42.17  ? 480  TRP B CZ2 1 
ATOM   7879 C CZ3 . TRP B 1 479 ? -0.491  -76.699 -17.776 1.00 41.00  ? 480  TRP B CZ3 1 
ATOM   7880 C CH2 . TRP B 1 479 ? -0.283  -75.310 -17.815 1.00 31.21  ? 480  TRP B CH2 1 
ATOM   7881 N N   . ALA B 1 480 ? -3.679  -81.037 -22.540 1.00 40.81  ? 481  ALA B N   1 
ATOM   7882 C CA  . ALA B 1 480 ? -4.498  -81.771 -23.511 1.00 46.49  ? 481  ALA B CA  1 
ATOM   7883 C C   . ALA B 1 480 ? -5.767  -82.306 -22.841 1.00 44.56  ? 481  ALA B C   1 
ATOM   7884 O O   . ALA B 1 480 ? -6.849  -82.236 -23.422 1.00 46.18  ? 481  ALA B O   1 
ATOM   7885 C CB  . ALA B 1 480 ? -3.700  -82.911 -24.162 1.00 43.61  ? 481  ALA B CB  1 
ATOM   7886 N N   . ASN B 1 481 ? -5.635  -82.827 -21.620 1.00 46.48  ? 482  ASN B N   1 
ATOM   7887 C CA  . ASN B 1 481 ? -6.811  -83.176 -20.813 1.00 46.33  ? 482  ASN B CA  1 
ATOM   7888 C C   . ASN B 1 481 ? -7.798  -82.012 -20.763 1.00 43.54  ? 482  ASN B C   1 
ATOM   7889 O O   . ASN B 1 481 ? -8.991  -82.177 -21.022 1.00 46.72  ? 482  ASN B O   1 
ATOM   7890 C CB  . ASN B 1 481 ? -6.411  -83.565 -19.391 1.00 47.51  ? 482  ASN B CB  1 
ATOM   7891 C CG  . ASN B 1 481 ? -5.967  -85.016 -19.269 1.00 49.14  ? 482  ASN B CG  1 
ATOM   7892 O OD1 . ASN B 1 481 ? -5.993  -85.785 -20.233 1.00 48.67  ? 482  ASN B OD1 1 
ATOM   7893 N ND2 . ASN B 1 481 ? -5.544  -85.389 -18.078 1.00 46.31  ? 482  ASN B ND2 1 
ATOM   7894 N N   . PHE B 1 482 ? -7.283  -80.826 -20.456 1.00 44.60  ? 483  PHE B N   1 
ATOM   7895 C CA  . PHE B 1 482 ? -8.119  -79.641 -20.404 1.00 41.92  ? 483  PHE B CA  1 
ATOM   7896 C C   . PHE B 1 482 ? -8.760  -79.359 -21.756 1.00 44.91  ? 483  PHE B C   1 
ATOM   7897 O O   . PHE B 1 482 ? -9.957  -79.062 -21.832 1.00 45.05  ? 483  PHE B O   1 
ATOM   7898 C CB  . PHE B 1 482 ? -7.318  -78.411 -19.929 1.00 43.68  ? 483  PHE B CB  1 
ATOM   7899 C CG  . PHE B 1 482 ? -8.124  -77.136 -19.966 1.00 46.50  ? 483  PHE B CG  1 
ATOM   7900 C CD1 . PHE B 1 482 ? -9.042  -76.855 -18.966 1.00 43.05  ? 483  PHE B CD1 1 
ATOM   7901 C CD2 . PHE B 1 482 ? -8.011  -76.246 -21.032 1.00 41.92  ? 483  PHE B CD2 1 
ATOM   7902 C CE1 . PHE B 1 482 ? -9.814  -75.696 -19.012 1.00 44.44  ? 483  PHE B CE1 1 
ATOM   7903 C CE2 . PHE B 1 482 ? -8.774  -75.090 -21.077 1.00 42.55  ? 483  PHE B CE2 1 
ATOM   7904 C CZ  . PHE B 1 482 ? -9.684  -74.816 -20.058 1.00 40.89  ? 483  PHE B CZ  1 
ATOM   7905 N N   . ALA B 1 483 ? -7.969  -79.447 -22.829 1.00 45.36  ? 484  ALA B N   1 
ATOM   7906 C CA  . ALA B 1 483 ? -8.491  -79.212 -24.177 1.00 42.84  ? 484  ALA B CA  1 
ATOM   7907 C C   . ALA B 1 483 ? -9.569  -80.236 -24.564 1.00 42.79  ? 484  ALA B C   1 
ATOM   7908 O O   . ALA B 1 483 ? -10.589 -79.864 -25.140 1.00 41.84  ? 484  ALA B O   1 
ATOM   7909 C CB  . ALA B 1 483 ? -7.358  -79.226 -25.196 1.00 45.66  ? 484  ALA B CB  1 
ATOM   7910 N N   . ARG B 1 484 ? -9.345  -81.515 -24.237 1.00 39.89  ? 485  ARG B N   1 
ATOM   7911 C CA  . ARG B 1 484 ? -10.351 -82.562 -24.496 1.00 45.48  ? 485  ARG B CA  1 
ATOM   7912 C C   . ARG B 1 484 ? -11.608 -82.394 -23.647 1.00 45.83  ? 485  ARG B C   1 
ATOM   7913 O O   . ARG B 1 484 ? -12.717 -82.476 -24.177 1.00 54.01  ? 485  ARG B O   1 
ATOM   7914 C CB  . ARG B 1 484 ? -9.779  -83.967 -24.269 1.00 35.79  ? 485  ARG B CB  1 
ATOM   7915 C CG  . ARG B 1 484 ? -8.649  -84.309 -25.214 1.00 40.84  ? 485  ARG B CG  1 
ATOM   7916 C CD  . ARG B 1 484 ? -8.148  -85.709 -25.019 1.00 40.92  ? 485  ARG B CD  1 
ATOM   7917 N NE  . ARG B 1 484 ? -7.242  -85.795 -23.895 1.00 42.97  ? 485  ARG B NE  1 
ATOM   7918 C CZ  . ARG B 1 484 ? -5.927  -85.881 -24.016 1.00 48.85  ? 485  ARG B CZ  1 
ATOM   7919 N NH1 . ARG B 1 484 ? -5.372  -85.909 -25.218 1.00 50.84  ? 485  ARG B NH1 1 
ATOM   7920 N NH2 . ARG B 1 484 ? -5.166  -85.944 -22.931 1.00 49.47  ? 485  ARG B NH2 1 
ATOM   7921 N N   . THR B 1 485 ? -11.447 -82.122 -22.350 1.00 46.66  ? 486  THR B N   1 
ATOM   7922 C CA  . THR B 1 485 ? -12.574 -82.255 -21.418 1.00 49.33  ? 486  THR B CA  1 
ATOM   7923 C C   . THR B 1 485 ? -12.973 -80.991 -20.654 1.00 52.35  ? 486  THR B C   1 
ATOM   7924 O O   . THR B 1 485 ? -14.024 -80.963 -20.025 1.00 59.79  ? 486  THR B O   1 
ATOM   7925 C CB  . THR B 1 485 ? -12.285 -83.354 -20.374 1.00 48.22  ? 486  THR B CB  1 
ATOM   7926 O OG1 . THR B 1 485 ? -11.242 -82.919 -19.482 1.00 50.39  ? 486  THR B OG1 1 
ATOM   7927 C CG2 . THR B 1 485 ? -11.848 -84.654 -21.067 1.00 44.22  ? 486  THR B CG2 1 
ATOM   7928 N N   . GLY B 1 486 ? -12.148 -79.947 -20.704 1.00 51.39  ? 487  GLY B N   1 
ATOM   7929 C CA  . GLY B 1 486 ? -12.385 -78.757 -19.894 1.00 46.03  ? 487  GLY B CA  1 
ATOM   7930 C C   . GLY B 1 486 ? -11.928 -78.963 -18.454 1.00 50.68  ? 487  GLY B C   1 
ATOM   7931 O O   . GLY B 1 486 ? -12.211 -78.162 -17.564 1.00 45.81  ? 487  GLY B O   1 
ATOM   7932 N N   . ASP B 1 487 ? -11.188 -80.040 -18.236 1.00 47.28  ? 488  ASP B N   1 
ATOM   7933 C CA  . ASP B 1 487 ? -10.743 -80.421 -16.917 1.00 46.63  ? 488  ASP B CA  1 
ATOM   7934 C C   . ASP B 1 487 ? -9.386  -81.101 -17.078 1.00 47.50  ? 488  ASP B C   1 
ATOM   7935 O O   . ASP B 1 487 ? -9.281  -82.138 -17.722 1.00 48.93  ? 488  ASP B O   1 
ATOM   7936 C CB  . ASP B 1 487 ? -11.785 -81.341 -16.277 1.00 51.97  ? 488  ASP B CB  1 
ATOM   7937 C CG  . ASP B 1 487 ? -11.421 -81.797 -14.871 1.00 54.91  ? 488  ASP B CG  1 
ATOM   7938 O OD1 . ASP B 1 487 ? -10.225 -81.794 -14.471 1.00 51.38  ? 488  ASP B OD1 1 
ATOM   7939 O OD2 . ASP B 1 487 ? -12.375 -82.195 -14.161 1.00 61.31  ? 488  ASP B OD2 1 
ATOM   7940 N N   . PRO B 1 488 ? -8.341  -80.511 -16.490 1.00 49.38  ? 489  PRO B N   1 
ATOM   7941 C CA  . PRO B 1 488 ? -6.969  -81.025 -16.649 1.00 45.52  ? 489  PRO B CA  1 
ATOM   7942 C C   . PRO B 1 488 ? -6.708  -82.326 -15.896 1.00 49.63  ? 489  PRO B C   1 
ATOM   7943 O O   . PRO B 1 488 ? -5.647  -82.930 -16.105 1.00 45.45  ? 489  PRO B O   1 
ATOM   7944 C CB  . PRO B 1 488 ? -6.104  -79.895 -16.074 1.00 43.21  ? 489  PRO B CB  1 
ATOM   7945 C CG  . PRO B 1 488 ? -7.016  -79.259 -15.009 1.00 42.99  ? 489  PRO B CG  1 
ATOM   7946 C CD  . PRO B 1 488 ? -8.388  -79.274 -15.683 1.00 46.59  ? 489  PRO B CD  1 
ATOM   7947 N N   . ASN B 1 489 ? -7.639  -82.742 -15.035 1.00 47.21  ? 490  ASN B N   1 
ATOM   7948 C CA  . ASN B 1 489 ? -7.436  -83.935 -14.213 1.00 51.67  ? 490  ASN B CA  1 
ATOM   7949 C C   . ASN B 1 489 ? -7.580  -85.213 -15.010 1.00 51.24  ? 490  ASN B C   1 
ATOM   7950 O O   . ASN B 1 489 ? -8.442  -85.307 -15.882 1.00 58.92  ? 490  ASN B O   1 
ATOM   7951 C CB  . ASN B 1 489 ? -8.427  -83.984 -13.045 1.00 56.21  ? 490  ASN B CB  1 
ATOM   7952 C CG  . ASN B 1 489 ? -8.145  -82.941 -11.984 1.00 51.35  ? 490  ASN B CG  1 
ATOM   7953 O OD1 . ASN B 1 489 ? -7.276  -83.123 -11.133 1.00 52.58  ? 490  ASN B OD1 1 
ATOM   7954 N ND2 . ASN B 1 489 ? -8.910  -81.855 -12.006 1.00 49.64  ? 490  ASN B ND2 1 
ATOM   7955 N N   . GLU B 1 490 ? -6.752  -86.200 -14.678 1.00 66.95  ? 491  GLU B N   1 
ATOM   7956 C CA  . GLU B 1 490 ? -6.796  -87.519 -15.317 1.00 72.70  ? 491  GLU B CA  1 
ATOM   7957 C C   . GLU B 1 490 ? -8.176  -88.164 -15.203 1.00 81.55  ? 491  GLU B C   1 
ATOM   7958 O O   . GLU B 1 490 ? -8.585  -88.576 -14.107 1.00 84.23  ? 491  GLU B O   1 
ATOM   7959 C CB  . GLU B 1 490 ? -5.742  -88.451 -14.709 1.00 70.86  ? 491  GLU B CB  1 
ATOM   7960 C CG  . GLU B 1 490 ? -4.298  -88.051 -15.013 1.00 79.22  ? 491  GLU B CG  1 
ATOM   7961 C CD  . GLU B 1 490 ? -3.842  -88.484 -16.397 1.00 79.71  ? 491  GLU B CD  1 
ATOM   7962 O OE1 . GLU B 1 490 ? -4.650  -88.416 -17.357 1.00 70.52  ? 491  GLU B OE1 1 
ATOM   7963 O OE2 . GLU B 1 490 ? -2.667  -88.908 -16.519 1.00 85.96  ? 491  GLU B OE2 1 
ATOM   7964 N N   . PRO B 1 491 ? -8.892  -88.261 -16.344 1.00 81.62  ? 492  PRO B N   1 
ATOM   7965 C CA  . PRO B 1 491 ? -10.257 -88.792 -16.351 1.00 80.48  ? 492  PRO B CA  1 
ATOM   7966 C C   . PRO B 1 491 ? -10.278 -90.321 -16.383 1.00 85.83  ? 492  PRO B C   1 
ATOM   7967 O O   . PRO B 1 491 ? -10.545 -90.927 -15.340 1.00 88.16  ? 492  PRO B O   1 
ATOM   7968 C CB  . PRO B 1 491 ? -10.859 -88.195 -17.634 1.00 82.27  ? 492  PRO B CB  1 
ATOM   7969 C CG  . PRO B 1 491 ? -9.646  -87.778 -18.515 1.00 68.82  ? 492  PRO B CG  1 
ATOM   7970 C CD  . PRO B 1 491 ? -8.388  -88.021 -17.714 1.00 73.97  ? 492  PRO B CD  1 
ATOM   7971 N N   . ALA B 1 496 ? -3.481  -90.190 -8.220  1.00 82.69  ? 497  ALA B N   1 
ATOM   7972 C CA  . ALA B 1 496 ? -2.756  -88.920 -8.229  1.00 86.68  ? 497  ALA B CA  1 
ATOM   7973 C C   . ALA B 1 496 ? -3.579  -87.812 -7.565  1.00 83.51  ? 497  ALA B C   1 
ATOM   7974 O O   . ALA B 1 496 ? -4.811  -87.795 -7.695  1.00 82.75  ? 497  ALA B O   1 
ATOM   7975 C CB  . ALA B 1 496 ? -2.385  -88.530 -9.660  1.00 79.44  ? 497  ALA B CB  1 
ATOM   7976 N N   . PRO B 1 497 ? -2.901  -86.888 -6.847  1.00 81.75  ? 498  PRO B N   1 
ATOM   7977 C CA  . PRO B 1 497 ? -3.571  -85.740 -6.202  1.00 81.84  ? 498  PRO B CA  1 
ATOM   7978 C C   . PRO B 1 497 ? -4.392  -84.930 -7.211  1.00 72.82  ? 498  PRO B C   1 
ATOM   7979 O O   . PRO B 1 497 ? -4.048  -84.884 -8.400  1.00 72.46  ? 498  PRO B O   1 
ATOM   7980 C CB  . PRO B 1 497 ? -2.406  -84.908 -5.633  1.00 77.77  ? 498  PRO B CB  1 
ATOM   7981 C CG  . PRO B 1 497 ? -1.172  -85.387 -6.384  1.00 74.84  ? 498  PRO B CG  1 
ATOM   7982 C CD  . PRO B 1 497 ? -1.437  -86.845 -6.667  1.00 76.55  ? 498  PRO B CD  1 
ATOM   7983 N N   . GLN B 1 498 ? -5.475  -84.318 -6.748  1.00 66.21  ? 499  GLN B N   1 
ATOM   7984 C CA  . GLN B 1 498 ? -6.410  -83.696 -7.666  1.00 59.76  ? 499  GLN B CA  1 
ATOM   7985 C C   . GLN B 1 498 ? -6.205  -82.193 -7.752  1.00 58.61  ? 499  GLN B C   1 
ATOM   7986 O O   . GLN B 1 498 ? -5.886  -81.537 -6.776  1.00 58.13  ? 499  GLN B O   1 
ATOM   7987 C CB  . GLN B 1 498 ? -7.854  -84.003 -7.256  1.00 61.53  ? 499  GLN B CB  1 
ATOM   7988 C CG  . GLN B 1 498 ? -8.266  -85.456 -7.472  1.00 66.96  ? 499  GLN B CG  1 
ATOM   7989 C CD  . GLN B 1 498 ? -8.218  -85.860 -8.941  1.00 72.66  ? 499  GLN B CD  1 
ATOM   7990 O OE1 . GLN B 1 498 ? -9.027  -85.385 -9.753  1.00 67.09  ? 499  GLN B OE1 1 
ATOM   7991 N NE2 . GLN B 1 498 ? -7.264  -86.730 -9.291  1.00 59.99  ? 499  GLN B NE2 1 
ATOM   7992 N N   . TRP B 1 499 ? -6.420  -81.663 -8.944  1.00 53.42  ? 500  TRP B N   1 
ATOM   7993 C CA  . TRP B 1 499 ? -6.370  -80.239 -9.185  1.00 51.00  ? 500  TRP B CA  1 
ATOM   7994 C C   . TRP B 1 499 ? -7.786  -79.655 -9.079  1.00 51.62  ? 500  TRP B C   1 
ATOM   7995 O O   . TRP B 1 499 ? -8.598  -79.846 -9.980  1.00 49.01  ? 500  TRP B O   1 
ATOM   7996 C CB  . TRP B 1 499 ? -5.754  -80.005 -10.560 1.00 47.91  ? 500  TRP B CB  1 
ATOM   7997 C CG  . TRP B 1 499 ? -5.489  -78.597 -10.977 1.00 47.62  ? 500  TRP B CG  1 
ATOM   7998 C CD1 . TRP B 1 499 ? -5.979  -77.442 -10.423 1.00 48.29  ? 500  TRP B CD1 1 
ATOM   7999 C CD2 . TRP B 1 499 ? -4.664  -78.201 -12.070 1.00 50.95  ? 500  TRP B CD2 1 
ATOM   8000 N NE1 . TRP B 1 499 ? -5.499  -76.349 -11.109 1.00 48.45  ? 500  TRP B NE1 1 
ATOM   8001 C CE2 . TRP B 1 499 ? -4.684  -76.789 -12.122 1.00 46.61  ? 500  TRP B CE2 1 
ATOM   8002 C CE3 . TRP B 1 499 ? -3.903  -78.908 -13.015 1.00 43.15  ? 500  TRP B CE3 1 
ATOM   8003 C CZ2 . TRP B 1 499 ? -3.966  -76.074 -13.072 1.00 41.77  ? 500  TRP B CZ2 1 
ATOM   8004 C CZ3 . TRP B 1 499 ? -3.193  -78.203 -13.942 1.00 44.07  ? 500  TRP B CZ3 1 
ATOM   8005 C CH2 . TRP B 1 499 ? -3.230  -76.797 -13.974 1.00 47.26  ? 500  TRP B CH2 1 
ATOM   8006 N N   . PRO B 1 500 ? -8.088  -78.955 -7.965  1.00 48.54  ? 501  PRO B N   1 
ATOM   8007 C CA  . PRO B 1 500 ? -9.429  -78.403 -7.717  1.00 47.29  ? 501  PRO B CA  1 
ATOM   8008 C C   . PRO B 1 500 ? -9.661  -77.097 -8.478  1.00 48.11  ? 501  PRO B C   1 
ATOM   8009 O O   . PRO B 1 500 ? -8.702  -76.389 -8.767  1.00 45.65  ? 501  PRO B O   1 
ATOM   8010 C CB  . PRO B 1 500 ? -9.429  -78.158 -6.199  1.00 43.35  ? 501  PRO B CB  1 
ATOM   8011 C CG  . PRO B 1 500 ? -8.025  -77.881 -5.881  1.00 43.69  ? 501  PRO B CG  1 
ATOM   8012 C CD  . PRO B 1 500 ? -7.183  -78.708 -6.830  1.00 40.24  ? 501  PRO B CD  1 
ATOM   8013 N N   . PRO B 1 501 ? -10.918 -76.787 -8.806  1.00 41.02  ? 502  PRO B N   1 
ATOM   8014 C CA  . PRO B 1 501 ? -11.224 -75.491 -9.417  1.00 41.96  ? 502  PRO B CA  1 
ATOM   8015 C C   . PRO B 1 501 ? -10.848 -74.298 -8.530  1.00 47.70  ? 502  PRO B C   1 
ATOM   8016 O O   . PRO B 1 501 ? -10.750 -74.424 -7.320  1.00 47.61  ? 502  PRO B O   1 
ATOM   8017 C CB  . PRO B 1 501 ? -12.737 -75.554 -9.636  1.00 38.88  ? 502  PRO B CB  1 
ATOM   8018 C CG  . PRO B 1 501 ? -13.011 -77.026 -9.794  1.00 44.37  ? 502  PRO B CG  1 
ATOM   8019 C CD  . PRO B 1 501 ? -12.068 -77.702 -8.830  1.00 42.31  ? 502  PRO B CD  1 
ATOM   8020 N N   . TYR B 1 502 ? -10.617 -73.152 -9.163  1.00 52.13  ? 503  TYR B N   1 
ATOM   8021 C CA  . TYR B 1 502 ? -10.347 -71.900 -8.485  1.00 45.81  ? 503  TYR B CA  1 
ATOM   8022 C C   . TYR B 1 502 ? -11.666 -71.167 -8.268  1.00 44.14  ? 503  TYR B C   1 
ATOM   8023 O O   . TYR B 1 502 ? -12.499 -71.099 -9.175  1.00 51.20  ? 503  TYR B O   1 
ATOM   8024 C CB  . TYR B 1 502 ? -9.366  -71.046 -9.322  1.00 46.72  ? 503  TYR B CB  1 
ATOM   8025 C CG  . TYR B 1 502 ? -8.981  -69.718 -8.695  1.00 40.90  ? 503  TYR B CG  1 
ATOM   8026 C CD1 . TYR B 1 502 ? -7.821  -69.585 -7.939  1.00 34.11  ? 503  TYR B CD1 1 
ATOM   8027 C CD2 . TYR B 1 502 ? -9.788  -68.606 -8.864  1.00 42.43  ? 503  TYR B CD2 1 
ATOM   8028 C CE1 . TYR B 1 502 ? -7.473  -68.357 -7.380  1.00 36.75  ? 503  TYR B CE1 1 
ATOM   8029 C CE2 . TYR B 1 502 ? -9.470  -67.399 -8.317  1.00 41.32  ? 503  TYR B CE2 1 
ATOM   8030 C CZ  . TYR B 1 502 ? -8.315  -67.263 -7.571  1.00 44.26  ? 503  TYR B CZ  1 
ATOM   8031 O OH  . TYR B 1 502 ? -8.035  -66.014 -7.029  1.00 42.93  ? 503  TYR B OH  1 
ATOM   8032 N N   . THR B 1 503 ? -11.833 -70.587 -7.085  1.00 47.62  ? 504  THR B N   1 
ATOM   8033 C CA  . THR B 1 503 ? -13.051 -69.841 -6.724  1.00 54.04  ? 504  THR B CA  1 
ATOM   8034 C C   . THR B 1 503 ? -12.696 -68.545 -6.012  1.00 47.58  ? 504  THR B C   1 
ATOM   8035 O O   . THR B 1 503 ? -11.627 -68.442 -5.404  1.00 46.79  ? 504  THR B O   1 
ATOM   8036 C CB  . THR B 1 503 ? -13.980 -70.665 -5.804  1.00 50.87  ? 504  THR B CB  1 
ATOM   8037 O OG1 . THR B 1 503 ? -13.179 -71.270 -4.781  1.00 46.67  ? 504  THR B OG1 1 
ATOM   8038 C CG2 . THR B 1 503 ? -14.702 -71.757 -6.610  1.00 47.45  ? 504  THR B CG2 1 
ATOM   8039 N N   . ALA B 1 504 ? -13.588 -67.559 -6.079  1.00 54.67  ? 505  ALA B N   1 
ATOM   8040 C CA  . ALA B 1 504 ? -13.314 -66.249 -5.494  1.00 55.17  ? 505  ALA B CA  1 
ATOM   8041 C C   . ALA B 1 504 ? -13.004 -66.349 -3.999  1.00 55.58  ? 505  ALA B C   1 
ATOM   8042 O O   . ALA B 1 504 ? -12.210 -65.556 -3.470  1.00 55.69  ? 505  ALA B O   1 
ATOM   8043 C CB  . ALA B 1 504 ? -14.484 -65.297 -5.735  1.00 49.04  ? 505  ALA B CB  1 
ATOM   8044 N N   . GLY B 1 505 ? -13.595 -67.345 -3.330  1.00 56.91  ? 506  GLY B N   1 
ATOM   8045 C CA  . GLY B 1 505 ? -13.401 -67.529 -1.896  1.00 46.03  ? 506  GLY B CA  1 
ATOM   8046 C C   . GLY B 1 505 ? -12.234 -68.406 -1.471  1.00 51.50  ? 506  GLY B C   1 
ATOM   8047 O O   . GLY B 1 505 ? -11.328 -67.959 -0.770  1.00 56.14  ? 506  GLY B O   1 
ATOM   8048 N N   . ALA B 1 506 ? -12.234 -69.672 -1.865  1.00 49.86  ? 507  ALA B N   1 
ATOM   8049 C CA  . ALA B 1 506 ? -11.128 -70.518 -1.430  1.00 47.21  ? 507  ALA B CA  1 
ATOM   8050 C C   . ALA B 1 506 ? -9.856  -70.239 -2.263  1.00 49.61  ? 507  ALA B C   1 
ATOM   8051 O O   . ALA B 1 506 ? -8.740  -70.468 -1.787  1.00 45.32  ? 507  ALA B O   1 
ATOM   8052 C CB  . ALA B 1 506 ? -11.528 -71.999 -1.483  1.00 42.32  ? 507  ALA B CB  1 
ATOM   8053 N N   . GLN B 1 507 ? -10.029 -69.715 -3.483  1.00 52.72  ? 508  GLN B N   1 
ATOM   8054 C CA  . GLN B 1 507 ? -8.902  -69.246 -4.305  1.00 43.66  ? 508  GLN B CA  1 
ATOM   8055 C C   . GLN B 1 507 ? -7.804  -70.305 -4.445  1.00 39.77  ? 508  GLN B C   1 
ATOM   8056 O O   . GLN B 1 507 ? -6.614  -70.010 -4.311  1.00 42.79  ? 508  GLN B O   1 
ATOM   8057 C CB  . GLN B 1 507 ? -8.302  -67.964 -3.701  1.00 43.42  ? 508  GLN B CB  1 
ATOM   8058 C CG  . GLN B 1 507 ? -9.267  -66.776 -3.531  1.00 43.39  ? 508  GLN B CG  1 
ATOM   8059 C CD  . GLN B 1 507 ? -8.732  -65.731 -2.510  1.00 53.24  ? 508  GLN B CD  1 
ATOM   8060 O OE1 . GLN B 1 507 ? -7.653  -65.160 -2.683  1.00 45.23  ? 508  GLN B OE1 1 
ATOM   8061 N NE2 . GLN B 1 507 ? -9.485  -65.507 -1.438  1.00 47.69  ? 508  GLN B NE2 1 
ATOM   8062 N N   . GLN B 1 508 ? -8.194  -71.548 -4.666  1.00 36.57  ? 509  GLN B N   1 
ATOM   8063 C CA  . GLN B 1 508 ? -7.208  -72.620 -4.695  1.00 46.57  ? 509  GLN B CA  1 
ATOM   8064 C C   . GLN B 1 508 ? -6.488  -72.716 -6.058  1.00 44.07  ? 509  GLN B C   1 
ATOM   8065 O O   . GLN B 1 508 ? -7.072  -72.429 -7.116  1.00 40.90  ? 509  GLN B O   1 
ATOM   8066 C CB  . GLN B 1 508 ? -7.873  -73.948 -4.355  1.00 45.41  ? 509  GLN B CB  1 
ATOM   8067 C CG  . GLN B 1 508 ? -8.366  -74.052 -2.907  1.00 48.23  ? 509  GLN B CG  1 
ATOM   8068 C CD  . GLN B 1 508 ? -9.213  -75.294 -2.692  1.00 46.88  ? 509  GLN B CD  1 
ATOM   8069 O OE1 . GLN B 1 508 ? -10.365 -75.370 -3.143  1.00 47.57  ? 509  GLN B OE1 1 
ATOM   8070 N NE2 . GLN B 1 508 ? -8.637  -76.286 -2.036  1.00 46.59  ? 509  GLN B NE2 1 
ATOM   8071 N N   . TYR B 1 509 ? -5.221  -73.117 -6.019  1.00 42.13  ? 510  TYR B N   1 
ATOM   8072 C CA  . TYR B 1 509 ? -4.423  -73.291 -7.239  1.00 42.59  ? 510  TYR B CA  1 
ATOM   8073 C C   . TYR B 1 509 ? -3.385  -74.364 -6.950  1.00 44.95  ? 510  TYR B C   1 
ATOM   8074 O O   . TYR B 1 509 ? -3.129  -74.674 -5.782  1.00 44.62  ? 510  TYR B O   1 
ATOM   8075 C CB  . TYR B 1 509 ? -3.753  -71.981 -7.648  1.00 34.93  ? 510  TYR B CB  1 
ATOM   8076 C CG  . TYR B 1 509 ? -2.638  -71.535 -6.697  1.00 44.49  ? 510  TYR B CG  1 
ATOM   8077 C CD1 . TYR B 1 509 ? -2.890  -70.657 -5.620  1.00 43.86  ? 510  TYR B CD1 1 
ATOM   8078 C CD2 . TYR B 1 509 ? -1.329  -71.981 -6.880  1.00 42.60  ? 510  TYR B CD2 1 
ATOM   8079 C CE1 . TYR B 1 509 ? -1.838  -70.246 -4.755  1.00 37.59  ? 510  TYR B CE1 1 
ATOM   8080 C CE2 . TYR B 1 509 ? -0.302  -71.598 -6.028  1.00 43.62  ? 510  TYR B CE2 1 
ATOM   8081 C CZ  . TYR B 1 509 ? -0.554  -70.731 -4.977  1.00 45.04  ? 510  TYR B CZ  1 
ATOM   8082 O OH  . TYR B 1 509 ? 0.511   -70.376 -4.186  1.00 49.95  ? 510  TYR B OH  1 
ATOM   8083 N N   . VAL B 1 510 ? -2.776  -74.927 -7.985  1.00 41.54  ? 511  VAL B N   1 
ATOM   8084 C CA  . VAL B 1 510 ? -1.741  -75.930 -7.761  1.00 42.30  ? 511  VAL B CA  1 
ATOM   8085 C C   . VAL B 1 510 ? -0.359  -75.421 -8.183  1.00 48.78  ? 511  VAL B C   1 
ATOM   8086 O O   . VAL B 1 510 ? -0.227  -74.572 -9.089  1.00 38.80  ? 511  VAL B O   1 
ATOM   8087 C CB  . VAL B 1 510 ? -2.039  -77.252 -8.518  1.00 45.18  ? 511  VAL B CB  1 
ATOM   8088 C CG1 . VAL B 1 510 ? -3.339  -77.895 -8.008  1.00 42.69  ? 511  VAL B CG1 1 
ATOM   8089 C CG2 . VAL B 1 510 ? -2.073  -77.014 -10.039 1.00 41.74  ? 511  VAL B CG2 1 
ATOM   8090 N N   . SER B 1 511 ? 0.671   -75.932 -7.507  1.00 41.89  ? 512  SER B N   1 
ATOM   8091 C CA  . SER B 1 511 ? 2.035   -75.693 -7.940  1.00 45.78  ? 512  SER B CA  1 
ATOM   8092 C C   . SER B 1 511 ? 2.449   -76.751 -8.975  1.00 46.90  ? 512  SER B C   1 
ATOM   8093 O O   . SER B 1 511 ? 2.162   -77.945 -8.823  1.00 43.23  ? 512  SER B O   1 
ATOM   8094 C CB  . SER B 1 511 ? 2.985   -75.707 -6.757  1.00 44.98  ? 512  SER B CB  1 
ATOM   8095 O OG  . SER B 1 511 ? 2.971   -76.980 -6.161  1.00 50.55  ? 512  SER B OG  1 
ATOM   8096 N N   . LEU B 1 512 ? 3.104   -76.299 -10.037 1.00 46.72  ? 513  LEU B N   1 
ATOM   8097 C CA  . LEU B 1 512 ? 3.575   -77.190 -11.091 1.00 39.20  ? 513  LEU B CA  1 
ATOM   8098 C C   . LEU B 1 512 ? 5.087   -77.296 -11.009 1.00 43.43  ? 513  LEU B C   1 
ATOM   8099 O O   . LEU B 1 512 ? 5.786   -76.348 -11.360 1.00 45.37  ? 513  LEU B O   1 
ATOM   8100 C CB  . LEU B 1 512 ? 3.146   -76.663 -12.456 1.00 40.53  ? 513  LEU B CB  1 
ATOM   8101 C CG  . LEU B 1 512 ? 1.642   -76.709 -12.706 1.00 43.32  ? 513  LEU B CG  1 
ATOM   8102 C CD1 . LEU B 1 512 ? 1.327   -76.317 -14.136 1.00 37.23  ? 513  LEU B CD1 1 
ATOM   8103 C CD2 . LEU B 1 512 ? 1.102   -78.099 -12.395 1.00 40.50  ? 513  LEU B CD2 1 
ATOM   8104 N N   . ASP B 1 513 ? 5.600   -78.413 -10.495 1.00 42.67  ? 514  ASP B N   1 
ATOM   8105 C CA  . ASP B 1 513 ? 7.054   -78.630 -10.476 1.00 45.33  ? 514  ASP B CA  1 
ATOM   8106 C C   . ASP B 1 513 ? 7.363   -80.121 -10.540 1.00 40.50  ? 514  ASP B C   1 
ATOM   8107 O O   . ASP B 1 513 ? 6.496   -80.918 -10.888 1.00 46.23  ? 514  ASP B O   1 
ATOM   8108 C CB  . ASP B 1 513 ? 7.737   -77.957 -9.242  1.00 48.24  ? 514  ASP B CB  1 
ATOM   8109 C CG  . ASP B 1 513 ? 7.097   -78.328 -7.883  1.00 52.39  ? 514  ASP B CG  1 
ATOM   8110 O OD1 . ASP B 1 513 ? 6.526   -79.432 -7.725  1.00 55.44  ? 514  ASP B OD1 1 
ATOM   8111 O OD2 . ASP B 1 513 ? 7.184   -77.500 -6.943  1.00 65.47  ? 514  ASP B OD2 1 
ATOM   8112 N N   . LEU B 1 514 ? 8.596   -80.494 -10.236 1.00 44.42  ? 515  LEU B N   1 
ATOM   8113 C CA  . LEU B 1 514 ? 8.992   -81.906 -10.267 1.00 52.70  ? 515  LEU B CA  1 
ATOM   8114 C C   . LEU B 1 514 ? 8.250   -82.736 -9.213  1.00 47.32  ? 515  LEU B C   1 
ATOM   8115 O O   . LEU B 1 514 ? 8.010   -83.921 -9.424  1.00 52.19  ? 515  LEU B O   1 
ATOM   8116 C CB  . LEU B 1 514 ? 10.512  -82.066 -10.079 1.00 49.64  ? 515  LEU B CB  1 
ATOM   8117 C CG  . LEU B 1 514 ? 11.370  -81.418 -11.174 1.00 48.02  ? 515  LEU B CG  1 
ATOM   8118 C CD1 . LEU B 1 514 ? 12.853  -81.732 -11.054 1.00 44.92  ? 515  LEU B CD1 1 
ATOM   8119 C CD2 . LEU B 1 514 ? 10.849  -81.816 -12.538 1.00 53.27  ? 515  LEU B CD2 1 
ATOM   8120 N N   . ARG B 1 515 ? 7.881   -82.124 -8.091  1.00 52.57  ? 516  ARG B N   1 
ATOM   8121 C CA  . ARG B 1 515 ? 7.117   -82.824 -7.054  1.00 49.63  ? 516  ARG B CA  1 
ATOM   8122 C C   . ARG B 1 515 ? 5.688   -83.001 -7.558  1.00 51.75  ? 516  ARG B C   1 
ATOM   8123 O O   . ARG B 1 515 ? 5.299   -82.346 -8.525  1.00 46.79  ? 516  ARG B O   1 
ATOM   8124 C CB  . ARG B 1 515 ? 7.140   -82.045 -5.728  1.00 49.67  ? 516  ARG B CB  1 
ATOM   8125 C CG  . ARG B 1 515 ? 8.543   -81.762 -5.184  1.00 54.75  ? 516  ARG B CG  1 
ATOM   8126 C CD  . ARG B 1 515 ? 8.503   -80.659 -4.112  1.00 62.21  ? 516  ARG B CD  1 
ATOM   8127 N NE  . ARG B 1 515 ? 7.582   -79.576 -4.480  1.00 67.72  ? 516  ARG B NE  1 
ATOM   8128 C CZ  . ARG B 1 515 ? 6.504   -79.220 -3.771  1.00 76.59  ? 516  ARG B CZ  1 
ATOM   8129 N NH1 . ARG B 1 515 ? 6.214   -79.849 -2.628  1.00 72.28  ? 516  ARG B NH1 1 
ATOM   8130 N NH2 . ARG B 1 515 ? 5.719   -78.226 -4.196  1.00 65.34  ? 516  ARG B NH2 1 
ATOM   8131 N N   . PRO B 1 516 ? 4.899   -83.888 -6.915  1.00 52.87  ? 517  PRO B N   1 
ATOM   8132 C CA  . PRO B 1 516 ? 3.484   -84.007 -7.308  1.00 48.96  ? 517  PRO B CA  1 
ATOM   8133 C C   . PRO B 1 516 ? 2.713   -82.719 -7.026  1.00 53.34  ? 517  PRO B C   1 
ATOM   8134 O O   . PRO B 1 516 ? 3.201   -81.882 -6.245  1.00 51.90  ? 517  PRO B O   1 
ATOM   8135 C CB  . PRO B 1 516 ? 2.953   -85.152 -6.422  1.00 50.00  ? 517  PRO B CB  1 
ATOM   8136 C CG  . PRO B 1 516 ? 4.158   -85.876 -5.953  1.00 44.66  ? 517  PRO B CG  1 
ATOM   8137 C CD  . PRO B 1 516 ? 5.284   -84.888 -5.898  1.00 45.99  ? 517  PRO B CD  1 
ATOM   8138 N N   . LEU B 1 517 ? 1.531   -82.574 -7.629  1.00 48.58  ? 518  LEU B N   1 
ATOM   8139 C CA  . LEU B 1 517 ? 0.649   -81.435 -7.352  1.00 53.95  ? 518  LEU B CA  1 
ATOM   8140 C C   . LEU B 1 517 ? 0.469   -81.138 -5.858  1.00 55.15  ? 518  LEU B C   1 
ATOM   8141 O O   . LEU B 1 517 ? 0.113   -82.016 -5.063  1.00 53.04  ? 518  LEU B O   1 
ATOM   8142 C CB  . LEU B 1 517 ? -0.735  -81.659 -7.950  1.00 49.26  ? 518  LEU B CB  1 
ATOM   8143 C CG  . LEU B 1 517 ? -0.921  -81.769 -9.449  1.00 50.05  ? 518  LEU B CG  1 
ATOM   8144 C CD1 . LEU B 1 517 ? -2.392  -81.563 -9.740  1.00 51.03  ? 518  LEU B CD1 1 
ATOM   8145 C CD2 . LEU B 1 517 ? -0.069  -80.750 -10.193 1.00 50.47  ? 518  LEU B CD2 1 
ATOM   8146 N N   . GLU B 1 518 ? 0.702   -79.889 -5.486  1.00 52.26  ? 519  GLU B N   1 
ATOM   8147 C CA  . GLU B 1 518 ? 0.384   -79.435 -4.140  1.00 54.50  ? 519  GLU B CA  1 
ATOM   8148 C C   . GLU B 1 518 ? -0.676  -78.336 -4.231  1.00 51.92  ? 519  GLU B C   1 
ATOM   8149 O O   . GLU B 1 518 ? -0.544  -77.427 -5.045  1.00 49.22  ? 519  GLU B O   1 
ATOM   8150 C CB  . GLU B 1 518 ? 1.638   -78.938 -3.431  1.00 44.37  ? 519  GLU B CB  1 
ATOM   8151 C CG  . GLU B 1 518 ? 1.354   -78.217 -2.145  1.00 59.71  ? 519  GLU B CG  1 
ATOM   8152 C CD  . GLU B 1 518 ? 2.594   -77.558 -1.585  1.00 70.59  ? 519  GLU B CD  1 
ATOM   8153 O OE1 . GLU B 1 518 ? 3.658   -77.650 -2.247  1.00 78.01  ? 519  GLU B OE1 1 
ATOM   8154 O OE2 . GLU B 1 518 ? 2.506   -76.948 -0.496  1.00 78.18  ? 519  GLU B OE2 1 
ATOM   8155 N N   . VAL B 1 519 ? -1.736  -78.427 -3.428  1.00 48.97  ? 520  VAL B N   1 
ATOM   8156 C CA  . VAL B 1 519 ? -2.784  -77.411 -3.460  1.00 44.27  ? 520  VAL B CA  1 
ATOM   8157 C C   . VAL B 1 519 ? -2.473  -76.291 -2.476  1.00 45.86  ? 520  VAL B C   1 
ATOM   8158 O O   . VAL B 1 519 ? -2.095  -76.541 -1.329  1.00 51.22  ? 520  VAL B O   1 
ATOM   8159 C CB  . VAL B 1 519 ? -4.166  -78.008 -3.162  1.00 43.55  ? 520  VAL B CB  1 
ATOM   8160 C CG1 . VAL B 1 519 ? -5.242  -76.929 -3.206  1.00 37.60  ? 520  VAL B CG1 1 
ATOM   8161 C CG2 . VAL B 1 519 ? -4.488  -79.086 -4.188  1.00 44.61  ? 520  VAL B CG2 1 
ATOM   8162 N N   . ARG B 1 520 ? -2.604  -75.052 -2.948  1.00 45.45  ? 521  ARG B N   1 
ATOM   8163 C CA  . ARG B 1 520 ? -2.321  -73.875 -2.134  1.00 43.45  ? 521  ARG B CA  1 
ATOM   8164 C C   . ARG B 1 520 ? -3.424  -72.850 -2.312  1.00 44.03  ? 521  ARG B C   1 
ATOM   8165 O O   . ARG B 1 520 ? -4.282  -73.024 -3.168  1.00 42.16  ? 521  ARG B O   1 
ATOM   8166 C CB  . ARG B 1 520 ? -0.968  -73.279 -2.496  1.00 45.71  ? 521  ARG B CB  1 
ATOM   8167 C CG  . ARG B 1 520 ? 0.195   -74.257 -2.351  1.00 44.23  ? 521  ARG B CG  1 
ATOM   8168 C CD  . ARG B 1 520 ? 1.490   -73.507 -2.454  1.00 44.85  ? 521  ARG B CD  1 
ATOM   8169 N NE  . ARG B 1 520 ? 2.618   -74.377 -2.742  1.00 54.20  ? 521  ARG B NE  1 
ATOM   8170 C CZ  . ARG B 1 520 ? 3.612   -74.040 -3.564  1.00 60.86  ? 521  ARG B CZ  1 
ATOM   8171 N NH1 . ARG B 1 520 ? 3.595   -72.858 -4.176  1.00 52.63  ? 521  ARG B NH1 1 
ATOM   8172 N NH2 . ARG B 1 520 ? 4.617   -74.882 -3.784  1.00 63.39  ? 521  ARG B NH2 1 
ATOM   8173 N N   . ARG B 1 521 ? -3.416  -71.798 -1.488  1.00 49.95  ? 522  ARG B N   1 
ATOM   8174 C CA  . ARG B 1 521 ? -4.480  -70.787 -1.508  1.00 47.70  ? 522  ARG B CA  1 
ATOM   8175 C C   . ARG B 1 521 ? -3.971  -69.370 -1.720  1.00 49.32  ? 522  ARG B C   1 
ATOM   8176 O O   . ARG B 1 521 ? -3.011  -68.927 -1.068  1.00 44.58  ? 522  ARG B O   1 
ATOM   8177 C CB  . ARG B 1 521 ? -5.286  -70.800 -0.210  1.00 48.04  ? 522  ARG B CB  1 
ATOM   8178 C CG  . ARG B 1 521 ? -6.247  -71.949 -0.044  1.00 50.70  ? 522  ARG B CG  1 
ATOM   8179 C CD  . ARG B 1 521 ? -7.147  -71.705 1.154   1.00 45.52  ? 522  ARG B CD  1 
ATOM   8180 N NE  . ARG B 1 521 ? -8.058  -70.596 0.882   1.00 52.50  ? 522  ARG B NE  1 
ATOM   8181 C CZ  . ARG B 1 521 ? -8.345  -69.632 1.749   1.00 47.61  ? 522  ARG B CZ  1 
ATOM   8182 N NH1 . ARG B 1 521 ? -7.792  -69.644 2.950   1.00 48.26  ? 522  ARG B NH1 1 
ATOM   8183 N NH2 . ARG B 1 521 ? -9.183  -68.665 1.414   1.00 49.61  ? 522  ARG B NH2 1 
ATOM   8184 N N   . GLY B 1 522 ? -4.644  -68.664 -2.626  1.00 45.70  ? 523  GLY B N   1 
ATOM   8185 C CA  . GLY B 1 522 ? -4.418  -67.253 -2.847  1.00 46.44  ? 523  GLY B CA  1 
ATOM   8186 C C   . GLY B 1 522 ? -3.296  -66.945 -3.808  1.00 43.81  ? 523  GLY B C   1 
ATOM   8187 O O   . GLY B 1 522 ? -2.139  -67.270 -3.553  1.00 50.10  ? 523  GLY B O   1 
ATOM   8188 N N   . LEU B 1 523 ? -3.640  -66.320 -4.926  1.00 46.32  ? 524  LEU B N   1 
ATOM   8189 C CA  . LEU B 1 523 ? -2.627  -65.858 -5.860  1.00 50.75  ? 524  LEU B CA  1 
ATOM   8190 C C   . LEU B 1 523 ? -2.159  -64.490 -5.397  1.00 43.05  ? 524  LEU B C   1 
ATOM   8191 O O   . LEU B 1 523 ? -2.747  -63.480 -5.790  1.00 43.63  ? 524  LEU B O   1 
ATOM   8192 C CB  . LEU B 1 523 ? -3.176  -65.787 -7.299  1.00 42.27  ? 524  LEU B CB  1 
ATOM   8193 C CG  . LEU B 1 523 ? -3.521  -67.127 -7.956  1.00 43.85  ? 524  LEU B CG  1 
ATOM   8194 C CD1 . LEU B 1 523 ? -4.339  -66.940 -9.235  1.00 38.39  ? 524  LEU B CD1 1 
ATOM   8195 C CD2 . LEU B 1 523 ? -2.270  -67.935 -8.210  1.00 38.46  ? 524  LEU B CD2 1 
ATOM   8196 N N   . ARG B 1 524 ? -1.098  -64.467 -4.591  1.00 42.74  ? 525  ARG B N   1 
ATOM   8197 C CA  A ARG B 1 524 ? -0.622  -63.218 -3.992  0.57 45.69  ? 525  ARG B CA  1 
ATOM   8198 C CA  B ARG B 1 524 ? -0.620  -63.257 -3.920  0.43 45.63  ? 525  ARG B CA  1 
ATOM   8199 C C   . ARG B 1 524 ? -1.794  -62.377 -3.469  1.00 44.07  ? 525  ARG B C   1 
ATOM   8200 O O   . ARG B 1 524 ? -1.922  -61.201 -3.846  1.00 43.02  ? 525  ARG B O   1 
ATOM   8201 C CB  A ARG B 1 524 ? 0.185   -62.396 -5.009  0.57 43.68  ? 525  ARG B CB  1 
ATOM   8202 C CB  B ARG B 1 524 ? 0.351   -62.501 -4.830  0.43 43.62  ? 525  ARG B CB  1 
ATOM   8203 C CG  A ARG B 1 524 ? 1.436   -63.074 -5.562  0.57 42.63  ? 525  ARG B CG  1 
ATOM   8204 C CG  B ARG B 1 524 ? 1.560   -63.360 -5.202  0.43 42.63  ? 525  ARG B CG  1 
ATOM   8205 C CD  A ARG B 1 524 ? 2.640   -62.862 -4.664  0.57 42.78  ? 525  ARG B CD  1 
ATOM   8206 C CD  B ARG B 1 524 ? 2.736   -62.551 -5.711  0.43 43.17  ? 525  ARG B CD  1 
ATOM   8207 N NE  A ARG B 1 524 ? 3.011   -61.453 -4.538  0.57 44.13  ? 525  ARG B NE  1 
ATOM   8208 N NE  B ARG B 1 524 ? 3.940   -63.371 -5.851  0.43 46.10  ? 525  ARG B NE  1 
ATOM   8209 C CZ  A ARG B 1 524 ? 3.819   -60.983 -3.589  0.57 41.18  ? 525  ARG B CZ  1 
ATOM   8210 C CZ  B ARG B 1 524 ? 5.129   -62.900 -6.217  0.43 46.45  ? 525  ARG B CZ  1 
ATOM   8211 N NH1 A ARG B 1 524 ? 4.331   -61.817 -2.695  0.57 36.37  ? 525  ARG B NH1 1 
ATOM   8212 N NH1 B ARG B 1 524 ? 5.271   -61.610 -6.488  0.43 44.22  ? 525  ARG B NH1 1 
ATOM   8213 N NH2 A ARG B 1 524 ? 4.112   -59.690 -3.536  0.57 35.17  ? 525  ARG B NH2 1 
ATOM   8214 N NH2 B ARG B 1 524 ? 6.175   -63.713 -6.314  0.43 44.83  ? 525  ARG B NH2 1 
ATOM   8215 N N   . ALA B 1 525 ? -2.648  -62.978 -2.634  1.00 40.41  ? 526  ALA B N   1 
ATOM   8216 C CA  . ALA B 1 525 ? -3.914  -62.373 -2.197  1.00 41.81  ? 526  ALA B CA  1 
ATOM   8217 C C   . ALA B 1 525 ? -3.774  -61.035 -1.487  1.00 42.07  ? 526  ALA B C   1 
ATOM   8218 O O   . ALA B 1 525 ? -4.536  -60.113 -1.787  1.00 43.75  ? 526  ALA B O   1 
ATOM   8219 C CB  . ALA B 1 525 ? -4.685  -63.349 -1.296  1.00 41.13  ? 526  ALA B CB  1 
ATOM   8220 N N   . GLN B 1 526 ? -2.829  -60.921 -0.548  1.00 43.19  ? 527  GLN B N   1 
ATOM   8221 C CA  . GLN B 1 526 ? -2.642  -59.655 0.155   1.00 39.86  ? 527  GLN B CA  1 
ATOM   8222 C C   . GLN B 1 526 ? -2.186  -58.580 -0.815  1.00 44.17  ? 527  GLN B C   1 
ATOM   8223 O O   . GLN B 1 526 ? -2.783  -57.499 -0.883  1.00 46.77  ? 527  GLN B O   1 
ATOM   8224 C CB  . GLN B 1 526 ? -1.634  -59.782 1.306   1.00 44.94  ? 527  GLN B CB  1 
ATOM   8225 C CG  . GLN B 1 526 ? -2.101  -60.639 2.488   1.00 42.54  ? 527  GLN B CG  1 
ATOM   8226 C CD  . GLN B 1 526 ? -3.508  -60.313 2.976   1.00 40.99  ? 527  GLN B CD  1 
ATOM   8227 O OE1 . GLN B 1 526 ? -4.318  -61.209 3.193   1.00 48.66  ? 527  GLN B OE1 1 
ATOM   8228 N NE2 . GLN B 1 526 ? -3.791  -59.043 3.177   1.00 45.62  ? 527  GLN B NE2 1 
ATOM   8229 N N   . ALA B 1 527 ? -1.137  -58.877 -1.573  1.00 44.01  ? 528  ALA B N   1 
ATOM   8230 C CA  . ALA B 1 527 ? -0.629  -57.935 -2.572  1.00 45.17  ? 528  ALA B CA  1 
ATOM   8231 C C   . ALA B 1 527 ? -1.697  -57.537 -3.588  1.00 43.53  ? 528  ALA B C   1 
ATOM   8232 O O   . ALA B 1 527 ? -1.865  -56.353 -3.905  1.00 44.68  ? 528  ALA B O   1 
ATOM   8233 C CB  . ALA B 1 527 ? 0.572   -58.529 -3.293  1.00 44.67  ? 528  ALA B CB  1 
ATOM   8234 N N   . CYS B 1 528 ? -2.442  -58.509 -4.089  1.00 35.96  ? 529  CYS B N   1 
ATOM   8235 C CA  . CYS B 1 528 ? -3.382  -58.179 -5.151  1.00 40.94  ? 529  CYS B CA  1 
ATOM   8236 C C   . CYS B 1 528 ? -4.622  -57.447 -4.639  1.00 45.47  ? 529  CYS B C   1 
ATOM   8237 O O   . CYS B 1 528 ? -5.343  -56.855 -5.438  1.00 40.57  ? 529  CYS B O   1 
ATOM   8238 C CB  . CYS B 1 528 ? -3.774  -59.436 -5.928  1.00 44.46  ? 529  CYS B CB  1 
ATOM   8239 S SG  . CYS B 1 528 ? -2.401  -60.076 -6.949  1.00 43.13  ? 529  CYS B SG  1 
ATOM   8240 N N   . ALA B 1 529 ? -4.872  -57.468 -3.323  1.00 42.82  ? 530  ALA B N   1 
ATOM   8241 C CA  . ALA B 1 529 ? -5.964  -56.652 -2.784  1.00 43.55  ? 530  ALA B CA  1 
ATOM   8242 C C   . ALA B 1 529 ? -5.598  -55.188 -2.960  1.00 39.61  ? 530  ALA B C   1 
ATOM   8243 O O   . ALA B 1 529 ? -6.413  -54.369 -3.390  1.00 43.10  ? 530  ALA B O   1 
ATOM   8244 C CB  . ALA B 1 529 ? -6.238  -56.971 -1.323  1.00 42.74  ? 530  ALA B CB  1 
ATOM   8245 N N   . PHE B 1 530 ? -4.346  -54.870 -2.660  1.00 41.20  ? 531  PHE B N   1 
ATOM   8246 C CA  . PHE B 1 530 ? -3.823  -53.540 -2.948  1.00 42.44  ? 531  PHE B CA  1 
ATOM   8247 C C   . PHE B 1 530 ? -4.072  -53.130 -4.396  1.00 42.10  ? 531  PHE B C   1 
ATOM   8248 O O   . PHE B 1 530 ? -4.673  -52.081 -4.650  1.00 46.87  ? 531  PHE B O   1 
ATOM   8249 C CB  . PHE B 1 530 ? -2.319  -53.464 -2.640  1.00 45.18  ? 531  PHE B CB  1 
ATOM   8250 C CG  . PHE B 1 530 ? -1.668  -52.212 -3.154  1.00 43.39  ? 531  PHE B CG  1 
ATOM   8251 C CD1 . PHE B 1 530 ? -1.781  -51.025 -2.458  1.00 43.64  ? 531  PHE B CD1 1 
ATOM   8252 C CD2 . PHE B 1 530 ? -0.955  -52.220 -4.346  1.00 45.65  ? 531  PHE B CD2 1 
ATOM   8253 C CE1 . PHE B 1 530 ? -1.203  -49.856 -2.933  1.00 47.70  ? 531  PHE B CE1 1 
ATOM   8254 C CE2 . PHE B 1 530 ? -0.381  -51.051 -4.841  1.00 48.16  ? 531  PHE B CE2 1 
ATOM   8255 C CZ  . PHE B 1 530 ? -0.498  -49.867 -4.118  1.00 51.81  ? 531  PHE B CZ  1 
ATOM   8256 N N   . TRP B 1 531 ? -3.630  -53.949 -5.357  1.00 40.07  ? 532  TRP B N   1 
ATOM   8257 C CA  . TRP B 1 531 ? -3.724  -53.544 -6.763  1.00 42.54  ? 532  TRP B CA  1 
ATOM   8258 C C   . TRP B 1 531 ? -5.141  -53.599 -7.323  1.00 42.86  ? 532  TRP B C   1 
ATOM   8259 O O   . TRP B 1 531 ? -5.537  -52.734 -8.118  1.00 43.44  ? 532  TRP B O   1 
ATOM   8260 C CB  . TRP B 1 531 ? -2.806  -54.403 -7.643  1.00 42.40  ? 532  TRP B CB  1 
ATOM   8261 C CG  . TRP B 1 531 ? -1.356  -54.244 -7.330  1.00 40.67  ? 532  TRP B CG  1 
ATOM   8262 C CD1 . TRP B 1 531 ? -0.564  -55.103 -6.603  1.00 34.15  ? 532  TRP B CD1 1 
ATOM   8263 C CD2 . TRP B 1 531 ? -0.514  -53.164 -7.742  1.00 39.12  ? 532  TRP B CD2 1 
ATOM   8264 N NE1 . TRP B 1 531 ? 0.723   -54.616 -6.550  1.00 35.18  ? 532  TRP B NE1 1 
ATOM   8265 C CE2 . TRP B 1 531 ? 0.776   -53.422 -7.227  1.00 35.19  ? 532  TRP B CE2 1 
ATOM   8266 C CE3 . TRP B 1 531 ? -0.728  -51.996 -8.496  1.00 37.60  ? 532  TRP B CE3 1 
ATOM   8267 C CZ2 . TRP B 1 531 ? 1.851   -52.564 -7.454  1.00 35.69  ? 532  TRP B CZ2 1 
ATOM   8268 C CZ3 . TRP B 1 531 ? 0.326   -51.138 -8.698  1.00 34.07  ? 532  TRP B CZ3 1 
ATOM   8269 C CH2 . TRP B 1 531 ? 1.607   -51.429 -8.191  1.00 36.08  ? 532  TRP B CH2 1 
ATOM   8270 N N   . ASN B 1 532 ? -5.904  -54.611 -6.934  1.00 36.80  ? 533  ASN B N   1 
ATOM   8271 C CA  . ASN B 1 532 ? -7.232  -54.786 -7.537  1.00 45.21  ? 533  ASN B CA  1 
ATOM   8272 C C   . ASN B 1 532 ? -8.383  -54.087 -6.787  1.00 52.06  ? 533  ASN B C   1 
ATOM   8273 O O   . ASN B 1 532 ? -9.431  -53.795 -7.371  1.00 46.02  ? 533  ASN B O   1 
ATOM   8274 C CB  . ASN B 1 532 ? -7.532  -56.286 -7.682  1.00 45.35  ? 533  ASN B CB  1 
ATOM   8275 C CG  . ASN B 1 532 ? -6.548  -56.966 -8.610  1.00 46.32  ? 533  ASN B CG  1 
ATOM   8276 O OD1 . ASN B 1 532 ? -5.955  -56.297 -9.448  1.00 41.15  ? 533  ASN B OD1 1 
ATOM   8277 N ND2 . ASN B 1 532 ? -6.337  -58.278 -8.446  1.00 38.02  ? 533  ASN B ND2 1 
ATOM   8278 N N   . ARG B 1 533 ? -8.203  -53.808 -5.498  1.00 51.78  ? 534  ARG B N   1 
ATOM   8279 C CA  . ARG B 1 533 ? -9.290  -53.188 -4.752  1.00 50.55  ? 534  ARG B CA  1 
ATOM   8280 C C   . ARG B 1 533 ? -9.002  -51.732 -4.374  1.00 53.64  ? 534  ARG B C   1 
ATOM   8281 O O   . ARG B 1 533 ? -9.776  -50.848 -4.721  1.00 56.22  ? 534  ARG B O   1 
ATOM   8282 C CB  . ARG B 1 533 ? -9.602  -54.019 -3.516  1.00 50.82  ? 534  ARG B CB  1 
ATOM   8283 C CG  . ARG B 1 533 ? -9.955  -55.448 -3.856  1.00 44.89  ? 534  ARG B CG  1 
ATOM   8284 C CD  . ARG B 1 533 ? -10.019 -56.322 -2.621  1.00 50.62  ? 534  ARG B CD  1 
ATOM   8285 N NE  . ARG B 1 533 ? -10.290 -57.712 -2.976  1.00 55.37  ? 534  ARG B NE  1 
ATOM   8286 C CZ  . ARG B 1 533 ? -11.511 -58.246 -3.027  1.00 60.65  ? 534  ARG B CZ  1 
ATOM   8287 N NH1 . ARG B 1 533 ? -12.571 -57.499 -2.733  1.00 51.72  ? 534  ARG B NH1 1 
ATOM   8288 N NH2 . ARG B 1 533 ? -11.671 -59.520 -3.375  1.00 61.51  ? 534  ARG B NH2 1 
ATOM   8289 N N   . PHE B 1 534 ? -7.893  -51.470 -3.685  1.00 53.53  ? 535  PHE B N   1 
ATOM   8290 C CA  . PHE B 1 534 ? -7.654  -50.122 -3.168  1.00 52.38  ? 535  PHE B CA  1 
ATOM   8291 C C   . PHE B 1 534 ? -7.191  -49.101 -4.209  1.00 52.65  ? 535  PHE B C   1 
ATOM   8292 O O   . PHE B 1 534 ? -7.779  -48.029 -4.350  1.00 52.77  ? 535  PHE B O   1 
ATOM   8293 C CB  . PHE B 1 534 ? -6.623  -50.139 -2.025  1.00 47.59  ? 535  PHE B CB  1 
ATOM   8294 C CG  . PHE B 1 534 ? -6.264  -48.758 -1.551  1.00 46.15  ? 535  PHE B CG  1 
ATOM   8295 C CD1 . PHE B 1 534 ? -7.212  -47.965 -0.908  1.00 45.67  ? 535  PHE B CD1 1 
ATOM   8296 C CD2 . PHE B 1 534 ? -5.009  -48.223 -1.795  1.00 49.53  ? 535  PHE B CD2 1 
ATOM   8297 C CE1 . PHE B 1 534 ? -6.901  -46.663 -0.491  1.00 48.90  ? 535  PHE B CE1 1 
ATOM   8298 C CE2 . PHE B 1 534 ? -4.691  -46.921 -1.376  1.00 48.88  ? 535  PHE B CE2 1 
ATOM   8299 C CZ  . PHE B 1 534 ? -5.638  -46.145 -0.726  1.00 44.45  ? 535  PHE B CZ  1 
ATOM   8300 N N   . LEU B 1 535 ? -6.116  -49.423 -4.914  1.00 55.22  ? 536  LEU B N   1 
ATOM   8301 C CA  . LEU B 1 535 ? -5.474  -48.466 -5.800  1.00 54.94  ? 536  LEU B CA  1 
ATOM   8302 C C   . LEU B 1 535 ? -6.406  -47.810 -6.837  1.00 62.96  ? 536  LEU B C   1 
ATOM   8303 O O   . LEU B 1 535 ? -6.244  -46.621 -7.148  1.00 63.66  ? 536  LEU B O   1 
ATOM   8304 C CB  . LEU B 1 535 ? -4.312  -49.140 -6.515  1.00 59.67  ? 536  LEU B CB  1 
ATOM   8305 C CG  . LEU B 1 535 ? -3.356  -48.132 -7.137  1.00 69.95  ? 536  LEU B CG  1 
ATOM   8306 C CD1 . LEU B 1 535 ? -2.333  -47.731 -6.085  1.00 63.92  ? 536  LEU B CD1 1 
ATOM   8307 C CD2 . LEU B 1 535 ? -2.712  -48.687 -8.406  1.00 58.17  ? 536  LEU B CD2 1 
ATOM   8308 N N   . PRO B 1 536 ? -7.374  -48.567 -7.387  1.00 58.49  ? 537  PRO B N   1 
ATOM   8309 C CA  . PRO B 1 536 ? -8.279  -47.856 -8.306  1.00 61.81  ? 537  PRO B CA  1 
ATOM   8310 C C   . PRO B 1 536 ? -9.132  -46.779 -7.617  1.00 65.11  ? 537  PRO B C   1 
ATOM   8311 O O   . PRO B 1 536 ? -9.551  -45.836 -8.295  1.00 64.27  ? 537  PRO B O   1 
ATOM   8312 C CB  . PRO B 1 536 ? -9.175  -48.974 -8.870  1.00 56.24  ? 537  PRO B CB  1 
ATOM   8313 C CG  . PRO B 1 536 ? -8.373  -50.221 -8.715  1.00 58.22  ? 537  PRO B CG  1 
ATOM   8314 C CD  . PRO B 1 536 ? -7.569  -50.028 -7.444  1.00 56.67  ? 537  PRO B CD  1 
ATOM   8315 N N   . LYS B 1 537 ? -9.383  -46.907 -6.310  1.00 60.46  ? 538  LYS B N   1 
ATOM   8316 C CA  . LYS B 1 537 ? -10.153 -45.882 -5.599  1.00 60.73  ? 538  LYS B CA  1 
ATOM   8317 C C   . LYS B 1 537 ? -9.308  -44.631 -5.416  1.00 62.77  ? 538  LYS B C   1 
ATOM   8318 O O   . LYS B 1 537 ? -9.824  -43.514 -5.327  1.00 66.19  ? 538  LYS B O   1 
ATOM   8319 C CB  . LYS B 1 537 ? -10.643 -46.403 -4.253  1.00 55.61  ? 538  LYS B CB  1 
ATOM   8320 C CG  . LYS B 1 537 ? -11.643 -47.532 -4.382  1.00 58.76  ? 538  LYS B CG  1 
ATOM   8321 C CD  . LYS B 1 537 ? -12.011 -48.102 -3.019  1.00 69.42  ? 538  LYS B CD  1 
ATOM   8322 C CE  . LYS B 1 537 ? -13.211 -49.028 -3.118  1.00 70.26  ? 538  LYS B CE  1 
ATOM   8323 N NZ  . LYS B 1 537 ? -12.925 -50.205 -3.984  1.00 73.47  ? 538  LYS B NZ  1 
ATOM   8324 N N   . LEU B 1 538 ? -7.999  -44.839 -5.391  1.00 61.85  ? 539  LEU B N   1 
ATOM   8325 C CA  . LEU B 1 538 ? -7.040  -43.758 -5.273  1.00 66.26  ? 539  LEU B CA  1 
ATOM   8326 C C   . LEU B 1 538 ? -6.989  -42.954 -6.558  1.00 65.51  ? 539  LEU B C   1 
ATOM   8327 O O   . LEU B 1 538 ? -6.823  -41.737 -6.525  1.00 68.26  ? 539  LEU B O   1 
ATOM   8328 C CB  . LEU B 1 538 ? -5.651  -44.312 -4.933  1.00 62.87  ? 539  LEU B CB  1 
ATOM   8329 C CG  . LEU B 1 538 ? -4.666  -43.393 -4.211  1.00 61.26  ? 539  LEU B CG  1 
ATOM   8330 C CD1 . LEU B 1 538 ? -3.623  -44.229 -3.512  1.00 59.00  ? 539  LEU B CD1 1 
ATOM   8331 C CD2 . LEU B 1 538 ? -3.995  -42.434 -5.168  1.00 63.43  ? 539  LEU B CD2 1 
ATOM   8332 N N   . LEU B 1 539 ? -7.119  -43.634 -7.692  1.00 69.49  ? 540  LEU B N   1 
ATOM   8333 C CA  . LEU B 1 539 ? -7.059  -42.952 -8.986  1.00 76.75  ? 540  LEU B CA  1 
ATOM   8334 C C   . LEU B 1 539 ? -8.317  -42.106 -9.240  1.00 74.74  ? 540  LEU B C   1 
ATOM   8335 O O   . LEU B 1 539 ? -8.220  -41.015 -9.803  1.00 79.64  ? 540  LEU B O   1 
ATOM   8336 C CB  . LEU B 1 539 ? -6.840  -43.964 -10.119 1.00 78.03  ? 540  LEU B CB  1 
ATOM   8337 C CG  . LEU B 1 539 ? -5.520  -44.742 -10.001 1.00 79.35  ? 540  LEU B CG  1 
ATOM   8338 C CD1 . LEU B 1 539 ? -5.484  -45.947 -10.940 1.00 75.55  ? 540  LEU B CD1 1 
ATOM   8339 C CD2 . LEU B 1 539 ? -4.299  -43.835 -10.212 1.00 70.28  ? 540  LEU B CD2 1 
ATOM   8340 N N   . SER B 1 540 ? -9.481  -42.601 -8.817  1.00 72.26  ? 541  SER B N   1 
ATOM   8341 C CA  . SER B 1 540 ? -10.712 -41.800 -8.819  1.00 77.04  ? 541  SER B CA  1 
ATOM   8342 C C   . SER B 1 540 ? -10.598 -40.525 -7.957  1.00 84.57  ? 541  SER B C   1 
ATOM   8343 O O   . SER B 1 540 ? -10.991 -39.440 -8.393  1.00 90.96  ? 541  SER B O   1 
ATOM   8344 C CB  . SER B 1 540 ? -11.899 -42.638 -8.330  1.00 72.96  ? 541  SER B CB  1 
ATOM   8345 O OG  . SER B 1 540 ? -12.027 -43.833 -9.083  1.00 76.17  ? 541  SER B OG  1 
ATOM   8346 N N   . ALA B 1 541 ? -10.069 -40.655 -6.740  1.00 81.33  ? 542  ALA B N   1 
ATOM   8347 C CA  . ALA B 1 541 ? -9.915  -39.506 -5.839  1.00 84.53  ? 542  ALA B CA  1 
ATOM   8348 C C   . ALA B 1 541 ? -8.471  -39.008 -5.788  1.00 78.71  ? 542  ALA B C   1 
ATOM   8349 O O   . ALA B 1 541 ? -7.966  -38.433 -6.751  1.00 82.83  ? 542  ALA B O   1 
ATOM   8350 C CB  . ALA B 1 541 ? -10.399 -39.863 -4.431  1.00 77.12  ? 542  ALA B CB  1 
HETATM 8351 C C1  . NAG C 2 .   ? -22.866 -59.723 21.909  1.00 65.58  ? 1    NAG C C1  1 
HETATM 8352 C C2  . NAG C 2 .   ? -23.886 -60.237 20.882  1.00 73.12  ? 1    NAG C C2  1 
HETATM 8353 C C3  . NAG C 2 .   ? -24.309 -59.114 19.938  1.00 70.60  ? 1    NAG C C3  1 
HETATM 8354 C C4  . NAG C 2 .   ? -24.789 -57.907 20.732  1.00 75.16  ? 1    NAG C C4  1 
HETATM 8355 C C5  . NAG C 2 .   ? -23.726 -57.497 21.758  1.00 70.67  ? 1    NAG C C5  1 
HETATM 8356 C C6  . NAG C 2 .   ? -24.147 -56.357 22.663  1.00 74.81  ? 1    NAG C C6  1 
HETATM 8357 C C7  . NAG C 2 .   ? -24.083 -62.489 19.925  1.00 80.14  ? 1    NAG C C7  1 
HETATM 8358 C C8  . NAG C 2 .   ? -25.470 -62.509 20.503  1.00 76.15  ? 1    NAG C C8  1 
HETATM 8359 N N2  . NAG C 2 .   ? -23.371 -61.374 20.136  1.00 76.76  ? 1    NAG C N2  1 
HETATM 8360 O O3  . NAG C 2 .   ? -25.352 -59.573 19.084  1.00 74.48  ? 1    NAG C O3  1 
HETATM 8361 O O4  . NAG C 2 .   ? -25.067 -56.845 19.826  1.00 78.39  ? 1    NAG C O4  1 
HETATM 8362 O O5  . NAG C 2 .   ? -23.418 -58.611 22.612  1.00 66.61  ? 1    NAG C O5  1 
HETATM 8363 O O6  . NAG C 2 .   ? -25.516 -56.454 23.033  1.00 83.04  ? 1    NAG C O6  1 
HETATM 8364 O O7  . NAG C 2 .   ? -23.628 -63.439 19.297  1.00 92.71  ? 1    NAG C O7  1 
HETATM 8365 C C1  . NAG C 2 .   ? -26.418 -56.374 20.035  1.00 84.77  ? 2    NAG C C1  1 
HETATM 8366 C C2  . NAG C 2 .   ? -26.466 -54.905 19.602  1.00 89.72  ? 2    NAG C C2  1 
HETATM 8367 C C3  . NAG C 2 .   ? -27.880 -54.344 19.788  1.00 96.78  ? 2    NAG C C3  1 
HETATM 8368 C C4  . NAG C 2 .   ? -28.903 -55.234 19.087  1.00 102.65 ? 2    NAG C C4  1 
HETATM 8369 C C5  . NAG C 2 .   ? -28.742 -56.683 19.553  1.00 100.08 ? 2    NAG C C5  1 
HETATM 8370 C C6  . NAG C 2 .   ? -29.662 -57.646 18.842  1.00 97.68  ? 2    NAG C C6  1 
HETATM 8371 C C7  . NAG C 2 .   ? -24.395 -53.592 19.799  1.00 79.65  ? 2    NAG C C7  1 
HETATM 8372 C C8  . NAG C 2 .   ? -23.506 -52.816 20.728  1.00 70.04  ? 2    NAG C C8  1 
HETATM 8373 N N2  . NAG C 2 .   ? -25.497 -54.118 20.348  1.00 91.25  ? 2    NAG C N2  1 
HETATM 8374 O O3  . NAG C 2 .   ? -27.937 -53.015 19.276  1.00 98.05  ? 2    NAG C O3  1 
HETATM 8375 O O4  . NAG C 2 .   ? -30.230 -54.780 19.344  1.00 101.09 ? 2    NAG C O4  1 
HETATM 8376 O O5  . NAG C 2 .   ? -27.400 -57.128 19.300  1.00 99.26  ? 2    NAG C O5  1 
HETATM 8377 O O6  . NAG C 2 .   ? -31.023 -57.346 19.118  1.00 103.01 ? 2    NAG C O6  1 
HETATM 8378 O O7  . NAG C 2 .   ? -24.133 -53.726 18.604  1.00 66.85  ? 2    NAG C O7  1 
HETATM 8379 C C1  . FUC C 2 .   ? -25.732 -56.258 24.455  1.00 87.47  ? 3    FUC C C1  1 
HETATM 8380 C C2  . FUC C 2 .   ? -27.263 -56.224 24.656  1.00 91.27  ? 3    FUC C C2  1 
HETATM 8381 C C3  . FUC C 2 .   ? -27.881 -57.641 24.465  1.00 90.07  ? 3    FUC C C3  1 
HETATM 8382 C C4  . FUC C 2 .   ? -27.179 -58.708 25.340  1.00 84.82  ? 3    FUC C C4  1 
HETATM 8383 C C5  . FUC C 2 .   ? -25.646 -58.638 25.151  1.00 83.58  ? 3    FUC C C5  1 
HETATM 8384 C C6  . FUC C 2 .   ? -24.857 -59.549 26.108  1.00 67.05  ? 3    FUC C C6  1 
HETATM 8385 O O2  . FUC C 2 .   ? -27.890 -55.266 23.779  1.00 95.50  ? 3    FUC C O2  1 
HETATM 8386 O O3  . FUC C 2 .   ? -29.256 -57.640 24.838  1.00 99.79  ? 3    FUC C O3  1 
HETATM 8387 O O4  . FUC C 2 .   ? -27.534 -58.519 26.704  1.00 91.98  ? 3    FUC C O4  1 
HETATM 8388 O O5  . FUC C 2 .   ? -25.125 -57.264 25.290  1.00 83.30  ? 3    FUC C O5  1 
HETATM 8389 C C1  . NAG D 2 .   ? 25.303  -54.362 -11.819 1.00 68.43  ? 1    NAG D C1  1 
HETATM 8390 C C2  . NAG D 2 .   ? 26.064  -53.241 -11.106 1.00 69.30  ? 1    NAG D C2  1 
HETATM 8391 C C3  . NAG D 2 .   ? 25.371  -51.909 -11.339 1.00 69.22  ? 1    NAG D C3  1 
HETATM 8392 C C4  . NAG D 2 .   ? 25.269  -51.640 -12.832 1.00 75.37  ? 1    NAG D C4  1 
HETATM 8393 C C5  . NAG D 2 .   ? 24.541  -52.807 -13.509 1.00 68.32  ? 1    NAG D C5  1 
HETATM 8394 C C6  . NAG D 2 .   ? 24.510  -52.697 -15.020 1.00 75.81  ? 1    NAG D C6  1 
HETATM 8395 C C7  . NAG D 2 .   ? 27.379  -53.829 -9.131  1.00 75.36  ? 1    NAG D C7  1 
HETATM 8396 C C8  . NAG D 2 .   ? 28.551  -53.909 -10.070 1.00 70.98  ? 1    NAG D C8  1 
HETATM 8397 N N2  . NAG D 2 .   ? 26.206  -53.507 -9.687  1.00 63.60  ? 1    NAG D N2  1 
HETATM 8398 O O3  . NAG D 2 .   ? 26.088  -50.860 -10.701 1.00 77.30  ? 1    NAG D O3  1 
HETATM 8399 O O4  . NAG D 2 .   ? 24.586  -50.405 -13.035 1.00 84.14  ? 1    NAG D O4  1 
HETATM 8400 O O5  . NAG D 2 .   ? 25.194  -54.054 -13.205 1.00 65.24  ? 1    NAG D O5  1 
HETATM 8401 O O6  . NAG D 2 .   ? 25.723  -52.158 -15.531 1.00 84.35  ? 1    NAG D O6  1 
HETATM 8402 O O7  . NAG D 2 .   ? 27.490  -54.052 -7.926  1.00 83.62  ? 1    NAG D O7  1 
HETATM 8403 C C1  . NAG D 2 .   ? 25.329  -49.466 -13.867 1.00 83.96  ? 2    NAG D C1  1 
HETATM 8404 C C2  . NAG D 2 .   ? 24.326  -48.480 -14.453 1.00 84.70  ? 2    NAG D C2  1 
HETATM 8405 C C3  . NAG D 2 .   ? 25.034  -47.527 -15.410 1.00 86.52  ? 2    NAG D C3  1 
HETATM 8406 C C4  . NAG D 2 .   ? 26.173  -46.822 -14.681 1.00 95.19  ? 2    NAG D C4  1 
HETATM 8407 C C5  . NAG D 2 .   ? 27.108  -47.830 -14.003 1.00 94.51  ? 2    NAG D C5  1 
HETATM 8408 C C6  . NAG D 2 .   ? 28.136  -47.159 -13.118 1.00 96.24  ? 2    NAG D C6  1 
HETATM 8409 C C7  . NAG D 2 .   ? 22.042  -49.350 -14.506 1.00 72.49  ? 2    NAG D C7  1 
HETATM 8410 C C8  . NAG D 2 .   ? 21.003  -50.085 -15.300 1.00 63.48  ? 2    NAG D C8  1 
HETATM 8411 N N2  . NAG D 2 .   ? 23.222  -49.164 -15.107 1.00 83.98  ? 2    NAG D N2  1 
HETATM 8412 O O3  . NAG D 2 .   ? 24.106  -46.567 -15.908 1.00 84.93  ? 2    NAG D O3  1 
HETATM 8413 O O4  . NAG D 2 .   ? 26.925  -46.018 -15.583 1.00 89.45  ? 2    NAG D O4  1 
HETATM 8414 O O5  . NAG D 2 .   ? 26.368  -48.737 -13.164 1.00 92.16  ? 2    NAG D O5  1 
HETATM 8415 O O6  . NAG D 2 .   ? 29.070  -48.090 -12.588 1.00 95.30  ? 2    NAG D O6  1 
HETATM 8416 O O7  . NAG D 2 .   ? 21.825  -48.942 -13.367 1.00 65.10  ? 2    NAG D O7  1 
HETATM 8417 C C1  . FUC D 2 .   ? 26.294  -52.981 -16.579 1.00 80.19  ? 3    FUC D C1  1 
HETATM 8418 C C2  . FUC D 2 .   ? 27.695  -52.370 -16.995 1.00 85.14  ? 3    FUC D C2  1 
HETATM 8419 C C3  . FUC D 2 .   ? 28.816  -52.776 -15.998 1.00 86.66  ? 3    FUC D C3  1 
HETATM 8420 C C4  . FUC D 2 .   ? 28.834  -54.292 -15.821 1.00 86.37  ? 3    FUC D C4  1 
HETATM 8421 C C5  . FUC D 2 .   ? 27.487  -54.723 -15.271 1.00 74.52  ? 3    FUC D C5  1 
HETATM 8422 C C6  . FUC D 2 .   ? 27.389  -56.226 -15.022 1.00 66.50  ? 3    FUC D C6  1 
HETATM 8423 O O2  . FUC D 2 .   ? 27.658  -50.945 -17.180 1.00 78.75  ? 3    FUC D O2  1 
HETATM 8424 O O3  . FUC D 2 .   ? 30.109  -52.382 -16.478 1.00 92.95  ? 3    FUC D O3  1 
HETATM 8425 O O4  . FUC D 2 .   ? 29.065  -54.931 -17.088 1.00 94.93  ? 3    FUC D O4  1 
HETATM 8426 O O5  . FUC D 2 .   ? 26.403  -54.364 -16.184 1.00 76.15  ? 3    FUC D O5  1 
HETATM 8427 C C1  A DEP E 3 .   ? -7.355  -42.166 25.201  0.65 45.85  ? 604  DEP A C1  1 
HETATM 8428 C C2  A DEP E 3 .   ? -6.065  -42.902 24.875  0.65 43.27  ? 604  DEP A C2  1 
HETATM 8429 C C3  A DEP E 3 .   ? -8.490  -43.812 28.961  0.65 40.33  ? 604  DEP A C3  1 
HETATM 8430 C C4  A DEP E 3 .   ? -9.770  -43.040 29.222  0.65 45.93  ? 604  DEP A C4  1 
HETATM 8431 O O1  A DEP E 3 .   ? -7.156  -41.425 26.361  0.65 43.70  ? 604  DEP A O1  1 
HETATM 8432 O O2  A DEP E 3 .   ? -7.972  -43.263 27.749  0.65 44.11  ? 604  DEP A O2  1 
HETATM 8433 O O3  A DEP E 3 .   ? -7.039  -41.166 28.908  0.65 38.69  ? 604  DEP A O3  1 
HETATM 8434 P P   A DEP E 3 .   ? -6.891  -42.105 27.762  0.65 39.69  ? 604  DEP A P   1 
HETATM 8435 C C1  . EDO F 4 .   ? -9.330  -59.399 9.565   1.00 43.50  ? 605  EDO A C1  1 
HETATM 8436 O O1  . EDO F 4 .   ? -7.906  -59.413 9.593   1.00 40.77  ? 605  EDO A O1  1 
HETATM 8437 C C2  . EDO F 4 .   ? -9.816  -60.639 8.817   1.00 52.81  ? 605  EDO A C2  1 
HETATM 8438 O O2  . EDO F 4 .   ? -9.514  -60.505 7.429   1.00 44.39  ? 605  EDO A O2  1 
HETATM 8439 C C1  . EDO G 4 .   ? 8.780   -47.858 11.761  0.88 46.33  ? 606  EDO A C1  1 
HETATM 8440 O O1  . EDO G 4 .   ? 9.838   -47.049 11.231  0.88 49.91  ? 606  EDO A O1  1 
HETATM 8441 C C2  . EDO G 4 .   ? 7.548   -47.812 10.861  0.88 43.46  ? 606  EDO A C2  1 
HETATM 8442 O O2  . EDO G 4 .   ? 7.118   -46.467 10.624  0.88 46.77  ? 606  EDO A O2  1 
HETATM 8443 O O3  . HI6 H 5 .   ? -20.656 -36.393 29.129  0.76 63.38  ? 607  HI6 A O3  1 
HETATM 8444 C C14 . HI6 H 5 .   ? -21.023 -37.420 28.585  0.76 62.36  ? 607  HI6 A C14 1 
HETATM 8445 N N4  . HI6 H 5 .   ? -22.359 -37.597 28.193  0.76 66.78  ? 607  HI6 A N4  1 
HETATM 8446 C C11 . HI6 H 5 .   ? -19.962 -38.533 28.290  0.76 58.88  ? 607  HI6 A C11 1 
HETATM 8447 C C10 . HI6 H 5 .   ? -20.294 -39.754 27.661  0.76 59.92  ? 607  HI6 A C10 1 
HETATM 8448 C C9  . HI6 H 5 .   ? -19.326 -40.741 27.390  0.76 64.00  ? 607  HI6 A C9  1 
HETATM 8449 N N3  . HI6 H 5 .   ? -17.986 -40.567 27.728  0.76 63.43  ? 607  HI6 A N3  1 
HETATM 8450 C C13 . HI6 H 5 .   ? -17.646 -39.393 28.344  0.76 51.45  ? 607  HI6 A C13 1 
HETATM 8451 C C12 . HI6 H 5 .   ? -18.604 -38.407 28.626  0.76 57.08  ? 607  HI6 A C12 1 
HETATM 8452 C C8  . HI6 H 5 .   ? -16.940 -41.665 27.432  0.76 63.93  ? 607  HI6 A C8  1 
HETATM 8453 O O2  . HI6 H 5 .   ? -17.304 -42.893 28.091  0.76 62.17  ? 607  HI6 A O2  1 
HETATM 8454 C C7  . HI6 H 5 .   ? -16.788 -44.089 27.489  0.76 62.22  ? 607  HI6 A C7  1 
HETATM 8455 N N2  . HI6 H 5 .   ? -15.366 -44.459 27.988  0.76 61.74  ? 607  HI6 A N2  1 
HETATM 8456 C C2  . HI6 H 5 .   ? -14.263 -44.562 27.101  0.76 65.17  ? 607  HI6 A C2  1 
HETATM 8457 C C1  . HI6 H 5 .   ? -14.385 -44.342 25.719  0.76 61.73  ? 607  HI6 A C1  1 
HETATM 8458 N N1  . HI6 H 5 .   ? -14.880 -43.177 25.055  0.76 63.36  ? 607  HI6 A N1  1 
HETATM 8459 O O1  . HI6 H 5 .   ? -14.970 -43.008 23.899  0.76 71.03  ? 607  HI6 A O1  1 
HETATM 8460 C C3  . HI6 H 5 .   ? -12.978 -44.907 27.665  0.76 60.31  ? 607  HI6 A C3  1 
HETATM 8461 C C4  . HI6 H 5 .   ? -12.791 -45.128 29.006  0.76 62.62  ? 607  HI6 A C4  1 
HETATM 8462 C C5  . HI6 H 5 .   ? -13.908 -45.031 29.872  0.76 63.54  ? 607  HI6 A C5  1 
HETATM 8463 C C6  . HI6 H 5 .   ? -15.135 -44.705 29.353  0.76 59.42  ? 607  HI6 A C6  1 
HETATM 8464 C C1  . NAG I 6 .   ? -9.233  -36.393 -46.652 1.00 85.13  ? 604  NAG B C1  1 
HETATM 8465 C C2  . NAG I 6 .   ? -10.753 -36.124 -46.632 1.00 84.25  ? 604  NAG B C2  1 
HETATM 8466 C C3  . NAG I 6 .   ? -11.215 -35.528 -47.972 1.00 91.70  ? 604  NAG B C3  1 
HETATM 8467 C C4  . NAG I 6 .   ? -10.890 -36.449 -49.150 1.00 93.24  ? 604  NAG B C4  1 
HETATM 8468 C C5  . NAG I 6 .   ? -9.538  -37.131 -48.957 1.00 90.08  ? 604  NAG B C5  1 
HETATM 8469 C C6  . NAG I 6 .   ? -8.736  -37.273 -50.238 1.00 88.34  ? 604  NAG B C6  1 
HETATM 8470 C C7  . NAG I 6 .   ? -12.297 -37.495 -45.279 1.00 91.51  ? 604  NAG B C7  1 
HETATM 8471 C C8  . NAG I 6 .   ? -12.987 -38.827 -45.169 1.00 80.07  ? 604  NAG B C8  1 
HETATM 8472 N N2  . NAG I 6 .   ? -11.494 -37.342 -46.340 1.00 91.36  ? 604  NAG B N2  1 
HETATM 8473 O O3  . NAG I 6 .   ? -10.625 -34.247 -48.165 1.00 99.05  ? 604  NAG B O3  1 
HETATM 8474 O O4  . NAG I 6 .   ? -11.899 -37.438 -49.337 1.00 86.40  ? 604  NAG B O4  1 
HETATM 8475 O O5  . NAG I 6 .   ? -8.742  -36.367 -48.036 1.00 93.45  ? 604  NAG B O5  1 
HETATM 8476 O O6  . NAG I 6 .   ? -9.052  -36.284 -51.210 1.00 88.81  ? 604  NAG B O6  1 
HETATM 8477 O O7  . NAG I 6 .   ? -12.459 -36.601 -44.441 1.00 82.51  ? 604  NAG B O7  1 
HETATM 8478 C C1  A DEP J 3 .   ? 3.897   -58.467 -21.049 0.80 46.31  ? 605  DEP B C1  1 
HETATM 8479 C C2  A DEP J 3 .   ? 3.302   -59.372 -19.997 0.80 46.65  ? 605  DEP B C2  1 
HETATM 8480 C C3  A DEP J 3 .   ? 6.961   -60.390 -23.112 0.80 47.38  ? 605  DEP B C3  1 
HETATM 8481 C C4  A DEP J 3 .   ? 7.360   -59.153 -23.933 0.80 50.47  ? 605  DEP B C4  1 
HETATM 8482 O O1  A DEP J 3 .   ? 3.602   -59.004 -22.287 0.80 44.28  ? 605  DEP B O1  1 
HETATM 8483 O O2  A DEP J 3 .   ? 5.820   -60.029 -22.373 0.80 43.11  ? 605  DEP B O2  1 
HETATM 8484 O O3  A DEP J 3 .   ? 4.088   -60.527 -24.265 0.80 41.35  ? 605  DEP B O3  1 
HETATM 8485 P P   A DEP J 3 .   ? 4.319   -60.338 -22.812 0.80 43.53  ? 605  DEP B P   1 
HETATM 8486 O O1  . PE8 K 7 .   ? -19.055 -45.440 -32.941 0.72 66.01  ? 606  PE8 B O1  1 
HETATM 8487 C C2  . PE8 K 7 .   ? -19.476 -44.495 -31.937 0.72 70.66  ? 606  PE8 B C2  1 
HETATM 8488 C C3  . PE8 K 7 .   ? -18.480 -43.336 -31.875 0.72 67.18  ? 606  PE8 B C3  1 
HETATM 8489 O O4  . PE8 K 7 .   ? -17.177 -43.837 -31.534 0.72 66.94  ? 606  PE8 B O4  1 
HETATM 8490 C C5  . PE8 K 7 .   ? -16.139 -43.250 -32.323 0.72 63.35  ? 606  PE8 B C5  1 
HETATM 8491 C C6  . PE8 K 7 .   ? -14.848 -44.065 -32.176 0.72 61.92  ? 606  PE8 B C6  1 
HETATM 8492 O O7  . PE8 K 7 .   ? -14.562 -44.743 -33.442 0.72 57.21  ? 606  PE8 B O7  1 
HETATM 8493 C C8  . PE8 K 7 .   ? -14.073 -46.066 -33.275 0.72 55.54  ? 606  PE8 B C8  1 
HETATM 8494 C C9  . PE8 K 7 .   ? -14.511 -46.944 -34.506 0.72 57.98  ? 606  PE8 B C9  1 
HETATM 8495 O O10 . PE8 K 7 .   ? -15.784 -47.498 -34.241 0.72 64.47  ? 606  PE8 B O10 1 
HETATM 8496 C C11 . PE8 K 7 .   ? -16.103 -48.659 -35.040 0.72 62.30  ? 606  PE8 B C11 1 
HETATM 8497 C C12 . PE8 K 7 .   ? -17.590 -49.014 -34.904 0.72 63.82  ? 606  PE8 B C12 1 
HETATM 8498 O O13 . PE8 K 7 .   ? -18.093 -48.642 -33.613 0.72 63.37  ? 606  PE8 B O13 1 
HETATM 8499 C C14 . PE8 K 7 .   ? -19.016 -49.560 -33.047 0.72 61.88  ? 606  PE8 B C14 1 
HETATM 8500 C C15 . PE8 K 7 .   ? -20.017 -48.832 -32.109 0.72 67.88  ? 606  PE8 B C15 1 
HETATM 8501 O O16 . PE8 K 7 .   ? -19.354 -48.171 -31.039 0.72 60.03  ? 606  PE8 B O16 1 
HETATM 8502 C C17 . PE8 K 7 .   ? -19.997 -48.314 -29.752 0.72 57.37  ? 606  PE8 B C17 1 
HETATM 8503 C C18 . PE8 K 7 .   ? -19.191 -47.519 -28.643 0.72 61.00  ? 606  PE8 B C18 1 
HETATM 8504 O O19 . PE8 K 7 .   ? -18.634 -46.301 -29.192 0.72 64.62  ? 606  PE8 B O19 1 
HETATM 8505 C C20 . PE8 K 7 .   ? -17.437 -45.756 -28.512 0.72 59.61  ? 606  PE8 B C20 1 
HETATM 8506 C C21 . PE8 K 7 .   ? -17.320 -46.317 -27.063 0.72 61.43  ? 606  PE8 B C21 1 
HETATM 8507 O O22 . PE8 K 7 .   ? -15.928 -46.423 -26.704 0.72 57.33  ? 606  PE8 B O22 1 
HETATM 8508 C C23 . PE8 K 7 .   ? -15.670 -46.279 -25.318 0.72 60.16  ? 606  PE8 B C23 1 
HETATM 8509 C C24 . PE8 K 7 .   ? -15.949 -47.645 -24.659 0.72 57.98  ? 606  PE8 B C24 1 
HETATM 8510 O O25 . PE8 K 7 .   ? -17.126 -47.510 -23.896 0.72 56.35  ? 606  PE8 B O25 1 
HETATM 8511 C C1  . EDO L 4 .   ? 12.565  -54.298 2.168   0.89 44.83  ? 607  EDO B C1  1 
HETATM 8512 O O1  . EDO L 4 .   ? 12.225  -53.063 2.797   0.89 39.57  ? 607  EDO B O1  1 
HETATM 8513 C C2  . EDO L 4 .   ? 11.812  -54.434 0.843   0.89 42.55  ? 607  EDO B C2  1 
HETATM 8514 O O2  . EDO L 4 .   ? 10.473  -54.870 1.121   0.89 42.12  ? 607  EDO B O2  1 
HETATM 8515 C C1  . EDO M 4 .   ? -7.640  -61.649 -3.095  0.93 46.20  ? 608  EDO B C1  1 
HETATM 8516 O O1  . EDO M 4 .   ? -9.040  -61.954 -3.090  0.93 47.63  ? 608  EDO B O1  1 
HETATM 8517 C C2  . EDO M 4 .   ? -7.451  -60.144 -2.909  0.93 43.77  ? 608  EDO B C2  1 
HETATM 8518 O O2  . EDO M 4 .   ? -8.240  -59.393 -3.857  0.93 48.61  ? 608  EDO B O2  1 
HETATM 8519 N N   . NO3 N 8 .   ? -9.696  -40.243 -30.917 0.75 52.70  ? 609  NO3 B N   1 
HETATM 8520 O O1  . NO3 N 8 .   ? -10.802 -40.757 -30.556 0.75 54.40  ? 609  NO3 B O1  1 
HETATM 8521 O O2  . NO3 N 8 .   ? -9.018  -39.578 -30.077 0.75 45.70  ? 609  NO3 B O2  1 
HETATM 8522 O O3  . NO3 N 8 .   ? -9.284  -40.386 -32.115 0.75 51.12  ? 609  NO3 B O3  1 
HETATM 8523 O O3  . HI6 O 5 .   ? 12.476  -49.001 -30.820 0.82 68.31  ? 610  HI6 B O3  1 
HETATM 8524 C C14 . HI6 O 5 .   ? 11.751  -49.987 -30.747 0.82 59.74  ? 610  HI6 B C14 1 
HETATM 8525 N N4  . HI6 O 5 .   ? 10.947  -50.375 -31.811 0.82 55.77  ? 610  HI6 B N4  1 
HETATM 8526 C C11 . HI6 O 5 .   ? 11.705  -50.830 -29.445 0.82 55.92  ? 610  HI6 B C11 1 
HETATM 8527 C C10 . HI6 O 5 .   ? 10.738  -51.836 -29.266 0.82 53.02  ? 610  HI6 B C10 1 
HETATM 8528 C C9  . HI6 O 5 .   ? 10.655  -52.609 -28.114 0.82 50.91  ? 610  HI6 B C9  1 
HETATM 8529 N N3  . HI6 O 5 .   ? 11.529  -52.430 -27.069 0.82 60.81  ? 610  HI6 B N3  1 
HETATM 8530 C C13 . HI6 O 5 .   ? 12.495  -51.455 -27.216 0.82 56.98  ? 610  HI6 B C13 1 
HETATM 8531 C C12 . HI6 O 5 .   ? 12.585  -50.674 -28.377 0.82 55.15  ? 610  HI6 B C12 1 
HETATM 8532 C C8  . HI6 O 5 .   ? 11.436  -53.285 -25.808 0.82 52.69  ? 610  HI6 B C8  1 
HETATM 8533 O O2  . HI6 O 5 .   ? 12.760  -53.543 -25.336 0.82 61.50  ? 610  HI6 B O2  1 
HETATM 8534 C C7  . HI6 O 5 .   ? 13.169  -54.930 -25.235 0.82 57.49  ? 610  HI6 B C7  1 
HETATM 8535 N N2  . HI6 O 5 .   ? 12.350  -55.749 -24.154 0.82 58.80  ? 610  HI6 B N2  1 
HETATM 8536 C C2  . HI6 O 5 .   ? 12.104  -57.145 -24.324 0.82 53.91  ? 610  HI6 B C2  1 
HETATM 8537 C C1  . HI6 O 5 .   ? 12.559  -57.832 -25.463 0.82 53.93  ? 610  HI6 B C1  1 
HETATM 8538 N N1  . HI6 O 5 .   ? 12.303  -57.431 -26.837 0.82 58.24  ? 610  HI6 B N1  1 
HETATM 8539 O O1  . HI6 O 5 .   ? 12.315  -58.070 -27.822 0.82 60.11  ? 610  HI6 B O1  1 
HETATM 8540 C C3  . HI6 O 5 .   ? 11.338  -57.827 -23.310 0.82 51.86  ? 610  HI6 B C3  1 
HETATM 8541 C C4  . HI6 O 5 .   ? 10.859  -57.198 -22.187 0.82 54.45  ? 610  HI6 B C4  1 
HETATM 8542 C C5  . HI6 O 5 .   ? 11.117  -55.799 -22.021 0.82 57.14  ? 610  HI6 B C5  1 
HETATM 8543 C C6  . HI6 O 5 .   ? 11.837  -55.120 -22.981 0.82 51.79  ? 610  HI6 B C6  1 
HETATM 8544 O O   . HOH P 9 .   ? -1.781  -23.887 22.612  0.86 49.01  ? 701  HOH A O   1 
HETATM 8545 O O   . HOH P 9 .   ? 4.738   -53.316 4.469   1.00 51.37  ? 702  HOH A O   1 
HETATM 8546 O O   . HOH P 9 .   ? -10.928 -38.660 51.329  0.67 44.64  ? 703  HOH A O   1 
HETATM 8547 O O   . HOH P 9 .   ? -23.033 -40.847 34.564  0.84 45.50  ? 704  HOH A O   1 
HETATM 8548 O O   . HOH P 9 .   ? -20.982 -44.544 30.576  0.99 55.85  ? 705  HOH A O   1 
HETATM 8549 O O   . HOH P 9 .   ? -21.788 -12.236 18.725  1.00 75.02  ? 706  HOH A O   1 
HETATM 8550 O O   . HOH P 9 .   ? -13.415 -66.148 20.939  1.00 54.50  ? 707  HOH A O   1 
HETATM 8551 O O   . HOH P 9 .   ? -4.615  -66.280 9.899   1.00 59.85  ? 708  HOH A O   1 
HETATM 8552 O O   . HOH P 9 .   ? -12.098 -42.249 33.388  1.00 41.59  ? 709  HOH A O   1 
HETATM 8553 O O   . HOH P 9 .   ? -14.899 -10.501 30.200  1.00 66.68  ? 710  HOH A O   1 
HETATM 8554 O O   . HOH P 9 .   ? -19.686 -45.383 40.459  1.00 51.86  ? 711  HOH A O   1 
HETATM 8555 O O   . HOH P 9 .   ? 17.298  -39.005 54.170  1.00 61.86  ? 712  HOH A O   1 
HETATM 8556 O O   . HOH P 9 .   ? 0.407   -41.806 14.639  1.00 41.69  ? 713  HOH A O   1 
HETATM 8557 O O   . HOH P 9 .   ? 9.471   -61.214 29.080  0.93 49.97  ? 714  HOH A O   1 
HETATM 8558 O O   . HOH P 9 .   ? 7.354   -62.960 39.112  0.72 45.90  ? 715  HOH A O   1 
HETATM 8559 O O   . HOH P 9 .   ? -8.933  -38.663 1.437   1.00 67.60  ? 716  HOH A O   1 
HETATM 8560 O O   . HOH P 9 .   ? -20.913 -52.023 7.650   1.00 59.07  ? 717  HOH A O   1 
HETATM 8561 O O   . HOH P 9 .   ? 5.737   -62.366 26.428  0.92 59.22  ? 718  HOH A O   1 
HETATM 8562 O O   . HOH P 9 .   ? -4.717  -20.271 25.531  1.00 60.35  ? 719  HOH A O   1 
HETATM 8563 O O   . HOH P 9 .   ? 13.617  -41.945 55.957  1.00 48.43  ? 720  HOH A O   1 
HETATM 8564 O O   . HOH P 9 .   ? -6.335  -61.079 10.487  0.91 44.14  ? 721  HOH A O   1 
HETATM 8565 O O   . HOH P 9 .   ? -7.712  -41.715 35.963  0.94 35.51  ? 722  HOH A O   1 
HETATM 8566 O O   . HOH P 9 .   ? -13.064 -45.505 41.766  0.92 36.28  ? 723  HOH A O   1 
HETATM 8567 O O   . HOH P 9 .   ? 22.781  -51.649 29.973  1.00 54.47  ? 724  HOH A O   1 
HETATM 8568 O O   . HOH P 9 .   ? 19.830  -47.908 36.333  0.94 51.35  ? 725  HOH A O   1 
HETATM 8569 O O   . HOH P 9 .   ? -13.242 -13.372 22.612  1.00 61.73  ? 726  HOH A O   1 
HETATM 8570 O O   . HOH P 9 .   ? 20.355  -36.922 25.475  1.00 53.86  ? 727  HOH A O   1 
HETATM 8571 O O   . HOH P 9 .   ? -10.277 -62.184 -0.491  0.96 45.46  ? 728  HOH A O   1 
HETATM 8572 O O   . HOH P 9 .   ? -8.007  -44.469 47.089  0.92 40.84  ? 729  HOH A O   1 
HETATM 8573 O O   . HOH P 9 .   ? -4.364  -42.816 34.386  0.79 29.02  ? 730  HOH A O   1 
HETATM 8574 O O   . HOH P 9 .   ? -28.864 -31.459 32.925  0.95 51.47  ? 731  HOH A O   1 
HETATM 8575 O O   . HOH P 9 .   ? -18.336 -44.120 22.766  1.00 71.08  ? 732  HOH A O   1 
HETATM 8576 O O   . HOH P 9 .   ? -7.020  -29.241 61.048  0.91 62.91  ? 733  HOH A O   1 
HETATM 8577 O O   . HOH P 9 .   ? -23.719 -57.732 11.005  1.00 60.91  ? 734  HOH A O   1 
HETATM 8578 O O   . HOH P 9 .   ? -16.375 -35.173 32.138  1.00 35.63  ? 735  HOH A O   1 
HETATM 8579 O O   . HOH P 9 .   ? -30.543 -28.968 25.272  0.96 47.73  ? 736  HOH A O   1 
HETATM 8580 O O   . HOH P 9 .   ? -2.435  -40.302 42.987  1.00 35.22  ? 737  HOH A O   1 
HETATM 8581 O O   . HOH P 9 .   ? 15.924  -56.837 34.179  0.85 55.15  ? 738  HOH A O   1 
HETATM 8582 O O   . HOH P 9 .   ? -7.489  -25.603 46.014  1.00 34.54  ? 739  HOH A O   1 
HETATM 8583 O O   . HOH P 9 .   ? 11.624  -23.265 47.863  1.00 63.37  ? 740  HOH A O   1 
HETATM 8584 O O   . HOH P 9 .   ? -20.039 -26.071 41.316  0.87 40.26  ? 741  HOH A O   1 
HETATM 8585 O O   . HOH P 9 .   ? -27.495 -32.999 24.821  1.00 68.38  ? 742  HOH A O   1 
HETATM 8586 O O   . HOH P 9 .   ? 12.917  -52.249 47.127  0.83 39.76  ? 743  HOH A O   1 
HETATM 8587 O O   . HOH P 9 .   ? 10.701  -52.546 44.055  1.00 38.98  ? 744  HOH A O   1 
HETATM 8588 O O   . HOH P 9 .   ? 4.042   -20.065 22.660  0.92 51.36  ? 745  HOH A O   1 
HETATM 8589 O O   . HOH P 9 .   ? 18.904  -41.570 20.781  1.00 46.56  ? 746  HOH A O   1 
HETATM 8590 O O   . HOH P 9 .   ? 2.385   -47.313 45.182  0.85 34.36  ? 747  HOH A O   1 
HETATM 8591 O O   . HOH P 9 .   ? 0.454   -18.920 56.275  1.00 42.80  ? 748  HOH A O   1 
HETATM 8592 O O   . HOH P 9 .   ? -14.421 -14.252 35.031  1.00 67.47  ? 749  HOH A O   1 
HETATM 8593 O O   . HOH P 9 .   ? 2.039   -20.648 32.601  1.00 50.85  ? 750  HOH A O   1 
HETATM 8594 O O   . HOH P 9 .   ? 1.764   -48.608 29.275  1.00 37.54  ? 751  HOH A O   1 
HETATM 8595 O O   . HOH P 9 .   ? -10.688 -68.028 13.827  1.00 62.87  ? 752  HOH A O   1 
HETATM 8596 O O   . HOH P 9 .   ? -0.698  -16.480 28.043  1.00 67.69  ? 753  HOH A O   1 
HETATM 8597 O O   . HOH P 9 .   ? -25.212 -12.913 23.277  1.00 69.13  ? 754  HOH A O   1 
HETATM 8598 O O   . HOH P 9 .   ? -2.420  -48.367 29.623  1.00 41.71  ? 755  HOH A O   1 
HETATM 8599 O O   . HOH P 9 .   ? -10.495 -37.007 15.225  1.00 65.15  ? 756  HOH A O   1 
HETATM 8600 O O   . HOH P 9 .   ? -5.581  -64.144 41.690  1.00 51.71  ? 757  HOH A O   1 
HETATM 8601 O O   . HOH P 9 .   ? -11.055 -27.992 23.851  1.00 37.65  ? 758  HOH A O   1 
HETATM 8602 O O   . HOH P 9 .   ? -9.725  -26.016 44.851  0.95 34.19  ? 759  HOH A O   1 
HETATM 8603 O O   . HOH P 9 .   ? 12.852  -37.317 59.252  1.00 59.68  ? 760  HOH A O   1 
HETATM 8604 O O   . HOH P 9 .   ? 8.930   -45.442 54.601  1.00 40.95  ? 761  HOH A O   1 
HETATM 8605 O O   . HOH P 9 .   ? -18.615 -22.591 39.298  0.91 44.88  ? 762  HOH A O   1 
HETATM 8606 O O   . HOH P 9 .   ? -2.835  -56.908 33.209  0.80 45.25  ? 763  HOH A O   1 
HETATM 8607 O O   . HOH P 9 .   ? -17.757 -13.503 30.565  1.00 65.66  ? 764  HOH A O   1 
HETATM 8608 O O   . HOH P 9 .   ? -6.764  -56.748 37.811  0.97 50.13  ? 765  HOH A O   1 
HETATM 8609 O O   . HOH P 9 .   ? -16.216 -59.279 32.364  0.88 46.62  ? 766  HOH A O   1 
HETATM 8610 O O   . HOH P 9 .   ? -3.308  -60.760 24.608  1.00 52.23  ? 767  HOH A O   1 
HETATM 8611 O O   . HOH P 9 .   ? 17.546  -43.705 22.176  0.95 42.41  ? 768  HOH A O   1 
HETATM 8612 O O   . HOH P 9 .   ? 6.377   -21.474 34.547  1.00 52.17  ? 769  HOH A O   1 
HETATM 8613 O O   . HOH P 9 .   ? -13.749 -67.282 14.463  0.84 54.79  ? 770  HOH A O   1 
HETATM 8614 O O   . HOH P 9 .   ? -15.361 -40.646 35.850  0.99 41.55  ? 771  HOH A O   1 
HETATM 8615 O O   . HOH P 9 .   ? -2.643  -43.508 49.975  1.00 45.99  ? 772  HOH A O   1 
HETATM 8616 O O   . HOH P 9 .   ? -1.564  -54.594 10.005  1.00 55.02  ? 773  HOH A O   1 
HETATM 8617 O O   . HOH P 9 .   ? -6.942  -60.698 12.986  0.98 43.97  ? 774  HOH A O   1 
HETATM 8618 O O   . HOH P 9 .   ? -9.752  -36.757 44.249  0.86 42.82  ? 775  HOH A O   1 
HETATM 8619 O O   . HOH P 9 .   ? -11.692 -45.923 46.857  0.99 59.13  ? 776  HOH A O   1 
HETATM 8620 O O   . HOH P 9 .   ? 12.562  -45.566 56.841  1.00 44.53  ? 777  HOH A O   1 
HETATM 8621 O O   . HOH P 9 .   ? -7.309  -33.338 53.372  0.71 41.74  ? 778  HOH A O   1 
HETATM 8622 O O   . HOH P 9 .   ? -6.012  -19.001 51.722  0.85 54.31  ? 779  HOH A O   1 
HETATM 8623 O O   . HOH P 9 .   ? -12.720 -40.394 0.197   0.98 62.09  ? 780  HOH A O   1 
HETATM 8624 O O   . HOH P 9 .   ? -2.594  -34.387 19.018  0.85 33.97  ? 781  HOH A O   1 
HETATM 8625 O O   . HOH P 9 .   ? 8.887   -49.280 15.779  1.00 41.71  ? 782  HOH A O   1 
HETATM 8626 O O   . HOH P 9 .   ? 4.882   -35.807 11.349  1.00 60.47  ? 783  HOH A O   1 
HETATM 8627 O O   . HOH P 9 .   ? -21.886 -27.126 15.258  0.99 61.89  ? 784  HOH A O   1 
HETATM 8628 O O   . HOH P 9 .   ? -19.721 -48.976 34.051  0.86 51.90  ? 785  HOH A O   1 
HETATM 8629 O O   . HOH P 9 .   ? -12.042 -34.538 27.107  1.00 38.35  ? 786  HOH A O   1 
HETATM 8630 O O   . HOH P 9 .   ? -31.163 -24.909 23.697  0.84 50.92  ? 787  HOH A O   1 
HETATM 8631 O O   . HOH P 9 .   ? -3.681  -55.947 20.029  0.98 52.33  ? 788  HOH A O   1 
HETATM 8632 O O   . HOH P 9 .   ? 8.158   -28.272 57.893  0.97 52.21  ? 789  HOH A O   1 
HETATM 8633 O O   . HOH P 9 .   ? 17.538  -43.386 16.613  1.00 47.27  ? 790  HOH A O   1 
HETATM 8634 O O   . HOH P 9 .   ? -21.633 -37.088 18.835  1.00 67.50  ? 791  HOH A O   1 
HETATM 8635 O O   . HOH P 9 .   ? -12.996 -24.103 35.277  1.00 36.34  ? 792  HOH A O   1 
HETATM 8636 O O   . HOH P 9 .   ? -7.751  -30.293 52.462  0.99 46.61  ? 793  HOH A O   1 
HETATM 8637 O O   . HOH P 9 .   ? 10.352  -45.252 15.535  0.91 51.27  ? 794  HOH A O   1 
HETATM 8638 O O   . HOH P 9 .   ? -14.364 -25.032 37.518  0.92 34.02  ? 795  HOH A O   1 
HETATM 8639 O O   . HOH P 9 .   ? -0.536  -21.792 58.665  1.00 48.74  ? 796  HOH A O   1 
HETATM 8640 O O   . HOH P 9 .   ? -4.106  -51.083 36.558  1.00 34.97  ? 797  HOH A O   1 
HETATM 8641 O O   . HOH P 9 .   ? -6.278  -61.722 49.812  1.00 57.28  ? 798  HOH A O   1 
HETATM 8642 O O   . HOH P 9 .   ? -8.495  -40.553 51.977  0.92 44.91  ? 799  HOH A O   1 
HETATM 8643 O O   . HOH P 9 .   ? -14.354 -54.931 2.181   1.00 47.75  ? 800  HOH A O   1 
HETATM 8644 O O   . HOH P 9 .   ? -13.859 -25.773 23.497  1.00 38.55  ? 801  HOH A O   1 
HETATM 8645 O O   . HOH P 9 .   ? -15.757 -48.758 6.598   1.00 53.95  ? 802  HOH A O   1 
HETATM 8646 O O   . HOH P 9 .   ? -10.086 -35.174 39.559  1.00 35.31  ? 803  HOH A O   1 
HETATM 8647 O O   . HOH P 9 .   ? -8.832  -48.654 31.242  1.00 44.88  ? 804  HOH A O   1 
HETATM 8648 O O   . HOH P 9 .   ? 2.103   -23.457 50.044  1.00 44.42  ? 805  HOH A O   1 
HETATM 8649 O O   . HOH P 9 .   ? 4.305   -22.622 46.429  0.81 51.64  ? 806  HOH A O   1 
HETATM 8650 O O   . HOH P 9 .   ? 20.068  -49.304 21.514  0.94 47.47  ? 807  HOH A O   1 
HETATM 8651 O O   . HOH P 9 .   ? -2.356  -59.136 46.507  0.91 45.72  ? 808  HOH A O   1 
HETATM 8652 O O   . HOH P 9 .   ? 6.489   -51.416 49.143  0.81 42.38  ? 809  HOH A O   1 
HETATM 8653 O O   . HOH P 9 .   ? -14.712 -33.458 27.158  1.00 54.25  ? 810  HOH A O   1 
HETATM 8654 O O   . HOH P 9 .   ? -8.555  -23.761 13.473  1.00 54.94  ? 811  HOH A O   1 
HETATM 8655 O O   . HOH P 9 .   ? -17.584 -53.345 15.244  0.97 50.70  ? 812  HOH A O   1 
HETATM 8656 O O   . HOH P 9 .   ? -0.509  -46.228 60.745  0.97 56.95  ? 813  HOH A O   1 
HETATM 8657 O O   . HOH P 9 .   ? -10.311 -42.593 35.865  0.84 34.13  ? 814  HOH A O   1 
HETATM 8658 O O   . HOH P 9 .   ? -6.462  -63.676 25.723  1.00 55.76  ? 815  HOH A O   1 
HETATM 8659 O O   . HOH P 9 .   ? 13.923  -49.898 24.444  1.00 34.86  ? 816  HOH A O   1 
HETATM 8660 O O   . HOH P 9 .   ? -13.909 -17.831 42.844  1.00 51.26  ? 817  HOH A O   1 
HETATM 8661 O O   . HOH P 9 .   ? 2.846   -63.359 32.303  1.00 53.62  ? 818  HOH A O   1 
HETATM 8662 O O   . HOH P 9 .   ? -2.659  -47.336 56.832  1.00 51.96  ? 819  HOH A O   1 
HETATM 8663 O O   . HOH P 9 .   ? 8.190   -29.201 12.372  1.00 56.10  ? 820  HOH A O   1 
HETATM 8664 O O   . HOH P 9 .   ? -21.326 -36.612 36.669  0.87 40.29  ? 821  HOH A O   1 
HETATM 8665 O O   . HOH P 9 .   ? 13.122  -38.178 39.761  0.96 35.39  ? 822  HOH A O   1 
HETATM 8666 O O   . HOH P 9 .   ? 21.251  -47.998 29.036  1.00 46.12  ? 823  HOH A O   1 
HETATM 8667 O O   . HOH P 9 .   ? -5.092  -48.472 47.566  1.00 50.04  ? 824  HOH A O   1 
HETATM 8668 O O   . HOH P 9 .   ? 8.470   -29.761 39.763  0.93 35.60  ? 825  HOH A O   1 
HETATM 8669 O O   . HOH P 9 .   ? -17.464 -31.198 30.777  1.00 48.05  ? 826  HOH A O   1 
HETATM 8670 O O   . HOH P 9 .   ? -2.560  -37.117 39.139  1.00 34.05  ? 827  HOH A O   1 
HETATM 8671 O O   . HOH P 9 .   ? -7.900  -20.413 40.643  1.00 44.89  ? 828  HOH A O   1 
HETATM 8672 O O   . HOH P 9 .   ? -10.506 -21.948 29.269  1.00 46.44  ? 829  HOH A O   1 
HETATM 8673 O O   . HOH P 9 .   ? -7.614  -52.046 25.682  0.92 36.47  ? 830  HOH A O   1 
HETATM 8674 O O   . HOH P 9 .   ? -0.316  -62.883 30.815  1.00 46.07  ? 831  HOH A O   1 
HETATM 8675 O O   . HOH P 9 .   ? 6.533   -23.599 60.982  0.98 54.55  ? 832  HOH A O   1 
HETATM 8676 O O   . HOH P 9 .   ? -12.366 -40.354 38.426  0.98 33.92  ? 833  HOH A O   1 
HETATM 8677 O O   . HOH P 9 .   ? -10.785 -35.939 21.238  0.95 41.69  ? 834  HOH A O   1 
HETATM 8678 O O   . HOH P 9 .   ? 15.831  -49.140 45.629  0.99 46.19  ? 835  HOH A O   1 
HETATM 8679 O O   . HOH P 9 .   ? -2.478  -61.792 47.458  0.99 52.17  ? 836  HOH A O   1 
HETATM 8680 O O   . HOH P 9 .   ? -4.442  -42.781 45.186  0.92 34.37  ? 837  HOH A O   1 
HETATM 8681 O O   . HOH P 9 .   ? -10.568 -26.691 51.241  1.00 51.82  ? 838  HOH A O   1 
HETATM 8682 O O   . HOH P 9 .   ? -20.528 -36.278 43.877  1.00 47.58  ? 839  HOH A O   1 
HETATM 8683 O O   . HOH P 9 .   ? 7.682   -23.603 21.454  0.97 55.22  ? 840  HOH A O   1 
HETATM 8684 O O   . HOH P 9 .   ? -9.017  -47.705 41.462  1.00 38.47  ? 841  HOH A O   1 
HETATM 8685 O O   . HOH P 9 .   ? 11.610  -48.116 9.327   1.00 42.25  ? 842  HOH A O   1 
HETATM 8686 O O   . HOH P 9 .   ? -15.625 -22.447 14.641  1.00 55.64  ? 843  HOH A O   1 
HETATM 8687 O O   . HOH P 9 .   ? 12.767  -49.830 51.340  1.00 44.74  ? 844  HOH A O   1 
HETATM 8688 O O   . HOH P 9 .   ? 3.051   -67.575 41.943  1.00 60.39  ? 845  HOH A O   1 
HETATM 8689 O O   . HOH P 9 .   ? -18.781 -14.186 33.729  1.00 54.33  ? 846  HOH A O   1 
HETATM 8690 O O   . HOH P 9 .   ? -13.478 -64.629 29.491  1.00 53.20  ? 847  HOH A O   1 
HETATM 8691 O O   . HOH P 9 .   ? -7.842  -37.256 32.047  1.00 31.68  ? 848  HOH A O   1 
HETATM 8692 O O   . HOH P 9 .   ? -6.520  -34.838 47.412  1.00 38.03  ? 849  HOH A O   1 
HETATM 8693 O O   . HOH P 9 .   ? -23.063 -14.096 21.993  1.00 74.00  ? 850  HOH A O   1 
HETATM 8694 O O   . HOH P 9 .   ? -0.950  -35.659 15.265  1.00 56.33  ? 851  HOH A O   1 
HETATM 8695 O O   . HOH P 9 .   ? 11.521  -45.653 13.167  0.97 52.97  ? 852  HOH A O   1 
HETATM 8696 O O   . HOH P 9 .   ? -13.435 -30.772 35.872  0.92 34.75  ? 853  HOH A O   1 
HETATM 8697 O O   . HOH P 9 .   ? 11.806  -33.748 55.602  1.00 51.67  ? 854  HOH A O   1 
HETATM 8698 O O   . HOH P 9 .   ? -8.408  -26.533 25.886  0.99 42.48  ? 855  HOH A O   1 
HETATM 8699 O O   . HOH P 9 .   ? 11.468  -27.491 47.254  1.00 44.39  ? 856  HOH A O   1 
HETATM 8700 O O   . HOH P 9 .   ? 16.947  -49.988 19.446  1.00 47.49  ? 857  HOH A O   1 
HETATM 8701 O O   . HOH P 9 .   ? -11.238 -34.617 19.158  0.99 46.79  ? 858  HOH A O   1 
HETATM 8702 O O   . HOH P 9 .   ? 13.595  -25.210 44.348  1.00 60.10  ? 859  HOH A O   1 
HETATM 8703 O O   . HOH P 9 .   ? 9.920   -27.441 25.038  0.99 44.33  ? 860  HOH A O   1 
HETATM 8704 O O   . HOH P 9 .   ? -13.462 -65.514 5.572   1.00 52.35  ? 861  HOH A O   1 
HETATM 8705 O O   . HOH P 9 .   ? 5.320   -20.747 55.574  0.90 49.94  ? 862  HOH A O   1 
HETATM 8706 O O   . HOH P 9 .   ? -20.405 -51.361 21.552  1.00 52.28  ? 863  HOH A O   1 
HETATM 8707 O O   . HOH P 9 .   ? -22.459 -26.690 40.212  1.00 42.42  ? 864  HOH A O   1 
HETATM 8708 O O   . HOH P 9 .   ? 9.530   -58.934 31.719  1.00 45.60  ? 865  HOH A O   1 
HETATM 8709 O O   . HOH P 9 .   ? 16.395  -60.822 24.376  1.00 51.69  ? 866  HOH A O   1 
HETATM 8710 O O   . HOH P 9 .   ? -10.190 -55.641 37.136  1.00 50.96  ? 867  HOH A O   1 
HETATM 8711 O O   . HOH P 9 .   ? -2.702  -37.412 61.624  1.00 58.63  ? 868  HOH A O   1 
HETATM 8712 O O   . HOH P 9 .   ? 21.841  -57.571 38.981  1.00 70.08  ? 869  HOH A O   1 
HETATM 8713 O O   . HOH P 9 .   ? -5.364  -53.597 20.365  1.00 41.38  ? 870  HOH A O   1 
HETATM 8714 O O   . HOH P 9 .   ? 0.062   -24.493 48.942  0.81 40.96  ? 871  HOH A O   1 
HETATM 8715 O O   . HOH P 9 .   ? 7.445   -56.594 16.877  1.00 52.38  ? 872  HOH A O   1 
HETATM 8716 O O   . HOH P 9 .   ? 11.639  -59.162 44.707  1.00 56.22  ? 873  HOH A O   1 
HETATM 8717 O O   . HOH P 9 .   ? -7.092  -61.359 22.228  1.00 64.23  ? 874  HOH A O   1 
HETATM 8718 O O   . HOH P 9 .   ? 8.457   -24.895 51.121  1.00 41.36  ? 875  HOH A O   1 
HETATM 8719 O O   . HOH P 9 .   ? -9.975  -26.782 14.022  0.93 50.83  ? 876  HOH A O   1 
HETATM 8720 O O   . HOH P 9 .   ? -3.935  -68.463 6.385   1.00 61.33  ? 877  HOH A O   1 
HETATM 8721 O O   . HOH P 9 .   ? 12.591  -64.296 28.611  1.00 54.34  ? 878  HOH A O   1 
HETATM 8722 O O   . HOH P 9 .   ? -11.876 -18.741 44.612  0.94 60.64  ? 879  HOH A O   1 
HETATM 8723 O O   . HOH P 9 .   ? -19.200 -20.693 37.248  0.98 43.13  ? 880  HOH A O   1 
HETATM 8724 O O   . HOH P 9 .   ? -4.312  -15.776 44.456  1.00 57.72  ? 881  HOH A O   1 
HETATM 8725 O O   . HOH P 9 .   ? 0.462   -22.450 44.709  1.00 46.65  ? 882  HOH A O   1 
HETATM 8726 O O   . HOH P 9 .   ? 11.530  -58.668 42.035  0.88 50.37  ? 883  HOH A O   1 
HETATM 8727 O O   . HOH P 9 .   ? 2.241   -67.123 38.205  1.00 64.28  ? 884  HOH A O   1 
HETATM 8728 O O   . HOH P 9 .   ? 10.342  -23.430 33.396  0.97 51.18  ? 885  HOH A O   1 
HETATM 8729 O O   . HOH P 9 .   ? -13.561 -29.664 48.086  1.00 36.36  ? 886  HOH A O   1 
HETATM 8730 O O   . HOH P 9 .   ? -2.261  -42.503 14.091  0.89 37.45  ? 887  HOH A O   1 
HETATM 8731 O O   . HOH P 9 .   ? -1.512  -53.113 21.171  1.00 46.28  ? 888  HOH A O   1 
HETATM 8732 O O   . HOH P 9 .   ? -14.536 -42.106 9.459   1.00 61.26  ? 889  HOH A O   1 
HETATM 8733 O O   . HOH P 9 .   ? 17.863  -35.869 13.434  1.00 61.54  ? 890  HOH A O   1 
HETATM 8734 O O   . HOH P 9 .   ? 8.989   -27.038 22.307  1.00 44.69  ? 891  HOH A O   1 
HETATM 8735 O O   . HOH P 9 .   ? -9.358  -20.143 38.070  0.79 42.72  ? 892  HOH A O   1 
HETATM 8736 O O   . HOH P 9 .   ? -7.541  -10.950 25.062  1.00 66.46  ? 893  HOH A O   1 
HETATM 8737 O O   . HOH P 9 .   ? 5.525   -62.843 46.605  1.00 52.18  ? 894  HOH A O   1 
HETATM 8738 O O   . HOH P 9 .   ? -20.245 -62.949 19.642  1.00 57.73  ? 895  HOH A O   1 
HETATM 8739 O O   . HOH P 9 .   ? -16.304 -32.483 33.085  0.89 38.79  ? 896  HOH A O   1 
HETATM 8740 O O   . HOH P 9 .   ? -16.215 -41.041 21.720  1.00 63.97  ? 897  HOH A O   1 
HETATM 8741 O O   . HOH P 9 .   ? 19.139  -46.347 40.713  1.00 44.97  ? 898  HOH A O   1 
HETATM 8742 O O   . HOH P 9 .   ? 6.522   -45.571 13.345  1.00 49.91  ? 899  HOH A O   1 
HETATM 8743 O O   . HOH P 9 .   ? 10.149  -29.489 56.731  0.91 49.18  ? 900  HOH A O   1 
HETATM 8744 O O   . HOH P 9 .   ? -6.493  -18.477 56.750  1.00 54.70  ? 901  HOH A O   1 
HETATM 8745 O O   . HOH P 9 .   ? -7.338  -15.512 31.080  1.00 59.00  ? 902  HOH A O   1 
HETATM 8746 O O   . HOH P 9 .   ? -22.085 -32.137 17.155  1.00 65.38  ? 903  HOH A O   1 
HETATM 8747 O O   . HOH P 9 .   ? -14.976 -45.839 34.097  1.00 49.25  ? 904  HOH A O   1 
HETATM 8748 O O   . HOH P 9 .   ? -6.982  -18.627 23.549  1.00 58.38  ? 905  HOH A O   1 
HETATM 8749 O O   . HOH P 9 .   ? -13.181 -28.518 22.183  0.83 39.27  ? 906  HOH A O   1 
HETATM 8750 O O   . HOH P 9 .   ? -5.026  -63.213 9.997   0.99 47.34  ? 907  HOH A O   1 
HETATM 8751 O O   . HOH P 9 .   ? -16.115 -37.307 49.325  1.00 50.88  ? 908  HOH A O   1 
HETATM 8752 O O   . HOH P 9 .   ? -14.842 -38.834 2.081   1.00 64.62  ? 909  HOH A O   1 
HETATM 8753 O O   . HOH P 9 .   ? -21.995 -15.121 35.145  1.00 55.32  ? 910  HOH A O   1 
HETATM 8754 O O   . HOH P 9 .   ? 14.885  -55.227 46.680  0.96 51.65  ? 911  HOH A O   1 
HETATM 8755 O O   . HOH P 9 .   ? 18.759  -29.995 23.935  1.00 60.15  ? 912  HOH A O   1 
HETATM 8756 O O   . HOH P 9 .   ? 17.072  -31.344 16.350  1.00 57.71  ? 913  HOH A O   1 
HETATM 8757 O O   . HOH P 9 .   ? -1.530  -16.923 19.790  1.00 61.62  ? 914  HOH A O   1 
HETATM 8758 O O   . HOH P 9 .   ? 8.762   -58.096 49.786  1.00 49.58  ? 915  HOH A O   1 
HETATM 8759 O O   . HOH P 9 .   ? -11.739 -19.494 16.634  1.00 56.45  ? 916  HOH A O   1 
HETATM 8760 O O   . HOH P 9 .   ? -21.248 -60.293 18.349  1.00 57.93  ? 917  HOH A O   1 
HETATM 8761 O O   . HOH P 9 .   ? -11.525 -24.395 49.634  1.00 49.85  ? 918  HOH A O   1 
HETATM 8762 O O   . HOH P 9 .   ? -3.576  -45.107 58.130  0.89 57.74  ? 919  HOH A O   1 
HETATM 8763 O O   . HOH P 9 .   ? -4.029  -14.871 52.477  1.00 64.32  ? 920  HOH A O   1 
HETATM 8764 O O   . HOH P 9 .   ? 14.635  -59.227 33.421  1.00 52.86  ? 921  HOH A O   1 
HETATM 8765 O O   . HOH P 9 .   ? 8.330   -54.100 48.008  1.00 49.21  ? 922  HOH A O   1 
HETATM 8766 O O   . HOH P 9 .   ? -14.287 -29.338 38.138  1.00 36.97  ? 923  HOH A O   1 
HETATM 8767 O O   . HOH P 9 .   ? 5.135   -24.639 22.632  1.00 40.59  ? 924  HOH A O   1 
HETATM 8768 O O   . HOH P 9 .   ? -7.094  -63.120 34.038  1.00 54.52  ? 925  HOH A O   1 
HETATM 8769 O O   . HOH P 9 .   ? -9.282  -30.305 15.255  1.00 50.34  ? 926  HOH A O   1 
HETATM 8770 O O   . HOH P 9 .   ? -13.195 -27.285 38.611  0.99 32.74  ? 927  HOH A O   1 
HETATM 8771 O O   . HOH P 9 .   ? -1.355  -41.540 22.062  0.74 31.93  ? 928  HOH A O   1 
HETATM 8772 O O   . HOH P 9 .   ? -2.856  -65.747 6.490   1.00 57.87  ? 929  HOH A O   1 
HETATM 8773 O O   . HOH P 9 .   ? -18.702 -27.471 43.050  0.86 43.61  ? 930  HOH A O   1 
HETATM 8774 O O   . HOH P 9 .   ? 21.748  -50.055 38.163  1.00 54.71  ? 931  HOH A O   1 
HETATM 8775 O O   . HOH P 9 .   ? 9.732   -53.421 50.376  1.00 46.33  ? 932  HOH A O   1 
HETATM 8776 O O   . HOH P 9 .   ? 9.158   -61.473 37.265  1.00 53.13  ? 933  HOH A O   1 
HETATM 8777 O O   . HOH P 9 .   ? -2.807  -21.993 25.811  1.00 51.53  ? 934  HOH A O   1 
HETATM 8778 O O   . HOH P 9 .   ? -5.331  -24.591 15.458  1.00 59.98  ? 935  HOH A O   1 
HETATM 8779 O O   . HOH P 9 .   ? 18.515  -30.160 46.023  1.00 54.12  ? 936  HOH A O   1 
HETATM 8780 O O   . HOH P 9 .   ? -21.631 -24.872 17.155  1.00 52.42  ? 937  HOH A O   1 
HETATM 8781 O O   . HOH P 9 .   ? 6.600   -48.292 14.434  0.99 46.59  ? 938  HOH A O   1 
HETATM 8782 O O   . HOH P 9 .   ? -2.375  -34.390 6.250   1.00 66.14  ? 939  HOH A O   1 
HETATM 8783 O O   . HOH P 9 .   ? -23.821 -29.199 39.889  1.00 55.23  ? 940  HOH A O   1 
HETATM 8784 O O   . HOH P 9 .   ? -22.388 -38.249 34.934  0.86 46.56  ? 941  HOH A O   1 
HETATM 8785 O O   . HOH P 9 .   ? 4.539   -70.881 38.328  1.00 65.21  ? 942  HOH A O   1 
HETATM 8786 O O   . HOH P 9 .   ? 12.138  -59.140 17.342  1.00 51.59  ? 943  HOH A O   1 
HETATM 8787 O O   . HOH P 9 .   ? 10.518  -26.506 50.638  1.00 51.22  ? 944  HOH A O   1 
HETATM 8788 O O   . HOH P 9 .   ? 17.998  -54.466 33.578  1.00 59.27  ? 945  HOH A O   1 
HETATM 8789 O O   . HOH P 9 .   ? -8.391  -52.917 40.760  1.00 56.85  ? 946  HOH A O   1 
HETATM 8790 O O   . HOH P 9 .   ? 6.538   -58.369 54.415  1.00 60.85  ? 947  HOH A O   1 
HETATM 8791 O O   . HOH P 9 .   ? -6.073  -25.490 62.791  1.00 59.30  ? 948  HOH A O   1 
HETATM 8792 O O   . HOH P 9 .   ? 1.824   -21.371 28.228  0.98 50.91  ? 949  HOH A O   1 
HETATM 8793 O O   . HOH P 9 .   ? -10.845 -46.394 43.153  1.00 41.28  ? 950  HOH A O   1 
HETATM 8794 O O   . HOH P 9 .   ? -8.788  -24.382 48.546  0.87 43.77  ? 951  HOH A O   1 
HETATM 8795 O O   . HOH P 9 .   ? 0.280   -21.942 47.120  0.96 53.37  ? 952  HOH A O   1 
HETATM 8796 O O   . HOH P 9 .   ? -7.369  -41.436 54.426  1.00 55.09  ? 953  HOH A O   1 
HETATM 8797 O O   . HOH P 9 .   ? -21.152 -59.480 7.198   1.00 56.44  ? 954  HOH A O   1 
HETATM 8798 O O   . HOH P 9 .   ? 5.154   -28.022 60.663  1.00 49.39  ? 955  HOH A O   1 
HETATM 8799 O O   . HOH P 9 .   ? -19.990 -61.548 7.310   1.00 62.31  ? 956  HOH A O   1 
HETATM 8800 O O   . HOH P 9 .   ? -19.449 -40.606 20.641  1.00 63.61  ? 957  HOH A O   1 
HETATM 8801 O O   . HOH P 9 .   ? 5.753   -55.186 12.054  1.00 54.53  ? 958  HOH A O   1 
HETATM 8802 O O   . HOH P 9 .   ? -4.900  -44.005 50.606  1.00 45.60  ? 959  HOH A O   1 
HETATM 8803 O O   . HOH P 9 .   ? -20.802 -7.313  24.570  1.00 74.59  ? 960  HOH A O   1 
HETATM 8804 O O   . HOH P 9 .   ? -0.117  -22.197 35.658  1.00 48.30  ? 961  HOH A O   1 
HETATM 8805 O O   . HOH P 9 .   ? 6.999   -54.901 14.306  1.00 52.36  ? 962  HOH A O   1 
HETATM 8806 O O   . HOH P 9 .   ? -0.565  -20.514 28.497  1.00 57.62  ? 963  HOH A O   1 
HETATM 8807 O O   . HOH P 9 .   ? -8.387  -16.097 38.289  1.00 64.19  ? 964  HOH A O   1 
HETATM 8808 O O   . HOH P 9 .   ? 0.713   -38.738 11.734  1.00 48.70  ? 965  HOH A O   1 
HETATM 8809 O O   . HOH P 9 .   ? 5.032   -52.770 50.912  0.73 38.09  ? 966  HOH A O   1 
HETATM 8810 O O   . HOH P 9 .   ? 3.445   -50.538 58.385  0.93 45.72  ? 967  HOH A O   1 
HETATM 8811 O O   . HOH P 9 .   ? -14.600 -43.237 34.267  0.97 41.34  ? 968  HOH A O   1 
HETATM 8812 O O   . HOH P 9 .   ? 2.898   -54.540 12.370  1.00 47.32  ? 969  HOH A O   1 
HETATM 8813 O O   . HOH P 9 .   ? -8.037  -54.331 38.397  1.00 53.81  ? 970  HOH A O   1 
HETATM 8814 O O   . HOH P 9 .   ? 18.728  -50.107 42.392  1.00 51.66  ? 971  HOH A O   1 
HETATM 8815 O O   . HOH P 9 .   ? 20.618  -54.058 42.904  1.00 63.00  ? 972  HOH A O   1 
HETATM 8816 O O   . HOH P 9 .   ? 13.057  -35.304 62.821  1.00 61.94  ? 973  HOH A O   1 
HETATM 8817 O O   . HOH P 9 .   ? 2.478   -28.027 60.795  0.96 46.40  ? 974  HOH A O   1 
HETATM 8818 O O   . HOH P 9 .   ? -4.566  -15.943 27.040  1.00 66.69  ? 975  HOH A O   1 
HETATM 8819 O O   . HOH P 9 .   ? 1.377   -27.628 11.300  1.00 59.30  ? 976  HOH A O   1 
HETATM 8820 O O   . HOH P 9 .   ? -3.559  -69.359 9.106   1.00 74.17  ? 977  HOH A O   1 
HETATM 8821 O O   . HOH P 9 .   ? 5.689   -55.006 51.004  0.94 45.25  ? 978  HOH A O   1 
HETATM 8822 O O   . HOH P 9 .   ? -21.536 -42.749 19.675  1.00 69.81  ? 979  HOH A O   1 
HETATM 8823 O O   . HOH P 9 .   ? 12.204  -39.527 63.893  1.00 56.43  ? 980  HOH A O   1 
HETATM 8824 O O   . HOH P 9 .   ? -5.097  -16.039 29.656  1.00 64.63  ? 981  HOH A O   1 
HETATM 8825 O O   . HOH P 9 .   ? -15.215 -12.308 20.014  1.00 68.73  ? 982  HOH A O   1 
HETATM 8826 O O   . HOH P 9 .   ? -10.158 -51.615 -0.348  1.00 51.95  ? 983  HOH A O   1 
HETATM 8827 O O   . HOH P 9 .   ? -22.677 -21.775 39.248  1.00 58.55  ? 984  HOH A O   1 
HETATM 8828 O O   . HOH P 9 .   ? 19.509  -53.858 45.081  1.00 65.70  ? 985  HOH A O   1 
HETATM 8829 O O   . HOH P 9 .   ? 23.797  -50.495 36.968  1.00 58.04  ? 986  HOH A O   1 
HETATM 8830 O O   . HOH P 9 .   ? 2.789   -21.958 48.409  1.00 50.86  ? 987  HOH A O   1 
HETATM 8831 O O   . HOH P 9 .   ? -13.344 -37.973 52.769  1.00 56.80  ? 988  HOH A O   1 
HETATM 8832 O O   . HOH P 9 .   ? -2.967  -21.483 28.411  1.00 54.69  ? 989  HOH A O   1 
HETATM 8833 O O   . HOH P 9 .   ? -0.547  -22.139 15.561  1.00 56.17  ? 990  HOH A O   1 
HETATM 8834 O O   . HOH P 9 .   ? 3.235   -22.608 43.831  1.00 52.02  ? 991  HOH A O   1 
HETATM 8835 O O   . HOH P 9 .   ? -23.204 -53.551 11.138  1.00 61.21  ? 992  HOH A O   1 
HETATM 8836 O O   . HOH P 9 .   ? -11.941 -12.903 31.910  1.00 68.30  ? 993  HOH A O   1 
HETATM 8837 O O   . HOH P 9 .   ? -16.591 -13.539 18.687  1.00 57.63  ? 994  HOH A O   1 
HETATM 8838 O O   . HOH P 9 .   ? -14.981 -49.407 3.980   1.00 66.03  ? 995  HOH A O   1 
HETATM 8839 O O   . HOH P 9 .   ? 17.828  -50.057 44.775  0.92 52.22  ? 996  HOH A O   1 
HETATM 8840 O O   . HOH P 9 .   ? -1.854  -20.331 35.110  0.98 49.46  ? 997  HOH A O   1 
HETATM 8841 O O   . HOH P 9 .   ? -6.982  -14.717 45.842  1.00 74.20  ? 998  HOH A O   1 
HETATM 8842 O O   . HOH P 9 .   ? 1.958   -19.185 49.025  1.00 55.54  ? 999  HOH A O   1 
HETATM 8843 O O   . HOH P 9 .   ? -13.979 -35.640 50.091  0.95 59.73  ? 1000 HOH A O   1 
HETATM 8844 O O   . HOH P 9 .   ? 13.315  -56.118 42.646  1.00 55.11  ? 1001 HOH A O   1 
HETATM 8845 O O   . HOH P 9 .   ? 20.519  -47.734 38.811  1.00 54.33  ? 1002 HOH A O   1 
HETATM 8846 O O   . HOH P 9 .   ? -30.615 -31.519 25.021  1.00 59.01  ? 1003 HOH A O   1 
HETATM 8847 O O   . HOH P 9 .   ? -7.464  -14.633 48.275  1.00 68.37  ? 1004 HOH A O   1 
HETATM 8848 O O   . HOH P 9 .   ? -1.873  -20.424 16.101  1.00 59.61  ? 1005 HOH A O   1 
HETATM 8849 O O   . HOH P 9 .   ? -21.018 -20.423 41.375  1.00 65.89  ? 1006 HOH A O   1 
HETATM 8850 O O   . HOH P 9 .   ? 11.761  -33.635 61.161  1.00 56.90  ? 1007 HOH A O   1 
HETATM 8851 O O   . HOH P 9 .   ? 11.038  -54.059 46.307  0.99 42.20  ? 1008 HOH A O   1 
HETATM 8852 O O   . HOH P 9 .   ? -8.523  -50.507 41.980  1.00 49.02  ? 1009 HOH A O   1 
HETATM 8853 O O   . HOH P 9 .   ? -11.289 -38.302 -0.819  1.00 68.96  ? 1010 HOH A O   1 
HETATM 8854 O O   . HOH P 9 .   ? -3.415  -62.053 27.334  1.00 55.97  ? 1011 HOH A O   1 
HETATM 8855 O O   . HOH P 9 .   ? 8.139   -43.203 13.271  1.00 54.66  ? 1012 HOH A O   1 
HETATM 8856 O O   . HOH P 9 .   ? 25.812  -51.738 37.462  1.00 66.97  ? 1013 HOH A O   1 
HETATM 8857 O O   . HOH P 9 .   ? -8.459  -27.334 52.360  0.97 51.24  ? 1014 HOH A O   1 
HETATM 8858 O O   . HOH P 9 .   ? 4.349   -63.241 48.760  1.00 57.91  ? 1015 HOH A O   1 
HETATM 8859 O O   . HOH P 9 .   ? 11.023  -22.727 35.540  0.88 45.34  ? 1016 HOH A O   1 
HETATM 8860 O O   . HOH P 9 .   ? -0.736  -18.229 16.373  1.00 61.62  ? 1017 HOH A O   1 
HETATM 8861 O O   . HOH P 9 .   ? 6.150   -24.586 63.142  1.00 69.01  ? 1018 HOH A O   1 
HETATM 8862 O O   . HOH P 9 .   ? 7.697   -40.840 11.109  1.00 75.06  ? 1019 HOH A O   1 
HETATM 8863 O O   . HOH P 9 .   ? -5.480  -62.131 23.639  1.00 62.82  ? 1020 HOH A O   1 
HETATM 8864 O O   . HOH P 9 .   ? -21.733 -18.342 40.437  1.00 64.39  ? 1021 HOH A O   1 
HETATM 8865 O O   . HOH P 9 .   ? 17.040  -29.460 48.121  1.00 61.21  ? 1022 HOH A O   1 
HETATM 8866 O O   . HOH P 9 .   ? -5.893  -62.331 14.411  0.82 44.08  ? 1023 HOH A O   1 
HETATM 8867 O O   . HOH P 9 .   ? -11.818 -69.022 15.590  0.84 54.47  ? 1024 HOH A O   1 
HETATM 8868 O O   . HOH P 9 .   ? -8.750  -44.855 32.408  1.00 41.40  ? 1025 HOH A O   1 
HETATM 8869 O O   . HOH P 9 .   ? -1.077  -27.613 11.611  1.00 64.90  ? 1026 HOH A O   1 
HETATM 8870 O O   . HOH P 9 .   ? 21.577  -46.780 22.151  1.00 61.87  ? 1027 HOH A O   1 
HETATM 8871 O O   . HOH P 9 .   ? -20.926 -25.835 12.500  1.00 56.30  ? 1028 HOH A O   1 
HETATM 8872 O O   . HOH P 9 .   ? -6.828  -14.755 33.944  1.00 57.32  ? 1029 HOH A O   1 
HETATM 8873 O O   . HOH P 9 .   ? 23.912  -55.963 41.889  1.00 67.74  ? 1030 HOH A O   1 
HETATM 8874 O O   . HOH P 9 .   ? -6.158  -44.128 57.439  1.00 70.80  ? 1031 HOH A O   1 
HETATM 8875 O O   . HOH P 9 .   ? -23.854 -51.239 12.828  0.98 53.88  ? 1032 HOH A O   1 
HETATM 8876 O O   . HOH Q 9 .   ? -12.171 -51.940 -29.540 1.00 50.34  ? 701  HOH B O   1 
HETATM 8877 O O   . HOH Q 9 .   ? -3.770  -57.209 4.353   1.00 44.38  ? 702  HOH B O   1 
HETATM 8878 O O   . HOH Q 9 .   ? 6.196   -50.761 -35.104 1.00 51.69  ? 703  HOH B O   1 
HETATM 8879 O O   . HOH Q 9 .   ? 1.726   -86.255 -22.553 1.00 43.14  ? 704  HOH B O   1 
HETATM 8880 O O   . HOH Q 9 .   ? 2.575   -57.491 -0.489  1.00 55.77  ? 705  HOH B O   1 
HETATM 8881 O O   . HOH Q 9 .   ? 5.943   -89.320 -56.080 1.00 78.34  ? 706  HOH B O   1 
HETATM 8882 O O   . HOH Q 9 .   ? -2.765  -85.391 -42.361 1.00 59.96  ? 707  HOH B O   1 
HETATM 8883 O O   . HOH Q 9 .   ? -14.542 -59.289 -37.495 1.00 53.46  ? 708  HOH B O   1 
HETATM 8884 O O   . HOH Q 9 .   ? 16.165  -54.479 -26.323 0.90 59.89  ? 709  HOH B O   1 
HETATM 8885 O O   . HOH Q 9 .   ? -17.346 -46.886 -32.000 1.00 63.28  ? 710  HOH B O   1 
HETATM 8886 O O   . HOH Q 9 .   ? 2.331   -69.324 -17.097 0.98 34.79  ? 711  HOH B O   1 
HETATM 8887 O O   . HOH Q 9 .   ? -3.050  -38.913 -24.105 0.97 47.32  ? 712  HOH B O   1 
HETATM 8888 O O   . HOH Q 9 .   ? 21.836  -45.582 -4.784  1.00 56.49  ? 713  HOH B O   1 
HETATM 8889 O O   . HOH Q 9 .   ? 4.431   -79.592 -6.406  0.94 50.29  ? 714  HOH B O   1 
HETATM 8890 O O   . HOH Q 9 .   ? -9.459  -63.985 -7.314  1.00 44.30  ? 715  HOH B O   1 
HETATM 8891 O O   . HOH Q 9 .   ? -5.002  -55.896 -11.723 0.94 42.86  ? 716  HOH B O   1 
HETATM 8892 O O   . HOH Q 9 .   ? 6.692   -78.069 -55.187 1.00 41.31  ? 717  HOH B O   1 
HETATM 8893 O O   . HOH Q 9 .   ? 17.573  -54.432 -33.296 1.00 46.19  ? 718  HOH B O   1 
HETATM 8894 O O   . HOH Q 9 .   ? -12.712 -50.752 -40.498 1.00 65.41  ? 719  HOH B O   1 
HETATM 8895 O O   . HOH Q 9 .   ? -4.736  -36.547 -38.275 0.96 61.13  ? 720  HOH B O   1 
HETATM 8896 O O   . HOH Q 9 .   ? 1.578   -88.653 -35.146 1.00 55.09  ? 721  HOH B O   1 
HETATM 8897 O O   . HOH Q 9 .   ? 16.274  -82.737 -23.722 1.00 45.63  ? 722  HOH B O   1 
HETATM 8898 O O   . HOH Q 9 .   ? -0.464  -64.232 -46.428 0.99 35.34  ? 723  HOH B O   1 
HETATM 8899 O O   . HOH Q 9 .   ? 5.085   -61.111 -8.972  0.98 45.65  ? 724  HOH B O   1 
HETATM 8900 O O   . HOH Q 9 .   ? 12.414  -60.375 -28.926 1.00 42.32  ? 725  HOH B O   1 
HETATM 8901 O O   . HOH Q 9 .   ? -10.859 -45.442 -25.432 0.91 50.47  ? 726  HOH B O   1 
HETATM 8902 O O   . HOH Q 9 .   ? -12.306 -80.600 -11.343 0.91 52.80  ? 727  HOH B O   1 
HETATM 8903 O O   . HOH Q 9 .   ? -4.737  -91.831 -37.322 1.00 64.43  ? 728  HOH B O   1 
HETATM 8904 O O   . HOH Q 9 .   ? 0.003   -38.015 -47.754 1.00 59.15  ? 729  HOH B O   1 
HETATM 8905 O O   . HOH Q 9 .   ? -17.512 -71.148 -11.081 1.00 57.30  ? 730  HOH B O   1 
HETATM 8906 O O   . HOH Q 9 .   ? 10.118  -62.723 -14.977 1.00 37.89  ? 731  HOH B O   1 
HETATM 8907 O O   . HOH Q 9 .   ? -11.208 -70.859 -45.141 1.00 64.68  ? 732  HOH B O   1 
HETATM 8908 O O   . HOH Q 9 .   ? 3.953   -72.294 -33.408 1.00 35.98  ? 733  HOH B O   1 
HETATM 8909 O O   . HOH Q 9 .   ? 8.265   -53.996 -33.002 1.00 38.83  ? 734  HOH B O   1 
HETATM 8910 O O   . HOH Q 9 .   ? -1.606  -57.845 -50.973 1.00 50.01  ? 735  HOH B O   1 
HETATM 8911 O O   . HOH Q 9 .   ? -9.991  -78.463 -27.779 0.85 42.66  ? 736  HOH B O   1 
HETATM 8912 O O   . HOH Q 9 .   ? 4.188   -71.659 -47.825 0.92 41.61  ? 737  HOH B O   1 
HETATM 8913 O O   . HOH Q 9 .   ? -9.377  -36.816 -41.766 1.00 61.13  ? 738  HOH B O   1 
HETATM 8914 O O   . HOH Q 9 .   ? 7.644   -73.258 -33.809 0.87 36.42  ? 739  HOH B O   1 
HETATM 8915 O O   . HOH Q 9 .   ? 19.471  -85.428 -25.288 1.00 47.92  ? 740  HOH B O   1 
HETATM 8916 O O   . HOH Q 9 .   ? -11.810 -71.890 -34.449 0.89 42.65  ? 741  HOH B O   1 
HETATM 8917 O O   . HOH Q 9 .   ? 17.723  -70.309 -21.408 1.00 55.12  ? 742  HOH B O   1 
HETATM 8918 O O   . HOH Q 9 .   ? 1.078   -62.474 -45.794 0.95 37.45  ? 743  HOH B O   1 
HETATM 8919 O O   . HOH Q 9 .   ? 12.601  -38.082 -35.963 1.00 61.27  ? 744  HOH B O   1 
HETATM 8920 O O   . HOH Q 9 .   ? 24.985  -80.672 -25.458 1.00 74.22  ? 745  HOH B O   1 
HETATM 8921 O O   . HOH Q 9 .   ? -0.405  -68.122 -1.758  1.00 47.22  ? 746  HOH B O   1 
HETATM 8922 O O   . HOH Q 9 .   ? -8.788  -72.966 -55.924 0.91 52.12  ? 747  HOH B O   1 
HETATM 8923 O O   . HOH Q 9 .   ? 6.915   -64.824 -29.140 1.00 37.16  ? 748  HOH B O   1 
HETATM 8924 O O   . HOH Q 9 .   ? -5.593  -75.510 -55.752 1.00 47.03  ? 749  HOH B O   1 
HETATM 8925 O O   . HOH Q 9 .   ? -16.141 -76.685 -43.577 1.00 65.20  ? 750  HOH B O   1 
HETATM 8926 O O   . HOH Q 9 .   ? 3.842   -52.101 -47.309 1.00 45.04  ? 751  HOH B O   1 
HETATM 8927 O O   . HOH Q 9 .   ? 6.974   -63.712 -46.739 0.97 37.85  ? 752  HOH B O   1 
HETATM 8928 O O   . HOH Q 9 .   ? 4.450   -66.335 -26.098 1.00 38.85  ? 753  HOH B O   1 
HETATM 8929 O O   . HOH Q 9 .   ? 2.572   -49.458 -47.202 0.96 44.65  ? 754  HOH B O   1 
HETATM 8930 O O   . HOH Q 9 .   ? 10.839  -57.365 1.940   0.98 48.84  ? 755  HOH B O   1 
HETATM 8931 O O   . HOH Q 9 .   ? 22.341  -64.754 -9.383  0.97 52.12  ? 756  HOH B O   1 
HETATM 8932 O O   . HOH Q 9 .   ? -8.169  -82.945 -48.538 1.00 50.22  ? 757  HOH B O   1 
HETATM 8933 O O   . HOH Q 9 .   ? 9.849   -71.490 -22.272 0.76 38.07  ? 758  HOH B O   1 
HETATM 8934 O O   . HOH Q 9 .   ? 15.278  -42.570 -5.969  1.00 52.53  ? 759  HOH B O   1 
HETATM 8935 O O   . HOH Q 9 .   ? 0.753   -67.899 -32.598 1.00 35.63  ? 760  HOH B O   1 
HETATM 8936 O O   . HOH Q 9 .   ? 6.621   -35.314 -8.604  1.00 63.49  ? 761  HOH B O   1 
HETATM 8937 O O   . HOH Q 9 .   ? -10.648 -72.900 -5.132  1.00 44.10  ? 762  HOH B O   1 
HETATM 8938 O O   . HOH Q 9 .   ? 1.085   -36.764 -31.065 1.00 54.05  ? 763  HOH B O   1 
HETATM 8939 O O   . HOH Q 9 .   ? -2.608  -48.737 -30.271 1.00 36.12  ? 764  HOH B O   1 
HETATM 8940 O O   . HOH Q 9 .   ? -9.572  -53.129 -18.154 1.00 52.63  ? 765  HOH B O   1 
HETATM 8941 O O   . HOH Q 9 .   ? -4.824  -36.934 -35.220 1.00 51.38  ? 766  HOH B O   1 
HETATM 8942 O O   . HOH Q 9 .   ? 12.273  -72.978 -15.812 0.77 45.67  ? 767  HOH B O   1 
HETATM 8943 O O   . HOH Q 9 .   ? -11.936 -52.360 -32.662 0.97 46.09  ? 768  HOH B O   1 
HETATM 8944 O O   . HOH Q 9 .   ? 6.862   -84.788 -12.212 0.95 51.95  ? 769  HOH B O   1 
HETATM 8945 O O   . HOH Q 9 .   ? -7.284  -74.233 -9.508  0.93 38.50  ? 770  HOH B O   1 
HETATM 8946 O O   . HOH Q 9 .   ? 4.486   -70.205 -41.083 1.00 34.23  ? 771  HOH B O   1 
HETATM 8947 O O   . HOH Q 9 .   ? 4.832   -79.515 -29.127 0.87 43.45  ? 772  HOH B O   1 
HETATM 8948 O O   . HOH Q 9 .   ? 5.575   -38.978 -25.961 1.00 68.20  ? 773  HOH B O   1 
HETATM 8949 O O   . HOH Q 9 .   ? 4.952   -58.568 -1.236  1.00 54.44  ? 774  HOH B O   1 
HETATM 8950 O O   . HOH Q 9 .   ? 14.826  -67.272 -31.989 1.00 48.97  ? 775  HOH B O   1 
HETATM 8951 O O   . HOH Q 9 .   ? -13.288 -77.582 -40.115 1.00 51.17  ? 776  HOH B O   1 
HETATM 8952 O O   . HOH Q 9 .   ? 4.456   -56.525 -37.728 1.00 33.78  ? 777  HOH B O   1 
HETATM 8953 O O   . HOH Q 9 .   ? 0.505   -47.893 -14.437 0.97 52.32  ? 778  HOH B O   1 
HETATM 8954 O O   . HOH Q 9 .   ? 15.731  -50.310 -9.533  0.99 46.73  ? 779  HOH B O   1 
HETATM 8955 O O   . HOH Q 9 .   ? -6.329  -65.232 -5.051  1.00 43.18  ? 780  HOH B O   1 
HETATM 8956 O O   . HOH Q 9 .   ? -4.944  -58.582 -46.102 0.98 42.43  ? 781  HOH B O   1 
HETATM 8957 O O   . HOH Q 9 .   ? -16.302 -56.286 -26.649 1.00 52.01  ? 782  HOH B O   1 
HETATM 8958 O O   . HOH Q 9 .   ? -2.744  -44.871 -48.712 1.00 62.03  ? 783  HOH B O   1 
HETATM 8959 O O   . HOH Q 9 .   ? 1.771   -54.599 -42.712 0.92 38.74  ? 784  HOH B O   1 
HETATM 8960 O O   . HOH Q 9 .   ? -13.254 -84.084 -30.843 0.96 60.44  ? 785  HOH B O   1 
HETATM 8961 O O   . HOH Q 9 .   ? -0.438  -53.469 -41.435 1.00 37.69  ? 786  HOH B O   1 
HETATM 8962 O O   . HOH Q 9 .   ? 5.145   -67.054 -18.718 1.00 39.56  ? 787  HOH B O   1 
HETATM 8963 O O   . HOH Q 9 .   ? 9.999   -68.924 -45.322 1.00 47.21  ? 788  HOH B O   1 
HETATM 8964 O O   . HOH Q 9 .   ? 10.838  -66.098 -44.763 0.80 44.88  ? 789  HOH B O   1 
HETATM 8965 O O   . HOH Q 9 .   ? 1.659   -36.970 -8.740  1.00 66.23  ? 790  HOH B O   1 
HETATM 8966 O O   . HOH Q 9 .   ? 9.863   -60.925 -27.979 1.00 39.70  ? 791  HOH B O   1 
HETATM 8967 O O   . HOH Q 9 .   ? 11.788  -59.568 -31.904 0.96 43.43  ? 792  HOH B O   1 
HETATM 8968 O O   . HOH Q 9 .   ? 15.233  -61.906 -39.374 0.95 50.75  ? 793  HOH B O   1 
HETATM 8969 O O   . HOH Q 9 .   ? 16.988  -73.273 -30.090 1.00 58.56  ? 794  HOH B O   1 
HETATM 8970 O O   . HOH Q 9 .   ? -1.940  -48.573 -21.509 0.95 44.64  ? 795  HOH B O   1 
HETATM 8971 O O   . HOH Q 9 .   ? 4.411   -51.105 -30.299 0.95 50.33  ? 796  HOH B O   1 
HETATM 8972 O O   . HOH Q 9 .   ? -5.091  -49.914 -38.082 0.86 37.81  ? 797  HOH B O   1 
HETATM 8973 O O   . HOH Q 9 .   ? -18.244 -71.521 -28.741 0.96 51.53  ? 798  HOH B O   1 
HETATM 8974 O O   . HOH Q 9 .   ? 1.406   -83.284 -2.987  1.00 60.67  ? 799  HOH B O   1 
HETATM 8975 O O   . HOH Q 9 .   ? 4.728   -43.602 -11.844 1.00 54.04  ? 800  HOH B O   1 
HETATM 8976 O O   . HOH Q 9 .   ? -6.006  -53.483 -20.181 0.92 34.95  ? 801  HOH B O   1 
HETATM 8977 O O   . HOH Q 9 .   ? -4.710  -50.999 -32.067 1.00 37.17  ? 802  HOH B O   1 
HETATM 8978 O O   . HOH Q 9 .   ? -8.795  -86.061 -21.625 0.97 54.32  ? 803  HOH B O   1 
HETATM 8979 O O   . HOH Q 9 .   ? 13.053  -70.358 -29.487 1.00 44.11  ? 804  HOH B O   1 
HETATM 8980 O O   . HOH Q 9 .   ? -2.084  -45.852 -32.153 1.00 40.04  ? 805  HOH B O   1 
HETATM 8981 O O   . HOH Q 9 .   ? -13.702 -82.239 -26.881 1.00 57.15  ? 806  HOH B O   1 
HETATM 8982 O O   . HOH Q 9 .   ? 12.654  -43.449 -12.025 1.00 59.90  ? 807  HOH B O   1 
HETATM 8983 O O   . HOH Q 9 .   ? 7.881   -56.463 -46.281 1.00 48.55  ? 808  HOH B O   1 
HETATM 8984 O O   . HOH Q 9 .   ? 14.233  -62.050 -7.664  1.00 54.66  ? 809  HOH B O   1 
HETATM 8985 O O   . HOH Q 9 .   ? 19.697  -45.815 -1.047  0.99 54.65  ? 810  HOH B O   1 
HETATM 8986 O O   . HOH Q 9 .   ? 3.468   -80.502 -9.525  0.91 45.97  ? 811  HOH B O   1 
HETATM 8987 O O   . HOH Q 9 .   ? 9.126   -63.393 -29.208 1.00 35.00  ? 812  HOH B O   1 
HETATM 8988 O O   . HOH Q 9 .   ? -16.607 -63.991 -36.625 1.00 59.22  ? 813  HOH B O   1 
HETATM 8989 O O   . HOH Q 9 .   ? 13.477  -57.700 -44.395 1.00 51.51  ? 814  HOH B O   1 
HETATM 8990 O O   . HOH Q 9 .   ? 17.370  -51.883 6.587   1.00 53.42  ? 815  HOH B O   1 
HETATM 8991 O O   . HOH Q 9 .   ? 14.595  -61.090 -26.843 1.00 45.17  ? 816  HOH B O   1 
HETATM 8992 O O   . HOH Q 9 .   ? 19.558  -59.378 -26.593 0.99 57.00  ? 817  HOH B O   1 
HETATM 8993 O O   . HOH Q 9 .   ? -17.022 -84.565 -32.332 1.00 65.96  ? 818  HOH B O   1 
HETATM 8994 O O   . HOH Q 9 .   ? -4.464  -55.644 -44.925 0.98 43.95  ? 819  HOH B O   1 
HETATM 8995 O O   . HOH Q 9 .   ? 23.135  -65.099 -17.293 1.00 59.06  ? 820  HOH B O   1 
HETATM 8996 O O   . HOH Q 9 .   ? 3.014   -60.028 -29.263 1.00 38.18  ? 821  HOH B O   1 
HETATM 8997 O O   . HOH Q 9 .   ? 15.110  -71.878 -22.579 0.86 50.14  ? 822  HOH B O   1 
HETATM 8998 O O   . HOH Q 9 .   ? -2.622  -88.958 -24.215 1.00 55.66  ? 823  HOH B O   1 
HETATM 8999 O O   . HOH Q 9 .   ? 7.357   -66.935 -38.706 1.00 38.53  ? 824  HOH B O   1 
HETATM 9000 O O   . HOH Q 9 .   ? 1.565   -50.737 -23.151 1.00 48.08  ? 825  HOH B O   1 
HETATM 9001 O O   . HOH Q 9 .   ? 16.804  -62.305 -34.904 1.00 43.10  ? 826  HOH B O   1 
HETATM 9002 O O   . HOH Q 9 .   ? 9.437   -85.375 -12.980 0.88 49.01  ? 827  HOH B O   1 
HETATM 9003 O O   . HOH Q 9 .   ? 3.530   -53.086 -28.605 0.85 42.43  ? 828  HOH B O   1 
HETATM 9004 O O   . HOH Q 9 .   ? 6.547   -71.612 -46.510 1.00 34.76  ? 829  HOH B O   1 
HETATM 9005 O O   . HOH Q 9 .   ? -5.424  -62.698 -5.399  0.93 42.53  ? 830  HOH B O   1 
HETATM 9006 O O   . HOH Q 9 .   ? 8.641   -43.098 -0.301  1.00 56.19  ? 831  HOH B O   1 
HETATM 9007 O O   . HOH Q 9 .   ? -13.160 -75.008 -3.129  1.00 57.55  ? 832  HOH B O   1 
HETATM 9008 O O   . HOH Q 9 .   ? 10.658  -47.192 -22.049 1.00 66.24  ? 833  HOH B O   1 
HETATM 9009 O O   . HOH Q 9 .   ? -16.765 -81.012 -23.204 1.00 69.88  ? 834  HOH B O   1 
HETATM 9010 O O   . HOH Q 9 .   ? 12.510  -79.837 -38.513 1.00 59.67  ? 835  HOH B O   1 
HETATM 9011 O O   . HOH Q 9 .   ? 9.280   -43.799 -5.858  1.00 47.48  ? 836  HOH B O   1 
HETATM 9012 O O   . HOH Q 9 .   ? 7.669   -53.810 -46.810 1.00 53.29  ? 837  HOH B O   1 
HETATM 9013 O O   . HOH Q 9 .   ? -16.055 -78.777 -27.134 1.00 58.64  ? 838  HOH B O   1 
HETATM 9014 O O   . HOH Q 9 .   ? 5.438   -63.930 -9.613  0.97 44.85  ? 839  HOH B O   1 
HETATM 9015 O O   . HOH Q 9 .   ? -6.115  -70.447 -46.990 0.91 40.27  ? 840  HOH B O   1 
HETATM 9016 O O   . HOH Q 9 .   ? 12.017  -62.691 -8.225  1.00 52.64  ? 841  HOH B O   1 
HETATM 9017 O O   . HOH Q 9 .   ? -14.276 -72.442 -10.953 0.94 50.16  ? 842  HOH B O   1 
HETATM 9018 O O   . HOH Q 9 .   ? 8.237   -61.498 -9.358  0.99 46.26  ? 843  HOH B O   1 
HETATM 9019 O O   . HOH Q 9 .   ? 5.433   -62.704 -36.521 1.00 37.57  ? 844  HOH B O   1 
HETATM 9020 O O   . HOH Q 9 .   ? -4.170  -69.301 -58.459 1.00 52.29  ? 845  HOH B O   1 
HETATM 9021 O O   . HOH Q 9 .   ? 23.262  -53.538 -8.322  1.00 53.50  ? 846  HOH B O   1 
HETATM 9022 O O   . HOH Q 9 .   ? 13.306  -75.287 -9.432  1.00 50.96  ? 847  HOH B O   1 
HETATM 9023 O O   . HOH Q 9 .   ? -1.885  -65.426 -1.347  1.00 51.88  ? 848  HOH B O   1 
HETATM 9024 O O   . HOH Q 9 .   ? -16.121 -68.262 -7.231  1.00 52.30  ? 849  HOH B O   1 
HETATM 9025 O O   . HOH Q 9 .   ? 23.856  -68.174 -24.264 1.00 55.24  ? 850  HOH B O   1 
HETATM 9026 O O   . HOH Q 9 .   ? 9.341   -51.801 -46.177 1.00 49.94  ? 851  HOH B O   1 
HETATM 9027 O O   . HOH Q 9 .   ? 10.879  -77.420 -42.758 1.00 55.20  ? 852  HOH B O   1 
HETATM 9028 O O   . HOH Q 9 .   ? -3.654  -64.137 -53.589 1.00 53.52  ? 853  HOH B O   1 
HETATM 9029 O O   . HOH Q 9 .   ? 11.506  -58.856 -0.363  0.96 50.24  ? 854  HOH B O   1 
HETATM 9030 O O   . HOH Q 9 .   ? 2.218   -36.084 -27.798 0.99 59.43  ? 855  HOH B O   1 
HETATM 9031 O O   . HOH Q 9 .   ? -8.408  -71.972 -47.509 1.00 49.49  ? 856  HOH B O   1 
HETATM 9032 O O   . HOH Q 9 .   ? 7.028   -83.227 -48.482 1.00 55.95  ? 857  HOH B O   1 
HETATM 9033 O O   . HOH Q 9 .   ? 20.053  -49.678 0.729   0.93 53.94  ? 858  HOH B O   1 
HETATM 9034 O O   . HOH Q 9 .   ? 16.121  -73.114 -20.806 0.96 53.88  ? 859  HOH B O   1 
HETATM 9035 O O   . HOH Q 9 .   ? 7.960   -45.631 -50.801 1.00 63.01  ? 860  HOH B O   1 
HETATM 9036 O O   . HOH Q 9 .   ? 14.201  -54.660 -36.622 1.00 44.33  ? 861  HOH B O   1 
HETATM 9037 O O   . HOH Q 9 .   ? 10.511  -44.397 1.520   1.00 58.79  ? 862  HOH B O   1 
HETATM 9038 O O   . HOH Q 9 .   ? -6.946  -60.329 -6.286  0.95 46.41  ? 863  HOH B O   1 
HETATM 9039 O O   . HOH Q 9 .   ? -10.912 -60.777 -38.926 0.86 43.46  ? 864  HOH B O   1 
HETATM 9040 O O   . HOH Q 9 .   ? 12.784  -44.480 2.359   1.00 61.90  ? 865  HOH B O   1 
HETATM 9041 O O   . HOH Q 9 .   ? 9.531   -77.302 -36.713 1.00 57.34  ? 866  HOH B O   1 
HETATM 9042 O O   . HOH Q 9 .   ? -12.197 -77.238 -45.915 1.00 56.47  ? 867  HOH B O   1 
HETATM 9043 O O   . HOH Q 9 .   ? -2.000  -80.859 -1.826  1.00 53.49  ? 868  HOH B O   1 
HETATM 9044 O O   . HOH Q 9 .   ? 7.634   -78.229 -36.582 0.93 50.15  ? 869  HOH B O   1 
HETATM 9045 O O   . HOH Q 9 .   ? -7.086  -55.237 -13.685 1.00 51.70  ? 870  HOH B O   1 
HETATM 9046 O O   . HOH Q 9 .   ? 11.887  -52.152 -44.561 1.00 51.86  ? 871  HOH B O   1 
HETATM 9047 O O   . HOH Q 9 .   ? 15.181  -59.929 -41.644 1.00 53.19  ? 872  HOH B O   1 
HETATM 9048 O O   . HOH Q 9 .   ? 2.548   -56.748 -41.974 0.85 35.97  ? 873  HOH B O   1 
HETATM 9049 O O   . HOH Q 9 .   ? -13.035 -61.553 -39.282 0.98 55.38  ? 874  HOH B O   1 
HETATM 9050 O O   . HOH Q 9 .   ? -4.129  -66.753 -54.310 0.98 54.65  ? 875  HOH B O   1 
HETATM 9051 O O   . HOH Q 9 .   ? 10.218  -63.094 -32.800 0.90 35.73  ? 876  HOH B O   1 
HETATM 9052 O O   . HOH Q 9 .   ? -5.336  -82.612 -51.585 0.98 44.59  ? 877  HOH B O   1 
HETATM 9053 O O   . HOH Q 9 .   ? 19.542  -62.083 -33.562 1.00 57.04  ? 878  HOH B O   1 
HETATM 9054 O O   . HOH Q 9 .   ? 4.264   -82.478 -3.532  1.00 56.42  ? 879  HOH B O   1 
HETATM 9055 O O   . HOH Q 9 .   ? -1.839  -69.465 1.617   1.00 47.64  ? 880  HOH B O   1 
HETATM 9056 O O   . HOH Q 9 .   ? 1.421   -75.967 -58.148 1.00 46.22  ? 881  HOH B O   1 
HETATM 9057 O O   . HOH Q 9 .   ? -0.440  -44.202 -21.414 1.00 47.55  ? 882  HOH B O   1 
HETATM 9058 O O   . HOH Q 9 .   ? -3.134  -82.504 -54.641 1.00 50.94  ? 883  HOH B O   1 
HETATM 9059 O O   . HOH Q 9 .   ? -2.340  -35.212 -42.686 1.00 58.83  ? 884  HOH B O   1 
HETATM 9060 O O   . HOH Q 9 .   ? 12.180  -84.153 -33.005 0.99 59.37  ? 885  HOH B O   1 
HETATM 9061 O O   . HOH Q 9 .   ? 12.761  -88.165 -26.127 0.92 52.09  ? 886  HOH B O   1 
HETATM 9062 O O   . HOH Q 9 .   ? 0.585   -66.464 -2.575  0.76 50.72  ? 887  HOH B O   1 
HETATM 9063 O O   . HOH Q 9 .   ? 13.826  -69.897 -32.089 0.93 40.37  ? 888  HOH B O   1 
HETATM 9064 O O   . HOH Q 9 .   ? -3.076  -81.502 -52.171 0.76 46.30  ? 889  HOH B O   1 
HETATM 9065 O O   . HOH Q 9 .   ? 10.570  -61.782 -5.625  1.00 52.66  ? 890  HOH B O   1 
HETATM 9066 O O   . HOH Q 9 .   ? 24.260  -50.448 -17.661 1.00 70.58  ? 891  HOH B O   1 
HETATM 9067 O O   . HOH Q 9 .   ? 0.039   -91.397 -31.528 1.00 61.31  ? 892  HOH B O   1 
HETATM 9068 O O   . HOH Q 9 .   ? -7.101  -41.849 -24.083 1.00 46.75  ? 893  HOH B O   1 
HETATM 9069 O O   . HOH Q 9 .   ? -4.644  -44.798 -22.483 1.00 51.30  ? 894  HOH B O   1 
HETATM 9070 O O   . HOH Q 9 .   ? 15.285  -53.565 -34.497 1.00 50.20  ? 895  HOH B O   1 
HETATM 9071 O O   . HOH Q 9 .   ? 0.032   -64.919 -49.274 1.00 41.01  ? 896  HOH B O   1 
HETATM 9072 O O   . HOH Q 9 .   ? -4.762  -88.967 -26.634 1.00 56.37  ? 897  HOH B O   1 
HETATM 9073 O O   . HOH Q 9 .   ? 8.262   -85.077 -45.969 1.00 56.57  ? 898  HOH B O   1 
HETATM 9074 O O   . HOH Q 9 .   ? 4.547   -56.617 -40.503 0.86 41.57  ? 899  HOH B O   1 
HETATM 9075 O O   . HOH Q 9 .   ? -17.334 -75.468 -39.948 1.00 65.58  ? 900  HOH B O   1 
HETATM 9076 O O   . HOH Q 9 .   ? 6.131   -86.388 -27.966 1.00 55.76  ? 901  HOH B O   1 
HETATM 9077 O O   . HOH Q 9 .   ? 16.640  -86.936 -14.030 1.00 53.72  ? 902  HOH B O   1 
HETATM 9078 O O   . HOH Q 9 .   ? 6.813   -53.408 -35.452 1.00 40.40  ? 903  HOH B O   1 
HETATM 9079 O O   . HOH Q 9 .   ? -17.458 -81.706 -35.666 1.00 55.31  ? 904  HOH B O   1 
HETATM 9080 O O   . HOH Q 9 .   ? 4.411   -69.449 -49.217 1.00 36.95  ? 905  HOH B O   1 
HETATM 9081 O O   . HOH Q 9 .   ? -12.302 -63.982 -0.767  1.00 55.80  ? 906  HOH B O   1 
HETATM 9082 O O   . HOH Q 9 .   ? -3.135  -55.928 1.808   1.00 54.91  ? 907  HOH B O   1 
HETATM 9083 O O   . HOH Q 9 .   ? -19.182 -53.867 -30.420 1.00 63.71  ? 908  HOH B O   1 
HETATM 9084 O O   . HOH Q 9 .   ? 13.456  -66.641 -44.047 1.00 51.87  ? 909  HOH B O   1 
HETATM 9085 O O   . HOH Q 9 .   ? 0.602   -48.492 -22.708 1.00 47.52  ? 910  HOH B O   1 
HETATM 9086 O O   . HOH Q 9 .   ? 11.157  -78.352 -9.195  1.00 51.49  ? 911  HOH B O   1 
HETATM 9087 O O   . HOH Q 9 .   ? -7.275  -77.223 -56.999 1.00 51.02  ? 912  HOH B O   1 
HETATM 9088 O O   . HOH Q 9 .   ? -19.794 -62.741 -21.897 1.00 57.88  ? 913  HOH B O   1 
HETATM 9089 O O   . HOH Q 9 .   ? 22.514  -77.814 -26.617 1.00 58.24  ? 914  HOH B O   1 
HETATM 9090 O O   . HOH Q 9 .   ? -1.309  -72.096 0.965   1.00 46.31  ? 915  HOH B O   1 
HETATM 9091 O O   . HOH Q 9 .   ? -8.920  -33.678 -41.096 1.00 54.98  ? 916  HOH B O   1 
HETATM 9092 O O   . HOH Q 9 .   ? 18.020  -50.097 -39.264 0.87 53.74  ? 917  HOH B O   1 
HETATM 9093 O O   . HOH Q 9 .   ? -13.163 -81.640 -44.268 1.00 63.43  ? 918  HOH B O   1 
HETATM 9094 O O   . HOH Q 9 .   ? 5.020   -45.381 -20.377 1.00 62.76  ? 919  HOH B O   1 
HETATM 9095 O O   . HOH Q 9 .   ? 0.292   -61.992 -0.987  1.00 44.39  ? 920  HOH B O   1 
HETATM 9096 O O   . HOH Q 9 .   ? -1.723  -74.562 -61.564 0.78 46.28  ? 921  HOH B O   1 
HETATM 9097 O O   . HOH Q 9 .   ? 3.534   -66.566 -6.807  1.00 53.28  ? 922  HOH B O   1 
HETATM 9098 O O   . HOH Q 9 .   ? -12.908 -78.895 -43.781 0.85 59.20  ? 923  HOH B O   1 
HETATM 9099 O O   . HOH Q 9 .   ? -1.415  -64.058 0.330   1.00 52.18  ? 924  HOH B O   1 
HETATM 9100 O O   . HOH Q 9 .   ? 5.327   -44.532 2.129   1.00 55.13  ? 925  HOH B O   1 
HETATM 9101 O O   . HOH Q 9 .   ? 7.590   -64.055 -24.228 1.00 60.94  ? 926  HOH B O   1 
HETATM 9102 O O   . HOH Q 9 .   ? -13.886 -49.133 -38.365 1.00 62.48  ? 927  HOH B O   1 
HETATM 9103 O O   . HOH Q 9 .   ? -8.200  -68.908 -47.258 1.00 51.33  ? 928  HOH B O   1 
HETATM 9104 O O   . HOH Q 9 .   ? 0.381   -71.999 -56.271 1.00 50.34  ? 929  HOH B O   1 
HETATM 9105 O O   . HOH Q 9 .   ? 16.697  -64.230 -38.906 1.00 56.02  ? 930  HOH B O   1 
HETATM 9106 O O   . HOH Q 9 .   ? -15.934 -77.883 -41.208 1.00 60.09  ? 931  HOH B O   1 
HETATM 9107 O O   . HOH Q 9 .   ? 2.296   -39.245 -48.970 1.00 52.10  ? 932  HOH B O   1 
HETATM 9108 O O   . HOH Q 9 .   ? -9.376  -60.569 -7.123  1.00 45.60  ? 933  HOH B O   1 
HETATM 9109 O O   . HOH Q 9 .   ? 18.266  -64.609 -37.567 1.00 61.02  ? 934  HOH B O   1 
HETATM 9110 O O   . HOH Q 9 .   ? 19.038  -69.700 -28.658 1.00 66.92  ? 935  HOH B O   1 
HETATM 9111 O O   . HOH Q 9 .   ? 14.358  -66.547 -6.452  1.00 51.57  ? 936  HOH B O   1 
HETATM 9112 O O   . HOH Q 9 .   ? -23.585 -64.561 -11.531 1.00 67.89  ? 937  HOH B O   1 
HETATM 9113 O O   . HOH Q 9 .   ? 17.984  -52.002 -37.245 1.00 53.58  ? 938  HOH B O   1 
HETATM 9114 O O   . HOH Q 9 .   ? 9.578   -62.264 -24.775 1.00 56.76  ? 939  HOH B O   1 
HETATM 9115 O O   . HOH Q 9 .   ? 24.330  -79.331 -27.695 1.00 69.69  ? 940  HOH B O   1 
HETATM 9116 O O   . HOH Q 9 .   ? 8.727   -69.969 -47.448 0.89 40.99  ? 941  HOH B O   1 
HETATM 9117 O O   . HOH Q 9 .   ? 10.554  -84.324 -45.250 0.90 49.69  ? 942  HOH B O   1 
HETATM 9118 O O   . HOH Q 9 .   ? -11.025 -67.858 -43.810 1.00 51.41  ? 943  HOH B O   1 
HETATM 9119 O O   . HOH Q 9 .   ? -9.652  -71.628 -57.615 1.00 57.14  ? 944  HOH B O   1 
HETATM 9120 O O   . HOH Q 9 .   ? 12.840  -61.213 -0.162  1.00 57.48  ? 945  HOH B O   1 
HETATM 9121 O O   . HOH Q 9 .   ? -12.076 -53.088 -38.401 1.00 48.46  ? 946  HOH B O   1 
HETATM 9122 O O   . HOH Q 9 .   ? 16.324  -60.708 -37.124 0.95 45.46  ? 947  HOH B O   1 
HETATM 9123 O O   . HOH Q 9 .   ? -2.590  -45.943 -21.362 1.00 51.89  ? 948  HOH B O   1 
HETATM 9124 O O   . HOH Q 9 .   ? 16.142  -56.345 -37.898 1.00 47.51  ? 949  HOH B O   1 
HETATM 9125 O O   . HOH Q 9 .   ? -1.314  -64.179 3.290   1.00 55.84  ? 950  HOH B O   1 
HETATM 9126 O O   . HOH Q 9 .   ? 22.286  -49.854 -0.266  0.93 52.34  ? 951  HOH B O   1 
HETATM 9127 O O   . HOH Q 9 .   ? -12.563 -95.527 -38.766 1.00 70.16  ? 952  HOH B O   1 
HETATM 9128 O O   . HOH Q 9 .   ? 15.856  -89.988 -13.472 1.00 68.10  ? 953  HOH B O   1 
HETATM 9129 O O   . HOH Q 9 .   ? -9.143  -86.902 -28.614 1.00 68.29  ? 954  HOH B O   1 
HETATM 9130 O O   . HOH Q 9 .   ? 27.009  -79.779 -26.426 1.00 78.09  ? 955  HOH B O   1 
HETATM 9131 O O   . HOH Q 9 .   ? -24.480 -62.548 -10.545 1.00 75.41  ? 956  HOH B O   1 
HETATM 9132 O O   . HOH Q 9 .   ? 0.930   -62.703 2.928   1.00 58.77  ? 957  HOH B O   1 
HETATM 9133 O O   . HOH Q 9 .   ? -13.231 -55.462 -39.329 1.00 61.37  ? 958  HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   2   ?   ?   ?   A . n 
A 1 2   ARG 2   3   ?   ?   ?   A . n 
A 1 3   GLU 3   4   4   GLU GLU A . n 
A 1 4   ASP 4   5   5   ASP ASP A . n 
A 1 5   ALA 5   6   6   ALA ALA A . n 
A 1 6   GLU 6   7   7   GLU GLU A . n 
A 1 7   LEU 7   8   8   LEU LEU A . n 
A 1 8   LEU 8   9   9   LEU LEU A . n 
A 1 9   VAL 9   10  10  VAL VAL A . n 
A 1 10  THR 10  11  11  THR THR A . n 
A 1 11  VAL 11  12  12  VAL VAL A . n 
A 1 12  ARG 12  13  13  ARG ARG A . n 
A 1 13  GLY 13  14  14  GLY GLY A . n 
A 1 14  GLY 14  15  15  GLY GLY A . n 
A 1 15  ARG 15  16  16  ARG ARG A . n 
A 1 16  LEU 16  17  17  LEU LEU A . n 
A 1 17  ARG 17  18  18  ARG ARG A . n 
A 1 18  GLY 18  19  19  GLY GLY A . n 
A 1 19  ILE 19  20  20  ILE ILE A . n 
A 1 20  ARG 20  21  21  ARG ARG A . n 
A 1 21  LEU 21  22  22  LEU LEU A . n 
A 1 22  LYS 22  23  23  LYS LYS A . n 
A 1 23  THR 23  24  24  THR THR A . n 
A 1 24  PRO 24  25  25  PRO PRO A . n 
A 1 25  GLY 25  26  26  GLY GLY A . n 
A 1 26  GLY 26  27  27  GLY GLY A . n 
A 1 27  PRO 27  28  28  PRO PRO A . n 
A 1 28  VAL 28  29  29  VAL VAL A . n 
A 1 29  SER 29  30  30  SER SER A . n 
A 1 30  ALA 30  31  31  ALA ALA A . n 
A 1 31  PHE 31  32  32  PHE PHE A . n 
A 1 32  LEU 32  33  33  LEU LEU A . n 
A 1 33  GLY 33  34  34  GLY GLY A . n 
A 1 34  ILE 34  35  35  ILE ILE A . n 
A 1 35  PRO 35  36  36  PRO PRO A . n 
A 1 36  PHE 36  37  37  PHE PHE A . n 
A 1 37  ALA 37  38  38  ALA ALA A . n 
A 1 38  GLU 38  39  39  GLU GLU A . n 
A 1 39  PRO 39  40  40  PRO PRO A . n 
A 1 40  PRO 40  41  41  PRO PRO A . n 
A 1 41  MET 41  42  42  MET MET A . n 
A 1 42  GLY 42  43  43  GLY GLY A . n 
A 1 43  PRO 43  44  44  PRO PRO A . n 
A 1 44  ARG 44  45  45  ARG ARG A . n 
A 1 45  ARG 45  46  46  ARG ARG A . n 
A 1 46  PHE 46  47  47  PHE PHE A . n 
A 1 47  LEU 47  48  48  LEU LEU A . n 
A 1 48  PRO 48  49  49  PRO PRO A . n 
A 1 49  PRO 49  50  50  PRO PRO A . n 
A 1 50  GLU 50  51  51  GLU GLU A . n 
A 1 51  PRO 51  52  52  PRO PRO A . n 
A 1 52  LYS 52  53  53  LYS LYS A . n 
A 1 53  GLN 53  54  54  GLN GLN A . n 
A 1 54  PRO 54  55  55  PRO PRO A . n 
A 1 55  TRP 55  56  56  TRP TRP A . n 
A 1 56  SER 56  57  57  SER SER A . n 
A 1 57  GLY 57  58  58  GLY GLY A . n 
A 1 58  VAL 58  59  59  VAL VAL A . n 
A 1 59  VAL 59  60  60  VAL VAL A . n 
A 1 60  ASP 60  61  61  ASP ASP A . n 
A 1 61  ALA 61  62  62  ALA ALA A . n 
A 1 62  THR 62  63  63  THR THR A . n 
A 1 63  THR 63  64  64  THR THR A . n 
A 1 64  PHE 64  65  65  PHE PHE A . n 
A 1 65  GLN 65  66  66  GLN GLN A . n 
A 1 66  SER 66  67  67  SER SER A . n 
A 1 67  VAL 67  68  68  VAL VAL A . n 
A 1 68  CYS 68  69  69  CYS CYS A . n 
A 1 69  TYR 69  70  70  TYR TYR A . n 
A 1 70  GLN 70  71  71  GLN GLN A . n 
A 1 71  TYR 71  72  72  TYR TYR A . n 
A 1 72  VAL 72  73  73  VAL VAL A . n 
A 1 73  ASP 73  74  74  ASP ASP A . n 
A 1 74  THR 74  75  75  THR THR A . n 
A 1 75  LEU 75  76  76  LEU LEU A . n 
A 1 76  TYR 76  77  77  TYR TYR A . n 
A 1 77  PRO 77  78  78  PRO PRO A . n 
A 1 78  GLY 78  79  79  GLY GLY A . n 
A 1 79  PHE 79  80  80  PHE PHE A . n 
A 1 80  GLU 80  81  81  GLU GLU A . n 
A 1 81  GLY 81  82  82  GLY GLY A . n 
A 1 82  THR 82  83  83  THR THR A . n 
A 1 83  GLU 83  84  84  GLU GLU A . n 
A 1 84  MET 84  85  85  MET MET A . n 
A 1 85  TRP 85  86  86  TRP TRP A . n 
A 1 86  ASN 86  87  87  ASN ASN A . n 
A 1 87  PRO 87  88  88  PRO PRO A . n 
A 1 88  ASN 88  89  89  ASN ASN A . n 
A 1 89  ARG 89  90  90  ARG ARG A . n 
A 1 90  GLU 90  91  91  GLU GLU A . n 
A 1 91  LEU 91  92  92  LEU LEU A . n 
A 1 92  SER 92  93  93  SER SER A . n 
A 1 93  GLU 93  94  94  GLU GLU A . n 
A 1 94  ASP 94  95  95  ASP ASP A . n 
A 1 95  CYS 95  96  96  CYS CYS A . n 
A 1 96  LEU 96  97  97  LEU LEU A . n 
A 1 97  TYR 97  98  98  TYR TYR A . n 
A 1 98  LEU 98  99  99  LEU LEU A . n 
A 1 99  ASN 99  100 100 ASN ASN A . n 
A 1 100 VAL 100 101 101 VAL VAL A . n 
A 1 101 TRP 101 102 102 TRP TRP A . n 
A 1 102 THR 102 103 103 THR THR A . n 
A 1 103 PRO 103 104 104 PRO PRO A . n 
A 1 104 TYR 104 105 105 TYR TYR A . n 
A 1 105 PRO 105 106 106 PRO PRO A . n 
A 1 106 ARG 106 107 107 ARG ARG A . n 
A 1 107 PRO 107 108 108 PRO PRO A . n 
A 1 108 THR 108 109 109 THR THR A . n 
A 1 109 SER 109 110 110 SER SER A . n 
A 1 110 PRO 110 111 111 PRO PRO A . n 
A 1 111 THR 111 112 112 THR THR A . n 
A 1 112 PRO 112 113 113 PRO PRO A . n 
A 1 113 VAL 113 114 114 VAL VAL A . n 
A 1 114 LEU 114 115 115 LEU LEU A . n 
A 1 115 VAL 115 116 116 VAL VAL A . n 
A 1 116 TRP 116 117 117 TRP TRP A . n 
A 1 117 ILE 117 118 118 ILE ILE A . n 
A 1 118 TYR 118 119 119 TYR TYR A . n 
A 1 119 GLY 119 120 120 GLY GLY A . n 
A 1 120 GLY 120 121 121 GLY GLY A . n 
A 1 121 GLY 121 122 122 GLY GLY A . n 
A 1 122 PHE 122 123 123 PHE PHE A . n 
A 1 123 TYR 123 124 124 TYR TYR A . n 
A 1 124 SER 124 125 125 SER SER A . n 
A 1 125 GLY 125 126 126 GLY GLY A . n 
A 1 126 ALA 126 127 127 ALA ALA A . n 
A 1 127 SER 127 128 128 SER SER A . n 
A 1 128 SER 128 129 129 SER SER A . n 
A 1 129 LEU 129 130 130 LEU LEU A . n 
A 1 130 ASP 130 131 131 ASP ASP A . n 
A 1 131 VAL 131 132 132 VAL VAL A . n 
A 1 132 TYR 132 133 133 TYR TYR A . n 
A 1 133 ASP 133 134 134 ASP ASP A . n 
A 1 134 GLY 134 135 135 GLY GLY A . n 
A 1 135 ARG 135 136 136 ARG ARG A . n 
A 1 136 PHE 136 137 137 PHE PHE A . n 
A 1 137 LEU 137 138 138 LEU LEU A . n 
A 1 138 VAL 138 139 139 VAL VAL A . n 
A 1 139 GLN 139 140 140 GLN GLN A . n 
A 1 140 ALA 140 141 141 ALA ALA A . n 
A 1 141 GLU 141 142 142 GLU GLU A . n 
A 1 142 ARG 142 143 143 ARG ARG A . n 
A 1 143 THR 143 144 144 THR THR A . n 
A 1 144 VAL 144 145 145 VAL VAL A . n 
A 1 145 LEU 145 146 146 LEU LEU A . n 
A 1 146 VAL 146 147 147 VAL VAL A . n 
A 1 147 SER 147 148 148 SER SER A . n 
A 1 148 MET 148 149 149 MET MET A . n 
A 1 149 ASN 149 150 150 ASN ASN A . n 
A 1 150 TYR 150 151 151 TYR TYR A . n 
A 1 151 ARG 151 152 152 ARG ARG A . n 
A 1 152 VAL 152 153 153 VAL VAL A . n 
A 1 153 GLY 153 154 154 GLY GLY A . n 
A 1 154 ALA 154 155 155 ALA ALA A . n 
A 1 155 PHE 155 156 156 PHE PHE A . n 
A 1 156 GLY 156 157 157 GLY GLY A . n 
A 1 157 PHE 157 158 158 PHE PHE A . n 
A 1 158 LEU 158 159 159 LEU LEU A . n 
A 1 159 ALA 159 160 160 ALA ALA A . n 
A 1 160 LEU 160 161 161 LEU LEU A . n 
A 1 161 PRO 161 162 162 PRO PRO A . n 
A 1 162 GLY 162 163 163 GLY GLY A . n 
A 1 163 SER 163 164 164 SER SER A . n 
A 1 164 ARG 164 165 165 ARG ARG A . n 
A 1 165 GLU 165 166 166 GLU GLU A . n 
A 1 166 ALA 166 167 167 ALA ALA A . n 
A 1 167 PRO 167 168 168 PRO PRO A . n 
A 1 168 GLY 168 169 169 GLY GLY A . n 
A 1 169 ASN 169 170 170 ASN ASN A . n 
A 1 170 VAL 170 171 171 VAL VAL A . n 
A 1 171 GLY 171 172 172 GLY GLY A . n 
A 1 172 LEU 172 173 173 LEU LEU A . n 
A 1 173 LEU 173 174 174 LEU LEU A . n 
A 1 174 ASP 174 175 175 ASP ASP A . n 
A 1 175 GLN 175 176 176 GLN GLN A . n 
A 1 176 ARG 176 177 177 ARG ARG A . n 
A 1 177 LEU 177 178 178 LEU LEU A . n 
A 1 178 ALA 178 179 179 ALA ALA A . n 
A 1 179 LEU 179 180 180 LEU LEU A . n 
A 1 180 GLN 180 181 181 GLN GLN A . n 
A 1 181 TRP 181 182 182 TRP TRP A . n 
A 1 182 VAL 182 183 183 VAL VAL A . n 
A 1 183 GLN 183 184 184 GLN GLN A . n 
A 1 184 GLU 184 185 185 GLU GLU A . n 
A 1 185 ASN 185 186 186 ASN ASN A . n 
A 1 186 VAL 186 187 187 VAL VAL A . n 
A 1 187 ALA 187 188 188 ALA ALA A . n 
A 1 188 ALA 188 189 189 ALA ALA A . n 
A 1 189 PHE 189 190 190 PHE PHE A . n 
A 1 190 GLY 190 191 191 GLY GLY A . n 
A 1 191 GLY 191 192 192 GLY GLY A . n 
A 1 192 ASP 192 193 193 ASP ASP A . n 
A 1 193 PRO 193 194 194 PRO PRO A . n 
A 1 194 THR 194 195 195 THR THR A . n 
A 1 195 SER 195 196 196 SER SER A . n 
A 1 196 VAL 196 197 197 VAL VAL A . n 
A 1 197 THR 197 198 198 THR THR A . n 
A 1 198 LEU 198 199 199 LEU LEU A . n 
A 1 199 PHE 199 200 200 PHE PHE A . n 
A 1 200 GLY 200 201 201 GLY GLY A . n 
A 1 201 GLU 201 202 202 GLU GLU A . n 
A 1 202 SER 202 203 203 SER SER A . n 
A 1 203 ALA 203 204 204 ALA ALA A . n 
A 1 204 GLY 204 205 205 GLY GLY A . n 
A 1 205 ALA 205 206 206 ALA ALA A . n 
A 1 206 ALA 206 207 207 ALA ALA A . n 
A 1 207 SER 207 208 208 SER SER A . n 
A 1 208 VAL 208 209 209 VAL VAL A . n 
A 1 209 GLY 209 210 210 GLY GLY A . n 
A 1 210 MET 210 211 211 MET MET A . n 
A 1 211 HIS 211 212 212 HIS HIS A . n 
A 1 212 LEU 212 213 213 LEU LEU A . n 
A 1 213 LEU 213 214 214 LEU LEU A . n 
A 1 214 SER 214 215 215 SER SER A . n 
A 1 215 PRO 215 216 216 PRO PRO A . n 
A 1 216 PRO 216 217 217 PRO PRO A . n 
A 1 217 SER 217 218 218 SER SER A . n 
A 1 218 ARG 218 219 219 ARG ARG A . n 
A 1 219 GLY 219 220 220 GLY GLY A . n 
A 1 220 LEU 220 221 221 LEU LEU A . n 
A 1 221 PHE 221 222 222 PHE PHE A . n 
A 1 222 HIS 222 223 223 HIS HIS A . n 
A 1 223 ARG 223 224 224 ARG ARG A . n 
A 1 224 ALA 224 225 225 ALA ALA A . n 
A 1 225 VAL 225 226 226 VAL VAL A . n 
A 1 226 LEU 226 227 227 LEU LEU A . n 
A 1 227 GLN 227 228 228 GLN GLN A . n 
A 1 228 SER 228 229 229 SER SER A . n 
A 1 229 GLY 229 230 230 GLY GLY A . n 
A 1 230 ALA 230 231 231 ALA ALA A . n 
A 1 231 PRO 231 232 232 PRO PRO A . n 
A 1 232 ASN 232 233 233 ASN ASN A . n 
A 1 233 GLY 233 234 234 GLY GLY A . n 
A 1 234 PRO 234 235 235 PRO PRO A . n 
A 1 235 TRP 235 236 236 TRP TRP A . n 
A 1 236 ALA 236 237 237 ALA ALA A . n 
A 1 237 THR 237 238 238 THR THR A . n 
A 1 238 VAL 238 239 239 VAL VAL A . n 
A 1 239 GLY 239 240 240 GLY GLY A . n 
A 1 240 MET 240 241 241 MET MET A . n 
A 1 241 GLY 241 242 242 GLY GLY A . n 
A 1 242 GLU 242 243 243 GLU GLU A . n 
A 1 243 ALA 243 244 244 ALA ALA A . n 
A 1 244 ARG 244 245 245 ARG ARG A . n 
A 1 245 ARG 245 246 246 ARG ARG A . n 
A 1 246 ARG 246 247 247 ARG ARG A . n 
A 1 247 ALA 247 248 248 ALA ALA A . n 
A 1 248 THR 248 249 249 THR THR A . n 
A 1 249 GLN 249 250 250 GLN GLN A . n 
A 1 250 LEU 250 251 251 LEU LEU A . n 
A 1 251 ALA 251 252 252 ALA ALA A . n 
A 1 252 HIS 252 253 253 HIS HIS A . n 
A 1 253 LEU 253 254 254 LEU LEU A . n 
A 1 254 VAL 254 255 255 VAL VAL A . n 
A 1 255 GLY 255 256 256 GLY GLY A . n 
A 1 256 CYS 256 257 257 CYS CYS A . n 
A 1 257 PRO 257 258 258 PRO PRO A . n 
A 1 258 PRO 258 259 ?   ?   ?   A . n 
A 1 259 GLY 259 260 ?   ?   ?   A . n 
A 1 260 GLY 260 261 ?   ?   ?   A . n 
A 1 261 THR 261 262 ?   ?   ?   A . n 
A 1 262 GLY 262 263 ?   ?   ?   A . n 
A 1 263 GLY 263 264 ?   ?   ?   A . n 
A 1 264 ASN 264 265 265 ASN ASN A . n 
A 1 265 ASP 265 266 266 ASP ASP A . n 
A 1 266 THR 266 267 267 THR THR A . n 
A 1 267 GLU 267 268 268 GLU GLU A . n 
A 1 268 LEU 268 269 269 LEU LEU A . n 
A 1 269 VAL 269 270 270 VAL VAL A . n 
A 1 270 ALA 270 271 271 ALA ALA A . n 
A 1 271 CYS 271 272 272 CYS CYS A . n 
A 1 272 LEU 272 273 273 LEU LEU A . n 
A 1 273 ARG 273 274 274 ARG ARG A . n 
A 1 274 THR 274 275 275 THR THR A . n 
A 1 275 ARG 275 276 276 ARG ARG A . n 
A 1 276 PRO 276 277 277 PRO PRO A . n 
A 1 277 ALA 277 278 278 ALA ALA A . n 
A 1 278 GLN 278 279 279 GLN GLN A . n 
A 1 279 VAL 279 280 280 VAL VAL A . n 
A 1 280 LEU 280 281 281 LEU LEU A . n 
A 1 281 VAL 281 282 282 VAL VAL A . n 
A 1 282 ASN 282 283 283 ASN ASN A . n 
A 1 283 HIS 283 284 284 HIS HIS A . n 
A 1 284 GLU 284 285 285 GLU GLU A . n 
A 1 285 TRP 285 286 286 TRP TRP A . n 
A 1 286 HIS 286 287 287 HIS HIS A . n 
A 1 287 VAL 287 288 288 VAL VAL A . n 
A 1 288 LEU 288 289 289 LEU LEU A . n 
A 1 289 PRO 289 290 290 PRO PRO A . n 
A 1 290 GLN 290 291 291 GLN GLN A . n 
A 1 291 GLU 291 292 292 GLU GLU A . n 
A 1 292 SER 292 293 293 SER SER A . n 
A 1 293 VAL 293 294 294 VAL VAL A . n 
A 1 294 PHE 294 295 295 PHE PHE A . n 
A 1 295 ARG 295 296 296 ARG ARG A . n 
A 1 296 PHE 296 297 297 PHE PHE A . n 
A 1 297 SER 297 298 298 SER SER A . n 
A 1 298 PHE 298 299 299 PHE PHE A . n 
A 1 299 VAL 299 300 300 VAL VAL A . n 
A 1 300 PRO 300 301 301 PRO PRO A . n 
A 1 301 VAL 301 302 302 VAL VAL A . n 
A 1 302 VAL 302 303 303 VAL VAL A . n 
A 1 303 ASP 303 304 304 ASP ASP A . n 
A 1 304 GLY 304 305 305 GLY GLY A . n 
A 1 305 ASP 305 306 306 ASP ASP A . n 
A 1 306 PHE 306 307 307 PHE PHE A . n 
A 1 307 LEU 307 308 308 LEU LEU A . n 
A 1 308 SER 308 309 309 SER SER A . n 
A 1 309 ASP 309 310 310 ASP ASP A . n 
A 1 310 THR 310 311 311 THR THR A . n 
A 1 311 PRO 311 312 312 PRO PRO A . n 
A 1 312 GLU 312 313 313 GLU GLU A . n 
A 1 313 ALA 313 314 314 ALA ALA A . n 
A 1 314 LEU 314 315 315 LEU LEU A . n 
A 1 315 ILE 315 316 316 ILE ILE A . n 
A 1 316 ASN 316 317 317 ASN ASN A . n 
A 1 317 ALA 317 318 318 ALA ALA A . n 
A 1 318 GLY 318 319 319 GLY GLY A . n 
A 1 319 ASP 319 320 320 ASP ASP A . n 
A 1 320 PHE 320 321 321 PHE PHE A . n 
A 1 321 HIS 321 322 322 HIS HIS A . n 
A 1 322 GLY 322 323 323 GLY GLY A . n 
A 1 323 LEU 323 324 324 LEU LEU A . n 
A 1 324 GLN 324 325 325 GLN GLN A . n 
A 1 325 VAL 325 326 326 VAL VAL A . n 
A 1 326 LEU 326 327 327 LEU LEU A . n 
A 1 327 VAL 327 328 328 VAL VAL A . n 
A 1 328 GLY 328 329 329 GLY GLY A . n 
A 1 329 VAL 329 330 330 VAL VAL A . n 
A 1 330 VAL 330 331 331 VAL VAL A . n 
A 1 331 LYS 331 332 332 LYS LYS A . n 
A 1 332 ASP 332 333 333 ASP ASP A . n 
A 1 333 GLU 333 334 334 GLU GLU A . n 
A 1 334 GLY 334 335 335 GLY GLY A . n 
A 1 335 SER 335 336 336 SER SER A . n 
A 1 336 TYR 336 337 337 TYR TYR A . n 
A 1 337 PHE 337 338 338 PHE PHE A . n 
A 1 338 LEU 338 339 339 LEU LEU A . n 
A 1 339 VAL 339 340 340 VAL VAL A . n 
A 1 340 TYR 340 341 341 TYR TYR A . n 
A 1 341 GLY 341 342 342 GLY GLY A . n 
A 1 342 ALA 342 343 343 ALA ALA A . n 
A 1 343 PRO 343 344 344 PRO PRO A . n 
A 1 344 GLY 344 345 345 GLY GLY A . n 
A 1 345 PHE 345 346 346 PHE PHE A . n 
A 1 346 SER 346 347 347 SER SER A . n 
A 1 347 LYS 347 348 348 LYS LYS A . n 
A 1 348 ASP 348 349 349 ASP ASP A . n 
A 1 349 ASN 349 350 350 ASN ASN A . n 
A 1 350 GLU 350 351 351 GLU GLU A . n 
A 1 351 SER 351 352 352 SER SER A . n 
A 1 352 LEU 352 353 353 LEU LEU A . n 
A 1 353 ILE 353 354 354 ILE ILE A . n 
A 1 354 SER 354 355 355 SER SER A . n 
A 1 355 ARG 355 356 356 ARG ARG A . n 
A 1 356 ALA 356 357 357 ALA ALA A . n 
A 1 357 GLU 357 358 358 GLU GLU A . n 
A 1 358 PHE 358 359 359 PHE PHE A . n 
A 1 359 LEU 359 360 360 LEU LEU A . n 
A 1 360 ALA 360 361 361 ALA ALA A . n 
A 1 361 GLY 361 362 362 GLY GLY A . n 
A 1 362 VAL 362 363 363 VAL VAL A . n 
A 1 363 ARG 363 364 364 ARG ARG A . n 
A 1 364 VAL 364 365 365 VAL VAL A . n 
A 1 365 GLY 365 366 366 GLY GLY A . n 
A 1 366 VAL 366 367 367 VAL VAL A . n 
A 1 367 PRO 367 368 368 PRO PRO A . n 
A 1 368 GLN 368 369 369 GLN GLN A . n 
A 1 369 VAL 369 370 370 VAL VAL A . n 
A 1 370 SER 370 371 371 SER SER A . n 
A 1 371 ASP 371 372 372 ASP ASP A . n 
A 1 372 LEU 372 373 373 LEU LEU A . n 
A 1 373 ALA 373 374 374 ALA ALA A . n 
A 1 374 ALA 374 375 375 ALA ALA A . n 
A 1 375 GLU 375 376 376 GLU GLU A . n 
A 1 376 ALA 376 377 377 ALA ALA A . n 
A 1 377 VAL 377 378 378 VAL VAL A . n 
A 1 378 VAL 378 379 379 VAL VAL A . n 
A 1 379 LEU 379 380 380 LEU LEU A . n 
A 1 380 HIS 380 381 381 HIS HIS A . n 
A 1 381 TYR 381 382 382 TYR TYR A . n 
A 1 382 THR 382 383 383 THR THR A . n 
A 1 383 ASP 383 384 384 ASP ASP A . n 
A 1 384 TRP 384 385 385 TRP TRP A . n 
A 1 385 LEU 385 386 386 LEU LEU A . n 
A 1 386 HIS 386 387 387 HIS HIS A . n 
A 1 387 PRO 387 388 388 PRO PRO A . n 
A 1 388 GLU 388 389 389 GLU GLU A . n 
A 1 389 ASP 389 390 390 ASP ASP A . n 
A 1 390 PRO 390 391 391 PRO PRO A . n 
A 1 391 ALA 391 392 392 ALA ALA A . n 
A 1 392 ARG 392 393 393 ARG ARG A . n 
A 1 393 LEU 393 394 394 LEU LEU A . n 
A 1 394 ARG 394 395 395 ARG ARG A . n 
A 1 395 GLU 395 396 396 GLU GLU A . n 
A 1 396 ALA 396 397 397 ALA ALA A . n 
A 1 397 LEU 397 398 398 LEU LEU A . n 
A 1 398 SER 398 399 399 SER SER A . n 
A 1 399 ASP 399 400 400 ASP ASP A . n 
A 1 400 VAL 400 401 401 VAL VAL A . n 
A 1 401 VAL 401 402 402 VAL VAL A . n 
A 1 402 GLY 402 403 403 GLY GLY A . n 
A 1 403 ASP 403 404 404 ASP ASP A . n 
A 1 404 HIS 404 405 405 HIS HIS A . n 
A 1 405 ASN 405 406 406 ASN ASN A . n 
A 1 406 VAL 406 407 407 VAL VAL A . n 
A 1 407 VAL 407 408 408 VAL VAL A . n 
A 1 408 CYS 408 409 409 CYS CYS A . n 
A 1 409 PRO 409 410 410 PRO PRO A . n 
A 1 410 VAL 410 411 411 VAL VAL A . n 
A 1 411 ALA 411 412 412 ALA ALA A . n 
A 1 412 GLN 412 413 413 GLN GLN A . n 
A 1 413 LEU 413 414 414 LEU LEU A . n 
A 1 414 ALA 414 415 415 ALA ALA A . n 
A 1 415 GLY 415 416 416 GLY GLY A . n 
A 1 416 ARG 416 417 417 ARG ARG A . n 
A 1 417 LEU 417 418 418 LEU LEU A . n 
A 1 418 ALA 418 419 419 ALA ALA A . n 
A 1 419 ALA 419 420 420 ALA ALA A . n 
A 1 420 GLN 420 421 421 GLN GLN A . n 
A 1 421 GLY 421 422 422 GLY GLY A . n 
A 1 422 ALA 422 423 423 ALA ALA A . n 
A 1 423 ARG 423 424 424 ARG ARG A . n 
A 1 424 VAL 424 425 425 VAL VAL A . n 
A 1 425 TYR 425 426 426 TYR TYR A . n 
A 1 426 ALA 426 427 427 ALA ALA A . n 
A 1 427 TYR 427 428 428 TYR TYR A . n 
A 1 428 VAL 428 429 429 VAL VAL A . n 
A 1 429 PHE 429 430 430 PHE PHE A . n 
A 1 430 GLU 430 431 431 GLU GLU A . n 
A 1 431 HIS 431 432 432 HIS HIS A . n 
A 1 432 ARG 432 433 433 ARG ARG A . n 
A 1 433 ALA 433 434 434 ALA ALA A . n 
A 1 434 SER 434 435 435 SER SER A . n 
A 1 435 THR 435 436 436 THR THR A . n 
A 1 436 LEU 436 437 437 LEU LEU A . n 
A 1 437 SER 437 438 438 SER SER A . n 
A 1 438 TRP 438 439 439 TRP TRP A . n 
A 1 439 PRO 439 440 440 PRO PRO A . n 
A 1 440 LEU 440 441 441 LEU LEU A . n 
A 1 441 TRP 441 442 442 TRP TRP A . n 
A 1 442 MET 442 443 443 MET MET A . n 
A 1 443 GLY 443 444 444 GLY GLY A . n 
A 1 444 VAL 444 445 445 VAL VAL A . n 
A 1 445 PRO 445 446 446 PRO PRO A . n 
A 1 446 HIS 446 447 447 HIS HIS A . n 
A 1 447 GLY 447 448 448 GLY GLY A . n 
A 1 448 TYR 448 449 449 TYR TYR A . n 
A 1 449 GLU 449 450 450 GLU GLU A . n 
A 1 450 ILE 450 451 451 ILE ILE A . n 
A 1 451 GLU 451 452 452 GLU GLU A . n 
A 1 452 PHE 452 453 453 PHE PHE A . n 
A 1 453 ILE 453 454 454 ILE ILE A . n 
A 1 454 PHE 454 455 455 PHE PHE A . n 
A 1 455 GLY 455 456 456 GLY GLY A . n 
A 1 456 ILE 456 457 457 ILE ILE A . n 
A 1 457 PRO 457 458 458 PRO PRO A . n 
A 1 458 LEU 458 459 459 LEU LEU A . n 
A 1 459 ASP 459 460 460 ASP ASP A . n 
A 1 460 PRO 460 461 461 PRO PRO A . n 
A 1 461 SER 461 462 462 SER SER A . n 
A 1 462 ARG 462 463 463 ARG ARG A . n 
A 1 463 ASN 463 464 464 ASN ASN A . n 
A 1 464 TYR 464 465 465 TYR TYR A . n 
A 1 465 THR 465 466 466 THR THR A . n 
A 1 466 ALA 466 467 467 ALA ALA A . n 
A 1 467 GLU 467 468 468 GLU GLU A . n 
A 1 468 GLU 468 469 469 GLU GLU A . n 
A 1 469 LYS 469 470 470 LYS LYS A . n 
A 1 470 ILE 470 471 471 ILE ILE A . n 
A 1 471 PHE 471 472 472 PHE PHE A . n 
A 1 472 ALA 472 473 473 ALA ALA A . n 
A 1 473 GLN 473 474 474 GLN GLN A . n 
A 1 474 ARG 474 475 475 ARG ARG A . n 
A 1 475 LEU 475 476 476 LEU LEU A . n 
A 1 476 MET 476 477 477 MET MET A . n 
A 1 477 ARG 477 478 478 ARG ARG A . n 
A 1 478 TYR 478 479 479 TYR TYR A . n 
A 1 479 TRP 479 480 480 TRP TRP A . n 
A 1 480 ALA 480 481 481 ALA ALA A . n 
A 1 481 ASN 481 482 482 ASN ASN A . n 
A 1 482 PHE 482 483 483 PHE PHE A . n 
A 1 483 ALA 483 484 484 ALA ALA A . n 
A 1 484 ARG 484 485 485 ARG ARG A . n 
A 1 485 THR 485 486 486 THR THR A . n 
A 1 486 GLY 486 487 487 GLY GLY A . n 
A 1 487 ASP 487 488 488 ASP ASP A . n 
A 1 488 PRO 488 489 489 PRO PRO A . n 
A 1 489 ASN 489 490 490 ASN ASN A . n 
A 1 490 GLU 490 491 491 GLU GLU A . n 
A 1 491 PRO 491 492 492 PRO PRO A . n 
A 1 492 ARG 492 493 493 ARG ARG A . n 
A 1 493 ASP 493 494 494 ASP ASP A . n 
A 1 494 PRO 494 495 ?   ?   ?   A . n 
A 1 495 LYS 495 496 ?   ?   ?   A . n 
A 1 496 ALA 496 497 ?   ?   ?   A . n 
A 1 497 PRO 497 498 498 PRO PRO A . n 
A 1 498 GLN 498 499 499 GLN GLN A . n 
A 1 499 TRP 499 500 500 TRP TRP A . n 
A 1 500 PRO 500 501 501 PRO PRO A . n 
A 1 501 PRO 501 502 502 PRO PRO A . n 
A 1 502 TYR 502 503 503 TYR TYR A . n 
A 1 503 THR 503 504 504 THR THR A . n 
A 1 504 ALA 504 505 505 ALA ALA A . n 
A 1 505 GLY 505 506 506 GLY GLY A . n 
A 1 506 ALA 506 507 507 ALA ALA A . n 
A 1 507 GLN 507 508 508 GLN GLN A . n 
A 1 508 GLN 508 509 509 GLN GLN A . n 
A 1 509 TYR 509 510 510 TYR TYR A . n 
A 1 510 VAL 510 511 511 VAL VAL A . n 
A 1 511 SER 511 512 512 SER SER A . n 
A 1 512 LEU 512 513 513 LEU LEU A . n 
A 1 513 ASP 513 514 514 ASP ASP A . n 
A 1 514 LEU 514 515 515 LEU LEU A . n 
A 1 515 ARG 515 516 516 ARG ARG A . n 
A 1 516 PRO 516 517 517 PRO PRO A . n 
A 1 517 LEU 517 518 518 LEU LEU A . n 
A 1 518 GLU 518 519 519 GLU GLU A . n 
A 1 519 VAL 519 520 520 VAL VAL A . n 
A 1 520 ARG 520 521 521 ARG ARG A . n 
A 1 521 ARG 521 522 522 ARG ARG A . n 
A 1 522 GLY 522 523 523 GLY GLY A . n 
A 1 523 LEU 523 524 524 LEU LEU A . n 
A 1 524 ARG 524 525 525 ARG ARG A . n 
A 1 525 ALA 525 526 526 ALA ALA A . n 
A 1 526 GLN 526 527 527 GLN GLN A . n 
A 1 527 ALA 527 528 528 ALA ALA A . n 
A 1 528 CYS 528 529 529 CYS CYS A . n 
A 1 529 ALA 529 530 530 ALA ALA A . n 
A 1 530 PHE 530 531 531 PHE PHE A . n 
A 1 531 TRP 531 532 532 TRP TRP A . n 
A 1 532 ASN 532 533 533 ASN ASN A . n 
A 1 533 ARG 533 534 534 ARG ARG A . n 
A 1 534 PHE 534 535 535 PHE PHE A . n 
A 1 535 LEU 535 536 536 LEU LEU A . n 
A 1 536 PRO 536 537 537 PRO PRO A . n 
A 1 537 LYS 537 538 538 LYS LYS A . n 
A 1 538 LEU 538 539 539 LEU LEU A . n 
A 1 539 LEU 539 540 540 LEU LEU A . n 
A 1 540 SER 540 541 541 SER SER A . n 
A 1 541 ALA 541 542 542 ALA ALA A . n 
A 1 542 THR 542 543 ?   ?   ?   A . n 
B 1 1   GLY 1   2   ?   ?   ?   B . n 
B 1 2   ARG 2   3   ?   ?   ?   B . n 
B 1 3   GLU 3   4   4   GLU GLU B . n 
B 1 4   ASP 4   5   5   ASP ASP B . n 
B 1 5   ALA 5   6   6   ALA ALA B . n 
B 1 6   GLU 6   7   7   GLU GLU B . n 
B 1 7   LEU 7   8   8   LEU LEU B . n 
B 1 8   LEU 8   9   9   LEU LEU B . n 
B 1 9   VAL 9   10  10  VAL VAL B . n 
B 1 10  THR 10  11  11  THR THR B . n 
B 1 11  VAL 11  12  12  VAL VAL B . n 
B 1 12  ARG 12  13  13  ARG ARG B . n 
B 1 13  GLY 13  14  14  GLY GLY B . n 
B 1 14  GLY 14  15  15  GLY GLY B . n 
B 1 15  ARG 15  16  16  ARG ARG B . n 
B 1 16  LEU 16  17  17  LEU LEU B . n 
B 1 17  ARG 17  18  18  ARG ARG B . n 
B 1 18  GLY 18  19  19  GLY GLY B . n 
B 1 19  ILE 19  20  20  ILE ILE B . n 
B 1 20  ARG 20  21  21  ARG ARG B . n 
B 1 21  LEU 21  22  22  LEU LEU B . n 
B 1 22  LYS 22  23  23  LYS LYS B . n 
B 1 23  THR 23  24  24  THR THR B . n 
B 1 24  PRO 24  25  25  PRO PRO B . n 
B 1 25  GLY 25  26  26  GLY GLY B . n 
B 1 26  GLY 26  27  27  GLY GLY B . n 
B 1 27  PRO 27  28  28  PRO PRO B . n 
B 1 28  VAL 28  29  29  VAL VAL B . n 
B 1 29  SER 29  30  30  SER SER B . n 
B 1 30  ALA 30  31  31  ALA ALA B . n 
B 1 31  PHE 31  32  32  PHE PHE B . n 
B 1 32  LEU 32  33  33  LEU LEU B . n 
B 1 33  GLY 33  34  34  GLY GLY B . n 
B 1 34  ILE 34  35  35  ILE ILE B . n 
B 1 35  PRO 35  36  36  PRO PRO B . n 
B 1 36  PHE 36  37  37  PHE PHE B . n 
B 1 37  ALA 37  38  38  ALA ALA B . n 
B 1 38  GLU 38  39  39  GLU GLU B . n 
B 1 39  PRO 39  40  40  PRO PRO B . n 
B 1 40  PRO 40  41  41  PRO PRO B . n 
B 1 41  MET 41  42  42  MET MET B . n 
B 1 42  GLY 42  43  43  GLY GLY B . n 
B 1 43  PRO 43  44  44  PRO PRO B . n 
B 1 44  ARG 44  45  45  ARG ARG B . n 
B 1 45  ARG 45  46  46  ARG ARG B . n 
B 1 46  PHE 46  47  47  PHE PHE B . n 
B 1 47  LEU 47  48  48  LEU LEU B . n 
B 1 48  PRO 48  49  49  PRO PRO B . n 
B 1 49  PRO 49  50  50  PRO PRO B . n 
B 1 50  GLU 50  51  51  GLU GLU B . n 
B 1 51  PRO 51  52  52  PRO PRO B . n 
B 1 52  LYS 52  53  53  LYS LYS B . n 
B 1 53  GLN 53  54  54  GLN GLN B . n 
B 1 54  PRO 54  55  55  PRO PRO B . n 
B 1 55  TRP 55  56  56  TRP TRP B . n 
B 1 56  SER 56  57  57  SER SER B . n 
B 1 57  GLY 57  58  58  GLY GLY B . n 
B 1 58  VAL 58  59  59  VAL VAL B . n 
B 1 59  VAL 59  60  60  VAL VAL B . n 
B 1 60  ASP 60  61  61  ASP ASP B . n 
B 1 61  ALA 61  62  62  ALA ALA B . n 
B 1 62  THR 62  63  63  THR THR B . n 
B 1 63  THR 63  64  64  THR THR B . n 
B 1 64  PHE 64  65  65  PHE PHE B . n 
B 1 65  GLN 65  66  66  GLN GLN B . n 
B 1 66  SER 66  67  67  SER SER B . n 
B 1 67  VAL 67  68  68  VAL VAL B . n 
B 1 68  CYS 68  69  69  CYS CYS B . n 
B 1 69  TYR 69  70  70  TYR TYR B . n 
B 1 70  GLN 70  71  71  GLN GLN B . n 
B 1 71  TYR 71  72  72  TYR TYR B . n 
B 1 72  VAL 72  73  73  VAL VAL B . n 
B 1 73  ASP 73  74  74  ASP ASP B . n 
B 1 74  THR 74  75  75  THR THR B . n 
B 1 75  LEU 75  76  76  LEU LEU B . n 
B 1 76  TYR 76  77  77  TYR TYR B . n 
B 1 77  PRO 77  78  78  PRO PRO B . n 
B 1 78  GLY 78  79  79  GLY GLY B . n 
B 1 79  PHE 79  80  80  PHE PHE B . n 
B 1 80  GLU 80  81  81  GLU GLU B . n 
B 1 81  GLY 81  82  82  GLY GLY B . n 
B 1 82  THR 82  83  83  THR THR B . n 
B 1 83  GLU 83  84  84  GLU GLU B . n 
B 1 84  MET 84  85  85  MET MET B . n 
B 1 85  TRP 85  86  86  TRP TRP B . n 
B 1 86  ASN 86  87  87  ASN ASN B . n 
B 1 87  PRO 87  88  88  PRO PRO B . n 
B 1 88  ASN 88  89  89  ASN ASN B . n 
B 1 89  ARG 89  90  90  ARG ARG B . n 
B 1 90  GLU 90  91  91  GLU GLU B . n 
B 1 91  LEU 91  92  92  LEU LEU B . n 
B 1 92  SER 92  93  93  SER SER B . n 
B 1 93  GLU 93  94  94  GLU GLU B . n 
B 1 94  ASP 94  95  95  ASP ASP B . n 
B 1 95  CYS 95  96  96  CYS CYS B . n 
B 1 96  LEU 96  97  97  LEU LEU B . n 
B 1 97  TYR 97  98  98  TYR TYR B . n 
B 1 98  LEU 98  99  99  LEU LEU B . n 
B 1 99  ASN 99  100 100 ASN ASN B . n 
B 1 100 VAL 100 101 101 VAL VAL B . n 
B 1 101 TRP 101 102 102 TRP TRP B . n 
B 1 102 THR 102 103 103 THR THR B . n 
B 1 103 PRO 103 104 104 PRO PRO B . n 
B 1 104 TYR 104 105 105 TYR TYR B . n 
B 1 105 PRO 105 106 106 PRO PRO B . n 
B 1 106 ARG 106 107 107 ARG ARG B . n 
B 1 107 PRO 107 108 108 PRO PRO B . n 
B 1 108 THR 108 109 109 THR THR B . n 
B 1 109 SER 109 110 110 SER SER B . n 
B 1 110 PRO 110 111 111 PRO PRO B . n 
B 1 111 THR 111 112 112 THR THR B . n 
B 1 112 PRO 112 113 113 PRO PRO B . n 
B 1 113 VAL 113 114 114 VAL VAL B . n 
B 1 114 LEU 114 115 115 LEU LEU B . n 
B 1 115 VAL 115 116 116 VAL VAL B . n 
B 1 116 TRP 116 117 117 TRP TRP B . n 
B 1 117 ILE 117 118 118 ILE ILE B . n 
B 1 118 TYR 118 119 119 TYR TYR B . n 
B 1 119 GLY 119 120 120 GLY GLY B . n 
B 1 120 GLY 120 121 121 GLY GLY B . n 
B 1 121 GLY 121 122 122 GLY GLY B . n 
B 1 122 PHE 122 123 123 PHE PHE B . n 
B 1 123 TYR 123 124 124 TYR TYR B . n 
B 1 124 SER 124 125 125 SER SER B . n 
B 1 125 GLY 125 126 126 GLY GLY B . n 
B 1 126 ALA 126 127 127 ALA ALA B . n 
B 1 127 SER 127 128 128 SER SER B . n 
B 1 128 SER 128 129 129 SER SER B . n 
B 1 129 LEU 129 130 130 LEU LEU B . n 
B 1 130 ASP 130 131 131 ASP ASP B . n 
B 1 131 VAL 131 132 132 VAL VAL B . n 
B 1 132 TYR 132 133 133 TYR TYR B . n 
B 1 133 ASP 133 134 134 ASP ASP B . n 
B 1 134 GLY 134 135 135 GLY GLY B . n 
B 1 135 ARG 135 136 136 ARG ARG B . n 
B 1 136 PHE 136 137 137 PHE PHE B . n 
B 1 137 LEU 137 138 138 LEU LEU B . n 
B 1 138 VAL 138 139 139 VAL VAL B . n 
B 1 139 GLN 139 140 140 GLN GLN B . n 
B 1 140 ALA 140 141 141 ALA ALA B . n 
B 1 141 GLU 141 142 142 GLU GLU B . n 
B 1 142 ARG 142 143 143 ARG ARG B . n 
B 1 143 THR 143 144 144 THR THR B . n 
B 1 144 VAL 144 145 145 VAL VAL B . n 
B 1 145 LEU 145 146 146 LEU LEU B . n 
B 1 146 VAL 146 147 147 VAL VAL B . n 
B 1 147 SER 147 148 148 SER SER B . n 
B 1 148 MET 148 149 149 MET MET B . n 
B 1 149 ASN 149 150 150 ASN ASN B . n 
B 1 150 TYR 150 151 151 TYR TYR B . n 
B 1 151 ARG 151 152 152 ARG ARG B . n 
B 1 152 VAL 152 153 153 VAL VAL B . n 
B 1 153 GLY 153 154 154 GLY GLY B . n 
B 1 154 ALA 154 155 155 ALA ALA B . n 
B 1 155 PHE 155 156 156 PHE PHE B . n 
B 1 156 GLY 156 157 157 GLY GLY B . n 
B 1 157 PHE 157 158 158 PHE PHE B . n 
B 1 158 LEU 158 159 159 LEU LEU B . n 
B 1 159 ALA 159 160 160 ALA ALA B . n 
B 1 160 LEU 160 161 161 LEU LEU B . n 
B 1 161 PRO 161 162 162 PRO PRO B . n 
B 1 162 GLY 162 163 163 GLY GLY B . n 
B 1 163 SER 163 164 164 SER SER B . n 
B 1 164 ARG 164 165 165 ARG ARG B . n 
B 1 165 GLU 165 166 166 GLU GLU B . n 
B 1 166 ALA 166 167 167 ALA ALA B . n 
B 1 167 PRO 167 168 168 PRO PRO B . n 
B 1 168 GLY 168 169 169 GLY GLY B . n 
B 1 169 ASN 169 170 170 ASN ASN B . n 
B 1 170 VAL 170 171 171 VAL VAL B . n 
B 1 171 GLY 171 172 172 GLY GLY B . n 
B 1 172 LEU 172 173 173 LEU LEU B . n 
B 1 173 LEU 173 174 174 LEU LEU B . n 
B 1 174 ASP 174 175 175 ASP ASP B . n 
B 1 175 GLN 175 176 176 GLN GLN B . n 
B 1 176 ARG 176 177 177 ARG ARG B . n 
B 1 177 LEU 177 178 178 LEU LEU B . n 
B 1 178 ALA 178 179 179 ALA ALA B . n 
B 1 179 LEU 179 180 180 LEU LEU B . n 
B 1 180 GLN 180 181 181 GLN GLN B . n 
B 1 181 TRP 181 182 182 TRP TRP B . n 
B 1 182 VAL 182 183 183 VAL VAL B . n 
B 1 183 GLN 183 184 184 GLN GLN B . n 
B 1 184 GLU 184 185 185 GLU GLU B . n 
B 1 185 ASN 185 186 186 ASN ASN B . n 
B 1 186 VAL 186 187 187 VAL VAL B . n 
B 1 187 ALA 187 188 188 ALA ALA B . n 
B 1 188 ALA 188 189 189 ALA ALA B . n 
B 1 189 PHE 189 190 190 PHE PHE B . n 
B 1 190 GLY 190 191 191 GLY GLY B . n 
B 1 191 GLY 191 192 192 GLY GLY B . n 
B 1 192 ASP 192 193 193 ASP ASP B . n 
B 1 193 PRO 193 194 194 PRO PRO B . n 
B 1 194 THR 194 195 195 THR THR B . n 
B 1 195 SER 195 196 196 SER SER B . n 
B 1 196 VAL 196 197 197 VAL VAL B . n 
B 1 197 THR 197 198 198 THR THR B . n 
B 1 198 LEU 198 199 199 LEU LEU B . n 
B 1 199 PHE 199 200 200 PHE PHE B . n 
B 1 200 GLY 200 201 201 GLY GLY B . n 
B 1 201 GLU 201 202 202 GLU GLU B . n 
B 1 202 SER 202 203 203 SER SER B . n 
B 1 203 ALA 203 204 204 ALA ALA B . n 
B 1 204 GLY 204 205 205 GLY GLY B . n 
B 1 205 ALA 205 206 206 ALA ALA B . n 
B 1 206 ALA 206 207 207 ALA ALA B . n 
B 1 207 SER 207 208 208 SER SER B . n 
B 1 208 VAL 208 209 209 VAL VAL B . n 
B 1 209 GLY 209 210 210 GLY GLY B . n 
B 1 210 MET 210 211 211 MET MET B . n 
B 1 211 HIS 211 212 212 HIS HIS B . n 
B 1 212 LEU 212 213 213 LEU LEU B . n 
B 1 213 LEU 213 214 214 LEU LEU B . n 
B 1 214 SER 214 215 215 SER SER B . n 
B 1 215 PRO 215 216 216 PRO PRO B . n 
B 1 216 PRO 216 217 217 PRO PRO B . n 
B 1 217 SER 217 218 218 SER SER B . n 
B 1 218 ARG 218 219 219 ARG ARG B . n 
B 1 219 GLY 219 220 220 GLY GLY B . n 
B 1 220 LEU 220 221 221 LEU LEU B . n 
B 1 221 PHE 221 222 222 PHE PHE B . n 
B 1 222 HIS 222 223 223 HIS HIS B . n 
B 1 223 ARG 223 224 224 ARG ARG B . n 
B 1 224 ALA 224 225 225 ALA ALA B . n 
B 1 225 VAL 225 226 226 VAL VAL B . n 
B 1 226 LEU 226 227 227 LEU LEU B . n 
B 1 227 GLN 227 228 228 GLN GLN B . n 
B 1 228 SER 228 229 229 SER SER B . n 
B 1 229 GLY 229 230 230 GLY GLY B . n 
B 1 230 ALA 230 231 231 ALA ALA B . n 
B 1 231 PRO 231 232 232 PRO PRO B . n 
B 1 232 ASN 232 233 233 ASN ASN B . n 
B 1 233 GLY 233 234 234 GLY GLY B . n 
B 1 234 PRO 234 235 235 PRO PRO B . n 
B 1 235 TRP 235 236 236 TRP TRP B . n 
B 1 236 ALA 236 237 237 ALA ALA B . n 
B 1 237 THR 237 238 238 THR THR B . n 
B 1 238 VAL 238 239 239 VAL VAL B . n 
B 1 239 GLY 239 240 240 GLY GLY B . n 
B 1 240 MET 240 241 241 MET MET B . n 
B 1 241 GLY 241 242 242 GLY GLY B . n 
B 1 242 GLU 242 243 243 GLU GLU B . n 
B 1 243 ALA 243 244 244 ALA ALA B . n 
B 1 244 ARG 244 245 245 ARG ARG B . n 
B 1 245 ARG 245 246 246 ARG ARG B . n 
B 1 246 ARG 246 247 247 ARG ARG B . n 
B 1 247 ALA 247 248 248 ALA ALA B . n 
B 1 248 THR 248 249 249 THR THR B . n 
B 1 249 GLN 249 250 250 GLN GLN B . n 
B 1 250 LEU 250 251 251 LEU LEU B . n 
B 1 251 ALA 251 252 252 ALA ALA B . n 
B 1 252 HIS 252 253 253 HIS HIS B . n 
B 1 253 LEU 253 254 254 LEU LEU B . n 
B 1 254 VAL 254 255 255 VAL VAL B . n 
B 1 255 GLY 255 256 256 GLY GLY B . n 
B 1 256 CYS 256 257 257 CYS CYS B . n 
B 1 257 PRO 257 258 258 PRO PRO B . n 
B 1 258 PRO 258 259 259 PRO PRO B . n 
B 1 259 GLY 259 260 ?   ?   ?   B . n 
B 1 260 GLY 260 261 ?   ?   ?   B . n 
B 1 261 THR 261 262 262 THR THR B . n 
B 1 262 GLY 262 263 263 GLY GLY B . n 
B 1 263 GLY 263 264 264 GLY GLY B . n 
B 1 264 ASN 264 265 265 ASN ASN B . n 
B 1 265 ASP 265 266 266 ASP ASP B . n 
B 1 266 THR 266 267 267 THR THR B . n 
B 1 267 GLU 267 268 268 GLU GLU B . n 
B 1 268 LEU 268 269 269 LEU LEU B . n 
B 1 269 VAL 269 270 270 VAL VAL B . n 
B 1 270 ALA 270 271 271 ALA ALA B . n 
B 1 271 CYS 271 272 272 CYS CYS B . n 
B 1 272 LEU 272 273 273 LEU LEU B . n 
B 1 273 ARG 273 274 274 ARG ARG B . n 
B 1 274 THR 274 275 275 THR THR B . n 
B 1 275 ARG 275 276 276 ARG ARG B . n 
B 1 276 PRO 276 277 277 PRO PRO B . n 
B 1 277 ALA 277 278 278 ALA ALA B . n 
B 1 278 GLN 278 279 279 GLN GLN B . n 
B 1 279 VAL 279 280 280 VAL VAL B . n 
B 1 280 LEU 280 281 281 LEU LEU B . n 
B 1 281 VAL 281 282 282 VAL VAL B . n 
B 1 282 ASN 282 283 283 ASN ASN B . n 
B 1 283 HIS 283 284 284 HIS HIS B . n 
B 1 284 GLU 284 285 285 GLU GLU B . n 
B 1 285 TRP 285 286 286 TRP TRP B . n 
B 1 286 HIS 286 287 287 HIS HIS B . n 
B 1 287 VAL 287 288 288 VAL VAL B . n 
B 1 288 LEU 288 289 289 LEU LEU B . n 
B 1 289 PRO 289 290 290 PRO PRO B . n 
B 1 290 GLN 290 291 291 GLN GLN B . n 
B 1 291 GLU 291 292 292 GLU GLU B . n 
B 1 292 SER 292 293 293 SER SER B . n 
B 1 293 VAL 293 294 294 VAL VAL B . n 
B 1 294 PHE 294 295 295 PHE PHE B . n 
B 1 295 ARG 295 296 296 ARG ARG B . n 
B 1 296 PHE 296 297 297 PHE PHE B . n 
B 1 297 SER 297 298 298 SER SER B . n 
B 1 298 PHE 298 299 299 PHE PHE B . n 
B 1 299 VAL 299 300 300 VAL VAL B . n 
B 1 300 PRO 300 301 301 PRO PRO B . n 
B 1 301 VAL 301 302 302 VAL VAL B . n 
B 1 302 VAL 302 303 303 VAL VAL B . n 
B 1 303 ASP 303 304 304 ASP ASP B . n 
B 1 304 GLY 304 305 305 GLY GLY B . n 
B 1 305 ASP 305 306 306 ASP ASP B . n 
B 1 306 PHE 306 307 307 PHE PHE B . n 
B 1 307 LEU 307 308 308 LEU LEU B . n 
B 1 308 SER 308 309 309 SER SER B . n 
B 1 309 ASP 309 310 310 ASP ASP B . n 
B 1 310 THR 310 311 311 THR THR B . n 
B 1 311 PRO 311 312 312 PRO PRO B . n 
B 1 312 GLU 312 313 313 GLU GLU B . n 
B 1 313 ALA 313 314 314 ALA ALA B . n 
B 1 314 LEU 314 315 315 LEU LEU B . n 
B 1 315 ILE 315 316 316 ILE ILE B . n 
B 1 316 ASN 316 317 317 ASN ASN B . n 
B 1 317 ALA 317 318 318 ALA ALA B . n 
B 1 318 GLY 318 319 319 GLY GLY B . n 
B 1 319 ASP 319 320 320 ASP ASP B . n 
B 1 320 PHE 320 321 321 PHE PHE B . n 
B 1 321 HIS 321 322 322 HIS HIS B . n 
B 1 322 GLY 322 323 323 GLY GLY B . n 
B 1 323 LEU 323 324 324 LEU LEU B . n 
B 1 324 GLN 324 325 325 GLN GLN B . n 
B 1 325 VAL 325 326 326 VAL VAL B . n 
B 1 326 LEU 326 327 327 LEU LEU B . n 
B 1 327 VAL 327 328 328 VAL VAL B . n 
B 1 328 GLY 328 329 329 GLY GLY B . n 
B 1 329 VAL 329 330 330 VAL VAL B . n 
B 1 330 VAL 330 331 331 VAL VAL B . n 
B 1 331 LYS 331 332 332 LYS LYS B . n 
B 1 332 ASP 332 333 333 ASP ASP B . n 
B 1 333 GLU 333 334 334 GLU GLU B . n 
B 1 334 GLY 334 335 335 GLY GLY B . n 
B 1 335 SER 335 336 336 SER SER B . n 
B 1 336 TYR 336 337 337 TYR TYR B . n 
B 1 337 PHE 337 338 338 PHE PHE B . n 
B 1 338 LEU 338 339 339 LEU LEU B . n 
B 1 339 VAL 339 340 340 VAL VAL B . n 
B 1 340 TYR 340 341 341 TYR TYR B . n 
B 1 341 GLY 341 342 342 GLY GLY B . n 
B 1 342 ALA 342 343 343 ALA ALA B . n 
B 1 343 PRO 343 344 344 PRO PRO B . n 
B 1 344 GLY 344 345 345 GLY GLY B . n 
B 1 345 PHE 345 346 346 PHE PHE B . n 
B 1 346 SER 346 347 347 SER SER B . n 
B 1 347 LYS 347 348 348 LYS LYS B . n 
B 1 348 ASP 348 349 349 ASP ASP B . n 
B 1 349 ASN 349 350 350 ASN ASN B . n 
B 1 350 GLU 350 351 351 GLU GLU B . n 
B 1 351 SER 351 352 352 SER SER B . n 
B 1 352 LEU 352 353 353 LEU LEU B . n 
B 1 353 ILE 353 354 354 ILE ILE B . n 
B 1 354 SER 354 355 355 SER SER B . n 
B 1 355 ARG 355 356 356 ARG ARG B . n 
B 1 356 ALA 356 357 357 ALA ALA B . n 
B 1 357 GLU 357 358 358 GLU GLU B . n 
B 1 358 PHE 358 359 359 PHE PHE B . n 
B 1 359 LEU 359 360 360 LEU LEU B . n 
B 1 360 ALA 360 361 361 ALA ALA B . n 
B 1 361 GLY 361 362 362 GLY GLY B . n 
B 1 362 VAL 362 363 363 VAL VAL B . n 
B 1 363 ARG 363 364 364 ARG ARG B . n 
B 1 364 VAL 364 365 365 VAL VAL B . n 
B 1 365 GLY 365 366 366 GLY GLY B . n 
B 1 366 VAL 366 367 367 VAL VAL B . n 
B 1 367 PRO 367 368 368 PRO PRO B . n 
B 1 368 GLN 368 369 369 GLN GLN B . n 
B 1 369 VAL 369 370 370 VAL VAL B . n 
B 1 370 SER 370 371 371 SER SER B . n 
B 1 371 ASP 371 372 372 ASP ASP B . n 
B 1 372 LEU 372 373 373 LEU LEU B . n 
B 1 373 ALA 373 374 374 ALA ALA B . n 
B 1 374 ALA 374 375 375 ALA ALA B . n 
B 1 375 GLU 375 376 376 GLU GLU B . n 
B 1 376 ALA 376 377 377 ALA ALA B . n 
B 1 377 VAL 377 378 378 VAL VAL B . n 
B 1 378 VAL 378 379 379 VAL VAL B . n 
B 1 379 LEU 379 380 380 LEU LEU B . n 
B 1 380 HIS 380 381 381 HIS HIS B . n 
B 1 381 TYR 381 382 382 TYR TYR B . n 
B 1 382 THR 382 383 383 THR THR B . n 
B 1 383 ASP 383 384 384 ASP ASP B . n 
B 1 384 TRP 384 385 385 TRP TRP B . n 
B 1 385 LEU 385 386 386 LEU LEU B . n 
B 1 386 HIS 386 387 387 HIS HIS B . n 
B 1 387 PRO 387 388 388 PRO PRO B . n 
B 1 388 GLU 388 389 389 GLU GLU B . n 
B 1 389 ASP 389 390 390 ASP ASP B . n 
B 1 390 PRO 390 391 391 PRO PRO B . n 
B 1 391 ALA 391 392 392 ALA ALA B . n 
B 1 392 ARG 392 393 393 ARG ARG B . n 
B 1 393 LEU 393 394 394 LEU LEU B . n 
B 1 394 ARG 394 395 395 ARG ARG B . n 
B 1 395 GLU 395 396 396 GLU GLU B . n 
B 1 396 ALA 396 397 397 ALA ALA B . n 
B 1 397 LEU 397 398 398 LEU LEU B . n 
B 1 398 SER 398 399 399 SER SER B . n 
B 1 399 ASP 399 400 400 ASP ASP B . n 
B 1 400 VAL 400 401 401 VAL VAL B . n 
B 1 401 VAL 401 402 402 VAL VAL B . n 
B 1 402 GLY 402 403 403 GLY GLY B . n 
B 1 403 ASP 403 404 404 ASP ASP B . n 
B 1 404 HIS 404 405 405 HIS HIS B . n 
B 1 405 ASN 405 406 406 ASN ASN B . n 
B 1 406 VAL 406 407 407 VAL VAL B . n 
B 1 407 VAL 407 408 408 VAL VAL B . n 
B 1 408 CYS 408 409 409 CYS CYS B . n 
B 1 409 PRO 409 410 410 PRO PRO B . n 
B 1 410 VAL 410 411 411 VAL VAL B . n 
B 1 411 ALA 411 412 412 ALA ALA B . n 
B 1 412 GLN 412 413 413 GLN GLN B . n 
B 1 413 LEU 413 414 414 LEU LEU B . n 
B 1 414 ALA 414 415 415 ALA ALA B . n 
B 1 415 GLY 415 416 416 GLY GLY B . n 
B 1 416 ARG 416 417 417 ARG ARG B . n 
B 1 417 LEU 417 418 418 LEU LEU B . n 
B 1 418 ALA 418 419 419 ALA ALA B . n 
B 1 419 ALA 419 420 420 ALA ALA B . n 
B 1 420 GLN 420 421 421 GLN GLN B . n 
B 1 421 GLY 421 422 422 GLY GLY B . n 
B 1 422 ALA 422 423 423 ALA ALA B . n 
B 1 423 ARG 423 424 424 ARG ARG B . n 
B 1 424 VAL 424 425 425 VAL VAL B . n 
B 1 425 TYR 425 426 426 TYR TYR B . n 
B 1 426 ALA 426 427 427 ALA ALA B . n 
B 1 427 TYR 427 428 428 TYR TYR B . n 
B 1 428 VAL 428 429 429 VAL VAL B . n 
B 1 429 PHE 429 430 430 PHE PHE B . n 
B 1 430 GLU 430 431 431 GLU GLU B . n 
B 1 431 HIS 431 432 432 HIS HIS B . n 
B 1 432 ARG 432 433 433 ARG ARG B . n 
B 1 433 ALA 433 434 434 ALA ALA B . n 
B 1 434 SER 434 435 435 SER SER B . n 
B 1 435 THR 435 436 436 THR THR B . n 
B 1 436 LEU 436 437 437 LEU LEU B . n 
B 1 437 SER 437 438 438 SER SER B . n 
B 1 438 TRP 438 439 439 TRP TRP B . n 
B 1 439 PRO 439 440 440 PRO PRO B . n 
B 1 440 LEU 440 441 441 LEU LEU B . n 
B 1 441 TRP 441 442 442 TRP TRP B . n 
B 1 442 MET 442 443 443 MET MET B . n 
B 1 443 GLY 443 444 444 GLY GLY B . n 
B 1 444 VAL 444 445 445 VAL VAL B . n 
B 1 445 PRO 445 446 446 PRO PRO B . n 
B 1 446 HIS 446 447 447 HIS HIS B . n 
B 1 447 GLY 447 448 448 GLY GLY B . n 
B 1 448 TYR 448 449 449 TYR TYR B . n 
B 1 449 GLU 449 450 450 GLU GLU B . n 
B 1 450 ILE 450 451 451 ILE ILE B . n 
B 1 451 GLU 451 452 452 GLU GLU B . n 
B 1 452 PHE 452 453 453 PHE PHE B . n 
B 1 453 ILE 453 454 454 ILE ILE B . n 
B 1 454 PHE 454 455 455 PHE PHE B . n 
B 1 455 GLY 455 456 456 GLY GLY B . n 
B 1 456 ILE 456 457 457 ILE ILE B . n 
B 1 457 PRO 457 458 458 PRO PRO B . n 
B 1 458 LEU 458 459 459 LEU LEU B . n 
B 1 459 ASP 459 460 460 ASP ASP B . n 
B 1 460 PRO 460 461 461 PRO PRO B . n 
B 1 461 SER 461 462 462 SER SER B . n 
B 1 462 ARG 462 463 463 ARG ARG B . n 
B 1 463 ASN 463 464 464 ASN ASN B . n 
B 1 464 TYR 464 465 465 TYR TYR B . n 
B 1 465 THR 465 466 466 THR THR B . n 
B 1 466 ALA 466 467 467 ALA ALA B . n 
B 1 467 GLU 467 468 468 GLU GLU B . n 
B 1 468 GLU 468 469 469 GLU GLU B . n 
B 1 469 LYS 469 470 470 LYS LYS B . n 
B 1 470 ILE 470 471 471 ILE ILE B . n 
B 1 471 PHE 471 472 472 PHE PHE B . n 
B 1 472 ALA 472 473 473 ALA ALA B . n 
B 1 473 GLN 473 474 474 GLN GLN B . n 
B 1 474 ARG 474 475 475 ARG ARG B . n 
B 1 475 LEU 475 476 476 LEU LEU B . n 
B 1 476 MET 476 477 477 MET MET B . n 
B 1 477 ARG 477 478 478 ARG ARG B . n 
B 1 478 TYR 478 479 479 TYR TYR B . n 
B 1 479 TRP 479 480 480 TRP TRP B . n 
B 1 480 ALA 480 481 481 ALA ALA B . n 
B 1 481 ASN 481 482 482 ASN ASN B . n 
B 1 482 PHE 482 483 483 PHE PHE B . n 
B 1 483 ALA 483 484 484 ALA ALA B . n 
B 1 484 ARG 484 485 485 ARG ARG B . n 
B 1 485 THR 485 486 486 THR THR B . n 
B 1 486 GLY 486 487 487 GLY GLY B . n 
B 1 487 ASP 487 488 488 ASP ASP B . n 
B 1 488 PRO 488 489 489 PRO PRO B . n 
B 1 489 ASN 489 490 490 ASN ASN B . n 
B 1 490 GLU 490 491 491 GLU GLU B . n 
B 1 491 PRO 491 492 492 PRO PRO B . n 
B 1 492 ARG 492 493 ?   ?   ?   B . n 
B 1 493 ASP 493 494 ?   ?   ?   B . n 
B 1 494 PRO 494 495 ?   ?   ?   B . n 
B 1 495 LYS 495 496 ?   ?   ?   B . n 
B 1 496 ALA 496 497 497 ALA ALA B . n 
B 1 497 PRO 497 498 498 PRO PRO B . n 
B 1 498 GLN 498 499 499 GLN GLN B . n 
B 1 499 TRP 499 500 500 TRP TRP B . n 
B 1 500 PRO 500 501 501 PRO PRO B . n 
B 1 501 PRO 501 502 502 PRO PRO B . n 
B 1 502 TYR 502 503 503 TYR TYR B . n 
B 1 503 THR 503 504 504 THR THR B . n 
B 1 504 ALA 504 505 505 ALA ALA B . n 
B 1 505 GLY 505 506 506 GLY GLY B . n 
B 1 506 ALA 506 507 507 ALA ALA B . n 
B 1 507 GLN 507 508 508 GLN GLN B . n 
B 1 508 GLN 508 509 509 GLN GLN B . n 
B 1 509 TYR 509 510 510 TYR TYR B . n 
B 1 510 VAL 510 511 511 VAL VAL B . n 
B 1 511 SER 511 512 512 SER SER B . n 
B 1 512 LEU 512 513 513 LEU LEU B . n 
B 1 513 ASP 513 514 514 ASP ASP B . n 
B 1 514 LEU 514 515 515 LEU LEU B . n 
B 1 515 ARG 515 516 516 ARG ARG B . n 
B 1 516 PRO 516 517 517 PRO PRO B . n 
B 1 517 LEU 517 518 518 LEU LEU B . n 
B 1 518 GLU 518 519 519 GLU GLU B . n 
B 1 519 VAL 519 520 520 VAL VAL B . n 
B 1 520 ARG 520 521 521 ARG ARG B . n 
B 1 521 ARG 521 522 522 ARG ARG B . n 
B 1 522 GLY 522 523 523 GLY GLY B . n 
B 1 523 LEU 523 524 524 LEU LEU B . n 
B 1 524 ARG 524 525 525 ARG ARG B . n 
B 1 525 ALA 525 526 526 ALA ALA B . n 
B 1 526 GLN 526 527 527 GLN GLN B . n 
B 1 527 ALA 527 528 528 ALA ALA B . n 
B 1 528 CYS 528 529 529 CYS CYS B . n 
B 1 529 ALA 529 530 530 ALA ALA B . n 
B 1 530 PHE 530 531 531 PHE PHE B . n 
B 1 531 TRP 531 532 532 TRP TRP B . n 
B 1 532 ASN 532 533 533 ASN ASN B . n 
B 1 533 ARG 533 534 534 ARG ARG B . n 
B 1 534 PHE 534 535 535 PHE PHE B . n 
B 1 535 LEU 535 536 536 LEU LEU B . n 
B 1 536 PRO 536 537 537 PRO PRO B . n 
B 1 537 LYS 537 538 538 LYS LYS B . n 
B 1 538 LEU 538 539 539 LEU LEU B . n 
B 1 539 LEU 539 540 540 LEU LEU B . n 
B 1 540 SER 540 541 541 SER SER B . n 
B 1 541 ALA 541 542 542 ALA ALA B . n 
B 1 542 THR 542 543 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 DEP 1   604  1001 DEP DEP A . 
F 4 EDO 1   605  1    EDO EDO A . 
G 4 EDO 1   606  2    EDO EDO A . 
H 5 HI6 1   607  1    HI6 HI6 A . 
I 6 NAG 1   604  604  NAG NAG B . 
J 3 DEP 1   605  1001 DEP DEP B . 
K 7 PE8 1   606  608  PE8 PE8 B . 
L 4 EDO 1   607  3    EDO EDO B . 
M 4 EDO 1   608  4    EDO EDO B . 
N 8 NO3 1   609  5    NO3 NO3 B . 
O 5 HI6 1   610  2    HI6 HI6 B . 
P 9 HOH 1   701  436  HOH HOH A . 
P 9 HOH 2   702  434  HOH HOH A . 
P 9 HOH 3   703  346  HOH HOH A . 
P 9 HOH 4   704  399  HOH HOH A . 
P 9 HOH 5   705  377  HOH HOH A . 
P 9 HOH 6   706  539  HOH HOH A . 
P 9 HOH 7   707  316  HOH HOH A . 
P 9 HOH 8   708  537  HOH HOH A . 
P 9 HOH 9   709  180  HOH HOH A . 
P 9 HOH 10  710  562  HOH HOH A . 
P 9 HOH 11  711  329  HOH HOH A . 
P 9 HOH 12  712  538  HOH HOH A . 
P 9 HOH 13  713  37   HOH HOH A . 
P 9 HOH 14  714  241  HOH HOH A . 
P 9 HOH 15  715  306  HOH HOH A . 
P 9 HOH 16  716  378  HOH HOH A . 
P 9 HOH 17  717  337  HOH HOH A . 
P 9 HOH 18  718  423  HOH HOH A . 
P 9 HOH 19  719  454  HOH HOH A . 
P 9 HOH 20  720  353  HOH HOH A . 
P 9 HOH 21  721  67   HOH HOH A . 
P 9 HOH 22  722  9    HOH HOH A . 
P 9 HOH 23  723  111  HOH HOH A . 
P 9 HOH 24  724  440  HOH HOH A . 
P 9 HOH 25  725  522  HOH HOH A . 
P 9 HOH 26  726  547  HOH HOH A . 
P 9 HOH 27  727  297  HOH HOH A . 
P 9 HOH 28  728  280  HOH HOH A . 
P 9 HOH 29  729  182  HOH HOH A . 
P 9 HOH 30  730  117  HOH HOH A . 
P 9 HOH 31  731  315  HOH HOH A . 
P 9 HOH 32  732  585  HOH HOH A . 
P 9 HOH 33  733  486  HOH HOH A . 
P 9 HOH 34  734  487  HOH HOH A . 
P 9 HOH 35  735  131  HOH HOH A . 
P 9 HOH 36  736  196  HOH HOH A . 
P 9 HOH 37  737  1    HOH HOH A . 
P 9 HOH 38  738  325  HOH HOH A . 
P 9 HOH 39  739  97   HOH HOH A . 
P 9 HOH 40  740  469  HOH HOH A . 
P 9 HOH 41  741  237  HOH HOH A . 
P 9 HOH 42  742  529  HOH HOH A . 
P 9 HOH 43  743  425  HOH HOH A . 
P 9 HOH 44  744  60   HOH HOH A . 
P 9 HOH 45  745  271  HOH HOH A . 
P 9 HOH 46  746  112  HOH HOH A . 
P 9 HOH 47  747  27   HOH HOH A . 
P 9 HOH 48  748  302  HOH HOH A . 
P 9 HOH 49  749  352  HOH HOH A . 
P 9 HOH 50  750  354  HOH HOH A . 
P 9 HOH 51  751  19   HOH HOH A . 
P 9 HOH 52  752  428  HOH HOH A . 
P 9 HOH 53  753  416  HOH HOH A . 
P 9 HOH 54  754  490  HOH HOH A . 
P 9 HOH 55  755  31   HOH HOH A . 
P 9 HOH 56  756  388  HOH HOH A . 
P 9 HOH 57  757  253  HOH HOH A . 
P 9 HOH 58  758  54   HOH HOH A . 
P 9 HOH 59  759  18   HOH HOH A . 
P 9 HOH 60  760  287  HOH HOH A . 
P 9 HOH 61  761  39   HOH HOH A . 
P 9 HOH 62  762  214  HOH HOH A . 
P 9 HOH 63  763  234  HOH HOH A . 
P 9 HOH 64  764  574  HOH HOH A . 
P 9 HOH 65  765  147  HOH HOH A . 
P 9 HOH 66  766  525  HOH HOH A . 
P 9 HOH 67  767  183  HOH HOH A . 
P 9 HOH 68  768  142  HOH HOH A . 
P 9 HOH 69  769  342  HOH HOH A . 
P 9 HOH 70  770  359  HOH HOH A . 
P 9 HOH 71  771  61   HOH HOH A . 
P 9 HOH 72  772  90   HOH HOH A . 
P 9 HOH 73  773  458  HOH HOH A . 
P 9 HOH 74  774  285  HOH HOH A . 
P 9 HOH 75  775  79   HOH HOH A . 
P 9 HOH 76  776  512  HOH HOH A . 
P 9 HOH 77  777  40   HOH HOH A . 
P 9 HOH 78  778  265  HOH HOH A . 
P 9 HOH 79  779  244  HOH HOH A . 
P 9 HOH 80  780  519  HOH HOH A . 
P 9 HOH 81  781  187  HOH HOH A . 
P 9 HOH 82  782  59   HOH HOH A . 
P 9 HOH 83  783  236  HOH HOH A . 
P 9 HOH 84  784  349  HOH HOH A . 
P 9 HOH 85  785  245  HOH HOH A . 
P 9 HOH 86  786  364  HOH HOH A . 
P 9 HOH 87  787  355  HOH HOH A . 
P 9 HOH 88  788  452  HOH HOH A . 
P 9 HOH 89  789  229  HOH HOH A . 
P 9 HOH 90  790  70   HOH HOH A . 
P 9 HOH 91  791  548  HOH HOH A . 
P 9 HOH 92  792  23   HOH HOH A . 
P 9 HOH 93  793  254  HOH HOH A . 
P 9 HOH 94  794  172  HOH HOH A . 
P 9 HOH 95  795  125  HOH HOH A . 
P 9 HOH 96  796  252  HOH HOH A . 
P 9 HOH 97  797  43   HOH HOH A . 
P 9 HOH 98  798  345  HOH HOH A . 
P 9 HOH 99  799  503  HOH HOH A . 
P 9 HOH 100 800  515  HOH HOH A . 
P 9 HOH 101 801  4    HOH HOH A . 
P 9 HOH 102 802  228  HOH HOH A . 
P 9 HOH 103 803  83   HOH HOH A . 
P 9 HOH 104 804  516  HOH HOH A . 
P 9 HOH 105 805  100  HOH HOH A . 
P 9 HOH 106 806  508  HOH HOH A . 
P 9 HOH 107 807  235  HOH HOH A . 
P 9 HOH 108 808  68   HOH HOH A . 
P 9 HOH 109 809  146  HOH HOH A . 
P 9 HOH 110 810  579  HOH HOH A . 
P 9 HOH 111 811  322  HOH HOH A . 
P 9 HOH 112 812  101  HOH HOH A . 
P 9 HOH 113 813  492  HOH HOH A . 
P 9 HOH 114 814  58   HOH HOH A . 
P 9 HOH 115 815  243  HOH HOH A . 
P 9 HOH 116 816  44   HOH HOH A . 
P 9 HOH 117 817  114  HOH HOH A . 
P 9 HOH 118 818  157  HOH HOH A . 
P 9 HOH 119 819  273  HOH HOH A . 
P 9 HOH 120 820  256  HOH HOH A . 
P 9 HOH 121 821  48   HOH HOH A . 
P 9 HOH 122 822  38   HOH HOH A . 
P 9 HOH 123 823  248  HOH HOH A . 
P 9 HOH 124 824  391  HOH HOH A . 
P 9 HOH 125 825  46   HOH HOH A . 
P 9 HOH 126 826  363  HOH HOH A . 
P 9 HOH 127 827  5    HOH HOH A . 
P 9 HOH 128 828  47   HOH HOH A . 
P 9 HOH 129 829  57   HOH HOH A . 
P 9 HOH 130 830  20   HOH HOH A . 
P 9 HOH 131 831  140  HOH HOH A . 
P 9 HOH 132 832  338  HOH HOH A . 
P 9 HOH 133 833  89   HOH HOH A . 
P 9 HOH 134 834  369  HOH HOH A . 
P 9 HOH 135 835  175  HOH HOH A . 
P 9 HOH 136 836  413  HOH HOH A . 
P 9 HOH 137 837  52   HOH HOH A . 
P 9 HOH 138 838  263  HOH HOH A . 
P 9 HOH 139 839  127  HOH HOH A . 
P 9 HOH 140 840  376  HOH HOH A . 
P 9 HOH 141 841  63   HOH HOH A . 
P 9 HOH 142 842  186  HOH HOH A . 
P 9 HOH 143 843  291  HOH HOH A . 
P 9 HOH 144 844  258  HOH HOH A . 
P 9 HOH 145 845  507  HOH HOH A . 
P 9 HOH 146 846  197  HOH HOH A . 
P 9 HOH 147 847  341  HOH HOH A . 
P 9 HOH 148 848  14   HOH HOH A . 
P 9 HOH 149 849  26   HOH HOH A . 
P 9 HOH 150 850  563  HOH HOH A . 
P 9 HOH 151 851  453  HOH HOH A . 
P 9 HOH 152 852  224  HOH HOH A . 
P 9 HOH 153 853  11   HOH HOH A . 
P 9 HOH 154 854  308  HOH HOH A . 
P 9 HOH 155 855  6    HOH HOH A . 
P 9 HOH 156 856  580  HOH HOH A . 
P 9 HOH 157 857  3    HOH HOH A . 
P 9 HOH 158 858  380  HOH HOH A . 
P 9 HOH 159 859  463  HOH HOH A . 
P 9 HOH 160 860  268  HOH HOH A . 
P 9 HOH 161 861  81   HOH HOH A . 
P 9 HOH 162 862  310  HOH HOH A . 
P 9 HOH 163 863  155  HOH HOH A . 
P 9 HOH 164 864  170  HOH HOH A . 
P 9 HOH 165 865  94   HOH HOH A . 
P 9 HOH 166 866  514  HOH HOH A . 
P 9 HOH 167 867  150  HOH HOH A . 
P 9 HOH 168 868  426  HOH HOH A . 
P 9 HOH 169 869  484  HOH HOH A . 
P 9 HOH 170 870  66   HOH HOH A . 
P 9 HOH 171 871  189  HOH HOH A . 
P 9 HOH 172 872  219  HOH HOH A . 
P 9 HOH 173 873  477  HOH HOH A . 
P 9 HOH 174 874  575  HOH HOH A . 
P 9 HOH 175 875  161  HOH HOH A . 
P 9 HOH 176 876  217  HOH HOH A . 
P 9 HOH 177 877  314  HOH HOH A . 
P 9 HOH 178 878  421  HOH HOH A . 
P 9 HOH 179 879  149  HOH HOH A . 
P 9 HOH 180 880  45   HOH HOH A . 
P 9 HOH 181 881  305  HOH HOH A . 
P 9 HOH 182 882  226  HOH HOH A . 
P 9 HOH 183 883  330  HOH HOH A . 
P 9 HOH 184 884  457  HOH HOH A . 
P 9 HOH 185 885  201  HOH HOH A . 
P 9 HOH 186 886  29   HOH HOH A . 
P 9 HOH 187 887  160  HOH HOH A . 
P 9 HOH 188 888  98   HOH HOH A . 
P 9 HOH 189 889  372  HOH HOH A . 
P 9 HOH 190 890  494  HOH HOH A . 
P 9 HOH 191 891  321  HOH HOH A . 
P 9 HOH 192 892  192  HOH HOH A . 
P 9 HOH 193 893  493  HOH HOH A . 
P 9 HOH 194 894  278  HOH HOH A . 
P 9 HOH 195 895  418  HOH HOH A . 
P 9 HOH 196 896  76   HOH HOH A . 
P 9 HOH 197 897  420  HOH HOH A . 
P 9 HOH 198 898  145  HOH HOH A . 
P 9 HOH 199 899  199  HOH HOH A . 
P 9 HOH 200 900  348  HOH HOH A . 
P 9 HOH 201 901  510  HOH HOH A . 
P 9 HOH 202 902  126  HOH HOH A . 
P 9 HOH 203 903  571  HOH HOH A . 
P 9 HOH 204 904  42   HOH HOH A . 
P 9 HOH 205 905  335  HOH HOH A . 
P 9 HOH 206 906  290  HOH HOH A . 
P 9 HOH 207 907  200  HOH HOH A . 
P 9 HOH 208 908  211  HOH HOH A . 
P 9 HOH 209 909  379  HOH HOH A . 
P 9 HOH 210 910  295  HOH HOH A . 
P 9 HOH 211 911  470  HOH HOH A . 
P 9 HOH 212 912  275  HOH HOH A . 
P 9 HOH 213 913  257  HOH HOH A . 
P 9 HOH 214 914  293  HOH HOH A . 
P 9 HOH 215 915  553  HOH HOH A . 
P 9 HOH 216 916  517  HOH HOH A . 
P 9 HOH 217 917  298  HOH HOH A . 
P 9 HOH 218 918  166  HOH HOH A . 
P 9 HOH 219 919  564  HOH HOH A . 
P 9 HOH 220 920  415  HOH HOH A . 
P 9 HOH 221 921  262  HOH HOH A . 
P 9 HOH 222 922  193  HOH HOH A . 
P 9 HOH 223 923  92   HOH HOH A . 
P 9 HOH 224 924  216  HOH HOH A . 
P 9 HOH 225 925  176  HOH HOH A . 
P 9 HOH 226 926  221  HOH HOH A . 
P 9 HOH 227 927  77   HOH HOH A . 
P 9 HOH 228 928  371  HOH HOH A . 
P 9 HOH 229 929  296  HOH HOH A . 
P 9 HOH 230 930  158  HOH HOH A . 
P 9 HOH 231 931  449  HOH HOH A . 
P 9 HOH 232 932  288  HOH HOH A . 
P 9 HOH 233 933  513  HOH HOH A . 
P 9 HOH 234 934  21   HOH HOH A . 
P 9 HOH 235 935  535  HOH HOH A . 
P 9 HOH 236 936  343  HOH HOH A . 
P 9 HOH 237 937  240  HOH HOH A . 
P 9 HOH 238 938  95   HOH HOH A . 
P 9 HOH 239 939  497  HOH HOH A . 
P 9 HOH 240 940  220  HOH HOH A . 
P 9 HOH 241 941  179  HOH HOH A . 
P 9 HOH 242 942  431  HOH HOH A . 
P 9 HOH 243 943  350  HOH HOH A . 
P 9 HOH 244 944  137  HOH HOH A . 
P 9 HOH 245 945  395  HOH HOH A . 
P 9 HOH 246 946  530  HOH HOH A . 
P 9 HOH 247 947  588  HOH HOH A . 
P 9 HOH 248 948  561  HOH HOH A . 
P 9 HOH 249 949  238  HOH HOH A . 
P 9 HOH 250 950  152  HOH HOH A . 
P 9 HOH 251 951  195  HOH HOH A . 
P 9 HOH 252 952  435  HOH HOH A . 
P 9 HOH 253 953  332  HOH HOH A . 
P 9 HOH 254 954  541  HOH HOH A . 
P 9 HOH 255 955  502  HOH HOH A . 
P 9 HOH 256 956  556  HOH HOH A . 
P 9 HOH 257 957  439  HOH HOH A . 
P 9 HOH 258 958  456  HOH HOH A . 
P 9 HOH 259 959  218  HOH HOH A . 
P 9 HOH 260 960  467  HOH HOH A . 
P 9 HOH 261 961  109  HOH HOH A . 
P 9 HOH 262 962  505  HOH HOH A . 
P 9 HOH 263 963  333  HOH HOH A . 
P 9 HOH 264 964  360  HOH HOH A . 
P 9 HOH 265 965  550  HOH HOH A . 
P 9 HOH 266 966  374  HOH HOH A . 
P 9 HOH 267 967  499  HOH HOH A . 
P 9 HOH 268 968  91   HOH HOH A . 
P 9 HOH 269 969  578  HOH HOH A . 
P 9 HOH 270 970  132  HOH HOH A . 
P 9 HOH 271 971  390  HOH HOH A . 
P 9 HOH 272 972  410  HOH HOH A . 
P 9 HOH 273 973  546  HOH HOH A . 
P 9 HOH 274 974  500  HOH HOH A . 
P 9 HOH 275 975  447  HOH HOH A . 
P 9 HOH 276 976  445  HOH HOH A . 
P 9 HOH 277 977  464  HOH HOH A . 
P 9 HOH 278 978  406  HOH HOH A . 
P 9 HOH 279 979  460  HOH HOH A . 
P 9 HOH 280 980  383  HOH HOH A . 
P 9 HOH 281 981  397  HOH HOH A . 
P 9 HOH 282 982  455  HOH HOH A . 
P 9 HOH 283 983  584  HOH HOH A . 
P 9 HOH 284 984  596  HOH HOH A . 
P 9 HOH 285 985  488  HOH HOH A . 
P 9 HOH 286 986  370  HOH HOH A . 
P 9 HOH 287 987  386  HOH HOH A . 
P 9 HOH 288 988  429  HOH HOH A . 
P 9 HOH 289 989  289  HOH HOH A . 
P 9 HOH 290 990  433  HOH HOH A . 
P 9 HOH 291 991  230  HOH HOH A . 
P 9 HOH 292 992  480  HOH HOH A . 
P 9 HOH 293 993  518  HOH HOH A . 
P 9 HOH 294 994  351  HOH HOH A . 
P 9 HOH 295 995  405  HOH HOH A . 
P 9 HOH 296 996  437  HOH HOH A . 
P 9 HOH 297 997  382  HOH HOH A . 
P 9 HOH 298 998  565  HOH HOH A . 
P 9 HOH 299 999  412  HOH HOH A . 
P 9 HOH 300 1000 259  HOH HOH A . 
P 9 HOH 301 1001 324  HOH HOH A . 
P 9 HOH 302 1002 504  HOH HOH A . 
P 9 HOH 303 1003 509  HOH HOH A . 
P 9 HOH 304 1004 551  HOH HOH A . 
P 9 HOH 305 1005 422  HOH HOH A . 
P 9 HOH 306 1006 394  HOH HOH A . 
P 9 HOH 307 1007 476  HOH HOH A . 
P 9 HOH 308 1008 174  HOH HOH A . 
P 9 HOH 309 1009 272  HOH HOH A . 
P 9 HOH 310 1010 495  HOH HOH A . 
P 9 HOH 311 1011 533  HOH HOH A . 
P 9 HOH 312 1012 206  HOH HOH A . 
P 9 HOH 313 1013 528  HOH HOH A . 
P 9 HOH 314 1014 313  HOH HOH A . 
P 9 HOH 315 1015 549  HOH HOH A . 
P 9 HOH 316 1016 417  HOH HOH A . 
P 9 HOH 317 1017 478  HOH HOH A . 
P 9 HOH 318 1018 496  HOH HOH A . 
P 9 HOH 319 1019 595  HOH HOH A . 
P 9 HOH 320 1020 521  HOH HOH A . 
P 9 HOH 321 1021 402  HOH HOH A . 
P 9 HOH 322 1022 334  HOH HOH A . 
P 9 HOH 323 1023 320  HOH HOH A . 
P 9 HOH 324 1024 465  HOH HOH A . 
P 9 HOH 325 1025 576  HOH HOH A . 
P 9 HOH 326 1026 475  HOH HOH A . 
P 9 HOH 327 1027 573  HOH HOH A . 
P 9 HOH 328 1028 570  HOH HOH A . 
P 9 HOH 329 1029 545  HOH HOH A . 
P 9 HOH 330 1030 401  HOH HOH A . 
P 9 HOH 331 1031 567  HOH HOH A . 
P 9 HOH 332 1032 482  HOH HOH A . 
Q 9 HOH 1   701  432  HOH HOH B . 
Q 9 HOH 2   702  442  HOH HOH B . 
Q 9 HOH 3   703  592  HOH HOH B . 
Q 9 HOH 4   704  153  HOH HOH B . 
Q 9 HOH 5   705  84   HOH HOH B . 
Q 9 HOH 6   706  536  HOH HOH B . 
Q 9 HOH 7   707  50   HOH HOH B . 
Q 9 HOH 8   708  133  HOH HOH B . 
Q 9 HOH 9   709  307  HOH HOH B . 
Q 9 HOH 10  710  120  HOH HOH B . 
Q 9 HOH 11  711  36   HOH HOH B . 
Q 9 HOH 12  712  319  HOH HOH B . 
Q 9 HOH 13  713  328  HOH HOH B . 
Q 9 HOH 14  714  62   HOH HOH B . 
Q 9 HOH 15  715  178  HOH HOH B . 
Q 9 HOH 16  716  115  HOH HOH B . 
Q 9 HOH 17  717  74   HOH HOH B . 
Q 9 HOH 18  718  301  HOH HOH B . 
Q 9 HOH 19  719  326  HOH HOH B . 
Q 9 HOH 20  720  461  HOH HOH B . 
Q 9 HOH 21  721  167  HOH HOH B . 
Q 9 HOH 22  722  116  HOH HOH B . 
Q 9 HOH 23  723  99   HOH HOH B . 
Q 9 HOH 24  724  210  HOH HOH B . 
Q 9 HOH 25  725  55   HOH HOH B . 
Q 9 HOH 26  726  213  HOH HOH B . 
Q 9 HOH 27  727  270  HOH HOH B . 
Q 9 HOH 28  728  479  HOH HOH B . 
Q 9 HOH 29  729  572  HOH HOH B . 
Q 9 HOH 30  730  427  HOH HOH B . 
Q 9 HOH 31  731  17   HOH HOH B . 
Q 9 HOH 32  732  524  HOH HOH B . 
Q 9 HOH 33  733  10   HOH HOH B . 
Q 9 HOH 34  734  96   HOH HOH B . 
Q 9 HOH 35  735  396  HOH HOH B . 
Q 9 HOH 36  736  136  HOH HOH B . 
Q 9 HOH 37  737  56   HOH HOH B . 
Q 9 HOH 38  738  404  HOH HOH B . 
Q 9 HOH 39  739  103  HOH HOH B . 
Q 9 HOH 40  740  64   HOH HOH B . 
Q 9 HOH 41  741  51   HOH HOH B . 
Q 9 HOH 42  742  163  HOH HOH B . 
Q 9 HOH 43  743  28   HOH HOH B . 
Q 9 HOH 44  744  448  HOH HOH B . 
Q 9 HOH 45  745  300  HOH HOH B . 
Q 9 HOH 46  746  82   HOH HOH B . 
Q 9 HOH 47  747  233  HOH HOH B . 
Q 9 HOH 48  748  32   HOH HOH B . 
Q 9 HOH 49  749  148  HOH HOH B . 
Q 9 HOH 50  750  459  HOH HOH B . 
Q 9 HOH 51  751  78   HOH HOH B . 
Q 9 HOH 52  752  65   HOH HOH B . 
Q 9 HOH 53  753  88   HOH HOH B . 
Q 9 HOH 54  754  129  HOH HOH B . 
Q 9 HOH 55  755  222  HOH HOH B . 
Q 9 HOH 56  756  368  HOH HOH B . 
Q 9 HOH 57  757  171  HOH HOH B . 
Q 9 HOH 58  758  123  HOH HOH B . 
Q 9 HOH 59  759  267  HOH HOH B . 
Q 9 HOH 60  760  2    HOH HOH B . 
Q 9 HOH 61  761  471  HOH HOH B . 
Q 9 HOH 62  762  75   HOH HOH B . 
Q 9 HOH 63  763  246  HOH HOH B . 
Q 9 HOH 64  764  69   HOH HOH B . 
Q 9 HOH 65  765  113  HOH HOH B . 
Q 9 HOH 66  766  261  HOH HOH B . 
Q 9 HOH 67  767  215  HOH HOH B . 
Q 9 HOH 68  768  8    HOH HOH B . 
Q 9 HOH 69  769  597  HOH HOH B . 
Q 9 HOH 70  770  93   HOH HOH B . 
Q 9 HOH 71  771  22   HOH HOH B . 
Q 9 HOH 72  772  12   HOH HOH B . 
Q 9 HOH 73  773  408  HOH HOH B . 
Q 9 HOH 74  774  506  HOH HOH B . 
Q 9 HOH 75  775  198  HOH HOH B . 
Q 9 HOH 76  776  49   HOH HOH B . 
Q 9 HOH 77  777  16   HOH HOH B . 
Q 9 HOH 78  778  264  HOH HOH B . 
Q 9 HOH 79  779  124  HOH HOH B . 
Q 9 HOH 80  780  73   HOH HOH B . 
Q 9 HOH 81  781  119  HOH HOH B . 
Q 9 HOH 82  782  156  HOH HOH B . 
Q 9 HOH 83  783  387  HOH HOH B . 
Q 9 HOH 84  784  110  HOH HOH B . 
Q 9 HOH 85  785  279  HOH HOH B . 
Q 9 HOH 86  786  72   HOH HOH B . 
Q 9 HOH 87  787  13   HOH HOH B . 
Q 9 HOH 88  788  303  HOH HOH B . 
Q 9 HOH 89  789  151  HOH HOH B . 
Q 9 HOH 90  790  444  HOH HOH B . 
Q 9 HOH 91  791  191  HOH HOH B . 
Q 9 HOH 92  792  208  HOH HOH B . 
Q 9 HOH 93  793  223  HOH HOH B . 
Q 9 HOH 94  794  381  HOH HOH B . 
Q 9 HOH 95  795  389  HOH HOH B . 
Q 9 HOH 96  796  366  HOH HOH B . 
Q 9 HOH 97  797  106  HOH HOH B . 
Q 9 HOH 98  798  356  HOH HOH B . 
Q 9 HOH 99  799  483  HOH HOH B . 
Q 9 HOH 100 800  242  HOH HOH B . 
Q 9 HOH 101 801  188  HOH HOH B . 
Q 9 HOH 102 802  33   HOH HOH B . 
Q 9 HOH 103 803  286  HOH HOH B . 
Q 9 HOH 104 804  121  HOH HOH B . 
Q 9 HOH 105 805  15   HOH HOH B . 
Q 9 HOH 106 806  185  HOH HOH B . 
Q 9 HOH 107 807  327  HOH HOH B . 
Q 9 HOH 108 808  141  HOH HOH B . 
Q 9 HOH 109 809  276  HOH HOH B . 
Q 9 HOH 110 810  227  HOH HOH B . 
Q 9 HOH 111 811  138  HOH HOH B . 
Q 9 HOH 112 812  30   HOH HOH B . 
Q 9 HOH 113 813  441  HOH HOH B . 
Q 9 HOH 114 814  339  HOH HOH B . 
Q 9 HOH 115 815  164  HOH HOH B . 
Q 9 HOH 116 816  104  HOH HOH B . 
Q 9 HOH 117 817  534  HOH HOH B . 
Q 9 HOH 118 818  491  HOH HOH B . 
Q 9 HOH 119 819  108  HOH HOH B . 
Q 9 HOH 120 820  558  HOH HOH B . 
Q 9 HOH 121 821  25   HOH HOH B . 
Q 9 HOH 122 822  231  HOH HOH B . 
Q 9 HOH 123 823  331  HOH HOH B . 
Q 9 HOH 124 824  85   HOH HOH B . 
Q 9 HOH 125 825  375  HOH HOH B . 
Q 9 HOH 126 826  239  HOH HOH B . 
Q 9 HOH 127 827  299  HOH HOH B . 
Q 9 HOH 128 828  367  HOH HOH B . 
Q 9 HOH 129 829  35   HOH HOH B . 
Q 9 HOH 130 830  41   HOH HOH B . 
Q 9 HOH 131 831  318  HOH HOH B . 
Q 9 HOH 132 832  559  HOH HOH B . 
Q 9 HOH 133 833  542  HOH HOH B . 
Q 9 HOH 134 834  282  HOH HOH B . 
Q 9 HOH 135 835  424  HOH HOH B . 
Q 9 HOH 136 836  184  HOH HOH B . 
Q 9 HOH 137 837  207  HOH HOH B . 
Q 9 HOH 138 838  204  HOH HOH B . 
Q 9 HOH 139 839  24   HOH HOH B . 
Q 9 HOH 140 840  135  HOH HOH B . 
Q 9 HOH 141 841  362  HOH HOH B . 
Q 9 HOH 142 842  80   HOH HOH B . 
Q 9 HOH 143 843  190  HOH HOH B . 
Q 9 HOH 144 844  34   HOH HOH B . 
Q 9 HOH 145 845  531  HOH HOH B . 
Q 9 HOH 146 846  251  HOH HOH B . 
Q 9 HOH 147 847  177  HOH HOH B . 
Q 9 HOH 148 848  168  HOH HOH B . 
Q 9 HOH 149 849  159  HOH HOH B . 
Q 9 HOH 150 850  274  HOH HOH B . 
Q 9 HOH 151 851  128  HOH HOH B . 
Q 9 HOH 152 852  165  HOH HOH B . 
Q 9 HOH 153 853  194  HOH HOH B . 
Q 9 HOH 154 854  260  HOH HOH B . 
Q 9 HOH 155 855  568  HOH HOH B . 
Q 9 HOH 156 856  134  HOH HOH B . 
Q 9 HOH 157 857  520  HOH HOH B . 
Q 9 HOH 158 858  309  HOH HOH B . 
Q 9 HOH 159 859  225  HOH HOH B . 
Q 9 HOH 160 860  438  HOH HOH B . 
Q 9 HOH 161 861  162  HOH HOH B . 
Q 9 HOH 162 862  202  HOH HOH B . 
Q 9 HOH 163 863  205  HOH HOH B . 
Q 9 HOH 164 864  347  HOH HOH B . 
Q 9 HOH 165 865  411  HOH HOH B . 
Q 9 HOH 166 866  250  HOH HOH B . 
Q 9 HOH 167 867  485  HOH HOH B . 
Q 9 HOH 168 868  249  HOH HOH B . 
Q 9 HOH 169 869  7    HOH HOH B . 
Q 9 HOH 170 870  344  HOH HOH B . 
Q 9 HOH 171 871  203  HOH HOH B . 
Q 9 HOH 172 872  591  HOH HOH B . 
Q 9 HOH 173 873  87   HOH HOH B . 
Q 9 HOH 174 874  294  HOH HOH B . 
Q 9 HOH 175 875  543  HOH HOH B . 
Q 9 HOH 176 876  144  HOH HOH B . 
Q 9 HOH 177 877  154  HOH HOH B . 
Q 9 HOH 178 878  446  HOH HOH B . 
Q 9 HOH 179 879  392  HOH HOH B . 
Q 9 HOH 180 880  414  HOH HOH B . 
Q 9 HOH 181 881  393  HOH HOH B . 
Q 9 HOH 182 882  384  HOH HOH B . 
Q 9 HOH 183 883  181  HOH HOH B . 
Q 9 HOH 184 884  281  HOH HOH B . 
Q 9 HOH 185 885  336  HOH HOH B . 
Q 9 HOH 186 886  169  HOH HOH B . 
Q 9 HOH 187 887  523  HOH HOH B . 
Q 9 HOH 188 888  71   HOH HOH B . 
Q 9 HOH 189 889  283  HOH HOH B . 
Q 9 HOH 190 890  255  HOH HOH B . 
Q 9 HOH 191 891  498  HOH HOH B . 
Q 9 HOH 192 892  532  HOH HOH B . 
Q 9 HOH 193 893  122  HOH HOH B . 
Q 9 HOH 194 894  118  HOH HOH B . 
Q 9 HOH 195 895  102  HOH HOH B . 
Q 9 HOH 196 896  107  HOH HOH B . 
Q 9 HOH 197 897  409  HOH HOH B . 
Q 9 HOH 198 898  266  HOH HOH B . 
Q 9 HOH 199 899  130  HOH HOH B . 
Q 9 HOH 200 900  552  HOH HOH B . 
Q 9 HOH 201 901  554  HOH HOH B . 
Q 9 HOH 202 902  105  HOH HOH B . 
Q 9 HOH 203 903  53   HOH HOH B . 
Q 9 HOH 204 904  312  HOH HOH B . 
Q 9 HOH 205 905  173  HOH HOH B . 
Q 9 HOH 206 906  403  HOH HOH B . 
Q 9 HOH 207 907  284  HOH HOH B . 
Q 9 HOH 208 908  292  HOH HOH B . 
Q 9 HOH 209 909  212  HOH HOH B . 
Q 9 HOH 210 910  373  HOH HOH B . 
Q 9 HOH 211 911  232  HOH HOH B . 
Q 9 HOH 212 912  407  HOH HOH B . 
Q 9 HOH 213 913  317  HOH HOH B . 
Q 9 HOH 214 914  269  HOH HOH B . 
Q 9 HOH 215 915  311  HOH HOH B . 
Q 9 HOH 216 916  581  HOH HOH B . 
Q 9 HOH 217 917  489  HOH HOH B . 
Q 9 HOH 218 918  526  HOH HOH B . 
Q 9 HOH 219 919  443  HOH HOH B . 
Q 9 HOH 220 920  577  HOH HOH B . 
Q 9 HOH 221 921  451  HOH HOH B . 
Q 9 HOH 222 922  590  HOH HOH B . 
Q 9 HOH 223 923  474  HOH HOH B . 
Q 9 HOH 224 924  358  HOH HOH B . 
Q 9 HOH 225 925  586  HOH HOH B . 
Q 9 HOH 226 926  589  HOH HOH B . 
Q 9 HOH 227 927  430  HOH HOH B . 
Q 9 HOH 228 928  209  HOH HOH B . 
Q 9 HOH 229 929  450  HOH HOH B . 
Q 9 HOH 230 930  385  HOH HOH B . 
Q 9 HOH 231 931  247  HOH HOH B . 
Q 9 HOH 232 932  501  HOH HOH B . 
Q 9 HOH 233 933  582  HOH HOH B . 
Q 9 HOH 234 934  462  HOH HOH B . 
Q 9 HOH 235 935  593  HOH HOH B . 
Q 9 HOH 236 936  583  HOH HOH B . 
Q 9 HOH 237 937  566  HOH HOH B . 
Q 9 HOH 238 938  361  HOH HOH B . 
Q 9 HOH 239 939  594  HOH HOH B . 
Q 9 HOH 240 940  557  HOH HOH B . 
Q 9 HOH 241 941  143  HOH HOH B . 
Q 9 HOH 242 942  398  HOH HOH B . 
Q 9 HOH 243 943  587  HOH HOH B . 
Q 9 HOH 244 944  323  HOH HOH B . 
Q 9 HOH 245 945  419  HOH HOH B . 
Q 9 HOH 246 946  340  HOH HOH B . 
Q 9 HOH 247 947  277  HOH HOH B . 
Q 9 HOH 248 948  400  HOH HOH B . 
Q 9 HOH 249 949  304  HOH HOH B . 
Q 9 HOH 250 950  569  HOH HOH B . 
Q 9 HOH 251 951  466  HOH HOH B . 
Q 9 HOH 252 952  468  HOH HOH B . 
Q 9 HOH 253 953  540  HOH HOH B . 
Q 9 HOH 254 954  357  HOH HOH B . 
Q 9 HOH 255 955  481  HOH HOH B . 
Q 9 HOH 256 956  560  HOH HOH B . 
Q 9 HOH 257 957  544  HOH HOH B . 
Q 9 HOH 258 958  527  HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 7660  ? 
1 MORE         58    ? 
1 'SSA (A^2)'  37990 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-06-22 
2 'Structure model' 1 1 2016-08-24 
3 'Structure model' 1 2 2017-11-22 
4 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Database references'    
3 3 'Structure model' 'Derived calculations'   
4 3 'Structure model' 'Refinement description' 
5 4 'Structure model' 'Atomic model'           
6 4 'Structure model' 'Data collection'        
7 4 'Structure model' 'Derived calculations'   
8 4 'Structure model' 'Structure summary'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  3 'Structure model' citation                      
2  3 'Structure model' pdbx_struct_oper_list         
3  3 'Structure model' software                      
4  4 'Structure model' atom_site                     
5  4 'Structure model' chem_comp                     
6  4 'Structure model' entity                        
7  4 'Structure model' pdbx_branch_scheme            
8  4 'Structure model' pdbx_chem_comp_identifier     
9  4 'Structure model' pdbx_entity_branch            
10 4 'Structure model' pdbx_entity_branch_descriptor 
11 4 'Structure model' pdbx_entity_branch_link       
12 4 'Structure model' pdbx_entity_branch_list       
13 4 'Structure model' pdbx_entity_nonpoly           
14 4 'Structure model' pdbx_nonpoly_scheme           
15 4 'Structure model' pdbx_struct_assembly_gen      
16 4 'Structure model' struct_asym                   
17 4 'Structure model' struct_conn                   
18 4 'Structure model' struct_site                   
19 4 'Structure model' struct_site_gen               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  3 'Structure model' '_citation.journal_id_CSD'                  
2  3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
3  3 'Structure model' '_software.classification'                  
4  4 'Structure model' '_atom_site.B_iso_or_equiv'                 
5  4 'Structure model' '_atom_site.Cartn_x'                        
6  4 'Structure model' '_atom_site.Cartn_y'                        
7  4 'Structure model' '_atom_site.Cartn_z'                        
8  4 'Structure model' '_atom_site.auth_asym_id'                   
9  4 'Structure model' '_atom_site.auth_atom_id'                   
10 4 'Structure model' '_atom_site.auth_comp_id'                   
11 4 'Structure model' '_atom_site.auth_seq_id'                    
12 4 'Structure model' '_atom_site.label_alt_id'                   
13 4 'Structure model' '_atom_site.label_asym_id'                  
14 4 'Structure model' '_atom_site.label_atom_id'                  
15 4 'Structure model' '_atom_site.label_comp_id'                  
16 4 'Structure model' '_atom_site.label_entity_id'                
17 4 'Structure model' '_atom_site.occupancy'                      
18 4 'Structure model' '_atom_site.type_symbol'                    
19 4 'Structure model' '_chem_comp.name'                           
20 4 'Structure model' '_chem_comp.type'                           
21 4 'Structure model' '_entity.formula_weight'                    
22 4 'Structure model' '_entity.pdbx_description'                  
23 4 'Structure model' '_entity.pdbx_number_of_molecules'          
24 4 'Structure model' '_entity.src_method'                        
25 4 'Structure model' '_entity.type'                              
26 4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list'    
27 4 'Structure model' '_struct_conn.pdbx_role'                    
28 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id'           
29 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'            
30 4 'Structure model' '_struct_conn.ptnr1_label_asym_id'          
31 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id'           
32 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'            
33 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'          
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data collection' ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .    1 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? SCALEPACK   ? ? ? .    2 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? .    3 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 4 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .    5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   B HOH 930 ? ? O B HOH 934 ? ? 2.10 
2 1 OD1 B ASP 304 ? ? O B HOH 701 ? ? 2.12 
3 1 NE2 A GLN 527 ? ? O A HOH 702 ? ? 2.17 
4 1 NE2 B GLN 527 ? ? O B HOH 702 ? ? 2.18 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 47  ? ? 76.12   -5.40   
2  1 ALA A 62  ? ? -112.68 55.70   
3  1 SER A 203 ? ? 58.39   -121.08 
4  1 ASP A 306 ? ? -87.70  -90.83  
5  1 VAL A 407 ? ? -126.28 -62.48  
6  1 SER A 462 ? ? -58.30  -8.36   
7  1 ASP A 514 ? ? -162.48 -168.20 
8  1 SER A 541 ? ? -55.19  -75.06  
9  1 PHE B 47  ? ? 73.72   -0.90   
10 1 ALA B 62  ? ? -103.49 70.72   
11 1 ALA B 167 ? ? -153.93 75.09   
12 1 SER B 203 ? ? 59.02   -124.47 
13 1 ASP B 306 ? ? -101.55 -92.00  
14 1 TYR B 341 ? ? -98.60  35.36   
15 1 HIS B 387 ? ? -146.46 57.21   
16 1 VAL B 407 ? ? -127.87 -61.89  
17 1 ASN B 464 ? ? -112.03 51.55   
18 1 GLU B 491 ? ? -56.35  109.84  
19 1 ARG B 525 ? ? 37.32   58.61   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 2   ? A GLY 1   
2  1 Y 1 A ARG 3   ? A ARG 2   
3  1 Y 1 A PRO 259 ? A PRO 258 
4  1 Y 1 A GLY 260 ? A GLY 259 
5  1 Y 1 A GLY 261 ? A GLY 260 
6  1 Y 1 A THR 262 ? A THR 261 
7  1 Y 1 A GLY 263 ? A GLY 262 
8  1 Y 1 A GLY 264 ? A GLY 263 
9  1 Y 1 A PRO 495 ? A PRO 494 
10 1 Y 1 A LYS 496 ? A LYS 495 
11 1 Y 1 A ALA 497 ? A ALA 496 
12 1 Y 1 A THR 543 ? A THR 542 
13 1 Y 1 B GLY 2   ? B GLY 1   
14 1 Y 1 B ARG 3   ? B ARG 2   
15 1 Y 1 B GLY 260 ? B GLY 259 
16 1 Y 1 B GLY 261 ? B GLY 260 
17 1 Y 1 B ARG 493 ? B ARG 492 
18 1 Y 1 B ASP 494 ? B ASP 493 
19 1 Y 1 B PRO 495 ? B PRO 494 
20 1 Y 1 B LYS 496 ? B LYS 495 
21 1 Y 1 B THR 543 ? B THR 542 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
C 2 NAG 1 C NAG 1 A NAG 601 n 
C 2 NAG 2 C NAG 2 A NAG 603 n 
C 2 FUC 3 C FUC 3 A FUC 602 n 
D 2 NAG 1 D NAG 1 B NAG 601 n 
D 2 NAG 2 D NAG 2 B NAG 603 n 
D 2 FUC 3 D FUC 3 B FUC 602 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
FUC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 LFucpa                         
FUC 'COMMON NAME'                         GMML     1.0 a-L-fucopyranose               
FUC 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-L-Fucp                       
FUC 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Fuc                            
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
_pdbx_entity_branch.entity_id   2 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 'DGlcpNAcb1-4[LFucpa1-6]DGlcpNAcb1-'                                         'Glycam Condensed Sequence' GMML       1.0   
2 2 'WURCS=2.0/2,3,2/[a2122h-1b_1-5_2*NCC/3=O][a1221m-1a_1-5]/1-1-2/a4-b1_a6-c1' WURCS                       PDB2Glycan 1.1.0 
3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}[(6+1)][a-L-Fucp]{}}}'        LINUCS                      PDB-CARE   ?     
# 
loop_
_pdbx_entity_branch_link.link_id 
_pdbx_entity_branch_link.entity_id 
_pdbx_entity_branch_link.entity_branch_list_num_1 
_pdbx_entity_branch_link.comp_id_1 
_pdbx_entity_branch_link.atom_id_1 
_pdbx_entity_branch_link.leaving_atom_id_1 
_pdbx_entity_branch_link.entity_branch_list_num_2 
_pdbx_entity_branch_link.comp_id_2 
_pdbx_entity_branch_link.atom_id_2 
_pdbx_entity_branch_link.leaving_atom_id_2 
_pdbx_entity_branch_link.value_order 
_pdbx_entity_branch_link.details 
1 2 2 NAG C1 O1 1 NAG O4 HO4 sing ? 
2 2 3 FUC C1 O1 1 NAG O6 HO6 sing ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 NAG 1 n 
2 NAG 2 n 
2 FUC 3 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'DIETHYL PHOSPHONATE'                                                                          DEP 
4 1,2-ETHANEDIOL                                                                                 EDO 
5 '4-(AMINOCARBONYL)-1-[({2-[(E)-(HYDROXYIMINO)METHYL]PYRIDINIUM-1-YL}METHOXY)METHYL]PYRIDINIUM' HI6 
6 2-acetamido-2-deoxy-beta-D-glucopyranose                                                       NAG 
7 3,6,9,12,15,18,21-HEPTAOXATRICOSANE-1,23-DIOL                                                  PE8 
8 'NITRATE ION'                                                                                  NO3 
9 water                                                                                          HOH 
#