data_5HG1
# 
_entry.id   5HG1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5HG1         
WWPDB D_1000216979 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 5HEX PDB . 
unspecified 5HFU PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5HG1 
_pdbx_database_status.recvd_initial_deposition_date   2016-01-07 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Campobasso, N.' 1 
'Zhao, B.'       2 
'Smallwood, A.'  3 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Acs Med.Chem.Lett.' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1948-5875 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            7 
_citation.language                  ? 
_citation.page_first                217 
_citation.page_last                 222 
_citation.title                     
'Discovery of a Novel 2,6-Disubstituted Glucosamine Series of Potent and Selective Hexokinase 2 Inhibitors.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1021/acsmedchemlett.5b00214 
_citation.pdbx_database_id_PubMed   26985301 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Lin, H.'         1  ? 
primary 'Zeng, J.'        2  ? 
primary 'Xie, R.'         3  ? 
primary 'Schulz, M.J.'    4  ? 
primary 'Tedesco, R.'     5  ? 
primary 'Qu, J.'          6  ? 
primary 'Erhard, K.F.'    7  ? 
primary 'Mack, J.F.'      8  ? 
primary 'Raha, K.'        9  ? 
primary 'Rendina, A.R.'   10 ? 
primary 'Szewczuk, L.M.'  11 ? 
primary 'Kratz, P.M.'     12 ? 
primary 'Jurewicz, A.J.'  13 ? 
primary 'Cecconie, T.'    14 ? 
primary 'Martens, S.'     15 ? 
primary 'McDevitt, P.J.'  16 ? 
primary 'Martin, J.D.'    17 ? 
primary 'Chen, S.B.'      18 ? 
primary 'Jiang, Y.'       19 ? 
primary 'Nickels, L.'     20 ? 
primary 'Schwartz, B.J.'  21 ? 
primary 'Smallwood, A.'   22 ? 
primary 'Zhao, B.'        23 ? 
primary 'Campobasso, N.'  24 ? 
primary 'Qian, Y.'        25 ? 
primary 'Briand, J.'      26 ? 
primary 'Rominger, C.M.'  27 ? 
primary 'Oleykowski, C.'  28 ? 
primary 'Hardwicke, M.A.' 29 ? 
primary 'Luengo, J.I.'    30 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5HG1 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     165.120 
_cell.length_a_esd                 ? 
_cell.length_b                     165.120 
_cell.length_b_esd                 ? 
_cell.length_c                     126.478 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        6 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5HG1 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Hexokinase-2                                                                       102945.312 1 2.7.1.1 ? ? ? 
2 non-polymer syn '2-deoxy-2-{[(2E)-3-(3,4-dichlorophenyl)prop-2-enoyl]amino}-alpha-D-glucopyranose' 378.205    2 ?       ? ? ? 
3 non-polymer man 6-O-phosphono-beta-D-glucopyranose                                                 260.136    1 ?       ? ? ? 
4 non-polymer syn 'CITRATE ANION'                                                                    189.100    1 ?       ? ? ? 
5 water       nat water                                                                              18.015     8 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Hexokinase type II,HK II,Muscle form hexokinase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGSSHHHHHHSSGLENLYFQGSDQVQKVDQYLYHMRLSDETLLEISKRFRKEMEKGLGATTHPTAAVKMLPTFVRSTPDG
TEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMRGSGTQLFDHIAECLANFMDKLQIKDKKLPLGFTF
SFPCHQTKLDESFLVSWTKGFKSSGVEGRDVVALIRKAIQRRGDFDIDIVAVVNDTVGTMMTCGYDDHNCEIGLIVGTGS
NACYMEEMRHIDMVEGDEGRMCINMEWGAFGDDGSLNDIRTEFDQEIDMGSLNPGKQLFEKMISGMYMGELVRLILVKMA
KEELLFGGKLSPELLNTGRFETKDISDIEGEKDGIRKAREVLMRLGLDPTQEDCVATHRICQIVSTRSASLCAATLAAVL
QRIKENKGEERLRSTIGVDGSVYKKHPHFAKRLHKTVRRLVPGCDVRFLRSEDGSGKGAAMVTAVAYRLADQHRARQKTL
EHLQLSHDQLLEVKRRMKVEMERGLSKETHASAPVKMLPTYVCATPDGTEKGDFLALDLGGTNFRVLLVRVRNGKWGGVE
MHNKIYAIPQEVMHGTGDELFDHIVQCIADFLEYMGMKGVSLPLGFTFSFPCQQNSLDESILLKWTKGFKASGCEGEDVV
TLLKEAIHRREEFDLDVVAVVNDTVGTMMTCGFEDPHCEVGLIVGTGSNACYMEEMRNVELVEGEEGRMCVNMEWGAFGD
NGCLDDFRTEFDVAVDELSLNPGKQRFEKMISGMYLGEIVRNILIDFTKRGLLFRGRISERLKTRGIFETKFLSQIESDC
LALLQVRAILQHLGLESTCDDSIIVKEVCTVVARRAAQLCGAGMAAVVDRIRENRGLDALKVTVGVDGTLYKLHPHFAKV
MHETVKDLAPKCDVSFLQSEDGSGKGAALITAVACRIREAGQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSSHHHHHHSSGLENLYFQGSDQVQKVDQYLYHMRLSDETLLEISKRFRKEMEKGLGATTHPTAAVKMLPTFVRSTPDG
TEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMRGSGTQLFDHIAECLANFMDKLQIKDKKLPLGFTF
SFPCHQTKLDESFLVSWTKGFKSSGVEGRDVVALIRKAIQRRGDFDIDIVAVVNDTVGTMMTCGYDDHNCEIGLIVGTGS
NACYMEEMRHIDMVEGDEGRMCINMEWGAFGDDGSLNDIRTEFDQEIDMGSLNPGKQLFEKMISGMYMGELVRLILVKMA
KEELLFGGKLSPELLNTGRFETKDISDIEGEKDGIRKAREVLMRLGLDPTQEDCVATHRICQIVSTRSASLCAATLAAVL
QRIKENKGEERLRSTIGVDGSVYKKHPHFAKRLHKTVRRLVPGCDVRFLRSEDGSGKGAAMVTAVAYRLADQHRARQKTL
EHLQLSHDQLLEVKRRMKVEMERGLSKETHASAPVKMLPTYVCATPDGTEKGDFLALDLGGTNFRVLLVRVRNGKWGGVE
MHNKIYAIPQEVMHGTGDELFDHIVQCIADFLEYMGMKGVSLPLGFTFSFPCQQNSLDESILLKWTKGFKASGCEGEDVV
TLLKEAIHRREEFDLDVVAVVNDTVGTMMTCGFEDPHCEVGLIVGTGSNACYMEEMRNVELVEGEEGRMCVNMEWGAFGD
NGCLDDFRTEFDVAVDELSLNPGKQRFEKMISGMYLGEIVRNILIDFTKRGLLFRGRISERLKTRGIFETKFLSQIESDC
LALLQVRAILQHLGLESTCDDSIIVKEVCTVVARRAAQLCGAGMAAVVDRIRENRGLDALKVTVGVDGTLYKLHPHFAKV
MHETVKDLAPKCDVSFLQSEDGSGKGAALITAVACRIREAGQ
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  GLU n 
1 16  ASN n 
1 17  LEU n 
1 18  TYR n 
1 19  PHE n 
1 20  GLN n 
1 21  GLY n 
1 22  SER n 
1 23  ASP n 
1 24  GLN n 
1 25  VAL n 
1 26  GLN n 
1 27  LYS n 
1 28  VAL n 
1 29  ASP n 
1 30  GLN n 
1 31  TYR n 
1 32  LEU n 
1 33  TYR n 
1 34  HIS n 
1 35  MET n 
1 36  ARG n 
1 37  LEU n 
1 38  SER n 
1 39  ASP n 
1 40  GLU n 
1 41  THR n 
1 42  LEU n 
1 43  LEU n 
1 44  GLU n 
1 45  ILE n 
1 46  SER n 
1 47  LYS n 
1 48  ARG n 
1 49  PHE n 
1 50  ARG n 
1 51  LYS n 
1 52  GLU n 
1 53  MET n 
1 54  GLU n 
1 55  LYS n 
1 56  GLY n 
1 57  LEU n 
1 58  GLY n 
1 59  ALA n 
1 60  THR n 
1 61  THR n 
1 62  HIS n 
1 63  PRO n 
1 64  THR n 
1 65  ALA n 
1 66  ALA n 
1 67  VAL n 
1 68  LYS n 
1 69  MET n 
1 70  LEU n 
1 71  PRO n 
1 72  THR n 
1 73  PHE n 
1 74  VAL n 
1 75  ARG n 
1 76  SER n 
1 77  THR n 
1 78  PRO n 
1 79  ASP n 
1 80  GLY n 
1 81  THR n 
1 82  GLU n 
1 83  HIS n 
1 84  GLY n 
1 85  GLU n 
1 86  PHE n 
1 87  LEU n 
1 88  ALA n 
1 89  LEU n 
1 90  ASP n 
1 91  LEU n 
1 92  GLY n 
1 93  GLY n 
1 94  THR n 
1 95  ASN n 
1 96  PHE n 
1 97  ARG n 
1 98  VAL n 
1 99  LEU n 
1 100 TRP n 
1 101 VAL n 
1 102 LYS n 
1 103 VAL n 
1 104 THR n 
1 105 ASP n 
1 106 ASN n 
1 107 GLY n 
1 108 LEU n 
1 109 GLN n 
1 110 LYS n 
1 111 VAL n 
1 112 GLU n 
1 113 MET n 
1 114 GLU n 
1 115 ASN n 
1 116 GLN n 
1 117 ILE n 
1 118 TYR n 
1 119 ALA n 
1 120 ILE n 
1 121 PRO n 
1 122 GLU n 
1 123 ASP n 
1 124 ILE n 
1 125 MET n 
1 126 ARG n 
1 127 GLY n 
1 128 SER n 
1 129 GLY n 
1 130 THR n 
1 131 GLN n 
1 132 LEU n 
1 133 PHE n 
1 134 ASP n 
1 135 HIS n 
1 136 ILE n 
1 137 ALA n 
1 138 GLU n 
1 139 CYS n 
1 140 LEU n 
1 141 ALA n 
1 142 ASN n 
1 143 PHE n 
1 144 MET n 
1 145 ASP n 
1 146 LYS n 
1 147 LEU n 
1 148 GLN n 
1 149 ILE n 
1 150 LYS n 
1 151 ASP n 
1 152 LYS n 
1 153 LYS n 
1 154 LEU n 
1 155 PRO n 
1 156 LEU n 
1 157 GLY n 
1 158 PHE n 
1 159 THR n 
1 160 PHE n 
1 161 SER n 
1 162 PHE n 
1 163 PRO n 
1 164 CYS n 
1 165 HIS n 
1 166 GLN n 
1 167 THR n 
1 168 LYS n 
1 169 LEU n 
1 170 ASP n 
1 171 GLU n 
1 172 SER n 
1 173 PHE n 
1 174 LEU n 
1 175 VAL n 
1 176 SER n 
1 177 TRP n 
1 178 THR n 
1 179 LYS n 
1 180 GLY n 
1 181 PHE n 
1 182 LYS n 
1 183 SER n 
1 184 SER n 
1 185 GLY n 
1 186 VAL n 
1 187 GLU n 
1 188 GLY n 
1 189 ARG n 
1 190 ASP n 
1 191 VAL n 
1 192 VAL n 
1 193 ALA n 
1 194 LEU n 
1 195 ILE n 
1 196 ARG n 
1 197 LYS n 
1 198 ALA n 
1 199 ILE n 
1 200 GLN n 
1 201 ARG n 
1 202 ARG n 
1 203 GLY n 
1 204 ASP n 
1 205 PHE n 
1 206 ASP n 
1 207 ILE n 
1 208 ASP n 
1 209 ILE n 
1 210 VAL n 
1 211 ALA n 
1 212 VAL n 
1 213 VAL n 
1 214 ASN n 
1 215 ASP n 
1 216 THR n 
1 217 VAL n 
1 218 GLY n 
1 219 THR n 
1 220 MET n 
1 221 MET n 
1 222 THR n 
1 223 CYS n 
1 224 GLY n 
1 225 TYR n 
1 226 ASP n 
1 227 ASP n 
1 228 HIS n 
1 229 ASN n 
1 230 CYS n 
1 231 GLU n 
1 232 ILE n 
1 233 GLY n 
1 234 LEU n 
1 235 ILE n 
1 236 VAL n 
1 237 GLY n 
1 238 THR n 
1 239 GLY n 
1 240 SER n 
1 241 ASN n 
1 242 ALA n 
1 243 CYS n 
1 244 TYR n 
1 245 MET n 
1 246 GLU n 
1 247 GLU n 
1 248 MET n 
1 249 ARG n 
1 250 HIS n 
1 251 ILE n 
1 252 ASP n 
1 253 MET n 
1 254 VAL n 
1 255 GLU n 
1 256 GLY n 
1 257 ASP n 
1 258 GLU n 
1 259 GLY n 
1 260 ARG n 
1 261 MET n 
1 262 CYS n 
1 263 ILE n 
1 264 ASN n 
1 265 MET n 
1 266 GLU n 
1 267 TRP n 
1 268 GLY n 
1 269 ALA n 
1 270 PHE n 
1 271 GLY n 
1 272 ASP n 
1 273 ASP n 
1 274 GLY n 
1 275 SER n 
1 276 LEU n 
1 277 ASN n 
1 278 ASP n 
1 279 ILE n 
1 280 ARG n 
1 281 THR n 
1 282 GLU n 
1 283 PHE n 
1 284 ASP n 
1 285 GLN n 
1 286 GLU n 
1 287 ILE n 
1 288 ASP n 
1 289 MET n 
1 290 GLY n 
1 291 SER n 
1 292 LEU n 
1 293 ASN n 
1 294 PRO n 
1 295 GLY n 
1 296 LYS n 
1 297 GLN n 
1 298 LEU n 
1 299 PHE n 
1 300 GLU n 
1 301 LYS n 
1 302 MET n 
1 303 ILE n 
1 304 SER n 
1 305 GLY n 
1 306 MET n 
1 307 TYR n 
1 308 MET n 
1 309 GLY n 
1 310 GLU n 
1 311 LEU n 
1 312 VAL n 
1 313 ARG n 
1 314 LEU n 
1 315 ILE n 
1 316 LEU n 
1 317 VAL n 
1 318 LYS n 
1 319 MET n 
1 320 ALA n 
1 321 LYS n 
1 322 GLU n 
1 323 GLU n 
1 324 LEU n 
1 325 LEU n 
1 326 PHE n 
1 327 GLY n 
1 328 GLY n 
1 329 LYS n 
1 330 LEU n 
1 331 SER n 
1 332 PRO n 
1 333 GLU n 
1 334 LEU n 
1 335 LEU n 
1 336 ASN n 
1 337 THR n 
1 338 GLY n 
1 339 ARG n 
1 340 PHE n 
1 341 GLU n 
1 342 THR n 
1 343 LYS n 
1 344 ASP n 
1 345 ILE n 
1 346 SER n 
1 347 ASP n 
1 348 ILE n 
1 349 GLU n 
1 350 GLY n 
1 351 GLU n 
1 352 LYS n 
1 353 ASP n 
1 354 GLY n 
1 355 ILE n 
1 356 ARG n 
1 357 LYS n 
1 358 ALA n 
1 359 ARG n 
1 360 GLU n 
1 361 VAL n 
1 362 LEU n 
1 363 MET n 
1 364 ARG n 
1 365 LEU n 
1 366 GLY n 
1 367 LEU n 
1 368 ASP n 
1 369 PRO n 
1 370 THR n 
1 371 GLN n 
1 372 GLU n 
1 373 ASP n 
1 374 CYS n 
1 375 VAL n 
1 376 ALA n 
1 377 THR n 
1 378 HIS n 
1 379 ARG n 
1 380 ILE n 
1 381 CYS n 
1 382 GLN n 
1 383 ILE n 
1 384 VAL n 
1 385 SER n 
1 386 THR n 
1 387 ARG n 
1 388 SER n 
1 389 ALA n 
1 390 SER n 
1 391 LEU n 
1 392 CYS n 
1 393 ALA n 
1 394 ALA n 
1 395 THR n 
1 396 LEU n 
1 397 ALA n 
1 398 ALA n 
1 399 VAL n 
1 400 LEU n 
1 401 GLN n 
1 402 ARG n 
1 403 ILE n 
1 404 LYS n 
1 405 GLU n 
1 406 ASN n 
1 407 LYS n 
1 408 GLY n 
1 409 GLU n 
1 410 GLU n 
1 411 ARG n 
1 412 LEU n 
1 413 ARG n 
1 414 SER n 
1 415 THR n 
1 416 ILE n 
1 417 GLY n 
1 418 VAL n 
1 419 ASP n 
1 420 GLY n 
1 421 SER n 
1 422 VAL n 
1 423 TYR n 
1 424 LYS n 
1 425 LYS n 
1 426 HIS n 
1 427 PRO n 
1 428 HIS n 
1 429 PHE n 
1 430 ALA n 
1 431 LYS n 
1 432 ARG n 
1 433 LEU n 
1 434 HIS n 
1 435 LYS n 
1 436 THR n 
1 437 VAL n 
1 438 ARG n 
1 439 ARG n 
1 440 LEU n 
1 441 VAL n 
1 442 PRO n 
1 443 GLY n 
1 444 CYS n 
1 445 ASP n 
1 446 VAL n 
1 447 ARG n 
1 448 PHE n 
1 449 LEU n 
1 450 ARG n 
1 451 SER n 
1 452 GLU n 
1 453 ASP n 
1 454 GLY n 
1 455 SER n 
1 456 GLY n 
1 457 LYS n 
1 458 GLY n 
1 459 ALA n 
1 460 ALA n 
1 461 MET n 
1 462 VAL n 
1 463 THR n 
1 464 ALA n 
1 465 VAL n 
1 466 ALA n 
1 467 TYR n 
1 468 ARG n 
1 469 LEU n 
1 470 ALA n 
1 471 ASP n 
1 472 GLN n 
1 473 HIS n 
1 474 ARG n 
1 475 ALA n 
1 476 ARG n 
1 477 GLN n 
1 478 LYS n 
1 479 THR n 
1 480 LEU n 
1 481 GLU n 
1 482 HIS n 
1 483 LEU n 
1 484 GLN n 
1 485 LEU n 
1 486 SER n 
1 487 HIS n 
1 488 ASP n 
1 489 GLN n 
1 490 LEU n 
1 491 LEU n 
1 492 GLU n 
1 493 VAL n 
1 494 LYS n 
1 495 ARG n 
1 496 ARG n 
1 497 MET n 
1 498 LYS n 
1 499 VAL n 
1 500 GLU n 
1 501 MET n 
1 502 GLU n 
1 503 ARG n 
1 504 GLY n 
1 505 LEU n 
1 506 SER n 
1 507 LYS n 
1 508 GLU n 
1 509 THR n 
1 510 HIS n 
1 511 ALA n 
1 512 SER n 
1 513 ALA n 
1 514 PRO n 
1 515 VAL n 
1 516 LYS n 
1 517 MET n 
1 518 LEU n 
1 519 PRO n 
1 520 THR n 
1 521 TYR n 
1 522 VAL n 
1 523 CYS n 
1 524 ALA n 
1 525 THR n 
1 526 PRO n 
1 527 ASP n 
1 528 GLY n 
1 529 THR n 
1 530 GLU n 
1 531 LYS n 
1 532 GLY n 
1 533 ASP n 
1 534 PHE n 
1 535 LEU n 
1 536 ALA n 
1 537 LEU n 
1 538 ASP n 
1 539 LEU n 
1 540 GLY n 
1 541 GLY n 
1 542 THR n 
1 543 ASN n 
1 544 PHE n 
1 545 ARG n 
1 546 VAL n 
1 547 LEU n 
1 548 LEU n 
1 549 VAL n 
1 550 ARG n 
1 551 VAL n 
1 552 ARG n 
1 553 ASN n 
1 554 GLY n 
1 555 LYS n 
1 556 TRP n 
1 557 GLY n 
1 558 GLY n 
1 559 VAL n 
1 560 GLU n 
1 561 MET n 
1 562 HIS n 
1 563 ASN n 
1 564 LYS n 
1 565 ILE n 
1 566 TYR n 
1 567 ALA n 
1 568 ILE n 
1 569 PRO n 
1 570 GLN n 
1 571 GLU n 
1 572 VAL n 
1 573 MET n 
1 574 HIS n 
1 575 GLY n 
1 576 THR n 
1 577 GLY n 
1 578 ASP n 
1 579 GLU n 
1 580 LEU n 
1 581 PHE n 
1 582 ASP n 
1 583 HIS n 
1 584 ILE n 
1 585 VAL n 
1 586 GLN n 
1 587 CYS n 
1 588 ILE n 
1 589 ALA n 
1 590 ASP n 
1 591 PHE n 
1 592 LEU n 
1 593 GLU n 
1 594 TYR n 
1 595 MET n 
1 596 GLY n 
1 597 MET n 
1 598 LYS n 
1 599 GLY n 
1 600 VAL n 
1 601 SER n 
1 602 LEU n 
1 603 PRO n 
1 604 LEU n 
1 605 GLY n 
1 606 PHE n 
1 607 THR n 
1 608 PHE n 
1 609 SER n 
1 610 PHE n 
1 611 PRO n 
1 612 CYS n 
1 613 GLN n 
1 614 GLN n 
1 615 ASN n 
1 616 SER n 
1 617 LEU n 
1 618 ASP n 
1 619 GLU n 
1 620 SER n 
1 621 ILE n 
1 622 LEU n 
1 623 LEU n 
1 624 LYS n 
1 625 TRP n 
1 626 THR n 
1 627 LYS n 
1 628 GLY n 
1 629 PHE n 
1 630 LYS n 
1 631 ALA n 
1 632 SER n 
1 633 GLY n 
1 634 CYS n 
1 635 GLU n 
1 636 GLY n 
1 637 GLU n 
1 638 ASP n 
1 639 VAL n 
1 640 VAL n 
1 641 THR n 
1 642 LEU n 
1 643 LEU n 
1 644 LYS n 
1 645 GLU n 
1 646 ALA n 
1 647 ILE n 
1 648 HIS n 
1 649 ARG n 
1 650 ARG n 
1 651 GLU n 
1 652 GLU n 
1 653 PHE n 
1 654 ASP n 
1 655 LEU n 
1 656 ASP n 
1 657 VAL n 
1 658 VAL n 
1 659 ALA n 
1 660 VAL n 
1 661 VAL n 
1 662 ASN n 
1 663 ASP n 
1 664 THR n 
1 665 VAL n 
1 666 GLY n 
1 667 THR n 
1 668 MET n 
1 669 MET n 
1 670 THR n 
1 671 CYS n 
1 672 GLY n 
1 673 PHE n 
1 674 GLU n 
1 675 ASP n 
1 676 PRO n 
1 677 HIS n 
1 678 CYS n 
1 679 GLU n 
1 680 VAL n 
1 681 GLY n 
1 682 LEU n 
1 683 ILE n 
1 684 VAL n 
1 685 GLY n 
1 686 THR n 
1 687 GLY n 
1 688 SER n 
1 689 ASN n 
1 690 ALA n 
1 691 CYS n 
1 692 TYR n 
1 693 MET n 
1 694 GLU n 
1 695 GLU n 
1 696 MET n 
1 697 ARG n 
1 698 ASN n 
1 699 VAL n 
1 700 GLU n 
1 701 LEU n 
1 702 VAL n 
1 703 GLU n 
1 704 GLY n 
1 705 GLU n 
1 706 GLU n 
1 707 GLY n 
1 708 ARG n 
1 709 MET n 
1 710 CYS n 
1 711 VAL n 
1 712 ASN n 
1 713 MET n 
1 714 GLU n 
1 715 TRP n 
1 716 GLY n 
1 717 ALA n 
1 718 PHE n 
1 719 GLY n 
1 720 ASP n 
1 721 ASN n 
1 722 GLY n 
1 723 CYS n 
1 724 LEU n 
1 725 ASP n 
1 726 ASP n 
1 727 PHE n 
1 728 ARG n 
1 729 THR n 
1 730 GLU n 
1 731 PHE n 
1 732 ASP n 
1 733 VAL n 
1 734 ALA n 
1 735 VAL n 
1 736 ASP n 
1 737 GLU n 
1 738 LEU n 
1 739 SER n 
1 740 LEU n 
1 741 ASN n 
1 742 PRO n 
1 743 GLY n 
1 744 LYS n 
1 745 GLN n 
1 746 ARG n 
1 747 PHE n 
1 748 GLU n 
1 749 LYS n 
1 750 MET n 
1 751 ILE n 
1 752 SER n 
1 753 GLY n 
1 754 MET n 
1 755 TYR n 
1 756 LEU n 
1 757 GLY n 
1 758 GLU n 
1 759 ILE n 
1 760 VAL n 
1 761 ARG n 
1 762 ASN n 
1 763 ILE n 
1 764 LEU n 
1 765 ILE n 
1 766 ASP n 
1 767 PHE n 
1 768 THR n 
1 769 LYS n 
1 770 ARG n 
1 771 GLY n 
1 772 LEU n 
1 773 LEU n 
1 774 PHE n 
1 775 ARG n 
1 776 GLY n 
1 777 ARG n 
1 778 ILE n 
1 779 SER n 
1 780 GLU n 
1 781 ARG n 
1 782 LEU n 
1 783 LYS n 
1 784 THR n 
1 785 ARG n 
1 786 GLY n 
1 787 ILE n 
1 788 PHE n 
1 789 GLU n 
1 790 THR n 
1 791 LYS n 
1 792 PHE n 
1 793 LEU n 
1 794 SER n 
1 795 GLN n 
1 796 ILE n 
1 797 GLU n 
1 798 SER n 
1 799 ASP n 
1 800 CYS n 
1 801 LEU n 
1 802 ALA n 
1 803 LEU n 
1 804 LEU n 
1 805 GLN n 
1 806 VAL n 
1 807 ARG n 
1 808 ALA n 
1 809 ILE n 
1 810 LEU n 
1 811 GLN n 
1 812 HIS n 
1 813 LEU n 
1 814 GLY n 
1 815 LEU n 
1 816 GLU n 
1 817 SER n 
1 818 THR n 
1 819 CYS n 
1 820 ASP n 
1 821 ASP n 
1 822 SER n 
1 823 ILE n 
1 824 ILE n 
1 825 VAL n 
1 826 LYS n 
1 827 GLU n 
1 828 VAL n 
1 829 CYS n 
1 830 THR n 
1 831 VAL n 
1 832 VAL n 
1 833 ALA n 
1 834 ARG n 
1 835 ARG n 
1 836 ALA n 
1 837 ALA n 
1 838 GLN n 
1 839 LEU n 
1 840 CYS n 
1 841 GLY n 
1 842 ALA n 
1 843 GLY n 
1 844 MET n 
1 845 ALA n 
1 846 ALA n 
1 847 VAL n 
1 848 VAL n 
1 849 ASP n 
1 850 ARG n 
1 851 ILE n 
1 852 ARG n 
1 853 GLU n 
1 854 ASN n 
1 855 ARG n 
1 856 GLY n 
1 857 LEU n 
1 858 ASP n 
1 859 ALA n 
1 860 LEU n 
1 861 LYS n 
1 862 VAL n 
1 863 THR n 
1 864 VAL n 
1 865 GLY n 
1 866 VAL n 
1 867 ASP n 
1 868 GLY n 
1 869 THR n 
1 870 LEU n 
1 871 TYR n 
1 872 LYS n 
1 873 LEU n 
1 874 HIS n 
1 875 PRO n 
1 876 HIS n 
1 877 PHE n 
1 878 ALA n 
1 879 LYS n 
1 880 VAL n 
1 881 MET n 
1 882 HIS n 
1 883 GLU n 
1 884 THR n 
1 885 VAL n 
1 886 LYS n 
1 887 ASP n 
1 888 LEU n 
1 889 ALA n 
1 890 PRO n 
1 891 LYS n 
1 892 CYS n 
1 893 ASP n 
1 894 VAL n 
1 895 SER n 
1 896 PHE n 
1 897 LEU n 
1 898 GLN n 
1 899 SER n 
1 900 GLU n 
1 901 ASP n 
1 902 GLY n 
1 903 SER n 
1 904 GLY n 
1 905 LYS n 
1 906 GLY n 
1 907 ALA n 
1 908 ALA n 
1 909 LEU n 
1 910 ILE n 
1 911 THR n 
1 912 ALA n 
1 913 VAL n 
1 914 ALA n 
1 915 CYS n 
1 916 ARG n 
1 917 ILE n 
1 918 ARG n 
1 919 GLU n 
1 920 ALA n 
1 921 GLY n 
1 922 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   923 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 HK2 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    HXK2_HUMAN 
_struct_ref.pdbx_db_accession          P52789 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;DQVQKVDQYLYHMRLSDETLLEISKRFRKEMEKGLGATTHPTAAVKMLPTFVRSTPDGTEHGEFLALDLGGTNFRVLWVK
VTDNGLQKVEMENQIYAIPEDIMRGSGTQLFDHIAECLANFMDKLQIKDKKLPLGFTFSFPCHQTKLDESFLVSWTKGFK
SSGVEGRDVVALIRKAIQRRGDFDIDIVAVVNDTVGTMMTCGYDDHNCEIGLIVGTGSNACYMEEMRHIDMVEGDEGRMC
INMEWGAFGDDGSLNDIRTEFDQEIDMGSLNPGKQLFEKMISGMYMGELVRLILVKMAKEELLFGGKLSPELLNTGRFET
KDISDIEGEKDGIRKAREVLMRLGLDPTQEDCVATHRICQIVSTRSASLCAATLAAVLQRIKENKGEERLRSTIGVDGSV
YKKHPHFAKRLHKTVRRLVPGCDVRFLRSEDGSGKGAAMVTAVAYRLADQHRARQKTLEHLQLSHDQLLEVKRRMKVEME
RGLSKETHASAPVKMLPTYVCATPDGTEKGDFLALDLGGTNFRVLLVRVRNGKWGGVEMHNKIYAIPQEVMHGTGDELFD
HIVQCIADFLEYMGMKGVSLPLGFTFSFPCQQNSLDESILLKWTKGFKASGCEGEDVVTLLKEAIHRREEFDLDVVAVVN
DTVGTMMTCGFEDPHCEVGLIVGTGSNACYMEEMRNVELVEGEEGRMCVNMEWGAFGDNGCLDDFRTEFDVAVDELSLNP
GKQRFEKMISGMYLGEIVRNILIDFTKRGLLFRGRISERLKTRGIFETKFLSQIESDCLALLQVRAILQHLGLESTCDDS
IIVKEVCTVVARRAAQLCGAGMAAVVDRIRENRGLDALKVTVGVDGTLYKLHPHFAKVMHETVKDLAPKCDVSFLQSEDG
SGKGAALITAVACRIREAGQ
;
_struct_ref.pdbx_align_begin           17 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              5HG1 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 23 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 922 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P52789 
_struct_ref_seq.db_align_beg                  17 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  916 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       17 
_struct_ref_seq.pdbx_auth_seq_align_end       916 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5HG1 MET A 1  ? UNP P52789 ? ? 'initiating methionine' -5 1  
1 5HG1 GLY A 2  ? UNP P52789 ? ? 'expression tag'        -4 2  
1 5HG1 SER A 3  ? UNP P52789 ? ? 'expression tag'        -3 3  
1 5HG1 SER A 4  ? UNP P52789 ? ? 'expression tag'        -2 4  
1 5HG1 HIS A 5  ? UNP P52789 ? ? 'expression tag'        -1 5  
1 5HG1 HIS A 6  ? UNP P52789 ? ? 'expression tag'        0  6  
1 5HG1 HIS A 7  ? UNP P52789 ? ? 'expression tag'        1  7  
1 5HG1 HIS A 8  ? UNP P52789 ? ? 'expression tag'        2  8  
1 5HG1 HIS A 9  ? UNP P52789 ? ? 'expression tag'        3  9  
1 5HG1 HIS A 10 ? UNP P52789 ? ? 'expression tag'        4  10 
1 5HG1 SER A 11 ? UNP P52789 ? ? 'expression tag'        5  11 
1 5HG1 SER A 12 ? UNP P52789 ? ? 'expression tag'        6  12 
1 5HG1 GLY A 13 ? UNP P52789 ? ? 'expression tag'        7  13 
1 5HG1 LEU A 14 ? UNP P52789 ? ? 'expression tag'        8  14 
1 5HG1 GLU A 15 ? UNP P52789 ? ? 'expression tag'        9  15 
1 5HG1 ASN A 16 ? UNP P52789 ? ? 'expression tag'        10 16 
1 5HG1 LEU A 17 ? UNP P52789 ? ? 'expression tag'        11 17 
1 5HG1 TYR A 18 ? UNP P52789 ? ? 'expression tag'        12 18 
1 5HG1 PHE A 19 ? UNP P52789 ? ? 'expression tag'        13 19 
1 5HG1 GLN A 20 ? UNP P52789 ? ? 'expression tag'        14 20 
1 5HG1 GLY A 21 ? UNP P52789 ? ? 'expression tag'        15 21 
1 5HG1 SER A 22 ? UNP P52789 ? ? 'expression tag'        16 22 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
62C non-polymer                  . '2-deoxy-2-{[(2E)-3-(3,4-dichlorophenyl)prop-2-enoyl]amino}-alpha-D-glucopyranose' ? 
'C15 H17 Cl2 N O6' 378.205 
ALA 'L-peptide linking'          y ALANINE                                                                            ? 
'C3 H7 N O2'       89.093  
ARG 'L-peptide linking'          y ARGININE                                                                           ? 
'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking'          y ASPARAGINE                                                                         ? 
'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                                                                    ? 
'C4 H7 N O4'       133.103 
BG6 'D-saccharide, beta linking' n 6-O-phosphono-beta-D-glucopyranose                                                 ? 
'C6 H13 O9 P'      260.136 
CYS 'L-peptide linking'          y CYSTEINE                                                                           ? 
'C3 H7 N O2 S'     121.158 
FLC non-polymer                  . 'CITRATE ANION'                                                                    ? 
'C6 H5 O7 -3'      189.100 
GLN 'L-peptide linking'          y GLUTAMINE                                                                          ? 
'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                                                                    ? 
'C5 H9 N O4'       147.129 
GLY 'peptide linking'            y GLYCINE                                                                            ? 
'C2 H5 N O2'       75.067  
HIS 'L-peptide linking'          y HISTIDINE                                                                          ? 
'C6 H10 N3 O2 1'   156.162 
HOH non-polymer                  . WATER                                                                              ? 'H2 O' 
18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                                                                         ? 
'C6 H13 N O2'      131.173 
LEU 'L-peptide linking'          y LEUCINE                                                                            ? 
'C6 H13 N O2'      131.173 
LYS 'L-peptide linking'          y LYSINE                                                                             ? 
'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking'          y METHIONINE                                                                         ? 
'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking'          y PHENYLALANINE                                                                      ? 
'C9 H11 N O2'      165.189 
PRO 'L-peptide linking'          y PROLINE                                                                            ? 
'C5 H9 N O2'       115.130 
SER 'L-peptide linking'          y SERINE                                                                             ? 
'C3 H7 N O3'       105.093 
THR 'L-peptide linking'          y THREONINE                                                                          ? 
'C4 H9 N O3'       119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                                                                         ? 
'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking'          y TYROSINE                                                                           ? 
'C9 H11 N O3'      181.189 
VAL 'L-peptide linking'          y VALINE                                                                             ? 
'C5 H11 N O2'      117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5HG1 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            4.83 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         74.56 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            296 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;protein: 6.6 mgs/mL, 10mM Tris HCL, pH=8, 0.1 M NaCl, 1mM DTT, 20mM MgCl2
Well: 0.2 M Na Citrate pH 5.5, 14-24 % PEG3350, 20 % ethylene glycol
;
_exptl_crystal_grow.pdbx_pH_range   '5 - 6' 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 225 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2009-11-04 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97872 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 21-ID-F' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97872 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   21-ID-F 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5HG1 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.76 
_reflns.d_resolution_low                 126.48 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       51701 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             100 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  11.2 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            18.2 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5HG1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.76 
_refine.ls_d_res_low                             71.499 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     51597 
_refine.ls_number_reflns_R_free                  2476 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.81 
_refine.ls_percent_reflns_R_free                 4.80 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2200 
_refine.ls_R_factor_R_free                       0.2658 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2177 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 30.82 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.42 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6528 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         77 
_refine_hist.number_atoms_solvent             8 
_refine_hist.number_atoms_total               6613 
_refine_hist.d_res_high                       2.76 
_refine_hist.d_res_low                        71.499 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.008  ? 6701 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.234  ? 9041 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 10.852 ? 5455 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.069  ? 1043 ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.009  ? 1173 ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.7554 2.8084  . . 140 2712 100.00 . . . 0.3849 . 0.3338 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8084 2.8657  . . 134 2661 100.00 . . . 0.3385 . 0.3096 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8657 2.9281  . . 130 2705 100.00 . . . 0.3908 . 0.2922 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9281 2.9962  . . 100 2740 100.00 . . . 0.3719 . 0.2895 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9962 3.0711  . . 134 2705 100.00 . . . 0.3318 . 0.2875 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0711 3.1541  . . 171 2681 100.00 . . . 0.3174 . 0.2800 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1541 3.2470  . . 159 2685 100.00 . . . 0.3240 . 0.2801 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2470 3.3518  . . 138 2700 100.00 . . . 0.3334 . 0.2581 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3518 3.4715  . . 149 2707 100.00 . . . 0.3070 . 0.2408 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4715 3.6105  . . 123 2720 100.00 . . . 0.2635 . 0.2269 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.6105 3.7749  . . 138 2731 100.00 . . . 0.2504 . 0.2203 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7749 3.9739  . . 152 2704 100.00 . . . 0.2931 . 0.2129 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.9739 4.2228  . . 133 2738 100.00 . . . 0.2690 . 0.1936 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.2228 4.5488  . . 149 2720 100.00 . . . 0.2159 . 0.1763 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.5488 5.0065  . . 125 2756 100.00 . . . 0.2281 . 0.1699 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.0065 5.7306  . . 126 2791 100.00 . . . 0.2068 . 0.1967 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.7306 7.2189  . . 122 2803 100.00 . . . 0.2603 . 0.2239 . . . . . . . . . . 
'X-RAY DIFFRACTION' 7.2189 71.5231 . . 153 2862 99.00  . . . 0.2279 . 0.1910 . . . . . . . . . . 
# 
_struct.entry_id                     5HG1 
_struct.title                        'Crystal Structure of Human Hexokinase 2 with cmpd 1, a C-2-substituted glucosamine' 
_struct.pdbx_descriptor              'Hexokinase-2 (E.C.2.7.1.1)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5HG1 
_struct_keywords.text            'metabolism, inhibitor complex, TRANSFERASE-TRANSFERASE INHIBITOR complex' 
_struct_keywords.pdbx_keywords   'TRANSFERASE/TRANSFERASE INHIBITOR' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 23  ? LEU A 32  ? ASP A 17  LEU A 26  1 ? 10 
HELX_P HELX_P2  AA2 TYR A 33  ? ARG A 36  ? TYR A 27  ARG A 30  5 ? 4  
HELX_P HELX_P3  AA3 SER A 38  ? GLY A 58  ? SER A 32  GLY A 52  1 ? 21 
HELX_P HELX_P4  AA4 THR A 61  ? ALA A 65  ? THR A 55  ALA A 59  5 ? 5  
HELX_P HELX_P5  AA5 THR A 130 ? ASP A 134 ? THR A 124 ASP A 128 1 ? 5  
HELX_P HELX_P6  AA6 GLU A 138 ? PHE A 143 ? GLU A 132 PHE A 137 1 ? 6  
HELX_P HELX_P7  AA7 MET A 144 ? LYS A 146 ? MET A 138 LYS A 140 5 ? 3  
HELX_P HELX_P8  AA8 GLN A 148 ? LYS A 152 ? GLN A 142 LYS A 146 5 ? 5  
HELX_P HELX_P9  AA9 ALA A 193 ? ALA A 198 ? ALA A 187 ALA A 192 1 ? 6  
HELX_P HELX_P10 AB1 ASN A 214 ? ASP A 227 ? ASN A 208 ASP A 221 1 ? 14 
HELX_P HELX_P11 AB2 ARG A 249 ? ILE A 251 ? ARG A 243 ILE A 245 5 ? 3  
HELX_P HELX_P12 AB3 GLU A 266 ? PHE A 270 ? GLU A 260 PHE A 264 5 ? 5  
HELX_P HELX_P13 AB4 THR A 281 ? SER A 291 ? THR A 275 SER A 285 1 ? 11 
HELX_P HELX_P14 AB5 GLN A 297 ? MET A 302 ? GLN A 291 MET A 296 1 ? 6  
HELX_P HELX_P15 AB6 TYR A 307 ? GLU A 322 ? TYR A 301 GLU A 316 1 ? 16 
HELX_P HELX_P16 AB7 LEU A 325 ? LYS A 329 ? LEU A 319 LYS A 323 5 ? 5  
HELX_P HELX_P17 AB8 PRO A 332 ? ASN A 336 ? PRO A 326 ASN A 330 5 ? 5  
HELX_P HELX_P18 AB9 GLU A 341 ? GLU A 351 ? GLU A 335 GLU A 345 1 ? 11 
HELX_P HELX_P19 AC1 GLY A 354 ? LEU A 365 ? GLY A 348 LEU A 359 1 ? 12 
HELX_P HELX_P20 AC2 THR A 370 ? GLY A 408 ? THR A 364 GLY A 402 1 ? 39 
HELX_P HELX_P21 AC3 GLY A 420 ? HIS A 426 ? GLY A 414 HIS A 420 1 ? 7  
HELX_P HELX_P22 AC4 HIS A 428 ? VAL A 441 ? HIS A 422 VAL A 435 1 ? 14 
HELX_P HELX_P23 AC5 LYS A 457 ? HIS A 482 ? LYS A 451 HIS A 476 1 ? 26 
HELX_P HELX_P24 AC6 SER A 486 ? SER A 506 ? SER A 480 SER A 500 1 ? 21 
HELX_P HELX_P25 AC7 PRO A 569 ? HIS A 574 ? PRO A 563 HIS A 568 1 ? 6  
HELX_P HELX_P26 AC8 THR A 576 ? MET A 595 ? THR A 570 MET A 589 1 ? 20 
HELX_P HELX_P27 AC9 ASP A 638 ? GLU A 651 ? ASP A 632 GLU A 645 1 ? 14 
HELX_P HELX_P28 AD1 ASN A 662 ? ASP A 675 ? ASN A 656 ASP A 669 1 ? 14 
HELX_P HELX_P29 AD2 GLU A 714 ? PHE A 718 ? GLU A 708 PHE A 712 5 ? 5  
HELX_P HELX_P30 AD3 LEU A 724 ? ARG A 728 ? LEU A 718 ARG A 722 5 ? 5  
HELX_P HELX_P31 AD4 THR A 729 ? LEU A 738 ? THR A 723 LEU A 732 1 ? 10 
HELX_P HELX_P32 AD5 GLN A 745 ? SER A 752 ? GLN A 739 SER A 746 1 ? 8  
HELX_P HELX_P33 AD6 MET A 754 ? ARG A 770 ? MET A 748 ARG A 764 1 ? 17 
HELX_P HELX_P34 AD7 LEU A 773 ? ARG A 777 ? LEU A 767 ARG A 771 5 ? 5  
HELX_P HELX_P35 AD8 GLU A 780 ? THR A 784 ? GLU A 774 THR A 778 5 ? 5  
HELX_P HELX_P36 AD9 GLU A 789 ? SER A 798 ? GLU A 783 SER A 792 1 ? 10 
HELX_P HELX_P37 AE1 LEU A 803 ? LEU A 813 ? LEU A 797 LEU A 807 1 ? 11 
HELX_P HELX_P38 AE2 THR A 818 ? ARG A 855 ? THR A 812 ARG A 849 1 ? 38 
HELX_P HELX_P39 AE3 GLY A 868 ? HIS A 874 ? GLY A 862 HIS A 868 1 ? 7  
HELX_P HELX_P40 AE4 HIS A 876 ? ALA A 889 ? HIS A 870 ALA A 883 1 ? 14 
HELX_P HELX_P41 AE5 SER A 903 ? GLU A 919 ? SER A 897 GLU A 913 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ASP 
_struct_mon_prot_cis.label_seq_id           257 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ASP 
_struct_mon_prot_cis.auth_seq_id            251 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   GLU 
_struct_mon_prot_cis.pdbx_label_seq_id_2    258 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    GLU 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     252 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       25.74 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 5 ? 
AA3 ? 6 ? 
AA4 ? 5 ? 
AA5 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? parallel      
AA2 4 5 ? parallel      
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA3 4 5 ? parallel      
AA3 5 6 ? parallel      
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? parallel      
AA4 4 5 ? parallel      
AA5 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LEU A 70  ? PRO A 71  ? LEU A 64  PRO A 65  
AA1 2 ARG A 260 ? ASN A 264 ? ARG A 254 ASN A 258 
AA1 3 SER A 240 ? GLU A 247 ? SER A 234 GLU A 241 
AA1 4 ILE A 232 ? VAL A 236 ? ILE A 226 VAL A 230 
AA1 5 LEU A 412 ? ASP A 419 ? LEU A 406 ASP A 413 
AA1 6 CYS A 444 ? ARG A 450 ? CYS A 438 ARG A 444 
AA2 1 GLU A 112 ? MET A 113 ? GLU A 106 MET A 107 
AA2 2 VAL A 98  ? VAL A 103 ? VAL A 92  VAL A 97  
AA2 3 GLY A 84  ? ASP A 90  ? GLY A 78  ASP A 84  
AA2 4 LEU A 156 ? THR A 159 ? LEU A 150 THR A 153 
AA2 5 VAL A 210 ? VAL A 213 ? VAL A 204 VAL A 207 
AA3 1 LEU A 518 ? PRO A 519 ? LEU A 512 PRO A 513 
AA3 2 ARG A 708 ? ASN A 712 ? ARG A 702 ASN A 706 
AA3 3 SER A 688 ? GLU A 695 ? SER A 682 GLU A 689 
AA3 4 CYS A 678 ? VAL A 684 ? CYS A 672 VAL A 678 
AA3 5 LEU A 860 ? ASP A 867 ? LEU A 854 ASP A 861 
AA3 6 CYS A 892 ? GLN A 898 ? CYS A 886 GLN A 892 
AA4 1 VAL A 559 ? TYR A 566 ? VAL A 553 TYR A 560 
AA4 2 PHE A 544 ? VAL A 551 ? PHE A 538 VAL A 545 
AA4 3 GLY A 532 ? LEU A 539 ? GLY A 526 LEU A 533 
AA4 4 LEU A 602 ? PHE A 608 ? LEU A 596 PHE A 602 
AA4 5 LEU A 655 ? VAL A 661 ? LEU A 649 VAL A 655 
AA5 1 CYS A 612 ? SER A 616 ? CYS A 606 SER A 610 
AA5 2 GLU A 619 ? LEU A 622 ? GLU A 613 LEU A 616 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LEU A 70  ? N LEU A 64  O ASN A 264 ? O ASN A 258 
AA1 2 3 O MET A 261 ? O MET A 255 N GLU A 246 ? N GLU A 240 
AA1 3 4 O ASN A 241 ? O ASN A 235 N ILE A 235 ? N ILE A 229 
AA1 4 5 N ILE A 232 ? N ILE A 226 O GLY A 417 ? O GLY A 411 
AA1 5 6 N VAL A 418 ? N VAL A 412 O LEU A 449 ? O LEU A 443 
AA2 1 2 O GLU A 112 ? O GLU A 106 N LYS A 102 ? N LYS A 96  
AA2 2 3 O VAL A 101 ? O VAL A 95  N PHE A 86  ? N PHE A 80  
AA2 3 4 N LEU A 87  ? N LEU A 81  O GLY A 157 ? O GLY A 151 
AA2 4 5 N PHE A 158 ? N PHE A 152 O VAL A 213 ? O VAL A 207 
AA3 1 2 N LEU A 518 ? N LEU A 512 O ASN A 712 ? O ASN A 706 
AA3 2 3 O MET A 709 ? O MET A 703 N GLU A 694 ? N GLU A 688 
AA3 3 4 O ASN A 689 ? O ASN A 683 N ILE A 683 ? N ILE A 677 
AA3 4 5 N LEU A 682 ? N LEU A 676 O GLY A 865 ? O GLY A 859 
AA3 5 6 N VAL A 866 ? N VAL A 860 O LEU A 897 ? O LEU A 891 
AA4 1 2 O GLU A 560 ? O GLU A 554 N ARG A 550 ? N ARG A 544 
AA4 2 3 O LEU A 547 ? O LEU A 541 N ALA A 536 ? N ALA A 530 
AA4 3 4 N LEU A 537 ? N LEU A 531 O THR A 607 ? O THR A 601 
AA4 4 5 N PHE A 606 ? N PHE A 600 O VAL A 661 ? O VAL A 655 
AA5 1 2 N GLN A 613 ? N GLN A 607 O ILE A 621 ? O ILE A 615 
# 
_atom_sites.entry_id                    5HG1 
_atom_sites.fract_transf_matrix[1][1]   0.006056 
_atom_sites.fract_transf_matrix[1][2]   0.003497 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006993 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007907 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
H  
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N    . ASP A 1 23  ? 65.768 -68.743 18.964  1.00 88.92  ? 17   ASP A N    1 
ATOM   2    C  CA   . ASP A 1 23  ? 65.246 -69.986 19.547  1.00 101.08 ? 17   ASP A CA   1 
ATOM   3    C  C    . ASP A 1 23  ? 63.746 -70.144 19.428  1.00 98.62  ? 17   ASP A C    1 
ATOM   4    O  O    . ASP A 1 23  ? 63.247 -71.231 19.097  1.00 96.28  ? 17   ASP A O    1 
ATOM   5    C  CB   . ASP A 1 23  ? 65.613 -70.097 21.026  1.00 105.99 ? 17   ASP A CB   1 
ATOM   6    C  CG   . ASP A 1 23  ? 64.932 -71.283 21.706  1.00 110.35 ? 17   ASP A CG   1 
ATOM   7    O  OD1  . ASP A 1 23  ? 65.232 -72.439 21.327  1.00 108.05 ? 17   ASP A OD1  1 
ATOM   8    O  OD2  . ASP A 1 23  ? 64.089 -71.059 22.609  1.00 114.80 ? 17   ASP A OD2  1 
ATOM   9    N  N    . GLN A 1 24  ? 63.026 -69.068 19.752  1.00 97.82  ? 18   GLN A N    1 
ATOM   10   C  CA   . GLN A 1 24  ? 61.588 -69.031 19.490  1.00 96.40  ? 18   GLN A CA   1 
ATOM   11   C  C    . GLN A 1 24  ? 61.291 -68.993 17.991  1.00 97.82  ? 18   GLN A C    1 
ATOM   12   O  O    . GLN A 1 24  ? 60.266 -69.525 17.532  1.00 97.99  ? 18   GLN A O    1 
ATOM   13   C  CB   . GLN A 1 24  ? 60.959 -67.820 20.176  1.00 95.93  ? 18   GLN A CB   1 
ATOM   14   C  CG   . GLN A 1 24  ? 59.403 -67.750 19.989  1.00 95.92  ? 18   GLN A CG   1 
ATOM   15   C  CD   . GLN A 1 24  ? 58.648 -68.938 20.602  1.00 98.78  ? 18   GLN A CD   1 
ATOM   16   O  OE1  . GLN A 1 24  ? 58.967 -69.310 21.734  1.00 98.49  ? 18   GLN A OE1  1 
ATOM   17   N  NE2  . GLN A 1 24  ? 57.602 -69.459 19.925  1.00 93.00  ? 18   GLN A NE2  1 
ATOM   18   N  N    . VAL A 1 25  ? 62.155 -68.328 17.214  1.00 96.30  ? 19   VAL A N    1 
ATOM   19   C  CA   . VAL A 1 25  ? 61.966 -68.291 15.766  1.00 83.13  ? 19   VAL A CA   1 
ATOM   20   C  C    . VAL A 1 25  ? 62.006 -69.705 15.211  1.00 84.43  ? 19   VAL A C    1 
ATOM   21   O  O    . VAL A 1 25  ? 61.062 -70.162 14.562  1.00 87.82  ? 19   VAL A O    1 
ATOM   22   C  CB   . VAL A 1 25  ? 63.013 -67.390 15.087  1.00 75.84  ? 19   VAL A CB   1 
ATOM   23   C  CG1  . VAL A 1 25  ? 62.902 -65.956 15.589  1.00 67.32  ? 19   VAL A CG1  1 
ATOM   24   C  CG2  . VAL A 1 25  ? 64.406 -67.948 15.256  1.00 78.77  ? 19   VAL A CG2  1 
ATOM   25   N  N    . GLN A 1 26  ? 63.078 -70.441 15.506  1.00 83.29  ? 20   GLN A N    1 
ATOM   26   C  CA   . GLN A 1 26  ? 63.233 -71.758 14.900  1.00 84.55  ? 20   GLN A CA   1 
ATOM   27   C  C    . GLN A 1 26  ? 61.985 -72.623 15.089  1.00 87.35  ? 20   GLN A C    1 
ATOM   28   O  O    . GLN A 1 26  ? 61.712 -73.508 14.266  1.00 88.90  ? 20   GLN A O    1 
ATOM   29   C  CB   . GLN A 1 26  ? 64.476 -72.452 15.459  1.00 82.46  ? 20   GLN A CB   1 
ATOM   30   N  N    . LYS A 1 27  ? 61.203 -72.372 16.144  1.00 89.22  ? 21   LYS A N    1 
ATOM   31   C  CA   . LYS A 1 27  ? 59.932 -73.078 16.290  1.00 90.06  ? 21   LYS A CA   1 
ATOM   32   C  C    . LYS A 1 27  ? 58.881 -72.543 15.333  1.00 85.10  ? 21   LYS A C    1 
ATOM   33   O  O    . LYS A 1 27  ? 58.119 -73.325 14.755  1.00 86.40  ? 21   LYS A O    1 
ATOM   34   C  CB   . LYS A 1 27  ? 59.375 -72.974 17.711  1.00 98.64  ? 21   LYS A CB   1 
ATOM   35   C  CG   . LYS A 1 27  ? 58.009 -73.683 17.821  1.00 97.35  ? 21   LYS A CG   1 
ATOM   36   C  CD   . LYS A 1 27  ? 57.287 -73.412 19.131  1.00 104.46 ? 21   LYS A CD   1 
ATOM   37   C  CE   . LYS A 1 27  ? 56.578 -72.057 19.088  1.00 98.12  ? 21   LYS A CE   1 
ATOM   38   N  NZ   . LYS A 1 27  ? 55.820 -71.769 20.344  1.00 98.75  ? 21   LYS A NZ   1 
ATOM   39   N  N    . VAL A 1 28  ? 58.784 -71.217 15.197  1.00 83.47  ? 22   VAL A N    1 
ATOM   40   C  CA   . VAL A 1 28  ? 57.896 -70.638 14.186  1.00 86.27  ? 22   VAL A CA   1 
ATOM   41   C  C    . VAL A 1 28  ? 58.313 -71.090 12.783  1.00 79.46  ? 22   VAL A C    1 
ATOM   42   O  O    . VAL A 1 28  ? 57.494 -71.598 12.009  1.00 74.46  ? 22   VAL A O    1 
ATOM   43   C  CB   . VAL A 1 28  ? 57.871 -69.105 14.308  1.00 80.38  ? 22   VAL A CB   1 
ATOM   44   C  CG1  . VAL A 1 28  ? 57.065 -68.507 13.178  1.00 75.02  ? 22   VAL A CG1  1 
ATOM   45   C  CG2  . VAL A 1 28  ? 57.300 -68.697 15.648  1.00 73.83  ? 22   VAL A CG2  1 
ATOM   46   N  N    . ASP A 1 29  ? 59.598 -70.930 12.442  1.00 79.63  ? 23   ASP A N    1 
ATOM   47   C  CA   . ASP A 1 29  ? 60.097 -71.425 11.161  1.00 79.80  ? 23   ASP A CA   1 
ATOM   48   C  C    . ASP A 1 29  ? 59.671 -72.864 10.911  1.00 80.22  ? 23   ASP A C    1 
ATOM   49   O  O    . ASP A 1 29  ? 59.280 -73.219 9.794   1.00 85.65  ? 23   ASP A O    1 
ATOM   50   C  CB   . ASP A 1 29  ? 61.625 -71.337 11.093  1.00 78.04  ? 23   ASP A CB   1 
ATOM   51   C  CG   . ASP A 1 29  ? 62.127 -69.915 11.052  1.00 78.24  ? 23   ASP A CG   1 
ATOM   52   O  OD1  . ASP A 1 29  ? 61.286 -69.001 10.983  1.00 77.00  ? 23   ASP A OD1  1 
ATOM   53   O  OD2  . ASP A 1 29  ? 63.360 -69.709 11.032  1.00 76.15  ? 23   ASP A OD2  1 
ATOM   54   N  N    . GLN A 1 30  ? 59.777 -73.717 11.929  1.00 78.79  ? 24   GLN A N    1 
ATOM   55   C  CA   . GLN A 1 30  ? 59.409 -75.117 11.770  1.00 80.49  ? 24   GLN A CA   1 
ATOM   56   C  C    . GLN A 1 30  ? 57.903 -75.284 11.649  1.00 77.71  ? 24   GLN A C    1 
ATOM   57   O  O    . GLN A 1 30  ? 57.431 -76.214 10.989  1.00 76.92  ? 24   GLN A O    1 
ATOM   58   C  CB   . GLN A 1 30  ? 59.938 -75.924 12.956  1.00 86.52  ? 24   GLN A CB   1 
ATOM   59   C  CG   . GLN A 1 30  ? 59.574 -77.409 12.949  1.00 93.38  ? 24   GLN A CG   1 
ATOM   60   C  CD   . GLN A 1 30  ? 60.297 -78.202 11.878  1.00 100.96 ? 24   GLN A CD   1 
ATOM   61   O  OE1  . GLN A 1 30  ? 59.739 -78.497 10.812  1.00 96.85  ? 24   GLN A OE1  1 
ATOM   62   N  NE2  . GLN A 1 30  ? 61.547 -78.571 12.165  1.00 103.70 ? 24   GLN A NE2  1 
ATOM   63   N  N    . TYR A 1 31  ? 57.138 -74.411 12.293  1.00 79.55  ? 25   TYR A N    1 
ATOM   64   C  CA   . TYR A 1 31  ? 55.691 -74.581 12.331  1.00 80.21  ? 25   TYR A CA   1 
ATOM   65   C  C    . TYR A 1 31  ? 55.047 -74.054 11.052  1.00 76.77  ? 25   TYR A C    1 
ATOM   66   O  O    . TYR A 1 31  ? 54.191 -74.720 10.462  1.00 78.21  ? 25   TYR A O    1 
ATOM   67   C  CB   . TYR A 1 31  ? 55.138 -73.892 13.584  1.00 72.89  ? 25   TYR A CB   1 
ATOM   68   C  CG   . TYR A 1 31  ? 53.648 -73.999 13.779  1.00 75.47  ? 25   TYR A CG   1 
ATOM   69   C  CD1  . TYR A 1 31  ? 53.059 -75.189 14.208  1.00 74.63  ? 25   TYR A CD1  1 
ATOM   70   C  CD2  . TYR A 1 31  ? 52.834 -72.903 13.566  1.00 73.83  ? 25   TYR A CD2  1 
ATOM   71   C  CE1  . TYR A 1 31  ? 51.691 -75.277 14.388  1.00 75.22  ? 25   TYR A CE1  1 
ATOM   72   C  CE2  . TYR A 1 31  ? 51.481 -72.973 13.751  1.00 76.42  ? 25   TYR A CE2  1 
ATOM   73   C  CZ   . TYR A 1 31  ? 50.910 -74.159 14.157  1.00 80.22  ? 25   TYR A CZ   1 
ATOM   74   O  OH   . TYR A 1 31  ? 49.547 -74.209 14.328  1.00 85.96  ? 25   TYR A OH   1 
ATOM   75   N  N    . LEU A 1 32  ? 55.501 -72.892 10.590  1.00 74.31  ? 26   LEU A N    1 
ATOM   76   C  CA   . LEU A 1 32  ? 55.101 -72.259 9.345   1.00 67.62  ? 26   LEU A CA   1 
ATOM   77   C  C    . LEU A 1 32  ? 55.920 -72.758 8.160   1.00 76.40  ? 26   LEU A C    1 
ATOM   78   O  O    . LEU A 1 32  ? 55.982 -72.083 7.120   1.00 74.98  ? 26   LEU A O    1 
ATOM   79   C  CB   . LEU A 1 32  ? 55.198 -70.746 9.459   1.00 62.74  ? 26   LEU A CB   1 
ATOM   80   C  CG   . LEU A 1 32  ? 54.162 -70.157 10.387  1.00 65.64  ? 26   LEU A CG   1 
ATOM   81   C  CD1  . LEU A 1 32  ? 54.338 -68.664 10.435  1.00 67.85  ? 26   LEU A CD1  1 
ATOM   82   C  CD2  . LEU A 1 32  ? 52.783 -70.523 9.904   1.00 69.35  ? 26   LEU A CD2  1 
ATOM   83   N  N    . TYR A 1 33  ? 56.593 -73.892 8.334   1.00 74.54  ? 27   TYR A N    1 
ATOM   84   C  CA   . TYR A 1 33  ? 57.459 -74.540 7.362   1.00 75.47  ? 27   TYR A CA   1 
ATOM   85   C  C    . TYR A 1 33  ? 56.932 -74.513 5.924   1.00 80.38  ? 27   TYR A C    1 
ATOM   86   O  O    . TYR A 1 33  ? 57.699 -74.269 4.987   1.00 75.79  ? 27   TYR A O    1 
ATOM   87   C  CB   . TYR A 1 33  ? 57.652 -75.973 7.854   1.00 78.08  ? 27   TYR A CB   1 
ATOM   88   C  CG   . TYR A 1 33  ? 58.168 -76.954 6.861   1.00 88.25  ? 27   TYR A CG   1 
ATOM   89   C  CD1  . TYR A 1 33  ? 59.489 -76.907 6.431   1.00 93.25  ? 27   TYR A CD1  1 
ATOM   90   C  CD2  . TYR A 1 33  ? 57.351 -77.977 6.396   1.00 92.10  ? 27   TYR A CD2  1 
ATOM   91   C  CE1  . TYR A 1 33  ? 59.980 -77.825 5.524   1.00 99.32  ? 27   TYR A CE1  1 
ATOM   92   C  CE2  . TYR A 1 33  ? 57.827 -78.904 5.490   1.00 103.45 ? 27   TYR A CE2  1 
ATOM   93   C  CZ   . TYR A 1 33  ? 59.148 -78.824 5.056   1.00 107.90 ? 27   TYR A CZ   1 
ATOM   94   O  OH   . TYR A 1 33  ? 59.640 -79.739 4.149   1.00 117.43 ? 27   TYR A OH   1 
ATOM   95   N  N    . HIS A 1 34  ? 55.631 -74.718 5.731   1.00 83.21  ? 28   HIS A N    1 
ATOM   96   C  CA   . HIS A 1 34  ? 55.059 -74.716 4.389   1.00 79.16  ? 28   HIS A CA   1 
ATOM   97   C  C    . HIS A 1 34  ? 54.899 -73.312 3.800   1.00 77.70  ? 28   HIS A C    1 
ATOM   98   O  O    . HIS A 1 34  ? 54.633 -73.196 2.592   1.00 80.17  ? 28   HIS A O    1 
ATOM   99   C  CB   . HIS A 1 34  ? 53.709 -75.452 4.407   1.00 78.99  ? 28   HIS A CB   1 
ATOM   100  C  CG   . HIS A 1 34  ? 53.810 -76.867 4.894   1.00 93.60  ? 28   HIS A CG   1 
ATOM   101  N  ND1  . HIS A 1 34  ? 54.317 -77.890 4.119   1.00 99.10  ? 28   HIS A ND1  1 
ATOM   102  C  CD2  . HIS A 1 34  ? 53.530 -77.415 6.103   1.00 101.78 ? 28   HIS A CD2  1 
ATOM   103  C  CE1  . HIS A 1 34  ? 54.314 -79.013 4.818   1.00 102.26 ? 28   HIS A CE1  1 
ATOM   104  N  NE2  . HIS A 1 34  ? 53.845 -78.752 6.026   1.00 106.17 ? 28   HIS A NE2  1 
ATOM   105  N  N    . MET A 1 35  ? 55.041 -72.253 4.607   1.00 68.81  ? 29   MET A N    1 
ATOM   106  C  CA   . MET A 1 35  ? 55.007 -70.875 4.122   1.00 60.47  ? 29   MET A CA   1 
ATOM   107  C  C    . MET A 1 35  ? 56.388 -70.267 3.893   1.00 64.49  ? 29   MET A C    1 
ATOM   108  O  O    . MET A 1 35  ? 56.488 -69.052 3.691   1.00 58.88  ? 29   MET A O    1 
ATOM   109  C  CB   . MET A 1 35  ? 54.208 -69.982 5.063   1.00 56.44  ? 29   MET A CB   1 
ATOM   110  C  CG   . MET A 1 35  ? 52.756 -70.271 5.033   1.00 54.31  ? 29   MET A CG   1 
ATOM   111  S  SD   . MET A 1 35  ? 51.817 -69.127 6.022   1.00 63.22  ? 29   MET A SD   1 
ATOM   112  C  CE   . MET A 1 35  ? 51.910 -67.590 5.123   1.00 50.68  ? 29   MET A CE   1 
ATOM   113  N  N    . ARG A 1 36  ? 57.456 -71.051 4.001   1.00 69.37  ? 30   ARG A N    1 
ATOM   114  C  CA   . ARG A 1 36  ? 58.794 -70.574 3.673   1.00 67.80  ? 30   ARG A CA   1 
ATOM   115  C  C    . ARG A 1 36  ? 59.259 -71.348 2.442   1.00 69.60  ? 30   ARG A C    1 
ATOM   116  O  O    . ARG A 1 36  ? 59.629 -72.528 2.545   1.00 67.82  ? 30   ARG A O    1 
ATOM   117  C  CB   . ARG A 1 36  ? 59.747 -70.747 4.856   1.00 68.79  ? 30   ARG A CB   1 
ATOM   118  C  CG   . ARG A 1 36  ? 59.288 -69.988 6.100   1.00 76.03  ? 30   ARG A CG   1 
ATOM   119  C  CD   . ARG A 1 36  ? 60.324 -69.980 7.204   1.00 74.42  ? 30   ARG A CD   1 
ATOM   120  N  NE   . ARG A 1 36  ? 60.775 -71.338 7.458   1.00 79.17  ? 30   ARG A NE   1 
ATOM   121  C  CZ   . ARG A 1 36  ? 61.984 -71.775 7.134   1.00 78.61  ? 30   ARG A CZ   1 
ATOM   122  N  NH1  . ARG A 1 36  ? 62.861 -70.929 6.601   1.00 75.27  ? 30   ARG A NH1  1 
ATOM   123  N  NH2  . ARG A 1 36  ? 62.326 -73.038 7.378   1.00 76.72  ? 30   ARG A NH2  1 
ATOM   124  N  N    . LEU A 1 37  ? 59.278 -70.663 1.291   1.00 70.18  ? 31   LEU A N    1 
ATOM   125  C  CA   . LEU A 1 37  ? 59.362 -71.299 -0.022  1.00 65.33  ? 31   LEU A CA   1 
ATOM   126  C  C    . LEU A 1 37  ? 60.800 -71.258 -0.527  1.00 64.15  ? 31   LEU A C    1 
ATOM   127  O  O    . LEU A 1 37  ? 61.404 -70.179 -0.614  1.00 62.42  ? 31   LEU A O    1 
ATOM   128  C  CB   . LEU A 1 37  ? 58.424 -70.599 -1.003  1.00 65.05  ? 31   LEU A CB   1 
ATOM   129  C  CG   . LEU A 1 37  ? 56.937 -70.595 -0.623  1.00 67.11  ? 31   LEU A CG   1 
ATOM   130  C  CD1  . LEU A 1 37  ? 56.115 -69.714 -1.580  1.00 59.05  ? 31   LEU A CD1  1 
ATOM   131  C  CD2  . LEU A 1 37  ? 56.392 -72.021 -0.566  1.00 63.92  ? 31   LEU A CD2  1 
ATOM   132  N  N    . SER A 1 38  ? 61.344 -72.431 -0.847  1.00 60.93  ? 32   SER A N    1 
ATOM   133  C  CA   . SER A 1 38  ? 62.699 -72.536 -1.370  1.00 61.00  ? 32   SER A CA   1 
ATOM   134  C  C    . SER A 1 38  ? 62.790 -71.958 -2.784  1.00 69.95  ? 32   SER A C    1 
ATOM   135  O  O    . SER A 1 38  ? 61.786 -71.786 -3.488  1.00 66.85  ? 32   SER A O    1 
ATOM   136  C  CB   . SER A 1 38  ? 63.160 -73.996 -1.379  1.00 65.06  ? 32   SER A CB   1 
ATOM   137  O  OG   . SER A 1 38  ? 62.360 -74.795 -2.240  1.00 71.25  ? 32   SER A OG   1 
ATOM   138  N  N    . ASP A 1 39  ? 64.025 -71.644 -3.196  1.00 70.70  ? 33   ASP A N    1 
ATOM   139  C  CA   . ASP A 1 39  ? 64.249 -71.190 -4.564  1.00 65.90  ? 33   ASP A CA   1 
ATOM   140  C  C    . ASP A 1 39  ? 63.835 -72.249 -5.576  1.00 69.84  ? 33   ASP A C    1 
ATOM   141  O  O    . ASP A 1 39  ? 63.340 -71.917 -6.662  1.00 65.30  ? 33   ASP A O    1 
ATOM   142  C  CB   . ASP A 1 39  ? 65.712 -70.804 -4.772  1.00 66.22  ? 33   ASP A CB   1 
ATOM   143  C  CG   . ASP A 1 39  ? 66.061 -69.473 -4.129  1.00 71.69  ? 33   ASP A CG   1 
ATOM   144  O  OD1  . ASP A 1 39  ? 65.131 -68.758 -3.687  1.00 67.90  ? 33   ASP A OD1  1 
ATOM   145  O  OD2  . ASP A 1 39  ? 67.261 -69.114 -4.119  1.00 72.81  ? 33   ASP A OD2  1 
ATOM   146  N  N    . GLU A 1 40  ? 64.005 -73.524 -5.231  1.00 72.96  ? 34   GLU A N    1 
ATOM   147  C  CA   . GLU A 1 40  ? 63.593 -74.586 -6.137  1.00 68.74  ? 34   GLU A CA   1 
ATOM   148  C  C    . GLU A 1 40  ? 62.090 -74.534 -6.407  1.00 70.48  ? 34   GLU A C    1 
ATOM   149  O  O    . GLU A 1 40  ? 61.658 -74.666 -7.555  1.00 70.90  ? 34   GLU A O    1 
ATOM   150  C  CB   . GLU A 1 40  ? 64.029 -75.937 -5.565  1.00 70.58  ? 34   GLU A CB   1 
ATOM   151  C  CG   . GLU A 1 40  ? 63.718 -77.134 -6.446  1.00 78.15  ? 34   GLU A CG   1 
ATOM   152  C  CD   . GLU A 1 40  ? 64.386 -78.414 -5.959  1.00 84.46  ? 34   GLU A CD   1 
ATOM   153  O  OE1  . GLU A 1 40  ? 65.103 -78.373 -4.942  1.00 90.13  ? 34   GLU A OE1  1 
ATOM   154  O  OE2  . GLU A 1 40  ? 64.203 -79.466 -6.601  1.00 93.98  ? 34   GLU A OE2  1 
ATOM   155  N  N    . THR A 1 41  ? 61.269 -74.325 -5.373  1.00 74.09  ? 35   THR A N    1 
ATOM   156  C  CA   . THR A 1 41  ? 59.834 -74.296 -5.639  1.00 72.85  ? 35   THR A CA   1 
ATOM   157  C  C    . THR A 1 41  ? 59.392 -72.970 -6.243  1.00 70.11  ? 35   THR A C    1 
ATOM   158  O  O    . THR A 1 41  ? 58.303 -72.906 -6.822  1.00 73.34  ? 35   THR A O    1 
ATOM   159  C  CB   . THR A 1 41  ? 59.003 -74.577 -4.370  1.00 68.39  ? 35   THR A CB   1 
ATOM   160  O  OG1  . THR A 1 41  ? 59.112 -73.478 -3.468  1.00 71.88  ? 35   THR A OG1  1 
ATOM   161  C  CG2  . THR A 1 41  ? 59.483 -75.846 -3.665  1.00 59.16  ? 35   THR A CG2  1 
ATOM   162  N  N    . LEU A 1 42  ? 60.198 -71.910 -6.119  1.00 65.59  ? 36   LEU A N    1 
ATOM   163  C  CA   . LEU A 1 42  ? 59.865 -70.658 -6.792  1.00 66.69  ? 36   LEU A CA   1 
ATOM   164  C  C    . LEU A 1 42  ? 60.141 -70.735 -8.297  1.00 69.67  ? 36   LEU A C    1 
ATOM   165  O  O    . LEU A 1 42  ? 59.416 -70.125 -9.099  1.00 63.05  ? 36   LEU A O    1 
ATOM   166  C  CB   . LEU A 1 42  ? 60.636 -69.495 -6.158  1.00 67.74  ? 36   LEU A CB   1 
ATOM   167  C  CG   . LEU A 1 42  ? 60.357 -69.038 -4.716  1.00 65.05  ? 36   LEU A CG   1 
ATOM   168  C  CD1  . LEU A 1 42  ? 61.382 -67.986 -4.308  1.00 54.44  ? 36   LEU A CD1  1 
ATOM   169  C  CD2  . LEU A 1 42  ? 58.959 -68.466 -4.592  1.00 58.93  ? 36   LEU A CD2  1 
ATOM   170  N  N    . LEU A 1 43  ? 61.173 -71.482 -8.696  1.00 68.16  ? 37   LEU A N    1 
ATOM   171  C  CA   . LEU A 1 43  ? 61.377 -71.755 -10.110 1.00 63.73  ? 37   LEU A CA   1 
ATOM   172  C  C    . LEU A 1 43  ? 60.247 -72.607 -10.656 1.00 65.69  ? 37   LEU A C    1 
ATOM   173  O  O    . LEU A 1 43  ? 59.762 -72.368 -11.769 1.00 67.63  ? 37   LEU A O    1 
ATOM   174  C  CB   . LEU A 1 43  ? 62.726 -72.437 -10.324 1.00 63.72  ? 37   LEU A CB   1 
ATOM   175  C  CG   . LEU A 1 43  ? 63.900 -71.542 -9.921  1.00 68.35  ? 37   LEU A CG   1 
ATOM   176  C  CD1  . LEU A 1 43  ? 65.233 -72.275 -10.001 1.00 69.18  ? 37   LEU A CD1  1 
ATOM   177  C  CD2  . LEU A 1 43  ? 63.921 -70.272 -10.761 1.00 68.83  ? 37   LEU A CD2  1 
ATOM   178  N  N    . GLU A 1 44  ? 59.813 -73.606 -9.888  1.00 66.09  ? 38   GLU A N    1 
ATOM   179  C  CA   . GLU A 1 44  ? 58.622 -74.360 -10.255 1.00 66.04  ? 38   GLU A CA   1 
ATOM   180  C  C    . GLU A 1 44  ? 57.443 -73.433 -10.494 1.00 65.86  ? 38   GLU A C    1 
ATOM   181  O  O    . GLU A 1 44  ? 56.723 -73.565 -11.489 1.00 66.85  ? 38   GLU A O    1 
ATOM   182  C  CB   . GLU A 1 44  ? 58.265 -75.375 -9.171  1.00 69.04  ? 38   GLU A CB   1 
ATOM   183  C  CG   . GLU A 1 44  ? 56.976 -76.097 -9.490  1.00 68.48  ? 38   GLU A CG   1 
ATOM   184  C  CD   . GLU A 1 44  ? 57.122 -76.954 -10.702 1.00 81.37  ? 38   GLU A CD   1 
ATOM   185  O  OE1  . GLU A 1 44  ? 58.280 -77.358 -10.951 1.00 88.22  ? 38   GLU A OE1  1 
ATOM   186  O  OE2  . GLU A 1 44  ? 56.118 -77.158 -11.440 1.00 82.78  ? 38   GLU A OE2  1 
ATOM   187  N  N    . ILE A 1 45  ? 57.221 -72.493 -9.580  1.00 62.50  ? 39   ILE A N    1 
ATOM   188  C  CA   . ILE A 1 45  ? 56.067 -71.614 -9.711  1.00 62.34  ? 39   ILE A CA   1 
ATOM   189  C  C    . ILE A 1 45  ? 56.204 -70.730 -10.942 1.00 59.07  ? 39   ILE A C    1 
ATOM   190  O  O    . ILE A 1 45  ? 55.256 -70.590 -11.716 1.00 64.31  ? 39   ILE A O    1 
ATOM   191  C  CB   . ILE A 1 45  ? 55.858 -70.787 -8.429  1.00 60.50  ? 39   ILE A CB   1 
ATOM   192  C  CG1  . ILE A 1 45  ? 55.463 -71.711 -7.284  1.00 56.76  ? 39   ILE A CG1  1 
ATOM   193  C  CG2  . ILE A 1 45  ? 54.786 -69.744 -8.644  1.00 53.14  ? 39   ILE A CG2  1 
ATOM   194  C  CD1  . ILE A 1 45  ? 55.413 -71.021 -5.945  1.00 66.21  ? 39   ILE A CD1  1 
ATOM   195  N  N    . SER A 1 46  ? 57.383 -70.135 -11.160 1.00 58.31  ? 40   SER A N    1 
ATOM   196  C  CA   . SER A 1 46  ? 57.537 -69.230 -12.302 1.00 62.45  ? 40   SER A CA   1 
ATOM   197  C  C    . SER A 1 46  ? 57.355 -69.970 -13.626 1.00 59.82  ? 40   SER A C    1 
ATOM   198  O  O    . SER A 1 46  ? 56.680 -69.474 -14.538 1.00 56.79  ? 40   SER A O    1 
ATOM   199  C  CB   . SER A 1 46  ? 58.897 -68.530 -12.265 1.00 62.81  ? 40   SER A CB   1 
ATOM   200  O  OG   . SER A 1 46  ? 59.945 -69.453 -12.483 1.00 68.14  ? 40   SER A OG   1 
ATOM   201  N  N    . LYS A 1 47  ? 57.942 -71.161 -13.748 1.00 57.34  ? 41   LYS A N    1 
ATOM   202  C  CA   . LYS A 1 47  ? 57.665 -72.002 -14.906 1.00 55.38  ? 41   LYS A CA   1 
ATOM   203  C  C    . LYS A 1 47  ? 56.166 -72.213 -15.078 1.00 58.93  ? 41   LYS A C    1 
ATOM   204  O  O    . LYS A 1 47  ? 55.630 -72.080 -16.181 1.00 62.29  ? 41   LYS A O    1 
ATOM   205  C  CB   . LYS A 1 47  ? 58.400 -73.336 -14.771 1.00 52.66  ? 41   LYS A CB   1 
ATOM   206  C  CG   . LYS A 1 47  ? 57.734 -74.497 -15.466 1.00 51.44  ? 41   LYS A CG   1 
ATOM   207  N  N    . ARG A 1 48  ? 55.463 -72.517 -13.987 1.00 59.93  ? 42   ARG A N    1 
ATOM   208  C  CA   . ARG A 1 48  ? 54.023 -72.722 -14.086 1.00 56.21  ? 42   ARG A CA   1 
ATOM   209  C  C    . ARG A 1 48  ? 53.329 -71.471 -14.585 1.00 57.29  ? 42   ARG A C    1 
ATOM   210  O  O    . ARG A 1 48  ? 52.321 -71.551 -15.301 1.00 55.70  ? 42   ARG A O    1 
ATOM   211  C  CB   . ARG A 1 48  ? 53.437 -73.104 -12.734 1.00 56.75  ? 42   ARG A CB   1 
ATOM   212  C  CG   . ARG A 1 48  ? 53.922 -74.396 -12.164 1.00 62.18  ? 42   ARG A CG   1 
ATOM   213  C  CD   . ARG A 1 48  ? 53.149 -74.615 -10.910 1.00 67.02  ? 42   ARG A CD   1 
ATOM   214  N  NE   . ARG A 1 48  ? 53.598 -75.766 -10.149 1.00 69.93  ? 42   ARG A NE   1 
ATOM   215  C  CZ   . ARG A 1 48  ? 53.010 -76.154 -9.030  1.00 62.11  ? 42   ARG A CZ   1 
ATOM   216  N  NH1  . ARG A 1 48  ? 51.954 -75.489 -8.597  1.00 57.38  ? 42   ARG A NH1  1 
ATOM   217  N  NH2  . ARG A 1 48  ? 53.449 -77.216 -8.380  1.00 62.17  ? 42   ARG A NH2  1 
ATOM   218  N  N    . PHE A 1 49  ? 53.819 -70.302 -14.172 1.00 54.06  ? 43   PHE A N    1 
ATOM   219  C  CA   . PHE A 1 49  ? 53.162 -69.081 -14.596 1.00 54.09  ? 43   PHE A CA   1 
ATOM   220  C  C    . PHE A 1 49  ? 53.467 -68.772 -16.056 1.00 58.71  ? 43   PHE A C    1 
ATOM   221  O  O    . PHE A 1 49  ? 52.675 -68.085 -16.714 1.00 56.88  ? 43   PHE A O    1 
ATOM   222  C  CB   . PHE A 1 49  ? 53.557 -67.921 -13.689 1.00 45.89  ? 43   PHE A CB   1 
ATOM   223  C  CG   . PHE A 1 49  ? 52.902 -66.627 -14.052 1.00 47.61  ? 43   PHE A CG   1 
ATOM   224  C  CD1  . PHE A 1 49  ? 51.556 -66.423 -13.791 1.00 46.46  ? 43   PHE A CD1  1 
ATOM   225  C  CD2  . PHE A 1 49  ? 53.631 -65.600 -14.617 1.00 48.73  ? 43   PHE A CD2  1 
ATOM   226  C  CE1  . PHE A 1 49  ? 50.940 -65.230 -14.108 1.00 45.72  ? 43   PHE A CE1  1 
ATOM   227  C  CE2  . PHE A 1 49  ? 53.025 -64.404 -14.931 1.00 51.51  ? 43   PHE A CE2  1 
ATOM   228  C  CZ   . PHE A 1 49  ? 51.674 -64.220 -14.674 1.00 50.56  ? 43   PHE A CZ   1 
ATOM   229  N  N    . ARG A 1 50  ? 54.570 -69.294 -16.596 1.00 55.66  ? 44   ARG A N    1 
ATOM   230  C  CA   . ARG A 1 50  ? 54.785 -69.103 -18.022 1.00 62.89  ? 44   ARG A CA   1 
ATOM   231  C  C    . ARG A 1 50  ? 53.769 -69.910 -18.830 1.00 63.60  ? 44   ARG A C    1 
ATOM   232  O  O    . ARG A 1 50  ? 53.158 -69.377 -19.768 1.00 62.47  ? 44   ARG A O    1 
ATOM   233  C  CB   . ARG A 1 50  ? 56.225 -69.448 -18.418 1.00 63.19  ? 44   ARG A CB   1 
ATOM   234  C  CG   . ARG A 1 50  ? 56.515 -68.919 -19.814 1.00 71.54  ? 44   ARG A CG   1 
ATOM   235  C  CD   . ARG A 1 50  ? 57.976 -68.999 -20.223 1.00 84.44  ? 44   ARG A CD   1 
ATOM   236  N  NE   . ARG A 1 50  ? 58.195 -68.321 -21.503 1.00 75.11  ? 44   ARG A NE   1 
ATOM   237  C  CZ   . ARG A 1 50  ? 57.970 -68.880 -22.689 1.00 79.75  ? 44   ARG A CZ   1 
ATOM   238  N  NH1  . ARG A 1 50  ? 57.515 -70.131 -22.772 1.00 82.78  ? 44   ARG A NH1  1 
ATOM   239  N  NH2  . ARG A 1 50  ? 58.192 -68.190 -23.798 1.00 81.00  ? 44   ARG A NH2  1 
ATOM   240  N  N    . LYS A 1 51  ? 53.544 -71.183 -18.464 1.00 59.60  ? 45   LYS A N    1 
ATOM   241  C  CA   . LYS A 1 51  ? 52.455 -71.936 -19.084 1.00 58.47  ? 45   LYS A CA   1 
ATOM   242  C  C    . LYS A 1 51  ? 51.139 -71.178 -18.964 1.00 55.83  ? 45   LYS A C    1 
ATOM   243  O  O    . LYS A 1 51  ? 50.370 -71.094 -19.926 1.00 60.48  ? 45   LYS A O    1 
ATOM   244  C  CB   . LYS A 1 51  ? 52.318 -73.332 -18.464 1.00 52.17  ? 45   LYS A CB   1 
ATOM   245  C  CG   . LYS A 1 51  ? 53.476 -74.288 -18.748 1.00 51.28  ? 45   LYS A CG   1 
ATOM   246  N  N    . GLU A 1 52  ? 50.862 -70.602 -17.799 1.00 56.39  ? 46   GLU A N    1 
ATOM   247  C  CA   . GLU A 1 52  ? 49.623 -69.844 -17.677 1.00 59.32  ? 46   GLU A CA   1 
ATOM   248  C  C    . GLU A 1 52  ? 49.659 -68.644 -18.596 1.00 55.60  ? 46   GLU A C    1 
ATOM   249  O  O    . GLU A 1 52  ? 48.608 -68.190 -19.061 1.00 57.14  ? 46   GLU A O    1 
ATOM   250  C  CB   . GLU A 1 52  ? 49.383 -69.396 -16.228 1.00 54.01  ? 46   GLU A CB   1 
ATOM   251  C  CG   . GLU A 1 52  ? 49.413 -70.528 -15.215 1.00 56.72  ? 46   GLU A CG   1 
ATOM   252  C  CD   . GLU A 1 52  ? 48.406 -71.645 -15.479 1.00 61.41  ? 46   GLU A CD   1 
ATOM   253  O  OE1  . GLU A 1 52  ? 47.243 -71.343 -15.844 1.00 64.34  ? 46   GLU A OE1  1 
ATOM   254  O  OE2  . GLU A 1 52  ? 48.797 -72.830 -15.316 1.00 55.83  ? 46   GLU A OE2  1 
ATOM   255  N  N    . MET A 1 53  ? 50.864 -68.124 -18.865 1.00 54.74  ? 47   MET A N    1 
ATOM   256  C  CA   . MET A 1 53  ? 51.006 -66.957 -19.732 1.00 57.26  ? 47   MET A CA   1 
ATOM   257  C  C    . MET A 1 53  ? 50.629 -67.296 -21.161 1.00 59.12  ? 47   MET A C    1 
ATOM   258  O  O    . MET A 1 53  ? 49.836 -66.592 -21.800 1.00 58.15  ? 47   MET A O    1 
ATOM   259  C  CB   . MET A 1 53  ? 52.437 -66.413 -19.699 1.00 57.66  ? 47   MET A CB   1 
ATOM   260  C  CG   . MET A 1 53  ? 52.879 -65.818 -18.382 1.00 56.56  ? 47   MET A CG   1 
ATOM   261  S  SD   . MET A 1 53  ? 54.514 -65.049 -18.458 1.00 56.41  ? 47   MET A SD   1 
ATOM   262  C  CE   . MET A 1 53  ? 54.133 -63.425 -19.086 1.00 55.86  ? 47   MET A CE   1 
ATOM   263  N  N    . GLU A 1 54  ? 51.191 -68.383 -21.674 1.00 59.83  ? 48   GLU A N    1 
ATOM   264  C  CA   . GLU A 1 54  ? 50.928 -68.784 -23.044 1.00 57.65  ? 48   GLU A CA   1 
ATOM   265  C  C    . GLU A 1 54  ? 49.468 -69.168 -23.239 1.00 59.65  ? 48   GLU A C    1 
ATOM   266  O  O    . GLU A 1 54  ? 48.874 -68.848 -24.274 1.00 66.86  ? 48   GLU A O    1 
ATOM   267  C  CB   . GLU A 1 54  ? 51.881 -69.914 -23.403 1.00 52.45  ? 48   GLU A CB   1 
ATOM   268  C  CG   . GLU A 1 54  ? 53.294 -69.385 -23.398 1.00 55.31  ? 48   GLU A CG   1 
ATOM   269  C  CD   . GLU A 1 54  ? 54.332 -70.462 -23.464 1.00 70.81  ? 48   GLU A CD   1 
ATOM   270  O  OE1  . GLU A 1 54  ? 53.974 -71.657 -23.369 1.00 72.96  ? 48   GLU A OE1  1 
ATOM   271  O  OE2  . GLU A 1 54  ? 55.522 -70.108 -23.572 1.00 76.84  ? 48   GLU A OE2  1 
ATOM   272  N  N    . LYS A 1 55  ? 48.854 -69.814 -22.244 1.00 59.21  ? 49   LYS A N    1 
ATOM   273  C  CA   . LYS A 1 55  ? 47.460 -70.217 -22.408 1.00 58.47  ? 49   LYS A CA   1 
ATOM   274  C  C    . LYS A 1 55  ? 46.555 -69.013 -22.601 1.00 54.44  ? 49   LYS A C    1 
ATOM   275  O  O    . LYS A 1 55  ? 45.576 -69.082 -23.346 1.00 60.92  ? 49   LYS A O    1 
ATOM   276  C  CB   . LYS A 1 55  ? 46.975 -71.061 -21.219 1.00 62.01  ? 49   LYS A CB   1 
ATOM   277  C  CG   . LYS A 1 55  ? 47.560 -72.468 -21.196 1.00 62.81  ? 49   LYS A CG   1 
ATOM   278  C  CD   . LYS A 1 55  ? 47.274 -73.202 -19.901 1.00 70.84  ? 49   LYS A CD   1 
ATOM   279  C  CE   . LYS A 1 55  ? 45.784 -73.439 -19.692 1.00 81.63  ? 49   LYS A CE   1 
ATOM   280  N  NZ   . LYS A 1 55  ? 45.528 -74.209 -18.419 1.00 73.16  ? 49   LYS A NZ   1 
ATOM   281  N  N    . GLY A 1 56  ? 46.853 -67.901 -21.941 1.00 52.58  ? 50   GLY A N    1 
ATOM   282  C  CA   . GLY A 1 56  ? 45.969 -66.757 -22.051 1.00 54.35  ? 50   GLY A CA   1 
ATOM   283  C  C    . GLY A 1 56  ? 46.172 -65.981 -23.330 1.00 56.96  ? 50   GLY A C    1 
ATOM   284  O  O    . GLY A 1 56  ? 45.254 -65.293 -23.794 1.00 55.99  ? 50   GLY A O    1 
ATOM   285  N  N    . LEU A 1 57  ? 47.381 -66.052 -23.895 1.00 53.72  ? 51   LEU A N    1 
ATOM   286  C  CA   . LEU A 1 57  ? 47.675 -65.431 -25.181 1.00 56.51  ? 51   LEU A CA   1 
ATOM   287  C  C    . LEU A 1 57  ? 47.106 -66.246 -26.343 1.00 61.28  ? 51   LEU A C    1 
ATOM   288  O  O    . LEU A 1 57  ? 46.504 -65.673 -27.262 1.00 59.58  ? 51   LEU A O    1 
ATOM   289  C  CB   . LEU A 1 57  ? 49.190 -65.246 -25.348 1.00 52.31  ? 51   LEU A CB   1 
ATOM   290  C  CG   . LEU A 1 57  ? 49.915 -64.203 -24.496 1.00 47.49  ? 51   LEU A CG   1 
ATOM   291  C  CD1  . LEU A 1 57  ? 51.431 -64.300 -24.683 1.00 42.05  ? 51   LEU A CD1  1 
ATOM   292  C  CD2  . LEU A 1 57  ? 49.394 -62.795 -24.798 1.00 45.36  ? 51   LEU A CD2  1 
ATOM   293  N  N    . GLY A 1 58  ? 47.284 -67.577 -26.306 1.00 58.96  ? 52   GLY A N    1 
ATOM   294  C  CA   . GLY A 1 58  ? 46.713 -68.514 -27.260 1.00 56.37  ? 52   GLY A CA   1 
ATOM   295  C  C    . GLY A 1 58  ? 45.225 -68.332 -27.519 1.00 62.93  ? 52   GLY A C    1 
ATOM   296  O  O    . GLY A 1 58  ? 44.461 -67.989 -26.615 1.00 61.91  ? 52   GLY A O    1 
ATOM   297  N  N    . ALA A 1 59  ? 44.800 -68.550 -28.765 1.00 65.48  ? 53   ALA A N    1 
ATOM   298  C  CA   . ALA A 1 59  ? 43.435 -68.217 -29.160 1.00 63.69  ? 53   ALA A CA   1 
ATOM   299  C  C    . ALA A 1 59  ? 42.433 -69.277 -28.712 1.00 64.50  ? 53   ALA A C    1 
ATOM   300  O  O    . ALA A 1 59  ? 41.305 -68.948 -28.317 1.00 61.53  ? 53   ALA A O    1 
ATOM   301  C  CB   . ALA A 1 59  ? 43.379 -68.027 -30.675 1.00 63.32  ? 53   ALA A CB   1 
ATOM   302  N  N    . THR A 1 60  ? 42.816 -70.555 -28.787 1.00 61.99  ? 54   THR A N    1 
ATOM   303  C  CA   . THR A 1 60  ? 41.924 -71.614 -28.321 1.00 65.91  ? 54   THR A CA   1 
ATOM   304  C  C    . THR A 1 60  ? 41.852 -71.641 -26.793 1.00 69.03  ? 54   THR A C    1 
ATOM   305  O  O    . THR A 1 60  ? 40.766 -71.782 -26.214 1.00 70.79  ? 54   THR A O    1 
ATOM   306  C  CB   . THR A 1 60  ? 42.394 -72.966 -28.865 1.00 70.15  ? 54   THR A CB   1 
ATOM   307  O  OG1  . THR A 1 60  ? 43.707 -73.247 -28.372 1.00 73.00  ? 54   THR A OG1  1 
ATOM   308  C  CG2  . THR A 1 60  ? 42.461 -72.929 -30.380 1.00 60.23  ? 54   THR A CG2  1 
ATOM   309  N  N    . THR A 1 61  ? 42.995 -71.452 -26.126 1.00 67.21  ? 55   THR A N    1 
ATOM   310  C  CA   . THR A 1 61  ? 43.099 -71.580 -24.679 1.00 58.96  ? 55   THR A CA   1 
ATOM   311  C  C    . THR A 1 61  ? 42.566 -70.371 -23.917 1.00 59.28  ? 55   THR A C    1 
ATOM   312  O  O    . THR A 1 61  ? 42.109 -70.522 -22.783 1.00 62.70  ? 55   THR A O    1 
ATOM   313  C  CB   . THR A 1 61  ? 44.553 -71.821 -24.311 1.00 56.30  ? 55   THR A CB   1 
ATOM   314  O  OG1  . THR A 1 61  ? 45.340 -70.752 -24.841 1.00 62.46  ? 55   THR A OG1  1 
ATOM   315  C  CG2  . THR A 1 61  ? 45.035 -73.123 -24.901 1.00 53.49  ? 55   THR A CG2  1 
ATOM   316  N  N    . HIS A 1 62  ? 42.593 -69.195 -24.499 1.00 58.77  ? 56   HIS A N    1 
ATOM   317  C  CA   . HIS A 1 62  ? 42.208 -67.993 -23.776 1.00 56.71  ? 56   HIS A CA   1 
ATOM   318  C  C    . HIS A 1 62  ? 40.955 -68.160 -22.929 1.00 64.22  ? 56   HIS A C    1 
ATOM   319  O  O    . HIS A 1 62  ? 41.004 -67.943 -21.709 1.00 73.62  ? 56   HIS A O    1 
ATOM   320  C  CB   . HIS A 1 62  ? 41.962 -66.860 -24.752 1.00 58.86  ? 56   HIS A CB   1 
ATOM   321  C  CG   . HIS A 1 62  ? 41.538 -65.586 -24.104 1.00 59.07  ? 56   HIS A CG   1 
ATOM   322  N  ND1  . HIS A 1 62  ? 42.376 -64.849 -23.298 1.00 56.43  ? 56   HIS A ND1  1 
ATOM   323  C  CD2  . HIS A 1 62  ? 40.360 -64.919 -24.140 1.00 62.18  ? 56   HIS A CD2  1 
ATOM   324  C  CE1  . HIS A 1 62  ? 41.731 -63.776 -22.873 1.00 63.58  ? 56   HIS A CE1  1 
ATOM   325  N  NE2  . HIS A 1 62  ? 40.508 -63.791 -23.374 1.00 62.16  ? 56   HIS A NE2  1 
ATOM   326  N  N    . PRO A 1 63  ? 39.820 -68.546 -23.514 1.00 67.21  ? 57   PRO A N    1 
ATOM   327  C  CA   . PRO A 1 63  ? 38.553 -68.466 -22.758 1.00 68.40  ? 57   PRO A CA   1 
ATOM   328  C  C    . PRO A 1 63  ? 38.511 -69.357 -21.512 1.00 64.00  ? 57   PRO A C    1 
ATOM   329  O  O    . PRO A 1 63  ? 37.659 -69.135 -20.644 1.00 62.99  ? 57   PRO A O    1 
ATOM   330  C  CB   . PRO A 1 63  ? 37.501 -68.868 -23.806 1.00 65.03  ? 57   PRO A CB   1 
ATOM   331  C  CG   . PRO A 1 63  ? 38.254 -69.706 -24.775 1.00 66.42  ? 57   PRO A CG   1 
ATOM   332  C  CD   . PRO A 1 63  ? 39.635 -69.141 -24.848 1.00 65.54  ? 57   PRO A CD   1 
ATOM   333  N  N    . THR A 1 64  ? 39.375 -70.370 -21.432 1.00 65.15  ? 58   THR A N    1 
ATOM   334  C  CA   . THR A 1 64  ? 39.620 -71.213 -20.266 1.00 59.98  ? 58   THR A CA   1 
ATOM   335  C  C    . THR A 1 64  ? 40.870 -70.839 -19.469 1.00 65.96  ? 58   THR A C    1 
ATOM   336  O  O    . THR A 1 64  ? 41.126 -71.431 -18.408 1.00 64.34  ? 58   THR A O    1 
ATOM   337  C  CB   . THR A 1 64  ? 39.681 -72.677 -20.729 1.00 60.01  ? 58   THR A CB   1 
ATOM   338  O  OG1  . THR A 1 64  ? 38.352 -73.205 -20.761 1.00 56.25  ? 58   THR A OG1  1 
ATOM   339  C  CG2  . THR A 1 64  ? 40.613 -73.556 -19.912 1.00 67.97  ? 58   THR A CG2  1 
ATOM   340  N  N    . ALA A 1 65  ? 41.637 -69.856 -19.919 1.00 67.18  ? 59   ALA A N    1 
ATOM   341  C  CA   . ALA A 1 65  ? 42.861 -69.507 -19.215 1.00 65.31  ? 59   ALA A CA   1 
ATOM   342  C  C    . ALA A 1 65  ? 42.521 -68.793 -17.911 1.00 59.67  ? 59   ALA A C    1 
ATOM   343  O  O    . ALA A 1 65  ? 41.659 -67.912 -17.888 1.00 65.92  ? 59   ALA A O    1 
ATOM   344  C  CB   . ALA A 1 65  ? 43.744 -68.630 -20.103 1.00 57.52  ? 59   ALA A CB   1 
ATOM   345  N  N    . ALA A 1 66  ? 43.193 -69.170 -16.824 1.00 54.63  ? 60   ALA A N    1 
ATOM   346  C  CA   . ALA A 1 66  ? 43.010 -68.439 -15.569 1.00 59.98  ? 60   ALA A CA   1 
ATOM   347  C  C    . ALA A 1 66  ? 43.655 -67.056 -15.630 1.00 59.05  ? 60   ALA A C    1 
ATOM   348  O  O    . ALA A 1 66  ? 43.086 -66.073 -15.130 1.00 54.93  ? 60   ALA A O    1 
ATOM   349  C  CB   . ALA A 1 66  ? 43.583 -69.241 -14.400 1.00 52.58  ? 60   ALA A CB   1 
ATOM   350  N  N    . VAL A 1 67  ? 44.837 -66.959 -16.243 1.00 58.40  ? 61   VAL A N    1 
ATOM   351  C  CA   . VAL A 1 67  ? 45.532 -65.688 -16.407 1.00 54.84  ? 61   VAL A CA   1 
ATOM   352  C  C    . VAL A 1 67  ? 45.133 -65.150 -17.775 1.00 53.33  ? 61   VAL A C    1 
ATOM   353  O  O    . VAL A 1 67  ? 45.548 -65.687 -18.806 1.00 55.35  ? 61   VAL A O    1 
ATOM   354  C  CB   . VAL A 1 67  ? 47.054 -65.850 -16.291 1.00 57.47  ? 61   VAL A CB   1 
ATOM   355  C  CG1  . VAL A 1 67  ? 47.754 -64.478 -16.316 1.00 52.31  ? 61   VAL A CG1  1 
ATOM   356  C  CG2  . VAL A 1 67  ? 47.443 -66.661 -15.044 1.00 52.79  ? 61   VAL A CG2  1 
ATOM   357  N  N    . LYS A 1 68  ? 44.340 -64.074 -17.788 1.00 50.98  ? 62   LYS A N    1 
ATOM   358  C  CA   . LYS A 1 68  ? 43.643 -63.704 -19.013 1.00 49.72  ? 62   LYS A CA   1 
ATOM   359  C  C    . LYS A 1 68  ? 44.562 -63.103 -20.070 1.00 53.83  ? 62   LYS A C    1 
ATOM   360  O  O    . LYS A 1 68  ? 44.314 -63.299 -21.258 1.00 57.27  ? 62   LYS A O    1 
ATOM   361  C  CB   . LYS A 1 68  ? 42.487 -62.747 -18.730 1.00 49.58  ? 62   LYS A CB   1 
ATOM   362  C  CG   . LYS A 1 68  ? 41.312 -63.404 -18.062 1.00 47.64  ? 62   LYS A CG   1 
ATOM   363  C  CD   . LYS A 1 68  ? 40.965 -64.650 -18.852 1.00 55.68  ? 62   LYS A CD   1 
ATOM   364  C  CE   . LYS A 1 68  ? 39.732 -65.376 -18.317 1.00 57.67  ? 62   LYS A CE   1 
ATOM   365  N  NZ   . LYS A 1 68  ? 39.562 -66.681 -19.037 1.00 62.32  ? 62   LYS A NZ   1 
ATOM   366  N  N    . MET A 1 69  ? 45.597 -62.363 -19.687 1.00 54.84  ? 63   MET A N    1 
ATOM   367  C  CA   . MET A 1 69  ? 46.562 -61.862 -20.655 1.00 44.78  ? 63   MET A CA   1 
ATOM   368  C  C    . MET A 1 69  ? 45.907 -60.848 -21.597 1.00 48.34  ? 63   MET A C    1 
ATOM   369  O  O    . MET A 1 69  ? 46.094 -60.865 -22.813 1.00 53.84  ? 63   MET A O    1 
ATOM   370  C  CB   . MET A 1 69  ? 47.159 -63.041 -21.410 1.00 45.25  ? 63   MET A CB   1 
ATOM   371  C  CG   . MET A 1 69  ? 47.924 -64.014 -20.549 1.00 49.14  ? 63   MET A CG   1 
ATOM   372  S  SD   . MET A 1 69  ? 49.437 -63.202 -20.065 1.00 58.76  ? 63   MET A SD   1 
ATOM   373  C  CE   . MET A 1 69  ? 50.222 -64.391 -19.047 1.00 51.83  ? 63   MET A CE   1 
ATOM   374  N  N    . LEU A 1 70  ? 45.126 -59.958 -21.013 1.00 49.15  ? 64   LEU A N    1 
ATOM   375  C  CA   . LEU A 1 70  ? 44.303 -59.028 -21.767 1.00 50.57  ? 64   LEU A CA   1 
ATOM   376  C  C    . LEU A 1 70  ? 45.150 -58.083 -22.620 1.00 57.25  ? 64   LEU A C    1 
ATOM   377  O  O    . LEU A 1 70  ? 46.179 -57.577 -22.156 1.00 56.81  ? 64   LEU A O    1 
ATOM   378  C  CB   . LEU A 1 70  ? 43.446 -58.209 -20.815 1.00 48.35  ? 64   LEU A CB   1 
ATOM   379  C  CG   . LEU A 1 70  ? 42.545 -59.087 -19.960 1.00 53.79  ? 64   LEU A CG   1 
ATOM   380  C  CD1  . LEU A 1 70  ? 41.728 -58.230 -19.018 1.00 50.14  ? 64   LEU A CD1  1 
ATOM   381  C  CD2  . LEU A 1 70  ? 41.676 -59.957 -20.851 1.00 50.43  ? 64   LEU A CD2  1 
ATOM   382  N  N    . PRO A 1 71  ? 44.745 -57.839 -23.872 1.00 58.67  ? 65   PRO A N    1 
ATOM   383  C  CA   . PRO A 1 71  ? 45.356 -56.770 -24.674 1.00 52.89  ? 65   PRO A CA   1 
ATOM   384  C  C    . PRO A 1 71  ? 45.004 -55.383 -24.143 1.00 57.10  ? 65   PRO A C    1 
ATOM   385  O  O    . PRO A 1 71  ? 43.846 -55.088 -23.839 1.00 56.48  ? 65   PRO A O    1 
ATOM   386  C  CB   . PRO A 1 71  ? 44.763 -57.007 -26.064 1.00 58.94  ? 65   PRO A CB   1 
ATOM   387  C  CG   . PRO A 1 71  ? 44.433 -58.450 -26.080 1.00 54.28  ? 65   PRO A CG   1 
ATOM   388  C  CD   . PRO A 1 71  ? 43.943 -58.748 -24.706 1.00 57.24  ? 65   PRO A CD   1 
ATOM   389  N  N    . THR A 1 72  ? 46.035 -54.550 -23.988 1.00 58.68  ? 66   THR A N    1 
ATOM   390  C  CA   . THR A 1 72  ? 45.901 -53.182 -23.498 1.00 57.79  ? 66   THR A CA   1 
ATOM   391  C  C    . THR A 1 72  ? 45.632 -52.159 -24.586 1.00 63.41  ? 66   THR A C    1 
ATOM   392  O  O    . THR A 1 72  ? 45.035 -51.116 -24.299 1.00 63.45  ? 66   THR A O    1 
ATOM   393  C  CB   . THR A 1 72  ? 47.158 -52.783 -22.733 1.00 58.47  ? 66   THR A CB   1 
ATOM   394  O  OG1  . THR A 1 72  ? 48.267 -52.749 -23.633 1.00 53.95  ? 66   THR A OG1  1 
ATOM   395  C  CG2  . THR A 1 72  ? 47.438 -53.826 -21.640 1.00 54.73  ? 66   THR A CG2  1 
ATOM   396  N  N    . PHE A 1 73  ? 46.102 -52.427 -25.813 1.00 67.62  ? 67   PHE A N    1 
ATOM   397  C  CA   . PHE A 1 73  ? 46.121 -51.505 -26.949 1.00 65.23  ? 67   PHE A CA   1 
ATOM   398  C  C    . PHE A 1 73  ? 47.029 -50.297 -26.725 1.00 67.02  ? 67   PHE A C    1 
ATOM   399  O  O    . PHE A 1 73  ? 46.885 -49.264 -27.388 1.00 68.17  ? 67   PHE A O    1 
ATOM   400  C  CB   . PHE A 1 73  ? 44.702 -51.082 -27.323 1.00 68.04  ? 67   PHE A CB   1 
ATOM   401  C  CG   . PHE A 1 73  ? 43.864 -52.245 -27.702 1.00 72.73  ? 67   PHE A CG   1 
ATOM   402  C  CD1  . PHE A 1 73  ? 44.086 -52.893 -28.905 1.00 76.39  ? 67   PHE A CD1  1 
ATOM   403  C  CD2  . PHE A 1 73  ? 42.897 -52.736 -26.848 1.00 76.25  ? 67   PHE A CD2  1 
ATOM   404  C  CE1  . PHE A 1 73  ? 43.344 -54.007 -29.258 1.00 80.50  ? 67   PHE A CE1  1 
ATOM   405  C  CE2  . PHE A 1 73  ? 42.151 -53.844 -27.191 1.00 77.51  ? 67   PHE A CE2  1 
ATOM   406  C  CZ   . PHE A 1 73  ? 42.373 -54.481 -28.395 1.00 79.47  ? 67   PHE A CZ   1 
ATOM   407  N  N    . VAL A 1 74  ? 47.995 -50.434 -25.827 1.00 67.44  ? 68   VAL A N    1 
ATOM   408  C  CA   . VAL A 1 74  ? 49.117 -49.513 -25.715 1.00 63.49  ? 68   VAL A CA   1 
ATOM   409  C  C    . VAL A 1 74  ? 50.253 -50.114 -26.531 1.00 61.48  ? 68   VAL A C    1 
ATOM   410  O  O    . VAL A 1 74  ? 50.765 -51.190 -26.206 1.00 60.64  ? 68   VAL A O    1 
ATOM   411  C  CB   . VAL A 1 74  ? 49.521 -49.293 -24.252 1.00 59.08  ? 68   VAL A CB   1 
ATOM   412  C  CG1  . VAL A 1 74  ? 50.860 -48.611 -24.175 1.00 54.73  ? 68   VAL A CG1  1 
ATOM   413  C  CG2  . VAL A 1 74  ? 48.473 -48.456 -23.552 1.00 57.74  ? 68   VAL A CG2  1 
ATOM   414  N  N    . ARG A 1 75  ? 50.590 -49.475 -27.646 1.00 64.28  ? 69   ARG A N    1 
ATOM   415  C  CA   . ARG A 1 75  ? 51.555 -50.101 -28.530 1.00 63.52  ? 69   ARG A CA   1 
ATOM   416  C  C    . ARG A 1 75  ? 52.943 -49.483 -28.484 1.00 63.71  ? 69   ARG A C    1 
ATOM   417  O  O    . ARG A 1 75  ? 53.886 -50.073 -29.026 1.00 62.32  ? 69   ARG A O    1 
ATOM   418  C  CB   . ARG A 1 75  ? 50.983 -50.100 -29.933 1.00 62.72  ? 69   ARG A CB   1 
ATOM   419  C  CG   . ARG A 1 75  ? 49.604 -50.708 -29.859 1.00 62.64  ? 69   ARG A CG   1 
ATOM   420  C  CD   . ARG A 1 75  ? 49.222 -51.125 -31.166 1.00 65.08  ? 69   ARG A CD   1 
ATOM   421  N  NE   . ARG A 1 75  ? 50.320 -51.987 -31.531 1.00 69.48  ? 69   ARG A NE   1 
ATOM   422  C  CZ   . ARG A 1 75  ? 50.423 -52.582 -32.695 1.00 65.65  ? 69   ARG A CZ   1 
ATOM   423  N  NH1  . ARG A 1 75  ? 49.450 -52.416 -33.575 1.00 67.01  ? 69   ARG A NH1  1 
ATOM   424  N  NH2  . ARG A 1 75  ? 51.480 -53.342 -32.950 1.00 64.50  ? 69   ARG A NH2  1 
ATOM   425  N  N    . SER A 1 76  ? 53.109 -48.369 -27.784 1.00 64.20  ? 70   SER A N    1 
ATOM   426  C  CA   . SER A 1 76  ? 54.410 -47.745 -27.625 1.00 64.32  ? 70   SER A CA   1 
ATOM   427  C  C    . SER A 1 76  ? 54.532 -47.261 -26.191 1.00 64.11  ? 70   SER A C    1 
ATOM   428  O  O    . SER A 1 76  ? 53.588 -46.676 -25.653 1.00 62.47  ? 70   SER A O    1 
ATOM   429  C  CB   . SER A 1 76  ? 54.591 -46.560 -28.589 1.00 67.67  ? 70   SER A CB   1 
ATOM   430  O  OG   . SER A 1 76  ? 54.455 -46.953 -29.949 1.00 76.78  ? 70   SER A OG   1 
ATOM   431  N  N    . THR A 1 77  ? 55.695 -47.506 -25.578 1.00 64.44  ? 71   THR A N    1 
ATOM   432  C  CA   . THR A 1 77  ? 56.045 -46.871 -24.312 1.00 63.65  ? 71   THR A CA   1 
ATOM   433  C  C    . THR A 1 77  ? 56.375 -45.415 -24.624 1.00 65.86  ? 71   THR A C    1 
ATOM   434  O  O    . THR A 1 77  ? 56.309 -45.013 -25.786 1.00 65.89  ? 71   THR A O    1 
ATOM   435  C  CB   . THR A 1 77  ? 57.232 -47.561 -23.641 1.00 63.65  ? 71   THR A CB   1 
ATOM   436  O  OG1  . THR A 1 77  ? 58.426 -47.310 -24.387 1.00 72.58  ? 71   THR A OG1  1 
ATOM   437  C  CG2  . THR A 1 77  ? 57.014 -49.059 -23.593 1.00 58.35  ? 71   THR A CG2  1 
ATOM   438  N  N    . PRO A 1 78  ? 56.718 -44.588 -23.642 1.00 67.67  ? 72   PRO A N    1 
ATOM   439  C  CA   . PRO A 1 78  ? 56.913 -43.168 -23.937 1.00 67.14  ? 72   PRO A CA   1 
ATOM   440  C  C    . PRO A 1 78  ? 58.216 -42.882 -24.657 1.00 66.10  ? 72   PRO A C    1 
ATOM   441  O  O    . PRO A 1 78  ? 59.219 -43.594 -24.529 1.00 62.17  ? 72   PRO A O    1 
ATOM   442  C  CB   . PRO A 1 78  ? 56.879 -42.508 -22.557 1.00 61.57  ? 72   PRO A CB   1 
ATOM   443  C  CG   . PRO A 1 78  ? 56.034 -43.407 -21.791 1.00 72.65  ? 72   PRO A CG   1 
ATOM   444  C  CD   . PRO A 1 78  ? 56.489 -44.784 -22.211 1.00 68.60  ? 72   PRO A CD   1 
ATOM   445  N  N    . ASP A 1 79  ? 58.158 -41.823 -25.450 1.00 65.72  ? 73   ASP A N    1 
ATOM   446  C  CA   . ASP A 1 79  ? 59.207 -41.434 -26.376 1.00 77.77  ? 73   ASP A CA   1 
ATOM   447  C  C    . ASP A 1 79  ? 60.269 -40.583 -25.697 1.00 76.90  ? 73   ASP A C    1 
ATOM   448  O  O    . ASP A 1 79  ? 61.472 -40.756 -25.943 1.00 79.15  ? 73   ASP A O    1 
ATOM   449  C  CB   . ASP A 1 79  ? 58.567 -40.677 -27.548 1.00 70.69  ? 73   ASP A CB   1 
ATOM   450  C  CG   . ASP A 1 79  ? 59.504 -40.461 -28.673 1.00 76.44  ? 73   ASP A CG   1 
ATOM   451  O  OD1  . ASP A 1 79  ? 59.829 -41.448 -29.369 1.00 83.39  ? 73   ASP A OD1  1 
ATOM   452  O  OD2  . ASP A 1 79  ? 59.922 -39.303 -28.855 1.00 86.33  ? 73   ASP A OD2  1 
ATOM   453  N  N    . GLY A 1 80  ? 59.824 -39.696 -24.814 1.00 67.65  ? 74   GLY A N    1 
ATOM   454  C  CA   . GLY A 1 80  ? 60.600 -38.594 -24.321 1.00 73.01  ? 74   GLY A CA   1 
ATOM   455  C  C    . GLY A 1 80  ? 60.228 -37.270 -24.947 1.00 76.56  ? 74   GLY A C    1 
ATOM   456  O  O    . GLY A 1 80  ? 60.389 -36.224 -24.306 1.00 86.50  ? 74   GLY A O    1 
ATOM   457  N  N    . THR A 1 81  ? 59.656 -37.300 -26.143 1.00 76.75  ? 75   THR A N    1 
ATOM   458  C  CA   . THR A 1 81  ? 59.289 -36.099 -26.878 1.00 81.28  ? 75   THR A CA   1 
ATOM   459  C  C    . THR A 1 81  ? 57.856 -35.658 -26.634 1.00 81.67  ? 75   THR A C    1 
ATOM   460  O  O    . THR A 1 81  ? 57.440 -34.627 -27.171 1.00 88.37  ? 75   THR A O    1 
ATOM   461  C  CB   . THR A 1 81  ? 59.464 -36.338 -28.366 1.00 72.83  ? 75   THR A CB   1 
ATOM   462  O  OG1  . THR A 1 81  ? 58.639 -37.450 -28.730 1.00 78.88  ? 75   THR A OG1  1 
ATOM   463  C  CG2  . THR A 1 81  ? 60.917 -36.649 -28.689 1.00 70.00  ? 75   THR A CG2  1 
ATOM   464  N  N    . GLU A 1 82  ? 57.081 -36.418 -25.876 1.00 77.54  ? 76   GLU A N    1 
ATOM   465  C  CA   . GLU A 1 82  ? 55.678 -36.081 -25.722 1.00 77.85  ? 76   GLU A CA   1 
ATOM   466  C  C    . GLU A 1 82  ? 55.576 -34.666 -25.168 1.00 83.92  ? 76   GLU A C    1 
ATOM   467  O  O    . GLU A 1 82  ? 56.455 -34.202 -24.438 1.00 92.43  ? 76   GLU A O    1 
ATOM   468  C  CB   . GLU A 1 82  ? 54.993 -37.103 -24.811 1.00 75.41  ? 76   GLU A CB   1 
ATOM   469  C  CG   . GLU A 1 82  ? 55.008 -38.546 -25.345 1.00 65.99  ? 76   GLU A CG   1 
ATOM   470  C  CD   . GLU A 1 82  ? 56.353 -39.246 -25.151 1.00 65.63  ? 76   GLU A CD   1 
ATOM   471  O  OE1  . GLU A 1 82  ? 57.317 -38.601 -24.716 1.00 73.12  ? 76   GLU A OE1  1 
ATOM   472  O  OE2  . GLU A 1 82  ? 56.465 -40.447 -25.428 1.00 60.20  ? 76   GLU A OE2  1 
ATOM   473  N  N    . HIS A 1 83  ? 54.542 -33.947 -25.590 1.00 80.51  ? 77   HIS A N    1 
ATOM   474  C  CA   . HIS A 1 83  ? 54.299 -32.610 -25.074 1.00 84.10  ? 77   HIS A CA   1 
ATOM   475  C  C    . HIS A 1 83  ? 52.823 -32.292 -25.218 1.00 81.71  ? 77   HIS A C    1 
ATOM   476  O  O    . HIS A 1 83  ? 52.150 -32.811 -26.106 1.00 85.57  ? 77   HIS A O    1 
ATOM   477  C  CB   . HIS A 1 83  ? 55.160 -31.562 -25.785 1.00 90.51  ? 77   HIS A CB   1 
ATOM   478  C  CG   . HIS A 1 83  ? 55.068 -31.611 -27.280 1.00 91.13  ? 77   HIS A CG   1 
ATOM   479  N  ND1  . HIS A 1 83  ? 55.781 -32.516 -28.039 1.00 91.03  ? 77   HIS A ND1  1 
ATOM   480  C  CD2  . HIS A 1 83  ? 54.335 -30.882 -28.156 1.00 88.28  ? 77   HIS A CD2  1 
ATOM   481  C  CE1  . HIS A 1 83  ? 55.506 -32.330 -29.318 1.00 94.89  ? 77   HIS A CE1  1 
ATOM   482  N  NE2  . HIS A 1 83  ? 54.627 -31.347 -29.416 1.00 96.40  ? 77   HIS A NE2  1 
ATOM   483  N  N    . GLY A 1 84  ? 52.312 -31.495 -24.305 1.00 87.94  ? 78   GLY A N    1 
ATOM   484  C  CA   . GLY A 1 84  ? 50.955 -31.005 -24.433 1.00 92.04  ? 78   GLY A CA   1 
ATOM   485  C  C    . GLY A 1 84  ? 50.321 -30.830 -23.070 1.00 98.28  ? 78   GLY A C    1 
ATOM   486  O  O    . GLY A 1 84  ? 50.909 -31.140 -22.035 1.00 96.95  ? 78   GLY A O    1 
ATOM   487  N  N    . GLU A 1 85  ? 49.083 -30.341 -23.100 1.00 99.70  ? 79   GLU A N    1 
ATOM   488  C  CA   . GLU A 1 85  ? 48.230 -30.269 -21.921 1.00 103.93 ? 79   GLU A CA   1 
ATOM   489  C  C    . GLU A 1 85  ? 47.262 -31.443 -21.968 1.00 105.49 ? 79   GLU A C    1 
ATOM   490  O  O    . GLU A 1 85  ? 46.488 -31.575 -22.922 1.00 108.03 ? 79   GLU A O    1 
ATOM   491  C  CB   . GLU A 1 85  ? 47.473 -28.941 -21.860 1.00 105.07 ? 79   GLU A CB   1 
ATOM   492  N  N    . PHE A 1 86  ? 47.309 -32.293 -20.944 1.00 109.96 ? 80   PHE A N    1 
ATOM   493  C  CA   . PHE A 1 86  ? 46.526 -33.520 -20.914 1.00 108.90 ? 80   PHE A CA   1 
ATOM   494  C  C    . PHE A 1 86  ? 45.673 -33.590 -19.655 1.00 109.78 ? 80   PHE A C    1 
ATOM   495  O  O    . PHE A 1 86  ? 45.955 -32.946 -18.639 1.00 112.72 ? 80   PHE A O    1 
ATOM   496  C  CB   . PHE A 1 86  ? 47.421 -34.754 -20.997 1.00 104.32 ? 80   PHE A CB   1 
ATOM   497  C  CG   . PHE A 1 86  ? 48.194 -34.843 -22.269 1.00 97.03  ? 80   PHE A CG   1 
ATOM   498  C  CD1  . PHE A 1 86  ? 47.603 -35.334 -23.416 1.00 95.80  ? 80   PHE A CD1  1 
ATOM   499  C  CD2  . PHE A 1 86  ? 49.510 -34.434 -22.319 1.00 94.21  ? 80   PHE A CD2  1 
ATOM   500  C  CE1  . PHE A 1 86  ? 48.311 -35.419 -24.588 1.00 90.63  ? 80   PHE A CE1  1 
ATOM   501  C  CE2  . PHE A 1 86  ? 50.220 -34.514 -23.486 1.00 92.87  ? 80   PHE A CE2  1 
ATOM   502  C  CZ   . PHE A 1 86  ? 49.622 -35.005 -24.625 1.00 91.00  ? 80   PHE A CZ   1 
ATOM   503  N  N    . LEU A 1 87  ? 44.639 -34.421 -19.735 1.00 107.49 ? 81   LEU A N    1 
ATOM   504  C  CA   . LEU A 1 87  ? 43.581 -34.459 -18.744 1.00 111.87 ? 81   LEU A CA   1 
ATOM   505  C  C    . LEU A 1 87  ? 43.270 -35.917 -18.431 1.00 112.35 ? 81   LEU A C    1 
ATOM   506  O  O    . LEU A 1 87  ? 43.413 -36.787 -19.293 1.00 110.77 ? 81   LEU A O    1 
ATOM   507  C  CB   . LEU A 1 87  ? 42.351 -33.710 -19.282 1.00 108.22 ? 81   LEU A CB   1 
ATOM   508  C  CG   . LEU A 1 87  ? 41.142 -33.478 -18.389 1.00 111.33 ? 81   LEU A CG   1 
ATOM   509  C  CD1  . LEU A 1 87  ? 41.560 -32.588 -17.227 1.00 122.01 ? 81   LEU A CD1  1 
ATOM   510  C  CD2  . LEU A 1 87  ? 40.010 -32.843 -19.170 1.00 103.65 ? 81   LEU A CD2  1 
ATOM   511  N  N    . ALA A 1 88  ? 42.854 -36.193 -17.196 1.00 113.03 ? 82   ALA A N    1 
ATOM   512  C  CA   . ALA A 1 88  ? 42.627 -37.588 -16.823 1.00 114.83 ? 82   ALA A CA   1 
ATOM   513  C  C    . ALA A 1 88  ? 42.110 -37.680 -15.390 1.00 123.52 ? 82   ALA A C    1 
ATOM   514  O  O    . ALA A 1 88  ? 42.210 -36.733 -14.601 1.00 127.09 ? 82   ALA A O    1 
ATOM   515  C  CB   . ALA A 1 88  ? 43.901 -38.420 -16.980 1.00 109.00 ? 82   ALA A CB   1 
ATOM   516  N  N    . LEU A 1 89  ? 41.582 -38.859 -15.058 1.00 122.83 ? 83   LEU A N    1 
ATOM   517  C  CA   . LEU A 1 89  ? 40.855 -39.078 -13.817 1.00 123.91 ? 83   LEU A CA   1 
ATOM   518  C  C    . LEU A 1 89  ? 41.079 -40.505 -13.327 1.00 124.29 ? 83   LEU A C    1 
ATOM   519  O  O    . LEU A 1 89  ? 41.151 -41.441 -14.129 1.00 120.14 ? 83   LEU A O    1 
ATOM   520  C  CB   . LEU A 1 89  ? 39.360 -38.804 -14.021 1.00 122.47 ? 83   LEU A CB   1 
ATOM   521  C  CG   . LEU A 1 89  ? 38.667 -39.633 -15.106 1.00 116.20 ? 83   LEU A CG   1 
ATOM   522  C  CD1  . LEU A 1 89  ? 38.362 -41.039 -14.622 1.00 119.70 ? 83   LEU A CD1  1 
ATOM   523  C  CD2  . LEU A 1 89  ? 37.401 -38.943 -15.563 1.00 112.35 ? 83   LEU A CD2  1 
ATOM   524  N  N    . ASP A 1 90  ? 41.174 -40.659 -12.005 1.00 126.94 ? 84   ASP A N    1 
ATOM   525  C  CA   . ASP A 1 90  ? 41.374 -41.951 -11.357 1.00 123.14 ? 84   ASP A CA   1 
ATOM   526  C  C    . ASP A 1 90  ? 40.054 -42.407 -10.747 1.00 130.35 ? 84   ASP A C    1 
ATOM   527  O  O    . ASP A 1 90  ? 39.519 -41.749 -9.847  1.00 134.49 ? 84   ASP A O    1 
ATOM   528  C  CB   . ASP A 1 90  ? 42.462 -41.858 -10.285 1.00 123.14 ? 84   ASP A CB   1 
ATOM   529  C  CG   . ASP A 1 90  ? 42.747 -43.197 -9.617  1.00 126.88 ? 84   ASP A CG   1 
ATOM   530  O  OD1  . ASP A 1 90  ? 42.157 -44.215 -10.041 1.00 123.35 ? 84   ASP A OD1  1 
ATOM   531  O  OD2  . ASP A 1 90  ? 43.554 -43.227 -8.659  1.00 130.99 ? 84   ASP A OD2  1 
ATOM   532  N  N    . LEU A 1 91  ? 39.529 -43.526 -11.243 1.00 130.30 ? 85   LEU A N    1 
ATOM   533  C  CA   . LEU A 1 91  ? 38.237 -44.050 -10.821 1.00 134.36 ? 85   LEU A CA   1 
ATOM   534  C  C    . LEU A 1 91  ? 38.342 -45.134 -9.751  1.00 138.87 ? 85   LEU A C    1 
ATOM   535  O  O    . LEU A 1 91  ? 37.320 -45.724 -9.385  1.00 140.14 ? 85   LEU A O    1 
ATOM   536  C  CB   . LEU A 1 91  ? 37.461 -44.571 -12.030 1.00 128.44 ? 85   LEU A CB   1 
ATOM   537  C  CG   . LEU A 1 91  ? 35.997 -44.931 -11.787 1.00 127.07 ? 85   LEU A CG   1 
ATOM   538  C  CD1  . LEU A 1 91  ? 35.176 -44.563 -13.010 1.00 127.62 ? 85   LEU A CD1  1 
ATOM   539  C  CD2  . LEU A 1 91  ? 35.853 -46.409 -11.486 1.00 127.00 ? 85   LEU A CD2  1 
ATOM   540  N  N    . GLY A 1 92  ? 39.539 -45.394 -9.224  1.00 139.56 ? 86   GLY A N    1 
ATOM   541  C  CA   . GLY A 1 92  ? 39.742 -46.495 -8.297  1.00 142.79 ? 86   GLY A CA   1 
ATOM   542  C  C    . GLY A 1 92  ? 38.720 -46.550 -7.177  1.00 149.76 ? 86   GLY A C    1 
ATOM   543  O  O    . GLY A 1 92  ? 38.487 -47.613 -6.588  1.00 151.88 ? 86   GLY A O    1 
ATOM   544  N  N    . GLY A 1 93  ? 38.112 -45.404 -6.866  1.00 147.12 ? 87   GLY A N    1 
ATOM   545  C  CA   . GLY A 1 93  ? 37.063 -45.313 -5.879  1.00 145.81 ? 87   GLY A CA   1 
ATOM   546  C  C    . GLY A 1 93  ? 37.536 -44.951 -4.490  1.00 147.27 ? 87   GLY A C    1 
ATOM   547  O  O    . GLY A 1 93  ? 36.748 -44.418 -3.701  1.00 145.79 ? 87   GLY A O    1 
ATOM   548  N  N    . THR A 1 94  ? 38.799 -45.224 -4.168  1.00 147.94 ? 88   THR A N    1 
ATOM   549  C  CA   . THR A 1 94  ? 39.386 -44.704 -2.943  1.00 151.14 ? 88   THR A CA   1 
ATOM   550  C  C    . THR A 1 94  ? 39.330 -43.180 -2.990  1.00 151.85 ? 88   THR A C    1 
ATOM   551  O  O    . THR A 1 94  ? 38.572 -42.551 -2.244  1.00 150.59 ? 88   THR A O    1 
ATOM   552  C  CB   . THR A 1 94  ? 40.829 -45.196 -2.776  1.00 150.72 ? 88   THR A CB   1 
ATOM   553  O  OG1  . THR A 1 94  ? 40.861 -46.628 -2.858  1.00 147.15 ? 88   THR A OG1  1 
ATOM   554  C  CG2  . THR A 1 94  ? 41.388 -44.763 -1.416  1.00 144.55 ? 88   THR A CG2  1 
ATOM   555  N  N    . ASN A 1 95  ? 40.134 -42.582 -3.874  1.00 153.19 ? 89   ASN A N    1 
ATOM   556  C  CA   . ASN A 1 95  ? 40.128 -41.133 -4.043  1.00 151.04 ? 89   ASN A CA   1 
ATOM   557  C  C    . ASN A 1 95  ? 38.983 -40.659 -4.940  1.00 149.89 ? 89   ASN A C    1 
ATOM   558  O  O    . ASN A 1 95  ? 38.221 -39.762 -4.560  1.00 150.37 ? 89   ASN A O    1 
ATOM   559  C  CB   . ASN A 1 95  ? 41.477 -40.672 -4.604  1.00 147.32 ? 89   ASN A CB   1 
ATOM   560  N  N    . PHE A 1 96  ? 38.820 -41.277 -6.116  1.00 148.57 ? 90   PHE A N    1 
ATOM   561  C  CA   . PHE A 1 96  ? 37.985 -40.740 -7.199  1.00 146.37 ? 90   PHE A CA   1 
ATOM   562  C  C    . PHE A 1 96  ? 38.568 -39.452 -7.788  1.00 143.95 ? 90   PHE A C    1 
ATOM   563  O  O    . PHE A 1 96  ? 37.830 -38.601 -8.297  1.00 136.33 ? 90   PHE A O    1 
ATOM   564  C  CB   . PHE A 1 96  ? 36.543 -40.505 -6.734  1.00 142.01 ? 90   PHE A CB   1 
ATOM   565  N  N    . ARG A 1 97  ? 39.896 -39.328 -7.752  1.00 143.37 ? 91   ARG A N    1 
ATOM   566  C  CA   . ARG A 1 97  ? 40.602 -38.098 -8.090  1.00 138.83 ? 91   ARG A CA   1 
ATOM   567  C  C    . ARG A 1 97  ? 40.450 -37.760 -9.571  1.00 132.81 ? 91   ARG A C    1 
ATOM   568  O  O    . ARG A 1 97  ? 40.033 -38.586 -10.385 1.00 131.61 ? 91   ARG A O    1 
ATOM   569  C  CB   . ARG A 1 97  ? 42.086 -38.218 -7.731  1.00 132.53 ? 91   ARG A CB   1 
ATOM   570  N  N    . VAL A 1 98  ? 40.747 -36.502 -9.901  1.00 135.40 ? 92   VAL A N    1 
ATOM   571  C  CA   . VAL A 1 98  ? 40.848 -36.016 -11.278 1.00 132.71 ? 92   VAL A CA   1 
ATOM   572  C  C    . VAL A 1 98  ? 42.147 -35.229 -11.401 1.00 134.15 ? 92   VAL A C    1 
ATOM   573  O  O    . VAL A 1 98  ? 42.322 -34.212 -10.717 1.00 138.48 ? 92   VAL A O    1 
ATOM   574  C  CB   . VAL A 1 98  ? 39.650 -35.137 -11.679 1.00 131.98 ? 92   VAL A CB   1 
ATOM   575  C  CG1  . VAL A 1 98  ? 39.893 -34.494 -13.038 1.00 129.29 ? 92   VAL A CG1  1 
ATOM   576  C  CG2  . VAL A 1 98  ? 38.371 -35.959 -11.701 1.00 127.43 ? 92   VAL A CG2  1 
ATOM   577  N  N    . LEU A 1 99  ? 43.049 -35.686 -12.270 1.00 127.94 ? 93   LEU A N    1 
ATOM   578  C  CA   . LEU A 1 99  ? 44.379 -35.102 -12.375 1.00 126.15 ? 93   LEU A CA   1 
ATOM   579  C  C    . LEU A 1 99  ? 44.470 -34.148 -13.565 1.00 125.55 ? 93   LEU A C    1 
ATOM   580  O  O    . LEU A 1 99  ? 43.539 -34.008 -14.362 1.00 126.51 ? 93   LEU A O    1 
ATOM   581  C  CB   . LEU A 1 99  ? 45.437 -36.207 -12.492 1.00 115.00 ? 93   LEU A CB   1 
ATOM   582  N  N    . TRP A 1 100 ? 45.622 -33.479 -13.664 1.00 123.64 ? 94   TRP A N    1 
ATOM   583  C  CA   . TRP A 1 100 ? 45.966 -32.591 -14.770 1.00 119.34 ? 94   TRP A CA   1 
ATOM   584  C  C    . TRP A 1 100 ? 47.482 -32.571 -14.901 1.00 116.71 ? 94   TRP A C    1 
ATOM   585  O  O    . TRP A 1 100 ? 48.187 -32.550 -13.888 1.00 117.64 ? 94   TRP A O    1 
ATOM   586  C  CB   . TRP A 1 100 ? 45.421 -31.178 -14.523 1.00 121.87 ? 94   TRP A CB   1 
ATOM   587  C  CG   . TRP A 1 100 ? 45.791 -30.131 -15.547 1.00 120.25 ? 94   TRP A CG   1 
ATOM   588  C  CD1  . TRP A 1 100 ? 45.080 -29.773 -16.657 1.00 117.92 ? 94   TRP A CD1  1 
ATOM   589  C  CD2  . TRP A 1 100 ? 46.956 -29.287 -15.528 1.00 119.37 ? 94   TRP A CD2  1 
ATOM   590  N  NE1  . TRP A 1 100 ? 45.731 -28.763 -17.332 1.00 114.29 ? 94   TRP A NE1  1 
ATOM   591  C  CE2  . TRP A 1 100 ? 46.884 -28.450 -16.660 1.00 116.41 ? 94   TRP A CE2  1 
ATOM   592  C  CE3  . TRP A 1 100 ? 48.053 -29.162 -14.665 1.00 116.46 ? 94   TRP A CE3  1 
ATOM   593  C  CZ2  . TRP A 1 100 ? 47.866 -27.507 -16.951 1.00 117.12 ? 94   TRP A CZ2  1 
ATOM   594  C  CZ3  . TRP A 1 100 ? 49.027 -28.225 -14.958 1.00 114.45 ? 94   TRP A CZ3  1 
ATOM   595  C  CH2  . TRP A 1 100 ? 48.927 -27.411 -16.089 1.00 117.20 ? 94   TRP A CH2  1 
ATOM   596  N  N    . VAL A 1 101 ? 47.985 -32.554 -16.139 1.00 112.41 ? 95   VAL A N    1 
ATOM   597  C  CA   . VAL A 1 101 ? 49.426 -32.614 -16.373 1.00 112.77 ? 95   VAL A CA   1 
ATOM   598  C  C    . VAL A 1 101 ? 49.772 -31.915 -17.683 1.00 113.39 ? 95   VAL A C    1 
ATOM   599  O  O    . VAL A 1 101 ? 48.982 -31.902 -18.631 1.00 111.02 ? 95   VAL A O    1 
ATOM   600  C  CB   . VAL A 1 101 ? 49.946 -34.072 -16.389 1.00 108.80 ? 95   VAL A CB   1 
ATOM   601  C  CG1  . VAL A 1 101 ? 51.428 -34.103 -16.740 1.00 107.06 ? 95   VAL A CG1  1 
ATOM   602  C  CG2  . VAL A 1 101 ? 49.702 -34.741 -15.048 1.00 113.00 ? 95   VAL A CG2  1 
ATOM   603  N  N    . LYS A 1 102 ? 50.978 -31.340 -17.729 1.00 109.55 ? 96   LYS A N    1 
ATOM   604  C  CA   . LYS A 1 102 ? 51.559 -30.784 -18.944 1.00 106.91 ? 96   LYS A CA   1 
ATOM   605  C  C    . LYS A 1 102 ? 53.010 -31.234 -19.034 1.00 107.57 ? 96   LYS A C    1 
ATOM   606  O  O    . LYS A 1 102 ? 53.697 -31.330 -18.013 1.00 109.06 ? 96   LYS A O    1 
ATOM   607  C  CB   . LYS A 1 102 ? 51.475 -29.248 -18.968 1.00 105.46 ? 96   LYS A CB   1 
ATOM   608  C  CG   . LYS A 1 102 ? 50.071 -28.693 -19.161 1.00 106.83 ? 96   LYS A CG   1 
ATOM   609  N  N    . VAL A 1 103 ? 53.475 -31.507 -20.256 1.00 105.92 ? 97   VAL A N    1 
ATOM   610  C  CA   . VAL A 1 103 ? 54.802 -32.061 -20.490 1.00 104.01 ? 97   VAL A CA   1 
ATOM   611  C  C    . VAL A 1 103 ? 55.525 -31.180 -21.503 1.00 107.47 ? 97   VAL A C    1 
ATOM   612  O  O    . VAL A 1 103 ? 54.904 -30.427 -22.259 1.00 105.75 ? 97   VAL A O    1 
ATOM   613  C  CB   . VAL A 1 103 ? 54.735 -33.523 -21.001 1.00 103.50 ? 97   VAL A CB   1 
ATOM   614  C  CG1  . VAL A 1 103 ? 56.135 -34.107 -21.201 1.00 98.12  ? 97   VAL A CG1  1 
ATOM   615  C  CG2  . VAL A 1 103 ? 53.897 -34.389 -20.069 1.00 106.45 ? 97   VAL A CG2  1 
ATOM   616  N  N    . THR A 1 104 ? 56.858 -31.284 -21.511 1.00 108.43 ? 98   THR A N    1 
ATOM   617  C  CA   . THR A 1 104 ? 57.682 -30.655 -22.541 1.00 107.67 ? 98   THR A CA   1 
ATOM   618  C  C    . THR A 1 104 ? 58.929 -31.498 -22.792 1.00 111.31 ? 98   THR A C    1 
ATOM   619  O  O    . THR A 1 104 ? 59.393 -32.236 -21.915 1.00 106.75 ? 98   THR A O    1 
ATOM   620  C  CB   . THR A 1 104 ? 58.087 -29.224 -22.168 1.00 108.10 ? 98   THR A CB   1 
ATOM   621  O  OG1  . THR A 1 104 ? 58.776 -29.242 -20.911 1.00 117.47 ? 98   THR A OG1  1 
ATOM   622  C  CG2  . THR A 1 104 ? 56.862 -28.310 -22.092 1.00 98.03  ? 98   THR A CG2  1 
ATOM   623  N  N    . ASP A 1 105 ? 59.483 -31.353 -24.006 1.00 115.11 ? 99   ASP A N    1 
ATOM   624  C  CA   . ASP A 1 105 ? 60.564 -32.193 -24.519 1.00 108.69 ? 99   ASP A CA   1 
ATOM   625  C  C    . ASP A 1 105 ? 61.957 -31.723 -24.105 1.00 114.63 ? 99   ASP A C    1 
ATOM   626  O  O    . ASP A 1 105 ? 62.947 -32.310 -24.557 1.00 114.30 ? 99   ASP A O    1 
ATOM   627  C  CB   . ASP A 1 105 ? 60.487 -32.285 -26.049 1.00 90.36  ? 99   ASP A CB   1 
ATOM   628  N  N    . ASN A 1 106 ? 62.062 -30.682 -23.277 1.00 117.33 ? 100  ASN A N    1 
ATOM   629  C  CA   . ASN A 1 106 ? 63.348 -30.264 -22.732 1.00 117.52 ? 100  ASN A CA   1 
ATOM   630  C  C    . ASN A 1 106 ? 63.825 -31.262 -21.672 1.00 121.79 ? 100  ASN A C    1 
ATOM   631  O  O    . ASN A 1 106 ? 63.147 -32.237 -21.337 1.00 124.99 ? 100  ASN A O    1 
ATOM   632  N  N    . GLY A 1 107 ? 65.009 -31.005 -21.124 1.00 121.27 ? 101  GLY A N    1 
ATOM   633  C  CA   . GLY A 1 107 ? 65.667 -31.971 -20.261 1.00 121.66 ? 101  GLY A CA   1 
ATOM   634  C  C    . GLY A 1 107 ? 64.940 -32.311 -18.974 1.00 123.36 ? 101  GLY A C    1 
ATOM   635  O  O    . GLY A 1 107 ? 64.651 -33.486 -18.716 1.00 119.41 ? 101  GLY A O    1 
ATOM   636  N  N    . LEU A 1 108 ? 64.644 -31.297 -18.155 1.00 127.69 ? 102  LEU A N    1 
ATOM   637  C  CA   . LEU A 1 108 ? 63.930 -31.523 -16.901 1.00 122.55 ? 102  LEU A CA   1 
ATOM   638  C  C    . LEU A 1 108 ? 62.563 -32.132 -17.189 1.00 123.77 ? 102  LEU A C    1 
ATOM   639  O  O    . LEU A 1 108 ? 61.772 -31.583 -17.966 1.00 124.63 ? 102  LEU A O    1 
ATOM   640  C  CB   . LEU A 1 108 ? 63.787 -30.215 -16.124 1.00 115.57 ? 102  LEU A CB   1 
ATOM   641  N  N    . GLN A 1 109 ? 62.296 -33.276 -16.571 1.00 118.11 ? 103  GLN A N    1 
ATOM   642  C  CA   . GLN A 1 109 ? 61.166 -34.111 -16.942 1.00 113.83 ? 103  GLN A CA   1 
ATOM   643  C  C    . GLN A 1 109 ? 59.947 -33.924 -16.051 1.00 110.49 ? 103  GLN A C    1 
ATOM   644  O  O    . GLN A 1 109 ? 58.962 -34.651 -16.214 1.00 107.96 ? 103  GLN A O    1 
ATOM   645  C  CB   . GLN A 1 109 ? 61.612 -35.571 -16.965 1.00 108.48 ? 103  GLN A CB   1 
ATOM   646  C  CG   . GLN A 1 109 ? 62.647 -35.809 -18.058 1.00 111.26 ? 103  GLN A CG   1 
ATOM   647  C  CD   . GLN A 1 109 ? 63.213 -37.211 -18.046 1.00 109.29 ? 103  GLN A CD   1 
ATOM   648  O  OE1  . GLN A 1 109 ? 63.210 -37.890 -17.010 1.00 102.97 ? 103  GLN A OE1  1 
ATOM   649  N  NE2  . GLN A 1 109 ? 63.712 -37.657 -19.201 1.00 104.15 ? 103  GLN A NE2  1 
ATOM   650  N  N    . LYS A 1 110 ? 59.984 -32.984 -15.111 1.00 118.77 ? 104  LYS A N    1 
ATOM   651  C  CA   . LYS A 1 110 ? 58.837 -32.777 -14.237 1.00 118.09 ? 104  LYS A CA   1 
ATOM   652  C  C    . LYS A 1 110 ? 57.611 -32.394 -15.062 1.00 112.86 ? 104  LYS A C    1 
ATOM   653  O  O    . LYS A 1 110 ? 57.656 -31.479 -15.890 1.00 106.21 ? 104  LYS A O    1 
ATOM   654  C  CB   . LYS A 1 110 ? 59.146 -31.704 -13.188 1.00 110.78 ? 104  LYS A CB   1 
ATOM   655  N  N    . VAL A 1 111 ? 56.523 -33.123 -14.847 1.00 111.12 ? 105  VAL A N    1 
ATOM   656  C  CA   . VAL A 1 111 ? 55.247 -32.865 -15.498 1.00 108.44 ? 105  VAL A CA   1 
ATOM   657  C  C    . VAL A 1 111 ? 54.381 -32.096 -14.515 1.00 109.51 ? 105  VAL A C    1 
ATOM   658  O  O    . VAL A 1 111 ? 54.124 -32.573 -13.402 1.00 112.66 ? 105  VAL A O    1 
ATOM   659  C  CB   . VAL A 1 111 ? 54.568 -34.175 -15.928 1.00 104.92 ? 105  VAL A CB   1 
ATOM   660  N  N    . GLU A 1 112 ? 53.917 -30.912 -14.908 1.00 108.25 ? 106  GLU A N    1 
ATOM   661  C  CA   . GLU A 1 112 ? 53.150 -30.103 -13.970 1.00 109.82 ? 106  GLU A CA   1 
ATOM   662  C  C    . GLU A 1 112 ? 51.815 -30.786 -13.701 1.00 112.42 ? 106  GLU A C    1 
ATOM   663  O  O    . GLU A 1 112 ? 50.989 -30.926 -14.609 1.00 111.28 ? 106  GLU A O    1 
ATOM   664  C  CB   . GLU A 1 112 ? 52.935 -28.698 -14.529 1.00 107.58 ? 106  GLU A CB   1 
ATOM   665  N  N    . MET A 1 113 ? 51.580 -31.156 -12.441 1.00 114.51 ? 107  MET A N    1 
ATOM   666  C  CA   . MET A 1 113 ? 50.423 -31.950 -12.048 1.00 115.82 ? 107  MET A CA   1 
ATOM   667  C  C    . MET A 1 113 ? 49.655 -31.215 -10.959 1.00 119.86 ? 107  MET A C    1 
ATOM   668  O  O    . MET A 1 113 ? 50.239 -30.817 -9.945  1.00 123.49 ? 107  MET A O    1 
ATOM   669  C  CB   . MET A 1 113 ? 50.847 -33.341 -11.559 1.00 109.45 ? 107  MET A CB   1 
ATOM   670  N  N    . GLU A 1 114 ? 48.356 -31.015 -11.184 1.00 117.25 ? 108  GLU A N    1 
ATOM   671  C  CA   . GLU A 1 114 ? 47.475 -30.405 -10.197 1.00 122.81 ? 108  GLU A CA   1 
ATOM   672  C  C    . GLU A 1 114 ? 46.138 -31.132 -10.222 1.00 127.31 ? 108  GLU A C    1 
ATOM   673  O  O    . GLU A 1 114 ? 45.524 -31.254 -11.284 1.00 125.36 ? 108  GLU A O    1 
ATOM   674  C  CB   . GLU A 1 114 ? 47.282 -28.908 -10.475 1.00 118.51 ? 108  GLU A CB   1 
ATOM   675  N  N    . ASN A 1 115 ? 45.692 -31.609 -9.058  1.00 133.65 ? 109  ASN A N    1 
ATOM   676  C  CA   . ASN A 1 115 ? 44.425 -32.325 -8.942  1.00 134.02 ? 109  ASN A CA   1 
ATOM   677  C  C    . ASN A 1 115 ? 43.808 -32.060 -7.576  1.00 140.32 ? 109  ASN A C    1 
ATOM   678  O  O    . ASN A 1 115 ? 44.487 -31.647 -6.631  1.00 141.13 ? 109  ASN A O    1 
ATOM   679  C  CB   . ASN A 1 115 ? 44.591 -33.841 -9.122  1.00 131.05 ? 109  ASN A CB   1 
ATOM   680  C  CG   . ASN A 1 115 ? 45.411 -34.483 -8.007  1.00 133.51 ? 109  ASN A CG   1 
ATOM   681  O  OD1  . ASN A 1 115 ? 46.185 -33.815 -7.319  1.00 134.01 ? 109  ASN A OD1  1 
ATOM   682  N  ND2  . ASN A 1 115 ? 45.206 -35.779 -7.796  1.00 131.29 ? 109  ASN A ND2  1 
ATOM   683  N  N    . GLN A 1 116 ? 42.504 -32.318 -7.478  1.00 140.22 ? 110  GLN A N    1 
ATOM   684  C  CA   . GLN A 1 116 ? 41.812 -32.347 -6.196  1.00 146.34 ? 110  GLN A CA   1 
ATOM   685  C  C    . GLN A 1 116 ? 40.829 -33.510 -6.204  1.00 148.83 ? 110  GLN A C    1 
ATOM   686  O  O    . GLN A 1 116 ? 40.204 -33.796 -7.230  1.00 145.21 ? 110  GLN A O    1 
ATOM   687  C  CB   . GLN A 1 116 ? 41.087 -31.022 -5.894  1.00 143.65 ? 110  GLN A CB   1 
ATOM   688  C  CG   . GLN A 1 116 ? 40.050 -30.615 -6.928  1.00 144.05 ? 110  GLN A CG   1 
ATOM   689  N  N    . ILE A 1 117 ? 40.703 -34.178 -5.055  1.00 149.01 ? 111  ILE A N    1 
ATOM   690  C  CA   . ILE A 1 117 ? 39.975 -35.440 -4.946  1.00 145.93 ? 111  ILE A CA   1 
ATOM   691  C  C    . ILE A 1 117 ? 38.472 -35.176 -4.940  1.00 144.92 ? 111  ILE A C    1 
ATOM   692  O  O    . ILE A 1 117 ? 38.035 -34.020 -4.952  1.00 145.88 ? 111  ILE A O    1 
ATOM   693  C  CB   . ILE A 1 117 ? 40.432 -36.202 -3.685  1.00 146.54 ? 111  ILE A CB   1 
ATOM   694  C  CG1  . ILE A 1 117 ? 39.818 -37.603 -3.609  1.00 146.79 ? 111  ILE A CG1  1 
ATOM   695  C  CG2  . ILE A 1 117 ? 40.128 -35.395 -2.429  1.00 149.99 ? 111  ILE A CG2  1 
ATOM   696  C  CD1  . ILE A 1 117 ? 40.410 -38.472 -2.509  1.00 145.04 ? 111  ILE A CD1  1 
ATOM   697  N  N    . TYR A 1 118 ? 37.672 -36.241 -4.929  1.00 144.59 ? 112  TYR A N    1 
ATOM   698  C  CA   . TYR A 1 118 ? 36.210 -36.134 -4.908  1.00 147.13 ? 112  TYR A CA   1 
ATOM   699  C  C    . TYR A 1 118 ? 35.569 -37.358 -4.254  1.00 148.46 ? 112  TYR A C    1 
ATOM   700  O  O    . TYR A 1 118 ? 34.373 -37.611 -4.419  1.00 149.28 ? 112  TYR A O    1 
ATOM   701  C  CB   . TYR A 1 118 ? 35.652 -35.953 -6.324  1.00 146.90 ? 112  TYR A CB   1 
ATOM   702  C  CG   . TYR A 1 118 ? 35.986 -34.624 -6.960  1.00 147.43 ? 112  TYR A CG   1 
ATOM   703  C  CD1  . TYR A 1 118 ? 35.157 -33.525 -6.791  1.00 147.53 ? 112  TYR A CD1  1 
ATOM   704  C  CD2  . TYR A 1 118 ? 37.132 -34.467 -7.726  1.00 146.98 ? 112  TYR A CD2  1 
ATOM   705  C  CE1  . TYR A 1 118 ? 35.461 -32.306 -7.370  1.00 151.01 ? 112  TYR A CE1  1 
ATOM   706  C  CE2  . TYR A 1 118 ? 37.446 -33.251 -8.308  1.00 147.87 ? 112  TYR A CE2  1 
ATOM   707  C  CZ   . TYR A 1 118 ? 36.607 -32.174 -8.129  1.00 150.78 ? 112  TYR A CZ   1 
ATOM   708  O  OH   . TYR A 1 118 ? 36.921 -30.966 -8.712  1.00 150.03 ? 112  TYR A OH   1 
ATOM   709  N  N    . GLY A 1 129 ? 22.397 -45.008 -14.960 1.00 149.08 ? 123  GLY A N    1 
ATOM   710  C  CA   . GLY A 1 129 ? 21.504 -44.149 -15.718 1.00 151.90 ? 123  GLY A CA   1 
ATOM   711  C  C    . GLY A 1 129 ? 22.177 -42.930 -16.329 1.00 156.62 ? 123  GLY A C    1 
ATOM   712  O  O    . GLY A 1 129 ? 23.404 -42.816 -16.308 1.00 155.48 ? 123  GLY A O    1 
ATOM   713  N  N    . THR A 1 130 ? 21.364 -42.015 -16.874 1.00 159.83 ? 124  THR A N    1 
ATOM   714  C  CA   . THR A 1 130 ? 21.884 -40.811 -17.523 1.00 159.41 ? 124  THR A CA   1 
ATOM   715  C  C    . THR A 1 130 ? 22.368 -39.780 -16.507 1.00 159.13 ? 124  THR A C    1 
ATOM   716  O  O    . THR A 1 130 ? 23.393 -39.121 -16.730 1.00 155.63 ? 124  THR A O    1 
ATOM   717  C  CB   . THR A 1 130 ? 20.818 -40.193 -18.435 1.00 159.60 ? 124  THR A CB   1 
ATOM   718  O  OG1  . THR A 1 130 ? 20.490 -41.108 -19.491 1.00 156.04 ? 124  THR A OG1  1 
ATOM   719  C  CG2  . THR A 1 130 ? 21.315 -38.877 -19.033 1.00 155.94 ? 124  THR A CG2  1 
ATOM   720  N  N    . GLN A 1 131 ? 21.637 -39.611 -15.397 1.00 159.97 ? 125  GLN A N    1 
ATOM   721  C  CA   . GLN A 1 131 ? 22.127 -38.785 -14.298 1.00 158.25 ? 125  GLN A CA   1 
ATOM   722  C  C    . GLN A 1 131 ? 23.432 -39.314 -13.723 1.00 157.77 ? 125  GLN A C    1 
ATOM   723  O  O    . GLN A 1 131 ? 24.105 -38.592 -12.978 1.00 158.56 ? 125  GLN A O    1 
ATOM   724  C  CB   . GLN A 1 131 ? 21.097 -38.707 -13.160 1.00 157.01 ? 125  GLN A CB   1 
ATOM   725  C  CG   . GLN A 1 131 ? 19.808 -37.946 -13.457 1.00 154.76 ? 125  GLN A CG   1 
ATOM   726  C  CD   . GLN A 1 131 ? 18.842 -37.958 -12.276 1.00 146.13 ? 125  GLN A CD   1 
ATOM   727  O  OE1  . GLN A 1 131 ? 18.895 -38.850 -11.429 1.00 147.31 ? 125  GLN A OE1  1 
ATOM   728  N  NE2  . GLN A 1 131 ? 17.959 -36.965 -12.216 1.00 135.81 ? 125  GLN A NE2  1 
ATOM   729  N  N    . LEU A 1 132 ? 23.803 -40.550 -14.057 1.00 157.13 ? 126  LEU A N    1 
ATOM   730  C  CA   . LEU A 1 132 ? 24.862 -41.247 -13.342 1.00 157.91 ? 126  LEU A CA   1 
ATOM   731  C  C    . LEU A 1 132 ? 26.251 -40.788 -13.778 1.00 157.59 ? 126  LEU A C    1 
ATOM   732  O  O    . LEU A 1 132 ? 27.175 -40.772 -12.958 1.00 157.04 ? 126  LEU A O    1 
ATOM   733  C  CB   . LEU A 1 132 ? 24.682 -42.753 -13.542 1.00 159.30 ? 126  LEU A CB   1 
ATOM   734  C  CG   . LEU A 1 132 ? 25.556 -43.758 -12.798 1.00 161.29 ? 126  LEU A CG   1 
ATOM   735  C  CD1  . LEU A 1 132 ? 25.343 -43.609 -11.299 1.00 162.53 ? 126  LEU A CD1  1 
ATOM   736  C  CD2  . LEU A 1 132 ? 25.196 -45.169 -13.249 1.00 158.86 ? 126  LEU A CD2  1 
ATOM   737  N  N    . PHE A 1 133 ? 26.419 -40.412 -15.051 1.00 155.95 ? 127  PHE A N    1 
ATOM   738  C  CA   . PHE A 1 133 ? 27.687 -39.849 -15.510 1.00 153.73 ? 127  PHE A CA   1 
ATOM   739  C  C    . PHE A 1 133 ? 27.841 -38.380 -15.150 1.00 155.99 ? 127  PHE A C    1 
ATOM   740  O  O    . PHE A 1 133 ? 28.966 -37.917 -14.924 1.00 153.46 ? 127  PHE A O    1 
ATOM   741  C  CB   . PHE A 1 133 ? 27.836 -40.011 -17.025 1.00 149.57 ? 127  PHE A CB   1 
ATOM   742  C  CG   . PHE A 1 133 ? 28.116 -41.418 -17.461 1.00 146.10 ? 127  PHE A CG   1 
ATOM   743  C  CD1  . PHE A 1 133 ? 28.585 -42.358 -16.557 1.00 147.60 ? 127  PHE A CD1  1 
ATOM   744  C  CD2  . PHE A 1 133 ? 27.945 -41.794 -18.777 1.00 140.81 ? 127  PHE A CD2  1 
ATOM   745  C  CE1  . PHE A 1 133 ? 28.855 -43.653 -16.956 1.00 136.07 ? 127  PHE A CE1  1 
ATOM   746  C  CE2  . PHE A 1 133 ? 28.213 -43.087 -19.177 1.00 139.17 ? 127  PHE A CE2  1 
ATOM   747  C  CZ   . PHE A 1 133 ? 28.668 -44.016 -18.263 1.00 135.42 ? 127  PHE A CZ   1 
ATOM   748  N  N    . ASP A 1 134 ? 26.737 -37.645 -15.078 1.00 156.49 ? 128  ASP A N    1 
ATOM   749  C  CA   . ASP A 1 134 ? 26.756 -36.196 -14.957 1.00 154.74 ? 128  ASP A CA   1 
ATOM   750  C  C    . ASP A 1 134 ? 26.850 -35.728 -13.512 1.00 157.00 ? 128  ASP A C    1 
ATOM   751  O  O    . ASP A 1 134 ? 26.754 -34.522 -13.261 1.00 158.57 ? 128  ASP A O    1 
ATOM   752  C  CB   . ASP A 1 134 ? 25.513 -35.598 -15.624 1.00 151.70 ? 128  ASP A CB   1 
ATOM   753  C  CG   . ASP A 1 134 ? 25.507 -35.795 -17.133 1.00 151.90 ? 128  ASP A CG   1 
ATOM   754  O  OD1  . ASP A 1 134 ? 26.567 -36.144 -17.692 1.00 152.63 ? 128  ASP A OD1  1 
ATOM   755  O  OD2  . ASP A 1 134 ? 24.444 -35.598 -17.762 1.00 147.31 ? 128  ASP A OD2  1 
ATOM   756  N  N    . HIS A 1 135 ? 27.062 -36.648 -12.564 1.00 155.78 ? 129  HIS A N    1 
ATOM   757  C  CA   . HIS A 1 135 ? 26.905 -36.347 -11.144 1.00 158.54 ? 129  HIS A CA   1 
ATOM   758  C  C    . HIS A 1 135 ? 27.996 -35.408 -10.645 1.00 162.05 ? 129  HIS A C    1 
ATOM   759  O  O    . HIS A 1 135 ? 27.710 -34.254 -10.302 1.00 163.45 ? 129  HIS A O    1 
ATOM   760  C  CB   . HIS A 1 135 ? 26.913 -37.642 -10.328 1.00 156.91 ? 129  HIS A CB   1 
ATOM   761  N  N    . ILE A 1 136 ? 29.242 -35.886 -10.574 1.00 159.20 ? 130  ILE A N    1 
ATOM   762  C  CA   . ILE A 1 136 ? 30.388 -34.999 -10.390 1.00 157.86 ? 130  ILE A CA   1 
ATOM   763  C  C    . ILE A 1 136 ? 31.088 -34.685 -11.714 1.00 159.73 ? 130  ILE A C    1 
ATOM   764  O  O    . ILE A 1 136 ? 32.106 -33.977 -11.723 1.00 158.30 ? 130  ILE A O    1 
ATOM   765  C  CB   . ILE A 1 136 ? 31.367 -35.568 -9.337  1.00 156.64 ? 130  ILE A CB   1 
ATOM   766  C  CG1  . ILE A 1 136 ? 30.681 -35.624 -7.965  1.00 155.81 ? 130  ILE A CG1  1 
ATOM   767  C  CG2  . ILE A 1 136 ? 32.612 -34.704 -9.210  1.00 153.66 ? 130  ILE A CG2  1 
ATOM   768  C  CD1  . ILE A 1 136 ? 31.493 -36.319 -6.875  1.00 148.06 ? 130  ILE A CD1  1 
ATOM   769  N  N    . ALA A 1 137 ? 30.549 -35.170 -12.841 1.00 159.85 ? 131  ALA A N    1 
ATOM   770  C  CA   . ALA A 1 137 ? 31.041 -34.779 -14.160 1.00 156.21 ? 131  ALA A CA   1 
ATOM   771  C  C    . ALA A 1 137 ? 30.850 -33.296 -14.430 1.00 156.92 ? 131  ALA A C    1 
ATOM   772  O  O    . ALA A 1 137 ? 31.306 -32.809 -15.470 1.00 156.89 ? 131  ALA A O    1 
ATOM   773  C  CB   . ALA A 1 137 ? 30.347 -35.585 -15.259 1.00 150.52 ? 131  ALA A CB   1 
ATOM   774  N  N    . GLU A 1 138 ? 30.168 -32.579 -13.534 1.00 158.56 ? 132  GLU A N    1 
ATOM   775  C  CA   . GLU A 1 138 ? 30.092 -31.126 -13.598 1.00 161.28 ? 132  GLU A CA   1 
ATOM   776  C  C    . GLU A 1 138 ? 31.448 -30.460 -13.399 1.00 160.96 ? 132  GLU A C    1 
ATOM   777  O  O    . GLU A 1 138 ? 31.538 -29.232 -13.516 1.00 160.18 ? 132  GLU A O    1 
ATOM   778  C  CB   . GLU A 1 138 ? 29.100 -30.606 -12.552 1.00 160.29 ? 132  GLU A CB   1 
ATOM   779  N  N    . CYS A 1 139 ? 32.497 -31.232 -13.101 1.00 159.29 ? 133  CYS A N    1 
ATOM   780  C  CA   . CYS A 1 139 ? 33.809 -30.683 -12.776 1.00 159.90 ? 133  CYS A CA   1 
ATOM   781  C  C    . CYS A 1 139 ? 34.617 -30.263 -14.000 1.00 159.50 ? 133  CYS A C    1 
ATOM   782  O  O    . CYS A 1 139 ? 35.738 -29.766 -13.831 1.00 156.27 ? 133  CYS A O    1 
ATOM   783  C  CB   . CYS A 1 139 ? 34.621 -31.696 -11.959 1.00 157.58 ? 133  CYS A CB   1 
ATOM   784  S  SG   . CYS A 1 139 ? 33.990 -32.053 -10.295 1.00 154.55 ? 133  CYS A SG   1 
ATOM   785  N  N    . LEU A 1 140 ? 34.096 -30.448 -15.218 1.00 158.57 ? 134  LEU A N    1 
ATOM   786  C  CA   . LEU A 1 140 ? 34.808 -29.958 -16.396 1.00 159.01 ? 134  LEU A CA   1 
ATOM   787  C  C    . LEU A 1 140 ? 35.096 -28.465 -16.268 1.00 161.34 ? 134  LEU A C    1 
ATOM   788  O  O    . LEU A 1 140 ? 36.211 -28.009 -16.554 1.00 158.57 ? 134  LEU A O    1 
ATOM   789  C  CB   . LEU A 1 140 ? 34.007 -30.262 -17.668 1.00 159.05 ? 134  LEU A CB   1 
ATOM   790  C  CG   . LEU A 1 140 ? 34.572 -29.796 -19.021 1.00 154.80 ? 134  LEU A CG   1 
ATOM   791  C  CD1  . LEU A 1 140 ? 35.924 -30.438 -19.313 1.00 143.34 ? 134  LEU A CD1  1 
ATOM   792  C  CD2  . LEU A 1 140 ? 33.590 -30.078 -20.162 1.00 147.95 ? 134  LEU A CD2  1 
ATOM   793  N  N    . ALA A 1 141 ? 34.096 -27.686 -15.843 1.00 162.88 ? 135  ALA A N    1 
ATOM   794  C  CA   . ALA A 1 141 ? 34.331 -26.307 -15.429 1.00 163.75 ? 135  ALA A CA   1 
ATOM   795  C  C    . ALA A 1 141 ? 34.815 -26.211 -13.985 1.00 162.39 ? 135  ALA A C    1 
ATOM   796  O  O    . ALA A 1 141 ? 35.412 -25.192 -13.611 1.00 158.17 ? 135  ALA A O    1 
ATOM   797  C  CB   . ALA A 1 141 ? 33.056 -25.475 -15.608 1.00 158.59 ? 135  ALA A CB   1 
ATOM   798  N  N    . ASN A 1 142 ? 34.573 -27.250 -13.173 1.00 161.62 ? 136  ASN A N    1 
ATOM   799  C  CA   . ASN A 1 142 ? 34.952 -27.223 -11.763 1.00 160.27 ? 136  ASN A CA   1 
ATOM   800  C  C    . ASN A 1 142 ? 36.428 -27.529 -11.553 1.00 159.31 ? 136  ASN A C    1 
ATOM   801  O  O    . ASN A 1 142 ? 37.008 -27.084 -10.554 1.00 157.62 ? 136  ASN A O    1 
ATOM   802  C  CB   . ASN A 1 142 ? 34.099 -28.209 -10.961 1.00 158.46 ? 136  ASN A CB   1 
ATOM   803  N  N    . PHE A 1 143 ? 37.050 -28.289 -12.455 1.00 158.17 ? 137  PHE A N    1 
ATOM   804  C  CA   . PHE A 1 143 ? 38.496 -28.455 -12.399 1.00 156.93 ? 137  PHE A CA   1 
ATOM   805  C  C    . PHE A 1 143 ? 39.208 -27.459 -13.309 1.00 157.47 ? 137  PHE A C    1 
ATOM   806  O  O    . PHE A 1 143 ? 40.441 -27.474 -13.394 1.00 154.31 ? 137  PHE A O    1 
ATOM   807  C  CB   . PHE A 1 143 ? 38.896 -29.894 -12.753 1.00 149.85 ? 137  PHE A CB   1 
ATOM   808  C  CG   . PHE A 1 143 ? 40.291 -30.250 -12.312 1.00 147.35 ? 137  PHE A CG   1 
ATOM   809  C  CD1  . PHE A 1 143 ? 40.526 -30.600 -10.988 1.00 147.01 ? 137  PHE A CD1  1 
ATOM   810  C  CD2  . PHE A 1 143 ? 41.361 -30.219 -13.189 1.00 142.27 ? 137  PHE A CD2  1 
ATOM   811  C  CE1  . PHE A 1 143 ? 41.795 -30.922 -10.548 1.00 141.62 ? 137  PHE A CE1  1 
ATOM   812  C  CE2  . PHE A 1 143 ? 42.637 -30.538 -12.751 1.00 137.40 ? 137  PHE A CE2  1 
ATOM   813  C  CZ   . PHE A 1 143 ? 42.848 -30.890 -11.428 1.00 135.67 ? 137  PHE A CZ   1 
ATOM   814  N  N    . MET A 1 144 ? 38.449 -26.591 -13.980 1.00 158.82 ? 138  MET A N    1 
ATOM   815  C  CA   . MET A 1 144 ? 38.972 -25.380 -14.597 1.00 156.78 ? 138  MET A CA   1 
ATOM   816  C  C    . MET A 1 144 ? 39.131 -24.251 -13.590 1.00 154.90 ? 138  MET A C    1 
ATOM   817  O  O    . MET A 1 144 ? 39.536 -23.150 -13.974 1.00 151.84 ? 138  MET A O    1 
ATOM   818  C  CB   . MET A 1 144 ? 38.058 -24.929 -15.739 1.00 156.74 ? 138  MET A CB   1 
ATOM   819  N  N    . ASP A 1 145 ? 38.800 -24.496 -12.318 1.00 158.27 ? 139  ASP A N    1 
ATOM   820  C  CA   . ASP A 1 145 ? 39.065 -23.518 -11.269 1.00 158.84 ? 139  ASP A CA   1 
ATOM   821  C  C    . ASP A 1 145 ? 40.524 -23.082 -11.269 1.00 160.58 ? 139  ASP A C    1 
ATOM   822  O  O    . ASP A 1 145 ? 40.844 -21.978 -10.809 1.00 159.55 ? 139  ASP A O    1 
ATOM   823  C  CB   . ASP A 1 145 ? 38.687 -24.096 -9.903  1.00 153.74 ? 139  ASP A CB   1 
ATOM   824  N  N    . LYS A 1 146 ? 41.423 -23.938 -11.763 1.00 159.18 ? 140  LYS A N    1 
ATOM   825  C  CA   . LYS A 1 146 ? 42.826 -23.554 -11.913 1.00 157.50 ? 140  LYS A CA   1 
ATOM   826  C  C    . LYS A 1 146 ? 43.043 -22.792 -13.218 1.00 156.71 ? 140  LYS A C    1 
ATOM   827  O  O    . LYS A 1 146 ? 43.264 -21.577 -13.214 1.00 157.89 ? 140  LYS A O    1 
ATOM   828  C  CB   . LYS A 1 146 ? 43.720 -24.797 -11.847 1.00 153.60 ? 140  LYS A CB   1 
ATOM   829  N  N    . LEU A 1 147 ? 42.975 -23.494 -14.348 1.00 154.60 ? 141  LEU A N    1 
ATOM   830  C  CA   . LEU A 1 147 ? 43.272 -22.902 -15.646 1.00 151.97 ? 141  LEU A CA   1 
ATOM   831  C  C    . LEU A 1 147 ? 42.035 -22.452 -16.417 1.00 153.10 ? 141  LEU A C    1 
ATOM   832  O  O    . LEU A 1 147 ? 42.179 -21.979 -17.550 1.00 153.43 ? 141  LEU A O    1 
ATOM   833  C  CB   . LEU A 1 147 ? 44.086 -23.885 -16.496 1.00 147.06 ? 141  LEU A CB   1 
ATOM   834  C  CG   . LEU A 1 147 ? 45.475 -24.258 -15.969 1.00 135.44 ? 141  LEU A CG   1 
ATOM   835  N  N    . GLN A 1 148 ? 40.832 -22.590 -15.849 1.00 154.01 ? 142  GLN A N    1 
ATOM   836  C  CA   . GLN A 1 148 ? 39.591 -22.173 -16.514 1.00 153.36 ? 142  GLN A CA   1 
ATOM   837  C  C    . GLN A 1 148 ? 39.579 -22.643 -17.968 1.00 153.03 ? 142  GLN A C    1 
ATOM   838  O  O    . GLN A 1 148 ? 39.340 -21.876 -18.905 1.00 149.28 ? 142  GLN A O    1 
ATOM   839  C  CB   . GLN A 1 148 ? 39.392 -20.660 -16.415 1.00 152.27 ? 142  GLN A CB   1 
ATOM   840  N  N    . ILE A 1 149 ? 39.847 -23.942 -18.141 1.00 153.39 ? 143  ILE A N    1 
ATOM   841  C  CA   . ILE A 1 149 ? 40.171 -24.518 -19.445 1.00 149.30 ? 143  ILE A CA   1 
ATOM   842  C  C    . ILE A 1 149 ? 38.955 -24.910 -20.266 1.00 148.46 ? 143  ILE A C    1 
ATOM   843  O  O    . ILE A 1 149 ? 39.121 -25.450 -21.367 1.00 146.21 ? 143  ILE A O    1 
ATOM   844  C  CB   . ILE A 1 149 ? 41.087 -25.740 -19.232 1.00 147.00 ? 143  ILE A CB   1 
ATOM   845  C  CG1  . ILE A 1 149 ? 40.421 -26.729 -18.264 1.00 149.39 ? 143  ILE A CG1  1 
ATOM   846  C  CG2  . ILE A 1 149 ? 42.454 -25.302 -18.733 1.00 141.49 ? 143  ILE A CG2  1 
ATOM   847  C  CD1  . ILE A 1 149 ? 41.158 -28.043 -18.098 1.00 141.93 ? 143  ILE A CD1  1 
ATOM   848  N  N    . LYS A 1 150 ? 37.739 -24.637 -19.785 1.00 149.81 ? 144  LYS A N    1 
ATOM   849  C  CA   . LYS A 1 150 ? 36.540 -25.126 -20.460 1.00 148.52 ? 144  LYS A CA   1 
ATOM   850  C  C    . LYS A 1 150 ? 36.449 -24.670 -21.911 1.00 148.80 ? 144  LYS A C    1 
ATOM   851  O  O    . LYS A 1 150 ? 35.599 -25.180 -22.650 1.00 145.16 ? 144  LYS A O    1 
ATOM   852  C  CB   . LYS A 1 150 ? 35.290 -24.683 -19.694 1.00 150.51 ? 144  LYS A CB   1 
ATOM   853  N  N    . ASP A 1 151 ? 37.287 -23.722 -22.332 1.00 153.15 ? 145  ASP A N    1 
ATOM   854  C  CA   . ASP A 1 151 ? 37.385 -23.308 -23.726 1.00 150.70 ? 145  ASP A CA   1 
ATOM   855  C  C    . ASP A 1 151 ? 38.414 -24.114 -24.513 1.00 150.89 ? 145  ASP A C    1 
ATOM   856  O  O    . ASP A 1 151 ? 38.615 -23.839 -25.703 1.00 149.63 ? 145  ASP A O    1 
ATOM   857  C  CB   . ASP A 1 151 ? 37.726 -21.813 -23.811 1.00 145.19 ? 145  ASP A CB   1 
ATOM   858  N  N    . LYS A 1 152 ? 39.063 -25.101 -23.886 1.00 149.98 ? 146  LYS A N    1 
ATOM   859  C  CA   . LYS A 1 152 ? 40.105 -25.912 -24.515 1.00 147.21 ? 146  LYS A CA   1 
ATOM   860  C  C    . LYS A 1 152 ? 39.596 -27.344 -24.677 1.00 140.75 ? 146  LYS A C    1 
ATOM   861  O  O    . LYS A 1 152 ? 39.461 -28.073 -23.689 1.00 135.63 ? 146  LYS A O    1 
ATOM   862  C  CB   . LYS A 1 152 ? 41.391 -25.884 -23.684 1.00 140.52 ? 146  LYS A CB   1 
ATOM   863  C  CG   . LYS A 1 152 ? 42.091 -24.531 -23.623 1.00 134.84 ? 146  LYS A CG   1 
ATOM   864  N  N    . LYS A 1 153 ? 39.342 -27.755 -25.924 1.00 141.77 ? 147  LYS A N    1 
ATOM   865  C  CA   . LYS A 1 153 ? 38.950 -29.133 -26.212 1.00 134.10 ? 147  LYS A CA   1 
ATOM   866  C  C    . LYS A 1 153 ? 40.200 -30.006 -26.180 1.00 131.04 ? 147  LYS A C    1 
ATOM   867  O  O    . LYS A 1 153 ? 41.109 -29.832 -27.001 1.00 127.02 ? 147  LYS A O    1 
ATOM   868  C  CB   . LYS A 1 153 ? 38.254 -29.223 -27.570 1.00 129.24 ? 147  LYS A CB   1 
ATOM   869  N  N    . LEU A 1 154 ? 40.230 -30.968 -25.255 1.00 128.80 ? 148  LEU A N    1 
ATOM   870  C  CA   . LEU A 1 154 ? 41.497 -31.498 -24.770 1.00 124.98 ? 148  LEU A CA   1 
ATOM   871  C  C    . LEU A 1 154 ? 41.424 -33.004 -24.534 1.00 117.91 ? 148  LEU A C    1 
ATOM   872  O  O    . LEU A 1 154 ? 40.368 -33.519 -24.131 1.00 117.42 ? 148  LEU A O    1 
ATOM   873  C  CB   . LEU A 1 154 ? 41.869 -30.747 -23.476 1.00 119.98 ? 148  LEU A CB   1 
ATOM   874  C  CG   . LEU A 1 154 ? 43.266 -30.782 -22.860 1.00 115.33 ? 148  LEU A CG   1 
ATOM   875  C  CD1  . LEU A 1 154 ? 43.597 -29.410 -22.312 1.00 111.57 ? 148  LEU A CD1  1 
ATOM   876  C  CD2  . LEU A 1 154 ? 43.344 -31.810 -21.748 1.00 116.45 ? 148  LEU A CD2  1 
ATOM   877  N  N    . PRO A 1 155 ? 42.515 -33.733 -24.784 1.00 111.36 ? 149  PRO A N    1 
ATOM   878  C  CA   . PRO A 1 155 ? 42.475 -35.195 -24.651 1.00 109.92 ? 149  PRO A CA   1 
ATOM   879  C  C    . PRO A 1 155 ? 42.360 -35.643 -23.200 1.00 113.40 ? 149  PRO A C    1 
ATOM   880  O  O    . PRO A 1 155 ? 42.853 -34.992 -22.275 1.00 113.45 ? 149  PRO A O    1 
ATOM   881  C  CB   . PRO A 1 155 ? 43.807 -35.641 -25.263 1.00 104.08 ? 149  PRO A CB   1 
ATOM   882  C  CG   . PRO A 1 155 ? 44.710 -34.486 -25.058 1.00 104.94 ? 149  PRO A CG   1 
ATOM   883  C  CD   . PRO A 1 155 ? 43.847 -33.257 -25.195 1.00 110.78 ? 149  PRO A CD   1 
ATOM   884  N  N    . LEU A 1 156 ? 41.716 -36.794 -23.015 1.00 111.66 ? 150  LEU A N    1 
ATOM   885  C  CA   . LEU A 1 156 ? 41.349 -37.308 -21.699 1.00 109.98 ? 150  LEU A CA   1 
ATOM   886  C  C    . LEU A 1 156 ? 41.936 -38.698 -21.498 1.00 108.21 ? 150  LEU A C    1 
ATOM   887  O  O    . LEU A 1 156 ? 41.620 -39.623 -22.255 1.00 109.80 ? 150  LEU A O    1 
ATOM   888  C  CB   . LEU A 1 156 ? 39.828 -37.359 -21.551 1.00 111.04 ? 150  LEU A CB   1 
ATOM   889  C  CG   . LEU A 1 156 ? 39.275 -38.050 -20.307 1.00 106.71 ? 150  LEU A CG   1 
ATOM   890  C  CD1  . LEU A 1 156 ? 39.650 -37.293 -19.039 1.00 110.15 ? 150  LEU A CD1  1 
ATOM   891  C  CD2  . LEU A 1 156 ? 37.774 -38.220 -20.448 1.00 106.66 ? 150  LEU A CD2  1 
ATOM   892  N  N    . GLY A 1 157 ? 42.792 -38.842 -20.490 1.00 107.46 ? 151  GLY A N    1 
ATOM   893  C  CA   . GLY A 1 157 ? 43.195 -40.157 -20.020 1.00 104.09 ? 151  GLY A CA   1 
ATOM   894  C  C    . GLY A 1 157 ? 42.209 -40.672 -18.986 1.00 106.94 ? 151  GLY A C    1 
ATOM   895  O  O    . GLY A 1 157 ? 41.688 -39.912 -18.173 1.00 113.06 ? 151  GLY A O    1 
ATOM   896  N  N    . PHE A 1 158 ? 41.968 -41.979 -19.015 1.00 103.39 ? 152  PHE A N    1 
ATOM   897  C  CA   . PHE A 1 158 ? 40.894 -42.545 -18.210 1.00 108.98 ? 152  PHE A CA   1 
ATOM   898  C  C    . PHE A 1 158 ? 41.341 -43.868 -17.608 1.00 105.47 ? 152  PHE A C    1 
ATOM   899  O  O    . PHE A 1 158 ? 41.710 -44.793 -18.341 1.00 103.54 ? 152  PHE A O    1 
ATOM   900  C  CB   . PHE A 1 158 ? 39.640 -42.716 -19.071 1.00 110.54 ? 152  PHE A CB   1 
ATOM   901  C  CG   . PHE A 1 158 ? 38.447 -43.195 -18.317 1.00 112.36 ? 152  PHE A CG   1 
ATOM   902  C  CD1  . PHE A 1 158 ? 37.736 -42.328 -17.511 1.00 116.67 ? 152  PHE A CD1  1 
ATOM   903  C  CD2  . PHE A 1 158 ? 38.008 -44.497 -18.442 1.00 115.56 ? 152  PHE A CD2  1 
ATOM   904  C  CE1  . PHE A 1 158 ? 36.623 -42.756 -16.818 1.00 120.43 ? 152  PHE A CE1  1 
ATOM   905  C  CE2  . PHE A 1 158 ? 36.894 -44.934 -17.755 1.00 119.12 ? 152  PHE A CE2  1 
ATOM   906  C  CZ   . PHE A 1 158 ? 36.199 -44.061 -16.941 1.00 122.88 ? 152  PHE A CZ   1 
ATOM   907  N  N    . THR A 1 159 ? 41.297 -43.959 -16.280 1.00 107.05 ? 153  THR A N    1 
ATOM   908  C  CA   . THR A 1 159 ? 41.625 -45.176 -15.547 1.00 107.20 ? 153  THR A CA   1 
ATOM   909  C  C    . THR A 1 159 ? 40.390 -45.639 -14.782 1.00 111.63 ? 153  THR A C    1 
ATOM   910  O  O    . THR A 1 159 ? 39.662 -44.823 -14.211 1.00 118.42 ? 153  THR A O    1 
ATOM   911  C  CB   . THR A 1 159 ? 42.821 -44.956 -14.603 1.00 101.28 ? 153  THR A CB   1 
ATOM   912  O  OG1  . THR A 1 159 ? 43.198 -46.198 -14.005 1.00 94.73  ? 153  THR A OG1  1 
ATOM   913  C  CG2  . THR A 1 159 ? 42.491 -43.955 -13.526 1.00 107.66 ? 153  THR A CG2  1 
ATOM   914  N  N    . PHE A 1 160 ? 40.137 -46.947 -14.798 1.00 112.28 ? 154  PHE A N    1 
ATOM   915  C  CA   . PHE A 1 160 ? 38.832 -47.486 -14.426 1.00 118.49 ? 154  PHE A CA   1 
ATOM   916  C  C    . PHE A 1 160 ? 39.025 -48.711 -13.539 1.00 124.64 ? 154  PHE A C    1 
ATOM   917  O  O    . PHE A 1 160 ? 39.619 -49.702 -13.976 1.00 127.04 ? 154  PHE A O    1 
ATOM   918  C  CB   . PHE A 1 160 ? 38.052 -47.842 -15.692 1.00 117.41 ? 154  PHE A CB   1 
ATOM   919  C  CG   . PHE A 1 160 ? 36.639 -48.259 -15.450 1.00 121.49 ? 154  PHE A CG   1 
ATOM   920  C  CD1  . PHE A 1 160 ? 35.633 -47.313 -15.366 1.00 121.68 ? 154  PHE A CD1  1 
ATOM   921  C  CD2  . PHE A 1 160 ? 36.307 -49.594 -15.323 1.00 126.66 ? 154  PHE A CD2  1 
ATOM   922  C  CE1  . PHE A 1 160 ? 34.317 -47.692 -15.161 1.00 122.98 ? 154  PHE A CE1  1 
ATOM   923  C  CE2  . PHE A 1 160 ? 34.990 -49.979 -15.111 1.00 129.04 ? 154  PHE A CE2  1 
ATOM   924  C  CZ   . PHE A 1 160 ? 33.995 -49.025 -15.032 1.00 125.20 ? 154  PHE A CZ   1 
ATOM   925  N  N    . SER A 1 161 ? 38.498 -48.655 -12.310 1.00 124.97 ? 155  SER A N    1 
ATOM   926  C  CA   . SER A 1 161 ? 38.800 -49.680 -11.309 1.00 125.55 ? 155  SER A CA   1 
ATOM   927  C  C    . SER A 1 161 ? 38.170 -51.028 -11.657 1.00 124.71 ? 155  SER A C    1 
ATOM   928  O  O    . SER A 1 161 ? 38.853 -52.059 -11.659 1.00 120.90 ? 155  SER A O    1 
ATOM   929  C  CB   . SER A 1 161 ? 38.333 -49.213 -9.928  1.00 129.43 ? 155  SER A CB   1 
ATOM   930  N  N    . PHE A 1 162 ? 36.868 -51.041 -11.947 1.00 124.99 ? 156  PHE A N    1 
ATOM   931  C  CA   . PHE A 1 162 ? 36.132 -52.286 -12.150 1.00 124.57 ? 156  PHE A CA   1 
ATOM   932  C  C    . PHE A 1 162 ? 36.627 -53.051 -13.384 1.00 124.16 ? 156  PHE A C    1 
ATOM   933  O  O    . PHE A 1 162 ? 37.290 -52.486 -14.257 1.00 126.56 ? 156  PHE A O    1 
ATOM   934  C  CB   . PHE A 1 162 ? 34.641 -51.991 -12.288 1.00 123.47 ? 156  PHE A CB   1 
ATOM   935  N  N    . PRO A 1 163 ? 36.310 -54.343 -13.475 1.00 122.28 ? 157  PRO A N    1 
ATOM   936  C  CA   . PRO A 1 163 ? 36.767 -55.150 -14.616 1.00 120.34 ? 157  PRO A CA   1 
ATOM   937  C  C    . PRO A 1 163 ? 35.941 -54.911 -15.871 1.00 117.93 ? 157  PRO A C    1 
ATOM   938  O  O    . PRO A 1 163 ? 34.748 -54.604 -15.810 1.00 117.75 ? 157  PRO A O    1 
ATOM   939  C  CB   . PRO A 1 163 ? 36.584 -56.587 -14.116 1.00 115.16 ? 157  PRO A CB   1 
ATOM   940  C  CG   . PRO A 1 163 ? 35.429 -56.491 -13.167 1.00 114.66 ? 157  PRO A CG   1 
ATOM   941  C  CD   . PRO A 1 163 ? 35.554 -55.145 -12.495 1.00 119.22 ? 157  PRO A CD   1 
ATOM   942  N  N    . CYS A 1 164 ? 36.583 -55.092 -17.028 1.00 112.69 ? 158  CYS A N    1 
ATOM   943  C  CA   . CYS A 1 164 ? 35.928 -54.804 -18.301 1.00 113.29 ? 158  CYS A CA   1 
ATOM   944  C  C    . CYS A 1 164 ? 36.420 -55.760 -19.385 1.00 108.39 ? 158  CYS A C    1 
ATOM   945  O  O    . CYS A 1 164 ? 37.220 -56.667 -19.140 1.00 110.94 ? 158  CYS A O    1 
ATOM   946  C  CB   . CYS A 1 164 ? 36.167 -53.354 -18.736 1.00 113.46 ? 158  CYS A CB   1 
ATOM   947  S  SG   . CYS A 1 164 ? 35.434 -52.094 -17.670 1.00 114.25 ? 158  CYS A SG   1 
ATOM   948  N  N    . HIS A 1 165 ? 35.902 -55.548 -20.593 1.00 101.16 ? 159  HIS A N    1 
ATOM   949  C  CA   . HIS A 1 165 ? 36.398 -56.161 -21.822 1.00 105.10 ? 159  HIS A CA   1 
ATOM   950  C  C    . HIS A 1 165 ? 36.531 -55.043 -22.848 1.00 106.41 ? 159  HIS A C    1 
ATOM   951  O  O    . HIS A 1 165 ? 35.526 -54.424 -23.214 1.00 110.38 ? 159  HIS A O    1 
ATOM   952  C  CB   . HIS A 1 165 ? 35.435 -57.254 -22.304 1.00 101.86 ? 159  HIS A CB   1 
ATOM   953  C  CG   . HIS A 1 165 ? 35.788 -57.854 -23.631 1.00 104.01 ? 159  HIS A CG   1 
ATOM   954  N  ND1  . HIS A 1 165 ? 36.948 -58.568 -23.847 1.00 110.20 ? 159  HIS A ND1  1 
ATOM   955  C  CD2  . HIS A 1 165 ? 35.121 -57.856 -24.812 1.00 101.94 ? 159  HIS A CD2  1 
ATOM   956  C  CE1  . HIS A 1 165 ? 36.984 -58.975 -25.106 1.00 107.96 ? 159  HIS A CE1  1 
ATOM   957  N  NE2  . HIS A 1 165 ? 35.888 -58.556 -25.713 1.00 98.06  ? 159  HIS A NE2  1 
ATOM   958  N  N    . GLN A 1 166 ? 37.758 -54.754 -23.292 1.00 98.42  ? 160  GLN A N    1 
ATOM   959  C  CA   . GLN A 1 166 ? 37.988 -53.650 -24.217 1.00 96.20  ? 160  GLN A CA   1 
ATOM   960  C  C    . GLN A 1 166 ? 38.519 -54.156 -25.547 1.00 97.94  ? 160  GLN A C    1 
ATOM   961  O  O    . GLN A 1 166 ? 39.388 -55.037 -25.594 1.00 94.38  ? 160  GLN A O    1 
ATOM   962  C  CB   . GLN A 1 166 ? 38.951 -52.591 -23.660 1.00 97.07  ? 160  GLN A CB   1 
ATOM   963  C  CG   . GLN A 1 166 ? 40.366 -53.031 -23.355 1.00 93.75  ? 160  GLN A CG   1 
ATOM   964  C  CD   . GLN A 1 166 ? 41.244 -51.851 -22.939 1.00 90.82  ? 160  GLN A CD   1 
ATOM   965  O  OE1  . GLN A 1 166 ? 40.755 -50.741 -22.717 1.00 86.28  ? 160  GLN A OE1  1 
ATOM   966  N  NE2  . GLN A 1 166 ? 42.540 -52.101 -22.797 1.00 87.64  ? 160  GLN A NE2  1 
ATOM   967  N  N    . THR A 1 167 ? 37.959 -53.599 -26.623 1.00 97.91  ? 161  THR A N    1 
ATOM   968  C  CA   . THR A 1 167 ? 38.348 -53.904 -27.992 1.00 97.37  ? 161  THR A CA   1 
ATOM   969  C  C    . THR A 1 167 ? 39.287 -52.874 -28.627 1.00 92.05  ? 161  THR A C    1 
ATOM   970  O  O    . THR A 1 167 ? 39.768 -53.116 -29.739 1.00 90.62  ? 161  THR A O    1 
ATOM   971  C  CB   . THR A 1 167 ? 37.088 -54.042 -28.846 1.00 101.52 ? 161  THR A CB   1 
ATOM   972  O  OG1  . THR A 1 167 ? 36.350 -52.814 -28.795 1.00 102.58 ? 161  THR A OG1  1 
ATOM   973  C  CG2  . THR A 1 167 ? 36.216 -55.154 -28.288 1.00 96.21  ? 161  THR A CG2  1 
ATOM   974  N  N    . LYS A 1 168 ? 39.579 -51.760 -27.951 1.00 94.43  ? 162  LYS A N    1 
ATOM   975  C  CA   . LYS A 1 168 ? 40.427 -50.694 -28.483 1.00 91.91  ? 162  LYS A CA   1 
ATOM   976  C  C    . LYS A 1 168 ? 40.912 -49.854 -27.300 1.00 89.98  ? 162  LYS A C    1 
ATOM   977  O  O    . LYS A 1 168 ? 40.521 -50.099 -26.156 1.00 89.53  ? 162  LYS A O    1 
ATOM   978  C  CB   . LYS A 1 168 ? 39.656 -49.872 -29.530 1.00 96.04  ? 162  LYS A CB   1 
ATOM   979  C  CG   . LYS A 1 168 ? 39.379 -50.649 -30.839 1.00 100.57 ? 162  LYS A CG   1 
ATOM   980  C  CD   . LYS A 1 168 ? 38.218 -50.095 -31.674 1.00 98.25  ? 162  LYS A CD   1 
ATOM   981  C  CE   . LYS A 1 168 ? 38.478 -48.697 -32.200 1.00 104.45 ? 162  LYS A CE   1 
ATOM   982  N  NZ   . LYS A 1 168 ? 37.305 -48.194 -32.969 1.00 103.32 ? 162  LYS A NZ   1 
ATOM   983  N  N    . LEU A 1 169 ? 41.780 -48.863 -27.570 1.00 85.39  ? 163  LEU A N    1 
ATOM   984  C  CA   . LEU A 1 169 ? 42.149 -47.934 -26.501 1.00 84.09  ? 163  LEU A CA   1 
ATOM   985  C  C    . LEU A 1 169 ? 40.937 -47.209 -25.950 1.00 89.68  ? 163  LEU A C    1 
ATOM   986  O  O    . LEU A 1 169 ? 40.805 -47.059 -24.730 1.00 94.40  ? 163  LEU A O    1 
ATOM   987  C  CB   . LEU A 1 169 ? 43.202 -46.915 -26.936 1.00 83.45  ? 163  LEU A CB   1 
ATOM   988  C  CG   . LEU A 1 169 ? 44.658 -47.290 -26.689 1.00 77.29  ? 163  LEU A CG   1 
ATOM   989  C  CD1  . LEU A 1 169 ? 45.621 -46.216 -27.187 1.00 72.47  ? 163  LEU A CD1  1 
ATOM   990  C  CD2  . LEU A 1 169 ? 44.813 -47.458 -25.199 1.00 75.99  ? 163  LEU A CD2  1 
ATOM   991  N  N    . ASP A 1 170 ? 40.047 -46.738 -26.816 1.00 89.99  ? 164  ASP A N    1 
ATOM   992  C  CA   . ASP A 1 170 ? 38.752 -46.249 -26.359 1.00 95.55  ? 164  ASP A CA   1 
ATOM   993  C  C    . ASP A 1 170 ? 37.696 -47.274 -26.759 1.00 100.93 ? 164  ASP A C    1 
ATOM   994  O  O    . ASP A 1 170 ? 37.209 -47.267 -27.891 1.00 110.23 ? 164  ASP A O    1 
ATOM   995  C  CB   . ASP A 1 170 ? 38.452 -44.868 -26.945 1.00 102.17 ? 164  ASP A CB   1 
ATOM   996  C  CG   . ASP A 1 170 ? 38.495 -44.835 -28.489 1.00 106.62 ? 164  ASP A CG   1 
ATOM   997  O  OD1  . ASP A 1 170 ? 38.958 -45.810 -29.131 1.00 99.98  ? 164  ASP A OD1  1 
ATOM   998  O  OD2  . ASP A 1 170 ? 38.036 -43.822 -29.065 1.00 104.17 ? 164  ASP A OD2  1 
ATOM   999  N  N    . GLU A 1 171 ? 37.335 -48.143 -25.815 1.00 103.13 ? 165  GLU A N    1 
ATOM   1000 C  CA   . GLU A 1 171 ? 36.103 -48.920 -25.857 1.00 107.56 ? 165  GLU A CA   1 
ATOM   1001 C  C    . GLU A 1 171 ? 36.179 -49.957 -24.740 1.00 110.78 ? 165  GLU A C    1 
ATOM   1002 O  O    . GLU A 1 171 ? 37.264 -50.472 -24.459 1.00 110.32 ? 165  GLU A O    1 
ATOM   1003 C  CB   . GLU A 1 171 ? 35.945 -49.551 -27.242 1.00 107.09 ? 165  GLU A CB   1 
ATOM   1004 C  CG   . GLU A 1 171 ? 34.563 -50.047 -27.618 1.00 111.91 ? 165  GLU A CG   1 
ATOM   1005 C  CD   . GLU A 1 171 ? 34.473 -50.367 -29.116 1.00 106.79 ? 165  GLU A CD   1 
ATOM   1006 O  OE1  . GLU A 1 171 ? 35.522 -50.341 -29.796 1.00 103.57 ? 165  GLU A OE1  1 
ATOM   1007 O  OE2  . GLU A 1 171 ? 33.354 -50.585 -29.626 1.00 98.45  ? 165  GLU A OE2  1 
ATOM   1008 N  N    . SER A 1 172 ? 35.038 -50.354 -24.178 1.00 117.21 ? 166  SER A N    1 
ATOM   1009 C  CA   . SER A 1 172 ? 34.989 -51.229 -23.002 1.00 115.78 ? 166  SER A CA   1 
ATOM   1010 C  C    . SER A 1 172 ? 33.549 -51.406 -22.535 1.00 122.06 ? 166  SER A C    1 
ATOM   1011 O  O    . SER A 1 172 ? 32.668 -50.635 -22.922 1.00 128.33 ? 166  SER A O    1 
ATOM   1012 C  CB   . SER A 1 172 ? 35.823 -50.680 -21.834 1.00 110.75 ? 166  SER A CB   1 
ATOM   1013 O  OG   . SER A 1 172 ? 37.216 -50.758 -22.061 1.00 105.92 ? 166  SER A OG   1 
ATOM   1014 N  N    . PHE A 1 173 ? 33.286 -52.415 -21.712 1.00 119.61 ? 167  PHE A N    1 
ATOM   1015 C  CA   . PHE A 1 173 ? 32.003 -52.484 -21.030 1.00 121.19 ? 167  PHE A CA   1 
ATOM   1016 C  C    . PHE A 1 173 ? 32.185 -53.230 -19.719 1.00 114.74 ? 167  PHE A C    1 
ATOM   1017 O  O    . PHE A 1 173 ? 32.896 -54.236 -19.670 1.00 115.91 ? 167  PHE A O    1 
ATOM   1018 C  CB   . PHE A 1 173 ? 30.946 -53.169 -21.899 1.00 126.29 ? 167  PHE A CB   1 
ATOM   1019 N  N    . LEU A 1 174 ? 31.516 -52.753 -18.672 1.00 115.50 ? 168  LEU A N    1 
ATOM   1020 C  CA   . LEU A 1 174 ? 31.693 -53.342 -17.351 1.00 113.30 ? 168  LEU A CA   1 
ATOM   1021 C  C    . LEU A 1 174 ? 30.959 -54.674 -17.262 1.00 117.86 ? 168  LEU A C    1 
ATOM   1022 O  O    . LEU A 1 174 ? 29.901 -54.862 -17.872 1.00 122.28 ? 168  LEU A O    1 
ATOM   1023 C  CB   . LEU A 1 174 ? 31.188 -52.394 -16.264 1.00 104.49 ? 168  LEU A CB   1 
ATOM   1024 N  N    . VAL A 1 175 ? 31.579 -55.636 -16.580 1.00 115.48 ? 169  VAL A N    1 
ATOM   1025 C  CA   . VAL A 1 175 ? 30.892 -56.832 -16.109 1.00 108.65 ? 169  VAL A CA   1 
ATOM   1026 C  C    . VAL A 1 175 ? 30.557 -56.816 -14.605 1.00 104.91 ? 169  VAL A C    1 
ATOM   1027 O  O    . VAL A 1 175 ? 30.071 -57.831 -14.095 1.00 96.34  ? 169  VAL A O    1 
ATOM   1028 C  CB   . VAL A 1 175 ? 31.706 -58.082 -16.481 1.00 97.51  ? 169  VAL A CB   1 
ATOM   1029 N  N    . SER A 1 176 ? 30.828 -55.734 -13.863 1.00 97.33  ? 170  SER A N    1 
ATOM   1030 C  CA   . SER A 1 176 ? 30.475 -55.773 -12.431 1.00 100.93 ? 170  SER A CA   1 
ATOM   1031 C  C    . SER A 1 176 ? 30.629 -54.473 -11.619 1.00 99.26  ? 170  SER A C    1 
ATOM   1032 O  O    . SER A 1 176 ? 30.571 -54.495 -10.371 1.00 66.32  ? 170  SER A O    1 
ATOM   1033 C  CB   . SER A 1 176 ? 31.281 -56.878 -11.747 1.00 101.18 ? 170  SER A CB   1 
ATOM   1034 N  N    . GLY A 1 188 ? 26.088 -51.151 -17.735 1.00 92.30  ? 182  GLY A N    1 
ATOM   1035 C  CA   . GLY A 1 188 ? 27.062 -52.135 -18.173 1.00 102.35 ? 182  GLY A CA   1 
ATOM   1036 C  C    . GLY A 1 188 ? 27.065 -52.401 -19.674 1.00 114.16 ? 182  GLY A C    1 
ATOM   1037 O  O    . GLY A 1 188 ? 27.026 -53.556 -20.106 1.00 113.08 ? 182  GLY A O    1 
ATOM   1038 N  N    . ARG A 1 189 ? 27.126 -51.333 -20.476 1.00 120.39 ? 183  ARG A N    1 
ATOM   1039 C  CA   . ARG A 1 189 ? 27.075 -51.448 -21.934 1.00 123.40 ? 183  ARG A CA   1 
ATOM   1040 C  C    . ARG A 1 189 ? 28.345 -50.944 -22.614 1.00 126.64 ? 183  ARG A C    1 
ATOM   1041 O  O    . ARG A 1 189 ? 29.036 -51.732 -23.265 1.00 127.00 ? 183  ARG A O    1 
ATOM   1042 C  CB   . ARG A 1 189 ? 25.843 -50.706 -22.482 1.00 117.75 ? 183  ARG A CB   1 
ATOM   1043 N  N    . ASP A 1 190 ? 28.673 -49.654 -22.502 1.00 131.22 ? 184  ASP A N    1 
ATOM   1044 C  CA   . ASP A 1 190 ? 29.651 -49.043 -23.403 1.00 131.45 ? 184  ASP A CA   1 
ATOM   1045 C  C    . ASP A 1 190 ? 30.779 -48.291 -22.691 1.00 130.78 ? 184  ASP A C    1 
ATOM   1046 O  O    . ASP A 1 190 ? 31.931 -48.397 -23.119 1.00 129.08 ? 184  ASP A O    1 
ATOM   1047 C  CB   . ASP A 1 190 ? 28.973 -48.128 -24.421 1.00 133.20 ? 184  ASP A CB   1 
ATOM   1048 C  CG   . ASP A 1 190 ? 29.915 -47.733 -25.549 1.00 136.19 ? 184  ASP A CG   1 
ATOM   1049 O  OD1  . ASP A 1 190 ? 31.106 -48.132 -25.511 1.00 132.44 ? 184  ASP A OD1  1 
ATOM   1050 O  OD2  . ASP A 1 190 ? 29.458 -47.047 -26.487 1.00 140.17 ? 184  ASP A OD2  1 
ATOM   1051 N  N    . VAL A 1 191 ? 30.454 -47.425 -21.720 1.00 132.61 ? 185  VAL A N    1 
ATOM   1052 C  CA   . VAL A 1 191 ? 31.408 -46.535 -21.040 1.00 129.48 ? 185  VAL A CA   1 
ATOM   1053 C  C    . VAL A 1 191 ? 32.014 -45.543 -22.032 1.00 130.75 ? 185  VAL A C    1 
ATOM   1054 O  O    . VAL A 1 191 ? 31.361 -44.554 -22.382 1.00 134.89 ? 185  VAL A O    1 
ATOM   1055 C  CB   . VAL A 1 191 ? 32.489 -47.295 -20.228 1.00 124.39 ? 185  VAL A CB   1 
ATOM   1056 C  CG1  . VAL A 1 191 ? 31.837 -48.130 -19.141 1.00 126.41 ? 185  VAL A CG1  1 
ATOM   1057 C  CG2  . VAL A 1 191 ? 33.418 -48.157 -21.071 1.00 127.11 ? 185  VAL A CG2  1 
ATOM   1058 N  N    . VAL A 1 192 ? 33.266 -45.751 -22.450 1.00 128.91 ? 186  VAL A N    1 
ATOM   1059 C  CA   . VAL A 1 192 ? 34.081 -44.733 -23.117 1.00 128.02 ? 186  VAL A CA   1 
ATOM   1060 C  C    . VAL A 1 192 ? 33.253 -43.894 -24.085 1.00 128.02 ? 186  VAL A C    1 
ATOM   1061 O  O    . VAL A 1 192 ? 33.459 -42.680 -24.196 1.00 127.90 ? 186  VAL A O    1 
ATOM   1062 C  CB   . VAL A 1 192 ? 35.263 -45.385 -23.865 1.00 121.72 ? 186  VAL A CB   1 
ATOM   1063 C  CG1  . VAL A 1 192 ? 34.751 -46.286 -24.984 1.00 122.45 ? 186  VAL A CG1  1 
ATOM   1064 C  CG2  . VAL A 1 192 ? 36.198 -44.327 -24.431 1.00 114.83 ? 186  VAL A CG2  1 
ATOM   1065 N  N    . ALA A 1 193 ? 32.316 -44.520 -24.798 1.00 129.06 ? 187  ALA A N    1 
ATOM   1066 C  CA   . ALA A 1 193 ? 31.394 -43.736 -25.612 1.00 131.03 ? 187  ALA A CA   1 
ATOM   1067 C  C    . ALA A 1 193 ? 30.271 -43.119 -24.781 1.00 133.88 ? 187  ALA A C    1 
ATOM   1068 O  O    . ALA A 1 193 ? 29.788 -42.030 -25.116 1.00 135.72 ? 187  ALA A O    1 
ATOM   1069 C  CB   . ALA A 1 193 ? 30.811 -44.597 -26.733 1.00 129.56 ? 187  ALA A CB   1 
ATOM   1070 N  N    . LEU A 1 194 ? 29.856 -43.781 -23.695 1.00 133.47 ? 188  LEU A N    1 
ATOM   1071 C  CA   . LEU A 1 194 ? 28.721 -43.294 -22.913 1.00 131.72 ? 188  LEU A CA   1 
ATOM   1072 C  C    . LEU A 1 194 ? 29.090 -42.060 -22.091 1.00 135.39 ? 188  LEU A C    1 
ATOM   1073 O  O    . LEU A 1 194 ? 28.247 -41.179 -21.881 1.00 139.05 ? 188  LEU A O    1 
ATOM   1074 C  CB   . LEU A 1 194 ? 28.187 -44.411 -22.015 1.00 124.89 ? 188  LEU A CB   1 
ATOM   1075 N  N    . ILE A 1 195 ? 30.339 -41.974 -21.616 1.00 133.47 ? 189  ILE A N    1 
ATOM   1076 C  CA   . ILE A 1 195 ? 30.793 -40.770 -20.923 1.00 133.77 ? 189  ILE A CA   1 
ATOM   1077 C  C    . ILE A 1 195 ? 30.844 -39.573 -21.863 1.00 135.00 ? 189  ILE A C    1 
ATOM   1078 O  O    . ILE A 1 195 ? 30.901 -38.426 -21.405 1.00 132.74 ? 189  ILE A O    1 
ATOM   1079 C  CB   . ILE A 1 195 ? 32.172 -41.004 -20.270 1.00 125.41 ? 189  ILE A CB   1 
ATOM   1080 N  N    . ARG A 1 196 ? 30.840 -39.817 -23.178 1.00 135.39 ? 190  ARG A N    1 
ATOM   1081 C  CA   . ARG A 1 196 ? 30.894 -38.743 -24.167 1.00 135.10 ? 190  ARG A CA   1 
ATOM   1082 C  C    . ARG A 1 196 ? 29.533 -38.088 -24.390 1.00 137.75 ? 190  ARG A C    1 
ATOM   1083 O  O    . ARG A 1 196 ? 29.426 -36.856 -24.392 1.00 139.09 ? 190  ARG A O    1 
ATOM   1084 C  CB   . ARG A 1 196 ? 31.442 -39.282 -25.487 1.00 129.13 ? 190  ARG A CB   1 
ATOM   1085 C  CG   . ARG A 1 196 ? 32.911 -39.644 -25.463 1.00 122.27 ? 190  ARG A CG   1 
ATOM   1086 C  CD   . ARG A 1 196 ? 33.322 -40.142 -26.828 1.00 123.38 ? 190  ARG A CD   1 
ATOM   1087 N  NE   . ARG A 1 196 ? 34.743 -40.451 -26.917 1.00 121.87 ? 190  ARG A NE   1 
ATOM   1088 C  CZ   . ARG A 1 196 ? 35.306 -41.033 -27.972 1.00 117.85 ? 190  ARG A CZ   1 
ATOM   1089 N  NH1  . ARG A 1 196 ? 34.560 -41.382 -29.011 1.00 112.36 ? 190  ARG A NH1  1 
ATOM   1090 N  NH2  . ARG A 1 196 ? 36.610 -41.276 -27.985 1.00 116.61 ? 190  ARG A NH2  1 
ATOM   1091 N  N    . LYS A 1 197 ? 28.483 -38.890 -24.597 1.00 138.17 ? 191  LYS A N    1 
ATOM   1092 C  CA   . LYS A 1 197 ? 27.166 -38.306 -24.837 1.00 140.96 ? 191  LYS A CA   1 
ATOM   1093 C  C    . LYS A 1 197 ? 26.665 -37.523 -23.632 1.00 141.48 ? 191  LYS A C    1 
ATOM   1094 O  O    . LYS A 1 197 ? 25.711 -36.748 -23.761 1.00 142.50 ? 191  LYS A O    1 
ATOM   1095 C  CB   . LYS A 1 197 ? 26.155 -39.387 -25.237 1.00 139.91 ? 191  LYS A CB   1 
ATOM   1096 C  CG   . LYS A 1 197 ? 26.511 -40.115 -26.532 1.00 135.81 ? 191  LYS A CG   1 
ATOM   1097 C  CD   . LYS A 1 197 ? 26.709 -39.137 -27.695 1.00 137.32 ? 191  LYS A CD   1 
ATOM   1098 C  CE   . LYS A 1 197 ? 25.391 -38.545 -28.191 1.00 138.15 ? 191  LYS A CE   1 
ATOM   1099 N  NZ   . LYS A 1 197 ? 25.567 -37.702 -29.414 1.00 126.02 ? 191  LYS A NZ   1 
ATOM   1100 N  N    . ALA A 1 198 ? 27.291 -37.709 -22.466 1.00 140.93 ? 192  ALA A N    1 
ATOM   1101 C  CA   . ALA A 1 198 ? 27.127 -36.778 -21.359 1.00 141.49 ? 192  ALA A CA   1 
ATOM   1102 C  C    . ALA A 1 198 ? 27.719 -35.406 -21.664 1.00 142.35 ? 192  ALA A C    1 
ATOM   1103 O  O    . ALA A 1 198 ? 27.543 -34.482 -20.862 1.00 143.28 ? 192  ALA A O    1 
ATOM   1104 C  CB   . ALA A 1 198 ? 27.760 -37.352 -20.089 1.00 138.35 ? 192  ALA A CB   1 
ATOM   1105 N  N    . ILE A 1 199 ? 28.417 -35.253 -22.792 1.00 141.04 ? 193  ILE A N    1 
ATOM   1106 C  CA   . ILE A 1 199 ? 28.980 -33.964 -23.177 1.00 139.96 ? 193  ILE A CA   1 
ATOM   1107 C  C    . ILE A 1 199 ? 27.889 -33.095 -23.793 1.00 144.13 ? 193  ILE A C    1 
ATOM   1108 O  O    . ILE A 1 199 ? 27.347 -33.424 -24.856 1.00 141.82 ? 193  ILE A O    1 
ATOM   1109 C  CB   . ILE A 1 199 ? 30.137 -34.154 -24.155 1.00 131.97 ? 193  ILE A CB   1 
ATOM   1110 N  N    . GLN A 1 200 ? 27.602 -31.968 -23.139 1.00 146.68 ? 194  GLN A N    1 
ATOM   1111 C  CA   . GLN A 1 200 ? 26.519 -31.057 -23.514 1.00 141.38 ? 194  GLN A CA   1 
ATOM   1112 C  C    . GLN A 1 200 ? 25.228 -31.820 -23.821 1.00 141.02 ? 194  GLN A C    1 
ATOM   1113 O  O    . GLN A 1 200 ? 24.827 -32.718 -23.074 1.00 138.80 ? 194  GLN A O    1 
ATOM   1114 C  CB   . GLN A 1 200 ? 26.923 -30.194 -24.716 1.00 136.02 ? 194  GLN A CB   1 
ATOM   1115 C  CG   . GLN A 1 200 ? 28.115 -29.257 -24.477 1.00 132.40 ? 194  GLN A CG   1 
ATOM   1116 C  CD   . GLN A 1 200 ? 27.903 -28.284 -23.327 1.00 129.53 ? 194  GLN A CD   1 
ATOM   1117 O  OE1  . GLN A 1 200 ? 26.792 -27.810 -23.095 1.00 131.03 ? 194  GLN A OE1  1 
ATOM   1118 N  NE2  . GLN A 1 200 ? 28.981 -27.965 -22.615 1.00 123.89 ? 194  GLN A NE2  1 
ATOM   1119 N  N    . ILE A 1 207 ? 34.214 -31.814 -24.814 1.00 106.46 ? 201  ILE A N    1 
ATOM   1120 C  CA   . ILE A 1 207 ? 35.416 -31.921 -25.631 1.00 115.25 ? 201  ILE A CA   1 
ATOM   1121 C  C    . ILE A 1 207 ? 36.384 -32.976 -25.078 1.00 117.46 ? 201  ILE A C    1 
ATOM   1122 O  O    . ILE A 1 207 ? 36.801 -32.901 -23.922 1.00 114.10 ? 201  ILE A O    1 
ATOM   1123 C  CB   . ILE A 1 207 ? 36.101 -30.565 -25.729 1.00 115.05 ? 201  ILE A CB   1 
ATOM   1124 N  N    . ASP A 1 208 ? 36.721 -33.978 -25.890 1.00 119.08 ? 202  ASP A N    1 
ATOM   1125 C  CA   . ASP A 1 208 ? 37.694 -34.969 -25.451 1.00 116.36 ? 202  ASP A CA   1 
ATOM   1126 C  C    . ASP A 1 208 ? 38.270 -35.728 -26.644 1.00 114.48 ? 202  ASP A C    1 
ATOM   1127 O  O    . ASP A 1 208 ? 37.693 -35.755 -27.735 1.00 108.92 ? 202  ASP A O    1 
ATOM   1128 C  CB   . ASP A 1 208 ? 37.066 -35.940 -24.439 1.00 111.55 ? 202  ASP A CB   1 
ATOM   1129 N  N    . ILE A 1 209 ? 39.441 -36.322 -26.409 1.00 114.11 ? 203  ILE A N    1 
ATOM   1130 C  CA   . ILE A 1 209 ? 40.010 -37.421 -27.187 1.00 111.88 ? 203  ILE A CA   1 
ATOM   1131 C  C    . ILE A 1 209 ? 40.587 -38.384 -26.155 1.00 113.23 ? 203  ILE A C    1 
ATOM   1132 O  O    . ILE A 1 209 ? 41.422 -37.979 -25.339 1.00 112.25 ? 203  ILE A O    1 
ATOM   1133 C  CB   . ILE A 1 209 ? 41.114 -36.950 -28.150 1.00 116.92 ? 203  ILE A CB   1 
ATOM   1134 C  CG1  . ILE A 1 209 ? 40.600 -35.853 -29.084 1.00 115.89 ? 203  ILE A CG1  1 
ATOM   1135 C  CG2  . ILE A 1 209 ? 41.672 -38.128 -28.946 1.00 117.53 ? 203  ILE A CG2  1 
ATOM   1136 C  CD1  . ILE A 1 209 ? 40.961 -34.456 -28.617 1.00 111.70 ? 203  ILE A CD1  1 
ATOM   1137 N  N    . VAL A 1 210 ? 40.149 -39.645 -26.164 1.00 111.91 ? 204  VAL A N    1 
ATOM   1138 C  CA   . VAL A 1 210 ? 40.253 -40.453 -24.951 1.00 107.99 ? 204  VAL A CA   1 
ATOM   1139 C  C    . VAL A 1 210 ? 40.805 -41.854 -25.219 1.00 103.37 ? 204  VAL A C    1 
ATOM   1140 O  O    . VAL A 1 210 ? 40.704 -42.389 -26.328 1.00 102.95 ? 204  VAL A O    1 
ATOM   1141 C  CB   . VAL A 1 210 ? 38.874 -40.517 -24.239 1.00 105.12 ? 204  VAL A CB   1 
ATOM   1142 C  CG1  . VAL A 1 210 ? 37.829 -41.148 -25.134 1.00 109.38 ? 204  VAL A CG1  1 
ATOM   1143 C  CG2  . VAL A 1 210 ? 38.970 -41.265 -22.939 1.00 105.69 ? 204  VAL A CG2  1 
ATOM   1144 N  N    . ALA A 1 211 ? 41.429 -42.425 -24.181 1.00 98.89  ? 205  ALA A N    1 
ATOM   1145 C  CA   . ALA A 1 211 ? 41.785 -43.839 -24.093 1.00 97.88  ? 205  ALA A CA   1 
ATOM   1146 C  C    . ALA A 1 211 ? 41.618 -44.297 -22.643 1.00 97.96  ? 205  ALA A C    1 
ATOM   1147 O  O    . ALA A 1 211 ? 41.631 -43.487 -21.712 1.00 98.20  ? 205  ALA A O    1 
ATOM   1148 C  CB   . ALA A 1 211 ? 43.215 -44.108 -24.584 1.00 92.92  ? 205  ALA A CB   1 
ATOM   1149 N  N    . VAL A 1 212 ? 41.454 -45.610 -22.450 1.00 92.74  ? 206  VAL A N    1 
ATOM   1150 C  CA   . VAL A 1 212 ? 41.128 -46.187 -21.146 1.00 92.96  ? 206  VAL A CA   1 
ATOM   1151 C  C    . VAL A 1 212 ? 42.135 -47.279 -20.812 1.00 87.44  ? 206  VAL A C    1 
ATOM   1152 O  O    . VAL A 1 212 ? 42.360 -48.190 -21.615 1.00 84.51  ? 206  VAL A O    1 
ATOM   1153 C  CB   . VAL A 1 212 ? 39.699 -46.758 -21.114 1.00 98.23  ? 206  VAL A CB   1 
ATOM   1154 C  CG1  . VAL A 1 212 ? 39.465 -47.505 -19.821 1.00 92.38  ? 206  VAL A CG1  1 
ATOM   1155 C  CG2  . VAL A 1 212 ? 38.678 -45.639 -21.282 1.00 103.68 ? 206  VAL A CG2  1 
ATOM   1156 N  N    . VAL A 1 213 ? 42.716 -47.210 -19.616 1.00 85.84  ? 207  VAL A N    1 
ATOM   1157 C  CA   . VAL A 1 213 ? 43.872 -48.038 -19.306 1.00 84.20  ? 207  VAL A CA   1 
ATOM   1158 C  C    . VAL A 1 213 ? 43.830 -48.548 -17.864 1.00 79.87  ? 207  VAL A C    1 
ATOM   1159 O  O    . VAL A 1 213 ? 43.311 -47.889 -16.959 1.00 82.64  ? 207  VAL A O    1 
ATOM   1160 C  CB   . VAL A 1 213 ? 45.171 -47.255 -19.614 1.00 80.09  ? 207  VAL A CB   1 
ATOM   1161 C  CG1  . VAL A 1 213 ? 45.232 -45.980 -18.801 1.00 80.74  ? 207  VAL A CG1  1 
ATOM   1162 C  CG2  . VAL A 1 213 ? 46.404 -48.134 -19.398 1.00 77.63  ? 207  VAL A CG2  1 
ATOM   1163 N  N    . ASN A 1 214 ? 44.360 -49.759 -17.674 1.00 73.92  ? 208  ASN A N    1 
ATOM   1164 C  CA   . ASN A 1 214 ? 44.502 -50.374 -16.361 1.00 66.40  ? 208  ASN A CA   1 
ATOM   1165 C  C    . ASN A 1 214 ? 45.534 -49.630 -15.527 1.00 68.73  ? 208  ASN A C    1 
ATOM   1166 O  O    . ASN A 1 214 ? 46.483 -49.042 -16.052 1.00 72.42  ? 208  ASN A O    1 
ATOM   1167 C  CB   . ASN A 1 214 ? 44.951 -51.824 -16.499 1.00 61.71  ? 208  ASN A CB   1 
ATOM   1168 C  CG   . ASN A 1 214 ? 44.845 -52.589 -15.208 1.00 62.23  ? 208  ASN A CG   1 
ATOM   1169 O  OD1  . ASN A 1 214 ? 43.881 -52.427 -14.473 1.00 72.56  ? 208  ASN A OD1  1 
ATOM   1170 N  ND2  . ASN A 1 214 ? 45.855 -53.391 -14.897 1.00 56.02  ? 208  ASN A ND2  1 
ATOM   1171 N  N    . ASP A 1 215 ? 45.372 -49.690 -14.206 1.00 66.39  ? 209  ASP A N    1 
ATOM   1172 C  CA   . ASP A 1 215 ? 46.303 -48.969 -13.353 1.00 65.71  ? 209  ASP A CA   1 
ATOM   1173 C  C    . ASP A 1 215 ? 47.698 -49.572 -13.398 1.00 63.81  ? 209  ASP A C    1 
ATOM   1174 O  O    . ASP A 1 215 ? 48.662 -48.885 -13.058 1.00 66.96  ? 209  ASP A O    1 
ATOM   1175 C  CB   . ASP A 1 215 ? 45.796 -48.903 -11.902 1.00 71.51  ? 209  ASP A CB   1 
ATOM   1176 C  CG   . ASP A 1 215 ? 45.715 -50.268 -11.223 1.00 68.25  ? 209  ASP A CG   1 
ATOM   1177 O  OD1  . ASP A 1 215 ? 45.851 -51.300 -11.912 1.00 69.27  ? 209  ASP A OD1  1 
ATOM   1178 O  OD2  . ASP A 1 215 ? 45.547 -50.305 -9.978  1.00 69.77  ? 209  ASP A OD2  1 
ATOM   1179 N  N    . THR A 1 216 ? 47.841 -50.830 -13.813 1.00 63.12  ? 210  THR A N    1 
ATOM   1180 C  CA   . THR A 1 216 ? 49.186 -51.373 -13.949 1.00 60.54  ? 210  THR A CA   1 
ATOM   1181 C  C    . THR A 1 216 ? 49.878 -50.834 -15.197 1.00 67.56  ? 210  THR A C    1 
ATOM   1182 O  O    . THR A 1 216 ? 51.104 -50.672 -15.207 1.00 70.66  ? 210  THR A O    1 
ATOM   1183 C  CB   . THR A 1 216 ? 49.159 -52.899 -13.987 1.00 62.68  ? 210  THR A CB   1 
ATOM   1184 O  OG1  . THR A 1 216 ? 50.497 -53.386 -13.843 1.00 66.19  ? 210  THR A OG1  1 
ATOM   1185 C  CG2  . THR A 1 216 ? 48.643 -53.392 -15.318 1.00 61.02  ? 210  THR A CG2  1 
ATOM   1186 N  N    . VAL A 1 217 ? 49.119 -50.557 -16.256 1.00 65.97  ? 211  VAL A N    1 
ATOM   1187 C  CA   . VAL A 1 217 ? 49.705 -49.969 -17.450 1.00 60.89  ? 211  VAL A CA   1 
ATOM   1188 C  C    . VAL A 1 217 ? 50.069 -48.516 -17.187 1.00 64.61  ? 211  VAL A C    1 
ATOM   1189 O  O    . VAL A 1 217 ? 51.145 -48.049 -17.580 1.00 65.34  ? 211  VAL A O    1 
ATOM   1190 C  CB   . VAL A 1 217 ? 48.732 -50.124 -18.636 1.00 62.57  ? 211  VAL A CB   1 
ATOM   1191 C  CG1  . VAL A 1 217 ? 49.274 -49.463 -19.889 1.00 63.57  ? 211  VAL A CG1  1 
ATOM   1192 C  CG2  . VAL A 1 217 ? 48.466 -51.587 -18.887 1.00 61.41  ? 211  VAL A CG2  1 
ATOM   1193 N  N    . GLY A 1 218 ? 49.192 -47.781 -16.502 1.00 63.57  ? 212  GLY A N    1 
ATOM   1194 C  CA   . GLY A 1 218 ? 49.529 -46.416 -16.132 1.00 67.47  ? 212  GLY A CA   1 
ATOM   1195 C  C    . GLY A 1 218 ? 50.810 -46.333 -15.322 1.00 68.49  ? 212  GLY A C    1 
ATOM   1196 O  O    . GLY A 1 218 ? 51.575 -45.375 -15.444 1.00 70.51  ? 212  GLY A O    1 
ATOM   1197 N  N    . THR A 1 219 ? 51.063 -47.334 -14.482 1.00 64.31  ? 213  THR A N    1 
ATOM   1198 C  CA   . THR A 1 219 ? 52.311 -47.355 -13.730 1.00 70.20  ? 213  THR A CA   1 
ATOM   1199 C  C    . THR A 1 219 ? 53.498 -47.555 -14.663 1.00 64.90  ? 213  THR A C    1 
ATOM   1200 O  O    . THR A 1 219 ? 54.458 -46.780 -14.628 1.00 69.56  ? 213  THR A O    1 
ATOM   1201 C  CB   . THR A 1 219 ? 52.254 -48.432 -12.631 1.00 62.68  ? 213  THR A CB   1 
ATOM   1202 O  OG1  . THR A 1 219 ? 51.275 -48.043 -11.671 1.00 60.65  ? 213  THR A OG1  1 
ATOM   1203 C  CG2  . THR A 1 219 ? 53.598 -48.622 -11.930 1.00 56.49  ? 213  THR A CG2  1 
ATOM   1204 N  N    . MET A 1 220 ? 53.442 -48.566 -15.529 1.00 67.74  ? 214  MET A N    1 
ATOM   1205 C  CA   . MET A 1 220 ? 54.547 -48.771 -16.467 1.00 68.95  ? 214  MET A CA   1 
ATOM   1206 C  C    . MET A 1 220 ? 54.834 -47.505 -17.274 1.00 63.31  ? 214  MET A C    1 
ATOM   1207 O  O    . MET A 1 220 ? 55.996 -47.143 -17.471 1.00 63.41  ? 214  MET A O    1 
ATOM   1208 C  CB   . MET A 1 220 ? 54.246 -49.940 -17.401 1.00 61.67  ? 214  MET A CB   1 
ATOM   1209 C  CG   . MET A 1 220 ? 55.339 -50.210 -18.410 1.00 67.87  ? 214  MET A CG   1 
ATOM   1210 S  SD   . MET A 1 220 ? 54.853 -51.395 -19.684 1.00 58.69  ? 214  MET A SD   1 
ATOM   1211 C  CE   . MET A 1 220 ? 53.555 -50.394 -20.424 1.00 52.58  ? 214  MET A CE   1 
ATOM   1212 N  N    . MET A 1 221 ? 53.786 -46.786 -17.691 1.00 61.14  ? 215  MET A N    1 
ATOM   1213 C  CA   . MET A 1 221 ? 53.962 -45.670 -18.623 1.00 66.95  ? 215  MET A CA   1 
ATOM   1214 C  C    . MET A 1 221 ? 54.619 -44.442 -17.984 1.00 73.86  ? 215  MET A C    1 
ATOM   1215 O  O    . MET A 1 221 ? 55.396 -43.750 -18.662 1.00 71.57  ? 215  MET A O    1 
ATOM   1216 C  CB   . MET A 1 221 ? 52.615 -45.289 -19.252 1.00 64.91  ? 215  MET A CB   1 
ATOM   1217 C  CG   . MET A 1 221 ? 52.035 -46.373 -20.191 1.00 69.52  ? 215  MET A CG   1 
ATOM   1218 S  SD   . MET A 1 221 ? 52.964 -46.752 -21.716 1.00 66.66  ? 215  MET A SD   1 
ATOM   1219 C  CE   . MET A 1 221 ? 52.610 -45.269 -22.656 1.00 62.39  ? 215  MET A CE   1 
ATOM   1220 N  N    . THR A 1 222 ? 54.328 -44.137 -16.707 1.00 68.87  ? 216  THR A N    1 
ATOM   1221 C  CA   . THR A 1 222 ? 54.989 -42.993 -16.076 1.00 65.90  ? 216  THR A CA   1 
ATOM   1222 C  C    . THR A 1 222 ? 56.431 -43.310 -15.707 1.00 66.98  ? 216  THR A C    1 
ATOM   1223 O  O    . THR A 1 222 ? 57.299 -42.437 -15.787 1.00 69.17  ? 216  THR A O    1 
ATOM   1224 C  CB   . THR A 1 222 ? 54.232 -42.522 -14.839 1.00 69.15  ? 216  THR A CB   1 
ATOM   1225 O  OG1  . THR A 1 222 ? 54.113 -43.604 -13.914 1.00 77.87  ? 216  THR A OG1  1 
ATOM   1226 C  CG2  . THR A 1 222 ? 52.853 -42.009 -15.214 1.00 76.60  ? 216  THR A CG2  1 
ATOM   1227 N  N    . CYS A 1 223 ? 56.712 -44.543 -15.295 1.00 67.50  ? 217  CYS A N    1 
ATOM   1228 C  CA   . CYS A 1 223 ? 58.106 -44.954 -15.155 1.00 70.18  ? 217  CYS A CA   1 
ATOM   1229 C  C    . CYS A 1 223 ? 58.817 -44.995 -16.496 1.00 72.10  ? 217  CYS A C    1 
ATOM   1230 O  O    . CYS A 1 223 ? 60.044 -44.919 -16.541 1.00 72.75  ? 217  CYS A O    1 
ATOM   1231 C  CB   . CYS A 1 223 ? 58.209 -46.329 -14.493 1.00 65.10  ? 217  CYS A CB   1 
ATOM   1232 S  SG   . CYS A 1 223 ? 57.563 -46.394 -12.834 1.00 79.61  ? 217  CYS A SG   1 
ATOM   1233 N  N    . GLY A 1 224 ? 58.068 -45.129 -17.589 1.00 74.27  ? 218  GLY A N    1 
ATOM   1234 C  CA   . GLY A 1 224 ? 58.679 -45.131 -18.906 1.00 71.10  ? 218  GLY A CA   1 
ATOM   1235 C  C    . GLY A 1 224 ? 59.122 -43.752 -19.341 1.00 70.54  ? 218  GLY A C    1 
ATOM   1236 O  O    . GLY A 1 224 ? 60.194 -43.599 -19.932 1.00 70.41  ? 218  GLY A O    1 
ATOM   1237 N  N    . TYR A 1 225 ? 58.306 -42.730 -19.059 1.00 69.27  ? 219  TYR A N    1 
ATOM   1238 C  CA   . TYR A 1 225 ? 58.726 -41.362 -19.346 1.00 73.67  ? 219  TYR A CA   1 
ATOM   1239 C  C    . TYR A 1 225 ? 59.961 -40.951 -18.541 1.00 77.48  ? 219  TYR A C    1 
ATOM   1240 O  O    . TYR A 1 225 ? 60.736 -40.105 -18.997 1.00 85.25  ? 219  TYR A O    1 
ATOM   1241 C  CB   . TYR A 1 225 ? 57.577 -40.392 -19.085 1.00 73.68  ? 219  TYR A CB   1 
ATOM   1242 C  CG   . TYR A 1 225 ? 57.907 -38.956 -19.411 1.00 82.01  ? 219  TYR A CG   1 
ATOM   1243 C  CD1  . TYR A 1 225 ? 57.966 -38.524 -20.730 1.00 86.96  ? 219  TYR A CD1  1 
ATOM   1244 C  CD2  . TYR A 1 225 ? 58.154 -38.033 -18.411 1.00 88.01  ? 219  TYR A CD2  1 
ATOM   1245 C  CE1  . TYR A 1 225 ? 58.268 -37.204 -21.050 1.00 91.77  ? 219  TYR A CE1  1 
ATOM   1246 C  CE2  . TYR A 1 225 ? 58.453 -36.709 -18.714 1.00 98.50  ? 219  TYR A CE2  1 
ATOM   1247 C  CZ   . TYR A 1 225 ? 58.510 -36.295 -20.037 1.00 102.22 ? 219  TYR A CZ   1 
ATOM   1248 O  OH   . TYR A 1 225 ? 58.810 -34.976 -20.343 1.00 103.95 ? 219  TYR A OH   1 
ATOM   1249 N  N    . ASP A 1 226 ? 60.140 -41.498 -17.332 1.00 78.34  ? 220  ASP A N    1 
ATOM   1250 C  CA   . ASP A 1 226 ? 61.329 -41.226 -16.518 1.00 82.47  ? 220  ASP A CA   1 
ATOM   1251 C  C    . ASP A 1 226 ? 62.513 -42.128 -16.877 1.00 79.07  ? 220  ASP A C    1 
ATOM   1252 O  O    . ASP A 1 226 ? 63.669 -41.714 -16.739 1.00 86.37  ? 220  ASP A O    1 
ATOM   1253 C  CB   . ASP A 1 226 ? 60.997 -41.372 -15.028 1.00 82.10  ? 220  ASP A CB   1 
ATOM   1254 C  CG   . ASP A 1 226 ? 60.050 -40.285 -14.521 1.00 87.59  ? 220  ASP A CG   1 
ATOM   1255 O  OD1  . ASP A 1 226 ? 59.937 -39.217 -15.167 1.00 90.33  ? 220  ASP A OD1  1 
ATOM   1256 O  OD2  . ASP A 1 226 ? 59.398 -40.513 -13.478 1.00 87.18  ? 220  ASP A OD2  1 
ATOM   1257 N  N    . ASP A 1 227 ? 62.253 -43.365 -17.282 1.00 73.45  ? 221  ASP A N    1 
ATOM   1258 C  CA   . ASP A 1 227 ? 63.278 -44.276 -17.779 1.00 72.26  ? 221  ASP A CA   1 
ATOM   1259 C  C    . ASP A 1 227 ? 62.728 -44.954 -19.029 1.00 79.52  ? 221  ASP A C    1 
ATOM   1260 O  O    . ASP A 1 227 ? 61.660 -45.570 -18.989 1.00 79.77  ? 221  ASP A O    1 
ATOM   1261 C  CB   . ASP A 1 227 ? 63.666 -45.303 -16.714 1.00 70.48  ? 221  ASP A CB   1 
ATOM   1262 C  CG   . ASP A 1 227 ? 64.692 -46.307 -17.205 1.00 76.18  ? 221  ASP A CG   1 
ATOM   1263 O  OD1  . ASP A 1 227 ? 65.080 -46.248 -18.383 1.00 84.73  ? 221  ASP A OD1  1 
ATOM   1264 O  OD2  . ASP A 1 227 ? 65.117 -47.173 -16.419 1.00 78.74  ? 221  ASP A OD2  1 
ATOM   1265 N  N    . HIS A 1 228 ? 63.441 -44.839 -20.143 1.00 80.48  ? 222  HIS A N    1 
ATOM   1266 C  CA   . HIS A 1 228 ? 62.891 -45.328 -21.395 1.00 78.20  ? 222  HIS A CA   1 
ATOM   1267 C  C    . HIS A 1 228 ? 63.068 -46.827 -21.564 1.00 79.88  ? 222  HIS A C    1 
ATOM   1268 O  O    . HIS A 1 228 ? 62.610 -47.384 -22.565 1.00 87.35  ? 222  HIS A O    1 
ATOM   1269 C  CB   . HIS A 1 228 ? 63.509 -44.568 -22.574 1.00 80.03  ? 222  HIS A CB   1 
ATOM   1270 C  CG   . HIS A 1 228 ? 63.141 -43.117 -22.598 1.00 79.28  ? 222  HIS A CG   1 
ATOM   1271 N  ND1  . HIS A 1 228 ? 63.879 -42.149 -21.954 1.00 90.29  ? 222  HIS A ND1  1 
ATOM   1272 C  CD2  . HIS A 1 228 ? 62.073 -42.479 -23.128 1.00 78.62  ? 222  HIS A CD2  1 
ATOM   1273 C  CE1  . HIS A 1 228 ? 63.303 -40.971 -22.120 1.00 87.62  ? 222  HIS A CE1  1 
ATOM   1274 N  NE2  . HIS A 1 228 ? 62.204 -41.145 -22.828 1.00 79.74  ? 222  HIS A NE2  1 
ATOM   1275 N  N    . ASN A 1 229 ? 63.692 -47.494 -20.606 1.00 74.61  ? 223  ASN A N    1 
ATOM   1276 C  CA   . ASN A 1 229 ? 63.920 -48.925 -20.682 1.00 79.19  ? 223  ASN A CA   1 
ATOM   1277 C  C    . ASN A 1 229 ? 62.833 -49.731 -19.955 1.00 78.37  ? 223  ASN A C    1 
ATOM   1278 O  O    . ASN A 1 229 ? 62.999 -50.940 -19.751 1.00 75.18  ? 223  ASN A O    1 
ATOM   1279 C  CB   . ASN A 1 229 ? 65.316 -49.247 -20.146 1.00 84.18  ? 223  ASN A CB   1 
ATOM   1280 C  CG   . ASN A 1 229 ? 65.846 -50.571 -20.656 1.00 90.10  ? 223  ASN A CG   1 
ATOM   1281 O  OD1  . ASN A 1 229 ? 65.085 -51.439 -21.089 1.00 93.33  ? 223  ASN A OD1  1 
ATOM   1282 N  ND2  . ASN A 1 229 ? 67.165 -50.719 -20.642 1.00 92.22  ? 223  ASN A ND2  1 
ATOM   1283 N  N    . CYS A 1 230 ? 61.737 -49.089 -19.538 1.00 75.39  ? 224  CYS A N    1 
ATOM   1284 C  CA   . CYS A 1 230 ? 60.735 -49.726 -18.684 1.00 71.36  ? 224  CYS A CA   1 
ATOM   1285 C  C    . CYS A 1 230 ? 59.661 -50.421 -19.523 1.00 70.17  ? 224  CYS A C    1 
ATOM   1286 O  O    . CYS A 1 230 ? 58.782 -49.770 -20.110 1.00 61.97  ? 224  CYS A O    1 
ATOM   1287 C  CB   . CYS A 1 230 ? 60.099 -48.688 -17.764 1.00 70.56  ? 224  CYS A CB   1 
ATOM   1288 S  SG   . CYS A 1 230 ? 58.738 -49.323 -16.776 1.00 60.28  ? 224  CYS A SG   1 
ATOM   1289 N  N    . GLU A 1 231 ? 59.715 -51.754 -19.527 1.00 67.30  ? 225  GLU A N    1 
ATOM   1290 C  CA   . GLU A 1 231 ? 58.764 -52.623 -20.202 1.00 65.68  ? 225  GLU A CA   1 
ATOM   1291 C  C    . GLU A 1 231 ? 57.745 -53.318 -19.291 1.00 63.51  ? 225  GLU A C    1 
ATOM   1292 O  O    . GLU A 1 231 ? 56.879 -54.026 -19.806 1.00 58.63  ? 225  GLU A O    1 
ATOM   1293 C  CB   . GLU A 1 231 ? 59.553 -53.654 -21.016 1.00 71.63  ? 225  GLU A CB   1 
ATOM   1294 C  CG   . GLU A 1 231 ? 60.209 -53.019 -22.264 1.00 73.90  ? 225  GLU A CG   1 
ATOM   1295 C  CD   . GLU A 1 231 ? 61.229 -53.922 -22.946 1.00 82.48  ? 225  GLU A CD   1 
ATOM   1296 O  OE1  . GLU A 1 231 ? 61.706 -54.886 -22.297 1.00 84.01  ? 225  GLU A OE1  1 
ATOM   1297 O  OE2  . GLU A 1 231 ? 61.533 -53.678 -24.141 1.00 83.04  ? 225  GLU A OE2  1 
ATOM   1298 N  N    . ILE A 1 232 ? 57.811 -53.143 -17.962 1.00 71.50  ? 226  ILE A N    1 
ATOM   1299 C  CA   . ILE A 1 232 ? 56.950 -53.868 -17.021 1.00 59.71  ? 226  ILE A CA   1 
ATOM   1300 C  C    . ILE A 1 232 ? 56.356 -52.881 -16.032 1.00 58.90  ? 226  ILE A C    1 
ATOM   1301 O  O    . ILE A 1 232 ? 57.101 -52.113 -15.425 1.00 65.61  ? 226  ILE A O    1 
ATOM   1302 C  CB   . ILE A 1 232 ? 57.722 -54.943 -16.238 1.00 55.92  ? 226  ILE A CB   1 
ATOM   1303 C  CG1  . ILE A 1 232 ? 58.406 -55.939 -17.169 1.00 58.50  ? 226  ILE A CG1  1 
ATOM   1304 C  CG2  . ILE A 1 232 ? 56.768 -55.693 -15.351 1.00 55.43  ? 226  ILE A CG2  1 
ATOM   1305 C  CD1  . ILE A 1 232 ? 59.362 -56.872 -16.458 1.00 46.46  ? 226  ILE A CD1  1 
ATOM   1306 N  N    . GLY A 1 233 ? 55.019 -52.870 -15.896 1.00 61.68  ? 227  GLY A N    1 
ATOM   1307 C  CA   . GLY A 1 233 ? 54.367 -52.289 -14.716 1.00 59.94  ? 227  GLY A CA   1 
ATOM   1308 C  C    . GLY A 1 233 ? 54.053 -53.312 -13.623 1.00 57.92  ? 227  GLY A C    1 
ATOM   1309 O  O    . GLY A 1 233 ? 53.708 -54.455 -13.898 1.00 57.90  ? 227  GLY A O    1 
ATOM   1310 N  N    . LEU A 1 234 ? 54.130 -52.886 -12.357 1.00 59.71  ? 228  LEU A N    1 
ATOM   1311 C  CA   . LEU A 1 234 ? 53.866 -53.801 -11.239 1.00 56.56  ? 228  LEU A CA   1 
ATOM   1312 C  C    . LEU A 1 234 ? 53.172 -53.103 -10.079 1.00 53.68  ? 228  LEU A C    1 
ATOM   1313 O  O    . LEU A 1 234 ? 53.653 -52.081 -9.593  1.00 56.46  ? 228  LEU A O    1 
ATOM   1314 C  CB   . LEU A 1 234 ? 55.150 -54.448 -10.729 1.00 50.66  ? 228  LEU A CB   1 
ATOM   1315 C  CG   . LEU A 1 234 ? 54.915 -55.162 -9.406  1.00 53.76  ? 228  LEU A CG   1 
ATOM   1316 C  CD1  . LEU A 1 234 ? 53.862 -56.219 -9.594  1.00 54.69  ? 228  LEU A CD1  1 
ATOM   1317 C  CD2  . LEU A 1 234 ? 56.208 -55.775 -8.885  1.00 50.39  ? 228  LEU A CD2  1 
ATOM   1318 N  N    . ILE A 1 235 ? 52.076 -53.674 -9.596  1.00 52.85  ? 229  ILE A N    1 
ATOM   1319 C  CA   . ILE A 1 235 ? 51.393 -53.137 -8.422  1.00 59.33  ? 229  ILE A CA   1 
ATOM   1320 C  C    . ILE A 1 235 ? 51.326 -54.193 -7.328  1.00 55.72  ? 229  ILE A C    1 
ATOM   1321 O  O    . ILE A 1 235 ? 50.845 -55.309 -7.563  1.00 53.91  ? 229  ILE A O    1 
ATOM   1322 C  CB   . ILE A 1 235 ? 49.979 -52.634 -8.745  1.00 56.04  ? 229  ILE A CB   1 
ATOM   1323 C  CG1  . ILE A 1 235 ? 50.039 -51.338 -9.552  1.00 51.53  ? 229  ILE A CG1  1 
ATOM   1324 C  CG2  . ILE A 1 235 ? 49.183 -52.505 -7.459  1.00 49.47  ? 229  ILE A CG2  1 
ATOM   1325 C  CD1  . ILE A 1 235 ? 48.680 -50.828 -9.924  1.00 55.43  ? 229  ILE A CD1  1 
ATOM   1326 N  N    . VAL A 1 236 ? 51.797 -53.843 -6.133  1.00 52.95  ? 230  VAL A N    1 
ATOM   1327 C  CA   . VAL A 1 236 ? 51.521 -54.648 -4.944  1.00 54.20  ? 230  VAL A CA   1 
ATOM   1328 C  C    . VAL A 1 236 ? 51.005 -53.709 -3.859  1.00 56.09  ? 230  VAL A C    1 
ATOM   1329 O  O    . VAL A 1 236 ? 51.766 -52.907 -3.304  1.00 58.51  ? 230  VAL A O    1 
ATOM   1330 C  CB   . VAL A 1 236 ? 52.741 -55.432 -4.472  1.00 49.50  ? 230  VAL A CB   1 
ATOM   1331 C  CG1  . VAL A 1 236 ? 52.343 -56.338 -3.363  1.00 51.77  ? 230  VAL A CG1  1 
ATOM   1332 C  CG2  . VAL A 1 236 ? 53.308 -56.222 -5.624  1.00 52.41  ? 230  VAL A CG2  1 
ATOM   1333 N  N    . GLY A 1 237 ? 49.748 -53.880 -3.486  1.00 54.08  ? 231  GLY A N    1 
ATOM   1334 C  CA   . GLY A 1 237 ? 48.951 -52.853 -2.842  1.00 54.67  ? 231  GLY A CA   1 
ATOM   1335 C  C    . GLY A 1 237 ? 47.707 -53.509 -2.280  1.00 52.71  ? 231  GLY A C    1 
ATOM   1336 O  O    . GLY A 1 237 ? 47.743 -54.696 -1.920  1.00 46.68  ? 231  GLY A O    1 
ATOM   1337 N  N    . THR A 1 238 ? 46.623 -52.746 -2.152  1.00 45.18  ? 232  THR A N    1 
ATOM   1338 C  CA   . THR A 1 238 ? 45.337 -53.356 -1.840  1.00 46.90  ? 232  THR A CA   1 
ATOM   1339 C  C    . THR A 1 238 ? 45.112 -54.630 -2.652  1.00 55.88  ? 232  THR A C    1 
ATOM   1340 O  O    . THR A 1 238 ? 44.729 -55.663 -2.096  1.00 55.03  ? 232  THR A O    1 
ATOM   1341 C  CB   . THR A 1 238 ? 44.215 -52.370 -2.150  1.00 53.91  ? 232  THR A CB   1 
ATOM   1342 O  OG1  . THR A 1 238 ? 44.443 -51.129 -1.472  1.00 60.95  ? 232  THR A OG1  1 
ATOM   1343 C  CG2  . THR A 1 238 ? 42.891 -52.964 -1.741  1.00 53.55  ? 232  THR A CG2  1 
ATOM   1344 N  N    . GLY A 1 239 ? 45.280 -54.552 -3.984  1.00 62.14  ? 233  GLY A N    1 
ATOM   1345 C  CA   . GLY A 1 239 ? 45.392 -55.698 -4.862  1.00 54.48  ? 233  GLY A CA   1 
ATOM   1346 C  C    . GLY A 1 239 ? 46.795 -55.848 -5.441  1.00 56.02  ? 233  GLY A C    1 
ATOM   1347 O  O    . GLY A 1 239 ? 47.676 -55.034 -5.192  1.00 56.14  ? 233  GLY A O    1 
ATOM   1348 N  N    . SER A 1 240 ? 46.983 -56.898 -6.255  1.00 55.32  ? 234  SER A N    1 
ATOM   1349 C  CA   . SER A 1 240 ? 48.242 -57.086 -6.978  1.00 52.26  ? 234  SER A CA   1 
ATOM   1350 C  C    . SER A 1 240 ? 48.055 -57.622 -8.402  1.00 61.55  ? 234  SER A C    1 
ATOM   1351 O  O    . SER A 1 240 ? 47.411 -58.654 -8.601  1.00 59.29  ? 234  SER A O    1 
ATOM   1352 C  CB   . SER A 1 240 ? 49.163 -58.024 -6.220  1.00 49.92  ? 234  SER A CB   1 
ATOM   1353 O  OG   . SER A 1 240 ? 50.345 -58.213 -6.972  1.00 49.79  ? 234  SER A OG   1 
ATOM   1354 N  N    . ASN A 1 241 ? 48.702 -56.963 -9.373  1.00 57.07  ? 235  ASN A N    1 
ATOM   1355 C  CA   . ASN A 1 241 ? 48.664 -57.322 -10.783 1.00 52.77  ? 235  ASN A CA   1 
ATOM   1356 C  C    . ASN A 1 241 ? 49.987 -56.893 -11.435 1.00 59.93  ? 235  ASN A C    1 
ATOM   1357 O  O    . ASN A 1 241 ? 50.885 -56.380 -10.754 1.00 55.18  ? 235  ASN A O    1 
ATOM   1358 C  CB   . ASN A 1 241 ? 47.438 -56.662 -11.423 1.00 57.80  ? 235  ASN A CB   1 
ATOM   1359 C  CG   . ASN A 1 241 ? 47.173 -57.139 -12.830 1.00 52.55  ? 235  ASN A CG   1 
ATOM   1360 O  OD1  . ASN A 1 241 ? 47.651 -58.192 -13.249 1.00 48.00  ? 235  ASN A OD1  1 
ATOM   1361 N  ND2  . ASN A 1 241 ? 46.336 -56.408 -13.533 1.00 51.93  ? 235  ASN A ND2  1 
ATOM   1362 N  N    . ALA A 1 242 ? 50.135 -57.145 -12.751 1.00 52.50  ? 236  ALA A N    1 
ATOM   1363 C  CA   . ALA A 1 242 ? 51.255 -56.591 -13.519 1.00 50.31  ? 236  ALA A CA   1 
ATOM   1364 C  C    . ALA A 1 242 ? 51.008 -56.647 -15.034 1.00 59.15  ? 236  ALA A C    1 
ATOM   1365 O  O    . ALA A 1 242 ? 50.303 -57.520 -15.552 1.00 54.13  ? 236  ALA A O    1 
ATOM   1366 C  CB   . ALA A 1 242 ? 52.569 -57.309 -13.189 1.00 51.44  ? 236  ALA A CB   1 
ATOM   1367 N  N    . CYS A 1 243 ? 51.687 -55.757 -15.753 1.00 57.76  ? 237  CYS A N    1 
ATOM   1368 C  CA   . CYS A 1 243 ? 51.600 -55.712 -17.199 1.00 57.58  ? 237  CYS A CA   1 
ATOM   1369 C  C    . CYS A 1 243 ? 53.001 -55.717 -17.788 1.00 57.04  ? 237  CYS A C    1 
ATOM   1370 O  O    . CYS A 1 243 ? 53.977 -55.396 -17.115 1.00 55.22  ? 237  CYS A O    1 
ATOM   1371 C  CB   . CYS A 1 243 ? 50.836 -54.484 -17.689 1.00 59.47  ? 237  CYS A CB   1 
ATOM   1372 S  SG   . CYS A 1 243 ? 51.601 -52.977 -17.245 1.00 59.45  ? 237  CYS A SG   1 
ATOM   1373 N  N    . TYR A 1 244 ? 53.096 -56.094 -19.062 1.00 59.38  ? 238  TYR A N    1 
ATOM   1374 C  CA   . TYR A 1 244 ? 54.378 -56.033 -19.745 1.00 62.05  ? 238  TYR A CA   1 
ATOM   1375 C  C    . TYR A 1 244 ? 54.150 -55.887 -21.238 1.00 59.47  ? 238  TYR A C    1 
ATOM   1376 O  O    . TYR A 1 244 ? 53.026 -56.023 -21.731 1.00 60.40  ? 238  TYR A O    1 
ATOM   1377 C  CB   . TYR A 1 244 ? 55.208 -57.283 -19.464 1.00 64.76  ? 238  TYR A CB   1 
ATOM   1378 C  CG   . TYR A 1 244 ? 54.714 -58.524 -20.171 1.00 60.42  ? 238  TYR A CG   1 
ATOM   1379 C  CD1  . TYR A 1 244 ? 55.326 -58.987 -21.320 1.00 57.03  ? 238  TYR A CD1  1 
ATOM   1380 C  CD2  . TYR A 1 244 ? 53.613 -59.204 -19.707 1.00 60.99  ? 238  TYR A CD2  1 
ATOM   1381 C  CE1  . TYR A 1 244 ? 54.884 -60.131 -21.950 1.00 58.73  ? 238  TYR A CE1  1 
ATOM   1382 C  CE2  . TYR A 1 244 ? 53.155 -60.333 -20.342 1.00 64.27  ? 238  TYR A CE2  1 
ATOM   1383 C  CZ   . TYR A 1 244 ? 53.789 -60.797 -21.466 1.00 57.86  ? 238  TYR A CZ   1 
ATOM   1384 O  OH   . TYR A 1 244 ? 53.304 -61.932 -22.079 1.00 52.85  ? 238  TYR A OH   1 
ATOM   1385 N  N    . MET A 1 245 ? 55.252 -55.672 -21.962 1.00 60.35  ? 239  MET A N    1 
ATOM   1386 C  CA   . MET A 1 245 ? 55.218 -55.396 -23.396 1.00 59.28  ? 239  MET A CA   1 
ATOM   1387 C  C    . MET A 1 245 ? 55.460 -56.705 -24.118 1.00 58.84  ? 239  MET A C    1 
ATOM   1388 O  O    . MET A 1 245 ? 56.507 -57.334 -23.923 1.00 60.68  ? 239  MET A O    1 
ATOM   1389 C  CB   . MET A 1 245 ? 56.262 -54.357 -23.803 1.00 56.06  ? 239  MET A CB   1 
ATOM   1390 C  CG   . MET A 1 245 ? 56.005 -52.988 -23.226 1.00 58.40  ? 239  MET A CG   1 
ATOM   1391 S  SD   . MET A 1 245 ? 54.385 -52.352 -23.691 1.00 60.89  ? 239  MET A SD   1 
ATOM   1392 C  CE   . MET A 1 245 ? 54.651 -52.099 -25.444 1.00 53.21  ? 239  MET A CE   1 
ATOM   1393 N  N    . GLU A 1 246 ? 54.479 -57.131 -24.911 1.00 54.28  ? 240  GLU A N    1 
ATOM   1394 C  CA   . GLU A 1 246 ? 54.548 -58.406 -25.604 1.00 54.71  ? 240  GLU A CA   1 
ATOM   1395 C  C    . GLU A 1 246 ? 54.651 -58.159 -27.102 1.00 57.22  ? 240  GLU A C    1 
ATOM   1396 O  O    . GLU A 1 246 ? 54.223 -57.120 -27.617 1.00 55.93  ? 240  GLU A O    1 
ATOM   1397 C  CB   . GLU A 1 246 ? 53.335 -59.306 -25.300 1.00 50.70  ? 240  GLU A CB   1 
ATOM   1398 C  CG   . GLU A 1 246 ? 53.455 -60.632 -26.026 1.00 50.85  ? 240  GLU A CG   1 
ATOM   1399 C  CD   . GLU A 1 246 ? 54.454 -61.595 -25.416 1.00 56.85  ? 240  GLU A CD   1 
ATOM   1400 O  OE1  . GLU A 1 246 ? 54.419 -61.843 -24.202 1.00 61.31  ? 240  GLU A OE1  1 
ATOM   1401 O  OE2  . GLU A 1 246 ? 55.392 -61.998 -26.122 1.00 59.42  ? 240  GLU A OE2  1 
ATOM   1402 N  N    . GLU A 1 247 ? 55.256 -59.118 -27.787 1.00 59.40  ? 241  GLU A N    1 
ATOM   1403 C  CA   . GLU A 1 247 ? 55.356 -59.093 -29.238 1.00 51.21  ? 241  GLU A CA   1 
ATOM   1404 C  C    . GLU A 1 247 ? 54.011 -59.465 -29.865 1.00 54.79  ? 241  GLU A C    1 
ATOM   1405 O  O    . GLU A 1 247 ? 53.386 -60.453 -29.465 1.00 52.68  ? 241  GLU A O    1 
ATOM   1406 C  CB   . GLU A 1 247 ? 56.454 -60.060 -29.680 1.00 50.78  ? 241  GLU A CB   1 
ATOM   1407 C  CG   . GLU A 1 247 ? 57.853 -59.706 -29.154 1.00 55.59  ? 241  GLU A CG   1 
ATOM   1408 C  CD   . GLU A 1 247 ? 58.347 -58.310 -29.568 1.00 66.19  ? 241  GLU A CD   1 
ATOM   1409 O  OE1  . GLU A 1 247 ? 58.182 -57.914 -30.747 1.00 81.48  ? 241  GLU A OE1  1 
ATOM   1410 O  OE2  . GLU A 1 247 ? 58.912 -57.592 -28.719 1.00 67.99  ? 241  GLU A OE2  1 
ATOM   1411 N  N    . MET A 1 248 ? 53.582 -58.681 -30.870 1.00 59.41  ? 242  MET A N    1 
ATOM   1412 C  CA   . MET A 1 248 ? 52.287 -58.892 -31.527 1.00 52.43  ? 242  MET A CA   1 
ATOM   1413 C  C    . MET A 1 248 ? 52.172 -60.266 -32.186 1.00 49.35  ? 242  MET A C    1 
ATOM   1414 O  O    . MET A 1 248 ? 51.067 -60.805 -32.301 1.00 49.81  ? 242  MET A O    1 
ATOM   1415 C  CB   . MET A 1 248 ? 52.058 -57.802 -32.563 1.00 52.76  ? 242  MET A CB   1 
ATOM   1416 C  CG   . MET A 1 248 ? 51.765 -56.425 -32.025 1.00 51.74  ? 242  MET A CG   1 
ATOM   1417 S  SD   . MET A 1 248 ? 50.093 -56.184 -31.433 1.00 55.74  ? 242  MET A SD   1 
ATOM   1418 C  CE   . MET A 1 248 ? 49.108 -56.090 -32.914 1.00 60.12  ? 242  MET A CE   1 
ATOM   1419 N  N    . ARG A 1 249 ? 53.277 -60.851 -32.642 1.00 48.10  ? 243  ARG A N    1 
ATOM   1420 C  CA   . ARG A 1 249 ? 53.178 -62.224 -33.139 1.00 51.47  ? 243  ARG A CA   1 
ATOM   1421 C  C    . ARG A 1 249 ? 52.743 -63.198 -32.054 1.00 54.79  ? 243  ARG A C    1 
ATOM   1422 O  O    . ARG A 1 249 ? 52.257 -64.293 -32.364 1.00 56.47  ? 243  ARG A O    1 
ATOM   1423 C  CB   . ARG A 1 249 ? 54.500 -62.676 -33.776 1.00 48.75  ? 243  ARG A CB   1 
ATOM   1424 C  CG   . ARG A 1 249 ? 55.715 -62.107 -33.110 1.00 54.15  ? 243  ARG A CG   1 
ATOM   1425 C  CD   . ARG A 1 249 ? 57.016 -62.837 -33.389 1.00 53.13  ? 243  ARG A CD   1 
ATOM   1426 N  NE   . ARG A 1 249 ? 58.069 -62.111 -32.683 1.00 58.43  ? 243  ARG A NE   1 
ATOM   1427 C  CZ   . ARG A 1 249 ? 59.214 -62.652 -32.277 1.00 66.82  ? 243  ARG A CZ   1 
ATOM   1428 N  NH1  . ARG A 1 249 ? 59.423 -63.958 -32.449 1.00 66.22  ? 243  ARG A NH1  1 
ATOM   1429 N  NH2  . ARG A 1 249 ? 60.110 -61.909 -31.619 1.00 65.13  ? 243  ARG A NH2  1 
ATOM   1430 N  N    . HIS A 1 250 ? 52.898 -62.828 -30.794 1.00 56.37  ? 244  HIS A N    1 
ATOM   1431 C  CA   . HIS A 1 250 ? 52.541 -63.700 -29.694 1.00 49.68  ? 244  HIS A CA   1 
ATOM   1432 C  C    . HIS A 1 250 ? 51.132 -63.461 -29.170 1.00 51.05  ? 244  HIS A C    1 
ATOM   1433 O  O    . HIS A 1 250 ? 50.625 -64.309 -28.432 1.00 52.32  ? 244  HIS A O    1 
ATOM   1434 C  CB   . HIS A 1 250 ? 53.587 -63.539 -28.604 1.00 48.66  ? 244  HIS A CB   1 
ATOM   1435 C  CG   . HIS A 1 250 ? 54.903 -64.179 -28.936 1.00 53.17  ? 244  HIS A CG   1 
ATOM   1436 N  ND1  . HIS A 1 250 ? 56.107 -63.714 -28.449 1.00 55.24  ? 244  HIS A ND1  1 
ATOM   1437 C  CD2  . HIS A 1 250 ? 55.194 -65.305 -29.630 1.00 52.78  ? 244  HIS A CD2  1 
ATOM   1438 C  CE1  . HIS A 1 250 ? 57.086 -64.498 -28.867 1.00 53.41  ? 244  HIS A CE1  1 
ATOM   1439 N  NE2  . HIS A 1 250 ? 56.558 -65.476 -29.579 1.00 51.58  ? 244  HIS A NE2  1 
ATOM   1440 N  N    . ILE A 1 251 ? 50.460 -62.389 -29.598 1.00 50.42  ? 245  ILE A N    1 
ATOM   1441 C  CA   . ILE A 1 251 ? 49.116 -62.053 -29.128 1.00 49.27  ? 245  ILE A CA   1 
ATOM   1442 C  C    . ILE A 1 251 ? 48.122 -62.479 -30.217 1.00 58.30  ? 245  ILE A C    1 
ATOM   1443 O  O    . ILE A 1 251 ? 47.783 -61.690 -31.105 1.00 57.22  ? 245  ILE A O    1 
ATOM   1444 C  CB   . ILE A 1 251 ? 48.995 -60.548 -28.862 1.00 47.58  ? 245  ILE A CB   1 
ATOM   1445 C  CG1  . ILE A 1 251 ? 50.097 -60.021 -27.951 1.00 46.93  ? 245  ILE A CG1  1 
ATOM   1446 C  CG2  . ILE A 1 251 ? 47.630 -60.179 -28.304 1.00 52.29  ? 245  ILE A CG2  1 
ATOM   1447 C  CD1  . ILE A 1 251 ? 50.061 -58.508 -27.824 1.00 43.06  ? 245  ILE A CD1  1 
ATOM   1448 N  N    . ASP A 1 252 ? 47.503 -63.655 -30.062 1.00 58.82  ? 246  ASP A N    1 
ATOM   1449 C  CA   . ASP A 1 252 ? 46.562 -64.141 -31.068 1.00 47.33  ? 246  ASP A CA   1 
ATOM   1450 C  C    . ASP A 1 252 ? 45.256 -63.362 -31.049 1.00 54.30  ? 246  ASP A C    1 
ATOM   1451 O  O    . ASP A 1 252 ? 44.568 -63.278 -32.062 1.00 68.21  ? 246  ASP A O    1 
ATOM   1452 C  CB   . ASP A 1 252 ? 46.246 -65.612 -30.834 1.00 49.76  ? 246  ASP A CB   1 
ATOM   1453 C  CG   . ASP A 1 252 ? 47.474 -66.487 -30.887 1.00 60.16  ? 246  ASP A CG   1 
ATOM   1454 O  OD1  . ASP A 1 252 ? 48.545 -65.995 -31.315 1.00 59.80  ? 246  ASP A OD1  1 
ATOM   1455 O  OD2  . ASP A 1 252 ? 47.361 -67.679 -30.518 1.00 60.10  ? 246  ASP A OD2  1 
ATOM   1456 N  N    . MET A 1 253 ? 44.873 -62.826 -29.915 1.00 60.15  ? 247  MET A N    1 
ATOM   1457 C  CA   . MET A 1 253 ? 43.584 -62.173 -29.774 1.00 60.22  ? 247  MET A CA   1 
ATOM   1458 C  C    . MET A 1 253 ? 43.530 -60.829 -30.477 1.00 59.39  ? 247  MET A C    1 
ATOM   1459 O  O    . MET A 1 253 ? 42.488 -60.164 -30.413 1.00 57.31  ? 247  MET A O    1 
ATOM   1460 C  CB   . MET A 1 253 ? 43.267 -61.992 -28.285 1.00 67.48  ? 247  MET A CB   1 
ATOM   1461 C  CG   . MET A 1 253 ? 43.250 -63.292 -27.471 1.00 68.04  ? 247  MET A CG   1 
ATOM   1462 S  SD   . MET A 1 253 ? 42.009 -64.474 -28.012 1.00 77.31  ? 247  MET A SD   1 
ATOM   1463 C  CE   . MET A 1 253 ? 40.518 -63.544 -27.608 1.00 58.78  ? 247  MET A CE   1 
ATOM   1464 N  N    . VAL A 1 254 ? 44.634 -60.371 -31.067 1.00 60.30  ? 248  VAL A N    1 
ATOM   1465 C  CA   . VAL A 1 254 ? 44.657 -59.102 -31.792 1.00 62.82  ? 248  VAL A CA   1 
ATOM   1466 C  C    . VAL A 1 254 ? 45.430 -59.281 -33.090 1.00 60.08  ? 248  VAL A C    1 
ATOM   1467 O  O    . VAL A 1 254 ? 46.578 -59.740 -33.079 1.00 59.70  ? 248  VAL A O    1 
ATOM   1468 C  CB   . VAL A 1 254 ? 45.279 -57.971 -30.955 1.00 63.10  ? 248  VAL A CB   1 
ATOM   1469 C  CG1  . VAL A 1 254 ? 45.380 -56.704 -31.778 1.00 61.76  ? 248  VAL A CG1  1 
ATOM   1470 C  CG2  . VAL A 1 254 ? 44.456 -57.733 -29.706 1.00 64.28  ? 248  VAL A CG2  1 
ATOM   1471 N  N    . GLU A 1 255 ? 44.809 -58.901 -34.205 1.00 59.57  ? 249  GLU A N    1 
ATOM   1472 C  CA   . GLU A 1 255 ? 45.438 -59.069 -35.506 1.00 64.53  ? 249  GLU A CA   1 
ATOM   1473 C  C    . GLU A 1 255 ? 46.622 -58.112 -35.646 1.00 63.77  ? 249  GLU A C    1 
ATOM   1474 O  O    . GLU A 1 255 ? 46.488 -56.906 -35.397 1.00 62.74  ? 249  GLU A O    1 
ATOM   1475 C  CB   . GLU A 1 255 ? 44.414 -58.836 -36.614 1.00 67.50  ? 249  GLU A CB   1 
ATOM   1476 C  CG   . GLU A 1 255 ? 44.946 -59.155 -37.997 1.00 77.28  ? 249  GLU A CG   1 
ATOM   1477 C  CD   . GLU A 1 255 ? 43.933 -58.891 -39.096 1.00 88.36  ? 249  GLU A CD   1 
ATOM   1478 O  OE1  . GLU A 1 255 ? 42.828 -58.385 -38.777 1.00 92.25  ? 249  GLU A OE1  1 
ATOM   1479 O  OE2  . GLU A 1 255 ? 44.248 -59.197 -40.273 1.00 88.43  ? 249  GLU A OE2  1 
ATOM   1480 N  N    . GLY A 1 256 ? 47.777 -58.658 -36.018 1.00 52.52  ? 250  GLY A N    1 
ATOM   1481 C  CA   . GLY A 1 256 ? 49.025 -57.919 -36.028 1.00 56.90  ? 250  GLY A CA   1 
ATOM   1482 C  C    . GLY A 1 256 ? 50.198 -58.872 -35.997 1.00 63.05  ? 250  GLY A C    1 
ATOM   1483 O  O    . GLY A 1 256 ? 50.044 -60.077 -35.815 1.00 61.18  ? 250  GLY A O    1 
ATOM   1484 N  N    . ASP A 1 257 ? 51.392 -58.328 -36.236 1.00 62.47  ? 251  ASP A N    1 
ATOM   1485 C  CA   . ASP A 1 257 ? 52.501 -59.255 -36.464 1.00 55.71  ? 251  ASP A CA   1 
ATOM   1486 C  C    . ASP A 1 257 ? 53.950 -59.176 -35.981 1.00 57.16  ? 251  ASP A C    1 
ATOM   1487 O  O    . ASP A 1 257 ? 54.414 -60.234 -35.590 1.00 63.37  ? 251  ASP A O    1 
ATOM   1488 C  CB   . ASP A 1 257 ? 52.586 -59.564 -37.958 1.00 78.07  ? 251  ASP A CB   1 
ATOM   1489 C  CG   . ASP A 1 257 ? 51.923 -60.892 -38.290 1.00 80.19  ? 251  ASP A CG   1 
ATOM   1490 O  OD1  . ASP A 1 257 ? 51.706 -61.677 -37.319 1.00 72.04  ? 251  ASP A OD1  1 
ATOM   1491 O  OD2  . ASP A 1 257 ? 51.662 -61.161 -39.492 1.00 85.03  ? 251  ASP A OD2  1 
ATOM   1492 N  N    . GLU A 1 258 ? 54.784 -58.146 -36.182 1.00 60.12  ? 252  GLU A N    1 
ATOM   1493 C  CA   . GLU A 1 258 ? 54.559 -56.714 -36.412 1.00 60.33  ? 252  GLU A CA   1 
ATOM   1494 C  C    . GLU A 1 258 ? 53.902 -55.907 -35.294 1.00 61.44  ? 252  GLU A C    1 
ATOM   1495 O  O    . GLU A 1 258 ? 52.685 -55.661 -35.257 1.00 60.44  ? 252  GLU A O    1 
ATOM   1496 C  CB   . GLU A 1 258 ? 53.875 -56.473 -37.728 1.00 60.51  ? 252  GLU A CB   1 
ATOM   1497 C  CG   . GLU A 1 258 ? 54.879 -56.785 -38.823 1.00 63.08  ? 252  GLU A CG   1 
ATOM   1498 C  CD   . GLU A 1 258 ? 54.391 -56.418 -40.187 1.00 71.89  ? 252  GLU A CD   1 
ATOM   1499 O  OE1  . GLU A 1 258 ? 53.246 -55.922 -40.280 1.00 87.31  ? 252  GLU A OE1  1 
ATOM   1500 O  OE2  . GLU A 1 258 ? 55.143 -56.654 -41.157 1.00 64.92  ? 252  GLU A OE2  1 
ATOM   1501 N  N    . GLY A 1 259 ? 54.817 -55.506 -34.406 1.00 51.47  ? 253  GLY A N    1 
ATOM   1502 C  CA   . GLY A 1 259 ? 54.607 -54.601 -33.295 1.00 62.66  ? 253  GLY A CA   1 
ATOM   1503 C  C    . GLY A 1 259 ? 54.777 -55.258 -31.928 1.00 60.87  ? 253  GLY A C    1 
ATOM   1504 O  O    . GLY A 1 259 ? 55.082 -56.444 -31.783 1.00 57.34  ? 253  GLY A O    1 
ATOM   1505 N  N    . ARG A 1 260 ? 54.627 -54.410 -30.922 1.00 55.33  ? 254  ARG A N    1 
ATOM   1506 C  CA   . ARG A 1 260 ? 54.527 -54.800 -29.530 1.00 55.20  ? 254  ARG A CA   1 
ATOM   1507 C  C    . ARG A 1 260 ? 53.215 -54.256 -28.995 1.00 55.39  ? 254  ARG A C    1 
ATOM   1508 O  O    . ARG A 1 260 ? 52.718 -53.222 -29.453 1.00 58.14  ? 254  ARG A O    1 
ATOM   1509 C  CB   . ARG A 1 260 ? 55.746 -54.277 -28.729 1.00 54.39  ? 254  ARG A CB   1 
ATOM   1510 C  CG   . ARG A 1 260 ? 57.021 -54.985 -29.166 1.00 57.24  ? 254  ARG A CG   1 
ATOM   1511 C  CD   . ARG A 1 260 ? 58.317 -54.315 -28.762 1.00 62.34  ? 254  ARG A CD   1 
ATOM   1512 N  NE   . ARG A 1 260 ? 58.605 -54.295 -27.334 1.00 69.92  ? 254  ARG A NE   1 
ATOM   1513 C  CZ   . ARG A 1 260 ? 58.715 -53.185 -26.605 1.00 73.12  ? 254  ARG A CZ   1 
ATOM   1514 N  NH1  . ARG A 1 260 ? 58.566 -51.986 -27.165 1.00 70.38  ? 254  ARG A NH1  1 
ATOM   1515 N  NH2  . ARG A 1 260 ? 58.991 -53.275 -25.312 1.00 74.77  ? 254  ARG A NH2  1 
ATOM   1516 N  N    . MET A 1 261 ? 52.619 -54.987 -28.066 1.00 54.00  ? 255  MET A N    1 
ATOM   1517 C  CA   . MET A 1 261 ? 51.495 -54.443 -27.321 1.00 54.22  ? 255  MET A CA   1 
ATOM   1518 C  C    . MET A 1 261 ? 51.683 -54.770 -25.851 1.00 55.67  ? 255  MET A C    1 
ATOM   1519 O  O    . MET A 1 261 ? 52.199 -55.839 -25.493 1.00 54.57  ? 255  MET A O    1 
ATOM   1520 C  CB   . MET A 1 261 ? 50.144 -54.984 -27.786 1.00 52.41  ? 255  MET A CB   1 
ATOM   1521 C  CG   . MET A 1 261 ? 48.992 -54.180 -27.202 1.00 55.28  ? 255  MET A CG   1 
ATOM   1522 S  SD   . MET A 1 261 ? 47.378 -54.770 -27.711 1.00 57.54  ? 255  MET A SD   1 
ATOM   1523 C  CE   . MET A 1 261 ? 47.297 -54.314 -29.446 1.00 63.45  ? 255  MET A CE   1 
ATOM   1524 N  N    . CYS A 1 262 ? 51.275 -53.834 -25.008 1.00 54.00  ? 256  CYS A N    1 
ATOM   1525 C  CA   . CYS A 1 262 ? 51.295 -54.084 -23.582 1.00 55.72  ? 256  CYS A CA   1 
ATOM   1526 C  C    . CYS A 1 262 ? 50.149 -55.028 -23.237 1.00 57.94  ? 256  CYS A C    1 
ATOM   1527 O  O    . CYS A 1 262 ? 49.011 -54.824 -23.670 1.00 60.53  ? 256  CYS A O    1 
ATOM   1528 C  CB   . CYS A 1 262 ? 51.179 -52.769 -22.811 1.00 57.91  ? 256  CYS A CB   1 
ATOM   1529 S  SG   . CYS A 1 262 ? 51.311 -52.981 -21.016 1.00 62.03  ? 256  CYS A SG   1 
ATOM   1530 N  N    . ILE A 1 263 ? 50.455 -56.081 -22.490 1.00 52.83  ? 257  ILE A N    1 
ATOM   1531 C  CA   . ILE A 1 263 ? 49.464 -57.060 -22.054 1.00 55.60  ? 257  ILE A CA   1 
ATOM   1532 C  C    . ILE A 1 263 ? 49.189 -56.868 -20.563 1.00 58.50  ? 257  ILE A C    1 
ATOM   1533 O  O    . ILE A 1 263 ? 50.114 -56.895 -19.739 1.00 55.97  ? 257  ILE A O    1 
ATOM   1534 C  CB   . ILE A 1 263 ? 49.939 -58.494 -22.349 1.00 55.40  ? 257  ILE A CB   1 
ATOM   1535 C  CG1  . ILE A 1 263 ? 49.974 -58.776 -23.868 1.00 54.34  ? 257  ILE A CG1  1 
ATOM   1536 C  CG2  . ILE A 1 263 ? 49.123 -59.505 -21.573 1.00 52.54  ? 257  ILE A CG2  1 
ATOM   1537 C  CD1  . ILE A 1 263 ? 48.625 -58.749 -24.532 1.00 50.34  ? 257  ILE A CD1  1 
ATOM   1538 N  N    . ASN A 1 264 ? 47.917 -56.729 -20.211 1.00 54.35  ? 258  ASN A N    1 
ATOM   1539 C  CA   . ASN A 1 264 ? 47.508 -56.676 -18.814 1.00 47.47  ? 258  ASN A CA   1 
ATOM   1540 C  C    . ASN A 1 264 ? 47.264 -58.102 -18.334 1.00 51.92  ? 258  ASN A C    1 
ATOM   1541 O  O    . ASN A 1 264 ? 46.216 -58.687 -18.607 1.00 51.97  ? 258  ASN A O    1 
ATOM   1542 C  CB   . ASN A 1 264 ? 46.241 -55.849 -18.685 1.00 46.09  ? 258  ASN A CB   1 
ATOM   1543 C  CG   . ASN A 1 264 ? 45.632 -55.935 -17.327 1.00 50.24  ? 258  ASN A CG   1 
ATOM   1544 O  OD1  . ASN A 1 264 ? 46.003 -56.782 -16.518 1.00 50.34  ? 258  ASN A OD1  1 
ATOM   1545 N  ND2  . ASN A 1 264 ? 44.625 -55.113 -17.090 1.00 51.51  ? 258  ASN A ND2  1 
ATOM   1546 N  N    . MET A 1 265 ? 48.178 -58.619 -17.522 1.00 52.37  ? 259  MET A N    1 
ATOM   1547 C  CA   . MET A 1 265 ? 48.137 -60.039 -17.219 1.00 51.76  ? 259  MET A CA   1 
ATOM   1548 C  C    . MET A 1 265 ? 46.950 -60.408 -16.341 1.00 50.23  ? 259  MET A C    1 
ATOM   1549 O  O    . MET A 1 265 ? 46.410 -61.515 -16.470 1.00 47.60  ? 259  MET A O    1 
ATOM   1550 C  CB   . MET A 1 265 ? 49.446 -60.457 -16.568 1.00 45.56  ? 259  MET A CB   1 
ATOM   1551 C  CG   . MET A 1 265 ? 50.568 -60.521 -17.531 1.00 48.77  ? 259  MET A CG   1 
ATOM   1552 S  SD   . MET A 1 265 ? 52.088 -61.030 -16.755 1.00 57.13  ? 259  MET A SD   1 
ATOM   1553 C  CE   . MET A 1 265 ? 52.531 -59.452 -16.034 1.00 54.16  ? 259  MET A CE   1 
ATOM   1554 N  N    . GLU A 1 266 ? 46.522 -59.504 -15.461 1.00 51.22  ? 260  GLU A N    1 
ATOM   1555 C  CA   . GLU A 1 266 ? 45.574 -59.851 -14.404 1.00 53.77  ? 260  GLU A CA   1 
ATOM   1556 C  C    . GLU A 1 266 ? 46.027 -61.119 -13.658 1.00 51.15  ? 260  GLU A C    1 
ATOM   1557 O  O    . GLU A 1 266 ? 45.310 -62.121 -13.594 1.00 48.19  ? 260  GLU A O    1 
ATOM   1558 C  CB   . GLU A 1 266 ? 44.159 -60.018 -14.978 1.00 44.46  ? 260  GLU A CB   1 
ATOM   1559 C  CG   . GLU A 1 266 ? 43.410 -58.758 -15.396 1.00 41.82  ? 260  GLU A CG   1 
ATOM   1560 C  CD   . GLU A 1 266 ? 43.081 -57.816 -14.244 1.00 53.64  ? 260  GLU A CD   1 
ATOM   1561 O  OE1  . GLU A 1 266 ? 42.933 -58.293 -13.099 1.00 61.59  ? 260  GLU A OE1  1 
ATOM   1562 O  OE2  . GLU A 1 266 ? 42.882 -56.604 -14.482 1.00 54.01  ? 260  GLU A OE2  1 
ATOM   1563 N  N    . TRP A 1 267 ? 47.261 -61.107 -13.133 1.00 48.79  ? 261  TRP A N    1 
ATOM   1564 C  CA   . TRP A 1 267 ? 47.700 -62.349 -12.502 1.00 49.70  ? 261  TRP A CA   1 
ATOM   1565 C  C    . TRP A 1 267 ? 47.041 -62.594 -11.150 1.00 52.08  ? 261  TRP A C    1 
ATOM   1566 O  O    . TRP A 1 267 ? 47.243 -63.675 -10.576 1.00 47.72  ? 261  TRP A O    1 
ATOM   1567 C  CB   . TRP A 1 267 ? 49.211 -62.462 -12.267 1.00 50.56  ? 261  TRP A CB   1 
ATOM   1568 C  CG   . TRP A 1 267 ? 49.900 -61.399 -11.407 1.00 57.52  ? 261  TRP A CG   1 
ATOM   1569 C  CD1  . TRP A 1 267 ? 49.379 -60.747 -10.323 1.00 57.95  ? 261  TRP A CD1  1 
ATOM   1570 C  CD2  . TRP A 1 267 ? 51.323 -61.168 -11.337 1.00 59.30  ? 261  TRP A CD2  1 
ATOM   1571 N  NE1  . TRP A 1 267 ? 50.333 -59.970 -9.730  1.00 56.84  ? 261  TRP A NE1  1 
ATOM   1572 C  CE2  . TRP A 1 267 ? 51.545 -60.240 -10.305 1.00 56.96  ? 261  TRP A CE2  1 
ATOM   1573 C  CE3  . TRP A 1 267 ? 52.417 -61.597 -12.104 1.00 61.92  ? 261  TRP A CE3  1 
ATOM   1574 C  CZ2  . TRP A 1 267 ? 52.811 -59.733 -10.015 1.00 56.70  ? 261  TRP A CZ2  1 
ATOM   1575 C  CZ3  . TRP A 1 267 ? 53.675 -61.087 -11.816 1.00 62.82  ? 261  TRP A CZ3  1 
ATOM   1576 C  CH2  . TRP A 1 267 ? 53.860 -60.172 -10.773 1.00 61.20  ? 261  TRP A CH2  1 
ATOM   1577 N  N    . GLY A 1 268 ? 46.262 -61.637 -10.638 1.00 48.33  ? 262  GLY A N    1 
ATOM   1578 C  CA   . GLY A 1 268 ? 45.552 -61.883 -9.404  1.00 50.91  ? 262  GLY A CA   1 
ATOM   1579 C  C    . GLY A 1 268 ? 44.848 -63.219 -9.416  1.00 55.54  ? 262  GLY A C    1 
ATOM   1580 O  O    . GLY A 1 268 ? 44.724 -63.876 -8.368  1.00 57.67  ? 262  GLY A O    1 
ATOM   1581 N  N    . ALA A 1 269 ? 44.428 -63.668 -10.601 1.00 48.10  ? 263  ALA A N    1 
ATOM   1582 C  CA   . ALA A 1 269 ? 43.661 -64.887 -10.752 1.00 47.42  ? 263  ALA A CA   1 
ATOM   1583 C  C    . ALA A 1 269 ? 44.529 -66.098 -11.032 1.00 46.72  ? 263  ALA A C    1 
ATOM   1584 O  O    . ALA A 1 269 ? 44.006 -67.202 -11.186 1.00 48.00  ? 263  ALA A O    1 
ATOM   1585 C  CB   . ALA A 1 269 ? 42.616 -64.714 -11.839 1.00 41.97  ? 263  ALA A CB   1 
ATOM   1586 N  N    . PHE A 1 270 ? 45.837 -65.942 -11.048 1.00 44.11  ? 264  PHE A N    1 
ATOM   1587 C  CA   . PHE A 1 270 ? 46.689 -67.111 -11.139 1.00 43.88  ? 264  PHE A CA   1 
ATOM   1588 C  C    . PHE A 1 270 ? 46.314 -68.098 -10.039 1.00 55.24  ? 264  PHE A C    1 
ATOM   1589 O  O    . PHE A 1 270 ? 46.190 -67.732 -8.864  1.00 58.66  ? 264  PHE A O    1 
ATOM   1590 C  CB   . PHE A 1 270 ? 48.147 -66.645 -11.056 1.00 44.18  ? 264  PHE A CB   1 
ATOM   1591 C  CG   . PHE A 1 270 ? 49.165 -67.748 -11.020 1.00 43.34  ? 264  PHE A CG   1 
ATOM   1592 C  CD1  . PHE A 1 270 ? 49.040 -68.850 -11.827 1.00 44.96  ? 264  PHE A CD1  1 
ATOM   1593 C  CD2  . PHE A 1 270 ? 50.374 -67.548 -10.380 1.00 42.70  ? 264  PHE A CD2  1 
ATOM   1594 C  CE1  . PHE A 1 270 ? 50.021 -69.829 -11.847 1.00 48.17  ? 264  PHE A CE1  1 
ATOM   1595 C  CE2  . PHE A 1 270 ? 51.371 -68.510 -10.410 1.00 40.85  ? 264  PHE A CE2  1 
ATOM   1596 C  CZ   . PHE A 1 270 ? 51.192 -69.652 -11.140 1.00 46.20  ? 264  PHE A CZ   1 
ATOM   1597 N  N    . GLY A 1 271 ? 46.054 -69.338 -10.421 1.00 54.47  ? 265  GLY A N    1 
ATOM   1598 C  CA   . GLY A 1 271 ? 45.733 -70.356 -9.437  1.00 56.36  ? 265  GLY A CA   1 
ATOM   1599 C  C    . GLY A 1 271 ? 44.253 -70.643 -9.235  1.00 56.90  ? 265  GLY A C    1 
ATOM   1600 O  O    . GLY A 1 271 ? 43.921 -71.647 -8.591  1.00 58.84  ? 265  GLY A O    1 
ATOM   1601 N  N    . ASP A 1 272 ? 43.356 -69.824 -9.789  1.00 53.23  ? 266  ASP A N    1 
ATOM   1602 C  CA   . ASP A 1 272 ? 41.930 -70.076 -9.633  1.00 50.67  ? 266  ASP A CA   1 
ATOM   1603 C  C    . ASP A 1 272 ? 41.493 -71.437 -10.171 1.00 53.41  ? 266  ASP A C    1 
ATOM   1604 O  O    . ASP A 1 272 ? 40.369 -71.864 -9.894  1.00 58.63  ? 266  ASP A O    1 
ATOM   1605 C  CB   . ASP A 1 272 ? 41.138 -68.966 -10.308 1.00 43.69  ? 266  ASP A CB   1 
ATOM   1606 C  CG   . ASP A 1 272 ? 41.319 -67.647 -9.615  1.00 52.22  ? 266  ASP A CG   1 
ATOM   1607 O  OD1  . ASP A 1 272 ? 41.934 -67.668 -8.535  1.00 54.60  ? 266  ASP A OD1  1 
ATOM   1608 O  OD2  . ASP A 1 272 ? 40.827 -66.604 -10.100 1.00 52.98  ? 266  ASP A OD2  1 
ATOM   1609 N  N    . ASP A 1 273 ? 42.305 -72.095 -10.989 1.00 55.25  ? 267  ASP A N    1 
ATOM   1610 C  CA   . ASP A 1 273 ? 41.970 -73.411 -11.515 1.00 56.04  ? 267  ASP A CA   1 
ATOM   1611 C  C    . ASP A 1 273 ? 42.663 -74.537 -10.756 1.00 62.13  ? 267  ASP A C    1 
ATOM   1612 O  O    . ASP A 1 273 ? 42.632 -75.686 -11.216 1.00 61.75  ? 267  ASP A O    1 
ATOM   1613 C  CB   . ASP A 1 273 ? 42.279 -73.501 -13.018 1.00 59.16  ? 267  ASP A CB   1 
ATOM   1614 C  CG   . ASP A 1 273 ? 43.761 -73.408 -13.330 1.00 65.75  ? 267  ASP A CG   1 
ATOM   1615 O  OD1  . ASP A 1 273 ? 44.531 -73.110 -12.379 1.00 64.64  ? 267  ASP A OD1  1 
ATOM   1616 O  OD2  . ASP A 1 273 ? 44.152 -73.659 -14.513 1.00 60.85  ? 267  ASP A OD2  1 
ATOM   1617 N  N    . GLY A 1 274 ? 43.352 -74.224 -9.654  1.00 58.41  ? 268  GLY A N    1 
ATOM   1618 C  CA   . GLY A 1 274 ? 43.980 -75.231 -8.815  1.00 54.58  ? 268  GLY A CA   1 
ATOM   1619 C  C    . GLY A 1 274 ? 45.455 -75.471 -9.048  1.00 59.35  ? 268  GLY A C    1 
ATOM   1620 O  O    . GLY A 1 274 ? 45.998 -76.453 -8.528  1.00 54.63  ? 268  GLY A O    1 
ATOM   1621 N  N    . SER A 1 275 ? 46.122 -74.620 -9.817  1.00 63.29  ? 269  SER A N    1 
ATOM   1622 C  CA   . SER A 1 275 ? 47.521 -74.862 -10.123 1.00 60.02  ? 269  SER A CA   1 
ATOM   1623 C  C    . SER A 1 275 ? 48.451 -74.505 -8.968  1.00 58.26  ? 269  SER A C    1 
ATOM   1624 O  O    . SER A 1 275 ? 49.598 -74.962 -8.953  1.00 61.78  ? 269  SER A O    1 
ATOM   1625 C  CB   . SER A 1 275 ? 47.893 -74.105 -11.400 1.00 57.10  ? 269  SER A CB   1 
ATOM   1626 O  OG   . SER A 1 275 ? 47.556 -72.728 -11.306 1.00 59.60  ? 269  SER A OG   1 
ATOM   1627 N  N    . LEU A 1 276 ? 48.001 -73.694 -8.013  1.00 61.41  ? 270  LEU A N    1 
ATOM   1628 C  CA   . LEU A 1 276 ? 48.796 -73.359 -6.835  1.00 62.10  ? 270  LEU A CA   1 
ATOM   1629 C  C    . LEU A 1 276 ? 48.435 -74.176 -5.591  1.00 63.94  ? 270  LEU A C    1 
ATOM   1630 O  O    . LEU A 1 276 ? 48.980 -73.906 -4.516  1.00 63.75  ? 270  LEU A O    1 
ATOM   1631 C  CB   . LEU A 1 276 ? 48.691 -71.861 -6.531  1.00 55.53  ? 270  LEU A CB   1 
ATOM   1632 C  CG   . LEU A 1 276 ? 49.280 -71.071 -7.703  1.00 52.67  ? 270  LEU A CG   1 
ATOM   1633 C  CD1  . LEU A 1 276 ? 49.294 -69.573 -7.420  1.00 47.39  ? 270  LEU A CD1  1 
ATOM   1634 C  CD2  . LEU A 1 276 ? 50.651 -71.615 -8.056  1.00 49.71  ? 270  LEU A CD2  1 
ATOM   1635 N  N    . ASN A 1 277 ? 47.539 -75.160 -5.705  1.00 62.62  ? 271  ASN A N    1 
ATOM   1636 C  CA   . ASN A 1 277 ? 47.023 -75.836 -4.521  1.00 58.34  ? 271  ASN A CA   1 
ATOM   1637 C  C    . ASN A 1 277 ? 48.125 -76.487 -3.705  1.00 63.36  ? 271  ASN A C    1 
ATOM   1638 O  O    . ASN A 1 277 ? 48.064 -76.494 -2.468  1.00 66.42  ? 271  ASN A O    1 
ATOM   1639 C  CB   . ASN A 1 277 ? 45.979 -76.867 -4.907  1.00 55.53  ? 271  ASN A CB   1 
ATOM   1640 C  CG   . ASN A 1 277 ? 44.663 -76.238 -5.228  1.00 57.74  ? 271  ASN A CG   1 
ATOM   1641 O  OD1  . ASN A 1 277 ? 44.448 -75.063 -4.928  1.00 59.16  ? 271  ASN A OD1  1 
ATOM   1642 N  ND2  . ASN A 1 277 ? 43.734 -77.032 -5.763  1.00 58.16  ? 271  ASN A ND2  1 
ATOM   1643 N  N    . ASP A 1 278 ? 49.145 -77.032 -4.361  1.00 59.99  ? 272  ASP A N    1 
ATOM   1644 C  CA   . ASP A 1 278 ? 50.160 -77.727 -3.579  1.00 62.95  ? 272  ASP A CA   1 
ATOM   1645 C  C    . ASP A 1 278 ? 51.050 -76.779 -2.769  1.00 62.11  ? 272  ASP A C    1 
ATOM   1646 O  O    . ASP A 1 278 ? 51.806 -77.253 -1.919  1.00 66.41  ? 272  ASP A O    1 
ATOM   1647 C  CB   . ASP A 1 278 ? 51.021 -78.618 -4.478  1.00 63.75  ? 272  ASP A CB   1 
ATOM   1648 C  CG   . ASP A 1 278 ? 51.839 -77.834 -5.486  1.00 68.26  ? 272  ASP A CG   1 
ATOM   1649 O  OD1  . ASP A 1 278 ? 51.618 -76.607 -5.641  1.00 64.68  ? 272  ASP A OD1  1 
ATOM   1650 O  OD2  . ASP A 1 278 ? 52.735 -78.461 -6.097  1.00 69.29  ? 272  ASP A OD2  1 
ATOM   1651 N  N    . ILE A 1 279 ? 51.061 -75.474 -3.059  1.00 64.79  ? 273  ILE A N    1 
ATOM   1652 C  CA   . ILE A 1 279 ? 51.710 -74.521 -2.161  1.00 60.40  ? 273  ILE A CA   1 
ATOM   1653 C  C    . ILE A 1 279 ? 50.719 -73.716 -1.333  1.00 62.19  ? 273  ILE A C    1 
ATOM   1654 O  O    . ILE A 1 279 ? 51.149 -72.983 -0.430  1.00 63.50  ? 273  ILE A O    1 
ATOM   1655 C  CB   . ILE A 1 279 ? 52.672 -73.563 -2.913  1.00 64.40  ? 273  ILE A CB   1 
ATOM   1656 C  CG1  . ILE A 1 279 ? 51.920 -72.590 -3.815  1.00 63.78  ? 273  ILE A CG1  1 
ATOM   1657 C  CG2  . ILE A 1 279 ? 53.692 -74.337 -3.757  1.00 62.90  ? 273  ILE A CG2  1 
ATOM   1658 C  CD1  . ILE A 1 279 ? 51.790 -71.216 -3.198  1.00 65.39  ? 273  ILE A CD1  1 
ATOM   1659 N  N    . ARG A 1 280 ? 49.413 -73.844 -1.571  1.00 61.91  ? 274  ARG A N    1 
ATOM   1660 C  CA   . ARG A 1 280 ? 48.501 -73.033 -0.774  1.00 63.06  ? 274  ARG A CA   1 
ATOM   1661 C  C    . ARG A 1 280 ? 48.311 -73.654 0.603   1.00 67.94  ? 274  ARG A C    1 
ATOM   1662 O  O    . ARG A 1 280 ? 48.832 -74.731 0.919   1.00 70.25  ? 274  ARG A O    1 
ATOM   1663 C  CB   . ARG A 1 280 ? 47.144 -72.852 -1.443  1.00 61.17  ? 274  ARG A CB   1 
ATOM   1664 C  CG   . ARG A 1 280 ? 47.200 -72.150 -2.748  1.00 62.81  ? 274  ARG A CG   1 
ATOM   1665 C  CD   . ARG A 1 280 ? 45.821 -71.857 -3.282  1.00 62.17  ? 274  ARG A CD   1 
ATOM   1666 N  NE   . ARG A 1 280 ? 45.187 -70.693 -2.670  1.00 58.37  ? 274  ARG A NE   1 
ATOM   1667 C  CZ   . ARG A 1 280 ? 44.034 -70.696 -2.014  1.00 58.91  ? 274  ARG A CZ   1 
ATOM   1668 N  NH1  . ARG A 1 280 ? 43.338 -71.818 -1.861  1.00 54.18  ? 274  ARG A NH1  1 
ATOM   1669 N  NH2  . ARG A 1 280 ? 43.561 -69.546 -1.548  1.00 59.38  ? 274  ARG A NH2  1 
ATOM   1670 N  N    . THR A 1 281 ? 47.525 -72.984 1.437   1.00 63.27  ? 275  THR A N    1 
ATOM   1671 C  CA   . THR A 1 281 ? 47.657 -73.267 2.845   1.00 62.62  ? 275  THR A CA   1 
ATOM   1672 C  C    . THR A 1 281 ? 46.283 -73.229 3.505   1.00 64.59  ? 275  THR A C    1 
ATOM   1673 O  O    . THR A 1 281 ? 45.335 -72.608 3.007   1.00 58.88  ? 275  THR A O    1 
ATOM   1674 C  CB   . THR A 1 281 ? 48.638 -72.259 3.458   1.00 63.03  ? 275  THR A CB   1 
ATOM   1675 O  OG1  . THR A 1 281 ? 49.590 -72.964 4.244   1.00 61.43  ? 275  THR A OG1  1 
ATOM   1676 C  CG2  . THR A 1 281 ? 47.908 -71.271 4.363   1.00 53.63  ? 275  THR A CG2  1 
ATOM   1677 N  N    . GLU A 1 282 ? 46.201 -73.946 4.630   1.00 65.40  ? 276  GLU A N    1 
ATOM   1678 C  CA   . GLU A 1 282 ? 45.034 -73.923 5.508   1.00 61.84  ? 276  GLU A CA   1 
ATOM   1679 C  C    . GLU A 1 282 ? 44.533 -72.504 5.765   1.00 58.94  ? 276  GLU A C    1 
ATOM   1680 O  O    . GLU A 1 282 ? 43.321 -72.248 5.791   1.00 54.59  ? 276  GLU A O    1 
ATOM   1681 C  CB   . GLU A 1 282 ? 45.436 -74.591 6.817   1.00 66.27  ? 276  GLU A CB   1 
ATOM   1682 C  CG   . GLU A 1 282 ? 44.467 -74.411 7.947   1.00 75.29  ? 276  GLU A CG   1 
ATOM   1683 C  CD   . GLU A 1 282 ? 45.001 -74.951 9.260   1.00 75.31  ? 276  GLU A CD   1 
ATOM   1684 O  OE1  . GLU A 1 282 ? 46.135 -75.501 9.273   1.00 69.45  ? 276  GLU A OE1  1 
ATOM   1685 O  OE2  . GLU A 1 282 ? 44.288 -74.788 10.279  1.00 79.28  ? 276  GLU A OE2  1 
ATOM   1686 N  N    . PHE A 1 283 ? 45.459 -71.571 5.967   1.00 56.87  ? 277  PHE A N    1 
ATOM   1687 C  CA   . PHE A 1 283 ? 45.089 -70.197 6.269   1.00 54.30  ? 277  PHE A CA   1 
ATOM   1688 C  C    . PHE A 1 283 ? 44.576 -69.499 5.026   1.00 60.64  ? 277  PHE A C    1 
ATOM   1689 O  O    . PHE A 1 283 ? 43.650 -68.682 5.098   1.00 61.39  ? 277  PHE A O    1 
ATOM   1690 C  CB   . PHE A 1 283 ? 46.304 -69.468 6.840   1.00 58.67  ? 277  PHE A CB   1 
ATOM   1691 C  CG   . PHE A 1 283 ? 46.964 -70.204 7.978   1.00 61.09  ? 277  PHE A CG   1 
ATOM   1692 C  CD1  . PHE A 1 283 ? 46.466 -70.116 9.277   1.00 61.97  ? 277  PHE A CD1  1 
ATOM   1693 C  CD2  . PHE A 1 283 ? 48.084 -71.000 7.740   1.00 59.24  ? 277  PHE A CD2  1 
ATOM   1694 C  CE1  . PHE A 1 283 ? 47.085 -70.808 10.312  1.00 65.10  ? 277  PHE A CE1  1 
ATOM   1695 C  CE2  . PHE A 1 283 ? 48.707 -71.698 8.772   1.00 65.23  ? 277  PHE A CE2  1 
ATOM   1696 C  CZ   . PHE A 1 283 ? 48.209 -71.605 10.058  1.00 61.20  ? 277  PHE A CZ   1 
ATOM   1697 N  N    . ASP A 1 284 ? 45.176 -69.824 3.874   1.00 62.33  ? 278  ASP A N    1 
ATOM   1698 C  CA   . ASP A 1 284 ? 44.739 -69.316 2.577   1.00 55.38  ? 278  ASP A CA   1 
ATOM   1699 C  C    . ASP A 1 284 ? 43.335 -69.787 2.232   1.00 55.54  ? 278  ASP A C    1 
ATOM   1700 O  O    . ASP A 1 284 ? 42.497 -68.997 1.779   1.00 55.40  ? 278  ASP A O    1 
ATOM   1701 C  CB   . ASP A 1 284 ? 45.746 -69.773 1.538   1.00 56.98  ? 278  ASP A CB   1 
ATOM   1702 C  CG   . ASP A 1 284 ? 47.003 -68.951 1.565   1.00 59.97  ? 278  ASP A CG   1 
ATOM   1703 O  OD1  . ASP A 1 284 ? 46.897 -67.699 1.720   1.00 53.92  ? 278  ASP A OD1  1 
ATOM   1704 O  OD2  . ASP A 1 284 ? 48.087 -69.581 1.534   1.00 58.08  ? 278  ASP A OD2  1 
ATOM   1705 N  N    . GLN A 1 285 ? 43.057 -71.079 2.448   1.00 55.48  ? 279  GLN A N    1 
ATOM   1706 C  CA   . GLN A 1 285 ? 41.709 -71.594 2.225   1.00 50.79  ? 279  GLN A CA   1 
ATOM   1707 C  C    . GLN A 1 285 ? 40.681 -70.814 3.021   1.00 53.40  ? 279  GLN A C    1 
ATOM   1708 O  O    . GLN A 1 285 ? 39.614 -70.472 2.497   1.00 56.52  ? 279  GLN A O    1 
ATOM   1709 C  CB   . GLN A 1 285 ? 41.634 -73.071 2.577   1.00 49.21  ? 279  GLN A CB   1 
ATOM   1710 C  CG   . GLN A 1 285 ? 42.587 -73.899 1.755   1.00 60.94  ? 279  GLN A CG   1 
ATOM   1711 C  CD   . GLN A 1 285 ? 42.473 -75.377 2.026   1.00 72.83  ? 279  GLN A CD   1 
ATOM   1712 O  OE1  . GLN A 1 285 ? 41.986 -75.793 3.077   1.00 79.85  ? 279  GLN A OE1  1 
ATOM   1713 N  NE2  . GLN A 1 285 ? 42.925 -76.187 1.075   1.00 81.36  ? 279  GLN A NE2  1 
ATOM   1714 N  N    . GLU A 1 286 ? 40.992 -70.499 4.284   1.00 55.34  ? 280  GLU A N    1 
ATOM   1715 C  CA   . GLU A 1 286 ? 40.012 -69.833 5.125   1.00 53.06  ? 280  GLU A CA   1 
ATOM   1716 C  C    . GLU A 1 286 ? 39.820 -68.378 4.721   1.00 55.07  ? 280  GLU A C    1 
ATOM   1717 O  O    . GLU A 1 286 ? 38.686 -67.887 4.704   1.00 54.42  ? 280  GLU A O    1 
ATOM   1718 C  CB   . GLU A 1 286 ? 40.403 -69.952 6.595   1.00 60.83  ? 280  GLU A CB   1 
ATOM   1719 C  CG   . GLU A 1 286 ? 39.358 -69.315 7.519   1.00 65.57  ? 280  GLU A CG   1 
ATOM   1720 C  CD   . GLU A 1 286 ? 39.640 -69.520 8.995   1.00 73.37  ? 280  GLU A CD   1 
ATOM   1721 O  OE1  . GLU A 1 286 ? 40.676 -70.146 9.328   1.00 75.22  ? 280  GLU A OE1  1 
ATOM   1722 O  OE2  . GLU A 1 286 ? 38.814 -69.056 9.817   1.00 75.41  ? 280  GLU A OE2  1 
ATOM   1723 N  N    . ILE A 1 287 ? 40.906 -67.661 4.396   1.00 59.62  ? 281  ILE A N    1 
ATOM   1724 C  CA   . ILE A 1 287 ? 40.736 -66.308 3.855   1.00 60.63  ? 281  ILE A CA   1 
ATOM   1725 C  C    . ILE A 1 287 ? 39.863 -66.349 2.607   1.00 60.68  ? 281  ILE A C    1 
ATOM   1726 O  O    . ILE A 1 287 ? 38.985 -65.495 2.418   1.00 62.37  ? 281  ILE A O    1 
ATOM   1727 C  CB   . ILE A 1 287 ? 42.095 -65.628 3.570   1.00 63.20  ? 281  ILE A CB   1 
ATOM   1728 C  CG1  . ILE A 1 287 ? 42.804 -65.205 4.860   1.00 61.92  ? 281  ILE A CG1  1 
ATOM   1729 C  CG2  . ILE A 1 287 ? 41.934 -64.409 2.659   1.00 61.27  ? 281  ILE A CG2  1 
ATOM   1730 C  CD1  . ILE A 1 287 ? 43.991 -66.038 5.182   1.00 62.47  ? 281  ILE A CD1  1 
ATOM   1731 N  N    . ASP A 1 288 ? 40.069 -67.356 1.749   1.00 52.47  ? 282  ASP A N    1 
ATOM   1732 C  CA   . ASP A 1 288 ? 39.263 -67.463 0.539   1.00 55.45  ? 282  ASP A CA   1 
ATOM   1733 C  C    . ASP A 1 288 ? 37.790 -67.677 0.871   1.00 58.11  ? 282  ASP A C    1 
ATOM   1734 O  O    . ASP A 1 288 ? 36.930 -66.914 0.413   1.00 54.92  ? 282  ASP A O    1 
ATOM   1735 C  CB   . ASP A 1 288 ? 39.822 -68.568 -0.363  1.00 58.52  ? 282  ASP A CB   1 
ATOM   1736 C  CG   . ASP A 1 288 ? 38.972 -68.807 -1.603  1.00 59.05  ? 282  ASP A CG   1 
ATOM   1737 O  OD1  . ASP A 1 288 ? 38.519 -67.816 -2.219  1.00 56.15  ? 282  ASP A OD1  1 
ATOM   1738 O  OD2  . ASP A 1 288 ? 38.841 -69.989 -2.006  1.00 56.68  ? 282  ASP A OD2  1 
ATOM   1739 N  N    . MET A 1 289 ? 37.482 -68.684 1.703   1.00 57.85  ? 283  MET A N    1 
ATOM   1740 C  CA   . MET A 1 289 ? 36.089 -68.963 2.061   1.00 53.93  ? 283  MET A CA   1 
ATOM   1741 C  C    . MET A 1 289 ? 35.412 -67.762 2.708   1.00 53.22  ? 283  MET A C    1 
ATOM   1742 O  O    . MET A 1 289 ? 34.215 -67.535 2.506   1.00 56.43  ? 283  MET A O    1 
ATOM   1743 C  CB   . MET A 1 289 ? 36.013 -70.147 3.003   1.00 54.33  ? 283  MET A CB   1 
ATOM   1744 C  CG   . MET A 1 289 ? 36.617 -71.411 2.474   1.00 62.22  ? 283  MET A CG   1 
ATOM   1745 S  SD   . MET A 1 289 ? 35.753 -72.109 1.072   1.00 77.10  ? 283  MET A SD   1 
ATOM   1746 C  CE   . MET A 1 289 ? 36.784 -73.562 0.863   1.00 73.92  ? 283  MET A CE   1 
ATOM   1747 N  N    . GLY A 1 290 ? 36.145 -66.993 3.505   1.00 53.74  ? 284  GLY A N    1 
ATOM   1748 C  CA   . GLY A 1 290 ? 35.535 -65.825 4.109   1.00 54.69  ? 284  GLY A CA   1 
ATOM   1749 C  C    . GLY A 1 290 ? 35.367 -64.637 3.190   1.00 58.78  ? 284  GLY A C    1 
ATOM   1750 O  O    . GLY A 1 290 ? 34.713 -63.657 3.570   1.00 59.66  ? 284  GLY A O    1 
ATOM   1751 N  N    . SER A 1 291 ? 35.929 -64.708 1.986   1.00 58.05  ? 285  SER A N    1 
ATOM   1752 C  CA   . SER A 1 291 ? 36.014 -63.560 1.099   1.00 55.67  ? 285  SER A CA   1 
ATOM   1753 C  C    . SER A 1 291 ? 34.675 -63.243 0.452   1.00 55.28  ? 285  SER A C    1 
ATOM   1754 O  O    . SER A 1 291 ? 33.769 -64.073 0.393   1.00 57.39  ? 285  SER A O    1 
ATOM   1755 C  CB   . SER A 1 291 ? 37.060 -63.805 0.024   1.00 59.55  ? 285  SER A CB   1 
ATOM   1756 O  OG   . SER A 1 291 ? 36.735 -64.956 -0.709  1.00 59.20  ? 285  SER A OG   1 
ATOM   1757 N  N    . LEU A 1 292 ? 34.560 -61.999 -0.012  1.00 57.30  ? 286  LEU A N    1 
ATOM   1758 C  CA   . LEU A 1 292 ? 33.427 -61.529 -0.799  1.00 56.25  ? 286  LEU A CA   1 
ATOM   1759 C  C    . LEU A 1 292 ? 33.411 -62.107 -2.206  1.00 57.24  ? 286  LEU A C    1 
ATOM   1760 O  O    . LEU A 1 292 ? 32.439 -61.894 -2.941  1.00 57.94  ? 286  LEU A O    1 
ATOM   1761 C  CB   . LEU A 1 292 ? 33.458 -60.007 -0.887  1.00 57.76  ? 286  LEU A CB   1 
ATOM   1762 C  CG   . LEU A 1 292 ? 32.858 -59.275 0.304   1.00 54.19  ? 286  LEU A CG   1 
ATOM   1763 C  CD1  . LEU A 1 292 ? 33.639 -59.676 1.528   1.00 76.78  ? 286  LEU A CD1  1 
ATOM   1764 C  CD2  . LEU A 1 292 ? 32.943 -57.767 0.091   1.00 53.64  ? 286  LEU A CD2  1 
ATOM   1765 N  N    . ASN A 1 293 ? 34.469 -62.807 -2.596  1.00 52.62  ? 287  ASN A N    1 
ATOM   1766 C  CA   . ASN A 1 293 ? 34.601 -63.352 -3.942  1.00 50.92  ? 287  ASN A CA   1 
ATOM   1767 C  C    . ASN A 1 293 ? 35.230 -64.735 -3.851  1.00 53.55  ? 287  ASN A C    1 
ATOM   1768 O  O    . ASN A 1 293 ? 36.298 -64.993 -4.413  1.00 57.05  ? 287  ASN A O    1 
ATOM   1769 C  CB   . ASN A 1 293 ? 35.438 -62.418 -4.815  1.00 52.10  ? 287  ASN A CB   1 
ATOM   1770 C  CG   . ASN A 1 293 ? 36.894 -62.321 -4.362  1.00 59.10  ? 287  ASN A CG   1 
ATOM   1771 O  OD1  . ASN A 1 293 ? 37.251 -62.674 -3.222  1.00 66.55  ? 287  ASN A OD1  1 
ATOM   1772 N  ND2  . ASN A 1 293 ? 37.748 -61.861 -5.262  1.00 58.89  ? 287  ASN A ND2  1 
ATOM   1773 N  N    . PRO A 1 294 ? 34.585 -65.660 -3.161  1.00 51.02  ? 288  PRO A N    1 
ATOM   1774 C  CA   . PRO A 1 294 ? 35.251 -66.936 -2.891  1.00 50.28  ? 288  PRO A CA   1 
ATOM   1775 C  C    . PRO A 1 294 ? 35.435 -67.719 -4.169  1.00 54.21  ? 288  PRO A C    1 
ATOM   1776 O  O    . PRO A 1 294 ? 34.548 -67.756 -5.027  1.00 57.59  ? 288  PRO A O    1 
ATOM   1777 C  CB   . PRO A 1 294 ? 34.322 -67.637 -1.884  1.00 47.58  ? 288  PRO A CB   1 
ATOM   1778 C  CG   . PRO A 1 294 ? 33.016 -66.911 -1.947  1.00 47.67  ? 288  PRO A CG   1 
ATOM   1779 C  CD   . PRO A 1 294 ? 33.258 -65.545 -2.527  1.00 53.73  ? 288  PRO A CD   1 
ATOM   1780 N  N    . GLY A 1 295 ? 36.631 -68.304 -4.309  1.00 57.65  ? 289  GLY A N    1 
ATOM   1781 C  CA   . GLY A 1 295 ? 37.030 -69.056 -5.480  1.00 52.67  ? 289  GLY A CA   1 
ATOM   1782 C  C    . GLY A 1 295 ? 37.880 -68.291 -6.476  1.00 58.61  ? 289  GLY A C    1 
ATOM   1783 O  O    . GLY A 1 295 ? 38.606 -68.920 -7.255  1.00 59.98  ? 289  GLY A O    1 
ATOM   1784 N  N    . LYS A 1 296 ? 37.818 -66.958 -6.462  1.00 59.38  ? 290  LYS A N    1 
ATOM   1785 C  CA   . LYS A 1 296 ? 38.508 -66.092 -7.409  1.00 58.94  ? 290  LYS A CA   1 
ATOM   1786 C  C    . LYS A 1 296 ? 39.683 -65.374 -6.740  1.00 62.93  ? 290  LYS A C    1 
ATOM   1787 O  O    . LYS A 1 296 ? 39.664 -65.095 -5.537  1.00 59.89  ? 290  LYS A O    1 
ATOM   1788 C  CB   . LYS A 1 296 ? 37.578 -65.021 -7.972  1.00 57.54  ? 290  LYS A CB   1 
ATOM   1789 C  CG   . LYS A 1 296 ? 36.317 -65.482 -8.641  1.00 68.08  ? 290  LYS A CG   1 
ATOM   1790 C  CD   . LYS A 1 296 ? 36.550 -66.223 -9.949  1.00 79.82  ? 290  LYS A CD   1 
ATOM   1791 C  CE   . LYS A 1 296 ? 35.238 -66.338 -10.703 1.00 78.86  ? 290  LYS A CE   1 
ATOM   1792 N  NZ   . LYS A 1 296 ? 34.214 -67.113 -9.943  1.00 69.81  ? 290  LYS A NZ   1 
ATOM   1793 N  N    . GLN A 1 297 ? 40.698 -65.059 -7.549  1.00 60.71  ? 291  GLN A N    1 
ATOM   1794 C  CA   . GLN A 1 297 ? 41.839 -64.230 -7.147  1.00 53.89  ? 291  GLN A CA   1 
ATOM   1795 C  C    . GLN A 1 297 ? 42.750 -64.933 -6.134  1.00 55.07  ? 291  GLN A C    1 
ATOM   1796 O  O    . GLN A 1 297 ? 43.341 -64.293 -5.263  1.00 52.61  ? 291  GLN A O    1 
ATOM   1797 C  CB   . GLN A 1 297 ? 41.350 -62.884 -6.609  1.00 49.67  ? 291  GLN A CB   1 
ATOM   1798 C  CG   . GLN A 1 297 ? 40.532 -62.092 -7.623  1.00 53.35  ? 291  GLN A CG   1 
ATOM   1799 C  CD   . GLN A 1 297 ? 41.339 -61.653 -8.866  1.00 61.43  ? 291  GLN A CD   1 
ATOM   1800 O  OE1  . GLN A 1 297 ? 41.311 -62.319 -9.909  1.00 67.44  ? 291  GLN A OE1  1 
ATOM   1801 N  NE2  . GLN A 1 297 ? 42.022 -60.517 -8.765  1.00 54.80  ? 291  GLN A NE2  1 
ATOM   1802 N  N    . LEU A 1 298 ? 42.930 -66.249 -6.286  1.00 52.51  ? 292  LEU A N    1 
ATOM   1803 C  CA   . LEU A 1 298 ? 43.609 -67.002 -5.237  1.00 53.08  ? 292  LEU A CA   1 
ATOM   1804 C  C    . LEU A 1 298 ? 45.069 -66.591 -5.072  1.00 56.60  ? 292  LEU A C    1 
ATOM   1805 O  O    . LEU A 1 298 ? 45.602 -66.642 -3.957  1.00 69.65  ? 292  LEU A O    1 
ATOM   1806 C  CB   . LEU A 1 298 ? 43.504 -68.507 -5.480  1.00 50.44  ? 292  LEU A CB   1 
ATOM   1807 C  CG   . LEU A 1 298 ? 42.073 -69.067 -5.488  1.00 53.00  ? 292  LEU A CG   1 
ATOM   1808 C  CD1  . LEU A 1 298 ? 42.059 -70.589 -5.579  1.00 50.02  ? 292  LEU A CD1  1 
ATOM   1809 C  CD2  . LEU A 1 298 ? 41.238 -68.565 -4.338  1.00 50.80  ? 292  LEU A CD2  1 
ATOM   1810 N  N    . PHE A 1 299 ? 45.736 -66.180 -6.144  1.00 60.17  ? 293  PHE A N    1 
ATOM   1811 C  CA   . PHE A 1 299 ? 47.116 -65.713 -6.013  1.00 56.67  ? 293  PHE A CA   1 
ATOM   1812 C  C    . PHE A 1 299 ? 47.153 -64.326 -5.378  1.00 58.27  ? 293  PHE A C    1 
ATOM   1813 O  O    . PHE A 1 299 ? 48.031 -64.024 -4.558  1.00 53.85  ? 293  PHE A O    1 
ATOM   1814 C  CB   . PHE A 1 299 ? 47.758 -65.722 -7.398  1.00 51.34  ? 293  PHE A CB   1 
ATOM   1815 C  CG   . PHE A 1 299 ? 49.215 -65.371 -7.435  1.00 49.95  ? 293  PHE A CG   1 
ATOM   1816 C  CD1  . PHE A 1 299 ? 50.181 -66.316 -7.092  1.00 48.43  ? 293  PHE A CD1  1 
ATOM   1817 C  CD2  . PHE A 1 299 ? 49.629 -64.124 -7.915  1.00 49.25  ? 293  PHE A CD2  1 
ATOM   1818 C  CE1  . PHE A 1 299 ? 51.543 -65.999 -7.173  1.00 51.38  ? 293  PHE A CE1  1 
ATOM   1819 C  CE2  . PHE A 1 299 ? 50.976 -63.800 -8.007  1.00 49.21  ? 293  PHE A CE2  1 
ATOM   1820 C  CZ   . PHE A 1 299 ? 51.941 -64.733 -7.639  1.00 47.00  ? 293  PHE A CZ   1 
ATOM   1821 N  N    . GLU A 1 300 ? 46.198 -63.466 -5.740  1.00 55.83  ? 294  GLU A N    1 
ATOM   1822 C  CA   . GLU A 1 300 ? 46.183 -62.139 -5.153  1.00 53.84  ? 294  GLU A CA   1 
ATOM   1823 C  C    . GLU A 1 300 ? 46.006 -62.232 -3.649  1.00 61.38  ? 294  GLU A C    1 
ATOM   1824 O  O    . GLU A 1 300 ? 46.587 -61.441 -2.896  1.00 63.05  ? 294  GLU A O    1 
ATOM   1825 C  CB   . GLU A 1 300 ? 45.058 -61.310 -5.757  1.00 51.75  ? 294  GLU A CB   1 
ATOM   1826 C  CG   . GLU A 1 300 ? 45.211 -59.833 -5.542  1.00 54.98  ? 294  GLU A CG   1 
ATOM   1827 C  CD   . GLU A 1 300 ? 44.018 -59.053 -6.030  1.00 60.24  ? 294  GLU A CD   1 
ATOM   1828 O  OE1  . GLU A 1 300 ? 42.942 -59.652 -6.176  1.00 64.07  ? 294  GLU A OE1  1 
ATOM   1829 O  OE2  . GLU A 1 300 ? 44.162 -57.858 -6.346  1.00 62.56  ? 294  GLU A OE2  1 
ATOM   1830 N  N    . LYS A 1 301 ? 45.214 -63.207 -3.195  1.00 63.66  ? 295  LYS A N    1 
ATOM   1831 C  CA   . LYS A 1 301 ? 44.858 -63.287 -1.785  1.00 57.33  ? 295  LYS A CA   1 
ATOM   1832 C  C    . LYS A 1 301 ? 46.030 -63.728 -0.936  1.00 59.32  ? 295  LYS A C    1 
ATOM   1833 O  O    . LYS A 1 301 ? 46.072 -63.406 0.259   1.00 61.02  ? 295  LYS A O    1 
ATOM   1834 C  CB   . LYS A 1 301 ? 43.662 -64.218 -1.588  1.00 55.70  ? 295  LYS A CB   1 
ATOM   1835 C  CG   . LYS A 1 301 ? 42.371 -63.599 -2.042  1.00 55.00  ? 295  LYS A CG   1 
ATOM   1836 C  CD   . LYS A 1 301 ? 41.230 -64.560 -2.015  1.00 56.48  ? 295  LYS A CD   1 
ATOM   1837 C  CE   . LYS A 1 301 ? 39.967 -63.859 -2.453  1.00 56.43  ? 295  LYS A CE   1 
ATOM   1838 N  NZ   . LYS A 1 301 ? 38.857 -64.823 -2.475  1.00 58.33  ? 295  LYS A NZ   1 
ATOM   1839 N  N    . MET A 1 302 ? 46.991 -64.442 -1.523  1.00 53.90  ? 296  MET A N    1 
ATOM   1840 C  CA   . MET A 1 302 ? 48.190 -64.820 -0.792  1.00 58.95  ? 296  MET A CA   1 
ATOM   1841 C  C    . MET A 1 302 ? 49.340 -63.820 -0.963  1.00 60.22  ? 296  MET A C    1 
ATOM   1842 O  O    . MET A 1 302 ? 50.468 -64.123 -0.575  1.00 67.46  ? 296  MET A O    1 
ATOM   1843 C  CB   . MET A 1 302 ? 48.608 -66.266 -1.124  1.00 51.80  ? 296  MET A CB   1 
ATOM   1844 C  CG   . MET A 1 302 ? 48.918 -66.655 -2.510  1.00 58.82  ? 296  MET A CG   1 
ATOM   1845 S  SD   . MET A 1 302 ? 49.109 -68.472 -2.617  1.00 67.27  ? 296  MET A SD   1 
ATOM   1846 C  CE   . MET A 1 302 ? 47.383 -68.914 -2.696  1.00 65.92  ? 296  MET A CE   1 
ATOM   1847 N  N    . ILE A 1 303 ? 49.079 -62.654 -1.547  1.00 54.36  ? 297  ILE A N    1 
ATOM   1848 C  CA   . ILE A 1 303 ? 50.091 -61.675 -1.938  1.00 52.17  ? 297  ILE A CA   1 
ATOM   1849 C  C    . ILE A 1 303 ? 49.700 -60.272 -1.496  1.00 52.97  ? 297  ILE A C    1 
ATOM   1850 O  O    . ILE A 1 303 ? 50.509 -59.528 -0.940  1.00 57.94  ? 297  ILE A O    1 
ATOM   1851 C  CB   . ILE A 1 303 ? 50.338 -61.756 -3.455  1.00 64.70  ? 297  ILE A CB   1 
ATOM   1852 C  CG1  . ILE A 1 303 ? 51.298 -62.894 -3.748  1.00 59.81  ? 297  ILE A CG1  1 
ATOM   1853 C  CG2  . ILE A 1 303 ? 50.737 -60.401 -4.095  1.00 63.18  ? 297  ILE A CG2  1 
ATOM   1854 C  CD1  . ILE A 1 303 ? 51.481 -63.036 -5.190  1.00 61.31  ? 297  ILE A CD1  1 
ATOM   1855 N  N    . SER A 1 304 ? 48.490 -59.875 -1.849  1.00 50.94  ? 298  SER A N    1 
ATOM   1856 C  CA   . SER A 1 304 ? 48.006 -58.515 -1.724  1.00 50.44  ? 298  SER A CA   1 
ATOM   1857 C  C    . SER A 1 304 ? 48.023 -58.029 -0.271  1.00 62.04  ? 298  SER A C    1 
ATOM   1858 O  O    . SER A 1 304 ? 48.118 -58.804 0.694   1.00 61.05  ? 298  SER A O    1 
ATOM   1859 C  CB   . SER A 1 304 ? 46.586 -58.451 -2.273  1.00 54.09  ? 298  SER A CB   1 
ATOM   1860 O  OG   . SER A 1 304 ? 46.047 -57.160 -2.167  1.00 57.89  ? 298  SER A OG   1 
ATOM   1861 N  N    . GLY A 1 305 ? 47.964 -56.705 -0.129  1.00 62.00  ? 299  GLY A N    1 
ATOM   1862 C  CA   . GLY A 1 305 ? 47.930 -56.103 1.191   1.00 57.33  ? 299  GLY A CA   1 
ATOM   1863 C  C    . GLY A 1 305 ? 46.602 -56.253 1.905   1.00 63.26  ? 299  GLY A C    1 
ATOM   1864 O  O    . GLY A 1 305 ? 46.550 -56.241 3.140   1.00 72.09  ? 299  GLY A O    1 
ATOM   1865 N  N    . MET A 1 306 ? 45.514 -56.403 1.161   1.00 62.57  ? 300  MET A N    1 
ATOM   1866 C  CA   . MET A 1 306 ? 44.210 -56.527 1.808   1.00 67.10  ? 300  MET A CA   1 
ATOM   1867 C  C    . MET A 1 306 ? 44.114 -57.770 2.694   1.00 64.81  ? 300  MET A C    1 
ATOM   1868 O  O    . MET A 1 306 ? 43.324 -57.793 3.643   1.00 63.22  ? 300  MET A O    1 
ATOM   1869 C  CB   . MET A 1 306 ? 43.108 -56.527 0.748   1.00 67.88  ? 300  MET A CB   1 
ATOM   1870 C  CG   . MET A 1 306 ? 41.712 -56.861 1.256   1.00 74.09  ? 300  MET A CG   1 
ATOM   1871 S  SD   . MET A 1 306 ? 40.440 -56.653 -0.022  1.00 85.47  ? 300  MET A SD   1 
ATOM   1872 C  CE   . MET A 1 306 ? 40.978 -57.850 -1.214  1.00 63.24  ? 300  MET A CE   1 
ATOM   1873 N  N    . TYR A 1 307 ? 44.844 -58.829 2.367   1.00 63.22  ? 301  TYR A N    1 
ATOM   1874 C  CA   . TYR A 1 307 ? 44.739 -60.096 3.080   1.00 63.43  ? 301  TYR A CA   1 
ATOM   1875 C  C    . TYR A 1 307 ? 45.906 -60.413 4.008   1.00 63.41  ? 301  TYR A C    1 
ATOM   1876 O  O    . TYR A 1 307 ? 45.914 -61.500 4.590   1.00 63.46  ? 301  TYR A O    1 
ATOM   1877 C  CB   . TYR A 1 307 ? 44.602 -61.232 2.060   1.00 73.48  ? 301  TYR A CB   1 
ATOM   1878 C  CG   . TYR A 1 307 ? 43.466 -61.055 1.085   1.00 71.50  ? 301  TYR A CG   1 
ATOM   1879 C  CD1  . TYR A 1 307 ? 42.138 -60.920 1.517   1.00 70.47  ? 301  TYR A CD1  1 
ATOM   1880 C  CD2  . TYR A 1 307 ? 43.736 -60.944 -0.278  1.00 71.39  ? 301  TYR A CD2  1 
ATOM   1881 C  CE1  . TYR A 1 307 ? 41.108 -60.733 0.595   1.00 74.45  ? 301  TYR A CE1  1 
ATOM   1882 C  CE2  . TYR A 1 307 ? 42.721 -60.757 -1.212  1.00 72.11  ? 301  TYR A CE2  1 
ATOM   1883 C  CZ   . TYR A 1 307 ? 41.415 -60.666 -0.781  1.00 75.71  ? 301  TYR A CZ   1 
ATOM   1884 O  OH   . TYR A 1 307 ? 40.434 -60.478 -1.734  1.00 72.31  ? 301  TYR A OH   1 
ATOM   1885 N  N    . MET A 1 308 ? 46.945 -59.570 4.089   1.00 66.50  ? 302  MET A N    1 
ATOM   1886 C  CA   . MET A 1 308 ? 48.139 -60.013 4.815   1.00 66.15  ? 302  MET A CA   1 
ATOM   1887 C  C    . MET A 1 308 ? 47.965 -59.926 6.319   1.00 69.92  ? 302  MET A C    1 
ATOM   1888 O  O    . MET A 1 308 ? 48.434 -60.810 7.041   1.00 68.43  ? 302  MET A O    1 
ATOM   1889 C  CB   . MET A 1 308 ? 49.391 -59.221 4.437   1.00 68.16  ? 302  MET A CB   1 
ATOM   1890 C  CG   . MET A 1 308 ? 50.070 -59.634 3.156   1.00 81.35  ? 302  MET A CG   1 
ATOM   1891 S  SD   . MET A 1 308 ? 51.622 -58.731 3.028   1.00 88.54  ? 302  MET A SD   1 
ATOM   1892 C  CE   . MET A 1 308 ? 52.521 -59.496 4.387   1.00 64.37  ? 302  MET A CE   1 
ATOM   1893 N  N    . GLY A 1 309 ? 47.364 -58.844 6.817   1.00 66.94  ? 303  GLY A N    1 
ATOM   1894 C  CA   . GLY A 1 309 ? 47.053 -58.800 8.233   1.00 72.09  ? 303  GLY A CA   1 
ATOM   1895 C  C    . GLY A 1 309 ? 46.174 -59.965 8.638   1.00 71.12  ? 303  GLY A C    1 
ATOM   1896 O  O    . GLY A 1 309 ? 46.450 -60.660 9.621   1.00 63.13  ? 303  GLY A O    1 
ATOM   1897 N  N    . GLU A 1 310 ? 45.118 -60.211 7.853   1.00 68.52  ? 304  GLU A N    1 
ATOM   1898 C  CA   . GLU A 1 310 ? 44.187 -61.288 8.140   1.00 66.71  ? 304  GLU A CA   1 
ATOM   1899 C  C    . GLU A 1 310 ? 44.874 -62.635 8.069   1.00 63.82  ? 304  GLU A C    1 
ATOM   1900 O  O    . GLU A 1 310 ? 44.422 -63.606 8.684   1.00 70.22  ? 304  GLU A O    1 
ATOM   1901 C  CB   . GLU A 1 310 ? 43.015 -61.210 7.164   1.00 64.30  ? 304  GLU A CB   1 
ATOM   1902 C  CG   . GLU A 1 310 ? 41.920 -62.266 7.314   1.00 71.60  ? 304  GLU A CG   1 
ATOM   1903 C  CD   . GLU A 1 310 ? 41.108 -62.173 8.607   1.00 72.47  ? 304  GLU A CD   1 
ATOM   1904 O  OE1  . GLU A 1 310 ? 41.281 -61.214 9.387   1.00 69.83  ? 304  GLU A OE1  1 
ATOM   1905 O  OE2  . GLU A 1 310 ? 40.251 -63.057 8.806   1.00 75.04  ? 304  GLU A OE2  1 
ATOM   1906 N  N    . LEU A 1 311 ? 45.974 -62.711 7.366   1.00 62.77  ? 305  LEU A N    1 
ATOM   1907 C  CA   . LEU A 1 311 ? 46.610 -64.000 7.202   1.00 66.30  ? 305  LEU A CA   1 
ATOM   1908 C  C    . LEU A 1 311 ? 47.437 -64.337 8.431   1.00 65.23  ? 305  LEU A C    1 
ATOM   1909 O  O    . LEU A 1 311 ? 47.513 -65.503 8.825   1.00 66.55  ? 305  LEU A O    1 
ATOM   1910 C  CB   . LEU A 1 311 ? 47.416 -63.970 5.894   1.00 65.21  ? 305  LEU A CB   1 
ATOM   1911 C  CG   . LEU A 1 311 ? 48.092 -65.152 5.222   1.00 63.15  ? 305  LEU A CG   1 
ATOM   1912 C  CD1  . LEU A 1 311 ? 47.094 -66.255 5.003   1.00 58.28  ? 305  LEU A CD1  1 
ATOM   1913 C  CD2  . LEU A 1 311 ? 48.543 -64.638 3.876   1.00 59.95  ? 305  LEU A CD2  1 
ATOM   1914 N  N    . VAL A 1 312 ? 48.025 -63.325 9.069   1.00 65.71  ? 306  VAL A N    1 
ATOM   1915 C  CA   . VAL A 1 312 ? 48.808 -63.541 10.282  1.00 67.79  ? 306  VAL A CA   1 
ATOM   1916 C  C    . VAL A 1 312 ? 47.908 -63.646 11.513  1.00 65.31  ? 306  VAL A C    1 
ATOM   1917 O  O    . VAL A 1 312 ? 48.152 -64.479 12.388  1.00 59.90  ? 306  VAL A O    1 
ATOM   1918 C  CB   . VAL A 1 312 ? 49.872 -62.438 10.420  1.00 69.31  ? 306  VAL A CB   1 
ATOM   1919 C  CG1  . VAL A 1 312 ? 49.230 -61.092 10.235  1.00 67.06  ? 306  VAL A CG1  1 
ATOM   1920 C  CG2  . VAL A 1 312 ? 50.546 -62.516 11.797  1.00 65.80  ? 306  VAL A CG2  1 
ATOM   1921 N  N    . ARG A 1 313 ? 46.850 -62.831 11.592  1.00 63.85  ? 307  ARG A N    1 
ATOM   1922 C  CA   . ARG A 1 313 ? 45.819 -63.053 12.599  1.00 56.69  ? 307  ARG A CA   1 
ATOM   1923 C  C    . ARG A 1 313 ? 45.430 -64.525 12.653  1.00 61.96  ? 307  ARG A C    1 
ATOM   1924 O  O    . ARG A 1 313 ? 45.661 -65.204 13.654  1.00 72.54  ? 307  ARG A O    1 
ATOM   1925 C  CB   . ARG A 1 313 ? 44.582 -62.197 12.332  1.00 61.16  ? 307  ARG A CB   1 
ATOM   1926 C  CG   . ARG A 1 313 ? 43.540 -62.401 13.411  1.00 63.05  ? 307  ARG A CG   1 
ATOM   1927 C  CD   . ARG A 1 313 ? 42.269 -61.555 13.290  1.00 67.99  ? 307  ARG A CD   1 
ATOM   1928 N  NE   . ARG A 1 313 ? 41.352 -62.027 12.261  1.00 75.09  ? 307  ARG A NE   1 
ATOM   1929 C  CZ   . ARG A 1 313 ? 40.500 -63.042 12.408  1.00 76.06  ? 307  ARG A CZ   1 
ATOM   1930 N  NH1  . ARG A 1 313 ? 40.451 -63.728 13.540  1.00 71.79  ? 307  ARG A NH1  1 
ATOM   1931 N  NH2  . ARG A 1 313 ? 39.703 -63.391 11.404  1.00 76.21  ? 307  ARG A NH2  1 
ATOM   1932 N  N    . LEU A 1 314 ? 44.858 -65.049 11.577  1.00 61.53  ? 308  LEU A N    1 
ATOM   1933 C  CA   . LEU A 1 314 ? 44.417 -66.439 11.606  1.00 64.32  ? 308  LEU A CA   1 
ATOM   1934 C  C    . LEU A 1 314 ? 45.515 -67.371 12.091  1.00 62.30  ? 308  LEU A C    1 
ATOM   1935 O  O    . LEU A 1 314 ? 45.224 -68.430 12.659  1.00 60.14  ? 308  LEU A O    1 
ATOM   1936 C  CB   . LEU A 1 314 ? 43.950 -66.895 10.214  1.00 66.69  ? 308  LEU A CB   1 
ATOM   1937 C  CG   . LEU A 1 314 ? 42.741 -66.208 9.577   1.00 64.79  ? 308  LEU A CG   1 
ATOM   1938 C  CD1  . LEU A 1 314 ? 42.432 -66.881 8.258   1.00 65.37  ? 308  LEU A CD1  1 
ATOM   1939 C  CD2  . LEU A 1 314 ? 41.525 -66.197 10.506  1.00 66.30  ? 308  LEU A CD2  1 
ATOM   1940 N  N    . ILE A 1 315 ? 46.777 -67.015 11.856  1.00 64.79  ? 309  ILE A N    1 
ATOM   1941 C  CA   . ILE A 1 315 ? 47.870 -67.892 12.265  1.00 67.57  ? 309  ILE A CA   1 
ATOM   1942 C  C    . ILE A 1 315 ? 48.058 -67.827 13.763  1.00 66.22  ? 309  ILE A C    1 
ATOM   1943 O  O    . ILE A 1 315 ? 48.338 -68.843 14.407  1.00 70.26  ? 309  ILE A O    1 
ATOM   1944 C  CB   . ILE A 1 315 ? 49.173 -67.530 11.529  1.00 68.00  ? 309  ILE A CB   1 
ATOM   1945 C  CG1  . ILE A 1 315 ? 49.057 -67.839 10.033  1.00 63.79  ? 309  ILE A CG1  1 
ATOM   1946 C  CG2  . ILE A 1 315 ? 50.351 -68.264 12.151  1.00 63.40  ? 309  ILE A CG2  1 
ATOM   1947 C  CD1  . ILE A 1 315 ? 50.208 -67.293 9.195   1.00 63.54  ? 309  ILE A CD1  1 
ATOM   1948 N  N    . LEU A 1 316 ? 47.936 -66.621 14.327  1.00 65.49  ? 310  LEU A N    1 
ATOM   1949 C  CA   . LEU A 1 316 ? 47.962 -66.456 15.773  1.00 64.53  ? 310  LEU A CA   1 
ATOM   1950 C  C    . LEU A 1 316 ? 46.886 -67.316 16.417  1.00 72.06  ? 310  LEU A C    1 
ATOM   1951 O  O    . LEU A 1 316 ? 47.177 -68.159 17.277  1.00 73.13  ? 310  LEU A O    1 
ATOM   1952 C  CB   . LEU A 1 316 ? 47.765 -64.981 16.132  1.00 60.83  ? 310  LEU A CB   1 
ATOM   1953 C  CG   . LEU A 1 316 ? 48.844 -64.006 15.654  1.00 59.56  ? 310  LEU A CG   1 
ATOM   1954 C  CD1  . LEU A 1 316 ? 48.512 -62.547 15.982  1.00 56.11  ? 310  LEU A CD1  1 
ATOM   1955 C  CD2  . LEU A 1 316 ? 50.210 -64.402 16.185  1.00 61.80  ? 310  LEU A CD2  1 
ATOM   1956 N  N    . VAL A 1 317 ? 45.633 -67.135 15.980  1.00 64.06  ? 311  VAL A N    1 
ATOM   1957 C  CA   . VAL A 1 317 ? 44.519 -67.911 16.514  1.00 56.11  ? 311  VAL A CA   1 
ATOM   1958 C  C    . VAL A 1 317 ? 44.838 -69.401 16.500  1.00 62.32  ? 311  VAL A C    1 
ATOM   1959 O  O    . VAL A 1 317 ? 44.682 -70.096 17.504  1.00 72.35  ? 311  VAL A O    1 
ATOM   1960 C  CB   . VAL A 1 317 ? 43.235 -67.596 15.736  1.00 56.65  ? 311  VAL A CB   1 
ATOM   1961 C  CG1  . VAL A 1 317 ? 42.101 -68.509 16.172  1.00 58.66  ? 311  VAL A CG1  1 
ATOM   1962 C  CG2  . VAL A 1 317 ? 42.871 -66.129 15.909  1.00 57.67  ? 311  VAL A CG2  1 
ATOM   1963 N  N    . LYS A 1 318 ? 45.307 -69.919 15.375  1.00 67.78  ? 312  LYS A N    1 
ATOM   1964 C  CA   . LYS A 1 318 ? 45.616 -71.345 15.348  1.00 73.56  ? 312  LYS A CA   1 
ATOM   1965 C  C    . LYS A 1 318 ? 46.672 -71.699 16.392  1.00 72.99  ? 312  LYS A C    1 
ATOM   1966 O  O    . LYS A 1 318 ? 46.615 -72.774 16.999  1.00 74.19  ? 312  LYS A O    1 
ATOM   1967 C  CB   . LYS A 1 318 ? 46.078 -71.791 13.955  1.00 63.28  ? 312  LYS A CB   1 
ATOM   1968 C  CG   . LYS A 1 318 ? 46.268 -73.304 13.872  1.00 67.91  ? 312  LYS A CG   1 
ATOM   1969 C  CD   . LYS A 1 318 ? 46.866 -73.755 12.561  1.00 70.96  ? 312  LYS A CD   1 
ATOM   1970 C  CE   . LYS A 1 318 ? 47.219 -75.246 12.552  1.00 68.80  ? 312  LYS A CE   1 
ATOM   1971 N  NZ   . LYS A 1 318 ? 46.020 -76.127 12.570  1.00 66.18  ? 312  LYS A NZ   1 
ATOM   1972 N  N    . MET A 1 319 ? 47.652 -70.817 16.607  1.00 71.92  ? 313  MET A N    1 
ATOM   1973 C  CA   . MET A 1 319 ? 48.728 -71.158 17.536  1.00 79.95  ? 313  MET A CA   1 
ATOM   1974 C  C    . MET A 1 319 ? 48.295 -70.992 18.988  1.00 79.89  ? 313  MET A C    1 
ATOM   1975 O  O    . MET A 1 319 ? 48.623 -71.835 19.830  1.00 80.13  ? 313  MET A O    1 
ATOM   1976 C  CB   . MET A 1 319 ? 49.987 -70.319 17.270  1.00 82.58  ? 313  MET A CB   1 
ATOM   1977 C  CG   . MET A 1 319 ? 50.781 -70.649 15.990  1.00 79.37  ? 313  MET A CG   1 
ATOM   1978 S  SD   . MET A 1 319 ? 52.353 -69.738 15.977  1.00 72.77  ? 313  MET A SD   1 
ATOM   1979 C  CE   . MET A 1 319 ? 53.007 -70.116 14.369  1.00 83.90  ? 313  MET A CE   1 
ATOM   1980 N  N    . ALA A 1 320 ? 47.576 -69.908 19.297  1.00 77.14  ? 314  ALA A N    1 
ATOM   1981 C  CA   . ALA A 1 320 ? 47.010 -69.741 20.629  1.00 75.00  ? 314  ALA A CA   1 
ATOM   1982 C  C    . ALA A 1 320 ? 46.207 -70.974 21.035  1.00 75.94  ? 314  ALA A C    1 
ATOM   1983 O  O    . ALA A 1 320 ? 46.492 -71.610 22.053  1.00 81.86  ? 314  ALA A O    1 
ATOM   1984 C  CB   . ALA A 1 320 ? 46.148 -68.478 20.667  1.00 69.64  ? 314  ALA A CB   1 
ATOM   1985 N  N    . LYS A 1 321 ? 45.225 -71.351 20.214  1.00 76.54  ? 315  LYS A N    1 
ATOM   1986 C  CA   . LYS A 1 321 ? 44.418 -72.538 20.477  1.00 74.86  ? 315  LYS A CA   1 
ATOM   1987 C  C    . LYS A 1 321 ? 45.261 -73.780 20.744  1.00 78.79  ? 315  LYS A C    1 
ATOM   1988 O  O    . LYS A 1 321 ? 44.795 -74.708 21.412  1.00 87.96  ? 315  LYS A O    1 
ATOM   1989 C  CB   . LYS A 1 321 ? 43.480 -72.815 19.293  1.00 78.84  ? 315  LYS A CB   1 
ATOM   1990 C  CG   . LYS A 1 321 ? 42.299 -71.859 19.119  1.00 75.65  ? 315  LYS A CG   1 
ATOM   1991 C  CD   . LYS A 1 321 ? 41.678 -72.003 17.728  1.00 68.89  ? 315  LYS A CD   1 
ATOM   1992 C  CE   . LYS A 1 321 ? 41.218 -73.433 17.461  1.00 78.37  ? 315  LYS A CE   1 
ATOM   1993 N  NZ   . LYS A 1 321 ? 40.656 -73.640 16.085  1.00 77.03  ? 315  LYS A NZ   1 
ATOM   1994 N  N    . GLU A 1 322 ? 46.475 -73.852 20.204  1.00 80.21  ? 316  GLU A N    1 
ATOM   1995 C  CA   . GLU A 1 322 ? 47.308 -75.039 20.370  1.00 85.28  ? 316  GLU A CA   1 
ATOM   1996 C  C    . GLU A 1 322 ? 48.305 -74.917 21.518  1.00 87.20  ? 316  GLU A C    1 
ATOM   1997 O  O    . GLU A 1 322 ? 49.171 -75.790 21.665  1.00 87.29  ? 316  GLU A O    1 
ATOM   1998 C  CB   . GLU A 1 322 ? 48.033 -75.385 19.068  1.00 81.60  ? 316  GLU A CB   1 
ATOM   1999 C  CG   . GLU A 1 322 ? 47.078 -75.813 17.964  1.00 89.30  ? 316  GLU A CG   1 
ATOM   2000 C  CD   . GLU A 1 322 ? 47.782 -76.239 16.683  1.00 92.26  ? 316  GLU A CD   1 
ATOM   2001 O  OE1  . GLU A 1 322 ? 49.031 -76.140 16.624  1.00 90.37  ? 316  GLU A OE1  1 
ATOM   2002 O  OE2  . GLU A 1 322 ? 47.075 -76.659 15.733  1.00 88.42  ? 316  GLU A OE2  1 
ATOM   2003 N  N    . GLU A 1 323 ? 48.225 -73.850 22.313  1.00 85.25  ? 317  GLU A N    1 
ATOM   2004 C  CA   . GLU A 1 323 ? 49.010 -73.650 23.531  1.00 92.94  ? 317  GLU A CA   1 
ATOM   2005 C  C    . GLU A 1 323 ? 50.393 -73.062 23.240  1.00 90.61  ? 317  GLU A C    1 
ATOM   2006 O  O    . GLU A 1 323 ? 51.166 -72.848 24.192  1.00 93.43  ? 317  GLU A O    1 
ATOM   2007 C  CB   . GLU A 1 323 ? 49.177 -74.950 24.348  1.00 98.65  ? 317  GLU A CB   1 
ATOM   2008 C  CG   . GLU A 1 323 ? 47.873 -75.547 24.925  1.00 95.48  ? 317  GLU A CG   1 
ATOM   2009 C  CD   . GLU A 1 323 ? 47.170 -74.619 25.917  1.00 99.02  ? 317  GLU A CD   1 
ATOM   2010 O  OE1  . GLU A 1 323 ? 47.863 -73.990 26.742  1.00 102.07 ? 317  GLU A OE1  1 
ATOM   2011 O  OE2  . GLU A 1 323 ? 45.925 -74.511 25.872  1.00 101.32 ? 317  GLU A OE2  1 
ATOM   2012 N  N    . LEU A 1 324 ? 50.747 -72.822 21.973  1.00 88.16  ? 318  LEU A N    1 
ATOM   2013 C  CA   . LEU A 1 324 ? 52.079 -72.348 21.605  1.00 87.15  ? 318  LEU A CA   1 
ATOM   2014 C  C    . LEU A 1 324 ? 52.272 -70.847 21.787  1.00 81.39  ? 318  LEU A C    1 
ATOM   2015 O  O    . LEU A 1 324 ? 53.399 -70.368 21.628  1.00 80.20  ? 318  LEU A O    1 
ATOM   2016 C  CB   . LEU A 1 324 ? 52.394 -72.707 20.150  1.00 87.52  ? 318  LEU A CB   1 
ATOM   2017 C  CG   . LEU A 1 324 ? 52.957 -74.099 19.888  1.00 85.97  ? 318  LEU A CG   1 
ATOM   2018 C  CD1  . LEU A 1 324 ? 51.909 -75.142 20.212  1.00 89.44  ? 318  LEU A CD1  1 
ATOM   2019 C  CD2  . LEU A 1 324 ? 53.432 -74.227 18.444  1.00 88.74  ? 318  LEU A CD2  1 
ATOM   2020 N  N    . LEU A 1 325 ? 51.222 -70.091 22.094  1.00 75.52  ? 319  LEU A N    1 
ATOM   2021 C  CA   . LEU A 1 325 ? 51.381 -68.658 22.291  1.00 80.09  ? 319  LEU A CA   1 
ATOM   2022 C  C    . LEU A 1 325 ? 50.347 -68.183 23.287  1.00 80.95  ? 319  LEU A C    1 
ATOM   2023 O  O    . LEU A 1 325 ? 49.225 -68.692 23.298  1.00 82.55  ? 319  LEU A O    1 
ATOM   2024 C  CB   . LEU A 1 325 ? 51.202 -67.864 20.994  1.00 82.72  ? 319  LEU A CB   1 
ATOM   2025 C  CG   . LEU A 1 325 ? 52.177 -68.044 19.838  1.00 81.58  ? 319  LEU A CG   1 
ATOM   2026 C  CD1  . LEU A 1 325 ? 51.685 -67.196 18.681  1.00 80.04  ? 319  LEU A CD1  1 
ATOM   2027 C  CD2  . LEU A 1 325 ? 53.592 -67.657 20.246  1.00 78.60  ? 319  LEU A CD2  1 
ATOM   2028 N  N    . PHE A 1 326 ? 50.717 -67.202 24.109  1.00 79.79  ? 320  PHE A N    1 
ATOM   2029 C  CA   . PHE A 1 326 ? 49.785 -66.512 24.991  1.00 81.27  ? 320  PHE A CA   1 
ATOM   2030 C  C    . PHE A 1 326 ? 49.356 -67.377 26.176  1.00 80.88  ? 320  PHE A C    1 
ATOM   2031 O  O    . PHE A 1 326 ? 48.509 -66.941 26.981  1.00 71.28  ? 320  PHE A O    1 
ATOM   2032 C  CB   . PHE A 1 326 ? 48.545 -66.041 24.222  1.00 76.30  ? 320  PHE A CB   1 
ATOM   2033 C  CG   . PHE A 1 326 ? 48.875 -65.221 23.015  1.00 82.97  ? 320  PHE A CG   1 
ATOM   2034 C  CD1  . PHE A 1 326 ? 49.198 -63.880 23.135  1.00 85.13  ? 320  PHE A CD1  1 
ATOM   2035 C  CD2  . PHE A 1 326 ? 48.874 -65.793 21.753  1.00 82.58  ? 320  PHE A CD2  1 
ATOM   2036 C  CE1  . PHE A 1 326 ? 49.521 -63.126 22.017  1.00 82.81  ? 320  PHE A CE1  1 
ATOM   2037 C  CE2  . PHE A 1 326 ? 49.187 -65.043 20.637  1.00 82.59  ? 320  PHE A CE2  1 
ATOM   2038 C  CZ   . PHE A 1 326 ? 49.504 -63.705 20.768  1.00 81.39  ? 320  PHE A CZ   1 
ATOM   2039 N  N    . GLY A 1 327 ? 49.864 -68.604 26.281  1.00 72.62  ? 321  GLY A N    1 
ATOM   2040 C  CA   . GLY A 1 327 ? 49.330 -69.551 27.230  1.00 77.00  ? 321  GLY A CA   1 
ATOM   2041 C  C    . GLY A 1 327 ? 47.901 -69.945 26.941  1.00 86.54  ? 321  GLY A C    1 
ATOM   2042 O  O    . GLY A 1 327 ? 47.145 -70.242 27.875  1.00 95.04  ? 321  GLY A O    1 
ATOM   2043 N  N    . GLY A 1 328 ? 47.506 -69.960 25.667  1.00 84.32  ? 322  GLY A N    1 
ATOM   2044 C  CA   . GLY A 1 328 ? 46.164 -70.349 25.285  1.00 81.66  ? 322  GLY A CA   1 
ATOM   2045 C  C    . GLY A 1 328 ? 45.085 -69.338 25.603  1.00 81.46  ? 322  GLY A C    1 
ATOM   2046 O  O    . GLY A 1 328 ? 43.896 -69.653 25.467  1.00 79.95  ? 322  GLY A O    1 
ATOM   2047 N  N    . LYS A 1 329 ? 45.445 -68.135 26.028  1.00 79.48  ? 323  LYS A N    1 
ATOM   2048 C  CA   . LYS A 1 329 ? 44.458 -67.154 26.453  1.00 84.86  ? 323  LYS A CA   1 
ATOM   2049 C  C    . LYS A 1 329 ? 44.213 -66.235 25.262  1.00 79.91  ? 323  LYS A C    1 
ATOM   2050 O  O    . LYS A 1 329 ? 45.099 -65.477 24.865  1.00 83.62  ? 323  LYS A O    1 
ATOM   2051 C  CB   . LYS A 1 329 ? 44.936 -66.397 27.695  1.00 89.22  ? 323  LYS A CB   1 
ATOM   2052 C  CG   . LYS A 1 329 ? 43.847 -65.568 28.414  1.00 94.28  ? 323  LYS A CG   1 
ATOM   2053 C  CD   . LYS A 1 329 ? 44.372 -64.841 29.679  1.00 96.96  ? 323  LYS A CD   1 
ATOM   2054 C  CE   . LYS A 1 329 ? 44.708 -65.775 30.883  1.00 106.39 ? 323  LYS A CE   1 
ATOM   2055 N  NZ   . LYS A 1 329 ? 43.549 -66.446 31.598  1.00 84.30  ? 323  LYS A NZ   1 
ATOM   2056 N  N    . LEU A 1 330 ? 43.017 -66.322 24.689  1.00 79.04  ? 324  LEU A N    1 
ATOM   2057 C  CA   . LEU A 1 330 ? 42.666 -65.671 23.432  1.00 77.69  ? 324  LEU A CA   1 
ATOM   2058 C  C    . LEU A 1 330 ? 41.668 -64.560 23.711  1.00 74.86  ? 324  LEU A C    1 
ATOM   2059 O  O    . LEU A 1 330 ? 40.552 -64.832 24.155  1.00 83.07  ? 324  LEU A O    1 
ATOM   2060 C  CB   . LEU A 1 330 ? 42.045 -66.668 22.447  1.00 76.22  ? 324  LEU A CB   1 
ATOM   2061 C  CG   . LEU A 1 330 ? 42.848 -67.635 21.573  1.00 78.24  ? 324  LEU A CG   1 
ATOM   2062 C  CD1  . LEU A 1 330 ? 43.509 -68.756 22.361  1.00 77.76  ? 324  LEU A CD1  1 
ATOM   2063 C  CD2  . LEU A 1 330 ? 41.932 -68.204 20.521  1.00 84.29  ? 324  LEU A CD2  1 
ATOM   2064 N  N    . SER A 1 331 ? 42.029 -63.327 23.406  1.00 74.74  ? 325  SER A N    1 
ATOM   2065 C  CA   . SER A 1 331 ? 41.111 -62.247 23.703  1.00 80.01  ? 325  SER A CA   1 
ATOM   2066 C  C    . SER A 1 331 ? 39.918 -62.307 22.760  1.00 83.07  ? 325  SER A C    1 
ATOM   2067 O  O    . SER A 1 331 ? 39.894 -63.094 21.810  1.00 83.54  ? 325  SER A O    1 
ATOM   2068 C  CB   . SER A 1 331 ? 41.810 -60.893 23.607  1.00 82.45  ? 325  SER A CB   1 
ATOM   2069 O  OG   . SER A 1 331 ? 42.220 -60.603 22.290  1.00 81.06  ? 325  SER A OG   1 
ATOM   2070 N  N    . PRO A 1 332 ? 38.876 -61.520 23.035  1.00 87.26  ? 326  PRO A N    1 
ATOM   2071 C  CA   . PRO A 1 332 ? 37.768 -61.434 22.069  1.00 88.35  ? 326  PRO A CA   1 
ATOM   2072 C  C    . PRO A 1 332 ? 38.162 -60.775 20.761  1.00 84.87  ? 326  PRO A C    1 
ATOM   2073 O  O    . PRO A 1 332 ? 37.669 -61.186 19.704  1.00 89.37  ? 326  PRO A O    1 
ATOM   2074 C  CB   . PRO A 1 332 ? 36.711 -60.613 22.825  1.00 85.51  ? 326  PRO A CB   1 
ATOM   2075 C  CG   . PRO A 1 332 ? 37.033 -60.844 24.261  1.00 86.37  ? 326  PRO A CG   1 
ATOM   2076 C  CD   . PRO A 1 332 ? 38.532 -60.884 24.314  1.00 86.11  ? 326  PRO A CD   1 
ATOM   2077 N  N    . GLU A 1 333 ? 39.034 -59.760 20.793  1.00 85.75  ? 327  GLU A N    1 
ATOM   2078 C  CA   . GLU A 1 333 ? 39.323 -59.007 19.573  1.00 87.18  ? 327  GLU A CA   1 
ATOM   2079 C  C    . GLU A 1 333 ? 40.185 -59.806 18.601  1.00 82.37  ? 327  GLU A C    1 
ATOM   2080 O  O    . GLU A 1 333 ? 40.018 -59.675 17.381  1.00 79.64  ? 327  GLU A O    1 
ATOM   2081 C  CB   . GLU A 1 333 ? 39.994 -57.675 19.911  1.00 87.58  ? 327  GLU A CB   1 
ATOM   2082 C  CG   . GLU A 1 333 ? 39.115 -56.714 20.700  1.00 92.87  ? 327  GLU A CG   1 
ATOM   2083 C  CD   . GLU A 1 333 ? 39.141 -56.982 22.208  1.00 99.05  ? 327  GLU A CD   1 
ATOM   2084 O  OE1  . GLU A 1 333 ? 39.787 -57.974 22.632  1.00 93.91  ? 327  GLU A OE1  1 
ATOM   2085 O  OE2  . GLU A 1 333 ? 38.520 -56.194 22.966  1.00 97.85  ? 327  GLU A OE2  1 
ATOM   2086 N  N    . LEU A 1 334 ? 41.093 -60.644 19.114  1.00 73.76  ? 328  LEU A N    1 
ATOM   2087 C  CA   . LEU A 1 334 ? 41.894 -61.483 18.234  1.00 72.13  ? 328  LEU A CA   1 
ATOM   2088 C  C    . LEU A 1 334 ? 41.034 -62.373 17.343  1.00 77.82  ? 328  LEU A C    1 
ATOM   2089 O  O    . LEU A 1 334 ? 41.526 -62.858 16.322  1.00 76.33  ? 328  LEU A O    1 
ATOM   2090 C  CB   . LEU A 1 334 ? 42.845 -62.370 19.032  1.00 66.00  ? 328  LEU A CB   1 
ATOM   2091 C  CG   . LEU A 1 334 ? 43.748 -63.220 18.137  1.00 63.98  ? 328  LEU A CG   1 
ATOM   2092 C  CD1  . LEU A 1 334 ? 44.737 -62.320 17.400  1.00 66.16  ? 328  LEU A CD1  1 
ATOM   2093 C  CD2  . LEU A 1 334 ? 44.471 -64.329 18.869  1.00 61.10  ? 328  LEU A CD2  1 
ATOM   2094 N  N    . LEU A 1 335 ? 39.780 -62.630 17.713  1.00 81.61  ? 329  LEU A N    1 
ATOM   2095 C  CA   . LEU A 1 335 ? 38.895 -63.464 16.910  1.00 77.81  ? 329  LEU A CA   1 
ATOM   2096 C  C    . LEU A 1 335 ? 37.999 -62.654 15.991  1.00 82.05  ? 329  LEU A C    1 
ATOM   2097 O  O    . LEU A 1 335 ? 37.183 -63.235 15.264  1.00 81.77  ? 329  LEU A O    1 
ATOM   2098 C  CB   . LEU A 1 335 ? 38.048 -64.364 17.810  1.00 75.61  ? 329  LEU A CB   1 
ATOM   2099 C  CG   . LEU A 1 335 ? 38.872 -65.448 18.506  1.00 77.70  ? 329  LEU A CG   1 
ATOM   2100 C  CD1  . LEU A 1 335 ? 38.022 -66.230 19.499  1.00 83.58  ? 329  LEU A CD1  1 
ATOM   2101 C  CD2  . LEU A 1 335 ? 39.495 -66.386 17.483  1.00 71.88  ? 329  LEU A CD2  1 
ATOM   2102 N  N    . ASN A 1 336 ? 38.147 -61.338 15.987  1.00 79.28  ? 330  ASN A N    1 
ATOM   2103 C  CA   . ASN A 1 336 ? 37.320 -60.468 15.168  1.00 81.82  ? 330  ASN A CA   1 
ATOM   2104 C  C    . ASN A 1 336 ? 38.052 -60.182 13.851  1.00 85.11  ? 330  ASN A C    1 
ATOM   2105 O  O    . ASN A 1 336 ? 39.236 -59.830 13.854  1.00 84.33  ? 330  ASN A O    1 
ATOM   2106 C  CB   . ASN A 1 336 ? 37.010 -59.201 15.966  1.00 85.46  ? 330  ASN A CB   1 
ATOM   2107 C  CG   . ASN A 1 336 ? 35.925 -58.358 15.348  1.00 95.47  ? 330  ASN A CG   1 
ATOM   2108 O  OD1  . ASN A 1 336 ? 35.717 -58.364 14.126  1.00 103.72 ? 330  ASN A OD1  1 
ATOM   2109 N  ND2  . ASN A 1 336 ? 35.197 -57.640 16.197  1.00 93.04  ? 330  ASN A ND2  1 
ATOM   2110 N  N    . THR A 1 337 ? 37.363 -60.377 12.725  1.00 82.06  ? 331  THR A N    1 
ATOM   2111 C  CA   . THR A 1 337 ? 38.044 -60.368 11.437  1.00 81.03  ? 331  THR A CA   1 
ATOM   2112 C  C    . THR A 1 337 ? 38.594 -58.982 11.113  1.00 82.95  ? 331  THR A C    1 
ATOM   2113 O  O    . THR A 1 337 ? 37.898 -57.969 11.258  1.00 83.70  ? 331  THR A O    1 
ATOM   2114 C  CB   . THR A 1 337 ? 37.109 -60.820 10.321  1.00 79.37  ? 331  THR A CB   1 
ATOM   2115 O  OG1  . THR A 1 337 ? 37.881 -61.062 9.141   1.00 79.41  ? 331  THR A OG1  1 
ATOM   2116 C  CG2  . THR A 1 337 ? 36.098 -59.734 10.010  1.00 77.20  ? 331  THR A CG2  1 
ATOM   2117 N  N    . GLY A 1 338 ? 39.855 -58.945 10.679  1.00 77.84  ? 332  GLY A N    1 
ATOM   2118 C  CA   . GLY A 1 338 ? 40.482 -57.738 10.200  1.00 74.92  ? 332  GLY A CA   1 
ATOM   2119 C  C    . GLY A 1 338 ? 41.141 -56.862 11.238  1.00 80.33  ? 332  GLY A C    1 
ATOM   2120 O  O    . GLY A 1 338 ? 41.717 -55.832 10.869  1.00 82.30  ? 332  GLY A O    1 
ATOM   2121 N  N    . ARG A 1 339 ? 41.080 -57.223 12.523  1.00 86.52  ? 333  ARG A N    1 
ATOM   2122 C  CA   . ARG A 1 339 ? 41.655 -56.353 13.548  1.00 83.03  ? 333  ARG A CA   1 
ATOM   2123 C  C    . ARG A 1 339 ? 43.180 -56.327 13.482  1.00 79.16  ? 333  ARG A C    1 
ATOM   2124 O  O    . ARG A 1 339 ? 43.794 -55.317 13.845  1.00 83.51  ? 333  ARG A O    1 
ATOM   2125 C  CB   . ARG A 1 339 ? 41.190 -56.782 14.939  1.00 81.24  ? 333  ARG A CB   1 
ATOM   2126 C  CG   . ARG A 1 339 ? 39.695 -56.624 15.220  1.00 86.67  ? 333  ARG A CG   1 
ATOM   2127 C  CD   . ARG A 1 339 ? 39.249 -55.166 15.344  1.00 88.24  ? 333  ARG A CD   1 
ATOM   2128 N  NE   . ARG A 1 339 ? 37.844 -55.065 15.753  1.00 92.89  ? 333  ARG A NE   1 
ATOM   2129 C  CZ   . ARG A 1 339 ? 37.425 -55.096 17.023  1.00 104.95 ? 333  ARG A CZ   1 
ATOM   2130 N  NH1  . ARG A 1 339 ? 38.299 -55.221 18.026  1.00 97.79  ? 333  ARG A NH1  1 
ATOM   2131 N  NH2  . ARG A 1 339 ? 36.127 -54.999 17.299  1.00 105.65 ? 333  ARG A NH2  1 
ATOM   2132 N  N    . PHE A 1 340 ? 43.807 -57.413 13.035  1.00 71.17  ? 334  PHE A N    1 
ATOM   2133 C  CA   . PHE A 1 340 ? 45.247 -57.428 12.796  1.00 69.26  ? 334  PHE A CA   1 
ATOM   2134 C  C    . PHE A 1 340 ? 45.447 -57.066 11.327  1.00 75.67  ? 334  PHE A C    1 
ATOM   2135 O  O    . PHE A 1 340 ? 45.071 -57.837 10.434  1.00 74.82  ? 334  PHE A O    1 
ATOM   2136 C  CB   . PHE A 1 340 ? 45.833 -58.799 13.106  1.00 66.34  ? 334  PHE A CB   1 
ATOM   2137 C  CG   . PHE A 1 340 ? 47.324 -58.795 13.279  1.00 73.99  ? 334  PHE A CG   1 
ATOM   2138 C  CD1  . PHE A 1 340 ? 47.880 -58.560 14.529  1.00 79.25  ? 334  PHE A CD1  1 
ATOM   2139 C  CD2  . PHE A 1 340 ? 48.168 -58.996 12.211  1.00 75.59  ? 334  PHE A CD2  1 
ATOM   2140 C  CE1  . PHE A 1 340 ? 49.244 -58.554 14.714  1.00 77.03  ? 334  PHE A CE1  1 
ATOM   2141 C  CE2  . PHE A 1 340 ? 49.541 -58.986 12.395  1.00 77.26  ? 334  PHE A CE2  1 
ATOM   2142 C  CZ   . PHE A 1 340 ? 50.074 -58.763 13.652  1.00 76.80  ? 334  PHE A CZ   1 
ATOM   2143 N  N    . GLU A 1 341 ? 46.014 -55.895 11.067  1.00 69.91  ? 335  GLU A N    1 
ATOM   2144 C  CA   . GLU A 1 341 ? 45.906 -55.311 9.741   1.00 73.83  ? 335  GLU A CA   1 
ATOM   2145 C  C    . GLU A 1 341 ? 47.280 -55.117 9.106   1.00 70.84  ? 335  GLU A C    1 
ATOM   2146 O  O    . GLU A 1 341 ? 48.304 -55.066 9.789   1.00 67.67  ? 335  GLU A O    1 
ATOM   2147 C  CB   . GLU A 1 341 ? 45.112 -53.999 9.797   1.00 73.20  ? 335  GLU A CB   1 
ATOM   2148 C  CG   . GLU A 1 341 ? 45.712 -52.911 10.636  1.00 74.39  ? 335  GLU A CG   1 
ATOM   2149 C  CD   . GLU A 1 341 ? 44.748 -51.756 10.828  1.00 82.67  ? 335  GLU A CD   1 
ATOM   2150 O  OE1  . GLU A 1 341 ? 43.742 -51.700 10.095  1.00 87.58  ? 335  GLU A OE1  1 
ATOM   2151 O  OE2  . GLU A 1 341 ? 44.991 -50.903 11.707  1.00 89.75  ? 335  GLU A OE2  1 
ATOM   2152 N  N    . THR A 1 342 ? 47.295 -55.056 7.768   1.00 72.20  ? 336  THR A N    1 
ATOM   2153 C  CA   . THR A 1 342 ? 48.566 -55.049 7.048   1.00 71.04  ? 336  THR A CA   1 
ATOM   2154 C  C    . THR A 1 342 ? 49.454 -53.900 7.519   1.00 70.25  ? 336  THR A C    1 
ATOM   2155 O  O    . THR A 1 342 ? 50.667 -54.074 7.693   1.00 68.05  ? 336  THR A O    1 
ATOM   2156 C  CB   . THR A 1 342 ? 48.313 -54.990 5.536   1.00 65.33  ? 336  THR A CB   1 
ATOM   2157 O  OG1  . THR A 1 342 ? 47.638 -56.186 5.129   1.00 65.64  ? 336  THR A OG1  1 
ATOM   2158 C  CG2  . THR A 1 342 ? 49.616 -54.879 4.759   1.00 63.43  ? 336  THR A CG2  1 
ATOM   2159 N  N    . LYS A 1 343 ? 48.854 -52.741 7.786   1.00 65.49  ? 337  LYS A N    1 
ATOM   2160 C  CA   . LYS A 1 343 ? 49.533 -51.622 8.428   1.00 69.52  ? 337  LYS A CA   1 
ATOM   2161 C  C    . LYS A 1 343 ? 50.382 -52.078 9.617   1.00 73.98  ? 337  LYS A C    1 
ATOM   2162 O  O    . LYS A 1 343 ? 51.509 -51.609 9.807   1.00 74.22  ? 337  LYS A O    1 
ATOM   2163 C  CB   . LYS A 1 343 ? 48.475 -50.610 8.873   1.00 72.49  ? 337  LYS A CB   1 
ATOM   2164 C  CG   . LYS A 1 343 ? 48.937 -49.502 9.787   1.00 73.75  ? 337  LYS A CG   1 
ATOM   2165 C  CD   . LYS A 1 343 ? 49.942 -48.575 9.160   1.00 81.49  ? 337  LYS A CD   1 
ATOM   2166 C  CE   . LYS A 1 343 ? 50.098 -47.329 10.029  1.00 85.21  ? 337  LYS A CE   1 
ATOM   2167 N  NZ   . LYS A 1 343 ? 50.581 -47.689 11.403  1.00 84.38  ? 337  LYS A NZ   1 
ATOM   2168 N  N    . ASP A 1 344 ? 49.863 -53.017 10.407  1.00 67.94  ? 338  ASP A N    1 
ATOM   2169 C  CA   . ASP A 1 344 ? 50.573 -53.462 11.594  1.00 65.97  ? 338  ASP A CA   1 
ATOM   2170 C  C    . ASP A 1 344 ? 51.771 -54.320 11.238  1.00 68.77  ? 338  ASP A C    1 
ATOM   2171 O  O    . ASP A 1 344 ? 52.763 -54.319 11.972  1.00 72.39  ? 338  ASP A O    1 
ATOM   2172 C  CB   . ASP A 1 344 ? 49.632 -54.251 12.504  1.00 71.62  ? 338  ASP A CB   1 
ATOM   2173 C  CG   . ASP A 1 344 ? 48.434 -53.436 12.940  1.00 76.27  ? 338  ASP A CG   1 
ATOM   2174 O  OD1  . ASP A 1 344 ? 48.492 -52.181 12.877  1.00 79.37  ? 338  ASP A OD1  1 
ATOM   2175 O  OD2  . ASP A 1 344 ? 47.409 -54.056 13.282  1.00 74.96  ? 338  ASP A OD2  1 
ATOM   2176 N  N    . ILE A 1 345 ? 51.697 -55.077 10.141  1.00 71.28  ? 339  ILE A N    1 
ATOM   2177 C  CA   . ILE A 1 345 ? 52.826 -55.930 9.768   1.00 70.16  ? 339  ILE A CA   1 
ATOM   2178 C  C    . ILE A 1 345 ? 54.051 -55.065 9.495   1.00 68.84  ? 339  ILE A C    1 
ATOM   2179 O  O    . ILE A 1 345 ? 55.191 -55.435 9.812   1.00 61.62  ? 339  ILE A O    1 
ATOM   2180 C  CB   . ILE A 1 345 ? 52.461 -56.799 8.550   1.00 67.17  ? 339  ILE A CB   1 
ATOM   2181 C  CG1  . ILE A 1 345 ? 51.195 -57.595 8.831   1.00 71.46  ? 339  ILE A CG1  1 
ATOM   2182 C  CG2  . ILE A 1 345 ? 53.569 -57.799 8.262   1.00 67.55  ? 339  ILE A CG2  1 
ATOM   2183 C  CD1  . ILE A 1 345 ? 50.643 -58.303 7.637   1.00 66.74  ? 339  ILE A CD1  1 
ATOM   2184 N  N    . SER A 1 346 ? 53.821 -53.879 8.931   1.00 67.85  ? 340  SER A N    1 
ATOM   2185 C  CA   . SER A 1 346 ? 54.914 -52.984 8.582   1.00 67.45  ? 340  SER A CA   1 
ATOM   2186 C  C    . SER A 1 346 ? 55.552 -52.401 9.830   1.00 73.17  ? 340  SER A C    1 
ATOM   2187 O  O    . SER A 1 346 ? 56.782 -52.376 9.962   1.00 75.48  ? 340  SER A O    1 
ATOM   2188 C  CB   . SER A 1 346 ? 54.388 -51.880 7.679   1.00 67.09  ? 340  SER A CB   1 
ATOM   2189 O  OG   . SER A 1 346 ? 53.843 -52.441 6.502   1.00 74.47  ? 340  SER A OG   1 
ATOM   2190 N  N    . ASP A 1 347 ? 54.721 -51.933 10.764  1.00 76.71  ? 341  ASP A N    1 
ATOM   2191 C  CA   . ASP A 1 347 ? 55.222 -51.393 12.022  1.00 69.27  ? 341  ASP A CA   1 
ATOM   2192 C  C    . ASP A 1 347 ? 56.086 -52.416 12.747  1.00 66.46  ? 341  ASP A C    1 
ATOM   2193 O  O    . ASP A 1 347 ? 57.245 -52.140 13.069  1.00 72.84  ? 341  ASP A O    1 
ATOM   2194 C  CB   . ASP A 1 347 ? 54.043 -50.941 12.877  1.00 68.58  ? 341  ASP A CB   1 
ATOM   2195 C  CG   . ASP A 1 347 ? 53.225 -49.842 12.203  1.00 77.84  ? 341  ASP A CG   1 
ATOM   2196 O  OD1  . ASP A 1 347 ? 53.714 -49.243 11.222  1.00 81.46  ? 341  ASP A OD1  1 
ATOM   2197 O  OD2  . ASP A 1 347 ? 52.082 -49.578 12.634  1.00 80.66  ? 341  ASP A OD2  1 
ATOM   2198 N  N    . ILE A 1 348 ? 55.560 -53.625 12.969  1.00 64.68  ? 342  ILE A N    1 
ATOM   2199 C  CA   . ILE A 1 348 ? 56.333 -54.651 13.671  1.00 68.90  ? 342  ILE A CA   1 
ATOM   2200 C  C    . ILE A 1 348 ? 57.701 -54.868 13.029  1.00 71.26  ? 342  ILE A C    1 
ATOM   2201 O  O    . ILE A 1 348 ? 58.700 -55.083 13.726  1.00 70.13  ? 342  ILE A O    1 
ATOM   2202 C  CB   . ILE A 1 348 ? 55.540 -55.970 13.766  1.00 67.10  ? 342  ILE A CB   1 
ATOM   2203 C  CG1  . ILE A 1 348 ? 54.440 -55.868 14.823  1.00 70.81  ? 342  ILE A CG1  1 
ATOM   2204 C  CG2  . ILE A 1 348 ? 56.462 -57.142 14.113  1.00 67.59  ? 342  ILE A CG2  1 
ATOM   2205 C  CD1  . ILE A 1 348 ? 53.079 -55.563 14.301  1.00 72.98  ? 342  ILE A CD1  1 
ATOM   2206 N  N    . GLU A 1 349 ? 57.774 -54.858 11.697  1.00 76.77  ? 343  GLU A N    1 
ATOM   2207 C  CA   . GLU A 1 349 ? 59.041 -55.182 11.050  1.00 71.82  ? 343  GLU A CA   1 
ATOM   2208 C  C    . GLU A 1 349 ? 59.924 -53.980 10.762  1.00 69.86  ? 343  GLU A C    1 
ATOM   2209 O  O    . GLU A 1 349 ? 61.109 -54.174 10.471  1.00 74.76  ? 343  GLU A O    1 
ATOM   2210 C  CB   . GLU A 1 349 ? 58.805 -55.933 9.742   1.00 75.71  ? 343  GLU A CB   1 
ATOM   2211 C  CG   . GLU A 1 349 ? 58.324 -57.359 9.893   1.00 75.79  ? 343  GLU A CG   1 
ATOM   2212 C  CD   . GLU A 1 349 ? 58.134 -58.010 8.539   1.00 77.03  ? 343  GLU A CD   1 
ATOM   2213 O  OE1  . GLU A 1 349 ? 58.160 -57.278 7.533   1.00 72.56  ? 343  GLU A OE1  1 
ATOM   2214 O  OE2  . GLU A 1 349 ? 57.973 -59.241 8.473   1.00 75.37  ? 343  GLU A OE2  1 
ATOM   2215 N  N    . GLY A 1 350 ? 59.396 -52.759 10.847  1.00 70.28  ? 344  GLY A N    1 
ATOM   2216 C  CA   . GLY A 1 350 ? 60.163 -51.607 10.395  1.00 82.57  ? 344  GLY A CA   1 
ATOM   2217 C  C    . GLY A 1 350 ? 61.331 -51.225 11.293  1.00 98.16  ? 344  GLY A C    1 
ATOM   2218 O  O    . GLY A 1 350 ? 62.482 -51.161 10.842  1.00 99.37  ? 344  GLY A O    1 
ATOM   2219 N  N    . GLU A 1 351 ? 61.058 -50.981 12.578  1.00 104.46 ? 345  GLU A N    1 
ATOM   2220 C  CA   . GLU A 1 351 ? 61.883 -50.091 13.387  1.00 116.98 ? 345  GLU A CA   1 
ATOM   2221 C  C    . GLU A 1 351 ? 62.995 -50.820 14.153  1.00 119.00 ? 345  GLU A C    1 
ATOM   2222 O  O    . GLU A 1 351 ? 63.105 -52.049 14.142  1.00 118.33 ? 345  GLU A O    1 
ATOM   2223 C  CB   . GLU A 1 351 ? 60.994 -49.309 14.358  1.00 117.67 ? 345  GLU A CB   1 
ATOM   2224 C  CG   . GLU A 1 351 ? 60.245 -50.186 15.362  1.00 114.19 ? 345  GLU A CG   1 
ATOM   2225 C  CD   . GLU A 1 351 ? 59.311 -49.388 16.271  1.00 114.85 ? 345  GLU A CD   1 
ATOM   2226 O  OE1  . GLU A 1 351 ? 59.489 -48.151 16.391  1.00 114.76 ? 345  GLU A OE1  1 
ATOM   2227 O  OE2  . GLU A 1 351 ? 58.392 -50.004 16.858  1.00 113.07 ? 345  GLU A OE2  1 
ATOM   2228 N  N    . LYS A 1 352 ? 63.823 -50.026 14.847  1.00 118.21 ? 346  LYS A N    1 
ATOM   2229 C  CA   . LYS A 1 352 ? 64.922 -50.519 15.673  1.00 124.63 ? 346  LYS A CA   1 
ATOM   2230 C  C    . LYS A 1 352 ? 64.458 -51.642 16.584  1.00 123.78 ? 346  LYS A C    1 
ATOM   2231 O  O    . LYS A 1 352 ? 64.846 -52.802 16.407  1.00 123.49 ? 346  LYS A O    1 
ATOM   2232 C  CB   . LYS A 1 352 ? 65.507 -49.400 16.543  1.00 127.39 ? 346  LYS A CB   1 
ATOM   2233 C  CG   . LYS A 1 352 ? 66.640 -49.876 17.462  1.00 123.96 ? 346  LYS A CG   1 
ATOM   2234 C  CD   . LYS A 1 352 ? 67.062 -48.807 18.465  1.00 122.53 ? 346  LYS A CD   1 
ATOM   2235 C  CE   . LYS A 1 352 ? 65.981 -48.576 19.521  1.00 123.43 ? 346  LYS A CE   1 
ATOM   2236 N  NZ   . LYS A 1 352 ? 65.751 -49.765 20.396  1.00 114.07 ? 346  LYS A NZ   1 
ATOM   2237 N  N    . ASP A 1 353 ? 63.649 -51.290 17.584  1.00 124.63 ? 347  ASP A N    1 
ATOM   2238 C  CA   . ASP A 1 353 ? 62.921 -52.270 18.382  1.00 121.77 ? 347  ASP A CA   1 
ATOM   2239 C  C    . ASP A 1 353 ? 61.481 -52.244 17.877  1.00 119.25 ? 347  ASP A C    1 
ATOM   2240 O  O    . ASP A 1 353 ? 60.686 -51.375 18.255  1.00 112.66 ? 347  ASP A O    1 
ATOM   2241 C  CB   . ASP A 1 353 ? 63.015 -51.935 19.871  1.00 119.14 ? 347  ASP A CB   1 
ATOM   2242 C  CG   . ASP A 1 353 ? 62.394 -53.005 20.758  1.00 116.61 ? 347  ASP A CG   1 
ATOM   2243 O  OD1  . ASP A 1 353 ? 61.965 -54.049 20.211  1.00 111.20 ? 347  ASP A OD1  1 
ATOM   2244 O  OD2  . ASP A 1 353 ? 62.337 -52.800 21.998  1.00 113.04 ? 347  ASP A OD2  1 
ATOM   2245 N  N    . GLY A 1 354 ? 61.141 -53.235 17.054  1.00 115.10 ? 348  GLY A N    1 
ATOM   2246 C  CA   . GLY A 1 354 ? 59.794 -53.399 16.552  1.00 106.73 ? 348  GLY A CA   1 
ATOM   2247 C  C    . GLY A 1 354 ? 59.177 -54.554 17.298  1.00 98.65  ? 348  GLY A C    1 
ATOM   2248 O  O    . GLY A 1 354 ? 57.986 -54.854 17.172  1.00 93.62  ? 348  GLY A O    1 
ATOM   2249 N  N    . ILE A 1 355 ? 60.023 -55.225 18.078  1.00 103.68 ? 349  ILE A N    1 
ATOM   2250 C  CA   . ILE A 1 355 ? 59.538 -56.223 19.010  1.00 102.58 ? 349  ILE A CA   1 
ATOM   2251 C  C    . ILE A 1 355 ? 58.715 -55.574 20.113  1.00 95.86  ? 349  ILE A C    1 
ATOM   2252 O  O    . ILE A 1 355 ? 57.859 -56.233 20.708  1.00 94.99  ? 349  ILE A O    1 
ATOM   2253 C  CB   . ILE A 1 355 ? 60.730 -57.022 19.556  1.00 101.40 ? 349  ILE A CB   1 
ATOM   2254 C  CG1  . ILE A 1 355 ? 61.462 -57.671 18.378  1.00 103.88 ? 349  ILE A CG1  1 
ATOM   2255 C  CG2  . ILE A 1 355 ? 60.249 -58.088 20.521  1.00 91.62  ? 349  ILE A CG2  1 
ATOM   2256 C  CD1  . ILE A 1 355 ? 62.572 -56.797 17.787  1.00 108.91 ? 349  ILE A CD1  1 
ATOM   2257 N  N    . ARG A 1 356 ? 58.924 -54.284 20.385  1.00 97.86  ? 350  ARG A N    1 
ATOM   2258 C  CA   . ARG A 1 356 ? 58.012 -53.586 21.283  1.00 99.11  ? 350  ARG A CA   1 
ATOM   2259 C  C    . ARG A 1 356 ? 56.703 -53.258 20.578  1.00 94.28  ? 350  ARG A C    1 
ATOM   2260 O  O    . ARG A 1 356 ? 55.620 -53.426 21.153  1.00 89.45  ? 350  ARG A O    1 
ATOM   2261 C  CB   . ARG A 1 356 ? 58.625 -52.288 21.819  1.00 108.70 ? 350  ARG A CB   1 
ATOM   2262 C  CG   . ARG A 1 356 ? 58.831 -51.219 20.748  1.00 113.13 ? 350  ARG A CG   1 
ATOM   2263 C  CD   . ARG A 1 356 ? 59.063 -49.836 21.352  1.00 117.13 ? 350  ARG A CD   1 
ATOM   2264 N  NE   . ARG A 1 356 ? 57.862 -49.349 22.037  1.00 116.04 ? 350  ARG A NE   1 
ATOM   2265 C  CZ   . ARG A 1 356 ? 56.825 -48.775 21.425  1.00 114.61 ? 350  ARG A CZ   1 
ATOM   2266 N  NH1  . ARG A 1 356 ? 56.821 -48.617 20.103  1.00 106.83 ? 350  ARG A NH1  1 
ATOM   2267 N  NH2  . ARG A 1 356 ? 55.780 -48.366 22.135  1.00 112.29 ? 350  ARG A NH2  1 
ATOM   2268 N  N    . LYS A 1 357 ? 56.782 -52.763 19.339  1.00 95.76  ? 351  LYS A N    1 
ATOM   2269 C  CA   . LYS A 1 357 ? 55.558 -52.376 18.654  1.00 92.89  ? 351  LYS A CA   1 
ATOM   2270 C  C    . LYS A 1 357 ? 54.703 -53.586 18.310  1.00 84.17  ? 351  LYS A C    1 
ATOM   2271 O  O    . LYS A 1 357 ? 53.494 -53.434 18.116  1.00 86.17  ? 351  LYS A O    1 
ATOM   2272 C  CB   . LYS A 1 357 ? 55.874 -51.538 17.414  1.00 88.49  ? 351  LYS A CB   1 
ATOM   2273 C  CG   . LYS A 1 357 ? 54.634 -51.013 16.724  1.00 84.92  ? 351  LYS A CG   1 
ATOM   2274 C  CD   . LYS A 1 357 ? 54.988 -49.983 15.664  1.00 92.48  ? 351  LYS A CD   1 
ATOM   2275 C  CE   . LYS A 1 357 ? 55.254 -48.594 16.232  1.00 92.24  ? 351  LYS A CE   1 
ATOM   2276 N  NZ   . LYS A 1 357 ? 53.972 -47.974 16.699  1.00 92.42  ? 351  LYS A NZ   1 
ATOM   2277 N  N    . ALA A 1 358 ? 55.292 -54.781 18.258  1.00 75.37  ? 352  ALA A N    1 
ATOM   2278 C  CA   . ALA A 1 358 ? 54.494 -55.993 18.371  1.00 72.29  ? 352  ALA A CA   1 
ATOM   2279 C  C    . ALA A 1 358 ? 53.691 -55.975 19.662  1.00 80.91  ? 352  ALA A C    1 
ATOM   2280 O  O    . ALA A 1 358 ? 52.454 -56.026 19.651  1.00 74.18  ? 352  ALA A O    1 
ATOM   2281 C  CB   . ALA A 1 358 ? 55.402 -57.221 18.328  1.00 77.84  ? 352  ALA A CB   1 
ATOM   2282 N  N    . ARG A 1 359 ? 54.400 -55.874 20.796  1.00 89.30  ? 353  ARG A N    1 
ATOM   2283 C  CA   . ARG A 1 359 ? 53.760 -55.758 22.100  1.00 77.61  ? 353  ARG A CA   1 
ATOM   2284 C  C    . ARG A 1 359 ? 52.704 -54.663 22.099  1.00 79.50  ? 353  ARG A C    1 
ATOM   2285 O  O    . ARG A 1 359 ? 51.620 -54.834 22.667  1.00 78.47  ? 353  ARG A O    1 
ATOM   2286 C  CB   . ARG A 1 359 ? 54.818 -55.493 23.171  1.00 84.59  ? 353  ARG A CB   1 
ATOM   2287 C  CG   . ARG A 1 359 ? 54.290 -55.506 24.625  1.00 90.79  ? 353  ARG A CG   1 
ATOM   2288 C  CD   . ARG A 1 359 ? 55.397 -55.281 25.670  1.00 74.64  ? 353  ARG A CD   1 
ATOM   2289 N  NE   . ARG A 1 359 ? 56.434 -56.316 25.602  1.00 80.41  ? 353  ARG A NE   1 
ATOM   2290 C  CZ   . ARG A 1 359 ? 56.328 -57.546 26.119  1.00 87.11  ? 353  ARG A CZ   1 
ATOM   2291 N  NH1  . ARG A 1 359 ? 55.212 -57.930 26.739  1.00 86.80  ? 353  ARG A NH1  1 
ATOM   2292 N  NH2  . ARG A 1 359 ? 57.339 -58.410 26.001  1.00 81.28  ? 353  ARG A NH2  1 
ATOM   2293 N  N    . GLU A 1 360 ? 52.989 -53.532 21.456  1.00 74.88  ? 354  GLU A N    1 
ATOM   2294 C  CA   . GLU A 1 360 ? 52.002 -52.462 21.450  1.00 75.92  ? 354  GLU A CA   1 
ATOM   2295 C  C    . GLU A 1 360 ? 50.725 -52.903 20.752  1.00 81.82  ? 354  GLU A C    1 
ATOM   2296 O  O    . GLU A 1 360 ? 49.623 -52.559 21.196  1.00 83.71  ? 354  GLU A O    1 
ATOM   2297 C  CB   . GLU A 1 360 ? 52.577 -51.205 20.797  1.00 82.44  ? 354  GLU A CB   1 
ATOM   2298 C  CG   . GLU A 1 360 ? 51.567 -50.060 20.703  1.00 84.09  ? 354  GLU A CG   1 
ATOM   2299 C  CD   . GLU A 1 360 ? 52.161 -48.780 20.114  1.00 98.23  ? 354  GLU A CD   1 
ATOM   2300 O  OE1  . GLU A 1 360 ? 53.384 -48.763 19.815  1.00 100.49 ? 354  GLU A OE1  1 
ATOM   2301 O  OE2  . GLU A 1 360 ? 51.392 -47.799 19.934  1.00 90.54  ? 354  GLU A OE2  1 
ATOM   2302 N  N    . VAL A 1 361 ? 50.856 -53.661 19.654  1.00 82.22  ? 355  VAL A N    1 
ATOM   2303 C  CA   . VAL A 1 361 ? 49.708 -54.087 18.852  1.00 76.90  ? 355  VAL A CA   1 
ATOM   2304 C  C    . VAL A 1 361 ? 49.006 -55.276 19.497  1.00 71.73  ? 355  VAL A C    1 
ATOM   2305 O  O    . VAL A 1 361 ? 47.778 -55.291 19.620  1.00 72.44  ? 355  VAL A O    1 
ATOM   2306 C  CB   . VAL A 1 361 ? 50.154 -54.401 17.402  1.00 80.24  ? 355  VAL A CB   1 
ATOM   2307 C  CG1  . VAL A 1 361 ? 49.013 -55.001 16.565  1.00 68.36  ? 355  VAL A CG1  1 
ATOM   2308 C  CG2  . VAL A 1 361 ? 50.698 -53.151 16.727  1.00 84.16  ? 355  VAL A CG2  1 
ATOM   2309 N  N    . LEU A 1 362 ? 49.772 -56.294 19.907  1.00 68.28  ? 356  LEU A N    1 
ATOM   2310 C  CA   . LEU A 1 362 ? 49.184 -57.451 20.577  1.00 71.68  ? 356  LEU A CA   1 
ATOM   2311 C  C    . LEU A 1 362 ? 48.283 -57.047 21.745  1.00 80.69  ? 356  LEU A C    1 
ATOM   2312 O  O    . LEU A 1 362 ? 47.285 -57.722 22.018  1.00 81.80  ? 356  LEU A O    1 
ATOM   2313 C  CB   . LEU A 1 362 ? 50.286 -58.391 21.070  1.00 69.17  ? 356  LEU A CB   1 
ATOM   2314 C  CG   . LEU A 1 362 ? 51.047 -59.262 20.085  1.00 69.58  ? 356  LEU A CG   1 
ATOM   2315 C  CD1  . LEU A 1 362 ? 52.244 -59.928 20.717  1.00 70.68  ? 356  LEU A CD1  1 
ATOM   2316 C  CD2  . LEU A 1 362 ? 50.100 -60.331 19.605  1.00 74.61  ? 356  LEU A CD2  1 
ATOM   2317 N  N    . MET A 1 363 ? 48.630 -55.967 22.461  1.00 80.64  ? 357  MET A N    1 
ATOM   2318 C  CA   . MET A 1 363 ? 47.790 -55.466 23.548  1.00 83.79  ? 357  MET A CA   1 
ATOM   2319 C  C    . MET A 1 363 ? 46.623 -54.633 23.033  1.00 80.81  ? 357  MET A C    1 
ATOM   2320 O  O    . MET A 1 363 ? 45.555 -54.614 23.651  1.00 85.19  ? 357  MET A O    1 
ATOM   2321 C  CB   . MET A 1 363 ? 48.625 -54.643 24.536  1.00 85.02  ? 357  MET A CB   1 
ATOM   2322 C  CG   . MET A 1 363 ? 49.664 -55.453 25.310  1.00 85.65  ? 357  MET A CG   1 
ATOM   2323 S  SD   . MET A 1 363 ? 50.739 -54.415 26.330  1.00 98.03  ? 357  MET A SD   1 
ATOM   2324 C  CE   . MET A 1 363 ? 51.869 -55.647 26.991  1.00 86.44  ? 357  MET A CE   1 
ATOM   2325 N  N    . ARG A 1 364 ? 46.796 -53.932 21.919  1.00 80.36  ? 358  ARG A N    1 
ATOM   2326 C  CA   . ARG A 1 364 ? 45.649 -53.268 21.318  1.00 85.06  ? 358  ARG A CA   1 
ATOM   2327 C  C    . ARG A 1 364 ? 44.542 -54.273 21.023  1.00 85.33  ? 358  ARG A C    1 
ATOM   2328 O  O    . ARG A 1 364 ? 43.360 -53.905 20.943  1.00 80.11  ? 358  ARG A O    1 
ATOM   2329 C  CB   . ARG A 1 364 ? 46.095 -52.530 20.057  1.00 80.11  ? 358  ARG A CB   1 
ATOM   2330 C  CG   . ARG A 1 364 ? 45.012 -51.743 19.361  1.00 87.70  ? 358  ARG A CG   1 
ATOM   2331 C  CD   . ARG A 1 364 ? 45.627 -50.904 18.249  1.00 96.50  ? 358  ARG A CD   1 
ATOM   2332 N  NE   . ARG A 1 364 ? 46.309 -51.754 17.282  1.00 91.69  ? 358  ARG A NE   1 
ATOM   2333 C  CZ   . ARG A 1 364 ? 45.697 -52.368 16.284  1.00 89.73  ? 358  ARG A CZ   1 
ATOM   2334 N  NH1  . ARG A 1 364 ? 46.391 -53.133 15.458  1.00 87.32  ? 358  ARG A NH1  1 
ATOM   2335 N  NH2  . ARG A 1 364 ? 44.391 -52.208 16.117  1.00 99.77  ? 358  ARG A NH2  1 
ATOM   2336 N  N    . LEU A 1 365 ? 44.915 -55.543 20.859  1.00 84.64  ? 359  LEU A N    1 
ATOM   2337 C  CA   . LEU A 1 365 ? 43.995 -56.655 20.685  1.00 83.76  ? 359  LEU A CA   1 
ATOM   2338 C  C    . LEU A 1 365 ? 43.719 -57.365 22.001  1.00 87.78  ? 359  LEU A C    1 
ATOM   2339 O  O    . LEU A 1 365 ? 43.066 -58.414 21.999  1.00 87.98  ? 359  LEU A O    1 
ATOM   2340 C  CB   . LEU A 1 365 ? 44.537 -57.654 19.649  1.00 83.84  ? 359  LEU A CB   1 
ATOM   2341 C  CG   . LEU A 1 365 ? 44.824 -57.184 18.212  1.00 74.72  ? 359  LEU A CG   1 
ATOM   2342 C  CD1  . LEU A 1 365 ? 45.343 -58.333 17.358  1.00 69.18  ? 359  LEU A CD1  1 
ATOM   2343 C  CD2  . LEU A 1 365 ? 43.624 -56.527 17.562  1.00 78.98  ? 359  LEU A CD2  1 
ATOM   2344 N  N    . GLY A 1 366 ? 44.228 -56.826 23.116  1.00 89.63  ? 360  GLY A N    1 
ATOM   2345 C  CA   . GLY A 1 366 ? 43.940 -57.304 24.459  1.00 82.53  ? 360  GLY A CA   1 
ATOM   2346 C  C    . GLY A 1 366 ? 44.521 -58.640 24.882  1.00 84.94  ? 360  GLY A C    1 
ATOM   2347 O  O    . GLY A 1 366 ? 43.765 -59.542 25.255  1.00 88.26  ? 360  GLY A O    1 
ATOM   2348 N  N    . LEU A 1 367 ? 45.846 -58.790 24.857  1.00 82.60  ? 361  LEU A N    1 
ATOM   2349 C  CA   . LEU A 1 367 ? 46.475 -60.058 25.206  1.00 86.31  ? 361  LEU A CA   1 
ATOM   2350 C  C    . LEU A 1 367 ? 47.582 -59.825 26.235  1.00 84.94  ? 361  LEU A C    1 
ATOM   2351 O  O    . LEU A 1 367 ? 48.006 -58.691 26.482  1.00 78.74  ? 361  LEU A O    1 
ATOM   2352 C  CB   . LEU A 1 367 ? 47.038 -60.759 23.956  1.00 86.05  ? 361  LEU A CB   1 
ATOM   2353 C  CG   . LEU A 1 367 ? 46.015 -61.329 22.963  1.00 86.20  ? 361  LEU A CG   1 
ATOM   2354 C  CD1  . LEU A 1 367 ? 45.315 -60.187 22.260  1.00 86.16  ? 361  LEU A CD1  1 
ATOM   2355 C  CD2  . LEU A 1 367 ? 46.620 -62.265 21.932  1.00 81.14  ? 361  LEU A CD2  1 
ATOM   2356 N  N    . ASP A 1 368 ? 48.077 -60.935 26.809  1.00 88.02  ? 362  ASP A N    1 
ATOM   2357 C  CA   . ASP A 1 368 ? 49.159 -60.959 27.797  1.00 92.61  ? 362  ASP A CA   1 
ATOM   2358 C  C    . ASP A 1 368 ? 50.394 -61.607 27.189  1.00 89.23  ? 362  ASP A C    1 
ATOM   2359 O  O    . ASP A 1 368 ? 50.714 -62.769 27.491  1.00 85.15  ? 362  ASP A O    1 
ATOM   2360 C  CB   . ASP A 1 368 ? 48.776 -61.729 29.071  1.00 100.68 ? 362  ASP A CB   1 
ATOM   2361 C  CG   . ASP A 1 368 ? 48.114 -60.853 30.138  1.00 106.59 ? 362  ASP A CG   1 
ATOM   2362 O  OD1  . ASP A 1 368 ? 48.296 -59.612 30.110  1.00 103.13 ? 362  ASP A OD1  1 
ATOM   2363 O  OD2  . ASP A 1 368 ? 47.422 -61.424 31.018  1.00 106.16 ? 362  ASP A OD2  1 
ATOM   2364 N  N    . PRO A 1 369 ? 51.095 -60.887 26.315  1.00 85.75  ? 363  PRO A N    1 
ATOM   2365 C  CA   . PRO A 1 369 ? 52.269 -61.460 25.652  1.00 84.81  ? 363  PRO A CA   1 
ATOM   2366 C  C    . PRO A 1 369 ? 53.518 -61.476 26.524  1.00 80.50  ? 363  PRO A C    1 
ATOM   2367 O  O    . PRO A 1 369 ? 53.912 -60.466 27.109  1.00 74.68  ? 363  PRO A O    1 
ATOM   2368 C  CB   . PRO A 1 369 ? 52.459 -60.543 24.438  1.00 83.79  ? 363  PRO A CB   1 
ATOM   2369 C  CG   . PRO A 1 369 ? 51.939 -59.204 24.904  1.00 85.03  ? 363  PRO A CG   1 
ATOM   2370 C  CD   . PRO A 1 369 ? 50.850 -59.486 25.922  1.00 86.10  ? 363  PRO A CD   1 
ATOM   2371 N  N    . THR A 1 370 ? 54.231 -62.595 26.439  1.00 81.82  ? 364  THR A N    1 
ATOM   2372 C  CA   . THR A 1 370 ? 55.575 -62.782 26.962  1.00 81.35  ? 364  THR A CA   1 
ATOM   2373 C  C    . THR A 1 370 ? 56.472 -61.833 26.179  1.00 87.46  ? 364  THR A C    1 
ATOM   2374 O  O    . THR A 1 370 ? 55.953 -60.958 25.483  1.00 90.32  ? 364  THR A O    1 
ATOM   2375 C  CB   . THR A 1 370 ? 55.992 -64.247 26.761  1.00 84.95  ? 364  THR A CB   1 
ATOM   2376 O  OG1  . THR A 1 370 ? 55.047 -65.103 27.414  1.00 81.66  ? 364  THR A OG1  1 
ATOM   2377 C  CG2  . THR A 1 370 ? 57.398 -64.533 27.298  1.00 89.62  ? 364  THR A CG2  1 
ATOM   2378 N  N    . GLN A 1 371 ? 57.798 -61.893 26.330  1.00 90.78  ? 365  GLN A N    1 
ATOM   2379 C  CA   . GLN A 1 371 ? 58.578 -61.368 25.212  1.00 89.70  ? 365  GLN A CA   1 
ATOM   2380 C  C    . GLN A 1 371 ? 58.657 -62.422 24.110  1.00 89.75  ? 365  GLN A C    1 
ATOM   2381 O  O    . GLN A 1 371 ? 58.562 -62.091 22.922  1.00 87.04  ? 365  GLN A O    1 
ATOM   2382 C  CB   . GLN A 1 371 ? 59.980 -60.905 25.638  1.00 78.52  ? 365  GLN A CB   1 
ATOM   2383 C  CG   . GLN A 1 371 ? 61.084 -61.970 25.723  1.00 85.82  ? 365  GLN A CG   1 
ATOM   2384 C  CD   . GLN A 1 371 ? 61.032 -62.853 26.975  1.00 103.68 ? 365  GLN A CD   1 
ATOM   2385 O  OE1  . GLN A 1 371 ? 60.061 -62.826 27.745  1.00 106.70 ? 365  GLN A OE1  1 
ATOM   2386 N  NE2  . GLN A 1 371 ? 62.123 -63.589 27.221  1.00 99.72  ? 365  GLN A NE2  1 
ATOM   2387 N  N    . GLU A 1 372 ? 58.774 -63.701 24.493  1.00 88.19  ? 366  GLU A N    1 
ATOM   2388 C  CA   . GLU A 1 372 ? 58.776 -64.789 23.520  1.00 89.99  ? 366  GLU A CA   1 
ATOM   2389 C  C    . GLU A 1 372 ? 57.495 -64.820 22.683  1.00 90.12  ? 366  GLU A C    1 
ATOM   2390 O  O    . GLU A 1 372 ? 57.474 -65.449 21.618  1.00 85.13  ? 366  GLU A O    1 
ATOM   2391 C  CB   . GLU A 1 372 ? 58.991 -66.125 24.239  1.00 83.49  ? 366  GLU A CB   1 
ATOM   2392 N  N    . ASP A 1 373 ? 56.423 -64.174 23.155  1.00 91.20  ? 367  ASP A N    1 
ATOM   2393 C  CA   . ASP A 1 373 ? 55.243 -63.960 22.323  1.00 85.86  ? 367  ASP A CA   1 
ATOM   2394 C  C    . ASP A 1 373 ? 55.459 -62.821 21.338  1.00 82.98  ? 367  ASP A C    1 
ATOM   2395 O  O    . ASP A 1 373 ? 55.092 -62.946 20.169  1.00 84.16  ? 367  ASP A O    1 
ATOM   2396 C  CB   . ASP A 1 373 ? 54.003 -63.670 23.182  1.00 84.28  ? 367  ASP A CB   1 
ATOM   2397 C  CG   . ASP A 1 373 ? 53.464 -64.905 23.894  1.00 83.07  ? 367  ASP A CG   1 
ATOM   2398 O  OD1  . ASP A 1 373 ? 53.862 -66.047 23.567  1.00 82.02  ? 367  ASP A OD1  1 
ATOM   2399 O  OD2  . ASP A 1 373 ? 52.606 -64.724 24.774  1.00 84.33  ? 367  ASP A OD2  1 
ATOM   2400 N  N    . CYS A 1 374 ? 56.014 -61.691 21.794  1.00 85.60  ? 368  CYS A N    1 
ATOM   2401 C  CA   . CYS A 1 374 ? 56.272 -60.579 20.878  1.00 85.24  ? 368  CYS A CA   1 
ATOM   2402 C  C    . CYS A 1 374 ? 57.285 -60.959 19.807  1.00 83.61  ? 368  CYS A C    1 
ATOM   2403 O  O    . CYS A 1 374 ? 57.241 -60.431 18.691  1.00 80.25  ? 368  CYS A O    1 
ATOM   2404 C  CB   . CYS A 1 374 ? 56.759 -59.347 21.646  1.00 87.38  ? 368  CYS A CB   1 
ATOM   2405 S  SG   . CYS A 1 374 ? 55.522 -58.491 22.685  1.00 83.97  ? 368  CYS A SG   1 
ATOM   2406 N  N    . VAL A 1 375 ? 58.207 -61.867 20.132  1.00 85.71  ? 369  VAL A N    1 
ATOM   2407 C  CA   . VAL A 1 375 ? 59.174 -62.353 19.154  1.00 82.14  ? 369  VAL A CA   1 
ATOM   2408 C  C    . VAL A 1 375 ? 58.485 -63.210 18.096  1.00 83.15  ? 369  VAL A C    1 
ATOM   2409 O  O    . VAL A 1 375 ? 58.778 -63.096 16.897  1.00 81.69  ? 369  VAL A O    1 
ATOM   2410 C  CB   . VAL A 1 375 ? 60.301 -63.117 19.878  1.00 83.20  ? 369  VAL A CB   1 
ATOM   2411 C  CG1  . VAL A 1 375 ? 61.157 -63.896 18.900  1.00 81.85  ? 369  VAL A CG1  1 
ATOM   2412 C  CG2  . VAL A 1 375 ? 61.168 -62.146 20.655  1.00 78.68  ? 369  VAL A CG2  1 
ATOM   2413 N  N    . ALA A 1 376 ? 57.556 -64.074 18.517  1.00 83.81  ? 370  ALA A N    1 
ATOM   2414 C  CA   . ALA A 1 376 ? 56.842 -64.928 17.571  1.00 78.11  ? 370  ALA A CA   1 
ATOM   2415 C  C    . ALA A 1 376 ? 55.971 -64.104 16.628  1.00 72.23  ? 370  ALA A C    1 
ATOM   2416 O  O    . ALA A 1 376 ? 56.016 -64.294 15.412  1.00 69.52  ? 370  ALA A O    1 
ATOM   2417 C  CB   . ALA A 1 376 ? 56.001 -65.960 18.324  1.00 81.26  ? 370  ALA A CB   1 
ATOM   2418 N  N    . THR A 1 377 ? 55.167 -63.185 17.165  1.00 68.11  ? 371  THR A N    1 
ATOM   2419 C  CA   . THR A 1 377 ? 54.394 -62.311 16.292  1.00 70.03  ? 371  THR A CA   1 
ATOM   2420 C  C    . THR A 1 377 ? 55.280 -61.565 15.299  1.00 75.14  ? 371  THR A C    1 
ATOM   2421 O  O    . THR A 1 377 ? 54.843 -61.263 14.183  1.00 74.07  ? 371  THR A O    1 
ATOM   2422 C  CB   . THR A 1 377 ? 53.562 -61.340 17.126  1.00 65.18  ? 371  THR A CB   1 
ATOM   2423 O  OG1  . THR A 1 377 ? 52.480 -62.057 17.711  1.00 69.65  ? 371  THR A OG1  1 
ATOM   2424 C  CG2  . THR A 1 377 ? 53.009 -60.195 16.292  1.00 67.65  ? 371  THR A CG2  1 
ATOM   2425 N  N    . HIS A 1 378 ? 56.517 -61.250 15.677  1.00 77.84  ? 372  HIS A N    1 
ATOM   2426 C  CA   . HIS A 1 378 ? 57.413 -60.602 14.732  1.00 68.21  ? 372  HIS A CA   1 
ATOM   2427 C  C    . HIS A 1 378 ? 57.750 -61.540 13.589  1.00 71.55  ? 372  HIS A C    1 
ATOM   2428 O  O    . HIS A 1 378 ? 57.659 -61.166 12.416  1.00 72.68  ? 372  HIS A O    1 
ATOM   2429 C  CB   . HIS A 1 378 ? 58.693 -60.155 15.424  1.00 74.91  ? 372  HIS A CB   1 
ATOM   2430 C  CG   . HIS A 1 378 ? 59.639 -59.431 14.520  1.00 75.98  ? 372  HIS A CG   1 
ATOM   2431 N  ND1  . HIS A 1 378 ? 59.364 -58.182 14.003  1.00 73.74  ? 372  HIS A ND1  1 
ATOM   2432 C  CD2  . HIS A 1 378 ? 60.840 -59.795 14.011  1.00 73.17  ? 372  HIS A CD2  1 
ATOM   2433 C  CE1  . HIS A 1 378 ? 60.369 -57.795 13.240  1.00 72.43  ? 372  HIS A CE1  1 
ATOM   2434 N  NE2  . HIS A 1 378 ? 61.276 -58.757 13.225  1.00 74.17  ? 372  HIS A NE2  1 
ATOM   2435 N  N    . ARG A 1 379 ? 58.145 -62.770 13.903  1.00 71.54  ? 373  ARG A N    1 
ATOM   2436 C  CA   . ARG A 1 379 ? 58.589 -63.629 12.819  1.00 68.35  ? 373  ARG A CA   1 
ATOM   2437 C  C    . ARG A 1 379 ? 57.420 -64.178 12.010  1.00 70.17  ? 373  ARG A C    1 
ATOM   2438 O  O    . ARG A 1 379 ? 57.572 -64.430 10.809  1.00 75.23  ? 373  ARG A O    1 
ATOM   2439 C  CB   . ARG A 1 379 ? 59.462 -64.757 13.343  1.00 60.40  ? 373  ARG A CB   1 
ATOM   2440 C  CG   . ARG A 1 379 ? 60.103 -65.472 12.203  1.00 71.49  ? 373  ARG A CG   1 
ATOM   2441 C  CD   . ARG A 1 379 ? 61.243 -66.342 12.610  1.00 77.45  ? 373  ARG A CD   1 
ATOM   2442 N  NE   . ARG A 1 379 ? 61.849 -66.970 11.439  1.00 79.64  ? 373  ARG A NE   1 
ATOM   2443 C  CZ   . ARG A 1 379 ? 62.673 -66.356 10.596  1.00 76.36  ? 373  ARG A CZ   1 
ATOM   2444 N  NH1  . ARG A 1 379 ? 62.980 -65.071 10.754  1.00 70.72  ? 373  ARG A NH1  1 
ATOM   2445 N  NH2  . ARG A 1 379 ? 63.172 -67.031 9.574   1.00 83.96  ? 373  ARG A NH2  1 
ATOM   2446 N  N    . ILE A 1 380 ? 56.256 -64.361 12.627  1.00 67.36  ? 374  ILE A N    1 
ATOM   2447 C  CA   . ILE A 1 380 ? 55.060 -64.641 11.845  1.00 66.42  ? 374  ILE A CA   1 
ATOM   2448 C  C    . ILE A 1 380 ? 54.832 -63.523 10.834  1.00 70.81  ? 374  ILE A C    1 
ATOM   2449 O  O    . ILE A 1 380 ? 54.433 -63.776 9.688   1.00 69.95  ? 374  ILE A O    1 
ATOM   2450 C  CB   . ILE A 1 380 ? 53.836 -64.834 12.762  1.00 70.96  ? 374  ILE A CB   1 
ATOM   2451 C  CG1  . ILE A 1 380 ? 54.012 -66.070 13.657  1.00 71.44  ? 374  ILE A CG1  1 
ATOM   2452 C  CG2  . ILE A 1 380 ? 52.548 -64.939 11.917  1.00 68.60  ? 374  ILE A CG2  1 
ATOM   2453 C  CD1  . ILE A 1 380 ? 52.970 -66.188 14.786  1.00 63.64  ? 374  ILE A CD1  1 
ATOM   2454 N  N    . CYS A 1 381 ? 55.089 -62.272 11.234  1.00 61.75  ? 375  CYS A N    1 
ATOM   2455 C  CA   . CYS A 1 381 ? 54.985 -61.174 10.280  1.00 66.20  ? 375  CYS A CA   1 
ATOM   2456 C  C    . CYS A 1 381 ? 56.013 -61.282 9.155   1.00 67.99  ? 375  CYS A C    1 
ATOM   2457 O  O    . CYS A 1 381 ? 55.683 -61.034 7.993   1.00 63.55  ? 375  CYS A O    1 
ATOM   2458 C  CB   . CYS A 1 381 ? 55.102 -59.835 10.991  1.00 65.39  ? 375  CYS A CB   1 
ATOM   2459 S  SG   . CYS A 1 381 ? 53.579 -59.373 11.730  1.00 64.27  ? 375  CYS A SG   1 
ATOM   2460 N  N    . GLN A 1 382 ? 57.264 -61.633 9.472   1.00 70.87  ? 376  GLN A N    1 
ATOM   2461 C  CA   . GLN A 1 382 ? 58.263 -61.780 8.416   1.00 68.70  ? 376  GLN A CA   1 
ATOM   2462 C  C    . GLN A 1 382 ? 57.883 -62.884 7.453   1.00 69.15  ? 376  GLN A C    1 
ATOM   2463 O  O    . GLN A 1 382 ? 58.034 -62.729 6.234   1.00 68.89  ? 376  GLN A O    1 
ATOM   2464 C  CB   . GLN A 1 382 ? 59.650 -62.057 8.988   1.00 68.56  ? 376  GLN A CB   1 
ATOM   2465 C  CG   . GLN A 1 382 ? 60.304 -60.871 9.629   1.00 74.09  ? 376  GLN A CG   1 
ATOM   2466 C  CD   . GLN A 1 382 ? 61.653 -61.215 10.215  1.00 77.01  ? 376  GLN A CD   1 
ATOM   2467 O  OE1  . GLN A 1 382 ? 61.954 -62.382 10.493  1.00 75.10  ? 376  GLN A OE1  1 
ATOM   2468 N  NE2  . GLN A 1 382 ? 62.471 -60.193 10.430  1.00 78.88  ? 376  GLN A NE2  1 
ATOM   2469 N  N    . ILE A 1 383 ? 57.397 -64.007 7.973   1.00 63.28  ? 377  ILE A N    1 
ATOM   2470 C  CA   . ILE A 1 383 ? 57.151 -65.142 7.098   1.00 66.29  ? 377  ILE A CA   1 
ATOM   2471 C  C    . ILE A 1 383 ? 56.027 -64.834 6.105   1.00 67.40  ? 377  ILE A C    1 
ATOM   2472 O  O    . ILE A 1 383 ? 56.110 -65.192 4.920   1.00 62.29  ? 377  ILE A O    1 
ATOM   2473 C  CB   . ILE A 1 383 ? 56.898 -66.402 7.940   1.00 62.81  ? 377  ILE A CB   1 
ATOM   2474 C  CG1  . ILE A 1 383 ? 58.226 -66.864 8.532   1.00 61.46  ? 377  ILE A CG1  1 
ATOM   2475 C  CG2  . ILE A 1 383 ? 56.245 -67.501 7.115   1.00 62.47  ? 377  ILE A CG2  1 
ATOM   2476 C  CD1  . ILE A 1 383 ? 58.093 -68.028 9.449   1.00 69.43  ? 377  ILE A CD1  1 
ATOM   2477 N  N    . VAL A 1 384 ? 54.990 -64.126 6.550   1.00 68.06  ? 378  VAL A N    1 
ATOM   2478 C  CA   . VAL A 1 384 ? 53.912 -63.739 5.645   1.00 63.33  ? 378  VAL A CA   1 
ATOM   2479 C  C    . VAL A 1 384 ? 54.422 -62.762 4.589   1.00 62.73  ? 378  VAL A C    1 
ATOM   2480 O  O    . VAL A 1 384 ? 54.312 -63.017 3.386   1.00 63.22  ? 378  VAL A O    1 
ATOM   2481 C  CB   . VAL A 1 384 ? 52.724 -63.166 6.439   1.00 59.89  ? 378  VAL A CB   1 
ATOM   2482 C  CG1  . VAL A 1 384 ? 51.721 -62.490 5.528   1.00 66.04  ? 378  VAL A CG1  1 
ATOM   2483 C  CG2  . VAL A 1 384 ? 52.041 -64.285 7.155   1.00 64.78  ? 378  VAL A CG2  1 
ATOM   2484 N  N    . SER A 1 385 ? 55.009 -61.642 5.014   1.00 61.37  ? 379  SER A N    1 
ATOM   2485 C  CA   . SER A 1 385 ? 55.439 -60.648 4.037   1.00 61.57  ? 379  SER A CA   1 
ATOM   2486 C  C    . SER A 1 385 ? 56.590 -61.158 3.166   1.00 62.56  ? 379  SER A C    1 
ATOM   2487 O  O    . SER A 1 385 ? 56.723 -60.728 2.016   1.00 57.92  ? 379  SER A O    1 
ATOM   2488 C  CB   . SER A 1 385 ? 55.832 -59.349 4.733   1.00 60.53  ? 379  SER A CB   1 
ATOM   2489 O  OG   . SER A 1 385 ? 57.005 -59.536 5.496   1.00 64.77  ? 379  SER A OG   1 
ATOM   2490 N  N    . THR A 1 386 ? 57.437 -62.056 3.680   1.00 63.60  ? 380  THR A N    1 
ATOM   2491 C  CA   . THR A 1 386 ? 58.471 -62.644 2.829   1.00 61.15  ? 380  THR A CA   1 
ATOM   2492 C  C    . THR A 1 386 ? 57.872 -63.592 1.792   1.00 61.62  ? 380  THR A C    1 
ATOM   2493 O  O    . THR A 1 386 ? 58.284 -63.582 0.624   1.00 62.05  ? 380  THR A O    1 
ATOM   2494 C  CB   . THR A 1 386 ? 59.536 -63.356 3.673   1.00 59.96  ? 380  THR A CB   1 
ATOM   2495 O  OG1  . THR A 1 386 ? 60.428 -62.394 4.262   1.00 60.04  ? 380  THR A OG1  1 
ATOM   2496 C  CG2  . THR A 1 386 ? 60.316 -64.355 2.851   1.00 51.45  ? 380  THR A CG2  1 
ATOM   2497 N  N    . ARG A 1 387 ? 56.896 -64.415 2.185   1.00 63.64  ? 381  ARG A N    1 
ATOM   2498 C  CA   . ARG A 1 387 ? 56.261 -65.284 1.198   1.00 58.05  ? 381  ARG A CA   1 
ATOM   2499 C  C    . ARG A 1 387 ? 55.561 -64.463 0.120   1.00 56.97  ? 381  ARG A C    1 
ATOM   2500 O  O    . ARG A 1 387 ? 55.587 -64.823 -1.057  1.00 58.37  ? 381  ARG A O    1 
ATOM   2501 C  CB   . ARG A 1 387 ? 55.252 -66.227 1.849   1.00 56.42  ? 381  ARG A CB   1 
ATOM   2502 C  CG   . ARG A 1 387 ? 54.775 -67.257 0.851   1.00 59.72  ? 381  ARG A CG   1 
ATOM   2503 C  CD   . ARG A 1 387 ? 53.552 -68.051 1.252   1.00 55.92  ? 381  ARG A CD   1 
ATOM   2504 N  NE   . ARG A 1 387 ? 52.374 -67.195 1.406   1.00 50.95  ? 381  ARG A NE   1 
ATOM   2505 C  CZ   . ARG A 1 387 ? 51.172 -67.687 1.654   1.00 49.81  ? 381  ARG A CZ   1 
ATOM   2506 N  NH1  . ARG A 1 387 ? 51.033 -69.006 1.703   1.00 46.51  ? 381  ARG A NH1  1 
ATOM   2507 N  NH2  . ARG A 1 387 ? 50.119 -66.887 1.779   1.00 48.50  ? 381  ARG A NH2  1 
ATOM   2508 N  N    . SER A 1 388 ? 54.915 -63.366 0.505   1.00 52.68  ? 382  SER A N    1 
ATOM   2509 C  CA   . SER A 1 388 ? 54.352 -62.465 -0.481  1.00 48.27  ? 382  SER A CA   1 
ATOM   2510 C  C    . SER A 1 388 ? 55.418 -61.983 -1.461  1.00 59.44  ? 382  SER A C    1 
ATOM   2511 O  O    . SER A 1 388 ? 55.228 -62.031 -2.686  1.00 62.88  ? 382  SER A O    1 
ATOM   2512 C  CB   . SER A 1 388 ? 53.696 -61.285 0.219   1.00 53.02  ? 382  SER A CB   1 
ATOM   2513 O  OG   . SER A 1 388 ? 53.246 -60.337 -0.732  1.00 61.57  ? 382  SER A OG   1 
ATOM   2514 N  N    . ALA A 1 389 ? 56.549 -61.507 -0.945  1.00 59.00  ? 383  ALA A N    1 
ATOM   2515 C  CA   . ALA A 1 389 ? 57.569 -60.957 -1.825  1.00 57.14  ? 383  ALA A CA   1 
ATOM   2516 C  C    . ALA A 1 389 ? 58.148 -62.039 -2.729  1.00 58.66  ? 383  ALA A C    1 
ATOM   2517 O  O    . ALA A 1 389 ? 58.301 -61.836 -3.939  1.00 55.62  ? 383  ALA A O    1 
ATOM   2518 C  CB   . ALA A 1 389 ? 58.662 -60.279 -1.002  1.00 56.10  ? 383  ALA A CB   1 
ATOM   2519 N  N    . SER A 1 390 ? 58.468 -63.201 -2.164  1.00 55.84  ? 384  SER A N    1 
ATOM   2520 C  CA   . SER A 1 390 ? 59.016 -64.271 -2.985  1.00 55.79  ? 384  SER A CA   1 
ATOM   2521 C  C    . SER A 1 390 ? 58.028 -64.739 -4.044  1.00 60.77  ? 384  SER A C    1 
ATOM   2522 O  O    . SER A 1 390 ? 58.446 -65.306 -5.061  1.00 60.24  ? 384  SER A O    1 
ATOM   2523 C  CB   . SER A 1 390 ? 59.435 -65.443 -2.101  1.00 51.86  ? 384  SER A CB   1 
ATOM   2524 O  OG   . SER A 1 390 ? 60.475 -65.058 -1.213  1.00 54.54  ? 384  SER A OG   1 
ATOM   2525 N  N    . LEU A 1 391 ? 56.725 -64.531 -3.831  1.00 58.87  ? 385  LEU A N    1 
ATOM   2526 C  CA   . LEU A 1 391 ? 55.761 -64.967 -4.831  1.00 55.02  ? 385  LEU A CA   1 
ATOM   2527 C  C    . LEU A 1 391 ? 55.692 -63.996 -6.012  1.00 57.75  ? 385  LEU A C    1 
ATOM   2528 O  O    . LEU A 1 391 ? 55.614 -64.446 -7.158  1.00 56.49  ? 385  LEU A O    1 
ATOM   2529 C  CB   . LEU A 1 391 ? 54.384 -65.192 -4.193  1.00 49.60  ? 385  LEU A CB   1 
ATOM   2530 C  CG   . LEU A 1 391 ? 54.240 -66.494 -3.395  1.00 57.85  ? 385  LEU A CG   1 
ATOM   2531 C  CD1  . LEU A 1 391 ? 52.927 -66.554 -2.625  1.00 60.21  ? 385  LEU A CD1  1 
ATOM   2532 C  CD2  . LEU A 1 391 ? 54.352 -67.708 -4.300  1.00 54.16  ? 385  LEU A CD2  1 
ATOM   2533 N  N    . CYS A 1 392 ? 55.724 -62.674 -5.772  1.00 54.13  ? 386  CYS A N    1 
ATOM   2534 C  CA   . CYS A 1 392 ? 55.875 -61.747 -6.894  1.00 55.53  ? 386  CYS A CA   1 
ATOM   2535 C  C    . CYS A 1 392 ? 57.200 -61.946 -7.613  1.00 56.81  ? 386  CYS A C    1 
ATOM   2536 O  O    . CYS A 1 392 ? 57.317 -61.626 -8.795  1.00 59.22  ? 386  CYS A O    1 
ATOM   2537 C  CB   . CYS A 1 392 ? 55.763 -60.292 -6.443  1.00 51.82  ? 386  CYS A CB   1 
ATOM   2538 S  SG   . CYS A 1 392 ? 54.147 -59.885 -5.806  1.00 70.36  ? 386  CYS A SG   1 
ATOM   2539 N  N    . ALA A 1 393 ? 58.215 -62.457 -6.927  1.00 59.26  ? 387  ALA A N    1 
ATOM   2540 C  CA   . ALA A 1 393 ? 59.479 -62.675 -7.607  1.00 58.13  ? 387  ALA A CA   1 
ATOM   2541 C  C    . ALA A 1 393 ? 59.403 -63.887 -8.525  1.00 58.80  ? 387  ALA A C    1 
ATOM   2542 O  O    . ALA A 1 393 ? 60.068 -63.912 -9.564  1.00 60.71  ? 387  ALA A O    1 
ATOM   2543 C  CB   . ALA A 1 393 ? 60.613 -62.825 -6.589  1.00 58.57  ? 387  ALA A CB   1 
ATOM   2544 N  N    . ALA A 1 394 ? 58.595 -64.894 -8.179  1.00 57.44  ? 388  ALA A N    1 
ATOM   2545 C  CA   . ALA A 1 394 ? 58.460 -66.041 -9.072  1.00 57.63  ? 388  ALA A CA   1 
ATOM   2546 C  C    . ALA A 1 394 ? 57.739 -65.651 -10.360 1.00 59.65  ? 388  ALA A C    1 
ATOM   2547 O  O    . ALA A 1 394 ? 58.167 -66.027 -11.462 1.00 53.30  ? 388  ALA A O    1 
ATOM   2548 C  CB   . ALA A 1 394 ? 57.730 -67.187 -8.378  1.00 54.92  ? 388  ALA A CB   1 
ATOM   2549 N  N    . THR A 1 395 ? 56.639 -64.895 -10.245 1.00 54.35  ? 389  THR A N    1 
ATOM   2550 C  CA   . THR A 1 395 ? 55.889 -64.561 -11.445 1.00 56.61  ? 389  THR A CA   1 
ATOM   2551 C  C    . THR A 1 395 ? 56.552 -63.445 -12.248 1.00 60.33  ? 389  THR A C    1 
ATOM   2552 O  O    . THR A 1 395 ? 56.375 -63.402 -13.468 1.00 61.97  ? 389  THR A O    1 
ATOM   2553 C  CB   . THR A 1 395 ? 54.445 -64.200 -11.106 1.00 52.20  ? 389  THR A CB   1 
ATOM   2554 O  OG1  . THR A 1 395 ? 54.422 -63.101 -10.193 1.00 56.02  ? 389  THR A OG1  1 
ATOM   2555 C  CG2  . THR A 1 395 ? 53.735 -65.397 -10.507 1.00 47.25  ? 389  THR A CG2  1 
ATOM   2556 N  N    . LEU A 1 396 ? 57.326 -62.551 -11.611 1.00 56.97  ? 390  LEU A N    1 
ATOM   2557 C  CA   . LEU A 1 396 ? 58.172 -61.653 -12.396 1.00 55.28  ? 390  LEU A CA   1 
ATOM   2558 C  C    . LEU A 1 396 ? 59.301 -62.409 -13.079 1.00 57.48  ? 390  LEU A C    1 
ATOM   2559 O  O    . LEU A 1 396 ? 59.605 -62.158 -14.253 1.00 60.87  ? 390  LEU A O    1 
ATOM   2560 C  CB   . LEU A 1 396 ? 58.747 -60.531 -11.545 1.00 55.33  ? 390  LEU A CB   1 
ATOM   2561 C  CG   . LEU A 1 396 ? 57.850 -59.360 -11.182 1.00 55.68  ? 390  LEU A CG   1 
ATOM   2562 C  CD1  . LEU A 1 396 ? 58.606 -58.474 -10.220 1.00 54.79  ? 390  LEU A CD1  1 
ATOM   2563 C  CD2  . LEU A 1 396 ? 57.546 -58.597 -12.430 1.00 54.45  ? 390  LEU A CD2  1 
ATOM   2564 N  N    . ALA A 1 397 ? 59.929 -63.346 -12.378 1.00 51.52  ? 391  ALA A N    1 
ATOM   2565 C  CA   . ALA A 1 397 ? 60.970 -64.132 -13.024 1.00 57.60  ? 391  ALA A CA   1 
ATOM   2566 C  C    . ALA A 1 397 ? 60.483 -64.700 -14.360 1.00 60.92  ? 391  ALA A C    1 
ATOM   2567 O  O    . ALA A 1 397 ? 61.256 -64.838 -15.314 1.00 56.44  ? 391  ALA A O    1 
ATOM   2568 C  CB   . ALA A 1 397 ? 61.425 -65.253 -12.096 1.00 54.40  ? 391  ALA A CB   1 
ATOM   2569 N  N    . ALA A 1 398 ? 59.201 -65.041 -14.442 1.00 60.96  ? 392  ALA A N    1 
ATOM   2570 C  CA   . ALA A 1 398 ? 58.672 -65.592 -15.673 1.00 55.28  ? 392  ALA A CA   1 
ATOM   2571 C  C    . ALA A 1 398 ? 58.489 -64.499 -16.716 1.00 61.72  ? 392  ALA A C    1 
ATOM   2572 O  O    . ALA A 1 398 ? 58.790 -64.710 -17.900 1.00 61.53  ? 392  ALA A O    1 
ATOM   2573 C  CB   . ALA A 1 398 ? 57.360 -66.326 -15.394 1.00 53.97  ? 392  ALA A CB   1 
ATOM   2574 N  N    . VAL A 1 399 ? 58.023 -63.317 -16.300 1.00 59.11  ? 393  VAL A N    1 
ATOM   2575 C  CA   . VAL A 1 399 ? 57.839 -62.239 -17.268 1.00 61.67  ? 393  VAL A CA   1 
ATOM   2576 C  C    . VAL A 1 399 ? 59.186 -61.774 -17.814 1.00 61.50  ? 393  VAL A C    1 
ATOM   2577 O  O    . VAL A 1 399 ? 59.336 -61.537 -19.010 1.00 62.76  ? 393  VAL A O    1 
ATOM   2578 C  CB   . VAL A 1 399 ? 57.053 -61.075 -16.649 1.00 59.17  ? 393  VAL A CB   1 
ATOM   2579 C  CG1  . VAL A 1 399 ? 56.900 -59.972 -17.681 1.00 56.12  ? 393  VAL A CG1  1 
ATOM   2580 C  CG2  . VAL A 1 399 ? 55.697 -61.550 -16.149 1.00 56.73  ? 393  VAL A CG2  1 
ATOM   2581 N  N    . LEU A 1 400 ? 60.188 -61.637 -16.950 1.00 68.75  ? 394  LEU A N    1 
ATOM   2582 C  CA   . LEU A 1 400 ? 61.506 -61.211 -17.416 1.00 64.40  ? 394  LEU A CA   1 
ATOM   2583 C  C    . LEU A 1 400 ? 62.154 -62.263 -18.306 1.00 60.44  ? 394  LEU A C    1 
ATOM   2584 O  O    . LEU A 1 400 ? 63.012 -61.936 -19.125 1.00 66.39  ? 394  LEU A O    1 
ATOM   2585 C  CB   . LEU A 1 400 ? 62.416 -60.904 -16.218 1.00 62.03  ? 394  LEU A CB   1 
ATOM   2586 C  CG   . LEU A 1 400 ? 62.091 -59.736 -15.283 1.00 60.26  ? 394  LEU A CG   1 
ATOM   2587 C  CD1  . LEU A 1 400 ? 63.046 -59.747 -14.100 1.00 66.72  ? 394  LEU A CD1  1 
ATOM   2588 C  CD2  . LEU A 1 400 ? 62.141 -58.396 -15.990 1.00 57.22  ? 394  LEU A CD2  1 
ATOM   2589 N  N    . GLN A 1 401 ? 61.796 -63.527 -18.138 1.00 58.18  ? 395  GLN A N    1 
ATOM   2590 C  CA   . GLN A 1 401 ? 62.379 -64.565 -18.967 1.00 58.39  ? 395  GLN A CA   1 
ATOM   2591 C  C    . GLN A 1 401 ? 61.745 -64.569 -20.347 1.00 68.41  ? 395  GLN A C    1 
ATOM   2592 O  O    . GLN A 1 401 ? 62.391 -64.936 -21.334 1.00 68.10  ? 395  GLN A O    1 
ATOM   2593 C  CB   . GLN A 1 401 ? 62.201 -65.904 -18.271 1.00 62.56  ? 395  GLN A CB   1 
ATOM   2594 C  CG   . GLN A 1 401 ? 62.748 -67.097 -18.999 1.00 73.83  ? 395  GLN A CG   1 
ATOM   2595 C  CD   . GLN A 1 401 ? 64.217 -66.959 -19.304 1.00 80.84  ? 395  GLN A CD   1 
ATOM   2596 O  OE1  . GLN A 1 401 ? 65.028 -66.661 -18.421 1.00 78.86  ? 395  GLN A OE1  1 
ATOM   2597 N  NE2  . GLN A 1 401 ? 64.577 -67.206 -20.561 1.00 79.63  ? 395  GLN A NE2  1 
ATOM   2598 N  N    . ARG A 1 402 ? 60.476 -64.168 -20.417 1.00 71.03  ? 396  ARG A N    1 
ATOM   2599 C  CA   . ARG A 1 402 ? 59.784 -63.943 -21.681 1.00 65.58  ? 396  ARG A CA   1 
ATOM   2600 C  C    . ARG A 1 402 ? 60.405 -62.780 -22.447 1.00 66.76  ? 396  ARG A C    1 
ATOM   2601 O  O    . ARG A 1 402 ? 60.740 -62.909 -23.630 1.00 67.16  ? 396  ARG A O    1 
ATOM   2602 C  CB   . ARG A 1 402 ? 58.315 -63.668 -21.378 1.00 59.63  ? 396  ARG A CB   1 
ATOM   2603 C  CG   . ARG A 1 402 ? 57.418 -63.336 -22.521 1.00 62.87  ? 396  ARG A CG   1 
ATOM   2604 C  CD   . ARG A 1 402 ? 57.274 -64.493 -23.455 1.00 65.74  ? 396  ARG A CD   1 
ATOM   2605 N  NE   . ARG A 1 402 ? 56.035 -64.358 -24.207 1.00 61.95  ? 396  ARG A NE   1 
ATOM   2606 C  CZ   . ARG A 1 402 ? 55.632 -65.214 -25.125 1.00 57.43  ? 396  ARG A CZ   1 
ATOM   2607 N  NH1  . ARG A 1 402 ? 56.379 -66.268 -25.409 1.00 58.55  ? 396  ARG A NH1  1 
ATOM   2608 N  NH2  . ARG A 1 402 ? 54.460 -65.033 -25.706 1.00 54.94  ? 396  ARG A NH2  1 
ATOM   2609 N  N    . ILE A 1 403 ? 60.568 -61.631 -21.784 1.00 62.33  ? 397  ILE A N    1 
ATOM   2610 C  CA   . ILE A 1 403 ? 61.135 -60.469 -22.453 1.00 65.28  ? 397  ILE A CA   1 
ATOM   2611 C  C    . ILE A 1 403 ? 62.552 -60.757 -22.929 1.00 70.91  ? 397  ILE A C    1 
ATOM   2612 O  O    . ILE A 1 403 ? 62.929 -60.383 -24.049 1.00 68.79  ? 397  ILE A O    1 
ATOM   2613 C  CB   . ILE A 1 403 ? 61.076 -59.238 -21.540 1.00 64.04  ? 397  ILE A CB   1 
ATOM   2614 C  CG1  . ILE A 1 403 ? 59.621 -58.821 -21.348 1.00 63.09  ? 397  ILE A CG1  1 
ATOM   2615 C  CG2  . ILE A 1 403 ? 61.865 -58.091 -22.149 1.00 69.78  ? 397  ILE A CG2  1 
ATOM   2616 C  CD1  . ILE A 1 403 ? 59.432 -57.745 -20.311 1.00 64.70  ? 397  ILE A CD1  1 
ATOM   2617 N  N    . LYS A 1 404 ? 63.360 -61.429 -22.102 1.00 68.10  ? 398  LYS A N    1 
ATOM   2618 C  CA   . LYS A 1 404 ? 64.686 -61.840 -22.562 1.00 70.50  ? 398  LYS A CA   1 
ATOM   2619 C  C    . LYS A 1 404 ? 64.590 -62.644 -23.854 1.00 74.81  ? 398  LYS A C    1 
ATOM   2620 O  O    . LYS A 1 404 ? 65.308 -62.372 -24.824 1.00 75.54  ? 398  LYS A O    1 
ATOM   2621 C  CB   . LYS A 1 404 ? 65.410 -62.645 -21.488 1.00 68.25  ? 398  LYS A CB   1 
ATOM   2622 C  CG   . LYS A 1 404 ? 66.793 -63.111 -21.908 1.00 72.18  ? 398  LYS A CG   1 
ATOM   2623 C  CD   . LYS A 1 404 ? 67.476 -63.882 -20.801 1.00 81.39  ? 398  LYS A CD   1 
ATOM   2624 C  CE   . LYS A 1 404 ? 68.832 -64.422 -21.220 1.00 87.85  ? 398  LYS A CE   1 
ATOM   2625 N  NZ   . LYS A 1 404 ? 69.471 -65.194 -20.106 1.00 98.19  ? 398  LYS A NZ   1 
ATOM   2626 N  N    . GLU A 1 405 ? 63.691 -63.629 -23.893 1.00 71.76  ? 399  GLU A N    1 
ATOM   2627 C  CA   . GLU A 1 405 ? 63.526 -64.426 -25.102 1.00 70.00  ? 399  GLU A CA   1 
ATOM   2628 C  C    . GLU A 1 405 ? 63.097 -63.556 -26.283 1.00 70.94  ? 399  GLU A C    1 
ATOM   2629 O  O    . GLU A 1 405 ? 63.753 -63.555 -27.329 1.00 71.38  ? 399  GLU A O    1 
ATOM   2630 C  CB   . GLU A 1 405 ? 62.534 -65.558 -24.843 1.00 68.84  ? 399  GLU A CB   1 
ATOM   2631 C  CG   . GLU A 1 405 ? 63.016 -66.541 -23.779 1.00 75.70  ? 399  GLU A CG   1 
ATOM   2632 C  CD   . GLU A 1 405 ? 62.007 -67.635 -23.492 1.00 78.51  ? 399  GLU A CD   1 
ATOM   2633 O  OE1  . GLU A 1 405 ? 60.911 -67.594 -24.093 1.00 82.88  ? 399  GLU A OE1  1 
ATOM   2634 O  OE2  . GLU A 1 405 ? 62.298 -68.510 -22.646 1.00 75.97  ? 399  GLU A OE2  1 
ATOM   2635 N  N    . ASN A 1 406 ? 62.014 -62.783 -26.122 1.00 71.32  ? 400  ASN A N    1 
ATOM   2636 C  CA   . ASN A 1 406 ? 61.550 -61.915 -27.201 1.00 68.83  ? 400  ASN A CA   1 
ATOM   2637 C  C    . ASN A 1 406 ? 62.675 -61.080 -27.792 1.00 73.82  ? 400  ASN A C    1 
ATOM   2638 O  O    . ASN A 1 406 ? 62.639 -60.720 -28.967 1.00 76.81  ? 400  ASN A O    1 
ATOM   2639 C  CB   . ASN A 1 406 ? 60.473 -60.944 -26.713 1.00 68.44  ? 400  ASN A CB   1 
ATOM   2640 C  CG   . ASN A 1 406 ? 59.177 -61.611 -26.421 1.00 64.05  ? 400  ASN A CG   1 
ATOM   2641 O  OD1  . ASN A 1 406 ? 58.959 -62.762 -26.793 1.00 65.26  ? 400  ASN A OD1  1 
ATOM   2642 N  ND2  . ASN A 1 406 ? 58.261 -60.861 -25.824 1.00 62.10  ? 400  ASN A ND2  1 
ATOM   2643 N  N    . LYS A 1 407 ? 63.621 -60.679 -26.957 1.00 79.18  ? 401  LYS A N    1 
ATOM   2644 C  CA   . LYS A 1 407 ? 64.572 -59.637 -27.303 1.00 82.35  ? 401  LYS A CA   1 
ATOM   2645 C  C    . LYS A 1 407 ? 65.798 -60.169 -28.040 1.00 85.14  ? 401  LYS A C    1 
ATOM   2646 O  O    . LYS A 1 407 ? 66.212 -59.605 -29.052 1.00 86.07  ? 401  LYS A O    1 
ATOM   2647 C  CB   . LYS A 1 407 ? 64.955 -58.899 -26.025 1.00 79.97  ? 401  LYS A CB   1 
ATOM   2648 C  CG   . LYS A 1 407 ? 65.710 -57.632 -26.243 1.00 86.35  ? 401  LYS A CG   1 
ATOM   2649 C  CD   . LYS A 1 407 ? 65.786 -56.830 -24.960 1.00 86.78  ? 401  LYS A CD   1 
ATOM   2650 C  CE   . LYS A 1 407 ? 64.386 -56.372 -24.549 1.00 84.69  ? 401  LYS A CE   1 
ATOM   2651 N  NZ   . LYS A 1 407 ? 63.723 -55.484 -25.557 1.00 77.97  ? 401  LYS A NZ   1 
ATOM   2652 N  N    . GLY A 1 408 ? 66.376 -61.270 -27.562 1.00 86.64  ? 402  GLY A N    1 
ATOM   2653 C  CA   . GLY A 1 408 ? 67.552 -61.843 -28.170 1.00 83.87  ? 402  GLY A CA   1 
ATOM   2654 C  C    . GLY A 1 408 ? 68.856 -61.440 -27.530 1.00 98.70  ? 402  GLY A C    1 
ATOM   2655 O  O    . GLY A 1 408 ? 69.916 -61.742 -28.089 1.00 105.29 ? 402  GLY A O    1 
ATOM   2656 N  N    . GLU A 1 409 ? 68.811 -60.769 -26.380 1.00 101.72 ? 403  GLU A N    1 
ATOM   2657 C  CA   . GLU A 1 409 ? 69.996 -60.236 -25.725 1.00 106.35 ? 403  GLU A CA   1 
ATOM   2658 C  C    . GLU A 1 409 ? 70.494 -61.234 -24.689 1.00 102.61 ? 403  GLU A C    1 
ATOM   2659 O  O    . GLU A 1 409 ? 69.696 -61.859 -23.984 1.00 95.21  ? 403  GLU A O    1 
ATOM   2660 C  CB   . GLU A 1 409 ? 69.677 -58.892 -25.061 1.00 107.25 ? 403  GLU A CB   1 
ATOM   2661 C  CG   . GLU A 1 409 ? 69.147 -57.794 -26.019 1.00 105.55 ? 403  GLU A CG   1 
ATOM   2662 C  CD   . GLU A 1 409 ? 70.091 -57.455 -27.173 1.00 109.50 ? 403  GLU A CD   1 
ATOM   2663 O  OE1  . GLU A 1 409 ? 71.324 -57.441 -26.963 1.00 112.28 ? 403  GLU A OE1  1 
ATOM   2664 O  OE2  . GLU A 1 409 ? 69.593 -57.184 -28.291 1.00 115.67 ? 403  GLU A OE2  1 
ATOM   2665 N  N    . GLU A 1 410 ? 71.822 -61.383 -24.611 1.00 105.06 ? 404  GLU A N    1 
ATOM   2666 C  CA   . GLU A 1 410 ? 72.428 -62.369 -23.717 1.00 106.34 ? 404  GLU A CA   1 
ATOM   2667 C  C    . GLU A 1 410 ? 72.244 -62.016 -22.242 1.00 104.35 ? 404  GLU A C    1 
ATOM   2668 O  O    . GLU A 1 410 ? 72.293 -62.913 -21.389 1.00 99.48  ? 404  GLU A O    1 
ATOM   2669 C  CB   . GLU A 1 410 ? 73.916 -62.520 -24.047 1.00 95.76  ? 404  GLU A CB   1 
ATOM   2670 N  N    . ARG A 1 411 ? 72.056 -60.734 -21.929 1.00 102.55 ? 405  ARG A N    1 
ATOM   2671 C  CA   . ARG A 1 411 ? 71.671 -60.271 -20.601 1.00 98.42  ? 405  ARG A CA   1 
ATOM   2672 C  C    . ARG A 1 411 ? 70.559 -59.255 -20.785 1.00 100.16 ? 405  ARG A C    1 
ATOM   2673 O  O    . ARG A 1 411 ? 70.766 -58.237 -21.455 1.00 96.60  ? 405  ARG A O    1 
ATOM   2674 C  CB   . ARG A 1 411 ? 72.838 -59.615 -19.865 1.00 95.16  ? 405  ARG A CB   1 
ATOM   2675 C  CG   . ARG A 1 411 ? 73.961 -60.508 -19.412 1.00 88.09  ? 405  ARG A CG   1 
ATOM   2676 C  CD   . ARG A 1 411 ? 74.995 -59.587 -18.807 1.00 80.03  ? 405  ARG A CD   1 
ATOM   2677 N  NE   . ARG A 1 411 ? 76.202 -60.260 -18.351 1.00 79.32  ? 405  ARG A NE   1 
ATOM   2678 C  CZ   . ARG A 1 411 ? 77.314 -59.608 -18.015 1.00 77.07  ? 405  ARG A CZ   1 
ATOM   2679 N  NH1  . ARG A 1 411 ? 77.348 -58.285 -18.122 1.00 82.77  ? 405  ARG A NH1  1 
ATOM   2680 N  NH2  . ARG A 1 411 ? 78.394 -60.264 -17.599 1.00 67.18  ? 405  ARG A NH2  1 
ATOM   2681 N  N    . LEU A 1 412 ? 69.391 -59.518 -20.200 1.00 97.39  ? 406  LEU A N    1 
ATOM   2682 C  CA   . LEU A 1 412 ? 68.301 -58.555 -20.301 1.00 96.49  ? 406  LEU A CA   1 
ATOM   2683 C  C    . LEU A 1 412 ? 68.647 -57.317 -19.481 1.00 90.75  ? 406  LEU A C    1 
ATOM   2684 O  O    . LEU A 1 412 ? 69.165 -57.428 -18.369 1.00 93.69  ? 406  LEU A O    1 
ATOM   2685 C  CB   . LEU A 1 412 ? 66.981 -59.174 -19.829 1.00 85.71  ? 406  LEU A CB   1 
ATOM   2686 N  N    . ARG A 1 413 ? 68.426 -56.141 -20.059 1.00 83.81  ? 407  ARG A N    1 
ATOM   2687 C  CA   . ARG A 1 413 ? 68.459 -54.876 -19.337 1.00 81.88  ? 407  ARG A CA   1 
ATOM   2688 C  C    . ARG A 1 413 ? 67.060 -54.283 -19.390 1.00 84.72  ? 407  ARG A C    1 
ATOM   2689 O  O    . ARG A 1 413 ? 66.646 -53.760 -20.430 1.00 81.55  ? 407  ARG A O    1 
ATOM   2690 C  CB   . ARG A 1 413 ? 69.494 -53.934 -19.942 1.00 87.01  ? 407  ARG A CB   1 
ATOM   2691 C  CG   . ARG A 1 413 ? 69.363 -52.476 -19.527 1.00 91.91  ? 407  ARG A CG   1 
ATOM   2692 C  CD   . ARG A 1 413 ? 69.500 -52.246 -18.029 1.00 97.28  ? 407  ARG A CD   1 
ATOM   2693 N  NE   . ARG A 1 413 ? 69.380 -50.821 -17.703 1.00 103.98 ? 407  ARG A NE   1 
ATOM   2694 C  CZ   . ARG A 1 413 ? 68.227 -50.180 -17.496 1.00 98.89  ? 407  ARG A CZ   1 
ATOM   2695 N  NH1  . ARG A 1 413 ? 68.234 -48.880 -17.215 1.00 100.89 ? 407  ARG A NH1  1 
ATOM   2696 N  NH2  . ARG A 1 413 ? 67.068 -50.827 -17.575 1.00 88.17  ? 407  ARG A NH2  1 
ATOM   2697 N  N    . SER A 1 414 ? 66.353 -54.327 -18.260 1.00 82.15  ? 408  SER A N    1 
ATOM   2698 C  CA   . SER A 1 414 ? 64.936 -54.000 -18.225 1.00 80.79  ? 408  SER A CA   1 
ATOM   2699 C  C    . SER A 1 414 ? 64.598 -53.276 -16.925 1.00 76.22  ? 408  SER A C    1 
ATOM   2700 O  O    . SER A 1 414 ? 65.219 -53.504 -15.886 1.00 76.65  ? 408  SER A O    1 
ATOM   2701 C  CB   . SER A 1 414 ? 64.083 -55.271 -18.388 1.00 73.48  ? 408  SER A CB   1 
ATOM   2702 O  OG   . SER A 1 414 ? 62.705 -54.955 -18.446 1.00 74.47  ? 408  SER A OG   1 
ATOM   2703 N  N    . THR A 1 415 ? 63.601 -52.403 -16.994 1.00 73.31  ? 409  THR A N    1 
ATOM   2704 C  CA   . THR A 1 415 ? 63.224 -51.533 -15.892 1.00 70.39  ? 409  THR A CA   1 
ATOM   2705 C  C    . THR A 1 415 ? 61.769 -51.781 -15.519 1.00 75.33  ? 409  THR A C    1 
ATOM   2706 O  O    . THR A 1 415 ? 60.875 -51.628 -16.367 1.00 68.83  ? 409  THR A O    1 
ATOM   2707 C  CB   . THR A 1 415 ? 63.415 -50.062 -16.266 1.00 74.31  ? 409  THR A CB   1 
ATOM   2708 O  OG1  . THR A 1 415 ? 64.801 -49.807 -16.544 1.00 80.09  ? 409  THR A OG1  1 
ATOM   2709 C  CG2  . THR A 1 415 ? 62.917 -49.144 -15.142 1.00 72.40  ? 409  THR A CG2  1 
ATOM   2710 N  N    . ILE A 1 416 ? 61.534 -52.127 -14.245 1.00 68.72  ? 410  ILE A N    1 
ATOM   2711 C  CA   . ILE A 1 416 ? 60.195 -52.405 -13.738 1.00 59.66  ? 410  ILE A CA   1 
ATOM   2712 C  C    . ILE A 1 416 ? 59.684 -51.162 -13.025 1.00 59.75  ? 410  ILE A C    1 
ATOM   2713 O  O    . ILE A 1 416 ? 60.329 -50.680 -12.093 1.00 64.67  ? 410  ILE A O    1 
ATOM   2714 C  CB   . ILE A 1 416 ? 60.195 -53.617 -12.801 1.00 56.15  ? 410  ILE A CB   1 
ATOM   2715 C  CG1  . ILE A 1 416 ? 60.748 -54.826 -13.538 1.00 54.38  ? 410  ILE A CG1  1 
ATOM   2716 C  CG2  . ILE A 1 416 ? 58.792 -53.900 -12.328 1.00 55.11  ? 410  ILE A CG2  1 
ATOM   2717 C  CD1  . ILE A 1 416 ? 60.885 -56.049 -12.711 1.00 54.69  ? 410  ILE A CD1  1 
ATOM   2718 N  N    . GLY A 1 417 ? 58.601 -50.571 -13.531 1.00 55.24  ? 411  GLY A N    1 
ATOM   2719 C  CA   . GLY A 1 417 ? 57.870 -49.557 -12.781 1.00 57.61  ? 411  GLY A CA   1 
ATOM   2720 C  C    . GLY A 1 417 ? 56.961 -50.202 -11.750 1.00 63.35  ? 411  GLY A C    1 
ATOM   2721 O  O    . GLY A 1 417 ? 56.114 -51.029 -12.100 1.00 60.43  ? 411  GLY A O    1 
ATOM   2722 N  N    . VAL A 1 418 ? 57.078 -49.765 -10.478 1.00 67.70  ? 412  VAL A N    1 
ATOM   2723 C  CA   . VAL A 1 418 ? 56.395 -50.415 -9.356  1.00 58.24  ? 412  VAL A CA   1 
ATOM   2724 C  C    . VAL A 1 418 ? 55.579 -49.405 -8.563  1.00 56.44  ? 412  VAL A C    1 
ATOM   2725 O  O    . VAL A 1 418 ? 55.921 -48.221 -8.489  1.00 63.49  ? 412  VAL A O    1 
ATOM   2726 C  CB   . VAL A 1 418 ? 57.353 -51.122 -8.389  1.00 54.27  ? 412  VAL A CB   1 
ATOM   2727 C  CG1  . VAL A 1 418 ? 56.538 -51.940 -7.422  1.00 56.33  ? 412  VAL A CG1  1 
ATOM   2728 C  CG2  . VAL A 1 418 ? 58.359 -51.971 -9.116  1.00 58.28  ? 412  VAL A CG2  1 
ATOM   2729 N  N    . ASP A 1 419 ? 54.504 -49.892 -7.943  1.00 54.31  ? 413  ASP A N    1 
ATOM   2730 C  CA   . ASP A 1 419 ? 53.602 -49.037 -7.175  1.00 61.44  ? 413  ASP A CA   1 
ATOM   2731 C  C    . ASP A 1 419 ? 52.844 -49.892 -6.146  1.00 59.71  ? 413  ASP A C    1 
ATOM   2732 O  O    . ASP A 1 419 ? 52.977 -51.120 -6.103  1.00 56.63  ? 413  ASP A O    1 
ATOM   2733 C  CB   . ASP A 1 419 ? 52.672 -48.279 -8.136  1.00 58.83  ? 413  ASP A CB   1 
ATOM   2734 C  CG   . ASP A 1 419 ? 51.894 -47.165 -7.453  1.00 69.52  ? 413  ASP A CG   1 
ATOM   2735 O  OD1  . ASP A 1 419 ? 51.996 -47.040 -6.213  1.00 69.12  ? 413  ASP A OD1  1 
ATOM   2736 O  OD2  . ASP A 1 419 ? 51.199 -46.399 -8.156  1.00 74.48  ? 413  ASP A OD2  1 
ATOM   2737 N  N    . GLY A 1 420 ? 52.059 -49.232 -5.306  1.00 55.52  ? 414  GLY A N    1 
ATOM   2738 C  CA   . GLY A 1 420 ? 51.182 -49.936 -4.387  1.00 59.72  ? 414  GLY A CA   1 
ATOM   2739 C  C    . GLY A 1 420 ? 51.661 -49.934 -2.934  1.00 60.63  ? 414  GLY A C    1 
ATOM   2740 O  O    . GLY A 1 420 ? 52.865 -49.933 -2.639  1.00 59.34  ? 414  GLY A O    1 
ATOM   2741 N  N    . SER A 1 421 ? 50.683 -50.028 -2.015  1.00 65.30  ? 415  SER A N    1 
ATOM   2742 C  CA   . SER A 1 421 ? 50.896 -49.900 -0.565  1.00 55.56  ? 415  SER A CA   1 
ATOM   2743 C  C    . SER A 1 421 ? 52.018 -50.786 -0.057  1.00 55.15  ? 415  SER A C    1 
ATOM   2744 O  O    . SER A 1 421 ? 52.959 -50.305 0.580   1.00 57.38  ? 415  SER A O    1 
ATOM   2745 C  CB   . SER A 1 421 ? 49.616 -50.262 0.184   1.00 50.88  ? 415  SER A CB   1 
ATOM   2746 O  OG   . SER A 1 421 ? 48.554 -49.400 -0.190  1.00 68.43  ? 415  SER A OG   1 
ATOM   2747 N  N    . VAL A 1 422 ? 51.925 -52.092 -0.304  1.00 54.14  ? 416  VAL A N    1 
ATOM   2748 C  CA   . VAL A 1 422 ? 52.900 -53.011 0.278   1.00 54.73  ? 416  VAL A CA   1 
ATOM   2749 C  C    . VAL A 1 422 ? 54.310 -52.709 -0.218  1.00 59.10  ? 416  VAL A C    1 
ATOM   2750 O  O    . VAL A 1 422 ? 55.268 -52.766 0.558   1.00 62.25  ? 416  VAL A O    1 
ATOM   2751 C  CB   . VAL A 1 422 ? 52.506 -54.470 0.003   1.00 57.16  ? 416  VAL A CB   1 
ATOM   2752 C  CG1  . VAL A 1 422 ? 53.585 -55.421 0.528   1.00 49.77  ? 416  VAL A CG1  1 
ATOM   2753 C  CG2  . VAL A 1 422 ? 51.152 -54.774 0.619   1.00 56.78  ? 416  VAL A CG2  1 
ATOM   2754 N  N    . TYR A 1 423 ? 54.476 -52.393 -1.512  1.00 61.76  ? 417  TYR A N    1 
ATOM   2755 C  CA   . TYR A 1 423 ? 55.827 -52.162 -2.036  1.00 57.63  ? 417  TYR A CA   1 
ATOM   2756 C  C    . TYR A 1 423 ? 56.465 -50.929 -1.395  1.00 62.92  ? 417  TYR A C    1 
ATOM   2757 O  O    . TYR A 1 423 ? 57.572 -51.000 -0.844  1.00 66.08  ? 417  TYR A O    1 
ATOM   2758 C  CB   . TYR A 1 423 ? 55.798 -52.022 -3.554  1.00 56.71  ? 417  TYR A CB   1 
ATOM   2759 C  CG   . TYR A 1 423 ? 57.170 -51.851 -4.189  1.00 58.99  ? 417  TYR A CG   1 
ATOM   2760 C  CD1  . TYR A 1 423 ? 58.024 -52.944 -4.338  1.00 56.19  ? 417  TYR A CD1  1 
ATOM   2761 C  CD2  . TYR A 1 423 ? 57.601 -50.602 -4.670  1.00 55.28  ? 417  TYR A CD2  1 
ATOM   2762 C  CE1  . TYR A 1 423 ? 59.283 -52.806 -4.925  1.00 56.65  ? 417  TYR A CE1  1 
ATOM   2763 C  CE2  . TYR A 1 423 ? 58.856 -50.448 -5.270  1.00 52.23  ? 417  TYR A CE2  1 
ATOM   2764 C  CZ   . TYR A 1 423 ? 59.695 -51.557 -5.389  1.00 58.22  ? 417  TYR A CZ   1 
ATOM   2765 O  OH   . TYR A 1 423 ? 60.945 -51.433 -5.962  1.00 54.54  ? 417  TYR A OH   1 
ATOM   2766 N  N    . LYS A 1 424 ? 55.761 -49.795 -1.424  1.00 60.61  ? 418  LYS A N    1 
ATOM   2767 C  CA   . LYS A 1 424 ? 56.338 -48.543 -0.943  1.00 63.99  ? 418  LYS A CA   1 
ATOM   2768 C  C    . LYS A 1 424 ? 56.463 -48.497 0.586   1.00 68.24  ? 418  LYS A C    1 
ATOM   2769 O  O    . LYS A 1 424 ? 57.523 -48.149 1.116   1.00 73.48  ? 418  LYS A O    1 
ATOM   2770 C  CB   . LYS A 1 424 ? 55.503 -47.372 -1.451  1.00 65.29  ? 418  LYS A CB   1 
ATOM   2771 C  CG   . LYS A 1 424 ? 55.568 -47.195 -2.953  1.00 65.10  ? 418  LYS A CG   1 
ATOM   2772 C  CD   . LYS A 1 424 ? 54.744 -46.006 -3.386  1.00 69.11  ? 418  LYS A CD   1 
ATOM   2773 C  CE   . LYS A 1 424 ? 54.858 -45.768 -4.874  1.00 70.34  ? 418  LYS A CE   1 
ATOM   2774 N  NZ   . LYS A 1 424 ? 54.016 -44.607 -5.260  1.00 78.35  ? 418  LYS A NZ   1 
ATOM   2775 N  N    . LYS A 1 425 ? 55.384 -48.793 1.317   1.00 63.86  ? 419  LYS A N    1 
ATOM   2776 C  CA   . LYS A 1 425 ? 55.379 -48.524 2.754   1.00 58.18  ? 419  LYS A CA   1 
ATOM   2777 C  C    . LYS A 1 425 ? 56.008 -49.628 3.605   1.00 63.20  ? 419  LYS A C    1 
ATOM   2778 O  O    . LYS A 1 425 ? 56.562 -49.335 4.671   1.00 69.76  ? 419  LYS A O    1 
ATOM   2779 C  CB   . LYS A 1 425 ? 53.959 -48.254 3.235   1.00 58.60  ? 419  LYS A CB   1 
ATOM   2780 C  CG   . LYS A 1 425 ? 53.374 -46.927 2.807   1.00 51.59  ? 419  LYS A CG   1 
ATOM   2781 C  CD   . LYS A 1 425 ? 51.950 -46.850 3.316   1.00 49.31  ? 419  LYS A CD   1 
ATOM   2782 C  CE   . LYS A 1 425 ? 51.306 -45.541 2.971   1.00 55.74  ? 419  LYS A CE   1 
ATOM   2783 N  NZ   . LYS A 1 425 ? 49.858 -45.572 3.327   1.00 66.21  ? 419  LYS A NZ   1 
ATOM   2784 N  N    . HIS A 1 426 ? 55.893 -50.885 3.214   1.00 59.81  ? 420  HIS A N    1 
ATOM   2785 C  CA   . HIS A 1 426 ? 56.479 -51.941 4.024   1.00 58.79  ? 420  HIS A CA   1 
ATOM   2786 C  C    . HIS A 1 426 ? 57.993 -51.761 4.064   1.00 62.45  ? 420  HIS A C    1 
ATOM   2787 O  O    . HIS A 1 426 ? 58.602 -51.442 3.042   1.00 75.42  ? 420  HIS A O    1 
ATOM   2788 C  CB   . HIS A 1 426 ? 56.109 -53.304 3.450   1.00 57.33  ? 420  HIS A CB   1 
ATOM   2789 C  CG   . HIS A 1 426 ? 56.582 -54.470 4.260   1.00 63.47  ? 420  HIS A CG   1 
ATOM   2790 N  ND1  . HIS A 1 426 ? 57.893 -54.903 4.247   1.00 63.28  ? 420  HIS A ND1  1 
ATOM   2791 C  CD2  . HIS A 1 426 ? 55.907 -55.337 5.053   1.00 63.62  ? 420  HIS A CD2  1 
ATOM   2792 C  CE1  . HIS A 1 426 ? 58.010 -55.975 5.007   1.00 63.08  ? 420  HIS A CE1  1 
ATOM   2793 N  NE2  . HIS A 1 426 ? 56.820 -56.256 5.514   1.00 68.59  ? 420  HIS A NE2  1 
ATOM   2794 N  N    . PRO A 1 427 ? 58.637 -51.916 5.221   1.00 70.16  ? 421  PRO A N    1 
ATOM   2795 C  CA   . PRO A 1 427 ? 60.074 -51.604 5.262   1.00 71.10  ? 421  PRO A CA   1 
ATOM   2796 C  C    . PRO A 1 427 ? 60.958 -52.543 4.443   1.00 65.64  ? 421  PRO A C    1 
ATOM   2797 O  O    . PRO A 1 427 ? 61.979 -52.085 3.927   1.00 70.46  ? 421  PRO A O    1 
ATOM   2798 C  CB   . PRO A 1 427 ? 60.397 -51.667 6.769   1.00 69.55  ? 421  PRO A CB   1 
ATOM   2799 C  CG   . PRO A 1 427 ? 59.386 -52.573 7.338   1.00 65.35  ? 421  PRO A CG   1 
ATOM   2800 C  CD   . PRO A 1 427 ? 58.123 -52.262 6.564   1.00 69.78  ? 421  PRO A CD   1 
ATOM   2801 N  N    . HIS A 1 428 ? 60.697 -53.853 4.436   1.00 62.75  ? 422  HIS A N    1 
ATOM   2802 C  CA   . HIS A 1 428 ? 61.593 -54.822 3.805   1.00 64.54  ? 422  HIS A CA   1 
ATOM   2803 C  C    . HIS A 1 428 ? 61.084 -55.490 2.527   1.00 69.18  ? 422  HIS A C    1 
ATOM   2804 O  O    . HIS A 1 428 ? 61.752 -56.406 2.029   1.00 66.79  ? 422  HIS A O    1 
ATOM   2805 C  CB   . HIS A 1 428 ? 61.983 -55.886 4.823   1.00 68.54  ? 422  HIS A CB   1 
ATOM   2806 C  CG   . HIS A 1 428 ? 62.662 -55.307 6.019   1.00 80.94  ? 422  HIS A CG   1 
ATOM   2807 N  ND1  . HIS A 1 428 ? 63.937 -54.788 5.961   1.00 84.43  ? 422  HIS A ND1  1 
ATOM   2808 C  CD2  . HIS A 1 428 ? 62.216 -55.080 7.279   1.00 70.66  ? 422  HIS A CD2  1 
ATOM   2809 C  CE1  . HIS A 1 428 ? 64.264 -54.310 7.150   1.00 82.94  ? 422  HIS A CE1  1 
ATOM   2810 N  NE2  . HIS A 1 428 ? 63.235 -54.471 7.963   1.00 73.09  ? 422  HIS A NE2  1 
ATOM   2811 N  N    . PHE A 1 429 ? 59.903 -55.135 2.017   1.00 64.32  ? 423  PHE A N    1 
ATOM   2812 C  CA   . PHE A 1 429 ? 59.321 -55.939 0.946   1.00 62.35  ? 423  PHE A CA   1 
ATOM   2813 C  C    . PHE A 1 429 ? 60.110 -55.761 -0.349  1.00 62.94  ? 423  PHE A C    1 
ATOM   2814 O  O    . PHE A 1 429 ? 60.472 -56.741 -1.017  1.00 55.52  ? 423  PHE A O    1 
ATOM   2815 C  CB   . PHE A 1 429 ? 57.843 -55.571 0.765   1.00 62.69  ? 423  PHE A CB   1 
ATOM   2816 C  CG   . PHE A 1 429 ? 57.130 -56.383 -0.292  1.00 61.51  ? 423  PHE A CG   1 
ATOM   2817 C  CD1  . PHE A 1 429 ? 56.671 -57.667 -0.006  1.00 59.61  ? 423  PHE A CD1  1 
ATOM   2818 C  CD2  . PHE A 1 429 ? 56.914 -55.862 -1.566  1.00 56.79  ? 423  PHE A CD2  1 
ATOM   2819 C  CE1  . PHE A 1 429 ? 56.010 -58.424 -0.975  1.00 59.30  ? 423  PHE A CE1  1 
ATOM   2820 C  CE2  . PHE A 1 429 ? 56.255 -56.612 -2.540  1.00 57.92  ? 423  PHE A CE2  1 
ATOM   2821 C  CZ   . PHE A 1 429 ? 55.804 -57.897 -2.244  1.00 57.88  ? 423  PHE A CZ   1 
ATOM   2822 N  N    . ALA A 1 430 ? 60.419 -54.508 -0.685  1.00 59.21  ? 424  ALA A N    1 
ATOM   2823 C  CA   . ALA A 1 430 ? 61.212 -54.218 -1.866  1.00 56.87  ? 424  ALA A CA   1 
ATOM   2824 C  C    . ALA A 1 430 ? 62.565 -54.928 -1.827  1.00 63.95  ? 424  ALA A C    1 
ATOM   2825 O  O    . ALA A 1 430 ? 62.972 -55.547 -2.816  1.00 67.86  ? 424  ALA A O    1 
ATOM   2826 C  CB   . ALA A 1 430 ? 61.376 -52.707 -2.014  1.00 51.89  ? 424  ALA A CB   1 
ATOM   2827 N  N    . LYS A 1 431 ? 63.287 -54.854 -0.702  1.00 63.66  ? 425  LYS A N    1 
ATOM   2828 C  CA   . LYS A 1 431 ? 64.605 -55.492 -0.655  1.00 67.62  ? 425  LYS A CA   1 
ATOM   2829 C  C    . LYS A 1 431 ? 64.510 -56.979 -0.982  1.00 67.05  ? 425  LYS A C    1 
ATOM   2830 O  O    . LYS A 1 431 ? 65.377 -57.529 -1.672  1.00 69.34  ? 425  LYS A O    1 
ATOM   2831 C  CB   . LYS A 1 431 ? 65.279 -55.281 0.716   1.00 72.65  ? 425  LYS A CB   1 
ATOM   2832 C  CG   . LYS A 1 431 ? 66.654 -55.992 0.872   1.00 69.35  ? 425  LYS A CG   1 
ATOM   2833 C  CD   . LYS A 1 431 ? 67.409 -55.653 2.177   1.00 80.85  ? 425  LYS A CD   1 
ATOM   2834 C  CE   . LYS A 1 431 ? 66.765 -56.182 3.492   1.00 93.51  ? 425  LYS A CE   1 
ATOM   2835 N  NZ   . LYS A 1 431 ? 66.803 -57.667 3.730   1.00 91.25  ? 425  LYS A NZ   1 
ATOM   2836 N  N    . ARG A 1 432 ? 63.462 -57.646 -0.502  1.00 64.46  ? 426  ARG A N    1 
ATOM   2837 C  CA   . ARG A 1 432 ? 63.336 -59.084 -0.706  1.00 63.75  ? 426  ARG A CA   1 
ATOM   2838 C  C    . ARG A 1 432 ? 62.857 -59.404 -2.119  1.00 66.71  ? 426  ARG A C    1 
ATOM   2839 O  O    . ARG A 1 432 ? 63.313 -60.377 -2.730  1.00 66.20  ? 426  ARG A O    1 
ATOM   2840 C  CB   . ARG A 1 432 ? 62.380 -59.657 0.336   1.00 65.82  ? 426  ARG A CB   1 
ATOM   2841 C  CG   . ARG A 1 432 ? 62.848 -59.438 1.761   1.00 69.64  ? 426  ARG A CG   1 
ATOM   2842 C  CD   . ARG A 1 432 ? 61.783 -59.830 2.756   1.00 69.88  ? 426  ARG A CD   1 
ATOM   2843 N  NE   . ARG A 1 432 ? 62.187 -59.555 4.130   1.00 79.25  ? 426  ARG A NE   1 
ATOM   2844 C  CZ   . ARG A 1 432 ? 61.361 -59.616 5.173   1.00 79.87  ? 426  ARG A CZ   1 
ATOM   2845 N  NH1  . ARG A 1 432 ? 60.082 -59.934 4.982   1.00 76.58  ? 426  ARG A NH1  1 
ATOM   2846 N  NH2  . ARG A 1 432 ? 61.804 -59.341 6.399   1.00 76.24  ? 426  ARG A NH2  1 
ATOM   2847 N  N    . LEU A 1 433 ? 61.937 -58.601 -2.656  1.00 63.42  ? 427  LEU A N    1 
ATOM   2848 C  CA   . LEU A 1 433 ? 61.534 -58.779 -4.044  1.00 59.45  ? 427  LEU A CA   1 
ATOM   2849 C  C    . LEU A 1 433 ? 62.737 -58.649 -4.973  1.00 63.87  ? 427  LEU A C    1 
ATOM   2850 O  O    . LEU A 1 433 ? 63.071 -59.583 -5.711  1.00 64.88  ? 427  LEU A O    1 
ATOM   2851 C  CB   . LEU A 1 433 ? 60.433 -57.774 -4.401  1.00 58.14  ? 427  LEU A CB   1 
ATOM   2852 C  CG   . LEU A 1 433 ? 59.967 -57.759 -5.861  1.00 56.99  ? 427  LEU A CG   1 
ATOM   2853 C  CD1  . LEU A 1 433 ? 59.507 -59.136 -6.281  1.00 53.89  ? 427  LEU A CD1  1 
ATOM   2854 C  CD2  . LEU A 1 433 ? 58.844 -56.764 -6.010  1.00 52.32  ? 427  LEU A CD2  1 
ATOM   2855 N  N    . HIS A 1 434 ? 63.422 -57.502 -4.926  1.00 63.45  ? 428  HIS A N    1 
ATOM   2856 C  CA   . HIS A 1 434 ? 64.625 -57.312 -5.727  1.00 57.25  ? 428  HIS A CA   1 
ATOM   2857 C  C    . HIS A 1 434 ? 65.608 -58.459 -5.505  1.00 58.67  ? 428  HIS A C    1 
ATOM   2858 O  O    . HIS A 1 434 ? 66.012 -59.147 -6.440  1.00 64.61  ? 428  HIS A O    1 
ATOM   2859 C  CB   . HIS A 1 434 ? 65.282 -55.974 -5.382  1.00 59.15  ? 428  HIS A CB   1 
ATOM   2860 C  CG   . HIS A 1 434 ? 64.377 -54.785 -5.513  1.00 61.52  ? 428  HIS A CG   1 
ATOM   2861 N  ND1  . HIS A 1 434 ? 64.743 -53.527 -5.086  1.00 61.64  ? 428  HIS A ND1  1 
ATOM   2862 C  CD2  . HIS A 1 434 ? 63.118 -54.661 -5.995  1.00 65.90  ? 428  HIS A CD2  1 
ATOM   2863 C  CE1  . HIS A 1 434 ? 63.760 -52.675 -5.321  1.00 62.16  ? 428  HIS A CE1  1 
ATOM   2864 N  NE2  . HIS A 1 434 ? 62.759 -53.337 -5.869  1.00 60.97  ? 428  HIS A NE2  1 
ATOM   2865 N  N    . LYS A 1 435 ? 65.992 -58.707 -4.266  1.00 65.35  ? 429  LYS A N    1 
ATOM   2866 C  CA   . LYS A 1 435 ? 67.026 -59.714 -4.067  1.00 69.91  ? 429  LYS A CA   1 
ATOM   2867 C  C    . LYS A 1 435 ? 66.608 -61.063 -4.644  1.00 67.04  ? 429  LYS A C    1 
ATOM   2868 O  O    . LYS A 1 435 ? 67.452 -61.808 -5.153  1.00 68.20  ? 429  LYS A O    1 
ATOM   2869 C  CB   . LYS A 1 435 ? 67.387 -59.828 -2.574  1.00 67.82  ? 429  LYS A CB   1 
ATOM   2870 C  CG   . LYS A 1 435 ? 68.583 -60.766 -2.323  1.00 75.04  ? 429  LYS A CG   1 
ATOM   2871 C  CD   . LYS A 1 435 ? 68.988 -60.866 -0.856  1.00 80.77  ? 429  LYS A CD   1 
ATOM   2872 C  CE   . LYS A 1 435 ? 69.638 -59.581 -0.361  1.00 76.89  ? 429  LYS A CE   1 
ATOM   2873 N  NZ   . LYS A 1 435 ? 69.968 -59.690 1.090   1.00 84.36  ? 429  LYS A NZ   1 
ATOM   2874 N  N    . THR A 1 436 ? 65.316 -61.392 -4.583  1.00 68.20  ? 430  THR A N    1 
ATOM   2875 C  CA   . THR A 1 436 ? 64.866 -62.731 -4.953  1.00 66.03  ? 430  THR A CA   1 
ATOM   2876 C  C    . THR A 1 436 ? 64.728 -62.876 -6.466  1.00 66.91  ? 430  THR A C    1 
ATOM   2877 O  O    . THR A 1 436 ? 65.026 -63.940 -7.018  1.00 68.87  ? 430  THR A O    1 
ATOM   2878 C  CB   . THR A 1 436 ? 63.541 -63.056 -4.256  1.00 63.55  ? 430  THR A CB   1 
ATOM   2879 O  OG1  . THR A 1 436 ? 63.677 -62.850 -2.847  1.00 67.29  ? 430  THR A OG1  1 
ATOM   2880 C  CG2  . THR A 1 436 ? 63.170 -64.513 -4.476  1.00 62.31  ? 430  THR A CG2  1 
ATOM   2881 N  N    . VAL A 1 437 ? 64.251 -61.831 -7.151  1.00 64.99  ? 431  VAL A N    1 
ATOM   2882 C  CA   . VAL A 1 437 ? 64.282 -61.819 -8.617  1.00 67.40  ? 431  VAL A CA   1 
ATOM   2883 C  C    . VAL A 1 437 ? 65.691 -62.097 -9.122  1.00 67.38  ? 431  VAL A C    1 
ATOM   2884 O  O    . VAL A 1 437 ? 65.944 -63.102 -9.790  1.00 67.31  ? 431  VAL A O    1 
ATOM   2885 C  CB   . VAL A 1 437 ? 63.753 -60.486 -9.167  1.00 63.57  ? 431  VAL A CB   1 
ATOM   2886 C  CG1  . VAL A 1 437 ? 64.225 -60.335 -10.581 1.00 68.36  ? 431  VAL A CG1  1 
ATOM   2887 C  CG2  . VAL A 1 437 ? 62.230 -60.481 -9.135  1.00 58.40  ? 431  VAL A CG2  1 
ATOM   2888 N  N    . ARG A 1 438 ? 66.632 -61.211 -8.781  1.00 67.56  ? 432  ARG A N    1 
ATOM   2889 C  CA   . ARG A 1 438 ? 68.001 -61.317 -9.266  1.00 65.77  ? 432  ARG A CA   1 
ATOM   2890 C  C    . ARG A 1 438 ? 68.613 -62.686 -9.009  1.00 66.43  ? 432  ARG A C    1 
ATOM   2891 O  O    . ARG A 1 438 ? 69.588 -63.051 -9.665  1.00 74.25  ? 432  ARG A O    1 
ATOM   2892 C  CB   . ARG A 1 438 ? 68.879 -60.233 -8.633  1.00 56.28  ? 432  ARG A CB   1 
ATOM   2893 C  CG   . ARG A 1 438 ? 68.417 -58.827 -8.952  1.00 51.70  ? 432  ARG A CG   1 
ATOM   2894 C  CD   . ARG A 1 438 ? 69.451 -57.802 -8.558  1.00 52.93  ? 432  ARG A CD   1 
ATOM   2895 N  NE   . ARG A 1 438 ? 69.043 -56.448 -8.927  1.00 63.89  ? 432  ARG A NE   1 
ATOM   2896 C  CZ   . ARG A 1 438 ? 68.487 -55.572 -8.098  1.00 69.59  ? 432  ARG A CZ   1 
ATOM   2897 N  NH1  . ARG A 1 438 ? 68.331 -55.890 -6.816  1.00 69.59  ? 432  ARG A NH1  1 
ATOM   2898 N  NH2  . ARG A 1 438 ? 68.139 -54.359 -8.533  1.00 69.02  ? 432  ARG A NH2  1 
ATOM   2899 N  N    . ARG A 1 439 ? 68.094 -63.446 -8.057  1.00 66.51  ? 433  ARG A N    1 
ATOM   2900 C  CA   . ARG A 1 439 ? 68.591 -64.806 -7.881  1.00 69.76  ? 433  ARG A CA   1 
ATOM   2901 C  C    . ARG A 1 439 ? 67.925 -65.778 -8.860  1.00 70.06  ? 433  ARG A C    1 
ATOM   2902 O  O    . ARG A 1 439 ? 68.568 -66.719 -9.342  1.00 70.80  ? 433  ARG A O    1 
ATOM   2903 C  CB   . ARG A 1 439 ? 68.395 -65.242 -6.420  1.00 63.83  ? 433  ARG A CB   1 
ATOM   2904 C  CG   . ARG A 1 439 ? 69.178 -64.354 -5.427  1.00 72.64  ? 433  ARG A CG   1 
ATOM   2905 C  CD   . ARG A 1 439 ? 69.127 -64.823 -3.953  1.00 80.54  ? 433  ARG A CD   1 
ATOM   2906 N  NE   . ARG A 1 439 ? 67.782 -64.780 -3.379  1.00 73.53  ? 433  ARG A NE   1 
ATOM   2907 C  CZ   . ARG A 1 439 ? 67.013 -65.855 -3.258  1.00 69.97  ? 433  ARG A CZ   1 
ATOM   2908 N  NH1  . ARG A 1 439 ? 67.474 -67.028 -3.671  1.00 65.35  ? 433  ARG A NH1  1 
ATOM   2909 N  NH2  . ARG A 1 439 ? 65.793 -65.758 -2.746  1.00 70.81  ? 433  ARG A NH2  1 
ATOM   2910 N  N    . LEU A 1 440 ? 66.643 -65.569 -9.169  1.00 66.42  ? 434  LEU A N    1 
ATOM   2911 C  CA   . LEU A 1 440 ? 65.926 -66.479 -10.055 1.00 71.18  ? 434  LEU A CA   1 
ATOM   2912 C  C    . LEU A 1 440 ? 66.246 -66.244 -11.536 1.00 76.70  ? 434  LEU A C    1 
ATOM   2913 O  O    . LEU A 1 440 ? 66.071 -67.158 -12.353 1.00 73.46  ? 434  LEU A O    1 
ATOM   2914 C  CB   . LEU A 1 440 ? 64.418 -66.353 -9.823  1.00 67.34  ? 434  LEU A CB   1 
ATOM   2915 C  CG   . LEU A 1 440 ? 63.797 -66.744 -8.487  1.00 65.39  ? 434  LEU A CG   1 
ATOM   2916 C  CD1  . LEU A 1 440 ? 62.299 -66.441 -8.519  1.00 59.84  ? 434  LEU A CD1  1 
ATOM   2917 C  CD2  . LEU A 1 440 ? 64.050 -68.204 -8.169  1.00 63.20  ? 434  LEU A CD2  1 
ATOM   2918 N  N    . VAL A 1 441 ? 66.690 -65.043 -11.895 1.00 72.36  ? 435  VAL A N    1 
ATOM   2919 C  CA   . VAL A 1 441 ? 67.204 -64.735 -13.222 1.00 72.47  ? 435  VAL A CA   1 
ATOM   2920 C  C    . VAL A 1 441 ? 68.626 -64.203 -13.070 1.00 77.08  ? 435  VAL A C    1 
ATOM   2921 O  O    . VAL A 1 441 ? 68.829 -62.983 -13.039 1.00 77.32  ? 435  VAL A O    1 
ATOM   2922 C  CB   . VAL A 1 441 ? 66.294 -63.733 -13.946 1.00 76.45  ? 435  VAL A CB   1 
ATOM   2923 C  CG1  . VAL A 1 441 ? 64.964 -64.363 -14.234 1.00 76.02  ? 435  VAL A CG1  1 
ATOM   2924 C  CG2  . VAL A 1 441 ? 66.081 -62.516 -13.090 1.00 77.66  ? 435  VAL A CG2  1 
ATOM   2925 N  N    . PRO A 1 442 ? 69.639 -65.067 -12.956 1.00 81.02  ? 436  PRO A N    1 
ATOM   2926 C  CA   . PRO A 1 442 ? 71.015 -64.554 -12.808 1.00 82.76  ? 436  PRO A CA   1 
ATOM   2927 C  C    . PRO A 1 442 ? 71.507 -63.780 -14.024 1.00 88.28  ? 436  PRO A C    1 
ATOM   2928 O  O    . PRO A 1 442 ? 72.287 -62.827 -13.879 1.00 84.09  ? 436  PRO A O    1 
ATOM   2929 C  CB   . PRO A 1 442 ? 71.837 -65.830 -12.570 1.00 81.38  ? 436  PRO A CB   1 
ATOM   2930 C  CG   . PRO A 1 442 ? 71.020 -66.931 -13.185 1.00 83.39  ? 436  PRO A CG   1 
ATOM   2931 C  CD   . PRO A 1 442 ? 69.588 -66.540 -12.939 1.00 80.40  ? 436  PRO A CD   1 
ATOM   2932 N  N    . GLY A 1 443 ? 71.040 -64.133 -15.216 1.00 87.04  ? 437  GLY A N    1 
ATOM   2933 C  CA   . GLY A 1 443 ? 71.395 -63.400 -16.411 1.00 92.93  ? 437  GLY A CA   1 
ATOM   2934 C  C    . GLY A 1 443 ? 70.584 -62.125 -16.556 1.00 98.27  ? 437  GLY A C    1 
ATOM   2935 O  O    . GLY A 1 443 ? 70.387 -61.635 -17.677 1.00 103.03 ? 437  GLY A O    1 
ATOM   2936 N  N    . CYS A 1 444 ? 70.036 -61.633 -15.442 1.00 88.09  ? 438  CYS A N    1 
ATOM   2937 C  CA   . CYS A 1 444 ? 69.373 -60.340 -15.418 1.00 88.11  ? 438  CYS A CA   1 
ATOM   2938 C  C    . CYS A 1 444 ? 70.394 -59.216 -15.268 1.00 87.50  ? 438  CYS A C    1 
ATOM   2939 O  O    . CYS A 1 444 ? 71.538 -59.426 -14.847 1.00 83.80  ? 438  CYS A O    1 
ATOM   2940 C  CB   . CYS A 1 444 ? 68.353 -60.241 -14.267 1.00 92.13  ? 438  CYS A CB   1 
ATOM   2941 S  SG   . CYS A 1 444 ? 69.009 -60.241 -12.526 1.00 91.43  ? 438  CYS A SG   1 
ATOM   2942 N  N    . ASP A 1 445 ? 69.988 -58.029 -15.713 1.00 83.69  ? 439  ASP A N    1 
ATOM   2943 C  CA   . ASP A 1 445 ? 70.322 -56.774 -15.051 1.00 80.93  ? 439  ASP A CA   1 
ATOM   2944 C  C    . ASP A 1 445 ? 69.026 -55.980 -15.011 1.00 83.01  ? 439  ASP A C    1 
ATOM   2945 O  O    . ASP A 1 445 ? 68.581 -55.464 -16.038 1.00 87.37  ? 439  ASP A O    1 
ATOM   2946 C  CB   . ASP A 1 445 ? 71.431 -56.008 -15.775 1.00 86.83  ? 439  ASP A CB   1 
ATOM   2947 C  CG   . ASP A 1 445 ? 71.774 -54.677 -15.091 1.00 98.07  ? 439  ASP A CG   1 
ATOM   2948 O  OD1  . ASP A 1 445 ? 72.280 -54.701 -13.937 1.00 95.55  ? 439  ASP A OD1  1 
ATOM   2949 O  OD2  . ASP A 1 445 ? 71.548 -53.607 -15.712 1.00 98.22  ? 439  ASP A OD2  1 
ATOM   2950 N  N    . VAL A 1 446 ? 68.464 -55.820 -13.822 1.00 86.46  ? 440  VAL A N    1 
ATOM   2951 C  CA   . VAL A 1 446 ? 67.128 -55.275 -13.642 1.00 77.50  ? 440  VAL A CA   1 
ATOM   2952 C  C    . VAL A 1 446 ? 67.256 -54.055 -12.758 1.00 75.08  ? 440  VAL A C    1 
ATOM   2953 O  O    . VAL A 1 446 ? 68.138 -53.997 -11.898 1.00 81.70  ? 440  VAL A O    1 
ATOM   2954 C  CB   . VAL A 1 446 ? 66.181 -56.304 -12.985 1.00 80.50  ? 440  VAL A CB   1 
ATOM   2955 C  CG1  . VAL A 1 446 ? 64.762 -55.731 -12.852 1.00 77.62  ? 440  VAL A CG1  1 
ATOM   2956 C  CG2  . VAL A 1 446 ? 66.209 -57.633 -13.729 1.00 83.39  ? 440  VAL A CG2  1 
ATOM   2957 N  N    . ARG A 1 447 ? 66.375 -53.084 -12.945 1.00 68.64  ? 441  ARG A N    1 
ATOM   2958 C  CA   . ARG A 1 447 ? 66.330 -52.005 -11.974 1.00 76.67  ? 441  ARG A CA   1 
ATOM   2959 C  C    . ARG A 1 447 ? 64.885 -51.589 -11.785 1.00 74.11  ? 441  ARG A C    1 
ATOM   2960 O  O    . ARG A 1 447 ? 64.121 -51.534 -12.758 1.00 67.60  ? 441  ARG A O    1 
ATOM   2961 C  CB   . ARG A 1 447 ? 67.202 -50.807 -12.396 1.00 80.68  ? 441  ARG A CB   1 
ATOM   2962 C  CG   . ARG A 1 447 ? 66.594 -49.831 -13.377 1.00 81.40  ? 441  ARG A CG   1 
ATOM   2963 C  CD   . ARG A 1 447 ? 67.610 -48.731 -13.661 1.00 93.37  ? 441  ARG A CD   1 
ATOM   2964 N  NE   . ARG A 1 447 ? 68.778 -49.309 -14.332 1.00 101.87 ? 441  ARG A NE   1 
ATOM   2965 C  CZ   . ARG A 1 447 ? 69.979 -48.742 -14.408 1.00 103.95 ? 441  ARG A CZ   1 
ATOM   2966 N  NH1  . ARG A 1 447 ? 70.201 -47.560 -13.843 1.00 100.86 ? 441  ARG A NH1  1 
ATOM   2967 N  NH2  . ARG A 1 447 ? 70.964 -49.370 -15.044 1.00 101.77 ? 441  ARG A NH2  1 
ATOM   2968 N  N    . PHE A 1 448 ? 64.508 -51.305 -10.530 1.00 65.63  ? 442  PHE A N    1 
ATOM   2969 C  CA   . PHE A 1 448 ? 63.120 -50.987 -10.254 1.00 59.95  ? 442  PHE A CA   1 
ATOM   2970 C  C    . PHE A 1 448 ? 62.982 -49.495 -10.016 1.00 58.83  ? 442  PHE A C    1 
ATOM   2971 O  O    . PHE A 1 448 ? 63.908 -48.839 -9.550  1.00 64.25  ? 442  PHE A O    1 
ATOM   2972 C  CB   . PHE A 1 448 ? 62.514 -51.749 -9.064  1.00 59.81  ? 442  PHE A CB   1 
ATOM   2973 C  CG   . PHE A 1 448 ? 62.814 -53.231 -9.033  1.00 60.64  ? 442  PHE A CG   1 
ATOM   2974 C  CD1  . PHE A 1 448 ? 64.092 -53.725 -9.251  1.00 64.02  ? 442  PHE A CD1  1 
ATOM   2975 C  CD2  . PHE A 1 448 ? 61.765 -54.136 -9.027  1.00 56.95  ? 442  PHE A CD2  1 
ATOM   2976 C  CE1  . PHE A 1 448 ? 64.345 -55.093 -9.259  1.00 62.41  ? 442  PHE A CE1  1 
ATOM   2977 C  CE2  . PHE A 1 448 ? 62.002 -55.502 -9.082  1.00 59.80  ? 442  PHE A CE2  1 
ATOM   2978 C  CZ   . PHE A 1 448 ? 63.298 -55.984 -9.201  1.00 58.28  ? 442  PHE A CZ   1 
ATOM   2979 N  N    . LEU A 1 449 ? 61.828 -48.965 -10.391 1.00 63.78  ? 443  LEU A N    1 
ATOM   2980 C  CA   . LEU A 1 449 ? 61.462 -47.578 -10.171 1.00 67.23  ? 443  LEU A CA   1 
ATOM   2981 C  C    . LEU A 1 449 ? 60.064 -47.524 -9.576  1.00 71.62  ? 443  LEU A C    1 
ATOM   2982 O  O    . LEU A 1 449 ? 59.317 -48.504 -9.579  1.00 71.46  ? 443  LEU A O    1 
ATOM   2983 C  CB   . LEU A 1 449 ? 61.496 -46.741 -11.460 1.00 67.02  ? 443  LEU A CB   1 
ATOM   2984 C  CG   . LEU A 1 449 ? 62.838 -46.455 -12.128 1.00 71.42  ? 443  LEU A CG   1 
ATOM   2985 C  CD1  . LEU A 1 449 ? 62.622 -45.689 -13.434 1.00 70.88  ? 443  LEU A CD1  1 
ATOM   2986 C  CD2  . LEU A 1 449 ? 63.764 -45.689 -11.189 1.00 69.49  ? 443  LEU A CD2  1 
ATOM   2987 N  N    . ARG A 1 450 ? 59.714 -46.333 -9.116  1.00 73.26  ? 444  ARG A N    1 
ATOM   2988 C  CA   . ARG A 1 450 ? 58.554 -46.063 -8.292  1.00 68.74  ? 444  ARG A CA   1 
ATOM   2989 C  C    . ARG A 1 450 ? 57.845 -44.846 -8.863  1.00 72.40  ? 444  ARG A C    1 
ATOM   2990 O  O    . ARG A 1 450 ? 58.499 -43.876 -9.250  1.00 78.94  ? 444  ARG A O    1 
ATOM   2991 C  CB   . ARG A 1 450 ? 59.054 -45.851 -6.852  1.00 73.82  ? 444  ARG A CB   1 
ATOM   2992 C  CG   . ARG A 1 450 ? 58.086 -45.340 -5.814  1.00 79.08  ? 444  ARG A CG   1 
ATOM   2993 C  CD   . ARG A 1 450 ? 58.783 -45.336 -4.445  1.00 79.77  ? 444  ARG A CD   1 
ATOM   2994 N  NE   . ARG A 1 450 ? 57.968 -44.706 -3.405  1.00 83.71  ? 444  ARG A NE   1 
ATOM   2995 C  CZ   . ARG A 1 450 ? 58.160 -44.877 -2.101  1.00 77.78  ? 444  ARG A CZ   1 
ATOM   2996 N  NH1  . ARG A 1 450 ? 57.371 -44.260 -1.232  1.00 75.47  ? 444  ARG A NH1  1 
ATOM   2997 N  NH2  . ARG A 1 450 ? 59.109 -45.703 -1.671  1.00 75.26  ? 444  ARG A NH2  1 
ATOM   2998 N  N    . SER A 1 451 ? 56.520 -44.886 -8.958  1.00 69.54  ? 445  SER A N    1 
ATOM   2999 C  CA   . SER A 1 451 ? 55.800 -43.772 -9.565  1.00 84.76  ? 445  SER A CA   1 
ATOM   3000 C  C    . SER A 1 451 ? 54.819 -43.173 -8.572  1.00 96.65  ? 445  SER A C    1 
ATOM   3001 O  O    . SER A 1 451 ? 53.877 -43.848 -8.143  1.00 95.49  ? 445  SER A O    1 
ATOM   3002 C  CB   . SER A 1 451 ? 55.057 -44.202 -10.826 1.00 89.45  ? 445  SER A CB   1 
ATOM   3003 O  OG   . SER A 1 451 ? 53.991 -45.062 -10.499 1.00 94.14  ? 445  SER A OG   1 
ATOM   3004 N  N    . GLU A 1 452 ? 55.024 -41.893 -8.238  1.00 105.50 ? 446  GLU A N    1 
ATOM   3005 C  CA   . GLU A 1 452 ? 54.097 -41.196 -7.350  1.00 104.68 ? 446  GLU A CA   1 
ATOM   3006 C  C    . GLU A 1 452 ? 52.690 -41.150 -7.942  1.00 104.69 ? 446  GLU A C    1 
ATOM   3007 O  O    . GLU A 1 452 ? 51.697 -41.230 -7.211  1.00 109.64 ? 446  GLU A O    1 
ATOM   3008 C  CB   . GLU A 1 452 ? 54.610 -39.781 -7.059  1.00 98.07  ? 446  GLU A CB   1 
ATOM   3009 N  N    . ASP A 1 453 ? 52.583 -41.035 -9.266  1.00 102.49 ? 447  ASP A N    1 
ATOM   3010 C  CA   . ASP A 1 453 ? 51.280 -40.800 -9.890  1.00 108.87 ? 447  ASP A CA   1 
ATOM   3011 C  C    . ASP A 1 453 ? 50.400 -42.044 -9.856  1.00 104.77 ? 447  ASP A C    1 
ATOM   3012 O  O    . ASP A 1 453 ? 49.259 -42.001 -9.373  1.00 95.55  ? 447  ASP A O    1 
ATOM   3013 C  CB   . ASP A 1 453 ? 51.478 -40.337 -11.334 1.00 102.72 ? 447  ASP A CB   1 
ATOM   3014 N  N    . GLY A 1 454 ? 50.918 -43.160 -10.378 1.00 106.49 ? 448  GLY A N    1 
ATOM   3015 C  CA   . GLY A 1 454 ? 50.169 -44.394 -10.517 1.00 103.91 ? 448  GLY A CA   1 
ATOM   3016 C  C    . GLY A 1 454 ? 49.043 -44.347 -11.534 1.00 101.53 ? 448  GLY A C    1 
ATOM   3017 O  O    . GLY A 1 454 ? 49.256 -44.121 -12.732 1.00 95.14  ? 448  GLY A O    1 
ATOM   3018 N  N    . SER A 1 455 ? 47.832 -44.620 -11.052 1.00 107.05 ? 449  SER A N    1 
ATOM   3019 C  CA   . SER A 1 455 ? 46.634 -44.532 -11.876 1.00 103.43 ? 449  SER A CA   1 
ATOM   3020 C  C    . SER A 1 455 ? 46.247 -43.095 -12.214 1.00 101.55 ? 449  SER A C    1 
ATOM   3021 O  O    . SER A 1 455 ? 45.387 -42.892 -13.077 1.00 99.24  ? 449  SER A O    1 
ATOM   3022 C  CB   . SER A 1 455 ? 45.484 -45.248 -11.159 1.00 106.51 ? 449  SER A CB   1 
ATOM   3023 O  OG   . SER A 1 455 ? 45.263 -44.708 -9.860  1.00 111.66 ? 449  SER A OG   1 
ATOM   3024 N  N    . GLY A 1 456 ? 46.779 -42.104 -11.498 1.00 105.53 ? 450  GLY A N    1 
ATOM   3025 C  CA   . GLY A 1 456 ? 46.500 -40.717 -11.827 1.00 102.70 ? 450  GLY A CA   1 
ATOM   3026 C  C    . GLY A 1 456 ? 47.203 -40.109 -13.029 1.00 97.00  ? 450  GLY A C    1 
ATOM   3027 O  O    . GLY A 1 456 ? 46.553 -39.731 -14.011 1.00 93.66  ? 450  GLY A O    1 
ATOM   3028 N  N    . LYS A 1 457 ? 48.538 -40.000 -12.964 1.00 97.92  ? 451  LYS A N    1 
ATOM   3029 C  CA   . LYS A 1 457 ? 49.282 -39.415 -14.076 1.00 92.87  ? 451  LYS A CA   1 
ATOM   3030 C  C    . LYS A 1 457 ? 49.580 -40.447 -15.150 1.00 85.83  ? 451  LYS A C    1 
ATOM   3031 O  O    . LYS A 1 457 ? 49.658 -40.094 -16.327 1.00 82.54  ? 451  LYS A O    1 
ATOM   3032 C  CB   . LYS A 1 457 ? 50.570 -38.744 -13.582 1.00 87.10  ? 451  LYS A CB   1 
ATOM   3033 N  N    . GLY A 1 458 ? 49.727 -41.718 -14.762 1.00 88.84  ? 452  GLY A N    1 
ATOM   3034 C  CA   . GLY A 1 458 ? 49.892 -42.780 -15.739 1.00 77.48  ? 452  GLY A CA   1 
ATOM   3035 C  C    . GLY A 1 458 ? 48.774 -42.833 -16.760 1.00 80.72  ? 452  GLY A C    1 
ATOM   3036 O  O    . GLY A 1 458 ? 48.990 -43.240 -17.903 1.00 78.95  ? 452  GLY A O    1 
ATOM   3037 N  N    . ALA A 1 459 ? 47.568 -42.426 -16.372 1.00 81.51  ? 453  ALA A N    1 
ATOM   3038 C  CA   . ALA A 1 459 ? 46.501 -42.326 -17.356 1.00 82.25  ? 453  ALA A CA   1 
ATOM   3039 C  C    . ALA A 1 459 ? 46.684 -41.106 -18.246 1.00 86.62  ? 453  ALA A C    1 
ATOM   3040 O  O    . ALA A 1 459 ? 46.233 -41.105 -19.398 1.00 86.47  ? 453  ALA A O    1 
ATOM   3041 C  CB   . ALA A 1 459 ? 45.142 -42.280 -16.667 1.00 90.26  ? 453  ALA A CB   1 
ATOM   3042 N  N    . ALA A 1 460 ? 47.336 -40.058 -17.737 1.00 85.59  ? 454  ALA A N    1 
ATOM   3043 C  CA   . ALA A 1 460 ? 47.658 -38.924 -18.596 1.00 84.30  ? 454  ALA A CA   1 
ATOM   3044 C  C    . ALA A 1 460 ? 48.788 -39.276 -19.559 1.00 79.68  ? 454  ALA A C    1 
ATOM   3045 O  O    . ALA A 1 460 ? 48.729 -38.941 -20.749 1.00 76.46  ? 454  ALA A O    1 
ATOM   3046 C  CB   . ALA A 1 460 ? 48.029 -37.709 -17.746 1.00 83.61  ? 454  ALA A CB   1 
ATOM   3047 N  N    . MET A 1 461 ? 49.809 -39.977 -19.062 1.00 74.53  ? 455  MET A N    1 
ATOM   3048 C  CA   . MET A 1 461 ? 50.979 -40.281 -19.870 1.00 75.48  ? 455  MET A CA   1 
ATOM   3049 C  C    . MET A 1 461 ? 50.621 -41.211 -21.028 1.00 80.91  ? 455  MET A C    1 
ATOM   3050 O  O    . MET A 1 461 ? 51.178 -41.090 -22.127 1.00 78.45  ? 455  MET A O    1 
ATOM   3051 C  CB   . MET A 1 461 ? 52.067 -40.882 -18.979 1.00 75.24  ? 455  MET A CB   1 
ATOM   3052 C  CG   . MET A 1 461 ? 53.416 -41.061 -19.651 1.00 79.86  ? 455  MET A CG   1 
ATOM   3053 S  SD   . MET A 1 461 ? 54.124 -39.491 -20.214 1.00 87.36  ? 455  MET A SD   1 
ATOM   3054 C  CE   . MET A 1 461 ? 54.585 -38.665 -18.697 1.00 79.37  ? 455  MET A CE   1 
ATOM   3055 N  N    . VAL A 1 462 ? 49.682 -42.137 -20.811 1.00 79.59  ? 456  VAL A N    1 
ATOM   3056 C  CA   . VAL A 1 462 ? 49.184 -42.943 -21.922 1.00 72.67  ? 456  VAL A CA   1 
ATOM   3057 C  C    . VAL A 1 462 ? 48.427 -42.081 -22.920 1.00 74.26  ? 456  VAL A C    1 
ATOM   3058 O  O    . VAL A 1 462 ? 48.412 -42.375 -24.117 1.00 71.96  ? 456  VAL A O    1 
ATOM   3059 C  CB   . VAL A 1 462 ? 48.312 -44.097 -21.404 1.00 71.88  ? 456  VAL A CB   1 
ATOM   3060 C  CG1  . VAL A 1 462 ? 47.576 -44.760 -22.550 1.00 74.15  ? 456  VAL A CG1  1 
ATOM   3061 C  CG2  . VAL A 1 462 ? 49.174 -45.111 -20.704 1.00 71.97  ? 456  VAL A CG2  1 
ATOM   3062 N  N    . THR A 1 463 ? 47.780 -41.014 -22.467 1.00 76.45  ? 457  THR A N    1 
ATOM   3063 C  CA   . THR A 1 463 ? 47.131 -40.143 -23.437 1.00 80.69  ? 457  THR A CA   1 
ATOM   3064 C  C    . THR A 1 463 ? 48.160 -39.293 -24.181 1.00 78.02  ? 457  THR A C    1 
ATOM   3065 O  O    . THR A 1 463 ? 47.900 -38.825 -25.296 1.00 68.75  ? 457  THR A O    1 
ATOM   3066 C  CB   . THR A 1 463 ? 46.084 -39.268 -22.735 1.00 86.25  ? 457  THR A CB   1 
ATOM   3067 O  OG1  . THR A 1 463 ? 45.159 -40.107 -22.045 1.00 88.04  ? 457  THR A OG1  1 
ATOM   3068 C  CG2  . THR A 1 463 ? 45.296 -38.449 -23.750 1.00 92.78  ? 457  THR A CG2  1 
ATOM   3069 N  N    . ALA A 1 464 ? 49.327 -39.071 -23.575 1.00 79.21  ? 458  ALA A N    1 
ATOM   3070 C  CA   . ALA A 1 464 ? 50.361 -38.296 -24.243 1.00 76.10  ? 458  ALA A CA   1 
ATOM   3071 C  C    . ALA A 1 464 ? 51.008 -39.111 -25.351 1.00 70.99  ? 458  ALA A C    1 
ATOM   3072 O  O    . ALA A 1 464 ? 51.315 -38.582 -26.423 1.00 71.10  ? 458  ALA A O    1 
ATOM   3073 C  CB   . ALA A 1 464 ? 51.405 -37.827 -23.226 1.00 71.77  ? 458  ALA A CB   1 
ATOM   3074 N  N    . VAL A 1 465 ? 51.215 -40.403 -25.108 1.00 66.74  ? 459  VAL A N    1 
ATOM   3075 C  CA   . VAL A 1 465 ? 51.799 -41.260 -26.123 1.00 61.16  ? 459  VAL A CA   1 
ATOM   3076 C  C    . VAL A 1 465 ? 50.773 -41.586 -27.201 1.00 67.42  ? 459  VAL A C    1 
ATOM   3077 O  O    . VAL A 1 465 ? 51.097 -41.605 -28.393 1.00 68.87  ? 459  VAL A O    1 
ATOM   3078 C  CB   . VAL A 1 465 ? 52.382 -42.523 -25.475 1.00 59.27  ? 459  VAL A CB   1 
ATOM   3079 C  CG1  . VAL A 1 465 ? 52.812 -43.509 -26.527 1.00 66.56  ? 459  VAL A CG1  1 
ATOM   3080 C  CG2  . VAL A 1 465 ? 53.563 -42.149 -24.634 1.00 65.55  ? 459  VAL A CG2  1 
ATOM   3081 N  N    . ALA A 1 466 ? 49.523 -41.837 -26.814 1.00 65.85  ? 460  ALA A N    1 
ATOM   3082 C  CA   . ALA A 1 466 ? 48.496 -42.076 -27.819 1.00 59.19  ? 460  ALA A CA   1 
ATOM   3083 C  C    . ALA A 1 466 ? 48.307 -40.850 -28.699 1.00 67.03  ? 460  ALA A C    1 
ATOM   3084 O  O    . ALA A 1 466 ? 48.135 -40.965 -29.922 1.00 70.50  ? 460  ALA A O    1 
ATOM   3085 C  CB   . ALA A 1 466 ? 47.181 -42.474 -27.156 1.00 58.09  ? 460  ALA A CB   1 
ATOM   3086 N  N    . TYR A 1 467 ? 48.355 -39.662 -28.102 1.00 68.71  ? 461  TYR A N    1 
ATOM   3087 C  CA   . TYR A 1 467 ? 48.201 -38.447 -28.891 1.00 67.70  ? 461  TYR A CA   1 
ATOM   3088 C  C    . TYR A 1 467 ? 49.405 -38.245 -29.802 1.00 70.97  ? 461  TYR A C    1 
ATOM   3089 O  O    . TYR A 1 467 ? 49.253 -37.958 -30.996 1.00 71.40  ? 461  TYR A O    1 
ATOM   3090 C  CB   . TYR A 1 467 ? 48.017 -37.243 -27.978 1.00 71.62  ? 461  TYR A CB   1 
ATOM   3091 C  CG   . TYR A 1 467 ? 47.750 -35.984 -28.741 1.00 80.70  ? 461  TYR A CG   1 
ATOM   3092 C  CD1  . TYR A 1 467 ? 46.456 -35.645 -29.124 1.00 85.47  ? 461  TYR A CD1  1 
ATOM   3093 C  CD2  . TYR A 1 467 ? 48.798 -35.157 -29.140 1.00 85.99  ? 461  TYR A CD2  1 
ATOM   3094 C  CE1  . TYR A 1 467 ? 46.210 -34.492 -29.853 1.00 91.71  ? 461  TYR A CE1  1 
ATOM   3095 C  CE2  . TYR A 1 467 ? 48.565 -34.006 -29.872 1.00 87.45  ? 461  TYR A CE2  1 
ATOM   3096 C  CZ   . TYR A 1 467 ? 47.272 -33.677 -30.227 1.00 91.88  ? 461  TYR A CZ   1 
ATOM   3097 O  OH   . TYR A 1 467 ? 47.047 -32.530 -30.953 1.00 95.08  ? 461  TYR A OH   1 
ATOM   3098 N  N    . ARG A 1 468 ? 50.613 -38.405 -29.255 1.00 68.75  ? 462  ARG A N    1 
ATOM   3099 C  CA   . ARG A 1 468 ? 51.817 -38.303 -30.072 1.00 66.79  ? 462  ARG A CA   1 
ATOM   3100 C  C    . ARG A 1 468 ? 51.728 -39.205 -31.297 1.00 67.72  ? 462  ARG A C    1 
ATOM   3101 O  O    . ARG A 1 468 ? 51.878 -38.750 -32.438 1.00 65.99  ? 462  ARG A O    1 
ATOM   3102 C  CB   . ARG A 1 468 ? 53.055 -38.654 -29.246 1.00 61.29  ? 462  ARG A CB   1 
ATOM   3103 C  CG   . ARG A 1 468 ? 54.302 -38.631 -30.088 1.00 62.04  ? 462  ARG A CG   1 
ATOM   3104 C  CD   . ARG A 1 468 ? 55.568 -38.862 -29.331 1.00 64.52  ? 462  ARG A CD   1 
ATOM   3105 N  NE   . ARG A 1 468 ? 55.647 -40.175 -28.706 1.00 63.65  ? 462  ARG A NE   1 
ATOM   3106 C  CZ   . ARG A 1 468 ? 55.838 -41.308 -29.370 1.00 69.24  ? 462  ARG A CZ   1 
ATOM   3107 N  NH1  . ARG A 1 468 ? 55.892 -41.293 -30.700 1.00 62.94  ? 462  ARG A NH1  1 
ATOM   3108 N  NH2  . ARG A 1 468 ? 55.932 -42.463 -28.712 1.00 65.32  ? 462  ARG A NH2  1 
ATOM   3109 N  N    . LEU A 1 469 ? 51.482 -40.497 -31.076 1.00 64.39  ? 463  LEU A N    1 
ATOM   3110 C  CA   . LEU A 1 469 ? 51.393 -41.427 -32.190 1.00 60.43  ? 463  LEU A CA   1 
ATOM   3111 C  C    . LEU A 1 469 ? 50.370 -40.955 -33.219 1.00 69.11  ? 463  LEU A C    1 
ATOM   3112 O  O    . LEU A 1 469 ? 50.682 -40.819 -34.408 1.00 67.75  ? 463  LEU A O    1 
ATOM   3113 C  CB   . LEU A 1 469 ? 51.052 -42.822 -31.681 1.00 51.99  ? 463  LEU A CB   1 
ATOM   3114 C  CG   . LEU A 1 469 ? 52.116 -43.423 -30.770 1.00 60.07  ? 463  LEU A CG   1 
ATOM   3115 C  CD1  . LEU A 1 469 ? 51.770 -44.844 -30.389 1.00 62.54  ? 463  LEU A CD1  1 
ATOM   3116 C  CD2  . LEU A 1 469 ? 53.504 -43.344 -31.344 1.00 49.41  ? 463  LEU A CD2  1 
ATOM   3117 N  N    . ALA A 1 470 ? 49.140 -40.684 -32.779 1.00 70.11  ? 464  ALA A N    1 
ATOM   3118 C  CA   . ALA A 1 470 ? 48.109 -40.284 -33.730 1.00 67.66  ? 464  ALA A CA   1 
ATOM   3119 C  C    . ALA A 1 470 ? 48.510 -39.028 -34.485 1.00 70.07  ? 464  ALA A C    1 
ATOM   3120 O  O    . ALA A 1 470 ? 48.167 -38.873 -35.660 1.00 74.09  ? 464  ALA A O    1 
ATOM   3121 C  CB   . ALA A 1 470 ? 46.777 -40.068 -33.018 1.00 69.43  ? 464  ALA A CB   1 
ATOM   3122 N  N    . ASP A 1 471 ? 49.231 -38.116 -33.826 1.00 68.59  ? 465  ASP A N    1 
ATOM   3123 C  CA   . ASP A 1 471 ? 49.595 -36.852 -34.461 1.00 69.65  ? 465  ASP A CA   1 
ATOM   3124 C  C    . ASP A 1 471 ? 50.689 -37.058 -35.505 1.00 70.46  ? 465  ASP A C    1 
ATOM   3125 O  O    . ASP A 1 471 ? 50.633 -36.484 -36.603 1.00 65.88  ? 465  ASP A O    1 
ATOM   3126 C  CB   . ASP A 1 471 ? 50.037 -35.859 -33.388 1.00 72.55  ? 465  ASP A CB   1 
ATOM   3127 C  CG   . ASP A 1 471 ? 50.296 -34.465 -33.930 1.00 80.05  ? 465  ASP A CG   1 
ATOM   3128 O  OD1  . ASP A 1 471 ? 49.325 -33.818 -34.381 1.00 87.34  ? 465  ASP A OD1  1 
ATOM   3129 O  OD2  . ASP A 1 471 ? 51.460 -33.999 -33.870 1.00 81.58  ? 465  ASP A OD2  1 
ATOM   3130 N  N    . GLN A 1 472 ? 51.679 -37.895 -35.183 1.00 66.70  ? 466  GLN A N    1 
ATOM   3131 C  CA   . GLN A 1 472 ? 52.752 -38.202 -36.119 1.00 64.92  ? 466  GLN A CA   1 
ATOM   3132 C  C    . GLN A 1 472 ? 52.256 -39.069 -37.276 1.00 66.19  ? 466  GLN A C    1 
ATOM   3133 O  O    . GLN A 1 472 ? 52.814 -39.026 -38.378 1.00 59.25  ? 466  GLN A O    1 
ATOM   3134 C  CB   . GLN A 1 472 ? 53.887 -38.903 -35.373 1.00 60.85  ? 466  GLN A CB   1 
ATOM   3135 C  CG   . GLN A 1 472 ? 54.514 -38.073 -34.269 1.00 60.01  ? 466  GLN A CG   1 
ATOM   3136 C  CD   . GLN A 1 472 ? 55.661 -38.798 -33.612 1.00 63.87  ? 466  GLN A CD   1 
ATOM   3137 O  OE1  . GLN A 1 472 ? 55.751 -40.033 -33.665 1.00 62.78  ? 466  GLN A OE1  1 
ATOM   3138 N  NE2  . GLN A 1 472 ? 56.562 -38.040 -33.003 1.00 65.15  ? 466  GLN A NE2  1 
ATOM   3139 N  N    . HIS A 1 473 ? 51.216 -39.864 -37.033 1.00 70.09  ? 467  HIS A N    1 
ATOM   3140 C  CA   . HIS A 1 473 ? 50.641 -40.707 -38.073 1.00 64.11  ? 467  HIS A CA   1 
ATOM   3141 C  C    . HIS A 1 473 ? 49.977 -39.867 -39.152 1.00 61.24  ? 467  HIS A C    1 
ATOM   3142 O  O    . HIS A 1 473 ? 50.261 -40.034 -40.336 1.00 61.50  ? 467  HIS A O    1 
ATOM   3143 C  CB   . HIS A 1 473 ? 49.622 -41.650 -37.455 1.00 68.53  ? 467  HIS A CB   1 
ATOM   3144 C  CG   . HIS A 1 473 ? 49.082 -42.663 -38.405 1.00 66.79  ? 467  HIS A CG   1 
ATOM   3145 N  ND1  . HIS A 1 473 ? 49.775 -43.805 -38.745 1.00 64.10  ? 467  HIS A ND1  1 
ATOM   3146 C  CD2  . HIS A 1 473 ? 47.936 -42.683 -39.125 1.00 63.56  ? 467  HIS A CD2  1 
ATOM   3147 C  CE1  . HIS A 1 473 ? 49.057 -44.508 -39.602 1.00 69.45  ? 467  HIS A CE1  1 
ATOM   3148 N  NE2  . HIS A 1 473 ? 47.942 -43.845 -39.856 1.00 72.21  ? 467  HIS A NE2  1 
ATOM   3149 N  N    . ARG A 1 474 ? 49.079 -38.957 -38.772 1.00 65.02  ? 468  ARG A N    1 
ATOM   3150 C  CA   . ARG A 1 474 ? 48.448 -38.159 -39.813 1.00 65.08  ? 468  ARG A CA   1 
ATOM   3151 C  C    . ARG A 1 474 ? 49.488 -37.317 -40.537 1.00 64.76  ? 468  ARG A C    1 
ATOM   3152 O  O    . ARG A 1 474 ? 49.321 -37.020 -41.728 1.00 65.36  ? 468  ARG A O    1 
ATOM   3153 C  CB   . ARG A 1 474 ? 47.320 -37.272 -39.259 1.00 62.70  ? 468  ARG A CB   1 
ATOM   3154 C  CG   . ARG A 1 474 ? 47.753 -36.053 -38.480 1.00 72.79  ? 468  ARG A CG   1 
ATOM   3155 C  CD   . ARG A 1 474 ? 46.543 -35.227 -38.022 1.00 82.21  ? 468  ARG A CD   1 
ATOM   3156 N  NE   . ARG A 1 474 ? 45.697 -35.951 -37.061 1.00 93.42  ? 468  ARG A NE   1 
ATOM   3157 C  CZ   . ARG A 1 474 ? 45.919 -36.021 -35.741 1.00 85.93  ? 468  ARG A CZ   1 
ATOM   3158 N  NH1  . ARG A 1 474 ? 46.973 -35.417 -35.198 1.00 84.05  ? 468  ARG A NH1  1 
ATOM   3159 N  NH2  . ARG A 1 474 ? 45.091 -36.709 -34.961 1.00 81.18  ? 468  ARG A NH2  1 
ATOM   3160 N  N    . ALA A 1 475 ? 50.577 -36.946 -39.851 1.00 59.95  ? 469  ALA A N    1 
ATOM   3161 C  CA   . ALA A 1 475 ? 51.649 -36.215 -40.516 1.00 54.35  ? 469  ALA A CA   1 
ATOM   3162 C  C    . ALA A 1 475 ? 52.269 -37.059 -41.620 1.00 60.92  ? 469  ALA A C    1 
ATOM   3163 O  O    . ALA A 1 475 ? 52.406 -36.611 -42.767 1.00 58.32  ? 469  ALA A O    1 
ATOM   3164 C  CB   . ALA A 1 475 ? 52.715 -35.802 -39.510 1.00 53.52  ? 469  ALA A CB   1 
ATOM   3165 N  N    . ARG A 1 476 ? 52.665 -38.289 -41.281 1.00 58.49  ? 470  ARG A N    1 
ATOM   3166 C  CA   . ARG A 1 476 ? 53.250 -39.175 -42.272 1.00 53.34  ? 470  ARG A CA   1 
ATOM   3167 C  C    . ARG A 1 476 ? 52.240 -39.519 -43.347 1.00 62.72  ? 470  ARG A C    1 
ATOM   3168 O  O    . ARG A 1 476 ? 52.606 -39.665 -44.523 1.00 64.20  ? 470  ARG A O    1 
ATOM   3169 C  CB   . ARG A 1 476 ? 53.779 -40.447 -41.607 1.00 50.10  ? 470  ARG A CB   1 
ATOM   3170 C  CG   . ARG A 1 476 ? 54.982 -40.202 -40.728 1.00 48.70  ? 470  ARG A CG   1 
ATOM   3171 C  CD   . ARG A 1 476 ? 55.706 -41.479 -40.429 1.00 46.75  ? 470  ARG A CD   1 
ATOM   3172 N  NE   . ARG A 1 476 ? 54.860 -42.444 -39.736 1.00 57.32  ? 470  ARG A NE   1 
ATOM   3173 C  CZ   . ARG A 1 476 ? 54.633 -42.439 -38.413 1.00 58.05  ? 470  ARG A CZ   1 
ATOM   3174 N  NH1  . ARG A 1 476 ? 55.162 -41.504 -37.624 1.00 49.15  ? 470  ARG A NH1  1 
ATOM   3175 N  NH2  . ARG A 1 476 ? 53.856 -43.370 -37.882 1.00 51.91  ? 470  ARG A NH2  1 
ATOM   3176 N  N    . GLN A 1 477 ? 50.964 -39.616 -42.971 1.00 57.83  ? 471  GLN A N    1 
ATOM   3177 C  CA   . GLN A 1 477 ? 49.952 -40.028 -43.927 1.00 58.57  ? 471  GLN A CA   1 
ATOM   3178 C  C    . GLN A 1 477 ? 49.624 -38.913 -44.910 1.00 59.66  ? 471  GLN A C    1 
ATOM   3179 O  O    . GLN A 1 477 ? 49.327 -39.188 -46.072 1.00 60.80  ? 471  GLN A O    1 
ATOM   3180 C  CB   . GLN A 1 477 ? 48.699 -40.481 -43.195 1.00 63.92  ? 471  GLN A CB   1 
ATOM   3181 C  CG   . GLN A 1 477 ? 47.751 -41.193 -44.108 1.00 70.77  ? 471  GLN A CG   1 
ATOM   3182 C  CD   . GLN A 1 477 ? 48.418 -42.414 -44.708 1.00 76.98  ? 471  GLN A CD   1 
ATOM   3183 O  OE1  . GLN A 1 477 ? 48.999 -43.239 -43.976 1.00 79.26  ? 471  GLN A OE1  1 
ATOM   3184 N  NE2  . GLN A 1 477 ? 48.333 -42.554 -46.033 1.00 63.30  ? 471  GLN A NE2  1 
ATOM   3185 N  N    . LYS A 1 478 ? 49.647 -37.652 -44.464 1.00 60.41  ? 472  LYS A N    1 
ATOM   3186 C  CA   . LYS A 1 478 ? 49.448 -36.549 -45.401 1.00 59.25  ? 472  LYS A CA   1 
ATOM   3187 C  C    . LYS A 1 478 ? 50.529 -36.561 -46.475 1.00 62.54  ? 472  LYS A C    1 
ATOM   3188 O  O    . LYS A 1 478 ? 50.256 -36.273 -47.648 1.00 63.86  ? 472  LYS A O    1 
ATOM   3189 C  CB   . LYS A 1 478 ? 49.427 -35.203 -44.663 1.00 58.03  ? 472  LYS A CB   1 
ATOM   3190 N  N    . THR A 1 479 ? 51.763 -36.910 -46.099 1.00 60.30  ? 473  THR A N    1 
ATOM   3191 C  CA   . THR A 1 479 ? 52.826 -37.040 -47.088 1.00 60.52  ? 473  THR A CA   1 
ATOM   3192 C  C    . THR A 1 479 ? 52.555 -38.205 -48.033 1.00 61.35  ? 473  THR A C    1 
ATOM   3193 O  O    . THR A 1 479 ? 52.429 -38.020 -49.249 1.00 61.57  ? 473  THR A O    1 
ATOM   3194 C  CB   . THR A 1 479 ? 54.169 -37.234 -46.393 1.00 60.92  ? 473  THR A CB   1 
ATOM   3195 O  OG1  . THR A 1 479 ? 54.482 -36.077 -45.608 1.00 65.59  ? 473  THR A OG1  1 
ATOM   3196 C  CG2  . THR A 1 479 ? 55.270 -37.493 -47.421 1.00 50.26  ? 473  THR A CG2  1 
ATOM   3197 N  N    . LEU A 1 480 ? 52.419 -39.412 -47.480 1.00 58.02  ? 474  LEU A N    1 
ATOM   3198 C  CA   . LEU A 1 480 ? 52.306 -40.612 -48.300 1.00 56.21  ? 474  LEU A CA   1 
ATOM   3199 C  C    . LEU A 1 480 ? 51.125 -40.568 -49.269 1.00 58.64  ? 474  LEU A C    1 
ATOM   3200 O  O    . LEU A 1 480 ? 51.132 -41.299 -50.266 1.00 56.91  ? 474  LEU A O    1 
ATOM   3201 C  CB   . LEU A 1 480 ? 52.201 -41.836 -47.395 1.00 53.65  ? 474  LEU A CB   1 
ATOM   3202 C  CG   . LEU A 1 480 ? 53.473 -42.107 -46.598 1.00 55.39  ? 474  LEU A CG   1 
ATOM   3203 C  CD1  . LEU A 1 480 ? 53.280 -43.278 -45.653 1.00 48.46  ? 474  LEU A CD1  1 
ATOM   3204 C  CD2  . LEU A 1 480 ? 54.673 -42.331 -47.524 1.00 44.71  ? 474  LEU A CD2  1 
ATOM   3205 N  N    . GLU A 1 481 ? 50.126 -39.723 -49.009 1.00 57.61  ? 475  GLU A N    1 
ATOM   3206 C  CA   . GLU A 1 481 ? 48.909 -39.723 -49.809 1.00 57.21  ? 475  GLU A CA   1 
ATOM   3207 C  C    . GLU A 1 481 ? 49.184 -39.222 -51.232 1.00 62.03  ? 475  GLU A C    1 
ATOM   3208 O  O    . GLU A 1 481 ? 48.531 -39.659 -52.195 1.00 57.52  ? 475  GLU A O    1 
ATOM   3209 C  CB   . GLU A 1 481 ? 47.844 -38.888 -49.069 1.00 58.53  ? 475  GLU A CB   1 
ATOM   3210 C  CG   . GLU A 1 481 ? 46.455 -38.877 -49.687 1.00 66.49  ? 475  GLU A CG   1 
ATOM   3211 C  CD   . GLU A 1 481 ? 46.275 -37.791 -50.754 1.00 74.53  ? 475  GLU A CD   1 
ATOM   3212 O  OE1  . GLU A 1 481 ? 46.895 -36.707 -50.618 1.00 75.33  ? 475  GLU A OE1  1 
ATOM   3213 O  OE2  . GLU A 1 481 ? 45.539 -38.034 -51.739 1.00 76.07  ? 475  GLU A OE2  1 
ATOM   3214 N  N    . HIS A 1 482 ? 50.175 -38.337 -51.386 1.00 59.74  ? 476  HIS A N    1 
ATOM   3215 C  CA   . HIS A 1 482 ? 50.525 -37.823 -52.696 1.00 52.68  ? 476  HIS A CA   1 
ATOM   3216 C  C    . HIS A 1 482 ? 51.117 -38.893 -53.600 1.00 53.47  ? 476  HIS A C    1 
ATOM   3217 O  O    . HIS A 1 482 ? 51.137 -38.711 -54.818 1.00 60.66  ? 476  HIS A O    1 
ATOM   3218 C  CB   . HIS A 1 482 ? 51.504 -36.668 -52.556 1.00 55.52  ? 476  HIS A CB   1 
ATOM   3219 C  CG   . HIS A 1 482 ? 50.913 -35.445 -51.930 1.00 61.31  ? 476  HIS A CG   1 
ATOM   3220 N  ND1  . HIS A 1 482 ? 50.887 -35.241 -50.567 1.00 64.81  ? 476  HIS A ND1  1 
ATOM   3221 C  CD2  . HIS A 1 482 ? 50.318 -34.361 -52.482 1.00 65.79  ? 476  HIS A CD2  1 
ATOM   3222 C  CE1  . HIS A 1 482 ? 50.309 -34.082 -50.306 1.00 64.53  ? 476  HIS A CE1  1 
ATOM   3223 N  NE2  . HIS A 1 482 ? 49.956 -33.526 -51.450 1.00 66.90  ? 476  HIS A NE2  1 
ATOM   3224 N  N    . LEU A 1 483 ? 51.618 -39.981 -53.038 1.00 51.18  ? 477  LEU A N    1 
ATOM   3225 C  CA   . LEU A 1 483 ? 52.086 -41.127 -53.795 1.00 46.04  ? 477  LEU A CA   1 
ATOM   3226 C  C    . LEU A 1 483 ? 51.015 -42.197 -53.940 1.00 50.32  ? 477  LEU A C    1 
ATOM   3227 O  O    . LEU A 1 483 ? 51.333 -43.344 -54.286 1.00 50.86  ? 477  LEU A O    1 
ATOM   3228 C  CB   . LEU A 1 483 ? 53.346 -41.731 -53.172 1.00 45.70  ? 477  LEU A CB   1 
ATOM   3229 C  CG   . LEU A 1 483 ? 54.626 -40.912 -53.327 1.00 44.84  ? 477  LEU A CG   1 
ATOM   3230 C  CD1  . LEU A 1 483 ? 54.689 -39.843 -52.249 1.00 54.66  ? 477  LEU A CD1  1 
ATOM   3231 C  CD2  . LEU A 1 483 ? 55.872 -41.754 -53.333 1.00 49.99  ? 477  LEU A CD2  1 
ATOM   3232 N  N    . GLN A 1 484 ? 49.779 -41.891 -53.585 1.00 51.38  ? 478  GLN A N    1 
ATOM   3233 C  CA   . GLN A 1 484 ? 48.691 -42.852 -53.707 1.00 56.00  ? 478  GLN A CA   1 
ATOM   3234 C  C    . GLN A 1 484 ? 47.714 -42.382 -54.778 1.00 56.34  ? 478  GLN A C    1 
ATOM   3235 O  O    . GLN A 1 484 ? 47.002 -41.388 -54.585 1.00 63.27  ? 478  GLN A O    1 
ATOM   3236 C  CB   . GLN A 1 484 ? 48.008 -43.031 -52.360 1.00 51.41  ? 478  GLN A CB   1 
ATOM   3237 C  CG   . GLN A 1 484 ? 48.966 -43.550 -51.348 1.00 55.85  ? 478  GLN A CG   1 
ATOM   3238 C  CD   . GLN A 1 484 ? 48.343 -43.750 -50.005 1.00 60.39  ? 478  GLN A CD   1 
ATOM   3239 O  OE1  . GLN A 1 484 ? 47.305 -43.168 -49.682 1.00 63.27  ? 478  GLN A OE1  1 
ATOM   3240 N  NE2  . GLN A 1 484 ? 48.977 -44.576 -49.202 1.00 56.28  ? 478  GLN A NE2  1 
ATOM   3241 N  N    . LEU A 1 485 ? 47.660 -43.116 -55.886 1.00 52.97  ? 479  LEU A N    1 
ATOM   3242 C  CA   . LEU A 1 485 ? 46.921 -42.712 -57.079 1.00 53.83  ? 479  LEU A CA   1 
ATOM   3243 C  C    . LEU A 1 485 ? 45.614 -43.491 -57.199 1.00 53.23  ? 479  LEU A C    1 
ATOM   3244 O  O    . LEU A 1 485 ? 45.586 -44.722 -57.045 1.00 51.55  ? 479  LEU A O    1 
ATOM   3245 C  CB   . LEU A 1 485 ? 47.778 -42.914 -58.338 1.00 57.85  ? 479  LEU A CB   1 
ATOM   3246 C  CG   . LEU A 1 485 ? 49.075 -42.083 -58.407 1.00 56.66  ? 479  LEU A CG   1 
ATOM   3247 C  CD1  . LEU A 1 485 ? 49.907 -42.368 -59.651 1.00 54.12  ? 479  LEU A CD1  1 
ATOM   3248 C  CD2  . LEU A 1 485 ? 48.764 -40.615 -58.314 1.00 60.25  ? 479  LEU A CD2  1 
ATOM   3249 N  N    . SER A 1 486 ? 44.534 -42.770 -57.471 1.00 51.13  ? 480  SER A N    1 
ATOM   3250 C  CA   . SER A 1 486 ? 43.224 -43.376 -57.612 1.00 46.58  ? 480  SER A CA   1 
ATOM   3251 C  C    . SER A 1 486 ? 43.098 -44.096 -58.938 1.00 59.87  ? 480  SER A C    1 
ATOM   3252 O  O    . SER A 1 486 ? 43.868 -43.861 -59.883 1.00 63.83  ? 480  SER A O    1 
ATOM   3253 C  CB   . SER A 1 486 ? 42.140 -42.318 -57.506 1.00 52.79  ? 480  SER A CB   1 
ATOM   3254 O  OG   . SER A 1 486 ? 42.367 -41.290 -58.444 1.00 53.62  ? 480  SER A OG   1 
ATOM   3255 N  N    . HIS A 1 487 ? 42.098 -44.978 -59.008 1.00 61.45  ? 481  HIS A N    1 
ATOM   3256 C  CA   . HIS A 1 487 ? 41.713 -45.575 -60.287 1.00 56.61  ? 481  HIS A CA   1 
ATOM   3257 C  C    . HIS A 1 487 ? 41.573 -44.508 -61.367 1.00 55.54  ? 481  HIS A C    1 
ATOM   3258 O  O    . HIS A 1 487 ? 42.207 -44.590 -62.421 1.00 56.22  ? 481  HIS A O    1 
ATOM   3259 C  CB   . HIS A 1 487 ? 40.399 -46.319 -60.118 1.00 56.93  ? 481  HIS A CB   1 
ATOM   3260 C  CG   . HIS A 1 487 ? 39.891 -46.952 -61.367 1.00 57.81  ? 481  HIS A CG   1 
ATOM   3261 N  ND1  . HIS A 1 487 ? 40.409 -48.122 -61.875 1.00 60.74  ? 481  HIS A ND1  1 
ATOM   3262 C  CD2  . HIS A 1 487 ? 38.925 -46.557 -62.231 1.00 56.85  ? 481  HIS A CD2  1 
ATOM   3263 C  CE1  . HIS A 1 487 ? 39.763 -48.440 -62.982 1.00 61.73  ? 481  HIS A CE1  1 
ATOM   3264 N  NE2  . HIS A 1 487 ? 38.858 -47.506 -63.220 1.00 61.37  ? 481  HIS A NE2  1 
ATOM   3265 N  N    . ASP A 1 488 ? 40.768 -43.476 -61.107 1.00 59.28  ? 482  ASP A N    1 
ATOM   3266 C  CA   . ASP A 1 488 ? 40.619 -42.409 -62.091 1.00 57.90  ? 482  ASP A CA   1 
ATOM   3267 C  C    . ASP A 1 488 ? 41.967 -41.840 -62.491 1.00 56.45  ? 482  ASP A C    1 
ATOM   3268 O  O    . ASP A 1 488 ? 42.251 -41.660 -63.681 1.00 62.84  ? 482  ASP A O    1 
ATOM   3269 C  CB   . ASP A 1 488 ? 39.712 -41.292 -61.572 1.00 55.10  ? 482  ASP A CB   1 
ATOM   3270 C  CG   . ASP A 1 488 ? 38.254 -41.702 -61.539 1.00 68.03  ? 482  ASP A CG   1 
ATOM   3271 O  OD1  . ASP A 1 488 ? 37.943 -42.816 -62.035 1.00 67.50  ? 482  ASP A OD1  1 
ATOM   3272 O  OD2  . ASP A 1 488 ? 37.417 -40.895 -61.071 1.00 72.30  ? 482  ASP A OD2  1 
ATOM   3273 N  N    . GLN A 1 489 ? 42.814 -41.550 -61.513 1.00 52.53  ? 483  GLN A N    1 
ATOM   3274 C  CA   . GLN A 1 489 ? 44.126 -40.996 -61.833 1.00 57.92  ? 483  GLN A CA   1 
ATOM   3275 C  C    . GLN A 1 489 ? 44.926 -41.920 -62.748 1.00 57.53  ? 483  GLN A C    1 
ATOM   3276 O  O    . GLN A 1 489 ? 45.599 -41.459 -63.679 1.00 51.91  ? 483  GLN A O    1 
ATOM   3277 C  CB   . GLN A 1 489 ? 44.888 -40.709 -60.543 1.00 56.45  ? 483  GLN A CB   1 
ATOM   3278 C  CG   . GLN A 1 489 ? 44.421 -39.451 -59.868 1.00 56.14  ? 483  GLN A CG   1 
ATOM   3279 C  CD   . GLN A 1 489 ? 45.067 -39.244 -58.543 1.00 58.24  ? 483  GLN A CD   1 
ATOM   3280 O  OE1  . GLN A 1 489 ? 45.292 -40.197 -57.782 1.00 59.02  ? 483  GLN A OE1  1 
ATOM   3281 N  NE2  . GLN A 1 489 ? 45.450 -38.001 -58.276 1.00 58.01  ? 483  GLN A NE2  1 
ATOM   3282 N  N    . LEU A 1 490 ? 44.869 -43.227 -62.501 1.00 54.56  ? 484  LEU A N    1 
ATOM   3283 C  CA   . LEU A 1 490 ? 45.648 -44.137 -63.323 1.00 51.74  ? 484  LEU A CA   1 
ATOM   3284 C  C    . LEU A 1 490 ? 45.073 -44.259 -64.731 1.00 56.57  ? 484  LEU A C    1 
ATOM   3285 O  O    . LEU A 1 490 ? 45.820 -44.548 -65.670 1.00 55.38  ? 484  LEU A O    1 
ATOM   3286 C  CB   . LEU A 1 490 ? 45.758 -45.494 -62.628 1.00 55.16  ? 484  LEU A CB   1 
ATOM   3287 C  CG   . LEU A 1 490 ? 46.594 -45.506 -61.332 1.00 57.29  ? 484  LEU A CG   1 
ATOM   3288 C  CD1  . LEU A 1 490 ? 46.413 -46.800 -60.555 1.00 50.80  ? 484  LEU A CD1  1 
ATOM   3289 C  CD2  . LEU A 1 490 ? 48.083 -45.311 -61.639 1.00 49.10  ? 484  LEU A CD2  1 
ATOM   3290 N  N    . LEU A 1 491 ? 43.764 -44.028 -64.914 1.00 58.08  ? 485  LEU A N    1 
ATOM   3291 C  CA   . LEU A 1 491 ? 43.235 -43.941 -66.275 1.00 51.93  ? 485  LEU A CA   1 
ATOM   3292 C  C    . LEU A 1 491 ? 43.772 -42.720 -66.995 1.00 50.50  ? 485  LEU A C    1 
ATOM   3293 O  O    . LEU A 1 491 ? 44.148 -42.804 -68.167 1.00 55.94  ? 485  LEU A O    1 
ATOM   3294 C  CB   . LEU A 1 491 ? 41.708 -43.902 -66.304 1.00 52.06  ? 485  LEU A CB   1 
ATOM   3295 C  CG   . LEU A 1 491 ? 40.874 -45.149 -66.030 1.00 56.52  ? 485  LEU A CG   1 
ATOM   3296 C  CD1  . LEU A 1 491 ? 39.397 -44.808 -66.171 1.00 53.60  ? 485  LEU A CD1  1 
ATOM   3297 C  CD2  . LEU A 1 491 ? 41.253 -46.257 -66.982 1.00 53.95  ? 485  LEU A CD2  1 
ATOM   3298 N  N    . GLU A 1 492 ? 43.798 -41.574 -66.323 1.00 51.27  ? 486  GLU A N    1 
ATOM   3299 C  CA   . GLU A 1 492 ? 44.355 -40.382 -66.948 1.00 52.87  ? 486  GLU A CA   1 
ATOM   3300 C  C    . GLU A 1 492 ? 45.810 -40.608 -67.356 1.00 56.72  ? 486  GLU A C    1 
ATOM   3301 O  O    . GLU A 1 492 ? 46.229 -40.202 -68.447 1.00 57.43  ? 486  GLU A O    1 
ATOM   3302 C  CB   . GLU A 1 492 ? 44.206 -39.185 -66.006 1.00 51.31  ? 486  GLU A CB   1 
ATOM   3303 C  CG   . GLU A 1 492 ? 44.772 -37.892 -66.547 1.00 56.01  ? 486  GLU A CG   1 
ATOM   3304 C  CD   . GLU A 1 492 ? 44.122 -37.429 -67.851 1.00 62.17  ? 486  GLU A CD   1 
ATOM   3305 O  OE1  . GLU A 1 492 ? 43.057 -37.963 -68.244 1.00 64.24  ? 486  GLU A OE1  1 
ATOM   3306 O  OE2  . GLU A 1 492 ? 44.688 -36.515 -68.491 1.00 60.83  ? 486  GLU A OE2  1 
ATOM   3307 N  N    . VAL A 1 493 ? 46.591 -41.281 -66.506 1.00 56.45  ? 487  VAL A N    1 
ATOM   3308 C  CA   . VAL A 1 493 ? 47.951 -41.663 -66.882 1.00 51.83  ? 487  VAL A CA   1 
ATOM   3309 C  C    . VAL A 1 493 ? 47.927 -42.520 -68.141 1.00 50.34  ? 487  VAL A C    1 
ATOM   3310 O  O    . VAL A 1 493 ? 48.693 -42.288 -69.081 1.00 57.19  ? 487  VAL A O    1 
ATOM   3311 C  CB   . VAL A 1 493 ? 48.650 -42.382 -65.713 1.00 49.41  ? 487  VAL A CB   1 
ATOM   3312 C  CG1  . VAL A 1 493 ? 50.024 -42.864 -66.122 1.00 43.61  ? 487  VAL A CG1  1 
ATOM   3313 C  CG2  . VAL A 1 493 ? 48.748 -41.454 -64.529 1.00 52.03  ? 487  VAL A CG2  1 
ATOM   3314 N  N    . LYS A 1 494 ? 47.043 -43.520 -68.180 1.00 50.02  ? 488  LYS A N    1 
ATOM   3315 C  CA   . LYS A 1 494 ? 46.873 -44.341 -69.379 1.00 50.74  ? 488  LYS A CA   1 
ATOM   3316 C  C    . LYS A 1 494 ? 46.516 -43.489 -70.595 1.00 55.22  ? 488  LYS A C    1 
ATOM   3317 O  O    . LYS A 1 494 ? 47.065 -43.675 -71.696 1.00 46.68  ? 488  LYS A O    1 
ATOM   3318 C  CB   . LYS A 1 494 ? 45.791 -45.388 -69.149 1.00 43.59  ? 488  LYS A CB   1 
ATOM   3319 C  CG   . LYS A 1 494 ? 45.545 -46.205 -70.358 1.00 45.54  ? 488  LYS A CG   1 
ATOM   3320 C  CD   . LYS A 1 494 ? 44.440 -47.219 -70.196 1.00 50.50  ? 488  LYS A CD   1 
ATOM   3321 C  CE   . LYS A 1 494 ? 44.166 -47.870 -71.553 1.00 55.76  ? 488  LYS A CE   1 
ATOM   3322 N  NZ   . LYS A 1 494 ? 43.086 -48.891 -71.603 1.00 56.55  ? 488  LYS A NZ   1 
ATOM   3323 N  N    . ARG A 1 495 ? 45.575 -42.557 -70.410 1.00 55.11  ? 489  ARG A N    1 
ATOM   3324 C  CA   . ARG A 1 495 ? 45.153 -41.694 -71.507 1.00 56.49  ? 489  ARG A CA   1 
ATOM   3325 C  C    . ARG A 1 495 ? 46.310 -40.842 -72.004 1.00 57.79  ? 489  ARG A C    1 
ATOM   3326 O  O    . ARG A 1 495 ? 46.500 -40.680 -73.212 1.00 59.19  ? 489  ARG A O    1 
ATOM   3327 C  CB   . ARG A 1 495 ? 44.013 -40.786 -71.056 1.00 53.97  ? 489  ARG A CB   1 
ATOM   3328 C  CG   . ARG A 1 495 ? 43.421 -40.001 -72.189 1.00 56.15  ? 489  ARG A CG   1 
ATOM   3329 C  CD   . ARG A 1 495 ? 42.501 -38.900 -71.724 1.00 57.41  ? 489  ARG A CD   1 
ATOM   3330 N  NE   . ARG A 1 495 ? 43.265 -37.784 -71.165 1.00 59.31  ? 489  ARG A NE   1 
ATOM   3331 C  CZ   . ARG A 1 495 ? 43.930 -36.908 -71.918 1.00 58.62  ? 489  ARG A CZ   1 
ATOM   3332 N  NH1  . ARG A 1 495 ? 43.941 -37.062 -73.234 1.00 59.74  ? 489  ARG A NH1  1 
ATOM   3333 N  NH2  . ARG A 1 495 ? 44.605 -35.901 -71.372 1.00 57.33  ? 489  ARG A NH2  1 
ATOM   3334 N  N    . ARG A 1 496 ? 47.090 -40.278 -71.078 1.00 56.70  ? 490  ARG A N    1 
ATOM   3335 C  CA   . ARG A 1 496 ? 48.191 -39.409 -71.471 1.00 55.25  ? 490  ARG A CA   1 
ATOM   3336 C  C    . ARG A 1 496 ? 49.311 -40.189 -72.139 1.00 54.68  ? 490  ARG A C    1 
ATOM   3337 O  O    . ARG A 1 496 ? 50.076 -39.615 -72.915 1.00 60.80  ? 490  ARG A O    1 
ATOM   3338 C  CB   . ARG A 1 496 ? 48.736 -38.658 -70.254 1.00 54.80  ? 490  ARG A CB   1 
ATOM   3339 C  CG   . ARG A 1 496 ? 47.735 -37.721 -69.617 1.00 55.00  ? 490  ARG A CG   1 
ATOM   3340 C  CD   . ARG A 1 496 ? 48.377 -36.894 -68.543 1.00 60.70  ? 490  ARG A CD   1 
ATOM   3341 N  NE   . ARG A 1 496 ? 47.401 -36.112 -67.791 1.00 60.86  ? 490  ARG A NE   1 
ATOM   3342 C  CZ   . ARG A 1 496 ? 47.722 -35.303 -66.788 1.00 64.30  ? 490  ARG A CZ   1 
ATOM   3343 N  NH1  . ARG A 1 496 ? 48.987 -35.151 -66.439 1.00 62.29  ? 490  ARG A NH1  1 
ATOM   3344 N  NH2  . ARG A 1 496 ? 46.784 -34.627 -66.146 1.00 70.91  ? 490  ARG A NH2  1 
ATOM   3345 N  N    . MET A 1 497 ? 49.453 -41.478 -71.823 1.00 53.32  ? 491  MET A N    1 
ATOM   3346 C  CA   . MET A 1 497 ? 50.458 -42.283 -72.502 1.00 52.14  ? 491  MET A CA   1 
ATOM   3347 C  C    . MET A 1 497 ? 50.063 -42.529 -73.949 1.00 57.45  ? 491  MET A C    1 
ATOM   3348 O  O    . MET A 1 497 ? 50.927 -42.642 -74.824 1.00 55.05  ? 491  MET A O    1 
ATOM   3349 C  CB   . MET A 1 497 ? 50.654 -43.616 -71.775 1.00 49.74  ? 491  MET A CB   1 
ATOM   3350 C  CG   . MET A 1 497 ? 51.600 -44.537 -72.521 1.00 48.82  ? 491  MET A CG   1 
ATOM   3351 S  SD   . MET A 1 497 ? 53.326 -44.009 -72.563 1.00 52.61  ? 491  MET A SD   1 
ATOM   3352 C  CE   . MET A 1 497 ? 54.034 -44.900 -71.186 1.00 50.22  ? 491  MET A CE   1 
ATOM   3353 N  N    . LYS A 1 498 ? 48.756 -42.639 -74.199 1.00 61.35  ? 492  LYS A N    1 
ATOM   3354 C  CA   . LYS A 1 498 ? 48.237 -42.840 -75.546 1.00 58.04  ? 492  LYS A CA   1 
ATOM   3355 C  C    . LYS A 1 498 ? 48.601 -41.670 -76.449 1.00 59.05  ? 492  LYS A C    1 
ATOM   3356 O  O    . LYS A 1 498 ? 49.149 -41.866 -77.538 1.00 53.81  ? 492  LYS A O    1 
ATOM   3357 C  CB   . LYS A 1 498 ? 46.725 -43.026 -75.467 1.00 62.82  ? 492  LYS A CB   1 
ATOM   3358 C  CG   . LYS A 1 498 ? 45.992 -43.178 -76.768 1.00 72.32  ? 492  LYS A CG   1 
ATOM   3359 C  CD   . LYS A 1 498 ? 44.491 -43.301 -76.480 1.00 71.83  ? 492  LYS A CD   1 
ATOM   3360 C  CE   . LYS A 1 498 ? 43.669 -43.263 -77.760 1.00 85.60  ? 492  LYS A CE   1 
ATOM   3361 N  NZ   . LYS A 1 498 ? 43.708 -41.900 -78.403 1.00 90.83  ? 492  LYS A NZ   1 
ATOM   3362 N  N    . VAL A 1 499 ? 48.339 -40.436 -76.001 1.00 57.46  ? 493  VAL A N    1 
ATOM   3363 C  CA   . VAL A 1 499 ? 48.596 -39.320 -76.900 1.00 58.79  ? 493  VAL A CA   1 
ATOM   3364 C  C    . VAL A 1 499 ? 50.090 -39.130 -77.056 1.00 56.28  ? 493  VAL A C    1 
ATOM   3365 O  O    . VAL A 1 499 ? 50.560 -38.701 -78.109 1.00 64.34  ? 493  VAL A O    1 
ATOM   3366 C  CB   . VAL A 1 499 ? 47.948 -38.004 -76.432 1.00 52.61  ? 493  VAL A CB   1 
ATOM   3367 C  CG1  . VAL A 1 499 ? 46.667 -38.259 -75.651 1.00 54.04  ? 493  VAL A CG1  1 
ATOM   3368 C  CG2  . VAL A 1 499 ? 48.944 -37.056 -75.826 1.00 55.92  ? 493  VAL A CG2  1 
ATOM   3369 N  N    . GLU A 1 500 ? 50.873 -39.438 -76.036 1.00 55.77  ? 494  GLU A N    1 
ATOM   3370 C  CA   . GLU A 1 500 ? 52.309 -39.356 -76.252 1.00 58.58  ? 494  GLU A CA   1 
ATOM   3371 C  C    . GLU A 1 500 ? 52.779 -40.415 -77.245 1.00 54.26  ? 494  GLU A C    1 
ATOM   3372 O  O    . GLU A 1 500 ? 53.758 -40.190 -77.963 1.00 54.93  ? 494  GLU A O    1 
ATOM   3373 C  CB   . GLU A 1 500 ? 53.054 -39.452 -74.918 1.00 50.31  ? 494  GLU A CB   1 
ATOM   3374 C  CG   . GLU A 1 500 ? 52.880 -38.224 -74.035 1.00 55.21  ? 494  GLU A CG   1 
ATOM   3375 C  CD   . GLU A 1 500 ? 53.278 -36.922 -74.746 1.00 68.29  ? 494  GLU A CD   1 
ATOM   3376 O  OE1  . GLU A 1 500 ? 54.186 -36.962 -75.623 1.00 68.21  ? 494  GLU A OE1  1 
ATOM   3377 O  OE2  . GLU A 1 500 ? 52.705 -35.856 -74.402 1.00 67.03  ? 494  GLU A OE2  1 
ATOM   3378 N  N    . MET A 1 501 ? 52.097 -41.562 -77.310 1.00 50.41  ? 495  MET A N    1 
ATOM   3379 C  CA   . MET A 1 501 ? 52.480 -42.600 -78.262 1.00 53.62  ? 495  MET A CA   1 
ATOM   3380 C  C    . MET A 1 501 ? 52.177 -42.159 -79.689 1.00 62.27  ? 495  MET A C    1 
ATOM   3381 O  O    . MET A 1 501 ? 52.980 -42.367 -80.607 1.00 61.98  ? 495  MET A O    1 
ATOM   3382 C  CB   . MET A 1 501 ? 51.742 -43.902 -77.949 1.00 51.61  ? 495  MET A CB   1 
ATOM   3383 C  CG   . MET A 1 501 ? 52.106 -44.537 -76.629 1.00 52.91  ? 495  MET A CG   1 
ATOM   3384 S  SD   . MET A 1 501 ? 51.087 -45.974 -76.249 1.00 56.58  ? 495  MET A SD   1 
ATOM   3385 C  CE   . MET A 1 501 ? 51.751 -47.213 -77.359 1.00 50.92  ? 495  MET A CE   1 
ATOM   3386 N  N    . GLU A 1 502 ? 50.997 -41.575 -79.897 1.00 60.58  ? 496  GLU A N    1 
ATOM   3387 C  CA   . GLU A 1 502 ? 50.666 -40.988 -81.182 1.00 55.53  ? 496  GLU A CA   1 
ATOM   3388 C  C    . GLU A 1 502 ? 51.668 -39.904 -81.551 1.00 58.10  ? 496  GLU A C    1 
ATOM   3389 O  O    . GLU A 1 502 ? 52.258 -39.939 -82.639 1.00 65.74  ? 496  GLU A O    1 
ATOM   3390 C  CB   . GLU A 1 502 ? 49.244 -40.445 -81.127 1.00 53.59  ? 496  GLU A CB   1 
ATOM   3391 C  CG   . GLU A 1 502 ? 48.253 -41.566 -80.877 1.00 61.24  ? 496  GLU A CG   1 
ATOM   3392 C  CD   . GLU A 1 502 ? 46.854 -41.075 -80.542 1.00 75.57  ? 496  GLU A CD   1 
ATOM   3393 O  OE1  . GLU A 1 502 ? 46.646 -39.838 -80.553 1.00 78.01  ? 496  GLU A OE1  1 
ATOM   3394 O  OE2  . GLU A 1 502 ? 45.995 -41.925 -80.180 1.00 75.55  ? 496  GLU A OE2  1 
ATOM   3395 N  N    . ARG A 1 503 ? 51.898 -38.949 -80.648 1.00 52.27  ? 497  ARG A N    1 
ATOM   3396 C  CA   . ARG A 1 503 ? 52.794 -37.841 -80.954 1.00 53.16  ? 497  ARG A CA   1 
ATOM   3397 C  C    . ARG A 1 503 ? 54.116 -38.329 -81.529 1.00 58.65  ? 497  ARG A C    1 
ATOM   3398 O  O    . ARG A 1 503 ? 54.667 -37.717 -82.447 1.00 64.02  ? 497  ARG A O    1 
ATOM   3399 C  CB   . ARG A 1 503 ? 53.067 -37.009 -79.711 1.00 59.39  ? 497  ARG A CB   1 
ATOM   3400 C  CG   . ARG A 1 503 ? 53.791 -35.712 -80.011 1.00 63.85  ? 497  ARG A CG   1 
ATOM   3401 C  CD   . ARG A 1 503 ? 54.362 -35.061 -78.753 1.00 70.37  ? 497  ARG A CD   1 
ATOM   3402 N  NE   . ARG A 1 503 ? 53.371 -34.858 -77.699 1.00 69.40  ? 497  ARG A NE   1 
ATOM   3403 C  CZ   . ARG A 1 503 ? 52.483 -33.874 -77.685 1.00 77.02  ? 497  ARG A CZ   1 
ATOM   3404 N  NH1  . ARG A 1 503 ? 52.433 -33.011 -78.696 1.00 75.37  ? 497  ARG A NH1  1 
ATOM   3405 N  NH2  . ARG A 1 503 ? 51.629 -33.779 -76.670 1.00 77.76  ? 497  ARG A NH2  1 
ATOM   3406 N  N    . GLY A 1 504 ? 54.654 -39.423 -81.002 1.00 56.16  ? 498  GLY A N    1 
ATOM   3407 C  CA   . GLY A 1 504 ? 55.944 -39.878 -81.483 1.00 56.52  ? 498  GLY A CA   1 
ATOM   3408 C  C    . GLY A 1 504 ? 55.864 -40.649 -82.777 1.00 58.43  ? 498  GLY A C    1 
ATOM   3409 O  O    . GLY A 1 504 ? 56.798 -40.607 -83.588 1.00 59.43  ? 498  GLY A O    1 
ATOM   3410 N  N    . LEU A 1 505 ? 54.772 -41.385 -82.980 1.00 52.62  ? 499  LEU A N    1 
ATOM   3411 C  CA   . LEU A 1 505 ? 54.587 -42.093 -84.230 1.00 54.84  ? 499  LEU A CA   1 
ATOM   3412 C  C    . LEU A 1 505 ? 54.329 -41.137 -85.399 1.00 62.63  ? 499  LEU A C    1 
ATOM   3413 O  O    . LEU A 1 505 ? 54.606 -41.486 -86.560 1.00 54.94  ? 499  LEU A O    1 
ATOM   3414 C  CB   . LEU A 1 505 ? 53.444 -43.092 -84.084 1.00 50.35  ? 499  LEU A CB   1 
ATOM   3415 C  CG   . LEU A 1 505 ? 53.632 -44.342 -83.246 1.00 52.63  ? 499  LEU A CG   1 
ATOM   3416 C  CD1  . LEU A 1 505 ? 52.323 -45.102 -83.178 1.00 56.67  ? 499  LEU A CD1  1 
ATOM   3417 C  CD2  . LEU A 1 505 ? 54.713 -45.219 -83.824 1.00 49.05  ? 499  LEU A CD2  1 
ATOM   3418 N  N    . SER A 1 506 ? 53.822 -39.940 -85.106 1.00 60.21  ? 500  SER A N    1 
ATOM   3419 C  CA   . SER A 1 506 ? 53.508 -38.943 -86.115 1.00 58.79  ? 500  SER A CA   1 
ATOM   3420 C  C    . SER A 1 506 ? 54.786 -38.287 -86.619 1.00 64.97  ? 500  SER A C    1 
ATOM   3421 O  O    . SER A 1 506 ? 55.485 -37.620 -85.850 1.00 61.97  ? 500  SER A O    1 
ATOM   3422 C  CB   . SER A 1 506 ? 52.589 -37.895 -85.504 1.00 62.08  ? 500  SER A CB   1 
ATOM   3423 O  OG   . SER A 1 506 ? 52.385 -36.812 -86.382 1.00 72.93  ? 500  SER A OG   1 
ATOM   3424 N  N    . LYS A 1 507 ? 55.063 -38.416 -87.924 1.00 68.55  ? 501  LYS A N    1 
ATOM   3425 C  CA   . LYS A 1 507 ? 56.273 -37.796 -88.450 1.00 67.93  ? 501  LYS A CA   1 
ATOM   3426 C  C    . LYS A 1 507 ? 56.208 -36.289 -88.296 1.00 65.63  ? 501  LYS A C    1 
ATOM   3427 O  O    . LYS A 1 507 ? 57.242 -35.634 -88.128 1.00 64.65  ? 501  LYS A O    1 
ATOM   3428 C  CB   . LYS A 1 507 ? 56.495 -38.172 -89.911 1.00 68.15  ? 501  LYS A CB   1 
ATOM   3429 C  CG   . LYS A 1 507 ? 55.498 -37.567 -90.836 1.00 75.63  ? 501  LYS A CG   1 
ATOM   3430 C  CD   . LYS A 1 507 ? 55.726 -37.983 -92.278 1.00 71.71  ? 501  LYS A CD   1 
ATOM   3431 C  CE   . LYS A 1 507 ? 54.676 -37.295 -93.132 1.00 78.81  ? 501  LYS A CE   1 
ATOM   3432 N  NZ   . LYS A 1 507 ? 53.310 -37.675 -92.634 1.00 78.28  ? 501  LYS A NZ   1 
ATOM   3433 N  N    . GLU A 1 508 ? 55.002 -35.726 -88.300 1.00 64.77  ? 502  GLU A N    1 
ATOM   3434 C  CA   . GLU A 1 508 ? 54.861 -34.311 -87.992 1.00 70.57  ? 502  GLU A CA   1 
ATOM   3435 C  C    . GLU A 1 508 ? 55.500 -33.970 -86.651 1.00 68.64  ? 502  GLU A C    1 
ATOM   3436 O  O    . GLU A 1 508 ? 56.436 -33.165 -86.585 1.00 66.04  ? 502  GLU A O    1 
ATOM   3437 C  CB   . GLU A 1 508 ? 53.383 -33.921 -88.007 1.00 78.40  ? 502  GLU A CB   1 
ATOM   3438 C  CG   . GLU A 1 508 ? 53.109 -32.483 -87.583 1.00 87.54  ? 502  GLU A CG   1 
ATOM   3439 C  CD   . GLU A 1 508 ? 51.633 -32.109 -87.699 1.00 102.77 ? 502  GLU A CD   1 
ATOM   3440 O  OE1  . GLU A 1 508 ? 50.841 -32.930 -88.227 1.00 107.95 ? 502  GLU A OE1  1 
ATOM   3441 O  OE2  . GLU A 1 508 ? 51.264 -31.009 -87.225 1.00 104.49 ? 502  GLU A OE2  1 
ATOM   3442 N  N    . THR A 1 509 ? 55.032 -34.610 -85.571 1.00 72.80  ? 503  THR A N    1 
ATOM   3443 C  CA   . THR A 1 509 ? 55.388 -34.229 -84.202 1.00 64.63  ? 503  THR A CA   1 
ATOM   3444 C  C    . THR A 1 509 ? 56.529 -35.047 -83.593 1.00 60.44  ? 503  THR A C    1 
ATOM   3445 O  O    . THR A 1 509 ? 56.972 -34.728 -82.489 1.00 64.41  ? 503  THR A O    1 
ATOM   3446 C  CB   . THR A 1 509 ? 54.141 -34.295 -83.311 1.00 63.81  ? 503  THR A CB   1 
ATOM   3447 O  OG1  . THR A 1 509 ? 53.488 -35.557 -83.475 1.00 64.92  ? 503  THR A OG1  1 
ATOM   3448 C  CG2  . THR A 1 509 ? 53.169 -33.190 -83.666 1.00 62.21  ? 503  THR A CG2  1 
ATOM   3449 N  N    . HIS A 1 510 ? 57.073 -36.027 -84.316 1.00 60.69  ? 504  HIS A N    1 
ATOM   3450 C  CA   . HIS A 1 510 ? 58.125 -36.896 -83.791 1.00 58.91  ? 504  HIS A CA   1 
ATOM   3451 C  C    . HIS A 1 510 ? 59.354 -36.164 -83.265 1.00 66.07  ? 504  HIS A C    1 
ATOM   3452 O  O    . HIS A 1 510 ? 60.148 -36.773 -82.549 1.00 71.50  ? 504  HIS A O    1 
ATOM   3453 C  CB   . HIS A 1 510 ? 58.609 -37.837 -84.869 1.00 58.36  ? 504  HIS A CB   1 
ATOM   3454 C  CG   . HIS A 1 510 ? 59.730 -38.718 -84.437 1.00 57.91  ? 504  HIS A CG   1 
ATOM   3455 N  ND1  . HIS A 1 510 ? 59.538 -39.861 -83.696 1.00 59.75  ? 504  HIS A ND1  1 
ATOM   3456 C  CD2  . HIS A 1 510 ? 61.070 -38.581 -84.577 1.00 62.47  ? 504  HIS A CD2  1 
ATOM   3457 C  CE1  . HIS A 1 510 ? 60.711 -40.420 -83.444 1.00 62.81  ? 504  HIS A CE1  1 
ATOM   3458 N  NE2  . HIS A 1 510 ? 61.657 -39.661 -83.965 1.00 62.57  ? 504  HIS A NE2  1 
ATOM   3459 N  N    . ALA A 1 511 ? 59.589 -34.909 -83.641 1.00 72.14  ? 505  ALA A N    1 
ATOM   3460 C  CA   . ALA A 1 511 ? 60.798 -34.244 -83.155 1.00 69.89  ? 505  ALA A CA   1 
ATOM   3461 C  C    . ALA A 1 511 ? 60.617 -33.678 -81.748 1.00 74.30  ? 505  ALA A C    1 
ATOM   3462 O  O    . ALA A 1 511 ? 61.557 -33.686 -80.944 1.00 75.98  ? 505  ALA A O    1 
ATOM   3463 C  CB   . ALA A 1 511 ? 61.222 -33.133 -84.114 1.00 68.68  ? 505  ALA A CB   1 
ATOM   3464 N  N    . SER A 1 512 ? 59.434 -33.148 -81.443 1.00 70.39  ? 506  SER A N    1 
ATOM   3465 C  CA   . SER A 1 512 ? 59.185 -32.608 -80.116 1.00 69.53  ? 506  SER A CA   1 
ATOM   3466 C  C    . SER A 1 512 ? 58.727 -33.674 -79.139 1.00 70.41  ? 506  SER A C    1 
ATOM   3467 O  O    . SER A 1 512 ? 58.751 -33.434 -77.926 1.00 74.20  ? 506  SER A O    1 
ATOM   3468 C  CB   . SER A 1 512 ? 58.111 -31.514 -80.172 1.00 77.51  ? 506  SER A CB   1 
ATOM   3469 O  OG   . SER A 1 512 ? 56.834 -32.067 -80.500 1.00 74.67  ? 506  SER A OG   1 
ATOM   3470 N  N    . ALA A 1 513 ? 58.313 -34.834 -79.638 1.00 68.39  ? 507  ALA A N    1 
ATOM   3471 C  CA   . ALA A 1 513 ? 57.632 -35.806 -78.802 1.00 63.41  ? 507  ALA A CA   1 
ATOM   3472 C  C    . ALA A 1 513 ? 58.623 -36.489 -77.861 1.00 65.33  ? 507  ALA A C    1 
ATOM   3473 O  O    . ALA A 1 513 ? 59.677 -36.965 -78.313 1.00 60.36  ? 507  ALA A O    1 
ATOM   3474 C  CB   . ALA A 1 513 ? 56.906 -36.830 -79.667 1.00 59.65  ? 507  ALA A CB   1 
ATOM   3475 N  N    . PRO A 1 514 ? 58.327 -36.535 -76.552 1.00 59.14  ? 508  PRO A N    1 
ATOM   3476 C  CA   . PRO A 1 514 ? 59.250 -37.167 -75.591 1.00 51.37  ? 508  PRO A CA   1 
ATOM   3477 C  C    . PRO A 1 514 ? 59.327 -38.683 -75.705 1.00 54.06  ? 508  PRO A C    1 
ATOM   3478 O  O    . PRO A 1 514 ? 60.407 -39.274 -75.531 1.00 50.17  ? 508  PRO A O    1 
ATOM   3479 C  CB   . PRO A 1 514 ? 58.652 -36.744 -74.250 1.00 58.40  ? 508  PRO A CB   1 
ATOM   3480 C  CG   . PRO A 1 514 ? 57.781 -35.553 -74.580 1.00 61.44  ? 508  PRO A CG   1 
ATOM   3481 C  CD   . PRO A 1 514 ? 57.194 -35.885 -75.881 1.00 57.93  ? 508  PRO A CD   1 
ATOM   3482 N  N    . VAL A 1 515 ? 58.204 -39.337 -75.991 1.00 52.29  ? 509  VAL A N    1 
ATOM   3483 C  CA   . VAL A 1 515 ? 58.189 -40.774 -76.224 1.00 50.50  ? 509  VAL A CA   1 
ATOM   3484 C  C    . VAL A 1 515 ? 58.400 -40.963 -77.724 1.00 51.39  ? 509  VAL A C    1 
ATOM   3485 O  O    . VAL A 1 515 ? 57.519 -40.652 -78.521 1.00 57.23  ? 509  VAL A O    1 
ATOM   3486 C  CB   . VAL A 1 515 ? 56.874 -41.400 -75.739 1.00 46.96  ? 509  VAL A CB   1 
ATOM   3487 C  CG1  . VAL A 1 515 ? 56.841 -42.884 -75.991 1.00 47.62  ? 509  VAL A CG1  1 
ATOM   3488 C  CG2  . VAL A 1 515 ? 56.675 -41.124 -74.268 1.00 46.58  ? 509  VAL A CG2  1 
ATOM   3489 N  N    . LYS A 1 516 ? 59.576 -41.467 -78.111 1.00 49.44  ? 510  LYS A N    1 
ATOM   3490 C  CA   . LYS A 1 516 ? 60.007 -41.382 -79.504 1.00 49.94  ? 510  LYS A CA   1 
ATOM   3491 C  C    . LYS A 1 516 ? 59.435 -42.464 -80.401 1.00 50.82  ? 510  LYS A C    1 
ATOM   3492 O  O    . LYS A 1 516 ? 59.419 -42.277 -81.611 1.00 52.54  ? 510  LYS A O    1 
ATOM   3493 C  CB   . LYS A 1 516 ? 61.532 -41.423 -79.634 1.00 49.43  ? 510  LYS A CB   1 
ATOM   3494 C  CG   . LYS A 1 516 ? 62.242 -40.250 -79.042 1.00 44.23  ? 510  LYS A CG   1 
ATOM   3495 C  CD   . LYS A 1 516 ? 61.674 -38.977 -79.570 1.00 46.62  ? 510  LYS A CD   1 
ATOM   3496 C  CE   . LYS A 1 516 ? 62.520 -37.813 -79.168 1.00 46.77  ? 510  LYS A CE   1 
ATOM   3497 N  NZ   . LYS A 1 516 ? 61.893 -36.546 -79.615 1.00 60.37  ? 510  LYS A NZ   1 
ATOM   3498 N  N    . MET A 1 517 ? 59.047 -43.617 -79.873 1.00 51.12  ? 511  MET A N    1 
ATOM   3499 C  CA   . MET A 1 517 ? 58.347 -44.620 -80.677 1.00 49.02  ? 511  MET A CA   1 
ATOM   3500 C  C    . MET A 1 517 ? 59.207 -45.100 -81.855 1.00 48.80  ? 511  MET A C    1 
ATOM   3501 O  O    . MET A 1 517 ? 58.717 -45.319 -82.963 1.00 58.57  ? 511  MET A O    1 
ATOM   3502 C  CB   . MET A 1 517 ? 57.012 -44.052 -81.155 1.00 48.22  ? 511  MET A CB   1 
ATOM   3503 C  CG   . MET A 1 517 ? 56.130 -43.553 -80.013 1.00 49.87  ? 511  MET A CG   1 
ATOM   3504 S  SD   . MET A 1 517 ? 55.516 -44.820 -78.872 1.00 55.26  ? 511  MET A SD   1 
ATOM   3505 C  CE   . MET A 1 517 ? 54.204 -45.582 -79.822 1.00 51.57  ? 511  MET A CE   1 
ATOM   3506 N  N    . LEU A 1 518 ? 60.489 -45.312 -81.590 1.00 46.93  ? 512  LEU A N    1 
ATOM   3507 C  CA   . LEU A 1 518 ? 61.491 -45.491 -82.625 1.00 44.36  ? 512  LEU A CA   1 
ATOM   3508 C  C    . LEU A 1 518 ? 61.274 -46.781 -83.406 1.00 52.90  ? 512  LEU A C    1 
ATOM   3509 O  O    . LEU A 1 518 ? 61.000 -47.823 -82.809 1.00 50.87  ? 512  LEU A O    1 
ATOM   3510 C  CB   . LEU A 1 518 ? 62.880 -45.533 -82.008 1.00 47.93  ? 512  LEU A CB   1 
ATOM   3511 C  CG   . LEU A 1 518 ? 63.188 -44.254 -81.257 1.00 54.14  ? 512  LEU A CG   1 
ATOM   3512 C  CD1  . LEU A 1 518 ? 64.555 -44.352 -80.633 1.00 55.23  ? 512  LEU A CD1  1 
ATOM   3513 C  CD2  . LEU A 1 518 ? 63.057 -43.085 -82.230 1.00 54.38  ? 512  LEU A CD2  1 
ATOM   3514 N  N    . PRO A 1 519 ? 61.442 -46.754 -84.736 1.00 55.87  ? 513  PRO A N    1 
ATOM   3515 C  CA   . PRO A 1 519 ? 61.337 -47.986 -85.521 1.00 47.26  ? 513  PRO A CA   1 
ATOM   3516 C  C    . PRO A 1 519 ? 62.537 -48.877 -85.252 1.00 47.10  ? 513  PRO A C    1 
ATOM   3517 O  O    . PRO A 1 519 ? 63.675 -48.407 -85.215 1.00 49.09  ? 513  PRO A O    1 
ATOM   3518 C  CB   . PRO A 1 519 ? 61.319 -47.480 -86.970 1.00 53.36  ? 513  PRO A CB   1 
ATOM   3519 C  CG   . PRO A 1 519 ? 60.931 -46.031 -86.856 1.00 51.46  ? 513  PRO A CG   1 
ATOM   3520 C  CD   . PRO A 1 519 ? 61.618 -45.581 -85.610 1.00 48.33  ? 513  PRO A CD   1 
ATOM   3521 N  N    . THR A 1 520 ? 62.276 -50.164 -85.047 1.00 47.35  ? 514  THR A N    1 
ATOM   3522 C  CA   . THR A 1 520 ? 63.331 -51.131 -84.785 1.00 48.77  ? 514  THR A CA   1 
ATOM   3523 C  C    . THR A 1 520 ? 63.785 -51.893 -86.013 1.00 52.86  ? 514  THR A C    1 
ATOM   3524 O  O    . THR A 1 520 ? 64.788 -52.597 -85.931 1.00 58.55  ? 514  THR A O    1 
ATOM   3525 C  CB   . THR A 1 520 ? 62.872 -52.160 -83.730 1.00 52.20  ? 514  THR A CB   1 
ATOM   3526 O  OG1  . THR A 1 520 ? 61.768 -52.913 -84.241 1.00 49.07  ? 514  THR A OG1  1 
ATOM   3527 C  CG2  . THR A 1 520 ? 62.441 -51.469 -82.413 1.00 46.25  ? 514  THR A CG2  1 
ATOM   3528 N  N    . TYR A 1 521 ? 63.057 -51.799 -87.131 1.00 57.74  ? 515  TYR A N    1 
ATOM   3529 C  CA   . TYR A 1 521 ? 63.270 -52.631 -88.328 1.00 55.45  ? 515  TYR A CA   1 
ATOM   3530 C  C    . TYR A 1 521 ? 63.243 -54.123 -87.997 1.00 60.03  ? 515  TYR A C    1 
ATOM   3531 O  O    . TYR A 1 521 ? 63.868 -54.940 -88.682 1.00 58.29  ? 515  TYR A O    1 
ATOM   3532 C  CB   . TYR A 1 521 ? 64.567 -52.251 -89.056 1.00 55.92  ? 515  TYR A CB   1 
ATOM   3533 C  CG   . TYR A 1 521 ? 64.525 -50.813 -89.509 1.00 57.78  ? 515  TYR A CG   1 
ATOM   3534 C  CD1  . TYR A 1 521 ? 63.920 -50.454 -90.698 1.00 49.96  ? 515  TYR A CD1  1 
ATOM   3535 C  CD2  . TYR A 1 521 ? 65.036 -49.805 -88.707 1.00 58.73  ? 515  TYR A CD2  1 
ATOM   3536 C  CE1  . TYR A 1 521 ? 63.844 -49.133 -91.079 1.00 53.19  ? 515  TYR A CE1  1 
ATOM   3537 C  CE2  . TYR A 1 521 ? 64.962 -48.481 -89.084 1.00 56.83  ? 515  TYR A CE2  1 
ATOM   3538 C  CZ   . TYR A 1 521 ? 64.373 -48.153 -90.270 1.00 57.86  ? 515  TYR A CZ   1 
ATOM   3539 O  OH   . TYR A 1 521 ? 64.315 -46.828 -90.626 1.00 66.75  ? 515  TYR A OH   1 
ATOM   3540 N  N    . VAL A 1 522 ? 62.513 -54.496 -86.946 1.00 56.37  ? 516  VAL A N    1 
ATOM   3541 C  CA   . VAL A 1 522 ? 62.233 -55.898 -86.654 1.00 58.31  ? 516  VAL A CA   1 
ATOM   3542 C  C    . VAL A 1 522 ? 60.790 -56.146 -87.092 1.00 60.64  ? 516  VAL A C    1 
ATOM   3543 O  O    . VAL A 1 522 ? 59.848 -55.614 -86.500 1.00 54.08  ? 516  VAL A O    1 
ATOM   3544 C  CB   . VAL A 1 522 ? 62.471 -56.218 -85.178 1.00 54.64  ? 516  VAL A CB   1 
ATOM   3545 C  CG1  . VAL A 1 522 ? 62.145 -57.658 -84.883 1.00 57.77  ? 516  VAL A CG1  1 
ATOM   3546 C  CG2  . VAL A 1 522 ? 63.912 -55.921 -84.821 1.00 54.32  ? 516  VAL A CG2  1 
ATOM   3547 N  N    . CYS A 1 523 ? 60.622 -56.831 -88.234 1.00 68.67  ? 517  CYS A N    1 
ATOM   3548 C  CA   . CYS A 1 523 ? 59.294 -57.097 -88.772 1.00 62.64  ? 517  CYS A CA   1 
ATOM   3549 C  C    . CYS A 1 523 ? 58.863 -58.556 -88.791 1.00 66.96  ? 517  CYS A C    1 
ATOM   3550 O  O    . CYS A 1 523 ? 57.675 -58.817 -88.994 1.00 67.81  ? 517  CYS A O    1 
ATOM   3551 C  CB   . CYS A 1 523 ? 59.209 -56.542 -90.193 1.00 60.45  ? 517  CYS A CB   1 
ATOM   3552 S  SG   . CYS A 1 523 ? 59.529 -54.784 -90.251 1.00 69.38  ? 517  CYS A SG   1 
ATOM   3553 N  N    . ALA A 1 524 ? 59.758 -59.511 -88.560 1.00 69.27  ? 518  ALA A N    1 
ATOM   3554 C  CA   . ALA A 1 524 ? 59.490 -60.885 -88.975 1.00 70.97  ? 518  ALA A CA   1 
ATOM   3555 C  C    . ALA A 1 524 ? 59.654 -61.840 -87.809 1.00 74.78  ? 518  ALA A C    1 
ATOM   3556 O  O    . ALA A 1 524 ? 60.730 -61.917 -87.211 1.00 74.01  ? 518  ALA A O    1 
ATOM   3557 C  CB   . ALA A 1 524 ? 60.407 -61.303 -90.126 1.00 73.37  ? 518  ALA A CB   1 
ATOM   3558 N  N    . THR A 1 525 ? 58.593 -62.578 -87.511 1.00 82.45  ? 519  THR A N    1 
ATOM   3559 C  CA   . THR A 1 525 ? 58.642 -63.644 -86.530 1.00 83.91  ? 519  THR A CA   1 
ATOM   3560 C  C    . THR A 1 525 ? 59.515 -64.788 -87.031 1.00 84.02  ? 519  THR A C    1 
ATOM   3561 O  O    . THR A 1 525 ? 59.767 -64.905 -88.232 1.00 89.30  ? 519  THR A O    1 
ATOM   3562 C  CB   . THR A 1 525 ? 57.238 -64.171 -86.264 1.00 88.47  ? 519  THR A CB   1 
ATOM   3563 O  OG1  . THR A 1 525 ? 57.293 -65.201 -85.271 1.00 91.32  ? 519  THR A OG1  1 
ATOM   3564 C  CG2  . THR A 1 525 ? 56.640 -64.738 -87.566 1.00 94.64  ? 519  THR A CG2  1 
ATOM   3565 N  N    . PRO A 1 526 ? 59.980 -65.654 -86.130 1.00 83.29  ? 520  PRO A N    1 
ATOM   3566 C  CA   . PRO A 1 526 ? 60.645 -66.885 -86.577 1.00 87.49  ? 520  PRO A CA   1 
ATOM   3567 C  C    . PRO A 1 526 ? 59.680 -67.810 -87.310 1.00 93.75  ? 520  PRO A C    1 
ATOM   3568 O  O    . PRO A 1 526 ? 58.493 -67.904 -86.984 1.00 95.13  ? 520  PRO A O    1 
ATOM   3569 C  CB   . PRO A 1 526 ? 61.157 -67.504 -85.274 1.00 80.16  ? 520  PRO A CB   1 
ATOM   3570 C  CG   . PRO A 1 526 ? 61.368 -66.342 -84.396 1.00 83.97  ? 520  PRO A CG   1 
ATOM   3571 C  CD   . PRO A 1 526 ? 60.218 -65.405 -84.703 1.00 85.99  ? 520  PRO A CD   1 
ATOM   3572 N  N    . ASP A 1 527 ? 60.199 -68.463 -88.342 1.00 98.09  ? 521  ASP A N    1 
ATOM   3573 C  CA   . ASP A 1 527 ? 59.382 -69.197 -89.301 1.00 102.81 ? 521  ASP A CA   1 
ATOM   3574 C  C    . ASP A 1 527 ? 59.962 -70.582 -89.547 1.00 105.96 ? 521  ASP A C    1 
ATOM   3575 O  O    . ASP A 1 527 ? 60.892 -70.723 -90.352 1.00 105.35 ? 521  ASP A O    1 
ATOM   3576 C  CB   . ASP A 1 527 ? 59.331 -68.396 -90.605 1.00 99.73  ? 521  ASP A CB   1 
ATOM   3577 C  CG   . ASP A 1 527 ? 58.753 -69.168 -91.746 1.00 100.70 ? 521  ASP A CG   1 
ATOM   3578 O  OD1  . ASP A 1 527 ? 58.300 -70.312 -91.531 1.00 105.71 ? 521  ASP A OD1  1 
ATOM   3579 O  OD2  . ASP A 1 527 ? 58.780 -68.626 -92.874 1.00 104.84 ? 521  ASP A OD2  1 
ATOM   3580 N  N    . GLY A 1 528 ? 59.336 -71.614 -88.978 1.00 97.02  ? 522  GLY A N    1 
ATOM   3581 C  CA   . GLY A 1 528 ? 59.673 -72.949 -89.431 1.00 104.21 ? 522  GLY A CA   1 
ATOM   3582 C  C    . GLY A 1 528 ? 61.156 -73.254 -89.355 1.00 105.47 ? 522  GLY A C    1 
ATOM   3583 O  O    . GLY A 1 528 ? 61.737 -73.336 -88.271 1.00 103.49 ? 522  GLY A O    1 
ATOM   3584 N  N    . THR A 1 529 ? 61.763 -73.488 -90.517 1.00 109.67 ? 523  THR A N    1 
ATOM   3585 C  CA   . THR A 1 529 ? 63.188 -73.779 -90.597 1.00 111.38 ? 523  THR A CA   1 
ATOM   3586 C  C    . THR A 1 529 ? 64.024 -72.502 -90.533 1.00 109.41 ? 523  THR A C    1 
ATOM   3587 O  O    . THR A 1 529 ? 63.961 -71.662 -91.442 1.00 108.88 ? 523  THR A O    1 
ATOM   3588 C  CB   . THR A 1 529 ? 63.490 -74.532 -91.892 1.00 115.66 ? 523  THR A CB   1 
ATOM   3589 O  OG1  . THR A 1 529 ? 64.875 -74.909 -91.917 1.00 114.76 ? 523  THR A OG1  1 
ATOM   3590 C  CG2  . THR A 1 529 ? 63.153 -73.665 -93.116 1.00 118.25 ? 523  THR A CG2  1 
ATOM   3591 N  N    . GLU A 1 530 ? 64.829 -72.383 -89.469 1.00 105.61 ? 524  GLU A N    1 
ATOM   3592 C  CA   . GLU A 1 530 ? 65.996 -71.507 -89.398 1.00 96.39  ? 524  GLU A CA   1 
ATOM   3593 C  C    . GLU A 1 530 ? 67.146 -72.329 -88.836 1.00 96.78  ? 524  GLU A C    1 
ATOM   3594 O  O    . GLU A 1 530 ? 66.981 -73.005 -87.815 1.00 101.32 ? 524  GLU A O    1 
ATOM   3595 C  CB   . GLU A 1 530 ? 65.783 -70.273 -88.510 1.00 93.21  ? 524  GLU A CB   1 
ATOM   3596 C  CG   . GLU A 1 530 ? 64.802 -69.212 -88.988 1.00 88.13  ? 524  GLU A CG   1 
ATOM   3597 C  CD   . GLU A 1 530 ? 63.403 -69.399 -88.450 1.00 92.05  ? 524  GLU A CD   1 
ATOM   3598 O  OE1  . GLU A 1 530 ? 63.136 -70.440 -87.816 1.00 99.37  ? 524  GLU A OE1  1 
ATOM   3599 O  OE2  . GLU A 1 530 ? 62.581 -68.474 -88.619 1.00 87.02  ? 524  GLU A OE2  1 
ATOM   3600 N  N    . LYS A 1 531 ? 68.306 -72.263 -89.481 1.00 94.94  ? 525  LYS A N    1 
ATOM   3601 C  CA   . LYS A 1 531 ? 69.419 -73.150 -89.172 1.00 95.26  ? 525  LYS A CA   1 
ATOM   3602 C  C    . LYS A 1 531 ? 70.678 -72.351 -88.855 1.00 88.69  ? 525  LYS A C    1 
ATOM   3603 O  O    . LYS A 1 531 ? 70.812 -71.184 -89.233 1.00 89.29  ? 525  LYS A O    1 
ATOM   3604 C  CB   . LYS A 1 531 ? 69.699 -74.113 -90.347 1.00 93.75  ? 525  LYS A CB   1 
ATOM   3605 N  N    . GLY A 1 532 ? 71.609 -73.002 -88.166 1.00 85.81  ? 526  GLY A N    1 
ATOM   3606 C  CA   . GLY A 1 532 ? 72.968 -72.512 -88.026 1.00 86.18  ? 526  GLY A CA   1 
ATOM   3607 C  C    . GLY A 1 532 ? 73.279 -71.999 -86.629 1.00 86.59  ? 526  GLY A C    1 
ATOM   3608 O  O    . GLY A 1 532 ? 72.438 -71.973 -85.729 1.00 89.66  ? 526  GLY A O    1 
ATOM   3609 N  N    . ASP A 1 533 ? 74.538 -71.599 -86.467 1.00 82.27  ? 527  ASP A N    1 
ATOM   3610 C  CA   . ASP A 1 533 ? 75.033 -71.035 -85.224 1.00 77.15  ? 527  ASP A CA   1 
ATOM   3611 C  C    . ASP A 1 533 ? 75.006 -69.515 -85.298 1.00 80.58  ? 527  ASP A C    1 
ATOM   3612 O  O    . ASP A 1 533 ? 75.275 -68.930 -86.353 1.00 83.99  ? 527  ASP A O    1 
ATOM   3613 C  CB   . ASP A 1 533 ? 76.454 -71.509 -84.938 1.00 83.16  ? 527  ASP A CB   1 
ATOM   3614 C  CG   . ASP A 1 533 ? 76.528 -73.001 -84.724 1.00 93.48  ? 527  ASP A CG   1 
ATOM   3615 O  OD1  . ASP A 1 533 ? 75.451 -73.635 -84.651 1.00 90.81  ? 527  ASP A OD1  1 
ATOM   3616 O  OD2  . ASP A 1 533 ? 77.658 -73.532 -84.599 1.00 99.99  ? 527  ASP A OD2  1 
ATOM   3617 N  N    . PHE A 1 534 ? 74.681 -68.877 -84.173 1.00 78.63  ? 528  PHE A N    1 
ATOM   3618 C  CA   . PHE A 1 534 ? 74.530 -67.429 -84.125 1.00 70.81  ? 528  PHE A CA   1 
ATOM   3619 C  C    . PHE A 1 534 ? 75.139 -66.889 -82.847 1.00 67.30  ? 528  PHE A C    1 
ATOM   3620 O  O    . PHE A 1 534 ? 74.847 -67.389 -81.761 1.00 72.13  ? 528  PHE A O    1 
ATOM   3621 C  CB   . PHE A 1 534 ? 73.059 -67.038 -84.201 1.00 69.64  ? 528  PHE A CB   1 
ATOM   3622 C  CG   . PHE A 1 534 ? 72.397 -67.480 -85.458 1.00 72.04  ? 528  PHE A CG   1 
ATOM   3623 C  CD1  . PHE A 1 534 ? 72.534 -66.745 -86.620 1.00 72.03  ? 528  PHE A CD1  1 
ATOM   3624 C  CD2  . PHE A 1 534 ? 71.647 -68.635 -85.487 1.00 73.61  ? 528  PHE A CD2  1 
ATOM   3625 C  CE1  . PHE A 1 534 ? 71.930 -67.151 -87.781 1.00 72.59  ? 528  PHE A CE1  1 
ATOM   3626 C  CE2  . PHE A 1 534 ? 71.038 -69.040 -86.644 1.00 73.83  ? 528  PHE A CE2  1 
ATOM   3627 C  CZ   . PHE A 1 534 ? 71.182 -68.300 -87.793 1.00 76.52  ? 528  PHE A CZ   1 
ATOM   3628 N  N    . LEU A 1 535 ? 75.994 -65.890 -82.977 1.00 64.02  ? 529  LEU A N    1 
ATOM   3629 C  CA   . LEU A 1 535 ? 76.521 -65.185 -81.825 1.00 62.88  ? 529  LEU A CA   1 
ATOM   3630 C  C    . LEU A 1 535 ? 75.580 -64.054 -81.474 1.00 65.16  ? 529  LEU A C    1 
ATOM   3631 O  O    . LEU A 1 535 ? 74.986 -63.432 -82.356 1.00 64.11  ? 529  LEU A O    1 
ATOM   3632 C  CB   . LEU A 1 535 ? 77.912 -64.626 -82.106 1.00 66.41  ? 529  LEU A CB   1 
ATOM   3633 C  CG   . LEU A 1 535 ? 79.072 -65.609 -82.172 1.00 72.67  ? 529  LEU A CG   1 
ATOM   3634 C  CD1  . LEU A 1 535 ? 80.261 -64.951 -82.844 1.00 75.46  ? 529  LEU A CD1  1 
ATOM   3635 C  CD2  . LEU A 1 535 ? 79.438 -66.013 -80.757 1.00 67.38  ? 529  LEU A CD2  1 
ATOM   3636 N  N    . ALA A 1 536 ? 75.430 -63.797 -80.181 1.00 60.48  ? 530  ALA A N    1 
ATOM   3637 C  CA   . ALA A 1 536 ? 74.710 -62.617 -79.761 1.00 57.11  ? 530  ALA A CA   1 
ATOM   3638 C  C    . ALA A 1 536 ? 75.488 -61.968 -78.633 1.00 60.71  ? 530  ALA A C    1 
ATOM   3639 O  O    . ALA A 1 536 ? 76.336 -62.594 -77.999 1.00 60.85  ? 530  ALA A O    1 
ATOM   3640 C  CB   . ALA A 1 536 ? 73.272 -62.948 -79.360 1.00 60.89  ? 530  ALA A CB   1 
ATOM   3641 N  N    . LEU A 1 537 ? 75.231 -60.680 -78.432 1.00 63.25  ? 531  LEU A N    1 
ATOM   3642 C  CA   . LEU A 1 537 ? 75.832 -59.922 -77.350 1.00 60.59  ? 531  LEU A CA   1 
ATOM   3643 C  C    . LEU A 1 537 ? 74.725 -59.274 -76.545 1.00 59.93  ? 531  LEU A C    1 
ATOM   3644 O  O    . LEU A 1 537 ? 73.665 -58.935 -77.082 1.00 60.30  ? 531  LEU A O    1 
ATOM   3645 C  CB   . LEU A 1 537 ? 76.784 -58.842 -77.852 1.00 59.63  ? 531  LEU A CB   1 
ATOM   3646 C  CG   . LEU A 1 537 ? 78.067 -59.251 -78.549 1.00 60.57  ? 531  LEU A CG   1 
ATOM   3647 C  CD1  . LEU A 1 537 ? 78.798 -58.002 -78.989 1.00 61.63  ? 531  LEU A CD1  1 
ATOM   3648 C  CD2  . LEU A 1 537 ? 78.915 -60.066 -77.618 1.00 59.43  ? 531  LEU A CD2  1 
ATOM   3649 N  N    . ASP A 1 538 ? 74.964 -59.133 -75.254 1.00 58.72  ? 532  ASP A N    1 
ATOM   3650 C  CA   . ASP A 1 538 ? 74.028 -58.484 -74.353 1.00 59.58  ? 532  ASP A CA   1 
ATOM   3651 C  C    . ASP A 1 538 ? 74.842 -57.451 -73.583 1.00 62.97  ? 532  ASP A C    1 
ATOM   3652 O  O    . ASP A 1 538 ? 75.673 -57.806 -72.739 1.00 64.25  ? 532  ASP A O    1 
ATOM   3653 C  CB   . ASP A 1 538 ? 73.385 -59.538 -73.451 1.00 65.07  ? 532  ASP A CB   1 
ATOM   3654 C  CG   . ASP A 1 538 ? 72.179 -59.036 -72.696 1.00 72.49  ? 532  ASP A CG   1 
ATOM   3655 O  OD1  . ASP A 1 538 ? 71.717 -57.903 -72.955 1.00 72.99  ? 532  ASP A OD1  1 
ATOM   3656 O  OD2  . ASP A 1 538 ? 71.701 -59.796 -71.819 1.00 74.55  ? 532  ASP A OD2  1 
ATOM   3657 N  N    . LEU A 1 539 ? 74.612 -56.174 -73.869 1.00 59.60  ? 533  LEU A N    1 
ATOM   3658 C  CA   . LEU A 1 539 ? 75.434 -55.109 -73.318 1.00 58.09  ? 533  LEU A CA   1 
ATOM   3659 C  C    . LEU A 1 539 ? 74.538 -53.997 -72.817 1.00 58.12  ? 533  LEU A C    1 
ATOM   3660 O  O    . LEU A 1 539 ? 73.593 -53.594 -73.495 1.00 60.12  ? 533  LEU A O    1 
ATOM   3661 C  CB   . LEU A 1 539 ? 76.415 -54.537 -74.347 1.00 62.79  ? 533  LEU A CB   1 
ATOM   3662 C  CG   . LEU A 1 539 ? 77.300 -53.396 -73.809 1.00 59.61  ? 533  LEU A CG   1 
ATOM   3663 C  CD1  . LEU A 1 539 ? 78.310 -53.872 -72.769 1.00 58.35  ? 533  LEU A CD1  1 
ATOM   3664 C  CD2  . LEU A 1 539 ? 78.018 -52.656 -74.928 1.00 67.84  ? 533  LEU A CD2  1 
ATOM   3665 N  N    . GLY A 1 540 ? 74.841 -53.504 -71.626 1.00 68.19  ? 534  GLY A N    1 
ATOM   3666 C  CA   . GLY A 1 540 ? 74.058 -52.466 -71.003 1.00 66.01  ? 534  GLY A CA   1 
ATOM   3667 C  C    . GLY A 1 540 ? 73.234 -52.938 -69.840 1.00 71.00  ? 534  GLY A C    1 
ATOM   3668 O  O    . GLY A 1 540 ? 72.570 -52.111 -69.203 1.00 72.06  ? 534  GLY A O    1 
ATOM   3669 N  N    . GLY A 1 541 ? 73.213 -54.239 -69.569 1.00 69.26  ? 535  GLY A N    1 
ATOM   3670 C  CA   . GLY A 1 541 ? 72.566 -54.747 -68.381 1.00 75.38  ? 535  GLY A CA   1 
ATOM   3671 C  C    . GLY A 1 541 ? 73.521 -54.702 -67.207 1.00 72.69  ? 535  GLY A C    1 
ATOM   3672 O  O    . GLY A 1 541 ? 74.573 -54.058 -67.245 1.00 73.28  ? 535  GLY A O    1 
ATOM   3673 N  N    . THR A 1 542 ? 73.147 -55.404 -66.133 1.00 68.37  ? 536  THR A N    1 
ATOM   3674 C  CA   . THR A 1 542 ? 74.144 -55.567 -65.082 1.00 73.11  ? 536  THR A CA   1 
ATOM   3675 C  C    . THR A 1 542 ? 75.226 -56.529 -65.548 1.00 68.73  ? 536  THR A C    1 
ATOM   3676 O  O    . THR A 1 542 ? 76.390 -56.373 -65.172 1.00 71.12  ? 536  THR A O    1 
ATOM   3677 C  CB   . THR A 1 542 ? 73.528 -56.029 -63.737 1.00 70.66  ? 536  THR A CB   1 
ATOM   3678 O  OG1  . THR A 1 542 ? 72.955 -57.336 -63.852 1.00 73.23  ? 536  THR A OG1  1 
ATOM   3679 C  CG2  . THR A 1 542 ? 72.450 -55.063 -63.250 1.00 61.30  ? 536  THR A CG2  1 
ATOM   3680 N  N    . ASN A 1 543 ? 74.878 -57.472 -66.425 1.00 62.42  ? 537  ASN A N    1 
ATOM   3681 C  CA   . ASN A 1 543 ? 75.792 -58.520 -66.870 1.00 66.23  ? 537  ASN A CA   1 
ATOM   3682 C  C    . ASN A 1 543 ? 76.007 -58.428 -68.374 1.00 68.06  ? 537  ASN A C    1 
ATOM   3683 O  O    . ASN A 1 543 ? 75.085 -58.700 -69.156 1.00 70.45  ? 537  ASN A O    1 
ATOM   3684 C  CB   . ASN A 1 543 ? 75.244 -59.900 -66.525 1.00 70.37  ? 537  ASN A CB   1 
ATOM   3685 C  CG   . ASN A 1 543 ? 75.145 -60.130 -65.051 1.00 74.09  ? 537  ASN A CG   1 
ATOM   3686 O  OD1  . ASN A 1 543 ? 75.840 -59.493 -64.257 1.00 72.22  ? 537  ASN A OD1  1 
ATOM   3687 N  ND2  . ASN A 1 543 ? 74.270 -61.049 -64.666 1.00 80.47  ? 537  ASN A ND2  1 
ATOM   3688 N  N    . PHE A 1 544 ? 77.228 -58.096 -68.784 1.00 63.33  ? 538  PHE A N    1 
ATOM   3689 C  CA   . PHE A 1 544 ? 77.600 -58.263 -70.180 1.00 64.29  ? 538  PHE A CA   1 
ATOM   3690 C  C    . PHE A 1 544 ? 77.939 -59.721 -70.452 1.00 63.97  ? 538  PHE A C    1 
ATOM   3691 O  O    . PHE A 1 544 ? 78.725 -60.327 -69.721 1.00 62.90  ? 538  PHE A O    1 
ATOM   3692 C  CB   . PHE A 1 544 ? 78.765 -57.342 -70.558 1.00 65.27  ? 538  PHE A CB   1 
ATOM   3693 C  CG   . PHE A 1 544 ? 79.485 -57.773 -71.796 1.00 63.16  ? 538  PHE A CG   1 
ATOM   3694 C  CD1  . PHE A 1 544 ? 78.838 -57.809 -73.015 1.00 64.30  ? 538  PHE A CD1  1 
ATOM   3695 C  CD2  . PHE A 1 544 ? 80.820 -58.117 -71.744 1.00 61.30  ? 538  PHE A CD2  1 
ATOM   3696 C  CE1  . PHE A 1 544 ? 79.504 -58.231 -74.153 1.00 66.27  ? 538  PHE A CE1  1 
ATOM   3697 C  CE2  . PHE A 1 544 ? 81.486 -58.528 -72.878 1.00 62.43  ? 538  PHE A CE2  1 
ATOM   3698 C  CZ   . PHE A 1 544 ? 80.835 -58.588 -74.080 1.00 60.43  ? 538  PHE A CZ   1 
ATOM   3699 N  N    . ARG A 1 545 ? 77.341 -60.288 -71.498 1.00 62.53  ? 539  ARG A N    1 
ATOM   3700 C  CA   . ARG A 1 545 ? 77.594 -61.684 -71.801 1.00 65.22  ? 539  ARG A CA   1 
ATOM   3701 C  C    . ARG A 1 545 ? 77.606 -61.906 -73.309 1.00 67.35  ? 539  ARG A C    1 
ATOM   3702 O  O    . ARG A 1 545 ? 77.033 -61.130 -74.078 1.00 67.28  ? 539  ARG A O    1 
ATOM   3703 C  CB   . ARG A 1 545 ? 76.567 -62.575 -71.102 1.00 70.92  ? 539  ARG A CB   1 
ATOM   3704 C  CG   . ARG A 1 545 ? 75.164 -62.512 -71.655 1.00 71.55  ? 539  ARG A CG   1 
ATOM   3705 C  CD   . ARG A 1 545 ? 74.252 -63.418 -70.836 1.00 75.49  ? 539  ARG A CD   1 
ATOM   3706 N  NE   . ARG A 1 545 ? 74.111 -62.934 -69.458 1.00 75.54  ? 539  ARG A NE   1 
ATOM   3707 C  CZ   . ARG A 1 545 ? 73.718 -63.690 -68.434 1.00 78.38  ? 539  ARG A CZ   1 
ATOM   3708 N  NH1  . ARG A 1 545 ? 73.442 -64.972 -68.627 1.00 79.24  ? 539  ARG A NH1  1 
ATOM   3709 N  NH2  . ARG A 1 545 ? 73.620 -63.176 -67.211 1.00 76.60  ? 539  ARG A NH2  1 
ATOM   3710 N  N    . VAL A 1 546 ? 78.312 -62.965 -73.718 1.00 65.65  ? 540  VAL A N    1 
ATOM   3711 C  CA   . VAL A 1 546 ? 78.388 -63.417 -75.101 1.00 60.49  ? 540  VAL A CA   1 
ATOM   3712 C  C    . VAL A 1 546 ? 77.630 -64.730 -75.193 1.00 64.40  ? 540  VAL A C    1 
ATOM   3713 O  O    . VAL A 1 546 ? 77.738 -65.573 -74.304 1.00 72.45  ? 540  VAL A O    1 
ATOM   3714 C  CB   . VAL A 1 546 ? 79.847 -63.613 -75.557 1.00 62.71  ? 540  VAL A CB   1 
ATOM   3715 C  CG1  . VAL A 1 546 ? 79.897 -64.083 -76.996 1.00 59.00  ? 540  VAL A CG1  1 
ATOM   3716 C  CG2  . VAL A 1 546 ? 80.665 -62.354 -75.355 1.00 62.58  ? 540  VAL A CG2  1 
ATOM   3717 N  N    . LEU A 1 547 ? 76.889 -64.917 -76.269 1.00 66.93  ? 541  LEU A N    1 
ATOM   3718 C  CA   . LEU A 1 547 ? 76.010 -66.066 -76.432 1.00 69.68  ? 541  LEU A CA   1 
ATOM   3719 C  C    . LEU A 1 547 ? 76.312 -66.755 -77.757 1.00 73.97  ? 541  LEU A C    1 
ATOM   3720 O  O    . LEU A 1 547 ? 76.627 -66.092 -78.751 1.00 65.88  ? 541  LEU A O    1 
ATOM   3721 C  CB   . LEU A 1 547 ? 74.542 -65.640 -76.468 1.00 70.69  ? 541  LEU A CB   1 
ATOM   3722 C  CG   . LEU A 1 547 ? 73.797 -65.088 -75.268 1.00 73.21  ? 541  LEU A CG   1 
ATOM   3723 C  CD1  . LEU A 1 547 ? 74.388 -63.740 -74.864 1.00 66.57  ? 541  LEU A CD1  1 
ATOM   3724 C  CD2  . LEU A 1 547 ? 72.351 -64.924 -75.679 1.00 75.75  ? 541  LEU A CD2  1 
ATOM   3725 N  N    . LEU A 1 548 ? 76.193 -68.083 -77.776 1.00 77.95  ? 542  LEU A N    1 
ATOM   3726 C  CA   . LEU A 1 548 ? 76.051 -68.843 -79.013 1.00 72.65  ? 542  LEU A CA   1 
ATOM   3727 C  C    . LEU A 1 548 ? 74.751 -69.626 -78.925 1.00 75.53  ? 542  LEU A C    1 
ATOM   3728 O  O    . LEU A 1 548 ? 74.646 -70.567 -78.137 1.00 85.70  ? 542  LEU A O    1 
ATOM   3729 C  CB   . LEU A 1 548 ? 77.234 -69.782 -79.251 1.00 74.17  ? 542  LEU A CB   1 
ATOM   3730 C  CG   . LEU A 1 548 ? 77.161 -70.446 -80.639 1.00 80.97  ? 542  LEU A CG   1 
ATOM   3731 C  CD1  . LEU A 1 548 ? 78.534 -70.718 -81.239 1.00 81.26  ? 542  LEU A CD1  1 
ATOM   3732 C  CD2  . LEU A 1 548 ? 76.358 -71.725 -80.571 1.00 85.49  ? 542  LEU A CD2  1 
ATOM   3733 N  N    . VAL A 1 549 ? 73.765 -69.256 -79.728 1.00 73.42  ? 543  VAL A N    1 
ATOM   3734 C  CA   . VAL A 1 549 ? 72.515 -69.996 -79.803 1.00 76.34  ? 543  VAL A CA   1 
ATOM   3735 C  C    . VAL A 1 549 ? 72.564 -70.846 -81.064 1.00 83.97  ? 543  VAL A C    1 
ATOM   3736 O  O    . VAL A 1 549 ? 72.754 -70.329 -82.172 1.00 81.29  ? 543  VAL A O    1 
ATOM   3737 C  CB   . VAL A 1 549 ? 71.297 -69.064 -79.800 1.00 69.72  ? 543  VAL A CB   1 
ATOM   3738 C  CG1  . VAL A 1 549 ? 71.313 -68.177 -78.571 1.00 77.74  ? 543  VAL A CG1  1 
ATOM   3739 C  CG2  . VAL A 1 549 ? 71.276 -68.250 -81.032 1.00 77.01  ? 543  VAL A CG2  1 
ATOM   3740 N  N    . ARG A 1 550 ? 72.395 -72.151 -80.893 1.00 92.20  ? 544  ARG A N    1 
ATOM   3741 C  CA   . ARG A 1 550 ? 72.604 -73.136 -81.945 1.00 91.09  ? 544  ARG A CA   1 
ATOM   3742 C  C    . ARG A 1 550 ? 71.234 -73.713 -82.266 1.00 96.40  ? 544  ARG A C    1 
ATOM   3743 O  O    . ARG A 1 550 ? 70.681 -74.485 -81.475 1.00 99.06  ? 544  ARG A O    1 
ATOM   3744 C  CB   . ARG A 1 550 ? 73.594 -74.188 -81.450 1.00 91.36  ? 544  ARG A CB   1 
ATOM   3745 C  CG   . ARG A 1 550 ? 74.188 -75.117 -82.465 1.00 94.71  ? 544  ARG A CG   1 
ATOM   3746 C  CD   . ARG A 1 550 ? 75.366 -75.823 -81.807 1.00 97.08  ? 544  ARG A CD   1 
ATOM   3747 N  NE   . ARG A 1 550 ? 76.169 -76.593 -82.748 1.00 107.53 ? 544  ARG A NE   1 
ATOM   3748 C  CZ   . ARG A 1 550 ? 77.375 -77.076 -82.466 1.00 108.94 ? 544  ARG A CZ   1 
ATOM   3749 N  NH1  . ARG A 1 550 ? 77.910 -76.854 -81.270 1.00 98.21  ? 544  ARG A NH1  1 
ATOM   3750 N  NH2  . ARG A 1 550 ? 78.049 -77.769 -83.380 1.00 111.88 ? 544  ARG A NH2  1 
ATOM   3751 N  N    . VAL A 1 551 ? 70.685 -73.337 -83.418 1.00 94.68  ? 545  VAL A N    1 
ATOM   3752 C  CA   . VAL A 1 551 ? 69.260 -73.489 -83.688 1.00 96.68  ? 545  VAL A CA   1 
ATOM   3753 C  C    . VAL A 1 551 ? 69.054 -74.555 -84.759 1.00 101.46 ? 545  VAL A C    1 
ATOM   3754 O  O    . VAL A 1 551 ? 69.519 -74.410 -85.897 1.00 101.91 ? 545  VAL A O    1 
ATOM   3755 C  CB   . VAL A 1 551 ? 68.621 -72.154 -84.092 1.00 91.06  ? 545  VAL A CB   1 
ATOM   3756 C  CG1  . VAL A 1 551 ? 69.278 -71.615 -85.326 1.00 92.88  ? 545  VAL A CG1  1 
ATOM   3757 C  CG2  . VAL A 1 551 ? 67.140 -72.333 -84.319 1.00 95.85  ? 545  VAL A CG2  1 
ATOM   3758 N  N    . ARG A 1 552 ? 68.337 -75.618 -84.385 1.00 109.05 ? 546  ARG A N    1 
ATOM   3759 C  CA   . ARG A 1 552 ? 67.950 -76.719 -85.257 1.00 106.48 ? 546  ARG A CA   1 
ATOM   3760 C  C    . ARG A 1 552 ? 66.432 -76.739 -85.422 1.00 109.42 ? 546  ARG A C    1 
ATOM   3761 O  O    . ARG A 1 552 ? 65.687 -76.230 -84.575 1.00 105.65 ? 546  ARG A O    1 
ATOM   3762 C  CB   . ARG A 1 552 ? 68.433 -78.066 -84.700 1.00 104.59 ? 546  ARG A CB   1 
ATOM   3763 C  CG   . ARG A 1 552 ? 69.934 -78.164 -84.471 1.00 100.72 ? 546  ARG A CG   1 
ATOM   3764 N  N    . ASN A 1 553 ? 65.978 -77.330 -86.527 1.00 113.02 ? 547  ASN A N    1 
ATOM   3765 C  CA   . ASN A 1 553 ? 64.566 -77.337 -86.912 1.00 118.29 ? 547  ASN A CA   1 
ATOM   3766 C  C    . ASN A 1 553 ? 64.061 -78.776 -87.009 1.00 122.07 ? 547  ASN A C    1 
ATOM   3767 O  O    . ASN A 1 553 ? 64.462 -79.520 -87.912 1.00 122.32 ? 547  ASN A O    1 
ATOM   3768 C  CB   . ASN A 1 553 ? 64.381 -76.590 -88.233 1.00 110.67 ? 547  ASN A CB   1 
ATOM   3769 C  CG   . ASN A 1 553 ? 65.257 -77.149 -89.334 1.00 114.34 ? 547  ASN A CG   1 
ATOM   3770 O  OD1  . ASN A 1 553 ? 66.194 -77.904 -89.068 1.00 114.51 ? 547  ASN A OD1  1 
ATOM   3771 N  ND2  . ASN A 1 553 ? 64.965 -76.782 -90.573 1.00 117.88 ? 547  ASN A ND2  1 
ATOM   3772 N  N    . GLY A 1 554 ? 63.170 -79.162 -86.093 1.00 120.41 ? 548  GLY A N    1 
ATOM   3773 C  CA   . GLY A 1 554 ? 62.629 -80.513 -86.060 1.00 115.42 ? 548  GLY A CA   1 
ATOM   3774 C  C    . GLY A 1 554 ? 63.360 -81.438 -85.103 1.00 115.44 ? 548  GLY A C    1 
ATOM   3775 O  O    . GLY A 1 554 ? 62.772 -82.366 -84.539 1.00 113.60 ? 548  GLY A O    1 
ATOM   3776 N  N    . GLY A 1 558 ? 64.489 -76.190 -82.080 1.00 105.95 ? 552  GLY A N    1 
ATOM   3777 C  CA   . GLY A 1 558 ? 65.432 -76.744 -81.123 1.00 106.97 ? 552  GLY A CA   1 
ATOM   3778 C  C    . GLY A 1 558 ? 66.660 -75.876 -80.901 1.00 106.70 ? 552  GLY A C    1 
ATOM   3779 O  O    . GLY A 1 558 ? 67.711 -76.093 -81.511 1.00 103.05 ? 552  GLY A O    1 
ATOM   3780 N  N    . VAL A 1 559 ? 66.536 -74.913 -79.991 1.00 105.45 ? 553  VAL A N    1 
ATOM   3781 C  CA   . VAL A 1 559 ? 67.551 -73.884 -79.794 1.00 100.75 ? 553  VAL A CA   1 
ATOM   3782 C  C    . VAL A 1 559 ? 68.519 -74.340 -78.704 1.00 101.43 ? 553  VAL A C    1 
ATOM   3783 O  O    . VAL A 1 559 ? 68.168 -74.398 -77.522 1.00 104.34 ? 553  VAL A O    1 
ATOM   3784 C  CB   . VAL A 1 559 ? 66.905 -72.540 -79.443 1.00 98.52  ? 553  VAL A CB   1 
ATOM   3785 C  CG1  . VAL A 1 559 ? 66.046 -72.059 -80.598 1.00 96.54  ? 553  VAL A CG1  1 
ATOM   3786 C  CG2  . VAL A 1 559 ? 66.060 -72.669 -78.179 1.00 105.72 ? 553  VAL A CG2  1 
ATOM   3787 N  N    . GLU A 1 560 ? 69.753 -74.643 -79.107 1.00 102.79 ? 554  GLU A N    1 
ATOM   3788 C  CA   . GLU A 1 560 ? 70.827 -75.015 -78.191 1.00 102.57 ? 554  GLU A CA   1 
ATOM   3789 C  C    . GLU A 1 560 ? 71.532 -73.748 -77.718 1.00 96.88  ? 554  GLU A C    1 
ATOM   3790 O  O    . GLU A 1 560 ? 71.959 -72.927 -78.532 1.00 94.91  ? 554  GLU A O    1 
ATOM   3791 C  CB   . GLU A 1 560 ? 71.816 -75.949 -78.894 1.00 105.39 ? 554  GLU A CB   1 
ATOM   3792 C  CG   . GLU A 1 560 ? 72.945 -76.484 -78.028 1.00 105.79 ? 554  GLU A CG   1 
ATOM   3793 C  CD   . GLU A 1 560 ? 72.472 -77.507 -77.021 1.00 116.03 ? 554  GLU A CD   1 
ATOM   3794 O  OE1  . GLU A 1 560 ? 71.335 -78.012 -77.178 1.00 118.56 ? 554  GLU A OE1  1 
ATOM   3795 O  OE2  . GLU A 1 560 ? 73.240 -77.806 -76.077 1.00 117.47 ? 554  GLU A OE2  1 
ATOM   3796 N  N    . MET A 1 561 ? 71.679 -73.599 -76.410 1.00 95.76  ? 555  MET A N    1 
ATOM   3797 C  CA   . MET A 1 561 ? 71.977 -72.307 -75.810 1.00 92.03  ? 555  MET A CA   1 
ATOM   3798 C  C    . MET A 1 561 ? 73.267 -72.380 -74.996 1.00 94.13  ? 555  MET A C    1 
ATOM   3799 O  O    . MET A 1 561 ? 73.450 -73.317 -74.213 1.00 98.39  ? 555  MET A O    1 
ATOM   3800 C  CB   . MET A 1 561 ? 70.801 -71.902 -74.927 1.00 98.75  ? 555  MET A CB   1 
ATOM   3801 C  CG   . MET A 1 561 ? 70.884 -70.552 -74.291 1.00 101.73 ? 555  MET A CG   1 
ATOM   3802 S  SD   . MET A 1 561 ? 70.528 -69.211 -75.432 1.00 106.96 ? 555  MET A SD   1 
ATOM   3803 C  CE   . MET A 1 561 ? 70.719 -67.845 -74.271 1.00 96.28  ? 555  MET A CE   1 
ATOM   3804 N  N    . HIS A 1 562 ? 74.155 -71.394 -75.173 1.00 91.22  ? 556  HIS A N    1 
ATOM   3805 C  CA   . HIS A 1 562 ? 75.405 -71.310 -74.415 1.00 91.75  ? 556  HIS A CA   1 
ATOM   3806 C  C    . HIS A 1 562 ? 75.771 -69.848 -74.184 1.00 85.63  ? 556  HIS A C    1 
ATOM   3807 O  O    . HIS A 1 562 ? 75.625 -69.028 -75.096 1.00 83.32  ? 556  HIS A O    1 
ATOM   3808 C  CB   . HIS A 1 562 ? 76.565 -72.001 -75.152 1.00 90.32  ? 556  HIS A CB   1 
ATOM   3809 C  CG   . HIS A 1 562 ? 76.368 -73.470 -75.365 1.00 98.99  ? 556  HIS A CG   1 
ATOM   3810 N  ND1  . HIS A 1 562 ? 76.494 -74.394 -74.349 1.00 97.65  ? 556  HIS A ND1  1 
ATOM   3811 C  CD2  . HIS A 1 562 ? 76.041 -74.175 -76.476 1.00 101.89 ? 556  HIS A CD2  1 
ATOM   3812 C  CE1  . HIS A 1 562 ? 76.261 -75.604 -74.827 1.00 103.67 ? 556  HIS A CE1  1 
ATOM   3813 N  NE2  . HIS A 1 562 ? 75.982 -75.499 -76.114 1.00 103.41 ? 556  HIS A NE2  1 
ATOM   3814 N  N    . ASN A 1 563 ? 76.274 -69.521 -72.987 1.00 75.69  ? 557  ASN A N    1 
ATOM   3815 C  CA   . ASN A 1 563 ? 76.735 -68.157 -72.759 1.00 74.84  ? 557  ASN A CA   1 
ATOM   3816 C  C    . ASN A 1 563 ? 77.884 -68.137 -71.757 1.00 74.73  ? 557  ASN A C    1 
ATOM   3817 O  O    . ASN A 1 563 ? 78.279 -69.166 -71.208 1.00 84.47  ? 557  ASN A O    1 
ATOM   3818 C  CB   . ASN A 1 563 ? 75.585 -67.235 -72.304 1.00 76.03  ? 557  ASN A CB   1 
ATOM   3819 C  CG   . ASN A 1 563 ? 75.131 -67.475 -70.866 1.00 83.35  ? 557  ASN A CG   1 
ATOM   3820 O  OD1  . ASN A 1 563 ? 75.931 -67.753 -69.972 1.00 80.11  ? 557  ASN A OD1  1 
ATOM   3821 N  ND2  . ASN A 1 563 ? 73.829 -67.338 -70.638 1.00 89.29  ? 557  ASN A ND2  1 
ATOM   3822 N  N    . LYS A 1 564 ? 78.444 -66.944 -71.557 1.00 72.68  ? 558  LYS A N    1 
ATOM   3823 C  CA   . LYS A 1 564 ? 79.391 -66.679 -70.482 1.00 70.39  ? 558  LYS A CA   1 
ATOM   3824 C  C    . LYS A 1 564 ? 79.328 -65.195 -70.128 1.00 68.11  ? 558  LYS A C    1 
ATOM   3825 O  O    . LYS A 1 564 ? 79.172 -64.346 -71.002 1.00 70.67  ? 558  LYS A O    1 
ATOM   3826 C  CB   . LYS A 1 564 ? 80.814 -67.101 -70.872 1.00 70.26  ? 558  LYS A CB   1 
ATOM   3827 C  CG   . LYS A 1 564 ? 81.862 -66.857 -69.795 1.00 73.26  ? 558  LYS A CG   1 
ATOM   3828 C  CD   . LYS A 1 564 ? 83.239 -67.395 -70.197 1.00 80.08  ? 558  LYS A CD   1 
ATOM   3829 C  CE   . LYS A 1 564 ? 84.306 -67.066 -69.141 1.00 79.70  ? 558  LYS A CE   1 
ATOM   3830 N  NZ   . LYS A 1 564 ? 85.671 -67.586 -69.500 1.00 85.30  ? 558  LYS A NZ   1 
ATOM   3831 N  N    . ILE A 1 565 ? 79.457 -64.884 -68.857 1.00 71.91  ? 559  ILE A N    1 
ATOM   3832 C  CA   . ILE A 1 565 ? 79.387 -63.507 -68.382 1.00 70.93  ? 559  ILE A CA   1 
ATOM   3833 C  C    . ILE A 1 565 ? 80.805 -62.974 -68.239 1.00 68.67  ? 559  ILE A C    1 
ATOM   3834 O  O    . ILE A 1 565 ? 81.700 -63.696 -67.787 1.00 67.90  ? 559  ILE A O    1 
ATOM   3835 C  CB   . ILE A 1 565 ? 78.614 -63.430 -67.048 1.00 64.23  ? 559  ILE A CB   1 
ATOM   3836 C  CG1  . ILE A 1 565 ? 77.169 -63.877 -67.281 1.00 69.60  ? 559  ILE A CG1  1 
ATOM   3837 C  CG2  . ILE A 1 565 ? 78.675 -62.018 -66.447 1.00 59.51  ? 559  ILE A CG2  1 
ATOM   3838 C  CD1  . ILE A 1 565 ? 76.328 -64.026 -66.043 1.00 66.25  ? 559  ILE A CD1  1 
ATOM   3839 N  N    . TYR A 1 566 ? 81.037 -61.727 -68.663 1.00 71.83  ? 560  TYR A N    1 
ATOM   3840 C  CA   . TYR A 1 566 ? 82.325 -61.108 -68.390 1.00 68.59  ? 560  TYR A CA   1 
ATOM   3841 C  C    . TYR A 1 566 ? 82.112 -59.759 -67.722 1.00 66.07  ? 560  TYR A C    1 
ATOM   3842 O  O    . TYR A 1 566 ? 81.076 -59.108 -67.894 1.00 65.49  ? 560  TYR A O    1 
ATOM   3843 C  CB   . TYR A 1 566 ? 83.264 -60.901 -69.625 1.00 62.12  ? 560  TYR A CB   1 
ATOM   3844 C  CG   . TYR A 1 566 ? 83.352 -62.032 -70.634 1.00 63.75  ? 560  TYR A CG   1 
ATOM   3845 C  CD1  . TYR A 1 566 ? 82.286 -62.863 -70.891 1.00 69.32  ? 560  TYR A CD1  1 
ATOM   3846 C  CD2  . TYR A 1 566 ? 84.598 -62.462 -71.077 1.00 66.02  ? 560  TYR A CD2  1 
ATOM   3847 C  CE1  . TYR A 1 566 ? 82.398 -63.930 -71.767 1.00 71.89  ? 560  TYR A CE1  1 
ATOM   3848 C  CE2  . TYR A 1 566 ? 84.733 -63.555 -71.915 1.00 67.29  ? 560  TYR A CE2  1 
ATOM   3849 C  CZ   . TYR A 1 566 ? 83.625 -64.289 -72.256 1.00 68.66  ? 560  TYR A CZ   1 
ATOM   3850 O  OH   . TYR A 1 566 ? 83.722 -65.386 -73.085 1.00 71.59  ? 560  TYR A OH   1 
ATOM   3851 N  N    . ALA A 1 567 ? 83.089 -59.376 -66.913 1.00 64.78  ? 561  ALA A N    1 
ATOM   3852 C  CA   . ALA A 1 567 ? 83.070 -58.072 -66.276 1.00 66.47  ? 561  ALA A CA   1 
ATOM   3853 C  C    . ALA A 1 567 ? 83.581 -57.016 -67.241 1.00 69.69  ? 561  ALA A C    1 
ATOM   3854 O  O    . ALA A 1 567 ? 84.361 -57.302 -68.161 1.00 65.42  ? 561  ALA A O    1 
ATOM   3855 C  CB   . ALA A 1 567 ? 83.924 -58.064 -65.006 1.00 60.17  ? 561  ALA A CB   1 
ATOM   3856 N  N    . ILE A 1 568 ? 83.117 -55.789 -67.042 1.00 64.35  ? 562  ILE A N    1 
ATOM   3857 C  CA   . ILE A 1 568 ? 83.755 -54.672 -67.721 1.00 64.19  ? 562  ILE A CA   1 
ATOM   3858 C  C    . ILE A 1 568 ? 84.296 -53.778 -66.614 1.00 58.44  ? 562  ILE A C    1 
ATOM   3859 O  O    . ILE A 1 568 ? 83.525 -53.108 -65.918 1.00 59.01  ? 562  ILE A O    1 
ATOM   3860 C  CB   . ILE A 1 568 ? 82.787 -53.958 -68.683 1.00 63.49  ? 562  ILE A CB   1 
ATOM   3861 C  CG1  . ILE A 1 568 ? 82.333 -54.940 -69.771 1.00 58.78  ? 562  ILE A CG1  1 
ATOM   3862 C  CG2  . ILE A 1 568 ? 83.472 -52.764 -69.341 1.00 61.23  ? 562  ILE A CG2  1 
ATOM   3863 C  CD1  . ILE A 1 568 ? 81.138 -54.485 -70.595 1.00 55.53  ? 562  ILE A CD1  1 
ATOM   3864 N  N    . PRO A 1 569 ? 85.606 -53.751 -66.414 1.00 60.22  ? 563  PRO A N    1 
ATOM   3865 C  CA   . PRO A 1 569 ? 86.184 -52.908 -65.364 1.00 57.45  ? 563  PRO A CA   1 
ATOM   3866 C  C    . PRO A 1 569 ? 85.715 -51.467 -65.483 1.00 60.86  ? 563  PRO A C    1 
ATOM   3867 O  O    . PRO A 1 569 ? 85.693 -50.896 -66.571 1.00 62.44  ? 563  PRO A O    1 
ATOM   3868 C  CB   . PRO A 1 569 ? 87.688 -53.019 -65.620 1.00 61.16  ? 563  PRO A CB   1 
ATOM   3869 C  CG   . PRO A 1 569 ? 87.858 -54.314 -66.343 1.00 63.72  ? 563  PRO A CG   1 
ATOM   3870 C  CD   . PRO A 1 569 ? 86.621 -54.522 -67.153 1.00 63.99  ? 563  PRO A CD   1 
ATOM   3871 N  N    . GLN A 1 570 ? 85.387 -50.858 -64.341 1.00 68.07  ? 564  GLN A N    1 
ATOM   3872 C  CA   . GLN A 1 570 ? 84.988 -49.452 -64.339 1.00 67.92  ? 564  GLN A CA   1 
ATOM   3873 C  C    . GLN A 1 570 ? 85.949 -48.607 -65.177 1.00 66.14  ? 564  GLN A C    1 
ATOM   3874 O  O    . GLN A 1 570 ? 85.521 -47.712 -65.918 1.00 65.37  ? 564  GLN A O    1 
ATOM   3875 C  CB   . GLN A 1 570 ? 84.897 -48.931 -62.892 1.00 59.30  ? 564  GLN A CB   1 
ATOM   3876 N  N    . GLU A 1 571 ? 87.253 -48.894 -65.097 1.00 68.87  ? 565  GLU A N    1 
ATOM   3877 C  CA   . GLU A 1 571 ? 88.225 -48.161 -65.907 1.00 66.98  ? 565  GLU A CA   1 
ATOM   3878 C  C    . GLU A 1 571 ? 87.897 -48.240 -67.393 1.00 64.49  ? 565  GLU A C    1 
ATOM   3879 O  O    . GLU A 1 571 ? 88.139 -47.279 -68.132 1.00 67.94  ? 565  GLU A O    1 
ATOM   3880 C  CB   . GLU A 1 571 ? 89.643 -48.686 -65.652 1.00 62.95  ? 565  GLU A CB   1 
ATOM   3881 N  N    . VAL A 1 572 ? 87.367 -49.371 -67.857 1.00 63.56  ? 566  VAL A N    1 
ATOM   3882 C  CA   . VAL A 1 572 ? 87.078 -49.523 -69.283 1.00 63.91  ? 566  VAL A CA   1 
ATOM   3883 C  C    . VAL A 1 572 ? 85.752 -48.870 -69.655 1.00 64.15  ? 566  VAL A C    1 
ATOM   3884 O  O    . VAL A 1 572 ? 85.641 -48.228 -70.704 1.00 64.45  ? 566  VAL A O    1 
ATOM   3885 C  CB   . VAL A 1 572 ? 87.102 -51.008 -69.677 1.00 60.89  ? 566  VAL A CB   1 
ATOM   3886 C  CG1  . VAL A 1 572 ? 86.609 -51.165 -71.073 1.00 57.35  ? 566  VAL A CG1  1 
ATOM   3887 C  CG2  . VAL A 1 572 ? 88.514 -51.558 -69.552 1.00 56.50  ? 566  VAL A CG2  1 
ATOM   3888 N  N    . MET A 1 573 ? 84.723 -49.044 -68.821 1.00 62.46  ? 567  MET A N    1 
ATOM   3889 C  CA   . MET A 1 573 ? 83.455 -48.357 -69.034 1.00 58.13  ? 567  MET A CA   1 
ATOM   3890 C  C    . MET A 1 573 ? 83.643 -46.852 -69.100 1.00 57.77  ? 567  MET A C    1 
ATOM   3891 O  O    . MET A 1 573 ? 82.822 -46.149 -69.697 1.00 58.69  ? 567  MET A O    1 
ATOM   3892 C  CB   . MET A 1 573 ? 82.477 -48.690 -67.904 1.00 62.52  ? 567  MET A CB   1 
ATOM   3893 C  CG   . MET A 1 573 ? 81.985 -50.133 -67.825 1.00 63.92  ? 567  MET A CG   1 
ATOM   3894 S  SD   . MET A 1 573 ? 80.780 -50.315 -66.481 1.00 65.30  ? 567  MET A SD   1 
ATOM   3895 C  CE   . MET A 1 573 ? 81.851 -50.336 -65.038 1.00 76.50  ? 567  MET A CE   1 
ATOM   3896 N  N    . HIS A 1 574 ? 84.631 -46.337 -68.383 1.00 60.75  ? 568  HIS A N    1 
ATOM   3897 C  CA   . HIS A 1 574 ? 84.944 -44.920 -68.319 1.00 60.71  ? 568  HIS A CA   1 
ATOM   3898 C  C    . HIS A 1 574 ? 86.155 -44.524 -69.161 1.00 61.32  ? 568  HIS A C    1 
ATOM   3899 O  O    . HIS A 1 574 ? 86.649 -43.400 -69.019 1.00 62.03  ? 568  HIS A O    1 
ATOM   3900 C  CB   . HIS A 1 574 ? 85.108 -44.493 -66.859 1.00 65.99  ? 568  HIS A CB   1 
ATOM   3901 C  CG   . HIS A 1 574 ? 83.813 -44.468 -66.104 1.00 74.20  ? 568  HIS A CG   1 
ATOM   3902 N  ND1  . HIS A 1 574 ? 83.281 -45.585 -65.494 1.00 76.43  ? 568  HIS A ND1  1 
ATOM   3903 C  CD2  . HIS A 1 574 ? 82.913 -43.472 -65.911 1.00 77.46  ? 568  HIS A CD2  1 
ATOM   3904 C  CE1  . HIS A 1 574 ? 82.123 -45.273 -64.937 1.00 78.89  ? 568  HIS A CE1  1 
ATOM   3905 N  NE2  . HIS A 1 574 ? 81.872 -43.998 -65.182 1.00 80.07  ? 568  HIS A NE2  1 
ATOM   3906 N  N    . GLY A 1 575 ? 86.687 -45.435 -69.979 1.00 58.57  ? 569  GLY A N    1 
ATOM   3907 C  CA   . GLY A 1 575 ? 87.833 -45.153 -70.825 1.00 56.91  ? 569  GLY A CA   1 
ATOM   3908 C  C    . GLY A 1 575 ? 87.458 -44.582 -72.175 1.00 56.76  ? 569  GLY A C    1 
ATOM   3909 O  O    . GLY A 1 575 ? 86.410 -43.955 -72.348 1.00 61.65  ? 569  GLY A O    1 
ATOM   3910 N  N    . THR A 1 576 ? 88.345 -44.787 -73.147 1.00 57.82  ? 570  THR A N    1 
ATOM   3911 C  CA   . THR A 1 576 ? 88.035 -44.457 -74.536 1.00 54.17  ? 570  THR A CA   1 
ATOM   3912 C  C    . THR A 1 576 ? 87.213 -45.573 -75.187 1.00 57.19  ? 570  THR A C    1 
ATOM   3913 O  O    . THR A 1 576 ? 87.231 -46.728 -74.750 1.00 57.14  ? 570  THR A O    1 
ATOM   3914 C  CB   . THR A 1 576 ? 89.306 -44.224 -75.353 1.00 50.05  ? 570  THR A CB   1 
ATOM   3915 O  OG1  . THR A 1 576 ? 90.071 -45.429 -75.404 1.00 54.51  ? 570  THR A OG1  1 
ATOM   3916 C  CG2  . THR A 1 576 ? 90.150 -43.151 -74.742 1.00 43.54  ? 570  THR A CG2  1 
ATOM   3917 N  N    . GLY A 1 577 ? 86.478 -45.205 -76.250 1.00 57.51  ? 571  GLY A N    1 
ATOM   3918 C  CA   . GLY A 1 577 ? 85.665 -46.174 -76.974 1.00 47.19  ? 571  GLY A CA   1 
ATOM   3919 C  C    . GLY A 1 577 ? 86.478 -47.261 -77.645 1.00 53.37  ? 571  GLY A C    1 
ATOM   3920 O  O    . GLY A 1 577 ? 85.984 -48.372 -77.864 1.00 53.77  ? 571  GLY A O    1 
ATOM   3921 N  N    . ASP A 1 578 ? 87.729 -46.961 -77.995 1.00 60.08  ? 572  ASP A N    1 
ATOM   3922 C  CA   . ASP A 1 578 ? 88.607 -47.997 -78.533 1.00 61.16  ? 572  ASP A CA   1 
ATOM   3923 C  C    . ASP A 1 578 ? 88.846 -49.078 -77.496 1.00 57.72  ? 572  ASP A C    1 
ATOM   3924 O  O    . ASP A 1 578 ? 88.712 -50.276 -77.779 1.00 52.83  ? 572  ASP A O    1 
ATOM   3925 C  CB   . ASP A 1 578 ? 89.941 -47.389 -78.982 1.00 62.97  ? 572  ASP A CB   1 
ATOM   3926 C  CG   . ASP A 1 578 ? 89.828 -46.582 -80.288 1.00 67.48  ? 572  ASP A CG   1 
ATOM   3927 O  OD1  . ASP A 1 578 ? 88.827 -46.760 -81.044 1.00 62.14  ? 572  ASP A OD1  1 
ATOM   3928 O  OD2  . ASP A 1 578 ? 90.755 -45.768 -80.543 1.00 66.91  ? 572  ASP A OD2  1 
ATOM   3929 N  N    . GLU A 1 579 ? 89.205 -48.653 -76.279 1.00 59.95  ? 573  GLU A N    1 
ATOM   3930 C  CA   . GLU A 1 579 ? 89.430 -49.567 -75.164 1.00 58.04  ? 573  GLU A CA   1 
ATOM   3931 C  C    . GLU A 1 579 ? 88.184 -50.391 -74.857 1.00 61.01  ? 573  GLU A C    1 
ATOM   3932 O  O    . GLU A 1 579 ? 88.283 -51.581 -74.526 1.00 61.01  ? 573  GLU A O    1 
ATOM   3933 C  CB   . GLU A 1 579 ? 89.857 -48.766 -73.937 1.00 58.08  ? 573  GLU A CB   1 
ATOM   3934 C  CG   . GLU A 1 579 ? 91.203 -48.045 -74.089 1.00 61.12  ? 573  GLU A CG   1 
ATOM   3935 C  CD   . GLU A 1 579 ? 91.532 -47.113 -72.912 1.00 69.25  ? 573  GLU A CD   1 
ATOM   3936 O  OE1  . GLU A 1 579 ? 90.654 -46.830 -72.049 1.00 64.91  ? 573  GLU A OE1  1 
ATOM   3937 O  OE2  . GLU A 1 579 ? 92.694 -46.657 -72.859 1.00 76.52  ? 573  GLU A OE2  1 
ATOM   3938 N  N    . LEU A 1 580 ? 87.001 -49.775 -74.977 1.00 60.73  ? 574  LEU A N    1 
ATOM   3939 C  CA   . LEU A 1 580 ? 85.753 -50.471 -74.667 1.00 55.45  ? 574  LEU A CA   1 
ATOM   3940 C  C    . LEU A 1 580 ? 85.403 -51.528 -75.712 1.00 58.58  ? 574  LEU A C    1 
ATOM   3941 O  O    . LEU A 1 580 ? 84.987 -52.632 -75.341 1.00 58.83  ? 574  LEU A O    1 
ATOM   3942 C  CB   . LEU A 1 580 ? 84.605 -49.476 -74.515 1.00 54.21  ? 574  LEU A CB   1 
ATOM   3943 C  CG   . LEU A 1 580 ? 83.247 -50.156 -74.375 1.00 55.85  ? 574  LEU A CG   1 
ATOM   3944 C  CD1  . LEU A 1 580 ? 83.229 -51.007 -73.123 1.00 54.05  ? 574  LEU A CD1  1 
ATOM   3945 C  CD2  . LEU A 1 580 ? 82.098 -49.158 -74.381 1.00 49.65  ? 574  LEU A CD2  1 
ATOM   3946 N  N    . PHE A 1 581 ? 85.516 -51.223 -77.027 1.00 56.35  ? 575  PHE A N    1 
ATOM   3947 C  CA   . PHE A 1 581 ? 85.183 -52.304 -77.952 1.00 54.91  ? 575  PHE A CA   1 
ATOM   3948 C  C    . PHE A 1 581 ? 86.335 -53.261 -78.173 1.00 57.35  ? 575  PHE A C    1 
ATOM   3949 O  O    . PHE A 1 581 ? 86.093 -54.416 -78.542 1.00 55.27  ? 575  PHE A O    1 
ATOM   3950 C  CB   . PHE A 1 581 ? 84.660 -51.859 -79.322 1.00 51.63  ? 575  PHE A CB   1 
ATOM   3951 C  CG   . PHE A 1 581 ? 83.412 -51.056 -79.257 1.00 53.59  ? 575  PHE A CG   1 
ATOM   3952 C  CD1  . PHE A 1 581 ? 83.320 -49.925 -78.476 1.00 53.60  ? 575  PHE A CD1  1 
ATOM   3953 C  CD2  . PHE A 1 581 ? 82.237 -51.628 -79.704 1.00 52.52  ? 575  PHE A CD2  1 
ATOM   3954 C  CE1  . PHE A 1 581 ? 82.118 -49.244 -78.379 1.00 54.43  ? 575  PHE A CE1  1 
ATOM   3955 C  CE2  . PHE A 1 581 ? 81.033 -50.981 -79.562 1.00 50.69  ? 575  PHE A CE2  1 
ATOM   3956 C  CZ   . PHE A 1 581 ? 80.968 -49.795 -78.911 1.00 47.19  ? 575  PHE A CZ   1 
ATOM   3957 N  N    . ASP A 1 582 ? 87.575 -52.814 -77.970 1.00 59.17  ? 576  ASP A N    1 
ATOM   3958 C  CA   . ASP A 1 582 ? 88.665 -53.770 -77.859 1.00 58.59  ? 576  ASP A CA   1 
ATOM   3959 C  C    . ASP A 1 582 ? 88.346 -54.796 -76.783 1.00 60.62  ? 576  ASP A C    1 
ATOM   3960 O  O    . ASP A 1 582 ? 88.467 -56.007 -77.004 1.00 63.52  ? 576  ASP A O    1 
ATOM   3961 C  CB   . ASP A 1 582 ? 89.982 -53.046 -77.573 1.00 56.40  ? 576  ASP A CB   1 
ATOM   3962 C  CG   . ASP A 1 582 ? 90.594 -52.417 -78.819 1.00 59.34  ? 576  ASP A CG   1 
ATOM   3963 O  OD1  . ASP A 1 582 ? 90.223 -52.803 -79.955 1.00 62.10  ? 576  ASP A OD1  1 
ATOM   3964 O  OD2  . ASP A 1 582 ? 91.471 -51.545 -78.667 1.00 59.34  ? 576  ASP A OD2  1 
ATOM   3965 N  N    . HIS A 1 583 ? 87.866 -54.324 -75.627 1.00 62.55  ? 577  HIS A N    1 
ATOM   3966 C  CA   . HIS A 1 583 ? 87.552 -55.225 -74.518 1.00 59.99  ? 577  HIS A CA   1 
ATOM   3967 C  C    . HIS A 1 583 ? 86.406 -56.165 -74.866 1.00 59.49  ? 577  HIS A C    1 
ATOM   3968 O  O    . HIS A 1 583 ? 86.484 -57.370 -74.612 1.00 60.94  ? 577  HIS A O    1 
ATOM   3969 C  CB   . HIS A 1 583 ? 87.201 -54.437 -73.265 1.00 57.54  ? 577  HIS A CB   1 
ATOM   3970 C  CG   . HIS A 1 583 ? 87.135 -55.296 -72.046 1.00 65.74  ? 577  HIS A CG   1 
ATOM   3971 N  ND1  . HIS A 1 583 ? 86.071 -56.132 -71.784 1.00 66.86  ? 577  HIS A ND1  1 
ATOM   3972 C  CD2  . HIS A 1 583 ? 88.023 -55.490 -71.045 1.00 64.42  ? 577  HIS A CD2  1 
ATOM   3973 C  CE1  . HIS A 1 583 ? 86.299 -56.793 -70.667 1.00 63.18  ? 577  HIS A CE1  1 
ATOM   3974 N  NE2  . HIS A 1 583 ? 87.473 -56.416 -70.196 1.00 65.44  ? 577  HIS A NE2  1 
ATOM   3975 N  N    . ILE A 1 584 ? 85.324 -55.620 -75.429 1.00 57.32  ? 578  ILE A N    1 
ATOM   3976 C  CA   . ILE A 1 584 ? 84.189 -56.433 -75.868 1.00 58.47  ? 578  ILE A CA   1 
ATOM   3977 C  C    . ILE A 1 584 ? 84.636 -57.540 -76.824 1.00 61.33  ? 578  ILE A C    1 
ATOM   3978 O  O    . ILE A 1 584 ? 84.204 -58.694 -76.703 1.00 60.56  ? 578  ILE A O    1 
ATOM   3979 C  CB   . ILE A 1 584 ? 83.113 -55.534 -76.509 1.00 54.80  ? 578  ILE A CB   1 
ATOM   3980 C  CG1  . ILE A 1 584 ? 82.490 -54.622 -75.456 1.00 54.96  ? 578  ILE A CG1  1 
ATOM   3981 C  CG2  . ILE A 1 584 ? 82.052 -56.356 -77.224 1.00 49.61  ? 578  ILE A CG2  1 
ATOM   3982 C  CD1  . ILE A 1 584 ? 81.612 -53.566 -76.022 1.00 50.44  ? 578  ILE A CD1  1 
ATOM   3983 N  N    . VAL A 1 585 ? 85.481 -57.209 -77.809 1.00 60.49  ? 579  VAL A N    1 
ATOM   3984 C  CA   . VAL A 1 585 ? 85.857 -58.237 -78.784 1.00 63.37  ? 579  VAL A CA   1 
ATOM   3985 C  C    . VAL A 1 585 ? 86.902 -59.185 -78.202 1.00 67.08  ? 579  VAL A C    1 
ATOM   3986 O  O    . VAL A 1 585 ? 87.002 -60.337 -78.638 1.00 68.30  ? 579  VAL A O    1 
ATOM   3987 C  CB   . VAL A 1 585 ? 86.352 -57.628 -80.110 1.00 59.06  ? 579  VAL A CB   1 
ATOM   3988 C  CG1  . VAL A 1 585 ? 85.250 -56.845 -80.787 1.00 59.38  ? 579  VAL A CG1  1 
ATOM   3989 C  CG2  . VAL A 1 585 ? 87.573 -56.762 -79.869 1.00 65.14  ? 579  VAL A CG2  1 
ATOM   3990 N  N    . GLN A 1 586 ? 87.701 -58.735 -77.227 1.00 67.27  ? 580  GLN A N    1 
ATOM   3991 C  CA   . GLN A 1 586 ? 88.544 -59.686 -76.504 1.00 72.32  ? 580  GLN A CA   1 
ATOM   3992 C  C    . GLN A 1 586 ? 87.707 -60.684 -75.720 1.00 72.14  ? 580  GLN A C    1 
ATOM   3993 O  O    . GLN A 1 586 ? 88.155 -61.808 -75.469 1.00 76.23  ? 580  GLN A O    1 
ATOM   3994 C  CB   . GLN A 1 586 ? 89.490 -58.990 -75.535 1.00 69.83  ? 580  GLN A CB   1 
ATOM   3995 C  CG   . GLN A 1 586 ? 90.492 -59.969 -74.973 1.00 72.25  ? 580  GLN A CG   1 
ATOM   3996 C  CD   . GLN A 1 586 ? 91.398 -59.367 -73.920 1.00 93.14  ? 580  GLN A CD   1 
ATOM   3997 O  OE1  . GLN A 1 586 ? 91.217 -58.221 -73.499 1.00 89.77  ? 580  GLN A OE1  1 
ATOM   3998 N  NE2  . GLN A 1 586 ? 92.411 -60.131 -73.512 1.00 104.16 ? 580  GLN A NE2  1 
ATOM   3999 N  N    . CYS A 1 587 ? 86.507 -60.287 -75.296 1.00 65.54  ? 581  CYS A N    1 
ATOM   4000 C  CA   . CYS A 1 587 ? 85.611 -61.252 -74.680 1.00 63.71  ? 581  CYS A CA   1 
ATOM   4001 C  C    . CYS A 1 587 ? 84.974 -62.151 -75.736 1.00 66.83  ? 581  CYS A C    1 
ATOM   4002 O  O    . CYS A 1 587 ? 84.802 -63.348 -75.503 1.00 69.61  ? 581  CYS A O    1 
ATOM   4003 C  CB   . CYS A 1 587 ? 84.555 -60.529 -73.841 1.00 58.24  ? 581  CYS A CB   1 
ATOM   4004 S  SG   . CYS A 1 587 ? 85.238 -59.536 -72.464 1.00 57.91  ? 581  CYS A SG   1 
ATOM   4005 N  N    . ILE A 1 588 ? 84.635 -61.616 -76.910 1.00 62.72  ? 582  ILE A N    1 
ATOM   4006 C  CA   . ILE A 1 588 ? 84.122 -62.495 -77.959 1.00 69.11  ? 582  ILE A CA   1 
ATOM   4007 C  C    . ILE A 1 588 ? 85.137 -63.583 -78.275 1.00 72.90  ? 582  ILE A C    1 
ATOM   4008 O  O    . ILE A 1 588 ? 84.771 -64.725 -78.578 1.00 73.17  ? 582  ILE A O    1 
ATOM   4009 C  CB   . ILE A 1 588 ? 83.754 -61.712 -79.234 1.00 66.95  ? 582  ILE A CB   1 
ATOM   4010 C  CG1  . ILE A 1 588 ? 82.550 -60.801 -79.010 1.00 63.33  ? 582  ILE A CG1  1 
ATOM   4011 C  CG2  . ILE A 1 588 ? 83.481 -62.677 -80.363 1.00 63.07  ? 582  ILE A CG2  1 
ATOM   4012 C  CD1  . ILE A 1 588 ? 82.231 -59.930 -80.205 1.00 53.11  ? 582  ILE A CD1  1 
ATOM   4013 N  N    . ALA A 1 589 ? 86.427 -63.242 -78.228 1.00 74.03  ? 583  ALA A N    1 
ATOM   4014 C  CA   . ALA A 1 589 ? 87.468 -64.192 -78.609 1.00 74.25  ? 583  ALA A CA   1 
ATOM   4015 C  C    . ALA A 1 589 ? 87.666 -65.246 -77.529 1.00 81.14  ? 583  ALA A C    1 
ATOM   4016 O  O    . ALA A 1 589 ? 87.699 -66.448 -77.825 1.00 82.59  ? 583  ALA A O    1 
ATOM   4017 C  CB   . ALA A 1 589 ? 88.777 -63.457 -78.897 1.00 70.72  ? 583  ALA A CB   1 
ATOM   4018 N  N    . ASP A 1 590 ? 87.793 -64.806 -76.267 1.00 76.37  ? 584  ASP A N    1 
ATOM   4019 C  CA   . ASP A 1 590 ? 87.834 -65.735 -75.145 1.00 74.95  ? 584  ASP A CA   1 
ATOM   4020 C  C    . ASP A 1 590 ? 86.641 -66.677 -75.158 1.00 79.81  ? 584  ASP A C    1 
ATOM   4021 O  O    . ASP A 1 590 ? 86.743 -67.815 -74.690 1.00 86.57  ? 584  ASP A O    1 
ATOM   4022 C  CB   . ASP A 1 590 ? 87.870 -64.965 -73.821 1.00 78.44  ? 584  ASP A CB   1 
ATOM   4023 C  CG   . ASP A 1 590 ? 87.909 -65.885 -72.597 1.00 83.10  ? 584  ASP A CG   1 
ATOM   4024 O  OD1  . ASP A 1 590 ? 88.126 -67.103 -72.758 1.00 92.18  ? 584  ASP A OD1  1 
ATOM   4025 O  OD2  . ASP A 1 590 ? 87.668 -65.397 -71.469 1.00 83.32  ? 584  ASP A OD2  1 
ATOM   4026 N  N    . PHE A 1 591 ? 85.500 -66.222 -75.666 1.00 76.96  ? 585  PHE A N    1 
ATOM   4027 C  CA   . PHE A 1 591 ? 84.334 -67.093 -75.716 1.00 78.70  ? 585  PHE A CA   1 
ATOM   4028 C  C    . PHE A 1 591 ? 84.430 -68.082 -76.872 1.00 83.98  ? 585  PHE A C    1 
ATOM   4029 O  O    . PHE A 1 591 ? 84.214 -69.284 -76.686 1.00 88.56  ? 585  PHE A O    1 
ATOM   4030 C  CB   . PHE A 1 591 ? 83.058 -66.261 -75.829 1.00 75.22  ? 585  PHE A CB   1 
ATOM   4031 C  CG   . PHE A 1 591 ? 81.806 -67.086 -75.955 1.00 73.31  ? 585  PHE A CG   1 
ATOM   4032 C  CD1  . PHE A 1 591 ? 81.167 -67.578 -74.835 1.00 74.64  ? 585  PHE A CD1  1 
ATOM   4033 C  CD2  . PHE A 1 591 ? 81.281 -67.379 -77.195 1.00 72.61  ? 585  PHE A CD2  1 
ATOM   4034 C  CE1  . PHE A 1 591 ? 80.026 -68.329 -74.953 1.00 74.42  ? 585  PHE A CE1  1 
ATOM   4035 C  CE2  . PHE A 1 591 ? 80.141 -68.132 -77.313 1.00 75.09  ? 585  PHE A CE2  1 
ATOM   4036 C  CZ   . PHE A 1 591 ? 79.514 -68.607 -76.191 1.00 74.49  ? 585  PHE A CZ   1 
ATOM   4037 N  N    . LEU A 1 592 ? 84.745 -67.602 -78.076 1.00 81.05  ? 586  LEU A N    1 
ATOM   4038 C  CA   . LEU A 1 592 ? 84.901 -68.526 -79.192 1.00 85.79  ? 586  LEU A CA   1 
ATOM   4039 C  C    . LEU A 1 592 ? 85.866 -69.648 -78.830 1.00 88.61  ? 586  LEU A C    1 
ATOM   4040 O  O    . LEU A 1 592 ? 85.639 -70.813 -79.175 1.00 90.10  ? 586  LEU A O    1 
ATOM   4041 C  CB   . LEU A 1 592 ? 85.375 -67.777 -80.441 1.00 85.21  ? 586  LEU A CB   1 
ATOM   4042 C  CG   . LEU A 1 592 ? 84.309 -67.158 -81.349 1.00 81.94  ? 586  LEU A CG   1 
ATOM   4043 C  CD1  . LEU A 1 592 ? 83.566 -66.076 -80.630 1.00 83.93  ? 586  LEU A CD1  1 
ATOM   4044 C  CD2  . LEU A 1 592 ? 84.943 -66.594 -82.594 1.00 86.30  ? 586  LEU A CD2  1 
ATOM   4045 N  N    . GLU A 1 593 ? 86.934 -69.325 -78.104 1.00 86.18  ? 587  GLU A N    1 
ATOM   4046 C  CA   . GLU A 1 593 ? 87.902 -70.348 -77.728 1.00 90.26  ? 587  GLU A CA   1 
ATOM   4047 C  C    . GLU A 1 593 ? 87.325 -71.278 -76.665 1.00 92.08  ? 587  GLU A C    1 
ATOM   4048 O  O    . GLU A 1 593 ? 87.449 -72.503 -76.763 1.00 96.61  ? 587  GLU A O    1 
ATOM   4049 C  CB   . GLU A 1 593 ? 89.183 -69.674 -77.244 1.00 96.53  ? 587  GLU A CB   1 
ATOM   4050 C  CG   . GLU A 1 593 ? 90.361 -70.597 -77.045 1.00 104.68 ? 587  GLU A CG   1 
ATOM   4051 C  CD   . GLU A 1 593 ? 91.631 -69.828 -76.738 1.00 107.85 ? 587  GLU A CD   1 
ATOM   4052 O  OE1  . GLU A 1 593 ? 91.556 -68.591 -76.582 1.00 106.85 ? 587  GLU A OE1  1 
ATOM   4053 O  OE2  . GLU A 1 593 ? 92.708 -70.454 -76.682 1.00 115.25 ? 587  GLU A OE2  1 
ATOM   4054 N  N    . TYR A 1 594 ? 86.670 -70.704 -75.652 1.00 90.12  ? 588  TYR A N    1 
ATOM   4055 C  CA   . TYR A 1 594 ? 85.949 -71.476 -74.643 1.00 89.54  ? 588  TYR A CA   1 
ATOM   4056 C  C    . TYR A 1 594 ? 84.982 -72.483 -75.254 1.00 91.39  ? 588  TYR A C    1 
ATOM   4057 O  O    . TYR A 1 594 ? 84.710 -73.525 -74.646 1.00 96.70  ? 588  TYR A O    1 
ATOM   4058 C  CB   . TYR A 1 594 ? 85.190 -70.506 -73.733 1.00 93.56  ? 588  TYR A CB   1 
ATOM   4059 C  CG   . TYR A 1 594 ? 84.204 -71.125 -72.766 1.00 95.19  ? 588  TYR A CG   1 
ATOM   4060 C  CD1  . TYR A 1 594 ? 84.605 -71.571 -71.516 1.00 102.20 ? 588  TYR A CD1  1 
ATOM   4061 C  CD2  . TYR A 1 594 ? 82.864 -71.260 -73.113 1.00 95.42  ? 588  TYR A CD2  1 
ATOM   4062 C  CE1  . TYR A 1 594 ? 83.690 -72.123 -70.628 1.00 106.77 ? 588  TYR A CE1  1 
ATOM   4063 C  CE2  . TYR A 1 594 ? 81.947 -71.814 -72.244 1.00 99.22  ? 588  TYR A CE2  1 
ATOM   4064 C  CZ   . TYR A 1 594 ? 82.361 -72.245 -71.002 1.00 105.97 ? 588  TYR A CZ   1 
ATOM   4065 O  OH   . TYR A 1 594 ? 81.445 -72.796 -70.134 1.00 109.77 ? 588  TYR A OH   1 
ATOM   4066 N  N    . MET A 1 595 ? 84.427 -72.175 -76.426 1.00 90.45  ? 589  MET A N    1 
ATOM   4067 C  CA   . MET A 1 595 ? 83.511 -73.049 -77.149 1.00 87.88  ? 589  MET A CA   1 
ATOM   4068 C  C    . MET A 1 595 ? 84.213 -73.918 -78.175 1.00 89.24  ? 589  MET A C    1 
ATOM   4069 O  O    . MET A 1 595 ? 83.538 -74.598 -78.955 1.00 92.55  ? 589  MET A O    1 
ATOM   4070 C  CB   . MET A 1 595 ? 82.435 -72.227 -77.858 1.00 88.10  ? 589  MET A CB   1 
ATOM   4071 C  CG   . MET A 1 595 ? 81.473 -71.503 -76.935 1.00 93.28  ? 589  MET A CG   1 
ATOM   4072 S  SD   . MET A 1 595 ? 80.393 -72.587 -75.991 1.00 96.03  ? 589  MET A SD   1 
ATOM   4073 C  CE   . MET A 1 595 ? 79.391 -73.265 -77.310 1.00 97.59  ? 589  MET A CE   1 
ATOM   4074 N  N    . GLY A 1 596 ? 85.542 -73.877 -78.228 1.00 88.04  ? 590  GLY A N    1 
ATOM   4075 C  CA   . GLY A 1 596 ? 86.244 -74.529 -79.317 1.00 91.93  ? 590  GLY A CA   1 
ATOM   4076 C  C    . GLY A 1 596 ? 85.855 -74.025 -80.690 1.00 91.36  ? 590  GLY A C    1 
ATOM   4077 O  O    . GLY A 1 596 ? 86.083 -74.720 -81.682 1.00 91.19  ? 590  GLY A O    1 
ATOM   4078 N  N    . MET A 1 597 ? 85.257 -72.828 -80.769 1.00 91.47  ? 591  MET A N    1 
ATOM   4079 C  CA   . MET A 1 597 ? 84.868 -72.211 -82.032 1.00 88.19  ? 591  MET A CA   1 
ATOM   4080 C  C    . MET A 1 597 ? 86.027 -71.498 -82.719 1.00 92.86  ? 591  MET A C    1 
ATOM   4081 O  O    . MET A 1 597 ? 85.952 -71.263 -83.933 1.00 95.92  ? 591  MET A O    1 
ATOM   4082 C  CB   . MET A 1 597 ? 83.738 -71.199 -81.809 1.00 92.08  ? 591  MET A CB   1 
ATOM   4083 C  CG   . MET A 1 597 ? 82.424 -71.737 -81.203 1.00 92.70  ? 591  MET A CG   1 
ATOM   4084 S  SD   . MET A 1 597 ? 81.491 -72.964 -82.145 1.00 90.62  ? 591  MET A SD   1 
ATOM   4085 C  CE   . MET A 1 597 ? 80.987 -72.047 -83.600 1.00 86.15  ? 591  MET A CE   1 
ATOM   4086 N  N    . LYS A 1 598 ? 87.079 -71.127 -81.976 1.00 88.99  ? 592  LYS A N    1 
ATOM   4087 C  CA   . LYS A 1 598 ? 88.305 -70.605 -82.576 1.00 88.41  ? 592  LYS A CA   1 
ATOM   4088 C  C    . LYS A 1 598 ? 88.017 -69.460 -83.540 1.00 94.17  ? 592  LYS A C    1 
ATOM   4089 O  O    . LYS A 1 598 ? 87.535 -68.402 -83.130 1.00 102.22 ? 592  LYS A O    1 
ATOM   4090 N  N    . GLY A 1 599 ? 88.322 -69.649 -84.818 1.00 90.00  ? 593  GLY A N    1 
ATOM   4091 C  CA   . GLY A 1 599 ? 88.132 -68.596 -85.798 1.00 91.21  ? 593  GLY A CA   1 
ATOM   4092 C  C    . GLY A 1 599 ? 86.942 -68.738 -86.733 1.00 97.33  ? 593  GLY A C    1 
ATOM   4093 O  O    . GLY A 1 599 ? 86.973 -68.199 -87.846 1.00 100.80 ? 593  GLY A O    1 
ATOM   4094 N  N    . VAL A 1 600 ? 85.902 -69.474 -86.329 1.00 94.19  ? 594  VAL A N    1 
ATOM   4095 C  CA   . VAL A 1 600 ? 84.819 -69.790 -87.260 1.00 95.83  ? 594  VAL A CA   1 
ATOM   4096 C  C    . VAL A 1 600 ? 84.063 -68.526 -87.675 1.00 90.87  ? 594  VAL A C    1 
ATOM   4097 O  O    . VAL A 1 600 ? 84.012 -67.525 -86.946 1.00 87.87  ? 594  VAL A O    1 
ATOM   4098 C  CB   . VAL A 1 600 ? 83.865 -70.836 -86.656 1.00 90.71  ? 594  VAL A CB   1 
ATOM   4099 C  CG1  . VAL A 1 600 ? 84.597 -72.157 -86.445 1.00 91.01  ? 594  VAL A CG1  1 
ATOM   4100 C  CG2  . VAL A 1 600 ? 83.277 -70.322 -85.355 1.00 93.88  ? 594  VAL A CG2  1 
ATOM   4101 N  N    . SER A 1 601 ? 83.461 -68.576 -88.865 1.00 92.37  ? 595  SER A N    1 
ATOM   4102 C  CA   . SER A 1 601 ? 82.766 -67.429 -89.446 1.00 91.02  ? 595  SER A CA   1 
ATOM   4103 C  C    . SER A 1 601 ? 81.299 -67.507 -89.048 1.00 88.45  ? 595  SER A C    1 
ATOM   4104 O  O    . SER A 1 601 ? 80.555 -68.349 -89.563 1.00 91.07  ? 595  SER A O    1 
ATOM   4105 C  CB   . SER A 1 601 ? 82.917 -67.416 -90.968 1.00 85.67  ? 595  SER A CB   1 
ATOM   4106 N  N    . LEU A 1 602 ? 80.876 -66.599 -88.165 1.00 83.48  ? 596  LEU A N    1 
ATOM   4107 C  CA   . LEU A 1 602 ? 79.552 -66.618 -87.561 1.00 75.35  ? 596  LEU A CA   1 
ATOM   4108 C  C    . LEU A 1 602 ? 78.865 -65.269 -87.711 1.00 69.02  ? 596  LEU A C    1 
ATOM   4109 O  O    . LEU A 1 602 ? 79.516 -64.221 -87.609 1.00 68.67  ? 596  LEU A O    1 
ATOM   4110 C  CB   . LEU A 1 602 ? 79.642 -66.965 -86.068 1.00 80.82  ? 596  LEU A CB   1 
ATOM   4111 C  CG   . LEU A 1 602 ? 80.078 -68.369 -85.663 1.00 82.24  ? 596  LEU A CG   1 
ATOM   4112 C  CD1  . LEU A 1 602 ? 80.371 -68.411 -84.173 1.00 78.06  ? 596  LEU A CD1  1 
ATOM   4113 C  CD2  . LEU A 1 602 ? 78.976 -69.348 -86.012 1.00 80.72  ? 596  LEU A CD2  1 
ATOM   4114 N  N    . PRO A 1 603 ? 77.557 -65.264 -87.943 1.00 61.56  ? 597  PRO A N    1 
ATOM   4115 C  CA   . PRO A 1 603 ? 76.786 -64.018 -87.878 1.00 62.23  ? 597  PRO A CA   1 
ATOM   4116 C  C    . PRO A 1 603 ? 76.491 -63.623 -86.429 1.00 65.70  ? 597  PRO A C    1 
ATOM   4117 O  O    . PRO A 1 603 ? 76.548 -64.440 -85.509 1.00 66.62  ? 597  PRO A O    1 
ATOM   4118 C  CB   . PRO A 1 603 ? 75.506 -64.363 -88.643 1.00 62.88  ? 597  PRO A CB   1 
ATOM   4119 C  CG   . PRO A 1 603 ? 75.347 -65.847 -88.434 1.00 64.14  ? 597  PRO A CG   1 
ATOM   4120 C  CD   . PRO A 1 603 ? 76.711 -66.440 -88.199 1.00 58.97  ? 597  PRO A CD   1 
ATOM   4121 N  N    . LEU A 1 604 ? 76.187 -62.340 -86.229 1.00 62.24  ? 598  LEU A N    1 
ATOM   4122 C  CA   . LEU A 1 604 ? 76.109 -61.782 -84.884 1.00 62.25  ? 598  LEU A CA   1 
ATOM   4123 C  C    . LEU A 1 604 ? 74.889 -60.891 -84.721 1.00 63.81  ? 598  LEU A C    1 
ATOM   4124 O  O    . LEU A 1 604 ? 74.718 -59.924 -85.467 1.00 62.41  ? 598  LEU A O    1 
ATOM   4125 C  CB   . LEU A 1 604 ? 77.377 -60.999 -84.550 1.00 65.15  ? 598  LEU A CB   1 
ATOM   4126 C  CG   . LEU A 1 604 ? 77.466 -60.512 -83.101 1.00 64.21  ? 598  LEU A CG   1 
ATOM   4127 C  CD1  . LEU A 1 604 ? 78.896 -60.583 -82.603 1.00 61.50  ? 598  LEU A CD1  1 
ATOM   4128 C  CD2  . LEU A 1 604 ? 76.949 -59.088 -83.013 1.00 63.69  ? 598  LEU A CD2  1 
ATOM   4129 N  N    . GLY A 1 605 ? 74.037 -61.234 -83.754 1.00 63.57  ? 599  GLY A N    1 
ATOM   4130 C  CA   . GLY A 1 605 ? 73.014 -60.337 -83.256 1.00 59.96  ? 599  GLY A CA   1 
ATOM   4131 C  C    . GLY A 1 605 ? 73.517 -59.648 -82.002 1.00 62.87  ? 599  GLY A C    1 
ATOM   4132 O  O    . GLY A 1 605 ? 74.354 -60.178 -81.278 1.00 65.20  ? 599  GLY A O    1 
ATOM   4133 N  N    . PHE A 1 606 ? 73.009 -58.452 -81.748 1.00 59.97  ? 600  PHE A N    1 
ATOM   4134 C  CA   . PHE A 1 606 ? 73.623 -57.605 -80.742 1.00 58.23  ? 600  PHE A CA   1 
ATOM   4135 C  C    . PHE A 1 606 ? 72.550 -56.846 -79.973 1.00 58.93  ? 600  PHE A C    1 
ATOM   4136 O  O    . PHE A 1 606 ? 71.833 -56.025 -80.552 1.00 58.20  ? 600  PHE A O    1 
ATOM   4137 C  CB   . PHE A 1 606 ? 74.649 -56.737 -81.486 1.00 61.53  ? 600  PHE A CB   1 
ATOM   4138 C  CG   . PHE A 1 606 ? 75.321 -55.684 -80.682 1.00 64.43  ? 600  PHE A CG   1 
ATOM   4139 C  CD1  . PHE A 1 606 ? 75.762 -55.931 -79.391 1.00 58.76  ? 600  PHE A CD1  1 
ATOM   4140 C  CD2  . PHE A 1 606 ? 75.764 -54.529 -81.337 1.00 60.58  ? 600  PHE A CD2  1 
ATOM   4141 C  CE1  . PHE A 1 606 ? 76.461 -54.957 -78.690 1.00 64.00  ? 600  PHE A CE1  1 
ATOM   4142 C  CE2  . PHE A 1 606 ? 76.481 -53.558 -80.663 1.00 62.55  ? 600  PHE A CE2  1 
ATOM   4143 C  CZ   . PHE A 1 606 ? 76.831 -53.767 -79.331 1.00 65.59  ? 600  PHE A CZ   1 
ATOM   4144 N  N    . THR A 1 607 ? 72.425 -57.127 -78.669 1.00 60.48  ? 601  THR A N    1 
ATOM   4145 C  CA   . THR A 1 607 ? 71.484 -56.412 -77.811 1.00 53.27  ? 601  THR A CA   1 
ATOM   4146 C  C    . THR A 1 607 ? 72.243 -55.278 -77.153 1.00 54.99  ? 601  THR A C    1 
ATOM   4147 O  O    . THR A 1 607 ? 73.199 -55.514 -76.408 1.00 57.00  ? 601  THR A O    1 
ATOM   4148 C  CB   . THR A 1 607 ? 70.856 -57.297 -76.737 1.00 56.57  ? 601  THR A CB   1 
ATOM   4149 O  OG1  . THR A 1 607 ? 70.216 -58.416 -77.340 1.00 66.24  ? 601  THR A OG1  1 
ATOM   4150 C  CG2  . THR A 1 607 ? 69.788 -56.536 -76.029 1.00 54.56  ? 601  THR A CG2  1 
ATOM   4151 N  N    . PHE A 1 608 ? 71.847 -54.055 -77.465 1.00 51.78  ? 602  PHE A N    1 
ATOM   4152 C  CA   . PHE A 1 608 ? 72.555 -52.863 -77.030 1.00 51.41  ? 602  PHE A CA   1 
ATOM   4153 C  C    . PHE A 1 608 ? 71.469 -51.975 -76.469 1.00 52.53  ? 602  PHE A C    1 
ATOM   4154 O  O    . PHE A 1 608 ? 70.670 -51.441 -77.241 1.00 51.98  ? 602  PHE A O    1 
ATOM   4155 C  CB   . PHE A 1 608 ? 73.266 -52.235 -78.232 1.00 50.42  ? 602  PHE A CB   1 
ATOM   4156 C  CG   . PHE A 1 608 ? 74.077 -51.019 -77.941 1.00 53.09  ? 602  PHE A CG   1 
ATOM   4157 C  CD1  . PHE A 1 608 ? 75.311 -51.121 -77.323 1.00 56.51  ? 602  PHE A CD1  1 
ATOM   4158 C  CD2  . PHE A 1 608 ? 73.663 -49.776 -78.397 1.00 54.17  ? 602  PHE A CD2  1 
ATOM   4159 C  CE1  . PHE A 1 608 ? 76.080 -49.990 -77.097 1.00 56.10  ? 602  PHE A CE1  1 
ATOM   4160 C  CE2  . PHE A 1 608 ? 74.432 -48.642 -78.185 1.00 48.26  ? 602  PHE A CE2  1 
ATOM   4161 C  CZ   . PHE A 1 608 ? 75.639 -48.750 -77.541 1.00 53.54  ? 602  PHE A CZ   1 
ATOM   4162 N  N    . SER A 1 609 ? 71.429 -51.806 -75.144 1.00 52.12  ? 603  SER A N    1 
ATOM   4163 C  CA   . SER A 1 609 ? 70.290 -51.125 -74.531 1.00 52.99  ? 603  SER A CA   1 
ATOM   4164 C  C    . SER A 1 609 ? 70.712 -49.741 -74.061 1.00 54.29  ? 603  SER A C    1 
ATOM   4165 O  O    . SER A 1 609 ? 70.839 -49.480 -72.863 1.00 53.31  ? 603  SER A O    1 
ATOM   4166 C  CB   . SER A 1 609 ? 69.770 -51.953 -73.370 1.00 53.11  ? 603  SER A CB   1 
ATOM   4167 O  OG   . SER A 1 609 ? 70.778 -52.113 -72.383 1.00 56.39  ? 603  SER A OG   1 
ATOM   4168 N  N    . PHE A 1 610 ? 70.681 -48.807 -75.002 1.00 53.20  ? 604  PHE A N    1 
ATOM   4169 C  CA   . PHE A 1 610 ? 70.993 -47.405 -74.788 1.00 49.74  ? 604  PHE A CA   1 
ATOM   4170 C  C    . PHE A 1 610 ? 70.185 -46.610 -75.785 1.00 52.24  ? 604  PHE A C    1 
ATOM   4171 O  O    . PHE A 1 610 ? 69.762 -47.146 -76.824 1.00 57.27  ? 604  PHE A O    1 
ATOM   4172 C  CB   . PHE A 1 610 ? 72.486 -47.105 -74.954 1.00 49.47  ? 604  PHE A CB   1 
ATOM   4173 C  CG   . PHE A 1 610 ? 73.367 -47.885 -74.043 1.00 49.20  ? 604  PHE A CG   1 
ATOM   4174 C  CD1  . PHE A 1 610 ? 73.629 -47.448 -72.758 1.00 56.13  ? 604  PHE A CD1  1 
ATOM   4175 C  CD2  . PHE A 1 610 ? 73.940 -49.066 -74.469 1.00 53.28  ? 604  PHE A CD2  1 
ATOM   4176 C  CE1  . PHE A 1 610 ? 74.455 -48.179 -71.912 1.00 54.78  ? 604  PHE A CE1  1 
ATOM   4177 C  CE2  . PHE A 1 610 ? 74.762 -49.808 -73.621 1.00 54.94  ? 604  PHE A CE2  1 
ATOM   4178 C  CZ   . PHE A 1 610 ? 75.022 -49.362 -72.354 1.00 50.29  ? 604  PHE A CZ   1 
ATOM   4179 N  N    . PRO A 1 611 ? 69.977 -45.345 -75.545 1.00 51.88  ? 605  PRO A N    1 
ATOM   4180 C  CA   . PRO A 1 611 ? 69.144 -44.553 -76.451 1.00 52.28  ? 605  PRO A CA   1 
ATOM   4181 C  C    . PRO A 1 611 ? 69.821 -44.333 -77.801 1.00 51.49  ? 605  PRO A C    1 
ATOM   4182 O  O    . PRO A 1 611 ? 70.656 -43.439 -77.933 1.00 54.55  ? 605  PRO A O    1 
ATOM   4183 C  CB   . PRO A 1 611 ? 68.926 -43.250 -75.666 1.00 46.70  ? 605  PRO A CB   1 
ATOM   4184 C  CG   . PRO A 1 611 ? 70.070 -43.154 -74.764 1.00 48.15  ? 605  PRO A CG   1 
ATOM   4185 C  CD   . PRO A 1 611 ? 70.457 -44.557 -74.395 1.00 48.54  ? 605  PRO A CD   1 
ATOM   4186 N  N    . CYS A 1 612 ? 69.565 -45.209 -78.774 1.00 53.61  ? 606  CYS A N    1 
ATOM   4187 C  CA   . CYS A 1 612 ? 70.099 -45.088 -80.135 1.00 53.60  ? 606  CYS A CA   1 
ATOM   4188 C  C    . CYS A 1 612 ? 69.066 -44.587 -81.142 1.00 56.20  ? 606  CYS A C    1 
ATOM   4189 O  O    . CYS A 1 612 ? 67.866 -44.850 -81.030 1.00 60.58  ? 606  CYS A O    1 
ATOM   4190 C  CB   . CYS A 1 612 ? 70.611 -46.427 -80.667 1.00 51.96  ? 606  CYS A CB   1 
ATOM   4191 S  SG   . CYS A 1 612 ? 71.946 -47.154 -79.775 1.00 65.45  ? 606  CYS A SG   1 
ATOM   4192 N  N    . GLN A 1 613 ? 69.561 -43.907 -82.171 1.00 60.39  ? 607  GLN A N    1 
ATOM   4193 C  CA   . GLN A 1 613 ? 68.809 -43.714 -83.412 1.00 57.87  ? 607  GLN A CA   1 
ATOM   4194 C  C    . GLN A 1 613 ? 69.107 -44.844 -84.394 1.00 56.98  ? 607  GLN A C    1 
ATOM   4195 O  O    . GLN A 1 613 ? 70.212 -44.924 -84.935 1.00 56.98  ? 607  GLN A O    1 
ATOM   4196 C  CB   . GLN A 1 613 ? 69.173 -42.388 -84.055 1.00 56.12  ? 607  GLN A CB   1 
ATOM   4197 C  CG   . GLN A 1 613 ? 68.521 -42.238 -85.386 1.00 65.59  ? 607  GLN A CG   1 
ATOM   4198 C  CD   . GLN A 1 613 ? 68.892 -40.953 -86.037 1.00 70.74  ? 607  GLN A CD   1 
ATOM   4199 O  OE1  . GLN A 1 613 ? 69.552 -40.100 -85.437 1.00 74.07  ? 607  GLN A OE1  1 
ATOM   4200 N  NE2  . GLN A 1 613 ? 68.502 -40.807 -87.288 1.00 77.94  ? 607  GLN A NE2  1 
ATOM   4201 N  N    . GLN A 1 614 ? 68.119 -45.692 -84.664 1.00 58.55  ? 608  GLN A N    1 
ATOM   4202 C  CA   . GLN A 1 614 ? 68.288 -46.749 -85.653 1.00 61.30  ? 608  GLN A CA   1 
ATOM   4203 C  C    . GLN A 1 614 ? 67.818 -46.305 -87.022 1.00 61.62  ? 608  GLN A C    1 
ATOM   4204 O  O    . GLN A 1 614 ? 66.652 -45.950 -87.195 1.00 70.20  ? 608  GLN A O    1 
ATOM   4205 C  CB   . GLN A 1 614 ? 67.569 -48.041 -85.292 1.00 56.94  ? 608  GLN A CB   1 
ATOM   4206 C  CG   . GLN A 1 614 ? 68.473 -48.969 -84.581 1.00 61.69  ? 608  GLN A CG   1 
ATOM   4207 C  CD   . GLN A 1 614 ? 67.966 -50.358 -84.650 1.00 65.46  ? 608  GLN A CD   1 
ATOM   4208 O  OE1  . GLN A 1 614 ? 66.760 -50.580 -84.657 1.00 74.24  ? 608  GLN A OE1  1 
ATOM   4209 N  NE2  . GLN A 1 614 ? 68.875 -51.308 -84.822 1.00 62.24  ? 608  GLN A NE2  1 
ATOM   4210 N  N    . ASN A 1 615 ? 68.724 -46.350 -87.991 1.00 61.33  ? 609  ASN A N    1 
ATOM   4211 C  CA   . ASN A 1 615 ? 68.404 -46.067 -89.378 1.00 59.43  ? 609  ASN A CA   1 
ATOM   4212 C  C    . ASN A 1 615 ? 68.108 -47.327 -90.178 1.00 58.03  ? 609  ASN A C    1 
ATOM   4213 O  O    . ASN A 1 615 ? 67.584 -47.232 -91.289 1.00 55.30  ? 609  ASN A O    1 
ATOM   4214 C  CB   . ASN A 1 615 ? 69.558 -45.289 -90.020 1.00 57.15  ? 609  ASN A CB   1 
ATOM   4215 C  CG   . ASN A 1 615 ? 69.846 -43.975 -89.295 1.00 64.69  ? 609  ASN A CG   1 
ATOM   4216 O  OD1  . ASN A 1 615 ? 69.002 -43.077 -89.251 1.00 68.24  ? 609  ASN A OD1  1 
ATOM   4217 N  ND2  . ASN A 1 615 ? 71.065 -43.835 -88.783 1.00 62.39  ? 609  ASN A ND2  1 
ATOM   4218 N  N    . SER A 1 616 ? 68.387 -48.497 -89.620 1.00 59.26  ? 610  SER A N    1 
ATOM   4219 C  CA   . SER A 1 616 ? 68.155 -49.784 -90.262 1.00 57.04  ? 610  SER A CA   1 
ATOM   4220 C  C    . SER A 1 616 ? 68.576 -50.848 -89.258 1.00 55.95  ? 610  SER A C    1 
ATOM   4221 O  O    . SER A 1 616 ? 69.234 -50.551 -88.259 1.00 62.18  ? 610  SER A O    1 
ATOM   4222 C  CB   . SER A 1 616 ? 68.932 -49.947 -91.561 1.00 55.22  ? 610  SER A CB   1 
ATOM   4223 O  OG   . SER A 1 616 ? 70.317 -50.022 -91.293 1.00 60.58  ? 610  SER A OG   1 
ATOM   4224 N  N    . LEU A 1 617 ? 68.204 -52.094 -89.545 1.00 49.19  ? 611  LEU A N    1 
ATOM   4225 C  CA   . LEU A 1 617 ? 68.417 -53.171 -88.588 1.00 52.09  ? 611  LEU A CA   1 
ATOM   4226 C  C    . LEU A 1 617 ? 69.882 -53.276 -88.160 1.00 58.12  ? 611  LEU A C    1 
ATOM   4227 O  O    . LEU A 1 617 ? 70.170 -53.585 -86.997 1.00 60.28  ? 611  LEU A O    1 
ATOM   4228 C  CB   . LEU A 1 617 ? 67.921 -54.487 -89.173 1.00 46.11  ? 611  LEU A CB   1 
ATOM   4229 C  CG   . LEU A 1 617 ? 68.022 -55.719 -88.289 1.00 53.83  ? 611  LEU A CG   1 
ATOM   4230 C  CD1  . LEU A 1 617 ? 67.161 -55.478 -87.062 1.00 59.00  ? 611  LEU A CD1  1 
ATOM   4231 C  CD2  . LEU A 1 617 ? 67.563 -56.967 -88.993 1.00 46.64  ? 611  LEU A CD2  1 
ATOM   4232 N  N    . ASP A 1 618 ? 70.821 -53.048 -89.080 1.00 56.64  ? 612  ASP A N    1 
ATOM   4233 C  CA   . ASP A 1 618 ? 72.248 -53.154 -88.781 1.00 57.58  ? 612  ASP A CA   1 
ATOM   4234 C  C    . ASP A 1 618 ? 72.941 -51.814 -88.520 1.00 57.02  ? 612  ASP A C    1 
ATOM   4235 O  O    . ASP A 1 618 ? 74.173 -51.765 -88.529 1.00 60.43  ? 612  ASP A O    1 
ATOM   4236 C  CB   . ASP A 1 618 ? 72.984 -53.901 -89.889 1.00 56.86  ? 612  ASP A CB   1 
ATOM   4237 C  CG   . ASP A 1 618 ? 73.025 -53.138 -91.167 1.00 66.70  ? 612  ASP A CG   1 
ATOM   4238 O  OD1  . ASP A 1 618 ? 72.331 -52.101 -91.268 1.00 67.65  ? 612  ASP A OD1  1 
ATOM   4239 O  OD2  . ASP A 1 618 ? 73.784 -53.562 -92.066 1.00 79.69  ? 612  ASP A OD2  1 
ATOM   4240 N  N    . GLU A 1 619 ? 72.210 -50.715 -88.404 1.00 53.81  ? 613  GLU A N    1 
ATOM   4241 C  CA   . GLU A 1 619 ? 72.830 -49.417 -88.164 1.00 57.69  ? 613  GLU A CA   1 
ATOM   4242 C  C    . GLU A 1 619 ? 72.067 -48.668 -87.083 1.00 59.66  ? 613  GLU A C    1 
ATOM   4243 O  O    . GLU A 1 619 ? 70.907 -48.301 -87.294 1.00 63.47  ? 613  GLU A O    1 
ATOM   4244 C  CB   . GLU A 1 619 ? 72.868 -48.590 -89.454 1.00 63.31  ? 613  GLU A CB   1 
ATOM   4245 C  CG   . GLU A 1 619 ? 73.358 -47.160 -89.246 1.00 66.40  ? 613  GLU A CG   1 
ATOM   4246 C  CD   . GLU A 1 619 ? 73.379 -46.333 -90.522 1.00 73.33  ? 613  GLU A CD   1 
ATOM   4247 O  OE1  . GLU A 1 619 ? 73.099 -46.883 -91.615 1.00 72.19  ? 613  GLU A OE1  1 
ATOM   4248 O  OE2  . GLU A 1 619 ? 73.648 -45.114 -90.414 1.00 75.54  ? 613  GLU A OE2  1 
ATOM   4249 N  N    . SER A 1 620 ? 72.718 -48.403 -85.946 1.00 56.54  ? 614  SER A N    1 
ATOM   4250 C  CA   . SER A 1 620 ? 72.120 -47.524 -84.947 1.00 58.61  ? 614  SER A CA   1 
ATOM   4251 C  C    . SER A 1 620 ? 73.187 -46.643 -84.313 1.00 53.07  ? 614  SER A C    1 
ATOM   4252 O  O    . SER A 1 620 ? 74.307 -47.085 -84.062 1.00 52.51  ? 614  SER A O    1 
ATOM   4253 C  CB   . SER A 1 620 ? 71.343 -48.305 -83.865 1.00 60.31  ? 614  SER A CB   1 
ATOM   4254 O  OG   . SER A 1 620 ? 72.165 -49.127 -83.060 1.00 70.26  ? 614  SER A OG   1 
ATOM   4255 N  N    . ILE A 1 621 ? 72.823 -45.395 -84.046 1.00 51.69  ? 615  ILE A N    1 
ATOM   4256 C  CA   . ILE A 1 621 ? 73.759 -44.369 -83.623 1.00 49.98  ? 615  ILE A CA   1 
ATOM   4257 C  C    . ILE A 1 621 ? 73.502 -44.053 -82.159 1.00 55.40  ? 615  ILE A C    1 
ATOM   4258 O  O    . ILE A 1 621 ? 72.364 -43.778 -81.760 1.00 60.96  ? 615  ILE A O    1 
ATOM   4259 C  CB   . ILE A 1 621 ? 73.631 -43.122 -84.514 1.00 55.71  ? 615  ILE A CB   1 
ATOM   4260 C  CG1  . ILE A 1 621 ? 74.029 -43.492 -85.944 1.00 47.84  ? 615  ILE A CG1  1 
ATOM   4261 C  CG2  . ILE A 1 621 ? 74.516 -41.977 -84.006 1.00 53.56  ? 615  ILE A CG2  1 
ATOM   4262 C  CD1  . ILE A 1 621 ? 73.750 -42.436 -86.907 1.00 55.86  ? 615  ILE A CD1  1 
ATOM   4263 N  N    . LEU A 1 622 ? 74.551 -44.120 -81.352 1.00 54.65  ? 616  LEU A N    1 
ATOM   4264 C  CA   . LEU A 1 622 ? 74.394 -43.896 -79.929 1.00 48.48  ? 616  LEU A CA   1 
ATOM   4265 C  C    . LEU A 1 622 ? 74.064 -42.431 -79.680 1.00 55.58  ? 616  LEU A C    1 
ATOM   4266 O  O    . LEU A 1 622 ? 74.753 -41.539 -80.181 1.00 55.54  ? 616  LEU A O    1 
ATOM   4267 C  CB   . LEU A 1 622 ? 75.669 -44.295 -79.192 1.00 51.49  ? 616  LEU A CB   1 
ATOM   4268 C  CG   . LEU A 1 622 ? 75.673 -44.109 -77.666 1.00 51.41  ? 616  LEU A CG   1 
ATOM   4269 C  CD1  . LEU A 1 622 ? 74.598 -44.978 -77.067 1.00 52.33  ? 616  LEU A CD1  1 
ATOM   4270 C  CD2  . LEU A 1 622 ? 77.022 -44.435 -77.068 1.00 47.22  ? 616  LEU A CD2  1 
ATOM   4271 N  N    . LEU A 1 623 ? 73.009 -42.177 -78.901 1.00 57.95  ? 617  LEU A N    1 
ATOM   4272 C  CA   . LEU A 1 623 ? 72.654 -40.804 -78.552 1.00 53.12  ? 617  LEU A CA   1 
ATOM   4273 C  C    . LEU A 1 623 ? 73.382 -40.366 -77.291 1.00 52.04  ? 617  LEU A C    1 
ATOM   4274 O  O    . LEU A 1 623 ? 74.117 -39.376 -77.315 1.00 58.52  ? 617  LEU A O    1 
ATOM   4275 C  CB   . LEU A 1 623 ? 71.135 -40.634 -78.438 1.00 51.71  ? 617  LEU A CB   1 
ATOM   4276 C  CG   . LEU A 1 623 ? 70.504 -40.910 -79.825 1.00 62.64  ? 617  LEU A CG   1 
ATOM   4277 C  CD1  . LEU A 1 623 ? 68.981 -40.756 -79.870 1.00 59.77  ? 617  LEU A CD1  1 
ATOM   4278 C  CD2  . LEU A 1 623 ? 71.186 -40.114 -80.959 1.00 56.25  ? 617  LEU A CD2  1 
ATOM   4279 N  N    . LYS A 1 624 ? 73.178 -41.066 -76.179 1.00 56.09  ? 618  LYS A N    1 
ATOM   4280 C  CA   . LYS A 1 624 ? 73.951 -40.763 -74.978 1.00 59.10  ? 618  LYS A CA   1 
ATOM   4281 C  C    . LYS A 1 624 ? 74.243 -42.036 -74.190 1.00 56.38  ? 618  LYS A C    1 
ATOM   4282 O  O    . LYS A 1 624 ? 73.377 -42.903 -74.057 1.00 55.67  ? 618  LYS A O    1 
ATOM   4283 C  CB   . LYS A 1 624 ? 73.227 -39.725 -74.106 1.00 56.30  ? 618  LYS A CB   1 
ATOM   4284 C  CG   . LYS A 1 624 ? 73.966 -39.419 -72.809 1.00 68.14  ? 618  LYS A CG   1 
ATOM   4285 C  CD   . LYS A 1 624 ? 73.290 -38.351 -71.963 1.00 66.87  ? 618  LYS A CD   1 
ATOM   4286 C  CE   . LYS A 1 624 ? 73.470 -36.997 -72.595 1.00 76.81  ? 618  LYS A CE   1 
ATOM   4287 N  NZ   . LYS A 1 624 ? 74.929 -36.663 -72.648 1.00 85.26  ? 618  LYS A NZ   1 
ATOM   4288 N  N    . TRP A 1 625 ? 75.472 -42.165 -73.685 1.00 55.66  ? 619  TRP A N    1 
ATOM   4289 C  CA   . TRP A 1 625 ? 75.748 -43.247 -72.751 1.00 55.57  ? 619  TRP A CA   1 
ATOM   4290 C  C    . TRP A 1 625 ? 74.895 -43.068 -71.506 1.00 57.78  ? 619  TRP A C    1 
ATOM   4291 O  O    . TRP A 1 625 ? 74.676 -41.943 -71.048 1.00 59.36  ? 619  TRP A O    1 
ATOM   4292 C  CB   . TRP A 1 625 ? 77.213 -43.304 -72.310 1.00 53.45  ? 619  TRP A CB   1 
ATOM   4293 C  CG   . TRP A 1 625 ? 78.253 -43.902 -73.234 1.00 53.12  ? 619  TRP A CG   1 
ATOM   4294 C  CD1  . TRP A 1 625 ? 79.369 -43.290 -73.718 1.00 55.27  ? 619  TRP A CD1  1 
ATOM   4295 C  CD2  . TRP A 1 625 ? 78.245 -45.215 -73.807 1.00 46.23  ? 619  TRP A CD2  1 
ATOM   4296 N  NE1  . TRP A 1 625 ? 80.086 -44.157 -74.509 1.00 49.72  ? 619  TRP A NE1  1 
ATOM   4297 C  CE2  . TRP A 1 625 ? 79.409 -45.343 -74.578 1.00 45.83  ? 619  TRP A CE2  1 
ATOM   4298 C  CE3  . TRP A 1 625 ? 77.379 -46.300 -73.724 1.00 48.62  ? 619  TRP A CE3  1 
ATOM   4299 C  CZ2  . TRP A 1 625 ? 79.726 -46.507 -75.251 1.00 51.67  ? 619  TRP A CZ2  1 
ATOM   4300 C  CZ3  . TRP A 1 625 ? 77.700 -47.459 -74.399 1.00 47.14  ? 619  TRP A CZ3  1 
ATOM   4301 C  CH2  . TRP A 1 625 ? 78.861 -47.554 -75.144 1.00 50.28  ? 619  TRP A CH2  1 
ATOM   4302 N  N    . THR A 1 626 ? 74.437 -44.187 -70.944 1.00 54.19  ? 620  THR A N    1 
ATOM   4303 C  CA   . THR A 1 626 ? 73.652 -44.188 -69.720 1.00 52.29  ? 620  THR A CA   1 
ATOM   4304 C  C    . THR A 1 626 ? 74.147 -45.331 -68.839 1.00 58.13  ? 620  THR A C    1 
ATOM   4305 O  O    . THR A 1 626 ? 75.089 -46.050 -69.194 1.00 59.26  ? 620  THR A O    1 
ATOM   4306 C  CB   . THR A 1 626 ? 72.159 -44.312 -70.030 1.00 54.56  ? 620  THR A CB   1 
ATOM   4307 O  OG1  . THR A 1 626 ? 71.900 -45.579 -70.660 1.00 56.13  ? 620  THR A OG1  1 
ATOM   4308 C  CG2  . THR A 1 626 ? 71.710 -43.160 -70.958 1.00 49.89  ? 620  THR A CG2  1 
ATOM   4309 N  N    . LYS A 1 627 ? 73.510 -45.503 -67.680 1.00 54.59  ? 621  LYS A N    1 
ATOM   4310 C  CA   . LYS A 1 627 ? 73.883 -46.551 -66.708 1.00 53.30  ? 621  LYS A CA   1 
ATOM   4311 C  C    . LYS A 1 627 ? 75.345 -46.330 -66.325 1.00 54.10  ? 621  LYS A C    1 
ATOM   4312 O  O    . LYS A 1 627 ? 75.732 -45.199 -65.987 1.00 58.18  ? 621  LYS A O    1 
ATOM   4313 C  CB   . LYS A 1 627 ? 73.560 -47.914 -67.290 1.00 50.43  ? 621  LYS A CB   1 
ATOM   4314 C  CG   . LYS A 1 627 ? 72.082 -48.034 -67.670 1.00 54.96  ? 621  LYS A CG   1 
ATOM   4315 C  CD   . LYS A 1 627 ? 71.771 -49.422 -68.220 1.00 67.80  ? 621  LYS A CD   1 
ATOM   4316 C  CE   . LYS A 1 627 ? 70.288 -49.621 -68.572 1.00 61.14  ? 621  LYS A CE   1 
ATOM   4317 N  NZ   . LYS A 1 627 ? 69.915 -49.089 -69.894 1.00 55.24  ? 621  LYS A NZ   1 
ATOM   4318 N  N    . GLY A 1 628 ? 76.196 -47.350 -66.359 1.00 53.60  ? 622  GLY A N    1 
ATOM   4319 C  CA   . GLY A 1 628 ? 77.563 -47.136 -65.908 1.00 58.68  ? 622  GLY A CA   1 
ATOM   4320 C  C    . GLY A 1 628 ? 78.480 -46.393 -66.867 1.00 61.41  ? 622  GLY A C    1 
ATOM   4321 O  O    . GLY A 1 628 ? 79.478 -45.818 -66.414 1.00 59.37  ? 622  GLY A O    1 
ATOM   4322 N  N    . PHE A 1 629 ? 78.163 -46.367 -68.172 1.00 61.83  ? 623  PHE A N    1 
ATOM   4323 C  CA   . PHE A 1 629 ? 79.169 -46.082 -69.190 1.00 56.97  ? 623  PHE A CA   1 
ATOM   4324 C  C    . PHE A 1 629 ? 79.289 -44.589 -69.436 1.00 58.92  ? 623  PHE A C    1 
ATOM   4325 O  O    . PHE A 1 629 ? 78.280 -43.909 -69.631 1.00 61.56  ? 623  PHE A O    1 
ATOM   4326 C  CB   . PHE A 1 629 ? 78.892 -46.753 -70.539 1.00 50.28  ? 623  PHE A CB   1 
ATOM   4327 C  CG   . PHE A 1 629 ? 78.584 -48.216 -70.468 1.00 53.36  ? 623  PHE A CG   1 
ATOM   4328 C  CD1  . PHE A 1 629 ? 77.719 -48.738 -69.537 1.00 56.88  ? 623  PHE A CD1  1 
ATOM   4329 C  CD2  . PHE A 1 629 ? 79.369 -49.102 -71.182 1.00 54.74  ? 623  PHE A CD2  1 
ATOM   4330 C  CE1  . PHE A 1 629 ? 77.498 -50.104 -69.466 1.00 54.44  ? 623  PHE A CE1  1 
ATOM   4331 C  CE2  . PHE A 1 629 ? 79.183 -50.472 -71.086 1.00 55.89  ? 623  PHE A CE2  1 
ATOM   4332 C  CZ   . PHE A 1 629 ? 78.251 -50.967 -70.224 1.00 56.30  ? 623  PHE A CZ   1 
ATOM   4333 N  N    . LYS A 1 630 ? 80.519 -44.076 -69.385 1.00 59.95  ? 624  LYS A N    1 
ATOM   4334 C  CA   . LYS A 1 630 ? 80.890 -42.883 -70.142 1.00 60.59  ? 624  LYS A CA   1 
ATOM   4335 C  C    . LYS A 1 630 ? 82.209 -43.197 -70.845 1.00 60.02  ? 624  LYS A C    1 
ATOM   4336 O  O    . LYS A 1 630 ? 83.279 -43.044 -70.254 1.00 68.35  ? 624  LYS A O    1 
ATOM   4337 C  CB   . LYS A 1 630 ? 81.004 -41.656 -69.230 1.00 52.47  ? 624  LYS A CB   1 
ATOM   4338 N  N    . ALA A 1 631 ? 82.145 -43.500 -72.139 1.00 56.32  ? 625  ALA A N    1 
ATOM   4339 C  CA   . ALA A 1 631 ? 83.318 -43.829 -72.942 1.00 54.07  ? 625  ALA A CA   1 
ATOM   4340 C  C    . ALA A 1 631 ? 83.368 -42.868 -74.121 1.00 56.35  ? 625  ALA A C    1 
ATOM   4341 O  O    . ALA A 1 631 ? 82.346 -42.623 -74.772 1.00 55.28  ? 625  ALA A O    1 
ATOM   4342 C  CB   . ALA A 1 631 ? 83.282 -45.280 -73.434 1.00 49.98  ? 625  ALA A CB   1 
ATOM   4343 N  N    . SER A 1 632 ? 84.551 -42.317 -74.380 1.00 51.22  ? 626  SER A N    1 
ATOM   4344 C  CA   . SER A 1 632 ? 84.694 -41.197 -75.294 1.00 51.31  ? 626  SER A CA   1 
ATOM   4345 C  C    . SER A 1 632 ? 84.735 -41.657 -76.753 1.00 56.83  ? 626  SER A C    1 
ATOM   4346 O  O    . SER A 1 632 ? 85.107 -42.791 -77.063 1.00 57.70  ? 626  SER A O    1 
ATOM   4347 C  CB   . SER A 1 632 ? 85.947 -40.403 -74.935 1.00 44.66  ? 626  SER A CB   1 
ATOM   4348 O  OG   . SER A 1 632 ? 87.098 -41.215 -75.024 1.00 49.64  ? 626  SER A OG   1 
ATOM   4349 N  N    . GLY A 1 633 ? 84.332 -40.761 -77.650 1.00 55.55  ? 627  GLY A N    1 
ATOM   4350 C  CA   . GLY A 1 633 ? 84.341 -41.078 -79.062 1.00 49.99  ? 627  GLY A CA   1 
ATOM   4351 C  C    . GLY A 1 633 ? 83.352 -42.143 -79.466 1.00 55.40  ? 627  GLY A C    1 
ATOM   4352 O  O    . GLY A 1 633 ? 83.636 -42.934 -80.370 1.00 57.28  ? 627  GLY A O    1 
ATOM   4353 N  N    . CYS A 1 634 ? 82.189 -42.181 -78.823 1.00 55.53  ? 628  CYS A N    1 
ATOM   4354 C  CA   . CYS A 1 634 ? 81.131 -43.142 -79.122 1.00 49.59  ? 628  CYS A CA   1 
ATOM   4355 C  C    . CYS A 1 634 ? 79.816 -42.422 -79.369 1.00 49.67  ? 628  CYS A C    1 
ATOM   4356 O  O    . CYS A 1 634 ? 79.161 -42.680 -80.372 1.00 55.46  ? 628  CYS A O    1 
ATOM   4357 C  CB   . CYS A 1 634 ? 80.971 -44.179 -78.008 1.00 53.25  ? 628  CYS A CB   1 
ATOM   4358 S  SG   . CYS A 1 634 ? 82.407 -45.216 -77.699 1.00 57.68  ? 628  CYS A SG   1 
ATOM   4359 N  N    . GLU A 1 635 ? 79.354 -41.605 -78.432 1.00 57.94  ? 629  GLU A N    1 
ATOM   4360 C  CA   . GLU A 1 635 ? 78.122 -40.866 -78.656 1.00 55.04  ? 629  GLU A CA   1 
ATOM   4361 C  C    . GLU A 1 635 ? 78.206 -40.158 -79.990 1.00 51.88  ? 629  GLU A C    1 
ATOM   4362 O  O    . GLU A 1 635 ? 79.221 -39.540 -80.312 1.00 54.52  ? 629  GLU A O    1 
ATOM   4363 C  CB   . GLU A 1 635 ? 77.890 -39.850 -77.538 1.00 54.83  ? 629  GLU A CB   1 
ATOM   4364 C  CG   . GLU A 1 635 ? 77.690 -40.452 -76.184 1.00 53.58  ? 629  GLU A CG   1 
ATOM   4365 C  CD   . GLU A 1 635 ? 77.530 -39.388 -75.137 1.00 62.34  ? 629  GLU A CD   1 
ATOM   4366 O  OE1  . GLU A 1 635 ? 77.732 -38.208 -75.498 1.00 63.71  ? 629  GLU A OE1  1 
ATOM   4367 O  OE2  . GLU A 1 635 ? 77.215 -39.721 -73.966 1.00 63.81  ? 629  GLU A OE2  1 
ATOM   4368 N  N    . GLY A 1 636 ? 77.136 -40.266 -80.767 1.00 55.80  ? 630  GLY A N    1 
ATOM   4369 C  CA   . GLY A 1 636 ? 77.090 -39.736 -82.113 1.00 54.38  ? 630  GLY A CA   1 
ATOM   4370 C  C    . GLY A 1 636 ? 77.608 -40.655 -83.201 1.00 53.07  ? 630  GLY A C    1 
ATOM   4371 O  O    . GLY A 1 636 ? 77.658 -40.232 -84.356 1.00 52.23  ? 630  GLY A O    1 
ATOM   4372 N  N    . GLU A 1 637 ? 77.993 -41.892 -82.870 1.00 53.01  ? 631  GLU A N    1 
ATOM   4373 C  CA   . GLU A 1 637 ? 78.661 -42.808 -83.783 1.00 51.65  ? 631  GLU A CA   1 
ATOM   4374 C  C    . GLU A 1 637 ? 77.812 -44.043 -84.050 1.00 55.55  ? 631  GLU A C    1 
ATOM   4375 O  O    . GLU A 1 637 ? 77.096 -44.519 -83.168 1.00 51.19  ? 631  GLU A O    1 
ATOM   4376 C  CB   . GLU A 1 637 ? 80.009 -43.249 -83.228 1.00 50.17  ? 631  GLU A CB   1 
ATOM   4377 C  CG   . GLU A 1 637 ? 81.038 -42.154 -83.241 1.00 55.01  ? 631  GLU A CG   1 
ATOM   4378 C  CD   . GLU A 1 637 ? 81.242 -41.595 -84.648 1.00 61.62  ? 631  GLU A CD   1 
ATOM   4379 O  OE1  . GLU A 1 637 ? 81.159 -42.376 -85.636 1.00 65.65  ? 631  GLU A OE1  1 
ATOM   4380 O  OE2  . GLU A 1 637 ? 81.499 -40.382 -84.762 1.00 59.32  ? 631  GLU A OE2  1 
ATOM   4381 N  N    . ASP A 1 638 ? 77.880 -44.566 -85.281 1.00 57.79  ? 632  ASP A N    1 
ATOM   4382 C  CA   . ASP A 1 638 ? 77.258 -45.863 -85.522 1.00 55.56  ? 632  ASP A CA   1 
ATOM   4383 C  C    . ASP A 1 638 ? 77.912 -46.908 -84.629 1.00 56.91  ? 632  ASP A C    1 
ATOM   4384 O  O    . ASP A 1 638 ? 79.137 -47.061 -84.622 1.00 60.21  ? 632  ASP A O    1 
ATOM   4385 C  CB   . ASP A 1 638 ? 77.368 -46.279 -86.980 1.00 50.72  ? 632  ASP A CB   1 
ATOM   4386 C  CG   . ASP A 1 638 ? 76.747 -47.639 -87.253 1.00 56.56  ? 632  ASP A CG   1 
ATOM   4387 O  OD1  . ASP A 1 638 ? 76.207 -48.260 -86.320 1.00 57.48  ? 632  ASP A OD1  1 
ATOM   4388 O  OD2  . ASP A 1 638 ? 76.802 -48.108 -88.409 1.00 60.72  ? 632  ASP A OD2  1 
ATOM   4389 N  N    . VAL A 1 639 ? 77.085 -47.631 -83.873 1.00 53.53  ? 633  VAL A N    1 
ATOM   4390 C  CA   . VAL A 1 639 ? 77.626 -48.602 -82.935 1.00 55.71  ? 633  VAL A CA   1 
ATOM   4391 C  C    . VAL A 1 639 ? 78.117 -49.846 -83.645 1.00 57.12  ? 633  VAL A C    1 
ATOM   4392 O  O    . VAL A 1 639 ? 79.052 -50.506 -83.172 1.00 55.44  ? 633  VAL A O    1 
ATOM   4393 C  CB   . VAL A 1 639 ? 76.590 -48.942 -81.863 1.00 55.52  ? 633  VAL A CB   1 
ATOM   4394 C  CG1  . VAL A 1 639 ? 77.006 -50.201 -81.163 1.00 59.47  ? 633  VAL A CG1  1 
ATOM   4395 C  CG2  . VAL A 1 639 ? 76.555 -47.809 -80.867 1.00 56.83  ? 633  VAL A CG2  1 
ATOM   4396 N  N    . VAL A 1 640 ? 77.517 -50.198 -84.781 1.00 54.46  ? 634  VAL A N    1 
ATOM   4397 C  CA   . VAL A 1 640 ? 77.976 -51.401 -85.459 1.00 56.13  ? 634  VAL A CA   1 
ATOM   4398 C  C    . VAL A 1 640 ? 79.358 -51.160 -86.057 1.00 59.08  ? 634  VAL A C    1 
ATOM   4399 O  O    . VAL A 1 640 ? 80.246 -52.020 -85.978 1.00 59.41  ? 634  VAL A O    1 
ATOM   4400 C  CB   . VAL A 1 640 ? 76.942 -51.854 -86.504 1.00 57.05  ? 634  VAL A CB   1 
ATOM   4401 C  CG1  . VAL A 1 640 ? 77.441 -53.082 -87.246 1.00 58.83  ? 634  VAL A CG1  1 
ATOM   4402 C  CG2  . VAL A 1 640 ? 75.615 -52.150 -85.830 1.00 50.55  ? 634  VAL A CG2  1 
ATOM   4403 N  N    . THR A 1 641 ? 79.583 -49.967 -86.612 1.00 57.89  ? 635  THR A N    1 
ATOM   4404 C  CA   . THR A 1 641 ? 80.907 -49.637 -87.126 1.00 56.05  ? 635  THR A CA   1 
ATOM   4405 C  C    . THR A 1 641 ? 81.952 -49.686 -86.018 1.00 57.95  ? 635  THR A C    1 
ATOM   4406 O  O    . THR A 1 641 ? 83.013 -50.298 -86.180 1.00 59.49  ? 635  THR A O    1 
ATOM   4407 C  CB   . THR A 1 641 ? 80.895 -48.260 -87.790 1.00 57.46  ? 635  THR A CB   1 
ATOM   4408 O  OG1  . THR A 1 641 ? 79.994 -48.271 -88.906 1.00 58.35  ? 635  THR A OG1  1 
ATOM   4409 C  CG2  . THR A 1 641 ? 82.293 -47.893 -88.271 1.00 51.03  ? 635  THR A CG2  1 
ATOM   4410 N  N    . LEU A 1 642 ? 81.681 -49.034 -84.884 1.00 56.61  ? 636  LEU A N    1 
ATOM   4411 C  CA   . LEU A 1 642 ? 82.635 -49.084 -83.781 1.00 58.15  ? 636  LEU A CA   1 
ATOM   4412 C  C    . LEU A 1 642 ? 82.969 -50.523 -83.408 1.00 57.99  ? 636  LEU A C    1 
ATOM   4413 O  O    . LEU A 1 642 ? 84.124 -50.845 -83.120 1.00 58.98  ? 636  LEU A O    1 
ATOM   4414 C  CB   . LEU A 1 642 ? 82.095 -48.325 -82.567 1.00 55.77  ? 636  LEU A CB   1 
ATOM   4415 C  CG   . LEU A 1 642 ? 81.931 -46.805 -82.705 1.00 54.99  ? 636  LEU A CG   1 
ATOM   4416 C  CD1  . LEU A 1 642 ? 81.317 -46.225 -81.443 1.00 55.75  ? 636  LEU A CD1  1 
ATOM   4417 C  CD2  . LEU A 1 642 ? 83.259 -46.123 -83.018 1.00 52.95  ? 636  LEU A CD2  1 
ATOM   4418 N  N    . LEU A 1 643 ? 81.977 -51.411 -83.434 1.00 57.59  ? 637  LEU A N    1 
ATOM   4419 C  CA   . LEU A 1 643 ? 82.248 -52.815 -83.147 1.00 57.13  ? 637  LEU A CA   1 
ATOM   4420 C  C    . LEU A 1 643 ? 83.033 -53.469 -84.278 1.00 57.85  ? 637  LEU A C    1 
ATOM   4421 O  O    . LEU A 1 643 ? 84.034 -54.150 -84.031 1.00 57.74  ? 637  LEU A O    1 
ATOM   4422 C  CB   . LEU A 1 643 ? 80.942 -53.572 -82.896 1.00 59.00  ? 637  LEU A CB   1 
ATOM   4423 C  CG   . LEU A 1 643 ? 81.100 -55.072 -82.594 1.00 59.50  ? 637  LEU A CG   1 
ATOM   4424 C  CD1  . LEU A 1 643 ? 81.758 -55.321 -81.216 1.00 51.65  ? 637  LEU A CD1  1 
ATOM   4425 C  CD2  . LEU A 1 643 ? 79.784 -55.820 -82.740 1.00 56.72  ? 637  LEU A CD2  1 
ATOM   4426 N  N    . LYS A 1 644 ? 82.589 -53.284 -85.530 1.00 58.08  ? 638  LYS A N    1 
ATOM   4427 C  CA   . LYS A 1 644 ? 83.309 -53.855 -86.673 1.00 57.18  ? 638  LYS A CA   1 
ATOM   4428 C  C    . LYS A 1 644 ? 84.781 -53.435 -86.687 1.00 61.12  ? 638  LYS A C    1 
ATOM   4429 O  O    . LYS A 1 644 ? 85.679 -54.268 -86.854 1.00 63.79  ? 638  LYS A O    1 
ATOM   4430 C  CB   . LYS A 1 644 ? 82.622 -53.463 -87.982 1.00 51.57  ? 638  LYS A CB   1 
ATOM   4431 C  CG   . LYS A 1 644 ? 81.327 -54.209 -88.285 1.00 53.14  ? 638  LYS A CG   1 
ATOM   4432 C  CD   . LYS A 1 644 ? 80.673 -53.726 -89.603 1.00 59.97  ? 638  LYS A CD   1 
ATOM   4433 C  CE   . LYS A 1 644 ? 79.510 -54.650 -90.051 1.00 66.45  ? 638  LYS A CE   1 
ATOM   4434 N  NZ   . LYS A 1 644 ? 78.719 -54.208 -91.244 1.00 48.73  ? 638  LYS A NZ   1 
ATOM   4435 N  N    . GLU A 1 645 ? 85.051 -52.146 -86.492 1.00 59.91  ? 639  GLU A N    1 
ATOM   4436 C  CA   . GLU A 1 645 ? 86.434 -51.686 -86.462 1.00 56.61  ? 639  GLU A CA   1 
ATOM   4437 C  C    . GLU A 1 645 ? 87.236 -52.400 -85.383 1.00 60.26  ? 639  GLU A C    1 
ATOM   4438 O  O    . GLU A 1 645 ? 88.422 -52.678 -85.571 1.00 65.55  ? 639  GLU A O    1 
ATOM   4439 C  CB   . GLU A 1 645 ? 86.477 -50.184 -86.232 1.00 53.85  ? 639  GLU A CB   1 
ATOM   4440 C  CG   . GLU A 1 645 ? 85.747 -49.387 -87.267 1.00 45.41  ? 639  GLU A CG   1 
ATOM   4441 C  CD   . GLU A 1 645 ? 85.775 -47.925 -86.949 1.00 53.95  ? 639  GLU A CD   1 
ATOM   4442 O  OE1  . GLU A 1 645 ? 86.234 -47.592 -85.831 1.00 64.85  ? 639  GLU A OE1  1 
ATOM   4443 O  OE2  . GLU A 1 645 ? 85.340 -47.107 -87.792 1.00 57.63  ? 639  GLU A OE2  1 
ATOM   4444 N  N    . ALA A 1 646 ? 86.619 -52.683 -84.231 1.00 62.24  ? 640  ALA A N    1 
ATOM   4445 C  CA   . ALA A 1 646 ? 87.343 -53.367 -83.158 1.00 61.15  ? 640  ALA A CA   1 
ATOM   4446 C  C    . ALA A 1 646 ? 87.585 -54.838 -83.481 1.00 66.01  ? 640  ALA A C    1 
ATOM   4447 O  O    . ALA A 1 646 ? 88.542 -55.427 -82.962 1.00 66.21  ? 640  ALA A O    1 
ATOM   4448 C  CB   . ALA A 1 646 ? 86.593 -53.237 -81.830 1.00 51.00  ? 640  ALA A CB   1 
ATOM   4449 N  N    . ILE A 1 647 ? 86.744 -55.437 -84.328 1.00 63.31  ? 641  ILE A N    1 
ATOM   4450 C  CA   . ILE A 1 647 ? 86.957 -56.812 -84.759 1.00 63.75  ? 641  ILE A CA   1 
ATOM   4451 C  C    . ILE A 1 647 ? 88.114 -56.887 -85.739 1.00 67.26  ? 641  ILE A C    1 
ATOM   4452 O  O    . ILE A 1 647 ? 88.932 -57.810 -85.680 1.00 68.42  ? 641  ILE A O    1 
ATOM   4453 C  CB   . ILE A 1 647 ? 85.659 -57.382 -85.359 1.00 63.20  ? 641  ILE A CB   1 
ATOM   4454 C  CG1  . ILE A 1 647 ? 84.596 -57.532 -84.268 1.00 61.76  ? 641  ILE A CG1  1 
ATOM   4455 C  CG2  . ILE A 1 647 ? 85.915 -58.702 -86.038 1.00 55.38  ? 641  ILE A CG2  1 
ATOM   4456 C  CD1  . ILE A 1 647 ? 83.222 -57.851 -84.801 1.00 59.84  ? 641  ILE A CD1  1 
ATOM   4457 N  N    . HIS A 1 648 ? 88.211 -55.916 -86.651 1.00 70.61  ? 642  HIS A N    1 
ATOM   4458 C  CA   . HIS A 1 648 ? 89.325 -55.918 -87.596 1.00 69.32  ? 642  HIS A CA   1 
ATOM   4459 C  C    . HIS A 1 648 ? 90.666 -55.675 -86.898 1.00 68.51  ? 642  HIS A C    1 
ATOM   4460 O  O    . HIS A 1 648 ? 91.664 -56.317 -87.240 1.00 68.31  ? 642  HIS A O    1 
ATOM   4461 C  CB   . HIS A 1 648 ? 89.076 -54.897 -88.706 1.00 66.68  ? 642  HIS A CB   1 
ATOM   4462 C  CG   . HIS A 1 648 ? 87.999 -55.303 -89.670 1.00 80.94  ? 642  HIS A CG   1 
ATOM   4463 N  ND1  . HIS A 1 648 ? 86.653 -55.157 -89.398 1.00 79.64  ? 642  HIS A ND1  1 
ATOM   4464 C  CD2  . HIS A 1 648 ? 88.072 -55.844 -90.912 1.00 88.36  ? 642  HIS A CD2  1 
ATOM   4465 C  CE1  . HIS A 1 648 ? 85.943 -55.593 -90.426 1.00 75.32  ? 642  HIS A CE1  1 
ATOM   4466 N  NE2  . HIS A 1 648 ? 86.781 -56.015 -91.358 1.00 88.52  ? 642  HIS A NE2  1 
ATOM   4467 N  N    . ARG A 1 649 ? 90.716 -54.779 -85.904 1.00 64.15  ? 643  ARG A N    1 
ATOM   4468 C  CA   . ARG A 1 649 ? 91.979 -54.552 -85.203 1.00 63.11  ? 643  ARG A CA   1 
ATOM   4469 C  C    . ARG A 1 649 ? 92.483 -55.814 -84.516 1.00 68.65  ? 643  ARG A C    1 
ATOM   4470 O  O    . ARG A 1 649 ? 93.679 -55.917 -84.224 1.00 71.20  ? 643  ARG A O    1 
ATOM   4471 C  CB   . ARG A 1 649 ? 91.843 -53.441 -84.165 1.00 58.63  ? 643  ARG A CB   1 
ATOM   4472 C  CG   . ARG A 1 649 ? 91.582 -52.060 -84.712 1.00 62.96  ? 643  ARG A CG   1 
ATOM   4473 C  CD   . ARG A 1 649 ? 91.765 -50.995 -83.626 1.00 70.27  ? 643  ARG A CD   1 
ATOM   4474 N  NE   . ARG A 1 649 ? 90.784 -51.078 -82.538 1.00 63.60  ? 643  ARG A NE   1 
ATOM   4475 C  CZ   . ARG A 1 649 ? 89.592 -50.485 -82.564 1.00 62.37  ? 643  ARG A CZ   1 
ATOM   4476 N  NH1  . ARG A 1 649 ? 89.220 -49.777 -83.625 1.00 65.57  ? 643  ARG A NH1  1 
ATOM   4477 N  NH2  . ARG A 1 649 ? 88.763 -50.605 -81.539 1.00 58.64  ? 643  ARG A NH2  1 
ATOM   4478 N  N    . ARG A 1 650 ? 91.583 -56.755 -84.228 1.00 72.95  ? 644  ARG A N    1 
ATOM   4479 C  CA   . ARG A 1 650 ? 91.919 -58.035 -83.608 1.00 70.76  ? 644  ARG A CA   1 
ATOM   4480 C  C    . ARG A 1 650 ? 92.474 -59.033 -84.611 1.00 74.00  ? 644  ARG A C    1 
ATOM   4481 O  O    . ARG A 1 650 ? 93.236 -59.919 -84.216 1.00 77.85  ? 644  ARG A O    1 
ATOM   4482 C  CB   . ARG A 1 650 ? 90.671 -58.595 -82.917 1.00 71.96  ? 644  ARG A CB   1 
ATOM   4483 C  CG   . ARG A 1 650 ? 90.699 -60.055 -82.506 1.00 77.83  ? 644  ARG A CG   1 
ATOM   4484 C  CD   . ARG A 1 650 ? 91.614 -60.422 -81.349 1.00 81.18  ? 644  ARG A CD   1 
ATOM   4485 N  NE   . ARG A 1 650 ? 91.195 -59.897 -80.054 1.00 74.06  ? 644  ARG A NE   1 
ATOM   4486 C  CZ   . ARG A 1 650 ? 91.804 -60.201 -78.911 1.00 76.22  ? 644  ARG A CZ   1 
ATOM   4487 N  NH1  . ARG A 1 650 ? 92.817 -61.053 -78.904 1.00 82.52  ? 644  ARG A NH1  1 
ATOM   4488 N  NH2  . ARG A 1 650 ? 91.389 -59.682 -77.770 1.00 81.69  ? 644  ARG A NH2  1 
ATOM   4489 N  N    . GLU A 1 651 ? 92.082 -58.924 -85.893 1.00 73.58  ? 645  GLU A N    1 
ATOM   4490 C  CA   . GLU A 1 651 ? 92.696 -59.677 -86.995 1.00 72.16  ? 645  GLU A CA   1 
ATOM   4491 C  C    . GLU A 1 651 ? 92.615 -61.194 -86.785 1.00 75.76  ? 645  GLU A C    1 
ATOM   4492 O  O    . GLU A 1 651 ? 93.528 -61.936 -87.158 1.00 77.51  ? 645  GLU A O    1 
ATOM   4493 C  CB   . GLU A 1 651 ? 94.158 -59.248 -87.216 1.00 71.88  ? 645  GLU A CB   1 
ATOM   4494 C  CG   . GLU A 1 651 ? 94.468 -57.883 -87.917 1.00 70.81  ? 645  GLU A CG   1 
ATOM   4495 C  CD   . GLU A 1 651 ? 94.083 -57.822 -89.416 1.00 79.90  ? 645  GLU A CD   1 
ATOM   4496 O  OE1  . GLU A 1 651 ? 94.078 -58.868 -90.116 1.00 75.46  ? 645  GLU A OE1  1 
ATOM   4497 O  OE2  . GLU A 1 651 ? 93.855 -56.700 -89.918 1.00 82.60  ? 645  GLU A OE2  1 
ATOM   4498 N  N    . GLU A 1 652 ? 91.518 -61.675 -86.196 1.00 75.26  ? 646  GLU A N    1 
ATOM   4499 C  CA   . GLU A 1 652 ? 91.331 -63.107 -85.966 1.00 73.11  ? 646  GLU A CA   1 
ATOM   4500 C  C    . GLU A 1 652 ? 90.161 -63.626 -86.795 1.00 75.60  ? 646  GLU A C    1 
ATOM   4501 O  O    . GLU A 1 652 ? 90.368 -64.286 -87.813 1.00 89.66  ? 646  GLU A O    1 
ATOM   4502 C  CB   . GLU A 1 652 ? 91.113 -63.431 -84.481 1.00 74.89  ? 646  GLU A CB   1 
ATOM   4503 C  CG   . GLU A 1 652 ? 92.257 -63.093 -83.525 1.00 75.51  ? 646  GLU A CG   1 
ATOM   4504 C  CD   . GLU A 1 652 ? 91.904 -63.399 -82.056 1.00 83.58  ? 646  GLU A CD   1 
ATOM   4505 O  OE1  . GLU A 1 652 ? 90.757 -63.817 -81.792 1.00 82.93  ? 646  GLU A OE1  1 
ATOM   4506 O  OE2  . GLU A 1 652 ? 92.749 -63.186 -81.153 1.00 84.50  ? 646  GLU A OE2  1 
ATOM   4507 N  N    . PHE A 1 653 ? 88.934 -63.313 -86.413 1.00 73.74  ? 647  PHE A N    1 
ATOM   4508 C  CA   . PHE A 1 653 ? 87.753 -63.969 -86.951 1.00 80.48  ? 647  PHE A CA   1 
ATOM   4509 C  C    . PHE A 1 653 ? 86.960 -63.018 -87.830 1.00 79.63  ? 647  PHE A C    1 
ATOM   4510 O  O    . PHE A 1 653 ? 87.066 -61.797 -87.702 1.00 81.20  ? 647  PHE A O    1 
ATOM   4511 C  CB   . PHE A 1 653 ? 86.876 -64.507 -85.812 1.00 85.36  ? 647  PHE A CB   1 
ATOM   4512 C  CG   . PHE A 1 653 ? 86.670 -63.517 -84.686 1.00 84.51  ? 647  PHE A CG   1 
ATOM   4513 C  CD1  . PHE A 1 653 ? 85.638 -62.598 -84.722 1.00 82.48  ? 647  PHE A CD1  1 
ATOM   4514 C  CD2  . PHE A 1 653 ? 87.528 -63.505 -83.598 1.00 78.89  ? 647  PHE A CD2  1 
ATOM   4515 C  CE1  . PHE A 1 653 ? 85.471 -61.698 -83.700 1.00 78.96  ? 647  PHE A CE1  1 
ATOM   4516 C  CE2  . PHE A 1 653 ? 87.363 -62.601 -82.578 1.00 75.41  ? 647  PHE A CE2  1 
ATOM   4517 C  CZ   . PHE A 1 653 ? 86.340 -61.702 -82.624 1.00 76.29  ? 647  PHE A CZ   1 
ATOM   4518 N  N    . ASP A 1 654 ? 86.213 -63.585 -88.769 1.00 81.69  ? 648  ASP A N    1 
ATOM   4519 C  CA   . ASP A 1 654 ? 85.254 -62.808 -89.545 1.00 88.87  ? 648  ASP A CA   1 
ATOM   4520 C  C    . ASP A 1 654 ? 83.878 -62.950 -88.901 1.00 82.32  ? 648  ASP A C    1 
ATOM   4521 O  O    . ASP A 1 654 ? 83.375 -64.067 -88.729 1.00 81.24  ? 648  ASP A O    1 
ATOM   4522 C  CB   . ASP A 1 654 ? 85.224 -63.233 -91.021 1.00 89.15  ? 648  ASP A CB   1 
ATOM   4523 C  CG   . ASP A 1 654 ? 84.939 -64.732 -91.211 1.00 96.76  ? 648  ASP A CG   1 
ATOM   4524 O  OD1  . ASP A 1 654 ? 84.992 -65.480 -90.201 1.00 94.74  ? 648  ASP A OD1  1 
ATOM   4525 O  OD2  . ASP A 1 654 ? 84.649 -65.155 -92.365 1.00 90.48  ? 648  ASP A OD2  1 
ATOM   4526 N  N    . LEU A 1 655 ? 83.286 -61.819 -88.524 1.00 78.11  ? 649  LEU A N    1 
ATOM   4527 C  CA   . LEU A 1 655 ? 81.938 -61.778 -87.976 1.00 74.42  ? 649  LEU A CA   1 
ATOM   4528 C  C    . LEU A 1 655 ? 81.085 -60.858 -88.842 1.00 70.23  ? 649  LEU A C    1 
ATOM   4529 O  O    . LEU A 1 655 ? 81.518 -59.763 -89.217 1.00 71.23  ? 649  LEU A O    1 
ATOM   4530 C  CB   . LEU A 1 655 ? 81.933 -61.314 -86.505 1.00 69.52  ? 649  LEU A CB   1 
ATOM   4531 C  CG   . LEU A 1 655 ? 82.389 -62.296 -85.416 1.00 65.01  ? 649  LEU A CG   1 
ATOM   4532 N  N    . ASP A 1 656 ? 79.883 -61.312 -89.157 1.00 64.58  ? 650  ASP A N    1 
ATOM   4533 C  CA   . ASP A 1 656 ? 78.914 -60.561 -89.941 1.00 64.14  ? 650  ASP A CA   1 
ATOM   4534 C  C    . ASP A 1 656 ? 77.858 -59.994 -88.998 1.00 67.95  ? 650  ASP A C    1 
ATOM   4535 O  O    . ASP A 1 656 ? 76.969 -60.731 -88.557 1.00 69.48  ? 650  ASP A O    1 
ATOM   4536 C  CB   . ASP A 1 656 ? 78.267 -61.496 -90.960 1.00 66.50  ? 650  ASP A CB   1 
ATOM   4537 C  CG   . ASP A 1 656 ? 77.210 -60.821 -91.797 1.00 70.36  ? 650  ASP A CG   1 
ATOM   4538 O  OD1  . ASP A 1 656 ? 77.176 -59.568 -91.865 1.00 69.82  ? 650  ASP A OD1  1 
ATOM   4539 O  OD2  . ASP A 1 656 ? 76.354 -61.570 -92.323 1.00 72.99  ? 650  ASP A OD2  1 
ATOM   4540 N  N    . VAL A 1 657 ? 77.878 -58.682 -88.765 1.00 67.42  ? 651  VAL A N    1 
ATOM   4541 C  CA   . VAL A 1 657 ? 76.992 -58.076 -87.771 1.00 61.85  ? 651  VAL A CA   1 
ATOM   4542 C  C    . VAL A 1 657 ? 75.672 -57.754 -88.461 1.00 62.39  ? 651  VAL A C    1 
ATOM   4543 O  O    . VAL A 1 657 ? 75.576 -56.799 -89.229 1.00 69.04  ? 651  VAL A O    1 
ATOM   4544 C  CB   . VAL A 1 657 ? 77.607 -56.812 -87.160 1.00 60.64  ? 651  VAL A CB   1 
ATOM   4545 C  CG1  . VAL A 1 657 ? 76.579 -56.081 -86.301 1.00 61.84  ? 651  VAL A CG1  1 
ATOM   4546 C  CG2  . VAL A 1 657 ? 78.865 -57.139 -86.344 1.00 56.40  ? 651  VAL A CG2  1 
ATOM   4547 N  N    . VAL A 1 658 ? 74.652 -58.559 -88.185 1.00 61.40  ? 652  VAL A N    1 
ATOM   4548 C  CA   . VAL A 1 658 ? 73.369 -58.440 -88.868 1.00 60.08  ? 652  VAL A CA   1 
ATOM   4549 C  C    . VAL A 1 658 ? 72.399 -57.462 -88.202 1.00 62.37  ? 652  VAL A C    1 
ATOM   4550 O  O    . VAL A 1 658 ? 71.566 -56.867 -88.895 1.00 63.69  ? 652  VAL A O    1 
ATOM   4551 C  CB   . VAL A 1 658 ? 72.717 -59.825 -89.010 1.00 62.41  ? 652  VAL A CB   1 
ATOM   4552 C  CG1  . VAL A 1 658 ? 71.412 -59.715 -89.786 1.00 56.46  ? 652  VAL A CG1  1 
ATOM   4553 C  CG2  . VAL A 1 658 ? 73.693 -60.818 -89.636 1.00 65.28  ? 652  VAL A CG2  1 
ATOM   4554 N  N    . ALA A 1 659 ? 72.406 -57.357 -86.866 1.00 60.32  ? 653  ALA A N    1 
ATOM   4555 C  CA   . ALA A 1 659 ? 71.348 -56.627 -86.174 1.00 57.09  ? 653  ALA A CA   1 
ATOM   4556 C  C    . ALA A 1 659 ? 71.824 -56.070 -84.837 1.00 57.95  ? 653  ALA A C    1 
ATOM   4557 O  O    . ALA A 1 659 ? 72.635 -56.684 -84.138 1.00 56.11  ? 653  ALA A O    1 
ATOM   4558 C  CB   . ALA A 1 659 ? 70.125 -57.516 -85.934 1.00 57.98  ? 653  ALA A CB   1 
ATOM   4559 N  N    . VAL A 1 660 ? 71.284 -54.902 -84.486 1.00 54.84  ? 654  VAL A N    1 
ATOM   4560 C  CA   . VAL A 1 660 ? 71.355 -54.347 -83.142 1.00 58.05  ? 654  VAL A CA   1 
ATOM   4561 C  C    . VAL A 1 660 ? 69.935 -54.083 -82.681 1.00 55.64  ? 654  VAL A C    1 
ATOM   4562 O  O    . VAL A 1 660 ? 69.144 -53.482 -83.414 1.00 57.19  ? 654  VAL A O    1 
ATOM   4563 C  CB   . VAL A 1 660 ? 72.194 -53.059 -83.080 1.00 60.90  ? 654  VAL A CB   1 
ATOM   4564 C  CG1  . VAL A 1 660 ? 73.644 -53.377 -83.325 1.00 65.51  ? 654  VAL A CG1  1 
ATOM   4565 C  CG2  . VAL A 1 660 ? 71.697 -52.070 -84.110 1.00 59.29  ? 654  VAL A CG2  1 
ATOM   4566 N  N    . VAL A 1 661 ? 69.609 -54.533 -81.473 1.00 52.97  ? 655  VAL A N    1 
ATOM   4567 C  CA   . VAL A 1 661 ? 68.257 -54.419 -80.950 1.00 52.51  ? 655  VAL A CA   1 
ATOM   4568 C  C    . VAL A 1 661 ? 68.317 -53.939 -79.511 1.00 52.59  ? 655  VAL A C    1 
ATOM   4569 O  O    . VAL A 1 661 ? 69.255 -54.254 -78.771 1.00 56.07  ? 655  VAL A O    1 
ATOM   4570 C  CB   . VAL A 1 661 ? 67.500 -55.762 -81.040 1.00 57.24  ? 655  VAL A CB   1 
ATOM   4571 C  CG1  . VAL A 1 661 ? 67.402 -56.226 -82.491 1.00 54.62  ? 655  VAL A CG1  1 
ATOM   4572 C  CG2  . VAL A 1 661 ? 68.189 -56.802 -80.193 1.00 59.78  ? 655  VAL A CG2  1 
ATOM   4573 N  N    . ASN A 1 662 ? 67.303 -53.169 -79.122 1.00 50.41  ? 656  ASN A N    1 
ATOM   4574 C  CA   . ASN A 1 662 ? 67.120 -52.782 -77.726 1.00 46.57  ? 656  ASN A CA   1 
ATOM   4575 C  C    . ASN A 1 662 ? 66.728 -54.002 -76.885 1.00 50.44  ? 656  ASN A C    1 
ATOM   4576 O  O    . ASN A 1 662 ? 66.250 -55.010 -77.411 1.00 47.96  ? 656  ASN A O    1 
ATOM   4577 C  CB   . ASN A 1 662 ? 66.115 -51.621 -77.676 1.00 44.82  ? 656  ASN A CB   1 
ATOM   4578 C  CG   . ASN A 1 662 ? 65.740 -51.177 -76.270 1.00 49.42  ? 656  ASN A CG   1 
ATOM   4579 O  OD1  . ASN A 1 662 ? 65.254 -51.956 -75.471 1.00 53.51  ? 656  ASN A OD1  1 
ATOM   4580 N  ND2  . ASN A 1 662 ? 66.079 -49.940 -75.936 1.00 47.44  ? 656  ASN A ND2  1 
ATOM   4581 N  N    . ASP A 1 663 ? 67.024 -53.949 -75.570 1.00 51.24  ? 657  ASP A N    1 
ATOM   4582 C  CA   . ASP A 1 663 ? 66.762 -55.118 -74.731 1.00 47.78  ? 657  ASP A CA   1 
ATOM   4583 C  C    . ASP A 1 663 ? 65.272 -55.443 -74.672 1.00 49.65  ? 657  ASP A C    1 
ATOM   4584 O  O    . ASP A 1 663 ? 64.878 -56.617 -74.679 1.00 52.12  ? 657  ASP A O    1 
ATOM   4585 C  CB   . ASP A 1 663 ? 67.368 -54.952 -73.330 1.00 54.06  ? 657  ASP A CB   1 
ATOM   4586 C  CG   . ASP A 1 663 ? 67.037 -53.612 -72.661 1.00 54.77  ? 657  ASP A CG   1 
ATOM   4587 O  OD1  . ASP A 1 663 ? 66.586 -52.684 -73.351 1.00 51.50  ? 657  ASP A OD1  1 
ATOM   4588 O  OD2  . ASP A 1 663 ? 67.223 -53.501 -71.423 1.00 50.41  ? 657  ASP A OD2  1 
ATOM   4589 N  N    . THR A 1 664 ? 64.423 -54.424 -74.651 1.00 45.49  ? 658  THR A N    1 
ATOM   4590 C  CA   . THR A 1 664 ? 63.000 -54.664 -74.822 1.00 45.93  ? 658  THR A CA   1 
ATOM   4591 C  C    . THR A 1 664 ? 62.755 -55.594 -76.008 1.00 52.26  ? 658  THR A C    1 
ATOM   4592 O  O    . THR A 1 664 ? 62.240 -56.705 -75.845 1.00 54.56  ? 658  THR A O    1 
ATOM   4593 C  CB   . THR A 1 664 ? 62.283 -53.330 -74.997 1.00 49.42  ? 658  THR A CB   1 
ATOM   4594 O  OG1  . THR A 1 664 ? 62.916 -52.609 -76.055 1.00 55.14  ? 658  THR A OG1  1 
ATOM   4595 C  CG2  . THR A 1 664 ? 62.372 -52.495 -73.734 1.00 46.51  ? 658  THR A CG2  1 
ATOM   4596 N  N    . VAL A 1 665 ? 63.148 -55.157 -77.212 1.00 50.65  ? 659  VAL A N    1 
ATOM   4597 C  CA   . VAL A 1 665 ? 62.956 -55.953 -78.427 1.00 46.15  ? 659  VAL A CA   1 
ATOM   4598 C  C    . VAL A 1 665 ? 63.565 -57.346 -78.280 1.00 47.12  ? 659  VAL A C    1 
ATOM   4599 O  O    . VAL A 1 665 ? 62.951 -58.355 -78.639 1.00 50.34  ? 659  VAL A O    1 
ATOM   4600 C  CB   . VAL A 1 665 ? 63.546 -55.210 -79.641 1.00 49.69  ? 659  VAL A CB   1 
ATOM   4601 C  CG1  . VAL A 1 665 ? 63.369 -56.010 -80.919 1.00 48.09  ? 659  VAL A CG1  1 
ATOM   4602 C  CG2  . VAL A 1 665 ? 62.936 -53.824 -79.764 1.00 51.46  ? 659  VAL A CG2  1 
ATOM   4603 N  N    . GLY A 1 666 ? 64.801 -57.426 -77.799 1.00 50.07  ? 660  GLY A N    1 
ATOM   4604 C  CA   . GLY A 1 666 ? 65.411 -58.735 -77.608 1.00 53.79  ? 660  GLY A CA   1 
ATOM   4605 C  C    . GLY A 1 666 ? 64.596 -59.629 -76.690 1.00 60.26  ? 660  GLY A C    1 
ATOM   4606 O  O    . GLY A 1 666 ? 64.429 -60.823 -76.958 1.00 59.26  ? 660  GLY A O    1 
ATOM   4607 N  N    . THR A 1 667 ? 64.072 -59.057 -75.591 1.00 56.35  ? 661  THR A N    1 
ATOM   4608 C  CA   . THR A 1 667 ? 63.221 -59.808 -74.673 1.00 54.71  ? 661  THR A CA   1 
ATOM   4609 C  C    . THR A 1 667 ? 61.907 -60.232 -75.322 1.00 54.92  ? 661  THR A C    1 
ATOM   4610 O  O    . THR A 1 667 ? 61.461 -61.370 -75.142 1.00 58.29  ? 661  THR A O    1 
ATOM   4611 C  CB   . THR A 1 667 ? 62.973 -58.995 -73.402 1.00 53.14  ? 661  THR A CB   1 
ATOM   4612 O  OG1  . THR A 1 667 ? 64.171 -58.983 -72.604 1.00 56.72  ? 661  THR A OG1  1 
ATOM   4613 C  CG2  . THR A 1 667 ? 61.832 -59.586 -72.613 1.00 52.09  ? 661  THR A CG2  1 
ATOM   4614 N  N    . MET A 1 668 ? 61.271 -59.352 -76.089 1.00 53.86  ? 662  MET A N    1 
ATOM   4615 C  CA   . MET A 1 668 ? 60.057 -59.771 -76.783 1.00 55.24  ? 662  MET A CA   1 
ATOM   4616 C  C    . MET A 1 668 ? 60.311 -60.962 -77.708 1.00 59.81  ? 662  MET A C    1 
ATOM   4617 O  O    . MET A 1 668 ? 59.501 -61.893 -77.752 1.00 62.11  ? 662  MET A O    1 
ATOM   4618 C  CB   . MET A 1 668 ? 59.466 -58.620 -77.573 1.00 53.91  ? 662  MET A CB   1 
ATOM   4619 C  CG   . MET A 1 668 ? 58.274 -59.034 -78.405 1.00 51.94  ? 662  MET A CG   1 
ATOM   4620 S  SD   . MET A 1 668 ? 57.825 -57.696 -79.525 1.00 55.72  ? 662  MET A SD   1 
ATOM   4621 C  CE   . MET A 1 668 ? 59.162 -57.875 -80.705 1.00 50.77  ? 662  MET A CE   1 
ATOM   4622 N  N    . MET A 1 669 ? 61.415 -60.954 -78.470 1.00 56.76  ? 663  MET A N    1 
ATOM   4623 C  CA   . MET A 1 669 ? 61.673 -62.099 -79.340 1.00 59.98  ? 663  MET A CA   1 
ATOM   4624 C  C    . MET A 1 669 ? 62.000 -63.352 -78.540 1.00 64.78  ? 663  MET A C    1 
ATOM   4625 O  O    . MET A 1 669 ? 61.574 -64.448 -78.913 1.00 67.73  ? 663  MET A O    1 
ATOM   4626 C  CB   . MET A 1 669 ? 62.800 -61.819 -80.332 1.00 61.51  ? 663  MET A CB   1 
ATOM   4627 C  CG   . MET A 1 669 ? 62.460 -60.876 -81.478 1.00 70.14  ? 663  MET A CG   1 
ATOM   4628 S  SD   . MET A 1 669 ? 61.124 -61.428 -82.556 1.00 72.45  ? 663  MET A SD   1 
ATOM   4629 C  CE   . MET A 1 669 ? 61.795 -62.986 -83.125 1.00 74.85  ? 663  MET A CE   1 
ATOM   4630 N  N    . THR A 1 670 ? 62.775 -63.227 -77.456 1.00 65.34  ? 664  THR A N    1 
ATOM   4631 C  CA   . THR A 1 670 ? 63.067 -64.407 -76.644 1.00 65.50  ? 664  THR A CA   1 
ATOM   4632 C  C    . THR A 1 670 ? 61.783 -65.076 -76.188 1.00 69.10  ? 664  THR A C    1 
ATOM   4633 O  O    . THR A 1 670 ? 61.620 -66.294 -76.325 1.00 73.78  ? 664  THR A O    1 
ATOM   4634 C  CB   . THR A 1 670 ? 63.903 -64.055 -75.423 1.00 63.88  ? 664  THR A CB   1 
ATOM   4635 O  OG1  . THR A 1 670 ? 65.147 -63.485 -75.830 1.00 68.87  ? 664  THR A OG1  1 
ATOM   4636 C  CG2  . THR A 1 670 ? 64.172 -65.310 -74.642 1.00 69.22  ? 664  THR A CG2  1 
ATOM   4637 N  N    . CYS A 1 671 ? 60.854 -64.286 -75.644 1.00 66.57  ? 665  CYS A N    1 
ATOM   4638 C  CA   . CYS A 1 671 ? 59.625 -64.843 -75.103 1.00 65.52  ? 665  CYS A CA   1 
ATOM   4639 C  C    . CYS A 1 671 ? 58.653 -65.275 -76.189 1.00 71.19  ? 665  CYS A C    1 
ATOM   4640 O  O    . CYS A 1 671 ? 57.835 -66.162 -75.936 1.00 78.26  ? 665  CYS A O    1 
ATOM   4641 C  CB   . CYS A 1 671 ? 58.966 -63.839 -74.150 1.00 62.28  ? 665  CYS A CB   1 
ATOM   4642 S  SG   . CYS A 1 671 ? 59.918 -63.574 -72.591 1.00 68.02  ? 665  CYS A SG   1 
ATOM   4643 N  N    . GLY A 1 672 ? 58.733 -64.692 -77.387 1.00 70.72  ? 666  GLY A N    1 
ATOM   4644 C  CA   . GLY A 1 672 ? 57.831 -65.084 -78.459 1.00 71.50  ? 666  GLY A CA   1 
ATOM   4645 C  C    . GLY A 1 672 ? 58.161 -66.428 -79.080 1.00 77.42  ? 666  GLY A C    1 
ATOM   4646 O  O    . GLY A 1 672 ? 57.283 -67.086 -79.648 1.00 79.04  ? 666  GLY A O    1 
ATOM   4647 N  N    . PHE A 1 673 ? 59.424 -66.850 -79.000 1.00 84.29  ? 667  PHE A N    1 
ATOM   4648 C  CA   . PHE A 1 673 ? 59.793 -68.188 -79.455 1.00 89.61  ? 667  PHE A CA   1 
ATOM   4649 C  C    . PHE A 1 673 ? 58.947 -69.245 -78.757 1.00 90.32  ? 667  PHE A C    1 
ATOM   4650 O  O    . PHE A 1 673 ? 58.418 -70.162 -79.398 1.00 92.77  ? 667  PHE A O    1 
ATOM   4651 C  CB   . PHE A 1 673 ? 61.287 -68.421 -79.207 1.00 92.16  ? 667  PHE A CB   1 
ATOM   4652 C  CG   . PHE A 1 673 ? 61.779 -69.784 -79.624 1.00 101.07 ? 667  PHE A CG   1 
ATOM   4653 C  CD1  . PHE A 1 673 ? 61.901 -70.111 -80.978 1.00 99.18  ? 667  PHE A CD1  1 
ATOM   4654 C  CD2  . PHE A 1 673 ? 62.178 -70.715 -78.674 1.00 98.97  ? 667  PHE A CD2  1 
ATOM   4655 C  CE1  . PHE A 1 673 ? 62.369 -71.360 -81.375 1.00 93.75  ? 667  PHE A CE1  1 
ATOM   4656 C  CE2  . PHE A 1 673 ? 62.655 -71.967 -79.067 1.00 103.26 ? 667  PHE A CE2  1 
ATOM   4657 C  CZ   . PHE A 1 673 ? 62.750 -72.287 -80.420 1.00 94.55  ? 667  PHE A CZ   1 
ATOM   4658 N  N    . GLU A 1 674 ? 58.797 -69.115 -77.436 1.00 90.03  ? 668  GLU A N    1 
ATOM   4659 C  CA   . GLU A 1 674 ? 57.910 -69.991 -76.672 1.00 93.82  ? 668  GLU A CA   1 
ATOM   4660 C  C    . GLU A 1 674 ? 56.439 -69.686 -76.956 1.00 87.69  ? 668  GLU A C    1 
ATOM   4661 O  O    . GLU A 1 674 ? 55.643 -70.598 -77.208 1.00 88.53  ? 668  GLU A O    1 
ATOM   4662 C  CB   . GLU A 1 674 ? 58.221 -69.850 -75.177 1.00 87.37  ? 668  GLU A CB   1 
ATOM   4663 C  CG   . GLU A 1 674 ? 59.633 -70.318 -74.835 1.00 98.10  ? 668  GLU A CG   1 
ATOM   4664 C  CD   . GLU A 1 674 ? 60.054 -70.003 -73.409 1.00 111.74 ? 668  GLU A CD   1 
ATOM   4665 O  OE1  . GLU A 1 674 ? 59.334 -69.253 -72.708 1.00 110.10 ? 668  GLU A OE1  1 
ATOM   4666 O  OE2  . GLU A 1 674 ? 61.124 -70.499 -72.992 1.00 121.03 ? 668  GLU A OE2  1 
ATOM   4667 N  N    . ASP A 1 675 ? 56.054 -68.414 -76.908 1.00 83.17  ? 669  ASP A N    1 
ATOM   4668 C  CA   . ASP A 1 675 ? 54.645 -68.021 -76.991 1.00 77.20  ? 669  ASP A CA   1 
ATOM   4669 C  C    . ASP A 1 675 ? 54.382 -67.134 -78.210 1.00 70.88  ? 669  ASP A C    1 
ATOM   4670 O  O    . ASP A 1 675 ? 54.786 -65.955 -78.229 1.00 68.46  ? 669  ASP A O    1 
ATOM   4671 C  CB   . ASP A 1 675 ? 54.243 -67.332 -75.679 1.00 72.63  ? 669  ASP A CB   1 
ATOM   4672 C  CG   . ASP A 1 675 ? 52.751 -67.032 -75.589 1.00 71.25  ? 669  ASP A CG   1 
ATOM   4673 O  OD1  . ASP A 1 675 ? 52.032 -67.263 -76.585 1.00 78.67  ? 669  ASP A OD1  1 
ATOM   4674 O  OD2  . ASP A 1 675 ? 52.295 -66.575 -74.515 1.00 65.96  ? 669  ASP A OD2  1 
ATOM   4675 N  N    . PRO A 1 676 ? 53.715 -67.644 -79.244 1.00 76.32  ? 670  PRO A N    1 
ATOM   4676 C  CA   . PRO A 1 676 ? 53.438 -66.825 -80.437 1.00 69.77  ? 670  PRO A CA   1 
ATOM   4677 C  C    . PRO A 1 676 ? 52.479 -65.666 -80.208 1.00 69.96  ? 670  PRO A C    1 
ATOM   4678 O  O    . PRO A 1 676 ? 52.324 -64.841 -81.117 1.00 66.71  ? 670  PRO A O    1 
ATOM   4679 C  CB   . PRO A 1 676 ? 52.856 -67.840 -81.421 1.00 73.22  ? 670  PRO A CB   1 
ATOM   4680 C  CG   . PRO A 1 676 ? 53.510 -69.143 -81.011 1.00 80.83  ? 670  PRO A CG   1 
ATOM   4681 C  CD   . PRO A 1 676 ? 53.544 -69.083 -79.508 1.00 81.61  ? 670  PRO A CD   1 
ATOM   4682 N  N    . HIS A 1 677 ? 51.795 -65.601 -79.063 1.00 71.58  ? 671  HIS A N    1 
ATOM   4683 C  CA   . HIS A 1 677 ? 50.931 -64.478 -78.696 1.00 61.48  ? 671  HIS A CA   1 
ATOM   4684 C  C    . HIS A 1 677 ? 51.683 -63.283 -78.137 1.00 56.64  ? 671  HIS A C    1 
ATOM   4685 O  O    . HIS A 1 677 ? 51.047 -62.271 -77.821 1.00 50.01  ? 671  HIS A O    1 
ATOM   4686 C  CB   . HIS A 1 677 ? 49.904 -64.931 -77.670 1.00 62.55  ? 671  HIS A CB   1 
ATOM   4687 C  CG   . HIS A 1 677 ? 48.764 -65.693 -78.251 1.00 61.84  ? 671  HIS A CG   1 
ATOM   4688 N  ND1  . HIS A 1 677 ? 47.637 -65.068 -78.741 1.00 59.98  ? 671  HIS A ND1  1 
ATOM   4689 C  CD2  . HIS A 1 677 ? 48.596 -67.016 -78.476 1.00 64.08  ? 671  HIS A CD2  1 
ATOM   4690 C  CE1  . HIS A 1 677 ? 46.801 -65.978 -79.204 1.00 66.70  ? 671  HIS A CE1  1 
ATOM   4691 N  NE2  . HIS A 1 677 ? 47.365 -67.167 -79.067 1.00 72.62  ? 671  HIS A NE2  1 
ATOM   4692 N  N    . CYS A 1 678 ? 53.010 -63.356 -78.054 1.00 59.39  ? 672  CYS A N    1 
ATOM   4693 C  CA   . CYS A 1 678 ? 53.813 -62.324 -77.412 1.00 56.52  ? 672  CYS A CA   1 
ATOM   4694 C  C    . CYS A 1 678 ? 54.138 -61.257 -78.452 1.00 61.31  ? 672  CYS A C    1 
ATOM   4695 O  O    . CYS A 1 678 ? 54.910 -61.488 -79.392 1.00 62.35  ? 672  CYS A O    1 
ATOM   4696 C  CB   . CYS A 1 678 ? 55.079 -62.954 -76.842 1.00 62.22  ? 672  CYS A CB   1 
ATOM   4697 S  SG   . CYS A 1 678 ? 56.200 -61.826 -76.058 1.00 61.47  ? 672  CYS A SG   1 
ATOM   4698 N  N    . GLU A 1 679 ? 53.461 -60.126 -78.329 1.00 57.58  ? 673  GLU A N    1 
ATOM   4699 C  CA   . GLU A 1 679 ? 53.639 -58.971 -79.179 1.00 52.01  ? 673  GLU A CA   1 
ATOM   4700 C  C    . GLU A 1 679 ? 54.283 -57.774 -78.493 1.00 54.60  ? 673  GLU A C    1 
ATOM   4701 O  O    . GLU A 1 679 ? 54.337 -56.700 -79.092 1.00 57.83  ? 673  GLU A O    1 
ATOM   4702 C  CB   . GLU A 1 679 ? 52.286 -58.591 -79.780 1.00 58.17  ? 673  GLU A CB   1 
ATOM   4703 C  CG   . GLU A 1 679 ? 51.815 -59.623 -80.813 1.00 65.95  ? 673  GLU A CG   1 
ATOM   4704 C  CD   . GLU A 1 679 ? 50.531 -59.205 -81.527 1.00 80.16  ? 673  GLU A CD   1 
ATOM   4705 O  OE1  . GLU A 1 679 ? 49.821 -58.307 -81.000 1.00 77.60  ? 673  GLU A OE1  1 
ATOM   4706 O  OE2  . GLU A 1 679 ? 50.271 -59.727 -82.645 1.00 76.44  ? 673  GLU A OE2  1 
ATOM   4707 N  N    . VAL A 1 680 ? 54.677 -57.891 -77.226 1.00 59.34  ? 674  VAL A N    1 
ATOM   4708 C  CA   . VAL A 1 680 ? 55.125 -56.759 -76.426 1.00 49.53  ? 674  VAL A CA   1 
ATOM   4709 C  C    . VAL A 1 680 ? 56.382 -57.180 -75.691 1.00 51.85  ? 674  VAL A C    1 
ATOM   4710 O  O    . VAL A 1 680 ? 56.610 -58.364 -75.445 1.00 52.55  ? 674  VAL A O    1 
ATOM   4711 C  CB   . VAL A 1 680 ? 54.057 -56.301 -75.412 1.00 49.62  ? 674  VAL A CB   1 
ATOM   4712 C  CG1  . VAL A 1 680 ? 54.553 -55.101 -74.606 1.00 48.42  ? 674  VAL A CG1  1 
ATOM   4713 C  CG2  . VAL A 1 680 ? 52.742 -55.994 -76.108 1.00 52.68  ? 674  VAL A CG2  1 
ATOM   4714 N  N    . GLY A 1 681 ? 57.164 -56.197 -75.273 1.00 51.89  ? 675  GLY A N    1 
ATOM   4715 C  CA   . GLY A 1 681 ? 58.271 -56.481 -74.376 1.00 51.21  ? 675  GLY A CA   1 
ATOM   4716 C  C    . GLY A 1 681 ? 58.493 -55.339 -73.415 1.00 47.25  ? 675  GLY A C    1 
ATOM   4717 O  O    . GLY A 1 681 ? 58.286 -54.167 -73.747 1.00 44.95  ? 675  GLY A O    1 
ATOM   4718 N  N    . LEU A 1 682 ? 58.955 -55.690 -72.216 1.00 45.31  ? 676  LEU A N    1 
ATOM   4719 C  CA   . LEU A 1 682 ? 58.974 -54.769 -71.088 1.00 41.16  ? 676  LEU A CA   1 
ATOM   4720 C  C    . LEU A 1 682 ? 60.228 -55.030 -70.284 1.00 43.15  ? 676  LEU A C    1 
ATOM   4721 O  O    . LEU A 1 682 ? 60.522 -56.186 -69.979 1.00 45.54  ? 676  LEU A O    1 
ATOM   4722 C  CB   . LEU A 1 682 ? 57.739 -54.963 -70.218 1.00 38.52  ? 676  LEU A CB   1 
ATOM   4723 C  CG   . LEU A 1 682 ? 57.560 -54.150 -68.949 1.00 42.48  ? 676  LEU A CG   1 
ATOM   4724 C  CD1  . LEU A 1 682 ? 57.403 -52.673 -69.249 1.00 40.03  ? 676  LEU A CD1  1 
ATOM   4725 C  CD2  . LEU A 1 682 ? 56.348 -54.680 -68.218 1.00 46.74  ? 676  LEU A CD2  1 
ATOM   4726 N  N    . ILE A 1 683 ? 60.962 -53.973 -69.944 1.00 41.99  ? 677  ILE A N    1 
ATOM   4727 C  CA   . ILE A 1 683 ? 62.039 -54.055 -68.963 1.00 43.53  ? 677  ILE A CA   1 
ATOM   4728 C  C    . ILE A 1 683 ? 61.683 -53.193 -67.753 1.00 45.32  ? 677  ILE A C    1 
ATOM   4729 O  O    . ILE A 1 683 ? 61.310 -52.019 -67.902 1.00 44.77  ? 677  ILE A O    1 
ATOM   4730 C  CB   . ILE A 1 683 ? 63.383 -53.617 -69.565 1.00 44.52  ? 677  ILE A CB   1 
ATOM   4731 C  CG1  . ILE A 1 683 ? 63.693 -54.418 -70.821 1.00 44.32  ? 677  ILE A CG1  1 
ATOM   4732 C  CG2  . ILE A 1 683 ? 64.480 -53.831 -68.576 1.00 47.53  ? 677  ILE A CG2  1 
ATOM   4733 C  CD1  . ILE A 1 683 ? 63.836 -55.856 -70.580 1.00 44.65  ? 677  ILE A CD1  1 
ATOM   4734 N  N    . VAL A 1 684 ? 61.795 -53.770 -66.555 1.00 46.39  ? 678  VAL A N    1 
ATOM   4735 C  CA   . VAL A 1 684 ? 61.761 -53.002 -65.302 1.00 45.74  ? 678  VAL A CA   1 
ATOM   4736 C  C    . VAL A 1 684 ? 62.942 -53.472 -64.451 1.00 48.99  ? 678  VAL A C    1 
ATOM   4737 O  O    . VAL A 1 684 ? 62.956 -54.612 -63.969 1.00 49.42  ? 678  VAL A O    1 
ATOM   4738 C  CB   . VAL A 1 684 ? 60.440 -53.158 -64.544 1.00 40.60  ? 678  VAL A CB   1 
ATOM   4739 C  CG1  . VAL A 1 684 ? 60.400 -52.179 -63.415 1.00 44.60  ? 678  VAL A CG1  1 
ATOM   4740 C  CG2  . VAL A 1 684 ? 59.260 -52.957 -65.469 1.00 46.18  ? 678  VAL A CG2  1 
ATOM   4741 N  N    . GLY A 1 685 ? 63.898 -52.578 -64.219 1.00 44.84  ? 679  GLY A N    1 
ATOM   4742 C  CA   . GLY A 1 685 ? 65.273 -52.957 -63.964 1.00 42.53  ? 679  GLY A CA   1 
ATOM   4743 C  C    . GLY A 1 685 ? 66.095 -51.721 -63.686 1.00 43.66  ? 679  GLY A C    1 
ATOM   4744 O  O    . GLY A 1 685 ? 65.571 -50.733 -63.168 1.00 43.57  ? 679  GLY A O    1 
ATOM   4745 N  N    . THR A 1 686 ? 67.393 -51.776 -63.977 1.00 45.75  ? 680  THR A N    1 
ATOM   4746 C  CA   . THR A 1 686 ? 68.243 -50.588 -63.960 1.00 44.69  ? 680  THR A CA   1 
ATOM   4747 C  C    . THR A 1 686 ? 67.523 -49.424 -64.635 1.00 47.03  ? 680  THR A C    1 
ATOM   4748 O  O    . THR A 1 686 ? 67.607 -48.283 -64.170 1.00 42.96  ? 680  THR A O    1 
ATOM   4749 C  CB   . THR A 1 686 ? 69.565 -50.875 -64.675 1.00 53.84  ? 680  THR A CB   1 
ATOM   4750 O  OG1  . THR A 1 686 ? 70.213 -51.989 -64.057 1.00 58.50  ? 680  THR A OG1  1 
ATOM   4751 C  CG2  . THR A 1 686 ? 70.472 -49.679 -64.616 1.00 47.52  ? 680  THR A CG2  1 
ATOM   4752 N  N    . GLY A 1 687 ? 66.769 -49.715 -65.716 1.00 47.07  ? 681  GLY A N    1 
ATOM   4753 C  CA   . GLY A 1 687 ? 65.886 -48.736 -66.313 1.00 42.72  ? 681  GLY A CA   1 
ATOM   4754 C  C    . GLY A 1 687 ? 64.609 -49.426 -66.743 1.00 47.66  ? 681  GLY A C    1 
ATOM   4755 O  O    . GLY A 1 687 ? 64.496 -50.647 -66.649 1.00 49.36  ? 681  GLY A O    1 
ATOM   4756 N  N    . SER A 1 688 ? 63.633 -48.635 -67.181 1.00 47.25  ? 682  SER A N    1 
ATOM   4757 C  CA   . SER A 1 688 ? 62.377 -49.190 -67.671 1.00 46.62  ? 682  SER A CA   1 
ATOM   4758 C  C    . SER A 1 688 ? 62.143 -48.804 -69.131 1.00 46.91  ? 682  SER A C    1 
ATOM   4759 O  O    . SER A 1 688 ? 62.234 -47.629 -69.487 1.00 46.97  ? 682  SER A O    1 
ATOM   4760 C  CB   . SER A 1 688 ? 61.215 -48.716 -66.811 1.00 46.88  ? 682  SER A CB   1 
ATOM   4761 O  OG   . SER A 1 688 ? 59.998 -49.292 -67.230 1.00 47.53  ? 682  SER A OG   1 
ATOM   4762 N  N    . ASN A 1 689 ? 61.801 -49.780 -69.968 1.00 44.61  ? 683  ASN A N    1 
ATOM   4763 C  CA   . ASN A 1 689 ? 61.379 -49.475 -71.328 1.00 45.84  ? 683  ASN A CA   1 
ATOM   4764 C  C    . ASN A 1 689 ? 60.425 -50.553 -71.836 1.00 49.34  ? 683  ASN A C    1 
ATOM   4765 O  O    . ASN A 1 689 ? 60.209 -51.576 -71.174 1.00 46.48  ? 683  ASN A O    1 
ATOM   4766 C  CB   . ASN A 1 689 ? 62.590 -49.340 -72.261 1.00 46.59  ? 683  ASN A CB   1 
ATOM   4767 C  CG   . ASN A 1 689 ? 62.227 -48.750 -73.584 1.00 43.84  ? 683  ASN A CG   1 
ATOM   4768 O  OD1  . ASN A 1 689 ? 61.245 -48.024 -73.686 1.00 42.47  ? 683  ASN A OD1  1 
ATOM   4769 N  ND2  . ASN A 1 689 ? 63.015 -49.047 -74.613 1.00 47.43  ? 683  ASN A ND2  1 
ATOM   4770 N  N    . ALA A 1 690 ? 59.878 -50.332 -73.043 1.00 45.52  ? 684  ALA A N    1 
ATOM   4771 C  CA   . ALA A 1 690 ? 58.910 -51.265 -73.613 1.00 44.12  ? 684  ALA A CA   1 
ATOM   4772 C  C    . ALA A 1 690 ? 58.787 -51.101 -75.130 1.00 48.33  ? 684  ALA A C    1 
ATOM   4773 O  O    . ALA A 1 690 ? 59.029 -50.028 -75.691 1.00 47.16  ? 684  ALA A O    1 
ATOM   4774 C  CB   . ALA A 1 690 ? 57.540 -51.089 -72.956 1.00 42.74  ? 684  ALA A CB   1 
ATOM   4775 N  N    . CYS A 1 691 ? 58.322 -52.173 -75.772 1.00 46.02  ? 685  CYS A N    1 
ATOM   4776 C  CA   . CYS A 1 691 ? 58.089 -52.201 -77.204 1.00 48.14  ? 685  CYS A CA   1 
ATOM   4777 C  C    . CYS A 1 691 ? 56.887 -53.085 -77.484 1.00 51.03  ? 685  CYS A C    1 
ATOM   4778 O  O    . CYS A 1 691 ? 56.679 -54.086 -76.802 1.00 55.45  ? 685  CYS A O    1 
ATOM   4779 C  CB   . CYS A 1 691 ? 59.297 -52.750 -77.974 1.00 52.41  ? 685  CYS A CB   1 
ATOM   4780 S  SG   . CYS A 1 691 ? 59.715 -54.477 -77.598 1.00 52.14  ? 685  CYS A SG   1 
ATOM   4781 N  N    . TYR A 1 692 ? 56.094 -52.699 -78.484 1.00 53.68  ? 686  TYR A N    1 
ATOM   4782 C  CA   . TYR A 1 692 ? 55.129 -53.571 -79.157 1.00 53.66  ? 686  TYR A CA   1 
ATOM   4783 C  C    . TYR A 1 692 ? 55.319 -53.575 -80.681 1.00 54.10  ? 686  TYR A C    1 
ATOM   4784 O  O    . TYR A 1 692 ? 56.085 -52.794 -81.254 1.00 48.52  ? 686  TYR A O    1 
ATOM   4785 C  CB   . TYR A 1 692 ? 53.664 -53.180 -78.968 1.00 55.67  ? 686  TYR A CB   1 
ATOM   4786 C  CG   . TYR A 1 692 ? 53.343 -51.724 -79.222 1.00 58.25  ? 686  TYR A CG   1 
ATOM   4787 C  CD1  . TYR A 1 692 ? 54.305 -50.832 -79.581 1.00 58.99  ? 686  TYR A CD1  1 
ATOM   4788 C  CD2  . TYR A 1 692 ? 52.041 -51.367 -79.524 1.00 64.46  ? 686  TYR A CD2  1 
ATOM   4789 C  CE1  . TYR A 1 692 ? 53.994 -49.542 -79.892 1.00 62.27  ? 686  TYR A CE1  1 
ATOM   4790 C  CE2  . TYR A 1 692 ? 51.711 -50.084 -79.892 1.00 61.42  ? 686  TYR A CE2  1 
ATOM   4791 C  CZ   . TYR A 1 692 ? 52.700 -49.179 -80.079 1.00 58.07  ? 686  TYR A CZ   1 
ATOM   4792 O  OH   . TYR A 1 692 ? 52.412 -47.897 -80.443 1.00 59.68  ? 686  TYR A OH   1 
ATOM   4793 N  N    . MET A 1 693 ? 54.491 -54.401 -81.330 1.00 55.76  ? 687  MET A N    1 
ATOM   4794 C  CA   . MET A 1 693 ? 54.404 -54.519 -82.784 1.00 52.22  ? 687  MET A CA   1 
ATOM   4795 C  C    . MET A 1 693 ? 53.316 -53.580 -83.288 1.00 53.41  ? 687  MET A C    1 
ATOM   4796 O  O    . MET A 1 693 ? 52.124 -53.835 -83.084 1.00 47.17  ? 687  MET A O    1 
ATOM   4797 C  CB   . MET A 1 693 ? 54.055 -55.948 -83.182 1.00 53.99  ? 687  MET A CB   1 
ATOM   4798 C  CG   . MET A 1 693 ? 55.032 -56.997 -82.731 1.00 56.11  ? 687  MET A CG   1 
ATOM   4799 S  SD   . MET A 1 693 ? 56.617 -56.811 -83.529 1.00 62.19  ? 687  MET A SD   1 
ATOM   4800 C  CE   . MET A 1 693 ? 56.207 -57.235 -85.218 1.00 53.47  ? 687  MET A CE   1 
ATOM   4801 N  N    . GLU A 1 694 ? 53.717 -52.532 -84.001 1.00 56.48  ? 688  GLU A N    1 
ATOM   4802 C  CA   . GLU A 1 694 ? 52.785 -51.548 -84.521 1.00 54.02  ? 688  GLU A CA   1 
ATOM   4803 C  C    . GLU A 1 694 ? 52.385 -51.879 -85.964 1.00 60.86  ? 688  GLU A C    1 
ATOM   4804 O  O    . GLU A 1 694 ? 52.907 -52.799 -86.609 1.00 56.72  ? 688  GLU A O    1 
ATOM   4805 C  CB   . GLU A 1 694 ? 53.402 -50.150 -84.443 1.00 52.58  ? 688  GLU A CB   1 
ATOM   4806 C  CG   . GLU A 1 694 ? 52.483 -49.068 -84.922 1.00 56.74  ? 688  GLU A CG   1 
ATOM   4807 C  CD   . GLU A 1 694 ? 51.403 -48.718 -83.942 1.00 61.16  ? 688  GLU A CD   1 
ATOM   4808 O  OE1  . GLU A 1 694 ? 51.645 -48.832 -82.728 1.00 64.62  ? 688  GLU A OE1  1 
ATOM   4809 O  OE2  . GLU A 1 694 ? 50.288 -48.383 -84.384 1.00 64.82  ? 688  GLU A OE2  1 
ATOM   4810 N  N    . GLU A 1 695 ? 51.450 -51.094 -86.482 1.00 61.92  ? 689  GLU A N    1 
ATOM   4811 C  CA   . GLU A 1 695 ? 51.037 -51.180 -87.869 1.00 58.70  ? 689  GLU A CA   1 
ATOM   4812 C  C    . GLU A 1 695 ? 51.912 -50.251 -88.706 1.00 59.31  ? 689  GLU A C    1 
ATOM   4813 O  O    . GLU A 1 695 ? 52.056 -49.065 -88.375 1.00 57.10  ? 689  GLU A O    1 
ATOM   4814 C  CB   . GLU A 1 695 ? 49.561 -50.793 -88.007 1.00 58.92  ? 689  GLU A CB   1 
ATOM   4815 C  CG   . GLU A 1 695 ? 48.601 -51.632 -87.202 1.00 52.40  ? 689  GLU A CG   1 
ATOM   4816 C  CD   . GLU A 1 695 ? 48.921 -53.106 -87.293 1.00 57.92  ? 689  GLU A CD   1 
ATOM   4817 O  OE1  . GLU A 1 695 ? 49.473 -53.547 -88.304 1.00 74.00  ? 689  GLU A OE1  1 
ATOM   4818 O  OE2  . GLU A 1 695 ? 48.606 -53.858 -86.366 1.00 64.82  ? 689  GLU A OE2  1 
ATOM   4819 N  N    . MET A 1 696 ? 52.491 -50.786 -89.795 1.00 61.24  ? 690  MET A N    1 
ATOM   4820 C  CA   . MET A 1 696 ? 53.324 -49.955 -90.671 1.00 57.63  ? 690  MET A CA   1 
ATOM   4821 C  C    . MET A 1 696 ? 52.633 -48.667 -91.084 1.00 57.89  ? 690  MET A C    1 
ATOM   4822 O  O    . MET A 1 696 ? 53.296 -47.639 -91.246 1.00 56.69  ? 690  MET A O    1 
ATOM   4823 C  CB   . MET A 1 696 ? 53.743 -50.716 -91.915 1.00 56.17  ? 690  MET A CB   1 
ATOM   4824 C  CG   . MET A 1 696 ? 54.876 -51.675 -91.720 1.00 60.06  ? 690  MET A CG   1 
ATOM   4825 S  SD   . MET A 1 696 ? 56.352 -50.779 -91.233 1.00 65.43  ? 690  MET A SD   1 
ATOM   4826 C  CE   . MET A 1 696 ? 56.582 -49.647 -92.598 1.00 60.00  ? 690  MET A CE   1 
ATOM   4827 N  N    . ARG A 1 697 ? 51.313 -48.695 -91.275 1.00 57.91  ? 691  ARG A N    1 
ATOM   4828 C  CA   . ARG A 1 697 ? 50.619 -47.466 -91.637 1.00 59.28  ? 691  ARG A CA   1 
ATOM   4829 C  C    . ARG A 1 697 ? 50.683 -46.424 -90.540 1.00 57.88  ? 691  ARG A C    1 
ATOM   4830 O  O    . ARG A 1 697 ? 50.523 -45.235 -90.827 1.00 61.17  ? 691  ARG A O    1 
ATOM   4831 C  CB   . ARG A 1 697 ? 49.171 -47.766 -92.009 1.00 59.61  ? 691  ARG A CB   1 
ATOM   4832 C  CG   . ARG A 1 697 ? 48.437 -48.554 -90.976 1.00 63.05  ? 691  ARG A CG   1 
ATOM   4833 C  CD   . ARG A 1 697 ? 47.052 -48.922 -91.432 1.00 63.36  ? 691  ARG A CD   1 
ATOM   4834 N  NE   . ARG A 1 697 ? 46.421 -49.844 -90.493 1.00 68.04  ? 691  ARG A NE   1 
ATOM   4835 C  CZ   . ARG A 1 697 ? 45.725 -49.469 -89.426 1.00 75.99  ? 691  ARG A CZ   1 
ATOM   4836 N  NH1  . ARG A 1 697 ? 45.565 -48.177 -89.151 1.00 79.71  ? 691  ARG A NH1  1 
ATOM   4837 N  NH2  . ARG A 1 697 ? 45.194 -50.391 -88.631 1.00 73.89  ? 691  ARG A NH2  1 
ATOM   4838 N  N    . ASN A 1 698 ? 50.898 -46.838 -89.295 1.00 63.28  ? 692  ASN A N    1 
ATOM   4839 C  CA   . ASN A 1 698 ? 51.008 -45.904 -88.182 1.00 59.05  ? 692  ASN A CA   1 
ATOM   4840 C  C    . ASN A 1 698 ? 52.437 -45.459 -87.899 1.00 54.70  ? 692  ASN A C    1 
ATOM   4841 O  O    . ASN A 1 698 ? 52.613 -44.430 -87.237 1.00 55.27  ? 692  ASN A O    1 
ATOM   4842 C  CB   . ASN A 1 698 ? 50.386 -46.533 -86.940 1.00 58.16  ? 692  ASN A CB   1 
ATOM   4843 C  CG   . ASN A 1 698 ? 48.879 -46.508 -86.982 1.00 64.76  ? 692  ASN A CG   1 
ATOM   4844 O  OD1  . ASN A 1 698 ? 48.277 -45.560 -87.482 1.00 65.57  ? 692  ASN A OD1  1 
ATOM   4845 N  ND2  . ASN A 1 698 ? 48.257 -47.583 -86.518 1.00 68.43  ? 692  ASN A ND2  1 
ATOM   4846 N  N    . VAL A 1 699 ? 53.441 -46.150 -88.444 1.00 49.91  ? 693  VAL A N    1 
ATOM   4847 C  CA   . VAL A 1 699 ? 54.836 -45.752 -88.304 1.00 49.19  ? 693  VAL A CA   1 
ATOM   4848 C  C    . VAL A 1 699 ? 55.139 -44.859 -89.504 1.00 56.12  ? 693  VAL A C    1 
ATOM   4849 O  O    . VAL A 1 699 ? 55.546 -45.340 -90.561 1.00 55.81  ? 693  VAL A O    1 
ATOM   4850 C  CB   . VAL A 1 699 ? 55.766 -46.970 -88.312 1.00 47.54  ? 693  VAL A CB   1 
ATOM   4851 C  CG1  . VAL A 1 699 ? 57.200 -46.574 -88.024 1.00 46.30  ? 693  VAL A CG1  1 
ATOM   4852 C  CG2  . VAL A 1 699 ? 55.262 -48.092 -87.447 1.00 49.05  ? 693  VAL A CG2  1 
ATOM   4853 N  N    . GLU A 1 700 ? 55.099 -43.546 -89.307 1.00 58.14  ? 694  GLU A N    1 
ATOM   4854 C  CA   . GLU A 1 700 ? 55.308 -42.664 -90.443 1.00 48.48  ? 694  GLU A CA   1 
ATOM   4855 C  C    . GLU A 1 700 ? 56.786 -42.472 -90.768 1.00 53.49  ? 694  GLU A C    1 
ATOM   4856 O  O    . GLU A 1 700 ? 57.137 -42.239 -91.925 1.00 66.69  ? 694  GLU A O    1 
ATOM   4857 C  CB   . GLU A 1 700 ? 54.617 -41.340 -90.188 1.00 48.47  ? 694  GLU A CB   1 
ATOM   4858 C  CG   . GLU A 1 700 ? 53.137 -41.537 -89.994 1.00 49.33  ? 694  GLU A CG   1 
ATOM   4859 C  CD   . GLU A 1 700 ? 52.389 -40.226 -89.788 1.00 66.21  ? 694  GLU A CD   1 
ATOM   4860 O  OE1  . GLU A 1 700 ? 53.037 -39.149 -89.744 1.00 69.58  ? 694  GLU A OE1  1 
ATOM   4861 O  OE2  . GLU A 1 700 ? 51.146 -40.271 -89.637 1.00 66.71  ? 694  GLU A OE2  1 
ATOM   4862 N  N    . LEU A 1 701 ? 57.673 -42.607 -89.792 1.00 57.79  ? 695  LEU A N    1 
ATOM   4863 C  CA   . LEU A 1 701 ? 59.099 -42.454 -90.056 1.00 56.19  ? 695  LEU A CA   1 
ATOM   4864 C  C    . LEU A 1 701 ? 59.657 -43.537 -90.982 1.00 51.23  ? 695  LEU A C    1 
ATOM   4865 O  O    . LEU A 1 701 ? 60.826 -43.452 -91.370 1.00 51.26  ? 695  LEU A O    1 
ATOM   4866 C  CB   . LEU A 1 701 ? 59.862 -42.414 -88.722 1.00 45.31  ? 695  LEU A CB   1 
ATOM   4867 C  CG   . LEU A 1 701 ? 59.871 -41.000 -88.137 1.00 50.13  ? 695  LEU A CG   1 
ATOM   4868 C  CD1  . LEU A 1 701 ? 58.469 -40.553 -87.793 1.00 51.40  ? 695  LEU A CD1  1 
ATOM   4869 C  CD2  . LEU A 1 701 ? 60.783 -40.881 -86.928 1.00 59.02  ? 695  LEU A CD2  1 
ATOM   4870 N  N    . VAL A 1 702 ? 58.879 -44.552 -91.334 1.00 49.53  ? 696  VAL A N    1 
ATOM   4871 C  CA   . VAL A 1 702 ? 59.301 -45.542 -92.318 1.00 53.88  ? 696  VAL A CA   1 
ATOM   4872 C  C    . VAL A 1 702 ? 58.224 -45.681 -93.378 1.00 57.80  ? 696  VAL A C    1 
ATOM   4873 O  O    . VAL A 1 702 ? 57.061 -45.959 -93.057 1.00 59.51  ? 696  VAL A O    1 
ATOM   4874 C  CB   . VAL A 1 702 ? 59.614 -46.904 -91.697 1.00 52.16  ? 696  VAL A CB   1 
ATOM   4875 C  CG1  . VAL A 1 702 ? 59.670 -47.942 -92.790 1.00 50.48  ? 696  VAL A CG1  1 
ATOM   4876 C  CG2  . VAL A 1 702 ? 60.943 -46.831 -91.012 1.00 54.50  ? 696  VAL A CG2  1 
ATOM   4877 N  N    . GLU A 1 703 ? 58.617 -45.507 -94.639 1.00 63.40  ? 697  GLU A N    1 
ATOM   4878 C  CA   . GLU A 1 703 ? 57.663 -45.520 -95.736 1.00 58.73  ? 697  GLU A CA   1 
ATOM   4879 C  C    . GLU A 1 703 ? 57.059 -46.908 -95.899 1.00 59.13  ? 697  GLU A C    1 
ATOM   4880 O  O    . GLU A 1 703 ? 57.753 -47.930 -95.830 1.00 57.87  ? 697  GLU A O    1 
ATOM   4881 C  CB   . GLU A 1 703 ? 58.339 -45.079 -97.037 1.00 58.71  ? 697  GLU A CB   1 
ATOM   4882 N  N    . GLY A 1 704 ? 55.777 -46.929 -96.180 1.00 55.63  ? 698  GLY A N    1 
ATOM   4883 C  CA   . GLY A 1 704 ? 55.049 -48.136 -96.495 1.00 57.46  ? 698  GLY A CA   1 
ATOM   4884 C  C    . GLY A 1 704 ? 54.086 -48.526 -95.397 1.00 64.88  ? 698  GLY A C    1 
ATOM   4885 O  O    . GLY A 1 704 ? 54.304 -48.262 -94.205 1.00 68.90  ? 698  GLY A O    1 
ATOM   4886 N  N    . GLU A 1 705 ? 52.955 -49.083 -95.819 1.00 63.03  ? 699  GLU A N    1 
ATOM   4887 C  CA   . GLU A 1 705 ? 51.837 -49.360 -94.937 1.00 62.64  ? 699  GLU A CA   1 
ATOM   4888 C  C    . GLU A 1 705 ? 51.561 -50.839 -94.702 1.00 65.37  ? 699  GLU A C    1 
ATOM   4889 O  O    . GLU A 1 705 ? 50.560 -51.172 -94.064 1.00 70.60  ? 699  GLU A O    1 
ATOM   4890 C  CB   . GLU A 1 705 ? 50.620 -48.611 -95.452 1.00 62.48  ? 699  GLU A CB   1 
ATOM   4891 C  CG   . GLU A 1 705 ? 50.998 -47.141 -95.521 1.00 62.83  ? 699  GLU A CG   1 
ATOM   4892 C  CD   . GLU A 1 705 ? 49.824 -46.253 -95.722 1.00 74.30  ? 699  GLU A CD   1 
ATOM   4893 O  OE1  . GLU A 1 705 ? 48.709 -46.787 -95.931 1.00 77.33  ? 699  GLU A OE1  1 
ATOM   4894 O  OE2  . GLU A 1 705 ? 50.016 -45.020 -95.642 1.00 77.59  ? 699  GLU A OE2  1 
ATOM   4895 N  N    . GLU A 1 706 ? 52.385 -51.738 -95.207 1.00 64.97  ? 700  GLU A N    1 
ATOM   4896 C  CA   . GLU A 1 706 ? 52.066 -53.159 -95.142 1.00 69.64  ? 700  GLU A CA   1 
ATOM   4897 C  C    . GLU A 1 706 ? 52.802 -53.810 -93.979 1.00 67.18  ? 700  GLU A C    1 
ATOM   4898 O  O    . GLU A 1 706 ? 54.036 -53.768 -93.918 1.00 73.43  ? 700  GLU A O    1 
ATOM   4899 C  CB   . GLU A 1 706 ? 52.417 -53.864 -96.454 1.00 78.66  ? 700  GLU A CB   1 
ATOM   4900 N  N    . GLY A 1 707 ? 52.044 -54.418 -93.076 1.00 66.75  ? 701  GLY A N    1 
ATOM   4901 C  CA   . GLY A 1 707 ? 52.590 -55.296 -92.058 1.00 62.29  ? 701  GLY A CA   1 
ATOM   4902 C  C    . GLY A 1 707 ? 52.808 -54.635 -90.711 1.00 65.68  ? 701  GLY A C    1 
ATOM   4903 O  O    . GLY A 1 707 ? 52.255 -53.582 -90.375 1.00 60.20  ? 701  GLY A O    1 
ATOM   4904 N  N    . ARG A 1 708 ? 53.650 -55.288 -89.922 1.00 65.08  ? 702  ARG A N    1 
ATOM   4905 C  CA   . ARG A 1 708 ? 53.949 -54.847 -88.574 1.00 61.09  ? 702  ARG A CA   1 
ATOM   4906 C  C    . ARG A 1 708 ? 55.385 -54.345 -88.520 1.00 58.67  ? 702  ARG A C    1 
ATOM   4907 O  O    . ARG A 1 708 ? 56.258 -54.843 -89.235 1.00 56.92  ? 702  ARG A O    1 
ATOM   4908 C  CB   . ARG A 1 708 ? 53.831 -55.991 -87.568 1.00 64.92  ? 702  ARG A CB   1 
ATOM   4909 C  CG   . ARG A 1 708 ? 52.617 -56.899 -87.616 1.00 63.25  ? 702  ARG A CG   1 
ATOM   4910 C  CD   . ARG A 1 708 ? 51.293 -56.299 -87.246 1.00 62.60  ? 702  ARG A CD   1 
ATOM   4911 N  NE   . ARG A 1 708 ? 50.401 -57.438 -87.011 1.00 70.35  ? 702  ARG A NE   1 
ATOM   4912 C  CZ   . ARG A 1 708 ? 49.077 -57.384 -86.905 1.00 68.61  ? 702  ARG A CZ   1 
ATOM   4913 N  NH1  . ARG A 1 708 ? 48.436 -56.230 -87.044 1.00 68.84  ? 702  ARG A NH1  1 
ATOM   4914 N  NH2  . ARG A 1 708 ? 48.397 -58.500 -86.681 1.00 57.68  ? 702  ARG A NH2  1 
ATOM   4915 N  N    . MET A 1 709 ? 55.641 -53.388 -87.637 1.00 55.73  ? 703  MET A N    1 
ATOM   4916 C  CA   . MET A 1 709 ? 57.002 -53.182 -87.165 1.00 57.93  ? 703  MET A CA   1 
ATOM   4917 C  C    . MET A 1 709 ? 57.022 -53.060 -85.642 1.00 56.45  ? 703  MET A C    1 
ATOM   4918 O  O    . MET A 1 709 ? 56.154 -52.421 -85.038 1.00 52.96  ? 703  MET A O    1 
ATOM   4919 C  CB   . MET A 1 709 ? 57.649 -51.958 -87.796 1.00 52.38  ? 703  MET A CB   1 
ATOM   4920 C  CG   . MET A 1 709 ? 59.117 -51.860 -87.430 1.00 54.55  ? 703  MET A CG   1 
ATOM   4921 S  SD   . MET A 1 709 ? 60.016 -50.604 -88.352 1.00 63.77  ? 703  MET A SD   1 
ATOM   4922 C  CE   . MET A 1 709 ? 60.122 -51.450 -89.924 1.00 51.75  ? 703  MET A CE   1 
ATOM   4923 N  N    . CYS A 1 710 ? 58.009 -53.690 -85.023 1.00 53.21  ? 704  CYS A N    1 
ATOM   4924 C  CA   . CYS A 1 710 ? 58.264 -53.420 -83.622 1.00 48.78  ? 704  CYS A CA   1 
ATOM   4925 C  C    . CYS A 1 710 ? 58.817 -52.011 -83.479 1.00 49.56  ? 704  CYS A C    1 
ATOM   4926 O  O    . CYS A 1 710 ? 59.628 -51.569 -84.293 1.00 51.54  ? 704  CYS A O    1 
ATOM   4927 C  CB   . CYS A 1 710 ? 59.237 -54.441 -83.045 1.00 43.76  ? 704  CYS A CB   1 
ATOM   4928 S  SG   . CYS A 1 710 ? 59.455 -54.221 -81.257 1.00 57.35  ? 704  CYS A SG   1 
ATOM   4929 N  N    . VAL A 1 711 ? 58.372 -51.298 -82.444 1.00 50.74  ? 705  VAL A N    1 
ATOM   4930 C  CA   . VAL A 1 711 ? 58.823 -49.939 -82.184 1.00 48.76  ? 705  VAL A CA   1 
ATOM   4931 C  C    . VAL A 1 711 ? 59.296 -49.844 -80.735 1.00 52.85  ? 705  VAL A C    1 
ATOM   4932 O  O    . VAL A 1 711 ? 58.522 -50.070 -79.798 1.00 51.01  ? 705  VAL A O    1 
ATOM   4933 C  CB   . VAL A 1 711 ? 57.731 -48.895 -82.475 1.00 47.22  ? 705  VAL A CB   1 
ATOM   4934 C  CG1  . VAL A 1 711 ? 57.317 -48.976 -83.921 1.00 47.73  ? 705  VAL A CG1  1 
ATOM   4935 C  CG2  . VAL A 1 711 ? 56.551 -49.110 -81.611 1.00 44.50  ? 705  VAL A CG2  1 
ATOM   4936 N  N    . ASN A 1 712 ? 60.562 -49.503 -80.562 1.00 52.69  ? 706  ASN A N    1 
ATOM   4937 C  CA   . ASN A 1 712 ? 61.126 -49.207 -79.259 1.00 46.46  ? 706  ASN A CA   1 
ATOM   4938 C  C    . ASN A 1 712 ? 60.507 -47.915 -78.747 1.00 51.00  ? 706  ASN A C    1 
ATOM   4939 O  O    . ASN A 1 712 ? 60.720 -46.856 -79.340 1.00 52.13  ? 706  ASN A O    1 
ATOM   4940 C  CB   . ASN A 1 712 ? 62.631 -49.057 -79.442 1.00 43.72  ? 706  ASN A CB   1 
ATOM   4941 C  CG   . ASN A 1 712 ? 63.368 -48.754 -78.181 1.00 51.36  ? 706  ASN A CG   1 
ATOM   4942 O  OD1  . ASN A 1 712 ? 62.779 -48.456 -77.123 1.00 55.29  ? 706  ASN A OD1  1 
ATOM   4943 N  ND2  . ASN A 1 712 ? 64.687 -48.730 -78.298 1.00 46.77  ? 706  ASN A ND2  1 
ATOM   4944 N  N    . MET A 1 713 ? 59.801 -47.969 -77.612 1.00 46.89  ? 707  MET A N    1 
ATOM   4945 C  CA   . MET A 1 713 ? 59.047 -46.783 -77.231 1.00 44.24  ? 707  MET A CA   1 
ATOM   4946 C  C    . MET A 1 713 ? 59.937 -45.739 -76.600 1.00 46.20  ? 707  MET A C    1 
ATOM   4947 O  O    . MET A 1 713 ? 59.606 -44.552 -76.624 1.00 49.02  ? 707  MET A O    1 
ATOM   4948 C  CB   . MET A 1 713 ? 57.922 -47.119 -76.255 1.00 43.28  ? 707  MET A CB   1 
ATOM   4949 C  CG   . MET A 1 713 ? 56.791 -47.928 -76.800 1.00 47.97  ? 707  MET A CG   1 
ATOM   4950 S  SD   . MET A 1 713 ? 55.541 -48.172 -75.535 1.00 47.97  ? 707  MET A SD   1 
ATOM   4951 C  CE   . MET A 1 713 ? 54.949 -46.507 -75.279 1.00 44.34  ? 707  MET A CE   1 
ATOM   4952 N  N    . GLU A 1 714 ? 61.047 -46.156 -76.011 1.00 45.21  ? 708  GLU A N    1 
ATOM   4953 C  CA   . GLU A 1 714 ? 61.762 -45.308 -75.069 1.00 45.39  ? 708  GLU A CA   1 
ATOM   4954 C  C    . GLU A 1 714 ? 60.799 -44.646 -74.065 1.00 47.69  ? 708  GLU A C    1 
ATOM   4955 O  O    . GLU A 1 714 ? 60.838 -43.438 -73.820 1.00 51.55  ? 708  GLU A O    1 
ATOM   4956 C  CB   . GLU A 1 714 ? 62.613 -44.289 -75.815 1.00 37.14  ? 708  GLU A CB   1 
ATOM   4957 C  CG   . GLU A 1 714 ? 63.844 -44.925 -76.428 1.00 43.31  ? 708  GLU A CG   1 
ATOM   4958 C  CD   . GLU A 1 714 ? 64.849 -45.479 -75.406 1.00 48.01  ? 708  GLU A CD   1 
ATOM   4959 O  OE1  . GLU A 1 714 ? 65.122 -44.810 -74.379 1.00 47.91  ? 708  GLU A OE1  1 
ATOM   4960 O  OE2  . GLU A 1 714 ? 65.396 -46.578 -75.647 1.00 49.89  ? 708  GLU A OE2  1 
ATOM   4961 N  N    . TRP A 1 715 ? 59.950 -45.465 -73.435 1.00 41.34  ? 709  TRP A N    1 
ATOM   4962 C  CA   . TRP A 1 715 ? 58.821 -44.908 -72.688 1.00 48.86  ? 709  TRP A CA   1 
ATOM   4963 C  C    . TRP A 1 715 ? 59.265 -44.249 -71.377 1.00 48.77  ? 709  TRP A C    1 
ATOM   4964 O  O    . TRP A 1 715 ? 58.538 -43.408 -70.831 1.00 46.76  ? 709  TRP A O    1 
ATOM   4965 C  CB   . TRP A 1 715 ? 57.800 -46.028 -72.486 1.00 45.28  ? 709  TRP A CB   1 
ATOM   4966 C  CG   . TRP A 1 715 ? 57.829 -46.836 -71.248 1.00 48.50  ? 709  TRP A CG   1 
ATOM   4967 C  CD1  . TRP A 1 715 ? 58.893 -47.092 -70.422 1.00 48.39  ? 709  TRP A CD1  1 
ATOM   4968 C  CD2  . TRP A 1 715 ? 56.821 -47.785 -70.883 1.00 51.87  ? 709  TRP A CD2  1 
ATOM   4969 N  NE1  . TRP A 1 715 ? 58.529 -47.988 -69.445 1.00 46.64  ? 709  TRP A NE1  1 
ATOM   4970 C  CE2  . TRP A 1 715 ? 57.270 -48.450 -69.720 1.00 48.34  ? 709  TRP A CE2  1 
ATOM   4971 C  CE3  . TRP A 1 715 ? 55.546 -48.083 -71.386 1.00 46.53  ? 709  TRP A CE3  1 
ATOM   4972 C  CZ2  . TRP A 1 715 ? 56.497 -49.396 -69.059 1.00 44.68  ? 709  TRP A CZ2  1 
ATOM   4973 C  CZ3  . TRP A 1 715 ? 54.774 -49.018 -70.723 1.00 48.15  ? 709  TRP A CZ3  1 
ATOM   4974 C  CH2  . TRP A 1 715 ? 55.257 -49.667 -69.568 1.00 48.38  ? 709  TRP A CH2  1 
ATOM   4975 N  N    . GLY A 1 716 ? 60.474 -44.558 -70.907 1.00 45.04  ? 710  GLY A N    1 
ATOM   4976 C  CA   . GLY A 1 716 ? 61.029 -43.864 -69.769 1.00 44.72  ? 710  GLY A CA   1 
ATOM   4977 C  C    . GLY A 1 716 ? 61.064 -42.356 -69.917 1.00 49.69  ? 710  GLY A C    1 
ATOM   4978 O  O    . GLY A 1 716 ? 61.200 -41.655 -68.913 1.00 47.69  ? 710  GLY A O    1 
ATOM   4979 N  N    . ALA A 1 717 ? 60.953 -41.823 -71.139 1.00 50.24  ? 711  ALA A N    1 
ATOM   4980 C  CA   . ALA A 1 717 ? 61.000 -40.370 -71.262 1.00 47.31  ? 711  ALA A CA   1 
ATOM   4981 C  C    . ALA A 1 717 ? 59.620 -39.743 -71.239 1.00 46.73  ? 711  ALA A C    1 
ATOM   4982 O  O    . ALA A 1 717 ? 59.497 -38.517 -71.311 1.00 45.21  ? 711  ALA A O    1 
ATOM   4983 C  CB   . ALA A 1 717 ? 61.759 -39.964 -72.506 1.00 45.13  ? 711  ALA A CB   1 
ATOM   4984 N  N    . PHE A 1 718 ? 58.593 -40.560 -71.079 1.00 47.02  ? 712  PHE A N    1 
ATOM   4985 C  CA   . PHE A 1 718 ? 57.246 -40.080 -70.816 1.00 48.57  ? 712  PHE A CA   1 
ATOM   4986 C  C    . PHE A 1 718 ? 57.241 -39.158 -69.604 1.00 52.46  ? 712  PHE A C    1 
ATOM   4987 O  O    . PHE A 1 718 ? 57.730 -39.521 -68.530 1.00 55.09  ? 712  PHE A O    1 
ATOM   4988 C  CB   . PHE A 1 718 ? 56.356 -41.321 -70.629 1.00 47.12  ? 712  PHE A CB   1 
ATOM   4989 C  CG   . PHE A 1 718 ? 54.939 -41.041 -70.195 1.00 53.56  ? 712  PHE A CG   1 
ATOM   4990 C  CD1  . PHE A 1 718 ? 54.128 -40.173 -70.914 1.00 54.51  ? 712  PHE A CD1  1 
ATOM   4991 C  CD2  . PHE A 1 718 ? 54.359 -41.806 -69.183 1.00 51.05  ? 712  PHE A CD2  1 
ATOM   4992 C  CE1  . PHE A 1 718 ? 52.816 -39.956 -70.538 1.00 54.37  ? 712  PHE A CE1  1 
ATOM   4993 C  CE2  . PHE A 1 718 ? 53.039 -41.618 -68.820 1.00 50.33  ? 712  PHE A CE2  1 
ATOM   4994 C  CZ   . PHE A 1 718 ? 52.265 -40.691 -69.491 1.00 53.54  ? 712  PHE A CZ   1 
ATOM   4995 N  N    . GLY A 1 719 ? 56.723 -37.945 -69.777 1.00 54.37  ? 713  GLY A N    1 
ATOM   4996 C  CA   . GLY A 1 719 ? 56.798 -36.929 -68.740 1.00 51.15  ? 713  GLY A CA   1 
ATOM   4997 C  C    . GLY A 1 719 ? 57.962 -35.966 -68.873 1.00 56.16  ? 713  GLY A C    1 
ATOM   4998 O  O    . GLY A 1 719 ? 58.123 -35.079 -68.024 1.00 53.26  ? 713  GLY A O    1 
ATOM   4999 N  N    . ASP A 1 720 ? 58.791 -36.111 -69.905 1.00 58.10  ? 714  ASP A N    1 
ATOM   5000 C  CA   . ASP A 1 720 ? 59.826 -35.111 -70.099 1.00 57.74  ? 714  ASP A CA   1 
ATOM   5001 C  C    . ASP A 1 720 ? 59.259 -33.799 -70.631 1.00 60.60  ? 714  ASP A C    1 
ATOM   5002 O  O    . ASP A 1 720 ? 59.926 -32.766 -70.516 1.00 63.80  ? 714  ASP A O    1 
ATOM   5003 C  CB   . ASP A 1 720 ? 60.914 -35.650 -71.022 1.00 54.81  ? 714  ASP A CB   1 
ATOM   5004 C  CG   . ASP A 1 720 ? 61.730 -36.749 -70.373 1.00 58.14  ? 714  ASP A CG   1 
ATOM   5005 O  OD1  . ASP A 1 720 ? 61.609 -36.921 -69.137 1.00 56.50  ? 714  ASP A OD1  1 
ATOM   5006 O  OD2  . ASP A 1 720 ? 62.500 -37.432 -71.097 1.00 63.05  ? 714  ASP A OD2  1 
ATOM   5007 N  N    . ASN A 1 721 ? 58.049 -33.811 -71.199 1.00 57.88  ? 715  ASN A N    1 
ATOM   5008 C  CA   . ASN A 1 721 ? 57.388 -32.601 -71.675 1.00 58.98  ? 715  ASN A CA   1 
ATOM   5009 C  C    . ASN A 1 721 ? 56.454 -31.980 -70.640 1.00 61.35  ? 715  ASN A C    1 
ATOM   5010 O  O    . ASN A 1 721 ? 55.730 -31.035 -70.966 1.00 65.59  ? 715  ASN A O    1 
ATOM   5011 C  CB   . ASN A 1 721 ? 56.624 -32.875 -72.977 1.00 54.98  ? 715  ASN A CB   1 
ATOM   5012 C  CG   . ASN A 1 721 ? 55.502 -33.894 -72.817 1.00 64.76  ? 715  ASN A CG   1 
ATOM   5013 O  OD1  . ASN A 1 721 ? 55.354 -34.521 -71.762 1.00 66.39  ? 715  ASN A OD1  1 
ATOM   5014 N  ND2  . ASN A 1 721 ? 54.735 -34.105 -73.896 1.00 64.35  ? 715  ASN A ND2  1 
ATOM   5015 N  N    . GLY A 1 722 ? 56.436 -32.496 -69.416 1.00 56.58  ? 716  GLY A N    1 
ATOM   5016 C  CA   . GLY A 1 722 ? 55.593 -31.974 -68.364 1.00 55.96  ? 716  GLY A CA   1 
ATOM   5017 C  C    . GLY A 1 722 ? 54.336 -32.772 -68.090 1.00 58.09  ? 716  GLY A C    1 
ATOM   5018 O  O    . GLY A 1 722 ? 53.674 -32.521 -67.075 1.00 55.54  ? 716  GLY A O    1 
ATOM   5019 N  N    . CYS A 1 723 ? 53.996 -33.744 -68.936 1.00 55.98  ? 717  CYS A N    1 
ATOM   5020 C  CA   . CYS A 1 723 ? 52.660 -34.316 -68.833 1.00 61.96  ? 717  CYS A CA   1 
ATOM   5021 C  C    . CYS A 1 723 ? 52.420 -35.118 -67.551 1.00 57.22  ? 717  CYS A C    1 
ATOM   5022 O  O    . CYS A 1 723 ? 51.275 -35.502 -67.304 1.00 62.64  ? 717  CYS A O    1 
ATOM   5023 C  CB   . CYS A 1 723 ? 52.347 -35.195 -70.048 1.00 61.55  ? 717  CYS A CB   1 
ATOM   5024 S  SG   . CYS A 1 723 ? 53.392 -36.644 -70.294 1.00 63.35  ? 717  CYS A SG   1 
ATOM   5025 N  N    . LEU A 1 724 ? 53.441 -35.440 -66.763 1.00 57.43  ? 718  LEU A N    1 
ATOM   5026 C  CA   . LEU A 1 724 ? 53.206 -36.102 -65.482 1.00 56.29  ? 718  LEU A CA   1 
ATOM   5027 C  C    . LEU A 1 724 ? 53.294 -35.166 -64.271 1.00 58.70  ? 718  LEU A C    1 
ATOM   5028 O  O    . LEU A 1 724 ? 53.085 -35.624 -63.151 1.00 57.50  ? 718  LEU A O    1 
ATOM   5029 C  CB   . LEU A 1 724 ? 54.159 -37.295 -65.312 1.00 53.27  ? 718  LEU A CB   1 
ATOM   5030 C  CG   . LEU A 1 724 ? 53.864 -38.524 -66.190 1.00 52.15  ? 718  LEU A CG   1 
ATOM   5031 C  CD1  . LEU A 1 724 ? 54.945 -39.614 -66.113 1.00 47.82  ? 718  LEU A CD1  1 
ATOM   5032 C  CD2  . LEU A 1 724 ? 52.495 -39.117 -65.863 1.00 51.15  ? 718  LEU A CD2  1 
ATOM   5033 N  N    . ASP A 1 725 ? 53.574 -33.871 -64.465 1.00 60.20  ? 719  ASP A N    1 
ATOM   5034 C  CA   . ASP A 1 725 ? 53.921 -32.992 -63.346 1.00 55.29  ? 719  ASP A CA   1 
ATOM   5035 C  C    . ASP A 1 725 ? 52.874 -32.973 -62.236 1.00 63.92  ? 719  ASP A C    1 
ATOM   5036 O  O    . ASP A 1 725 ? 53.220 -32.799 -61.057 1.00 63.15  ? 719  ASP A O    1 
ATOM   5037 C  CB   . ASP A 1 725 ? 54.159 -31.566 -63.839 1.00 52.78  ? 719  ASP A CB   1 
ATOM   5038 C  CG   . ASP A 1 725 ? 55.466 -31.421 -64.566 1.00 63.04  ? 719  ASP A CG   1 
ATOM   5039 O  OD1  . ASP A 1 725 ? 56.286 -32.350 -64.451 1.00 70.88  ? 719  ASP A OD1  1 
ATOM   5040 O  OD2  . ASP A 1 725 ? 55.685 -30.388 -65.240 1.00 67.84  ? 719  ASP A OD2  1 
ATOM   5041 N  N    . ASP A 1 726 ? 51.601 -33.127 -62.566 1.00 63.25  ? 720  ASP A N    1 
ATOM   5042 C  CA   . ASP A 1 726 ? 50.602 -33.037 -61.507 1.00 67.60  ? 720  ASP A CA   1 
ATOM   5043 C  C    . ASP A 1 726 ? 50.350 -34.370 -60.794 1.00 64.44  ? 720  ASP A C    1 
ATOM   5044 O  O    . ASP A 1 726 ? 49.476 -34.429 -59.929 1.00 67.38  ? 720  ASP A O    1 
ATOM   5045 C  CB   . ASP A 1 726 ? 49.298 -32.439 -62.067 1.00 67.00  ? 720  ASP A CB   1 
ATOM   5046 C  CG   . ASP A 1 726 ? 48.677 -33.292 -63.150 1.00 72.19  ? 720  ASP A CG   1 
ATOM   5047 O  OD1  . ASP A 1 726 ? 49.030 -34.492 -63.224 1.00 68.37  ? 720  ASP A OD1  1 
ATOM   5048 O  OD2  . ASP A 1 726 ? 47.876 -32.748 -63.953 1.00 76.21  ? 720  ASP A OD2  1 
ATOM   5049 N  N    . PHE A 1 727 ? 51.030 -35.448 -61.184 1.00 60.51  ? 721  PHE A N    1 
ATOM   5050 C  CA   . PHE A 1 727 ? 51.163 -36.647 -60.370 1.00 51.95  ? 721  PHE A CA   1 
ATOM   5051 C  C    . PHE A 1 727 ? 52.530 -36.768 -59.704 1.00 57.92  ? 721  PHE A C    1 
ATOM   5052 O  O    . PHE A 1 727 ? 52.841 -37.823 -59.151 1.00 59.48  ? 721  PHE A O    1 
ATOM   5053 C  CB   . PHE A 1 727 ? 50.883 -37.902 -61.182 1.00 53.91  ? 721  PHE A CB   1 
ATOM   5054 C  CG   . PHE A 1 727 ? 49.550 -37.893 -61.857 1.00 61.38  ? 721  PHE A CG   1 
ATOM   5055 C  CD1  . PHE A 1 727 ? 48.380 -37.983 -61.117 1.00 64.85  ? 721  PHE A CD1  1 
ATOM   5056 C  CD2  . PHE A 1 727 ? 49.464 -37.843 -63.242 1.00 55.62  ? 721  PHE A CD2  1 
ATOM   5057 C  CE1  . PHE A 1 727 ? 47.140 -37.979 -61.748 1.00 63.16  ? 721  PHE A CE1  1 
ATOM   5058 C  CE2  . PHE A 1 727 ? 48.245 -37.847 -63.876 1.00 59.52  ? 721  PHE A CE2  1 
ATOM   5059 C  CZ   . PHE A 1 727 ? 47.078 -37.921 -63.135 1.00 62.16  ? 721  PHE A CZ   1 
ATOM   5060 N  N    . ARG A 1 728 ? 53.386 -35.764 -59.798 1.00 57.25  ? 722  ARG A N    1 
ATOM   5061 C  CA   . ARG A 1 728 ? 54.717 -35.895 -59.224 1.00 57.39  ? 722  ARG A CA   1 
ATOM   5062 C  C    . ARG A 1 728 ? 54.824 -35.166 -57.888 1.00 62.61  ? 722  ARG A C    1 
ATOM   5063 O  O    . ARG A 1 728 ? 54.240 -34.091 -57.694 1.00 63.38  ? 722  ARG A O    1 
ATOM   5064 C  CB   . ARG A 1 728 ? 55.770 -35.407 -60.220 1.00 59.55  ? 722  ARG A CB   1 
ATOM   5065 C  CG   . ARG A 1 728 ? 55.709 -36.266 -61.483 1.00 61.88  ? 722  ARG A CG   1 
ATOM   5066 C  CD   . ARG A 1 728 ? 56.698 -35.930 -62.540 1.00 56.34  ? 722  ARG A CD   1 
ATOM   5067 N  NE   . ARG A 1 728 ? 58.058 -36.260 -62.163 1.00 55.66  ? 722  ARG A NE   1 
ATOM   5068 C  CZ   . ARG A 1 728 ? 58.999 -35.343 -61.996 1.00 62.95  ? 722  ARG A CZ   1 
ATOM   5069 N  NH1  . ARG A 1 728 ? 60.233 -35.721 -61.666 1.00 62.13  ? 722  ARG A NH1  1 
ATOM   5070 N  NH2  . ARG A 1 728 ? 58.704 -34.050 -62.181 1.00 58.95  ? 722  ARG A NH2  1 
ATOM   5071 N  N    . THR A 1 729 ? 55.557 -35.771 -56.959 1.00 53.94  ? 723  THR A N    1 
ATOM   5072 C  CA   . THR A 1 729 ? 55.695 -35.200 -55.637 1.00 54.72  ? 723  THR A CA   1 
ATOM   5073 C  C    . THR A 1 729 ? 56.992 -34.403 -55.550 1.00 54.27  ? 723  THR A C    1 
ATOM   5074 O  O    . THR A 1 729 ? 57.819 -34.418 -56.457 1.00 57.27  ? 723  THR A O    1 
ATOM   5075 C  CB   . THR A 1 729 ? 55.671 -36.304 -54.581 1.00 57.87  ? 723  THR A CB   1 
ATOM   5076 O  OG1  . THR A 1 729 ? 56.819 -37.146 -54.748 1.00 58.41  ? 723  THR A OG1  1 
ATOM   5077 C  CG2  . THR A 1 729 ? 54.406 -37.147 -54.719 1.00 51.21  ? 723  THR A CG2  1 
ATOM   5078 N  N    . GLU A 1 730 ? 57.191 -33.733 -54.415 1.00 55.56  ? 724  GLU A N    1 
ATOM   5079 C  CA   . GLU A 1 730 ? 58.456 -33.049 -54.171 1.00 55.64  ? 724  GLU A CA   1 
ATOM   5080 C  C    . GLU A 1 730 ? 59.640 -34.009 -54.199 1.00 58.71  ? 724  GLU A C    1 
ATOM   5081 O  O    . GLU A 1 730 ? 60.761 -33.606 -54.534 1.00 58.11  ? 724  GLU A O    1 
ATOM   5082 C  CB   . GLU A 1 730 ? 58.410 -32.338 -52.827 1.00 58.69  ? 724  GLU A CB   1 
ATOM   5083 C  CG   . GLU A 1 730 ? 58.028 -33.267 -51.669 1.00 64.43  ? 724  GLU A CG   1 
ATOM   5084 C  CD   . GLU A 1 730 ? 58.067 -32.588 -50.307 1.00 68.33  ? 724  GLU A CD   1 
ATOM   5085 O  OE1  . GLU A 1 730 ? 58.953 -31.726 -50.075 1.00 67.50  ? 724  GLU A OE1  1 
ATOM   5086 O  OE2  . GLU A 1 730 ? 57.150 -32.864 -49.499 1.00 74.13  ? 724  GLU A OE2  1 
ATOM   5087 N  N    . PHE A 1 731 ? 59.421 -35.274 -53.838 1.00 54.87  ? 725  PHE A N    1 
ATOM   5088 C  CA   . PHE A 1 731 ? 60.536 -36.212 -53.781 1.00 55.29  ? 725  PHE A CA   1 
ATOM   5089 C  C    . PHE A 1 731 ? 60.942 -36.661 -55.175 1.00 56.51  ? 725  PHE A C    1 
ATOM   5090 O  O    . PHE A 1 731 ? 62.117 -36.959 -55.414 1.00 55.13  ? 725  PHE A O    1 
ATOM   5091 C  CB   . PHE A 1 731 ? 60.157 -37.424 -52.931 1.00 54.80  ? 725  PHE A CB   1 
ATOM   5092 C  CG   . PHE A 1 731 ? 59.583 -37.063 -51.600 1.00 58.25  ? 725  PHE A CG   1 
ATOM   5093 C  CD1  . PHE A 1 731 ? 60.403 -36.698 -50.542 1.00 57.63  ? 725  PHE A CD1  1 
ATOM   5094 C  CD2  . PHE A 1 731 ? 58.206 -37.078 -51.408 1.00 57.72  ? 725  PHE A CD2  1 
ATOM   5095 C  CE1  . PHE A 1 731 ? 59.858 -36.365 -49.312 1.00 57.05  ? 725  PHE A CE1  1 
ATOM   5096 C  CE2  . PHE A 1 731 ? 57.662 -36.746 -50.200 1.00 58.39  ? 725  PHE A CE2  1 
ATOM   5097 C  CZ   . PHE A 1 731 ? 58.491 -36.393 -49.138 1.00 58.84  ? 725  PHE A CZ   1 
ATOM   5098 N  N    . ASP A 1 732 ? 59.966 -36.749 -56.079 1.00 57.85  ? 726  ASP A N    1 
ATOM   5099 C  CA   . ASP A 1 732 ? 60.220 -36.925 -57.506 1.00 53.72  ? 726  ASP A CA   1 
ATOM   5100 C  C    . ASP A 1 732 ? 61.033 -35.765 -58.058 1.00 51.37  ? 726  ASP A C    1 
ATOM   5101 O  O    . ASP A 1 732 ? 62.138 -35.953 -58.572 1.00 51.82  ? 726  ASP A O    1 
ATOM   5102 C  CB   . ASP A 1 732 ? 58.874 -37.048 -58.201 1.00 52.23  ? 726  ASP A CB   1 
ATOM   5103 C  CG   . ASP A 1 732 ? 58.206 -38.367 -57.903 1.00 58.67  ? 726  ASP A CG   1 
ATOM   5104 O  OD1  . ASP A 1 732 ? 58.931 -39.387 -57.829 1.00 56.84  ? 726  ASP A OD1  1 
ATOM   5105 O  OD2  . ASP A 1 732 ? 56.984 -38.366 -57.617 1.00 60.45  ? 726  ASP A OD2  1 
ATOM   5106 N  N    . VAL A 1 733 ? 60.520 -34.545 -57.896 1.00 53.44  ? 727  VAL A N    1 
ATOM   5107 C  CA   . VAL A 1 733 ? 61.250 -33.346 -58.304 1.00 53.39  ? 727  VAL A CA   1 
ATOM   5108 C  C    . VAL A 1 733 ? 62.691 -33.397 -57.817 1.00 54.32  ? 727  VAL A C    1 
ATOM   5109 O  O    . VAL A 1 733 ? 63.633 -33.187 -58.588 1.00 59.72  ? 727  VAL A O    1 
ATOM   5110 C  CB   . VAL A 1 733 ? 60.532 -32.086 -57.789 1.00 49.35  ? 727  VAL A CB   1 
ATOM   5111 C  CG1  . VAL A 1 733 ? 61.403 -30.871 -57.985 1.00 45.22  ? 727  VAL A CG1  1 
ATOM   5112 C  CG2  . VAL A 1 733 ? 59.201 -31.907 -58.504 1.00 45.89  ? 727  VAL A CG2  1 
ATOM   5113 N  N    . ALA A 1 734 ? 62.883 -33.690 -56.531 1.00 57.41  ? 728  ALA A N    1 
ATOM   5114 C  CA   . ALA A 1 734 ? 64.221 -33.685 -55.946 1.00 54.13  ? 728  ALA A CA   1 
ATOM   5115 C  C    . ALA A 1 734 ? 65.104 -34.770 -56.551 1.00 55.92  ? 728  ALA A C    1 
ATOM   5116 O  O    . ALA A 1 734 ? 66.282 -34.536 -56.838 1.00 58.66  ? 728  ALA A O    1 
ATOM   5117 C  CB   . ALA A 1 734 ? 64.122 -33.868 -54.438 1.00 47.33  ? 728  ALA A CB   1 
ATOM   5118 N  N    . VAL A 1 735 ? 64.568 -35.982 -56.706 1.00 56.19  ? 729  VAL A N    1 
ATOM   5119 C  CA   . VAL A 1 735 ? 65.343 -37.045 -57.335 1.00 52.03  ? 729  VAL A CA   1 
ATOM   5120 C  C    . VAL A 1 735 ? 65.733 -36.639 -58.737 1.00 58.99  ? 729  VAL A C    1 
ATOM   5121 O  O    . VAL A 1 735 ? 66.857 -36.896 -59.182 1.00 64.80  ? 729  VAL A O    1 
ATOM   5122 C  CB   . VAL A 1 735 ? 64.561 -38.367 -57.345 1.00 53.45  ? 729  VAL A CB   1 
ATOM   5123 C  CG1  . VAL A 1 735 ? 65.247 -39.372 -58.247 1.00 42.87  ? 729  VAL A CG1  1 
ATOM   5124 C  CG2  . VAL A 1 735 ? 64.443 -38.918 -55.927 1.00 52.93  ? 729  VAL A CG2  1 
ATOM   5125 N  N    . ASP A 1 736 ? 64.806 -35.997 -59.458 1.00 58.64  ? 730  ASP A N    1 
ATOM   5126 C  CA   . ASP A 1 736 ? 65.075 -35.580 -60.827 1.00 55.09  ? 730  ASP A CA   1 
ATOM   5127 C  C    . ASP A 1 736 ? 66.163 -34.517 -60.857 1.00 58.86  ? 730  ASP A C    1 
ATOM   5128 O  O    . ASP A 1 736 ? 67.107 -34.590 -61.657 1.00 62.95  ? 730  ASP A O    1 
ATOM   5129 C  CB   . ASP A 1 736 ? 63.795 -35.045 -61.469 1.00 54.32  ? 730  ASP A CB   1 
ATOM   5130 C  CG   . ASP A 1 736 ? 63.941 -34.782 -62.973 1.00 59.24  ? 730  ASP A CG   1 
ATOM   5131 O  OD1  . ASP A 1 736 ? 64.884 -35.314 -63.618 1.00 50.91  ? 730  ASP A OD1  1 
ATOM   5132 O  OD2  . ASP A 1 736 ? 63.132 -33.975 -63.484 1.00 61.60  ? 730  ASP A OD2  1 
ATOM   5133 N  N    . GLU A 1 737 ? 66.052 -33.519 -59.984 1.00 54.00  ? 731  GLU A N    1 
ATOM   5134 C  CA   . GLU A 1 737 ? 66.942 -32.372 -60.092 1.00 57.45  ? 731  GLU A CA   1 
ATOM   5135 C  C    . GLU A 1 737 ? 68.363 -32.693 -59.642 1.00 58.31  ? 731  GLU A C    1 
ATOM   5136 O  O    . GLU A 1 737 ? 69.313 -32.065 -60.114 1.00 64.51  ? 731  GLU A O    1 
ATOM   5137 C  CB   . GLU A 1 737 ? 66.355 -31.191 -59.322 1.00 56.85  ? 731  GLU A CB   1 
ATOM   5138 C  CG   . GLU A 1 737 ? 65.078 -30.685 -59.984 1.00 59.05  ? 731  GLU A CG   1 
ATOM   5139 C  CD   . GLU A 1 737 ? 64.480 -29.436 -59.347 1.00 72.19  ? 731  GLU A CD   1 
ATOM   5140 O  OE1  . GLU A 1 737 ? 64.857 -29.064 -58.198 1.00 72.15  ? 731  GLU A OE1  1 
ATOM   5141 O  OE2  . GLU A 1 737 ? 63.646 -28.801 -60.041 1.00 73.87  ? 731  GLU A OE2  1 
ATOM   5142 N  N    . LEU A 1 738 ? 68.545 -33.670 -58.771 1.00 57.26  ? 732  LEU A N    1 
ATOM   5143 C  CA   . LEU A 1 738 ? 69.877 -34.058 -58.333 1.00 54.31  ? 732  LEU A CA   1 
ATOM   5144 C  C    . LEU A 1 738 ? 70.456 -35.202 -59.150 1.00 55.92  ? 732  LEU A C    1 
ATOM   5145 O  O    . LEU A 1 738 ? 71.510 -35.734 -58.787 1.00 54.10  ? 732  LEU A O    1 
ATOM   5146 C  CB   . LEU A 1 738 ? 69.860 -34.436 -56.856 1.00 51.89  ? 732  LEU A CB   1 
ATOM   5147 C  CG   . LEU A 1 738 ? 69.463 -33.288 -55.943 1.00 53.91  ? 732  LEU A CG   1 
ATOM   5148 C  CD1  . LEU A 1 738 ? 69.432 -33.780 -54.507 1.00 61.47  ? 732  LEU A CD1  1 
ATOM   5149 C  CD2  . LEU A 1 738 ? 70.424 -32.128 -56.101 1.00 61.48  ? 732  LEU A CD2  1 
ATOM   5150 N  N    . SER A 1 739 ? 69.781 -35.612 -60.222 1.00 54.59  ? 733  SER A N    1 
ATOM   5151 C  CA   . SER A 1 739 ? 70.240 -36.737 -61.021 1.00 57.86  ? 733  SER A CA   1 
ATOM   5152 C  C    . SER A 1 739 ? 71.260 -36.296 -62.068 1.00 58.49  ? 733  SER A C    1 
ATOM   5153 O  O    . SER A 1 739 ? 71.633 -35.129 -62.187 1.00 56.93  ? 733  SER A O    1 
ATOM   5154 C  CB   . SER A 1 739 ? 69.064 -37.439 -61.691 1.00 54.85  ? 733  SER A CB   1 
ATOM   5155 O  OG   . SER A 1 739 ? 68.394 -36.569 -62.578 1.00 57.10  ? 733  SER A OG   1 
ATOM   5156 N  N    . LEU A 1 740 ? 71.715 -37.273 -62.836 1.00 59.86  ? 734  LEU A N    1 
ATOM   5157 C  CA   . LEU A 1 740 ? 72.771 -37.039 -63.802 1.00 59.56  ? 734  LEU A CA   1 
ATOM   5158 C  C    . LEU A 1 740 ? 72.253 -36.246 -64.993 1.00 61.52  ? 734  LEU A C    1 
ATOM   5159 O  O    . LEU A 1 740 ? 72.944 -35.360 -65.505 1.00 68.98  ? 734  LEU A O    1 
ATOM   5160 C  CB   . LEU A 1 740 ? 73.334 -38.385 -64.239 1.00 64.40  ? 734  LEU A CB   1 
ATOM   5161 C  CG   . LEU A 1 740 ? 74.559 -38.454 -65.124 1.00 58.81  ? 734  LEU A CG   1 
ATOM   5162 C  CD1  . LEU A 1 740 ? 75.704 -37.864 -64.339 1.00 65.73  ? 734  LEU A CD1  1 
ATOM   5163 C  CD2  . LEU A 1 740 ? 74.813 -39.893 -65.439 1.00 60.83  ? 734  LEU A CD2  1 
ATOM   5164 N  N    . ASN A 1 741 ? 71.030 -36.533 -65.438 1.00 58.55  ? 735  ASN A N    1 
ATOM   5165 C  CA   . ASN A 1 741 ? 70.413 -35.831 -66.556 1.00 56.14  ? 735  ASN A CA   1 
ATOM   5166 C  C    . ASN A 1 741 ? 69.088 -35.223 -66.112 1.00 53.45  ? 735  ASN A C    1 
ATOM   5167 O  O    . ASN A 1 741 ? 68.008 -35.740 -66.433 1.00 54.11  ? 735  ASN A O    1 
ATOM   5168 C  CB   . ASN A 1 741 ? 70.244 -36.763 -67.750 1.00 60.25  ? 735  ASN A CB   1 
ATOM   5169 C  CG   . ASN A 1 741 ? 71.576 -37.163 -68.343 1.00 65.25  ? 735  ASN A CG   1 
ATOM   5170 O  OD1  . ASN A 1 741 ? 72.279 -36.322 -68.913 1.00 71.97  ? 735  ASN A OD1  1 
ATOM   5171 N  ND2  . ASN A 1 741 ? 71.924 -38.450 -68.241 1.00 61.83  ? 735  ASN A ND2  1 
ATOM   5172 N  N    . PRO A 1 742 ? 69.135 -34.099 -65.404 1.00 49.99  ? 736  PRO A N    1 
ATOM   5173 C  CA   . PRO A 1 742 ? 67.904 -33.457 -64.936 1.00 52.19  ? 736  PRO A CA   1 
ATOM   5174 C  C    . PRO A 1 742 ? 66.910 -33.241 -66.059 1.00 47.72  ? 736  PRO A C    1 
ATOM   5175 O  O    . PRO A 1 742 ? 67.263 -32.785 -67.135 1.00 59.43  ? 736  PRO A O    1 
ATOM   5176 C  CB   . PRO A 1 742 ? 68.400 -32.125 -64.370 1.00 53.96  ? 736  PRO A CB   1 
ATOM   5177 C  CG   . PRO A 1 742 ? 69.776 -32.417 -63.915 1.00 55.37  ? 736  PRO A CG   1 
ATOM   5178 C  CD   . PRO A 1 742 ? 70.338 -33.425 -64.898 1.00 52.17  ? 736  PRO A CD   1 
ATOM   5179 N  N    . GLY A 1 743 ? 65.650 -33.556 -65.792 1.00 53.93  ? 737  GLY A N    1 
ATOM   5180 C  CA   . GLY A 1 743 ? 64.590 -33.355 -66.753 1.00 52.57  ? 737  GLY A CA   1 
ATOM   5181 C  C    . GLY A 1 743 ? 64.436 -34.457 -67.773 1.00 56.25  ? 737  GLY A C    1 
ATOM   5182 O  O    . GLY A 1 743 ? 63.497 -34.407 -68.575 1.00 60.15  ? 737  GLY A O    1 
ATOM   5183 N  N    . LYS A 1 744 ? 65.323 -35.446 -67.778 1.00 54.57  ? 738  LYS A N    1 
ATOM   5184 C  CA   . LYS A 1 744 ? 65.248 -36.561 -68.708 1.00 55.60  ? 738  LYS A CA   1 
ATOM   5185 C  C    . LYS A 1 744 ? 64.847 -37.828 -67.961 1.00 54.98  ? 738  LYS A C    1 
ATOM   5186 O  O    . LYS A 1 744 ? 65.281 -38.055 -66.828 1.00 53.93  ? 738  LYS A O    1 
ATOM   5187 C  CB   . LYS A 1 744 ? 66.587 -36.778 -69.427 1.00 56.62  ? 738  LYS A CB   1 
ATOM   5188 C  CG   . LYS A 1 744 ? 67.101 -35.548 -70.151 1.00 64.14  ? 738  LYS A CG   1 
ATOM   5189 C  CD   . LYS A 1 744 ? 66.236 -35.183 -71.339 1.00 67.83  ? 738  LYS A CD   1 
ATOM   5190 C  CE   . LYS A 1 744 ? 66.690 -33.873 -71.957 1.00 68.26  ? 738  LYS A CE   1 
ATOM   5191 N  NZ   . LYS A 1 744 ? 66.411 -32.739 -71.011 1.00 75.76  ? 738  LYS A NZ   1 
ATOM   5192 N  N    . GLN A 1 745 ? 64.015 -38.649 -68.606 1.00 52.65  ? 739  GLN A N    1 
ATOM   5193 C  CA   . GLN A 1 745 ? 63.657 -39.968 -68.097 1.00 48.95  ? 739  GLN A CA   1 
ATOM   5194 C  C    . GLN A 1 745 ? 62.804 -39.896 -66.821 1.00 50.74  ? 739  GLN A C    1 
ATOM   5195 O  O    . GLN A 1 745 ? 62.930 -40.735 -65.931 1.00 45.95  ? 739  GLN A O    1 
ATOM   5196 C  CB   . GLN A 1 745 ? 64.914 -40.794 -67.861 1.00 46.91  ? 739  GLN A CB   1 
ATOM   5197 C  CG   . GLN A 1 745 ? 65.682 -41.066 -69.127 1.00 46.78  ? 739  GLN A CG   1 
ATOM   5198 C  CD   . GLN A 1 745 ? 64.911 -41.908 -70.110 1.00 48.55  ? 739  GLN A CD   1 
ATOM   5199 O  OE1  . GLN A 1 745 ? 64.374 -41.386 -71.099 1.00 59.04  ? 739  GLN A OE1  1 
ATOM   5200 N  NE2  . GLN A 1 745 ? 64.858 -43.217 -69.864 1.00 42.72  ? 739  GLN A NE2  1 
ATOM   5201 N  N    . ARG A 1 746 ? 61.881 -38.930 -66.773 1.00 51.02  ? 740  ARG A N    1 
ATOM   5202 C  CA   . ARG A 1 746 ? 61.089 -38.704 -65.574 1.00 45.38  ? 740  ARG A CA   1 
ATOM   5203 C  C    . ARG A 1 746 ? 60.216 -39.898 -65.215 1.00 45.18  ? 740  ARG A C    1 
ATOM   5204 O  O    . ARG A 1 746 ? 60.045 -40.202 -64.033 1.00 56.07  ? 740  ARG A O    1 
ATOM   5205 C  CB   . ARG A 1 746 ? 60.249 -37.440 -65.736 1.00 48.95  ? 740  ARG A CB   1 
ATOM   5206 C  CG   . ARG A 1 746 ? 61.057 -36.184 -65.519 1.00 51.38  ? 740  ARG A CG   1 
ATOM   5207 C  CD   . ARG A 1 746 ? 60.233 -34.954 -65.711 1.00 56.70  ? 740  ARG A CD   1 
ATOM   5208 N  NE   . ARG A 1 746 ? 61.020 -33.751 -65.467 1.00 61.10  ? 740  ARG A NE   1 
ATOM   5209 C  CZ   . ARG A 1 746 ? 60.638 -32.519 -65.799 1.00 64.67  ? 740  ARG A CZ   1 
ATOM   5210 N  NH1  . ARG A 1 746 ? 59.486 -32.330 -66.433 1.00 68.37  ? 740  ARG A NH1  1 
ATOM   5211 N  NH2  . ARG A 1 746 ? 61.417 -31.474 -65.517 1.00 59.97  ? 740  ARG A NH2  1 
ATOM   5212 N  N    . PHE A 1 747 ? 59.637 -40.580 -66.198 1.00 46.67  ? 741  PHE A N    1 
ATOM   5213 C  CA   . PHE A 1 747 ? 58.752 -41.698 -65.870 1.00 46.22  ? 741  PHE A CA   1 
ATOM   5214 C  C    . PHE A 1 747 ? 59.561 -42.890 -65.388 1.00 50.81  ? 741  PHE A C    1 
ATOM   5215 O  O    . PHE A 1 747 ? 59.164 -43.590 -64.440 1.00 49.70  ? 741  PHE A O    1 
ATOM   5216 C  CB   . PHE A 1 747 ? 57.907 -42.050 -67.088 1.00 43.71  ? 741  PHE A CB   1 
ATOM   5217 C  CG   . PHE A 1 747 ? 56.893 -43.140 -66.877 1.00 41.94  ? 741  PHE A CG   1 
ATOM   5218 C  CD1  . PHE A 1 747 ? 55.784 -42.930 -66.075 1.00 42.70  ? 741  PHE A CD1  1 
ATOM   5219 C  CD2  . PHE A 1 747 ? 56.961 -44.319 -67.613 1.00 43.04  ? 741  PHE A CD2  1 
ATOM   5220 C  CE1  . PHE A 1 747 ? 54.808 -43.930 -65.919 1.00 42.26  ? 741  PHE A CE1  1 
ATOM   5221 C  CE2  . PHE A 1 747 ? 55.983 -45.313 -67.496 1.00 41.55  ? 741  PHE A CE2  1 
ATOM   5222 C  CZ   . PHE A 1 747 ? 54.911 -45.124 -66.635 1.00 42.32  ? 741  PHE A CZ   1 
ATOM   5223 N  N    . GLU A 1 748 ? 60.716 -43.109 -66.014 1.00 46.83  ? 742  GLU A N    1 
ATOM   5224 C  CA   . GLU A 1 748 ? 61.657 -44.110 -65.541 1.00 44.71  ? 742  GLU A CA   1 
ATOM   5225 C  C    . GLU A 1 748 ? 61.997 -43.904 -64.064 1.00 52.19  ? 742  GLU A C    1 
ATOM   5226 O  O    . GLU A 1 748 ? 62.214 -44.868 -63.320 1.00 53.23  ? 742  GLU A O    1 
ATOM   5227 C  CB   . GLU A 1 748 ? 62.923 -44.006 -66.356 1.00 44.09  ? 742  GLU A CB   1 
ATOM   5228 C  CG   . GLU A 1 748 ? 63.705 -45.247 -66.326 1.00 50.78  ? 742  GLU A CG   1 
ATOM   5229 C  CD   . GLU A 1 748 ? 65.025 -45.090 -66.999 1.00 51.11  ? 742  GLU A CD   1 
ATOM   5230 O  OE1  . GLU A 1 748 ? 65.571 -43.961 -67.025 1.00 46.54  ? 742  GLU A OE1  1 
ATOM   5231 O  OE2  . GLU A 1 748 ? 65.452 -46.090 -67.596 1.00 51.57  ? 742  GLU A OE2  1 
ATOM   5232 N  N    . LYS A 1 749 ? 62.088 -42.647 -63.637 1.00 44.56  ? 743  LYS A N    1 
ATOM   5233 C  CA   . LYS A 1 749 ? 62.543 -42.306 -62.310 1.00 44.66  ? 743  LYS A CA   1 
ATOM   5234 C  C    . LYS A 1 749 ? 61.461 -42.494 -61.259 1.00 52.57  ? 743  LYS A C    1 
ATOM   5235 O  O    . LYS A 1 749 ? 61.764 -42.492 -60.053 1.00 50.33  ? 743  LYS A O    1 
ATOM   5236 C  CB   . LYS A 1 749 ? 63.051 -40.865 -62.315 1.00 42.20  ? 743  LYS A CB   1 
ATOM   5237 C  CG   . LYS A 1 749 ? 64.350 -40.712 -63.043 1.00 41.30  ? 743  LYS A CG   1 
ATOM   5238 C  CD   . LYS A 1 749 ? 64.705 -39.275 -63.186 1.00 46.25  ? 743  LYS A CD   1 
ATOM   5239 C  CE   . LYS A 1 749 ? 65.999 -39.101 -63.947 1.00 49.24  ? 743  LYS A CE   1 
ATOM   5240 N  NZ   . LYS A 1 749 ? 66.244 -37.662 -64.261 1.00 51.38  ? 743  LYS A NZ   1 
ATOM   5241 N  N    . MET A 1 750 ? 60.207 -42.579 -61.687 1.00 49.82  ? 744  MET A N    1 
ATOM   5242 C  CA   . MET A 1 750 ? 59.120 -42.985 -60.816 1.00 44.92  ? 744  MET A CA   1 
ATOM   5243 C  C    . MET A 1 750 ? 58.955 -44.496 -60.733 1.00 43.28  ? 744  MET A C    1 
ATOM   5244 O  O    . MET A 1 750 ? 58.346 -44.974 -59.781 1.00 52.48  ? 744  MET A O    1 
ATOM   5245 C  CB   . MET A 1 750 ? 57.814 -42.351 -61.291 1.00 44.91  ? 744  MET A CB   1 
ATOM   5246 C  CG   . MET A 1 750 ? 57.911 -40.850 -61.378 1.00 45.66  ? 744  MET A CG   1 
ATOM   5247 S  SD   . MET A 1 750 ? 56.480 -40.018 -62.079 1.00 54.59  ? 744  MET A SD   1 
ATOM   5248 C  CE   . MET A 1 750 ? 55.335 -40.049 -60.697 1.00 47.48  ? 744  MET A CE   1 
ATOM   5249 N  N    . ILE A 1 751 ? 59.323 -45.259 -61.760 1.00 45.90  ? 745  ILE A N    1 
ATOM   5250 C  CA   . ILE A 1 751 ? 58.966 -46.674 -61.790 1.00 41.49  ? 745  ILE A CA   1 
ATOM   5251 C  C    . ILE A 1 751 ? 60.136 -47.646 -61.663 1.00 41.99  ? 745  ILE A C    1 
ATOM   5252 O  O    . ILE A 1 751 ? 59.891 -48.856 -61.753 1.00 42.11  ? 745  ILE A O    1 
ATOM   5253 C  CB   . ILE A 1 751 ? 58.125 -47.016 -63.029 1.00 48.73  ? 745  ILE A CB   1 
ATOM   5254 C  CG1  . ILE A 1 751 ? 58.919 -46.836 -64.326 1.00 47.77  ? 745  ILE A CG1  1 
ATOM   5255 C  CG2  . ILE A 1 751 ? 56.873 -46.140 -63.049 1.00 50.92  ? 745  ILE A CG2  1 
ATOM   5256 C  CD1  . ILE A 1 751 ? 58.243 -47.497 -65.485 1.00 43.54  ? 745  ILE A CD1  1 
ATOM   5257 N  N    . SER A 1 752 ? 61.382 -47.212 -61.512 1.00 42.28  ? 746  SER A N    1 
ATOM   5258 C  CA   . SER A 1 752 ? 62.430 -48.243 -61.621 1.00 40.62  ? 746  SER A CA   1 
ATOM   5259 C  C    . SER A 1 752 ? 63.779 -47.720 -61.160 1.00 44.32  ? 746  SER A C    1 
ATOM   5260 O  O    . SER A 1 752 ? 63.906 -46.594 -60.660 1.00 49.47  ? 746  SER A O    1 
ATOM   5261 C  CB   . SER A 1 752 ? 62.606 -48.740 -63.052 1.00 47.59  ? 746  SER A CB   1 
ATOM   5262 O  OG   . SER A 1 752 ? 63.121 -47.689 -63.870 1.00 49.66  ? 746  SER A OG   1 
ATOM   5263 N  N    . GLY A 1 753 ? 64.794 -48.561 -61.362 1.00 39.94  ? 747  GLY A N    1 
ATOM   5264 C  CA   . GLY A 1 753 ? 66.215 -48.368 -61.138 1.00 45.38  ? 747  GLY A CA   1 
ATOM   5265 C  C    . GLY A 1 753 ? 66.557 -47.945 -59.718 1.00 47.43  ? 747  GLY A C    1 
ATOM   5266 O  O    . GLY A 1 753 ? 65.845 -48.211 -58.753 1.00 46.11  ? 747  GLY A O    1 
ATOM   5267 N  N    . MET A 1 754 ? 67.690 -47.269 -59.589 1.00 51.43  ? 748  MET A N    1 
ATOM   5268 C  CA   . MET A 1 754 ? 68.062 -46.729 -58.297 1.00 40.48  ? 748  MET A CA   1 
ATOM   5269 C  C    . MET A 1 754 ? 66.992 -45.767 -57.806 1.00 47.13  ? 748  MET A C    1 
ATOM   5270 O  O    . MET A 1 754 ? 66.899 -45.498 -56.604 1.00 50.23  ? 748  MET A O    1 
ATOM   5271 C  CB   . MET A 1 754 ? 69.347 -45.917 -58.386 1.00 38.27  ? 748  MET A CB   1 
ATOM   5272 C  CG   . MET A 1 754 ? 68.908 -44.522 -58.712 1.00 43.35  ? 748  MET A CG   1 
ATOM   5273 S  SD   . MET A 1 754 ? 70.019 -43.184 -58.492 1.00 67.79  ? 748  MET A SD   1 
ATOM   5274 C  CE   . MET A 1 754 ? 70.264 -43.166 -56.724 1.00 45.35  ? 748  MET A CE   1 
ATOM   5275 N  N    . TYR A 1 755 ? 66.206 -45.210 -58.727 1.00 47.17  ? 749  TYR A N    1 
ATOM   5276 C  CA   . TYR A 1 755 ? 65.398 -44.034 -58.422 1.00 49.55  ? 749  TYR A CA   1 
ATOM   5277 C  C    . TYR A 1 755 ? 64.394 -44.320 -57.309 1.00 46.64  ? 749  TYR A C    1 
ATOM   5278 O  O    . TYR A 1 755 ? 63.980 -43.412 -56.584 1.00 45.86  ? 749  TYR A O    1 
ATOM   5279 C  CB   . TYR A 1 755 ? 64.730 -43.586 -59.738 1.00 44.77  ? 749  TYR A CB   1 
ATOM   5280 C  CG   . TYR A 1 755 ? 65.792 -43.264 -60.776 1.00 45.57  ? 749  TYR A CG   1 
ATOM   5281 C  CD1  . TYR A 1 755 ? 66.747 -42.290 -60.543 1.00 46.76  ? 749  TYR A CD1  1 
ATOM   5282 C  CD2  . TYR A 1 755 ? 65.920 -44.017 -61.932 1.00 51.52  ? 749  TYR A CD2  1 
ATOM   5283 C  CE1  . TYR A 1 755 ? 67.740 -42.025 -61.462 1.00 47.31  ? 749  TYR A CE1  1 
ATOM   5284 C  CE2  . TYR A 1 755 ? 66.921 -43.755 -62.872 1.00 46.72  ? 749  TYR A CE2  1 
ATOM   5285 C  CZ   . TYR A 1 755 ? 67.828 -42.763 -62.619 1.00 46.84  ? 749  TYR A CZ   1 
ATOM   5286 O  OH   . TYR A 1 755 ? 68.823 -42.500 -63.518 1.00 45.04  ? 749  TYR A OH   1 
ATOM   5287 N  N    . LEU A 1 756 ? 63.993 -45.580 -57.176 1.00 47.57  ? 750  LEU A N    1 
ATOM   5288 C  CA   . LEU A 1 756 ? 63.006 -45.986 -56.189 1.00 46.19  ? 750  LEU A CA   1 
ATOM   5289 C  C    . LEU A 1 756 ? 63.576 -45.924 -54.774 1.00 48.40  ? 750  LEU A C    1 
ATOM   5290 O  O    . LEU A 1 756 ? 62.995 -45.289 -53.886 1.00 46.42  ? 750  LEU A O    1 
ATOM   5291 C  CB   . LEU A 1 756 ? 62.518 -47.386 -56.566 1.00 48.11  ? 750  LEU A CB   1 
ATOM   5292 C  CG   . LEU A 1 756 ? 61.146 -47.446 -57.237 1.00 43.13  ? 750  LEU A CG   1 
ATOM   5293 C  CD1  . LEU A 1 756 ? 61.015 -46.366 -58.192 1.00 45.01  ? 750  LEU A CD1  1 
ATOM   5294 C  CD2  . LEU A 1 756 ? 61.008 -48.753 -57.969 1.00 39.24  ? 750  LEU A CD2  1 
ATOM   5295 N  N    . GLY A 1 757 ? 64.726 -46.562 -54.553 1.00 48.72  ? 751  GLY A N    1 
ATOM   5296 C  CA   . GLY A 1 757 ? 65.436 -46.377 -53.304 1.00 39.78  ? 751  GLY A CA   1 
ATOM   5297 C  C    . GLY A 1 757 ? 65.661 -44.919 -52.952 1.00 45.13  ? 751  GLY A C    1 
ATOM   5298 O  O    . GLY A 1 757 ? 65.608 -44.547 -51.777 1.00 53.60  ? 751  GLY A O    1 
ATOM   5299 N  N    . GLU A 1 758 ? 65.951 -44.071 -53.954 1.00 47.86  ? 752  GLU A N    1 
ATOM   5300 C  CA   . GLU A 1 758 ? 66.153 -42.643 -53.685 1.00 45.31  ? 752  GLU A CA   1 
ATOM   5301 C  C    . GLU A 1 758 ? 64.876 -41.957 -53.253 1.00 46.22  ? 752  GLU A C    1 
ATOM   5302 O  O    . GLU A 1 758 ? 64.915 -41.036 -52.431 1.00 51.15  ? 752  GLU A O    1 
ATOM   5303 C  CB   . GLU A 1 758 ? 66.738 -41.914 -54.891 1.00 44.14  ? 752  GLU A CB   1 
ATOM   5304 C  CG   . GLU A 1 758 ? 68.220 -41.878 -54.901 1.00 49.87  ? 752  GLU A CG   1 
ATOM   5305 C  CD   . GLU A 1 758 ? 68.794 -40.985 -53.794 1.00 54.09  ? 752  GLU A CD   1 
ATOM   5306 O  OE1  . GLU A 1 758 ? 68.385 -39.801 -53.682 1.00 50.07  ? 752  GLU A OE1  1 
ATOM   5307 O  OE2  . GLU A 1 758 ? 69.622 -41.500 -53.009 1.00 53.16  ? 752  GLU A OE2  1 
ATOM   5308 N  N    . ILE A 1 759 ? 63.737 -42.362 -53.805 1.00 44.44  ? 753  ILE A N    1 
ATOM   5309 C  CA   . ILE A 1 759 ? 62.482 -41.784 -53.340 1.00 47.48  ? 753  ILE A CA   1 
ATOM   5310 C  C    . ILE A 1 759 ? 62.270 -42.152 -51.880 1.00 48.51  ? 753  ILE A C    1 
ATOM   5311 O  O    . ILE A 1 759 ? 61.904 -41.309 -51.051 1.00 49.42  ? 753  ILE A O    1 
ATOM   5312 C  CB   . ILE A 1 759 ? 61.315 -42.259 -54.224 1.00 46.91  ? 753  ILE A CB   1 
ATOM   5313 C  CG1  . ILE A 1 759 ? 61.564 -41.871 -55.692 1.00 46.91  ? 753  ILE A CG1  1 
ATOM   5314 C  CG2  . ILE A 1 759 ? 60.031 -41.655 -53.745 1.00 42.84  ? 753  ILE A CG2  1 
ATOM   5315 C  CD1  . ILE A 1 759 ? 60.633 -42.562 -56.673 1.00 44.93  ? 753  ILE A CD1  1 
ATOM   5316 N  N    . VAL A 1 760 ? 62.536 -43.415 -51.536 1.00 47.58  ? 754  VAL A N    1 
ATOM   5317 C  CA   . VAL A 1 760 ? 62.429 -43.851 -50.147 1.00 48.54  ? 754  VAL A CA   1 
ATOM   5318 C  C    . VAL A 1 760 ? 63.320 -43.001 -49.247 1.00 49.15  ? 754  VAL A C    1 
ATOM   5319 O  O    . VAL A 1 760 ? 62.830 -42.365 -48.310 1.00 48.95  ? 754  VAL A O    1 
ATOM   5320 C  CB   . VAL A 1 760 ? 62.753 -45.348 -50.011 1.00 47.74  ? 754  VAL A CB   1 
ATOM   5321 C  CG1  . VAL A 1 760 ? 62.752 -45.722 -48.536 1.00 44.12  ? 754  VAL A CG1  1 
ATOM   5322 C  CG2  . VAL A 1 760 ? 61.742 -46.188 -50.789 1.00 39.58  ? 754  VAL A CG2  1 
ATOM   5323 N  N    . ARG A 1 761 ? 64.642 -42.950 -49.519 1.00 47.61  ? 755  ARG A N    1 
ATOM   5324 C  CA   . ARG A 1 761 ? 65.476 -42.218 -48.570 1.00 45.92  ? 755  ARG A CA   1 
ATOM   5325 C  C    . ARG A 1 761 ? 65.255 -40.727 -48.634 1.00 47.89  ? 755  ARG A C    1 
ATOM   5326 O  O    . ARG A 1 761 ? 65.632 -40.029 -47.698 1.00 52.79  ? 755  ARG A O    1 
ATOM   5327 C  CB   . ARG A 1 761 ? 66.978 -42.457 -48.708 1.00 44.46  ? 755  ARG A CB   1 
ATOM   5328 C  CG   . ARG A 1 761 ? 67.600 -42.009 -49.956 1.00 57.43  ? 755  ARG A CG   1 
ATOM   5329 C  CD   . ARG A 1 761 ? 69.124 -41.934 -49.812 1.00 51.91  ? 755  ARG A CD   1 
ATOM   5330 N  NE   . ARG A 1 761 ? 69.498 -40.721 -49.112 1.00 53.05  ? 755  ARG A NE   1 
ATOM   5331 C  CZ   . ARG A 1 761 ? 69.812 -39.565 -49.699 1.00 54.55  ? 755  ARG A CZ   1 
ATOM   5332 N  NH1  . ARG A 1 761 ? 69.844 -39.452 -51.008 1.00 44.36  ? 755  ARG A NH1  1 
ATOM   5333 N  NH2  . ARG A 1 761 ? 70.120 -38.508 -48.954 1.00 64.58  ? 755  ARG A NH2  1 
ATOM   5334 N  N    . ASN A 1 762 ? 64.652 -40.198 -49.688 1.00 51.64  ? 756  ASN A N    1 
ATOM   5335 C  CA   . ASN A 1 762 ? 64.230 -38.809 -49.575 1.00 50.55  ? 756  ASN A CA   1 
ATOM   5336 C  C    . ASN A 1 762 ? 63.055 -38.682 -48.613 1.00 50.84  ? 756  ASN A C    1 
ATOM   5337 O  O    . ASN A 1 762 ? 62.984 -37.721 -47.838 1.00 51.96  ? 756  ASN A O    1 
ATOM   5338 C  CB   . ASN A 1 762 ? 63.907 -38.229 -50.950 1.00 53.53  ? 756  ASN A CB   1 
ATOM   5339 C  CG   . ASN A 1 762 ? 65.154 -37.890 -51.734 1.00 54.13  ? 756  ASN A CG   1 
ATOM   5340 O  OD1  . ASN A 1 762 ? 66.191 -37.618 -51.156 1.00 56.43  ? 756  ASN A OD1  1 
ATOM   5341 N  ND2  . ASN A 1 762 ? 65.059 -37.910 -53.056 1.00 59.87  ? 756  ASN A ND2  1 
ATOM   5342 N  N    . ILE A 1 763 ? 62.145 -39.658 -48.620 1.00 49.57  ? 757  ILE A N    1 
ATOM   5343 C  CA   . ILE A 1 763 ? 61.023 -39.632 -47.685 1.00 50.35  ? 757  ILE A CA   1 
ATOM   5344 C  C    . ILE A 1 763 ? 61.504 -39.852 -46.253 1.00 50.04  ? 757  ILE A C    1 
ATOM   5345 O  O    . ILE A 1 763 ? 61.122 -39.118 -45.335 1.00 49.23  ? 757  ILE A O    1 
ATOM   5346 C  CB   . ILE A 1 763 ? 59.973 -40.678 -48.084 1.00 52.57  ? 757  ILE A CB   1 
ATOM   5347 C  CG1  . ILE A 1 763 ? 59.277 -40.270 -49.384 1.00 51.93  ? 757  ILE A CG1  1 
ATOM   5348 C  CG2  . ILE A 1 763 ? 58.999 -40.907 -46.917 1.00 51.98  ? 757  ILE A CG2  1 
ATOM   5349 C  CD1  . ILE A 1 763 ? 58.491 -41.395 -50.047 1.00 48.39  ? 757  ILE A CD1  1 
ATOM   5350 N  N    . LEU A 1 764 ? 62.347 -40.870 -46.038 1.00 49.13  ? 758  LEU A N    1 
ATOM   5351 C  CA   . LEU A 1 764 ? 62.826 -41.147 -44.689 1.00 45.78  ? 758  LEU A CA   1 
ATOM   5352 C  C    . LEU A 1 764 ? 63.556 -39.944 -44.115 1.00 47.88  ? 758  LEU A C    1 
ATOM   5353 O  O    . LEU A 1 764 ? 63.403 -39.631 -42.932 1.00 51.96  ? 758  LEU A O    1 
ATOM   5354 C  CB   . LEU A 1 764 ? 63.734 -42.377 -44.660 1.00 42.24  ? 758  LEU A CB   1 
ATOM   5355 C  CG   . LEU A 1 764 ? 63.068 -43.671 -45.100 1.00 43.25  ? 758  LEU A CG   1 
ATOM   5356 C  CD1  . LEU A 1 764 ? 63.975 -44.882 -44.938 1.00 44.81  ? 758  LEU A CD1  1 
ATOM   5357 C  CD2  . LEU A 1 764 ? 61.720 -43.870 -44.451 1.00 39.71  ? 758  LEU A CD2  1 
ATOM   5358 N  N    . ILE A 1 765 ? 64.347 -39.250 -44.931 1.00 48.00  ? 759  ILE A N    1 
ATOM   5359 C  CA   . ILE A 1 765 ? 64.999 -38.046 -44.434 1.00 47.84  ? 759  ILE A CA   1 
ATOM   5360 C  C    . ILE A 1 765 ? 63.990 -36.940 -44.179 1.00 51.43  ? 759  ILE A C    1 
ATOM   5361 O  O    . ILE A 1 765 ? 64.110 -36.196 -43.202 1.00 58.28  ? 759  ILE A O    1 
ATOM   5362 C  CB   . ILE A 1 765 ? 66.119 -37.598 -45.374 1.00 43.93  ? 759  ILE A CB   1 
ATOM   5363 C  CG1  . ILE A 1 765 ? 67.316 -38.515 -45.144 1.00 48.75  ? 759  ILE A CG1  1 
ATOM   5364 C  CG2  . ILE A 1 765 ? 66.446 -36.154 -45.126 1.00 41.02  ? 759  ILE A CG2  1 
ATOM   5365 C  CD1  . ILE A 1 765 ? 68.401 -38.354 -46.136 1.00 57.92  ? 759  ILE A CD1  1 
ATOM   5366 N  N    . ASP A 1 766 ? 62.952 -36.838 -44.999 1.00 50.25  ? 760  ASP A N    1 
ATOM   5367 C  CA   . ASP A 1 766 ? 61.945 -35.825 -44.705 1.00 51.85  ? 760  ASP A CA   1 
ATOM   5368 C  C    . ASP A 1 766 ? 61.216 -36.132 -43.407 1.00 55.77  ? 760  ASP A C    1 
ATOM   5369 O  O    . ASP A 1 766 ? 60.905 -35.221 -42.628 1.00 55.50  ? 760  ASP A O    1 
ATOM   5370 C  CB   . ASP A 1 766 ? 60.956 -35.710 -45.846 1.00 51.20  ? 760  ASP A CB   1 
ATOM   5371 C  CG   . ASP A 1 766 ? 59.969 -34.603 -45.626 1.00 59.70  ? 760  ASP A CG   1 
ATOM   5372 O  OD1  . ASP A 1 766 ? 60.412 -33.471 -45.322 1.00 63.27  ? 760  ASP A OD1  1 
ATOM   5373 O  OD2  . ASP A 1 766 ? 58.759 -34.831 -45.823 1.00 66.00  ? 760  ASP A OD2  1 
ATOM   5374 N  N    . PHE A 1 767 ? 60.926 -37.411 -43.166 1.00 54.90  ? 761  PHE A N    1 
ATOM   5375 C  CA   . PHE A 1 767 ? 60.266 -37.805 -41.929 1.00 51.99  ? 761  PHE A CA   1 
ATOM   5376 C  C    . PHE A 1 767 ? 61.147 -37.531 -40.713 1.00 55.15  ? 761  PHE A C    1 
ATOM   5377 O  O    . PHE A 1 767 ? 60.703 -36.908 -39.739 1.00 53.39  ? 761  PHE A O    1 
ATOM   5378 C  CB   . PHE A 1 767 ? 59.864 -39.283 -41.998 1.00 49.55  ? 761  PHE A CB   1 
ATOM   5379 C  CG   . PHE A 1 767 ? 58.636 -39.546 -42.825 1.00 47.70  ? 761  PHE A CG   1 
ATOM   5380 C  CD1  . PHE A 1 767 ? 57.833 -38.498 -43.251 1.00 50.15  ? 761  PHE A CD1  1 
ATOM   5381 C  CD2  . PHE A 1 767 ? 58.234 -40.846 -43.097 1.00 45.91  ? 761  PHE A CD2  1 
ATOM   5382 C  CE1  . PHE A 1 767 ? 56.683 -38.735 -43.986 1.00 52.61  ? 761  PHE A CE1  1 
ATOM   5383 C  CE2  . PHE A 1 767 ? 57.080 -41.094 -43.823 1.00 45.68  ? 761  PHE A CE2  1 
ATOM   5384 C  CZ   . PHE A 1 767 ? 56.300 -40.035 -44.267 1.00 47.96  ? 761  PHE A CZ   1 
ATOM   5385 N  N    . THR A 1 768 ? 62.400 -37.990 -40.749 1.00 52.65  ? 762  THR A N    1 
ATOM   5386 C  CA   . THR A 1 768 ? 63.297 -37.765 -39.626 1.00 48.65  ? 762  THR A CA   1 
ATOM   5387 C  C    . THR A 1 768 ? 63.432 -36.281 -39.307 1.00 51.68  ? 762  THR A C    1 
ATOM   5388 O  O    . THR A 1 768 ? 63.359 -35.885 -38.144 1.00 57.14  ? 762  THR A O    1 
ATOM   5389 C  CB   . THR A 1 768 ? 64.660 -38.371 -39.914 1.00 52.90  ? 762  THR A CB   1 
ATOM   5390 O  OG1  . THR A 1 768 ? 64.507 -39.765 -40.189 1.00 51.94  ? 762  THR A OG1  1 
ATOM   5391 C  CG2  . THR A 1 768 ? 65.553 -38.203 -38.701 1.00 54.77  ? 762  THR A CG2  1 
ATOM   5392 N  N    . LYS A 1 769 ? 63.643 -35.435 -40.318 1.00 54.14  ? 763  LYS A N    1 
ATOM   5393 C  CA   . LYS A 1 769 ? 63.757 -34.008 -40.018 1.00 54.84  ? 763  LYS A CA   1 
ATOM   5394 C  C    . LYS A 1 769 ? 62.542 -33.488 -39.266 1.00 54.82  ? 763  LYS A C    1 
ATOM   5395 O  O    . LYS A 1 769 ? 62.671 -32.586 -38.435 1.00 60.12  ? 763  LYS A O    1 
ATOM   5396 C  CB   . LYS A 1 769 ? 63.953 -33.169 -41.282 1.00 59.08  ? 763  LYS A CB   1 
ATOM   5397 C  CG   . LYS A 1 769 ? 65.336 -33.194 -41.899 1.00 63.04  ? 763  LYS A CG   1 
ATOM   5398 C  CD   . LYS A 1 769 ? 65.376 -32.264 -43.116 1.00 73.81  ? 763  LYS A CD   1 
ATOM   5399 C  CE   . LYS A 1 769 ? 66.734 -32.321 -43.807 1.00 85.45  ? 763  LYS A CE   1 
ATOM   5400 N  NZ   . LYS A 1 769 ? 67.831 -31.902 -42.874 1.00 94.27  ? 763  LYS A NZ   1 
ATOM   5401 N  N    . ARG A 1 770 ? 61.360 -34.022 -39.543 1.00 53.21  ? 764  ARG A N    1 
ATOM   5402 C  CA   . ARG A 1 770 ? 60.147 -33.516 -38.921 1.00 53.35  ? 764  ARG A CA   1 
ATOM   5403 C  C    . ARG A 1 770 ? 59.874 -34.224 -37.603 1.00 56.23  ? 764  ARG A C    1 
ATOM   5404 O  O    . ARG A 1 770 ? 58.781 -34.074 -37.045 1.00 56.36  ? 764  ARG A O    1 
ATOM   5405 C  CB   . ARG A 1 770 ? 58.939 -33.647 -39.866 1.00 56.61  ? 764  ARG A CB   1 
ATOM   5406 C  CG   . ARG A 1 770 ? 59.202 -33.128 -41.294 1.00 56.19  ? 764  ARG A CG   1 
ATOM   5407 C  CD   . ARG A 1 770 ? 58.018 -32.471 -41.963 1.00 55.90  ? 764  ARG A CD   1 
ATOM   5408 N  NE   . ARG A 1 770 ? 56.779 -33.237 -42.070 1.00 59.50  ? 764  ARG A NE   1 
ATOM   5409 C  CZ   . ARG A 1 770 ? 56.525 -34.127 -43.019 1.00 60.48  ? 764  ARG A CZ   1 
ATOM   5410 N  NH1  . ARG A 1 770 ? 57.464 -34.414 -43.899 1.00 63.36  ? 764  ARG A NH1  1 
ATOM   5411 N  NH2  . ARG A 1 770 ? 55.353 -34.754 -43.072 1.00 58.68  ? 764  ARG A NH2  1 
ATOM   5412 N  N    . GLY A 1 771 ? 60.833 -35.033 -37.138 1.00 53.50  ? 765  GLY A N    1 
ATOM   5413 C  CA   . GLY A 1 771 ? 60.722 -35.828 -35.939 1.00 45.68  ? 765  GLY A CA   1 
ATOM   5414 C  C    . GLY A 1 771 ? 59.720 -36.949 -36.029 1.00 56.28  ? 765  GLY A C    1 
ATOM   5415 O  O    . GLY A 1 771 ? 59.260 -37.439 -34.994 1.00 63.20  ? 765  GLY A O    1 
ATOM   5416 N  N    . LEU A 1 772 ? 59.360 -37.372 -37.237 1.00 51.32  ? 766  LEU A N    1 
ATOM   5417 C  CA   . LEU A 1 772 ? 58.333 -38.378 -37.430 1.00 48.94  ? 766  LEU A CA   1 
ATOM   5418 C  C    . LEU A 1 772 ? 58.896 -39.787 -37.554 1.00 52.77  ? 766  LEU A C    1 
ATOM   5419 O  O    . LEU A 1 772 ? 58.116 -40.734 -37.700 1.00 50.55  ? 766  LEU A O    1 
ATOM   5420 C  CB   . LEU A 1 772 ? 57.519 -38.028 -38.665 1.00 52.18  ? 766  LEU A CB   1 
ATOM   5421 C  CG   . LEU A 1 772 ? 56.757 -36.706 -38.557 1.00 54.92  ? 766  LEU A CG   1 
ATOM   5422 C  CD1  . LEU A 1 772 ? 56.210 -36.313 -39.917 1.00 55.53  ? 766  LEU A CD1  1 
ATOM   5423 C  CD2  . LEU A 1 772 ? 55.626 -36.819 -37.562 1.00 54.67  ? 766  LEU A CD2  1 
ATOM   5424 N  N    . LEU A 1 773 ? 60.217 -39.953 -37.497 1.00 50.29  ? 767  LEU A N    1 
ATOM   5425 C  CA   . LEU A 1 773 ? 60.838 -41.263 -37.617 1.00 45.35  ? 767  LEU A CA   1 
ATOM   5426 C  C    . LEU A 1 773 ? 62.190 -41.207 -36.918 1.00 49.73  ? 767  LEU A C    1 
ATOM   5427 O  O    . LEU A 1 773 ? 62.769 -40.133 -36.748 1.00 51.19  ? 767  LEU A O    1 
ATOM   5428 C  CB   . LEU A 1 773 ? 61.002 -41.673 -39.086 1.00 48.29  ? 767  LEU A CB   1 
ATOM   5429 C  CG   . LEU A 1 773 ? 61.512 -43.081 -39.406 1.00 49.20  ? 767  LEU A CG   1 
ATOM   5430 C  CD1  . LEU A 1 773 ? 60.468 -44.139 -39.090 1.00 48.50  ? 767  LEU A CD1  1 
ATOM   5431 C  CD2  . LEU A 1 773 ? 61.933 -43.194 -40.825 1.00 45.37  ? 767  LEU A CD2  1 
ATOM   5432 N  N    . PHE A 1 774 ? 62.660 -42.368 -36.462 1.00 52.08  ? 768  PHE A N    1 
ATOM   5433 C  CA   . PHE A 1 774 ? 63.957 -42.507 -35.779 1.00 55.25  ? 768  PHE A CA   1 
ATOM   5434 C  C    . PHE A 1 774 ? 64.125 -41.496 -34.644 1.00 60.35  ? 768  PHE A C    1 
ATOM   5435 O  O    . PHE A 1 774 ? 65.249 -41.142 -34.277 1.00 58.81  ? 768  PHE A O    1 
ATOM   5436 C  CB   . PHE A 1 774 ? 65.134 -42.355 -36.735 1.00 55.67  ? 768  PHE A CB   1 
ATOM   5437 C  CG   . PHE A 1 774 ? 65.039 -43.194 -37.969 1.00 57.37  ? 768  PHE A CG   1 
ATOM   5438 C  CD1  . PHE A 1 774 ? 65.085 -44.572 -37.897 1.00 56.78  ? 768  PHE A CD1  1 
ATOM   5439 C  CD2  . PHE A 1 774 ? 65.012 -42.597 -39.208 1.00 49.39  ? 768  PHE A CD2  1 
ATOM   5440 C  CE1  . PHE A 1 774 ? 65.029 -45.323 -39.032 1.00 52.79  ? 768  PHE A CE1  1 
ATOM   5441 C  CE2  . PHE A 1 774 ? 64.976 -43.353 -40.342 1.00 51.24  ? 768  PHE A CE2  1 
ATOM   5442 C  CZ   . PHE A 1 774 ? 64.991 -44.712 -40.260 1.00 50.13  ? 768  PHE A CZ   1 
ATOM   5443 N  N    . ARG A 1 775 ? 63.014 -41.026 -34.074 1.00 59.32  ? 769  ARG A N    1 
ATOM   5444 C  CA   . ARG A 1 775 ? 63.047 -40.002 -33.032 1.00 63.09  ? 769  ARG A CA   1 
ATOM   5445 C  C    . ARG A 1 775 ? 63.987 -38.851 -33.401 1.00 61.11  ? 769  ARG A C    1 
ATOM   5446 O  O    . ARG A 1 775 ? 64.709 -38.315 -32.558 1.00 66.86  ? 769  ARG A O    1 
ATOM   5447 C  CB   . ARG A 1 775 ? 63.417 -40.619 -31.672 1.00 67.33  ? 769  ARG A CB   1 
ATOM   5448 C  CG   . ARG A 1 775 ? 63.389 -39.622 -30.555 1.00 72.75  ? 769  ARG A CG   1 
ATOM   5449 C  CD   . ARG A 1 775 ? 63.560 -40.234 -29.191 1.00 86.39  ? 769  ARG A CD   1 
ATOM   5450 N  NE   . ARG A 1 775 ? 64.810 -40.962 -29.005 1.00 93.22  ? 769  ARG A NE   1 
ATOM   5451 C  CZ   . ARG A 1 775 ? 65.069 -41.704 -27.929 1.00 98.32  ? 769  ARG A CZ   1 
ATOM   5452 N  NH1  . ARG A 1 775 ? 64.174 -41.787 -26.940 1.00 85.84  ? 769  ARG A NH1  1 
ATOM   5453 N  NH2  . ARG A 1 775 ? 66.227 -42.348 -27.829 1.00 100.31 ? 769  ARG A NH2  1 
ATOM   5454 N  N    . GLY A 1 776 ? 63.979 -38.465 -34.682 1.00 57.12  ? 770  GLY A N    1 
ATOM   5455 C  CA   . GLY A 1 776 ? 64.634 -37.253 -35.142 1.00 52.39  ? 770  GLY A CA   1 
ATOM   5456 C  C    . GLY A 1 776 ? 66.115 -37.366 -35.417 1.00 54.42  ? 770  GLY A C    1 
ATOM   5457 O  O    . GLY A 1 776 ? 66.710 -36.400 -35.921 1.00 49.49  ? 770  GLY A O    1 
ATOM   5458 N  N    . ARG A 1 777 ? 66.729 -38.510 -35.127 1.00 55.29  ? 771  ARG A N    1 
ATOM   5459 C  CA   . ARG A 1 777 ? 68.178 -38.669 -35.184 1.00 57.84  ? 771  ARG A CA   1 
ATOM   5460 C  C    . ARG A 1 777 ? 68.587 -39.157 -36.564 1.00 58.99  ? 771  ARG A C    1 
ATOM   5461 O  O    . ARG A 1 777 ? 68.185 -40.245 -36.982 1.00 58.86  ? 771  ARG A O    1 
ATOM   5462 C  CB   . ARG A 1 777 ? 68.655 -39.658 -34.125 1.00 54.22  ? 771  ARG A CB   1 
ATOM   5463 C  CG   . ARG A 1 777 ? 68.374 -39.197 -32.717 1.00 70.32  ? 771  ARG A CG   1 
ATOM   5464 C  CD   . ARG A 1 777 ? 68.704 -40.256 -31.692 1.00 74.53  ? 771  ARG A CD   1 
ATOM   5465 N  NE   . ARG A 1 777 ? 68.354 -39.806 -30.351 1.00 89.95  ? 771  ARG A NE   1 
ATOM   5466 C  CZ   . ARG A 1 777 ? 68.360 -40.595 -29.280 1.00 99.68  ? 771  ARG A CZ   1 
ATOM   5467 N  NH1  . ARG A 1 777 ? 68.683 -41.880 -29.409 1.00 102.22 ? 771  ARG A NH1  1 
ATOM   5468 N  NH2  . ARG A 1 777 ? 68.029 -40.111 -28.086 1.00 93.58  ? 771  ARG A NH2  1 
ATOM   5469 N  N    . ILE A 1 778 ? 69.437 -38.384 -37.230 1.00 58.96  ? 772  ILE A N    1 
ATOM   5470 C  CA   . ILE A 1 778 ? 69.857 -38.637 -38.604 1.00 58.74  ? 772  ILE A CA   1 
ATOM   5471 C  C    . ILE A 1 778 ? 71.211 -39.344 -38.606 1.00 55.79  ? 772  ILE A C    1 
ATOM   5472 O  O    . ILE A 1 778 ? 72.174 -38.868 -37.998 1.00 59.42  ? 772  ILE A O    1 
ATOM   5473 C  CB   . ILE A 1 778 ? 69.936 -37.318 -39.390 1.00 61.55  ? 772  ILE A CB   1 
ATOM   5474 C  CG1  . ILE A 1 778 ? 69.980 -37.606 -40.875 1.00 51.01  ? 772  ILE A CG1  1 
ATOM   5475 C  CG2  . ILE A 1 778 ? 71.143 -36.464 -38.903 1.00 64.36  ? 772  ILE A CG2  1 
ATOM   5476 C  CD1  . ILE A 1 778 ? 68.697 -38.134 -41.328 1.00 56.06  ? 772  ILE A CD1  1 
ATOM   5477 N  N    . SER A 1 779 ? 71.288 -40.470 -39.301 1.00 53.13  ? 773  SER A N    1 
ATOM   5478 C  CA   . SER A 1 779 ? 72.559 -41.111 -39.609 1.00 50.18  ? 773  SER A CA   1 
ATOM   5479 C  C    . SER A 1 779 ? 73.351 -40.300 -40.652 1.00 61.54  ? 773  SER A C    1 
ATOM   5480 O  O    . SER A 1 779 ? 72.795 -39.524 -41.440 1.00 57.55  ? 773  SER A O    1 
ATOM   5481 C  CB   . SER A 1 779 ? 72.275 -42.531 -40.112 1.00 55.78  ? 773  SER A CB   1 
ATOM   5482 O  OG   . SER A 1 779 ? 73.413 -43.200 -40.643 1.00 66.38  ? 773  SER A OG   1 
ATOM   5483 N  N    . GLU A 1 780 ? 74.674 -40.470 -40.645 1.00 60.20  ? 774  GLU A N    1 
ATOM   5484 C  CA   . GLU A 1 780 ? 75.468 -39.885 -41.717 1.00 55.49  ? 774  GLU A CA   1 
ATOM   5485 C  C    . GLU A 1 780 ? 75.316 -40.685 -43.006 1.00 61.04  ? 774  GLU A C    1 
ATOM   5486 O  O    . GLU A 1 780 ? 75.232 -40.097 -44.096 1.00 62.56  ? 774  GLU A O    1 
ATOM   5487 C  CB   . GLU A 1 780 ? 76.943 -39.795 -41.320 1.00 60.86  ? 774  GLU A CB   1 
ATOM   5488 C  CG   . GLU A 1 780 ? 77.289 -38.789 -40.227 1.00 61.82  ? 774  GLU A CG   1 
ATOM   5489 C  CD   . GLU A 1 780 ? 76.875 -37.355 -40.567 1.00 72.03  ? 774  GLU A CD   1 
ATOM   5490 O  OE1  . GLU A 1 780 ? 76.981 -36.916 -41.740 1.00 68.00  ? 774  GLU A OE1  1 
ATOM   5491 O  OE2  . GLU A 1 780 ? 76.440 -36.648 -39.635 1.00 85.08  ? 774  GLU A OE2  1 
ATOM   5492 N  N    . ARG A 1 781 ? 75.308 -42.025 -42.905 1.00 57.47  ? 775  ARG A N    1 
ATOM   5493 C  CA   . ARG A 1 781 ? 75.041 -42.869 -44.068 1.00 50.70  ? 775  ARG A CA   1 
ATOM   5494 C  C    . ARG A 1 781 ? 73.750 -42.441 -44.758 1.00 56.86  ? 775  ARG A C    1 
ATOM   5495 O  O    . ARG A 1 781 ? 73.702 -42.298 -45.987 1.00 59.49  ? 775  ARG A O    1 
ATOM   5496 C  CB   . ARG A 1 781 ? 74.936 -44.342 -43.665 1.00 53.98  ? 775  ARG A CB   1 
ATOM   5497 C  CG   . ARG A 1 781 ? 76.163 -45.053 -43.142 1.00 51.23  ? 775  ARG A CG   1 
ATOM   5498 C  CD   . ARG A 1 781 ? 77.070 -45.389 -44.215 1.00 49.93  ? 775  ARG A CD   1 
ATOM   5499 N  NE   . ARG A 1 781 ? 78.243 -46.214 -43.899 1.00 49.98  ? 775  ARG A NE   1 
ATOM   5500 C  CZ   . ARG A 1 781 ? 78.276 -47.543 -43.956 1.00 53.93  ? 775  ARG A CZ   1 
ATOM   5501 N  NH1  . ARG A 1 781 ? 77.179 -48.221 -44.241 1.00 54.96  ? 775  ARG A NH1  1 
ATOM   5502 N  NH2  . ARG A 1 781 ? 79.407 -48.205 -43.741 1.00 59.03  ? 775  ARG A NH2  1 
ATOM   5503 N  N    . LEU A 1 782 ? 72.689 -42.212 -43.975 1.00 55.02  ? 776  LEU A N    1 
ATOM   5504 C  CA   . LEU A 1 782 ? 71.398 -41.907 -44.584 1.00 55.23  ? 776  LEU A CA   1 
ATOM   5505 C  C    . LEU A 1 782 ? 71.477 -40.657 -45.460 1.00 54.31  ? 776  LEU A C    1 
ATOM   5506 O  O    . LEU A 1 782 ? 70.745 -40.547 -46.448 1.00 50.96  ? 776  LEU A O    1 
ATOM   5507 C  CB   . LEU A 1 782 ? 70.332 -41.747 -43.496 1.00 50.54  ? 776  LEU A CB   1 
ATOM   5508 C  CG   . LEU A 1 782 ? 68.887 -41.714 -43.982 1.00 48.14  ? 776  LEU A CG   1 
ATOM   5509 C  CD1  . LEU A 1 782 ? 68.552 -43.065 -44.563 1.00 48.16  ? 776  LEU A CD1  1 
ATOM   5510 C  CD2  . LEU A 1 782 ? 67.929 -41.396 -42.875 1.00 51.83  ? 776  LEU A CD2  1 
ATOM   5511 N  N    . LYS A 1 783 ? 72.375 -39.721 -45.132 1.00 51.91  ? 777  LYS A N    1 
ATOM   5512 C  CA   . LYS A 1 783 ? 72.522 -38.481 -45.886 1.00 53.55  ? 777  LYS A CA   1 
ATOM   5513 C  C    . LYS A 1 783 ? 73.149 -38.665 -47.276 1.00 55.43  ? 777  LYS A C    1 
ATOM   5514 O  O    . LYS A 1 783 ? 73.263 -37.682 -48.019 1.00 50.36  ? 777  LYS A O    1 
ATOM   5515 C  CB   . LYS A 1 783 ? 73.354 -37.493 -45.071 1.00 47.74  ? 777  LYS A CB   1 
ATOM   5516 C  CG   . LYS A 1 783 ? 72.651 -36.894 -43.889 1.00 55.51  ? 777  LYS A CG   1 
ATOM   5517 C  CD   . LYS A 1 783 ? 73.663 -36.152 -43.039 1.00 60.60  ? 777  LYS A CD   1 
ATOM   5518 C  CE   . LYS A 1 783 ? 73.059 -35.609 -41.765 1.00 68.23  ? 777  LYS A CE   1 
ATOM   5519 N  NZ   . LYS A 1 783 ? 74.118 -34.996 -40.900 1.00 71.93  ? 777  LYS A NZ   1 
ATOM   5520 N  N    . THR A 1 784 ? 73.574 -39.873 -47.634 1.00 50.39  ? 778  THR A N    1 
ATOM   5521 C  CA   . THR A 1 784 ? 74.387 -40.120 -48.818 1.00 49.07  ? 778  THR A CA   1 
ATOM   5522 C  C    . THR A 1 784 ? 73.505 -40.526 -50.001 1.00 52.88  ? 778  THR A C    1 
ATOM   5523 O  O    . THR A 1 784 ? 72.836 -41.564 -49.961 1.00 54.68  ? 778  THR A O    1 
ATOM   5524 C  CB   . THR A 1 784 ? 75.416 -41.209 -48.505 1.00 51.84  ? 778  THR A CB   1 
ATOM   5525 O  OG1  . THR A 1 784 ? 76.302 -40.754 -47.478 1.00 60.05  ? 778  THR A OG1  1 
ATOM   5526 C  CG2  . THR A 1 784 ? 76.231 -41.589 -49.709 1.00 43.15  ? 778  THR A CG2  1 
ATOM   5527 N  N    . ARG A 1 785 ? 73.527 -39.734 -51.067 1.00 54.81  ? 779  ARG A N    1 
ATOM   5528 C  CA   . ARG A 1 785 ? 72.783 -40.115 -52.260 1.00 53.08  ? 779  ARG A CA   1 
ATOM   5529 C  C    . ARG A 1 785 ? 73.183 -41.521 -52.693 1.00 50.72  ? 779  ARG A C    1 
ATOM   5530 O  O    . ARG A 1 785 ? 74.352 -41.908 -52.603 1.00 49.48  ? 779  ARG A O    1 
ATOM   5531 C  CB   . ARG A 1 785 ? 73.016 -39.110 -53.390 1.00 47.03  ? 779  ARG A CB   1 
ATOM   5532 C  CG   . ARG A 1 785 ? 72.315 -39.476 -54.664 1.00 54.59  ? 779  ARG A CG   1 
ATOM   5533 C  CD   . ARG A 1 785 ? 72.651 -38.544 -55.838 1.00 53.27  ? 779  ARG A CD   1 
ATOM   5534 N  NE   . ARG A 1 785 ? 72.263 -39.183 -57.096 1.00 56.02  ? 779  ARG A NE   1 
ATOM   5535 C  CZ   . ARG A 1 785 ? 71.055 -39.119 -57.660 1.00 64.66  ? 779  ARG A CZ   1 
ATOM   5536 N  NH1  . ARG A 1 785 ? 70.064 -38.394 -57.116 1.00 54.57  ? 779  ARG A NH1  1 
ATOM   5537 N  NH2  . ARG A 1 785 ? 70.843 -39.781 -58.800 1.00 62.94  ? 779  ARG A NH2  1 
ATOM   5538 N  N    . GLY A 1 786 ? 72.188 -42.302 -53.116 1.00 49.40  ? 780  GLY A N    1 
ATOM   5539 C  CA   . GLY A 1 786 ? 72.398 -43.641 -53.617 1.00 46.07  ? 780  GLY A CA   1 
ATOM   5540 C  C    . GLY A 1 786 ? 72.594 -44.705 -52.568 1.00 53.94  ? 780  GLY A C    1 
ATOM   5541 O  O    . GLY A 1 786 ? 72.763 -45.878 -52.918 1.00 58.20  ? 780  GLY A O    1 
ATOM   5542 N  N    . ILE A 1 787 ? 72.589 -44.342 -51.288 1.00 56.73  ? 781  ILE A N    1 
ATOM   5543 C  CA   . ILE A 1 787 ? 72.919 -45.306 -50.254 1.00 53.47  ? 781  ILE A CA   1 
ATOM   5544 C  C    . ILE A 1 787 ? 71.806 -46.317 -50.044 1.00 57.35  ? 781  ILE A C    1 
ATOM   5545 O  O    . ILE A 1 787 ? 72.054 -47.403 -49.491 1.00 57.18  ? 781  ILE A O    1 
ATOM   5546 C  CB   . ILE A 1 787 ? 73.210 -44.587 -48.929 1.00 51.79  ? 781  ILE A CB   1 
ATOM   5547 C  CG1  . ILE A 1 787 ? 73.843 -45.563 -47.949 1.00 51.23  ? 781  ILE A CG1  1 
ATOM   5548 C  CG2  . ILE A 1 787 ? 71.926 -44.016 -48.369 1.00 48.05  ? 781  ILE A CG2  1 
ATOM   5549 C  CD1  . ILE A 1 787 ? 75.185 -46.004 -48.386 1.00 54.84  ? 781  ILE A CD1  1 
ATOM   5550 N  N    . PHE A 1 788 ? 70.572 -45.985 -50.430 1.00 56.18  ? 782  PHE A N    1 
ATOM   5551 C  CA   . PHE A 1 788 ? 69.447 -46.837 -50.083 1.00 50.77  ? 782  PHE A CA   1 
ATOM   5552 C  C    . PHE A 1 788 ? 69.047 -47.537 -51.371 1.00 52.78  ? 782  PHE A C    1 
ATOM   5553 O  O    . PHE A 1 788 ? 68.256 -47.038 -52.173 1.00 57.51  ? 782  PHE A O    1 
ATOM   5554 C  CB   . PHE A 1 788 ? 68.396 -46.000 -49.343 1.00 48.25  ? 782  PHE A CB   1 
ATOM   5555 C  CG   . PHE A 1 788 ? 67.197 -46.768 -48.850 1.00 53.98  ? 782  PHE A CG   1 
ATOM   5556 C  CD1  . PHE A 1 788 ? 66.880 -48.026 -49.304 1.00 54.37  ? 782  PHE A CD1  1 
ATOM   5557 C  CD2  . PHE A 1 788 ? 66.706 -46.425 -47.590 1.00 52.11  ? 782  PHE A CD2  1 
ATOM   5558 C  CE1  . PHE A 1 788 ? 65.823 -48.737 -48.750 1.00 51.23  ? 782  PHE A CE1  1 
ATOM   5559 C  CE2  . PHE A 1 788 ? 65.714 -47.168 -46.970 1.00 49.17  ? 782  PHE A CE2  1 
ATOM   5560 C  CZ   . PHE A 1 788 ? 65.273 -48.324 -47.554 1.00 53.83  ? 782  PHE A CZ   1 
ATOM   5561 N  N    . GLU A 1 789 ? 69.552 -48.754 -51.494 1.00 49.39  ? 783  GLU A N    1 
ATOM   5562 C  CA   . GLU A 1 789 ? 69.561 -49.471 -52.742 1.00 48.65  ? 783  GLU A CA   1 
ATOM   5563 C  C    . GLU A 1 789 ? 68.159 -49.993 -53.002 1.00 52.40  ? 783  GLU A C    1 
ATOM   5564 O  O    . GLU A 1 789 ? 67.425 -50.330 -52.073 1.00 50.40  ? 783  GLU A O    1 
ATOM   5565 C  CB   . GLU A 1 789 ? 70.564 -50.623 -52.674 1.00 47.41  ? 783  GLU A CB   1 
ATOM   5566 C  CG   . GLU A 1 789 ? 71.966 -50.206 -52.293 1.00 50.18  ? 783  GLU A CG   1 
ATOM   5567 C  CD   . GLU A 1 789 ? 72.934 -51.389 -52.135 1.00 60.28  ? 783  GLU A CD   1 
ATOM   5568 O  OE1  . GLU A 1 789 ? 72.614 -52.518 -52.564 1.00 61.62  ? 783  GLU A OE1  1 
ATOM   5569 O  OE2  . GLU A 1 789 ? 73.968 -51.220 -51.450 1.00 63.46  ? 783  GLU A OE2  1 
ATOM   5570 N  N    . THR A 1 790 ? 67.784 -50.063 -54.280 1.00 53.57  ? 784  THR A N    1 
ATOM   5571 C  CA   . THR A 1 790 ? 66.424 -50.491 -54.571 1.00 50.22  ? 784  THR A CA   1 
ATOM   5572 C  C    . THR A 1 790 ? 66.170 -51.934 -54.138 1.00 47.65  ? 784  THR A C    1 
ATOM   5573 O  O    . THR A 1 790 ? 65.019 -52.289 -53.863 1.00 49.99  ? 784  THR A O    1 
ATOM   5574 C  CB   . THR A 1 790 ? 66.123 -50.227 -56.056 1.00 46.41  ? 784  THR A CB   1 
ATOM   5575 O  OG1  . THR A 1 790 ? 65.957 -48.813 -56.240 1.00 43.46  ? 784  THR A OG1  1 
ATOM   5576 C  CG2  . THR A 1 790 ? 64.880 -50.939 -56.524 1.00 40.57  ? 784  THR A CG2  1 
ATOM   5577 N  N    . LYS A 1 791 ? 67.210 -52.761 -54.000 1.00 47.44  ? 785  LYS A N    1 
ATOM   5578 C  CA   . LYS A 1 791 ? 66.960 -54.109 -53.499 1.00 44.22  ? 785  LYS A CA   1 
ATOM   5579 C  C    . LYS A 1 791 ? 66.514 -54.104 -52.041 1.00 49.65  ? 785  LYS A C    1 
ATOM   5580 O  O    . LYS A 1 791 ? 65.886 -55.076 -51.608 1.00 49.55  ? 785  LYS A O    1 
ATOM   5581 C  CB   . LYS A 1 791 ? 68.181 -55.020 -53.635 1.00 43.45  ? 785  LYS A CB   1 
ATOM   5582 C  CG   . LYS A 1 791 ? 69.326 -54.721 -52.678 1.00 50.66  ? 785  LYS A CG   1 
ATOM   5583 C  CD   . LYS A 1 791 ? 70.452 -55.711 -52.894 1.00 50.79  ? 785  LYS A CD   1 
ATOM   5584 C  CE   . LYS A 1 791 ? 71.646 -55.424 -52.005 1.00 56.07  ? 785  LYS A CE   1 
ATOM   5585 N  NZ   . LYS A 1 791 ? 72.748 -56.363 -52.357 1.00 66.48  ? 785  LYS A NZ   1 
ATOM   5586 N  N    . PHE A 1 792 ? 66.816 -53.046 -51.275 1.00 47.70  ? 786  PHE A N    1 
ATOM   5587 C  CA   . PHE A 1 792 ? 66.280 -52.968 -49.918 1.00 48.18  ? 786  PHE A CA   1 
ATOM   5588 C  C    . PHE A 1 792 ? 64.763 -52.965 -49.920 1.00 52.06  ? 786  PHE A C    1 
ATOM   5589 O  O    . PHE A 1 792 ? 64.139 -53.499 -48.986 1.00 52.47  ? 786  PHE A O    1 
ATOM   5590 C  CB   . PHE A 1 792 ? 66.780 -51.725 -49.178 1.00 45.69  ? 786  PHE A CB   1 
ATOM   5591 C  CG   . PHE A 1 792 ? 68.246 -51.727 -48.928 1.00 46.51  ? 786  PHE A CG   1 
ATOM   5592 C  CD1  . PHE A 1 792 ? 68.968 -52.902 -49.004 1.00 47.04  ? 786  PHE A CD1  1 
ATOM   5593 C  CD2  . PHE A 1 792 ? 68.907 -50.558 -48.638 1.00 45.27  ? 786  PHE A CD2  1 
ATOM   5594 C  CE1  . PHE A 1 792 ? 70.316 -52.901 -48.818 1.00 42.57  ? 786  PHE A CE1  1 
ATOM   5595 C  CE2  . PHE A 1 792 ? 70.247 -50.556 -48.450 1.00 44.63  ? 786  PHE A CE2  1 
ATOM   5596 C  CZ   . PHE A 1 792 ? 70.953 -51.730 -48.548 1.00 44.97  ? 786  PHE A CZ   1 
ATOM   5597 N  N    . LEU A 1 793 ? 64.149 -52.350 -50.939 1.00 47.67  ? 787  LEU A N    1 
ATOM   5598 C  CA   . LEU A 1 793 ? 62.692 -52.325 -50.989 1.00 50.39  ? 787  LEU A CA   1 
ATOM   5599 C  C    . LEU A 1 793 ? 62.132 -53.737 -51.061 1.00 50.54  ? 787  LEU A C    1 
ATOM   5600 O  O    . LEU A 1 793 ? 61.100 -54.036 -50.463 1.00 52.07  ? 787  LEU A O    1 
ATOM   5601 C  CB   . LEU A 1 793 ? 62.195 -51.493 -52.172 1.00 49.34  ? 787  LEU A CB   1 
ATOM   5602 C  CG   . LEU A 1 793 ? 62.046 -49.989 -51.957 1.00 48.15  ? 787  LEU A CG   1 
ATOM   5603 C  CD1  . LEU A 1 793 ? 63.389 -49.306 -51.992 1.00 46.25  ? 787  LEU A CD1  1 
ATOM   5604 C  CD2  . LEU A 1 793 ? 61.070 -49.382 -52.944 1.00 46.28  ? 787  LEU A CD2  1 
ATOM   5605 N  N    . SER A 1 794 ? 62.802 -54.623 -51.786 1.00 53.00  ? 788  SER A N    1 
ATOM   5606 C  CA   . SER A 1 794 ? 62.313 -55.990 -51.890 1.00 53.36  ? 788  SER A CA   1 
ATOM   5607 C  C    . SER A 1 794 ? 62.561 -56.744 -50.595 1.00 52.30  ? 788  SER A C    1 
ATOM   5608 O  O    . SER A 1 794 ? 61.707 -57.511 -50.136 1.00 52.27  ? 788  SER A O    1 
ATOM   5609 C  CB   . SER A 1 794 ? 62.982 -56.691 -53.075 1.00 49.72  ? 788  SER A CB   1 
ATOM   5610 O  OG   . SER A 1 794 ? 62.710 -55.972 -54.262 1.00 54.88  ? 788  SER A OG   1 
ATOM   5611 N  N    . GLN A 1 795 ? 63.727 -56.530 -49.988 1.00 53.18  ? 789  GLN A N    1 
ATOM   5612 C  CA   . GLN A 1 795 ? 64.032 -57.205 -48.740 1.00 49.26  ? 789  GLN A CA   1 
ATOM   5613 C  C    . GLN A 1 795 ? 63.140 -56.689 -47.621 1.00 51.37  ? 789  GLN A C    1 
ATOM   5614 O  O    . GLN A 1 795 ? 62.676 -57.466 -46.782 1.00 55.61  ? 789  GLN A O    1 
ATOM   5615 C  CB   . GLN A 1 795 ? 65.497 -57.005 -48.398 1.00 46.44  ? 789  GLN A CB   1 
ATOM   5616 C  CG   . GLN A 1 795 ? 66.433 -57.484 -49.466 1.00 48.42  ? 789  GLN A CG   1 
ATOM   5617 C  CD   . GLN A 1 795 ? 67.864 -57.174 -49.124 1.00 51.95  ? 789  GLN A CD   1 
ATOM   5618 O  OE1  . GLN A 1 795 ? 68.129 -56.420 -48.192 1.00 60.62  ? 789  GLN A OE1  1 
ATOM   5619 N  NE2  . GLN A 1 795 ? 68.792 -57.698 -49.904 1.00 47.66  ? 789  GLN A NE2  1 
ATOM   5620 N  N    . ILE A 1 796 ? 62.875 -55.384 -47.599 1.00 47.83  ? 790  ILE A N    1 
ATOM   5621 C  CA   . ILE A 1 796 ? 62.085 -54.847 -46.506 1.00 46.04  ? 790  ILE A CA   1 
ATOM   5622 C  C    . ILE A 1 796 ? 60.637 -55.266 -46.633 1.00 49.22  ? 790  ILE A C    1 
ATOM   5623 O  O    . ILE A 1 796 ? 59.957 -55.499 -45.626 1.00 53.50  ? 790  ILE A O    1 
ATOM   5624 C  CB   . ILE A 1 796 ? 62.238 -53.319 -46.439 1.00 47.42  ? 790  ILE A CB   1 
ATOM   5625 C  CG1  . ILE A 1 796 ? 63.664 -52.972 -45.964 1.00 49.38  ? 790  ILE A CG1  1 
ATOM   5626 C  CG2  . ILE A 1 796 ? 61.149 -52.706 -45.559 1.00 40.87  ? 790  ILE A CG2  1 
ATOM   5627 C  CD1  . ILE A 1 796 ? 64.034 -51.522 -46.086 1.00 47.73  ? 790  ILE A CD1  1 
ATOM   5628 N  N    . GLU A 1 797 ? 60.131 -55.376 -47.850 1.00 49.64  ? 791  GLU A N    1 
ATOM   5629 C  CA   . GLU A 1 797 ? 58.725 -55.687 -48.022 1.00 50.17  ? 791  GLU A CA   1 
ATOM   5630 C  C    . GLU A 1 797 ? 58.441 -57.189 -48.028 1.00 51.65  ? 791  GLU A C    1 
ATOM   5631 O  O    . GLU A 1 797 ? 57.277 -57.584 -47.878 1.00 50.38  ? 791  GLU A O    1 
ATOM   5632 C  CB   . GLU A 1 797 ? 58.217 -54.998 -49.285 1.00 49.55  ? 791  GLU A CB   1 
ATOM   5633 C  CG   . GLU A 1 797 ? 56.778 -55.275 -49.591 1.00 58.79  ? 791  GLU A CG   1 
ATOM   5634 C  CD   . GLU A 1 797 ? 56.205 -54.325 -50.614 1.00 60.19  ? 791  GLU A CD   1 
ATOM   5635 O  OE1  . GLU A 1 797 ? 56.891 -53.325 -50.930 1.00 63.79  ? 791  GLU A OE1  1 
ATOM   5636 O  OE2  . GLU A 1 797 ? 55.089 -54.594 -51.126 1.00 60.46  ? 791  GLU A OE2  1 
ATOM   5637 N  N    . SER A 1 798 ? 59.480 -58.019 -48.154 1.00 48.82  ? 792  SER A N    1 
ATOM   5638 C  CA   . SER A 1 798 ? 59.393 -59.465 -48.024 1.00 46.68  ? 792  SER A CA   1 
ATOM   5639 C  C    . SER A 1 798 ? 59.470 -59.917 -46.578 1.00 55.72  ? 792  SER A C    1 
ATOM   5640 O  O    . SER A 1 798 ? 59.433 -61.124 -46.315 1.00 59.65  ? 792  SER A O    1 
ATOM   5641 C  CB   . SER A 1 798 ? 60.529 -60.142 -48.784 1.00 48.63  ? 792  SER A CB   1 
ATOM   5642 O  OG   . SER A 1 798 ? 60.452 -59.905 -50.176 1.00 65.13  ? 792  SER A OG   1 
ATOM   5643 N  N    . ASP A 1 799 ? 59.597 -58.980 -45.650 1.00 53.49  ? 793  ASP A N    1 
ATOM   5644 C  CA   . ASP A 1 799 ? 59.967 -59.262 -44.277 1.00 52.22  ? 793  ASP A CA   1 
ATOM   5645 C  C    . ASP A 1 799 ? 58.713 -59.160 -43.415 1.00 56.02  ? 793  ASP A C    1 
ATOM   5646 O  O    . ASP A 1 799 ? 57.799 -58.383 -43.708 1.00 57.81  ? 793  ASP A O    1 
ATOM   5647 C  CB   . ASP A 1 799 ? 61.046 -58.270 -43.819 1.00 49.56  ? 793  ASP A CB   1 
ATOM   5648 C  CG   . ASP A 1 799 ? 61.795 -58.732 -42.583 1.00 56.66  ? 793  ASP A CG   1 
ATOM   5649 O  OD1  . ASP A 1 799 ? 61.624 -59.905 -42.169 1.00 57.02  ? 793  ASP A OD1  1 
ATOM   5650 O  OD2  . ASP A 1 799 ? 62.563 -57.914 -42.029 1.00 54.12  ? 793  ASP A OD2  1 
ATOM   5651 N  N    . CYS A 1 800 ? 58.658 -59.965 -42.362 1.00 56.39  ? 794  CYS A N    1 
ATOM   5652 C  CA   . CYS A 1 800 ? 57.434 -60.073 -41.579 1.00 61.61  ? 794  CYS A CA   1 
ATOM   5653 C  C    . CYS A 1 800 ? 57.776 -60.308 -40.103 1.00 55.98  ? 794  CYS A C    1 
ATOM   5654 O  O    . CYS A 1 800 ? 58.942 -60.478 -39.732 1.00 51.70  ? 794  CYS A O    1 
ATOM   5655 C  CB   . CYS A 1 800 ? 56.565 -61.190 -42.165 1.00 52.51  ? 794  CYS A CB   1 
ATOM   5656 S  SG   . CYS A 1 800 ? 57.517 -62.715 -42.373 1.00 69.32  ? 794  CYS A SG   1 
ATOM   5657 N  N    . LEU A 1 801 ? 56.735 -60.336 -39.261 1.00 57.38  ? 795  LEU A N    1 
ATOM   5658 C  CA   . LEU A 1 801 ? 56.890 -60.697 -37.854 1.00 56.37  ? 795  LEU A CA   1 
ATOM   5659 C  C    . LEU A 1 801 ? 57.867 -59.794 -37.104 1.00 50.06  ? 795  LEU A C    1 
ATOM   5660 O  O    . LEU A 1 801 ? 57.558 -58.631 -36.824 1.00 48.39  ? 795  LEU A O    1 
ATOM   5661 C  CB   . LEU A 1 801 ? 57.332 -62.159 -37.739 1.00 53.19  ? 795  LEU A CB   1 
ATOM   5662 C  CG   . LEU A 1 801 ? 56.342 -63.197 -38.283 1.00 49.75  ? 795  LEU A CG   1 
ATOM   5663 C  CD1  . LEU A 1 801 ? 56.897 -64.581 -38.078 1.00 46.06  ? 795  LEU A CD1  1 
ATOM   5664 C  CD2  . LEU A 1 801 ? 54.943 -63.074 -37.691 1.00 48.44  ? 795  LEU A CD2  1 
ATOM   5665 N  N    . ALA A 1 802 ? 59.008 -60.350 -36.690 1.00 45.60  ? 796  ALA A N    1 
ATOM   5666 C  CA   . ALA A 1 802 ? 59.981 -59.565 -35.933 1.00 50.09  ? 796  ALA A CA   1 
ATOM   5667 C  C    . ALA A 1 802 ? 60.578 -58.410 -36.736 1.00 53.61  ? 796  ALA A C    1 
ATOM   5668 O  O    . ALA A 1 802 ? 61.113 -57.473 -36.130 1.00 52.94  ? 796  ALA A O    1 
ATOM   5669 C  CB   . ALA A 1 802 ? 61.111 -60.466 -35.420 1.00 45.56  ? 796  ALA A CB   1 
ATOM   5670 N  N    . LEU A 1 803 ? 60.517 -58.469 -38.077 1.00 46.96  ? 797  LEU A N    1 
ATOM   5671 C  CA   . LEU A 1 803 ? 61.109 -57.468 -38.966 1.00 42.93  ? 797  LEU A CA   1 
ATOM   5672 C  C    . LEU A 1 803 ? 62.609 -57.336 -38.726 1.00 46.57  ? 797  LEU A C    1 
ATOM   5673 O  O    . LEU A 1 803 ? 63.159 -56.234 -38.656 1.00 48.09  ? 797  LEU A O    1 
ATOM   5674 C  CB   . LEU A 1 803 ? 60.411 -56.112 -38.839 1.00 37.51  ? 797  LEU A CB   1 
ATOM   5675 C  CG   . LEU A 1 803 ? 58.940 -56.043 -39.259 1.00 41.76  ? 797  LEU A CG   1 
ATOM   5676 C  CD1  . LEU A 1 803 ? 58.328 -54.668 -39.038 1.00 39.41  ? 797  LEU A CD1  1 
ATOM   5677 C  CD2  . LEU A 1 803 ? 58.791 -56.473 -40.713 1.00 53.76  ? 797  LEU A CD2  1 
ATOM   5678 N  N    . LEU A 1 804 ? 63.286 -58.478 -38.607 1.00 45.81  ? 798  LEU A N    1 
ATOM   5679 C  CA   . LEU A 1 804 ? 64.706 -58.425 -38.267 1.00 45.59  ? 798  LEU A CA   1 
ATOM   5680 C  C    . LEU A 1 804 ? 65.541 -57.937 -39.439 1.00 53.80  ? 798  LEU A C    1 
ATOM   5681 O  O    . LEU A 1 804 ? 66.548 -57.244 -39.251 1.00 56.34  ? 798  LEU A O    1 
ATOM   5682 C  CB   . LEU A 1 804 ? 65.211 -59.792 -37.802 1.00 44.91  ? 798  LEU A CB   1 
ATOM   5683 C  CG   . LEU A 1 804 ? 64.660 -60.354 -36.474 1.00 52.93  ? 798  LEU A CG   1 
ATOM   5684 C  CD1  . LEU A 1 804 ? 65.345 -61.675 -36.162 1.00 45.05  ? 798  LEU A CD1  1 
ATOM   5685 C  CD2  . LEU A 1 804 ? 64.750 -59.358 -35.304 1.00 41.54  ? 798  LEU A CD2  1 
ATOM   5686 N  N    . GLN A 1 805 ? 65.140 -58.304 -40.657 1.00 56.11  ? 799  GLN A N    1 
ATOM   5687 C  CA   . GLN A 1 805 ? 65.880 -57.926 -41.848 1.00 52.36  ? 799  GLN A CA   1 
ATOM   5688 C  C    . GLN A 1 805 ? 65.741 -56.434 -42.142 1.00 50.30  ? 799  GLN A C    1 
ATOM   5689 O  O    . GLN A 1 805 ? 66.678 -55.816 -42.655 1.00 49.80  ? 799  GLN A O    1 
ATOM   5690 C  CB   . GLN A 1 805 ? 65.387 -58.781 -43.005 1.00 50.88  ? 799  GLN A CB   1 
ATOM   5691 C  CG   . GLN A 1 805 ? 66.175 -58.657 -44.259 1.00 64.82  ? 799  GLN A CG   1 
ATOM   5692 C  CD   . GLN A 1 805 ? 67.629 -59.043 -44.059 1.00 77.30  ? 799  GLN A CD   1 
ATOM   5693 O  OE1  . GLN A 1 805 ? 67.932 -60.014 -43.345 1.00 75.24  ? 799  GLN A OE1  1 
ATOM   5694 N  NE2  . GLN A 1 805 ? 68.534 -58.350 -44.770 1.00 73.40  ? 799  GLN A NE2  1 
ATOM   5695 N  N    . VAL A 1 806 ? 64.600 -55.833 -41.801 1.00 42.64  ? 800  VAL A N    1 
ATOM   5696 C  CA   . VAL A 1 806 ? 64.471 -54.388 -41.912 1.00 39.06  ? 800  VAL A CA   1 
ATOM   5697 C  C    . VAL A 1 806 ? 65.461 -53.708 -40.978 1.00 50.40  ? 800  VAL A C    1 
ATOM   5698 O  O    . VAL A 1 806 ? 66.203 -52.804 -41.379 1.00 51.28  ? 800  VAL A O    1 
ATOM   5699 C  CB   . VAL A 1 806 ? 63.025 -53.957 -41.617 1.00 42.34  ? 800  VAL A CB   1 
ATOM   5700 C  CG1  . VAL A 1 806 ? 62.859 -52.438 -41.704 1.00 40.16  ? 800  VAL A CG1  1 
ATOM   5701 C  CG2  . VAL A 1 806 ? 62.044 -54.697 -42.491 1.00 37.60  ? 800  VAL A CG2  1 
ATOM   5702 N  N    . ARG A 1 807 ? 65.494 -54.143 -39.708 1.00 54.40  ? 801  ARG A N    1 
ATOM   5703 C  CA   . ARG A 1 807 ? 66.445 -53.573 -38.760 1.00 49.40  ? 801  ARG A CA   1 
ATOM   5704 C  C    . ARG A 1 807 ? 67.886 -53.764 -39.226 1.00 50.62  ? 801  ARG A C    1 
ATOM   5705 O  O    . ARG A 1 807 ? 68.694 -52.837 -39.133 1.00 51.75  ? 801  ARG A O    1 
ATOM   5706 C  CB   . ARG A 1 807 ? 66.245 -54.174 -37.370 1.00 56.58  ? 801  ARG A CB   1 
ATOM   5707 C  CG   . ARG A 1 807 ? 67.237 -53.591 -36.351 1.00 61.59  ? 801  ARG A CG   1 
ATOM   5708 C  CD   . ARG A 1 807 ? 66.975 -53.996 -34.910 1.00 69.31  ? 801  ARG A CD   1 
ATOM   5709 N  NE   . ARG A 1 807 ? 67.144 -55.423 -34.648 1.00 78.52  ? 801  ARG A NE   1 
ATOM   5710 C  CZ   . ARG A 1 807 ? 66.689 -56.033 -33.551 1.00 84.62  ? 801  ARG A CZ   1 
ATOM   5711 N  NH1  . ARG A 1 807 ? 66.044 -55.330 -32.620 1.00 81.32  ? 801  ARG A NH1  1 
ATOM   5712 N  NH2  . ARG A 1 807 ? 66.874 -57.341 -33.381 1.00 77.30  ? 801  ARG A NH2  1 
ATOM   5713 N  N    . ALA A 1 808 ? 68.231 -54.957 -39.725 1.00 47.85  ? 802  ALA A N    1 
ATOM   5714 C  CA   . ALA A 1 808 ? 69.580 -55.180 -40.236 1.00 44.59  ? 802  ALA A CA   1 
ATOM   5715 C  C    . ALA A 1 808 ? 69.968 -54.108 -41.238 1.00 53.87  ? 802  ALA A C    1 
ATOM   5716 O  O    . ALA A 1 808 ? 71.101 -53.608 -41.225 1.00 56.66  ? 802  ALA A O    1 
ATOM   5717 C  CB   . ALA A 1 808 ? 69.686 -56.563 -40.874 1.00 38.88  ? 802  ALA A CB   1 
ATOM   5718 N  N    . ILE A 1 809 ? 69.027 -53.734 -42.110 1.00 50.51  ? 803  ILE A N    1 
ATOM   5719 C  CA   . ILE A 1 809 ? 69.289 -52.708 -43.108 1.00 52.31  ? 803  ILE A CA   1 
ATOM   5720 C  C    . ILE A 1 809 ? 69.426 -51.347 -42.441 1.00 51.56  ? 803  ILE A C    1 
ATOM   5721 O  O    . ILE A 1 809 ? 70.376 -50.606 -42.707 1.00 56.01  ? 803  ILE A O    1 
ATOM   5722 C  CB   . ILE A 1 809 ? 68.185 -52.728 -44.189 1.00 49.67  ? 803  ILE A CB   1 
ATOM   5723 C  CG1  . ILE A 1 809 ? 68.319 -53.973 -45.066 1.00 45.44  ? 803  ILE A CG1  1 
ATOM   5724 C  CG2  . ILE A 1 809 ? 68.209 -51.468 -45.035 1.00 45.33  ? 803  ILE A CG2  1 
ATOM   5725 C  CD1  . ILE A 1 809 ? 67.066 -54.311 -45.801 1.00 45.13  ? 803  ILE A CD1  1 
ATOM   5726 N  N    . LEU A 1 810 ? 68.490 -50.998 -41.560 1.00 47.54  ? 804  LEU A N    1 
ATOM   5727 C  CA   . LEU A 1 810 ? 68.588 -49.707 -40.888 1.00 51.16  ? 804  LEU A CA   1 
ATOM   5728 C  C    . LEU A 1 810 ? 69.869 -49.601 -40.062 1.00 56.62  ? 804  LEU A C    1 
ATOM   5729 O  O    . LEU A 1 810 ? 70.409 -48.503 -39.874 1.00 56.44  ? 804  LEU A O    1 
ATOM   5730 C  CB   . LEU A 1 810 ? 67.353 -49.477 -40.016 1.00 51.86  ? 804  LEU A CB   1 
ATOM   5731 C  CG   . LEU A 1 810 ? 66.029 -49.377 -40.770 1.00 50.80  ? 804  LEU A CG   1 
ATOM   5732 C  CD1  . LEU A 1 810 ? 64.889 -49.236 -39.807 1.00 46.47  ? 804  LEU A CD1  1 
ATOM   5733 C  CD2  . LEU A 1 810 ? 66.051 -48.197 -41.729 1.00 47.37  ? 804  LEU A CD2  1 
ATOM   5734 N  N    . GLN A 1 811 ? 70.372 -50.724 -39.556 1.00 55.52  ? 805  GLN A N    1 
ATOM   5735 C  CA   . GLN A 1 811 ? 71.669 -50.707 -38.896 1.00 54.80  ? 805  GLN A CA   1 
ATOM   5736 C  C    . GLN A 1 811 ? 72.776 -50.352 -39.875 1.00 54.83  ? 805  GLN A C    1 
ATOM   5737 O  O    . GLN A 1 811 ? 73.548 -49.413 -39.647 1.00 56.84  ? 805  GLN A O    1 
ATOM   5738 C  CB   . GLN A 1 811 ? 71.933 -52.055 -38.252 1.00 55.08  ? 805  GLN A CB   1 
ATOM   5739 C  CG   . GLN A 1 811 ? 73.325 -52.186 -37.690 1.00 59.47  ? 805  GLN A CG   1 
ATOM   5740 C  CD   . GLN A 1 811 ? 73.502 -53.480 -36.959 1.00 59.96  ? 805  GLN A CD   1 
ATOM   5741 O  OE1  . GLN A 1 811 ? 72.515 -54.098 -36.530 1.00 65.31  ? 805  GLN A OE1  1 
ATOM   5742 N  NE2  . GLN A 1 811 ? 74.746 -53.962 -36.899 1.00 51.60  ? 805  GLN A NE2  1 
ATOM   5743 N  N    . HIS A 1 812 ? 72.840 -51.076 -40.984 1.00 54.70  ? 806  HIS A N    1 
ATOM   5744 C  CA   . HIS A 1 812 ? 73.769 -50.821 -42.077 1.00 54.83  ? 806  HIS A CA   1 
ATOM   5745 C  C    . HIS A 1 812 ? 73.888 -49.342 -42.426 1.00 54.61  ? 806  HIS A C    1 
ATOM   5746 O  O    . HIS A 1 812 ? 74.989 -48.862 -42.697 1.00 57.25  ? 806  HIS A O    1 
ATOM   5747 C  CB   . HIS A 1 812 ? 73.301 -51.624 -43.278 1.00 53.65  ? 806  HIS A CB   1 
ATOM   5748 C  CG   . HIS A 1 812 ? 74.037 -51.334 -44.545 1.00 59.68  ? 806  HIS A CG   1 
ATOM   5749 N  ND1  . HIS A 1 812 ? 75.394 -51.528 -44.685 1.00 62.89  ? 806  HIS A ND1  1 
ATOM   5750 C  CD2  . HIS A 1 812 ? 73.586 -50.921 -45.752 1.00 48.32  ? 806  HIS A CD2  1 
ATOM   5751 C  CE1  . HIS A 1 812 ? 75.749 -51.227 -45.920 1.00 54.36  ? 806  HIS A CE1  1 
ATOM   5752 N  NE2  . HIS A 1 812 ? 74.672 -50.852 -46.583 1.00 47.62  ? 806  HIS A NE2  1 
ATOM   5753 N  N    . LEU A 1 813 ? 72.783 -48.601 -42.395 1.00 53.36  ? 807  LEU A N    1 
ATOM   5754 C  CA   . LEU A 1 813 ? 72.815 -47.156 -42.612 1.00 55.51  ? 807  LEU A CA   1 
ATOM   5755 C  C    . LEU A 1 813 ? 72.741 -46.585 -41.212 1.00 59.13  ? 807  LEU A C    1 
ATOM   5756 O  O    . LEU A 1 813 ? 71.659 -46.231 -40.758 1.00 69.57  ? 807  LEU A O    1 
ATOM   5757 C  CB   . LEU A 1 813 ? 71.558 -46.737 -43.366 1.00 53.70  ? 807  LEU A CB   1 
ATOM   5758 C  CG   . LEU A 1 813 ? 71.118 -47.517 -44.594 1.00 51.92  ? 807  LEU A CG   1 
ATOM   5759 C  CD1  . LEU A 1 813 ? 69.660 -47.226 -44.877 1.00 48.91  ? 807  LEU A CD1  1 
ATOM   5760 C  CD2  . LEU A 1 813 ? 71.969 -47.115 -45.761 1.00 53.67  ? 807  LEU A CD2  1 
ATOM   5761 N  N    . GLY A 1 814 ? 73.876 -46.358 -40.565 1.00 57.81  ? 808  GLY A N    1 
ATOM   5762 C  CA   . GLY A 1 814 ? 73.747 -46.650 -39.145 1.00 48.90  ? 808  GLY A CA   1 
ATOM   5763 C  C    . GLY A 1 814 ? 72.736 -45.778 -38.435 1.00 52.87  ? 808  GLY A C    1 
ATOM   5764 O  O    . GLY A 1 814 ? 73.031 -44.653 -38.035 1.00 53.93  ? 808  GLY A O    1 
ATOM   5765 N  N    . LEU A 1 815 ? 71.590 -46.372 -38.121 1.00 56.82  ? 809  LEU A N    1 
ATOM   5766 C  CA   . LEU A 1 815 ? 70.432 -45.663 -37.600 1.00 55.13  ? 809  LEU A CA   1 
ATOM   5767 C  C    . LEU A 1 815 ? 69.986 -46.341 -36.313 1.00 60.06  ? 809  LEU A C    1 
ATOM   5768 O  O    . LEU A 1 815 ? 69.990 -47.576 -36.209 1.00 58.07  ? 809  LEU A O    1 
ATOM   5769 C  CB   . LEU A 1 815 ? 69.288 -45.656 -38.612 1.00 53.71  ? 809  LEU A CB   1 
ATOM   5770 C  CG   . LEU A 1 815 ? 69.350 -44.877 -39.936 1.00 56.49  ? 809  LEU A CG   1 
ATOM   5771 C  CD1  . LEU A 1 815 ? 68.298 -45.366 -40.915 1.00 47.13  ? 809  LEU A CD1  1 
ATOM   5772 C  CD2  . LEU A 1 815 ? 69.138 -43.397 -39.685 1.00 55.48  ? 809  LEU A CD2  1 
ATOM   5773 N  N    . GLU A 1 816 ? 69.609 -45.534 -35.328 1.00 60.00  ? 810  GLU A N    1 
ATOM   5774 C  CA   . GLU A 1 816 ? 69.120 -46.070 -34.068 1.00 61.99  ? 810  GLU A CA   1 
ATOM   5775 C  C    . GLU A 1 816 ? 67.617 -46.188 -34.231 1.00 62.41  ? 810  GLU A C    1 
ATOM   5776 O  O    . GLU A 1 816 ? 66.905 -45.176 -34.255 1.00 65.81  ? 810  GLU A O    1 
ATOM   5777 C  CB   . GLU A 1 816 ? 69.503 -45.170 -32.895 1.00 67.62  ? 810  GLU A CB   1 
ATOM   5778 N  N    . SER A 1 817 ? 67.137 -47.422 -34.343 1.00 57.74  ? 811  SER A N    1 
ATOM   5779 C  CA   . SER A 1 817 ? 65.790 -47.679 -34.824 1.00 60.81  ? 811  SER A CA   1 
ATOM   5780 C  C    . SER A 1 817 ? 65.074 -48.590 -33.844 1.00 61.40  ? 811  SER A C    1 
ATOM   5781 O  O    . SER A 1 817 ? 65.652 -49.579 -33.379 1.00 59.31  ? 811  SER A O    1 
ATOM   5782 C  CB   . SER A 1 817 ? 65.808 -48.313 -36.231 1.00 59.98  ? 811  SER A CB   1 
ATOM   5783 O  OG   . SER A 1 817 ? 66.430 -49.594 -36.231 1.00 62.85  ? 811  SER A OG   1 
ATOM   5784 N  N    . THR A 1 818 ? 63.823 -48.249 -33.534 1.00 60.32  ? 812  THR A N    1 
ATOM   5785 C  CA   . THR A 1 818 ? 62.957 -49.135 -32.780 1.00 58.80  ? 812  THR A CA   1 
ATOM   5786 C  C    . THR A 1 818 ? 62.252 -50.107 -33.734 1.00 59.83  ? 812  THR A C    1 
ATOM   5787 O  O    . THR A 1 818 ? 62.362 -50.021 -34.959 1.00 57.38  ? 812  THR A O    1 
ATOM   5788 C  CB   . THR A 1 818 ? 61.953 -48.321 -31.958 1.00 58.50  ? 812  THR A CB   1 
ATOM   5789 O  OG1  . THR A 1 818 ? 61.150 -47.514 -32.821 1.00 58.56  ? 812  THR A OG1  1 
ATOM   5790 C  CG2  . THR A 1 818 ? 62.670 -47.394 -31.004 1.00 62.74  ? 812  THR A CG2  1 
ATOM   5791 N  N    . CYS A 1 819 ? 61.497 -51.045 -33.163 1.00 66.13  ? 813  CYS A N    1 
ATOM   5792 C  CA   . CYS A 1 819 ? 60.742 -51.982 -33.986 1.00 60.17  ? 813  CYS A CA   1 
ATOM   5793 C  C    . CYS A 1 819 ? 59.542 -51.312 -34.633 1.00 57.64  ? 813  CYS A C    1 
ATOM   5794 O  O    . CYS A 1 819 ? 58.965 -51.877 -35.572 1.00 55.87  ? 813  CYS A O    1 
ATOM   5795 C  CB   . CYS A 1 819 ? 60.254 -53.163 -33.143 1.00 59.92  ? 813  CYS A CB   1 
ATOM   5796 S  SG   . CYS A 1 819 ? 58.952 -52.705 -31.975 1.00 60.32  ? 813  CYS A SG   1 
ATOM   5797 N  N    . ASP A 1 820 ? 59.131 -50.146 -34.109 1.00 56.25  ? 814  ASP A N    1 
ATOM   5798 C  CA   . ASP A 1 820 ? 58.075 -49.348 -34.720 1.00 57.85  ? 814  ASP A CA   1 
ATOM   5799 C  C    . ASP A 1 820 ? 58.588 -48.565 -35.919 1.00 58.09  ? 814  ASP A C    1 
ATOM   5800 O  O    . ASP A 1 820 ? 57.841 -48.359 -36.884 1.00 55.38  ? 814  ASP A O    1 
ATOM   5801 C  CB   . ASP A 1 820 ? 57.477 -48.366 -33.715 1.00 53.60  ? 814  ASP A CB   1 
ATOM   5802 C  CG   . ASP A 1 820 ? 56.718 -49.049 -32.591 1.00 68.78  ? 814  ASP A CG   1 
ATOM   5803 O  OD1  . ASP A 1 820 ? 56.426 -50.266 -32.670 1.00 65.68  ? 814  ASP A OD1  1 
ATOM   5804 O  OD2  . ASP A 1 820 ? 56.399 -48.341 -31.613 1.00 77.83  ? 814  ASP A OD2  1 
ATOM   5805 N  N    . ASP A 1 821 ? 59.836 -48.091 -35.852 1.00 55.50  ? 815  ASP A N    1 
ATOM   5806 C  CA   . ASP A 1 821 ? 60.480 -47.509 -37.022 1.00 52.59  ? 815  ASP A CA   1 
ATOM   5807 C  C    . ASP A 1 821 ? 60.472 -48.494 -38.179 1.00 53.17  ? 815  ASP A C    1 
ATOM   5808 O  O    . ASP A 1 821 ? 60.098 -48.142 -39.305 1.00 47.14  ? 815  ASP A O    1 
ATOM   5809 C  CB   . ASP A 1 821 ? 61.910 -47.102 -36.685 1.00 53.69  ? 815  ASP A CB   1 
ATOM   5810 C  CG   . ASP A 1 821 ? 61.974 -45.932 -35.730 1.00 61.45  ? 815  ASP A CG   1 
ATOM   5811 O  OD1  . ASP A 1 821 ? 61.001 -45.136 -35.674 1.00 58.24  ? 815  ASP A OD1  1 
ATOM   5812 O  OD2  . ASP A 1 821 ? 62.984 -45.848 -34.985 1.00 66.25  ? 815  ASP A OD2  1 
ATOM   5813 N  N    . SER A 1 822 ? 60.871 -49.745 -37.916 1.00 51.14  ? 816  SER A N    1 
ATOM   5814 C  CA   . SER A 1 822 ? 60.883 -50.735 -38.984 1.00 50.14  ? 816  SER A CA   1 
ATOM   5815 C  C    . SER A 1 822 ? 59.520 -50.821 -39.653 1.00 50.23  ? 816  SER A C    1 
ATOM   5816 O  O    . SER A 1 822 ? 59.427 -50.862 -40.882 1.00 51.32  ? 816  SER A O    1 
ATOM   5817 C  CB   . SER A 1 822 ? 61.321 -52.097 -38.453 1.00 48.36  ? 816  SER A CB   1 
ATOM   5818 O  OG   . SER A 1 822 ? 62.674 -52.069 -38.011 1.00 54.58  ? 816  SER A OG   1 
ATOM   5819 N  N    . ILE A 1 823 ? 58.452 -50.804 -38.865 1.00 52.63  ? 817  ILE A N    1 
ATOM   5820 C  CA   . ILE A 1 823 ? 57.108 -50.833 -39.433 1.00 47.80  ? 817  ILE A CA   1 
ATOM   5821 C  C    . ILE A 1 823 ? 56.874 -49.620 -40.323 1.00 44.95  ? 817  ILE A C    1 
ATOM   5822 O  O    . ILE A 1 823 ? 56.356 -49.752 -41.433 1.00 53.06  ? 817  ILE A O    1 
ATOM   5823 C  CB   . ILE A 1 823 ? 56.062 -50.943 -38.304 1.00 48.89  ? 817  ILE A CB   1 
ATOM   5824 C  CG1  . ILE A 1 823 ? 56.172 -52.309 -37.604 1.00 51.11  ? 817  ILE A CG1  1 
ATOM   5825 C  CG2  . ILE A 1 823 ? 54.676 -50.747 -38.829 1.00 37.98  ? 817  ILE A CG2  1 
ATOM   5826 C  CD1  . ILE A 1 823 ? 55.440 -52.377 -36.248 1.00 52.15  ? 817  ILE A CD1  1 
ATOM   5827 N  N    . ILE A 1 824 ? 57.268 -48.424 -39.878 1.00 43.56  ? 818  ILE A N    1 
ATOM   5828 C  CA   . ILE A 1 824 ? 57.068 -47.241 -40.719 1.00 46.69  ? 818  ILE A CA   1 
ATOM   5829 C  C    . ILE A 1 824 ? 57.914 -47.319 -41.999 1.00 50.91  ? 818  ILE A C    1 
ATOM   5830 O  O    . ILE A 1 824 ? 57.429 -47.011 -43.094 1.00 47.97  ? 818  ILE A O    1 
ATOM   5831 C  CB   . ILE A 1 824 ? 57.356 -45.952 -39.939 1.00 43.88  ? 818  ILE A CB   1 
ATOM   5832 C  CG1  . ILE A 1 824 ? 56.276 -45.696 -38.887 1.00 52.02  ? 818  ILE A CG1  1 
ATOM   5833 C  CG2  . ILE A 1 824 ? 57.432 -44.781 -40.893 1.00 45.71  ? 818  ILE A CG2  1 
ATOM   5834 C  CD1  . ILE A 1 824 ? 56.684 -44.705 -37.785 1.00 40.47  ? 818  ILE A CD1  1 
ATOM   5835 N  N    . VAL A 1 825 ? 59.183 -47.728 -41.888 1.00 47.97  ? 819  VAL A N    1 
ATOM   5836 C  CA   . VAL A 1 825 ? 60.024 -47.883 -43.071 1.00 43.85  ? 819  VAL A CA   1 
ATOM   5837 C  C    . VAL A 1 825 ? 59.405 -48.872 -44.053 1.00 48.46  ? 819  VAL A C    1 
ATOM   5838 O  O    . VAL A 1 825 ? 59.357 -48.615 -45.261 1.00 51.86  ? 819  VAL A O    1 
ATOM   5839 C  CB   . VAL A 1 825 ? 61.451 -48.300 -42.678 1.00 46.26  ? 819  VAL A CB   1 
ATOM   5840 C  CG1  . VAL A 1 825 ? 62.235 -48.696 -43.936 1.00 43.96  ? 819  VAL A CG1  1 
ATOM   5841 C  CG2  . VAL A 1 825 ? 62.168 -47.164 -41.946 1.00 41.78  ? 819  VAL A CG2  1 
ATOM   5842 N  N    . LYS A 1 826 ? 58.926 -50.018 -43.562 1.00 50.84  ? 820  LYS A N    1 
ATOM   5843 C  CA   . LYS A 1 826 ? 58.227 -50.962 -44.433 1.00 44.73  ? 820  LYS A CA   1 
ATOM   5844 C  C    . LYS A 1 826 ? 56.987 -50.330 -45.042 1.00 48.39  ? 820  LYS A C    1 
ATOM   5845 O  O    . LYS A 1 826 ? 56.656 -50.594 -46.205 1.00 49.03  ? 820  LYS A O    1 
ATOM   5846 C  CB   . LYS A 1 826 ? 57.848 -52.223 -43.668 1.00 43.07  ? 820  LYS A CB   1 
ATOM   5847 C  CG   . LYS A 1 826 ? 57.149 -53.246 -44.489 1.00 44.02  ? 820  LYS A CG   1 
ATOM   5848 C  CD   . LYS A 1 826 ? 56.911 -54.526 -43.719 1.00 45.38  ? 820  LYS A CD   1 
ATOM   5849 C  CE   . LYS A 1 826 ? 56.143 -55.539 -44.531 1.00 46.51  ? 820  LYS A CE   1 
ATOM   5850 N  NZ   . LYS A 1 826 ? 55.830 -56.799 -43.825 1.00 48.42  ? 820  LYS A NZ   1 
ATOM   5851 N  N    . GLU A 1 827 ? 56.286 -49.477 -44.296 1.00 44.76  ? 821  GLU A N    1 
ATOM   5852 C  CA   . GLU A 1 827 ? 55.159 -48.812 -44.941 1.00 46.13  ? 821  GLU A CA   1 
ATOM   5853 C  C    . GLU A 1 827 ? 55.629 -47.976 -46.129 1.00 50.09  ? 821  GLU A C    1 
ATOM   5854 O  O    . GLU A 1 827 ? 55.017 -48.023 -47.202 1.00 53.65  ? 821  GLU A O    1 
ATOM   5855 C  CB   . GLU A 1 827 ? 54.383 -47.950 -43.960 1.00 45.65  ? 821  GLU A CB   1 
ATOM   5856 C  CG   . GLU A 1 827 ? 53.146 -47.359 -44.584 1.00 46.01  ? 821  GLU A CG   1 
ATOM   5857 C  CD   . GLU A 1 827 ? 52.257 -46.591 -43.613 1.00 66.35  ? 821  GLU A CD   1 
ATOM   5858 O  OE1  . GLU A 1 827 ? 52.554 -46.524 -42.385 1.00 69.78  ? 821  GLU A OE1  1 
ATOM   5859 O  OE2  . GLU A 1 827 ? 51.245 -46.036 -44.095 1.00 70.66  ? 821  GLU A OE2  1 
ATOM   5860 N  N    . VAL A 1 828 ? 56.729 -47.229 -45.971 1.00 45.54  ? 822  VAL A N    1 
ATOM   5861 C  CA   . VAL A 1 828 ? 57.170 -46.339 -47.040 1.00 49.38  ? 822  VAL A CA   1 
ATOM   5862 C  C    . VAL A 1 828 ? 57.572 -47.134 -48.282 1.00 47.94  ? 822  VAL A C    1 
ATOM   5863 O  O    . VAL A 1 828 ? 57.194 -46.786 -49.402 1.00 47.59  ? 822  VAL A O    1 
ATOM   5864 C  CB   . VAL A 1 828 ? 58.320 -45.438 -46.567 1.00 51.98  ? 822  VAL A CB   1 
ATOM   5865 C  CG1  . VAL A 1 828 ? 58.843 -44.632 -47.767 1.00 48.52  ? 822  VAL A CG1  1 
ATOM   5866 C  CG2  . VAL A 1 828 ? 57.850 -44.512 -45.495 1.00 48.33  ? 822  VAL A CG2  1 
ATOM   5867 N  N    . CYS A 1 829 ? 58.346 -48.204 -48.107 1.00 40.72  ? 823  CYS A N    1 
ATOM   5868 C  CA   . CYS A 1 829 ? 58.745 -48.988 -49.260 1.00 43.84  ? 823  CYS A CA   1 
ATOM   5869 C  C    . CYS A 1 829 ? 57.542 -49.584 -49.986 1.00 51.67  ? 823  CYS A C    1 
ATOM   5870 O  O    . CYS A 1 829 ? 57.586 -49.777 -51.207 1.00 54.13  ? 823  CYS A O    1 
ATOM   5871 C  CB   . CYS A 1 829 ? 59.710 -50.078 -48.834 1.00 45.68  ? 823  CYS A CB   1 
ATOM   5872 S  SG   . CYS A 1 829 ? 61.193 -49.380 -48.108 1.00 51.67  ? 823  CYS A SG   1 
ATOM   5873 N  N    . THR A 1 830 ? 56.456 -49.859 -49.269 1.00 53.34  ? 824  THR A N    1 
ATOM   5874 C  CA   . THR A 1 830 ? 55.279 -50.442 -49.910 1.00 51.64  ? 824  THR A CA   1 
ATOM   5875 C  C    . THR A 1 830 ? 54.513 -49.400 -50.716 1.00 50.03  ? 824  THR A C    1 
ATOM   5876 O  O    . THR A 1 830 ? 53.980 -49.712 -51.788 1.00 49.91  ? 824  THR A O    1 
ATOM   5877 C  CB   . THR A 1 830 ? 54.391 -51.105 -48.845 1.00 50.81  ? 824  THR A CB   1 
ATOM   5878 O  OG1  . THR A 1 830 ? 55.035 -52.301 -48.360 1.00 55.13  ? 824  THR A OG1  1 
ATOM   5879 C  CG2  . THR A 1 830 ? 53.004 -51.426 -49.367 1.00 40.53  ? 824  THR A CG2  1 
ATOM   5880 N  N    . VAL A 1 831 ? 54.445 -48.160 -50.224 1.00 45.73  ? 825  VAL A N    1 
ATOM   5881 C  CA   . VAL A 1 831 ? 53.787 -47.100 -50.983 1.00 42.65  ? 825  VAL A CA   1 
ATOM   5882 C  C    . VAL A 1 831 ? 54.541 -46.835 -52.272 1.00 54.78  ? 825  VAL A C    1 
ATOM   5883 O  O    . VAL A 1 831 ? 53.962 -46.801 -53.372 1.00 52.00  ? 825  VAL A O    1 
ATOM   5884 C  CB   . VAL A 1 831 ? 53.679 -45.822 -50.143 1.00 44.92  ? 825  VAL A CB   1 
ATOM   5885 C  CG1  . VAL A 1 831 ? 53.411 -44.648 -51.038 1.00 46.87  ? 825  VAL A CG1  1 
ATOM   5886 C  CG2  . VAL A 1 831 ? 52.559 -45.962 -49.131 1.00 48.13  ? 825  VAL A CG2  1 
ATOM   5887 N  N    . VAL A 1 832 ? 55.855 -46.640 -52.148 1.00 53.48  ? 826  VAL A N    1 
ATOM   5888 C  CA   . VAL A 1 832 ? 56.668 -46.301 -53.304 1.00 48.37  ? 826  VAL A CA   1 
ATOM   5889 C  C    . VAL A 1 832 ? 56.602 -47.411 -54.350 1.00 46.88  ? 826  VAL A C    1 
ATOM   5890 O  O    . VAL A 1 832 ? 56.342 -47.150 -55.531 1.00 45.48  ? 826  VAL A O    1 
ATOM   5891 C  CB   . VAL A 1 832 ? 58.104 -45.994 -52.855 1.00 45.25  ? 826  VAL A CB   1 
ATOM   5892 C  CG1  . VAL A 1 832 ? 59.009 -45.795 -54.063 1.00 45.45  ? 826  VAL A CG1  1 
ATOM   5893 C  CG2  . VAL A 1 832 ? 58.080 -44.752 -52.002 1.00 44.51  ? 826  VAL A CG2  1 
ATOM   5894 N  N    . ALA A 1 833 ? 56.803 -48.668 -53.934 1.00 45.07  ? 827  ALA A N    1 
ATOM   5895 C  CA   . ALA A 1 833 ? 56.809 -49.747 -54.917 1.00 42.38  ? 827  ALA A CA   1 
ATOM   5896 C  C    . ALA A 1 833 ? 55.419 -50.017 -55.480 1.00 48.38  ? 827  ALA A C    1 
ATOM   5897 O  O    . ALA A 1 833 ? 55.299 -50.557 -56.583 1.00 46.59  ? 827  ALA A O    1 
ATOM   5898 C  CB   . ALA A 1 833 ? 57.399 -51.019 -54.326 1.00 36.53  ? 827  ALA A CB   1 
ATOM   5899 N  N    . ARG A 1 834 ? 54.362 -49.620 -54.776 1.00 48.47  ? 828  ARG A N    1 
ATOM   5900 C  CA   . ARG A 1 834 ? 53.035 -49.745 -55.367 1.00 44.08  ? 828  ARG A CA   1 
ATOM   5901 C  C    . ARG A 1 834 ? 52.769 -48.652 -56.399 1.00 45.01  ? 828  ARG A C    1 
ATOM   5902 O  O    . ARG A 1 834 ? 52.141 -48.916 -57.424 1.00 50.11  ? 828  ARG A O    1 
ATOM   5903 C  CB   . ARG A 1 834 ? 51.981 -49.720 -54.270 1.00 43.88  ? 828  ARG A CB   1 
ATOM   5904 C  CG   . ARG A 1 834 ? 50.591 -49.935 -54.759 1.00 42.94  ? 828  ARG A CG   1 
ATOM   5905 C  CD   . ARG A 1 834 ? 49.643 -50.082 -53.605 1.00 38.20  ? 828  ARG A CD   1 
ATOM   5906 N  NE   . ARG A 1 834 ? 48.264 -50.245 -54.042 1.00 45.70  ? 828  ARG A NE   1 
ATOM   5907 C  CZ   . ARG A 1 834 ? 47.707 -51.408 -54.366 1.00 43.12  ? 828  ARG A CZ   1 
ATOM   5908 N  NH1  . ARG A 1 834 ? 48.404 -52.542 -54.308 1.00 36.27  ? 828  ARG A NH1  1 
ATOM   5909 N  NH2  . ARG A 1 834 ? 46.440 -51.428 -54.749 1.00 41.66  ? 828  ARG A NH2  1 
ATOM   5910 N  N    . ARG A 1 835 ? 53.216 -47.418 -56.147 1.00 44.99  ? 829  ARG A N    1 
ATOM   5911 C  CA   . ARG A 1 835 ? 53.089 -46.381 -57.162 1.00 39.53  ? 829  ARG A CA   1 
ATOM   5912 C  C    . ARG A 1 835 ? 53.896 -46.771 -58.399 1.00 47.93  ? 829  ARG A C    1 
ATOM   5913 O  O    . ARG A 1 835 ? 53.438 -46.613 -59.537 1.00 44.35  ? 829  ARG A O    1 
ATOM   5914 C  CB   . ARG A 1 835 ? 53.524 -45.012 -56.592 1.00 42.05  ? 829  ARG A CB   1 
ATOM   5915 C  CG   . ARG A 1 835 ? 53.299 -43.916 -57.575 1.00 40.41  ? 829  ARG A CG   1 
ATOM   5916 C  CD   . ARG A 1 835 ? 53.397 -42.383 -57.297 1.00 42.98  ? 829  ARG A CD   1 
ATOM   5917 N  NE   . ARG A 1 835 ? 54.657 -41.705 -56.989 1.00 39.19  ? 829  ARG A NE   1 
ATOM   5918 C  CZ   . ARG A 1 835 ? 55.883 -42.058 -57.363 1.00 48.11  ? 829  ARG A CZ   1 
ATOM   5919 N  NH1  . ARG A 1 835 ? 56.891 -41.225 -57.127 1.00 45.48  ? 829  ARG A NH1  1 
ATOM   5920 N  NH2  . ARG A 1 835 ? 56.156 -43.317 -57.718 1.00 47.15  ? 829  ARG A NH2  1 
ATOM   5921 N  N    . ALA A 1 836 ? 55.076 -47.355 -58.192 1.00 48.57  ? 830  ALA A N    1 
ATOM   5922 C  CA   . ALA A 1 836 ? 55.852 -47.849 -59.317 1.00 43.87  ? 830  ALA A CA   1 
ATOM   5923 C  C    . ALA A 1 836 ? 55.057 -48.868 -60.126 1.00 46.10  ? 830  ALA A C    1 
ATOM   5924 O  O    . ALA A 1 836 ? 54.903 -48.720 -61.338 1.00 48.76  ? 830  ALA A O    1 
ATOM   5925 C  CB   . ALA A 1 836 ? 57.169 -48.452 -58.822 1.00 43.22  ? 830  ALA A CB   1 
ATOM   5926 N  N    . ALA A 1 837 ? 54.553 -49.923 -59.480 1.00 49.64  ? 831  ALA A N    1 
ATOM   5927 C  CA   . ALA A 1 837 ? 53.907 -50.980 -60.248 1.00 47.44  ? 831  ALA A CA   1 
ATOM   5928 C  C    . ALA A 1 837 ? 52.598 -50.501 -60.873 1.00 52.11  ? 831  ALA A C    1 
ATOM   5929 O  O    . ALA A 1 837 ? 52.222 -50.970 -61.963 1.00 46.40  ? 831  ALA A O    1 
ATOM   5930 C  CB   . ALA A 1 837 ? 53.681 -52.216 -59.382 1.00 40.47  ? 831  ALA A CB   1 
ATOM   5931 N  N    . GLN A 1 838 ? 51.906 -49.555 -60.224 1.00 46.80  ? 832  GLN A N    1 
ATOM   5932 C  CA   . GLN A 1 838 ? 50.683 -49.025 -60.818 1.00 46.36  ? 832  GLN A CA   1 
ATOM   5933 C  C    . GLN A 1 838 ? 50.974 -48.132 -62.017 1.00 51.89  ? 832  GLN A C    1 
ATOM   5934 O  O    . GLN A 1 838 ? 50.245 -48.178 -63.016 1.00 52.09  ? 832  GLN A O    1 
ATOM   5935 C  CB   . GLN A 1 838 ? 49.865 -48.277 -59.779 1.00 43.80  ? 832  GLN A CB   1 
ATOM   5936 C  CG   . GLN A 1 838 ? 49.148 -49.233 -58.856 1.00 52.43  ? 832  GLN A CG   1 
ATOM   5937 C  CD   . GLN A 1 838 ? 48.346 -48.557 -57.765 1.00 50.07  ? 832  GLN A CD   1 
ATOM   5938 O  OE1  . GLN A 1 838 ? 48.780 -47.574 -57.148 1.00 55.77  ? 832  GLN A OE1  1 
ATOM   5939 N  NE2  . GLN A 1 838 ? 47.125 -49.031 -57.584 1.00 46.14  ? 832  GLN A NE2  1 
ATOM   5940 N  N    . LEU A 1 839 ? 52.015 -47.296 -61.938 1.00 49.91  ? 833  LEU A N    1 
ATOM   5941 C  CA   . LEU A 1 839 ? 52.359 -46.469 -63.087 1.00 40.85  ? 833  LEU A CA   1 
ATOM   5942 C  C    . LEU A 1 839 ? 52.771 -47.337 -64.260 1.00 46.97  ? 833  LEU A C    1 
ATOM   5943 O  O    . LEU A 1 839 ? 52.217 -47.222 -65.361 1.00 48.54  ? 833  LEU A O    1 
ATOM   5944 C  CB   . LEU A 1 839 ? 53.457 -45.476 -62.723 1.00 41.13  ? 833  LEU A CB   1 
ATOM   5945 C  CG   . LEU A 1 839 ? 52.973 -44.298 -61.880 1.00 45.39  ? 833  LEU A CG   1 
ATOM   5946 C  CD1  . LEU A 1 839 ? 54.140 -43.458 -61.360 1.00 46.54  ? 833  LEU A CD1  1 
ATOM   5947 C  CD2  . LEU A 1 839 ? 51.978 -43.436 -62.677 1.00 39.28  ? 833  LEU A CD2  1 
ATOM   5948 N  N    . CYS A 1 840 ? 53.735 -48.229 -64.046 1.00 46.82  ? 834  CYS A N    1 
ATOM   5949 C  CA   . CYS A 1 840 ? 54.098 -49.159 -65.107 1.00 44.09  ? 834  CYS A CA   1 
ATOM   5950 C  C    . CYS A 1 840 ? 52.853 -49.826 -65.680 1.00 48.80  ? 834  CYS A C    1 
ATOM   5951 O  O    . CYS A 1 840 ? 52.727 -49.987 -66.897 1.00 51.28  ? 834  CYS A O    1 
ATOM   5952 C  CB   . CYS A 1 840 ? 55.092 -50.184 -64.575 1.00 44.85  ? 834  CYS A CB   1 
ATOM   5953 S  SG   . CYS A 1 840 ? 55.653 -51.438 -65.729 1.00 53.32  ? 834  CYS A SG   1 
ATOM   5954 N  N    . GLY A 1 841 ? 51.896 -50.173 -64.823 1.00 50.77  ? 835  GLY A N    1 
ATOM   5955 C  CA   . GLY A 1 841 ? 50.689 -50.818 -65.308 1.00 46.77  ? 835  GLY A CA   1 
ATOM   5956 C  C    . GLY A 1 841 ? 49.839 -49.902 -66.167 1.00 50.08  ? 835  GLY A C    1 
ATOM   5957 O  O    . GLY A 1 841 ? 49.207 -50.353 -67.130 1.00 49.96  ? 835  GLY A O    1 
ATOM   5958 N  N    . ALA A 1 842 ? 49.799 -48.607 -65.831 1.00 47.18  ? 836  ALA A N    1 
ATOM   5959 C  CA   . ALA A 1 842 ? 49.015 -47.670 -66.630 1.00 44.56  ? 836  ALA A CA   1 
ATOM   5960 C  C    . ALA A 1 842 ? 49.642 -47.460 -68.000 1.00 48.93  ? 836  ALA A C    1 
ATOM   5961 O  O    . ALA A 1 842 ? 48.930 -47.313 -68.995 1.00 51.31  ? 836  ALA A O    1 
ATOM   5962 C  CB   . ALA A 1 842 ? 48.862 -46.337 -65.910 1.00 44.88  ? 836  ALA A CB   1 
ATOM   5963 N  N    . GLY A 1 843 ? 50.972 -47.443 -68.079 1.00 50.00  ? 837  GLY A N    1 
ATOM   5964 C  CA   . GLY A 1 843 ? 51.611 -47.418 -69.384 1.00 46.28  ? 837  GLY A CA   1 
ATOM   5965 C  C    . GLY A 1 843 ? 51.301 -48.665 -70.185 1.00 46.71  ? 837  GLY A C    1 
ATOM   5966 O  O    . GLY A 1 843 ? 50.810 -48.591 -71.306 1.00 52.40  ? 837  GLY A O    1 
ATOM   5967 N  N    . MET A 1 844 ? 51.552 -49.833 -69.604 1.00 51.19  ? 838  MET A N    1 
ATOM   5968 C  CA   . MET A 1 844 ? 51.314 -51.089 -70.308 1.00 50.75  ? 838  MET A CA   1 
ATOM   5969 C  C    . MET A 1 844 ? 49.848 -51.286 -70.670 1.00 50.84  ? 838  MET A C    1 
ATOM   5970 O  O    . MET A 1 844 ? 49.545 -52.074 -71.569 1.00 49.95  ? 838  MET A O    1 
ATOM   5971 C  CB   . MET A 1 844 ? 51.810 -52.254 -69.455 1.00 48.68  ? 838  MET A CB   1 
ATOM   5972 C  CG   . MET A 1 844 ? 51.688 -53.594 -70.113 1.00 51.13  ? 838  MET A CG   1 
ATOM   5973 S  SD   . MET A 1 844 ? 52.600 -53.684 -71.669 1.00 51.47  ? 838  MET A SD   1 
ATOM   5974 C  CE   . MET A 1 844 ? 54.300 -53.572 -71.119 1.00 50.41  ? 838  MET A CE   1 
ATOM   5975 N  N    . ALA A 1 845 ? 48.924 -50.605 -69.987 1.00 53.53  ? 839  ALA A N    1 
ATOM   5976 C  CA   . ALA A 1 845 ? 47.521 -50.694 -70.383 1.00 53.90  ? 839  ALA A CA   1 
ATOM   5977 C  C    . ALA A 1 845 ? 47.299 -49.962 -71.695 1.00 54.99  ? 839  ALA A C    1 
ATOM   5978 O  O    . ALA A 1 845 ? 46.621 -50.470 -72.599 1.00 51.48  ? 839  ALA A O    1 
ATOM   5979 C  CB   . ALA A 1 845 ? 46.605 -50.125 -69.298 1.00 47.10  ? 839  ALA A CB   1 
ATOM   5980 N  N    . ALA A 1 846 ? 47.862 -48.755 -71.800 1.00 53.48  ? 840  ALA A N    1 
ATOM   5981 C  CA   . ALA A 1 846 ? 47.803 -47.990 -73.035 1.00 47.48  ? 840  ALA A CA   1 
ATOM   5982 C  C    . ALA A 1 846 ? 48.451 -48.757 -74.184 1.00 50.17  ? 840  ALA A C    1 
ATOM   5983 O  O    . ALA A 1 846 ? 47.893 -48.831 -75.280 1.00 50.34  ? 840  ALA A O    1 
ATOM   5984 C  CB   . ALA A 1 846 ? 48.458 -46.629 -72.807 1.00 44.71  ? 840  ALA A CB   1 
ATOM   5985 N  N    . VAL A 1 847 ? 49.604 -49.382 -73.939 1.00 50.54  ? 841  VAL A N    1 
ATOM   5986 C  CA   . VAL A 1 847 ? 50.244 -50.186 -74.980 1.00 50.49  ? 841  VAL A CA   1 
ATOM   5987 C  C    . VAL A 1 847 ? 49.293 -51.255 -75.503 1.00 52.19  ? 841  VAL A C    1 
ATOM   5988 O  O    . VAL A 1 847 ? 49.046 -51.345 -76.711 1.00 59.98  ? 841  VAL A O    1 
ATOM   5989 C  CB   . VAL A 1 847 ? 51.559 -50.806 -74.475 1.00 48.30  ? 841  VAL A CB   1 
ATOM   5990 C  CG1  . VAL A 1 847 ? 52.011 -51.917 -75.416 1.00 48.05  ? 841  VAL A CG1  1 
ATOM   5991 C  CG2  . VAL A 1 847 ? 52.648 -49.738 -74.387 1.00 44.28  ? 841  VAL A CG2  1 
ATOM   5992 N  N    . VAL A 1 848 ? 48.772 -52.112 -74.619 1.00 52.14  ? 842  VAL A N    1 
ATOM   5993 C  CA   . VAL A 1 848 ? 48.034 -53.269 -75.138 1.00 52.78  ? 842  VAL A CA   1 
ATOM   5994 C  C    . VAL A 1 848 ? 46.695 -52.861 -75.733 1.00 51.19  ? 842  VAL A C    1 
ATOM   5995 O  O    . VAL A 1 848 ? 46.190 -53.522 -76.643 1.00 51.73  ? 842  VAL A O    1 
ATOM   5996 C  CB   . VAL A 1 848 ? 47.832 -54.353 -74.064 1.00 47.08  ? 842  VAL A CB   1 
ATOM   5997 C  CG1  . VAL A 1 848 ? 49.154 -54.964 -73.702 1.00 44.31  ? 842  VAL A CG1  1 
ATOM   5998 C  CG2  . VAL A 1 848 ? 47.061 -53.788 -72.852 1.00 42.54  ? 842  VAL A CG2  1 
ATOM   5999 N  N    . ASP A 1 849 ? 46.091 -51.793 -75.220 1.00 51.69  ? 843  ASP A N    1 
ATOM   6000 C  CA   . ASP A 1 849 ? 44.779 -51.372 -75.673 1.00 47.51  ? 843  ASP A CA   1 
ATOM   6001 C  C    . ASP A 1 849 ? 44.893 -50.690 -77.030 1.00 59.28  ? 843  ASP A C    1 
ATOM   6002 O  O    . ASP A 1 849 ? 43.972 -50.763 -77.854 1.00 59.40  ? 843  ASP A O    1 
ATOM   6003 C  CB   . ASP A 1 849 ? 44.191 -50.439 -74.630 1.00 50.41  ? 843  ASP A CB   1 
ATOM   6004 C  CG   . ASP A 1 849 ? 42.702 -50.480 -74.585 1.00 59.94  ? 843  ASP A CG   1 
ATOM   6005 O  OD1  . ASP A 1 849 ? 42.167 -51.607 -74.395 1.00 57.18  ? 843  ASP A OD1  1 
ATOM   6006 O  OD2  . ASP A 1 849 ? 42.079 -49.395 -74.640 1.00 64.46  ? 843  ASP A OD2  1 
ATOM   6007 N  N    . ARG A 1 850 ? 46.038 -50.051 -77.278 1.00 57.53  ? 844  ARG A N    1 
ATOM   6008 C  CA   . ARG A 1 850 ? 46.339 -49.543 -78.605 1.00 57.21  ? 844  ARG A CA   1 
ATOM   6009 C  C    . ARG A 1 850 ? 46.522 -50.673 -79.611 1.00 54.25  ? 844  ARG A C    1 
ATOM   6010 O  O    . ARG A 1 850 ? 45.984 -50.599 -80.719 1.00 57.59  ? 844  ARG A O    1 
ATOM   6011 C  CB   . ARG A 1 850 ? 47.576 -48.655 -78.567 1.00 57.60  ? 844  ARG A CB   1 
ATOM   6012 C  CG   . ARG A 1 850 ? 47.929 -48.185 -79.933 1.00 60.32  ? 844  ARG A CG   1 
ATOM   6013 C  CD   . ARG A 1 850 ? 49.082 -47.221 -79.970 1.00 65.31  ? 844  ARG A CD   1 
ATOM   6014 N  NE   . ARG A 1 850 ? 49.464 -47.047 -81.372 1.00 67.38  ? 844  ARG A NE   1 
ATOM   6015 C  CZ   . ARG A 1 850 ? 48.930 -46.161 -82.205 1.00 65.68  ? 844  ARG A CZ   1 
ATOM   6016 N  NH1  . ARG A 1 850 ? 48.005 -45.298 -81.789 1.00 60.03  ? 844  ARG A NH1  1 
ATOM   6017 N  NH2  . ARG A 1 850 ? 49.350 -46.131 -83.460 1.00 65.66  ? 844  ARG A NH2  1 
ATOM   6018 N  N    . ILE A 1 851 ? 47.265 -51.728 -79.264 1.00 49.63  ? 845  ILE A N    1 
ATOM   6019 C  CA   . ILE A 1 851 ? 47.318 -52.876 -80.172 1.00 49.60  ? 845  ILE A CA   1 
ATOM   6020 C  C    . ILE A 1 851 ? 45.912 -53.386 -80.483 1.00 55.44  ? 845  ILE A C    1 
ATOM   6021 O  O    . ILE A 1 851 ? 45.615 -53.782 -81.616 1.00 55.21  ? 845  ILE A O    1 
ATOM   6022 C  CB   . ILE A 1 851 ? 48.194 -54.004 -79.613 1.00 50.18  ? 845  ILE A CB   1 
ATOM   6023 C  CG1  . ILE A 1 851 ? 49.652 -53.579 -79.547 1.00 51.10  ? 845  ILE A CG1  1 
ATOM   6024 C  CG2  . ILE A 1 851 ? 48.065 -55.236 -80.484 1.00 50.83  ? 845  ILE A CG2  1 
ATOM   6025 C  CD1  . ILE A 1 851 ? 50.525 -54.597 -78.887 1.00 52.22  ? 845  ILE A CD1  1 
ATOM   6026 N  N    . ARG A 1 852 ? 45.021 -53.378 -79.491 1.00 58.51  ? 846  ARG A N    1 
ATOM   6027 C  CA   . ARG A 1 852 ? 43.670 -53.873 -79.729 1.00 55.60  ? 846  ARG A CA   1 
ATOM   6028 C  C    . ARG A 1 852 ? 42.933 -53.004 -80.750 1.00 53.15  ? 846  ARG A C    1 
ATOM   6029 O  O    . ARG A 1 852 ? 42.342 -53.521 -81.705 1.00 50.12  ? 846  ARG A O    1 
ATOM   6030 C  CB   . ARG A 1 852 ? 42.901 -53.947 -78.412 1.00 48.43  ? 846  ARG A CB   1 
ATOM   6031 C  CG   . ARG A 1 852 ? 41.493 -54.438 -78.579 1.00 49.94  ? 846  ARG A CG   1 
ATOM   6032 C  CD   . ARG A 1 852 ? 40.733 -54.383 -77.283 1.00 61.68  ? 846  ARG A CD   1 
ATOM   6033 N  NE   . ARG A 1 852 ? 40.643 -53.026 -76.728 1.00 59.62  ? 846  ARG A NE   1 
ATOM   6034 C  CZ   . ARG A 1 852 ? 39.759 -52.116 -77.115 1.00 61.45  ? 846  ARG A CZ   1 
ATOM   6035 N  NH1  . ARG A 1 852 ? 38.893 -52.404 -78.080 1.00 59.77  ? 846  ARG A NH1  1 
ATOM   6036 N  NH2  . ARG A 1 852 ? 39.749 -50.918 -76.547 1.00 59.19  ? 846  ARG A NH2  1 
ATOM   6037 N  N    . GLU A 1 853 ? 42.951 -51.679 -80.555 1.00 51.19  ? 847  GLU A N    1 
ATOM   6038 C  CA   . GLU A 1 853 ? 42.190 -50.779 -81.416 1.00 51.10  ? 847  GLU A CA   1 
ATOM   6039 C  C    . GLU A 1 853 ? 42.740 -50.787 -82.844 1.00 58.71  ? 847  GLU A C    1 
ATOM   6040 O  O    . GLU A 1 853 ? 41.973 -50.821 -83.821 1.00 53.13  ? 847  GLU A O    1 
ATOM   6041 C  CB   . GLU A 1 853 ? 42.225 -49.360 -80.857 1.00 50.30  ? 847  GLU A CB   1 
ATOM   6042 C  CG   . GLU A 1 853 ? 41.732 -49.198 -79.431 1.00 67.30  ? 847  GLU A CG   1 
ATOM   6043 C  CD   . GLU A 1 853 ? 41.968 -47.770 -78.882 1.00 82.41  ? 847  GLU A CD   1 
ATOM   6044 O  OE1  . GLU A 1 853 ? 42.517 -46.919 -79.626 1.00 86.31  ? 847  GLU A OE1  1 
ATOM   6045 O  OE2  . GLU A 1 853 ? 41.652 -47.513 -77.693 1.00 79.66  ? 847  GLU A OE2  1 
ATOM   6046 N  N    . ASN A 1 854 ? 44.071 -50.770 -82.980 1.00 58.35  ? 848  ASN A N    1 
ATOM   6047 C  CA   . ASN A 1 854 ? 44.690 -50.796 -84.300 1.00 59.78  ? 848  ASN A CA   1 
ATOM   6048 C  C    . ASN A 1 854 ? 44.100 -51.881 -85.178 1.00 58.48  ? 848  ASN A C    1 
ATOM   6049 O  O    . ASN A 1 854 ? 44.014 -51.722 -86.401 1.00 67.95  ? 848  ASN A O    1 
ATOM   6050 C  CB   . ASN A 1 854 ? 46.192 -51.034 -84.187 1.00 58.84  ? 848  ASN A CB   1 
ATOM   6051 C  CG   . ASN A 1 854 ? 46.926 -49.853 -83.657 1.00 60.03  ? 848  ASN A CG   1 
ATOM   6052 O  OD1  . ASN A 1 854 ? 46.401 -48.731 -83.640 1.00 58.85  ? 848  ASN A OD1  1 
ATOM   6053 N  ND2  . ASN A 1 854 ? 48.180 -50.077 -83.265 1.00 60.65  ? 848  ASN A ND2  1 
ATOM   6054 N  N    . ARG A 1 855 ? 43.746 -53.010 -84.578 1.00 52.24  ? 849  ARG A N    1 
ATOM   6055 C  CA   . ARG A 1 855 ? 43.302 -54.202 -85.280 1.00 53.36  ? 849  ARG A CA   1 
ATOM   6056 C  C    . ARG A 1 855 ? 41.780 -54.331 -85.325 1.00 53.02  ? 849  ARG A C    1 
ATOM   6057 O  O    . ARG A 1 855 ? 41.270 -55.400 -85.671 1.00 51.61  ? 849  ARG A O    1 
ATOM   6058 C  CB   . ARG A 1 855 ? 43.950 -55.423 -84.644 1.00 50.81  ? 849  ARG A CB   1 
ATOM   6059 C  CG   . ARG A 1 855 ? 45.437 -55.290 -84.664 1.00 53.14  ? 849  ARG A CG   1 
ATOM   6060 C  CD   . ARG A 1 855 ? 46.133 -56.438 -84.002 1.00 57.54  ? 849  ARG A CD   1 
ATOM   6061 N  NE   . ARG A 1 855 ? 47.573 -56.203 -84.000 1.00 63.56  ? 849  ARG A NE   1 
ATOM   6062 C  CZ   . ARG A 1 855 ? 48.468 -57.051 -83.507 1.00 66.61  ? 849  ARG A CZ   1 
ATOM   6063 N  NH1  . ARG A 1 855 ? 48.071 -58.206 -82.979 1.00 60.32  ? 849  ARG A NH1  1 
ATOM   6064 N  NH2  . ARG A 1 855 ? 49.762 -56.759 -83.574 1.00 65.41  ? 849  ARG A NH2  1 
ATOM   6065 N  N    . GLY A 1 856 ? 41.047 -53.301 -84.903 1.00 49.63  ? 850  GLY A N    1 
ATOM   6066 C  CA   . GLY A 1 856 ? 39.603 -53.354 -84.873 1.00 54.21  ? 850  GLY A CA   1 
ATOM   6067 C  C    . GLY A 1 856 ? 38.990 -54.220 -83.789 1.00 64.33  ? 850  GLY A C    1 
ATOM   6068 O  O    . GLY A 1 856 ? 37.769 -54.143 -83.578 1.00 67.57  ? 850  GLY A O    1 
ATOM   6069 N  N    . LEU A 1 857 ? 39.790 -54.994 -83.056 1.00 58.27  ? 851  LEU A N    1 
ATOM   6070 C  CA   . LEU A 1 857 ? 39.259 -56.086 -82.257 1.00 55.37  ? 851  LEU A CA   1 
ATOM   6071 C  C    . LEU A 1 857 ? 38.360 -55.587 -81.125 1.00 59.01  ? 851  LEU A C    1 
ATOM   6072 O  O    . LEU A 1 857 ? 38.492 -54.463 -80.634 1.00 60.66  ? 851  LEU A O    1 
ATOM   6073 C  CB   . LEU A 1 857 ? 40.408 -56.909 -81.687 1.00 56.40  ? 851  LEU A CB   1 
ATOM   6074 C  CG   . LEU A 1 857 ? 41.298 -57.542 -82.748 1.00 56.32  ? 851  LEU A CG   1 
ATOM   6075 C  CD1  . LEU A 1 857 ? 42.386 -58.394 -82.118 1.00 49.52  ? 851  LEU A CD1  1 
ATOM   6076 C  CD2  . LEU A 1 857 ? 40.451 -58.344 -83.719 1.00 53.83  ? 851  LEU A CD2  1 
ATOM   6077 N  N    . ASP A 1 858 ? 37.405 -56.429 -80.734 1.00 56.61  ? 852  ASP A N    1 
ATOM   6078 C  CA   . ASP A 1 858 ? 36.676 -56.179 -79.494 1.00 58.87  ? 852  ASP A CA   1 
ATOM   6079 C  C    . ASP A 1 858 ? 37.436 -56.661 -78.269 1.00 56.07  ? 852  ASP A C    1 
ATOM   6080 O  O    . ASP A 1 858 ? 37.265 -56.100 -77.191 1.00 51.32  ? 852  ASP A O    1 
ATOM   6081 C  CB   . ASP A 1 858 ? 35.310 -56.849 -79.540 1.00 61.96  ? 852  ASP A CB   1 
ATOM   6082 C  CG   . ASP A 1 858 ? 34.326 -56.076 -80.350 1.00 68.30  ? 852  ASP A CG   1 
ATOM   6083 O  OD1  . ASP A 1 858 ? 34.509 -54.837 -80.465 1.00 70.36  ? 852  ASP A OD1  1 
ATOM   6084 O  OD2  . ASP A 1 858 ? 33.399 -56.714 -80.897 1.00 70.93  ? 852  ASP A OD2  1 
ATOM   6085 N  N    . ALA A 1 859 ? 38.242 -57.707 -78.421 1.00 53.84  ? 853  ALA A N    1 
ATOM   6086 C  CA   . ALA A 1 859 ? 38.964 -58.342 -77.336 1.00 51.74  ? 853  ALA A CA   1 
ATOM   6087 C  C    . ALA A 1 859 ? 40.318 -58.804 -77.855 1.00 57.40  ? 853  ALA A C    1 
ATOM   6088 O  O    . ALA A 1 859 ? 40.387 -59.434 -78.916 1.00 57.19  ? 853  ALA A O    1 
ATOM   6089 C  CB   . ALA A 1 859 ? 38.170 -59.536 -76.797 1.00 55.95  ? 853  ALA A CB   1 
ATOM   6090 N  N    . LEU A 1 860 ? 41.387 -58.527 -77.101 1.00 53.93  ? 854  LEU A N    1 
ATOM   6091 C  CA   . LEU A 1 860 ? 42.743 -58.886 -77.504 1.00 49.31  ? 854  LEU A CA   1 
ATOM   6092 C  C    . LEU A 1 860 ? 43.395 -59.793 -76.470 1.00 48.92  ? 854  LEU A C    1 
ATOM   6093 O  O    . LEU A 1 860 ? 43.381 -59.497 -75.278 1.00 55.53  ? 854  LEU A O    1 
ATOM   6094 C  CB   . LEU A 1 860 ? 43.592 -57.632 -77.735 1.00 50.00  ? 854  LEU A CB   1 
ATOM   6095 C  CG   . LEU A 1 860 ? 45.106 -57.859 -77.799 1.00 50.07  ? 854  LEU A CG   1 
ATOM   6096 C  CD1  . LEU A 1 860 ? 45.570 -58.723 -78.969 1.00 45.36  ? 854  LEU A CD1  1 
ATOM   6097 C  CD2  . LEU A 1 860 ? 45.852 -56.516 -77.729 1.00 49.69  ? 854  LEU A CD2  1 
ATOM   6098 N  N    . LYS A 1 861 ? 43.980 -60.881 -76.931 1.00 52.12  ? 855  LYS A N    1 
ATOM   6099 C  CA   . LYS A 1 861 ? 44.699 -61.827 -76.093 1.00 54.00  ? 855  LYS A CA   1 
ATOM   6100 C  C    . LYS A 1 861 ? 46.189 -61.686 -76.394 1.00 56.84  ? 855  LYS A C    1 
ATOM   6101 O  O    . LYS A 1 861 ? 46.648 -62.158 -77.436 1.00 60.75  ? 855  LYS A O    1 
ATOM   6102 C  CB   . LYS A 1 861 ? 44.219 -63.249 -76.383 1.00 55.79  ? 855  LYS A CB   1 
ATOM   6103 C  CG   . LYS A 1 861 ? 44.967 -64.307 -75.621 1.00 61.33  ? 855  LYS A CG   1 
ATOM   6104 C  CD   . LYS A 1 861 ? 44.488 -65.721 -75.902 1.00 64.06  ? 855  LYS A CD   1 
ATOM   6105 C  CE   . LYS A 1 861 ? 45.296 -66.699 -75.039 1.00 76.41  ? 855  LYS A CE   1 
ATOM   6106 N  NZ   . LYS A 1 861 ? 44.875 -68.126 -75.117 1.00 82.60  ? 855  LYS A NZ   1 
ATOM   6107 N  N    . VAL A 1 862 ? 46.954 -61.091 -75.462 1.00 59.49  ? 856  VAL A N    1 
ATOM   6108 C  CA   . VAL A 1 862 ? 48.356 -60.749 -75.681 1.00 52.52  ? 856  VAL A CA   1 
ATOM   6109 C  C    . VAL A 1 862 ? 49.203 -61.351 -74.568 1.00 54.49  ? 856  VAL A C    1 
ATOM   6110 O  O    . VAL A 1 862 ? 48.762 -61.514 -73.430 1.00 54.48  ? 856  VAL A O    1 
ATOM   6111 C  CB   . VAL A 1 862 ? 48.640 -59.228 -75.674 1.00 52.47  ? 856  VAL A CB   1 
ATOM   6112 C  CG1  . VAL A 1 862 ? 49.889 -58.920 -76.503 1.00 56.59  ? 856  VAL A CG1  1 
ATOM   6113 C  CG2  . VAL A 1 862 ? 47.448 -58.395 -76.007 1.00 55.57  ? 856  VAL A CG2  1 
ATOM   6114 N  N    . THR A 1 863 ? 50.467 -61.567 -74.893 1.00 53.96  ? 857  THR A N    1 
ATOM   6115 C  CA   . THR A 1 863 ? 51.515 -61.934 -73.964 1.00 47.96  ? 857  THR A CA   1 
ATOM   6116 C  C    . THR A 1 863 ? 52.576 -60.840 -73.983 1.00 51.53  ? 857  THR A C    1 
ATOM   6117 O  O    . THR A 1 863 ? 52.868 -60.284 -75.042 1.00 56.20  ? 857  THR A O    1 
ATOM   6118 C  CB   . THR A 1 863 ? 52.100 -63.271 -74.372 1.00 49.94  ? 857  THR A CB   1 
ATOM   6119 O  OG1  . THR A 1 863 ? 51.060 -64.258 -74.350 1.00 51.75  ? 857  THR A OG1  1 
ATOM   6120 C  CG2  . THR A 1 863 ? 53.213 -63.677 -73.450 1.00 53.60  ? 857  THR A CG2  1 
ATOM   6121 N  N    . VAL A 1 864 ? 53.140 -60.519 -72.814 1.00 49.21  ? 858  VAL A N    1 
ATOM   6122 C  CA   . VAL A 1 864 ? 54.164 -59.481 -72.651 1.00 46.24  ? 858  VAL A CA   1 
ATOM   6123 C  C    . VAL A 1 864 ? 55.440 -60.122 -72.121 1.00 49.75  ? 858  VAL A C    1 
ATOM   6124 O  O    . VAL A 1 864 ? 55.471 -60.577 -70.972 1.00 54.97  ? 858  VAL A O    1 
ATOM   6125 C  CB   . VAL A 1 864 ? 53.716 -58.376 -71.693 1.00 46.22  ? 858  VAL A CB   1 
ATOM   6126 C  CG1  . VAL A 1 864 ? 54.853 -57.396 -71.499 1.00 46.09  ? 858  VAL A CG1  1 
ATOM   6127 C  CG2  . VAL A 1 864 ? 52.428 -57.691 -72.162 1.00 44.43  ? 858  VAL A CG2  1 
ATOM   6128 N  N    . GLY A 1 865 ? 56.498 -60.138 -72.930 1.00 49.07  ? 859  GLY A N    1 
ATOM   6129 C  CA   . GLY A 1 865 ? 57.793 -60.596 -72.442 1.00 48.42  ? 859  GLY A CA   1 
ATOM   6130 C  C    . GLY A 1 865 ? 58.388 -59.580 -71.477 1.00 50.46  ? 859  GLY A C    1 
ATOM   6131 O  O    . GLY A 1 865 ? 58.527 -58.398 -71.812 1.00 52.75  ? 859  GLY A O    1 
ATOM   6132 N  N    . VAL A 1 866 ? 58.747 -60.031 -70.272 1.00 50.76  ? 860  VAL A N    1 
ATOM   6133 C  CA   . VAL A 1 866 ? 59.230 -59.136 -69.224 1.00 48.92  ? 860  VAL A CA   1 
ATOM   6134 C  C    . VAL A 1 866 ? 60.625 -59.566 -68.807 1.00 50.49  ? 860  VAL A C    1 
ATOM   6135 O  O    . VAL A 1 866 ? 60.997 -60.741 -68.899 1.00 53.97  ? 860  VAL A O    1 
ATOM   6136 C  CB   . VAL A 1 866 ? 58.332 -59.090 -67.963 1.00 48.46  ? 860  VAL A CB   1 
ATOM   6137 C  CG1  . VAL A 1 866 ? 58.865 -58.050 -67.011 1.00 46.22  ? 860  VAL A CG1  1 
ATOM   6138 C  CG2  . VAL A 1 866 ? 56.894 -58.798 -68.298 1.00 52.82  ? 860  VAL A CG2  1 
ATOM   6139 N  N    . ASP A 1 867 ? 61.391 -58.602 -68.314 1.00 47.34  ? 861  ASP A N    1 
ATOM   6140 C  CA   . ASP A 1 867 ? 62.679 -58.912 -67.719 1.00 51.71  ? 861  ASP A CA   1 
ATOM   6141 C  C    . ASP A 1 867 ? 63.094 -57.727 -66.859 1.00 48.50  ? 861  ASP A C    1 
ATOM   6142 O  O    . ASP A 1 867 ? 62.393 -56.718 -66.784 1.00 47.42  ? 861  ASP A O    1 
ATOM   6143 C  CB   . ASP A 1 867 ? 63.703 -59.259 -68.800 1.00 51.82  ? 861  ASP A CB   1 
ATOM   6144 C  CG   . ASP A 1 867 ? 64.951 -59.893 -68.234 1.00 63.20  ? 861  ASP A CG   1 
ATOM   6145 O  OD1  . ASP A 1 867 ? 65.058 -59.992 -66.996 1.00 65.81  ? 861  ASP A OD1  1 
ATOM   6146 O  OD2  . ASP A 1 867 ? 65.810 -60.328 -69.020 1.00 69.83  ? 861  ASP A OD2  1 
ATOM   6147 N  N    . GLY A 1 868 ? 64.254 -57.850 -66.231 1.00 50.91  ? 862  GLY A N    1 
ATOM   6148 C  CA   . GLY A 1 868 ? 64.746 -56.899 -65.249 1.00 56.18  ? 862  GLY A CA   1 
ATOM   6149 C  C    . GLY A 1 868 ? 64.643 -57.350 -63.800 1.00 55.35  ? 862  GLY A C    1 
ATOM   6150 O  O    . GLY A 1 868 ? 63.658 -57.970 -63.385 1.00 55.33  ? 862  GLY A O    1 
ATOM   6151 N  N    . THR A 1 869 ? 65.652 -56.987 -63.002 1.00 57.82  ? 863  THR A N    1 
ATOM   6152 C  CA   . THR A 1 869 ? 65.772 -57.532 -61.647 1.00 61.13  ? 863  THR A CA   1 
ATOM   6153 C  C    . THR A 1 869 ? 64.643 -57.061 -60.742 1.00 52.87  ? 863  THR A C    1 
ATOM   6154 O  O    . THR A 1 869 ? 64.090 -57.858 -59.987 1.00 52.96  ? 863  THR A O    1 
ATOM   6155 C  CB   . THR A 1 869 ? 67.134 -57.176 -61.055 1.00 59.83  ? 863  THR A CB   1 
ATOM   6156 O  OG1  . THR A 1 869 ? 67.388 -55.783 -61.278 1.00 70.02  ? 863  THR A OG1  1 
ATOM   6157 C  CG2  . THR A 1 869 ? 68.243 -57.996 -61.716 1.00 64.08  ? 863  THR A CG2  1 
ATOM   6158 N  N    . LEU A 1 870 ? 64.254 -55.789 -60.826 1.00 50.13  ? 864  LEU A N    1 
ATOM   6159 C  CA   . LEU A 1 870 ? 63.171 -55.313 -59.970 1.00 47.59  ? 864  LEU A CA   1 
ATOM   6160 C  C    . LEU A 1 870 ? 61.871 -56.076 -60.220 1.00 48.48  ? 864  LEU A C    1 
ATOM   6161 O  O    . LEU A 1 870 ? 61.118 -56.346 -59.285 1.00 53.52  ? 864  LEU A O    1 
ATOM   6162 C  CB   . LEU A 1 870 ? 62.957 -53.810 -60.154 1.00 45.04  ? 864  LEU A CB   1 
ATOM   6163 C  CG   . LEU A 1 870 ? 61.796 -53.267 -59.322 1.00 44.17  ? 864  LEU A CG   1 
ATOM   6164 C  CD1  . LEU A 1 870 ? 62.076 -53.460 -57.860 1.00 40.96  ? 864  LEU A CD1  1 
ATOM   6165 C  CD2  . LEU A 1 870 ? 61.523 -51.809 -59.612 1.00 42.99  ? 864  LEU A CD2  1 
ATOM   6166 N  N    . TYR A 1 871 ? 61.571 -56.419 -61.466 1.00 51.08  ? 865  TYR A N    1 
ATOM   6167 C  CA   . TYR A 1 871 ? 60.310 -57.103 -61.731 1.00 46.85  ? 865  TYR A CA   1 
ATOM   6168 C  C    . TYR A 1 871 ? 60.306 -58.488 -61.098 1.00 52.84  ? 865  TYR A C    1 
ATOM   6169 O  O    . TYR A 1 871 ? 59.316 -58.892 -60.475 1.00 57.53  ? 865  TYR A O    1 
ATOM   6170 C  CB   . TYR A 1 871 ? 60.069 -57.185 -63.238 1.00 45.92  ? 865  TYR A CB   1 
ATOM   6171 C  CG   . TYR A 1 871 ? 58.877 -58.006 -63.672 1.00 43.40  ? 865  TYR A CG   1 
ATOM   6172 C  CD1  . TYR A 1 871 ? 57.600 -57.457 -63.719 1.00 44.20  ? 865  TYR A CD1  1 
ATOM   6173 C  CD2  . TYR A 1 871 ? 59.036 -59.330 -64.050 1.00 45.22  ? 865  TYR A CD2  1 
ATOM   6174 C  CE1  . TYR A 1 871 ? 56.513 -58.208 -64.118 1.00 41.03  ? 865  TYR A CE1  1 
ATOM   6175 C  CE2  . TYR A 1 871 ? 57.968 -60.089 -64.449 1.00 45.34  ? 865  TYR A CE2  1 
ATOM   6176 C  CZ   . TYR A 1 871 ? 56.705 -59.529 -64.476 1.00 47.76  ? 865  TYR A CZ   1 
ATOM   6177 O  OH   . TYR A 1 871 ? 55.641 -60.314 -64.869 1.00 50.82  ? 865  TYR A OH   1 
ATOM   6178 N  N    . LYS A 1 872 ? 61.399 -59.240 -61.259 1.00 53.63  ? 866  LYS A N    1 
ATOM   6179 C  CA   . LYS A 1 872 ? 61.433 -60.631 -60.818 1.00 57.11  ? 866  LYS A CA   1 
ATOM   6180 C  C    . LYS A 1 872 ? 61.844 -60.858 -59.355 1.00 58.63  ? 866  LYS A C    1 
ATOM   6181 O  O    . LYS A 1 872 ? 61.543 -61.924 -58.807 1.00 56.32  ? 866  LYS A O    1 
ATOM   6182 C  CB   . LYS A 1 872 ? 62.343 -61.435 -61.740 1.00 58.80  ? 866  LYS A CB   1 
ATOM   6183 C  CG   . LYS A 1 872 ? 63.747 -60.941 -61.828 1.00 65.07  ? 866  LYS A CG   1 
ATOM   6184 C  CD   . LYS A 1 872 ? 64.531 -61.819 -62.793 1.00 68.90  ? 866  LYS A CD   1 
ATOM   6185 C  CE   . LYS A 1 872 ? 63.996 -61.702 -64.215 1.00 67.40  ? 866  LYS A CE   1 
ATOM   6186 N  NZ   . LYS A 1 872 ? 64.757 -62.616 -65.114 1.00 80.43  ? 866  LYS A NZ   1 
ATOM   6187 N  N    . LEU A 1 873 ? 62.546 -59.936 -58.706 1.00 57.25  ? 867  LEU A N    1 
ATOM   6188 C  CA   . LEU A 1 873 ? 62.856 -60.162 -57.304 1.00 56.36  ? 867  LEU A CA   1 
ATOM   6189 C  C    . LEU A 1 873 ? 61.953 -59.403 -56.347 1.00 55.59  ? 867  LEU A C    1 
ATOM   6190 O  O    . LEU A 1 873 ? 61.972 -59.703 -55.153 1.00 58.56  ? 867  LEU A O    1 
ATOM   6191 C  CB   . LEU A 1 873 ? 64.328 -59.823 -57.014 1.00 58.21  ? 867  LEU A CB   1 
ATOM   6192 C  CG   . LEU A 1 873 ? 65.253 -60.723 -57.867 1.00 67.67  ? 867  LEU A CG   1 
ATOM   6193 C  CD1  . LEU A 1 873 ? 66.734 -60.363 -57.708 1.00 72.75  ? 867  LEU A CD1  1 
ATOM   6194 C  CD2  . LEU A 1 873 ? 65.023 -62.237 -57.655 1.00 60.67  ? 867  LEU A CD2  1 
ATOM   6195 N  N    . HIS A 1 874 ? 61.126 -58.508 -56.824 1.00 54.48  ? 868  HIS A N    1 
ATOM   6196 C  CA   . HIS A 1 874 ? 60.330 -57.811 -55.823 1.00 53.06  ? 868  HIS A CA   1 
ATOM   6197 C  C    . HIS A 1 874 ? 59.103 -58.651 -55.465 1.00 51.50  ? 868  HIS A C    1 
ATOM   6198 O  O    . HIS A 1 874 ? 58.552 -59.345 -56.324 1.00 56.81  ? 868  HIS A O    1 
ATOM   6199 C  CB   . HIS A 1 874 ? 59.912 -56.435 -56.331 1.00 47.75  ? 868  HIS A CB   1 
ATOM   6200 C  CG   . HIS A 1 874 ? 59.178 -55.602 -55.322 1.00 47.77  ? 868  HIS A CG   1 
ATOM   6201 N  ND1  . HIS A 1 874 ? 57.834 -55.754 -55.070 1.00 47.01  ? 868  HIS A ND1  1 
ATOM   6202 C  CD2  . HIS A 1 874 ? 59.594 -54.585 -54.529 1.00 48.92  ? 868  HIS A CD2  1 
ATOM   6203 C  CE1  . HIS A 1 874 ? 57.453 -54.872 -54.164 1.00 51.18  ? 868  HIS A CE1  1 
ATOM   6204 N  NE2  . HIS A 1 874 ? 58.503 -54.150 -53.817 1.00 49.93  ? 868  HIS A NE2  1 
ATOM   6205 N  N    . PRO A 1 875 ? 58.686 -58.654 -54.197 1.00 52.07  ? 869  PRO A N    1 
ATOM   6206 C  CA   . PRO A 1 875 ? 57.594 -59.561 -53.810 1.00 53.21  ? 869  PRO A CA   1 
ATOM   6207 C  C    . PRO A 1 875 ? 56.234 -59.219 -54.403 1.00 54.26  ? 869  PRO A C    1 
ATOM   6208 O  O    . PRO A 1 875 ? 55.476 -60.139 -54.715 1.00 53.73  ? 869  PRO A O    1 
ATOM   6209 C  CB   . PRO A 1 875 ? 57.592 -59.455 -52.278 1.00 51.04  ? 869  PRO A CB   1 
ATOM   6210 C  CG   . PRO A 1 875 ? 58.205 -58.123 -51.974 1.00 49.15  ? 869  PRO A CG   1 
ATOM   6211 C  CD   . PRO A 1 875 ? 59.273 -57.977 -53.025 1.00 53.92  ? 869  PRO A CD   1 
ATOM   6212 N  N    . HIS A 1 876 ? 55.838 -57.947 -54.461 1.00 53.48  ? 870  HIS A N    1 
ATOM   6213 C  CA   . HIS A 1 876 ? 54.509 -57.620 -54.955 1.00 52.11  ? 870  HIS A CA   1 
ATOM   6214 C  C    . HIS A 1 876 ? 54.424 -56.966 -56.338 1.00 54.31  ? 870  HIS A C    1 
ATOM   6215 O  O    . HIS A 1 876 ? 53.305 -56.763 -56.828 1.00 52.53  ? 870  HIS A O    1 
ATOM   6216 C  CB   . HIS A 1 876 ? 53.794 -56.733 -53.939 1.00 49.49  ? 870  HIS A CB   1 
ATOM   6217 C  CG   . HIS A 1 876 ? 53.556 -57.418 -52.637 1.00 62.67  ? 870  HIS A CG   1 
ATOM   6218 N  ND1  . HIS A 1 876 ? 54.451 -57.363 -51.591 1.00 61.54  ? 870  HIS A ND1  1 
ATOM   6219 C  CD2  . HIS A 1 876 ? 52.555 -58.235 -52.237 1.00 65.06  ? 870  HIS A CD2  1 
ATOM   6220 C  CE1  . HIS A 1 876 ? 53.986 -58.080 -50.585 1.00 58.86  ? 870  HIS A CE1  1 
ATOM   6221 N  NE2  . HIS A 1 876 ? 52.843 -58.627 -50.955 1.00 60.85  ? 870  HIS A NE2  1 
ATOM   6222 N  N    . PHE A 1 877 ? 55.534 -56.623 -56.992 1.00 52.39  ? 871  PHE A N    1 
ATOM   6223 C  CA   . PHE A 1 877 ? 55.367 -55.641 -58.066 1.00 51.50  ? 871  PHE A CA   1 
ATOM   6224 C  C    . PHE A 1 877 ? 54.817 -56.267 -59.347 1.00 49.09  ? 871  PHE A C    1 
ATOM   6225 O  O    . PHE A 1 877 ? 53.883 -55.710 -59.928 1.00 45.82  ? 871  PHE A O    1 
ATOM   6226 C  CB   . PHE A 1 877 ? 56.652 -54.781 -58.168 1.00 47.24  ? 871  PHE A CB   1 
ATOM   6227 C  CG   . PHE A 1 877 ? 56.952 -54.116 -59.507 1.00 46.59  ? 871  PHE A CG   1 
ATOM   6228 C  CD1  . PHE A 1 877 ? 56.262 -54.353 -60.682 1.00 53.68  ? 871  PHE A CD1  1 
ATOM   6229 C  CD2  . PHE A 1 877 ? 57.701 -52.951 -59.467 1.00 47.50  ? 871  PHE A CD2  1 
ATOM   6230 C  CE1  . PHE A 1 877 ? 56.560 -53.667 -61.871 1.00 44.57  ? 871  PHE A CE1  1 
ATOM   6231 C  CE2  . PHE A 1 877 ? 57.931 -52.208 -60.624 1.00 51.64  ? 871  PHE A CE2  1 
ATOM   6232 C  CZ   . PHE A 1 877 ? 57.354 -52.578 -61.829 1.00 41.65  ? 871  PHE A CZ   1 
ATOM   6233 N  N    . ALA A 1 878 ? 55.299 -57.438 -59.767 1.00 50.46  ? 872  ALA A N    1 
ATOM   6234 C  CA   . ALA A 1 878 ? 54.609 -58.150 -60.837 1.00 43.58  ? 872  ALA A CA   1 
ATOM   6235 C  C    . ALA A 1 878 ? 53.120 -58.289 -60.527 1.00 48.29  ? 872  ALA A C    1 
ATOM   6236 O  O    . ALA A 1 878 ? 52.267 -57.967 -61.356 1.00 50.81  ? 872  ALA A O    1 
ATOM   6237 C  CB   . ALA A 1 878 ? 55.251 -59.520 -61.071 1.00 40.06  ? 872  ALA A CB   1 
ATOM   6238 N  N    . LYS A 1 879 ? 52.784 -58.734 -59.317 1.00 53.87  ? 873  LYS A N    1 
ATOM   6239 C  CA   . LYS A 1 879 ? 51.379 -58.931 -58.972 1.00 48.21  ? 873  LYS A CA   1 
ATOM   6240 C  C    . LYS A 1 879 ? 50.571 -57.657 -59.204 1.00 49.04  ? 873  LYS A C    1 
ATOM   6241 O  O    . LYS A 1 879 ? 49.497 -57.692 -59.811 1.00 50.05  ? 873  LYS A O    1 
ATOM   6242 C  CB   . LYS A 1 879 ? 51.271 -59.406 -57.518 1.00 54.47  ? 873  LYS A CB   1 
ATOM   6243 C  CG   . LYS A 1 879 ? 49.896 -59.918 -57.076 1.00 54.92  ? 873  LYS A CG   1 
ATOM   6244 N  N    . VAL A 1 880 ? 51.083 -56.516 -58.743 1.00 53.24  ? 874  VAL A N    1 
ATOM   6245 C  CA   . VAL A 1 880 ? 50.295 -55.282 -58.746 1.00 49.99  ? 874  VAL A CA   1 
ATOM   6246 C  C    . VAL A 1 880 ? 50.198 -54.695 -60.148 1.00 48.03  ? 874  VAL A C    1 
ATOM   6247 O  O    . VAL A 1 880 ? 49.181 -54.090 -60.511 1.00 48.36  ? 874  VAL A O    1 
ATOM   6248 C  CB   . VAL A 1 880 ? 50.899 -54.279 -57.747 1.00 42.66  ? 874  VAL A CB   1 
ATOM   6249 C  CG1  . VAL A 1 880 ? 50.177 -52.953 -57.793 1.00 43.63  ? 874  VAL A CG1  1 
ATOM   6250 C  CG2  . VAL A 1 880 ? 50.856 -54.850 -56.372 1.00 40.79  ? 874  VAL A CG2  1 
ATOM   6251 N  N    . MET A 1 881 ? 51.242 -54.846 -60.954 1.00 48.94  ? 875  MET A N    1 
ATOM   6252 C  CA   . MET A 1 881 ? 51.154 -54.393 -62.332 1.00 47.19  ? 875  MET A CA   1 
ATOM   6253 C  C    . MET A 1 881 ? 50.075 -55.156 -63.087 1.00 47.63  ? 875  MET A C    1 
ATOM   6254 O  O    . MET A 1 881 ? 49.201 -54.555 -63.717 1.00 44.70  ? 875  MET A O    1 
ATOM   6255 C  CB   . MET A 1 881 ? 52.472 -54.586 -63.050 1.00 48.69  ? 875  MET A CB   1 
ATOM   6256 C  CG   . MET A 1 881 ? 52.279 -54.191 -64.501 1.00 51.69  ? 875  MET A CG   1 
ATOM   6257 S  SD   . MET A 1 881 ? 53.503 -55.001 -65.469 1.00 50.17  ? 875  MET A SD   1 
ATOM   6258 C  CE   . MET A 1 881 ? 52.921 -54.554 -67.105 1.00 64.48  ? 875  MET A CE   1 
ATOM   6259 N  N    . HIS A 1 882 ? 50.151 -56.492 -63.055 1.00 46.74  ? 876  HIS A N    1 
ATOM   6260 C  CA   . HIS A 1 882 ? 49.167 -57.333 -63.725 1.00 42.64  ? 876  HIS A CA   1 
ATOM   6261 C  C    . HIS A 1 882 ? 47.745 -56.937 -63.345 1.00 47.49  ? 876  HIS A C    1 
ATOM   6262 O  O    . HIS A 1 882 ? 46.868 -56.839 -64.208 1.00 57.83  ? 876  HIS A O    1 
ATOM   6263 C  CB   . HIS A 1 882 ? 49.420 -58.798 -63.392 1.00 36.24  ? 876  HIS A CB   1 
ATOM   6264 C  CG   . HIS A 1 882 ? 50.806 -59.263 -63.708 1.00 47.11  ? 876  HIS A CG   1 
ATOM   6265 N  ND1  . HIS A 1 882 ? 51.250 -60.535 -63.411 1.00 49.40  ? 876  HIS A ND1  1 
ATOM   6266 C  CD2  . HIS A 1 882 ? 51.867 -58.614 -64.250 1.00 51.72  ? 876  HIS A CD2  1 
ATOM   6267 C  CE1  . HIS A 1 882 ? 52.514 -60.659 -63.782 1.00 49.17  ? 876  HIS A CE1  1 
ATOM   6268 N  NE2  . HIS A 1 882 ? 52.916 -59.503 -64.285 1.00 50.79  ? 876  HIS A NE2  1 
ATOM   6269 N  N    . GLU A 1 883 ? 47.502 -56.698 -62.058 1.00 48.61  ? 877  GLU A N    1 
ATOM   6270 C  CA   . GLU A 1 883 ? 46.196 -56.240 -61.606 1.00 50.78  ? 877  GLU A CA   1 
ATOM   6271 C  C    . GLU A 1 883 ? 45.840 -54.895 -62.220 1.00 51.44  ? 877  GLU A C    1 
ATOM   6272 O  O    . GLU A 1 883 ? 44.693 -54.679 -62.626 1.00 56.35  ? 877  GLU A O    1 
ATOM   6273 C  CB   . GLU A 1 883 ? 46.170 -56.154 -60.070 1.00 44.14  ? 877  GLU A CB   1 
ATOM   6274 C  CG   . GLU A 1 883 ? 46.368 -57.509 -59.432 1.00 48.94  ? 877  GLU A CG   1 
ATOM   6275 C  CD   . GLU A 1 883 ? 46.489 -57.492 -57.922 1.00 58.68  ? 877  GLU A CD   1 
ATOM   6276 O  OE1  . GLU A 1 883 ? 46.482 -56.404 -57.294 1.00 57.15  ? 877  GLU A OE1  1 
ATOM   6277 O  OE2  . GLU A 1 883 ? 46.649 -58.599 -57.371 1.00 62.26  ? 877  GLU A OE2  1 
ATOM   6278 N  N    . THR A 1 884 ? 46.795 -53.966 -62.268 1.00 45.26  ? 878  THR A N    1 
ATOM   6279 C  CA   . THR A 1 884 ? 46.508 -52.666 -62.866 1.00 49.12  ? 878  THR A CA   1 
ATOM   6280 C  C    . THR A 1 884 ? 46.151 -52.792 -64.348 1.00 55.19  ? 878  THR A C    1 
ATOM   6281 O  O    . THR A 1 884 ? 45.245 -52.104 -64.842 1.00 54.08  ? 878  THR A O    1 
ATOM   6282 C  CB   . THR A 1 884 ? 47.701 -51.743 -62.695 1.00 48.88  ? 878  THR A CB   1 
ATOM   6283 O  OG1  . THR A 1 884 ? 48.046 -51.663 -61.295 1.00 53.33  ? 878  THR A OG1  1 
ATOM   6284 C  CG2  . THR A 1 884 ? 47.350 -50.368 -63.239 1.00 40.30  ? 878  THR A CG2  1 
ATOM   6285 N  N    . VAL A 1 885 ? 46.863 -53.650 -65.082 1.00 49.78  ? 879  VAL A N    1 
ATOM   6286 C  CA   . VAL A 1 885 ? 46.541 -53.838 -66.483 1.00 49.18  ? 879  VAL A CA   1 
ATOM   6287 C  C    . VAL A 1 885 ? 45.136 -54.397 -66.611 1.00 55.79  ? 879  VAL A C    1 
ATOM   6288 O  O    . VAL A 1 885 ? 44.311 -53.872 -67.369 1.00 60.40  ? 879  VAL A O    1 
ATOM   6289 C  CB   . VAL A 1 885 ? 47.587 -54.731 -67.180 1.00 52.70  ? 879  VAL A CB   1 
ATOM   6290 C  CG1  . VAL A 1 885 ? 47.149 -55.047 -68.600 1.00 52.20  ? 879  VAL A CG1  1 
ATOM   6291 C  CG2  . VAL A 1 885 ? 48.927 -54.028 -67.254 1.00 50.94  ? 879  VAL A CG2  1 
ATOM   6292 N  N    . LYS A 1 886 ? 44.828 -55.455 -65.855 1.00 54.77  ? 880  LYS A N    1 
ATOM   6293 C  CA   . LYS A 1 886 ? 43.485 -56.026 -65.944 1.00 55.92  ? 880  LYS A CA   1 
ATOM   6294 C  C    . LYS A 1 886 ? 42.419 -55.005 -65.565 1.00 56.40  ? 880  LYS A C    1 
ATOM   6295 O  O    . LYS A 1 886 ? 41.277 -55.086 -66.023 1.00 58.13  ? 880  LYS A O    1 
ATOM   6296 C  CB   . LYS A 1 886 ? 43.365 -57.270 -65.065 1.00 49.25  ? 880  LYS A CB   1 
ATOM   6297 C  CG   . LYS A 1 886 ? 41.949 -57.791 -65.046 1.00 60.73  ? 880  LYS A CG   1 
ATOM   6298 C  CD   . LYS A 1 886 ? 41.853 -59.302 -65.144 1.00 65.24  ? 880  LYS A CD   1 
ATOM   6299 C  CE   . LYS A 1 886 ? 40.381 -59.729 -65.265 1.00 62.64  ? 880  LYS A CE   1 
ATOM   6300 N  N    . ASP A 1 887 ? 42.773 -54.046 -64.724 1.00 59.39  ? 881  ASP A N    1 
ATOM   6301 C  CA   . ASP A 1 887 ? 41.807 -53.074 -64.236 1.00 59.65  ? 881  ASP A CA   1 
ATOM   6302 C  C    . ASP A 1 887 ? 41.621 -51.933 -65.231 1.00 58.44  ? 881  ASP A C    1 
ATOM   6303 O  O    . ASP A 1 887 ? 40.507 -51.423 -65.397 1.00 60.14  ? 881  ASP A O    1 
ATOM   6304 C  CB   . ASP A 1 887 ? 42.272 -52.574 -62.859 1.00 61.57  ? 881  ASP A CB   1 
ATOM   6305 C  CG   . ASP A 1 887 ? 41.258 -51.688 -62.173 1.00 70.03  ? 881  ASP A CG   1 
ATOM   6306 O  OD1  . ASP A 1 887 ? 40.173 -52.202 -61.828 1.00 79.50  ? 881  ASP A OD1  1 
ATOM   6307 O  OD2  . ASP A 1 887 ? 41.558 -50.493 -61.944 1.00 67.68  ? 881  ASP A OD2  1 
ATOM   6308 N  N    . LEU A 1 888 ? 42.712 -51.497 -65.868 1.00 60.99  ? 882  LEU A N    1 
ATOM   6309 C  CA   . LEU A 1 888 ? 42.690 -50.340 -66.759 1.00 58.29  ? 882  LEU A CA   1 
ATOM   6310 C  C    . LEU A 1 888 ? 42.482 -50.679 -68.235 1.00 52.05  ? 882  LEU A C    1 
ATOM   6311 O  O    . LEU A 1 888 ? 42.123 -49.787 -69.009 1.00 48.81  ? 882  LEU A O    1 
ATOM   6312 C  CB   . LEU A 1 888 ? 43.996 -49.555 -66.603 1.00 56.56  ? 882  LEU A CB   1 
ATOM   6313 C  CG   . LEU A 1 888 ? 44.326 -48.908 -65.259 1.00 53.52  ? 882  LEU A CG   1 
ATOM   6314 C  CD1  . LEU A 1 888 ? 45.754 -48.431 -65.333 1.00 54.23  ? 882  LEU A CD1  1 
ATOM   6315 C  CD2  . LEU A 1 888 ? 43.407 -47.737 -64.977 1.00 53.90  ? 882  LEU A CD2  1 
ATOM   6316 N  N    . ALA A 1 889 ? 42.661 -51.934 -68.639 1.00 53.28  ? 883  ALA A N    1 
ATOM   6317 C  CA   . ALA A 1 889 ? 42.397 -52.383 -70.009 1.00 49.54  ? 883  ALA A CA   1 
ATOM   6318 C  C    . ALA A 1 889 ? 41.540 -53.637 -69.929 1.00 54.87  ? 883  ALA A C    1 
ATOM   6319 O  O    . ALA A 1 889 ? 42.006 -54.750 -70.215 1.00 54.01  ? 883  ALA A O    1 
ATOM   6320 C  CB   . ALA A 1 889 ? 43.683 -52.644 -70.793 1.00 46.76  ? 883  ALA A CB   1 
ATOM   6321 N  N    . PRO A 1 890 ? 40.270 -53.478 -69.534 1.00 56.49  ? 884  PRO A N    1 
ATOM   6322 C  CA   . PRO A 1 890 ? 39.369 -54.632 -69.362 1.00 52.60  ? 884  PRO A CA   1 
ATOM   6323 C  C    . PRO A 1 890 ? 39.192 -55.482 -70.606 1.00 57.67  ? 884  PRO A C    1 
ATOM   6324 O  O    . PRO A 1 890 ? 38.911 -56.682 -70.488 1.00 56.89  ? 884  PRO A O    1 
ATOM   6325 C  CB   . PRO A 1 890 ? 38.037 -53.973 -68.988 1.00 56.58  ? 884  PRO A CB   1 
ATOM   6326 C  CG   . PRO A 1 890 ? 38.375 -52.602 -68.542 1.00 50.10  ? 884  PRO A CG   1 
ATOM   6327 C  CD   . PRO A 1 890 ? 39.631 -52.196 -69.187 1.00 52.82  ? 884  PRO A CD   1 
ATOM   6328 N  N    . LYS A 1 891 ? 39.311 -54.897 -71.800 1.00 55.83  ? 885  LYS A N    1 
ATOM   6329 C  CA   . LYS A 1 891 ? 39.079 -55.661 -73.018 1.00 51.80  ? 885  LYS A CA   1 
ATOM   6330 C  C    . LYS A 1 891 ? 40.287 -56.478 -73.449 1.00 54.75  ? 885  LYS A C    1 
ATOM   6331 O  O    . LYS A 1 891 ? 40.179 -57.251 -74.410 1.00 55.42  ? 885  LYS A O    1 
ATOM   6332 C  CB   . LYS A 1 891 ? 38.611 -54.713 -74.116 1.00 49.44  ? 885  LYS A CB   1 
ATOM   6333 C  CG   . LYS A 1 891 ? 37.185 -54.295 -73.836 1.00 58.38  ? 885  LYS A CG   1 
ATOM   6334 C  CD   . LYS A 1 891 ? 36.562 -53.327 -74.815 1.00 64.61  ? 885  LYS A CD   1 
ATOM   6335 C  CE   . LYS A 1 891 ? 37.063 -51.917 -74.598 1.00 62.95  ? 885  LYS A CE   1 
ATOM   6336 N  NZ   . LYS A 1 891 ? 36.305 -50.930 -75.422 1.00 75.77  ? 885  LYS A NZ   1 
ATOM   6337 N  N    . CYS A 1 892 ? 41.412 -56.386 -72.736 1.00 53.07  ? 886  CYS A N    1 
ATOM   6338 C  CA   . CYS A 1 892 ? 42.620 -57.117 -73.093 1.00 51.58  ? 886  CYS A CA   1 
ATOM   6339 C  C    . CYS A 1 892 ? 42.899 -58.173 -72.029 1.00 49.11  ? 886  CYS A C    1 
ATOM   6340 O  O    . CYS A 1 892 ? 42.660 -57.939 -70.844 1.00 56.21  ? 886  CYS A O    1 
ATOM   6341 C  CB   . CYS A 1 892 ? 43.801 -56.156 -73.238 1.00 50.77  ? 886  CYS A CB   1 
ATOM   6342 S  SG   . CYS A 1 892 ? 43.527 -54.825 -74.467 1.00 57.00  ? 886  CYS A SG   1 
ATOM   6343 N  N    . ASP A 1 893 ? 43.334 -59.355 -72.454 1.00 42.02  ? 887  ASP A N    1 
ATOM   6344 C  CA   . ASP A 1 893 ? 43.651 -60.453 -71.552 1.00 42.99  ? 887  ASP A CA   1 
ATOM   6345 C  C    . ASP A 1 893 ? 45.142 -60.752 -71.684 1.00 52.30  ? 887  ASP A C    1 
ATOM   6346 O  O    . ASP A 1 893 ? 45.560 -61.586 -72.502 1.00 51.83  ? 887  ASP A O    1 
ATOM   6347 C  CB   . ASP A 1 893 ? 42.747 -61.648 -71.875 1.00 45.95  ? 887  ASP A CB   1 
ATOM   6348 C  CG   . ASP A 1 893 ? 43.160 -62.944 -71.175 1.00 60.28  ? 887  ASP A CG   1 
ATOM   6349 O  OD1  . ASP A 1 893 ? 43.374 -62.974 -69.926 1.00 63.88  ? 887  ASP A OD1  1 
ATOM   6350 O  OD2  . ASP A 1 893 ? 43.200 -63.971 -71.893 1.00 64.10  ? 887  ASP A OD2  1 
ATOM   6351 N  N    . VAL A 1 894 ? 45.921 -60.189 -70.756 1.00 53.36  ? 888  VAL A N    1 
ATOM   6352 C  CA   . VAL A 1 894 ? 47.368 -60.072 -70.904 1.00 49.23  ? 888  VAL A CA   1 
ATOM   6353 C  C    . VAL A 1 894 ? 48.013 -61.123 -70.016 1.00 48.86  ? 888  VAL A C    1 
ATOM   6354 O  O    . VAL A 1 894 ? 47.775 -61.152 -68.804 1.00 54.36  ? 888  VAL A O    1 
ATOM   6355 C  CB   . VAL A 1 894 ? 47.872 -58.665 -70.530 1.00 45.09  ? 888  VAL A CB   1 
ATOM   6356 C  CG1  . VAL A 1 894 ? 49.349 -58.523 -70.897 1.00 43.92  ? 888  VAL A CG1  1 
ATOM   6357 C  CG2  . VAL A 1 894 ? 47.014 -57.559 -71.140 1.00 38.44  ? 888  VAL A CG2  1 
ATOM   6358 N  N    . SER A 1 895 ? 48.792 -62.005 -70.617 1.00 46.03  ? 889  SER A N    1 
ATOM   6359 C  CA   . SER A 1 895 ? 49.711 -62.863 -69.899 1.00 45.12  ? 889  SER A CA   1 
ATOM   6360 C  C    . SER A 1 895 ? 51.070 -62.185 -69.858 1.00 53.70  ? 889  SER A C    1 
ATOM   6361 O  O    . SER A 1 895 ? 51.437 -61.463 -70.784 1.00 50.88  ? 889  SER A O    1 
ATOM   6362 C  CB   . SER A 1 895 ? 49.858 -64.220 -70.581 1.00 48.19  ? 889  SER A CB   1 
ATOM   6363 O  OG   . SER A 1 895 ? 48.637 -64.917 -70.643 1.00 53.10  ? 889  SER A OG   1 
ATOM   6364 N  N    . PHE A 1 896 ? 51.811 -62.383 -68.765 1.00 57.98  ? 890  PHE A N    1 
ATOM   6365 C  CA   . PHE A 1 896 ? 53.203 -61.978 -68.783 1.00 51.82  ? 890  PHE A CA   1 
ATOM   6366 C  C    . PHE A 1 896 ? 54.064 -63.218 -68.695 1.00 53.07  ? 890  PHE A C    1 
ATOM   6367 O  O    . PHE A 1 896 ? 53.638 -64.242 -68.169 1.00 55.79  ? 890  PHE A O    1 
ATOM   6368 C  CB   . PHE A 1 896 ? 53.588 -60.983 -67.684 1.00 51.35  ? 890  PHE A CB   1 
ATOM   6369 C  CG   . PHE A 1 896 ? 52.692 -59.786 -67.603 1.00 50.31  ? 890  PHE A CG   1 
ATOM   6370 C  CD1  . PHE A 1 896 ? 51.322 -59.916 -67.515 1.00 49.09  ? 890  PHE A CD1  1 
ATOM   6371 C  CD2  . PHE A 1 896 ? 53.203 -58.546 -67.929 1.00 47.27  ? 890  PHE A CD2  1 
ATOM   6372 C  CE1  . PHE A 1 896 ? 50.502 -58.812 -67.502 1.00 47.84  ? 890  PHE A CE1  1 
ATOM   6373 C  CE2  . PHE A 1 896 ? 52.383 -57.443 -67.969 1.00 48.99  ? 890  PHE A CE2  1 
ATOM   6374 C  CZ   . PHE A 1 896 ? 51.023 -57.576 -67.753 1.00 47.00  ? 890  PHE A CZ   1 
ATOM   6375 N  N    . LEU A 1 897 ? 55.250 -63.137 -69.283 1.00 55.86  ? 891  LEU A N    1 
ATOM   6376 C  CA   . LEU A 1 897 ? 56.163 -64.263 -69.346 1.00 56.29  ? 891  LEU A CA   1 
ATOM   6377 C  C    . LEU A 1 897 ? 57.559 -63.711 -69.128 1.00 61.16  ? 891  LEU A C    1 
ATOM   6378 O  O    . LEU A 1 897 ? 57.857 -62.595 -69.553 1.00 63.62  ? 891  LEU A O    1 
ATOM   6379 C  CB   . LEU A 1 897 ? 56.045 -64.998 -70.683 1.00 62.31  ? 891  LEU A CB   1 
ATOM   6380 C  CG   . LEU A 1 897 ? 56.942 -66.211 -70.951 1.00 72.07  ? 891  LEU A CG   1 
ATOM   6381 C  CD1  . LEU A 1 897 ? 56.637 -67.367 -70.011 1.00 71.90  ? 891  LEU A CD1  1 
ATOM   6382 C  CD2  . LEU A 1 897 ? 56.839 -66.656 -72.406 1.00 68.17  ? 891  LEU A CD2  1 
ATOM   6383 N  N    . GLN A 1 898 ? 58.399 -64.481 -68.449 1.00 65.83  ? 892  GLN A N    1 
ATOM   6384 C  CA   . GLN A 1 898 ? 59.625 -63.996 -67.822 1.00 61.65  ? 892  GLN A CA   1 
ATOM   6385 C  C    . GLN A 1 898 ? 60.760 -64.781 -68.459 1.00 64.44  ? 892  GLN A C    1 
ATOM   6386 O  O    . GLN A 1 898 ? 60.813 -66.005 -68.330 1.00 65.89  ? 892  GLN A O    1 
ATOM   6387 C  CB   . GLN A 1 898 ? 59.521 -64.192 -66.307 1.00 58.48  ? 892  GLN A CB   1 
ATOM   6388 C  CG   . GLN A 1 898 ? 60.679 -63.718 -65.435 1.00 68.28  ? 892  GLN A CG   1 
ATOM   6389 C  CD   . GLN A 1 898 ? 60.334 -63.714 -63.927 1.00 68.38  ? 892  GLN A CD   1 
ATOM   6390 O  OE1  . GLN A 1 898 ? 59.165 -63.739 -63.524 1.00 62.32  ? 892  GLN A OE1  1 
ATOM   6391 N  NE2  . GLN A 1 898 ? 61.364 -63.748 -63.101 1.00 71.98  ? 892  GLN A NE2  1 
ATOM   6392 N  N    . SER A 1 899 ? 61.641 -64.097 -69.191 1.00 71.14  ? 893  SER A N    1 
ATOM   6393 C  CA   . SER A 1 899 ? 62.318 -64.778 -70.298 1.00 83.69  ? 893  SER A CA   1 
ATOM   6394 C  C    . SER A 1 899 ? 63.184 -65.940 -69.808 1.00 82.39  ? 893  SER A C    1 
ATOM   6395 O  O    . SER A 1 899 ? 63.128 -67.042 -70.370 1.00 85.63  ? 893  SER A O    1 
ATOM   6396 C  CB   . SER A 1 899 ? 63.121 -63.780 -71.163 1.00 80.16  ? 893  SER A CB   1 
ATOM   6397 O  OG   . SER A 1 899 ? 64.177 -63.114 -70.493 1.00 76.63  ? 893  SER A OG   1 
ATOM   6398 N  N    . GLU A 1 900 ? 63.995 -65.712 -68.771 1.00 77.73  ? 894  GLU A N    1 
ATOM   6399 C  CA   . GLU A 1 900 ? 64.890 -66.720 -68.200 1.00 81.32  ? 894  GLU A CA   1 
ATOM   6400 C  C    . GLU A 1 900 ? 66.123 -67.003 -69.060 1.00 86.99  ? 894  GLU A C    1 
ATOM   6401 O  O    . GLU A 1 900 ? 67.153 -67.448 -68.539 1.00 85.97  ? 894  GLU A O    1 
ATOM   6402 C  CB   . GLU A 1 900 ? 64.135 -68.037 -67.976 1.00 74.35  ? 894  GLU A CB   1 
ATOM   6403 N  N    . ASP A 1 901 ? 66.047 -66.722 -70.365 1.00 87.09  ? 895  ASP A N    1 
ATOM   6404 C  CA   . ASP A 1 901 ? 67.198 -66.818 -71.256 1.00 86.65  ? 895  ASP A CA   1 
ATOM   6405 C  C    . ASP A 1 901 ? 67.837 -65.477 -71.587 1.00 84.34  ? 895  ASP A C    1 
ATOM   6406 O  O    . ASP A 1 901 ? 68.878 -65.452 -72.247 1.00 87.56  ? 895  ASP A O    1 
ATOM   6407 C  CB   . ASP A 1 901 ? 66.808 -67.541 -72.547 1.00 87.80  ? 895  ASP A CB   1 
ATOM   6408 C  CG   . ASP A 1 901 ? 66.794 -69.050 -72.384 1.00 96.49  ? 895  ASP A CG   1 
ATOM   6409 O  OD1  . ASP A 1 901 ? 67.450 -69.554 -71.443 1.00 96.43  ? 895  ASP A OD1  1 
ATOM   6410 O  OD2  . ASP A 1 901 ? 66.132 -69.735 -73.193 1.00 102.18 ? 895  ASP A OD2  1 
ATOM   6411 N  N    . GLY A 1 902 ? 67.264 -64.372 -71.141 1.00 79.34  ? 896  GLY A N    1 
ATOM   6412 C  CA   . GLY A 1 902 ? 67.850 -63.080 -71.404 1.00 76.55  ? 896  GLY A CA   1 
ATOM   6413 C  C    . GLY A 1 902 ? 67.596 -62.585 -72.819 1.00 75.54  ? 896  GLY A C    1 
ATOM   6414 O  O    . GLY A 1 902 ? 67.259 -63.335 -73.736 1.00 72.08  ? 896  GLY A O    1 
ATOM   6415 N  N    . SER A 1 903 ? 67.781 -61.279 -72.988 1.00 74.55  ? 897  SER A N    1 
ATOM   6416 C  CA   . SER A 1 903 ? 67.524 -60.638 -74.270 1.00 67.52  ? 897  SER A CA   1 
ATOM   6417 C  C    . SER A 1 903 ? 68.509 -61.051 -75.353 1.00 66.72  ? 897  SER A C    1 
ATOM   6418 O  O    . SER A 1 903 ? 68.188 -60.916 -76.536 1.00 68.80  ? 897  SER A O    1 
ATOM   6419 C  CB   . SER A 1 903 ? 67.490 -59.117 -74.071 1.00 68.80  ? 897  SER A CB   1 
ATOM   6420 O  OG   . SER A 1 903 ? 68.563 -58.648 -73.257 1.00 77.59  ? 897  SER A OG   1 
ATOM   6421 N  N    . GLY A 1 904 ? 69.674 -61.587 -74.990 1.00 72.81  ? 898  GLY A N    1 
ATOM   6422 C  CA   . GLY A 1 904 ? 70.592 -62.087 -76.004 1.00 64.67  ? 898  GLY A CA   1 
ATOM   6423 C  C    . GLY A 1 904 ? 69.959 -63.130 -76.906 1.00 64.91  ? 898  GLY A C    1 
ATOM   6424 O  O    . GLY A 1 904 ? 70.093 -63.074 -78.126 1.00 70.36  ? 898  GLY A O    1 
ATOM   6425 N  N    . LYS A 1 905 ? 69.259 -64.101 -76.319 1.00 71.90  ? 899  LYS A N    1 
ATOM   6426 C  CA   . LYS A 1 905 ? 68.648 -65.152 -77.130 1.00 69.92  ? 899  LYS A CA   1 
ATOM   6427 C  C    . LYS A 1 905 ? 67.755 -64.583 -78.227 1.00 67.15  ? 899  LYS A C    1 
ATOM   6428 O  O    . LYS A 1 905 ? 67.568 -65.220 -79.267 1.00 68.74  ? 899  LYS A O    1 
ATOM   6429 C  CB   . LYS A 1 905 ? 67.841 -66.102 -76.242 1.00 73.55  ? 899  LYS A CB   1 
ATOM   6430 C  CG   . LYS A 1 905 ? 67.142 -67.225 -77.009 1.00 77.64  ? 899  LYS A CG   1 
ATOM   6431 C  CD   . LYS A 1 905 ? 66.257 -68.081 -76.103 1.00 82.75  ? 899  LYS A CD   1 
ATOM   6432 C  CE   . LYS A 1 905 ? 65.488 -69.129 -76.908 1.00 89.09  ? 899  LYS A CE   1 
ATOM   6433 N  NZ   . LYS A 1 905 ? 64.540 -69.931 -76.073 1.00 96.68  ? 899  LYS A NZ   1 
ATOM   6434 N  N    . GLY A 1 906 ? 67.160 -63.410 -78.003 1.00 67.37  ? 900  GLY A N    1 
ATOM   6435 C  CA   . GLY A 1 906 ? 66.295 -62.825 -79.010 1.00 63.31  ? 900  GLY A CA   1 
ATOM   6436 C  C    . GLY A 1 906 ? 67.061 -62.039 -80.045 1.00 65.05  ? 900  GLY A C    1 
ATOM   6437 O  O    . GLY A 1 906 ? 66.634 -61.951 -81.202 1.00 61.78  ? 900  GLY A O    1 
ATOM   6438 N  N    . ALA A 1 907 ? 68.184 -61.437 -79.642 1.00 64.06  ? 901  ALA A N    1 
ATOM   6439 C  CA   . ALA A 1 907 ? 69.128 -60.899 -80.610 1.00 62.37  ? 901  ALA A CA   1 
ATOM   6440 C  C    . ALA A 1 907 ? 69.503 -61.964 -81.629 1.00 62.63  ? 901  ALA A C    1 
ATOM   6441 O  O    . ALA A 1 907 ? 69.465 -61.732 -82.842 1.00 57.66  ? 901  ALA A O    1 
ATOM   6442 C  CB   . ALA A 1 907 ? 70.375 -60.380 -79.896 1.00 59.13  ? 901  ALA A CB   1 
ATOM   6443 N  N    . ALA A 1 908 ? 69.851 -63.153 -81.142 1.00 62.16  ? 902  ALA A N    1 
ATOM   6444 C  CA   . ALA A 1 908 ? 70.242 -64.230 -82.035 1.00 61.44  ? 902  ALA A CA   1 
ATOM   6445 C  C    . ALA A 1 908 ? 69.074 -64.701 -82.885 1.00 66.03  ? 902  ALA A C    1 
ATOM   6446 O  O    . ALA A 1 908 ? 69.266 -65.087 -84.042 1.00 71.20  ? 902  ALA A O    1 
ATOM   6447 C  CB   . ALA A 1 908 ? 70.820 -65.380 -81.230 1.00 65.18  ? 902  ALA A CB   1 
ATOM   6448 N  N    . LEU A 1 909 ? 67.856 -64.677 -82.343 1.00 65.26  ? 903  LEU A N    1 
ATOM   6449 C  CA   . LEU A 1 909 ? 66.706 -65.078 -83.151 1.00 66.14  ? 903  LEU A CA   1 
ATOM   6450 C  C    . LEU A 1 909 ? 66.390 -64.040 -84.219 1.00 67.60  ? 903  LEU A C    1 
ATOM   6451 O  O    . LEU A 1 909 ? 66.101 -64.395 -85.367 1.00 69.02  ? 903  LEU A O    1 
ATOM   6452 C  CB   . LEU A 1 909 ? 65.496 -65.335 -82.258 1.00 69.89  ? 903  LEU A CB   1 
ATOM   6453 C  CG   . LEU A 1 909 ? 65.653 -66.606 -81.416 1.00 75.09  ? 903  LEU A CG   1 
ATOM   6454 C  CD1  . LEU A 1 909 ? 64.590 -66.714 -80.322 1.00 74.01  ? 903  LEU A CD1  1 
ATOM   6455 C  CD2  . LEU A 1 909 ? 65.617 -67.831 -82.337 1.00 72.34  ? 903  LEU A CD2  1 
ATOM   6456 N  N    . ILE A 1 910 ? 66.456 -62.754 -83.869 1.00 67.20  ? 904  ILE A N    1 
ATOM   6457 C  CA   . ILE A 1 910 ? 66.243 -61.698 -84.858 1.00 67.00  ? 904  ILE A CA   1 
ATOM   6458 C  C    . ILE A 1 910 ? 67.270 -61.802 -85.988 1.00 67.55  ? 904  ILE A C    1 
ATOM   6459 O  O    . ILE A 1 910 ? 66.949 -61.567 -87.160 1.00 65.33  ? 904  ILE A O    1 
ATOM   6460 C  CB   . ILE A 1 910 ? 66.268 -60.327 -84.160 1.00 62.47  ? 904  ILE A CB   1 
ATOM   6461 C  CG1  . ILE A 1 910 ? 65.065 -60.223 -83.209 1.00 64.71  ? 904  ILE A CG1  1 
ATOM   6462 C  CG2  . ILE A 1 910 ? 66.272 -59.192 -85.178 1.00 56.03  ? 904  ILE A CG2  1 
ATOM   6463 C  CD1  . ILE A 1 910 ? 65.183 -59.125 -82.140 1.00 60.91  ? 904  ILE A CD1  1 
ATOM   6464 N  N    . THR A 1 911 ? 68.510 -62.184 -85.658 1.00 64.02  ? 905  THR A N    1 
ATOM   6465 C  CA   . THR A 1 911 ? 69.529 -62.419 -86.677 1.00 64.89  ? 905  THR A CA   1 
ATOM   6466 C  C    . THR A 1 911 ? 69.154 -63.578 -87.597 1.00 72.72  ? 905  THR A C    1 
ATOM   6467 O  O    . THR A 1 911 ? 69.183 -63.444 -88.828 1.00 68.34  ? 905  THR A O    1 
ATOM   6468 C  CB   . THR A 1 911 ? 70.875 -62.696 -86.015 1.00 61.73  ? 905  THR A CB   1 
ATOM   6469 O  OG1  . THR A 1 911 ? 71.354 -61.506 -85.389 1.00 64.23  ? 905  THR A OG1  1 
ATOM   6470 C  CG2  . THR A 1 911 ? 71.879 -63.170 -87.037 1.00 64.92  ? 905  THR A CG2  1 
ATOM   6471 N  N    . ALA A 1 912 ? 68.829 -64.737 -87.013 1.00 74.79  ? 906  ALA A N    1 
ATOM   6472 C  CA   . ALA A 1 912 ? 68.475 -65.908 -87.813 1.00 71.54  ? 906  ALA A CA   1 
ATOM   6473 C  C    . ALA A 1 912 ? 67.310 -65.604 -88.742 1.00 72.94  ? 906  ALA A C    1 
ATOM   6474 O  O    . ALA A 1 912 ? 67.329 -65.968 -89.921 1.00 79.33  ? 906  ALA A O    1 
ATOM   6475 C  CB   . ALA A 1 912 ? 68.145 -67.090 -86.903 1.00 66.45  ? 906  ALA A CB   1 
ATOM   6476 N  N    . VAL A 1 913 ? 66.282 -64.929 -88.231 1.00 73.96  ? 907  VAL A N    1 
ATOM   6477 C  CA   . VAL A 1 913 ? 65.158 -64.559 -89.083 1.00 73.42  ? 907  VAL A CA   1 
ATOM   6478 C  C    . VAL A 1 913 ? 65.605 -63.613 -90.191 1.00 75.94  ? 907  VAL A C    1 
ATOM   6479 O  O    . VAL A 1 913 ? 65.062 -63.641 -91.301 1.00 77.26  ? 907  VAL A O    1 
ATOM   6480 C  CB   . VAL A 1 913 ? 64.035 -63.948 -88.230 1.00 70.18  ? 907  VAL A CB   1 
ATOM   6481 C  CG1  . VAL A 1 913 ? 62.918 -63.460 -89.110 1.00 75.56  ? 907  VAL A CG1  1 
ATOM   6482 C  CG2  . VAL A 1 913 ? 63.520 -64.969 -87.267 1.00 75.59  ? 907  VAL A CG2  1 
ATOM   6483 N  N    . ALA A 1 914 ? 66.591 -62.758 -89.917 1.00 74.02  ? 908  ALA A N    1 
ATOM   6484 C  CA   . ALA A 1 914 ? 67.033 -61.820 -90.941 1.00 71.15  ? 908  ALA A CA   1 
ATOM   6485 C  C    . ALA A 1 914 ? 67.844 -62.520 -92.015 1.00 77.99  ? 908  ALA A C    1 
ATOM   6486 O  O    . ALA A 1 914 ? 67.916 -62.033 -93.152 1.00 82.30  ? 908  ALA A O    1 
ATOM   6487 C  CB   . ALA A 1 914 ? 67.850 -60.690 -90.316 1.00 66.54  ? 908  ALA A CB   1 
ATOM   6488 N  N    . CYS A 1 915 ? 68.466 -63.652 -91.675 1.00 76.18  ? 909  CYS A N    1 
ATOM   6489 C  CA   . CYS A 1 915 ? 69.199 -64.423 -92.674 1.00 82.50  ? 909  CYS A CA   1 
ATOM   6490 C  C    . CYS A 1 915 ? 68.253 -65.137 -93.640 1.00 85.87  ? 909  CYS A C    1 
ATOM   6491 O  O    . CYS A 1 915 ? 68.313 -64.911 -94.856 1.00 87.47  ? 909  CYS A O    1 
ATOM   6492 C  CB   . CYS A 1 915 ? 70.149 -65.407 -91.984 1.00 80.43  ? 909  CYS A CB   1 
ATOM   6493 S  SG   . CYS A 1 915 ? 71.555 -64.586 -91.159 1.00 72.27  ? 909  CYS A SG   1 
ATOM   6494 N  N    . ARG A 1 916 ? 67.333 -65.964 -93.123 1.00 80.90  ? 910  ARG A N    1 
ATOM   6495 C  CA   . ARG A 1 916 ? 66.431 -66.675 -94.029 1.00 84.25  ? 910  ARG A CA   1 
ATOM   6496 C  C    . ARG A 1 916 ? 65.791 -65.728 -95.036 1.00 84.30  ? 910  ARG A C    1 
ATOM   6497 O  O    . ARG A 1 916 ? 65.653 -66.071 -96.212 1.00 97.44  ? 910  ARG A O    1 
ATOM   6498 C  CB   . ARG A 1 916 ? 65.351 -67.450 -93.265 1.00 85.25  ? 910  ARG A CB   1 
ATOM   6499 C  CG   . ARG A 1 916 ? 64.520 -66.628 -92.312 1.00 85.26  ? 910  ARG A CG   1 
ATOM   6500 C  CD   . ARG A 1 916 ? 63.349 -67.419 -91.743 1.00 86.67  ? 910  ARG A CD   1 
ATOM   6501 N  NE   . ARG A 1 916 ? 62.199 -67.496 -92.644 1.00 88.73  ? 910  ARG A NE   1 
ATOM   6502 C  CZ   . ARG A 1 916 ? 61.197 -66.618 -92.645 1.00 87.57  ? 910  ARG A CZ   1 
ATOM   6503 N  NH1  . ARG A 1 916 ? 61.193 -65.608 -91.792 1.00 86.98  ? 910  ARG A NH1  1 
ATOM   6504 N  NH2  . ARG A 1 916 ? 60.181 -66.758 -93.478 1.00 91.33  ? 910  ARG A NH2  1 
ATOM   6505 N  N    . ILE A 1 917 ? 65.422 -64.522 -94.610 1.00 80.48  ? 911  ILE A N    1 
ATOM   6506 C  CA   . ILE A 1 917 ? 64.746 -63.615 -95.529 1.00 82.66  ? 911  ILE A CA   1 
ATOM   6507 C  C    . ILE A 1 917 ? 65.640 -63.269 -96.713 1.00 94.41  ? 911  ILE A C    1 
ATOM   6508 O  O    . ILE A 1 917 ? 65.157 -63.106 -97.847 1.00 97.03  ? 911  ILE A O    1 
ATOM   6509 C  CB   . ILE A 1 917 ? 64.249 -62.362 -94.787 1.00 82.56  ? 911  ILE A CB   1 
ATOM   6510 C  CG1  . ILE A 1 917 ? 62.984 -62.702 -93.994 1.00 79.32  ? 911  ILE A CG1  1 
ATOM   6511 C  CG2  . ILE A 1 917 ? 64.030 -61.214 -95.751 1.00 88.48  ? 911  ILE A CG2  1 
ATOM   6512 C  CD1  . ILE A 1 917 ? 62.458 -61.565 -93.164 1.00 82.03  ? 911  ILE A CD1  1 
ATOM   6513 N  N    . ARG A 1 918 ? 66.953 -63.141 -96.483 1.00 92.59  ? 912  ARG A N    1 
ATOM   6514 C  CA   . ARG A 1 918 ? 67.843 -62.924 -97.622 1.00 94.77  ? 912  ARG A CA   1 
ATOM   6515 C  C    . ARG A 1 918 ? 68.208 -64.236 -98.313 1.00 95.09  ? 912  ARG A C    1 
ATOM   6516 O  O    . ARG A 1 918 ? 68.335 -64.266 -99.544 1.00 103.19 ? 912  ARG A O    1 
ATOM   6517 C  CB   . ARG A 1 918 ? 69.084 -62.133 -97.192 1.00 92.99  ? 912  ARG A CB   1 
ATOM   6518 C  CG   . ARG A 1 918 ? 70.037 -62.797 -96.224 1.00 86.93  ? 912  ARG A CG   1 
ATOM   6519 C  CD   . ARG A 1 918 ? 71.062 -61.761 -95.748 1.00 82.81  ? 912  ARG A CD   1 
ATOM   6520 N  NE   . ARG A 1 918 ? 72.129 -62.330 -94.925 1.00 87.38  ? 912  ARG A NE   1 
ATOM   6521 C  CZ   . ARG A 1 918 ? 72.974 -61.613 -94.180 1.00 89.50  ? 912  ARG A CZ   1 
ATOM   6522 N  NH1  . ARG A 1 918 ? 72.852 -60.289 -94.094 1.00 86.32  ? 912  ARG A NH1  1 
ATOM   6523 N  NH2  . ARG A 1 918 ? 73.923 -62.223 -93.480 1.00 84.77  ? 912  ARG A NH2  1 
ATOM   6524 N  N    . GLU A 1 919 ? 68.336 -65.325 -97.553 1.00 91.51  ? 913  GLU A N    1 
ATOM   6525 C  CA   . GLU A 1 919 ? 68.481 -66.672 -98.115 1.00 91.70  ? 913  GLU A CA   1 
ATOM   6526 C  C    . GLU A 1 919 ? 67.126 -67.250 -98.559 1.00 87.98  ? 913  GLU A C    1 
ATOM   6527 O  O    . GLU A 1 919 ? 66.423 -66.675 -99.398 1.00 91.18  ? 913  GLU A O    1 
ATOM   6528 C  CB   . GLU A 1 919 ? 69.142 -67.610 -97.094 1.00 75.75  ? 913  GLU A CB   1 
HETATM 6529 C  C4   . 62C B 2 .   ? 66.463 -49.397 -72.139 1.00 47.59  ? 1001 62C A C4   1 
HETATM 6530 C  C5   . 62C B 2 .   ? 65.948 -49.413 -70.698 1.00 47.26  ? 1001 62C A C5   1 
HETATM 6531 C  C6   . 62C B 2 .   ? 65.967 -50.783 -70.066 1.00 47.45  ? 1001 62C A C6   1 
HETATM 6532 C  C8   . 62C B 2 .   ? 68.066 -44.823 -71.515 1.00 48.62  ? 1001 62C A C8   1 
HETATM 6533 C  C10  . 62C B 2 .   ? 67.972 -43.467 -72.048 1.00 51.08  ? 1001 62C A C10  1 
HETATM 6534 C  C13  . 62C B 2 .   ? 67.873 -40.818 -73.217 1.00 64.45  ? 1001 62C A C13  1 
HETATM 6535 C  C15  . 62C B 2 .   ? 68.589 -38.543 -73.125 1.00 73.63  ? 1001 62C A C15  1 
HETATM 6536 C  C17  . 62C B 2 .   ? 69.111 -40.036 -71.316 1.00 55.62  ? 1001 62C A C17  1 
HETATM 6537 CL CL1  . 62C B 2 .   ? 69.987 -37.522 -71.052 1.00 92.55  ? 1001 62C A CL1  1 
HETATM 6538 C  C16  . 62C B 2 .   ? 69.171 -38.781 -71.891 1.00 71.20  ? 1001 62C A C16  1 
HETATM 6539 CL CL2  . 62C B 2 .   ? 68.655 -36.967 -73.844 1.00 101.83 ? 1001 62C A CL2  1 
HETATM 6540 C  C14  . 62C B 2 .   ? 67.941 -39.564 -73.794 1.00 65.78  ? 1001 62C A C14  1 
HETATM 6541 C  C12  . 62C B 2 .   ? 68.428 -41.065 -71.960 1.00 59.09  ? 1001 62C A C12  1 
HETATM 6542 C  C11  . 62C B 2 .   ? 68.417 -42.413 -71.390 1.00 58.49  ? 1001 62C A C11  1 
HETATM 6543 O  O9   . 62C B 2 .   ? 68.918 -45.168 -70.679 1.00 48.71  ? 1001 62C A O9   1 
HETATM 6544 N  N7   . 62C B 2 .   ? 67.241 -45.700 -72.082 1.00 48.79  ? 1001 62C A N7   1 
HETATM 6545 C  C2   . 62C B 2 .   ? 67.301 -47.086 -71.665 1.00 47.12  ? 1001 62C A C2   1 
HETATM 6546 C  C1   . 62C B 2 .   ? 66.746 -47.252 -70.256 1.00 42.04  ? 1001 62C A C1   1 
HETATM 6547 O  O1   . 62C B 2 .   ? 65.455 -46.743 -70.221 1.00 44.30  ? 1001 62C A O1   1 
HETATM 6548 C  C3   . 62C B 2 .   ? 66.543 -47.969 -72.650 1.00 47.30  ? 1001 62C A C3   1 
HETATM 6549 O  O3   . 62C B 2 .   ? 67.235 -47.937 -73.884 1.00 47.22  ? 1001 62C A O3   1 
HETATM 6550 O  O4   . 62C B 2 .   ? 65.613 -50.157 -72.988 1.00 43.17  ? 1001 62C A O4   1 
HETATM 6551 O  O5   . 62C B 2 .   ? 66.798 -48.590 -69.893 1.00 41.23  ? 1001 62C A O5   1 
HETATM 6552 O  O6   . 62C B 2 .   ? 67.275 -51.325 -70.116 1.00 49.72  ? 1001 62C A O6   1 
HETATM 6553 H  H41  . 62C B 2 .   ? 67.353 -49.783 -72.156 1.00 57.11  ? 1001 62C A H41  1 
HETATM 6554 H  H51  . 62C B 2 .   ? 65.046 -49.057 -70.676 1.00 56.71  ? 1001 62C A H51  1 
HETATM 6555 H  H61  . 62C B 2 .   ? 65.359 -51.365 -70.547 1.00 56.94  ? 1001 62C A H61  1 
HETATM 6556 H  H62  . 62C B 2 .   ? 65.684 -50.714 -69.141 1.00 56.94  ? 1001 62C A H62  1 
HETATM 6557 H  H101 . 62C B 2 .   ? 67.641 -43.348 -72.909 1.00 61.29  ? 1001 62C A H101 1 
HETATM 6558 H  H131 . 62C B 2 .   ? 67.437 -41.505 -73.667 1.00 77.34  ? 1001 62C A H131 1 
HETATM 6559 H  H171 . 62C B 2 .   ? 69.510 -40.188 -70.490 1.00 66.75  ? 1001 62C A H171 1 
HETATM 6560 H  H141 . 62C B 2 .   ? 67.539 -39.404 -74.617 1.00 78.93  ? 1001 62C A H141 1 
HETATM 6561 H  H111 . 62C B 2 .   ? 68.797 -42.542 -70.551 1.00 70.18  ? 1001 62C A H111 1 
HETATM 6562 H  H71  . 62C B 2 .   ? 66.680 -45.449 -72.684 1.00 58.55  ? 1001 62C A H71  1 
HETATM 6563 H  H21  . 62C B 2 .   ? 68.230 -47.366 -71.660 1.00 56.54  ? 1001 62C A H21  1 
HETATM 6564 H  H11  . 62C B 2 .   ? 67.302 -46.745 -69.644 1.00 50.45  ? 1001 62C A H11  1 
HETATM 6565 H  H12  . 62C B 2 .   ? 65.485 -45.906 -70.076 1.00 53.16  ? 1001 62C A H12  1 
HETATM 6566 H  H31  . 62C B 2 .   ? 65.646 -47.620 -72.768 1.00 56.76  ? 1001 62C A H31  1 
HETATM 6567 H  H32  . 62C B 2 .   ? 67.922 -48.436 -73.836 1.00 56.67  ? 1001 62C A H32  1 
HETATM 6568 H  H42  . 62C B 2 .   ? 65.897 -50.957 -73.030 1.00 51.80  ? 1001 62C A H42  1 
HETATM 6569 H  H63  . 62C B 2 .   ? 67.837 -50.728 -69.894 1.00 59.66  ? 1001 62C A H63  1 
HETATM 6570 C  C4   . 62C C 2 .   ? 44.582 -54.511 -10.684 1.00 63.64  ? 1002 62C A C4   1 
HETATM 6571 C  C5   . 62C C 2 .   ? 45.181 -54.855 -9.313  1.00 58.51  ? 1002 62C A C5   1 
HETATM 6572 C  C6   . 62C C 2 .   ? 45.866 -53.683 -8.653  1.00 58.52  ? 1002 62C A C6   1 
HETATM 6573 C  C8   . 62C C 2 .   ? 40.571 -57.291 -10.263 1.00 69.79  ? 1002 62C A C8   1 
HETATM 6574 C  C10  . 62C C 2 .   ? 39.892 -58.505 -10.772 1.00 75.34  ? 1002 62C A C10  1 
HETATM 6575 C  C13  . 62C C 2 .   ? 37.700 -59.965 -12.728 1.00 100.30 ? 1002 62C A C13  1 
HETATM 6576 C  C15  . 62C C 2 .   ? 36.236 -61.815 -12.319 1.00 111.14 ? 1002 62C A C15  1 
HETATM 6577 C  C17  . 62C C 2 .   ? 37.046 -60.490 -10.480 1.00 98.86  ? 1002 62C A C17  1 
HETATM 6578 CL CL1  . 62C C 2 .   ? 35.413 -62.526 -9.811  1.00 119.49 ? 1002 62C A CL1  1 
HETATM 6579 C  C16  . 62C C 2 .   ? 36.287 -61.545 -10.955 1.00 105.40 ? 1002 62C A C16  1 
HETATM 6580 CL CL2  . 62C C 2 .   ? 35.296 -63.135 -12.942 1.00 128.21 ? 1002 62C A CL2  1 
HETATM 6581 C  C14  . 62C C 2 .   ? 36.944 -61.020 -13.204 1.00 100.34 ? 1002 62C A C14  1 
HETATM 6582 C  C12  . 62C C 2 .   ? 37.769 -59.685 -11.365 1.00 95.30  ? 1002 62C A C12  1 
HETATM 6583 C  C11  . 62C C 2 .   ? 38.565 -58.555 -10.869 1.00 83.43  ? 1002 62C A C11  1 
HETATM 6584 O  O9   . 62C C 2 .   ? 39.979 -56.415 -9.610  1.00 73.14  ? 1002 62C A O9   1 
HETATM 6585 N  N7   . 62C C 2 .   ? 41.888 -57.193 -10.569 1.00 61.97  ? 1002 62C A N7   1 
HETATM 6586 C  C2   . 62C C 2 .   ? 42.684 -56.058 -10.123 1.00 60.03  ? 1002 62C A C2   1 
HETATM 6587 C  C1   . 62C C 2 .   ? 43.446 -56.394 -8.844  1.00 62.95  ? 1002 62C A C1   1 
HETATM 6588 O  O1   . 62C C 2 .   ? 44.334 -57.436 -9.091  1.00 60.42  ? 1002 62C A O1   1 
HETATM 6589 C  C3   . 62C C 2 .   ? 43.669 -55.620 -11.202 1.00 63.05  ? 1002 62C A C3   1 
HETATM 6590 O  O3   . 62C C 2 .   ? 42.950 -55.136 -12.323 1.00 65.13  ? 1002 62C A O3   1 
HETATM 6591 O  O4   . 62C C 2 .   ? 45.624 -54.298 -11.629 1.00 61.69  ? 1002 62C A O4   1 
HETATM 6592 O  O5   . 62C C 2 .   ? 44.143 -55.258 -8.410  1.00 57.89  ? 1002 62C A O5   1 
HETATM 6593 O  O6   . 62C C 2 .   ? 45.010 -52.550 -8.611  1.00 57.97  ? 1002 62C A O6   1 
HETATM 6594 H  H41  . 62C C 2 .   ? 44.062 -53.696 -10.600 1.00 76.37  ? 1002 62C A H41  1 
HETATM 6595 H  H51  . 62C C 2 .   ? 45.812 -55.584 -9.416  1.00 70.21  ? 1002 62C A H51  1 
HETATM 6596 H  H61  . 62C C 2 .   ? 46.667 -53.461 -9.154  1.00 70.22  ? 1002 62C A H61  1 
HETATM 6597 H  H62  . 62C C 2 .   ? 46.115 -53.928 -7.748  1.00 70.22  ? 1002 62C A H62  1 
HETATM 6598 H  H101 . 62C C 2 .   ? 40.399 -59.239 -11.032 1.00 90.41  ? 1002 62C A H101 1 
HETATM 6599 H  H131 . 62C C 2 .   ? 38.172 -59.434 -13.328 1.00 120.36 ? 1002 62C A H131 1 
HETATM 6600 H  H171 . 62C C 2 .   ? 37.076 -60.317 -9.567  1.00 118.63 ? 1002 62C A H171 1 
HETATM 6601 H  H141 . 62C C 2 .   ? 36.912 -61.196 -14.116 1.00 120.41 ? 1002 62C A H141 1 
HETATM 6602 H  H111 . 62C C 2 .   ? 38.097 -57.797 -10.603 1.00 100.11 ? 1002 62C A H111 1 
HETATM 6603 H  H71  . 62C C 2 .   ? 42.264 -57.821 -11.020 1.00 74.36  ? 1002 62C A H71  1 
HETATM 6604 H  H21  . 62C C 2 .   ? 42.087 -55.316 -9.936  1.00 72.03  ? 1002 62C A H21  1 
HETATM 6605 H  H11  . 62C C 2 .   ? 42.814 -56.661 -8.158  1.00 75.54  ? 1002 62C A H11  1 
HETATM 6606 H  H12  . 62C C 2 .   ? 44.907 -57.474 -8.465  1.00 72.50  ? 1002 62C A H12  1 
HETATM 6607 H  H31  . 62C C 2 .   ? 44.210 -56.380 -11.467 1.00 75.66  ? 1002 62C A H31  1 
HETATM 6608 H  H32  . 62C C 2 .   ? 42.689 -54.342 -12.170 1.00 78.16  ? 1002 62C A H32  1 
HETATM 6609 H  H42  . 62C C 2 .   ? 45.350 -54.509 -12.406 1.00 74.03  ? 1002 62C A H42  1 
HETATM 6610 H  H63  . 62C C 2 .   ? 44.202 -52.808 -8.565  1.00 69.57  ? 1002 62C A H63  1 
HETATM 6611 C  C1   . BG6 D 3 .   ? 68.792 -59.408 -68.542 1.00 86.19  ? 1003 BG6 A C1   1 
HETATM 6612 C  C2   . BG6 D 3 .   ? 68.512 -59.463 -70.044 1.00 78.43  ? 1003 BG6 A C2   1 
HETATM 6613 O  O1   . BG6 D 3 .   ? 68.466 -60.625 -67.929 1.00 90.87  ? 1003 BG6 A O1   1 
HETATM 6614 O  O5   . BG6 D 3 .   ? 68.057 -58.326 -67.978 1.00 85.33  ? 1003 BG6 A O5   1 
HETATM 6615 C  C3   . BG6 D 3 .   ? 68.926 -58.152 -70.705 1.00 78.46  ? 1003 BG6 A C3   1 
HETATM 6616 O  O2   . BG6 D 3 .   ? 69.207 -60.561 -70.627 1.00 79.25  ? 1003 BG6 A O2   1 
HETATM 6617 C  C4   . BG6 D 3 .   ? 68.319 -56.944 -69.980 1.00 74.65  ? 1003 BG6 A C4   1 
HETATM 6618 O  O3   . BG6 D 3 .   ? 68.549 -58.169 -72.083 1.00 76.85  ? 1003 BG6 A O3   1 
HETATM 6619 C  C5   . BG6 D 3 .   ? 68.488 -57.042 -68.463 1.00 79.24  ? 1003 BG6 A C5   1 
HETATM 6620 O  O4   . BG6 D 3 .   ? 68.956 -55.736 -70.388 1.00 73.70  ? 1003 BG6 A O4   1 
HETATM 6621 C  C6   . BG6 D 3 .   ? 67.660 -56.006 -67.740 1.00 72.74  ? 1003 BG6 A C6   1 
HETATM 6622 O  O6   . BG6 D 3 .   ? 67.708 -56.271 -66.321 1.00 72.08  ? 1003 BG6 A O6   1 
HETATM 6623 P  P    . BG6 D 3 .   ? 68.595 -55.280 -65.426 1.00 78.34  ? 1003 BG6 A P    1 
HETATM 6624 O  O1P  . BG6 D 3 .   ? 68.119 -55.414 -63.932 1.00 66.22  ? 1003 BG6 A O1P  1 
HETATM 6625 O  O2P  . BG6 D 3 .   ? 70.069 -55.779 -65.606 1.00 76.80  ? 1003 BG6 A O2P  1 
HETATM 6626 O  O3P  . BG6 D 3 .   ? 68.347 -53.910 -65.986 1.00 73.06  ? 1003 BG6 A O3P  1 
HETATM 6627 C  CAC  . FLC E 4 .   ? 71.251 -40.879 -62.278 1.00 62.36  ? 1004 FLC A CAC  1 
HETATM 6628 C  CA   . FLC E 4 .   ? 72.028 -42.179 -62.363 1.00 65.61  ? 1004 FLC A CA   1 
HETATM 6629 C  CB   . FLC E 4 .   ? 73.259 -42.408 -61.470 1.00 70.83  ? 1004 FLC A CB   1 
HETATM 6630 C  CBC  . FLC E 4 .   ? 73.672 -41.180 -60.656 1.00 78.13  ? 1004 FLC A CBC  1 
HETATM 6631 C  CG   . FLC E 4 .   ? 72.924 -43.574 -60.538 1.00 65.45  ? 1004 FLC A CG   1 
HETATM 6632 C  CGC  . FLC E 4 .   ? 74.099 -44.089 -59.753 1.00 79.57  ? 1004 FLC A CGC  1 
HETATM 6633 O  OA1  . FLC E 4 .   ? 70.587 -40.460 -63.215 1.00 60.31  ? 1004 FLC A OA1  1 
HETATM 6634 O  OA2  . FLC E 4 .   ? 71.303 -40.267 -61.130 1.00 64.22  ? 1004 FLC A OA2  1 
HETATM 6635 O  OB1  . FLC E 4 .   ? 74.394 -40.304 -61.112 1.00 79.30  ? 1004 FLC A OB1  1 
HETATM 6636 O  OB2  . FLC E 4 .   ? 73.183 -41.174 -59.441 1.00 73.90  ? 1004 FLC A OB2  1 
HETATM 6637 O  OG1  . FLC E 4 .   ? 74.790 -45.007 -60.152 1.00 87.66  ? 1004 FLC A OG1  1 
HETATM 6638 O  OG2  . FLC E 4 .   ? 74.303 -43.476 -58.607 1.00 80.83  ? 1004 FLC A OG2  1 
HETATM 6639 O  OHB  . FLC E 4 .   ? 74.362 -42.780 -62.299 1.00 79.54  ? 1004 FLC A OHB  1 
HETATM 6640 H  HA1  . FLC E 4 .   ? 71.403 -42.897 -62.178 1.00 78.73  ? 1004 FLC A HA1  1 
HETATM 6641 H  HA2  . FLC E 4 .   ? 72.320 -42.276 -63.283 1.00 78.73  ? 1004 FLC A HA2  1 
HETATM 6642 H  HG1  . FLC E 4 .   ? 72.241 -43.283 -59.914 1.00 78.54  ? 1004 FLC A HG1  1 
HETATM 6643 H  HG2  . FLC E 4 .   ? 72.567 -44.301 -61.071 1.00 78.54  ? 1004 FLC A HG2  1 
HETATM 6644 H  HOB  . FLC E 4 .   ? 74.087 -43.279 -62.929 1.00 95.45  ? 1004 FLC A HOB  1 
HETATM 6645 O  O    . HOH F 5 .   ? 54.780 -46.212 -92.638 1.00 54.07  ? 1101 HOH A O    1 
HETATM 6646 O  O    . HOH F 5 .   ? 48.583 -61.055 -33.442 1.00 45.36  ? 1102 HOH A O    1 
HETATM 6647 O  O    . HOH F 5 .   ? 47.303 -49.363 -2.362  1.00 66.65  ? 1103 HOH A O    1 
HETATM 6648 O  O    . HOH F 5 .   ? 59.267 -52.050 -51.234 1.00 54.26  ? 1104 HOH A O    1 
HETATM 6649 O  O    . HOH F 5 .   ? 47.319 -61.170 -37.025 1.00 60.00  ? 1105 HOH A O    1 
HETATM 6650 O  O    . HOH F 5 .   ? 69.134 -38.663 -64.972 1.00 55.83  ? 1106 HOH A O    1 
HETATM 6651 O  O    . HOH F 5 .   ? 86.117 -49.136 -81.881 1.00 57.37  ? 1107 HOH A O    1 
HETATM 6652 O  O    . HOH F 5 .   ? 63.540 -59.141 -89.028 1.00 58.99  ? 1108 HOH A O    1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -5  ?   ?   ?   A . n 
A 1 2   GLY 2   -4  ?   ?   ?   A . n 
A 1 3   SER 3   -3  ?   ?   ?   A . n 
A 1 4   SER 4   -2  ?   ?   ?   A . n 
A 1 5   HIS 5   -1  ?   ?   ?   A . n 
A 1 6   HIS 6   0   ?   ?   ?   A . n 
A 1 7   HIS 7   1   ?   ?   ?   A . n 
A 1 8   HIS 8   2   ?   ?   ?   A . n 
A 1 9   HIS 9   3   ?   ?   ?   A . n 
A 1 10  HIS 10  4   ?   ?   ?   A . n 
A 1 11  SER 11  5   ?   ?   ?   A . n 
A 1 12  SER 12  6   ?   ?   ?   A . n 
A 1 13  GLY 13  7   ?   ?   ?   A . n 
A 1 14  LEU 14  8   ?   ?   ?   A . n 
A 1 15  GLU 15  9   ?   ?   ?   A . n 
A 1 16  ASN 16  10  ?   ?   ?   A . n 
A 1 17  LEU 17  11  ?   ?   ?   A . n 
A 1 18  TYR 18  12  ?   ?   ?   A . n 
A 1 19  PHE 19  13  ?   ?   ?   A . n 
A 1 20  GLN 20  14  ?   ?   ?   A . n 
A 1 21  GLY 21  15  ?   ?   ?   A . n 
A 1 22  SER 22  16  ?   ?   ?   A . n 
A 1 23  ASP 23  17  17  ASP ASP A . n 
A 1 24  GLN 24  18  18  GLN GLN A . n 
A 1 25  VAL 25  19  19  VAL VAL A . n 
A 1 26  GLN 26  20  20  GLN GLN A . n 
A 1 27  LYS 27  21  21  LYS LYS A . n 
A 1 28  VAL 28  22  22  VAL VAL A . n 
A 1 29  ASP 29  23  23  ASP ASP A . n 
A 1 30  GLN 30  24  24  GLN GLN A . n 
A 1 31  TYR 31  25  25  TYR TYR A . n 
A 1 32  LEU 32  26  26  LEU LEU A . n 
A 1 33  TYR 33  27  27  TYR TYR A . n 
A 1 34  HIS 34  28  28  HIS HIS A . n 
A 1 35  MET 35  29  29  MET MET A . n 
A 1 36  ARG 36  30  30  ARG ARG A . n 
A 1 37  LEU 37  31  31  LEU LEU A . n 
A 1 38  SER 38  32  32  SER SER A . n 
A 1 39  ASP 39  33  33  ASP ASP A . n 
A 1 40  GLU 40  34  34  GLU GLU A . n 
A 1 41  THR 41  35  35  THR THR A . n 
A 1 42  LEU 42  36  36  LEU LEU A . n 
A 1 43  LEU 43  37  37  LEU LEU A . n 
A 1 44  GLU 44  38  38  GLU GLU A . n 
A 1 45  ILE 45  39  39  ILE ILE A . n 
A 1 46  SER 46  40  40  SER SER A . n 
A 1 47  LYS 47  41  41  LYS LYS A . n 
A 1 48  ARG 48  42  42  ARG ARG A . n 
A 1 49  PHE 49  43  43  PHE PHE A . n 
A 1 50  ARG 50  44  44  ARG ARG A . n 
A 1 51  LYS 51  45  45  LYS LYS A . n 
A 1 52  GLU 52  46  46  GLU GLU A . n 
A 1 53  MET 53  47  47  MET MET A . n 
A 1 54  GLU 54  48  48  GLU GLU A . n 
A 1 55  LYS 55  49  49  LYS LYS A . n 
A 1 56  GLY 56  50  50  GLY GLY A . n 
A 1 57  LEU 57  51  51  LEU LEU A . n 
A 1 58  GLY 58  52  52  GLY GLY A . n 
A 1 59  ALA 59  53  53  ALA ALA A . n 
A 1 60  THR 60  54  54  THR THR A . n 
A 1 61  THR 61  55  55  THR THR A . n 
A 1 62  HIS 62  56  56  HIS HIS A . n 
A 1 63  PRO 63  57  57  PRO PRO A . n 
A 1 64  THR 64  58  58  THR THR A . n 
A 1 65  ALA 65  59  59  ALA ALA A . n 
A 1 66  ALA 66  60  60  ALA ALA A . n 
A 1 67  VAL 67  61  61  VAL VAL A . n 
A 1 68  LYS 68  62  62  LYS LYS A . n 
A 1 69  MET 69  63  63  MET MET A . n 
A 1 70  LEU 70  64  64  LEU LEU A . n 
A 1 71  PRO 71  65  65  PRO PRO A . n 
A 1 72  THR 72  66  66  THR THR A . n 
A 1 73  PHE 73  67  67  PHE PHE A . n 
A 1 74  VAL 74  68  68  VAL VAL A . n 
A 1 75  ARG 75  69  69  ARG ARG A . n 
A 1 76  SER 76  70  70  SER SER A . n 
A 1 77  THR 77  71  71  THR THR A . n 
A 1 78  PRO 78  72  72  PRO PRO A . n 
A 1 79  ASP 79  73  73  ASP ASP A . n 
A 1 80  GLY 80  74  74  GLY GLY A . n 
A 1 81  THR 81  75  75  THR THR A . n 
A 1 82  GLU 82  76  76  GLU GLU A . n 
A 1 83  HIS 83  77  77  HIS HIS A . n 
A 1 84  GLY 84  78  78  GLY GLY A . n 
A 1 85  GLU 85  79  79  GLU GLU A . n 
A 1 86  PHE 86  80  80  PHE PHE A . n 
A 1 87  LEU 87  81  81  LEU LEU A . n 
A 1 88  ALA 88  82  82  ALA ALA A . n 
A 1 89  LEU 89  83  83  LEU LEU A . n 
A 1 90  ASP 90  84  84  ASP ASP A . n 
A 1 91  LEU 91  85  85  LEU LEU A . n 
A 1 92  GLY 92  86  86  GLY GLY A . n 
A 1 93  GLY 93  87  87  GLY GLY A . n 
A 1 94  THR 94  88  88  THR THR A . n 
A 1 95  ASN 95  89  89  ASN ASN A . n 
A 1 96  PHE 96  90  90  PHE PHE A . n 
A 1 97  ARG 97  91  91  ARG ARG A . n 
A 1 98  VAL 98  92  92  VAL VAL A . n 
A 1 99  LEU 99  93  93  LEU LEU A . n 
A 1 100 TRP 100 94  94  TRP TRP A . n 
A 1 101 VAL 101 95  95  VAL VAL A . n 
A 1 102 LYS 102 96  96  LYS LYS A . n 
A 1 103 VAL 103 97  97  VAL VAL A . n 
A 1 104 THR 104 98  98  THR THR A . n 
A 1 105 ASP 105 99  99  ASP ASP A . n 
A 1 106 ASN 106 100 100 ASN ASN A . n 
A 1 107 GLY 107 101 101 GLY GLY A . n 
A 1 108 LEU 108 102 102 LEU ALA A . n 
A 1 109 GLN 109 103 103 GLN GLN A . n 
A 1 110 LYS 110 104 104 LYS ALA A . n 
A 1 111 VAL 111 105 105 VAL VAL A . n 
A 1 112 GLU 112 106 106 GLU GLU A . n 
A 1 113 MET 113 107 107 MET MET A . n 
A 1 114 GLU 114 108 108 GLU GLU A . n 
A 1 115 ASN 115 109 109 ASN ASN A . n 
A 1 116 GLN 116 110 110 GLN GLN A . n 
A 1 117 ILE 117 111 111 ILE ILE A . n 
A 1 118 TYR 118 112 112 TYR TYR A . n 
A 1 119 ALA 119 113 ?   ?   ?   A . n 
A 1 120 ILE 120 114 ?   ?   ?   A . n 
A 1 121 PRO 121 115 ?   ?   ?   A . n 
A 1 122 GLU 122 116 ?   ?   ?   A . n 
A 1 123 ASP 123 117 ?   ?   ?   A . n 
A 1 124 ILE 124 118 ?   ?   ?   A . n 
A 1 125 MET 125 119 ?   ?   ?   A . n 
A 1 126 ARG 126 120 ?   ?   ?   A . n 
A 1 127 GLY 127 121 ?   ?   ?   A . n 
A 1 128 SER 128 122 ?   ?   ?   A . n 
A 1 129 GLY 129 123 123 GLY GLY A . n 
A 1 130 THR 130 124 124 THR THR A . n 
A 1 131 GLN 131 125 125 GLN GLN A . n 
A 1 132 LEU 132 126 126 LEU LEU A . n 
A 1 133 PHE 133 127 127 PHE PHE A . n 
A 1 134 ASP 134 128 128 ASP ASP A . n 
A 1 135 HIS 135 129 129 HIS HIS A . n 
A 1 136 ILE 136 130 130 ILE ILE A . n 
A 1 137 ALA 137 131 131 ALA ALA A . n 
A 1 138 GLU 138 132 132 GLU GLU A . n 
A 1 139 CYS 139 133 133 CYS CYS A . n 
A 1 140 LEU 140 134 134 LEU LEU A . n 
A 1 141 ALA 141 135 135 ALA ALA A . n 
A 1 142 ASN 142 136 136 ASN ASN A . n 
A 1 143 PHE 143 137 137 PHE PHE A . n 
A 1 144 MET 144 138 138 MET MET A . n 
A 1 145 ASP 145 139 139 ASP ASP A . n 
A 1 146 LYS 146 140 140 LYS LYS A . n 
A 1 147 LEU 147 141 141 LEU LEU A . n 
A 1 148 GLN 148 142 142 GLN GLN A . n 
A 1 149 ILE 149 143 143 ILE ILE A . n 
A 1 150 LYS 150 144 144 LYS LYS A . n 
A 1 151 ASP 151 145 145 ASP ALA A . n 
A 1 152 LYS 152 146 146 LYS LYS A . n 
A 1 153 LYS 153 147 147 LYS LYS A . n 
A 1 154 LEU 154 148 148 LEU LEU A . n 
A 1 155 PRO 155 149 149 PRO PRO A . n 
A 1 156 LEU 156 150 150 LEU LEU A . n 
A 1 157 GLY 157 151 151 GLY GLY A . n 
A 1 158 PHE 158 152 152 PHE PHE A . n 
A 1 159 THR 159 153 153 THR THR A . n 
A 1 160 PHE 160 154 154 PHE PHE A . n 
A 1 161 SER 161 155 155 SER SER A . n 
A 1 162 PHE 162 156 156 PHE PHE A . n 
A 1 163 PRO 163 157 157 PRO PRO A . n 
A 1 164 CYS 164 158 158 CYS CYS A . n 
A 1 165 HIS 165 159 159 HIS HIS A . n 
A 1 166 GLN 166 160 160 GLN GLN A . n 
A 1 167 THR 167 161 161 THR THR A . n 
A 1 168 LYS 168 162 162 LYS LYS A . n 
A 1 169 LEU 169 163 163 LEU LEU A . n 
A 1 170 ASP 170 164 164 ASP ASP A . n 
A 1 171 GLU 171 165 165 GLU GLU A . n 
A 1 172 SER 172 166 166 SER SER A . n 
A 1 173 PHE 173 167 167 PHE PHE A . n 
A 1 174 LEU 174 168 168 LEU ALA A . n 
A 1 175 VAL 175 169 169 VAL ALA A . n 
A 1 176 SER 176 170 170 SER ALA A . n 
A 1 177 TRP 177 171 ?   ?   ?   A . n 
A 1 178 THR 178 172 ?   ?   ?   A . n 
A 1 179 LYS 179 173 ?   ?   ?   A . n 
A 1 180 GLY 180 174 ?   ?   ?   A . n 
A 1 181 PHE 181 175 ?   ?   ?   A . n 
A 1 182 LYS 182 176 ?   ?   ?   A . n 
A 1 183 SER 183 177 ?   ?   ?   A . n 
A 1 184 SER 184 178 ?   ?   ?   A . n 
A 1 185 GLY 185 179 ?   ?   ?   A . n 
A 1 186 VAL 186 180 ?   ?   ?   A . n 
A 1 187 GLU 187 181 ?   ?   ?   A . n 
A 1 188 GLY 188 182 182 GLY GLY A . n 
A 1 189 ARG 189 183 183 ARG ARG A . n 
A 1 190 ASP 190 184 184 ASP ASP A . n 
A 1 191 VAL 191 185 185 VAL VAL A . n 
A 1 192 VAL 192 186 186 VAL VAL A . n 
A 1 193 ALA 193 187 187 ALA ALA A . n 
A 1 194 LEU 194 188 188 LEU LEU A . n 
A 1 195 ILE 195 189 189 ILE ILE A . n 
A 1 196 ARG 196 190 190 ARG ARG A . n 
A 1 197 LYS 197 191 191 LYS LYS A . n 
A 1 198 ALA 198 192 192 ALA ALA A . n 
A 1 199 ILE 199 193 193 ILE ALA A . n 
A 1 200 GLN 200 194 194 GLN GLN A . n 
A 1 201 ARG 201 195 ?   ?   ?   A . n 
A 1 202 ARG 202 196 ?   ?   ?   A . n 
A 1 203 GLY 203 197 ?   ?   ?   A . n 
A 1 204 ASP 204 198 ?   ?   ?   A . n 
A 1 205 PHE 205 199 ?   ?   ?   A . n 
A 1 206 ASP 206 200 ?   ?   ?   A . n 
A 1 207 ILE 207 201 201 ILE ALA A . n 
A 1 208 ASP 208 202 202 ASP ASP A . n 
A 1 209 ILE 209 203 203 ILE ILE A . n 
A 1 210 VAL 210 204 204 VAL VAL A . n 
A 1 211 ALA 211 205 205 ALA ALA A . n 
A 1 212 VAL 212 206 206 VAL VAL A . n 
A 1 213 VAL 213 207 207 VAL VAL A . n 
A 1 214 ASN 214 208 208 ASN ASN A . n 
A 1 215 ASP 215 209 209 ASP ASP A . n 
A 1 216 THR 216 210 210 THR THR A . n 
A 1 217 VAL 217 211 211 VAL VAL A . n 
A 1 218 GLY 218 212 212 GLY GLY A . n 
A 1 219 THR 219 213 213 THR THR A . n 
A 1 220 MET 220 214 214 MET MET A . n 
A 1 221 MET 221 215 215 MET MET A . n 
A 1 222 THR 222 216 216 THR THR A . n 
A 1 223 CYS 223 217 217 CYS CYS A . n 
A 1 224 GLY 224 218 218 GLY GLY A . n 
A 1 225 TYR 225 219 219 TYR TYR A . n 
A 1 226 ASP 226 220 220 ASP ASP A . n 
A 1 227 ASP 227 221 221 ASP ASP A . n 
A 1 228 HIS 228 222 222 HIS HIS A . n 
A 1 229 ASN 229 223 223 ASN ASN A . n 
A 1 230 CYS 230 224 224 CYS CYS A . n 
A 1 231 GLU 231 225 225 GLU GLU A . n 
A 1 232 ILE 232 226 226 ILE ILE A . n 
A 1 233 GLY 233 227 227 GLY GLY A . n 
A 1 234 LEU 234 228 228 LEU LEU A . n 
A 1 235 ILE 235 229 229 ILE ILE A . n 
A 1 236 VAL 236 230 230 VAL VAL A . n 
A 1 237 GLY 237 231 231 GLY GLY A . n 
A 1 238 THR 238 232 232 THR THR A . n 
A 1 239 GLY 239 233 233 GLY GLY A . n 
A 1 240 SER 240 234 234 SER SER A . n 
A 1 241 ASN 241 235 235 ASN ASN A . n 
A 1 242 ALA 242 236 236 ALA ALA A . n 
A 1 243 CYS 243 237 237 CYS CYS A . n 
A 1 244 TYR 244 238 238 TYR TYR A . n 
A 1 245 MET 245 239 239 MET MET A . n 
A 1 246 GLU 246 240 240 GLU GLU A . n 
A 1 247 GLU 247 241 241 GLU GLU A . n 
A 1 248 MET 248 242 242 MET MET A . n 
A 1 249 ARG 249 243 243 ARG ARG A . n 
A 1 250 HIS 250 244 244 HIS HIS A . n 
A 1 251 ILE 251 245 245 ILE ILE A . n 
A 1 252 ASP 252 246 246 ASP ASP A . n 
A 1 253 MET 253 247 247 MET MET A . n 
A 1 254 VAL 254 248 248 VAL VAL A . n 
A 1 255 GLU 255 249 249 GLU GLU A . n 
A 1 256 GLY 256 250 250 GLY GLY A . n 
A 1 257 ASP 257 251 251 ASP ASP A . n 
A 1 258 GLU 258 252 252 GLU GLU A . n 
A 1 259 GLY 259 253 253 GLY GLY A . n 
A 1 260 ARG 260 254 254 ARG ARG A . n 
A 1 261 MET 261 255 255 MET MET A . n 
A 1 262 CYS 262 256 256 CYS CYS A . n 
A 1 263 ILE 263 257 257 ILE ILE A . n 
A 1 264 ASN 264 258 258 ASN ASN A . n 
A 1 265 MET 265 259 259 MET MET A . n 
A 1 266 GLU 266 260 260 GLU GLU A . n 
A 1 267 TRP 267 261 261 TRP TRP A . n 
A 1 268 GLY 268 262 262 GLY GLY A . n 
A 1 269 ALA 269 263 263 ALA ALA A . n 
A 1 270 PHE 270 264 264 PHE PHE A . n 
A 1 271 GLY 271 265 265 GLY GLY A . n 
A 1 272 ASP 272 266 266 ASP ASP A . n 
A 1 273 ASP 273 267 267 ASP ASP A . n 
A 1 274 GLY 274 268 268 GLY GLY A . n 
A 1 275 SER 275 269 269 SER SER A . n 
A 1 276 LEU 276 270 270 LEU LEU A . n 
A 1 277 ASN 277 271 271 ASN ASN A . n 
A 1 278 ASP 278 272 272 ASP ASP A . n 
A 1 279 ILE 279 273 273 ILE ILE A . n 
A 1 280 ARG 280 274 274 ARG ARG A . n 
A 1 281 THR 281 275 275 THR THR A . n 
A 1 282 GLU 282 276 276 GLU GLU A . n 
A 1 283 PHE 283 277 277 PHE PHE A . n 
A 1 284 ASP 284 278 278 ASP ASP A . n 
A 1 285 GLN 285 279 279 GLN GLN A . n 
A 1 286 GLU 286 280 280 GLU GLU A . n 
A 1 287 ILE 287 281 281 ILE ILE A . n 
A 1 288 ASP 288 282 282 ASP ASP A . n 
A 1 289 MET 289 283 283 MET MET A . n 
A 1 290 GLY 290 284 284 GLY GLY A . n 
A 1 291 SER 291 285 285 SER SER A . n 
A 1 292 LEU 292 286 286 LEU LEU A . n 
A 1 293 ASN 293 287 287 ASN ASN A . n 
A 1 294 PRO 294 288 288 PRO PRO A . n 
A 1 295 GLY 295 289 289 GLY GLY A . n 
A 1 296 LYS 296 290 290 LYS LYS A . n 
A 1 297 GLN 297 291 291 GLN GLN A . n 
A 1 298 LEU 298 292 292 LEU LEU A . n 
A 1 299 PHE 299 293 293 PHE PHE A . n 
A 1 300 GLU 300 294 294 GLU GLU A . n 
A 1 301 LYS 301 295 295 LYS LYS A . n 
A 1 302 MET 302 296 296 MET MET A . n 
A 1 303 ILE 303 297 297 ILE ILE A . n 
A 1 304 SER 304 298 298 SER SER A . n 
A 1 305 GLY 305 299 299 GLY GLY A . n 
A 1 306 MET 306 300 300 MET MET A . n 
A 1 307 TYR 307 301 301 TYR TYR A . n 
A 1 308 MET 308 302 302 MET MET A . n 
A 1 309 GLY 309 303 303 GLY GLY A . n 
A 1 310 GLU 310 304 304 GLU GLU A . n 
A 1 311 LEU 311 305 305 LEU LEU A . n 
A 1 312 VAL 312 306 306 VAL VAL A . n 
A 1 313 ARG 313 307 307 ARG ARG A . n 
A 1 314 LEU 314 308 308 LEU LEU A . n 
A 1 315 ILE 315 309 309 ILE ILE A . n 
A 1 316 LEU 316 310 310 LEU LEU A . n 
A 1 317 VAL 317 311 311 VAL VAL A . n 
A 1 318 LYS 318 312 312 LYS LYS A . n 
A 1 319 MET 319 313 313 MET MET A . n 
A 1 320 ALA 320 314 314 ALA ALA A . n 
A 1 321 LYS 321 315 315 LYS LYS A . n 
A 1 322 GLU 322 316 316 GLU GLU A . n 
A 1 323 GLU 323 317 317 GLU GLU A . n 
A 1 324 LEU 324 318 318 LEU LEU A . n 
A 1 325 LEU 325 319 319 LEU LEU A . n 
A 1 326 PHE 326 320 320 PHE PHE A . n 
A 1 327 GLY 327 321 321 GLY GLY A . n 
A 1 328 GLY 328 322 322 GLY GLY A . n 
A 1 329 LYS 329 323 323 LYS LYS A . n 
A 1 330 LEU 330 324 324 LEU LEU A . n 
A 1 331 SER 331 325 325 SER SER A . n 
A 1 332 PRO 332 326 326 PRO PRO A . n 
A 1 333 GLU 333 327 327 GLU GLU A . n 
A 1 334 LEU 334 328 328 LEU LEU A . n 
A 1 335 LEU 335 329 329 LEU LEU A . n 
A 1 336 ASN 336 330 330 ASN ASN A . n 
A 1 337 THR 337 331 331 THR THR A . n 
A 1 338 GLY 338 332 332 GLY GLY A . n 
A 1 339 ARG 339 333 333 ARG ARG A . n 
A 1 340 PHE 340 334 334 PHE PHE A . n 
A 1 341 GLU 341 335 335 GLU GLU A . n 
A 1 342 THR 342 336 336 THR THR A . n 
A 1 343 LYS 343 337 337 LYS LYS A . n 
A 1 344 ASP 344 338 338 ASP ASP A . n 
A 1 345 ILE 345 339 339 ILE ILE A . n 
A 1 346 SER 346 340 340 SER SER A . n 
A 1 347 ASP 347 341 341 ASP ASP A . n 
A 1 348 ILE 348 342 342 ILE ILE A . n 
A 1 349 GLU 349 343 343 GLU GLU A . n 
A 1 350 GLY 350 344 344 GLY GLY A . n 
A 1 351 GLU 351 345 345 GLU GLU A . n 
A 1 352 LYS 352 346 346 LYS LYS A . n 
A 1 353 ASP 353 347 347 ASP ASP A . n 
A 1 354 GLY 354 348 348 GLY GLY A . n 
A 1 355 ILE 355 349 349 ILE ILE A . n 
A 1 356 ARG 356 350 350 ARG ARG A . n 
A 1 357 LYS 357 351 351 LYS LYS A . n 
A 1 358 ALA 358 352 352 ALA ALA A . n 
A 1 359 ARG 359 353 353 ARG ARG A . n 
A 1 360 GLU 360 354 354 GLU GLU A . n 
A 1 361 VAL 361 355 355 VAL VAL A . n 
A 1 362 LEU 362 356 356 LEU LEU A . n 
A 1 363 MET 363 357 357 MET MET A . n 
A 1 364 ARG 364 358 358 ARG ARG A . n 
A 1 365 LEU 365 359 359 LEU LEU A . n 
A 1 366 GLY 366 360 360 GLY GLY A . n 
A 1 367 LEU 367 361 361 LEU LEU A . n 
A 1 368 ASP 368 362 362 ASP ASP A . n 
A 1 369 PRO 369 363 363 PRO PRO A . n 
A 1 370 THR 370 364 364 THR THR A . n 
A 1 371 GLN 371 365 365 GLN GLN A . n 
A 1 372 GLU 372 366 366 GLU GLU A . n 
A 1 373 ASP 373 367 367 ASP ASP A . n 
A 1 374 CYS 374 368 368 CYS CYS A . n 
A 1 375 VAL 375 369 369 VAL VAL A . n 
A 1 376 ALA 376 370 370 ALA ALA A . n 
A 1 377 THR 377 371 371 THR THR A . n 
A 1 378 HIS 378 372 372 HIS HIS A . n 
A 1 379 ARG 379 373 373 ARG ARG A . n 
A 1 380 ILE 380 374 374 ILE ILE A . n 
A 1 381 CYS 381 375 375 CYS CYS A . n 
A 1 382 GLN 382 376 376 GLN GLN A . n 
A 1 383 ILE 383 377 377 ILE ILE A . n 
A 1 384 VAL 384 378 378 VAL VAL A . n 
A 1 385 SER 385 379 379 SER SER A . n 
A 1 386 THR 386 380 380 THR THR A . n 
A 1 387 ARG 387 381 381 ARG ARG A . n 
A 1 388 SER 388 382 382 SER SER A . n 
A 1 389 ALA 389 383 383 ALA ALA A . n 
A 1 390 SER 390 384 384 SER SER A . n 
A 1 391 LEU 391 385 385 LEU LEU A . n 
A 1 392 CYS 392 386 386 CYS CYS A . n 
A 1 393 ALA 393 387 387 ALA ALA A . n 
A 1 394 ALA 394 388 388 ALA ALA A . n 
A 1 395 THR 395 389 389 THR THR A . n 
A 1 396 LEU 396 390 390 LEU LEU A . n 
A 1 397 ALA 397 391 391 ALA ALA A . n 
A 1 398 ALA 398 392 392 ALA ALA A . n 
A 1 399 VAL 399 393 393 VAL VAL A . n 
A 1 400 LEU 400 394 394 LEU LEU A . n 
A 1 401 GLN 401 395 395 GLN GLN A . n 
A 1 402 ARG 402 396 396 ARG ARG A . n 
A 1 403 ILE 403 397 397 ILE ILE A . n 
A 1 404 LYS 404 398 398 LYS LYS A . n 
A 1 405 GLU 405 399 399 GLU GLU A . n 
A 1 406 ASN 406 400 400 ASN ASN A . n 
A 1 407 LYS 407 401 401 LYS LYS A . n 
A 1 408 GLY 408 402 402 GLY GLY A . n 
A 1 409 GLU 409 403 403 GLU GLU A . n 
A 1 410 GLU 410 404 404 GLU GLU A . n 
A 1 411 ARG 411 405 405 ARG ARG A . n 
A 1 412 LEU 412 406 406 LEU LEU A . n 
A 1 413 ARG 413 407 407 ARG ARG A . n 
A 1 414 SER 414 408 408 SER SER A . n 
A 1 415 THR 415 409 409 THR THR A . n 
A 1 416 ILE 416 410 410 ILE ILE A . n 
A 1 417 GLY 417 411 411 GLY GLY A . n 
A 1 418 VAL 418 412 412 VAL VAL A . n 
A 1 419 ASP 419 413 413 ASP ASP A . n 
A 1 420 GLY 420 414 414 GLY GLY A . n 
A 1 421 SER 421 415 415 SER SER A . n 
A 1 422 VAL 422 416 416 VAL VAL A . n 
A 1 423 TYR 423 417 417 TYR TYR A . n 
A 1 424 LYS 424 418 418 LYS LYS A . n 
A 1 425 LYS 425 419 419 LYS LYS A . n 
A 1 426 HIS 426 420 420 HIS HIS A . n 
A 1 427 PRO 427 421 421 PRO PRO A . n 
A 1 428 HIS 428 422 422 HIS HIS A . n 
A 1 429 PHE 429 423 423 PHE PHE A . n 
A 1 430 ALA 430 424 424 ALA ALA A . n 
A 1 431 LYS 431 425 425 LYS LYS A . n 
A 1 432 ARG 432 426 426 ARG ARG A . n 
A 1 433 LEU 433 427 427 LEU LEU A . n 
A 1 434 HIS 434 428 428 HIS HIS A . n 
A 1 435 LYS 435 429 429 LYS LYS A . n 
A 1 436 THR 436 430 430 THR THR A . n 
A 1 437 VAL 437 431 431 VAL VAL A . n 
A 1 438 ARG 438 432 432 ARG ARG A . n 
A 1 439 ARG 439 433 433 ARG ARG A . n 
A 1 440 LEU 440 434 434 LEU LEU A . n 
A 1 441 VAL 441 435 435 VAL VAL A . n 
A 1 442 PRO 442 436 436 PRO PRO A . n 
A 1 443 GLY 443 437 437 GLY GLY A . n 
A 1 444 CYS 444 438 438 CYS CYS A . n 
A 1 445 ASP 445 439 439 ASP ASP A . n 
A 1 446 VAL 446 440 440 VAL VAL A . n 
A 1 447 ARG 447 441 441 ARG ARG A . n 
A 1 448 PHE 448 442 442 PHE PHE A . n 
A 1 449 LEU 449 443 443 LEU LEU A . n 
A 1 450 ARG 450 444 444 ARG ARG A . n 
A 1 451 SER 451 445 445 SER SER A . n 
A 1 452 GLU 452 446 446 GLU GLU A . n 
A 1 453 ASP 453 447 447 ASP ASP A . n 
A 1 454 GLY 454 448 448 GLY GLY A . n 
A 1 455 SER 455 449 449 SER SER A . n 
A 1 456 GLY 456 450 450 GLY GLY A . n 
A 1 457 LYS 457 451 451 LYS LYS A . n 
A 1 458 GLY 458 452 452 GLY GLY A . n 
A 1 459 ALA 459 453 453 ALA ALA A . n 
A 1 460 ALA 460 454 454 ALA ALA A . n 
A 1 461 MET 461 455 455 MET MET A . n 
A 1 462 VAL 462 456 456 VAL VAL A . n 
A 1 463 THR 463 457 457 THR THR A . n 
A 1 464 ALA 464 458 458 ALA ALA A . n 
A 1 465 VAL 465 459 459 VAL VAL A . n 
A 1 466 ALA 466 460 460 ALA ALA A . n 
A 1 467 TYR 467 461 461 TYR TYR A . n 
A 1 468 ARG 468 462 462 ARG ARG A . n 
A 1 469 LEU 469 463 463 LEU LEU A . n 
A 1 470 ALA 470 464 464 ALA ALA A . n 
A 1 471 ASP 471 465 465 ASP ASP A . n 
A 1 472 GLN 472 466 466 GLN GLN A . n 
A 1 473 HIS 473 467 467 HIS HIS A . n 
A 1 474 ARG 474 468 468 ARG ARG A . n 
A 1 475 ALA 475 469 469 ALA ALA A . n 
A 1 476 ARG 476 470 470 ARG ARG A . n 
A 1 477 GLN 477 471 471 GLN GLN A . n 
A 1 478 LYS 478 472 472 LYS LYS A . n 
A 1 479 THR 479 473 473 THR THR A . n 
A 1 480 LEU 480 474 474 LEU LEU A . n 
A 1 481 GLU 481 475 475 GLU GLU A . n 
A 1 482 HIS 482 476 476 HIS HIS A . n 
A 1 483 LEU 483 477 477 LEU LEU A . n 
A 1 484 GLN 484 478 478 GLN GLN A . n 
A 1 485 LEU 485 479 479 LEU LEU A . n 
A 1 486 SER 486 480 480 SER SER A . n 
A 1 487 HIS 487 481 481 HIS HIS A . n 
A 1 488 ASP 488 482 482 ASP ASP A . n 
A 1 489 GLN 489 483 483 GLN GLN A . n 
A 1 490 LEU 490 484 484 LEU LEU A . n 
A 1 491 LEU 491 485 485 LEU LEU A . n 
A 1 492 GLU 492 486 486 GLU GLU A . n 
A 1 493 VAL 493 487 487 VAL VAL A . n 
A 1 494 LYS 494 488 488 LYS LYS A . n 
A 1 495 ARG 495 489 489 ARG ARG A . n 
A 1 496 ARG 496 490 490 ARG ARG A . n 
A 1 497 MET 497 491 491 MET MET A . n 
A 1 498 LYS 498 492 492 LYS LYS A . n 
A 1 499 VAL 499 493 493 VAL VAL A . n 
A 1 500 GLU 500 494 494 GLU GLU A . n 
A 1 501 MET 501 495 495 MET MET A . n 
A 1 502 GLU 502 496 496 GLU GLU A . n 
A 1 503 ARG 503 497 497 ARG ARG A . n 
A 1 504 GLY 504 498 498 GLY GLY A . n 
A 1 505 LEU 505 499 499 LEU LEU A . n 
A 1 506 SER 506 500 500 SER SER A . n 
A 1 507 LYS 507 501 501 LYS LYS A . n 
A 1 508 GLU 508 502 502 GLU GLU A . n 
A 1 509 THR 509 503 503 THR THR A . n 
A 1 510 HIS 510 504 504 HIS HIS A . n 
A 1 511 ALA 511 505 505 ALA ALA A . n 
A 1 512 SER 512 506 506 SER SER A . n 
A 1 513 ALA 513 507 507 ALA ALA A . n 
A 1 514 PRO 514 508 508 PRO PRO A . n 
A 1 515 VAL 515 509 509 VAL VAL A . n 
A 1 516 LYS 516 510 510 LYS LYS A . n 
A 1 517 MET 517 511 511 MET MET A . n 
A 1 518 LEU 518 512 512 LEU LEU A . n 
A 1 519 PRO 519 513 513 PRO PRO A . n 
A 1 520 THR 520 514 514 THR THR A . n 
A 1 521 TYR 521 515 515 TYR TYR A . n 
A 1 522 VAL 522 516 516 VAL VAL A . n 
A 1 523 CYS 523 517 517 CYS CYS A . n 
A 1 524 ALA 524 518 518 ALA ALA A . n 
A 1 525 THR 525 519 519 THR THR A . n 
A 1 526 PRO 526 520 520 PRO PRO A . n 
A 1 527 ASP 527 521 521 ASP ASP A . n 
A 1 528 GLY 528 522 522 GLY GLY A . n 
A 1 529 THR 529 523 523 THR THR A . n 
A 1 530 GLU 530 524 524 GLU GLU A . n 
A 1 531 LYS 531 525 525 LYS LYS A . n 
A 1 532 GLY 532 526 526 GLY GLY A . n 
A 1 533 ASP 533 527 527 ASP ASP A . n 
A 1 534 PHE 534 528 528 PHE PHE A . n 
A 1 535 LEU 535 529 529 LEU LEU A . n 
A 1 536 ALA 536 530 530 ALA ALA A . n 
A 1 537 LEU 537 531 531 LEU LEU A . n 
A 1 538 ASP 538 532 532 ASP ASP A . n 
A 1 539 LEU 539 533 533 LEU LEU A . n 
A 1 540 GLY 540 534 534 GLY GLY A . n 
A 1 541 GLY 541 535 535 GLY GLY A . n 
A 1 542 THR 542 536 536 THR THR A . n 
A 1 543 ASN 543 537 537 ASN ASN A . n 
A 1 544 PHE 544 538 538 PHE PHE A . n 
A 1 545 ARG 545 539 539 ARG ARG A . n 
A 1 546 VAL 546 540 540 VAL VAL A . n 
A 1 547 LEU 547 541 541 LEU LEU A . n 
A 1 548 LEU 548 542 542 LEU LEU A . n 
A 1 549 VAL 549 543 543 VAL VAL A . n 
A 1 550 ARG 550 544 544 ARG ARG A . n 
A 1 551 VAL 551 545 545 VAL VAL A . n 
A 1 552 ARG 552 546 546 ARG ARG A . n 
A 1 553 ASN 553 547 547 ASN ASN A . n 
A 1 554 GLY 554 548 548 GLY GLY A . n 
A 1 555 LYS 555 549 ?   ?   ?   A . n 
A 1 556 TRP 556 550 ?   ?   ?   A . n 
A 1 557 GLY 557 551 ?   ?   ?   A . n 
A 1 558 GLY 558 552 552 GLY GLY A . n 
A 1 559 VAL 559 553 553 VAL VAL A . n 
A 1 560 GLU 560 554 554 GLU GLU A . n 
A 1 561 MET 561 555 555 MET MET A . n 
A 1 562 HIS 562 556 556 HIS HIS A . n 
A 1 563 ASN 563 557 557 ASN ASN A . n 
A 1 564 LYS 564 558 558 LYS LYS A . n 
A 1 565 ILE 565 559 559 ILE ILE A . n 
A 1 566 TYR 566 560 560 TYR TYR A . n 
A 1 567 ALA 567 561 561 ALA ALA A . n 
A 1 568 ILE 568 562 562 ILE ILE A . n 
A 1 569 PRO 569 563 563 PRO PRO A . n 
A 1 570 GLN 570 564 564 GLN GLN A . n 
A 1 571 GLU 571 565 565 GLU GLU A . n 
A 1 572 VAL 572 566 566 VAL VAL A . n 
A 1 573 MET 573 567 567 MET MET A . n 
A 1 574 HIS 574 568 568 HIS HIS A . n 
A 1 575 GLY 575 569 569 GLY GLY A . n 
A 1 576 THR 576 570 570 THR THR A . n 
A 1 577 GLY 577 571 571 GLY GLY A . n 
A 1 578 ASP 578 572 572 ASP ASP A . n 
A 1 579 GLU 579 573 573 GLU GLU A . n 
A 1 580 LEU 580 574 574 LEU LEU A . n 
A 1 581 PHE 581 575 575 PHE PHE A . n 
A 1 582 ASP 582 576 576 ASP ASP A . n 
A 1 583 HIS 583 577 577 HIS HIS A . n 
A 1 584 ILE 584 578 578 ILE ILE A . n 
A 1 585 VAL 585 579 579 VAL VAL A . n 
A 1 586 GLN 586 580 580 GLN GLN A . n 
A 1 587 CYS 587 581 581 CYS CYS A . n 
A 1 588 ILE 588 582 582 ILE ILE A . n 
A 1 589 ALA 589 583 583 ALA ALA A . n 
A 1 590 ASP 590 584 584 ASP ASP A . n 
A 1 591 PHE 591 585 585 PHE PHE A . n 
A 1 592 LEU 592 586 586 LEU LEU A . n 
A 1 593 GLU 593 587 587 GLU GLU A . n 
A 1 594 TYR 594 588 588 TYR TYR A . n 
A 1 595 MET 595 589 589 MET MET A . n 
A 1 596 GLY 596 590 590 GLY GLY A . n 
A 1 597 MET 597 591 591 MET MET A . n 
A 1 598 LYS 598 592 592 LYS LYS A . n 
A 1 599 GLY 599 593 593 GLY GLY A . n 
A 1 600 VAL 600 594 594 VAL VAL A . n 
A 1 601 SER 601 595 595 SER SER A . n 
A 1 602 LEU 602 596 596 LEU LEU A . n 
A 1 603 PRO 603 597 597 PRO PRO A . n 
A 1 604 LEU 604 598 598 LEU LEU A . n 
A 1 605 GLY 605 599 599 GLY GLY A . n 
A 1 606 PHE 606 600 600 PHE PHE A . n 
A 1 607 THR 607 601 601 THR THR A . n 
A 1 608 PHE 608 602 602 PHE PHE A . n 
A 1 609 SER 609 603 603 SER SER A . n 
A 1 610 PHE 610 604 604 PHE PHE A . n 
A 1 611 PRO 611 605 605 PRO PRO A . n 
A 1 612 CYS 612 606 606 CYS CYS A . n 
A 1 613 GLN 613 607 607 GLN GLN A . n 
A 1 614 GLN 614 608 608 GLN GLN A . n 
A 1 615 ASN 615 609 609 ASN ASN A . n 
A 1 616 SER 616 610 610 SER SER A . n 
A 1 617 LEU 617 611 611 LEU LEU A . n 
A 1 618 ASP 618 612 612 ASP ASP A . n 
A 1 619 GLU 619 613 613 GLU GLU A . n 
A 1 620 SER 620 614 614 SER SER A . n 
A 1 621 ILE 621 615 615 ILE ILE A . n 
A 1 622 LEU 622 616 616 LEU LEU A . n 
A 1 623 LEU 623 617 617 LEU LEU A . n 
A 1 624 LYS 624 618 618 LYS LYS A . n 
A 1 625 TRP 625 619 619 TRP TRP A . n 
A 1 626 THR 626 620 620 THR THR A . n 
A 1 627 LYS 627 621 621 LYS LYS A . n 
A 1 628 GLY 628 622 622 GLY GLY A . n 
A 1 629 PHE 629 623 623 PHE PHE A . n 
A 1 630 LYS 630 624 624 LYS LYS A . n 
A 1 631 ALA 631 625 625 ALA ALA A . n 
A 1 632 SER 632 626 626 SER SER A . n 
A 1 633 GLY 633 627 627 GLY GLY A . n 
A 1 634 CYS 634 628 628 CYS CYS A . n 
A 1 635 GLU 635 629 629 GLU GLU A . n 
A 1 636 GLY 636 630 630 GLY GLY A . n 
A 1 637 GLU 637 631 631 GLU GLU A . n 
A 1 638 ASP 638 632 632 ASP ASP A . n 
A 1 639 VAL 639 633 633 VAL VAL A . n 
A 1 640 VAL 640 634 634 VAL VAL A . n 
A 1 641 THR 641 635 635 THR THR A . n 
A 1 642 LEU 642 636 636 LEU LEU A . n 
A 1 643 LEU 643 637 637 LEU LEU A . n 
A 1 644 LYS 644 638 638 LYS LYS A . n 
A 1 645 GLU 645 639 639 GLU GLU A . n 
A 1 646 ALA 646 640 640 ALA ALA A . n 
A 1 647 ILE 647 641 641 ILE ILE A . n 
A 1 648 HIS 648 642 642 HIS HIS A . n 
A 1 649 ARG 649 643 643 ARG ARG A . n 
A 1 650 ARG 650 644 644 ARG ARG A . n 
A 1 651 GLU 651 645 645 GLU GLU A . n 
A 1 652 GLU 652 646 646 GLU GLU A . n 
A 1 653 PHE 653 647 647 PHE PHE A . n 
A 1 654 ASP 654 648 648 ASP ASP A . n 
A 1 655 LEU 655 649 649 LEU LEU A . n 
A 1 656 ASP 656 650 650 ASP ASP A . n 
A 1 657 VAL 657 651 651 VAL VAL A . n 
A 1 658 VAL 658 652 652 VAL VAL A . n 
A 1 659 ALA 659 653 653 ALA ALA A . n 
A 1 660 VAL 660 654 654 VAL VAL A . n 
A 1 661 VAL 661 655 655 VAL VAL A . n 
A 1 662 ASN 662 656 656 ASN ASN A . n 
A 1 663 ASP 663 657 657 ASP ASP A . n 
A 1 664 THR 664 658 658 THR THR A . n 
A 1 665 VAL 665 659 659 VAL VAL A . n 
A 1 666 GLY 666 660 660 GLY GLY A . n 
A 1 667 THR 667 661 661 THR THR A . n 
A 1 668 MET 668 662 662 MET MET A . n 
A 1 669 MET 669 663 663 MET MET A . n 
A 1 670 THR 670 664 664 THR THR A . n 
A 1 671 CYS 671 665 665 CYS CYS A . n 
A 1 672 GLY 672 666 666 GLY GLY A . n 
A 1 673 PHE 673 667 667 PHE PHE A . n 
A 1 674 GLU 674 668 668 GLU GLU A . n 
A 1 675 ASP 675 669 669 ASP ASP A . n 
A 1 676 PRO 676 670 670 PRO PRO A . n 
A 1 677 HIS 677 671 671 HIS HIS A . n 
A 1 678 CYS 678 672 672 CYS CYS A . n 
A 1 679 GLU 679 673 673 GLU GLU A . n 
A 1 680 VAL 680 674 674 VAL VAL A . n 
A 1 681 GLY 681 675 675 GLY GLY A . n 
A 1 682 LEU 682 676 676 LEU LEU A . n 
A 1 683 ILE 683 677 677 ILE ILE A . n 
A 1 684 VAL 684 678 678 VAL VAL A . n 
A 1 685 GLY 685 679 679 GLY GLY A . n 
A 1 686 THR 686 680 680 THR THR A . n 
A 1 687 GLY 687 681 681 GLY GLY A . n 
A 1 688 SER 688 682 682 SER SER A . n 
A 1 689 ASN 689 683 683 ASN ASN A . n 
A 1 690 ALA 690 684 684 ALA ALA A . n 
A 1 691 CYS 691 685 685 CYS CYS A . n 
A 1 692 TYR 692 686 686 TYR TYR A . n 
A 1 693 MET 693 687 687 MET MET A . n 
A 1 694 GLU 694 688 688 GLU GLU A . n 
A 1 695 GLU 695 689 689 GLU GLU A . n 
A 1 696 MET 696 690 690 MET MET A . n 
A 1 697 ARG 697 691 691 ARG ARG A . n 
A 1 698 ASN 698 692 692 ASN ASN A . n 
A 1 699 VAL 699 693 693 VAL VAL A . n 
A 1 700 GLU 700 694 694 GLU GLU A . n 
A 1 701 LEU 701 695 695 LEU LEU A . n 
A 1 702 VAL 702 696 696 VAL VAL A . n 
A 1 703 GLU 703 697 697 GLU GLU A . n 
A 1 704 GLY 704 698 698 GLY GLY A . n 
A 1 705 GLU 705 699 699 GLU GLU A . n 
A 1 706 GLU 706 700 700 GLU GLU A . n 
A 1 707 GLY 707 701 701 GLY GLY A . n 
A 1 708 ARG 708 702 702 ARG ARG A . n 
A 1 709 MET 709 703 703 MET MET A . n 
A 1 710 CYS 710 704 704 CYS CYS A . n 
A 1 711 VAL 711 705 705 VAL VAL A . n 
A 1 712 ASN 712 706 706 ASN ASN A . n 
A 1 713 MET 713 707 707 MET MET A . n 
A 1 714 GLU 714 708 708 GLU GLU A . n 
A 1 715 TRP 715 709 709 TRP TRP A . n 
A 1 716 GLY 716 710 710 GLY GLY A . n 
A 1 717 ALA 717 711 711 ALA ALA A . n 
A 1 718 PHE 718 712 712 PHE PHE A . n 
A 1 719 GLY 719 713 713 GLY GLY A . n 
A 1 720 ASP 720 714 714 ASP ASP A . n 
A 1 721 ASN 721 715 715 ASN ASN A . n 
A 1 722 GLY 722 716 716 GLY GLY A . n 
A 1 723 CYS 723 717 717 CYS CYS A . n 
A 1 724 LEU 724 718 718 LEU LEU A . n 
A 1 725 ASP 725 719 719 ASP ASP A . n 
A 1 726 ASP 726 720 720 ASP ASP A . n 
A 1 727 PHE 727 721 721 PHE PHE A . n 
A 1 728 ARG 728 722 722 ARG ARG A . n 
A 1 729 THR 729 723 723 THR THR A . n 
A 1 730 GLU 730 724 724 GLU GLU A . n 
A 1 731 PHE 731 725 725 PHE PHE A . n 
A 1 732 ASP 732 726 726 ASP ASP A . n 
A 1 733 VAL 733 727 727 VAL VAL A . n 
A 1 734 ALA 734 728 728 ALA ALA A . n 
A 1 735 VAL 735 729 729 VAL VAL A . n 
A 1 736 ASP 736 730 730 ASP ASP A . n 
A 1 737 GLU 737 731 731 GLU GLU A . n 
A 1 738 LEU 738 732 732 LEU LEU A . n 
A 1 739 SER 739 733 733 SER SER A . n 
A 1 740 LEU 740 734 734 LEU LEU A . n 
A 1 741 ASN 741 735 735 ASN ASN A . n 
A 1 742 PRO 742 736 736 PRO PRO A . n 
A 1 743 GLY 743 737 737 GLY GLY A . n 
A 1 744 LYS 744 738 738 LYS LYS A . n 
A 1 745 GLN 745 739 739 GLN GLN A . n 
A 1 746 ARG 746 740 740 ARG ARG A . n 
A 1 747 PHE 747 741 741 PHE PHE A . n 
A 1 748 GLU 748 742 742 GLU GLU A . n 
A 1 749 LYS 749 743 743 LYS LYS A . n 
A 1 750 MET 750 744 744 MET MET A . n 
A 1 751 ILE 751 745 745 ILE ILE A . n 
A 1 752 SER 752 746 746 SER SER A . n 
A 1 753 GLY 753 747 747 GLY GLY A . n 
A 1 754 MET 754 748 748 MET MET A . n 
A 1 755 TYR 755 749 749 TYR TYR A . n 
A 1 756 LEU 756 750 750 LEU LEU A . n 
A 1 757 GLY 757 751 751 GLY GLY A . n 
A 1 758 GLU 758 752 752 GLU GLU A . n 
A 1 759 ILE 759 753 753 ILE ILE A . n 
A 1 760 VAL 760 754 754 VAL VAL A . n 
A 1 761 ARG 761 755 755 ARG ARG A . n 
A 1 762 ASN 762 756 756 ASN ASN A . n 
A 1 763 ILE 763 757 757 ILE ILE A . n 
A 1 764 LEU 764 758 758 LEU LEU A . n 
A 1 765 ILE 765 759 759 ILE ILE A . n 
A 1 766 ASP 766 760 760 ASP ASP A . n 
A 1 767 PHE 767 761 761 PHE PHE A . n 
A 1 768 THR 768 762 762 THR THR A . n 
A 1 769 LYS 769 763 763 LYS LYS A . n 
A 1 770 ARG 770 764 764 ARG ARG A . n 
A 1 771 GLY 771 765 765 GLY GLY A . n 
A 1 772 LEU 772 766 766 LEU LEU A . n 
A 1 773 LEU 773 767 767 LEU LEU A . n 
A 1 774 PHE 774 768 768 PHE PHE A . n 
A 1 775 ARG 775 769 769 ARG ARG A . n 
A 1 776 GLY 776 770 770 GLY GLY A . n 
A 1 777 ARG 777 771 771 ARG ARG A . n 
A 1 778 ILE 778 772 772 ILE ILE A . n 
A 1 779 SER 779 773 773 SER SER A . n 
A 1 780 GLU 780 774 774 GLU GLU A . n 
A 1 781 ARG 781 775 775 ARG ARG A . n 
A 1 782 LEU 782 776 776 LEU LEU A . n 
A 1 783 LYS 783 777 777 LYS LYS A . n 
A 1 784 THR 784 778 778 THR THR A . n 
A 1 785 ARG 785 779 779 ARG ARG A . n 
A 1 786 GLY 786 780 780 GLY GLY A . n 
A 1 787 ILE 787 781 781 ILE ILE A . n 
A 1 788 PHE 788 782 782 PHE PHE A . n 
A 1 789 GLU 789 783 783 GLU GLU A . n 
A 1 790 THR 790 784 784 THR THR A . n 
A 1 791 LYS 791 785 785 LYS LYS A . n 
A 1 792 PHE 792 786 786 PHE PHE A . n 
A 1 793 LEU 793 787 787 LEU LEU A . n 
A 1 794 SER 794 788 788 SER SER A . n 
A 1 795 GLN 795 789 789 GLN GLN A . n 
A 1 796 ILE 796 790 790 ILE ILE A . n 
A 1 797 GLU 797 791 791 GLU GLU A . n 
A 1 798 SER 798 792 792 SER SER A . n 
A 1 799 ASP 799 793 793 ASP ASP A . n 
A 1 800 CYS 800 794 794 CYS CYS A . n 
A 1 801 LEU 801 795 795 LEU LEU A . n 
A 1 802 ALA 802 796 796 ALA ALA A . n 
A 1 803 LEU 803 797 797 LEU LEU A . n 
A 1 804 LEU 804 798 798 LEU LEU A . n 
A 1 805 GLN 805 799 799 GLN GLN A . n 
A 1 806 VAL 806 800 800 VAL VAL A . n 
A 1 807 ARG 807 801 801 ARG ARG A . n 
A 1 808 ALA 808 802 802 ALA ALA A . n 
A 1 809 ILE 809 803 803 ILE ILE A . n 
A 1 810 LEU 810 804 804 LEU LEU A . n 
A 1 811 GLN 811 805 805 GLN GLN A . n 
A 1 812 HIS 812 806 806 HIS HIS A . n 
A 1 813 LEU 813 807 807 LEU LEU A . n 
A 1 814 GLY 814 808 808 GLY GLY A . n 
A 1 815 LEU 815 809 809 LEU LEU A . n 
A 1 816 GLU 816 810 810 GLU GLU A . n 
A 1 817 SER 817 811 811 SER SER A . n 
A 1 818 THR 818 812 812 THR THR A . n 
A 1 819 CYS 819 813 813 CYS CYS A . n 
A 1 820 ASP 820 814 814 ASP ASP A . n 
A 1 821 ASP 821 815 815 ASP ASP A . n 
A 1 822 SER 822 816 816 SER SER A . n 
A 1 823 ILE 823 817 817 ILE ILE A . n 
A 1 824 ILE 824 818 818 ILE ILE A . n 
A 1 825 VAL 825 819 819 VAL VAL A . n 
A 1 826 LYS 826 820 820 LYS LYS A . n 
A 1 827 GLU 827 821 821 GLU GLU A . n 
A 1 828 VAL 828 822 822 VAL VAL A . n 
A 1 829 CYS 829 823 823 CYS CYS A . n 
A 1 830 THR 830 824 824 THR THR A . n 
A 1 831 VAL 831 825 825 VAL VAL A . n 
A 1 832 VAL 832 826 826 VAL VAL A . n 
A 1 833 ALA 833 827 827 ALA ALA A . n 
A 1 834 ARG 834 828 828 ARG ARG A . n 
A 1 835 ARG 835 829 829 ARG ARG A . n 
A 1 836 ALA 836 830 830 ALA ALA A . n 
A 1 837 ALA 837 831 831 ALA ALA A . n 
A 1 838 GLN 838 832 832 GLN GLN A . n 
A 1 839 LEU 839 833 833 LEU LEU A . n 
A 1 840 CYS 840 834 834 CYS CYS A . n 
A 1 841 GLY 841 835 835 GLY GLY A . n 
A 1 842 ALA 842 836 836 ALA ALA A . n 
A 1 843 GLY 843 837 837 GLY GLY A . n 
A 1 844 MET 844 838 838 MET MET A . n 
A 1 845 ALA 845 839 839 ALA ALA A . n 
A 1 846 ALA 846 840 840 ALA ALA A . n 
A 1 847 VAL 847 841 841 VAL VAL A . n 
A 1 848 VAL 848 842 842 VAL VAL A . n 
A 1 849 ASP 849 843 843 ASP ASP A . n 
A 1 850 ARG 850 844 844 ARG ARG A . n 
A 1 851 ILE 851 845 845 ILE ILE A . n 
A 1 852 ARG 852 846 846 ARG ARG A . n 
A 1 853 GLU 853 847 847 GLU GLU A . n 
A 1 854 ASN 854 848 848 ASN ASN A . n 
A 1 855 ARG 855 849 849 ARG ARG A . n 
A 1 856 GLY 856 850 850 GLY GLY A . n 
A 1 857 LEU 857 851 851 LEU LEU A . n 
A 1 858 ASP 858 852 852 ASP ASP A . n 
A 1 859 ALA 859 853 853 ALA ALA A . n 
A 1 860 LEU 860 854 854 LEU LEU A . n 
A 1 861 LYS 861 855 855 LYS LYS A . n 
A 1 862 VAL 862 856 856 VAL VAL A . n 
A 1 863 THR 863 857 857 THR THR A . n 
A 1 864 VAL 864 858 858 VAL VAL A . n 
A 1 865 GLY 865 859 859 GLY GLY A . n 
A 1 866 VAL 866 860 860 VAL VAL A . n 
A 1 867 ASP 867 861 861 ASP ASP A . n 
A 1 868 GLY 868 862 862 GLY GLY A . n 
A 1 869 THR 869 863 863 THR THR A . n 
A 1 870 LEU 870 864 864 LEU LEU A . n 
A 1 871 TYR 871 865 865 TYR TYR A . n 
A 1 872 LYS 872 866 866 LYS LYS A . n 
A 1 873 LEU 873 867 867 LEU LEU A . n 
A 1 874 HIS 874 868 868 HIS HIS A . n 
A 1 875 PRO 875 869 869 PRO PRO A . n 
A 1 876 HIS 876 870 870 HIS HIS A . n 
A 1 877 PHE 877 871 871 PHE PHE A . n 
A 1 878 ALA 878 872 872 ALA ALA A . n 
A 1 879 LYS 879 873 873 LYS LYS A . n 
A 1 880 VAL 880 874 874 VAL VAL A . n 
A 1 881 MET 881 875 875 MET MET A . n 
A 1 882 HIS 882 876 876 HIS HIS A . n 
A 1 883 GLU 883 877 877 GLU GLU A . n 
A 1 884 THR 884 878 878 THR THR A . n 
A 1 885 VAL 885 879 879 VAL VAL A . n 
A 1 886 LYS 886 880 880 LYS LYS A . n 
A 1 887 ASP 887 881 881 ASP ASP A . n 
A 1 888 LEU 888 882 882 LEU LEU A . n 
A 1 889 ALA 889 883 883 ALA ALA A . n 
A 1 890 PRO 890 884 884 PRO PRO A . n 
A 1 891 LYS 891 885 885 LYS LYS A . n 
A 1 892 CYS 892 886 886 CYS CYS A . n 
A 1 893 ASP 893 887 887 ASP ASP A . n 
A 1 894 VAL 894 888 888 VAL VAL A . n 
A 1 895 SER 895 889 889 SER SER A . n 
A 1 896 PHE 896 890 890 PHE PHE A . n 
A 1 897 LEU 897 891 891 LEU LEU A . n 
A 1 898 GLN 898 892 892 GLN GLN A . n 
A 1 899 SER 899 893 893 SER SER A . n 
A 1 900 GLU 900 894 894 GLU GLU A . n 
A 1 901 ASP 901 895 895 ASP ASP A . n 
A 1 902 GLY 902 896 896 GLY GLY A . n 
A 1 903 SER 903 897 897 SER SER A . n 
A 1 904 GLY 904 898 898 GLY GLY A . n 
A 1 905 LYS 905 899 899 LYS LYS A . n 
A 1 906 GLY 906 900 900 GLY GLY A . n 
A 1 907 ALA 907 901 901 ALA ALA A . n 
A 1 908 ALA 908 902 902 ALA ALA A . n 
A 1 909 LEU 909 903 903 LEU LEU A . n 
A 1 910 ILE 910 904 904 ILE ILE A . n 
A 1 911 THR 911 905 905 THR THR A . n 
A 1 912 ALA 912 906 906 ALA ALA A . n 
A 1 913 VAL 913 907 907 VAL VAL A . n 
A 1 914 ALA 914 908 908 ALA ALA A . n 
A 1 915 CYS 915 909 909 CYS CYS A . n 
A 1 916 ARG 916 910 910 ARG ARG A . n 
A 1 917 ILE 917 911 911 ILE ILE A . n 
A 1 918 ARG 918 912 912 ARG ARG A . n 
A 1 919 GLU 919 913 913 GLU GLU A . n 
A 1 920 ALA 920 914 ?   ?   ?   A . n 
A 1 921 GLY 921 915 ?   ?   ?   A . n 
A 1 922 GLN 922 916 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 62C 1 1001 1 62C LIG A . 
C 2 62C 1 1002 2 62C LIG A . 
D 3 BG6 1 1003 1 BG6 G6P A . 
E 4 FLC 1 1004 1 FLC FLC A . 
F 5 HOH 1 1101 6 HOH HOH A . 
F 5 HOH 2 1102 1 HOH HOH A . 
F 5 HOH 3 1103 5 HOH HOH A . 
F 5 HOH 4 1104 2 HOH HOH A . 
F 5 HOH 5 1105 8 HOH HOH A . 
F 5 HOH 6 1106 3 HOH HOH A . 
F 5 HOH 7 1107 7 HOH HOH A . 
F 5 HOH 8 1108 4 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 820   ? 
1 MORE         -5    ? 
1 'SSA (A^2)'  36140 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-03-30 
2 'Structure model' 1 1 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 2 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'      
2 2 'Structure model' 'Derived calculations' 
3 2 'Structure model' 'Structure summary'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' chem_comp                 
2 2 'Structure model' entity                    
3 2 'Structure model' pdbx_chem_comp_identifier 
4 2 'Structure model' pdbx_entity_nonpoly       
5 2 'Structure model' pdbx_struct_oper_list     
6 2 'Structure model' struct_site               
7 2 'Structure model' struct_site_gen           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_chem_comp.mon_nstd_flag'                  
2 2 'Structure model' '_chem_comp.name'                           
3 2 'Structure model' '_chem_comp.type'                           
4 2 'Structure model' '_entity.pdbx_description'                  
5 2 'Structure model' '_pdbx_entity_nonpoly.name'                 
6 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX  ? ? ? '(1.10_2155: ???)' 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS     ? ? ? .                  2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? .                  3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHENIX  ? ? ? .                  4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OG  A SER 897 ? ? O3  A BG6 1003 ? ? 1.27 
2 1 O   A THR 232 ? ? OG  A SER 298  ? ? 2.00 
3 1 O   A VAL 185 ? ? N   A LEU 188  ? ? 2.14 
4 1 OD2 A ASP 33  ? ? NH1 A ARG 433  ? ? 2.14 
5 1 NH1 A ARG 44  ? ? OE2 A GLU 48   ? ? 2.15 
6 1 OD1 A ASP 23  ? ? NE  A ARG 373  ? ? 2.16 
7 1 N   A ASP 73  ? ? OE2 A GLU 76   ? ? 2.18 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 N  A ASP 251 ? ? CA A ASP 251 ? ? C   A ASP 251 ? ? 129.50 111.00 18.50 2.70 N 
2 1 CB A PHE 871 ? ? CG A PHE 871 ? ? CD2 A PHE 871 ? ? 116.60 120.80 -4.20 0.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LYS A 140 ? ? -83.47  -71.67  
2  1 GLU A 165 ? ? 170.26  150.07  
3  1 SER A 166 ? ? 175.38  163.30  
4  1 VAL A 185 ? ? 63.36   -104.25 
5  1 VAL A 186 ? ? -38.95  -38.53  
6  1 ASP A 251 ? ? -139.90 -54.78  
7  1 GLU A 252 ? ? 63.73   84.47   
8  1 ILE A 297 ? ? -133.23 -51.85  
9  1 GLU A 317 ? ? 84.12   -1.17   
10 1 LYS A 346 ? ? -48.22  -70.53  
11 1 ASP A 362 ? ? -111.83 74.93   
12 1 THR A 364 ? ? -64.37  -172.12 
13 1 LYS A 592 ? ? 51.86   -116.45 
14 1 PRO A 605 ? ? -69.51  92.22   
15 1 LYS A 621 ? ? 58.09   -130.63 
16 1 CYS A 628 ? ? -127.21 -55.64  
17 1 GLU A 646 ? ? -114.52 -73.71  
18 1 LEU A 795 ? ? 58.35   -112.50 
19 1 GLU A 894 ? ? 74.64   -23.15  
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 CYS A 438 ? ? ASP A 439 ? ? 142.46  
2 1 LEU A 807 ? ? GLY A 808 ? ? -143.36 
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    PHE 
_pdbx_validate_planes.auth_asym_id    A 
_pdbx_validate_planes.auth_seq_id     782 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.058 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A GLN 20  ? CG  ? A GLN 26  CG  
2   1 Y 1 A GLN 20  ? CD  ? A GLN 26  CD  
3   1 Y 1 A GLN 20  ? OE1 ? A GLN 26  OE1 
4   1 Y 1 A GLN 20  ? NE2 ? A GLN 26  NE2 
5   1 Y 1 A LYS 41  ? CD  ? A LYS 47  CD  
6   1 Y 1 A LYS 41  ? CE  ? A LYS 47  CE  
7   1 Y 1 A LYS 41  ? NZ  ? A LYS 47  NZ  
8   1 Y 1 A LYS 45  ? CD  ? A LYS 51  CD  
9   1 Y 1 A LYS 45  ? CE  ? A LYS 51  CE  
10  1 Y 1 A LYS 45  ? NZ  ? A LYS 51  NZ  
11  1 Y 1 A GLU 79  ? CG  ? A GLU 85  CG  
12  1 Y 1 A GLU 79  ? CD  ? A GLU 85  CD  
13  1 Y 1 A GLU 79  ? OE1 ? A GLU 85  OE1 
14  1 Y 1 A GLU 79  ? OE2 ? A GLU 85  OE2 
15  1 Y 1 A ASN 89  ? CG  ? A ASN 95  CG  
16  1 Y 1 A ASN 89  ? OD1 ? A ASN 95  OD1 
17  1 Y 1 A ASN 89  ? ND2 ? A ASN 95  ND2 
18  1 Y 1 A PHE 90  ? CG  ? A PHE 96  CG  
19  1 Y 1 A PHE 90  ? CD1 ? A PHE 96  CD1 
20  1 Y 1 A PHE 90  ? CD2 ? A PHE 96  CD2 
21  1 Y 1 A PHE 90  ? CE1 ? A PHE 96  CE1 
22  1 Y 1 A PHE 90  ? CE2 ? A PHE 96  CE2 
23  1 Y 1 A PHE 90  ? CZ  ? A PHE 96  CZ  
24  1 Y 1 A ARG 91  ? CG  ? A ARG 97  CG  
25  1 Y 1 A ARG 91  ? CD  ? A ARG 97  CD  
26  1 Y 1 A ARG 91  ? NE  ? A ARG 97  NE  
27  1 Y 1 A ARG 91  ? CZ  ? A ARG 97  CZ  
28  1 Y 1 A ARG 91  ? NH1 ? A ARG 97  NH1 
29  1 Y 1 A ARG 91  ? NH2 ? A ARG 97  NH2 
30  1 Y 1 A LEU 93  ? CG  ? A LEU 99  CG  
31  1 Y 1 A LEU 93  ? CD1 ? A LEU 99  CD1 
32  1 Y 1 A LEU 93  ? CD2 ? A LEU 99  CD2 
33  1 Y 1 A LYS 96  ? CD  ? A LYS 102 CD  
34  1 Y 1 A LYS 96  ? CE  ? A LYS 102 CE  
35  1 Y 1 A LYS 96  ? NZ  ? A LYS 102 NZ  
36  1 Y 1 A ASP 99  ? CG  ? A ASP 105 CG  
37  1 Y 1 A ASP 99  ? OD1 ? A ASP 105 OD1 
38  1 Y 1 A ASP 99  ? OD2 ? A ASP 105 OD2 
39  1 Y 1 A ASN 100 ? CB  ? A ASN 106 CB  
40  1 Y 1 A ASN 100 ? CG  ? A ASN 106 CG  
41  1 Y 1 A ASN 100 ? OD1 ? A ASN 106 OD1 
42  1 Y 1 A ASN 100 ? ND2 ? A ASN 106 ND2 
43  1 Y 1 A LEU 102 ? CG  ? A LEU 108 CG  
44  1 Y 1 A LEU 102 ? CD1 ? A LEU 108 CD1 
45  1 Y 1 A LEU 102 ? CD2 ? A LEU 108 CD2 
46  1 Y 1 A LYS 104 ? CG  ? A LYS 110 CG  
47  1 Y 1 A LYS 104 ? CD  ? A LYS 110 CD  
48  1 Y 1 A LYS 104 ? CE  ? A LYS 110 CE  
49  1 Y 1 A LYS 104 ? NZ  ? A LYS 110 NZ  
50  1 Y 1 A VAL 105 ? CG1 ? A VAL 111 CG1 
51  1 Y 1 A VAL 105 ? CG2 ? A VAL 111 CG2 
52  1 Y 1 A GLU 106 ? CG  ? A GLU 112 CG  
53  1 Y 1 A GLU 106 ? CD  ? A GLU 112 CD  
54  1 Y 1 A GLU 106 ? OE1 ? A GLU 112 OE1 
55  1 Y 1 A GLU 106 ? OE2 ? A GLU 112 OE2 
56  1 Y 1 A MET 107 ? CG  ? A MET 113 CG  
57  1 Y 1 A MET 107 ? SD  ? A MET 113 SD  
58  1 Y 1 A MET 107 ? CE  ? A MET 113 CE  
59  1 Y 1 A GLU 108 ? CG  ? A GLU 114 CG  
60  1 Y 1 A GLU 108 ? CD  ? A GLU 114 CD  
61  1 Y 1 A GLU 108 ? OE1 ? A GLU 114 OE1 
62  1 Y 1 A GLU 108 ? OE2 ? A GLU 114 OE2 
63  1 Y 1 A GLN 110 ? CD  ? A GLN 116 CD  
64  1 Y 1 A GLN 110 ? OE1 ? A GLN 116 OE1 
65  1 Y 1 A GLN 110 ? NE2 ? A GLN 116 NE2 
66  1 Y 1 A HIS 129 ? CG  ? A HIS 135 CG  
67  1 Y 1 A HIS 129 ? ND1 ? A HIS 135 ND1 
68  1 Y 1 A HIS 129 ? CD2 ? A HIS 135 CD2 
69  1 Y 1 A HIS 129 ? CE1 ? A HIS 135 CE1 
70  1 Y 1 A HIS 129 ? NE2 ? A HIS 135 NE2 
71  1 Y 1 A GLU 132 ? CG  ? A GLU 138 CG  
72  1 Y 1 A GLU 132 ? CD  ? A GLU 138 CD  
73  1 Y 1 A GLU 132 ? OE1 ? A GLU 138 OE1 
74  1 Y 1 A GLU 132 ? OE2 ? A GLU 138 OE2 
75  1 Y 1 A ASN 136 ? CG  ? A ASN 142 CG  
76  1 Y 1 A ASN 136 ? OD1 ? A ASN 142 OD1 
77  1 Y 1 A ASN 136 ? ND2 ? A ASN 142 ND2 
78  1 Y 1 A MET 138 ? CG  ? A MET 144 CG  
79  1 Y 1 A MET 138 ? SD  ? A MET 144 SD  
80  1 Y 1 A MET 138 ? CE  ? A MET 144 CE  
81  1 Y 1 A ASP 139 ? CG  ? A ASP 145 CG  
82  1 Y 1 A ASP 139 ? OD1 ? A ASP 145 OD1 
83  1 Y 1 A ASP 139 ? OD2 ? A ASP 145 OD2 
84  1 Y 1 A LYS 140 ? CG  ? A LYS 146 CG  
85  1 Y 1 A LYS 140 ? CD  ? A LYS 146 CD  
86  1 Y 1 A LYS 140 ? CE  ? A LYS 146 CE  
87  1 Y 1 A LYS 140 ? NZ  ? A LYS 146 NZ  
88  1 Y 1 A LEU 141 ? CD1 ? A LEU 147 CD1 
89  1 Y 1 A LEU 141 ? CD2 ? A LEU 147 CD2 
90  1 Y 1 A GLN 142 ? CG  ? A GLN 148 CG  
91  1 Y 1 A GLN 142 ? CD  ? A GLN 148 CD  
92  1 Y 1 A GLN 142 ? OE1 ? A GLN 148 OE1 
93  1 Y 1 A GLN 142 ? NE2 ? A GLN 148 NE2 
94  1 Y 1 A LYS 144 ? CG  ? A LYS 150 CG  
95  1 Y 1 A LYS 144 ? CD  ? A LYS 150 CD  
96  1 Y 1 A LYS 144 ? CE  ? A LYS 150 CE  
97  1 Y 1 A LYS 144 ? NZ  ? A LYS 150 NZ  
98  1 Y 1 A ASP 145 ? CG  ? A ASP 151 CG  
99  1 Y 1 A ASP 145 ? OD1 ? A ASP 151 OD1 
100 1 Y 1 A ASP 145 ? OD2 ? A ASP 151 OD2 
101 1 Y 1 A LYS 146 ? CD  ? A LYS 152 CD  
102 1 Y 1 A LYS 146 ? CE  ? A LYS 152 CE  
103 1 Y 1 A LYS 146 ? NZ  ? A LYS 152 NZ  
104 1 Y 1 A LYS 147 ? CG  ? A LYS 153 CG  
105 1 Y 1 A LYS 147 ? CD  ? A LYS 153 CD  
106 1 Y 1 A LYS 147 ? CE  ? A LYS 153 CE  
107 1 Y 1 A LYS 147 ? NZ  ? A LYS 153 NZ  
108 1 Y 1 A SER 155 ? OG  ? A SER 161 OG  
109 1 Y 1 A PHE 156 ? CG  ? A PHE 162 CG  
110 1 Y 1 A PHE 156 ? CD1 ? A PHE 162 CD1 
111 1 Y 1 A PHE 156 ? CD2 ? A PHE 162 CD2 
112 1 Y 1 A PHE 156 ? CE1 ? A PHE 162 CE1 
113 1 Y 1 A PHE 156 ? CE2 ? A PHE 162 CE2 
114 1 Y 1 A PHE 156 ? CZ  ? A PHE 162 CZ  
115 1 Y 1 A PHE 167 ? CG  ? A PHE 173 CG  
116 1 Y 1 A PHE 167 ? CD1 ? A PHE 173 CD1 
117 1 Y 1 A PHE 167 ? CD2 ? A PHE 173 CD2 
118 1 Y 1 A PHE 167 ? CE1 ? A PHE 173 CE1 
119 1 Y 1 A PHE 167 ? CE2 ? A PHE 173 CE2 
120 1 Y 1 A PHE 167 ? CZ  ? A PHE 173 CZ  
121 1 Y 1 A LEU 168 ? CG  ? A LEU 174 CG  
122 1 Y 1 A LEU 168 ? CD1 ? A LEU 174 CD1 
123 1 Y 1 A LEU 168 ? CD2 ? A LEU 174 CD2 
124 1 Y 1 A VAL 169 ? CG1 ? A VAL 175 CG1 
125 1 Y 1 A VAL 169 ? CG2 ? A VAL 175 CG2 
126 1 Y 1 A SER 170 ? OG  ? A SER 176 OG  
127 1 Y 1 A ARG 183 ? CG  ? A ARG 189 CG  
128 1 Y 1 A ARG 183 ? CD  ? A ARG 189 CD  
129 1 Y 1 A ARG 183 ? NE  ? A ARG 189 NE  
130 1 Y 1 A ARG 183 ? CZ  ? A ARG 189 CZ  
131 1 Y 1 A ARG 183 ? NH1 ? A ARG 189 NH1 
132 1 Y 1 A ARG 183 ? NH2 ? A ARG 189 NH2 
133 1 Y 1 A LEU 188 ? CG  ? A LEU 194 CG  
134 1 Y 1 A LEU 188 ? CD1 ? A LEU 194 CD1 
135 1 Y 1 A LEU 188 ? CD2 ? A LEU 194 CD2 
136 1 Y 1 A ILE 189 ? CG1 ? A ILE 195 CG1 
137 1 Y 1 A ILE 189 ? CG2 ? A ILE 195 CG2 
138 1 Y 1 A ILE 189 ? CD1 ? A ILE 195 CD1 
139 1 Y 1 A ILE 193 ? CG1 ? A ILE 199 CG1 
140 1 Y 1 A ILE 193 ? CG2 ? A ILE 199 CG2 
141 1 Y 1 A ILE 193 ? CD1 ? A ILE 199 CD1 
142 1 Y 1 A ILE 201 ? CG1 ? A ILE 207 CG1 
143 1 Y 1 A ILE 201 ? CG2 ? A ILE 207 CG2 
144 1 Y 1 A ILE 201 ? CD1 ? A ILE 207 CD1 
145 1 Y 1 A ASP 202 ? CG  ? A ASP 208 CG  
146 1 Y 1 A ASP 202 ? OD1 ? A ASP 208 OD1 
147 1 Y 1 A ASP 202 ? OD2 ? A ASP 208 OD2 
148 1 Y 1 A GLU 366 ? CG  ? A GLU 372 CG  
149 1 Y 1 A GLU 366 ? CD  ? A GLU 372 CD  
150 1 Y 1 A GLU 366 ? OE1 ? A GLU 372 OE1 
151 1 Y 1 A GLU 366 ? OE2 ? A GLU 372 OE2 
152 1 Y 1 A GLU 404 ? CG  ? A GLU 410 CG  
153 1 Y 1 A GLU 404 ? CD  ? A GLU 410 CD  
154 1 Y 1 A GLU 404 ? OE1 ? A GLU 410 OE1 
155 1 Y 1 A GLU 404 ? OE2 ? A GLU 410 OE2 
156 1 Y 1 A LEU 406 ? CG  ? A LEU 412 CG  
157 1 Y 1 A LEU 406 ? CD1 ? A LEU 412 CD1 
158 1 Y 1 A LEU 406 ? CD2 ? A LEU 412 CD2 
159 1 Y 1 A GLU 446 ? CG  ? A GLU 452 CG  
160 1 Y 1 A GLU 446 ? CD  ? A GLU 452 CD  
161 1 Y 1 A GLU 446 ? OE1 ? A GLU 452 OE1 
162 1 Y 1 A GLU 446 ? OE2 ? A GLU 452 OE2 
163 1 Y 1 A ASP 447 ? CG  ? A ASP 453 CG  
164 1 Y 1 A ASP 447 ? OD1 ? A ASP 453 OD1 
165 1 Y 1 A ASP 447 ? OD2 ? A ASP 453 OD2 
166 1 Y 1 A LYS 451 ? CG  ? A LYS 457 CG  
167 1 Y 1 A LYS 451 ? CD  ? A LYS 457 CD  
168 1 Y 1 A LYS 451 ? CE  ? A LYS 457 CE  
169 1 Y 1 A LYS 451 ? NZ  ? A LYS 457 NZ  
170 1 Y 1 A LYS 472 ? CG  ? A LYS 478 CG  
171 1 Y 1 A LYS 472 ? CD  ? A LYS 478 CD  
172 1 Y 1 A LYS 472 ? CE  ? A LYS 478 CE  
173 1 Y 1 A LYS 472 ? NZ  ? A LYS 478 NZ  
174 1 Y 1 A LYS 525 ? CG  ? A LYS 531 CG  
175 1 Y 1 A LYS 525 ? CD  ? A LYS 531 CD  
176 1 Y 1 A LYS 525 ? CE  ? A LYS 531 CE  
177 1 Y 1 A LYS 525 ? NZ  ? A LYS 531 NZ  
178 1 Y 1 A ARG 546 ? CD  ? A ARG 552 CD  
179 1 Y 1 A ARG 546 ? NE  ? A ARG 552 NE  
180 1 Y 1 A ARG 546 ? CZ  ? A ARG 552 CZ  
181 1 Y 1 A ARG 546 ? NH1 ? A ARG 552 NH1 
182 1 Y 1 A ARG 546 ? NH2 ? A ARG 552 NH2 
183 1 Y 1 A GLN 564 ? CG  ? A GLN 570 CG  
184 1 Y 1 A GLN 564 ? CD  ? A GLN 570 CD  
185 1 Y 1 A GLN 564 ? OE1 ? A GLN 570 OE1 
186 1 Y 1 A GLN 564 ? NE2 ? A GLN 570 NE2 
187 1 Y 1 A GLU 565 ? CG  ? A GLU 571 CG  
188 1 Y 1 A GLU 565 ? CD  ? A GLU 571 CD  
189 1 Y 1 A GLU 565 ? OE1 ? A GLU 571 OE1 
190 1 Y 1 A GLU 565 ? OE2 ? A GLU 571 OE2 
191 1 Y 1 A LYS 592 ? CB  ? A LYS 598 CB  
192 1 Y 1 A LYS 592 ? CG  ? A LYS 598 CG  
193 1 Y 1 A LYS 592 ? CD  ? A LYS 598 CD  
194 1 Y 1 A LYS 592 ? CE  ? A LYS 598 CE  
195 1 Y 1 A LYS 592 ? NZ  ? A LYS 598 NZ  
196 1 Y 1 A SER 595 ? OG  ? A SER 601 OG  
197 1 Y 1 A LYS 624 ? CG  ? A LYS 630 CG  
198 1 Y 1 A LYS 624 ? CD  ? A LYS 630 CD  
199 1 Y 1 A LYS 624 ? CE  ? A LYS 630 CE  
200 1 Y 1 A LYS 624 ? NZ  ? A LYS 630 NZ  
201 1 Y 1 A LEU 649 ? CD1 ? A LEU 655 CD1 
202 1 Y 1 A LEU 649 ? CD2 ? A LEU 655 CD2 
203 1 Y 1 A GLU 697 ? CG  ? A GLU 703 CG  
204 1 Y 1 A GLU 697 ? CD  ? A GLU 703 CD  
205 1 Y 1 A GLU 697 ? OE1 ? A GLU 703 OE1 
206 1 Y 1 A GLU 697 ? OE2 ? A GLU 703 OE2 
207 1 Y 1 A GLU 700 ? CG  ? A GLU 706 CG  
208 1 Y 1 A GLU 700 ? CD  ? A GLU 706 CD  
209 1 Y 1 A GLU 700 ? OE1 ? A GLU 706 OE1 
210 1 Y 1 A GLU 700 ? OE2 ? A GLU 706 OE2 
211 1 Y 1 A GLU 810 ? CG  ? A GLU 816 CG  
212 1 Y 1 A GLU 810 ? CD  ? A GLU 816 CD  
213 1 Y 1 A GLU 810 ? OE1 ? A GLU 816 OE1 
214 1 Y 1 A GLU 810 ? OE2 ? A GLU 816 OE2 
215 1 Y 1 A LYS 873 ? CD  ? A LYS 879 CD  
216 1 Y 1 A LYS 873 ? CE  ? A LYS 879 CE  
217 1 Y 1 A LYS 873 ? NZ  ? A LYS 879 NZ  
218 1 Y 1 A LYS 880 ? NZ  ? A LYS 886 NZ  
219 1 Y 1 A GLU 894 ? CG  ? A GLU 900 CG  
220 1 Y 1 A GLU 894 ? CD  ? A GLU 900 CD  
221 1 Y 1 A GLU 894 ? OE1 ? A GLU 900 OE1 
222 1 Y 1 A GLU 894 ? OE2 ? A GLU 900 OE2 
223 1 Y 1 A GLU 913 ? CG  ? A GLU 919 CG  
224 1 Y 1 A GLU 913 ? CD  ? A GLU 919 CD  
225 1 Y 1 A GLU 913 ? OE1 ? A GLU 919 OE1 
226 1 Y 1 A GLU 913 ? OE2 ? A GLU 919 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -5  ? A MET 1   
2  1 Y 1 A GLY -4  ? A GLY 2   
3  1 Y 1 A SER -3  ? A SER 3   
4  1 Y 1 A SER -2  ? A SER 4   
5  1 Y 1 A HIS -1  ? A HIS 5   
6  1 Y 1 A HIS 0   ? A HIS 6   
7  1 Y 1 A HIS 1   ? A HIS 7   
8  1 Y 1 A HIS 2   ? A HIS 8   
9  1 Y 1 A HIS 3   ? A HIS 9   
10 1 Y 1 A HIS 4   ? A HIS 10  
11 1 Y 1 A SER 5   ? A SER 11  
12 1 Y 1 A SER 6   ? A SER 12  
13 1 Y 1 A GLY 7   ? A GLY 13  
14 1 Y 1 A LEU 8   ? A LEU 14  
15 1 Y 1 A GLU 9   ? A GLU 15  
16 1 Y 1 A ASN 10  ? A ASN 16  
17 1 Y 1 A LEU 11  ? A LEU 17  
18 1 Y 1 A TYR 12  ? A TYR 18  
19 1 Y 1 A PHE 13  ? A PHE 19  
20 1 Y 1 A GLN 14  ? A GLN 20  
21 1 Y 1 A GLY 15  ? A GLY 21  
22 1 Y 1 A SER 16  ? A SER 22  
23 1 Y 1 A ALA 113 ? A ALA 119 
24 1 Y 1 A ILE 114 ? A ILE 120 
25 1 Y 1 A PRO 115 ? A PRO 121 
26 1 Y 1 A GLU 116 ? A GLU 122 
27 1 Y 1 A ASP 117 ? A ASP 123 
28 1 Y 1 A ILE 118 ? A ILE 124 
29 1 Y 1 A MET 119 ? A MET 125 
30 1 Y 1 A ARG 120 ? A ARG 126 
31 1 Y 1 A GLY 121 ? A GLY 127 
32 1 Y 1 A SER 122 ? A SER 128 
33 1 Y 1 A TRP 171 ? A TRP 177 
34 1 Y 1 A THR 172 ? A THR 178 
35 1 Y 1 A LYS 173 ? A LYS 179 
36 1 Y 1 A GLY 174 ? A GLY 180 
37 1 Y 1 A PHE 175 ? A PHE 181 
38 1 Y 1 A LYS 176 ? A LYS 182 
39 1 Y 1 A SER 177 ? A SER 183 
40 1 Y 1 A SER 178 ? A SER 184 
41 1 Y 1 A GLY 179 ? A GLY 185 
42 1 Y 1 A VAL 180 ? A VAL 186 
43 1 Y 1 A GLU 181 ? A GLU 187 
44 1 Y 1 A ARG 195 ? A ARG 201 
45 1 Y 1 A ARG 196 ? A ARG 202 
46 1 Y 1 A GLY 197 ? A GLY 203 
47 1 Y 1 A ASP 198 ? A ASP 204 
48 1 Y 1 A PHE 199 ? A PHE 205 
49 1 Y 1 A ASP 200 ? A ASP 206 
50 1 Y 1 A LYS 549 ? A LYS 555 
51 1 Y 1 A TRP 550 ? A TRP 556 
52 1 Y 1 A GLY 551 ? A GLY 557 
53 1 Y 1 A ALA 914 ? A ALA 920 
54 1 Y 1 A GLY 915 ? A GLY 921 
55 1 Y 1 A GLN 916 ? A GLN 922 
# 
_pdbx_chem_comp_identifier.comp_id           BG6 
_pdbx_chem_comp_identifier.type              'IUPAC CARBOHYDRATE SYMBOL' 
_pdbx_chem_comp_identifier.program           PDB-CARE 
_pdbx_chem_comp_identifier.program_version   1.0 
_pdbx_chem_comp_identifier.identifier        b-D-Glcp6PO3 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '2-deoxy-2-{[(2E)-3-(3,4-dichlorophenyl)prop-2-enoyl]amino}-alpha-D-glucopyranose' 62C 
3 6-O-phosphono-beta-D-glucopyranose                                                 BG6 
4 'CITRATE ANION'                                                                    FLC 
5 water                                                                              HOH 
#